data_1EZF
# 
_entry.id   1EZF 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.289 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1EZF         
RCSB  RCSB011056   
WWPDB D_1000011056 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1EZF 
_pdbx_database_status.recvd_initial_deposition_date   2000-05-10 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Pandit, J.'      1 
'Danley, D.E.'    2 
'Schulte, G.K.'   3 
'Mazzalupo, S.M.' 4 
'Pauly, T.A.'     5 
'Hayward, C.M.'   6 
'Hamanaka, E.S.'  7 
'Thompson, J.F.'  8 
'Harwood, H.J.'   9 
# 
_citation.id                        primary 
_citation.title                     'Crystal structure of human squalene synthase. A key enzyme in cholesterol biosynthesis.' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            275 
_citation.page_first                30610 
_citation.page_last                 30617 
_citation.year                      2000 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   10896663 
_citation.pdbx_database_id_DOI      10.1074/jbc.M004132200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Pandit, J.'        1 
primary 'Danley, D.E.'      2 
primary 'Schulte, G.K.'     3 
primary 'Mazzalupo, S.'     4 
primary 'Pauly, T.A.'       5 
primary 'Hayward, C.M.'     6 
primary 'Hamanaka, E.S.'    7 
primary 'Thompson, J.F.'    8 
primary 'Harwood Jr., H.J.' 9 
# 
_cell.entry_id           1EZF 
_cell.length_a           76.760 
_cell.length_b           87.920 
_cell.length_c           154.170 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1EZF 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'FARNESYL-DIPHOSPHATE FARNESYLTRANSFERASE' 39221.805 3   2.5.1.21 'Q33R, D34N, S38N' 'RESIDUES 31-370' ? 
2 non-polymer syn 
;N-{2-[TRANS-7-CHLORO-1-(2,2-DIMETHYL-PROPYL) -5-NAPHTHALEN-1-YL-2-OXO-1,2,3,5-TETRAHYDRO-BENZO[E] [1,4]OXAZEPIN-3-YL]-ACETYL}-ASPARTIC ACID
;
567.029   3   ?        ?                  ?                 ? 
3 water       nat water 18.015    410 ?        ?                  ?                 ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'SQUALENE SYNTHETASE' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MDRNSLSNSLKTCYKYLNQTSRSFAAVIQALDGEMRNAVCIFYLVLRALDTLEDDMTISVEKKVPLLHNFHSFLYQPDWR
FMESKEKDRQVLEDFPTISLEFRNLAEKYQTVIADICRRMGIGMAEFLDKHVTSEQEWDKYCHYVAGLVGIGLSRLFSAS
EFEDPLVGEDTERANSMGLFLQKTNIIRDYLEDQQGGREFWPQEVWSRYVKKLGDFAKPENIDLAVQCLNELITNALHHI
PDVITYLSRLRNQSVFNFCAIPQVMAIATLAACYNNQQVFKGAVKIRKGQAVTLMMDATNMPAVKAIIYQYMEEIYHRIP
DSDPSSSKTRQIISTIRTQN
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MDRNSLSNSLKTCYKYLNQTSRSFAAVIQALDGEMRNAVCIFYLVLRALDTLEDDMTISVEKKVPLLHNFHSFLYQPDWR
FMESKEKDRQVLEDFPTISLEFRNLAEKYQTVIADICRRMGIGMAEFLDKHVTSEQEWDKYCHYVAGLVGIGLSRLFSAS
EFEDPLVGEDTERANSMGLFLQKTNIIRDYLEDQQGGREFWPQEVWSRYVKKLGDFAKPENIDLAVQCLNELITNALHHI
PDVITYLSRLRNQSVFNFCAIPQVMAIATLAACYNNQQVFKGAVKIRKGQAVTLMMDATNMPAVKAIIYQYMEEIYHRIP
DSDPSSSKTRQIISTIRTQN
;
_entity_poly.pdbx_strand_id                 A,B,C 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ASP n 
1 3   ARG n 
1 4   ASN n 
1 5   SER n 
1 6   LEU n 
1 7   SER n 
1 8   ASN n 
1 9   SER n 
1 10  LEU n 
1 11  LYS n 
1 12  THR n 
1 13  CYS n 
1 14  TYR n 
1 15  LYS n 
1 16  TYR n 
1 17  LEU n 
1 18  ASN n 
1 19  GLN n 
1 20  THR n 
1 21  SER n 
1 22  ARG n 
1 23  SER n 
1 24  PHE n 
1 25  ALA n 
1 26  ALA n 
1 27  VAL n 
1 28  ILE n 
1 29  GLN n 
1 30  ALA n 
1 31  LEU n 
1 32  ASP n 
1 33  GLY n 
1 34  GLU n 
1 35  MET n 
1 36  ARG n 
1 37  ASN n 
1 38  ALA n 
1 39  VAL n 
1 40  CYS n 
1 41  ILE n 
1 42  PHE n 
1 43  TYR n 
1 44  LEU n 
1 45  VAL n 
1 46  LEU n 
1 47  ARG n 
1 48  ALA n 
1 49  LEU n 
1 50  ASP n 
1 51  THR n 
1 52  LEU n 
1 53  GLU n 
1 54  ASP n 
1 55  ASP n 
1 56  MET n 
1 57  THR n 
1 58  ILE n 
1 59  SER n 
1 60  VAL n 
1 61  GLU n 
1 62  LYS n 
1 63  LYS n 
1 64  VAL n 
1 65  PRO n 
1 66  LEU n 
1 67  LEU n 
1 68  HIS n 
1 69  ASN n 
1 70  PHE n 
1 71  HIS n 
1 72  SER n 
1 73  PHE n 
1 74  LEU n 
1 75  TYR n 
1 76  GLN n 
1 77  PRO n 
1 78  ASP n 
1 79  TRP n 
1 80  ARG n 
1 81  PHE n 
1 82  MET n 
1 83  GLU n 
1 84  SER n 
1 85  LYS n 
1 86  GLU n 
1 87  LYS n 
1 88  ASP n 
1 89  ARG n 
1 90  GLN n 
1 91  VAL n 
1 92  LEU n 
1 93  GLU n 
1 94  ASP n 
1 95  PHE n 
1 96  PRO n 
1 97  THR n 
1 98  ILE n 
1 99  SER n 
1 100 LEU n 
1 101 GLU n 
1 102 PHE n 
1 103 ARG n 
1 104 ASN n 
1 105 LEU n 
1 106 ALA n 
1 107 GLU n 
1 108 LYS n 
1 109 TYR n 
1 110 GLN n 
1 111 THR n 
1 112 VAL n 
1 113 ILE n 
1 114 ALA n 
1 115 ASP n 
1 116 ILE n 
1 117 CYS n 
1 118 ARG n 
1 119 ARG n 
1 120 MET n 
1 121 GLY n 
1 122 ILE n 
1 123 GLY n 
1 124 MET n 
1 125 ALA n 
1 126 GLU n 
1 127 PHE n 
1 128 LEU n 
1 129 ASP n 
1 130 LYS n 
1 131 HIS n 
1 132 VAL n 
1 133 THR n 
1 134 SER n 
1 135 GLU n 
1 136 GLN n 
1 137 GLU n 
1 138 TRP n 
1 139 ASP n 
1 140 LYS n 
1 141 TYR n 
1 142 CYS n 
1 143 HIS n 
1 144 TYR n 
1 145 VAL n 
1 146 ALA n 
1 147 GLY n 
1 148 LEU n 
1 149 VAL n 
1 150 GLY n 
1 151 ILE n 
1 152 GLY n 
1 153 LEU n 
1 154 SER n 
1 155 ARG n 
1 156 LEU n 
1 157 PHE n 
1 158 SER n 
1 159 ALA n 
1 160 SER n 
1 161 GLU n 
1 162 PHE n 
1 163 GLU n 
1 164 ASP n 
1 165 PRO n 
1 166 LEU n 
1 167 VAL n 
1 168 GLY n 
1 169 GLU n 
1 170 ASP n 
1 171 THR n 
1 172 GLU n 
1 173 ARG n 
1 174 ALA n 
1 175 ASN n 
1 176 SER n 
1 177 MET n 
1 178 GLY n 
1 179 LEU n 
1 180 PHE n 
1 181 LEU n 
1 182 GLN n 
1 183 LYS n 
1 184 THR n 
1 185 ASN n 
1 186 ILE n 
1 187 ILE n 
1 188 ARG n 
1 189 ASP n 
1 190 TYR n 
1 191 LEU n 
1 192 GLU n 
1 193 ASP n 
1 194 GLN n 
1 195 GLN n 
1 196 GLY n 
1 197 GLY n 
1 198 ARG n 
1 199 GLU n 
1 200 PHE n 
1 201 TRP n 
1 202 PRO n 
1 203 GLN n 
1 204 GLU n 
1 205 VAL n 
1 206 TRP n 
1 207 SER n 
1 208 ARG n 
1 209 TYR n 
1 210 VAL n 
1 211 LYS n 
1 212 LYS n 
1 213 LEU n 
1 214 GLY n 
1 215 ASP n 
1 216 PHE n 
1 217 ALA n 
1 218 LYS n 
1 219 PRO n 
1 220 GLU n 
1 221 ASN n 
1 222 ILE n 
1 223 ASP n 
1 224 LEU n 
1 225 ALA n 
1 226 VAL n 
1 227 GLN n 
1 228 CYS n 
1 229 LEU n 
1 230 ASN n 
1 231 GLU n 
1 232 LEU n 
1 233 ILE n 
1 234 THR n 
1 235 ASN n 
1 236 ALA n 
1 237 LEU n 
1 238 HIS n 
1 239 HIS n 
1 240 ILE n 
1 241 PRO n 
1 242 ASP n 
1 243 VAL n 
1 244 ILE n 
1 245 THR n 
1 246 TYR n 
1 247 LEU n 
1 248 SER n 
1 249 ARG n 
1 250 LEU n 
1 251 ARG n 
1 252 ASN n 
1 253 GLN n 
1 254 SER n 
1 255 VAL n 
1 256 PHE n 
1 257 ASN n 
1 258 PHE n 
1 259 CYS n 
1 260 ALA n 
1 261 ILE n 
1 262 PRO n 
1 263 GLN n 
1 264 VAL n 
1 265 MET n 
1 266 ALA n 
1 267 ILE n 
1 268 ALA n 
1 269 THR n 
1 270 LEU n 
1 271 ALA n 
1 272 ALA n 
1 273 CYS n 
1 274 TYR n 
1 275 ASN n 
1 276 ASN n 
1 277 GLN n 
1 278 GLN n 
1 279 VAL n 
1 280 PHE n 
1 281 LYS n 
1 282 GLY n 
1 283 ALA n 
1 284 VAL n 
1 285 LYS n 
1 286 ILE n 
1 287 ARG n 
1 288 LYS n 
1 289 GLY n 
1 290 GLN n 
1 291 ALA n 
1 292 VAL n 
1 293 THR n 
1 294 LEU n 
1 295 MET n 
1 296 MET n 
1 297 ASP n 
1 298 ALA n 
1 299 THR n 
1 300 ASN n 
1 301 MET n 
1 302 PRO n 
1 303 ALA n 
1 304 VAL n 
1 305 LYS n 
1 306 ALA n 
1 307 ILE n 
1 308 ILE n 
1 309 TYR n 
1 310 GLN n 
1 311 TYR n 
1 312 MET n 
1 313 GLU n 
1 314 GLU n 
1 315 ILE n 
1 316 TYR n 
1 317 HIS n 
1 318 ARG n 
1 319 ILE n 
1 320 PRO n 
1 321 ASP n 
1 322 SER n 
1 323 ASP n 
1 324 PRO n 
1 325 SER n 
1 326 SER n 
1 327 SER n 
1 328 LYS n 
1 329 THR n 
1 330 ARG n 
1 331 GLN n 
1 332 ILE n 
1 333 ILE n 
1 334 SER n 
1 335 THR n 
1 336 ILE n 
1 337 ARG n 
1 338 THR n 
1 339 GLN n 
1 340 ASN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PHSS9 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_code                    FDFT_HUMAN 
_struct_ref.db_name                    UNP 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P37268 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1EZF A 1 ? 340 ? P37268 31 ? 370 ? 31 370 
2 1 1EZF B 1 ? 340 ? P37268 31 ? 370 ? 31 370 
3 1 1EZF C 1 ? 340 ? P37268 31 ? 370 ? 31 370 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1EZF ARG A 3 ? UNP P37268 GLN 33 ENGINEERED 33 1 
1 1EZF ASN A 4 ? UNP P37268 ASP 34 ENGINEERED 34 2 
1 1EZF ASN A 8 ? UNP P37268 SER 38 ENGINEERED 38 3 
2 1EZF ARG B 3 ? UNP P37268 GLN 33 ENGINEERED 33 4 
2 1EZF ASN B 4 ? UNP P37268 ASP 34 ENGINEERED 34 5 
2 1EZF ASN B 8 ? UNP P37268 SER 38 ENGINEERED 38 6 
3 1EZF ARG C 3 ? UNP P37268 GLN 33 ENGINEERED 33 7 
3 1EZF ASN C 4 ? UNP P37268 ASP 34 ENGINEERED 34 8 
3 1EZF ASN C 8 ? UNP P37268 SER 38 ENGINEERED 38 9 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE ?         'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE ?         'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE ?         'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?         'C4 H7 N O4'       133.103 
CYS 'L-peptide linking' y CYSTEINE ?         'C3 H7 N O2 S'     121.158 
GLN 'L-peptide linking' y GLUTAMINE ?         'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?         'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE ?         'C2 H5 N O2'       75.067  
HIS 'L-peptide linking' y HISTIDINE ?         'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER ?         'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE ?         'C6 H13 N O2'      131.173 
IN0 non-polymer         . 
;N-{2-[TRANS-7-CHLORO-1-(2,2-DIMETHYL-PROPYL) -5-NAPHTHALEN-1-YL-2-OXO-1,2,3,5-TETRAHYDRO-BENZO[E] [1,4]OXAZEPIN-3-YL]-ACETYL}-ASPARTIC ACID
;
CP-320473 'C30 H31 Cl N2 O7' 567.029 
LEU 'L-peptide linking' y LEUCINE ?         'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE ?         'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE ?         'C5 H11 N O2 S'    149.211 
PHE 'L-peptide linking' y PHENYLALANINE ?         'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE ?         'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE ?         'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE ?         'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ?         'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE ?         'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE ?         'C5 H11 N O2'      117.146 
# 
_exptl.entry_id          1EZF 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   47 
_exptl_crystal.density_Matthews      2.32 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              5.6 
_exptl_crystal_grow.temp            293.0 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
'25-30% PEG 4000, 0.1M sodium citrate, pH5.6, 0.2M ammonium acetate , VAPOR DIFFUSION, HANGING DROP, temperature 20K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IIC' 
_diffrn_detector.pdbx_collection_date   1995-11-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.monochromator                    Graphite 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU200' 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1EZF 
_reflns.observed_criterion_sigma_I   -3.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             40.00 
_reflns.d_resolution_high            2.15 
_reflns.number_obs                   ? 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            0.0420000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        35.0 
_reflns.B_iso_Wilson_estimate        26 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.15 
_reflns_shell.d_res_low              2.23 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.percent_possible_all   84.9 
_reflns_shell.Rmerge_I_obs           0.1410000 
_reflns_shell.meanI_over_sigI_obs    7.2 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1EZF 
_refine.ls_number_reflns_obs                     54783 
_refine.ls_number_reflns_all                     55223 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               1000000 
_refine.pdbx_data_cutoff_low_absF                0.1 
_refine.ls_d_res_low                             40.0 
_refine.ls_d_res_high                            2.15 
_refine.ls_percent_reflns_obs                    96.0 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2130000 
_refine.ls_R_factor_R_free                       0.2620000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  3340 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               Free-R 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          MIRAS 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            
;Random "shell" method.    
Ref: GJ Kleywegt & TA Jones, Structure 3, 535-540
;
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        7834 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         120 
_refine_hist.number_atoms_solvent             410 
_refine_hist.number_atoms_total               8364 
_refine_hist.d_res_high                       2.15 
_refine_hist.d_res_low                        40.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d    0.015 ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg 1.59  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.R_factor_R_free                  0.3090000 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.R_factor_R_work                  0.2760000 
_refine_ls_shell.d_res_high                       2.15 
_refine_ls_shell.d_res_low                        2.23 
_refine_ls_shell.pdbx_total_number_of_bins_used   10 
_refine_ls_shell.number_reflns_R_free             332 
_refine_ls_shell.number_reflns_R_work             4359 
_refine_ls_shell.percent_reflns_R_free            7.07 
_refine_ls_shell.percent_reflns_obs               84.5 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1EZF 
_struct.title                     'CRYSTAL STRUCTURE OF HUMAN SQUALENE SYNTHASE' 
_struct.pdbx_descriptor           'HUMAN SQUALENE SYNTHASE (E.C. 2.5.1.21)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1EZF 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'isoprenoid synthase fold, all alpha-helix, TRANSFERASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 2 ? 
E N N 2 ? 
F N N 2 ? 
G N N 3 ? 
H N N 3 ? 
I N N 3 ? 
# 
loop_
_struct_biol.id 
_struct_biol.details 
_struct_biol.pdbx_parent_biol_id 
1 'The biological assembly is a monomer.' ? 
2 ?                                       ? 
3 ?                                       ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN A 8   ? SER A 21  ? ASN A 38  SER A 51  1 ? 14 
HELX_P HELX_P2  2  SER A 23  ? ALA A 30  ? SER A 53  ALA A 60  1 ? 8  
HELX_P HELX_P3  3  GLU A 34  ? ASP A 55  ? GLU A 64  ASP A 85  1 ? 22 
HELX_P HELX_P4  4  SER A 59  ? LEU A 74  ? SER A 89  LEU A 104 1 ? 16 
HELX_P HELX_P5  5  ASP A 88  ? ASP A 94  ? ASP A 118 ASP A 124 1 ? 7  
HELX_P HELX_P6  6  ASP A 94  ? ASN A 104 ? ASP A 124 ASN A 134 1 ? 11 
HELX_P HELX_P7  7  ALA A 106 ? ASP A 129 ? ALA A 136 ASP A 159 1 ? 24 
HELX_P HELX_P8  8  SER A 134 ? ALA A 146 ? SER A 164 ALA A 176 1 ? 13 
HELX_P HELX_P9  9  ALA A 146 ? SER A 160 ? ALA A 176 SER A 190 1 ? 15 
HELX_P HELX_P10 10 ASP A 164 ? ASP A 170 ? ASP A 194 ASP A 200 1 ? 7  
HELX_P HELX_P11 11 ASP A 170 ? ASP A 189 ? ASP A 200 ASP A 219 1 ? 20 
HELX_P HELX_P12 12 ASP A 189 ? GLY A 197 ? ASP A 219 GLY A 227 1 ? 9  
HELX_P HELX_P13 13 PRO A 202 ? SER A 207 ? PRO A 232 SER A 237 1 ? 6  
HELX_P HELX_P14 14 LYS A 212 ? LYS A 218 ? LYS A 242 LYS A 248 5 ? 7  
HELX_P HELX_P15 15 LYS A 218 ? GLU A 220 ? LYS A 248 GLU A 250 5 ? 3  
HELX_P HELX_P16 16 ASN A 221 ? HIS A 238 ? ASN A 251 HIS A 268 1 ? 18 
HELX_P HELX_P17 17 HIS A 239 ? ARG A 249 ? HIS A 269 ARG A 279 1 ? 11 
HELX_P HELX_P18 18 ASN A 252 ? TYR A 274 ? ASN A 282 TYR A 304 1 ? 23 
HELX_P HELX_P19 19 ASN A 276 ? LYS A 281 ? ASN A 306 LYS A 311 5 ? 6  
HELX_P HELX_P20 20 ASN A 300 ? ILE A 319 ? ASN A 330 ILE A 349 1 ? 20 
HELX_P HELX_P21 21 SER A 325 ? THR A 338 ? SER A 355 THR A 368 1 ? 14 
HELX_P HELX_P22 22 SER B 7   ? THR B 20  ? SER B 37  THR B 50  1 ? 14 
HELX_P HELX_P23 23 PHE B 24  ? GLN B 29  ? PHE B 54  GLN B 59  1 ? 6  
HELX_P HELX_P24 24 ALA B 30  ? LEU B 31  ? ALA B 60  LEU B 61  5 ? 2  
HELX_P HELX_P25 25 ASP B 32  ? GLY B 33  ? ASP B 62  GLY B 63  5 ? 2  
HELX_P HELX_P26 26 GLU B 34  ? ASP B 55  ? GLU B 64  ASP B 85  1 ? 22 
HELX_P HELX_P27 27 SER B 59  ? LEU B 74  ? SER B 89  LEU B 104 1 ? 16 
HELX_P HELX_P28 28 ASP B 88  ? ASP B 94  ? ASP B 118 ASP B 124 1 ? 7  
HELX_P HELX_P29 29 ASP B 94  ? ASN B 104 ? ASP B 124 ASN B 134 1 ? 11 
HELX_P HELX_P30 30 ALA B 106 ? LEU B 128 ? ALA B 136 LEU B 158 1 ? 23 
HELX_P HELX_P31 31 SER B 134 ? ALA B 146 ? SER B 164 ALA B 176 1 ? 13 
HELX_P HELX_P32 32 ALA B 146 ? SER B 160 ? ALA B 176 SER B 190 1 ? 15 
HELX_P HELX_P33 33 ASP B 164 ? ASP B 170 ? ASP B 194 ASP B 200 1 ? 7  
HELX_P HELX_P34 34 ASP B 170 ? ASP B 189 ? ASP B 200 ASP B 219 1 ? 20 
HELX_P HELX_P35 35 ASP B 189 ? GLY B 196 ? ASP B 219 GLY B 226 1 ? 8  
HELX_P HELX_P36 36 PRO B 202 ? SER B 207 ? PRO B 232 SER B 237 1 ? 6  
HELX_P HELX_P37 37 GLY B 214 ? LYS B 218 ? GLY B 244 LYS B 248 5 ? 5  
HELX_P HELX_P38 38 LYS B 218 ? GLU B 220 ? LYS B 248 GLU B 250 5 ? 3  
HELX_P HELX_P39 39 ASN B 221 ? HIS B 238 ? ASN B 251 HIS B 268 1 ? 18 
HELX_P HELX_P40 40 HIS B 239 ? ARG B 249 ? HIS B 269 ARG B 279 1 ? 11 
HELX_P HELX_P41 41 ASN B 252 ? TYR B 274 ? ASN B 282 TYR B 304 1 ? 23 
HELX_P HELX_P42 42 ASN B 276 ? LYS B 281 ? ASN B 306 LYS B 311 5 ? 6  
HELX_P HELX_P43 43 ASN B 300 ? ILE B 319 ? ASN B 330 ILE B 349 1 ? 20 
HELX_P HELX_P44 44 SER B 325 ? GLN B 339 ? SER B 355 GLN B 369 1 ? 15 
HELX_P HELX_P45 45 ASN C 8   ? SER C 21  ? ASN C 38  SER C 51  1 ? 14 
HELX_P HELX_P46 46 PHE C 24  ? GLN C 29  ? PHE C 54  GLN C 59  1 ? 6  
HELX_P HELX_P47 47 ALA C 30  ? LEU C 31  ? ALA C 60  LEU C 61  5 ? 2  
HELX_P HELX_P48 48 ASP C 32  ? GLY C 33  ? ASP C 62  GLY C 63  5 ? 2  
HELX_P HELX_P49 49 GLU C 34  ? ASP C 55  ? GLU C 64  ASP C 85  1 ? 22 
HELX_P HELX_P50 50 SER C 59  ? LEU C 74  ? SER C 89  LEU C 104 1 ? 16 
HELX_P HELX_P51 51 ASP C 88  ? ASP C 94  ? ASP C 118 ASP C 124 1 ? 7  
HELX_P HELX_P52 52 ASP C 94  ? ASN C 104 ? ASP C 124 ASN C 134 1 ? 11 
HELX_P HELX_P53 53 ALA C 106 ? PHE C 127 ? ALA C 136 PHE C 157 1 ? 22 
HELX_P HELX_P54 54 SER C 134 ? ALA C 146 ? SER C 164 ALA C 176 1 ? 13 
HELX_P HELX_P55 55 ALA C 146 ? SER C 160 ? ALA C 176 SER C 190 1 ? 15 
HELX_P HELX_P56 56 ASP C 164 ? ASP C 170 ? ASP C 194 ASP C 200 1 ? 7  
HELX_P HELX_P57 57 ASP C 170 ? ASP C 189 ? ASP C 200 ASP C 219 1 ? 20 
HELX_P HELX_P58 58 ASP C 189 ? GLY C 196 ? ASP C 219 GLY C 226 1 ? 8  
HELX_P HELX_P59 59 PRO C 202 ? SER C 207 ? PRO C 232 SER C 237 1 ? 6  
HELX_P HELX_P60 60 LYS C 212 ? LYS C 218 ? LYS C 242 LYS C 248 5 ? 7  
HELX_P HELX_P61 61 LYS C 218 ? GLU C 220 ? LYS C 248 GLU C 250 5 ? 3  
HELX_P HELX_P62 62 ASN C 221 ? HIS C 238 ? ASN C 251 HIS C 268 1 ? 18 
HELX_P HELX_P63 63 HIS C 239 ? LEU C 250 ? HIS C 269 LEU C 280 1 ? 12 
HELX_P HELX_P64 64 ASN C 252 ? TYR C 274 ? ASN C 282 TYR C 304 1 ? 23 
HELX_P HELX_P65 65 ASN C 276 ? LYS C 281 ? ASN C 306 LYS C 311 5 ? 6  
HELX_P HELX_P66 66 ASN C 300 ? ILE C 319 ? ASN C 330 ILE C 349 1 ? 20 
HELX_P HELX_P67 67 SER C 325 ? GLN C 339 ? SER C 355 GLN C 369 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE IN0 A 991' 
AC2 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE IN0 B 992' 
AC3 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE IN0 C 995' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 13 ARG A 22  ? ARG A 52   . ? 1_555 ? 
2  AC1 13 SER A 23  ? SER A 53   . ? 1_555 ? 
3  AC1 13 PHE A 24  ? PHE A 54   . ? 1_555 ? 
4  AC1 13 TYR A 43  ? TYR A 73   . ? 1_555 ? 
5  AC1 13 ALA A 146 ? ALA A 176  . ? 1_555 ? 
6  AC1 13 GLY A 150 ? GLY A 180  . ? 1_555 ? 
7  AC1 13 LEU A 153 ? LEU A 183  . ? 1_555 ? 
8  AC1 13 GLY A 178 ? GLY A 208  . ? 1_555 ? 
9  AC1 13 LEU A 181 ? LEU A 211  . ? 1_555 ? 
10 AC1 13 GLN A 182 ? GLN A 212  . ? 1_555 ? 
11 AC1 13 PHE A 258 ? PHE A 288  . ? 1_555 ? 
12 AC1 13 PRO A 262 ? PRO A 292  . ? 1_555 ? 
13 AC1 13 HOH G .   ? HOH A 1075 . ? 1_555 ? 
14 AC2 12 SER B 21  ? SER B 51   . ? 1_555 ? 
15 AC2 12 ARG B 22  ? ARG B 52   . ? 1_555 ? 
16 AC2 12 SER B 23  ? SER B 53   . ? 1_555 ? 
17 AC2 12 PHE B 24  ? PHE B 54   . ? 1_555 ? 
18 AC2 12 TYR B 43  ? TYR B 73   . ? 1_555 ? 
19 AC2 12 VAL B 149 ? VAL B 179  . ? 1_555 ? 
20 AC2 12 GLY B 150 ? GLY B 180  . ? 1_555 ? 
21 AC2 12 LEU B 153 ? LEU B 183  . ? 1_555 ? 
22 AC2 12 GLY B 178 ? GLY B 208  . ? 1_555 ? 
23 AC2 12 LEU B 181 ? LEU B 211  . ? 1_555 ? 
24 AC2 12 GLN B 182 ? GLN B 212  . ? 1_555 ? 
25 AC2 12 PHE B 258 ? PHE B 288  . ? 1_555 ? 
26 AC3 13 ARG C 22  ? ARG C 52   . ? 1_555 ? 
27 AC3 13 SER C 23  ? SER C 53   . ? 1_555 ? 
28 AC3 13 PHE C 24  ? PHE C 54   . ? 1_555 ? 
29 AC3 13 TYR C 43  ? TYR C 73   . ? 1_555 ? 
30 AC3 13 LEU C 46  ? LEU C 76   . ? 1_555 ? 
31 AC3 13 GLY C 150 ? GLY C 180  . ? 1_555 ? 
32 AC3 13 LEU C 153 ? LEU C 183  . ? 1_555 ? 
33 AC3 13 MET C 177 ? MET C 207  . ? 1_555 ? 
34 AC3 13 GLY C 178 ? GLY C 208  . ? 1_555 ? 
35 AC3 13 LEU C 181 ? LEU C 211  . ? 1_555 ? 
36 AC3 13 GLN C 182 ? GLN C 212  . ? 1_555 ? 
37 AC3 13 PHE C 258 ? PHE C 288  . ? 1_555 ? 
38 AC3 13 HOH I .   ? HOH C 1036 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1EZF 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1EZF 
_atom_sites.fract_transf_matrix[1][1]   0.013028 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011374 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006486 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N    . ASN A 1 8   ? 2.031   65.426 31.203 1.00 59.06 ? 38   ASN A N    1 
ATOM   2    C  CA   . ASN A 1 8   ? 0.678   65.577 30.594 1.00 56.59 ? 38   ASN A CA   1 
ATOM   3    C  C    . ASN A 1 8   ? 0.264   64.290 29.884 1.00 52.78 ? 38   ASN A C    1 
ATOM   4    O  O    . ASN A 1 8   ? -0.904  64.108 29.550 1.00 51.03 ? 38   ASN A O    1 
ATOM   5    C  CB   . ASN A 1 8   ? 0.673   66.739 29.597 1.00 61.11 ? 38   ASN A CB   1 
ATOM   6    C  CG   . ASN A 1 8   ? -0.731  67.194 29.238 1.00 65.95 ? 38   ASN A CG   1 
ATOM   7    O  OD1  . ASN A 1 8   ? -1.346  67.957 29.976 1.00 71.19 ? 38   ASN A OD1  1 
ATOM   8    N  ND2  . ASN A 1 8   ? -1.246  66.719 28.113 1.00 67.41 ? 38   ASN A ND2  1 
ATOM   9    N  N    . SER A 1 9   ? 1.228   63.397 29.673 1.00 47.80 ? 39   SER A N    1 
ATOM   10   C  CA   . SER A 1 9   ? 0.976   62.129 29.005 1.00 42.84 ? 39   SER A CA   1 
ATOM   11   C  C    . SER A 1 9   ? 0.114   61.222 29.865 1.00 41.57 ? 39   SER A C    1 
ATOM   12   O  O    . SER A 1 9   ? -0.856  60.636 29.383 1.00 40.73 ? 39   SER A O    1 
ATOM   13   C  CB   . SER A 1 9   ? 2.299   61.447 28.683 1.00 41.79 ? 39   SER A CB   1 
ATOM   14   O  OG   . SER A 1 9   ? 3.197   61.586 29.767 1.00 39.68 ? 39   SER A OG   1 
ATOM   15   N  N    . LEU A 1 10  ? 0.453   61.134 31.147 1.00 39.66 ? 40   LEU A N    1 
ATOM   16   C  CA   . LEU A 1 10  ? -0.302  60.301 32.081 1.00 40.91 ? 40   LEU A CA   1 
ATOM   17   C  C    . LEU A 1 10  ? -1.757  60.741 32.084 1.00 39.47 ? 40   LEU A C    1 
ATOM   18   O  O    . LEU A 1 10  ? -2.665  59.909 32.107 1.00 41.24 ? 40   LEU A O    1 
ATOM   19   C  CB   . LEU A 1 10  ? 0.273   60.400 33.496 1.00 39.97 ? 40   LEU A CB   1 
ATOM   20   C  CG   . LEU A 1 10  ? -0.239  59.347 34.477 1.00 38.43 ? 40   LEU A CG   1 
ATOM   21   C  CD1  . LEU A 1 10  ? 0.276   57.978 34.077 1.00 40.22 ? 40   LEU A CD1  1 
ATOM   22   C  CD2  . LEU A 1 10  ? 0.218   59.682 35.873 1.00 42.14 ? 40   LEU A CD2  1 
ATOM   23   N  N    . LYS A 1 11  ? -1.964  62.055 32.036 1.00 38.73 ? 41   LYS A N    1 
ATOM   24   C  CA   . LYS A 1 11  ? -3.304  62.625 32.014 1.00 35.67 ? 41   LYS A CA   1 
ATOM   25   C  C    . LYS A 1 11  ? -4.042  62.160 30.772 1.00 32.21 ? 41   LYS A C    1 
ATOM   26   O  O    . LYS A 1 11  ? -5.215  61.783 30.835 1.00 32.14 ? 41   LYS A O    1 
ATOM   27   C  CB   . LYS A 1 11  ? -3.243  64.153 32.060 1.00 38.66 ? 41   LYS A CB   1 
ATOM   28   C  CG   . LYS A 1 11  ? -2.657  64.697 33.356 1.00 45.42 ? 41   LYS A CG   1 
ATOM   29   C  CD   . LYS A 1 11  ? -3.000  66.166 33.558 1.00 49.82 ? 41   LYS A CD   1 
ATOM   30   C  CE   . LYS A 1 11  ? -2.580  66.642 34.941 1.00 52.99 ? 41   LYS A CE   1 
ATOM   31   N  NZ   . LYS A 1 11  ? -2.939  68.068 35.174 1.00 52.89 ? 41   LYS A NZ   1 
ATOM   32   N  N    . THR A 1 12  ? -3.331  62.156 29.650 1.00 29.63 ? 42   THR A N    1 
ATOM   33   C  CA   . THR A 1 12  ? -3.895  61.725 28.380 1.00 30.64 ? 42   THR A CA   1 
ATOM   34   C  C    . THR A 1 12  ? -4.280  60.254 28.505 1.00 26.97 ? 42   THR A C    1 
ATOM   35   O  O    . THR A 1 12  ? -5.366  59.844 28.083 1.00 23.59 ? 42   THR A O    1 
ATOM   36   C  CB   . THR A 1 12  ? -2.864  61.894 27.242 1.00 35.26 ? 42   THR A CB   1 
ATOM   37   O  OG1  . THR A 1 12  ? -2.158  63.136 27.412 1.00 37.43 ? 42   THR A OG1  1 
ATOM   38   C  CG2  . THR A 1 12  ? -3.564  61.886 25.883 1.00 32.84 ? 42   THR A CG2  1 
ATOM   39   N  N    . CYS A 1 13  ? -3.400  59.473 29.125 1.00 24.39 ? 43   CYS A N    1 
ATOM   40   C  CA   . CYS A 1 13  ? -3.653  58.054 29.327 1.00 26.36 ? 43   CYS A CA   1 
ATOM   41   C  C    . CYS A 1 13  ? -4.924  57.850 30.144 1.00 26.28 ? 43   CYS A C    1 
ATOM   42   O  O    . CYS A 1 13  ? -5.739  56.983 29.812 1.00 26.58 ? 43   CYS A O    1 
ATOM   43   C  CB   . CYS A 1 13  ? -2.465  57.378 30.015 1.00 27.87 ? 43   CYS A CB   1 
ATOM   44   S  SG   . CYS A 1 13  ? -0.968  57.252 28.989 1.00 31.23 ? 43   CYS A SG   1 
ATOM   45   N  N    . TYR A 1 14  ? -5.127  58.672 31.177 1.00 24.40 ? 44   TYR A N    1 
ATOM   46   C  CA   . TYR A 1 14  ? -6.331  58.543 32.002 1.00 23.34 ? 44   TYR A CA   1 
ATOM   47   C  C    . TYR A 1 14  ? -7.580  58.995 31.275 1.00 21.90 ? 44   TYR A C    1 
ATOM   48   O  O    . TYR A 1 14  ? -8.676  58.518 31.555 1.00 18.73 ? 44   TYR A O    1 
ATOM   49   C  CB   . TYR A 1 14  ? -6.183  59.241 33.362 1.00 20.85 ? 44   TYR A CB   1 
ATOM   50   C  CG   . TYR A 1 14  ? -5.494  58.355 34.383 1.00 20.05 ? 44   TYR A CG   1 
ATOM   51   C  CD1  . TYR A 1 14  ? -6.170  57.292 34.981 1.00 13.82 ? 44   TYR A CD1  1 
ATOM   52   C  CD2  . TYR A 1 14  ? -4.141  58.519 34.675 1.00 16.85 ? 44   TYR A CD2  1 
ATOM   53   C  CE1  . TYR A 1 14  ? -5.513  56.409 35.834 1.00 17.83 ? 44   TYR A CE1  1 
ATOM   54   C  CE2  . TYR A 1 14  ? -3.474  57.643 35.534 1.00 21.66 ? 44   TYR A CE2  1 
ATOM   55   C  CZ   . TYR A 1 14  ? -4.162  56.586 36.106 1.00 19.10 ? 44   TYR A CZ   1 
ATOM   56   O  OH   . TYR A 1 14  ? -3.498  55.703 36.932 1.00 17.76 ? 44   TYR A OH   1 
ATOM   57   N  N    . LYS A 1 15  ? -7.410  59.896 30.316 1.00 25.57 ? 45   LYS A N    1 
ATOM   58   C  CA   . LYS A 1 15  ? -8.534  60.379 29.526 1.00 26.26 ? 45   LYS A CA   1 
ATOM   59   C  C    . LYS A 1 15  ? -8.981  59.251 28.584 1.00 25.97 ? 45   LYS A C    1 
ATOM   60   O  O    . LYS A 1 15  ? -10.182 59.017 28.416 1.00 28.57 ? 45   LYS A O    1 
ATOM   61   C  CB   . LYS A 1 15  ? -8.123  61.615 28.725 1.00 30.47 ? 45   LYS A CB   1 
ATOM   62   C  CG   . LYS A 1 15  ? -9.278  62.295 27.996 1.00 36.09 ? 45   LYS A CG   1 
ATOM   63   C  CD   . LYS A 1 15  ? -8.764  63.246 26.934 1.00 37.37 ? 45   LYS A CD   1 
ATOM   64   C  CE   . LYS A 1 15  ? -7.975  62.478 25.882 1.00 43.28 ? 45   LYS A CE   1 
ATOM   65   N  NZ   . LYS A 1 15  ? -7.411  63.370 24.826 1.00 51.41 ? 45   LYS A NZ   1 
ATOM   66   N  N    . TYR A 1 16  ? -8.011  58.541 28.001 1.00 23.42 ? 46   TYR A N    1 
ATOM   67   C  CA   . TYR A 1 16  ? -8.296  57.430 27.096 1.00 20.23 ? 46   TYR A CA   1 
ATOM   68   C  C    . TYR A 1 16  ? -8.940  56.310 27.871 1.00 21.68 ? 46   TYR A C    1 
ATOM   69   O  O    . TYR A 1 16  ? -9.916  55.722 27.414 1.00 24.16 ? 46   TYR A O    1 
ATOM   70   C  CB   . TYR A 1 16  ? -7.023  56.899 26.428 1.00 24.72 ? 46   TYR A CB   1 
ATOM   71   C  CG   . TYR A 1 16  ? -6.380  57.855 25.446 1.00 30.72 ? 46   TYR A CG   1 
ATOM   72   C  CD1  . TYR A 1 16  ? -7.074  58.976 24.967 1.00 32.98 ? 46   TYR A CD1  1 
ATOM   73   C  CD2  . TYR A 1 16  ? -5.061  57.671 25.034 1.00 28.08 ? 46   TYR A CD2  1 
ATOM   74   C  CE1  . TYR A 1 16  ? -6.465  59.887 24.116 1.00 31.21 ? 46   TYR A CE1  1 
ATOM   75   C  CE2  . TYR A 1 16  ? -4.444  58.577 24.185 1.00 30.05 ? 46   TYR A CE2  1 
ATOM   76   C  CZ   . TYR A 1 16  ? -5.151  59.683 23.733 1.00 31.13 ? 46   TYR A CZ   1 
ATOM   77   O  OH   . TYR A 1 16  ? -4.534  60.606 22.923 1.00 35.46 ? 46   TYR A OH   1 
ATOM   78   N  N    . LEU A 1 17  ? -8.401  56.016 29.052 1.00 20.36 ? 47   LEU A N    1 
ATOM   79   C  CA   . LEU A 1 17  ? -8.957  54.961 29.886 1.00 19.20 ? 47   LEU A CA   1 
ATOM   80   C  C    . LEU A 1 17  ? -10.449 55.204 30.079 1.00 18.70 ? 47   LEU A C    1 
ATOM   81   O  O    . LEU A 1 17  ? -11.268 54.314 29.867 1.00 20.55 ? 47   LEU A O    1 
ATOM   82   C  CB   . LEU A 1 17  ? -8.257  54.906 31.249 1.00 15.99 ? 47   LEU A CB   1 
ATOM   83   C  CG   . LEU A 1 17  ? -8.683  53.751 32.176 1.00 15.68 ? 47   LEU A CG   1 
ATOM   84   C  CD1  . LEU A 1 17  ? -8.124  52.419 31.693 1.00 8.55  ? 47   LEU A CD1  1 
ATOM   85   C  CD2  . LEU A 1 17  ? -8.181  54.021 33.581 1.00 14.15 ? 47   LEU A CD2  1 
ATOM   86   N  N    . ASN A 1 18  ? -10.809 56.422 30.455 1.00 17.97 ? 48   ASN A N    1 
ATOM   87   C  CA   . ASN A 1 18  ? -12.214 56.731 30.659 1.00 23.43 ? 48   ASN A CA   1 
ATOM   88   C  C    . ASN A 1 18  ? -12.978 56.654 29.343 1.00 28.72 ? 48   ASN A C    1 
ATOM   89   O  O    . ASN A 1 18  ? -14.162 56.320 29.326 1.00 30.66 ? 48   ASN A O    1 
ATOM   90   C  CB   . ASN A 1 18  ? -12.376 58.099 31.331 1.00 21.64 ? 48   ASN A CB   1 
ATOM   91   C  CG   . ASN A 1 18  ? -12.032 58.058 32.821 1.00 26.86 ? 48   ASN A CG   1 
ATOM   92   O  OD1  . ASN A 1 18  ? -12.833 57.613 33.635 1.00 24.90 ? 48   ASN A OD1  1 
ATOM   93   N  ND2  . ASN A 1 18  ? -10.829 58.496 33.174 1.00 22.02 ? 48   ASN A ND2  1 
ATOM   94   N  N    . GLN A 1 19  ? -12.297 56.949 28.238 1.00 32.97 ? 49   GLN A N    1 
ATOM   95   C  CA   . GLN A 1 19  ? -12.919 56.895 26.922 1.00 34.54 ? 49   GLN A CA   1 
ATOM   96   C  C    . GLN A 1 19  ? -13.176 55.465 26.485 1.00 34.54 ? 49   GLN A C    1 
ATOM   97   O  O    . GLN A 1 19  ? -14.174 55.189 25.832 1.00 38.91 ? 49   GLN A O    1 
ATOM   98   C  CB   . GLN A 1 19  ? -12.047 57.593 25.875 1.00 38.10 ? 49   GLN A CB   1 
ATOM   99   C  CG   . GLN A 1 19  ? -12.166 59.106 25.861 1.00 38.70 ? 49   GLN A CG   1 
ATOM   100  C  CD   . GLN A 1 19  ? -11.168 59.764 24.923 1.00 40.86 ? 49   GLN A CD   1 
ATOM   101  O  OE1  . GLN A 1 19  ? -10.599 59.118 24.042 1.00 42.87 ? 49   GLN A OE1  1 
ATOM   102  N  NE2  . GLN A 1 19  ? -10.944 61.055 25.116 1.00 40.82 ? 49   GLN A NE2  1 
ATOM   103  N  N    . THR A 1 20  ? -12.280 54.555 26.849 1.00 36.60 ? 50   THR A N    1 
ATOM   104  C  CA   . THR A 1 20  ? -12.423 53.154 26.464 1.00 39.28 ? 50   THR A CA   1 
ATOM   105  C  C    . THR A 1 20  ? -13.164 52.337 27.513 1.00 41.22 ? 50   THR A C    1 
ATOM   106  O  O    . THR A 1 20  ? -13.467 51.159 27.296 1.00 41.82 ? 50   THR A O    1 
ATOM   107  C  CB   . THR A 1 20  ? -11.052 52.494 26.196 1.00 37.01 ? 50   THR A CB   1 
ATOM   108  O  OG1  . THR A 1 20  ? -10.301 52.432 27.411 1.00 33.77 ? 50   THR A OG1  1 
ATOM   109  C  CG2  . THR A 1 20  ? -10.266 53.284 25.159 1.00 37.10 ? 50   THR A CG2  1 
ATOM   110  N  N    . SER A 1 21  ? -13.429 52.951 28.661 1.00 44.00 ? 51   SER A N    1 
ATOM   111  C  CA   . SER A 1 21  ? -14.130 52.268 29.735 1.00 45.28 ? 51   SER A CA   1 
ATOM   112  C  C    . SER A 1 21  ? -15.302 53.126 30.186 1.00 46.63 ? 51   SER A C    1 
ATOM   113  O  O    . SER A 1 21  ? -15.147 54.296 30.515 1.00 49.47 ? 51   SER A O    1 
ATOM   114  C  CB   . SER A 1 21  ? -13.177 51.988 30.899 1.00 42.15 ? 51   SER A CB   1 
ATOM   115  O  OG   . SER A 1 21  ? -13.582 50.833 31.613 1.00 41.89 ? 51   SER A OG   1 
ATOM   116  N  N    . ARG A 1 22  ? -16.485 52.533 30.181 1.00 50.20 ? 52   ARG A N    1 
ATOM   117  C  CA   . ARG A 1 22  ? -17.699 53.233 30.568 1.00 50.84 ? 52   ARG A CA   1 
ATOM   118  C  C    . ARG A 1 22  ? -17.856 53.400 32.074 1.00 47.48 ? 52   ARG A C    1 
ATOM   119  O  O    . ARG A 1 22  ? -18.350 54.424 32.542 1.00 47.51 ? 52   ARG A O    1 
ATOM   120  C  CB   . ARG A 1 22  ? -18.915 52.488 30.016 1.00 57.49 ? 52   ARG A CB   1 
ATOM   121  C  CG   . ARG A 1 22  ? -19.068 51.079 30.570 1.00 63.39 ? 52   ARG A CG   1 
ATOM   122  C  CD   . ARG A 1 22  ? -20.288 50.375 30.006 1.00 67.98 ? 52   ARG A CD   1 
ATOM   123  N  NE   . ARG A 1 22  ? -20.117 50.005 28.605 1.00 68.55 ? 52   ARG A NE   1 
ATOM   124  C  CZ   . ARG A 1 22  ? -21.124 49.817 27.760 1.00 71.25 ? 52   ARG A CZ   1 
ATOM   125  N  NH1  . ARG A 1 22  ? -22.377 49.971 28.170 1.00 71.26 ? 52   ARG A NH1  1 
ATOM   126  N  NH2  . ARG A 1 22  ? -20.878 49.478 26.502 1.00 73.25 ? 52   ARG A NH2  1 
ATOM   127  N  N    . SER A 1 23  ? -17.459 52.384 32.830 1.00 42.25 ? 53   SER A N    1 
ATOM   128  C  CA   . SER A 1 23  ? -17.601 52.432 34.279 1.00 38.68 ? 53   SER A CA   1 
ATOM   129  C  C    . SER A 1 23  ? -16.408 51.884 35.040 1.00 35.01 ? 53   SER A C    1 
ATOM   130  O  O    . SER A 1 23  ? -16.141 52.296 36.170 1.00 35.07 ? 53   SER A O    1 
ATOM   131  C  CB   . SER A 1 23  ? -18.857 51.661 34.688 1.00 38.50 ? 53   SER A CB   1 
ATOM   132  O  OG   . SER A 1 23  ? -18.916 50.410 34.018 1.00 39.63 ? 53   SER A OG   1 
ATOM   133  N  N    . PHE A 1 24  ? -15.681 50.968 34.414 1.00 26.79 ? 54   PHE A N    1 
ATOM   134  C  CA   . PHE A 1 24  ? -14.547 50.343 35.063 1.00 25.15 ? 54   PHE A CA   1 
ATOM   135  C  C    . PHE A 1 24  ? -13.330 51.237 35.314 1.00 21.40 ? 54   PHE A C    1 
ATOM   136  O  O    . PHE A 1 24  ? -12.470 50.888 36.117 1.00 21.68 ? 54   PHE A O    1 
ATOM   137  C  CB   . PHE A 1 24  ? -14.154 49.075 34.305 1.00 25.26 ? 54   PHE A CB   1 
ATOM   138  C  CG   . PHE A 1 24  ? -13.494 48.046 35.162 1.00 24.36 ? 54   PHE A CG   1 
ATOM   139  C  CD1  . PHE A 1 24  ? -14.118 47.592 36.322 1.00 20.76 ? 54   PHE A CD1  1 
ATOM   140  C  CD2  . PHE A 1 24  ? -12.241 47.543 34.827 1.00 22.64 ? 54   PHE A CD2  1 
ATOM   141  C  CE1  . PHE A 1 24  ? -13.507 46.649 37.140 1.00 21.13 ? 54   PHE A CE1  1 
ATOM   142  C  CE2  . PHE A 1 24  ? -11.621 46.597 35.640 1.00 27.70 ? 54   PHE A CE2  1 
ATOM   143  C  CZ   . PHE A 1 24  ? -12.256 46.150 36.801 1.00 25.42 ? 54   PHE A CZ   1 
ATOM   144  N  N    . ALA A 1 25  ? -13.258 52.391 34.655 1.00 21.58 ? 55   ALA A N    1 
ATOM   145  C  CA   . ALA A 1 25  ? -12.126 53.307 34.843 1.00 23.85 ? 55   ALA A CA   1 
ATOM   146  C  C    . ALA A 1 25  ? -12.050 53.771 36.309 1.00 25.85 ? 55   ALA A C    1 
ATOM   147  O  O    . ALA A 1 25  ? -10.960 53.878 36.900 1.00 19.60 ? 55   ALA A O    1 
ATOM   148  C  CB   . ALA A 1 25  ? -12.264 54.512 33.913 1.00 22.02 ? 55   ALA A CB   1 
ATOM   149  N  N    . ALA A 1 26  ? -13.226 54.036 36.876 1.00 24.25 ? 56   ALA A N    1 
ATOM   150  C  CA   . ALA A 1 26  ? -13.367 54.472 38.256 1.00 24.33 ? 56   ALA A CA   1 
ATOM   151  C  C    . ALA A 1 26  ? -12.763 53.441 39.205 1.00 22.09 ? 56   ALA A C    1 
ATOM   152  O  O    . ALA A 1 26  ? -12.090 53.795 40.173 1.00 22.17 ? 56   ALA A O    1 
ATOM   153  C  CB   . ALA A 1 26  ? -14.835 54.681 38.575 1.00 22.78 ? 56   ALA A CB   1 
ATOM   154  N  N    . VAL A 1 27  ? -12.977 52.166 38.901 1.00 21.37 ? 57   VAL A N    1 
ATOM   155  C  CA   . VAL A 1 27  ? -12.458 51.078 39.723 1.00 21.43 ? 57   VAL A CA   1 
ATOM   156  C  C    . VAL A 1 27  ? -10.939 50.939 39.610 1.00 21.75 ? 57   VAL A C    1 
ATOM   157  O  O    . VAL A 1 27  ? -10.258 50.649 40.602 1.00 21.92 ? 57   VAL A O    1 
ATOM   158  C  CB   . VAL A 1 27  ? -13.152 49.742 39.369 1.00 24.48 ? 57   VAL A CB   1 
ATOM   159  C  CG1  . VAL A 1 27  ? -12.558 48.592 40.166 1.00 21.86 ? 57   VAL A CG1  1 
ATOM   160  C  CG2  . VAL A 1 27  ? -14.652 49.851 39.633 1.00 24.13 ? 57   VAL A CG2  1 
ATOM   161  N  N    . ILE A 1 28  ? -10.412 51.165 38.408 1.00 22.02 ? 58   ILE A N    1 
ATOM   162  C  CA   . ILE A 1 28  ? -8.974  51.078 38.155 1.00 21.01 ? 58   ILE A CA   1 
ATOM   163  C  C    . ILE A 1 28  ? -8.272  52.240 38.851 1.00 21.83 ? 58   ILE A C    1 
ATOM   164  O  O    . ILE A 1 28  ? -7.265  52.047 39.541 1.00 20.42 ? 58   ILE A O    1 
ATOM   165  C  CB   . ILE A 1 28  ? -8.662  51.091 36.627 1.00 22.59 ? 58   ILE A CB   1 
ATOM   166  C  CG1  . ILE A 1 28  ? -9.102  49.765 35.997 1.00 22.32 ? 58   ILE A CG1  1 
ATOM   167  C  CG2  . ILE A 1 28  ? -7.169  51.335 36.372 1.00 20.60 ? 58   ILE A CG2  1 
ATOM   168  C  CD1  . ILE A 1 28  ? -9.061  49.753 34.484 1.00 19.40 ? 58   ILE A CD1  1 
ATOM   169  N  N    . GLN A 1 29  ? -8.821  53.442 38.691 1.00 22.11 ? 59   GLN A N    1 
ATOM   170  C  CA   . GLN A 1 29  ? -8.250  54.625 39.325 1.00 24.87 ? 59   GLN A CA   1 
ATOM   171  C  C    . GLN A 1 29  ? -8.251  54.477 40.860 1.00 26.13 ? 59   GLN A C    1 
ATOM   172  O  O    . GLN A 1 29  ? -7.477  55.131 41.555 1.00 25.93 ? 59   GLN A O    1 
ATOM   173  C  CB   . GLN A 1 29  ? -9.028  55.880 38.915 1.00 23.57 ? 59   GLN A CB   1 
ATOM   174  C  CG   . GLN A 1 29  ? -8.822  56.308 37.467 1.00 28.30 ? 59   GLN A CG   1 
ATOM   175  C  CD   . GLN A 1 29  ? -9.816  57.367 37.011 1.00 27.84 ? 59   GLN A CD   1 
ATOM   176  O  OE1  . GLN A 1 29  ? -10.438 58.060 37.822 1.00 34.10 ? 59   GLN A OE1  1 
ATOM   177  N  NE2  . GLN A 1 29  ? -9.989  57.479 35.709 1.00 26.76 ? 59   GLN A NE2  1 
ATOM   178  N  N    . ALA A 1 30  ? -9.110  53.602 41.379 1.00 21.86 ? 60   ALA A N    1 
ATOM   179  C  CA   . ALA A 1 30  ? -9.197  53.373 42.814 1.00 23.24 ? 60   ALA A CA   1 
ATOM   180  C  C    . ALA A 1 30  ? -8.173  52.355 43.335 1.00 24.13 ? 60   ALA A C    1 
ATOM   181  O  O    . ALA A 1 30  ? -8.205  51.991 44.514 1.00 26.94 ? 60   ALA A O    1 
ATOM   182  C  CB   . ALA A 1 30  ? -10.613 52.942 43.182 1.00 23.16 ? 60   ALA A CB   1 
ATOM   183  N  N    . LEU A 1 31  ? -7.276  51.880 42.473 1.00 22.80 ? 61   LEU A N    1 
ATOM   184  C  CA   . LEU A 1 31  ? -6.260  50.915 42.890 1.00 21.51 ? 61   LEU A CA   1 
ATOM   185  C  C    . LEU A 1 31  ? -5.164  51.576 43.737 1.00 21.28 ? 61   LEU A C    1 
ATOM   186  O  O    . LEU A 1 31  ? -4.843  52.742 43.538 1.00 19.04 ? 61   LEU A O    1 
ATOM   187  C  CB   . LEU A 1 31  ? -5.668  50.195 41.675 1.00 20.54 ? 61   LEU A CB   1 
ATOM   188  C  CG   . LEU A 1 31  ? -6.591  49.150 41.035 1.00 20.85 ? 61   LEU A CG   1 
ATOM   189  C  CD1  . LEU A 1 31  ? -6.138  48.836 39.611 1.00 14.37 ? 61   LEU A CD1  1 
ATOM   190  C  CD2  . LEU A 1 31  ? -6.630  47.891 41.899 1.00 19.70 ? 61   LEU A CD2  1 
ATOM   191  N  N    . ASP A 1 32  ? -4.604  50.827 44.687 1.00 23.70 ? 62   ASP A N    1 
ATOM   192  C  CA   . ASP A 1 32  ? -3.575  51.359 45.589 1.00 23.24 ? 62   ASP A CA   1 
ATOM   193  C  C    . ASP A 1 32  ? -2.221  51.492 44.941 1.00 24.54 ? 62   ASP A C    1 
ATOM   194  O  O    . ASP A 1 32  ? -1.825  50.657 44.128 1.00 22.89 ? 62   ASP A O    1 
ATOM   195  C  CB   . ASP A 1 32  ? -3.383  50.474 46.839 1.00 23.86 ? 62   ASP A CB   1 
ATOM   196  C  CG   . ASP A 1 32  ? -4.563  50.514 47.806 1.00 20.28 ? 62   ASP A CG   1 
ATOM   197  O  OD1  . ASP A 1 32  ? -5.358  51.480 47.801 1.00 18.26 ? 62   ASP A OD1  1 
ATOM   198  O  OD2  . ASP A 1 32  ? -4.687  49.551 48.588 1.00 20.09 ? 62   ASP A OD2  1 
ATOM   199  N  N    . GLY A 1 33  ? -1.492  52.511 45.387 1.00 26.30 ? 63   GLY A N    1 
ATOM   200  C  CA   . GLY A 1 33  ? -0.146  52.774 44.915 1.00 26.29 ? 63   GLY A CA   1 
ATOM   201  C  C    . GLY A 1 33  ? 0.168   52.567 43.449 1.00 27.84 ? 63   GLY A C    1 
ATOM   202  O  O    . GLY A 1 33  ? -0.559  53.019 42.560 1.00 29.27 ? 63   GLY A O    1 
ATOM   203  N  N    . GLU A 1 34  ? 1.265   51.861 43.209 1.00 29.23 ? 64   GLU A N    1 
ATOM   204  C  CA   . GLU A 1 34  ? 1.753   51.584 41.862 1.00 30.81 ? 64   GLU A CA   1 
ATOM   205  C  C    . GLU A 1 34  ? 0.827   50.773 40.965 1.00 30.21 ? 64   GLU A C    1 
ATOM   206  O  O    . GLU A 1 34  ? 0.965   50.815 39.745 1.00 33.35 ? 64   GLU A O    1 
ATOM   207  C  CB   . GLU A 1 34  ? 3.130   50.926 41.926 1.00 27.80 ? 64   GLU A CB   1 
ATOM   208  C  CG   . GLU A 1 34  ? 4.155   51.764 42.664 1.00 30.47 ? 64   GLU A CG   1 
ATOM   209  C  CD   . GLU A 1 34  ? 5.565   51.266 42.478 1.00 32.28 ? 64   GLU A CD   1 
ATOM   210  O  OE1  . GLU A 1 34  ? 5.813   50.060 42.671 1.00 37.43 ? 64   GLU A OE1  1 
ATOM   211  O  OE2  . GLU A 1 34  ? 6.434   52.088 42.135 1.00 40.80 ? 64   GLU A OE2  1 
ATOM   212  N  N    . MET A 1 35  ? -0.120  50.050 41.554 1.00 30.01 ? 65   MET A N    1 
ATOM   213  C  CA   . MET A 1 35  ? -1.051  49.245 40.764 1.00 28.55 ? 65   MET A CA   1 
ATOM   214  C  C    . MET A 1 35  ? -1.923  50.123 39.884 1.00 28.49 ? 65   MET A C    1 
ATOM   215  O  O    . MET A 1 35  ? -2.338  49.709 38.798 1.00 26.55 ? 65   MET A O    1 
ATOM   216  C  CB   . MET A 1 35  ? -1.951  48.404 41.662 1.00 26.62 ? 65   MET A CB   1 
ATOM   217  C  CG   . MET A 1 35  ? -1.257  47.284 42.383 1.00 24.56 ? 65   MET A CG   1 
ATOM   218  S  SD   . MET A 1 35  ? -2.467  46.529 43.438 1.00 35.28 ? 65   MET A SD   1 
ATOM   219  C  CE   . MET A 1 35  ? -1.755  44.969 43.732 1.00 36.70 ? 65   MET A CE   1 
ATOM   220  N  N    . ARG A 1 36  ? -2.186  51.340 40.343 1.00 25.47 ? 66   ARG A N    1 
ATOM   221  C  CA   . ARG A 1 36  ? -3.028  52.240 39.580 1.00 26.31 ? 66   ARG A CA   1 
ATOM   222  C  C    . ARG A 1 36  ? -2.456  52.500 38.187 1.00 29.60 ? 66   ARG A C    1 
ATOM   223  O  O    . ARG A 1 36  ? -3.019  52.033 37.190 1.00 30.09 ? 66   ARG A O    1 
ATOM   224  C  CB   . ARG A 1 36  ? -3.233  53.546 40.326 1.00 24.41 ? 66   ARG A CB   1 
ATOM   225  C  CG   . ARG A 1 36  ? -4.469  54.273 39.891 1.00 25.92 ? 66   ARG A CG   1 
ATOM   226  C  CD   . ARG A 1 36  ? -4.664  55.510 40.728 1.00 37.21 ? 66   ARG A CD   1 
ATOM   227  N  NE   . ARG A 1 36  ? -4.415  56.713 39.953 1.00 41.68 ? 66   ARG A NE   1 
ATOM   228  C  CZ   . ARG A 1 36  ? -5.299  57.688 39.780 1.00 43.97 ? 66   ARG A CZ   1 
ATOM   229  N  NH1  . ARG A 1 36  ? -6.509  57.623 40.327 1.00 41.98 ? 66   ARG A NH1  1 
ATOM   230  N  NH2  . ARG A 1 36  ? -4.974  58.719 39.023 1.00 45.84 ? 66   ARG A NH2  1 
ATOM   231  N  N    . ASN A 1 37  ? -1.324  53.201 38.113 1.00 26.11 ? 67   ASN A N    1 
ATOM   232  C  CA   . ASN A 1 37  ? -0.703  53.489 36.819 1.00 25.73 ? 67   ASN A CA   1 
ATOM   233  C  C    . ASN A 1 37  ? -0.395  52.209 36.054 1.00 25.10 ? 67   ASN A C    1 
ATOM   234  O  O    . ASN A 1 37  ? -0.681  52.114 34.865 1.00 24.59 ? 67   ASN A O    1 
ATOM   235  C  CB   . ASN A 1 37  ? 0.572   54.315 36.986 1.00 26.73 ? 67   ASN A CB   1 
ATOM   236  C  CG   . ASN A 1 37  ? 0.290   55.761 37.346 1.00 25.91 ? 67   ASN A CG   1 
ATOM   237  O  OD1  . ASN A 1 37  ? -0.829  56.251 37.181 1.00 27.51 ? 67   ASN A OD1  1 
ATOM   238  N  ND2  . ASN A 1 37  ? 1.309   56.457 37.831 1.00 28.29 ? 67   ASN A ND2  1 
ATOM   239  N  N    . ALA A 1 38  ? 0.136   51.210 36.755 1.00 26.48 ? 68   ALA A N    1 
ATOM   240  C  CA   . ALA A 1 38  ? 0.481   49.921 36.150 1.00 25.84 ? 68   ALA A CA   1 
ATOM   241  C  C    . ALA A 1 38  ? -0.725  49.270 35.470 1.00 28.87 ? 68   ALA A C    1 
ATOM   242  O  O    . ALA A 1 38  ? -0.636  48.826 34.319 1.00 26.95 ? 68   ALA A O    1 
ATOM   243  C  CB   . ALA A 1 38  ? 1.056   48.985 37.204 1.00 25.32 ? 68   ALA A CB   1 
ATOM   244  N  N    . VAL A 1 39  ? -1.860  49.241 36.167 1.00 26.31 ? 69   VAL A N    1 
ATOM   245  C  CA   . VAL A 1 39  ? -3.072  48.653 35.608 1.00 24.69 ? 69   VAL A CA   1 
ATOM   246  C  C    . VAL A 1 39  ? -3.716  49.568 34.566 1.00 23.76 ? 69   VAL A C    1 
ATOM   247  O  O    . VAL A 1 39  ? -4.327  49.084 33.616 1.00 23.40 ? 69   VAL A O    1 
ATOM   248  C  CB   . VAL A 1 39  ? -4.090  48.260 36.705 1.00 24.91 ? 69   VAL A CB   1 
ATOM   249  C  CG1  . VAL A 1 39  ? -5.437  47.850 36.076 1.00 22.76 ? 69   VAL A CG1  1 
ATOM   250  C  CG2  . VAL A 1 39  ? -3.534  47.100 37.529 1.00 21.69 ? 69   VAL A CG2  1 
ATOM   251  N  N    . CYS A 1 40  ? -3.565  50.881 34.728 1.00 21.94 ? 70   CYS A N    1 
ATOM   252  C  CA   . CYS A 1 40  ? -4.129  51.826 33.764 1.00 22.75 ? 70   CYS A CA   1 
ATOM   253  C  C    . CYS A 1 40  ? -3.466  51.593 32.415 1.00 21.34 ? 70   CYS A C    1 
ATOM   254  O  O    . CYS A 1 40  ? -4.133  51.433 31.396 1.00 18.71 ? 70   CYS A O    1 
ATOM   255  C  CB   . CYS A 1 40  ? -3.882  53.271 34.200 1.00 20.81 ? 70   CYS A CB   1 
ATOM   256  S  SG   . CYS A 1 40  ? -4.317  54.512 32.941 1.00 25.62 ? 70   CYS A SG   1 
ATOM   257  N  N    . ILE A 1 41  ? -2.142  51.528 32.433 1.00 22.70 ? 71   ILE A N    1 
ATOM   258  C  CA   . ILE A 1 41  ? -1.374  51.310 31.224 1.00 24.27 ? 71   ILE A CA   1 
ATOM   259  C  C    . ILE A 1 41  ? -1.676  49.934 30.644 1.00 24.24 ? 71   ILE A C    1 
ATOM   260  O  O    . ILE A 1 41  ? -1.964  49.822 29.450 1.00 21.40 ? 71   ILE A O    1 
ATOM   261  C  CB   . ILE A 1 41  ? 0.140   51.483 31.488 1.00 23.90 ? 71   ILE A CB   1 
ATOM   262  C  CG1  . ILE A 1 41  ? 0.424   52.914 31.975 1.00 21.96 ? 71   ILE A CG1  1 
ATOM   263  C  CG2  . ILE A 1 41  ? 0.951   51.149 30.230 1.00 25.99 ? 71   ILE A CG2  1 
ATOM   264  C  CD1  . ILE A 1 41  ? -0.180  54.017 31.105 1.00 19.53 ? 71   ILE A CD1  1 
ATOM   265  N  N    . PHE A 1 42  ? -1.672  48.912 31.502 1.00 22.64 ? 72   PHE A N    1 
ATOM   266  C  CA   . PHE A 1 42  ? -1.949  47.537 31.084 1.00 23.33 ? 72   PHE A CA   1 
ATOM   267  C  C    . PHE A 1 42  ? -3.253  47.447 30.293 1.00 24.79 ? 72   PHE A C    1 
ATOM   268  O  O    . PHE A 1 42  ? -3.309  46.833 29.224 1.00 23.80 ? 72   PHE A O    1 
ATOM   269  C  CB   . PHE A 1 42  ? -2.042  46.613 32.302 1.00 22.32 ? 72   PHE A CB   1 
ATOM   270  C  CG   . PHE A 1 42  ? -1.956  45.145 31.967 1.00 25.83 ? 72   PHE A CG   1 
ATOM   271  C  CD1  . PHE A 1 42  ? -1.293  44.709 30.815 1.00 29.81 ? 72   PHE A CD1  1 
ATOM   272  C  CD2  . PHE A 1 42  ? -2.510  44.194 32.815 1.00 24.39 ? 72   PHE A CD2  1 
ATOM   273  C  CE1  . PHE A 1 42  ? -1.179  43.347 30.522 1.00 28.17 ? 72   PHE A CE1  1 
ATOM   274  C  CE2  . PHE A 1 42  ? -2.402  42.835 32.533 1.00 27.97 ? 72   PHE A CE2  1 
ATOM   275  C  CZ   . PHE A 1 42  ? -1.737  42.408 31.386 1.00 28.64 ? 72   PHE A CZ   1 
ATOM   276  N  N    . TYR A 1 43  ? -4.295  48.071 30.830 1.00 24.85 ? 73   TYR A N    1 
ATOM   277  C  CA   . TYR A 1 43  ? -5.610  48.078 30.214 1.00 24.74 ? 73   TYR A CA   1 
ATOM   278  C  C    . TYR A 1 43  ? -5.560  48.759 28.841 1.00 25.65 ? 73   TYR A C    1 
ATOM   279  O  O    . TYR A 1 43  ? -6.074  48.223 27.861 1.00 26.36 ? 73   TYR A O    1 
ATOM   280  C  CB   . TYR A 1 43  ? -6.611  48.776 31.152 1.00 23.24 ? 73   TYR A CB   1 
ATOM   281  C  CG   . TYR A 1 43  ? -8.044  48.836 30.656 1.00 25.36 ? 73   TYR A CG   1 
ATOM   282  C  CD1  . TYR A 1 43  ? -8.425  49.755 29.673 1.00 26.21 ? 73   TYR A CD1  1 
ATOM   283  C  CD2  . TYR A 1 43  ? -9.029  48.004 31.192 1.00 21.58 ? 73   TYR A CD2  1 
ATOM   284  C  CE1  . TYR A 1 43  ? -9.742  49.850 29.241 1.00 29.46 ? 73   TYR A CE1  1 
ATOM   285  C  CE2  . TYR A 1 43  ? -10.357 48.093 30.768 1.00 24.71 ? 73   TYR A CE2  1 
ATOM   286  C  CZ   . TYR A 1 43  ? -10.704 49.022 29.789 1.00 29.51 ? 73   TYR A CZ   1 
ATOM   287  O  OH   . TYR A 1 43  ? -12.012 49.143 29.362 1.00 36.55 ? 73   TYR A OH   1 
ATOM   288  N  N    . LEU A 1 44  ? -4.915  49.918 28.761 1.00 25.63 ? 74   LEU A N    1 
ATOM   289  C  CA   . LEU A 1 44  ? -4.827  50.649 27.498 1.00 28.84 ? 74   LEU A CA   1 
ATOM   290  C  C    . LEU A 1 44  ? -4.028  49.904 26.421 1.00 30.29 ? 74   LEU A C    1 
ATOM   291  O  O    . LEU A 1 44  ? -4.393  49.932 25.239 1.00 29.24 ? 74   LEU A O    1 
ATOM   292  C  CB   . LEU A 1 44  ? -4.248  52.049 27.723 1.00 28.35 ? 74   LEU A CB   1 
ATOM   293  C  CG   . LEU A 1 44  ? -5.196  53.038 28.407 1.00 28.42 ? 74   LEU A CG   1 
ATOM   294  C  CD1  . LEU A 1 44  ? -4.481  54.359 28.677 1.00 26.21 ? 74   LEU A CD1  1 
ATOM   295  C  CD2  . LEU A 1 44  ? -6.421  53.249 27.534 1.00 26.43 ? 74   LEU A CD2  1 
ATOM   296  N  N    . VAL A 1 45  ? -2.939  49.253 26.827 1.00 28.82 ? 75   VAL A N    1 
ATOM   297  C  CA   . VAL A 1 45  ? -2.111  48.483 25.903 1.00 28.57 ? 75   VAL A CA   1 
ATOM   298  C  C    . VAL A 1 45  ? -2.915  47.270 25.409 1.00 29.01 ? 75   VAL A C    1 
ATOM   299  O  O    . VAL A 1 45  ? -2.958  46.997 24.205 1.00 29.34 ? 75   VAL A O    1 
ATOM   300  C  CB   . VAL A 1 45  ? -0.771  48.064 26.565 1.00 26.69 ? 75   VAL A CB   1 
ATOM   301  C  CG1  . VAL A 1 45  ? -0.222  46.805 25.944 1.00 29.22 ? 75   VAL A CG1  1 
ATOM   302  C  CG2  . VAL A 1 45  ? 0.240   49.178 26.409 1.00 19.37 ? 75   VAL A CG2  1 
ATOM   303  N  N    . LEU A 1 46  ? -3.592  46.585 26.329 1.00 26.14 ? 76   LEU A N    1 
ATOM   304  C  CA   . LEU A 1 46  ? -4.417  45.430 25.971 1.00 24.71 ? 76   LEU A CA   1 
ATOM   305  C  C    . LEU A 1 46  ? -5.582  45.881 25.090 1.00 25.30 ? 76   LEU A C    1 
ATOM   306  O  O    . LEU A 1 46  ? -6.090  45.116 24.273 1.00 21.87 ? 76   LEU A O    1 
ATOM   307  C  CB   . LEU A 1 46  ? -4.968  44.740 27.222 1.00 22.01 ? 76   LEU A CB   1 
ATOM   308  C  CG   . LEU A 1 46  ? -4.029  43.876 28.065 1.00 20.29 ? 76   LEU A CG   1 
ATOM   309  C  CD1  . LEU A 1 46  ? -4.720  43.500 29.346 1.00 16.51 ? 76   LEU A CD1  1 
ATOM   310  C  CD2  . LEU A 1 46  ? -3.624  42.624 27.297 1.00 20.53 ? 76   LEU A CD2  1 
ATOM   311  N  N    . ARG A 1 47  ? -5.999  47.131 25.249 1.00 23.57 ? 77   ARG A N    1 
ATOM   312  C  CA   . ARG A 1 47  ? -7.097  47.646 24.452 1.00 27.79 ? 77   ARG A CA   1 
ATOM   313  C  C    . ARG A 1 47  ? -6.634  47.862 23.024 1.00 26.82 ? 77   ARG A C    1 
ATOM   314  O  O    . ARG A 1 47  ? -7.347  47.529 22.084 1.00 30.43 ? 77   ARG A O    1 
ATOM   315  C  CB   . ARG A 1 47  ? -7.645  48.952 25.029 1.00 30.42 ? 77   ARG A CB   1 
ATOM   316  C  CG   . ARG A 1 47  ? -8.953  49.402 24.391 1.00 35.44 ? 77   ARG A CG   1 
ATOM   317  C  CD   . ARG A 1 47  ? -9.973  48.264 24.401 1.00 37.88 ? 77   ARG A CD   1 
ATOM   318  N  NE   . ARG A 1 47  ? -11.316 48.731 24.088 1.00 39.09 ? 77   ARG A NE   1 
ATOM   319  C  CZ   . ARG A 1 47  ? -12.268 48.929 24.997 1.00 39.04 ? 77   ARG A CZ   1 
ATOM   320  N  NH1  . ARG A 1 47  ? -12.029 48.692 26.281 1.00 43.25 ? 77   ARG A NH1  1 
ATOM   321  N  NH2  . ARG A 1 47  ? -13.459 49.374 24.623 1.00 36.80 ? 77   ARG A NH2  1 
ATOM   322  N  N    . ALA A 1 48  ? -5.436  48.409 22.864 1.00 25.07 ? 78   ALA A N    1 
ATOM   323  C  CA   . ALA A 1 48  ? -4.879  48.650 21.537 1.00 27.87 ? 78   ALA A CA   1 
ATOM   324  C  C    . ALA A 1 48  ? -4.792  47.338 20.739 1.00 26.53 ? 78   ALA A C    1 
ATOM   325  O  O    . ALA A 1 48  ? -5.282  47.250 19.609 1.00 22.79 ? 78   ALA A O    1 
ATOM   326  C  CB   . ALA A 1 48  ? -3.499  49.301 21.657 1.00 27.07 ? 78   ALA A CB   1 
ATOM   327  N  N    . LEU A 1 49  ? -4.191  46.318 21.349 1.00 27.95 ? 79   LEU A N    1 
ATOM   328  C  CA   . LEU A 1 49  ? -4.040  45.018 20.709 1.00 27.54 ? 79   LEU A CA   1 
ATOM   329  C  C    . LEU A 1 49  ? -5.409  44.443 20.372 1.00 29.68 ? 79   LEU A C    1 
ATOM   330  O  O    . LEU A 1 49  ? -5.624  43.933 19.263 1.00 29.46 ? 79   LEU A O    1 
ATOM   331  C  CB   . LEU A 1 49  ? -3.252  44.060 21.611 1.00 26.64 ? 79   LEU A CB   1 
ATOM   332  C  CG   . LEU A 1 49  ? -2.801  42.719 21.011 1.00 27.35 ? 79   LEU A CG   1 
ATOM   333  C  CD1  . LEU A 1 49  ? -2.062  42.927 19.696 1.00 25.13 ? 79   LEU A CD1  1 
ATOM   334  C  CD2  . LEU A 1 49  ? -1.935  41.954 22.005 1.00 29.04 ? 79   LEU A CD2  1 
ATOM   335  N  N    . ASP A 1 50  ? -6.346  44.569 21.307 1.00 27.44 ? 80   ASP A N    1 
ATOM   336  C  CA   . ASP A 1 50  ? -7.692  44.065 21.089 1.00 31.58 ? 80   ASP A CA   1 
ATOM   337  C  C    . ASP A 1 50  ? -8.343  44.742 19.887 1.00 32.56 ? 80   ASP A C    1 
ATOM   338  O  O    . ASP A 1 50  ? -8.959  44.080 19.042 1.00 33.47 ? 80   ASP A O    1 
ATOM   339  C  CB   . ASP A 1 50  ? -8.549  44.266 22.338 1.00 35.56 ? 80   ASP A CB   1 
ATOM   340  C  CG   . ASP A 1 50  ? -8.111  43.388 23.506 1.00 39.32 ? 80   ASP A CG   1 
ATOM   341  O  OD1  . ASP A 1 50  ? -7.219  42.531 23.337 1.00 40.58 ? 80   ASP A OD1  1 
ATOM   342  O  OD2  . ASP A 1 50  ? -8.663  43.565 24.611 1.00 45.70 ? 80   ASP A OD2  1 
ATOM   343  N  N    . THR A 1 51  ? -8.174  46.056 19.798 1.00 32.29 ? 81   THR A N    1 
ATOM   344  C  CA   . THR A 1 51  ? -8.728  46.841 18.708 1.00 28.31 ? 81   THR A CA   1 
ATOM   345  C  C    . THR A 1 51  ? -8.193  46.351 17.371 1.00 30.17 ? 81   THR A C    1 
ATOM   346  O  O    . THR A 1 51  ? -8.912  46.348 16.369 1.00 29.50 ? 81   THR A O    1 
ATOM   347  C  CB   . THR A 1 51  ? -8.373  48.315 18.868 1.00 27.88 ? 81   THR A CB   1 
ATOM   348  O  OG1  . THR A 1 51  ? -8.914  48.803 20.101 1.00 29.46 ? 81   THR A OG1  1 
ATOM   349  C  CG2  . THR A 1 51  ? -8.932  49.126 17.714 1.00 27.11 ? 81   THR A CG2  1 
ATOM   350  N  N    . LEU A 1 52  ? -6.923  45.951 17.358 1.00 31.44 ? 82   LEU A N    1 
ATOM   351  C  CA   . LEU A 1 52  ? -6.292  45.449 16.143 1.00 31.44 ? 82   LEU A CA   1 
ATOM   352  C  C    . LEU A 1 52  ? -6.928  44.125 15.744 1.00 31.75 ? 82   LEU A C    1 
ATOM   353  O  O    . LEU A 1 52  ? -7.444  43.984 14.637 1.00 29.26 ? 82   LEU A O    1 
ATOM   354  C  CB   . LEU A 1 52  ? -4.789  45.255 16.355 1.00 32.87 ? 82   LEU A CB   1 
ATOM   355  C  CG   . LEU A 1 52  ? -3.956  46.521 16.530 1.00 35.19 ? 82   LEU A CG   1 
ATOM   356  C  CD1  . LEU A 1 52  ? -2.507  46.147 16.795 1.00 37.41 ? 82   LEU A CD1  1 
ATOM   357  C  CD2  . LEU A 1 52  ? -4.069  47.385 15.283 1.00 35.56 ? 82   LEU A CD2  1 
ATOM   358  N  N    . GLU A 1 53  ? -6.946  43.185 16.684 1.00 30.85 ? 83   GLU A N    1 
ATOM   359  C  CA   . GLU A 1 53  ? -7.517  41.866 16.436 1.00 31.13 ? 83   GLU A CA   1 
ATOM   360  C  C    . GLU A 1 53  ? -8.937  41.952 15.904 1.00 28.69 ? 83   GLU A C    1 
ATOM   361  O  O    . GLU A 1 53  ? -9.308  41.218 14.992 1.00 29.50 ? 83   GLU A O    1 
ATOM   362  C  CB   . GLU A 1 53  ? -7.532  41.031 17.720 1.00 28.20 ? 83   GLU A CB   1 
ATOM   363  C  CG   . GLU A 1 53  ? -8.049  39.614 17.519 1.00 25.35 ? 83   GLU A CG   1 
ATOM   364  C  CD   . GLU A 1 53  ? -8.494  38.946 18.807 1.00 28.21 ? 83   GLU A CD   1 
ATOM   365  O  OE1  . GLU A 1 53  ? -9.082  39.635 19.671 1.00 26.49 ? 83   GLU A OE1  1 
ATOM   366  O  OE2  . GLU A 1 53  ? -8.272  37.721 18.946 1.00 24.01 ? 83   GLU A OE2  1 
ATOM   367  N  N    . ASP A 1 54  ? -9.739  42.813 16.515 1.00 26.77 ? 84   ASP A N    1 
ATOM   368  C  CA   . ASP A 1 54  ? -11.125 42.970 16.128 1.00 30.96 ? 84   ASP A CA   1 
ATOM   369  C  C    . ASP A 1 54  ? -11.348 43.718 14.833 1.00 34.31 ? 84   ASP A C    1 
ATOM   370  O  O    . ASP A 1 54  ? -12.433 43.631 14.254 1.00 35.91 ? 84   ASP A O    1 
ATOM   371  C  CB   . ASP A 1 54  ? -11.920 43.636 17.251 1.00 34.57 ? 84   ASP A CB   1 
ATOM   372  C  CG   . ASP A 1 54  ? -12.386 42.648 18.309 1.00 41.48 ? 84   ASP A CG   1 
ATOM   373  O  OD1  . ASP A 1 54  ? -12.054 41.434 18.230 1.00 46.34 ? 84   ASP A OD1  1 
ATOM   374  O  OD2  . ASP A 1 54  ? -13.104 43.091 19.223 1.00 43.54 ? 84   ASP A OD2  1 
ATOM   375  N  N    . ASP A 1 55  ? -10.329 44.419 14.349 1.00 35.46 ? 85   ASP A N    1 
ATOM   376  C  CA   . ASP A 1 55  ? -10.505 45.181 13.128 1.00 38.01 ? 85   ASP A CA   1 
ATOM   377  C  C    . ASP A 1 55  ? -10.519 44.342 11.868 1.00 38.14 ? 85   ASP A C    1 
ATOM   378  O  O    . ASP A 1 55  ? -9.475  44.046 11.286 1.00 38.24 ? 85   ASP A O    1 
ATOM   379  C  CB   . ASP A 1 55  ? -9.487  46.305 13.010 1.00 38.21 ? 85   ASP A CB   1 
ATOM   380  C  CG   . ASP A 1 55  ? -10.075 47.535 12.344 1.00 38.84 ? 85   ASP A CG   1 
ATOM   381  O  OD1  . ASP A 1 55  ? -11.077 47.391 11.610 1.00 36.71 ? 85   ASP A OD1  1 
ATOM   382  O  OD2  . ASP A 1 55  ? -9.561  48.646 12.578 1.00 43.84 ? 85   ASP A OD2  1 
ATOM   383  N  N    . MET A 1 56  ? -11.724 43.999 11.427 1.00 38.25 ? 86   MET A N    1 
ATOM   384  C  CA   . MET A 1 56  ? -11.887 43.191 10.235 1.00 39.19 ? 86   MET A CA   1 
ATOM   385  C  C    . MET A 1 56  ? -11.671 43.958 8.938  1.00 38.19 ? 86   MET A C    1 
ATOM   386  O  O    . MET A 1 56  ? -11.752 43.378 7.857  1.00 40.68 ? 86   MET A O    1 
ATOM   387  C  CB   . MET A 1 56  ? -13.235 42.471 10.243 1.00 37.77 ? 86   MET A CB   1 
ATOM   388  C  CG   . MET A 1 56  ? -13.320 41.392 11.302 1.00 37.78 ? 86   MET A CG   1 
ATOM   389  S  SD   . MET A 1 56  ? -11.836 40.374 11.306 1.00 38.55 ? 86   MET A SD   1 
ATOM   390  C  CE   . MET A 1 56  ? -11.543 40.237 13.032 1.00 40.48 ? 86   MET A CE   1 
ATOM   391  N  N    . THR A 1 57  ? -11.423 45.261 9.030  1.00 34.86 ? 87   THR A N    1 
ATOM   392  C  CA   . THR A 1 57  ? -11.152 46.028 7.822  1.00 33.47 ? 87   THR A CA   1 
ATOM   393  C  C    . THR A 1 57  ? -9.678  45.807 7.486  1.00 31.39 ? 87   THR A C    1 
ATOM   394  O  O    . THR A 1 57  ? -9.208  46.215 6.425  1.00 27.79 ? 87   THR A O    1 
ATOM   395  C  CB   . THR A 1 57  ? -11.451 47.551 7.970  1.00 34.07 ? 87   THR A CB   1 
ATOM   396  O  OG1  . THR A 1 57  ? -10.565 48.146 8.929  1.00 36.83 ? 87   THR A OG1  1 
ATOM   397  C  CG2  . THR A 1 57  ? -12.897 47.773 8.387  1.00 25.99 ? 87   THR A CG2  1 
ATOM   398  N  N    . ILE A 1 58  ? -8.956  45.175 8.409  1.00 30.27 ? 88   ILE A N    1 
ATOM   399  C  CA   . ILE A 1 58  ? -7.544  44.877 8.209  1.00 35.37 ? 88   ILE A CA   1 
ATOM   400  C  C    . ILE A 1 58  ? -7.476  43.415 7.783  1.00 37.59 ? 88   ILE A C    1 
ATOM   401  O  O    . ILE A 1 58  ? -8.173  42.567 8.350  1.00 39.34 ? 88   ILE A O    1 
ATOM   402  C  CB   . ILE A 1 58  ? -6.708  45.047 9.510  1.00 34.86 ? 88   ILE A CB   1 
ATOM   403  C  CG1  . ILE A 1 58  ? -7.034  46.375 10.199 1.00 36.09 ? 88   ILE A CG1  1 
ATOM   404  C  CG2  . ILE A 1 58  ? -5.212  44.995 9.177  1.00 32.77 ? 88   ILE A CG2  1 
ATOM   405  C  CD1  . ILE A 1 58  ? -6.260  46.595 11.494 1.00 36.05 ? 88   ILE A CD1  1 
ATOM   406  N  N    . SER A 1 59  ? -6.664  43.125 6.771  1.00 38.62 ? 89   SER A N    1 
ATOM   407  C  CA   . SER A 1 59  ? -6.526  41.756 6.285  1.00 38.60 ? 89   SER A CA   1 
ATOM   408  C  C    . SER A 1 59  ? -5.638  40.946 7.228  1.00 37.31 ? 89   SER A C    1 
ATOM   409  O  O    . SER A 1 59  ? -4.784  41.511 7.918  1.00 38.44 ? 89   SER A O    1 
ATOM   410  C  CB   . SER A 1 59  ? -5.928  41.752 4.873  1.00 38.07 ? 89   SER A CB   1 
ATOM   411  O  OG   . SER A 1 59  ? -4.535  42.042 4.886  1.00 41.09 ? 89   SER A OG   1 
ATOM   412  N  N    . VAL A 1 60  ? -5.805  39.627 7.229  1.00 36.45 ? 90   VAL A N    1 
ATOM   413  C  CA   . VAL A 1 60  ? -4.994  38.770 8.088  1.00 38.04 ? 90   VAL A CA   1 
ATOM   414  C  C    . VAL A 1 60  ? -3.510  38.921 7.753  1.00 39.66 ? 90   VAL A C    1 
ATOM   415  O  O    . VAL A 1 60  ? -2.649  38.812 8.631  1.00 37.97 ? 90   VAL A O    1 
ATOM   416  C  CB   . VAL A 1 60  ? -5.400  37.268 7.983  1.00 38.17 ? 90   VAL A CB   1 
ATOM   417  C  CG1  . VAL A 1 60  ? -6.899  37.103 8.172  1.00 40.85 ? 90   VAL A CG1  1 
ATOM   418  C  CG2  . VAL A 1 60  ? -4.953  36.666 6.675  1.00 36.35 ? 90   VAL A CG2  1 
ATOM   419  N  N    . GLU A 1 61  ? -3.232  39.224 6.485  1.00 41.71 ? 91   GLU A N    1 
ATOM   420  C  CA   . GLU A 1 61  ? -1.868  39.399 5.988  1.00 41.82 ? 91   GLU A CA   1 
ATOM   421  C  C    . GLU A 1 61  ? -1.159  40.547 6.697  1.00 40.04 ? 91   GLU A C    1 
ATOM   422  O  O    . GLU A 1 61  ? 0.039   40.470 6.965  1.00 37.61 ? 91   GLU A O    1 
ATOM   423  C  CB   . GLU A 1 61  ? -1.877  39.643 4.474  1.00 45.54 ? 91   GLU A CB   1 
ATOM   424  C  CG   . GLU A 1 61  ? -2.291  38.435 3.625  1.00 47.82 ? 91   GLU A CG   1 
ATOM   425  C  CD   . GLU A 1 61  ? -3.781  38.099 3.690  1.00 51.06 ? 91   GLU A CD   1 
ATOM   426  O  OE1  . GLU A 1 61  ? -4.628  39.021 3.729  1.00 52.38 ? 91   GLU A OE1  1 
ATOM   427  O  OE2  . GLU A 1 61  ? -4.107  36.893 3.677  1.00 50.71 ? 91   GLU A OE2  1 
ATOM   428  N  N    . LYS A 1 62  ? -1.905  41.614 6.977  1.00 42.61 ? 92   LYS A N    1 
ATOM   429  C  CA   . LYS A 1 62  ? -1.362  42.782 7.675  1.00 46.00 ? 92   LYS A CA   1 
ATOM   430  C  C    . LYS A 1 62  ? -1.350  42.555 9.190  1.00 45.73 ? 92   LYS A C    1 
ATOM   431  O  O    . LYS A 1 62  ? -0.370  42.872 9.876  1.00 45.23 ? 92   LYS A O    1 
ATOM   432  C  CB   . LYS A 1 62  ? -2.204  44.027 7.376  1.00 46.39 ? 92   LYS A CB   1 
ATOM   433  C  CG   . LYS A 1 62  ? -2.004  44.635 6.001  1.00 51.77 ? 92   LYS A CG   1 
ATOM   434  C  CD   . LYS A 1 62  ? -2.908  45.857 5.812  1.00 56.83 ? 92   LYS A CD   1 
ATOM   435  C  CE   . LYS A 1 62  ? -2.652  46.925 6.877  1.00 57.69 ? 92   LYS A CE   1 
ATOM   436  N  NZ   . LYS A 1 62  ? -3.596  48.079 6.758  1.00 61.48 ? 92   LYS A NZ   1 
ATOM   437  N  N    . LYS A 1 63  ? -2.441  41.985 9.695  1.00 44.84 ? 93   LYS A N    1 
ATOM   438  C  CA   . LYS A 1 63  ? -2.601  41.727 11.123 1.00 44.57 ? 93   LYS A CA   1 
ATOM   439  C  C    . LYS A 1 63  ? -1.579  40.806 11.767 1.00 42.15 ? 93   LYS A C    1 
ATOM   440  O  O    . LYS A 1 63  ? -1.075  41.119 12.844 1.00 42.38 ? 93   LYS A O    1 
ATOM   441  C  CB   . LYS A 1 63  ? -4.010  41.213 11.424 1.00 43.99 ? 93   LYS A CB   1 
ATOM   442  C  CG   . LYS A 1 63  ? -5.077  42.173 10.981 1.00 47.88 ? 93   LYS A CG   1 
ATOM   443  C  CD   . LYS A 1 63  ? -6.463  41.593 11.090 1.00 51.02 ? 93   LYS A CD   1 
ATOM   444  C  CE   . LYS A 1 63  ? -7.082  41.882 12.437 1.00 48.23 ? 93   LYS A CE   1 
ATOM   445  N  NZ   . LYS A 1 63  ? -8.542  41.602 12.403 1.00 43.42 ? 93   LYS A NZ   1 
ATOM   446  N  N    . VAL A 1 64  ? -1.249  39.693 11.120 1.00 38.09 ? 94   VAL A N    1 
ATOM   447  C  CA   . VAL A 1 64  ? -0.305  38.755 11.719 1.00 38.65 ? 94   VAL A CA   1 
ATOM   448  C  C    . VAL A 1 64  ? 0.979   39.412 12.253 1.00 39.87 ? 94   VAL A C    1 
ATOM   449  O  O    . VAL A 1 64  ? 1.298   39.272 13.440 1.00 38.09 ? 94   VAL A O    1 
ATOM   450  C  CB   . VAL A 1 64  ? -0.027  37.543 10.786 1.00 38.69 ? 94   VAL A CB   1 
ATOM   451  C  CG1  . VAL A 1 64  ? 1.035   36.628 11.387 1.00 32.43 ? 94   VAL A CG1  1 
ATOM   452  C  CG2  . VAL A 1 64  ? -1.317  36.755 10.578 1.00 34.02 ? 94   VAL A CG2  1 
ATOM   453  N  N    . PRO A 1 65  ? 1.708   40.169 11.409 1.00 38.94 ? 95   PRO A N    1 
ATOM   454  C  CA   . PRO A 1 65  ? 2.934   40.812 11.898 1.00 37.28 ? 95   PRO A CA   1 
ATOM   455  C  C    . PRO A 1 65  ? 2.644   41.852 12.976 1.00 33.82 ? 95   PRO A C    1 
ATOM   456  O  O    . PRO A 1 65  ? 3.458   42.059 13.876 1.00 37.61 ? 95   PRO A O    1 
ATOM   457  C  CB   . PRO A 1 65  ? 3.501   41.461 10.640 1.00 35.64 ? 95   PRO A CB   1 
ATOM   458  C  CG   . PRO A 1 65  ? 3.043   40.540 9.563  1.00 38.18 ? 95   PRO A CG   1 
ATOM   459  C  CD   . PRO A 1 65  ? 1.604   40.313 9.947  1.00 37.04 ? 95   PRO A CD   1 
ATOM   460  N  N    . LEU A 1 66  ? 1.491   42.507 12.878 1.00 32.96 ? 96   LEU A N    1 
ATOM   461  C  CA   . LEU A 1 66  ? 1.095   43.512 13.864 1.00 33.90 ? 96   LEU A CA   1 
ATOM   462  C  C    . LEU A 1 66  ? 0.824   42.868 15.221 1.00 32.75 ? 96   LEU A C    1 
ATOM   463  O  O    . LEU A 1 66  ? 1.320   43.334 16.246 1.00 32.06 ? 96   LEU A O    1 
ATOM   464  C  CB   . LEU A 1 66  ? -0.145  44.288 13.399 1.00 33.36 ? 96   LEU A CB   1 
ATOM   465  C  CG   . LEU A 1 66  ? 0.078   45.376 12.338 1.00 32.22 ? 96   LEU A CG   1 
ATOM   466  C  CD1  . LEU A 1 66  ? -1.256  45.946 11.876 1.00 27.18 ? 96   LEU A CD1  1 
ATOM   467  C  CD2  . LEU A 1 66  ? 0.968   46.476 12.903 1.00 27.60 ? 96   LEU A CD2  1 
ATOM   468  N  N    . LEU A 1 67  ? 0.072   41.771 15.213 1.00 30.28 ? 97   LEU A N    1 
ATOM   469  C  CA   . LEU A 1 67  ? -0.263  41.052 16.435 1.00 30.58 ? 97   LEU A CA   1 
ATOM   470  C  C    . LEU A 1 67  ? 1.001   40.477 17.054 1.00 31.48 ? 97   LEU A C    1 
ATOM   471  O  O    . LEU A 1 67  ? 1.203   40.560 18.266 1.00 32.51 ? 97   LEU A O    1 
ATOM   472  C  CB   . LEU A 1 67  ? -1.244  39.918 16.140 1.00 29.02 ? 97   LEU A CB   1 
ATOM   473  C  CG   . LEU A 1 67  ? -2.579  40.263 15.482 1.00 28.47 ? 97   LEU A CG   1 
ATOM   474  C  CD1  . LEU A 1 67  ? -3.356  38.986 15.254 1.00 28.32 ? 97   LEU A CD1  1 
ATOM   475  C  CD2  . LEU A 1 67  ? -3.376  41.220 16.342 1.00 28.81 ? 97   LEU A CD2  1 
ATOM   476  N  N    . HIS A 1 68  ? 1.859   39.921 16.204 1.00 32.94 ? 98   HIS A N    1 
ATOM   477  C  CA   . HIS A 1 68  ? 3.115   39.320 16.636 1.00 33.36 ? 98   HIS A CA   1 
ATOM   478  C  C    . HIS A 1 68  ? 4.131   40.312 17.195 1.00 30.99 ? 98   HIS A C    1 
ATOM   479  O  O    . HIS A 1 68  ? 4.783   40.037 18.203 1.00 30.16 ? 98   HIS A O    1 
ATOM   480  C  CB   . HIS A 1 68  ? 3.754   38.547 15.477 1.00 36.20 ? 98   HIS A CB   1 
ATOM   481  C  CG   . HIS A 1 68  ? 3.133   37.210 15.223 1.00 40.12 ? 98   HIS A CG   1 
ATOM   482  N  ND1  . HIS A 1 68  ? 3.060   36.648 13.966 1.00 41.67 ? 98   HIS A ND1  1 
ATOM   483  C  CD2  . HIS A 1 68  ? 2.593   36.302 16.070 1.00 42.65 ? 98   HIS A CD2  1 
ATOM   484  C  CE1  . HIS A 1 68  ? 2.506   35.452 14.051 1.00 40.15 ? 98   HIS A CE1  1 
ATOM   485  N  NE2  . HIS A 1 68  ? 2.213   35.218 15.317 1.00 40.15 ? 98   HIS A NE2  1 
ATOM   486  N  N    . ASN A 1 69  ? 4.268   41.461 16.541 1.00 30.65 ? 99   ASN A N    1 
ATOM   487  C  CA   . ASN A 1 69  ? 5.235   42.467 16.966 1.00 33.80 ? 99   ASN A CA   1 
ATOM   488  C  C    . ASN A 1 69  ? 4.743   43.517 17.962 1.00 32.80 ? 99   ASN A C    1 
ATOM   489  O  O    . ASN A 1 69  ? 5.501   44.418 18.351 1.00 31.14 ? 99   ASN A O    1 
ATOM   490  C  CB   . ASN A 1 69  ? 5.847   43.149 15.741 1.00 35.05 ? 99   ASN A CB   1 
ATOM   491  C  CG   . ASN A 1 69  ? 6.912   42.301 15.079 1.00 43.56 ? 99   ASN A CG   1 
ATOM   492  O  OD1  . ASN A 1 69  ? 7.749   41.689 15.755 1.00 44.64 ? 99   ASN A OD1  1 
ATOM   493  N  ND2  . ASN A 1 69  ? 6.907   42.272 13.754 1.00 41.56 ? 99   ASN A ND2  1 
ATOM   494  N  N    . PHE A 1 70  ? 3.500   43.383 18.412 1.00 28.96 ? 100  PHE A N    1 
ATOM   495  C  CA   . PHE A 1 70  ? 2.947   44.341 19.352 1.00 27.08 ? 100  PHE A CA   1 
ATOM   496  C  C    . PHE A 1 70  ? 3.841   44.572 20.571 1.00 25.74 ? 100  PHE A C    1 
ATOM   497  O  O    . PHE A 1 70  ? 4.139   45.711 20.922 1.00 22.34 ? 100  PHE A O    1 
ATOM   498  C  CB   . PHE A 1 70  ? 1.550   43.920 19.796 1.00 25.00 ? 100  PHE A CB   1 
ATOM   499  C  CG   . PHE A 1 70  ? 0.835   44.966 20.610 1.00 24.52 ? 100  PHE A CG   1 
ATOM   500  C  CD1  . PHE A 1 70  ? 0.314   46.108 20.002 1.00 25.85 ? 100  PHE A CD1  1 
ATOM   501  C  CD2  . PHE A 1 70  ? 0.668   44.805 21.981 1.00 21.50 ? 100  PHE A CD2  1 
ATOM   502  C  CE1  . PHE A 1 70  ? -0.367  47.073 20.756 1.00 28.44 ? 100  PHE A CE1  1 
ATOM   503  C  CE2  . PHE A 1 70  ? -0.006  45.757 22.738 1.00 18.61 ? 100  PHE A CE2  1 
ATOM   504  C  CZ   . PHE A 1 70  ? -0.525  46.892 22.127 1.00 22.79 ? 100  PHE A CZ   1 
ATOM   505  N  N    . HIS A 1 71  ? 4.310   43.495 21.187 1.00 26.37 ? 101  HIS A N    1 
ATOM   506  C  CA   . HIS A 1 71  ? 5.162   43.622 22.364 1.00 29.55 ? 101  HIS A CA   1 
ATOM   507  C  C    . HIS A 1 71  ? 6.373   44.529 22.107 1.00 30.30 ? 101  HIS A C    1 
ATOM   508  O  O    . HIS A 1 71  ? 6.693   45.399 22.917 1.00 33.16 ? 101  HIS A O    1 
ATOM   509  C  CB   . HIS A 1 71  ? 5.584   42.237 22.878 1.00 27.63 ? 101  HIS A CB   1 
ATOM   510  C  CG   . HIS A 1 71  ? 6.498   41.494 21.959 1.00 31.70 ? 101  HIS A CG   1 
ATOM   511  N  ND1  . HIS A 1 71  ? 6.231   41.317 20.617 1.00 31.72 ? 101  HIS A ND1  1 
ATOM   512  C  CD2  . HIS A 1 71  ? 7.686   40.886 22.186 1.00 31.78 ? 101  HIS A CD2  1 
ATOM   513  C  CE1  . HIS A 1 71  ? 7.214   40.636 20.060 1.00 29.89 ? 101  HIS A CE1  1 
ATOM   514  N  NE2  . HIS A 1 71  ? 8.111   40.362 20.992 1.00 31.70 ? 101  HIS A NE2  1 
ATOM   515  N  N    . SER A 1 72  ? 6.997   44.374 20.946 1.00 33.45 ? 102  SER A N    1 
ATOM   516  C  CA   . SER A 1 72  ? 8.149   45.190 20.578 1.00 30.37 ? 102  SER A CA   1 
ATOM   517  C  C    . SER A 1 72  ? 7.737   46.648 20.353 1.00 27.25 ? 102  SER A C    1 
ATOM   518  O  O    . SER A 1 72  ? 8.531   47.560 20.579 1.00 28.41 ? 102  SER A O    1 
ATOM   519  C  CB   . SER A 1 72  ? 8.804   44.618 19.320 1.00 33.20 ? 102  SER A CB   1 
ATOM   520  O  OG   . SER A 1 72  ? 9.083   43.233 19.485 1.00 35.65 ? 102  SER A OG   1 
ATOM   521  N  N    . PHE A 1 73  ? 6.492   46.864 19.928 1.00 28.36 ? 103  PHE A N    1 
ATOM   522  C  CA   . PHE A 1 73  ? 5.959   48.216 19.685 1.00 32.48 ? 103  PHE A CA   1 
ATOM   523  C  C    . PHE A 1 73  ? 5.956   49.074 20.954 1.00 32.79 ? 103  PHE A C    1 
ATOM   524  O  O    . PHE A 1 73  ? 5.989   50.312 20.881 1.00 29.09 ? 103  PHE A O    1 
ATOM   525  C  CB   . PHE A 1 73  ? 4.534   48.150 19.123 1.00 35.50 ? 103  PHE A CB   1 
ATOM   526  C  CG   . PHE A 1 73  ? 4.442   47.530 17.758 1.00 37.01 ? 103  PHE A CG   1 
ATOM   527  C  CD1  . PHE A 1 73  ? 5.552   47.478 16.922 1.00 35.01 ? 103  PHE A CD1  1 
ATOM   528  C  CD2  . PHE A 1 73  ? 3.236   47.012 17.304 1.00 37.05 ? 103  PHE A CD2  1 
ATOM   529  C  CE1  . PHE A 1 73  ? 5.456   46.927 15.656 1.00 39.15 ? 103  PHE A CE1  1 
ATOM   530  C  CE2  . PHE A 1 73  ? 3.131   46.457 16.036 1.00 40.70 ? 103  PHE A CE2  1 
ATOM   531  C  CZ   . PHE A 1 73  ? 4.242   46.413 15.212 1.00 39.88 ? 103  PHE A CZ   1 
ATOM   532  N  N    . LEU A 1 74  ? 5.878   48.405 22.105 1.00 30.54 ? 104  LEU A N    1 
ATOM   533  C  CA   . LEU A 1 74  ? 5.904   49.062 23.417 1.00 31.01 ? 104  LEU A CA   1 
ATOM   534  C  C    . LEU A 1 74  ? 7.230   49.807 23.575 1.00 31.33 ? 104  LEU A C    1 
ATOM   535  O  O    . LEU A 1 74  ? 7.306   50.834 24.253 1.00 30.27 ? 104  LEU A O    1 
ATOM   536  C  CB   . LEU A 1 74  ? 5.805   48.011 24.529 1.00 25.49 ? 104  LEU A CB   1 
ATOM   537  C  CG   . LEU A 1 74  ? 4.460   47.416 24.937 1.00 26.16 ? 104  LEU A CG   1 
ATOM   538  C  CD1  . LEU A 1 74  ? 3.549   47.237 23.736 1.00 29.56 ? 104  LEU A CD1  1 
ATOM   539  C  CD2  . LEU A 1 74  ? 4.718   46.087 25.646 1.00 23.29 ? 104  LEU A CD2  1 
ATOM   540  N  N    . TYR A 1 75  ? 8.276   49.266 22.961 1.00 29.15 ? 105  TYR A N    1 
ATOM   541  C  CA   . TYR A 1 75  ? 9.591   49.869 23.037 1.00 33.18 ? 105  TYR A CA   1 
ATOM   542  C  C    . TYR A 1 75  ? 9.975   50.683 21.797 1.00 33.78 ? 105  TYR A C    1 
ATOM   543  O  O    . TYR A 1 75  ? 11.129  51.074 21.630 1.00 38.12 ? 105  TYR A O    1 
ATOM   544  C  CB   . TYR A 1 75  ? 10.630  48.797 23.368 1.00 32.17 ? 105  TYR A CB   1 
ATOM   545  C  CG   . TYR A 1 75  ? 10.386  48.169 24.723 1.00 35.53 ? 105  TYR A CG   1 
ATOM   546  C  CD1  . TYR A 1 75  ? 10.856  48.775 25.889 1.00 36.25 ? 105  TYR A CD1  1 
ATOM   547  C  CD2  . TYR A 1 75  ? 9.649   46.995 24.846 1.00 36.14 ? 105  TYR A CD2  1 
ATOM   548  C  CE1  . TYR A 1 75  ? 10.594  48.228 27.147 1.00 40.68 ? 105  TYR A CE1  1 
ATOM   549  C  CE2  . TYR A 1 75  ? 9.381   46.437 26.097 1.00 41.38 ? 105  TYR A CE2  1 
ATOM   550  C  CZ   . TYR A 1 75  ? 9.857   47.057 27.244 1.00 41.48 ? 105  TYR A CZ   1 
ATOM   551  O  OH   . TYR A 1 75  ? 9.608   46.498 28.480 1.00 42.36 ? 105  TYR A OH   1 
ATOM   552  N  N    . GLN A 1 76  ? 9.002   50.957 20.937 1.00 33.28 ? 106  GLN A N    1 
ATOM   553  C  CA   . GLN A 1 76  ? 9.243   51.751 19.738 1.00 33.63 ? 106  GLN A CA   1 
ATOM   554  C  C    . GLN A 1 76  ? 8.524   53.074 19.970 1.00 29.97 ? 106  GLN A C    1 
ATOM   555  O  O    . GLN A 1 76  ? 7.358   53.211 19.618 1.00 31.21 ? 106  GLN A O    1 
ATOM   556  C  CB   . GLN A 1 76  ? 8.680   51.047 18.496 1.00 36.66 ? 106  GLN A CB   1 
ATOM   557  C  CG   . GLN A 1 76  ? 9.488   49.834 18.037 1.00 39.34 ? 106  GLN A CG   1 
ATOM   558  C  CD   . GLN A 1 76  ? 8.840   49.076 16.876 1.00 41.69 ? 106  GLN A CD   1 
ATOM   559  O  OE1  . GLN A 1 76  ? 8.159   49.657 16.029 1.00 40.98 ? 106  GLN A OE1  1 
ATOM   560  N  NE2  . GLN A 1 76  ? 9.058   47.769 16.838 1.00 43.18 ? 106  GLN A NE2  1 
ATOM   561  N  N    . PRO A 1 77  ? 9.225   54.075 20.534 1.00 29.96 ? 107  PRO A N    1 
ATOM   562  C  CA   . PRO A 1 77  ? 8.707   55.414 20.848 1.00 29.21 ? 107  PRO A CA   1 
ATOM   563  C  C    . PRO A 1 77  ? 7.816   56.104 19.829 1.00 31.70 ? 107  PRO A C    1 
ATOM   564  O  O    . PRO A 1 77  ? 6.925   56.858 20.209 1.00 33.56 ? 107  PRO A O    1 
ATOM   565  C  CB   . PRO A 1 77  ? 9.975   56.210 21.120 1.00 27.36 ? 107  PRO A CB   1 
ATOM   566  C  CG   . PRO A 1 77  ? 10.842  55.196 21.790 1.00 29.25 ? 107  PRO A CG   1 
ATOM   567  C  CD   . PRO A 1 77  ? 10.653  53.985 20.892 1.00 29.20 ? 107  PRO A CD   1 
ATOM   568  N  N    . ASP A 1 78  ? 8.039   55.851 18.544 1.00 36.35 ? 108  ASP A N    1 
ATOM   569  C  CA   . ASP A 1 78  ? 7.237   56.494 17.504 1.00 36.62 ? 108  ASP A CA   1 
ATOM   570  C  C    . ASP A 1 78  ? 6.131   55.631 16.910 1.00 35.59 ? 108  ASP A C    1 
ATOM   571  O  O    . ASP A 1 78  ? 5.265   56.145 16.201 1.00 36.69 ? 108  ASP A O    1 
ATOM   572  C  CB   . ASP A 1 78  ? 8.140   57.003 16.367 1.00 40.11 ? 108  ASP A CB   1 
ATOM   573  C  CG   . ASP A 1 78  ? 9.046   58.154 16.796 1.00 45.59 ? 108  ASP A CG   1 
ATOM   574  O  OD1  . ASP A 1 78  ? 8.737   58.843 17.793 1.00 48.14 ? 108  ASP A OD1  1 
ATOM   575  O  OD2  . ASP A 1 78  ? 10.072  58.382 16.121 1.00 51.43 ? 108  ASP A OD2  1 
ATOM   576  N  N    . TRP A 1 79  ? 6.146   54.330 17.187 1.00 36.10 ? 109  TRP A N    1 
ATOM   577  C  CA   . TRP A 1 79  ? 5.138   53.441 16.609 1.00 35.51 ? 109  TRP A CA   1 
ATOM   578  C  C    . TRP A 1 79  ? 3.718   53.845 16.935 1.00 35.36 ? 109  TRP A C    1 
ATOM   579  O  O    . TRP A 1 79  ? 3.388   54.120 18.092 1.00 38.73 ? 109  TRP A O    1 
ATOM   580  C  CB   . TRP A 1 79  ? 5.341   51.972 17.022 1.00 33.86 ? 109  TRP A CB   1 
ATOM   581  C  CG   . TRP A 1 79  ? 4.393   51.034 16.287 1.00 33.47 ? 109  TRP A CG   1 
ATOM   582  C  CD1  . TRP A 1 79  ? 4.625   50.401 15.091 1.00 30.68 ? 109  TRP A CD1  1 
ATOM   583  C  CD2  . TRP A 1 79  ? 3.037   50.711 16.644 1.00 30.00 ? 109  TRP A CD2  1 
ATOM   584  N  NE1  . TRP A 1 79  ? 3.499   49.727 14.683 1.00 25.71 ? 109  TRP A NE1  1 
ATOM   585  C  CE2  . TRP A 1 79  ? 2.512   49.901 15.614 1.00 29.09 ? 109  TRP A CE2  1 
ATOM   586  C  CE3  . TRP A 1 79  ? 2.219   51.039 17.735 1.00 31.08 ? 109  TRP A CE3  1 
ATOM   587  C  CZ2  . TRP A 1 79  ? 1.199   49.411 15.637 1.00 32.52 ? 109  TRP A CZ2  1 
ATOM   588  C  CZ3  . TRP A 1 79  ? 0.909   50.550 17.758 1.00 33.06 ? 109  TRP A CZ3  1 
ATOM   589  C  CH2  . TRP A 1 79  ? 0.414   49.745 16.713 1.00 32.77 ? 109  TRP A CH2  1 
ATOM   590  N  N    . ARG A 1 80  ? 2.879   53.829 15.905 1.00 32.86 ? 110  ARG A N    1 
ATOM   591  C  CA   . ARG A 1 80  ? 1.465   54.147 16.031 1.00 34.69 ? 110  ARG A CA   1 
ATOM   592  C  C    . ARG A 1 80  ? 0.765   53.484 14.845 1.00 34.13 ? 110  ARG A C    1 
ATOM   593  O  O    . ARG A 1 80  ? 1.420   53.067 13.892 1.00 35.06 ? 110  ARG A O    1 
ATOM   594  C  CB   . ARG A 1 80  ? 1.238   55.664 16.031 1.00 35.07 ? 110  ARG A CB   1 
ATOM   595  C  CG   . ARG A 1 80  ? 1.371   56.327 14.686 1.00 38.92 ? 110  ARG A CG   1 
ATOM   596  C  CD   . ARG A 1 80  ? 1.123   57.824 14.761 1.00 43.27 ? 110  ARG A CD   1 
ATOM   597  N  NE   . ARG A 1 80  ? 0.750   58.329 13.446 1.00 49.49 ? 110  ARG A NE   1 
ATOM   598  C  CZ   . ARG A 1 80  ? 1.370   59.309 12.799 1.00 51.43 ? 110  ARG A CZ   1 
ATOM   599  N  NH1  . ARG A 1 80  ? 2.414   59.919 13.339 1.00 57.43 ? 110  ARG A NH1  1 
ATOM   600  N  NH2  . ARG A 1 80  ? 0.958   59.657 11.585 1.00 52.15 ? 110  ARG A NH2  1 
ATOM   601  N  N    . PHE A 1 81  ? -0.548  53.327 14.925 1.00 33.78 ? 111  PHE A N    1 
ATOM   602  C  CA   . PHE A 1 81  ? -1.295  52.713 13.838 1.00 36.70 ? 111  PHE A CA   1 
ATOM   603  C  C    . PHE A 1 81  ? -2.400  53.678 13.437 1.00 39.18 ? 111  PHE A C    1 
ATOM   604  O  O    . PHE A 1 81  ? -3.296  53.969 14.231 1.00 40.18 ? 111  PHE A O    1 
ATOM   605  C  CB   . PHE A 1 81  ? -1.886  51.370 14.281 1.00 37.60 ? 111  PHE A CB   1 
ATOM   606  C  CG   . PHE A 1 81  ? -2.475  50.574 13.162 1.00 34.50 ? 111  PHE A CG   1 
ATOM   607  C  CD1  . PHE A 1 81  ? -1.661  49.815 12.332 1.00 38.77 ? 111  PHE A CD1  1 
ATOM   608  C  CD2  . PHE A 1 81  ? -3.839  50.593 12.921 1.00 35.17 ? 111  PHE A CD2  1 
ATOM   609  C  CE1  . PHE A 1 81  ? -2.201  49.090 11.271 1.00 40.59 ? 111  PHE A CE1  1 
ATOM   610  C  CE2  . PHE A 1 81  ? -4.387  49.869 11.861 1.00 38.74 ? 111  PHE A CE2  1 
ATOM   611  C  CZ   . PHE A 1 81  ? -3.569  49.119 11.038 1.00 36.94 ? 111  PHE A CZ   1 
ATOM   612  N  N    . MET A 1 82  ? -2.349  54.146 12.193 1.00 39.82 ? 112  MET A N    1 
ATOM   613  C  CA   . MET A 1 82  ? -3.320  55.110 11.691 1.00 38.24 ? 112  MET A CA   1 
ATOM   614  C  C    . MET A 1 82  ? -4.448  54.575 10.831 1.00 39.35 ? 112  MET A C    1 
ATOM   615  O  O    . MET A 1 82  ? -5.373  55.318 10.506 1.00 37.44 ? 112  MET A O    1 
ATOM   616  C  CB   . MET A 1 82  ? -2.602  56.214 10.920 1.00 38.43 ? 112  MET A CB   1 
ATOM   617  C  CG   . MET A 1 82  ? -1.629  57.006 11.761 1.00 35.48 ? 112  MET A CG   1 
ATOM   618  S  SD   . MET A 1 82  ? -2.392  57.662 13.263 1.00 41.14 ? 112  MET A SD   1 
ATOM   619  C  CE   . MET A 1 82  ? -3.471  58.931 12.580 1.00 31.61 ? 112  MET A CE   1 
ATOM   620  N  N    . GLU A 1 83  ? -4.392  53.294 10.476 1.00 42.69 ? 113  GLU A N    1 
ATOM   621  C  CA   . GLU A 1 83  ? -5.419  52.713 9.615  1.00 45.75 ? 113  GLU A CA   1 
ATOM   622  C  C    . GLU A 1 83  ? -6.504  51.890 10.317 1.00 46.07 ? 113  GLU A C    1 
ATOM   623  O  O    . GLU A 1 83  ? -7.068  50.968 9.727  1.00 46.05 ? 113  GLU A O    1 
ATOM   624  C  CB   . GLU A 1 83  ? -4.766  51.884 8.503  1.00 49.21 ? 113  GLU A CB   1 
ATOM   625  C  CG   . GLU A 1 83  ? -3.676  52.614 7.715  1.00 53.83 ? 113  GLU A CG   1 
ATOM   626  C  CD   . GLU A 1 83  ? -2.263  52.244 8.158  1.00 59.99 ? 113  GLU A CD   1 
ATOM   627  O  OE1  . GLU A 1 83  ? -2.106  51.298 8.960  1.00 63.22 ? 113  GLU A OE1  1 
ATOM   628  O  OE2  . GLU A 1 83  ? -1.298  52.889 7.691  1.00 62.23 ? 113  GLU A OE2  1 
ATOM   629  N  N    . SER A 1 84  ? -6.811  52.219 11.566 1.00 48.25 ? 114  SER A N    1 
ATOM   630  C  CA   . SER A 1 84  ? -7.839  51.475 12.278 1.00 49.04 ? 114  SER A CA   1 
ATOM   631  C  C    . SER A 1 84  ? -9.166  52.205 12.219 1.00 50.52 ? 114  SER A C    1 
ATOM   632  O  O    . SER A 1 84  ? -9.288  53.314 12.727 1.00 52.64 ? 114  SER A O    1 
ATOM   633  C  CB   . SER A 1 84  ? -7.447  51.244 13.733 1.00 47.77 ? 114  SER A CB   1 
ATOM   634  O  OG   . SER A 1 84  ? -8.392  50.395 14.362 1.00 46.10 ? 114  SER A OG   1 
ATOM   635  N  N    . LYS A 1 85  ? -10.161 51.575 11.606 1.00 52.72 ? 115  LYS A N    1 
ATOM   636  C  CA   . LYS A 1 85  ? -11.483 52.171 11.488 1.00 56.54 ? 115  LYS A CA   1 
ATOM   637  C  C    . LYS A 1 85  ? -12.371 51.640 12.606 1.00 57.53 ? 115  LYS A C    1 
ATOM   638  O  O    . LYS A 1 85  ? -13.567 51.417 12.414 1.00 57.95 ? 115  LYS A O    1 
ATOM   639  C  CB   . LYS A 1 85  ? -12.097 51.831 10.127 1.00 60.34 ? 115  LYS A CB   1 
ATOM   640  C  CG   . LYS A 1 85  ? -13.306 52.683 9.780  1.00 68.08 ? 115  LYS A CG   1 
ATOM   641  C  CD   . LYS A 1 85  ? -13.933 52.271 8.460  1.00 73.44 ? 115  LYS A CD   1 
ATOM   642  C  CE   . LYS A 1 85  ? -15.171 53.114 8.169  1.00 77.27 ? 115  LYS A CE   1 
ATOM   643  N  NZ   . LYS A 1 85  ? -16.176 53.042 9.270  1.00 77.18 ? 115  LYS A NZ   1 
ATOM   644  N  N    . GLU A 1 86  ? -11.776 51.421 13.773 1.00 58.48 ? 116  GLU A N    1 
ATOM   645  C  CA   . GLU A 1 86  ? -12.507 50.897 14.918 1.00 57.97 ? 116  GLU A CA   1 
ATOM   646  C  C    . GLU A 1 86  ? -13.076 52.022 15.778 1.00 56.22 ? 116  GLU A C    1 
ATOM   647  O  O    . GLU A 1 86  ? -12.949 53.192 15.440 1.00 59.06 ? 116  GLU A O    1 
ATOM   648  C  CB   . GLU A 1 86  ? -11.574 50.043 15.768 1.00 60.11 ? 116  GLU A CB   1 
ATOM   649  C  CG   . GLU A 1 86  ? -12.262 48.889 16.450 1.00 64.68 ? 116  GLU A CG   1 
ATOM   650  C  CD   . GLU A 1 86  ? -12.415 47.703 15.532 1.00 66.56 ? 116  GLU A CD   1 
ATOM   651  O  OE1  . GLU A 1 86  ? -11.447 46.928 15.443 1.00 70.32 ? 116  GLU A OE1  1 
ATOM   652  O  OE2  . GLU A 1 86  ? -13.484 47.544 14.899 1.00 64.66 ? 116  GLU A OE2  1 
ATOM   653  N  N    . LYS A 1 87  ? -13.716 51.665 16.884 1.00 51.12 ? 117  LYS A N    1 
ATOM   654  C  CA   . LYS A 1 87  ? -14.265 52.667 17.783 1.00 50.07 ? 117  LYS A CA   1 
ATOM   655  C  C    . LYS A 1 87  ? -13.140 53.291 18.611 1.00 48.69 ? 117  LYS A C    1 
ATOM   656  O  O    . LYS A 1 87  ? -13.074 54.509 18.767 1.00 48.79 ? 117  LYS A O    1 
ATOM   657  C  CB   . LYS A 1 87  ? -15.317 52.045 18.706 1.00 52.51 ? 117  LYS A CB   1 
ATOM   658  C  CG   . LYS A 1 87  ? -15.913 53.024 19.714 1.00 54.47 ? 117  LYS A CG   1 
ATOM   659  C  CD   . LYS A 1 87  ? -17.001 52.385 20.562 1.00 53.57 ? 117  LYS A CD   1 
ATOM   660  C  CE   . LYS A 1 87  ? -17.576 53.390 21.553 1.00 56.08 ? 117  LYS A CE   1 
ATOM   661  N  NZ   . LYS A 1 87  ? -18.698 52.831 22.362 1.00 54.53 ? 117  LYS A NZ   1 
ATOM   662  N  N    . ASP A 1 88  ? -12.223 52.457 19.091 1.00 46.66 ? 118  ASP A N    1 
ATOM   663  C  CA   . ASP A 1 88  ? -11.116 52.933 19.914 1.00 47.40 ? 118  ASP A CA   1 
ATOM   664  C  C    . ASP A 1 88  ? -9.832  53.185 19.129 1.00 48.08 ? 118  ASP A C    1 
ATOM   665  O  O    . ASP A 1 88  ? -8.746  52.775 19.542 1.00 47.29 ? 118  ASP A O    1 
ATOM   666  C  CB   . ASP A 1 88  ? -10.856 51.959 21.064 1.00 47.62 ? 118  ASP A CB   1 
ATOM   667  C  CG   . ASP A 1 88  ? -12.109 51.654 21.865 1.00 47.45 ? 118  ASP A CG   1 
ATOM   668  O  OD1  . ASP A 1 88  ? -12.913 52.575 22.129 1.00 46.14 ? 118  ASP A OD1  1 
ATOM   669  O  OD2  . ASP A 1 88  ? -12.294 50.476 22.219 1.00 49.18 ? 118  ASP A OD2  1 
ATOM   670  N  N    . ARG A 1 89  ? -9.966  53.923 18.032 1.00 50.94 ? 119  ARG A N    1 
ATOM   671  C  CA   . ARG A 1 89  ? -8.847  54.270 17.155 1.00 52.36 ? 119  ARG A CA   1 
ATOM   672  C  C    . ARG A 1 89  ? -7.722  55.004 17.882 1.00 49.37 ? 119  ARG A C    1 
ATOM   673  O  O    . ARG A 1 89  ? -6.553  54.621 17.792 1.00 48.55 ? 119  ARG A O    1 
ATOM   674  C  CB   . ARG A 1 89  ? -9.325  55.200 16.038 1.00 56.55 ? 119  ARG A CB   1 
ATOM   675  C  CG   . ARG A 1 89  ? -10.554 54.762 15.298 1.00 60.72 ? 119  ARG A CG   1 
ATOM   676  C  CD   . ARG A 1 89  ? -11.070 55.889 14.422 1.00 67.82 ? 119  ARG A CD   1 
ATOM   677  N  NE   . ARG A 1 89  ? -10.043 56.366 13.501 1.00 75.80 ? 119  ARG A NE   1 
ATOM   678  C  CZ   . ARG A 1 89  ? -10.239 57.295 12.570 1.00 81.91 ? 119  ARG A CZ   1 
ATOM   679  N  NH1  . ARG A 1 89  ? -11.431 57.865 12.428 1.00 84.42 ? 119  ARG A NH1  1 
ATOM   680  N  NH2  . ARG A 1 89  ? -9.237  57.650 11.771 1.00 83.27 ? 119  ARG A NH2  1 
ATOM   681  N  N    . GLN A 1 90  ? -8.091  56.070 18.588 1.00 45.90 ? 120  GLN A N    1 
ATOM   682  C  CA   . GLN A 1 90  ? -7.135  56.917 19.295 1.00 44.82 ? 120  GLN A CA   1 
ATOM   683  C  C    . GLN A 1 90  ? -6.069  56.216 20.118 1.00 41.80 ? 120  GLN A C    1 
ATOM   684  O  O    . GLN A 1 90  ? -4.934  56.692 20.204 1.00 40.72 ? 120  GLN A O    1 
ATOM   685  C  CB   . GLN A 1 90  ? -7.869  57.950 20.143 1.00 49.11 ? 120  GLN A CB   1 
ATOM   686  C  CG   . GLN A 1 90  ? -8.803  58.853 19.334 1.00 55.72 ? 120  GLN A CG   1 
ATOM   687  C  CD   . GLN A 1 90  ? -8.174  59.361 18.039 1.00 57.98 ? 120  GLN A CD   1 
ATOM   688  O  OE1  . GLN A 1 90  ? -7.324  60.252 18.051 1.00 59.13 ? 120  GLN A OE1  1 
ATOM   689  N  NE2  . GLN A 1 90  ? -8.569  58.767 16.918 1.00 56.29 ? 120  GLN A NE2  1 
ATOM   690  N  N    . VAL A 1 91  ? -6.417  55.073 20.697 1.00 40.24 ? 121  VAL A N    1 
ATOM   691  C  CA   . VAL A 1 91  ? -5.465  54.313 21.497 1.00 37.96 ? 121  VAL A CA   1 
ATOM   692  C  C    . VAL A 1 91  ? -4.304  53.842 20.592 1.00 35.93 ? 121  VAL A C    1 
ATOM   693  O  O    . VAL A 1 91  ? -3.145  53.809 21.014 1.00 33.74 ? 121  VAL A O    1 
ATOM   694  C  CB   . VAL A 1 91  ? -6.186  53.137 22.232 1.00 40.85 ? 121  VAL A CB   1 
ATOM   695  C  CG1  . VAL A 1 91  ? -6.134  51.844 21.425 1.00 39.04 ? 121  VAL A CG1  1 
ATOM   696  C  CG2  . VAL A 1 91  ? -5.622  52.953 23.625 1.00 43.26 ? 121  VAL A CG2  1 
ATOM   697  N  N    . LEU A 1 92  ? -4.618  53.540 19.331 1.00 33.95 ? 122  LEU A N    1 
ATOM   698  C  CA   . LEU A 1 92  ? -3.610  53.112 18.358 1.00 30.70 ? 122  LEU A CA   1 
ATOM   699  C  C    . LEU A 1 92  ? -2.898  54.321 17.788 1.00 27.64 ? 122  LEU A C    1 
ATOM   700  O  O    . LEU A 1 92  ? -1.667  54.362 17.730 1.00 28.00 ? 122  LEU A O    1 
ATOM   701  C  CB   . LEU A 1 92  ? -4.240  52.367 17.179 1.00 28.35 ? 122  LEU A CB   1 
ATOM   702  C  CG   . LEU A 1 92  ? -4.698  50.925 17.323 1.00 29.34 ? 122  LEU A CG   1 
ATOM   703  C  CD1  . LEU A 1 92  ? -3.658  50.148 18.115 1.00 32.60 ? 122  LEU A CD1  1 
ATOM   704  C  CD2  . LEU A 1 92  ? -6.038  50.891 18.001 1.00 34.18 ? 122  LEU A CD2  1 
ATOM   705  N  N    . GLU A 1 93  ? -3.697  55.287 17.345 1.00 26.09 ? 123  GLU A N    1 
ATOM   706  C  CA   . GLU A 1 93  ? -3.192  56.510 16.739 1.00 27.59 ? 123  GLU A CA   1 
ATOM   707  C  C    . GLU A 1 93  ? -2.245  57.301 17.613 1.00 27.87 ? 123  GLU A C    1 
ATOM   708  O  O    . GLU A 1 93  ? -1.311  57.918 17.100 1.00 27.81 ? 123  GLU A O    1 
ATOM   709  C  CB   . GLU A 1 93  ? -4.347  57.406 16.310 1.00 29.10 ? 123  GLU A CB   1 
ATOM   710  C  CG   . GLU A 1 93  ? -5.185  56.848 15.173 1.00 34.45 ? 123  GLU A CG   1 
ATOM   711  C  CD   . GLU A 1 93  ? -6.393  57.713 14.874 1.00 38.05 ? 123  GLU A CD   1 
ATOM   712  O  OE1  . GLU A 1 93  ? -6.339  58.932 15.151 1.00 43.78 ? 123  GLU A OE1  1 
ATOM   713  O  OE2  . GLU A 1 93  ? -7.404  57.178 14.374 1.00 40.37 ? 123  GLU A OE2  1 
ATOM   714  N  N    . ASP A 1 94  ? -2.476  57.286 18.924 1.00 26.68 ? 124  ASP A N    1 
ATOM   715  C  CA   . ASP A 1 94  ? -1.622  58.022 19.842 1.00 27.36 ? 124  ASP A CA   1 
ATOM   716  C  C    . ASP A 1 94  ? -0.841  57.077 20.740 1.00 30.64 ? 124  ASP A C    1 
ATOM   717  O  O    . ASP A 1 94  ? -0.363  57.467 21.808 1.00 33.28 ? 124  ASP A O    1 
ATOM   718  C  CB   . ASP A 1 94  ? -2.457  58.992 20.676 1.00 27.85 ? 124  ASP A CB   1 
ATOM   719  C  CG   . ASP A 1 94  ? -1.614  60.065 21.355 1.00 26.85 ? 124  ASP A CG   1 
ATOM   720  O  OD1  . ASP A 1 94  ? -0.477  60.319 20.905 1.00 32.87 ? 124  ASP A OD1  1 
ATOM   721  O  OD2  . ASP A 1 94  ? -2.087  60.659 22.343 1.00 24.14 ? 124  ASP A OD2  1 
ATOM   722  N  N    . PHE A 1 95  ? -0.605  55.868 20.242 1.00 32.79 ? 125  PHE A N    1 
ATOM   723  C  CA   . PHE A 1 95  ? 0.109   54.853 21.007 1.00 31.24 ? 125  PHE A CA   1 
ATOM   724  C  C    . PHE A 1 95  ? 1.422   55.302 21.640 1.00 29.33 ? 125  PHE A C    1 
ATOM   725  O  O    . PHE A 1 95  ? 1.764   54.834 22.727 1.00 30.35 ? 125  PHE A O    1 
ATOM   726  C  CB   . PHE A 1 95  ? 0.332   53.585 20.175 1.00 29.54 ? 125  PHE A CB   1 
ATOM   727  C  CG   . PHE A 1 95  ? 0.726   52.391 20.998 1.00 28.26 ? 125  PHE A CG   1 
ATOM   728  C  CD1  . PHE A 1 95  ? -0.219  51.723 21.768 1.00 28.12 ? 125  PHE A CD1  1 
ATOM   729  C  CD2  . PHE A 1 95  ? 2.036   51.929 20.999 1.00 27.06 ? 125  PHE A CD2  1 
ATOM   730  C  CE1  . PHE A 1 95  ? 0.137   50.609 22.527 1.00 29.46 ? 125  PHE A CE1  1 
ATOM   731  C  CE2  . PHE A 1 95  ? 2.403   50.816 21.754 1.00 24.64 ? 125  PHE A CE2  1 
ATOM   732  C  CZ   . PHE A 1 95  ? 1.453   50.155 22.518 1.00 27.56 ? 125  PHE A CZ   1 
ATOM   733  N  N    . PRO A 1 96  ? 2.182   56.202 20.980 1.00 31.46 ? 126  PRO A N    1 
ATOM   734  C  CA   . PRO A 1 96  ? 3.442   56.628 21.597 1.00 31.64 ? 126  PRO A CA   1 
ATOM   735  C  C    . PRO A 1 96  ? 3.248   57.197 23.006 1.00 32.43 ? 126  PRO A C    1 
ATOM   736  O  O    . PRO A 1 96  ? 4.105   57.028 23.874 1.00 32.89 ? 126  PRO A O    1 
ATOM   737  C  CB   . PRO A 1 96  ? 3.947   57.679 20.619 1.00 29.94 ? 126  PRO A CB   1 
ATOM   738  C  CG   . PRO A 1 96  ? 3.515   57.125 19.318 1.00 24.40 ? 126  PRO A CG   1 
ATOM   739  C  CD   . PRO A 1 96  ? 2.083   56.749 19.611 1.00 28.80 ? 126  PRO A CD   1 
ATOM   740  N  N    . THR A 1 97  ? 2.112   57.849 23.233 1.00 32.66 ? 127  THR A N    1 
ATOM   741  C  CA   . THR A 1 97  ? 1.804   58.421 24.542 1.00 34.04 ? 127  THR A CA   1 
ATOM   742  C  C    . THR A 1 97  ? 1.674   57.296 25.573 1.00 31.61 ? 127  THR A C    1 
ATOM   743  O  O    . THR A 1 97  ? 2.213   57.375 26.683 1.00 33.44 ? 127  THR A O    1 
ATOM   744  C  CB   . THR A 1 97  ? 0.482   59.216 24.489 1.00 34.01 ? 127  THR A CB   1 
ATOM   745  O  OG1  . THR A 1 97  ? 0.550   60.172 23.425 1.00 41.23 ? 127  THR A OG1  1 
ATOM   746  C  CG2  . THR A 1 97  ? 0.232   59.945 25.795 1.00 31.69 ? 127  THR A CG2  1 
ATOM   747  N  N    . ILE A 1 98  ? 0.990   56.232 25.181 1.00 28.05 ? 128  ILE A N    1 
ATOM   748  C  CA   . ILE A 1 98  ? 0.784   55.098 26.061 1.00 29.28 ? 128  ILE A CA   1 
ATOM   749  C  C    . ILE A 1 98  ? 2.084   54.318 26.278 1.00 29.86 ? 128  ILE A C    1 
ATOM   750  O  O    . ILE A 1 98  ? 2.386   53.905 27.398 1.00 32.69 ? 128  ILE A O    1 
ATOM   751  C  CB   . ILE A 1 98  ? -0.339  54.181 25.512 1.00 29.27 ? 128  ILE A CB   1 
ATOM   752  C  CG1  . ILE A 1 98  ? -1.635  54.988 25.375 1.00 25.53 ? 128  ILE A CG1  1 
ATOM   753  C  CG2  . ILE A 1 98  ? -0.548  52.974 26.431 1.00 25.92 ? 128  ILE A CG2  1 
ATOM   754  C  CD1  . ILE A 1 98  ? -2.774  54.234 24.724 1.00 26.88 ? 128  ILE A CD1  1 
ATOM   755  N  N    . SER A 1 99  ? 2.872   54.148 25.222 1.00 28.94 ? 129  SER A N    1 
ATOM   756  C  CA   . SER A 1 99  ? 4.130   53.423 25.341 1.00 29.22 ? 129  SER A CA   1 
ATOM   757  C  C    . SER A 1 99  ? 5.118   54.228 26.190 1.00 25.20 ? 129  SER A C    1 
ATOM   758  O  O    . SER A 1 99  ? 5.973   53.674 26.889 1.00 22.16 ? 129  SER A O    1 
ATOM   759  C  CB   . SER A 1 99  ? 4.712   53.132 23.950 1.00 34.09 ? 129  SER A CB   1 
ATOM   760  O  OG   . SER A 1 99  ? 4.871   54.312 23.177 1.00 36.82 ? 129  SER A OG   1 
ATOM   761  N  N    . LEU A 1 100 ? 5.007   55.546 26.107 1.00 23.94 ? 130  LEU A N    1 
ATOM   762  C  CA   . LEU A 1 100 ? 5.871   56.421 26.883 1.00 26.66 ? 130  LEU A CA   1 
ATOM   763  C  C    . LEU A 1 100 ? 5.635   56.086 28.354 1.00 25.37 ? 130  LEU A C    1 
ATOM   764  O  O    . LEU A 1 100 ? 6.549   55.659 29.058 1.00 22.87 ? 130  LEU A O    1 
ATOM   765  C  CB   . LEU A 1 100 ? 5.532   57.887 26.585 1.00 24.96 ? 130  LEU A CB   1 
ATOM   766  C  CG   . LEU A 1 100 ? 6.367   58.986 27.237 1.00 23.90 ? 130  LEU A CG   1 
ATOM   767  C  CD1  . LEU A 1 100 ? 7.845   58.748 27.000 1.00 23.79 ? 130  LEU A CD1  1 
ATOM   768  C  CD2  . LEU A 1 100 ? 5.928   60.328 26.671 1.00 20.67 ? 130  LEU A CD2  1 
ATOM   769  N  N    . GLU A 1 101 ? 4.379   56.182 28.778 1.00 24.39 ? 131  GLU A N    1 
ATOM   770  C  CA   . GLU A 1 101 ? 4.021   55.877 30.153 1.00 25.43 ? 131  GLU A CA   1 
ATOM   771  C  C    . GLU A 1 101 ? 4.291   54.420 30.534 1.00 25.69 ? 131  GLU A C    1 
ATOM   772  O  O    . GLU A 1 101 ? 4.507   54.111 31.712 1.00 26.09 ? 131  GLU A O    1 
ATOM   773  C  CB   . GLU A 1 101 ? 2.572   56.271 30.429 1.00 28.00 ? 131  GLU A CB   1 
ATOM   774  C  CG   . GLU A 1 101 ? 2.363   57.783 30.527 1.00 29.10 ? 131  GLU A CG   1 
ATOM   775  C  CD   . GLU A 1 101 ? 3.188   58.446 31.643 1.00 31.78 ? 131  GLU A CD   1 
ATOM   776  O  OE1  . GLU A 1 101 ? 3.681   57.749 32.556 1.00 30.74 ? 131  GLU A OE1  1 
ATOM   777  O  OE2  . GLU A 1 101 ? 3.339   59.681 31.606 1.00 31.33 ? 131  GLU A OE2  1 
ATOM   778  N  N    . PHE A 1 102 ? 4.269   53.523 29.551 1.00 25.43 ? 132  PHE A N    1 
ATOM   779  C  CA   . PHE A 1 102 ? 4.571   52.115 29.809 1.00 23.78 ? 132  PHE A CA   1 
ATOM   780  C  C    . PHE A 1 102 ? 6.066   51.987 30.163 1.00 22.34 ? 132  PHE A C    1 
ATOM   781  O  O    . PHE A 1 102 ? 6.449   51.202 31.026 1.00 21.84 ? 132  PHE A O    1 
ATOM   782  C  CB   . PHE A 1 102 ? 4.234   51.242 28.590 1.00 20.76 ? 132  PHE A CB   1 
ATOM   783  C  CG   . PHE A 1 102 ? 4.905   49.892 28.609 1.00 27.17 ? 132  PHE A CG   1 
ATOM   784  C  CD1  . PHE A 1 102 ? 4.390   48.849 29.379 1.00 28.25 ? 132  PHE A CD1  1 
ATOM   785  C  CD2  . PHE A 1 102 ? 6.078   49.674 27.889 1.00 26.16 ? 132  PHE A CD2  1 
ATOM   786  C  CE1  . PHE A 1 102 ? 5.037   47.608 29.432 1.00 27.01 ? 132  PHE A CE1  1 
ATOM   787  C  CE2  . PHE A 1 102 ? 6.730   48.437 27.938 1.00 27.28 ? 132  PHE A CE2  1 
ATOM   788  C  CZ   . PHE A 1 102 ? 6.207   47.402 28.713 1.00 29.03 ? 132  PHE A CZ   1 
ATOM   789  N  N    . ARG A 1 103 ? 6.913   52.761 29.496 1.00 23.80 ? 133  ARG A N    1 
ATOM   790  C  CA   . ARG A 1 103 ? 8.340   52.705 29.782 1.00 27.75 ? 133  ARG A CA   1 
ATOM   791  C  C    . ARG A 1 103 ? 8.676   53.395 31.114 1.00 28.14 ? 133  ARG A C    1 
ATOM   792  O  O    . ARG A 1 103 ? 9.756   53.189 31.675 1.00 25.88 ? 133  ARG A O    1 
ATOM   793  C  CB   . ARG A 1 103 ? 9.152   53.290 28.615 1.00 30.56 ? 133  ARG A CB   1 
ATOM   794  C  CG   . ARG A 1 103 ? 9.006   52.497 27.302 1.00 32.97 ? 133  ARG A CG   1 
ATOM   795  C  CD   . ARG A 1 103 ? 9.903   53.036 26.178 1.00 31.40 ? 133  ARG A CD   1 
ATOM   796  N  NE   . ARG A 1 103 ? 9.514   54.377 25.743 1.00 29.18 ? 133  ARG A NE   1 
ATOM   797  C  CZ   . ARG A 1 103 ? 8.639   54.632 24.772 1.00 27.98 ? 133  ARG A CZ   1 
ATOM   798  N  NH1  . ARG A 1 103 ? 8.049   53.643 24.111 1.00 26.84 ? 133  ARG A NH1  1 
ATOM   799  N  NH2  . ARG A 1 103 ? 8.318   55.885 24.491 1.00 25.12 ? 133  ARG A NH2  1 
ATOM   800  N  N    . ASN A 1 104 ? 7.738   54.196 31.619 1.00 26.01 ? 134  ASN A N    1 
ATOM   801  C  CA   . ASN A 1 104 ? 7.909   54.894 32.888 1.00 25.80 ? 134  ASN A CA   1 
ATOM   802  C  C    . ASN A 1 104 ? 7.552   53.992 34.059 1.00 25.41 ? 134  ASN A C    1 
ATOM   803  O  O    . ASN A 1 104 ? 7.810   54.330 35.216 1.00 26.17 ? 134  ASN A O    1 
ATOM   804  C  CB   . ASN A 1 104 ? 7.027   56.142 32.953 1.00 26.19 ? 134  ASN A CB   1 
ATOM   805  C  CG   . ASN A 1 104 ? 7.688   57.352 32.353 1.00 27.80 ? 134  ASN A CG   1 
ATOM   806  O  OD1  . ASN A 1 104 ? 8.912   57.465 32.358 1.00 30.80 ? 134  ASN A OD1  1 
ATOM   807  N  ND2  . ASN A 1 104 ? 6.880   58.293 31.876 1.00 29.35 ? 134  ASN A ND2  1 
ATOM   808  N  N    . LEU A 1 105 ? 6.889   52.879 33.771 1.00 24.56 ? 135  LEU A N    1 
ATOM   809  C  CA   . LEU A 1 105 ? 6.506   51.947 34.825 1.00 24.06 ? 135  LEU A CA   1 
ATOM   810  C  C    . LEU A 1 105 ? 7.749   51.263 35.365 1.00 24.32 ? 135  LEU A C    1 
ATOM   811  O  O    . LEU A 1 105 ? 8.785   51.220 34.696 1.00 24.19 ? 135  LEU A O    1 
ATOM   812  C  CB   . LEU A 1 105 ? 5.528   50.894 34.296 1.00 20.91 ? 135  LEU A CB   1 
ATOM   813  C  CG   . LEU A 1 105 ? 4.135   51.334 33.824 1.00 20.85 ? 135  LEU A CG   1 
ATOM   814  C  CD1  . LEU A 1 105 ? 3.386   50.129 33.277 1.00 14.81 ? 135  LEU A CD1  1 
ATOM   815  C  CD2  . LEU A 1 105 ? 3.353   51.970 34.963 1.00 18.26 ? 135  LEU A CD2  1 
ATOM   816  N  N    . ALA A 1 106 ? 7.660   50.744 36.582 1.00 28.86 ? 136  ALA A N    1 
ATOM   817  C  CA   . ALA A 1 106 ? 8.793   50.044 37.173 1.00 30.63 ? 136  ALA A CA   1 
ATOM   818  C  C    . ALA A 1 106 ? 9.084   48.848 36.274 1.00 32.78 ? 136  ALA A C    1 
ATOM   819  O  O    . ALA A 1 106 ? 8.160   48.189 35.783 1.00 33.10 ? 136  ALA A O    1 
ATOM   820  C  CB   . ALA A 1 106 ? 8.463   49.579 38.590 1.00 27.25 ? 136  ALA A CB   1 
ATOM   821  N  N    . GLU A 1 107 ? 10.363  48.574 36.047 1.00 34.41 ? 137  GLU A N    1 
ATOM   822  C  CA   . GLU A 1 107 ? 10.757  47.460 35.194 1.00 37.59 ? 137  GLU A CA   1 
ATOM   823  C  C    . GLU A 1 107 ? 10.126  46.116 35.578 1.00 37.86 ? 137  GLU A C    1 
ATOM   824  O  O    . GLU A 1 107 ? 9.827   45.303 34.700 1.00 38.79 ? 137  GLU A O    1 
ATOM   825  C  CB   . GLU A 1 107 ? 12.284  47.368 35.092 1.00 38.21 ? 137  GLU A CB   1 
ATOM   826  C  CG   . GLU A 1 107 ? 13.029  47.645 36.383 1.00 44.93 ? 137  GLU A CG   1 
ATOM   827  C  CD   . GLU A 1 107 ? 14.438  48.161 36.136 1.00 47.92 ? 137  GLU A CD   1 
ATOM   828  O  OE1  . GLU A 1 107 ? 14.573  49.338 35.738 1.00 52.57 ? 137  GLU A OE1  1 
ATOM   829  O  OE2  . GLU A 1 107 ? 15.410  47.401 36.343 1.00 49.66 ? 137  GLU A OE2  1 
ATOM   830  N  N    . LYS A 1 108 ? 9.851   45.911 36.866 1.00 34.57 ? 138  LYS A N    1 
ATOM   831  C  CA   . LYS A 1 108 ? 9.237   44.661 37.305 1.00 31.77 ? 138  LYS A CA   1 
ATOM   832  C  C    . LYS A 1 108 ? 7.839   44.516 36.711 1.00 29.41 ? 138  LYS A C    1 
ATOM   833  O  O    . LYS A 1 108 ? 7.372   43.407 36.471 1.00 28.82 ? 138  LYS A O    1 
ATOM   834  C  CB   . LYS A 1 108 ? 9.199   44.558 38.834 1.00 33.52 ? 138  LYS A CB   1 
ATOM   835  C  CG   . LYS A 1 108 ? 8.372   45.615 39.555 1.00 37.01 ? 138  LYS A CG   1 
ATOM   836  C  CD   . LYS A 1 108 ? 8.446   45.414 41.074 1.00 34.83 ? 138  LYS A CD   1 
ATOM   837  C  CE   . LYS A 1 108 ? 7.657   46.481 41.828 1.00 37.60 ? 138  LYS A CE   1 
ATOM   838  N  NZ   . LYS A 1 108 ? 8.099   47.864 41.490 1.00 40.98 ? 138  LYS A NZ   1 
ATOM   839  N  N    . TYR A 1 109 ? 7.194   45.648 36.448 1.00 27.40 ? 139  TYR A N    1 
ATOM   840  C  CA   . TYR A 1 109 ? 5.865   45.659 35.851 1.00 29.80 ? 139  TYR A CA   1 
ATOM   841  C  C    . TYR A 1 109 ? 5.990   45.487 34.335 1.00 29.45 ? 139  TYR A C    1 
ATOM   842  O  O    . TYR A 1 109 ? 5.277   44.679 33.731 1.00 31.16 ? 139  TYR A O    1 
ATOM   843  C  CB   . TYR A 1 109 ? 5.141   46.969 36.183 1.00 31.77 ? 139  TYR A CB   1 
ATOM   844  C  CG   . TYR A 1 109 ? 4.926   47.177 37.664 1.00 32.10 ? 139  TYR A CG   1 
ATOM   845  C  CD1  . TYR A 1 109 ? 4.655   46.092 38.505 1.00 32.91 ? 139  TYR A CD1  1 
ATOM   846  C  CD2  . TYR A 1 109 ? 5.018   48.448 38.233 1.00 30.22 ? 139  TYR A CD2  1 
ATOM   847  C  CE1  . TYR A 1 109 ? 4.484   46.266 39.867 1.00 36.01 ? 139  TYR A CE1  1 
ATOM   848  C  CE2  . TYR A 1 109 ? 4.851   48.635 39.599 1.00 30.20 ? 139  TYR A CE2  1 
ATOM   849  C  CZ   . TYR A 1 109 ? 4.587   47.540 40.412 1.00 34.41 ? 139  TYR A CZ   1 
ATOM   850  O  OH   . TYR A 1 109 ? 4.445   47.702 41.770 1.00 30.62 ? 139  TYR A OH   1 
ATOM   851  N  N    . GLN A 1 110 ? 6.905   46.241 33.729 1.00 26.71 ? 140  GLN A N    1 
ATOM   852  C  CA   . GLN A 1 110 ? 7.139   46.162 32.292 1.00 25.78 ? 140  GLN A CA   1 
ATOM   853  C  C    . GLN A 1 110 ? 7.376   44.714 31.870 1.00 26.69 ? 140  GLN A C    1 
ATOM   854  O  O    . GLN A 1 110 ? 6.755   44.233 30.921 1.00 30.32 ? 140  GLN A O    1 
ATOM   855  C  CB   . GLN A 1 110 ? 8.339   47.015 31.894 1.00 27.71 ? 140  GLN A CB   1 
ATOM   856  C  CG   . GLN A 1 110 ? 8.051   48.504 31.772 1.00 26.40 ? 140  GLN A CG   1 
ATOM   857  C  CD   . GLN A 1 110 ? 9.292   49.295 31.402 1.00 27.32 ? 140  GLN A CD   1 
ATOM   858  O  OE1  . GLN A 1 110 ? 10.081  48.873 30.559 1.00 29.12 ? 140  GLN A OE1  1 
ATOM   859  N  NE2  . GLN A 1 110 ? 9.495   50.423 32.064 1.00 30.24 ? 140  GLN A NE2  1 
ATOM   860  N  N    . THR A 1 111 ? 8.253   44.024 32.598 1.00 24.90 ? 141  THR A N    1 
ATOM   861  C  CA   . THR A 1 111 ? 8.579   42.628 32.334 1.00 24.76 ? 141  THR A CA   1 
ATOM   862  C  C    . THR A 1 111 ? 7.302   41.805 32.195 1.00 23.85 ? 141  THR A C    1 
ATOM   863  O  O    . THR A 1 111 ? 7.114   41.083 31.214 1.00 23.03 ? 141  THR A O    1 
ATOM   864  C  CB   . THR A 1 111 ? 9.422   42.046 33.485 1.00 24.84 ? 141  THR A CB   1 
ATOM   865  O  OG1  . THR A 1 111 ? 10.620  42.813 33.631 1.00 28.82 ? 141  THR A OG1  1 
ATOM   866  C  CG2  . THR A 1 111 ? 9.792   40.601 33.215 1.00 27.60 ? 141  THR A CG2  1 
ATOM   867  N  N    . VAL A 1 112 ? 6.398   41.968 33.154 1.00 24.63 ? 142  VAL A N    1 
ATOM   868  C  CA   . VAL A 1 112 ? 5.133   41.239 33.153 1.00 26.28 ? 142  VAL A CA   1 
ATOM   869  C  C    . VAL A 1 112 ? 4.224   41.576 31.966 1.00 25.96 ? 142  VAL A C    1 
ATOM   870  O  O    . VAL A 1 112 ? 3.735   40.677 31.278 1.00 26.33 ? 142  VAL A O    1 
ATOM   871  C  CB   . VAL A 1 112 ? 4.364   41.474 34.473 1.00 26.57 ? 142  VAL A CB   1 
ATOM   872  C  CG1  . VAL A 1 112 ? 2.965   40.860 34.398 1.00 22.98 ? 142  VAL A CG1  1 
ATOM   873  C  CG2  . VAL A 1 112 ? 5.144   40.872 35.633 1.00 27.58 ? 142  VAL A CG2  1 
ATOM   874  N  N    . ILE A 1 113 ? 3.998   42.866 31.741 1.00 24.80 ? 143  ILE A N    1 
ATOM   875  C  CA   . ILE A 1 113 ? 3.140   43.334 30.660 1.00 25.14 ? 143  ILE A CA   1 
ATOM   876  C  C    . ILE A 1 113 ? 3.644   42.924 29.263 1.00 29.46 ? 143  ILE A C    1 
ATOM   877  O  O    . ILE A 1 113 ? 2.871   42.430 28.432 1.00 28.47 ? 143  ILE A O    1 
ATOM   878  C  CB   . ILE A 1 113 ? 2.962   44.868 30.755 1.00 25.37 ? 143  ILE A CB   1 
ATOM   879  C  CG1  . ILE A 1 113 ? 2.317   45.217 32.105 1.00 21.37 ? 143  ILE A CG1  1 
ATOM   880  C  CG2  . ILE A 1 113 ? 2.139   45.402 29.572 1.00 23.20 ? 143  ILE A CG2  1 
ATOM   881  C  CD1  . ILE A 1 113 ? 2.223   46.693 32.399 1.00 15.43 ? 143  ILE A CD1  1 
ATOM   882  N  N    . ALA A 1 114 ? 4.941   43.099 29.022 1.00 28.40 ? 144  ALA A N    1 
ATOM   883  C  CA   . ALA A 1 114 ? 5.541   42.742 27.740 1.00 27.59 ? 144  ALA A CA   1 
ATOM   884  C  C    . ALA A 1 114 ? 5.376   41.249 27.447 1.00 28.17 ? 144  ALA A C    1 
ATOM   885  O  O    . ALA A 1 114 ? 5.037   40.864 26.325 1.00 29.25 ? 144  ALA A O    1 
ATOM   886  C  CB   . ALA A 1 114 ? 7.011   43.121 27.726 1.00 25.08 ? 144  ALA A CB   1 
ATOM   887  N  N    . ASP A 1 115 ? 5.599   40.412 28.455 1.00 27.29 ? 145  ASP A N    1 
ATOM   888  C  CA   . ASP A 1 115 ? 5.468   38.975 28.275 1.00 25.85 ? 145  ASP A CA   1 
ATOM   889  C  C    . ASP A 1 115 ? 4.051   38.564 27.890 1.00 25.35 ? 145  ASP A C    1 
ATOM   890  O  O    . ASP A 1 115 ? 3.866   37.714 27.022 1.00 29.11 ? 145  ASP A O    1 
ATOM   891  C  CB   . ASP A 1 115 ? 5.900   38.223 29.530 1.00 24.23 ? 145  ASP A CB   1 
ATOM   892  C  CG   . ASP A 1 115 ? 5.756   36.717 29.380 1.00 30.72 ? 145  ASP A CG   1 
ATOM   893  O  OD1  . ASP A 1 115 ? 6.488   36.110 28.560 1.00 34.46 ? 145  ASP A OD1  1 
ATOM   894  O  OD2  . ASP A 1 115 ? 4.893   36.140 30.072 1.00 32.04 ? 145  ASP A OD2  1 
ATOM   895  N  N    . ILE A 1 116 ? 3.051   39.158 28.530 1.00 24.56 ? 146  ILE A N    1 
ATOM   896  C  CA   . ILE A 1 116 ? 1.666   38.819 28.222 1.00 21.95 ? 146  ILE A CA   1 
ATOM   897  C  C    . ILE A 1 116 ? 1.319   39.271 26.806 1.00 23.38 ? 146  ILE A C    1 
ATOM   898  O  O    . ILE A 1 116 ? 0.667   38.542 26.062 1.00 25.48 ? 146  ILE A O    1 
ATOM   899  C  CB   . ILE A 1 116 ? 0.680   39.435 29.242 1.00 20.47 ? 146  ILE A CB   1 
ATOM   900  C  CG1  . ILE A 1 116 ? 0.920   38.838 30.632 1.00 18.00 ? 146  ILE A CG1  1 
ATOM   901  C  CG2  . ILE A 1 116 ? -0.760  39.210 28.796 1.00 16.70 ? 146  ILE A CG2  1 
ATOM   902  C  CD1  . ILE A 1 116 ? 0.828   37.321 30.690 1.00 21.59 ? 146  ILE A CD1  1 
ATOM   903  N  N    . CYS A 1 117 ? 1.777   40.459 26.426 1.00 24.23 ? 147  CYS A N    1 
ATOM   904  C  CA   . CYS A 1 117 ? 1.520   40.984 25.085 1.00 24.69 ? 147  CYS A CA   1 
ATOM   905  C  C    . CYS A 1 117 ? 2.126   40.128 23.976 1.00 25.27 ? 147  CYS A C    1 
ATOM   906  O  O    . CYS A 1 117 ? 1.503   39.920 22.926 1.00 26.03 ? 147  CYS A O    1 
ATOM   907  C  CB   . CYS A 1 117 ? 2.019   42.422 24.973 1.00 24.64 ? 147  CYS A CB   1 
ATOM   908  S  SG   . CYS A 1 117 ? 0.924   43.559 25.829 1.00 26.93 ? 147  CYS A SG   1 
ATOM   909  N  N    . ARG A 1 118 ? 3.334   39.629 24.209 1.00 23.02 ? 148  ARG A N    1 
ATOM   910  C  CA   . ARG A 1 118 ? 4.000   38.787 23.228 1.00 26.04 ? 148  ARG A CA   1 
ATOM   911  C  C    . ARG A 1 118 ? 3.200   37.493 23.090 1.00 25.91 ? 148  ARG A C    1 
ATOM   912  O  O    . ARG A 1 118 ? 2.780   37.113 21.992 1.00 25.74 ? 148  ARG A O    1 
ATOM   913  C  CB   . ARG A 1 118 ? 5.436   38.470 23.669 1.00 23.25 ? 148  ARG A CB   1 
ATOM   914  C  CG   . ARG A 1 118 ? 6.227   37.634 22.663 1.00 18.19 ? 148  ARG A CG   1 
ATOM   915  C  CD   . ARG A 1 118 ? 7.605   37.270 23.193 1.00 18.21 ? 148  ARG A CD   1 
ATOM   916  N  NE   . ARG A 1 118 ? 7.532   36.552 24.468 1.00 24.85 ? 148  ARG A NE   1 
ATOM   917  C  CZ   . ARG A 1 118 ? 7.315   35.243 24.600 1.00 25.00 ? 148  ARG A CZ   1 
ATOM   918  N  NH1  . ARG A 1 118 ? 7.147   34.463 23.540 1.00 23.77 ? 148  ARG A NH1  1 
ATOM   919  N  NH2  . ARG A 1 118 ? 7.246   34.716 25.817 1.00 27.87 ? 148  ARG A NH2  1 
ATOM   920  N  N    . ARG A 1 119 ? 2.949   36.845 24.218 1.00 22.24 ? 149  ARG A N    1 
ATOM   921  C  CA   . ARG A 1 119 ? 2.211   35.598 24.209 1.00 25.82 ? 149  ARG A CA   1 
ATOM   922  C  C    . ARG A 1 119 ? 0.798   35.750 23.648 1.00 27.75 ? 149  ARG A C    1 
ATOM   923  O  O    . ARG A 1 119 ? 0.304   34.869 22.920 1.00 20.93 ? 149  ARG A O    1 
ATOM   924  C  CB   . ARG A 1 119 ? 2.183   35.012 25.612 1.00 30.15 ? 149  ARG A CB   1 
ATOM   925  C  CG   . ARG A 1 119 ? 3.569   34.699 26.127 1.00 32.73 ? 149  ARG A CG   1 
ATOM   926  C  CD   . ARG A 1 119 ? 3.521   33.977 27.446 1.00 36.74 ? 149  ARG A CD   1 
ATOM   927  N  NE   . ARG A 1 119 ? 4.810   33.356 27.726 1.00 47.70 ? 149  ARG A NE   1 
ATOM   928  C  CZ   . ARG A 1 119 ? 4.988   32.368 28.593 1.00 52.45 ? 149  ARG A CZ   1 
ATOM   929  N  NH1  . ARG A 1 119 ? 3.946   31.888 29.270 1.00 62.34 ? 149  ARG A NH1  1 
ATOM   930  N  NH2  . ARG A 1 119 ? 6.193   31.857 28.779 1.00 48.13 ? 149  ARG A NH2  1 
ATOM   931  N  N    . MET A 1 120 ? 0.167   36.881 23.959 1.00 24.83 ? 150  MET A N    1 
ATOM   932  C  CA   . MET A 1 120 ? -1.181  37.156 23.484 1.00 25.37 ? 150  MET A CA   1 
ATOM   933  C  C    . MET A 1 120 ? -1.139  37.345 21.972 1.00 26.05 ? 150  MET A C    1 
ATOM   934  O  O    . MET A 1 120 ? -1.994  36.816 21.260 1.00 22.91 ? 150  MET A O    1 
ATOM   935  C  CB   . MET A 1 120 ? -1.776  38.392 24.170 1.00 25.43 ? 150  MET A CB   1 
ATOM   936  C  CG   . MET A 1 120 ? -3.276  38.576 23.917 1.00 26.54 ? 150  MET A CG   1 
ATOM   937  S  SD   . MET A 1 120 ? -4.094  39.665 25.113 1.00 25.38 ? 150  MET A SD   1 
ATOM   938  C  CE   . MET A 1 120 ? -4.476  41.040 24.132 1.00 18.32 ? 150  MET A CE   1 
ATOM   939  N  N    . GLY A 1 121 ? -0.119  38.055 21.491 1.00 26.97 ? 151  GLY A N    1 
ATOM   940  C  CA   . GLY A 1 121 ? 0.045   38.287 20.060 1.00 27.21 ? 151  GLY A CA   1 
ATOM   941  C  C    . GLY A 1 121 ? 0.114   36.980 19.288 1.00 24.03 ? 151  GLY A C    1 
ATOM   942  O  O    . GLY A 1 121 ? -0.640  36.773 18.334 1.00 22.60 ? 151  GLY A O    1 
ATOM   943  N  N    . ILE A 1 122 ? 1.011   36.094 19.708 1.00 23.53 ? 152  ILE A N    1 
ATOM   944  C  CA   . ILE A 1 122 ? 1.146   34.779 19.081 1.00 27.17 ? 152  ILE A CA   1 
ATOM   945  C  C    . ILE A 1 122 ? -0.247  34.137 19.058 1.00 30.52 ? 152  ILE A C    1 
ATOM   946  O  O    . ILE A 1 122 ? -0.688  33.619 18.025 1.00 31.23 ? 152  ILE A O    1 
ATOM   947  C  CB   . ILE A 1 122 ? 2.078   33.831 19.908 1.00 27.96 ? 152  ILE A CB   1 
ATOM   948  C  CG1  . ILE A 1 122 ? 3.480   34.434 20.073 1.00 25.15 ? 152  ILE A CG1  1 
ATOM   949  C  CG2  . ILE A 1 122 ? 2.123   32.438 19.275 1.00 23.38 ? 152  ILE A CG2  1 
ATOM   950  C  CD1  . ILE A 1 122 ? 4.220   34.630 18.783 1.00 31.34 ? 152  ILE A CD1  1 
ATOM   951  N  N    . GLY A 1 123 ? -0.939  34.208 20.199 1.00 28.43 ? 153  GLY A N    1 
ATOM   952  C  CA   . GLY A 1 123 ? -2.265  33.633 20.332 1.00 23.63 ? 153  GLY A CA   1 
ATOM   953  C  C    . GLY A 1 123 ? -3.333  34.209 19.428 1.00 23.37 ? 153  GLY A C    1 
ATOM   954  O  O    . GLY A 1 123 ? -4.110  33.454 18.846 1.00 21.79 ? 153  GLY A O    1 
ATOM   955  N  N    . MET A 1 124 ? -3.363  35.534 19.290 1.00 23.97 ? 154  MET A N    1 
ATOM   956  C  CA   . MET A 1 124 ? -4.352  36.199 18.439 1.00 26.62 ? 154  MET A CA   1 
ATOM   957  C  C    . MET A 1 124 ? -4.154  35.735 16.997 1.00 27.15 ? 154  MET A C    1 
ATOM   958  O  O    . MET A 1 124 ? -5.115  35.385 16.307 1.00 28.14 ? 154  MET A O    1 
ATOM   959  C  CB   . MET A 1 124 ? -4.207  37.730 18.502 1.00 28.69 ? 154  MET A CB   1 
ATOM   960  C  CG   . MET A 1 124 ? -4.028  38.312 19.897 1.00 32.27 ? 154  MET A CG   1 
ATOM   961  S  SD   . MET A 1 124 ? -5.251  39.514 20.480 1.00 29.72 ? 154  MET A SD   1 
ATOM   962  C  CE   . MET A 1 124 ? -4.909  40.833 19.493 1.00 32.32 ? 154  MET A CE   1 
ATOM   963  N  N    . ALA A 1 125 ? -2.900  35.736 16.549 1.00 27.38 ? 155  ALA A N    1 
ATOM   964  C  CA   . ALA A 1 125 ? -2.556  35.318 15.189 1.00 28.13 ? 155  ALA A CA   1 
ATOM   965  C  C    . ALA A 1 125 ? -2.960  33.865 14.952 1.00 27.29 ? 155  ALA A C    1 
ATOM   966  O  O    . ALA A 1 125 ? -3.582  33.535 13.945 1.00 28.06 ? 155  ALA A O    1 
ATOM   967  C  CB   . ALA A 1 125 ? -1.058  35.503 14.940 1.00 24.80 ? 155  ALA A CB   1 
ATOM   968  N  N    . GLU A 1 126 ? -2.634  33.011 15.909 1.00 24.35 ? 156  GLU A N    1 
ATOM   969  C  CA   . GLU A 1 126 ? -2.956  31.602 15.815 1.00 26.39 ? 156  GLU A CA   1 
ATOM   970  C  C    . GLU A 1 126 ? -4.430  31.340 15.490 1.00 30.66 ? 156  GLU A C    1 
ATOM   971  O  O    . GLU A 1 126 ? -4.745  30.500 14.639 1.00 34.86 ? 156  GLU A O    1 
ATOM   972  C  CB   . GLU A 1 126 ? -2.584  30.913 17.124 1.00 25.06 ? 156  GLU A CB   1 
ATOM   973  C  CG   . GLU A 1 126 ? -2.848  29.429 17.167 1.00 20.96 ? 156  GLU A CG   1 
ATOM   974  C  CD   . GLU A 1 126 ? -2.393  28.804 18.470 1.00 24.15 ? 156  GLU A CD   1 
ATOM   975  O  OE1  . GLU A 1 126 ? -1.361  29.243 19.017 1.00 22.25 ? 156  GLU A OE1  1 
ATOM   976  O  OE2  . GLU A 1 126 ? -3.070  27.870 18.948 1.00 29.59 ? 156  GLU A OE2  1 
ATOM   977  N  N    . PHE A 1 127 ? -5.330  32.056 16.159 1.00 30.48 ? 157  PHE A N    1 
ATOM   978  C  CA   . PHE A 1 127 ? -6.765  31.862 15.947 1.00 26.23 ? 157  PHE A CA   1 
ATOM   979  C  C    . PHE A 1 127 ? -7.432  32.799 14.950 1.00 25.17 ? 157  PHE A C    1 
ATOM   980  O  O    . PHE A 1 127 ? -8.630  32.675 14.681 1.00 26.57 ? 157  PHE A O    1 
ATOM   981  C  CB   . PHE A 1 127 ? -7.508  31.914 17.284 1.00 19.98 ? 157  PHE A CB   1 
ATOM   982  C  CG   . PHE A 1 127 ? -7.348  30.678 18.111 1.00 17.11 ? 157  PHE A CG   1 
ATOM   983  C  CD1  . PHE A 1 127 ? -6.268  30.542 18.972 1.00 15.38 ? 157  PHE A CD1  1 
ATOM   984  C  CD2  . PHE A 1 127 ? -8.288  29.654 18.041 1.00 18.91 ? 157  PHE A CD2  1 
ATOM   985  C  CE1  . PHE A 1 127 ? -6.124  29.408 19.766 1.00 12.76 ? 157  PHE A CE1  1 
ATOM   986  C  CE2  . PHE A 1 127 ? -8.155  28.511 18.828 1.00 20.57 ? 157  PHE A CE2  1 
ATOM   987  C  CZ   . PHE A 1 127 ? -7.067  28.388 19.694 1.00 18.18 ? 157  PHE A CZ   1 
ATOM   988  N  N    . LEU A 1 128 ? -6.657  33.706 14.376 1.00 26.09 ? 158  LEU A N    1 
ATOM   989  C  CA   . LEU A 1 128 ? -7.187  34.669 13.420 1.00 31.06 ? 158  LEU A CA   1 
ATOM   990  C  C    . LEU A 1 128 ? -7.795  34.062 12.150 1.00 34.82 ? 158  LEU A C    1 
ATOM   991  O  O    . LEU A 1 128 ? -8.875  34.482 11.706 1.00 35.04 ? 158  LEU A O    1 
ATOM   992  C  CB   . LEU A 1 128 ? -6.094  35.671 13.045 1.00 33.33 ? 158  LEU A CB   1 
ATOM   993  C  CG   . LEU A 1 128 ? -6.471  36.851 12.149 1.00 34.54 ? 158  LEU A CG   1 
ATOM   994  C  CD1  . LEU A 1 128 ? -7.676  37.616 12.725 1.00 32.01 ? 158  LEU A CD1  1 
ATOM   995  C  CD2  . LEU A 1 128 ? -5.245  37.753 12.013 1.00 34.01 ? 158  LEU A CD2  1 
ATOM   996  N  N    . ASP A 1 129 ? -7.113  33.084 11.564 1.00 34.40 ? 159  ASP A N    1 
ATOM   997  C  CA   . ASP A 1 129 ? -7.596  32.470 10.336 1.00 36.07 ? 159  ASP A CA   1 
ATOM   998  C  C    . ASP A 1 129 ? -8.035  31.012 10.460 1.00 35.18 ? 159  ASP A C    1 
ATOM   999  O  O    . ASP A 1 129 ? -8.061  30.273 9.471  1.00 34.21 ? 159  ASP A O    1 
ATOM   1000 C  CB   . ASP A 1 129 ? -6.556  32.630 9.215  1.00 39.57 ? 159  ASP A CB   1 
ATOM   1001 C  CG   . ASP A 1 129 ? -5.238  31.900 9.502  1.00 45.24 ? 159  ASP A CG   1 
ATOM   1002 O  OD1  . ASP A 1 129 ? -5.005  31.451 10.652 1.00 44.33 ? 159  ASP A OD1  1 
ATOM   1003 O  OD2  . ASP A 1 129 ? -4.422  31.781 8.555  1.00 46.66 ? 159  ASP A OD2  1 
ATOM   1004 N  N    . LYS A 1 130 ? -8.377  30.595 11.672 1.00 31.72 ? 160  LYS A N    1 
ATOM   1005 C  CA   . LYS A 1 130 ? -8.822  29.232 11.881 1.00 30.39 ? 160  LYS A CA   1 
ATOM   1006 C  C    . LYS A 1 130 ? -10.016 29.234 12.817 1.00 32.89 ? 160  LYS A C    1 
ATOM   1007 O  O    . LYS A 1 130 ? -10.249 30.192 13.554 1.00 35.10 ? 160  LYS A O    1 
ATOM   1008 C  CB   . LYS A 1 130 ? -7.694  28.348 12.437 1.00 29.60 ? 160  LYS A CB   1 
ATOM   1009 C  CG   . LYS A 1 130 ? -7.516  28.399 13.948 1.00 33.07 ? 160  LYS A CG   1 
ATOM   1010 C  CD   . LYS A 1 130 ? -6.376  27.511 14.427 1.00 32.83 ? 160  LYS A CD   1 
ATOM   1011 C  CE   . LYS A 1 130 ? -6.275  27.554 15.941 1.00 33.92 ? 160  LYS A CE   1 
ATOM   1012 N  NZ   . LYS A 1 130 ? -5.054  26.909 16.500 1.00 34.71 ? 160  LYS A NZ   1 
ATOM   1013 N  N    . HIS A 1 131 ? -10.805 28.173 12.732 1.00 34.30 ? 161  HIS A N    1 
ATOM   1014 C  CA   . HIS A 1 131 ? -11.988 28.009 13.563 1.00 32.09 ? 161  HIS A CA   1 
ATOM   1015 C  C    . HIS A 1 131 ? -11.581 27.570 14.954 1.00 30.68 ? 161  HIS A C    1 
ATOM   1016 O  O    . HIS A 1 131 ? -10.587 26.852 15.119 1.00 28.36 ? 161  HIS A O    1 
ATOM   1017 C  CB   . HIS A 1 131 ? -12.855 26.865 13.017 1.00 36.40 ? 161  HIS A CB   1 
ATOM   1018 C  CG   . HIS A 1 131 ? -13.914 27.289 12.051 1.00 41.30 ? 161  HIS A CG   1 
ATOM   1019 N  ND1  . HIS A 1 131 ? -15.248 27.034 12.260 1.00 42.31 ? 161  HIS A ND1  1 
ATOM   1020 C  CD2  . HIS A 1 131 ? -13.835 27.925 10.858 1.00 44.95 ? 161  HIS A CD2  1 
ATOM   1021 C  CE1  . HIS A 1 131 ? -15.951 27.495 11.240 1.00 43.56 ? 161  HIS A CE1  1 
ATOM   1022 N  NE2  . HIS A 1 131 ? -15.116 28.040 10.377 1.00 44.87 ? 161  HIS A NE2  1 
ATOM   1023 N  N    . VAL A 1 132 ? -12.340 28.004 15.953 1.00 27.23 ? 162  VAL A N    1 
ATOM   1024 C  CA   . VAL A 1 132 ? -12.115 27.520 17.304 1.00 26.46 ? 162  VAL A CA   1 
ATOM   1025 C  C    . VAL A 1 132 ? -12.857 26.189 17.103 1.00 26.10 ? 162  VAL A C    1 
ATOM   1026 O  O    . VAL A 1 132 ? -14.031 26.179 16.703 1.00 21.11 ? 162  VAL A O    1 
ATOM   1027 C  CB   . VAL A 1 132 ? -12.843 28.375 18.374 1.00 28.46 ? 162  VAL A CB   1 
ATOM   1028 C  CG1  . VAL A 1 132 ? -12.858 27.630 19.714 1.00 21.00 ? 162  VAL A CG1  1 
ATOM   1029 C  CG2  . VAL A 1 132 ? -12.167 29.738 18.521 1.00 20.15 ? 162  VAL A CG2  1 
ATOM   1030 N  N    . THR A 1 133 ? -12.147 25.082 17.264 1.00 22.43 ? 163  THR A N    1 
ATOM   1031 C  CA   . THR A 1 133 ? -12.739 23.776 17.035 1.00 22.41 ? 163  THR A CA   1 
ATOM   1032 C  C    . THR A 1 133 ? -13.356 23.137 18.266 1.00 22.19 ? 163  THR A C    1 
ATOM   1033 O  O    . THR A 1 133 ? -14.568 23.208 18.472 1.00 22.96 ? 163  THR A O    1 
ATOM   1034 C  CB   . THR A 1 133 ? -11.696 22.830 16.428 1.00 22.69 ? 163  THR A CB   1 
ATOM   1035 O  OG1  . THR A 1 133 ? -10.529 22.816 17.264 1.00 24.61 ? 163  THR A OG1  1 
ATOM   1036 C  CG2  . THR A 1 133 ? -11.298 23.312 15.047 1.00 23.23 ? 163  THR A CG2  1 
ATOM   1037 N  N    . SER A 1 134 ? -12.521 22.502 19.079 1.00 20.93 ? 164  SER A N    1 
ATOM   1038 C  CA   . SER A 1 134 ? -12.984 21.827 20.280 1.00 22.74 ? 164  SER A CA   1 
ATOM   1039 C  C    . SER A 1 134 ? -13.171 22.813 21.424 1.00 21.39 ? 164  SER A C    1 
ATOM   1040 O  O    . SER A 1 134 ? -12.707 23.955 21.359 1.00 19.86 ? 164  SER A O    1 
ATOM   1041 C  CB   . SER A 1 134 ? -11.961 20.771 20.691 1.00 22.65 ? 164  SER A CB   1 
ATOM   1042 O  OG   . SER A 1 134 ? -10.705 21.383 20.942 1.00 24.88 ? 164  SER A OG   1 
ATOM   1043 N  N    . GLU A 1 135 ? -13.850 22.368 22.475 1.00 20.09 ? 165  GLU A N    1 
ATOM   1044 C  CA   . GLU A 1 135 ? -14.049 23.206 23.645 1.00 23.04 ? 165  GLU A CA   1 
ATOM   1045 C  C    . GLU A 1 135 ? -12.663 23.465 24.239 1.00 23.49 ? 165  GLU A C    1 
ATOM   1046 O  O    . GLU A 1 135 ? -12.392 24.540 24.768 1.00 22.61 ? 165  GLU A O    1 
ATOM   1047 C  CB   . GLU A 1 135 ? -14.942 22.492 24.653 1.00 21.11 ? 165  GLU A CB   1 
ATOM   1048 C  CG   . GLU A 1 135 ? -16.347 22.256 24.147 1.00 23.81 ? 165  GLU A CG   1 
ATOM   1049 C  CD   . GLU A 1 135 ? -17.173 21.424 25.097 1.00 29.87 ? 165  GLU A CD   1 
ATOM   1050 O  OE1  . GLU A 1 135 ? -17.019 20.181 25.092 1.00 33.70 ? 165  GLU A OE1  1 
ATOM   1051 O  OE2  . GLU A 1 135 ? -17.974 22.011 25.854 1.00 32.71 ? 165  GLU A OE2  1 
ATOM   1052 N  N    . GLN A 1 136 ? -11.761 22.507 24.040 1.00 23.69 ? 166  GLN A N    1 
ATOM   1053 C  CA   . GLN A 1 136 ? -10.393 22.602 24.539 1.00 27.15 ? 166  GLN A CA   1 
ATOM   1054 C  C    . GLN A 1 136 ? -9.687  23.760 23.846 1.00 28.03 ? 166  GLN A C    1 
ATOM   1055 O  O    . GLN A 1 136 ? -8.897  24.485 24.456 1.00 27.32 ? 166  GLN A O    1 
ATOM   1056 C  CB   . GLN A 1 136 ? -9.610  21.291 24.309 1.00 32.19 ? 166  GLN A CB   1 
ATOM   1057 C  CG   . GLN A 1 136 ? -10.397 20.096 23.726 1.00 40.24 ? 166  GLN A CG   1 
ATOM   1058 C  CD   . GLN A 1 136 ? -11.702 19.779 24.460 1.00 44.63 ? 166  GLN A CD   1 
ATOM   1059 O  OE1  . GLN A 1 136 ? -12.767 19.760 23.849 1.00 46.03 ? 166  GLN A OE1  1 
ATOM   1060 N  NE2  . GLN A 1 136 ? -11.627 19.565 25.769 1.00 48.68 ? 166  GLN A NE2  1 
ATOM   1061 N  N    . GLU A 1 137 ? -9.994  23.933 22.565 1.00 26.80 ? 167  GLU A N    1 
ATOM   1062 C  CA   . GLU A 1 137 ? -9.421  25.010 21.779 1.00 22.07 ? 167  GLU A CA   1 
ATOM   1063 C  C    . GLU A 1 137 ? -10.076 26.338 22.155 1.00 19.72 ? 167  GLU A C    1 
ATOM   1064 O  O    . GLU A 1 137 ? -9.505  27.399 21.941 1.00 18.35 ? 167  GLU A O    1 
ATOM   1065 C  CB   . GLU A 1 137 ? -9.608  24.720 20.298 1.00 24.98 ? 167  GLU A CB   1 
ATOM   1066 C  CG   . GLU A 1 137 ? -8.584  23.756 19.739 1.00 30.25 ? 167  GLU A CG   1 
ATOM   1067 C  CD   . GLU A 1 137 ? -7.232  24.416 19.526 1.00 32.59 ? 167  GLU A CD   1 
ATOM   1068 O  OE1  . GLU A 1 137 ? -7.098  25.209 18.565 1.00 35.10 ? 167  GLU A OE1  1 
ATOM   1069 O  OE2  . GLU A 1 137 ? -6.302  24.139 20.313 1.00 28.66 ? 167  GLU A OE2  1 
ATOM   1070 N  N    . TRP A 1 138 ? -11.290 26.273 22.688 1.00 18.54 ? 168  TRP A N    1 
ATOM   1071 C  CA   . TRP A 1 138 ? -12.002 27.473 23.106 1.00 20.59 ? 168  TRP A CA   1 
ATOM   1072 C  C    . TRP A 1 138 ? -11.273 27.993 24.341 1.00 19.01 ? 168  TRP A C    1 
ATOM   1073 O  O    . TRP A 1 138 ? -11.024 29.190 24.464 1.00 18.52 ? 168  TRP A O    1 
ATOM   1074 C  CB   . TRP A 1 138 ? -13.466 27.143 23.421 1.00 22.11 ? 168  TRP A CB   1 
ATOM   1075 C  CG   . TRP A 1 138 ? -14.380 28.346 23.465 1.00 21.57 ? 168  TRP A CG   1 
ATOM   1076 C  CD1  . TRP A 1 138 ? -14.259 29.511 22.748 1.00 21.11 ? 168  TRP A CD1  1 
ATOM   1077 C  CD2  . TRP A 1 138 ? -15.559 28.485 24.257 1.00 18.85 ? 168  TRP A CD2  1 
ATOM   1078 N  NE1  . TRP A 1 138 ? -15.298 30.360 23.047 1.00 17.78 ? 168  TRP A NE1  1 
ATOM   1079 C  CE2  . TRP A 1 138 ? -16.112 29.760 23.968 1.00 18.43 ? 168  TRP A CE2  1 
ATOM   1080 C  CE3  . TRP A 1 138 ? -16.209 27.660 25.181 1.00 14.31 ? 168  TRP A CE3  1 
ATOM   1081 C  CZ2  . TRP A 1 138 ? -17.282 30.223 24.572 1.00 19.71 ? 168  TRP A CZ2  1 
ATOM   1082 C  CZ3  . TRP A 1 138 ? -17.374 28.118 25.783 1.00 20.37 ? 168  TRP A CZ3  1 
ATOM   1083 C  CH2  . TRP A 1 138 ? -17.899 29.393 25.475 1.00 20.41 ? 168  TRP A CH2  1 
ATOM   1084 N  N    . ASP A 1 139 ? -10.894 27.074 25.226 1.00 17.42 ? 169  ASP A N    1 
ATOM   1085 C  CA   . ASP A 1 139 ? -10.138 27.422 26.426 1.00 18.60 ? 169  ASP A CA   1 
ATOM   1086 C  C    . ASP A 1 139 ? -8.806  28.006 26.000 1.00 18.67 ? 169  ASP A C    1 
ATOM   1087 O  O    . ASP A 1 139 ? -8.306  28.951 26.607 1.00 22.41 ? 169  ASP A O    1 
ATOM   1088 C  CB   . ASP A 1 139 ? -9.859  26.177 27.265 1.00 18.54 ? 169  ASP A CB   1 
ATOM   1089 C  CG   . ASP A 1 139 ? -11.087 25.652 27.945 1.00 20.58 ? 169  ASP A CG   1 
ATOM   1090 O  OD1  . ASP A 1 139 ? -12.150 26.287 27.826 1.00 23.83 ? 169  ASP A OD1  1 
ATOM   1091 O  OD2  . ASP A 1 139 ? -10.989 24.600 28.600 1.00 24.85 ? 169  ASP A OD2  1 
ATOM   1092 N  N    . LYS A 1 140 ? -8.212  27.395 24.983 1.00 19.09 ? 170  LYS A N    1 
ATOM   1093 C  CA   . LYS A 1 140 ? -6.935  27.842 24.451 1.00 23.05 ? 170  LYS A CA   1 
ATOM   1094 C  C    . LYS A 1 140 ? -7.033  29.300 23.977 1.00 19.63 ? 170  LYS A C    1 
ATOM   1095 O  O    . LYS A 1 140 ? -6.207  30.128 24.352 1.00 22.70 ? 170  LYS A O    1 
ATOM   1096 C  CB   . LYS A 1 140 ? -6.496  26.921 23.305 1.00 28.35 ? 170  LYS A CB   1 
ATOM   1097 C  CG   . LYS A 1 140 ? -5.141  27.258 22.688 1.00 31.87 ? 170  LYS A CG   1 
ATOM   1098 C  CD   . LYS A 1 140 ? -4.014  26.511 23.368 1.00 34.70 ? 170  LYS A CD   1 
ATOM   1099 C  CE   . LYS A 1 140 ? -2.683  26.754 22.662 1.00 41.06 ? 170  LYS A CE   1 
ATOM   1100 N  NZ   . LYS A 1 140 ? -2.670  26.320 21.228 1.00 41.01 ? 170  LYS A NZ   1 
ATOM   1101 N  N    . TYR A 1 141 ? -8.045  29.621 23.179 1.00 13.73 ? 171  TYR A N    1 
ATOM   1102 C  CA   . TYR A 1 141 ? -8.209  30.992 22.698 1.00 16.23 ? 171  TYR A CA   1 
ATOM   1103 C  C    . TYR A 1 141 ? -8.437  31.939 23.873 1.00 17.67 ? 171  TYR A C    1 
ATOM   1104 O  O    . TYR A 1 141 ? -7.784  32.989 23.981 1.00 15.63 ? 171  TYR A O    1 
ATOM   1105 C  CB   . TYR A 1 141 ? -9.395  31.114 21.728 1.00 16.52 ? 171  TYR A CB   1 
ATOM   1106 C  CG   . TYR A 1 141 ? -9.632  32.549 21.288 1.00 16.42 ? 171  TYR A CG   1 
ATOM   1107 C  CD1  . TYR A 1 141 ? -8.736  33.192 20.422 1.00 14.99 ? 171  TYR A CD1  1 
ATOM   1108 C  CD2  . TYR A 1 141 ? -10.708 33.285 21.796 1.00 12.15 ? 171  TYR A CD2  1 
ATOM   1109 C  CE1  . TYR A 1 141 ? -8.908  34.533 20.076 1.00 14.74 ? 171  TYR A CE1  1 
ATOM   1110 C  CE2  . TYR A 1 141 ? -10.886 34.621 21.463 1.00 13.24 ? 171  TYR A CE2  1 
ATOM   1111 C  CZ   . TYR A 1 141 ? -9.986  35.239 20.601 1.00 15.16 ? 171  TYR A CZ   1 
ATOM   1112 O  OH   . TYR A 1 141 ? -10.168 36.558 20.253 1.00 18.91 ? 171  TYR A OH   1 
ATOM   1113 N  N    . CYS A 1 142 ? -9.399  31.571 24.722 1.00 18.80 ? 172  CYS A N    1 
ATOM   1114 C  CA   . CYS A 1 142 ? -9.756  32.350 25.900 1.00 18.83 ? 172  CYS A CA   1 
ATOM   1115 C  C    . CYS A 1 142 ? -8.541  32.580 26.776 1.00 19.16 ? 172  CYS A C    1 
ATOM   1116 O  O    . CYS A 1 142 ? -8.335  33.679 27.291 1.00 20.19 ? 172  CYS A O    1 
ATOM   1117 C  CB   . CYS A 1 142 ? -10.884 31.666 26.668 1.00 15.27 ? 172  CYS A CB   1 
ATOM   1118 S  SG   . CYS A 1 142 ? -12.462 31.781 25.791 1.00 20.80 ? 172  CYS A SG   1 
ATOM   1119 N  N    . HIS A 1 143 ? -7.698  31.562 26.889 1.00 22.12 ? 173  HIS A N    1 
ATOM   1120 C  CA   . HIS A 1 143 ? -6.484  31.683 27.674 1.00 22.21 ? 173  HIS A CA   1 
ATOM   1121 C  C    . HIS A 1 143 ? -5.619  32.792 27.074 1.00 22.87 ? 173  HIS A C    1 
ATOM   1122 O  O    . HIS A 1 143 ? -5.155  33.686 27.785 1.00 21.91 ? 173  HIS A O    1 
ATOM   1123 C  CB   . HIS A 1 143 ? -5.700  30.369 27.674 1.00 20.54 ? 173  HIS A CB   1 
ATOM   1124 C  CG   . HIS A 1 143 ? -4.242  30.548 27.971 1.00 22.50 ? 173  HIS A CG   1 
ATOM   1125 N  ND1  . HIS A 1 143 ? -3.751  30.617 29.253 1.00 24.45 ? 173  HIS A ND1  1 
ATOM   1126 C  CD2  . HIS A 1 143 ? -3.183  30.739 27.148 1.00 23.20 ? 173  HIS A CD2  1 
ATOM   1127 C  CE1  . HIS A 1 143 ? -2.448  30.850 29.213 1.00 24.12 ? 173  HIS A CE1  1 
ATOM   1128 N  NE2  . HIS A 1 143 ? -2.083  30.928 27.949 1.00 24.93 ? 173  HIS A NE2  1 
ATOM   1129 N  N    . TYR A 1 144 ? -5.444  32.750 25.757 1.00 22.29 ? 174  TYR A N    1 
ATOM   1130 C  CA   . TYR A 1 144 ? -4.626  33.728 25.048 1.00 19.96 ? 174  TYR A CA   1 
ATOM   1131 C  C    . TYR A 1 144 ? -5.069  35.176 25.196 1.00 18.18 ? 174  TYR A C    1 
ATOM   1132 O  O    . TYR A 1 144 ? -4.241  36.066 25.337 1.00 17.61 ? 174  TYR A O    1 
ATOM   1133 C  CB   . TYR A 1 144 ? -4.574  33.398 23.553 1.00 25.88 ? 174  TYR A CB   1 
ATOM   1134 C  CG   . TYR A 1 144 ? -3.596  32.315 23.152 1.00 27.17 ? 174  TYR A CG   1 
ATOM   1135 C  CD1  . TYR A 1 144 ? -2.249  32.396 23.499 1.00 29.11 ? 174  TYR A CD1  1 
ATOM   1136 C  CD2  . TYR A 1 144 ? -4.007  31.240 22.367 1.00 27.84 ? 174  TYR A CD2  1 
ATOM   1137 C  CE1  . TYR A 1 144 ? -1.334  31.434 23.068 1.00 28.43 ? 174  TYR A CE1  1 
ATOM   1138 C  CE2  . TYR A 1 144 ? -3.100  30.276 21.935 1.00 30.40 ? 174  TYR A CE2  1 
ATOM   1139 C  CZ   . TYR A 1 144 ? -1.768  30.380 22.288 1.00 27.92 ? 174  TYR A CZ   1 
ATOM   1140 O  OH   . TYR A 1 144 ? -0.866  29.431 21.861 1.00 30.47 ? 174  TYR A OH   1 
ATOM   1141 N  N    . VAL A 1 145 ? -6.372  35.422 25.157 1.00 19.56 ? 175  VAL A N    1 
ATOM   1142 C  CA   . VAL A 1 145 ? -6.854  36.797 25.229 1.00 21.20 ? 175  VAL A CA   1 
ATOM   1143 C  C    . VAL A 1 145 ? -7.413  37.297 26.570 1.00 23.08 ? 175  VAL A C    1 
ATOM   1144 O  O    . VAL A 1 145 ? -7.601  38.500 26.758 1.00 23.46 ? 175  VAL A O    1 
ATOM   1145 C  CB   . VAL A 1 145 ? -7.875  37.072 24.093 1.00 16.50 ? 175  VAL A CB   1 
ATOM   1146 C  CG1  . VAL A 1 145 ? -7.269  36.675 22.749 1.00 19.93 ? 175  VAL A CG1  1 
ATOM   1147 C  CG2  . VAL A 1 145 ? -9.162  36.316 24.338 1.00 16.59 ? 175  VAL A CG2  1 
ATOM   1148 N  N    . ALA A 1 146 ? -7.658  36.390 27.506 1.00 20.16 ? 176  ALA A N    1 
ATOM   1149 C  CA   . ALA A 1 146 ? -8.206  36.790 28.785 1.00 20.20 ? 176  ALA A CA   1 
ATOM   1150 C  C    . ALA A 1 146 ? -7.518  36.071 29.930 1.00 20.99 ? 176  ALA A C    1 
ATOM   1151 O  O    . ALA A 1 146 ? -7.299  36.659 30.991 1.00 21.54 ? 176  ALA A O    1 
ATOM   1152 C  CB   . ALA A 1 146 ? -9.708  36.539 28.809 1.00 18.05 ? 176  ALA A CB   1 
ATOM   1153 N  N    . GLY A 1 147 ? -7.176  34.802 29.722 1.00 23.12 ? 177  GLY A N    1 
ATOM   1154 C  CA   . GLY A 1 147 ? -6.491  34.043 30.758 1.00 21.48 ? 177  GLY A CA   1 
ATOM   1155 C  C    . GLY A 1 147 ? -5.166  34.715 31.088 1.00 22.62 ? 177  GLY A C    1 
ATOM   1156 O  O    . GLY A 1 147 ? -4.875  35.021 32.250 1.00 21.00 ? 177  GLY A O    1 
ATOM   1157 N  N    . LEU A 1 148 ? -4.392  35.012 30.050 1.00 18.48 ? 178  LEU A N    1 
ATOM   1158 C  CA   . LEU A 1 148 ? -3.104  35.666 30.211 1.00 23.21 ? 178  LEU A CA   1 
ATOM   1159 C  C    . LEU A 1 148 ? -3.245  37.025 30.893 1.00 23.23 ? 178  LEU A C    1 
ATOM   1160 O  O    . LEU A 1 148 ? -2.324  37.486 31.571 1.00 22.85 ? 178  LEU A O    1 
ATOM   1161 C  CB   . LEU A 1 148 ? -2.400  35.814 28.855 1.00 22.88 ? 178  LEU A CB   1 
ATOM   1162 C  CG   . LEU A 1 148 ? -1.803  34.535 28.247 1.00 18.78 ? 178  LEU A CG   1 
ATOM   1163 C  CD1  . LEU A 1 148 ? -1.206  34.831 26.877 1.00 22.68 ? 178  LEU A CD1  1 
ATOM   1164 C  CD2  . LEU A 1 148 ? -0.743  33.969 29.174 1.00 18.35 ? 178  LEU A CD2  1 
ATOM   1165 N  N    . VAL A 1 149 ? -4.388  37.674 30.702 1.00 24.42 ? 179  VAL A N    1 
ATOM   1166 C  CA   . VAL A 1 149 ? -4.635  38.969 31.335 1.00 27.24 ? 179  VAL A CA   1 
ATOM   1167 C  C    . VAL A 1 149 ? -4.752  38.736 32.851 1.00 28.48 ? 179  VAL A C    1 
ATOM   1168 O  O    . VAL A 1 149 ? -4.243  39.526 33.652 1.00 27.44 ? 179  VAL A O    1 
ATOM   1169 C  CB   . VAL A 1 149 ? -5.922  39.634 30.779 1.00 26.76 ? 179  VAL A CB   1 
ATOM   1170 C  CG1  . VAL A 1 149 ? -6.215  40.937 31.514 1.00 24.00 ? 179  VAL A CG1  1 
ATOM   1171 C  CG2  . VAL A 1 149 ? -5.763  39.900 29.292 1.00 25.02 ? 179  VAL A CG2  1 
ATOM   1172 N  N    . GLY A 1 150 ? -5.397  37.632 33.227 1.00 25.28 ? 180  GLY A N    1 
ATOM   1173 C  CA   . GLY A 1 150 ? -5.538  37.291 34.628 1.00 23.11 ? 180  GLY A CA   1 
ATOM   1174 C  C    . GLY A 1 150 ? -4.169  36.967 35.185 1.00 25.97 ? 180  GLY A C    1 
ATOM   1175 O  O    . GLY A 1 150 ? -3.805  37.412 36.278 1.00 26.12 ? 180  GLY A O    1 
ATOM   1176 N  N    . ILE A 1 151 ? -3.391  36.216 34.412 1.00 27.19 ? 181  ILE A N    1 
ATOM   1177 C  CA   . ILE A 1 151 ? -2.039  35.842 34.818 1.00 28.18 ? 181  ILE A CA   1 
ATOM   1178 C  C    . ILE A 1 151 ? -1.201  37.105 34.995 1.00 27.08 ? 181  ILE A C    1 
ATOM   1179 O  O    . ILE A 1 151 ? -0.459  37.237 35.970 1.00 27.19 ? 181  ILE A O    1 
ATOM   1180 C  CB   . ILE A 1 151 ? -1.332  34.964 33.755 1.00 30.39 ? 181  ILE A CB   1 
ATOM   1181 C  CG1  . ILE A 1 151 ? -2.216  33.785 33.342 1.00 33.99 ? 181  ILE A CG1  1 
ATOM   1182 C  CG2  . ILE A 1 151 ? -0.003  34.450 34.295 1.00 28.43 ? 181  ILE A CG2  1 
ATOM   1183 C  CD1  . ILE A 1 151 ? -2.586  32.887 34.465 1.00 31.53 ? 181  ILE A CD1  1 
ATOM   1184 N  N    . GLY A 1 152 ? -1.323  38.025 34.043 1.00 24.26 ? 182  GLY A N    1 
ATOM   1185 C  CA   . GLY A 1 152 ? -0.564  39.261 34.097 1.00 27.55 ? 182  GLY A CA   1 
ATOM   1186 C  C    . GLY A 1 152 ? -0.901  40.089 35.318 1.00 27.43 ? 182  GLY A C    1 
ATOM   1187 O  O    . GLY A 1 152 ? -0.015  40.476 36.089 1.00 28.84 ? 182  GLY A O    1 
ATOM   1188 N  N    . LEU A 1 153 ? -2.190  40.356 35.492 1.00 26.59 ? 183  LEU A N    1 
ATOM   1189 C  CA   . LEU A 1 153 ? -2.670  41.131 36.626 1.00 22.09 ? 183  LEU A CA   1 
ATOM   1190 C  C    . LEU A 1 153 ? -2.175  40.500 37.915 1.00 19.06 ? 183  LEU A C    1 
ATOM   1191 O  O    . LEU A 1 153 ? -1.538  41.177 38.712 1.00 19.34 ? 183  LEU A O    1 
ATOM   1192 C  CB   . LEU A 1 153 ? -4.203  41.228 36.618 1.00 18.93 ? 183  LEU A CB   1 
ATOM   1193 C  CG   . LEU A 1 153 ? -4.785  42.193 35.574 1.00 17.08 ? 183  LEU A CG   1 
ATOM   1194 C  CD1  . LEU A 1 153 ? -6.261  41.940 35.391 1.00 18.96 ? 183  LEU A CD1  1 
ATOM   1195 C  CD2  . LEU A 1 153 ? -4.527  43.639 35.968 1.00 14.09 ? 183  LEU A CD2  1 
ATOM   1196 N  N    . SER A 1 154 ? -2.387  39.195 38.077 1.00 17.80 ? 184  SER A N    1 
ATOM   1197 C  CA   . SER A 1 154 ? -1.954  38.500 39.285 1.00 19.83 ? 184  SER A CA   1 
ATOM   1198 C  C    . SER A 1 154 ? -0.486  38.743 39.587 1.00 22.73 ? 184  SER A C    1 
ATOM   1199 O  O    . SER A 1 154 ? -0.115  39.000 40.739 1.00 21.42 ? 184  SER A O    1 
ATOM   1200 C  CB   . SER A 1 154 ? -2.217  37.000 39.179 1.00 19.96 ? 184  SER A CB   1 
ATOM   1201 O  OG   . SER A 1 154 ? -3.607  36.728 39.171 1.00 20.04 ? 184  SER A OG   1 
ATOM   1202 N  N    . ARG A 1 155 ? 0.341   38.678 38.548 1.00 23.80 ? 185  ARG A N    1 
ATOM   1203 C  CA   . ARG A 1 155 ? 1.774   38.894 38.697 1.00 26.19 ? 185  ARG A CA   1 
ATOM   1204 C  C    . ARG A 1 155 ? 2.071   40.343 39.091 1.00 26.79 ? 185  ARG A C    1 
ATOM   1205 O  O    . ARG A 1 155 ? 2.974   40.605 39.893 1.00 26.23 ? 185  ARG A O    1 
ATOM   1206 C  CB   . ARG A 1 155 ? 2.518   38.503 37.413 1.00 27.86 ? 185  ARG A CB   1 
ATOM   1207 C  CG   . ARG A 1 155 ? 2.358   37.026 37.047 1.00 32.07 ? 185  ARG A CG   1 
ATOM   1208 C  CD   . ARG A 1 155 ? 3.420   36.575 36.065 1.00 35.27 ? 185  ARG A CD   1 
ATOM   1209 N  NE   . ARG A 1 155 ? 2.952   35.492 35.201 1.00 43.45 ? 185  ARG A NE   1 
ATOM   1210 C  CZ   . ARG A 1 155 ? 3.576   34.331 35.029 1.00 41.52 ? 185  ARG A CZ   1 
ATOM   1211 N  NH1  . ARG A 1 155 ? 4.703   34.069 35.674 1.00 48.29 ? 185  ARG A NH1  1 
ATOM   1212 N  NH2  . ARG A 1 155 ? 3.097   33.445 34.169 1.00 44.25 ? 185  ARG A NH2  1 
ATOM   1213 N  N    . LEU A 1 156 ? 1.295   41.278 38.551 1.00 25.71 ? 186  LEU A N    1 
ATOM   1214 C  CA   . LEU A 1 156 ? 1.473   42.689 38.881 1.00 25.55 ? 186  LEU A CA   1 
ATOM   1215 C  C    . LEU A 1 156 ? 1.103   42.910 40.347 1.00 26.49 ? 186  LEU A C    1 
ATOM   1216 O  O    . LEU A 1 156 ? 1.772   43.656 41.065 1.00 27.03 ? 186  LEU A O    1 
ATOM   1217 C  CB   . LEU A 1 156 ? 0.584   43.573 37.997 1.00 26.50 ? 186  LEU A CB   1 
ATOM   1218 C  CG   . LEU A 1 156 ? 0.962   43.766 36.530 1.00 22.04 ? 186  LEU A CG   1 
ATOM   1219 C  CD1  . LEU A 1 156 ? 0.032   44.792 35.897 1.00 21.50 ? 186  LEU A CD1  1 
ATOM   1220 C  CD2  . LEU A 1 156 ? 2.404   44.232 36.428 1.00 19.80 ? 186  LEU A CD2  1 
ATOM   1221 N  N    . PHE A 1 157 ? 0.037   42.252 40.788 1.00 23.80 ? 187  PHE A N    1 
ATOM   1222 C  CA   . PHE A 1 157 ? -0.414  42.374 42.166 1.00 25.23 ? 187  PHE A CA   1 
ATOM   1223 C  C    . PHE A 1 157 ? 0.694   41.948 43.125 1.00 26.46 ? 187  PHE A C    1 
ATOM   1224 O  O    . PHE A 1 157 ? 1.004   42.655 44.089 1.00 27.53 ? 187  PHE A O    1 
ATOM   1225 C  CB   . PHE A 1 157 ? -1.662  41.517 42.411 1.00 20.57 ? 187  PHE A CB   1 
ATOM   1226 C  CG   . PHE A 1 157 ? -2.879  41.943 41.616 1.00 17.74 ? 187  PHE A CG   1 
ATOM   1227 C  CD1  . PHE A 1 157 ? -3.017  43.246 41.156 1.00 11.63 ? 187  PHE A CD1  1 
ATOM   1228 C  CD2  . PHE A 1 157 ? -3.900  41.030 41.350 1.00 16.12 ? 187  PHE A CD2  1 
ATOM   1229 C  CE1  . PHE A 1 157 ? -4.146  43.635 40.446 1.00 13.95 ? 187  PHE A CE1  1 
ATOM   1230 C  CE2  . PHE A 1 157 ? -5.036  41.413 40.637 1.00 15.91 ? 187  PHE A CE2  1 
ATOM   1231 C  CZ   . PHE A 1 157 ? -5.158  42.716 40.188 1.00 12.65 ? 187  PHE A CZ   1 
ATOM   1232 N  N    . SER A 1 158 ? 1.292   40.796 42.850 1.00 26.59 ? 188  SER A N    1 
ATOM   1233 C  CA   . SER A 1 158 ? 2.359   40.279 43.689 1.00 29.53 ? 188  SER A CA   1 
ATOM   1234 C  C    . SER A 1 158 ? 3.616   41.137 43.621 1.00 29.14 ? 188  SER A C    1 
ATOM   1235 O  O    . SER A 1 158 ? 4.269   41.369 44.640 1.00 31.83 ? 188  SER A O    1 
ATOM   1236 C  CB   . SER A 1 158 ? 2.671   38.826 43.324 1.00 29.59 ? 188  SER A CB   1 
ATOM   1237 O  OG   . SER A 1 158 ? 1.544   37.991 43.559 1.00 30.11 ? 188  SER A OG   1 
ATOM   1238 N  N    . ALA A 1 159 ? 3.917   41.663 42.441 1.00 29.59 ? 189  ALA A N    1 
ATOM   1239 C  CA   . ALA A 1 159 ? 5.103   42.495 42.259 1.00 27.23 ? 189  ALA A CA   1 
ATOM   1240 C  C    . ALA A 1 159 ? 5.019   43.802 43.033 1.00 25.93 ? 189  ALA A C    1 
ATOM   1241 O  O    . ALA A 1 159 ? 6.036   44.369 43.408 1.00 27.72 ? 189  ALA A O    1 
ATOM   1242 C  CB   . ALA A 1 159 ? 5.349   42.767 40.774 1.00 25.66 ? 189  ALA A CB   1 
ATOM   1243 N  N    . SER A 1 160 ? 3.811   44.302 43.246 1.00 28.40 ? 190  SER A N    1 
ATOM   1244 C  CA   . SER A 1 160 ? 3.643   45.545 43.993 1.00 29.16 ? 190  SER A CA   1 
ATOM   1245 C  C    . SER A 1 160 ? 3.695   45.236 45.484 1.00 27.03 ? 190  SER A C    1 
ATOM   1246 O  O    . SER A 1 160 ? 3.910   46.122 46.308 1.00 27.42 ? 190  SER A O    1 
ATOM   1247 C  CB   . SER A 1 160 ? 2.301   46.187 43.660 1.00 23.81 ? 190  SER A CB   1 
ATOM   1248 O  OG   . SER A 1 160 ? 1.240   45.382 44.135 1.00 19.10 ? 190  SER A OG   1 
ATOM   1249 N  N    . GLU A 1 161 ? 3.456   43.967 45.797 1.00 26.56 ? 191  GLU A N    1 
ATOM   1250 C  CA   . GLU A 1 161 ? 3.446   43.445 47.150 1.00 26.18 ? 191  GLU A CA   1 
ATOM   1251 C  C    . GLU A 1 161 ? 2.165   43.700 47.919 1.00 24.34 ? 191  GLU A C    1 
ATOM   1252 O  O    . GLU A 1 161 ? 2.076   43.370 49.103 1.00 24.17 ? 191  GLU A O    1 
ATOM   1253 C  CB   . GLU A 1 161 ? 4.678   43.887 47.928 1.00 29.00 ? 191  GLU A CB   1 
ATOM   1254 C  CG   . GLU A 1 161 ? 5.930   43.214 47.406 1.00 36.16 ? 191  GLU A CG   1 
ATOM   1255 C  CD   . GLU A 1 161 ? 7.166   43.588 48.170 1.00 41.02 ? 191  GLU A CD   1 
ATOM   1256 O  OE1  . GLU A 1 161 ? 7.676   44.705 47.946 1.00 47.11 ? 191  GLU A OE1  1 
ATOM   1257 O  OE2  . GLU A 1 161 ? 7.630   42.763 48.991 1.00 47.19 ? 191  GLU A OE2  1 
ATOM   1258 N  N    . PHE A 1 162 ? 1.159   44.247 47.236 1.00 22.61 ? 192  PHE A N    1 
ATOM   1259 C  CA   . PHE A 1 162 ? -0.140  44.491 47.853 1.00 20.52 ? 192  PHE A CA   1 
ATOM   1260 C  C    . PHE A 1 162 ? -0.830  43.149 48.006 1.00 23.41 ? 192  PHE A C    1 
ATOM   1261 O  O    . PHE A 1 162 ? -1.768  43.003 48.796 1.00 27.46 ? 192  PHE A O    1 
ATOM   1262 C  CB   . PHE A 1 162 ? -0.994  45.419 46.999 1.00 17.58 ? 192  PHE A CB   1 
ATOM   1263 C  CG   . PHE A 1 162 ? -0.611  46.854 47.117 1.00 19.49 ? 192  PHE A CG   1 
ATOM   1264 C  CD1  . PHE A 1 162 ? -0.887  47.562 48.279 1.00 21.02 ? 192  PHE A CD1  1 
ATOM   1265 C  CD2  . PHE A 1 162 ? 0.060   47.495 46.089 1.00 18.57 ? 192  PHE A CD2  1 
ATOM   1266 C  CE1  . PHE A 1 162 ? -0.497  48.883 48.411 1.00 17.52 ? 192  PHE A CE1  1 
ATOM   1267 C  CE2  . PHE A 1 162 ? 0.453   48.818 46.217 1.00 13.93 ? 192  PHE A CE2  1 
ATOM   1268 C  CZ   . PHE A 1 162 ? 0.175   49.507 47.378 1.00 15.27 ? 192  PHE A CZ   1 
ATOM   1269 N  N    . GLU A 1 163 ? -0.372  42.173 47.228 1.00 22.21 ? 193  GLU A N    1 
ATOM   1270 C  CA   . GLU A 1 163 ? -0.919  40.833 47.286 1.00 21.88 ? 193  GLU A CA   1 
ATOM   1271 C  C    . GLU A 1 163 ? 0.209   39.835 47.457 1.00 24.56 ? 193  GLU A C    1 
ATOM   1272 O  O    . GLU A 1 163 ? 1.309   40.030 46.949 1.00 26.72 ? 193  GLU A O    1 
ATOM   1273 C  CB   . GLU A 1 163 ? -1.737  40.522 46.030 1.00 19.32 ? 193  GLU A CB   1 
ATOM   1274 C  CG   . GLU A 1 163 ? -3.052  41.296 45.937 1.00 19.94 ? 193  GLU A CG   1 
ATOM   1275 C  CD   . GLU A 1 163 ? -4.079  40.900 47.009 1.00 22.50 ? 193  GLU A CD   1 
ATOM   1276 O  OE1  . GLU A 1 163 ? -3.810  39.981 47.811 1.00 21.11 ? 193  GLU A OE1  1 
ATOM   1277 O  OE2  . GLU A 1 163 ? -5.173  41.503 47.037 1.00 25.10 ? 193  GLU A OE2  1 
ATOM   1278 N  N    . ASP A 1 164 ? -0.071  38.783 48.214 1.00 29.46 ? 194  ASP A N    1 
ATOM   1279 C  CA   . ASP A 1 164 ? 0.877   37.714 48.509 1.00 33.59 ? 194  ASP A CA   1 
ATOM   1280 C  C    . ASP A 1 164 ? 1.469   37.148 47.222 1.00 36.73 ? 194  ASP A C    1 
ATOM   1281 O  O    . ASP A 1 164 ? 0.821   37.171 46.171 1.00 39.61 ? 194  ASP A O    1 
ATOM   1282 C  CB   . ASP A 1 164 ? 0.137   36.601 49.251 1.00 37.57 ? 194  ASP A CB   1 
ATOM   1283 C  CG   . ASP A 1 164 ? 0.963   35.975 50.338 1.00 43.49 ? 194  ASP A CG   1 
ATOM   1284 O  OD1  . ASP A 1 164 ? 1.084   36.584 51.423 1.00 46.57 ? 194  ASP A OD1  1 
ATOM   1285 O  OD2  . ASP A 1 164 ? 1.489   34.869 50.109 1.00 47.97 ? 194  ASP A OD2  1 
ATOM   1286 N  N    . PRO A 1 165 ? 2.704   36.616 47.286 1.00 38.00 ? 195  PRO A N    1 
ATOM   1287 C  CA   . PRO A 1 165 ? 3.347   36.042 46.095 1.00 38.67 ? 195  PRO A CA   1 
ATOM   1288 C  C    . PRO A 1 165 ? 2.544   34.888 45.483 1.00 37.72 ? 195  PRO A C    1 
ATOM   1289 O  O    . PRO A 1 165 ? 2.648   34.610 44.286 1.00 38.25 ? 195  PRO A O    1 
ATOM   1290 C  CB   . PRO A 1 165 ? 4.706   35.573 46.632 1.00 39.03 ? 195  PRO A CB   1 
ATOM   1291 C  CG   . PRO A 1 165 ? 4.464   35.384 48.104 1.00 40.05 ? 195  PRO A CG   1 
ATOM   1292 C  CD   . PRO A 1 165 ? 3.622   36.581 48.431 1.00 38.05 ? 195  PRO A CD   1 
ATOM   1293 N  N    . LEU A 1 166 ? 1.750   34.226 46.320 1.00 37.12 ? 196  LEU A N    1 
ATOM   1294 C  CA   . LEU A 1 166 ? 0.903   33.116 45.903 1.00 36.84 ? 196  LEU A CA   1 
ATOM   1295 C  C    . LEU A 1 166 ? 0.005   33.522 44.733 1.00 37.34 ? 196  LEU A C    1 
ATOM   1296 O  O    . LEU A 1 166 ? -0.132  32.774 43.758 1.00 37.15 ? 196  LEU A O    1 
ATOM   1297 C  CB   . LEU A 1 166 ? 0.034   32.659 47.087 1.00 38.42 ? 196  LEU A CB   1 
ATOM   1298 C  CG   . LEU A 1 166 ? -1.278  31.887 46.858 1.00 40.77 ? 196  LEU A CG   1 
ATOM   1299 C  CD1  . LEU A 1 166 ? -1.018  30.467 46.355 1.00 44.43 ? 196  LEU A CD1  1 
ATOM   1300 C  CD2  . LEU A 1 166 ? -2.069  31.844 48.154 1.00 39.43 ? 196  LEU A CD2  1 
ATOM   1301 N  N    . VAL A 1 167 ? -0.559  34.727 44.816 1.00 33.34 ? 197  VAL A N    1 
ATOM   1302 C  CA   . VAL A 1 167 ? -1.474  35.230 43.794 1.00 29.42 ? 197  VAL A CA   1 
ATOM   1303 C  C    . VAL A 1 167 ? -0.894  35.154 42.384 1.00 29.71 ? 197  VAL A C    1 
ATOM   1304 O  O    . VAL A 1 167 ? -1.572  34.718 41.447 1.00 29.99 ? 197  VAL A O    1 
ATOM   1305 C  CB   . VAL A 1 167 ? -1.956  36.662 44.135 1.00 24.75 ? 197  VAL A CB   1 
ATOM   1306 C  CG1  . VAL A 1 167 ? -2.856  37.208 43.049 1.00 30.06 ? 197  VAL A CG1  1 
ATOM   1307 C  CG2  . VAL A 1 167 ? -2.723  36.646 45.435 1.00 26.39 ? 197  VAL A CG2  1 
ATOM   1308 N  N    . GLY A 1 168 ? 0.367   35.542 42.244 1.00 32.12 ? 198  GLY A N    1 
ATOM   1309 C  CA   . GLY A 1 168 ? 1.012   35.502 40.945 1.00 32.81 ? 198  GLY A CA   1 
ATOM   1310 C  C    . GLY A 1 168 ? 1.424   34.098 40.556 1.00 34.62 ? 198  GLY A C    1 
ATOM   1311 O  O    . GLY A 1 168 ? 1.556   33.789 39.376 1.00 35.52 ? 198  GLY A O    1 
ATOM   1312 N  N    . GLU A 1 169 ? 1.599   33.236 41.549 1.00 35.96 ? 199  GLU A N    1 
ATOM   1313 C  CA   . GLU A 1 169 ? 2.020   31.861 41.316 1.00 36.08 ? 199  GLU A CA   1 
ATOM   1314 C  C    . GLU A 1 169 ? 0.949   30.933 40.770 1.00 34.03 ? 199  GLU A C    1 
ATOM   1315 O  O    . GLU A 1 169 ? 1.235   30.080 39.919 1.00 34.03 ? 199  GLU A O    1 
ATOM   1316 C  CB   . GLU A 1 169 ? 2.599   31.268 42.601 1.00 37.42 ? 199  GLU A CB   1 
ATOM   1317 C  CG   . GLU A 1 169 ? 3.970   31.816 42.960 1.00 44.26 ? 199  GLU A CG   1 
ATOM   1318 C  CD   . GLU A 1 169 ? 4.443   31.392 44.340 1.00 47.05 ? 199  GLU A CD   1 
ATOM   1319 O  OE1  . GLU A 1 169 ? 3.934   30.385 44.883 1.00 51.89 ? 199  GLU A OE1  1 
ATOM   1320 O  OE2  . GLU A 1 169 ? 5.330   32.077 44.885 1.00 47.02 ? 199  GLU A OE2  1 
ATOM   1321 N  N    . ASP A 1 170 ? -0.275  31.067 41.271 1.00 30.45 ? 200  ASP A N    1 
ATOM   1322 C  CA   . ASP A 1 170 ? -1.355  30.197 40.822 1.00 27.07 ? 200  ASP A CA   1 
ATOM   1323 C  C    . ASP A 1 170 ? -1.926  30.654 39.484 1.00 25.80 ? 200  ASP A C    1 
ATOM   1324 O  O    . ASP A 1 170 ? -3.002  31.248 39.428 1.00 26.28 ? 200  ASP A O    1 
ATOM   1325 C  CB   . ASP A 1 170 ? -2.453  30.110 41.887 1.00 23.69 ? 200  ASP A CB   1 
ATOM   1326 C  CG   . ASP A 1 170 ? -3.382  28.922 41.680 1.00 24.26 ? 200  ASP A CG   1 
ATOM   1327 O  OD1  . ASP A 1 170 ? -3.368  28.322 40.591 1.00 29.50 ? 200  ASP A OD1  1 
ATOM   1328 O  OD2  . ASP A 1 170 ? -4.136  28.578 42.611 1.00 26.30 ? 200  ASP A OD2  1 
ATOM   1329 N  N    . THR A 1 171 ? -1.211  30.344 38.406 1.00 26.92 ? 201  THR A N    1 
ATOM   1330 C  CA   . THR A 1 171 ? -1.630  30.710 37.050 1.00 26.03 ? 201  THR A CA   1 
ATOM   1331 C  C    . THR A 1 171 ? -2.942  30.028 36.674 1.00 25.58 ? 201  THR A C    1 
ATOM   1332 O  O    . THR A 1 171 ? -3.749  30.585 35.936 1.00 23.61 ? 201  THR A O    1 
ATOM   1333 C  CB   . THR A 1 171 ? -0.547  30.339 36.013 1.00 27.07 ? 201  THR A CB   1 
ATOM   1334 O  OG1  . THR A 1 171 ? -0.070  29.013 36.280 1.00 30.29 ? 201  THR A OG1  1 
ATOM   1335 C  CG2  . THR A 1 171 ? 0.617   31.318 36.080 1.00 25.65 ? 201  THR A CG2  1 
ATOM   1336 N  N    . GLU A 1 172 ? -3.153  28.823 37.196 1.00 26.99 ? 202  GLU A N    1 
ATOM   1337 C  CA   . GLU A 1 172 ? -4.374  28.071 36.938 1.00 27.93 ? 202  GLU A CA   1 
ATOM   1338 C  C    . GLU A 1 172 ? -5.594  28.882 37.399 1.00 26.28 ? 202  GLU A C    1 
ATOM   1339 O  O    . GLU A 1 172 ? -6.582  29.019 36.668 1.00 22.60 ? 202  GLU A O    1 
ATOM   1340 C  CB   . GLU A 1 172 ? -4.320  26.727 37.671 1.00 32.22 ? 202  GLU A CB   1 
ATOM   1341 C  CG   . GLU A 1 172 ? -5.488  25.786 37.399 1.00 42.71 ? 202  GLU A CG   1 
ATOM   1342 C  CD   . GLU A 1 172 ? -5.464  25.201 35.996 1.00 52.16 ? 202  GLU A CD   1 
ATOM   1343 O  OE1  . GLU A 1 172 ? -4.504  24.470 35.660 1.00 56.53 ? 202  GLU A OE1  1 
ATOM   1344 O  OE2  . GLU A 1 172 ? -6.411  25.464 35.229 1.00 55.29 ? 202  GLU A OE2  1 
ATOM   1345 N  N    . ARG A 1 173 ? -5.504  29.434 38.606 1.00 24.68 ? 203  ARG A N    1 
ATOM   1346 C  CA   . ARG A 1 173 ? -6.583  30.234 39.186 1.00 24.07 ? 203  ARG A CA   1 
ATOM   1347 C  C    . ARG A 1 173 ? -6.789  31.542 38.426 1.00 22.06 ? 203  ARG A C    1 
ATOM   1348 O  O    . ARG A 1 173 ? -7.923  31.913 38.089 1.00 18.58 ? 203  ARG A O    1 
ATOM   1349 C  CB   . ARG A 1 173 ? -6.264  30.530 40.647 1.00 27.57 ? 203  ARG A CB   1 
ATOM   1350 C  CG   . ARG A 1 173 ? -7.301  30.037 41.632 1.00 36.27 ? 203  ARG A CG   1 
ATOM   1351 C  CD   . ARG A 1 173 ? -7.790  28.644 41.305 1.00 37.85 ? 203  ARG A CD   1 
ATOM   1352 N  NE   . ARG A 1 173 ? -6.703  27.719 41.009 1.00 43.71 ? 203  ARG A NE   1 
ATOM   1353 C  CZ   . ARG A 1 173 ? -6.440  26.623 41.710 1.00 46.54 ? 203  ARG A CZ   1 
ATOM   1354 N  NH1  . ARG A 1 173 ? -7.188  26.309 42.763 1.00 49.07 ? 203  ARG A NH1  1 
ATOM   1355 N  NH2  . ARG A 1 173 ? -5.438  25.834 41.346 1.00 48.11 ? 203  ARG A NH2  1 
ATOM   1356 N  N    . ALA A 1 174 ? -5.688  32.241 38.166 1.00 19.74 ? 204  ALA A N    1 
ATOM   1357 C  CA   . ALA A 1 174 ? -5.729  33.510 37.438 1.00 19.99 ? 204  ALA A CA   1 
ATOM   1358 C  C    . ALA A 1 174 ? -6.280  33.300 36.029 1.00 21.39 ? 204  ALA A C    1 
ATOM   1359 O  O    . ALA A 1 174 ? -7.045  34.120 35.521 1.00 27.29 ? 204  ALA A O    1 
ATOM   1360 C  CB   . ALA A 1 174 ? -4.335  34.125 37.378 1.00 13.18 ? 204  ALA A CB   1 
ATOM   1361 N  N    . ASN A 1 175 ? -5.929  32.169 35.422 1.00 22.49 ? 205  ASN A N    1 
ATOM   1362 C  CA   . ASN A 1 175 ? -6.384  31.842 34.078 1.00 20.50 ? 205  ASN A CA   1 
ATOM   1363 C  C    . ASN A 1 175 ? -7.894  31.642 34.053 1.00 21.15 ? 205  ASN A C    1 
ATOM   1364 O  O    . ASN A 1 175 ? -8.582  32.183 33.188 1.00 19.00 ? 205  ASN A O    1 
ATOM   1365 C  CB   . ASN A 1 175 ? -5.674  30.585 33.581 1.00 22.30 ? 205  ASN A CB   1 
ATOM   1366 C  CG   . ASN A 1 175 ? -6.081  30.199 32.175 1.00 23.17 ? 205  ASN A CG   1 
ATOM   1367 O  OD1  . ASN A 1 175 ? -5.754  30.887 31.205 1.00 17.74 ? 205  ASN A OD1  1 
ATOM   1368 N  ND2  . ASN A 1 175 ? -6.768  29.073 32.055 1.00 21.69 ? 205  ASN A ND2  1 
ATOM   1369 N  N    . SER A 1 176 ? -8.403  30.881 35.021 1.00 21.47 ? 206  SER A N    1 
ATOM   1370 C  CA   . SER A 1 176 ? -9.835  30.602 35.132 1.00 21.44 ? 206  SER A CA   1 
ATOM   1371 C  C    . SER A 1 176 ? -10.645 31.891 35.235 1.00 23.41 ? 206  SER A C    1 
ATOM   1372 O  O    . SER A 1 176 ? -11.742 31.996 34.672 1.00 22.03 ? 206  SER A O    1 
ATOM   1373 C  CB   . SER A 1 176 ? -10.104 29.714 36.348 1.00 22.71 ? 206  SER A CB   1 
ATOM   1374 O  OG   . SER A 1 176 ? -9.480  28.444 36.207 1.00 22.58 ? 206  SER A OG   1 
ATOM   1375 N  N    . MET A 1 177 ? -10.108 32.860 35.973 1.00 21.92 ? 207  MET A N    1 
ATOM   1376 C  CA   . MET A 1 177 ? -10.758 34.156 36.124 1.00 21.97 ? 207  MET A CA   1 
ATOM   1377 C  C    . MET A 1 177 ? -10.985 34.727 34.721 1.00 21.22 ? 207  MET A C    1 
ATOM   1378 O  O    . MET A 1 177 ? -12.097 35.136 34.375 1.00 24.74 ? 207  MET A O    1 
ATOM   1379 C  CB   . MET A 1 177 ? -9.859  35.110 36.924 1.00 19.40 ? 207  MET A CB   1 
ATOM   1380 C  CG   . MET A 1 177 ? -9.790  34.855 38.438 1.00 22.33 ? 207  MET A CG   1 
ATOM   1381 S  SD   . MET A 1 177 ? -11.225 35.466 39.385 1.00 17.40 ? 207  MET A SD   1 
ATOM   1382 C  CE   . MET A 1 177 ? -11.015 37.215 39.211 1.00 11.68 ? 207  MET A CE   1 
ATOM   1383 N  N    . GLY A 1 178 ? -9.929  34.708 33.908 1.00 20.80 ? 208  GLY A N    1 
ATOM   1384 C  CA   . GLY A 1 178 ? -9.996  35.229 32.548 1.00 18.60 ? 208  GLY A CA   1 
ATOM   1385 C  C    . GLY A 1 178 ? -10.930 34.470 31.629 1.00 16.15 ? 208  GLY A C    1 
ATOM   1386 O  O    . GLY A 1 178 ? -11.673 35.076 30.857 1.00 17.00 ? 208  GLY A O    1 
ATOM   1387 N  N    . LEU A 1 179 ? -10.898 33.144 31.712 1.00 16.91 ? 209  LEU A N    1 
ATOM   1388 C  CA   . LEU A 1 179 ? -11.756 32.299 30.884 1.00 20.25 ? 209  LEU A CA   1 
ATOM   1389 C  C    . LEU A 1 179 ? -13.214 32.563 31.194 1.00 18.33 ? 209  LEU A C    1 
ATOM   1390 O  O    . LEU A 1 179 ? -14.054 32.555 30.295 1.00 17.18 ? 209  LEU A O    1 
ATOM   1391 C  CB   . LEU A 1 179 ? -11.476 30.805 31.119 1.00 21.87 ? 209  LEU A CB   1 
ATOM   1392 C  CG   . LEU A 1 179 ? -10.065 30.242 30.956 1.00 25.25 ? 209  LEU A CG   1 
ATOM   1393 C  CD1  . LEU A 1 179 ? -10.143 28.734 30.858 1.00 23.00 ? 209  LEU A CD1  1 
ATOM   1394 C  CD2  . LEU A 1 179 ? -9.406  30.813 29.723 1.00 21.89 ? 209  LEU A CD2  1 
ATOM   1395 N  N    . PHE A 1 180 ? -13.520 32.789 32.469 1.00 19.23 ? 210  PHE A N    1 
ATOM   1396 C  CA   . PHE A 1 180 ? -14.902 33.031 32.844 1.00 18.47 ? 210  PHE A CA   1 
ATOM   1397 C  C    . PHE A 1 180 ? -15.430 34.287 32.174 1.00 19.67 ? 210  PHE A C    1 
ATOM   1398 O  O    . PHE A 1 180 ? -16.470 34.255 31.513 1.00 20.64 ? 210  PHE A O    1 
ATOM   1399 C  CB   . PHE A 1 180 ? -15.080 33.107 34.364 1.00 21.31 ? 210  PHE A CB   1 
ATOM   1400 C  CG   . PHE A 1 180 ? -16.523 33.119 34.788 1.00 19.74 ? 210  PHE A CG   1 
ATOM   1401 C  CD1  . PHE A 1 180 ? -17.344 32.028 34.519 1.00 20.71 ? 210  PHE A CD1  1 
ATOM   1402 C  CD2  . PHE A 1 180 ? -17.083 34.253 35.374 1.00 20.88 ? 210  PHE A CD2  1 
ATOM   1403 C  CE1  . PHE A 1 180 ? -18.715 32.069 34.816 1.00 24.50 ? 210  PHE A CE1  1 
ATOM   1404 C  CE2  . PHE A 1 180 ? -18.446 34.307 35.676 1.00 21.05 ? 210  PHE A CE2  1 
ATOM   1405 C  CZ   . PHE A 1 180 ? -19.265 33.214 35.396 1.00 24.21 ? 210  PHE A CZ   1 
ATOM   1406 N  N    . LEU A 1 181 ? -14.688 35.378 32.296 1.00 19.71 ? 211  LEU A N    1 
ATOM   1407 C  CA   . LEU A 1 181 ? -15.104 36.631 31.678 1.00 23.06 ? 211  LEU A CA   1 
ATOM   1408 C  C    . LEU A 1 181 ? -15.161 36.545 30.149 1.00 23.69 ? 211  LEU A C    1 
ATOM   1409 O  O    . LEU A 1 181 ? -16.132 36.989 29.529 1.00 22.34 ? 211  LEU A O    1 
ATOM   1410 C  CB   . LEU A 1 181 ? -14.155 37.765 32.065 1.00 22.82 ? 211  LEU A CB   1 
ATOM   1411 C  CG   . LEU A 1 181 ? -13.973 38.120 33.539 1.00 19.96 ? 211  LEU A CG   1 
ATOM   1412 C  CD1  . LEU A 1 181 ? -13.040 39.313 33.633 1.00 20.59 ? 211  LEU A CD1  1 
ATOM   1413 C  CD2  . LEU A 1 181 ? -15.308 38.437 34.192 1.00 14.94 ? 211  LEU A CD2  1 
ATOM   1414 N  N    . GLN A 1 182 ? -14.121 35.983 29.544 1.00 21.93 ? 212  GLN A N    1 
ATOM   1415 C  CA   . GLN A 1 182 ? -14.053 35.884 28.093 1.00 21.49 ? 212  GLN A CA   1 
ATOM   1416 C  C    . GLN A 1 182 ? -15.184 35.083 27.479 1.00 20.37 ? 212  GLN A C    1 
ATOM   1417 O  O    . GLN A 1 182 ? -15.783 35.502 26.489 1.00 20.43 ? 212  GLN A O    1 
ATOM   1418 C  CB   . GLN A 1 182 ? -12.716 35.298 27.650 1.00 26.78 ? 212  GLN A CB   1 
ATOM   1419 C  CG   . GLN A 1 182 ? -12.426 35.556 26.181 1.00 25.72 ? 212  GLN A CG   1 
ATOM   1420 C  CD   . GLN A 1 182 ? -12.501 37.029 25.860 1.00 24.70 ? 212  GLN A CD   1 
ATOM   1421 O  OE1  . GLN A 1 182 ? -11.730 37.818 26.387 1.00 30.58 ? 212  GLN A OE1  1 
ATOM   1422 N  NE2  . GLN A 1 182 ? -13.468 37.415 25.044 1.00 27.01 ? 212  GLN A NE2  1 
ATOM   1423 N  N    . LYS A 1 183 ? -15.463 33.918 28.046 1.00 18.69 ? 213  LYS A N    1 
ATOM   1424 C  CA   . LYS A 1 183 ? -16.533 33.097 27.524 1.00 18.25 ? 213  LYS A CA   1 
ATOM   1425 C  C    . LYS A 1 183 ? -17.879 33.806 27.638 1.00 18.26 ? 213  LYS A C    1 
ATOM   1426 O  O    . LYS A 1 183 ? -18.605 33.888 26.654 1.00 21.16 ? 213  LYS A O    1 
ATOM   1427 C  CB   . LYS A 1 183 ? -16.560 31.728 28.203 1.00 19.85 ? 213  LYS A CB   1 
ATOM   1428 C  CG   . LYS A 1 183 ? -15.310 30.891 27.934 1.00 21.40 ? 213  LYS A CG   1 
ATOM   1429 C  CD   . LYS A 1 183 ? -15.452 29.491 28.520 1.00 22.65 ? 213  LYS A CD   1 
ATOM   1430 C  CE   . LYS A 1 183 ? -14.139 28.723 28.472 1.00 22.56 ? 213  LYS A CE   1 
ATOM   1431 N  NZ   . LYS A 1 183 ? -14.327 27.320 28.956 1.00 14.40 ? 213  LYS A NZ   1 
ATOM   1432 N  N    . THR A 1 184 ? -18.185 34.400 28.787 1.00 18.84 ? 214  THR A N    1 
ATOM   1433 C  CA   . THR A 1 184 ? -19.470 35.080 28.919 1.00 22.47 ? 214  THR A CA   1 
ATOM   1434 C  C    . THR A 1 184 ? -19.610 36.178 27.856 1.00 21.96 ? 214  THR A C    1 
ATOM   1435 O  O    . THR A 1 184 ? -20.689 36.356 27.290 1.00 22.13 ? 214  THR A O    1 
ATOM   1436 C  CB   . THR A 1 184 ? -19.721 35.675 30.346 1.00 26.51 ? 214  THR A CB   1 
ATOM   1437 O  OG1  . THR A 1 184 ? -19.054 36.932 30.481 1.00 38.52 ? 214  THR A OG1  1 
ATOM   1438 C  CG2  . THR A 1 184 ? -19.231 34.735 31.431 1.00 21.62 ? 214  THR A CG2  1 
ATOM   1439 N  N    . ASN A 1 185 ? -18.520 36.890 27.569 1.00 19.57 ? 215  ASN A N    1 
ATOM   1440 C  CA   . ASN A 1 185 ? -18.543 37.943 26.546 1.00 23.13 ? 215  ASN A CA   1 
ATOM   1441 C  C    . ASN A 1 185 ? -18.760 37.371 25.133 1.00 22.36 ? 215  ASN A C    1 
ATOM   1442 O  O    . ASN A 1 185 ? -19.555 37.897 24.355 1.00 19.03 ? 215  ASN A O    1 
ATOM   1443 C  CB   . ASN A 1 185 ? -17.251 38.757 26.576 1.00 27.46 ? 215  ASN A CB   1 
ATOM   1444 C  CG   . ASN A 1 185 ? -17.123 39.598 27.826 1.00 32.39 ? 215  ASN A CG   1 
ATOM   1445 O  OD1  . ASN A 1 185 ? -18.110 40.111 28.357 1.00 32.20 ? 215  ASN A OD1  1 
ATOM   1446 N  ND2  . ASN A 1 185 ? -15.906 39.708 28.331 1.00 38.16 ? 215  ASN A ND2  1 
ATOM   1447 N  N    . ILE A 1 186 ? -18.063 36.286 24.811 1.00 19.83 ? 216  ILE A N    1 
ATOM   1448 C  CA   . ILE A 1 186 ? -18.208 35.643 23.510 1.00 20.54 ? 216  ILE A CA   1 
ATOM   1449 C  C    . ILE A 1 186 ? -19.642 35.122 23.328 1.00 19.22 ? 216  ILE A C    1 
ATOM   1450 O  O    . ILE A 1 186 ? -20.223 35.204 22.245 1.00 17.35 ? 216  ILE A O    1 
ATOM   1451 C  CB   . ILE A 1 186 ? -17.179 34.507 23.349 1.00 18.93 ? 216  ILE A CB   1 
ATOM   1452 C  CG1  . ILE A 1 186 ? -15.806 35.120 23.036 1.00 23.65 ? 216  ILE A CG1  1 
ATOM   1453 C  CG2  . ILE A 1 186 ? -17.589 33.553 22.242 1.00 21.62 ? 216  ILE A CG2  1 
ATOM   1454 C  CD1  . ILE A 1 186 ? -14.650 34.136 23.069 1.00 21.87 ? 216  ILE A CD1  1 
ATOM   1455 N  N    . ILE A 1 187 ? -20.215 34.605 24.404 1.00 17.84 ? 217  ILE A N    1 
ATOM   1456 C  CA   . ILE A 1 187 ? -21.574 34.105 24.373 1.00 16.67 ? 217  ILE A CA   1 
ATOM   1457 C  C    . ILE A 1 187 ? -22.536 35.280 24.168 1.00 19.41 ? 217  ILE A C    1 
ATOM   1458 O  O    . ILE A 1 187 ? -23.316 35.291 23.213 1.00 20.38 ? 217  ILE A O    1 
ATOM   1459 C  CB   . ILE A 1 187 ? -21.891 33.354 25.681 1.00 18.82 ? 217  ILE A CB   1 
ATOM   1460 C  CG1  . ILE A 1 187 ? -21.031 32.087 25.760 1.00 14.49 ? 217  ILE A CG1  1 
ATOM   1461 C  CG2  . ILE A 1 187 ? -23.374 33.027 25.771 1.00 21.47 ? 217  ILE A CG2  1 
ATOM   1462 C  CD1  . ILE A 1 187 ? -21.123 31.365 27.079 1.00 14.54 ? 217  ILE A CD1  1 
ATOM   1463 N  N    . ARG A 1 188 ? -22.429 36.290 25.029 1.00 17.69 ? 218  ARG A N    1 
ATOM   1464 C  CA   . ARG A 1 188 ? -23.286 37.478 24.976 1.00 15.07 ? 218  ARG A CA   1 
ATOM   1465 C  C    . ARG A 1 188 ? -23.178 38.245 23.669 1.00 14.30 ? 218  ARG A C    1 
ATOM   1466 O  O    . ARG A 1 188 ? -24.188 38.685 23.118 1.00 14.61 ? 218  ARG A O    1 
ATOM   1467 C  CB   . ARG A 1 188 ? -22.947 38.421 26.136 1.00 15.92 ? 218  ARG A CB   1 
ATOM   1468 C  CG   . ARG A 1 188 ? -23.771 39.707 26.167 1.00 22.35 ? 218  ARG A CG   1 
ATOM   1469 C  CD   . ARG A 1 188 ? -22.894 40.941 25.980 1.00 26.75 ? 218  ARG A CD   1 
ATOM   1470 N  NE   . ARG A 1 188 ? -22.127 41.262 27.176 1.00 27.37 ? 218  ARG A NE   1 
ATOM   1471 C  CZ   . ARG A 1 188 ? -20.895 41.761 27.174 1.00 30.90 ? 218  ARG A CZ   1 
ATOM   1472 N  NH1  . ARG A 1 188 ? -20.269 42.001 26.035 1.00 28.60 ? 218  ARG A NH1  1 
ATOM   1473 N  NH2  . ARG A 1 188 ? -20.303 42.057 28.323 1.00 34.21 ? 218  ARG A NH2  1 
ATOM   1474 N  N    . ASP A 1 189 ? -21.953 38.392 23.173 1.00 12.08 ? 219  ASP A N    1 
ATOM   1475 C  CA   . ASP A 1 189 ? -21.693 39.135 21.940 1.00 16.50 ? 219  ASP A CA   1 
ATOM   1476 C  C    . ASP A 1 189 ? -21.831 38.395 20.602 1.00 18.27 ? 219  ASP A C    1 
ATOM   1477 O  O    . ASP A 1 189 ? -21.357 38.891 19.581 1.00 20.08 ? 219  ASP A O    1 
ATOM   1478 C  CB   . ASP A 1 189 ? -20.307 39.780 22.009 1.00 14.15 ? 219  ASP A CB   1 
ATOM   1479 C  CG   . ASP A 1 189 ? -20.194 40.804 23.118 1.00 15.32 ? 219  ASP A CG   1 
ATOM   1480 O  OD1  . ASP A 1 189 ? -21.201 41.457 23.439 1.00 20.57 ? 219  ASP A OD1  1 
ATOM   1481 O  OD2  . ASP A 1 189 ? -19.090 40.964 23.667 1.00 16.81 ? 219  ASP A OD2  1 
ATOM   1482 N  N    . TYR A 1 190 ? -22.488 37.239 20.590 1.00 19.63 ? 220  TYR A N    1 
ATOM   1483 C  CA   . TYR A 1 190 ? -22.660 36.473 19.356 1.00 21.20 ? 220  TYR A CA   1 
ATOM   1484 C  C    . TYR A 1 190 ? -23.108 37.311 18.143 1.00 23.45 ? 220  TYR A C    1 
ATOM   1485 O  O    . TYR A 1 190 ? -22.415 37.333 17.125 1.00 24.95 ? 220  TYR A O    1 
ATOM   1486 C  CB   . TYR A 1 190 ? -23.640 35.311 19.564 1.00 20.68 ? 220  TYR A CB   1 
ATOM   1487 C  CG   . TYR A 1 190 ? -24.111 34.685 18.259 1.00 25.40 ? 220  TYR A CG   1 
ATOM   1488 C  CD1  . TYR A 1 190 ? -23.351 33.710 17.607 1.00 21.79 ? 220  TYR A CD1  1 
ATOM   1489 C  CD2  . TYR A 1 190 ? -25.278 35.131 17.639 1.00 22.87 ? 220  TYR A CD2  1 
ATOM   1490 C  CE1  . TYR A 1 190 ? -23.743 33.211 16.371 1.00 22.96 ? 220  TYR A CE1  1 
ATOM   1491 C  CE2  . TYR A 1 190 ? -25.671 34.644 16.414 1.00 28.00 ? 220  TYR A CE2  1 
ATOM   1492 C  CZ   . TYR A 1 190 ? -24.904 33.686 15.780 1.00 24.34 ? 220  TYR A CZ   1 
ATOM   1493 O  OH   . TYR A 1 190 ? -25.303 33.238 14.543 1.00 26.88 ? 220  TYR A OH   1 
ATOM   1494 N  N    . LEU A 1 191 ? -24.263 37.974 18.243 1.00 25.03 ? 221  LEU A N    1 
ATOM   1495 C  CA   . LEU A 1 191 ? -24.804 38.781 17.137 1.00 24.35 ? 221  LEU A CA   1 
ATOM   1496 C  C    . LEU A 1 191 ? -23.867 39.894 16.713 1.00 24.80 ? 221  LEU A C    1 
ATOM   1497 O  O    . LEU A 1 191 ? -23.615 40.077 15.526 1.00 24.90 ? 221  LEU A O    1 
ATOM   1498 C  CB   . LEU A 1 191 ? -26.161 39.395 17.498 1.00 24.78 ? 221  LEU A CB   1 
ATOM   1499 C  CG   . LEU A 1 191 ? -27.335 39.248 16.514 1.00 25.60 ? 221  LEU A CG   1 
ATOM   1500 C  CD1  . LEU A 1 191 ? -28.145 40.525 16.502 1.00 23.97 ? 221  LEU A CD1  1 
ATOM   1501 C  CD2  . LEU A 1 191 ? -26.866 38.926 15.111 1.00 28.71 ? 221  LEU A CD2  1 
ATOM   1502 N  N    . GLU A 1 192 ? -23.367 40.642 17.688 1.00 25.15 ? 222  GLU A N    1 
ATOM   1503 C  CA   . GLU A 1 192 ? -22.452 41.748 17.432 1.00 25.00 ? 222  GLU A CA   1 
ATOM   1504 C  C    . GLU A 1 192 ? -21.246 41.265 16.627 1.00 23.98 ? 222  GLU A C    1 
ATOM   1505 O  O    . GLU A 1 192 ? -20.832 41.913 15.660 1.00 21.52 ? 222  GLU A O    1 
ATOM   1506 C  CB   . GLU A 1 192 ? -22.017 42.372 18.762 1.00 26.75 ? 222  GLU A CB   1 
ATOM   1507 C  CG   . GLU A 1 192 ? -20.982 43.473 18.637 1.00 32.84 ? 222  GLU A CG   1 
ATOM   1508 C  CD   . GLU A 1 192 ? -20.955 44.400 19.842 1.00 36.59 ? 222  GLU A CD   1 
ATOM   1509 O  OE1  . GLU A 1 192 ? -21.116 43.925 20.992 1.00 35.97 ? 222  GLU A OE1  1 
ATOM   1510 O  OE2  . GLU A 1 192 ? -20.776 45.617 19.629 1.00 39.28 ? 222  GLU A OE2  1 
ATOM   1511 N  N    . ASP A 1 193 ? -20.709 40.107 17.004 1.00 24.09 ? 223  ASP A N    1 
ATOM   1512 C  CA   . ASP A 1 193 ? -19.565 39.526 16.306 1.00 23.89 ? 223  ASP A CA   1 
ATOM   1513 C  C    . ASP A 1 193 ? -19.941 39.111 14.886 1.00 25.97 ? 223  ASP A C    1 
ATOM   1514 O  O    . ASP A 1 193 ? -19.210 39.420 13.946 1.00 25.86 ? 223  ASP A O    1 
ATOM   1515 C  CB   . ASP A 1 193 ? -18.994 38.346 17.088 1.00 20.68 ? 223  ASP A CB   1 
ATOM   1516 C  CG   . ASP A 1 193 ? -18.169 38.786 18.281 1.00 21.53 ? 223  ASP A CG   1 
ATOM   1517 O  OD1  . ASP A 1 193 ? -17.656 39.926 18.258 1.00 18.64 ? 223  ASP A OD1  1 
ATOM   1518 O  OD2  . ASP A 1 193 ? -18.018 37.988 19.233 1.00 22.31 ? 223  ASP A OD2  1 
ATOM   1519 N  N    . GLN A 1 194 ? -21.085 38.441 14.730 1.00 25.47 ? 224  GLN A N    1 
ATOM   1520 C  CA   . GLN A 1 194 ? -21.562 38.025 13.409 1.00 27.26 ? 224  GLN A CA   1 
ATOM   1521 C  C    . GLN A 1 194 ? -21.586 39.249 12.512 1.00 29.88 ? 224  GLN A C    1 
ATOM   1522 O  O    . GLN A 1 194 ? -20.978 39.274 11.439 1.00 32.79 ? 224  GLN A O    1 
ATOM   1523 C  CB   . GLN A 1 194 ? -22.984 37.461 13.488 1.00 25.77 ? 224  GLN A CB   1 
ATOM   1524 C  CG   . GLN A 1 194 ? -23.071 35.998 13.887 1.00 31.99 ? 224  GLN A CG   1 
ATOM   1525 C  CD   . GLN A 1 194 ? -22.347 35.070 12.920 1.00 29.72 ? 224  GLN A CD   1 
ATOM   1526 O  OE1  . GLN A 1 194 ? -22.476 35.192 11.704 1.00 39.15 ? 224  GLN A OE1  1 
ATOM   1527 N  NE2  . GLN A 1 194 ? -21.596 34.127 13.460 1.00 27.55 ? 224  GLN A NE2  1 
ATOM   1528 N  N    . GLN A 1 195 ? -22.233 40.293 13.010 1.00 30.68 ? 225  GLN A N    1 
ATOM   1529 C  CA   . GLN A 1 195 ? -22.361 41.547 12.288 1.00 30.79 ? 225  GLN A CA   1 
ATOM   1530 C  C    . GLN A 1 195 ? -21.009 42.201 12.043 1.00 30.06 ? 225  GLN A C    1 
ATOM   1531 O  O    . GLN A 1 195 ? -20.856 42.984 11.109 1.00 32.56 ? 225  GLN A O    1 
ATOM   1532 C  CB   . GLN A 1 195 ? -23.311 42.472 13.046 1.00 30.91 ? 225  GLN A CB   1 
ATOM   1533 C  CG   . GLN A 1 195 ? -24.696 41.852 13.185 1.00 35.47 ? 225  GLN A CG   1 
ATOM   1534 C  CD   . GLN A 1 195 ? -25.610 42.592 14.135 1.00 41.70 ? 225  GLN A CD   1 
ATOM   1535 O  OE1  . GLN A 1 195 ? -26.829 42.553 13.985 1.00 45.80 ? 225  GLN A OE1  1 
ATOM   1536 N  NE2  . GLN A 1 195 ? -25.037 43.231 15.146 1.00 43.07 ? 225  GLN A NE2  1 
ATOM   1537 N  N    . GLY A 1 196 ? -20.034 41.872 12.885 1.00 28.67 ? 226  GLY A N    1 
ATOM   1538 C  CA   . GLY A 1 196 ? -18.701 42.422 12.731 1.00 26.93 ? 226  GLY A CA   1 
ATOM   1539 C  C    . GLY A 1 196 ? -17.789 41.493 11.944 1.00 26.26 ? 226  GLY A C    1 
ATOM   1540 O  O    . GLY A 1 196 ? -16.613 41.794 11.731 1.00 25.94 ? 226  GLY A O    1 
ATOM   1541 N  N    . GLY A 1 197 ? -18.327 40.357 11.518 1.00 26.94 ? 227  GLY A N    1 
ATOM   1542 C  CA   . GLY A 1 197 ? -17.538 39.404 10.761 1.00 26.02 ? 227  GLY A CA   1 
ATOM   1543 C  C    . GLY A 1 197 ? -16.561 38.629 11.627 1.00 24.73 ? 227  GLY A C    1 
ATOM   1544 O  O    . GLY A 1 197 ? -15.461 38.294 11.185 1.00 25.95 ? 227  GLY A O    1 
ATOM   1545 N  N    . ARG A 1 198 ? -16.963 38.333 12.859 1.00 20.84 ? 228  ARG A N    1 
ATOM   1546 C  CA   . ARG A 1 198 ? -16.119 37.586 13.789 1.00 21.52 ? 228  ARG A CA   1 
ATOM   1547 C  C    . ARG A 1 198 ? -16.856 36.369 14.319 1.00 18.52 ? 228  ARG A C    1 
ATOM   1548 O  O    . ARG A 1 198 ? -18.061 36.425 14.581 1.00 21.85 ? 228  ARG A O    1 
ATOM   1549 C  CB   . ARG A 1 198 ? -15.695 38.463 14.975 1.00 25.34 ? 228  ARG A CB   1 
ATOM   1550 C  CG   . ARG A 1 198 ? -14.727 39.584 14.631 1.00 29.71 ? 228  ARG A CG   1 
ATOM   1551 C  CD   . ARG A 1 198 ? -14.345 40.373 15.877 1.00 30.44 ? 228  ARG A CD   1 
ATOM   1552 N  NE   . ARG A 1 198 ? -15.519 40.999 16.471 1.00 28.62 ? 228  ARG A NE   1 
ATOM   1553 C  CZ   . ARG A 1 198 ? -15.899 42.249 16.229 1.00 26.58 ? 228  ARG A CZ   1 
ATOM   1554 N  NH1  . ARG A 1 198 ? -15.188 43.020 15.418 1.00 24.93 ? 228  ARG A NH1  1 
ATOM   1555 N  NH2  . ARG A 1 198 ? -17.029 42.703 16.742 1.00 28.75 ? 228  ARG A NH2  1 
ATOM   1556 N  N    . GLU A 1 199 ? -16.136 35.266 14.465 1.00 15.50 ? 229  GLU A N    1 
ATOM   1557 C  CA   . GLU A 1 199 ? -16.713 34.037 14.983 1.00 18.54 ? 229  GLU A CA   1 
ATOM   1558 C  C    . GLU A 1 199 ? -15.750 33.475 16.016 1.00 21.16 ? 229  GLU A C    1 
ATOM   1559 O  O    . GLU A 1 199 ? -14.536 33.432 15.782 1.00 16.78 ? 229  GLU A O    1 
ATOM   1560 C  CB   . GLU A 1 199 ? -16.937 33.021 13.871 1.00 18.84 ? 229  GLU A CB   1 
ATOM   1561 C  CG   . GLU A 1 199 ? -17.897 33.497 12.802 1.00 24.44 ? 229  GLU A CG   1 
ATOM   1562 C  CD   . GLU A 1 199 ? -18.550 32.352 12.052 1.00 32.61 ? 229  GLU A CD   1 
ATOM   1563 O  OE1  . GLU A 1 199 ? -17.953 31.243 11.974 1.00 32.34 ? 229  GLU A OE1  1 
ATOM   1564 O  OE2  . GLU A 1 199 ? -19.680 32.565 11.556 1.00 31.44 ? 229  GLU A OE2  1 
ATOM   1565 N  N    . PHE A 1 200 ? -16.289 33.085 17.168 1.00 18.85 ? 230  PHE A N    1 
ATOM   1566 C  CA   . PHE A 1 200 ? -15.477 32.555 18.247 1.00 17.93 ? 230  PHE A CA   1 
ATOM   1567 C  C    . PHE A 1 200 ? -16.087 31.335 18.935 1.00 19.55 ? 230  PHE A C    1 
ATOM   1568 O  O    . PHE A 1 200 ? -15.435 30.709 19.776 1.00 20.82 ? 230  PHE A O    1 
ATOM   1569 C  CB   . PHE A 1 200 ? -15.226 33.651 19.277 1.00 18.11 ? 230  PHE A CB   1 
ATOM   1570 C  CG   . PHE A 1 200 ? -14.456 34.826 18.742 1.00 16.76 ? 230  PHE A CG   1 
ATOM   1571 C  CD1  . PHE A 1 200 ? -13.075 34.751 18.576 1.00 16.57 ? 230  PHE A CD1  1 
ATOM   1572 C  CD2  . PHE A 1 200 ? -15.100 36.025 18.461 1.00 18.63 ? 230  PHE A CD2  1 
ATOM   1573 C  CE1  . PHE A 1 200 ? -12.344 35.859 18.148 1.00 13.51 ? 230  PHE A CE1  1 
ATOM   1574 C  CE2  . PHE A 1 200 ? -14.381 37.140 18.032 1.00 9.78  ? 230  PHE A CE2  1 
ATOM   1575 C  CZ   . PHE A 1 200 ? -13.001 37.056 17.878 1.00 13.10 ? 230  PHE A CZ   1 
ATOM   1576 N  N    . TRP A 1 201 ? -17.337 31.006 18.607 1.00 18.69 ? 231  TRP A N    1 
ATOM   1577 C  CA   . TRP A 1 201 ? -17.980 29.849 19.226 1.00 17.06 ? 231  TRP A CA   1 
ATOM   1578 C  C    . TRP A 1 201 ? -17.319 28.575 18.711 1.00 18.08 ? 231  TRP A C    1 
ATOM   1579 O  O    . TRP A 1 201 ? -16.921 28.516 17.553 1.00 14.25 ? 231  TRP A O    1 
ATOM   1580 C  CB   . TRP A 1 201 ? -19.482 29.839 18.937 1.00 17.76 ? 231  TRP A CB   1 
ATOM   1581 C  CG   . TRP A 1 201 ? -20.272 30.839 19.752 1.00 17.51 ? 231  TRP A CG   1 
ATOM   1582 C  CD1  . TRP A 1 201 ? -19.814 32.008 20.285 1.00 14.69 ? 231  TRP A CD1  1 
ATOM   1583 C  CD2  . TRP A 1 201 ? -21.654 30.738 20.130 1.00 18.69 ? 231  TRP A CD2  1 
ATOM   1584 N  NE1  . TRP A 1 201 ? -20.818 32.644 20.972 1.00 16.09 ? 231  TRP A NE1  1 
ATOM   1585 C  CE2  . TRP A 1 201 ? -21.959 31.888 20.900 1.00 15.28 ? 231  TRP A CE2  1 
ATOM   1586 C  CE3  . TRP A 1 201 ? -22.663 29.789 19.902 1.00 17.68 ? 231  TRP A CE3  1 
ATOM   1587 C  CZ2  . TRP A 1 201 ? -23.231 32.117 21.446 1.00 16.10 ? 231  TRP A CZ2  1 
ATOM   1588 C  CZ3  . TRP A 1 201 ? -23.931 30.013 20.448 1.00 19.74 ? 231  TRP A CZ3  1 
ATOM   1589 C  CH2  . TRP A 1 201 ? -24.200 31.173 21.214 1.00 18.04 ? 231  TRP A CH2  1 
ATOM   1590 N  N    . PRO A 1 202 ? -17.164 27.554 19.582 1.00 20.87 ? 232  PRO A N    1 
ATOM   1591 C  CA   . PRO A 1 202 ? -16.546 26.260 19.259 1.00 20.74 ? 232  PRO A CA   1 
ATOM   1592 C  C    . PRO A 1 202 ? -17.333 25.476 18.216 1.00 22.84 ? 232  PRO A C    1 
ATOM   1593 O  O    . PRO A 1 202 ? -18.490 25.081 18.446 1.00 19.04 ? 232  PRO A O    1 
ATOM   1594 C  CB   . PRO A 1 202 ? -16.560 25.519 20.604 1.00 17.06 ? 232  PRO A CB   1 
ATOM   1595 C  CG   . PRO A 1 202 ? -16.625 26.583 21.603 1.00 21.22 ? 232  PRO A CG   1 
ATOM   1596 C  CD   . PRO A 1 202 ? -17.567 27.580 20.997 1.00 22.08 ? 232  PRO A CD   1 
ATOM   1597 N  N    . GLN A 1 203 ? -16.681 25.213 17.087 1.00 26.12 ? 233  GLN A N    1 
ATOM   1598 C  CA   . GLN A 1 203 ? -17.293 24.476 15.988 1.00 24.48 ? 233  GLN A CA   1 
ATOM   1599 C  C    . GLN A 1 203 ? -17.808 23.113 16.422 1.00 22.48 ? 233  GLN A C    1 
ATOM   1600 O  O    . GLN A 1 203 ? -18.951 22.777 16.146 1.00 21.87 ? 233  GLN A O    1 
ATOM   1601 C  CB   . GLN A 1 203 ? -16.304 24.338 14.836 1.00 26.60 ? 233  GLN A CB   1 
ATOM   1602 C  CG   . GLN A 1 203 ? -16.867 23.702 13.565 1.00 29.16 ? 233  GLN A CG   1 
ATOM   1603 C  CD   . GLN A 1 203 ? -15.859 23.738 12.428 1.00 29.32 ? 233  GLN A CD   1 
ATOM   1604 O  OE1  . GLN A 1 203 ? -14.685 23.407 12.615 1.00 30.93 ? 233  GLN A OE1  1 
ATOM   1605 N  NE2  . GLN A 1 203 ? -16.296 24.178 11.259 1.00 28.90 ? 233  GLN A NE2  1 
ATOM   1606 N  N    . GLU A 1 204 ? -16.996 22.353 17.153 1.00 23.25 ? 234  GLU A N    1 
ATOM   1607 C  CA   . GLU A 1 204 ? -17.422 21.029 17.613 1.00 23.07 ? 234  GLU A CA   1 
ATOM   1608 C  C    . GLU A 1 204 ? -18.743 21.076 18.386 1.00 21.54 ? 234  GLU A C    1 
ATOM   1609 O  O    . GLU A 1 204 ? -19.434 20.066 18.505 1.00 22.26 ? 234  GLU A O    1 
ATOM   1610 C  CB   . GLU A 1 204 ? -16.324 20.354 18.446 1.00 22.41 ? 234  GLU A CB   1 
ATOM   1611 C  CG   . GLU A 1 204 ? -15.147 19.858 17.602 1.00 28.12 ? 234  GLU A CG   1 
ATOM   1612 C  CD   . GLU A 1 204 ? -14.115 19.072 18.393 1.00 33.20 ? 234  GLU A CD   1 
ATOM   1613 O  OE1  . GLU A 1 204 ? -14.462 18.516 19.460 1.00 36.82 ? 234  GLU A OE1  1 
ATOM   1614 O  OE2  . GLU A 1 204 ? -12.946 19.014 17.948 1.00 31.65 ? 234  GLU A OE2  1 
ATOM   1615 N  N    . VAL A 1 205 ? -19.080 22.243 18.931 1.00 20.26 ? 235  VAL A N    1 
ATOM   1616 C  CA   . VAL A 1 205 ? -20.332 22.395 19.656 1.00 19.84 ? 235  VAL A CA   1 
ATOM   1617 C  C    . VAL A 1 205 ? -21.426 22.866 18.697 1.00 19.35 ? 235  VAL A C    1 
ATOM   1618 O  O    . VAL A 1 205 ? -22.454 22.199 18.560 1.00 17.85 ? 235  VAL A O    1 
ATOM   1619 C  CB   . VAL A 1 205 ? -20.219 23.392 20.857 1.00 19.79 ? 235  VAL A CB   1 
ATOM   1620 C  CG1  . VAL A 1 205 ? -21.559 23.504 21.564 1.00 17.66 ? 235  VAL A CG1  1 
ATOM   1621 C  CG2  . VAL A 1 205 ? -19.170 22.921 21.857 1.00 16.81 ? 235  VAL A CG2  1 
ATOM   1622 N  N    . TRP A 1 206 ? -21.189 23.969 17.982 1.00 21.77 ? 236  TRP A N    1 
ATOM   1623 C  CA   . TRP A 1 206 ? -22.216 24.479 17.073 1.00 24.79 ? 236  TRP A CA   1 
ATOM   1624 C  C    . TRP A 1 206 ? -22.544 23.615 15.850 1.00 24.34 ? 236  TRP A C    1 
ATOM   1625 O  O    . TRP A 1 206 ? -23.685 23.632 15.384 1.00 26.80 ? 236  TRP A O    1 
ATOM   1626 C  CB   . TRP A 1 206 ? -22.006 25.968 16.694 1.00 22.24 ? 236  TRP A CB   1 
ATOM   1627 C  CG   . TRP A 1 206 ? -20.812 26.331 15.824 1.00 20.78 ? 236  TRP A CG   1 
ATOM   1628 C  CD1  . TRP A 1 206 ? -19.712 27.039 16.211 1.00 21.05 ? 236  TRP A CD1  1 
ATOM   1629 C  CD2  . TRP A 1 206 ? -20.627 26.033 14.427 1.00 21.40 ? 236  TRP A CD2  1 
ATOM   1630 N  NE1  . TRP A 1 206 ? -18.849 27.197 15.149 1.00 22.09 ? 236  TRP A NE1  1 
ATOM   1631 C  CE2  . TRP A 1 206 ? -19.382 26.588 14.044 1.00 21.60 ? 236  TRP A CE2  1 
ATOM   1632 C  CE3  . TRP A 1 206 ? -21.383 25.349 13.464 1.00 18.99 ? 236  TRP A CE3  1 
ATOM   1633 C  CZ2  . TRP A 1 206 ? -18.878 26.475 12.738 1.00 17.14 ? 236  TRP A CZ2  1 
ATOM   1634 C  CZ3  . TRP A 1 206 ? -20.877 25.237 12.166 1.00 18.07 ? 236  TRP A CZ3  1 
ATOM   1635 C  CH2  . TRP A 1 206 ? -19.635 25.799 11.821 1.00 15.22 ? 236  TRP A CH2  1 
ATOM   1636 N  N    . SER A 1 207 ? -21.582 22.831 15.361 1.00 21.08 ? 237  SER A N    1 
ATOM   1637 C  CA   . SER A 1 207 ? -21.825 21.967 14.199 1.00 21.07 ? 237  SER A CA   1 
ATOM   1638 C  C    . SER A 1 207 ? -22.798 20.842 14.543 1.00 19.95 ? 237  SER A C    1 
ATOM   1639 O  O    . SER A 1 207 ? -23.319 20.170 13.653 1.00 21.61 ? 237  SER A O    1 
ATOM   1640 C  CB   . SER A 1 207 ? -20.519 21.395 13.623 1.00 17.46 ? 237  SER A CB   1 
ATOM   1641 O  OG   . SER A 1 207 ? -19.814 20.621 14.572 1.00 20.98 ? 237  SER A OG   1 
ATOM   1642 N  N    . ARG A 1 208 ? -23.050 20.643 15.834 1.00 18.33 ? 238  ARG A N    1 
ATOM   1643 C  CA   . ARG A 1 208 ? -23.990 19.614 16.261 1.00 20.79 ? 238  ARG A CA   1 
ATOM   1644 C  C    . ARG A 1 208 ? -25.409 20.162 16.331 1.00 18.87 ? 238  ARG A C    1 
ATOM   1645 O  O    . ARG A 1 208 ? -26.342 19.443 16.672 1.00 19.67 ? 238  ARG A O    1 
ATOM   1646 C  CB   . ARG A 1 208 ? -23.610 19.046 17.622 1.00 17.24 ? 238  ARG A CB   1 
ATOM   1647 C  CG   . ARG A 1 208 ? -22.352 18.214 17.627 1.00 21.88 ? 238  ARG A CG   1 
ATOM   1648 C  CD   . ARG A 1 208 ? -22.119 17.632 19.016 1.00 29.23 ? 238  ARG A CD   1 
ATOM   1649 N  NE   . ARG A 1 208 ? -22.469 18.616 20.040 1.00 37.42 ? 238  ARG A NE   1 
ATOM   1650 C  CZ   . ARG A 1 208 ? -21.683 18.991 21.037 1.00 32.51 ? 238  ARG A CZ   1 
ATOM   1651 N  NH1  . ARG A 1 208 ? -20.481 18.465 21.196 1.00 38.52 ? 238  ARG A NH1  1 
ATOM   1652 N  NH2  . ARG A 1 208 ? -22.071 19.967 21.818 1.00 33.00 ? 238  ARG A NH2  1 
ATOM   1653 N  N    . TYR A 1 209 ? -25.562 21.447 16.037 1.00 20.29 ? 239  TYR A N    1 
ATOM   1654 C  CA   . TYR A 1 209 ? -26.868 22.086 16.081 1.00 20.76 ? 239  TYR A CA   1 
ATOM   1655 C  C    . TYR A 1 209 ? -27.231 22.670 14.740 1.00 22.02 ? 239  TYR A C    1 
ATOM   1656 O  O    . TYR A 1 209 ? -28.334 22.473 14.243 1.00 24.59 ? 239  TYR A O    1 
ATOM   1657 C  CB   . TYR A 1 209 ? -26.878 23.233 17.104 1.00 20.28 ? 239  TYR A CB   1 
ATOM   1658 C  CG   . TYR A 1 209 ? -26.798 22.786 18.539 1.00 21.73 ? 239  TYR A CG   1 
ATOM   1659 C  CD1  . TYR A 1 209 ? -27.945 22.397 19.228 1.00 23.11 ? 239  TYR A CD1  1 
ATOM   1660 C  CD2  . TYR A 1 209 ? -25.575 22.732 19.207 1.00 21.96 ? 239  TYR A CD2  1 
ATOM   1661 C  CE1  . TYR A 1 209 ? -27.880 21.962 20.548 1.00 24.25 ? 239  TYR A CE1  1 
ATOM   1662 C  CE2  . TYR A 1 209 ? -25.498 22.297 20.527 1.00 22.79 ? 239  TYR A CE2  1 
ATOM   1663 C  CZ   . TYR A 1 209 ? -26.658 21.917 21.190 1.00 21.46 ? 239  TYR A CZ   1 
ATOM   1664 O  OH   . TYR A 1 209 ? -26.599 21.504 22.499 1.00 26.71 ? 239  TYR A OH   1 
ATOM   1665 N  N    . VAL A 1 210 ? -26.264 23.324 14.116 1.00 21.78 ? 240  VAL A N    1 
ATOM   1666 C  CA   . VAL A 1 210 ? -26.529 24.008 12.876 1.00 22.21 ? 240  VAL A CA   1 
ATOM   1667 C  C    . VAL A 1 210 ? -25.375 23.876 11.869 1.00 23.35 ? 240  VAL A C    1 
ATOM   1668 O  O    . VAL A 1 210 ? -24.266 23.468 12.227 1.00 26.87 ? 240  VAL A O    1 
ATOM   1669 C  CB   . VAL A 1 210 ? -26.874 25.482 13.249 1.00 23.13 ? 240  VAL A CB   1 
ATOM   1670 C  CG1  . VAL A 1 210 ? -25.638 26.362 13.279 1.00 18.11 ? 240  VAL A CG1  1 
ATOM   1671 C  CG2  . VAL A 1 210 ? -27.992 26.002 12.417 1.00 27.56 ? 240  VAL A CG2  1 
ATOM   1672 N  N    . LYS A 1 211 ? -25.659 24.203 10.611 1.00 25.15 ? 241  LYS A N    1 
ATOM   1673 C  CA   . LYS A 1 211 ? -24.704 24.103 9.503  1.00 24.94 ? 241  LYS A CA   1 
ATOM   1674 C  C    . LYS A 1 211 ? -23.566 25.127 9.510  1.00 25.70 ? 241  LYS A C    1 
ATOM   1675 O  O    . LYS A 1 211 ? -22.421 24.794 9.188  1.00 27.16 ? 241  LYS A O    1 
ATOM   1676 C  CB   . LYS A 1 211 ? -25.460 24.174 8.171  1.00 25.25 ? 241  LYS A CB   1 
ATOM   1677 C  CG   . LYS A 1 211 ? -24.611 23.958 6.924  1.00 27.14 ? 241  LYS A CG   1 
ATOM   1678 C  CD   . LYS A 1 211 ? -24.130 22.518 6.790  1.00 27.81 ? 241  LYS A CD   1 
ATOM   1679 C  CE   . LYS A 1 211 ? -23.339 22.322 5.496  1.00 25.44 ? 241  LYS A CE   1 
ATOM   1680 N  NZ   . LYS A 1 211 ? -22.860 20.915 5.330  1.00 18.32 ? 241  LYS A NZ   1 
ATOM   1681 N  N    . LYS A 1 212 ? -23.895 26.381 9.795  1.00 26.27 ? 242  LYS A N    1 
ATOM   1682 C  CA   . LYS A 1 212 ? -22.900 27.458 9.856  1.00 27.08 ? 242  LYS A CA   1 
ATOM   1683 C  C    . LYS A 1 212 ? -23.197 28.224 11.141 1.00 26.02 ? 242  LYS A C    1 
ATOM   1684 O  O    . LYS A 1 212 ? -24.362 28.340 11.516 1.00 25.46 ? 242  LYS A O    1 
ATOM   1685 C  CB   . LYS A 1 212 ? -23.061 28.418 8.674  1.00 26.29 ? 242  LYS A CB   1 
ATOM   1686 C  CG   . LYS A 1 212 ? -23.231 27.745 7.335  1.00 33.54 ? 242  LYS A CG   1 
ATOM   1687 C  CD   . LYS A 1 212 ? -23.392 28.759 6.211  1.00 28.91 ? 242  LYS A CD   1 
ATOM   1688 C  CE   . LYS A 1 212 ? -22.059 29.390 5.855  1.00 33.53 ? 242  LYS A CE   1 
ATOM   1689 N  NZ   . LYS A 1 212 ? -21.109 28.415 5.266  1.00 29.46 ? 242  LYS A NZ   1 
ATOM   1690 N  N    . LEU A 1 213 ? -22.175 28.767 11.798 1.00 22.35 ? 243  LEU A N    1 
ATOM   1691 C  CA   . LEU A 1 213 ? -22.397 29.515 13.034 1.00 20.55 ? 243  LEU A CA   1 
ATOM   1692 C  C    . LEU A 1 213 ? -23.433 30.615 12.801 1.00 17.60 ? 243  LEU A C    1 
ATOM   1693 O  O    . LEU A 1 213 ? -24.361 30.781 13.584 1.00 17.43 ? 243  LEU A O    1 
ATOM   1694 C  CB   . LEU A 1 213 ? -21.096 30.145 13.535 1.00 22.59 ? 243  LEU A CB   1 
ATOM   1695 C  CG   . LEU A 1 213 ? -20.814 30.182 15.044 1.00 22.14 ? 243  LEU A CG   1 
ATOM   1696 C  CD1  . LEU A 1 213 ? -19.979 31.399 15.384 1.00 21.23 ? 243  LEU A CD1  1 
ATOM   1697 C  CD2  . LEU A 1 213 ? -22.092 30.185 15.852 1.00 17.96 ? 243  LEU A CD2  1 
ATOM   1698 N  N    . GLY A 1 214 ? -23.301 31.326 11.687 1.00 19.47 ? 244  GLY A N    1 
ATOM   1699 C  CA   . GLY A 1 214 ? -24.238 32.395 11.381 1.00 16.69 ? 244  GLY A CA   1 
ATOM   1700 C  C    . GLY A 1 214 ? -25.699 31.986 11.342 1.00 15.67 ? 244  GLY A C    1 
ATOM   1701 O  O    . GLY A 1 214 ? -26.586 32.835 11.442 1.00 17.52 ? 244  GLY A O    1 
ATOM   1702 N  N    . ASP A 1 215 ? -25.968 30.690 11.230 1.00 17.78 ? 245  ASP A N    1 
ATOM   1703 C  CA   . ASP A 1 215 ? -27.347 30.217 11.167 1.00 19.34 ? 245  ASP A CA   1 
ATOM   1704 C  C    . ASP A 1 215 ? -28.151 30.517 12.420 1.00 22.76 ? 245  ASP A C    1 
ATOM   1705 O  O    . ASP A 1 215 ? -29.382 30.497 12.369 1.00 25.53 ? 245  ASP A O    1 
ATOM   1706 C  CB   . ASP A 1 215 ? -27.417 28.720 10.857 1.00 18.03 ? 245  ASP A CB   1 
ATOM   1707 C  CG   . ASP A 1 215 ? -26.926 28.379 9.457  1.00 20.14 ? 245  ASP A CG   1 
ATOM   1708 O  OD1  . ASP A 1 215 ? -26.664 29.306 8.662  1.00 25.45 ? 245  ASP A OD1  1 
ATOM   1709 O  OD2  . ASP A 1 215 ? -26.803 27.176 9.154  1.00 19.91 ? 245  ASP A OD2  1 
ATOM   1710 N  N    . PHE A 1 216 ? -27.467 30.756 13.543 1.00 22.52 ? 246  PHE A N    1 
ATOM   1711 C  CA   . PHE A 1 216 ? -28.143 31.081 14.801 1.00 20.47 ? 246  PHE A CA   1 
ATOM   1712 C  C    . PHE A 1 216 ? -28.811 32.449 14.684 1.00 17.73 ? 246  PHE A C    1 
ATOM   1713 O  O    . PHE A 1 216 ? -29.817 32.722 15.348 1.00 20.07 ? 246  PHE A O    1 
ATOM   1714 C  CB   . PHE A 1 216 ? -27.161 31.106 15.979 1.00 20.02 ? 246  PHE A CB   1 
ATOM   1715 C  CG   . PHE A 1 216 ? -26.679 29.756 16.409 1.00 13.41 ? 246  PHE A CG   1 
ATOM   1716 C  CD1  . PHE A 1 216 ? -27.471 28.629 16.246 1.00 18.74 ? 246  PHE A CD1  1 
ATOM   1717 C  CD2  . PHE A 1 216 ? -25.437 29.616 17.007 1.00 16.92 ? 246  PHE A CD2  1 
ATOM   1718 C  CE1  . PHE A 1 216 ? -27.027 27.384 16.676 1.00 17.16 ? 246  PHE A CE1  1 
ATOM   1719 C  CE2  . PHE A 1 216 ? -24.985 28.379 17.438 1.00 14.80 ? 246  PHE A CE2  1 
ATOM   1720 C  CZ   . PHE A 1 216 ? -25.779 27.262 17.275 1.00 14.49 ? 246  PHE A CZ   1 
ATOM   1721 N  N    . ALA A 1 217 ? -28.239 33.311 13.849 1.00 15.21 ? 247  ALA A N    1 
ATOM   1722 C  CA   . ALA A 1 217 ? -28.798 34.643 13.637 1.00 16.85 ? 247  ALA A CA   1 
ATOM   1723 C  C    . ALA A 1 217 ? -30.088 34.600 12.803 1.00 20.26 ? 247  ALA A C    1 
ATOM   1724 O  O    . ALA A 1 217 ? -30.820 35.586 12.733 1.00 22.29 ? 247  ALA A O    1 
ATOM   1725 C  CB   . ALA A 1 217 ? -27.780 35.538 12.987 1.00 15.97 ? 247  ALA A CB   1 
ATOM   1726 N  N    . LYS A 1 218 ? -30.355 33.462 12.163 1.00 22.10 ? 248  LYS A N    1 
ATOM   1727 C  CA   . LYS A 1 218 ? -31.566 33.287 11.361 1.00 20.97 ? 248  LYS A CA   1 
ATOM   1728 C  C    . LYS A 1 218 ? -32.700 32.828 12.282 1.00 21.25 ? 248  LYS A C    1 
ATOM   1729 O  O    . LYS A 1 218 ? -32.588 31.809 12.966 1.00 19.68 ? 248  LYS A O    1 
ATOM   1730 C  CB   . LYS A 1 218 ? -31.329 32.268 10.250 1.00 22.13 ? 248  LYS A CB   1 
ATOM   1731 C  CG   . LYS A 1 218 ? -30.230 32.668 9.271  1.00 21.65 ? 248  LYS A CG   1 
ATOM   1732 C  CD   . LYS A 1 218 ? -29.975 31.560 8.270  1.00 23.58 ? 248  LYS A CD   1 
ATOM   1733 C  CE   . LYS A 1 218 ? -28.784 31.888 7.396  1.00 30.15 ? 248  LYS A CE   1 
ATOM   1734 N  NZ   . LYS A 1 218 ? -28.409 30.739 6.520  1.00 34.66 ? 248  LYS A NZ   1 
ATOM   1735 N  N    . PRO A 1 219 ? -33.832 33.551 12.257 1.00 22.52 ? 249  PRO A N    1 
ATOM   1736 C  CA   . PRO A 1 219 ? -35.045 33.325 13.049 1.00 19.92 ? 249  PRO A CA   1 
ATOM   1737 C  C    . PRO A 1 219 ? -35.508 31.886 13.175 1.00 21.66 ? 249  PRO A C    1 
ATOM   1738 O  O    . PRO A 1 219 ? -35.807 31.411 14.276 1.00 20.13 ? 249  PRO A O    1 
ATOM   1739 C  CB   . PRO A 1 219 ? -36.087 34.170 12.314 1.00 19.26 ? 249  PRO A CB   1 
ATOM   1740 C  CG   . PRO A 1 219 ? -35.287 35.313 11.820 1.00 24.38 ? 249  PRO A CG   1 
ATOM   1741 C  CD   . PRO A 1 219 ? -34.056 34.630 11.275 1.00 22.80 ? 249  PRO A CD   1 
ATOM   1742 N  N    . GLU A 1 220 ? -35.595 31.205 12.036 1.00 20.96 ? 250  GLU A N    1 
ATOM   1743 C  CA   . GLU A 1 220 ? -36.062 29.827 11.985 1.00 21.99 ? 250  GLU A CA   1 
ATOM   1744 C  C    . GLU A 1 220 ? -35.262 28.856 12.846 1.00 23.63 ? 250  GLU A C    1 
ATOM   1745 O  O    . GLU A 1 220 ? -35.784 27.823 13.265 1.00 24.91 ? 250  GLU A O    1 
ATOM   1746 C  CB   . GLU A 1 220 ? -36.112 29.324 10.535 1.00 21.98 ? 250  GLU A CB   1 
ATOM   1747 C  CG   . GLU A 1 220 ? -34.772 29.303 9.794  1.00 19.19 ? 250  GLU A CG   1 
ATOM   1748 C  CD   . GLU A 1 220 ? -34.457 30.607 9.075  1.00 21.45 ? 250  GLU A CD   1 
ATOM   1749 O  OE1  . GLU A 1 220 ? -35.108 31.623 9.362  1.00 25.38 ? 250  GLU A OE1  1 
ATOM   1750 O  OE2  . GLU A 1 220 ? -33.557 30.619 8.210  1.00 24.03 ? 250  GLU A OE2  1 
ATOM   1751 N  N    . ASN A 1 221 ? -34.025 29.214 13.167 1.00 22.14 ? 251  ASN A N    1 
ATOM   1752 C  CA   . ASN A 1 221 ? -33.174 28.339 13.958 1.00 22.84 ? 251  ASN A CA   1 
ATOM   1753 C  C    . ASN A 1 221 ? -33.028 28.746 15.426 1.00 24.83 ? 251  ASN A C    1 
ATOM   1754 O  O    . ASN A 1 221 ? -32.073 28.347 16.100 1.00 24.37 ? 251  ASN A O    1 
ATOM   1755 C  CB   . ASN A 1 221 ? -31.802 28.239 13.294 1.00 19.01 ? 251  ASN A CB   1 
ATOM   1756 C  CG   . ASN A 1 221 ? -31.880 27.660 11.895 1.00 18.84 ? 251  ASN A CG   1 
ATOM   1757 O  OD1  . ASN A 1 221 ? -32.580 26.671 11.651 1.00 15.86 ? 251  ASN A OD1  1 
ATOM   1758 N  ND2  . ASN A 1 221 ? -31.162 28.277 10.963 1.00 17.39 ? 251  ASN A ND2  1 
ATOM   1759 N  N    . ILE A 1 222 ? -33.998 29.491 15.943 1.00 23.28 ? 252  ILE A N    1 
ATOM   1760 C  CA   . ILE A 1 222 ? -33.926 29.942 17.320 1.00 22.89 ? 252  ILE A CA   1 
ATOM   1761 C  C    . ILE A 1 222 ? -33.862 28.820 18.370 1.00 20.58 ? 252  ILE A C    1 
ATOM   1762 O  O    . ILE A 1 222 ? -33.072 28.903 19.303 1.00 23.07 ? 252  ILE A O    1 
ATOM   1763 C  CB   . ILE A 1 222 ? -35.069 30.948 17.647 1.00 23.45 ? 252  ILE A CB   1 
ATOM   1764 C  CG1  . ILE A 1 222 ? -34.828 31.612 19.012 1.00 23.00 ? 252  ILE A CG1  1 
ATOM   1765 C  CG2  . ILE A 1 222 ? -36.430 30.257 17.614 1.00 20.87 ? 252  ILE A CG2  1 
ATOM   1766 C  CD1  . ILE A 1 222 ? -33.607 32.527 19.053 1.00 10.43 ? 252  ILE A CD1  1 
ATOM   1767 N  N    . ASP A 1 223 ? -34.638 27.754 18.203 1.00 19.61 ? 253  ASP A N    1 
ATOM   1768 C  CA   . ASP A 1 223 ? -34.636 26.661 19.185 1.00 18.36 ? 253  ASP A CA   1 
ATOM   1769 C  C    . ASP A 1 223 ? -33.270 26.013 19.350 1.00 20.29 ? 253  ASP A C    1 
ATOM   1770 O  O    . ASP A 1 223 ? -32.834 25.759 20.477 1.00 18.31 ? 253  ASP A O    1 
ATOM   1771 C  CB   . ASP A 1 223 ? -35.683 25.591 18.841 1.00 20.00 ? 253  ASP A CB   1 
ATOM   1772 C  CG   . ASP A 1 223 ? -37.118 26.021 19.181 1.00 22.03 ? 253  ASP A CG   1 
ATOM   1773 O  OD1  . ASP A 1 223 ? -37.308 27.080 19.808 1.00 22.03 ? 253  ASP A OD1  1 
ATOM   1774 O  OD2  . ASP A 1 223 ? -38.061 25.285 18.821 1.00 29.33 ? 253  ASP A OD2  1 
ATOM   1775 N  N    . LEU A 1 224 ? -32.609 25.735 18.228 1.00 20.62 ? 254  LEU A N    1 
ATOM   1776 C  CA   . LEU A 1 224 ? -31.277 25.124 18.221 1.00 21.07 ? 254  LEU A CA   1 
ATOM   1777 C  C    . LEU A 1 224 ? -30.236 26.109 18.745 1.00 22.16 ? 254  LEU A C    1 
ATOM   1778 O  O    . LEU A 1 224 ? -29.224 25.717 19.341 1.00 21.00 ? 254  LEU A O    1 
ATOM   1779 C  CB   . LEU A 1 224 ? -30.903 24.703 16.799 1.00 25.20 ? 254  LEU A CB   1 
ATOM   1780 C  CG   . LEU A 1 224 ? -31.757 23.597 16.182 1.00 25.91 ? 254  LEU A CG   1 
ATOM   1781 C  CD1  . LEU A 1 224 ? -31.374 23.399 14.724 1.00 28.42 ? 254  LEU A CD1  1 
ATOM   1782 C  CD2  . LEU A 1 224 ? -31.577 22.316 16.979 1.00 25.07 ? 254  LEU A CD2  1 
ATOM   1783 N  N    . ALA A 1 225 ? -30.476 27.387 18.475 1.00 20.50 ? 255  ALA A N    1 
ATOM   1784 C  CA   . ALA A 1 225 ? -29.600 28.457 18.914 1.00 20.60 ? 255  ALA A CA   1 
ATOM   1785 C  C    . ALA A 1 225 ? -29.585 28.485 20.438 1.00 16.92 ? 255  ALA A C    1 
ATOM   1786 O  O    . ALA A 1 225 ? -28.525 28.514 21.063 1.00 21.41 ? 255  ALA A O    1 
ATOM   1787 C  CB   . ALA A 1 225 ? -30.101 29.797 18.363 1.00 14.85 ? 255  ALA A CB   1 
ATOM   1788 N  N    . VAL A 1 226 ? -30.768 28.450 21.036 1.00 18.69 ? 256  VAL A N    1 
ATOM   1789 C  CA   . VAL A 1 226 ? -30.891 28.478 22.491 1.00 17.69 ? 256  VAL A CA   1 
ATOM   1790 C  C    . VAL A 1 226 ? -30.255 27.254 23.148 1.00 16.53 ? 256  VAL A C    1 
ATOM   1791 O  O    . VAL A 1 226 ? -29.526 27.387 24.124 1.00 22.31 ? 256  VAL A O    1 
ATOM   1792 C  CB   . VAL A 1 226 ? -32.359 28.663 22.925 1.00 17.01 ? 256  VAL A CB   1 
ATOM   1793 C  CG1  . VAL A 1 226 ? -32.500 28.456 24.423 1.00 14.86 ? 256  VAL A CG1  1 
ATOM   1794 C  CG2  . VAL A 1 226 ? -32.829 30.072 22.554 1.00 11.20 ? 256  VAL A CG2  1 
ATOM   1795 N  N    . GLN A 1 227 ? -30.482 26.072 22.592 1.00 17.53 ? 257  GLN A N    1 
ATOM   1796 C  CA   . GLN A 1 227 ? -29.877 24.863 23.142 1.00 17.20 ? 257  GLN A CA   1 
ATOM   1797 C  C    . GLN A 1 227 ? -28.353 24.989 23.173 1.00 18.67 ? 257  GLN A C    1 
ATOM   1798 O  O    . GLN A 1 227 ? -27.734 24.691 24.187 1.00 20.40 ? 257  GLN A O    1 
ATOM   1799 C  CB   . GLN A 1 227 ? -30.243 23.640 22.314 1.00 18.56 ? 257  GLN A CB   1 
ATOM   1800 C  CG   . GLN A 1 227 ? -31.707 23.275 22.311 1.00 24.57 ? 257  GLN A CG   1 
ATOM   1801 C  CD   . GLN A 1 227 ? -32.006 22.136 21.360 1.00 28.02 ? 257  GLN A CD   1 
ATOM   1802 O  OE1  . GLN A 1 227 ? -31.141 21.707 20.591 1.00 30.43 ? 257  GLN A OE1  1 
ATOM   1803 N  NE2  . GLN A 1 227 ? -33.233 21.639 21.404 1.00 30.82 ? 257  GLN A NE2  1 
ATOM   1804 N  N    . CYS A 1 228 ? -27.749 25.422 22.064 1.00 18.02 ? 258  CYS A N    1 
ATOM   1805 C  CA   . CYS A 1 228 ? -26.288 25.573 21.995 1.00 19.02 ? 258  CYS A CA   1 
ATOM   1806 C  C    . CYS A 1 228 ? -25.856 26.634 23.002 1.00 17.97 ? 258  CYS A C    1 
ATOM   1807 O  O    . CYS A 1 228 ? -24.854 26.477 23.704 1.00 16.34 ? 258  CYS A O    1 
ATOM   1808 C  CB   . CYS A 1 228 ? -25.845 25.976 20.578 1.00 19.40 ? 258  CYS A CB   1 
ATOM   1809 S  SG   . CYS A 1 228 ? -24.044 26.144 20.288 1.00 16.02 ? 258  CYS A SG   1 
ATOM   1810 N  N    . LEU A 1 229 ? -26.614 27.723 23.060 1.00 17.61 ? 259  LEU A N    1 
ATOM   1811 C  CA   . LEU A 1 229 ? -26.337 28.802 23.995 1.00 19.12 ? 259  LEU A CA   1 
ATOM   1812 C  C    . LEU A 1 229 ? -26.247 28.204 25.396 1.00 14.89 ? 259  LEU A C    1 
ATOM   1813 O  O    . LEU A 1 229 ? -25.245 28.362 26.095 1.00 17.75 ? 259  LEU A O    1 
ATOM   1814 C  CB   . LEU A 1 229 ? -27.465 29.841 23.935 1.00 18.19 ? 259  LEU A CB   1 
ATOM   1815 C  CG   . LEU A 1 229 ? -27.582 30.879 25.064 1.00 18.31 ? 259  LEU A CG   1 
ATOM   1816 C  CD1  . LEU A 1 229 ? -26.438 31.881 25.014 1.00 12.42 ? 259  LEU A CD1  1 
ATOM   1817 C  CD2  . LEU A 1 229 ? -28.911 31.593 24.935 1.00 18.51 ? 259  LEU A CD2  1 
ATOM   1818 N  N    . ASN A 1 230 ? -27.279 27.452 25.760 1.00 16.22 ? 260  ASN A N    1 
ATOM   1819 C  CA   . ASN A 1 230 ? -27.366 26.812 27.067 1.00 17.92 ? 260  ASN A CA   1 
ATOM   1820 C  C    . ASN A 1 230 ? -26.182 25.898 27.342 1.00 19.17 ? 260  ASN A C    1 
ATOM   1821 O  O    . ASN A 1 230 ? -25.668 25.854 28.457 1.00 21.08 ? 260  ASN A O    1 
ATOM   1822 C  CB   . ASN A 1 230 ? -28.691 26.052 27.198 1.00 15.09 ? 260  ASN A CB   1 
ATOM   1823 C  CG   . ASN A 1 230 ? -29.892 26.985 27.301 1.00 17.52 ? 260  ASN A CG   1 
ATOM   1824 O  OD1  . ASN A 1 230 ? -29.736 28.192 27.493 1.00 23.47 ? 260  ASN A OD1  1 
ATOM   1825 N  ND2  . ASN A 1 230 ? -31.092 26.430 27.202 1.00 9.21  ? 260  ASN A ND2  1 
ATOM   1826 N  N    . GLU A 1 231 ? -25.725 25.199 26.311 1.00 21.71 ? 261  GLU A N    1 
ATOM   1827 C  CA   . GLU A 1 231 ? -24.587 24.309 26.465 1.00 19.52 ? 261  GLU A CA   1 
ATOM   1828 C  C    . GLU A 1 231 ? -23.282 25.078 26.705 1.00 17.75 ? 261  GLU A C    1 
ATOM   1829 O  O    . GLU A 1 231 ? -22.421 24.633 27.465 1.00 20.69 ? 261  GLU A O    1 
ATOM   1830 C  CB   . GLU A 1 231 ? -24.439 23.401 25.245 1.00 17.71 ? 261  GLU A CB   1 
ATOM   1831 C  CG   . GLU A 1 231 ? -23.234 22.505 25.366 1.00 17.40 ? 261  GLU A CG   1 
ATOM   1832 C  CD   . GLU A 1 231 ? -23.100 21.539 24.228 1.00 19.31 ? 261  GLU A CD   1 
ATOM   1833 O  OE1  . GLU A 1 231 ? -24.063 21.368 23.459 1.00 20.10 ? 261  GLU A OE1  1 
ATOM   1834 O  OE2  . GLU A 1 231 ? -22.023 20.929 24.126 1.00 20.39 ? 261  GLU A OE2  1 
ATOM   1835 N  N    . LEU A 1 232 ? -23.121 26.215 26.037 1.00 19.10 ? 262  LEU A N    1 
ATOM   1836 C  CA   . LEU A 1 232 ? -21.920 27.034 26.200 1.00 17.83 ? 262  LEU A CA   1 
ATOM   1837 C  C    . LEU A 1 232 ? -21.884 27.661 27.593 1.00 18.06 ? 262  LEU A C    1 
ATOM   1838 O  O    . LEU A 1 232 ? -20.833 27.719 28.238 1.00 16.04 ? 262  LEU A O    1 
ATOM   1839 C  CB   . LEU A 1 232 ? -21.857 28.113 25.113 1.00 17.21 ? 262  LEU A CB   1 
ATOM   1840 C  CG   . LEU A 1 232 ? -20.980 27.817 23.891 1.00 24.24 ? 262  LEU A CG   1 
ATOM   1841 C  CD1  . LEU A 1 232 ? -20.718 26.325 23.706 1.00 24.22 ? 262  LEU A CD1  1 
ATOM   1842 C  CD2  . LEU A 1 232 ? -21.617 28.405 22.669 1.00 17.47 ? 262  LEU A CD2  1 
ATOM   1843 N  N    . ILE A 1 233 ? -23.042 28.094 28.072 1.00 17.06 ? 263  ILE A N    1 
ATOM   1844 C  CA   . ILE A 1 233 ? -23.133 28.686 29.397 1.00 18.51 ? 263  ILE A CA   1 
ATOM   1845 C  C    . ILE A 1 233 ? -22.775 27.652 30.459 1.00 20.63 ? 263  ILE A C    1 
ATOM   1846 O  O    . ILE A 1 233 ? -22.028 27.961 31.389 1.00 22.65 ? 263  ILE A O    1 
ATOM   1847 C  CB   . ILE A 1 233 ? -24.543 29.264 29.667 1.00 19.93 ? 263  ILE A CB   1 
ATOM   1848 C  CG1  . ILE A 1 233 ? -24.768 30.492 28.767 1.00 12.86 ? 263  ILE A CG1  1 
ATOM   1849 C  CG2  . ILE A 1 233 ? -24.720 29.582 31.172 1.00 16.12 ? 263  ILE A CG2  1 
ATOM   1850 C  CD1  . ILE A 1 233 ? -26.186 31.002 28.751 1.00 9.58  ? 263  ILE A CD1  1 
ATOM   1851 N  N    . THR A 1 234 ? -23.276 26.427 30.304 1.00 18.39 ? 264  THR A N    1 
ATOM   1852 C  CA   . THR A 1 234 ? -22.990 25.347 31.253 1.00 17.82 ? 264  THR A CA   1 
ATOM   1853 C  C    . THR A 1 234 ? -21.489 25.100 31.283 1.00 18.43 ? 264  THR A C    1 
ATOM   1854 O  O    . THR A 1 234 ? -20.907 24.801 32.329 1.00 18.90 ? 264  THR A O    1 
ATOM   1855 C  CB   . THR A 1 234 ? -23.714 24.053 30.852 1.00 22.18 ? 264  THR A CB   1 
ATOM   1856 O  OG1  . THR A 1 234 ? -25.131 24.283 30.872 1.00 22.93 ? 264  THR A OG1  1 
ATOM   1857 C  CG2  . THR A 1 234 ? -23.367 22.917 31.810 1.00 23.94 ? 264  THR A CG2  1 
ATOM   1858 N  N    . ASN A 1 235 ? -20.871 25.250 30.118 1.00 18.85 ? 265  ASN A N    1 
ATOM   1859 C  CA   . ASN A 1 235 ? -19.436 25.083 29.969 1.00 17.86 ? 265  ASN A CA   1 
ATOM   1860 C  C    . ASN A 1 235 ? -18.777 26.160 30.830 1.00 19.27 ? 265  ASN A C    1 
ATOM   1861 O  O    . ASN A 1 235 ? -17.898 25.869 31.641 1.00 21.52 ? 265  ASN A O    1 
ATOM   1862 C  CB   . ASN A 1 235 ? -19.069 25.260 28.482 1.00 17.50 ? 265  ASN A CB   1 
ATOM   1863 C  CG   . ASN A 1 235 ? -17.568 25.300 28.224 1.00 16.07 ? 265  ASN A CG   1 
ATOM   1864 O  OD1  . ASN A 1 235 ? -17.029 24.447 27.522 1.00 21.45 ? 265  ASN A OD1  1 
ATOM   1865 N  ND2  . ASN A 1 235 ? -16.906 26.332 28.711 1.00 14.02 ? 265  ASN A ND2  1 
ATOM   1866 N  N    . ALA A 1 236 ? -19.258 27.393 30.690 1.00 20.60 ? 266  ALA A N    1 
ATOM   1867 C  CA   . ALA A 1 236 ? -18.721 28.543 31.419 1.00 19.97 ? 266  ALA A CA   1 
ATOM   1868 C  C    . ALA A 1 236 ? -18.801 28.426 32.936 1.00 18.45 ? 266  ALA A C    1 
ATOM   1869 O  O    . ALA A 1 236 ? -17.862 28.795 33.640 1.00 19.74 ? 266  ALA A O    1 
ATOM   1870 C  CB   . ALA A 1 236 ? -19.407 29.820 30.958 1.00 16.71 ? 266  ALA A CB   1 
ATOM   1871 N  N    . LEU A 1 237 ? -19.919 27.919 33.441 1.00 18.19 ? 267  LEU A N    1 
ATOM   1872 C  CA   . LEU A 1 237 ? -20.107 27.775 34.878 1.00 19.12 ? 267  LEU A CA   1 
ATOM   1873 C  C    . LEU A 1 237 ? -18.988 27.011 35.567 1.00 21.06 ? 267  LEU A C    1 
ATOM   1874 O  O    . LEU A 1 237 ? -18.682 27.276 36.730 1.00 22.38 ? 267  LEU A O    1 
ATOM   1875 C  CB   . LEU A 1 237 ? -21.441 27.105 35.181 1.00 19.71 ? 267  LEU A CB   1 
ATOM   1876 C  CG   . LEU A 1 237 ? -22.676 27.862 34.687 1.00 23.02 ? 267  LEU A CG   1 
ATOM   1877 C  CD1  . LEU A 1 237 ? -23.919 27.045 35.010 1.00 23.62 ? 267  LEU A CD1  1 
ATOM   1878 C  CD2  . LEU A 1 237 ? -22.744 29.246 35.323 1.00 22.44 ? 267  LEU A CD2  1 
ATOM   1879 N  N    . HIS A 1 238 ? -18.331 26.114 34.841 1.00 21.89 ? 268  HIS A N    1 
ATOM   1880 C  CA   . HIS A 1 238 ? -17.251 25.317 35.416 1.00 21.49 ? 268  HIS A CA   1 
ATOM   1881 C  C    . HIS A 1 238 ? -16.065 26.084 35.976 1.00 19.74 ? 268  HIS A C    1 
ATOM   1882 O  O    . HIS A 1 238 ? -15.230 25.506 36.670 1.00 22.51 ? 268  HIS A O    1 
ATOM   1883 C  CB   . HIS A 1 238 ? -16.775 24.262 34.421 1.00 22.96 ? 268  HIS A CB   1 
ATOM   1884 C  CG   . HIS A 1 238 ? -17.728 23.120 34.259 1.00 26.61 ? 268  HIS A CG   1 
ATOM   1885 N  ND1  . HIS A 1 238 ? -18.991 23.277 33.726 1.00 29.72 ? 268  HIS A ND1  1 
ATOM   1886 C  CD2  . HIS A 1 238 ? -17.610 21.808 34.565 1.00 23.18 ? 268  HIS A CD2  1 
ATOM   1887 C  CE1  . HIS A 1 238 ? -19.607 22.110 33.712 1.00 29.03 ? 268  HIS A CE1  1 
ATOM   1888 N  NE2  . HIS A 1 238 ? -18.791 21.200 34.215 1.00 24.36 ? 268  HIS A NE2  1 
ATOM   1889 N  N    . HIS A 1 239 ? -15.976 27.375 35.677 1.00 21.42 ? 269  HIS A N    1 
ATOM   1890 C  CA   . HIS A 1 239 ? -14.874 28.189 36.190 1.00 21.74 ? 269  HIS A CA   1 
ATOM   1891 C  C    . HIS A 1 239 ? -15.197 28.874 37.520 1.00 21.65 ? 269  HIS A C    1 
ATOM   1892 O  O    . HIS A 1 239 ? -14.299 29.438 38.162 1.00 19.35 ? 269  HIS A O    1 
ATOM   1893 C  CB   . HIS A 1 239 ? -14.455 29.244 35.164 1.00 22.51 ? 269  HIS A CB   1 
ATOM   1894 C  CG   . HIS A 1 239 ? -14.011 28.665 33.857 1.00 25.53 ? 269  HIS A CG   1 
ATOM   1895 N  ND1  . HIS A 1 239 ? -14.813 28.666 32.738 1.00 24.80 ? 269  HIS A ND1  1 
ATOM   1896 C  CD2  . HIS A 1 239 ? -12.869 28.034 33.506 1.00 22.15 ? 269  HIS A CD2  1 
ATOM   1897 C  CE1  . HIS A 1 239 ? -14.183 28.055 31.751 1.00 20.49 ? 269  HIS A CE1  1 
ATOM   1898 N  NE2  . HIS A 1 239 ? -13.005 27.661 32.189 1.00 25.22 ? 269  HIS A NE2  1 
ATOM   1899 N  N    . ILE A 1 240 ? -16.462 28.819 37.937 1.00 17.23 ? 270  ILE A N    1 
ATOM   1900 C  CA   . ILE A 1 240 ? -16.888 29.450 39.186 1.00 21.59 ? 270  ILE A CA   1 
ATOM   1901 C  C    . ILE A 1 240 ? -16.032 29.072 40.402 1.00 19.97 ? 270  ILE A C    1 
ATOM   1902 O  O    . ILE A 1 240 ? -15.524 29.954 41.094 1.00 18.58 ? 270  ILE A O    1 
ATOM   1903 C  CB   . ILE A 1 240 ? -18.384 29.204 39.484 1.00 22.68 ? 270  ILE A CB   1 
ATOM   1904 C  CG1  . ILE A 1 240 ? -19.242 29.912 38.432 1.00 27.45 ? 270  ILE A CG1  1 
ATOM   1905 C  CG2  . ILE A 1 240 ? -18.745 29.710 40.880 1.00 20.23 ? 270  ILE A CG2  1 
ATOM   1906 C  CD1  . ILE A 1 240 ? -18.996 31.395 38.358 1.00 31.33 ? 270  ILE A CD1  1 
ATOM   1907 N  N    . PRO A 1 241 ? -15.844 27.763 40.661 1.00 17.69 ? 271  PRO A N    1 
ATOM   1908 C  CA   . PRO A 1 241 ? -15.032 27.355 41.806 1.00 19.50 ? 271  PRO A CA   1 
ATOM   1909 C  C    . PRO A 1 241 ? -13.671 28.033 41.831 1.00 22.73 ? 271  PRO A C    1 
ATOM   1910 O  O    . PRO A 1 241 ? -13.245 28.543 42.869 1.00 25.21 ? 271  PRO A O    1 
ATOM   1911 C  CB   . PRO A 1 241 ? -14.912 25.850 41.607 1.00 18.01 ? 271  PRO A CB   1 
ATOM   1912 C  CG   . PRO A 1 241 ? -16.244 25.511 41.073 1.00 14.03 ? 271  PRO A CG   1 
ATOM   1913 C  CD   . PRO A 1 241 ? -16.439 26.583 40.015 1.00 15.21 ? 271  PRO A CD   1 
ATOM   1914 N  N    . ASP A 1 242 ? -12.987 28.065 40.694 1.00 23.32 ? 272  ASP A N    1 
ATOM   1915 C  CA   . ASP A 1 242 ? -11.682 28.710 40.650 1.00 22.15 ? 272  ASP A CA   1 
ATOM   1916 C  C    . ASP A 1 242 ? -11.789 30.212 40.881 1.00 21.73 ? 272  ASP A C    1 
ATOM   1917 O  O    . ASP A 1 242 ? -10.917 30.802 41.514 1.00 19.67 ? 272  ASP A O    1 
ATOM   1918 C  CB   . ASP A 1 242 ? -10.956 28.400 39.339 1.00 26.35 ? 272  ASP A CB   1 
ATOM   1919 C  CG   . ASP A 1 242 ? -10.109 27.130 39.419 1.00 27.14 ? 272  ASP A CG   1 
ATOM   1920 O  OD1  . ASP A 1 242 ? -10.278 26.339 40.369 1.00 29.98 ? 272  ASP A OD1  1 
ATOM   1921 O  OD2  . ASP A 1 242 ? -9.250  26.931 38.539 1.00 27.21 ? 272  ASP A OD2  1 
ATOM   1922 N  N    . VAL A 1 243 ? -12.861 30.824 40.386 1.00 21.17 ? 273  VAL A N    1 
ATOM   1923 C  CA   . VAL A 1 243 ? -13.074 32.263 40.572 1.00 21.97 ? 273  VAL A CA   1 
ATOM   1924 C  C    . VAL A 1 243 ? -13.285 32.562 42.073 1.00 21.69 ? 273  VAL A C    1 
ATOM   1925 O  O    . VAL A 1 243 ? -12.756 33.549 42.594 1.00 17.57 ? 273  VAL A O    1 
ATOM   1926 C  CB   . VAL A 1 243 ? -14.289 32.775 39.732 1.00 20.62 ? 273  VAL A CB   1 
ATOM   1927 C  CG1  . VAL A 1 243 ? -14.707 34.164 40.176 1.00 22.03 ? 273  VAL A CG1  1 
ATOM   1928 C  CG2  . VAL A 1 243 ? -13.932 32.791 38.242 1.00 21.36 ? 273  VAL A CG2  1 
ATOM   1929 N  N    . ILE A 1 244 ? -14.050 31.709 42.757 1.00 17.63 ? 274  ILE A N    1 
ATOM   1930 C  CA   . ILE A 1 244 ? -14.292 31.880 44.186 1.00 20.38 ? 274  ILE A CA   1 
ATOM   1931 C  C    . ILE A 1 244 ? -12.979 31.675 44.944 1.00 21.63 ? 274  ILE A C    1 
ATOM   1932 O  O    . ILE A 1 244 ? -12.663 32.428 45.868 1.00 26.64 ? 274  ILE A O    1 
ATOM   1933 C  CB   . ILE A 1 244 ? -15.362 30.896 44.700 1.00 20.30 ? 274  ILE A CB   1 
ATOM   1934 C  CG1  . ILE A 1 244 ? -16.738 31.325 44.193 1.00 17.28 ? 274  ILE A CG1  1 
ATOM   1935 C  CG2  . ILE A 1 244 ? -15.339 30.808 46.224 1.00 22.78 ? 274  ILE A CG2  1 
ATOM   1936 C  CD1  . ILE A 1 244 ? -17.863 30.355 44.535 1.00 17.44 ? 274  ILE A CD1  1 
ATOM   1937 N  N    . THR A 1 245 ? -12.195 30.686 44.523 1.00 22.34 ? 275  THR A N    1 
ATOM   1938 C  CA   . THR A 1 245 ? -10.907 30.408 45.154 1.00 20.51 ? 275  THR A CA   1 
ATOM   1939 C  C    . THR A 1 245 ? -9.952  31.588 44.972 1.00 20.61 ? 275  THR A C    1 
ATOM   1940 O  O    . THR A 1 245 ? -9.336  32.057 45.925 1.00 23.59 ? 275  THR A O    1 
ATOM   1941 C  CB   . THR A 1 245 ? -10.262 29.131 44.567 1.00 18.45 ? 275  THR A CB   1 
ATOM   1942 O  OG1  . THR A 1 245 ? -11.117 28.008 44.808 1.00 18.87 ? 275  THR A OG1  1 
ATOM   1943 C  CG2  . THR A 1 245 ? -8.911  28.870 45.204 1.00 19.97 ? 275  THR A CG2  1 
ATOM   1944 N  N    . TYR A 1 246 ? -9.840  32.075 43.743 1.00 22.31 ? 276  TYR A N    1 
ATOM   1945 C  CA   . TYR A 1 246 ? -8.961  33.200 43.447 1.00 22.28 ? 276  TYR A CA   1 
ATOM   1946 C  C    . TYR A 1 246 ? -9.335  34.431 44.276 1.00 22.62 ? 276  TYR A C    1 
ATOM   1947 O  O    . TYR A 1 246 ? -8.467  35.115 44.835 1.00 25.04 ? 276  TYR A O    1 
ATOM   1948 C  CB   . TYR A 1 246 ? -9.047  33.557 41.956 1.00 21.27 ? 276  TYR A CB   1 
ATOM   1949 C  CG   . TYR A 1 246 ? -8.150  34.710 41.558 1.00 17.02 ? 276  TYR A CG   1 
ATOM   1950 C  CD1  . TYR A 1 246 ? -8.565  36.040 41.727 1.00 15.73 ? 276  TYR A CD1  1 
ATOM   1951 C  CD2  . TYR A 1 246 ? -6.873  34.478 41.066 1.00 16.04 ? 276  TYR A CD2  1 
ATOM   1952 C  CE1  . TYR A 1 246 ? -7.725  37.104 41.423 1.00 11.64 ? 276  TYR A CE1  1 
ATOM   1953 C  CE2  . TYR A 1 246 ? -6.018  35.543 40.753 1.00 20.20 ? 276  TYR A CE2  1 
ATOM   1954 C  CZ   . TYR A 1 246 ? -6.452  36.846 40.941 1.00 16.11 ? 276  TYR A CZ   1 
ATOM   1955 O  OH   . TYR A 1 246 ? -5.606  37.890 40.664 1.00 21.86 ? 276  TYR A OH   1 
ATOM   1956 N  N    . LEU A 1 247 ? -10.626 34.736 44.301 1.00 18.45 ? 277  LEU A N    1 
ATOM   1957 C  CA   . LEU A 1 247 ? -11.129 35.890 45.021 1.00 17.68 ? 277  LEU A CA   1 
ATOM   1958 C  C    . LEU A 1 247 ? -10.953 35.790 46.536 1.00 18.88 ? 277  LEU A C    1 
ATOM   1959 O  O    . LEU A 1 247 ? -10.607 36.780 47.194 1.00 16.96 ? 277  LEU A O    1 
ATOM   1960 C  CB   . LEU A 1 247 ? -12.600 36.121 44.663 1.00 14.91 ? 277  LEU A CB   1 
ATOM   1961 C  CG   . LEU A 1 247 ? -12.918 36.619 43.249 1.00 14.51 ? 277  LEU A CG   1 
ATOM   1962 C  CD1  . LEU A 1 247 ? -14.403 36.700 43.083 1.00 11.69 ? 277  LEU A CD1  1 
ATOM   1963 C  CD2  . LEU A 1 247 ? -12.308 37.985 42.995 1.00 11.76 ? 277  LEU A CD2  1 
ATOM   1964 N  N    . SER A 1 248 ? -11.123 34.587 47.078 1.00 18.96 ? 278  SER A N    1 
ATOM   1965 C  CA   . SER A 1 248 ? -11.005 34.376 48.516 1.00 19.44 ? 278  SER A CA   1 
ATOM   1966 C  C    . SER A 1 248 ? -9.590  34.553 49.069 1.00 23.27 ? 278  SER A C    1 
ATOM   1967 O  O    . SER A 1 248 ? -9.405  34.683 50.288 1.00 22.86 ? 278  SER A O    1 
ATOM   1968 C  CB   . SER A 1 248 ? -11.563 33.002 48.891 1.00 19.16 ? 278  SER A CB   1 
ATOM   1969 O  OG   . SER A 1 248 ? -10.717 31.962 48.440 1.00 25.19 ? 278  SER A OG   1 
ATOM   1970 N  N    . ARG A 1 249 ? -8.597  34.558 48.180 1.00 24.67 ? 279  ARG A N    1 
ATOM   1971 C  CA   . ARG A 1 249 ? -7.201  34.718 48.574 1.00 24.03 ? 279  ARG A CA   1 
ATOM   1972 C  C    . ARG A 1 249 ? -6.694  36.157 48.548 1.00 26.26 ? 279  ARG A C    1 
ATOM   1973 O  O    . ARG A 1 249 ? -5.585  36.427 49.016 1.00 26.69 ? 279  ARG A O    1 
ATOM   1974 C  CB   . ARG A 1 249 ? -6.295  33.884 47.681 1.00 25.64 ? 279  ARG A CB   1 
ATOM   1975 C  CG   . ARG A 1 249 ? -6.534  32.401 47.741 1.00 31.62 ? 279  ARG A CG   1 
ATOM   1976 C  CD   . ARG A 1 249 ? -5.493  31.728 46.882 1.00 39.28 ? 279  ARG A CD   1 
ATOM   1977 N  NE   . ARG A 1 249 ? -5.734  30.313 46.643 1.00 43.03 ? 279  ARG A NE   1 
ATOM   1978 C  CZ   . ARG A 1 249 ? -5.334  29.685 45.541 1.00 48.51 ? 279  ARG A CZ   1 
ATOM   1979 N  NH1  . ARG A 1 249 ? -4.692  30.366 44.600 1.00 47.04 ? 279  ARG A NH1  1 
ATOM   1980 N  NH2  . ARG A 1 249 ? -5.544  28.381 45.393 1.00 49.31 ? 279  ARG A NH2  1 
ATOM   1981 N  N    . LEU A 1 250 ? -7.476  37.066 47.968 1.00 23.99 ? 280  LEU A N    1 
ATOM   1982 C  CA   . LEU A 1 250 ? -7.084  38.475 47.881 1.00 23.45 ? 280  LEU A CA   1 
ATOM   1983 C  C    . LEU A 1 250 ? -7.130  39.145 49.253 1.00 23.91 ? 280  LEU A C    1 
ATOM   1984 O  O    . LEU A 1 250 ? -8.066  38.939 50.026 1.00 23.76 ? 280  LEU A O    1 
ATOM   1985 C  CB   . LEU A 1 250 ? -7.992  39.232 46.904 1.00 22.37 ? 280  LEU A CB   1 
ATOM   1986 C  CG   . LEU A 1 250 ? -8.042  38.711 45.463 1.00 20.48 ? 280  LEU A CG   1 
ATOM   1987 C  CD1  . LEU A 1 250 ? -9.062  39.497 44.666 1.00 14.97 ? 280  LEU A CD1  1 
ATOM   1988 C  CD2  . LEU A 1 250 ? -6.665  38.818 44.825 1.00 22.05 ? 280  LEU A CD2  1 
ATOM   1989 N  N    . ARG A 1 251 ? -6.138  39.983 49.525 1.00 24.69 ? 281  ARG A N    1 
ATOM   1990 C  CA   . ARG A 1 251 ? -6.040  40.677 50.795 1.00 25.21 ? 281  ARG A CA   1 
ATOM   1991 C  C    . ARG A 1 251 ? -6.204  42.185 50.694 1.00 22.37 ? 281  ARG A C    1 
ATOM   1992 O  O    . ARG A 1 251 ? -6.629  42.831 51.645 1.00 26.22 ? 281  ARG A O    1 
ATOM   1993 C  CB   . ARG A 1 251 ? -4.716  40.331 51.474 1.00 27.74 ? 281  ARG A CB   1 
ATOM   1994 C  CG   . ARG A 1 251 ? -4.645  38.892 51.933 1.00 33.64 ? 281  ARG A CG   1 
ATOM   1995 C  CD   . ARG A 1 251 ? -5.887  38.534 52.736 1.00 39.71 ? 281  ARG A CD   1 
ATOM   1996 N  NE   . ARG A 1 251 ? -5.741  37.265 53.433 1.00 44.42 ? 281  ARG A NE   1 
ATOM   1997 C  CZ   . ARG A 1 251 ? -6.399  36.157 53.118 1.00 51.03 ? 281  ARG A CZ   1 
ATOM   1998 N  NH1  . ARG A 1 251 ? -7.260  36.149 52.110 1.00 52.00 ? 281  ARG A NH1  1 
ATOM   1999 N  NH2  . ARG A 1 251 ? -6.189  35.050 53.819 1.00 59.18 ? 281  ARG A NH2  1 
ATOM   2000 N  N    . ASN A 1 252 ? -5.838  42.749 49.554 1.00 22.87 ? 282  ASN A N    1 
ATOM   2001 C  CA   . ASN A 1 252 ? -5.967  44.184 49.336 1.00 19.35 ? 282  ASN A CA   1 
ATOM   2002 C  C    . ASN A 1 252 ? -7.391  44.538 48.890 1.00 21.08 ? 282  ASN A C    1 
ATOM   2003 O  O    . ASN A 1 252 ? -7.916  43.961 47.931 1.00 24.82 ? 282  ASN A O    1 
ATOM   2004 C  CB   . ASN A 1 252 ? -4.966  44.634 48.288 1.00 15.10 ? 282  ASN A CB   1 
ATOM   2005 C  CG   . ASN A 1 252 ? -4.991  46.112 48.076 1.00 18.48 ? 282  ASN A CG   1 
ATOM   2006 O  OD1  . ASN A 1 252 ? -5.820  46.626 47.326 1.00 18.81 ? 282  ASN A OD1  1 
ATOM   2007 N  ND2  . ASN A 1 252 ? -4.097  46.820 48.755 1.00 18.84 ? 282  ASN A ND2  1 
ATOM   2008 N  N    . GLN A 1 253 ? -8.003  45.502 49.570 1.00 20.63 ? 283  GLN A N    1 
ATOM   2009 C  CA   . GLN A 1 253 ? -9.372  45.927 49.271 1.00 18.08 ? 283  GLN A CA   1 
ATOM   2010 C  C    . GLN A 1 253 ? -9.603  46.491 47.865 1.00 17.11 ? 283  GLN A C    1 
ATOM   2011 O  O    . GLN A 1 253 ? -10.617 46.178 47.227 1.00 17.75 ? 283  GLN A O    1 
ATOM   2012 C  CB   . GLN A 1 253 ? -9.858  46.935 50.321 1.00 14.75 ? 283  GLN A CB   1 
ATOM   2013 C  CG   . GLN A 1 253 ? -11.333 47.319 50.199 1.00 12.82 ? 283  GLN A CG   1 
ATOM   2014 C  CD   . GLN A 1 253 ? -12.280 46.186 50.574 1.00 20.54 ? 283  GLN A CD   1 
ATOM   2015 O  OE1  . GLN A 1 253 ? -12.343 45.774 51.733 1.00 24.52 ? 283  GLN A OE1  1 
ATOM   2016 N  NE2  . GLN A 1 253 ? -13.027 45.685 49.601 1.00 18.99 ? 283  GLN A NE2  1 
ATOM   2017 N  N    . SER A 1 254 ? -8.703  47.348 47.392 1.00 16.38 ? 284  SER A N    1 
ATOM   2018 C  CA   . SER A 1 254 ? -8.864  47.918 46.060 1.00 17.83 ? 284  SER A CA   1 
ATOM   2019 C  C    . SER A 1 254 ? -8.708  46.819 44.995 1.00 19.88 ? 284  SER A C    1 
ATOM   2020 O  O    . SER A 1 254 ? -9.397  46.832 43.970 1.00 21.35 ? 284  SER A O    1 
ATOM   2021 C  CB   . SER A 1 254 ? -7.904  49.096 45.830 1.00 12.35 ? 284  SER A CB   1 
ATOM   2022 O  OG   . SER A 1 254 ? -6.550  48.730 45.983 1.00 12.22 ? 284  SER A OG   1 
ATOM   2023 N  N    . VAL A 1 255 ? -7.843  45.844 45.270 1.00 22.26 ? 285  VAL A N    1 
ATOM   2024 C  CA   . VAL A 1 255 ? -7.637  44.716 44.358 1.00 21.43 ? 285  VAL A CA   1 
ATOM   2025 C  C    . VAL A 1 255 ? -8.884  43.831 44.350 1.00 20.26 ? 285  VAL A C    1 
ATOM   2026 O  O    . VAL A 1 255 ? -9.322  43.361 43.295 1.00 19.53 ? 285  VAL A O    1 
ATOM   2027 C  CB   . VAL A 1 255 ? -6.432  43.846 44.776 1.00 20.14 ? 285  VAL A CB   1 
ATOM   2028 C  CG1  . VAL A 1 255 ? -6.360  42.589 43.906 1.00 17.90 ? 285  VAL A CG1  1 
ATOM   2029 C  CG2  . VAL A 1 255 ? -5.145  44.635 44.644 1.00 21.35 ? 285  VAL A CG2  1 
ATOM   2030 N  N    . PHE A 1 256 ? -9.454  43.600 45.528 1.00 18.65 ? 286  PHE A N    1 
ATOM   2031 C  CA   . PHE A 1 256 ? -10.642 42.769 45.622 1.00 15.32 ? 286  PHE A CA   1 
ATOM   2032 C  C    . PHE A 1 256 ? -11.783 43.351 44.796 1.00 18.35 ? 286  PHE A C    1 
ATOM   2033 O  O    . PHE A 1 256 ? -12.394 42.640 44.000 1.00 18.09 ? 286  PHE A O    1 
ATOM   2034 C  CB   . PHE A 1 256 ? -11.085 42.583 47.074 1.00 12.06 ? 286  PHE A CB   1 
ATOM   2035 C  CG   . PHE A 1 256 ? -12.243 41.639 47.228 1.00 8.48  ? 286  PHE A CG   1 
ATOM   2036 C  CD1  . PHE A 1 256 ? -12.028 40.271 47.300 1.00 7.83  ? 286  PHE A CD1  1 
ATOM   2037 C  CD2  . PHE A 1 256 ? -13.552 42.117 47.244 1.00 10.48 ? 286  PHE A CD2  1 
ATOM   2038 C  CE1  . PHE A 1 256 ? -13.086 39.392 47.376 1.00 12.30 ? 286  PHE A CE1  1 
ATOM   2039 C  CE2  . PHE A 1 256 ? -14.630 41.243 47.321 1.00 9.92  ? 286  PHE A CE2  1 
ATOM   2040 C  CZ   . PHE A 1 256 ? -14.396 39.876 47.387 1.00 13.10 ? 286  PHE A CZ   1 
ATOM   2041 N  N    . ASN A 1 257 ? -12.058 44.640 44.982 1.00 20.27 ? 287  ASN A N    1 
ATOM   2042 C  CA   . ASN A 1 257 ? -13.135 45.320 44.254 1.00 22.11 ? 287  ASN A CA   1 
ATOM   2043 C  C    . ASN A 1 257 ? -12.850 45.254 42.761 1.00 21.51 ? 287  ASN A C    1 
ATOM   2044 O  O    . ASN A 1 257 ? -13.753 45.038 41.943 1.00 19.80 ? 287  ASN A O    1 
ATOM   2045 C  CB   . ASN A 1 257 ? -13.236 46.789 44.678 1.00 21.15 ? 287  ASN A CB   1 
ATOM   2046 C  CG   . ASN A 1 257 ? -13.580 46.960 46.145 1.00 20.91 ? 287  ASN A CG   1 
ATOM   2047 O  OD1  . ASN A 1 257 ? -13.611 45.998 46.912 1.00 21.69 ? 287  ASN A OD1  1 
ATOM   2048 N  ND2  . ASN A 1 257 ? -13.815 48.201 46.550 1.00 19.14 ? 287  ASN A ND2  1 
ATOM   2049 N  N    . PHE A 1 258 ? -11.580 45.443 42.419 1.00 20.77 ? 288  PHE A N    1 
ATOM   2050 C  CA   . PHE A 1 258 ? -11.136 45.409 41.034 1.00 22.41 ? 288  PHE A CA   1 
ATOM   2051 C  C    . PHE A 1 258 ? -11.479 44.061 40.371 1.00 21.83 ? 288  PHE A C    1 
ATOM   2052 O  O    . PHE A 1 258 ? -12.106 44.012 39.311 1.00 18.81 ? 288  PHE A O    1 
ATOM   2053 C  CB   . PHE A 1 258 ? -9.627  45.680 40.985 1.00 20.61 ? 288  PHE A CB   1 
ATOM   2054 C  CG   . PHE A 1 258 ? -9.044  45.671 39.598 1.00 24.84 ? 288  PHE A CG   1 
ATOM   2055 C  CD1  . PHE A 1 258 ? -9.370  46.663 38.682 1.00 24.43 ? 288  PHE A CD1  1 
ATOM   2056 C  CD2  . PHE A 1 258 ? -8.169  44.662 39.206 1.00 24.93 ? 288  PHE A CD2  1 
ATOM   2057 C  CE1  . PHE A 1 258 ? -8.832  46.649 37.403 1.00 23.36 ? 288  PHE A CE1  1 
ATOM   2058 C  CE2  . PHE A 1 258 ? -7.628  44.646 37.926 1.00 22.51 ? 288  PHE A CE2  1 
ATOM   2059 C  CZ   . PHE A 1 258 ? -7.961  45.638 37.025 1.00 20.95 ? 288  PHE A CZ   1 
ATOM   2060 N  N    . CYS A 1 259 ? -11.123 42.972 41.037 1.00 18.50 ? 289  CYS A N    1 
ATOM   2061 C  CA   . CYS A 1 259 ? -11.364 41.647 40.502 1.00 18.87 ? 289  CYS A CA   1 
ATOM   2062 C  C    . CYS A 1 259 ? -12.790 41.141 40.642 1.00 18.11 ? 289  CYS A C    1 
ATOM   2063 O  O    . CYS A 1 259 ? -13.323 40.531 39.723 1.00 22.88 ? 289  CYS A O    1 
ATOM   2064 C  CB   . CYS A 1 259 ? -10.398 40.643 41.146 1.00 21.08 ? 289  CYS A CB   1 
ATOM   2065 S  SG   . CYS A 1 259 ? -8.634  40.991 40.885 1.00 24.36 ? 289  CYS A SG   1 
ATOM   2066 N  N    . ALA A 1 260 ? -13.405 41.387 41.790 1.00 22.31 ? 290  ALA A N    1 
ATOM   2067 C  CA   . ALA A 1 260 ? -14.757 40.910 42.061 1.00 20.21 ? 290  ALA A CA   1 
ATOM   2068 C  C    . ALA A 1 260 ? -15.855 41.514 41.204 1.00 18.61 ? 290  ALA A C    1 
ATOM   2069 O  O    . ALA A 1 260 ? -16.814 40.822 40.843 1.00 16.78 ? 290  ALA A O    1 
ATOM   2070 C  CB   . ALA A 1 260 ? -15.096 41.095 43.543 1.00 22.74 ? 290  ALA A CB   1 
ATOM   2071 N  N    . ILE A 1 261 ? -15.736 42.800 40.893 1.00 17.18 ? 291  ILE A N    1 
ATOM   2072 C  CA   . ILE A 1 261 ? -16.763 43.462 40.108 1.00 19.69 ? 291  ILE A CA   1 
ATOM   2073 C  C    . ILE A 1 261 ? -17.041 42.776 38.767 1.00 18.71 ? 291  ILE A C    1 
ATOM   2074 O  O    . ILE A 1 261 ? -18.172 42.353 38.525 1.00 22.02 ? 291  ILE A O    1 
ATOM   2075 C  CB   . ILE A 1 261 ? -16.508 44.989 39.984 1.00 19.50 ? 291  ILE A CB   1 
ATOM   2076 C  CG1  . ILE A 1 261 ? -16.756 45.654 41.346 1.00 18.72 ? 291  ILE A CG1  1 
ATOM   2077 C  CG2  . ILE A 1 261 ? -17.394 45.607 38.892 1.00 17.61 ? 291  ILE A CG2  1 
ATOM   2078 C  CD1  . ILE A 1 261 ? -16.536 47.167 41.366 1.00 15.71 ? 291  ILE A CD1  1 
ATOM   2079 N  N    . PRO A 1 262 ? -16.012 42.590 37.916 1.00 16.98 ? 292  PRO A N    1 
ATOM   2080 C  CA   . PRO A 1 262 ? -16.241 41.933 36.625 1.00 17.80 ? 292  PRO A CA   1 
ATOM   2081 C  C    . PRO A 1 262 ? -16.799 40.506 36.740 1.00 16.74 ? 292  PRO A C    1 
ATOM   2082 O  O    . PRO A 1 262 ? -17.667 40.112 35.960 1.00 17.74 ? 292  PRO A O    1 
ATOM   2083 C  CB   . PRO A 1 262 ? -14.845 41.941 35.993 1.00 16.86 ? 292  PRO A CB   1 
ATOM   2084 C  CG   . PRO A 1 262 ? -14.260 43.197 36.510 1.00 16.30 ? 292  PRO A CG   1 
ATOM   2085 C  CD   . PRO A 1 262 ? -14.638 43.110 37.979 1.00 19.48 ? 292  PRO A CD   1 
ATOM   2086 N  N    . GLN A 1 263 ? -16.329 39.750 37.730 1.00 15.08 ? 293  GLN A N    1 
ATOM   2087 C  CA   . GLN A 1 263 ? -16.792 38.378 37.918 1.00 14.34 ? 293  GLN A CA   1 
ATOM   2088 C  C    . GLN A 1 263 ? -18.256 38.326 38.336 1.00 17.96 ? 293  GLN A C    1 
ATOM   2089 O  O    . GLN A 1 263 ? -18.974 37.394 37.979 1.00 24.04 ? 293  GLN A O    1 
ATOM   2090 C  CB   . GLN A 1 263 ? -15.923 37.641 38.931 1.00 13.41 ? 293  GLN A CB   1 
ATOM   2091 C  CG   . GLN A 1 263 ? -14.451 37.566 38.560 1.00 17.59 ? 293  GLN A CG   1 
ATOM   2092 C  CD   . GLN A 1 263 ? -14.168 36.685 37.336 1.00 23.08 ? 293  GLN A CD   1 
ATOM   2093 O  OE1  . GLN A 1 263 ? -14.915 35.756 37.032 1.00 18.93 ? 293  GLN A OE1  1 
ATOM   2094 N  NE2  . GLN A 1 263 ? -13.071 36.973 36.642 1.00 20.36 ? 293  GLN A NE2  1 
ATOM   2095 N  N    . VAL A 1 264 ? -18.712 39.329 39.079 1.00 18.27 ? 294  VAL A N    1 
ATOM   2096 C  CA   . VAL A 1 264 ? -20.113 39.368 39.505 1.00 19.12 ? 294  VAL A CA   1 
ATOM   2097 C  C    . VAL A 1 264 ? -20.999 39.794 38.327 1.00 20.13 ? 294  VAL A C    1 
ATOM   2098 O  O    . VAL A 1 264 ? -22.096 39.251 38.114 1.00 15.71 ? 294  VAL A O    1 
ATOM   2099 C  CB   . VAL A 1 264 ? -20.297 40.327 40.708 1.00 18.87 ? 294  VAL A CB   1 
ATOM   2100 C  CG1  . VAL A 1 264 ? -21.750 40.704 40.870 1.00 24.71 ? 294  VAL A CG1  1 
ATOM   2101 C  CG2  . VAL A 1 264 ? -19.803 39.651 41.979 1.00 19.32 ? 294  VAL A CG2  1 
ATOM   2102 N  N    . MET A 1 265 ? -20.497 40.754 37.554 1.00 18.31 ? 295  MET A N    1 
ATOM   2103 C  CA   . MET A 1 265 ? -21.200 41.257 36.385 1.00 18.03 ? 295  MET A CA   1 
ATOM   2104 C  C    . MET A 1 265 ? -21.291 40.150 35.334 1.00 19.57 ? 295  MET A C    1 
ATOM   2105 O  O    . MET A 1 265 ? -22.274 40.067 34.591 1.00 16.15 ? 295  MET A O    1 
ATOM   2106 C  CB   . MET A 1 265 ? -20.465 42.464 35.812 1.00 24.63 ? 295  MET A CB   1 
ATOM   2107 C  CG   . MET A 1 265 ? -20.513 43.698 36.694 1.00 27.18 ? 295  MET A CG   1 
ATOM   2108 S  SD   . MET A 1 265 ? -19.628 45.066 35.930 1.00 44.71 ? 295  MET A SD   1 
ATOM   2109 C  CE   . MET A 1 265 ? -20.945 45.842 34.959 1.00 38.39 ? 295  MET A CE   1 
ATOM   2110 N  N    . ALA A 1 266 ? -20.272 39.295 35.290 1.00 15.25 ? 296  ALA A N    1 
ATOM   2111 C  CA   . ALA A 1 266 ? -20.244 38.186 34.348 1.00 14.19 ? 296  ALA A CA   1 
ATOM   2112 C  C    . ALA A 1 266 ? -21.342 37.186 34.659 1.00 16.51 ? 296  ALA A C    1 
ATOM   2113 O  O    . ALA A 1 266 ? -22.142 36.851 33.787 1.00 19.92 ? 296  ALA A O    1 
ATOM   2114 C  CB   . ALA A 1 266 ? -18.896 37.499 34.375 1.00 15.25 ? 296  ALA A CB   1 
ATOM   2115 N  N    . ILE A 1 267 ? -21.386 36.701 35.897 1.00 18.59 ? 297  ILE A N    1 
ATOM   2116 C  CA   . ILE A 1 267 ? -22.406 35.727 36.289 1.00 19.53 ? 297  ILE A CA   1 
ATOM   2117 C  C    . ILE A 1 267 ? -23.805 36.312 36.116 1.00 19.82 ? 297  ILE A C    1 
ATOM   2118 O  O    . ILE A 1 267 ? -24.747 35.588 35.780 1.00 23.02 ? 297  ILE A O    1 
ATOM   2119 C  CB   . ILE A 1 267 ? -22.224 35.231 37.739 1.00 23.73 ? 297  ILE A CB   1 
ATOM   2120 C  CG1  . ILE A 1 267 ? -20.744 34.987 38.017 1.00 31.90 ? 297  ILE A CG1  1 
ATOM   2121 C  CG2  . ILE A 1 267 ? -22.971 33.904 37.940 1.00 23.99 ? 297  ILE A CG2  1 
ATOM   2122 C  CD1  . ILE A 1 267 ? -20.464 34.351 39.341 1.00 33.93 ? 297  ILE A CD1  1 
ATOM   2123 N  N    . ALA A 1 268 ? -23.943 37.616 36.342 1.00 19.19 ? 298  ALA A N    1 
ATOM   2124 C  CA   . ALA A 1 268 ? -25.231 38.283 36.169 1.00 21.36 ? 298  ALA A CA   1 
ATOM   2125 C  C    . ALA A 1 268 ? -25.622 38.175 34.688 1.00 21.31 ? 298  ALA A C    1 
ATOM   2126 O  O    . ALA A 1 268 ? -26.777 37.890 34.344 1.00 19.73 ? 298  ALA A O    1 
ATOM   2127 C  CB   . ALA A 1 268 ? -25.127 39.755 36.583 1.00 20.84 ? 298  ALA A CB   1 
ATOM   2128 N  N    . THR A 1 269 ? -24.644 38.415 33.820 1.00 20.39 ? 299  THR A N    1 
ATOM   2129 C  CA   . THR A 1 269 ? -24.841 38.338 32.386 1.00 18.72 ? 299  THR A CA   1 
ATOM   2130 C  C    . THR A 1 269 ? -25.252 36.924 31.978 1.00 19.10 ? 299  THR A C    1 
ATOM   2131 O  O    . THR A 1 269 ? -26.280 36.751 31.320 1.00 22.24 ? 299  THR A O    1 
ATOM   2132 C  CB   . THR A 1 269 ? -23.579 38.784 31.651 1.00 16.94 ? 299  THR A CB   1 
ATOM   2133 O  OG1  . THR A 1 269 ? -23.332 40.149 31.988 1.00 16.36 ? 299  THR A OG1  1 
ATOM   2134 C  CG2  . THR A 1 269 ? -23.741 38.660 30.127 1.00 18.16 ? 299  THR A CG2  1 
ATOM   2135 N  N    . LEU A 1 270 ? -24.504 35.915 32.422 1.00 16.29 ? 300  LEU A N    1 
ATOM   2136 C  CA   . LEU A 1 270 ? -24.840 34.530 32.099 1.00 18.04 ? 300  LEU A CA   1 
ATOM   2137 C  C    . LEU A 1 270 ? -26.263 34.224 32.540 1.00 21.68 ? 300  LEU A C    1 
ATOM   2138 O  O    . LEU A 1 270 ? -27.047 33.639 31.781 1.00 23.33 ? 300  LEU A O    1 
ATOM   2139 C  CB   . LEU A 1 270 ? -23.884 33.550 32.774 1.00 18.33 ? 300  LEU A CB   1 
ATOM   2140 C  CG   . LEU A 1 270 ? -22.469 33.466 32.195 1.00 24.94 ? 300  LEU A CG   1 
ATOM   2141 C  CD1  . LEU A 1 270 ? -21.671 32.437 32.966 1.00 20.35 ? 300  LEU A CD1  1 
ATOM   2142 C  CD2  . LEU A 1 270 ? -22.508 33.104 30.713 1.00 23.65 ? 300  LEU A CD2  1 
ATOM   2143 N  N    . ALA A 1 271 ? -26.608 34.664 33.747 1.00 20.24 ? 301  ALA A N    1 
ATOM   2144 C  CA   . ALA A 1 271 ? -27.947 34.437 34.284 1.00 18.94 ? 301  ALA A CA   1 
ATOM   2145 C  C    . ALA A 1 271 ? -29.009 35.099 33.408 1.00 18.34 ? 301  ALA A C    1 
ATOM   2146 O  O    . ALA A 1 271 ? -30.099 34.565 33.234 1.00 21.31 ? 301  ALA A O    1 
ATOM   2147 C  CB   . ALA A 1 271 ? -28.039 34.946 35.720 1.00 13.09 ? 301  ALA A CB   1 
ATOM   2148 N  N    . ALA A 1 272 ? -28.693 36.259 32.851 1.00 17.10 ? 302  ALA A N    1 
ATOM   2149 C  CA   . ALA A 1 272 ? -29.651 36.956 32.005 1.00 19.52 ? 302  ALA A CA   1 
ATOM   2150 C  C    . ALA A 1 272 ? -29.758 36.294 30.626 1.00 18.49 ? 302  ALA A C    1 
ATOM   2151 O  O    . ALA A 1 272 ? -30.842 36.208 30.047 1.00 17.59 ? 302  ALA A O    1 
ATOM   2152 C  CB   . ALA A 1 272 ? -29.254 38.436 31.861 1.00 18.40 ? 302  ALA A CB   1 
ATOM   2153 N  N    . CYS A 1 273 ? -28.623 35.835 30.114 1.00 17.69 ? 303  CYS A N    1 
ATOM   2154 C  CA   . CYS A 1 273 ? -28.542 35.199 28.802 1.00 20.09 ? 303  CYS A CA   1 
ATOM   2155 C  C    . CYS A 1 273 ? -29.044 33.756 28.741 1.00 21.70 ? 303  CYS A C    1 
ATOM   2156 O  O    . CYS A 1 273 ? -29.460 33.277 27.673 1.00 20.47 ? 303  CYS A O    1 
ATOM   2157 C  CB   . CYS A 1 273 ? -27.096 35.234 28.305 1.00 14.17 ? 303  CYS A CB   1 
ATOM   2158 S  SG   . CYS A 1 273 ? -26.487 36.866 27.880 1.00 21.58 ? 303  CYS A SG   1 
ATOM   2159 N  N    . TYR A 1 274 ? -29.000 33.066 29.877 1.00 22.40 ? 304  TYR A N    1 
ATOM   2160 C  CA   . TYR A 1 274 ? -29.414 31.667 29.930 1.00 21.46 ? 304  TYR A CA   1 
ATOM   2161 C  C    . TYR A 1 274 ? -30.805 31.373 29.385 1.00 20.87 ? 304  TYR A C    1 
ATOM   2162 O  O    . TYR A 1 274 ? -31.788 31.922 29.876 1.00 20.65 ? 304  TYR A O    1 
ATOM   2163 C  CB   . TYR A 1 274 ? -29.300 31.108 31.351 1.00 17.02 ? 304  TYR A CB   1 
ATOM   2164 C  CG   . TYR A 1 274 ? -29.672 29.654 31.401 1.00 16.54 ? 304  TYR A CG   1 
ATOM   2165 C  CD1  . TYR A 1 274 ? -28.813 28.685 30.833 1.00 21.88 ? 304  TYR A CD1  1 
ATOM   2166 C  CD2  . TYR A 1 274 ? -30.908 29.236 31.910 1.00 16.41 ? 304  TYR A CD2  1 
ATOM   2167 C  CE1  . TYR A 1 274 ? -29.176 27.346 30.765 1.00 17.69 ? 304  TYR A CE1  1 
ATOM   2168 C  CE2  . TYR A 1 274 ? -31.293 27.898 31.848 1.00 17.75 ? 304  TYR A CE2  1 
ATOM   2169 C  CZ   . TYR A 1 274 ? -30.431 26.958 31.281 1.00 18.03 ? 304  TYR A CZ   1 
ATOM   2170 O  OH   . TYR A 1 274 ? -30.776 25.625 31.236 1.00 18.25 ? 304  TYR A OH   1 
ATOM   2171 N  N    . ASN A 1 275 ? -30.876 30.492 28.382 1.00 21.89 ? 305  ASN A N    1 
ATOM   2172 C  CA   . ASN A 1 275 ? -32.146 30.079 27.769 1.00 20.66 ? 305  ASN A CA   1 
ATOM   2173 C  C    . ASN A 1 275 ? -32.922 31.305 27.285 1.00 19.03 ? 305  ASN A C    1 
ATOM   2174 O  O    . ASN A 1 275 ? -34.151 31.319 27.262 1.00 14.65 ? 305  ASN A O    1 
ATOM   2175 C  CB   . ASN A 1 275 ? -32.972 29.299 28.807 1.00 22.32 ? 305  ASN A CB   1 
ATOM   2176 C  CG   . ASN A 1 275 ? -34.087 28.483 28.189 1.00 25.77 ? 305  ASN A CG   1 
ATOM   2177 O  OD1  . ASN A 1 275 ? -33.854 27.651 27.305 1.00 30.86 ? 305  ASN A OD1  1 
ATOM   2178 N  ND2  . ASN A 1 275 ? -35.300 28.686 28.674 1.00 25.25 ? 305  ASN A ND2  1 
ATOM   2179 N  N    . ASN A 1 276 ? -32.182 32.332 26.890 1.00 20.46 ? 306  ASN A N    1 
ATOM   2180 C  CA   . ASN A 1 276 ? -32.772 33.586 26.450 1.00 20.12 ? 306  ASN A CA   1 
ATOM   2181 C  C    . ASN A 1 276 ? -32.651 33.773 24.941 1.00 20.45 ? 306  ASN A C    1 
ATOM   2182 O  O    . ASN A 1 276 ? -31.565 34.024 24.420 1.00 17.04 ? 306  ASN A O    1 
ATOM   2183 C  CB   . ASN A 1 276 ? -32.074 34.735 27.180 1.00 20.84 ? 306  ASN A CB   1 
ATOM   2184 C  CG   . ASN A 1 276 ? -32.794 36.055 27.031 1.00 25.84 ? 306  ASN A CG   1 
ATOM   2185 O  OD1  . ASN A 1 276 ? -33.707 36.205 26.213 1.00 29.05 ? 306  ASN A OD1  1 
ATOM   2186 N  ND2  . ASN A 1 276 ? -32.371 37.034 27.809 1.00 26.14 ? 306  ASN A ND2  1 
ATOM   2187 N  N    . GLN A 1 277 ? -33.776 33.679 24.242 1.00 20.98 ? 307  GLN A N    1 
ATOM   2188 C  CA   . GLN A 1 277 ? -33.779 33.843 22.792 1.00 22.73 ? 307  GLN A CA   1 
ATOM   2189 C  C    . GLN A 1 277 ? -33.247 35.211 22.341 1.00 22.75 ? 307  GLN A C    1 
ATOM   2190 O  O    . GLN A 1 277 ? -32.637 35.330 21.275 1.00 22.37 ? 307  GLN A O    1 
ATOM   2191 C  CB   . GLN A 1 277 ? -35.191 33.633 22.238 1.00 24.34 ? 307  GLN A CB   1 
ATOM   2192 C  CG   . GLN A 1 277 ? -35.731 32.215 22.403 1.00 31.93 ? 307  GLN A CG   1 
ATOM   2193 C  CD   . GLN A 1 277 ? -37.102 32.036 21.786 1.00 33.90 ? 307  GLN A CD   1 
ATOM   2194 O  OE1  . GLN A 1 277 ? -37.756 33.007 21.402 1.00 41.76 ? 307  GLN A OE1  1 
ATOM   2195 N  NE2  . GLN A 1 277 ? -37.531 30.791 21.656 1.00 36.40 ? 307  GLN A NE2  1 
ATOM   2196 N  N    . GLN A 1 278 ? -33.437 36.230 23.175 1.00 22.39 ? 308  GLN A N    1 
ATOM   2197 C  CA   . GLN A 1 278 ? -32.997 37.581 22.843 1.00 20.17 ? 308  GLN A CA   1 
ATOM   2198 C  C    . GLN A 1 278 ? -31.510 37.711 22.560 1.00 17.25 ? 308  GLN A C    1 
ATOM   2199 O  O    . GLN A 1 278 ? -31.079 38.672 21.928 1.00 17.13 ? 308  GLN A O    1 
ATOM   2200 C  CB   . GLN A 1 278 ? -33.428 38.558 23.935 1.00 23.62 ? 308  GLN A CB   1 
ATOM   2201 C  CG   . GLN A 1 278 ? -34.932 38.735 23.991 1.00 29.79 ? 308  GLN A CG   1 
ATOM   2202 C  CD   . GLN A 1 278 ? -35.498 39.198 22.656 1.00 33.74 ? 308  GLN A CD   1 
ATOM   2203 O  OE1  . GLN A 1 278 ? -35.246 40.315 22.213 1.00 37.81 ? 308  GLN A OE1  1 
ATOM   2204 N  NE2  . GLN A 1 278 ? -36.227 38.324 21.991 1.00 36.85 ? 308  GLN A NE2  1 
ATOM   2205 N  N    . VAL A 1 279 ? -30.727 36.740 23.012 1.00 16.81 ? 309  VAL A N    1 
ATOM   2206 C  CA   . VAL A 1 279 ? -29.286 36.742 22.773 1.00 19.97 ? 309  VAL A CA   1 
ATOM   2207 C  C    . VAL A 1 279 ? -28.991 36.744 21.270 1.00 19.41 ? 309  VAL A C    1 
ATOM   2208 O  O    . VAL A 1 279 ? -27.985 37.298 20.825 1.00 19.98 ? 309  VAL A O    1 
ATOM   2209 C  CB   . VAL A 1 279 ? -28.614 35.486 23.422 1.00 22.00 ? 309  VAL A CB   1 
ATOM   2210 C  CG1  . VAL A 1 279 ? -27.261 35.182 22.768 1.00 20.27 ? 309  VAL A CG1  1 
ATOM   2211 C  CG2  . VAL A 1 279 ? -28.435 35.701 24.921 1.00 17.68 ? 309  VAL A CG2  1 
ATOM   2212 N  N    . PHE A 1 280 ? -29.879 36.142 20.486 1.00 20.31 ? 310  PHE A N    1 
ATOM   2213 C  CA   . PHE A 1 280 ? -29.673 36.066 19.046 1.00 23.83 ? 310  PHE A CA   1 
ATOM   2214 C  C    . PHE A 1 280 ? -30.336 37.175 18.231 1.00 27.34 ? 310  PHE A C    1 
ATOM   2215 O  O    . PHE A 1 280 ? -30.126 37.284 17.024 1.00 29.98 ? 310  PHE A O    1 
ATOM   2216 C  CB   . PHE A 1 280 ? -30.082 34.680 18.553 1.00 23.11 ? 310  PHE A CB   1 
ATOM   2217 C  CG   . PHE A 1 280 ? -29.356 33.567 19.257 1.00 20.27 ? 310  PHE A CG   1 
ATOM   2218 C  CD1  . PHE A 1 280 ? -28.022 33.293 18.955 1.00 15.37 ? 310  PHE A CD1  1 
ATOM   2219 C  CD2  . PHE A 1 280 ? -29.977 32.842 20.269 1.00 18.36 ? 310  PHE A CD2  1 
ATOM   2220 C  CE1  . PHE A 1 280 ? -27.311 32.318 19.657 1.00 13.91 ? 310  PHE A CE1  1 
ATOM   2221 C  CE2  . PHE A 1 280 ? -29.275 31.865 20.980 1.00 20.23 ? 310  PHE A CE2  1 
ATOM   2222 C  CZ   . PHE A 1 280 ? -27.936 31.603 20.670 1.00 17.22 ? 310  PHE A CZ   1 
ATOM   2223 N  N    . LYS A 1 281 ? -31.114 38.017 18.899 1.00 30.43 ? 311  LYS A N    1 
ATOM   2224 C  CA   . LYS A 1 281 ? -31.783 39.117 18.226 1.00 34.03 ? 311  LYS A CA   1 
ATOM   2225 C  C    . LYS A 1 281 ? -31.082 40.433 18.542 1.00 36.02 ? 311  LYS A C    1 
ATOM   2226 O  O    . LYS A 1 281 ? -31.222 41.406 17.806 1.00 43.65 ? 311  LYS A O    1 
ATOM   2227 C  CB   . LYS A 1 281 ? -33.256 39.176 18.625 1.00 34.58 ? 311  LYS A CB   1 
ATOM   2228 C  CG   . LYS A 1 281 ? -33.991 37.860 18.426 1.00 41.10 ? 311  LYS A CG   1 
ATOM   2229 C  CD   . LYS A 1 281 ? -35.482 38.024 18.626 1.00 53.01 ? 311  LYS A CD   1 
ATOM   2230 C  CE   . LYS A 1 281 ? -36.230 36.746 18.286 1.00 59.65 ? 311  LYS A CE   1 
ATOM   2231 N  NZ   . LYS A 1 281 ? -37.689 37.008 18.056 1.00 67.32 ? 311  LYS A NZ   1 
ATOM   2232 N  N    . GLY A 1 282 ? -30.308 40.459 19.623 1.00 36.43 ? 312  GLY A N    1 
ATOM   2233 C  CA   . GLY A 1 282 ? -29.596 41.671 19.986 1.00 35.06 ? 312  GLY A CA   1 
ATOM   2234 C  C    . GLY A 1 282 ? -28.827 41.548 21.290 1.00 38.95 ? 312  GLY A C    1 
ATOM   2235 O  O    . GLY A 1 282 ? -28.483 40.448 21.726 1.00 34.14 ? 312  GLY A O    1 
ATOM   2236 N  N    . ALA A 1 283 ? -28.532 42.692 21.898 1.00 42.73 ? 313  ALA A N    1 
ATOM   2237 C  CA   . ALA A 1 283 ? -27.813 42.737 23.165 1.00 47.75 ? 313  ALA A CA   1 
ATOM   2238 C  C    . ALA A 1 283 ? -28.830 42.620 24.304 1.00 50.09 ? 313  ALA A C    1 
ATOM   2239 O  O    . ALA A 1 283 ? -29.829 43.336 24.326 1.00 52.20 ? 313  ALA A O    1 
ATOM   2240 C  CB   . ALA A 1 283 ? -27.036 44.035 23.271 1.00 49.10 ? 313  ALA A CB   1 
ATOM   2241 N  N    . VAL A 1 284 ? -28.578 41.712 25.240 1.00 52.36 ? 314  VAL A N    1 
ATOM   2242 C  CA   . VAL A 1 284 ? -29.485 41.477 26.365 1.00 54.60 ? 314  VAL A CA   1 
ATOM   2243 C  C    . VAL A 1 284 ? -29.222 42.398 27.559 1.00 58.29 ? 314  VAL A C    1 
ATOM   2244 O  O    . VAL A 1 284 ? -28.088 42.501 28.031 1.00 59.91 ? 314  VAL A O    1 
ATOM   2245 C  CB   . VAL A 1 284 ? -29.389 40.001 26.846 1.00 50.77 ? 314  VAL A CB   1 
ATOM   2246 C  CG1  . VAL A 1 284 ? -30.325 39.752 28.013 1.00 50.09 ? 314  VAL A CG1  1 
ATOM   2247 C  CG2  . VAL A 1 284 ? -29.716 39.058 25.715 1.00 47.32 ? 314  VAL A CG2  1 
ATOM   2248 N  N    . LYS A 1 285 ? -30.265 43.071 28.039 1.00 61.73 ? 315  LYS A N    1 
ATOM   2249 C  CA   . LYS A 1 285 ? -30.120 43.951 29.197 1.00 66.86 ? 315  LYS A CA   1 
ATOM   2250 C  C    . LYS A 1 285 ? -30.233 43.144 30.486 1.00 68.37 ? 315  LYS A C    1 
ATOM   2251 O  O    . LYS A 1 285 ? -31.012 42.193 30.568 1.00 68.50 ? 315  LYS A O    1 
ATOM   2252 C  CB   . LYS A 1 285 ? -31.139 45.094 29.171 1.00 69.69 ? 315  LYS A CB   1 
ATOM   2253 C  CG   . LYS A 1 285 ? -30.709 46.270 28.300 1.00 73.17 ? 315  LYS A CG   1 
ATOM   2254 C  CD   . LYS A 1 285 ? -31.590 47.493 28.525 1.00 77.22 ? 315  LYS A CD   1 
ATOM   2255 C  CE   . LYS A 1 285 ? -31.018 48.721 27.826 1.00 79.11 ? 315  LYS A CE   1 
ATOM   2256 N  NZ   . LYS A 1 285 ? -31.820 49.952 28.075 1.00 79.30 ? 315  LYS A NZ   1 
ATOM   2257 N  N    . ILE A 1 286 ? -29.442 43.530 31.480 1.00 70.46 ? 316  ILE A N    1 
ATOM   2258 C  CA   . ILE A 1 286 ? -29.389 42.841 32.766 1.00 72.21 ? 316  ILE A CA   1 
ATOM   2259 C  C    . ILE A 1 286 ? -30.188 43.563 33.853 1.00 72.38 ? 316  ILE A C    1 
ATOM   2260 O  O    . ILE A 1 286 ? -30.122 44.811 33.906 1.00 72.58 ? 316  ILE A O    1 
ATOM   2261 C  CB   . ILE A 1 286 ? -27.920 42.704 33.234 1.00 74.09 ? 316  ILE A CB   1 
ATOM   2262 C  CG1  . ILE A 1 286 ? -27.027 42.345 32.045 1.00 76.43 ? 316  ILE A CG1  1 
ATOM   2263 C  CG2  . ILE A 1 286 ? -27.795 41.624 34.299 1.00 74.14 ? 316  ILE A CG2  1 
ATOM   2264 C  CD1  . ILE A 1 286 ? -25.553 42.470 32.333 1.00 81.02 ? 316  ILE A CD1  1 
ATOM   2265 N  N    . ASP A 1 297 ? -22.377 45.670 46.633 1.00 50.06 ? 327  ASP A N    1 
ATOM   2266 C  CA   . ASP A 1 297 ? -22.229 44.593 47.648 1.00 46.65 ? 327  ASP A CA   1 
ATOM   2267 C  C    . ASP A 1 297 ? -20.979 43.750 47.445 1.00 43.16 ? 327  ASP A C    1 
ATOM   2268 O  O    . ASP A 1 297 ? -20.538 43.078 48.368 1.00 45.22 ? 327  ASP A O    1 
ATOM   2269 C  CB   . ASP A 1 297 ? -23.455 43.673 47.634 1.00 51.30 ? 327  ASP A CB   1 
ATOM   2270 C  CG   . ASP A 1 297 ? -24.626 44.233 48.421 1.00 57.10 ? 327  ASP A CG   1 
ATOM   2271 O  OD1  . ASP A 1 297 ? -24.519 45.348 48.982 1.00 63.61 ? 327  ASP A OD1  1 
ATOM   2272 O  OD2  . ASP A 1 297 ? -25.664 43.541 48.489 1.00 60.42 ? 327  ASP A OD2  1 
ATOM   2273 N  N    . ALA A 1 298 ? -20.397 43.798 46.251 1.00 36.84 ? 328  ALA A N    1 
ATOM   2274 C  CA   . ALA A 1 298 ? -19.211 43.002 45.947 1.00 34.73 ? 328  ALA A CA   1 
ATOM   2275 C  C    . ALA A 1 298 ? -17.915 43.496 46.619 1.00 33.05 ? 328  ALA A C    1 
ATOM   2276 O  O    . ALA A 1 298 ? -16.849 43.502 45.996 1.00 33.04 ? 328  ALA A O    1 
ATOM   2277 C  CB   . ALA A 1 298 ? -19.033 42.904 44.422 1.00 31.40 ? 328  ALA A CB   1 
ATOM   2278 N  N    . THR A 1 299 ? -17.998 43.854 47.900 1.00 30.20 ? 329  THR A N    1 
ATOM   2279 C  CA   . THR A 1 299 ? -16.836 44.360 48.625 1.00 26.74 ? 329  THR A CA   1 
ATOM   2280 C  C    . THR A 1 299 ? -16.216 43.435 49.682 1.00 22.12 ? 329  THR A C    1 
ATOM   2281 O  O    . THR A 1 299 ? -15.192 43.770 50.283 1.00 19.79 ? 329  THR A O    1 
ATOM   2282 C  CB   . THR A 1 299 ? -17.133 45.745 49.209 1.00 30.44 ? 329  THR A CB   1 
ATOM   2283 O  OG1  . THR A 1 299 ? -18.477 45.767 49.710 1.00 35.56 ? 329  THR A OG1  1 
ATOM   2284 C  CG2  . THR A 1 299 ? -16.994 46.805 48.118 1.00 27.98 ? 329  THR A CG2  1 
ATOM   2285 N  N    . ASN A 1 300 ? -16.838 42.282 49.914 1.00 19.23 ? 330  ASN A N    1 
ATOM   2286 C  CA   . ASN A 1 300 ? -16.305 41.293 50.852 1.00 21.73 ? 330  ASN A CA   1 
ATOM   2287 C  C    . ASN A 1 300 ? -16.635 39.909 50.302 1.00 22.36 ? 330  ASN A C    1 
ATOM   2288 O  O    . ASN A 1 300 ? -17.673 39.731 49.662 1.00 25.98 ? 330  ASN A O    1 
ATOM   2289 C  CB   . ASN A 1 300 ? -16.834 41.481 52.301 1.00 18.77 ? 330  ASN A CB   1 
ATOM   2290 C  CG   . ASN A 1 300 ? -18.338 41.296 52.428 1.00 18.50 ? 330  ASN A CG   1 
ATOM   2291 O  OD1  . ASN A 1 300 ? -18.834 40.172 52.543 1.00 20.38 ? 330  ASN A OD1  1 
ATOM   2292 N  ND2  . ASN A 1 300 ? -19.068 42.399 52.434 1.00 20.96 ? 330  ASN A ND2  1 
ATOM   2293 N  N    . MET A 1 301 ? -15.734 38.949 50.511 1.00 23.13 ? 331  MET A N    1 
ATOM   2294 C  CA   . MET A 1 301 ? -15.925 37.584 50.022 1.00 23.41 ? 331  MET A CA   1 
ATOM   2295 C  C    . MET A 1 301 ? -17.258 36.905 50.339 1.00 23.23 ? 331  MET A C    1 
ATOM   2296 O  O    . MET A 1 301 ? -17.850 36.277 49.456 1.00 25.53 ? 331  MET A O    1 
ATOM   2297 C  CB   . MET A 1 301 ? -14.774 36.673 50.450 1.00 27.91 ? 331  MET A CB   1 
ATOM   2298 C  CG   . MET A 1 301 ? -13.715 36.480 49.384 1.00 34.25 ? 331  MET A CG   1 
ATOM   2299 S  SD   . MET A 1 301 ? -14.418 36.129 47.759 1.00 26.57 ? 331  MET A SD   1 
ATOM   2300 C  CE   . MET A 1 301 ? -14.550 34.386 47.775 1.00 34.53 ? 331  MET A CE   1 
ATOM   2301 N  N    . PRO A 1 302 ? -17.717 36.951 51.608 1.00 19.44 ? 332  PRO A N    1 
ATOM   2302 C  CA   . PRO A 1 302 ? -18.997 36.309 51.933 1.00 15.65 ? 332  PRO A CA   1 
ATOM   2303 C  C    . PRO A 1 302 ? -20.151 36.892 51.115 1.00 15.58 ? 332  PRO A C    1 
ATOM   2304 O  O    . PRO A 1 302 ? -21.012 36.152 50.633 1.00 12.38 ? 332  PRO A O    1 
ATOM   2305 C  CB   . PRO A 1 302 ? -19.150 36.593 53.421 1.00 15.86 ? 332  PRO A CB   1 
ATOM   2306 C  CG   . PRO A 1 302 ? -17.735 36.590 53.892 1.00 18.13 ? 332  PRO A CG   1 
ATOM   2307 C  CD   . PRO A 1 302 ? -17.048 37.415 52.837 1.00 14.00 ? 332  PRO A CD   1 
ATOM   2308 N  N    . ALA A 1 303 ? -20.155 38.209 50.936 1.00 14.90 ? 333  ALA A N    1 
ATOM   2309 C  CA   . ALA A 1 303 ? -21.198 38.859 50.146 1.00 17.38 ? 333  ALA A CA   1 
ATOM   2310 C  C    . ALA A 1 303 ? -21.082 38.414 48.676 1.00 17.24 ? 333  ALA A C    1 
ATOM   2311 O  O    . ALA A 1 303 ? -22.073 38.043 48.038 1.00 17.97 ? 333  ALA A O    1 
ATOM   2312 C  CB   . ALA A 1 303 ? -21.076 40.379 50.261 1.00 14.28 ? 333  ALA A CB   1 
ATOM   2313 N  N    . VAL A 1 304 ? -19.863 38.439 48.151 1.00 19.63 ? 334  VAL A N    1 
ATOM   2314 C  CA   . VAL A 1 304 ? -19.615 38.021 46.775 1.00 19.76 ? 334  VAL A CA   1 
ATOM   2315 C  C    . VAL A 1 304 ? -20.129 36.591 46.545 1.00 20.84 ? 334  VAL A C    1 
ATOM   2316 O  O    . VAL A 1 304 ? -20.830 36.330 45.560 1.00 25.63 ? 334  VAL A O    1 
ATOM   2317 C  CB   . VAL A 1 304 ? -18.101 38.138 46.425 1.00 20.54 ? 334  VAL A CB   1 
ATOM   2318 C  CG1  . VAL A 1 304 ? -17.780 37.452 45.094 1.00 18.93 ? 334  VAL A CG1  1 
ATOM   2319 C  CG2  . VAL A 1 304 ? -17.709 39.611 46.356 1.00 18.16 ? 334  VAL A CG2  1 
ATOM   2320 N  N    . LYS A 1 305 ? -19.816 35.677 47.463 1.00 19.60 ? 335  LYS A N    1 
ATOM   2321 C  CA   . LYS A 1 305 ? -20.273 34.292 47.338 1.00 19.65 ? 335  LYS A CA   1 
ATOM   2322 C  C    . LYS A 1 305 ? -21.796 34.228 47.284 1.00 20.08 ? 335  LYS A C    1 
ATOM   2323 O  O    . LYS A 1 305 ? -22.366 33.502 46.472 1.00 23.08 ? 335  LYS A O    1 
ATOM   2324 C  CB   . LYS A 1 305 ? -19.784 33.428 48.503 1.00 18.46 ? 335  LYS A CB   1 
ATOM   2325 C  CG   . LYS A 1 305 ? -18.321 33.048 48.482 1.00 15.99 ? 335  LYS A CG   1 
ATOM   2326 C  CD   . LYS A 1 305 ? -18.073 31.952 49.509 1.00 23.49 ? 335  LYS A CD   1 
ATOM   2327 C  CE   . LYS A 1 305 ? -16.589 31.662 49.707 1.00 27.04 ? 335  LYS A CE   1 
ATOM   2328 N  NZ   . LYS A 1 305 ? -16.374 30.591 50.737 1.00 30.27 ? 335  LYS A NZ   1 
ATOM   2329 N  N    . ALA A 1 306 ? -22.456 34.990 48.149 1.00 20.23 ? 336  ALA A N    1 
ATOM   2330 C  CA   . ALA A 1 306 ? -23.909 35.005 48.181 1.00 15.24 ? 336  ALA A CA   1 
ATOM   2331 C  C    . ALA A 1 306 ? -24.449 35.504 46.854 1.00 14.71 ? 336  ALA A C    1 
ATOM   2332 O  O    . ALA A 1 306 ? -25.400 34.936 46.328 1.00 16.97 ? 336  ALA A O    1 
ATOM   2333 C  CB   . ALA A 1 306 ? -24.424 35.887 49.333 1.00 17.26 ? 336  ALA A CB   1 
ATOM   2334 N  N    . ILE A 1 307 ? -23.853 36.570 46.322 1.00 17.32 ? 337  ILE A N    1 
ATOM   2335 C  CA   . ILE A 1 307 ? -24.284 37.142 45.042 1.00 17.64 ? 337  ILE A CA   1 
ATOM   2336 C  C    . ILE A 1 307 ? -24.203 36.065 43.961 1.00 18.99 ? 337  ILE A C    1 
ATOM   2337 O  O    . ILE A 1 307 ? -25.176 35.809 43.253 1.00 19.19 ? 337  ILE A O    1 
ATOM   2338 C  CB   . ILE A 1 307 ? -23.384 38.330 44.608 1.00 20.57 ? 337  ILE A CB   1 
ATOM   2339 C  CG1  . ILE A 1 307 ? -23.417 39.454 45.653 1.00 24.35 ? 337  ILE A CG1  1 
ATOM   2340 C  CG2  . ILE A 1 307 ? -23.790 38.826 43.229 1.00 15.76 ? 337  ILE A CG2  1 
ATOM   2341 C  CD1  . ILE A 1 307 ? -24.788 40.051 45.904 1.00 29.21 ? 337  ILE A CD1  1 
ATOM   2342 N  N    . ILE A 1 308 ? -23.043 35.419 43.866 1.00 18.34 ? 338  ILE A N    1 
ATOM   2343 C  CA   . ILE A 1 308 ? -22.819 34.360 42.888 1.00 17.88 ? 338  ILE A CA   1 
ATOM   2344 C  C    . ILE A 1 308 ? -23.839 33.237 43.056 1.00 18.04 ? 338  ILE A C    1 
ATOM   2345 O  O    . ILE A 1 308 ? -24.489 32.832 42.094 1.00 21.69 ? 338  ILE A O    1 
ATOM   2346 C  CB   . ILE A 1 308 ? -21.378 33.797 43.000 1.00 17.71 ? 338  ILE A CB   1 
ATOM   2347 C  CG1  . ILE A 1 308 ? -20.368 34.869 42.581 1.00 11.89 ? 338  ILE A CG1  1 
ATOM   2348 C  CG2  . ILE A 1 308 ? -21.225 32.536 42.158 1.00 19.01 ? 338  ILE A CG2  1 
ATOM   2349 C  CD1  . ILE A 1 308 ? -18.907 34.416 42.567 1.00 11.06 ? 338  ILE A CD1  1 
ATOM   2350 N  N    . TYR A 1 309 ? -24.021 32.778 44.288 1.00 19.18 ? 339  TYR A N    1 
ATOM   2351 C  CA   . TYR A 1 309 ? -24.962 31.699 44.567 1.00 19.29 ? 339  TYR A CA   1 
ATOM   2352 C  C    . TYR A 1 309 ? -26.391 32.035 44.169 1.00 22.47 ? 339  TYR A C    1 
ATOM   2353 O  O    . TYR A 1 309 ? -27.101 31.194 43.619 1.00 21.15 ? 339  TYR A O    1 
ATOM   2354 C  CB   . TYR A 1 309 ? -24.901 31.297 46.036 1.00 20.16 ? 339  TYR A CB   1 
ATOM   2355 C  CG   . TYR A 1 309 ? -23.577 30.681 46.453 1.00 22.50 ? 339  TYR A CG   1 
ATOM   2356 C  CD1  . TYR A 1 309 ? -22.896 29.803 45.610 1.00 23.08 ? 339  TYR A CD1  1 
ATOM   2357 C  CD2  . TYR A 1 309 ? -23.018 30.960 47.693 1.00 20.89 ? 339  TYR A CD2  1 
ATOM   2358 C  CE1  . TYR A 1 309 ? -21.701 29.219 45.999 1.00 22.69 ? 339  TYR A CE1  1 
ATOM   2359 C  CE2  . TYR A 1 309 ? -21.824 30.380 48.090 1.00 21.23 ? 339  TYR A CE2  1 
ATOM   2360 C  CZ   . TYR A 1 309 ? -21.172 29.513 47.241 1.00 22.49 ? 339  TYR A CZ   1 
ATOM   2361 O  OH   . TYR A 1 309 ? -20.000 28.911 47.631 1.00 27.04 ? 339  TYR A OH   1 
ATOM   2362 N  N    . GLN A 1 310 ? -26.814 33.266 44.430 1.00 25.81 ? 340  GLN A N    1 
ATOM   2363 C  CA   . GLN A 1 310 ? -28.162 33.668 44.070 1.00 29.46 ? 340  GLN A CA   1 
ATOM   2364 C  C    . GLN A 1 310 ? -28.341 33.589 42.558 1.00 26.62 ? 340  GLN A C    1 
ATOM   2365 O  O    . GLN A 1 310 ? -29.342 33.048 42.079 1.00 25.68 ? 340  GLN A O    1 
ATOM   2366 C  CB   . GLN A 1 310 ? -28.476 35.074 44.584 1.00 35.73 ? 340  GLN A CB   1 
ATOM   2367 C  CG   . GLN A 1 310 ? -29.917 35.499 44.302 1.00 43.91 ? 340  GLN A CG   1 
ATOM   2368 C  CD   . GLN A 1 310 ? -30.928 34.433 44.701 1.00 49.75 ? 340  GLN A CD   1 
ATOM   2369 O  OE1  . GLN A 1 310 ? -31.018 34.051 45.868 1.00 53.13 ? 340  GLN A OE1  1 
ATOM   2370 N  NE2  . GLN A 1 310 ? -31.684 33.938 43.728 1.00 48.25 ? 340  GLN A NE2  1 
ATOM   2371 N  N    . TYR A 1 311 ? -27.361 34.104 41.816 1.00 24.65 ? 341  TYR A N    1 
ATOM   2372 C  CA   . TYR A 1 311 ? -27.396 34.074 40.353 1.00 25.77 ? 341  TYR A CA   1 
ATOM   2373 C  C    . TYR A 1 311 ? -27.422 32.653 39.802 1.00 27.04 ? 341  TYR A C    1 
ATOM   2374 O  O    . TYR A 1 311 ? -28.152 32.375 38.849 1.00 28.68 ? 341  TYR A O    1 
ATOM   2375 C  CB   . TYR A 1 311 ? -26.225 34.856 39.763 1.00 23.21 ? 341  TYR A CB   1 
ATOM   2376 C  CG   . TYR A 1 311 ? -26.500 36.336 39.673 1.00 20.99 ? 341  TYR A CG   1 
ATOM   2377 C  CD1  . TYR A 1 311 ? -27.648 36.807 39.034 1.00 21.03 ? 341  TYR A CD1  1 
ATOM   2378 C  CD2  . TYR A 1 311 ? -25.622 37.265 40.220 1.00 18.77 ? 341  TYR A CD2  1 
ATOM   2379 C  CE1  . TYR A 1 311 ? -27.915 38.165 38.935 1.00 21.33 ? 341  TYR A CE1  1 
ATOM   2380 C  CE2  . TYR A 1 311 ? -25.879 38.631 40.132 1.00 22.86 ? 341  TYR A CE2  1 
ATOM   2381 C  CZ   . TYR A 1 311 ? -27.031 39.072 39.487 1.00 24.10 ? 341  TYR A CZ   1 
ATOM   2382 O  OH   . TYR A 1 311 ? -27.292 40.420 39.386 1.00 31.58 ? 341  TYR A OH   1 
ATOM   2383 N  N    . MET A 1 312 ? -26.659 31.751 40.423 1.00 28.29 ? 342  MET A N    1 
ATOM   2384 C  CA   . MET A 1 312 ? -26.623 30.346 40.008 1.00 29.21 ? 342  MET A CA   1 
ATOM   2385 C  C    . MET A 1 312 ? -28.009 29.726 40.150 1.00 28.95 ? 342  MET A C    1 
ATOM   2386 O  O    . MET A 1 312 ? -28.403 28.872 39.356 1.00 29.98 ? 342  MET A O    1 
ATOM   2387 C  CB   . MET A 1 312 ? -25.626 29.547 40.849 1.00 33.70 ? 342  MET A CB   1 
ATOM   2388 C  CG   . MET A 1 312 ? -24.179 29.969 40.687 1.00 44.32 ? 342  MET A CG   1 
ATOM   2389 S  SD   . MET A 1 312 ? -23.611 30.007 38.966 1.00 56.55 ? 342  MET A SD   1 
ATOM   2390 C  CE   . MET A 1 312 ? -23.364 28.265 38.653 1.00 59.20 ? 342  MET A CE   1 
ATOM   2391 N  N    . GLU A 1 313 ? -28.752 30.157 41.163 1.00 27.93 ? 343  GLU A N    1 
ATOM   2392 C  CA   . GLU A 1 313 ? -30.096 29.643 41.384 1.00 27.70 ? 343  GLU A CA   1 
ATOM   2393 C  C    . GLU A 1 313 ? -31.062 30.153 40.328 1.00 28.74 ? 343  GLU A C    1 
ATOM   2394 O  O    . GLU A 1 313 ? -31.977 29.437 39.916 1.00 25.50 ? 343  GLU A O    1 
ATOM   2395 C  CB   . GLU A 1 313 ? -30.596 30.002 42.783 1.00 28.16 ? 343  GLU A CB   1 
ATOM   2396 C  CG   . GLU A 1 313 ? -29.915 29.199 43.874 1.00 30.67 ? 343  GLU A CG   1 
ATOM   2397 C  CD   . GLU A 1 313 ? -29.932 27.710 43.577 1.00 29.51 ? 343  GLU A CD   1 
ATOM   2398 O  OE1  . GLU A 1 313 ? -31.041 27.140 43.447 1.00 27.95 ? 343  GLU A OE1  1 
ATOM   2399 O  OE2  . GLU A 1 313 ? -28.834 27.126 43.453 1.00 26.83 ? 343  GLU A OE2  1 
ATOM   2400 N  N    . GLU A 1 314 ? -30.848 31.392 39.896 1.00 27.83 ? 344  GLU A N    1 
ATOM   2401 C  CA   . GLU A 1 314 ? -31.674 32.009 38.873 1.00 26.66 ? 344  GLU A CA   1 
ATOM   2402 C  C    . GLU A 1 314 ? -31.577 31.138 37.613 1.00 23.76 ? 344  GLU A C    1 
ATOM   2403 O  O    . GLU A 1 314 ? -32.582 30.844 36.958 1.00 21.93 ? 344  GLU A O    1 
ATOM   2404 C  CB   . GLU A 1 314 ? -31.147 33.412 38.587 1.00 33.72 ? 344  GLU A CB   1 
ATOM   2405 C  CG   . GLU A 1 314 ? -32.199 34.395 38.142 1.00 47.72 ? 344  GLU A CG   1 
ATOM   2406 C  CD   . GLU A 1 314 ? -32.191 35.645 38.995 1.00 57.13 ? 344  GLU A CD   1 
ATOM   2407 O  OE1  . GLU A 1 314 ? -32.308 35.518 40.234 1.00 64.88 ? 344  GLU A OE1  1 
ATOM   2408 O  OE2  . GLU A 1 314 ? -32.054 36.752 38.434 1.00 63.47 ? 344  GLU A OE2  1 
ATOM   2409 N  N    . ILE A 1 315 ? -30.361 30.712 37.288 1.00 19.64 ? 345  ILE A N    1 
ATOM   2410 C  CA   . ILE A 1 315 ? -30.135 29.856 36.129 1.00 19.75 ? 345  ILE A CA   1 
ATOM   2411 C  C    . ILE A 1 315 ? -30.799 28.499 36.376 1.00 21.70 ? 345  ILE A C    1 
ATOM   2412 O  O    . ILE A 1 315 ? -31.598 28.022 35.564 1.00 19.67 ? 345  ILE A O    1 
ATOM   2413 C  CB   . ILE A 1 315 ? -28.617 29.659 35.876 1.00 17.61 ? 345  ILE A CB   1 
ATOM   2414 C  CG1  . ILE A 1 315 ? -27.995 30.972 35.400 1.00 17.12 ? 345  ILE A CG1  1 
ATOM   2415 C  CG2  . ILE A 1 315 ? -28.371 28.530 34.868 1.00 19.02 ? 345  ILE A CG2  1 
ATOM   2416 C  CD1  . ILE A 1 315 ? -26.481 30.938 35.252 1.00 12.24 ? 345  ILE A CD1  1 
ATOM   2417 N  N    . TYR A 1 316 ? -30.515 27.914 37.533 1.00 24.29 ? 346  TYR A N    1 
ATOM   2418 C  CA   . TYR A 1 316 ? -31.065 26.615 37.887 1.00 29.46 ? 346  TYR A CA   1 
ATOM   2419 C  C    . TYR A 1 316 ? -32.574 26.532 37.682 1.00 32.82 ? 346  TYR A C    1 
ATOM   2420 O  O    . TYR A 1 316 ? -33.060 25.629 37.006 1.00 36.64 ? 346  TYR A O    1 
ATOM   2421 C  CB   . TYR A 1 316 ? -30.703 26.259 39.324 1.00 28.77 ? 346  TYR A CB   1 
ATOM   2422 C  CG   . TYR A 1 316 ? -31.196 24.902 39.758 1.00 31.26 ? 346  TYR A CG   1 
ATOM   2423 C  CD1  . TYR A 1 316 ? -32.477 24.745 40.287 1.00 32.11 ? 346  TYR A CD1  1 
ATOM   2424 C  CD2  . TYR A 1 316 ? -30.372 23.781 39.678 1.00 31.17 ? 346  TYR A CD2  1 
ATOM   2425 C  CE1  . TYR A 1 316 ? -32.927 23.510 40.729 1.00 34.01 ? 346  TYR A CE1  1 
ATOM   2426 C  CE2  . TYR A 1 316 ? -30.811 22.545 40.120 1.00 33.86 ? 346  TYR A CE2  1 
ATOM   2427 C  CZ   . TYR A 1 316 ? -32.091 22.418 40.648 1.00 36.41 ? 346  TYR A CZ   1 
ATOM   2428 O  OH   . TYR A 1 316 ? -32.536 21.205 41.112 1.00 43.79 ? 346  TYR A OH   1 
ATOM   2429 N  N    . HIS A 1 317 ? -33.315 27.470 38.261 1.00 32.27 ? 347  HIS A N    1 
ATOM   2430 C  CA   . HIS A 1 317 ? -34.766 27.471 38.113 1.00 31.96 ? 347  HIS A CA   1 
ATOM   2431 C  C    . HIS A 1 317 ? -35.200 27.478 36.659 1.00 30.68 ? 347  HIS A C    1 
ATOM   2432 O  O    . HIS A 1 317 ? -36.201 26.868 36.314 1.00 31.02 ? 347  HIS A O    1 
ATOM   2433 C  CB   . HIS A 1 317 ? -35.389 28.666 38.834 1.00 36.24 ? 347  HIS A CB   1 
ATOM   2434 C  CG   . HIS A 1 317 ? -35.409 28.521 40.318 1.00 39.38 ? 347  HIS A CG   1 
ATOM   2435 N  ND1  . HIS A 1 317 ? -34.973 29.513 41.172 1.00 40.61 ? 347  HIS A ND1  1 
ATOM   2436 C  CD2  . HIS A 1 317 ? -35.785 27.488 41.109 1.00 40.37 ? 347  HIS A CD2  1 
ATOM   2437 C  CE1  . HIS A 1 317 ? -35.075 29.097 42.418 1.00 45.16 ? 347  HIS A CE1  1 
ATOM   2438 N  NE2  . HIS A 1 317 ? -35.566 27.867 42.407 1.00 48.06 ? 347  HIS A NE2  1 
ATOM   2439 N  N    . ARG A 1 318 ? -34.441 28.157 35.808 1.00 29.86 ? 348  ARG A N    1 
ATOM   2440 C  CA   . ARG A 1 318 ? -34.774 28.236 34.396 1.00 32.72 ? 348  ARG A CA   1 
ATOM   2441 C  C    . ARG A 1 318 ? -34.429 27.005 33.568 1.00 30.43 ? 348  ARG A C    1 
ATOM   2442 O  O    . ARG A 1 318 ? -34.770 26.946 32.385 1.00 31.93 ? 348  ARG A O    1 
ATOM   2443 C  CB   . ARG A 1 318 ? -34.090 29.435 33.745 1.00 38.61 ? 348  ARG A CB   1 
ATOM   2444 C  CG   . ARG A 1 318 ? -34.655 30.806 34.061 1.00 40.04 ? 348  ARG A CG   1 
ATOM   2445 C  CD   . ARG A 1 318 ? -33.979 31.769 33.111 1.00 46.76 ? 348  ARG A CD   1 
ATOM   2446 N  NE   . ARG A 1 318 ? -34.097 33.170 33.477 1.00 52.37 ? 348  ARG A NE   1 
ATOM   2447 C  CZ   . ARG A 1 318 ? -33.353 34.132 32.937 1.00 57.97 ? 348  ARG A CZ   1 
ATOM   2448 N  NH1  . ARG A 1 318 ? -32.441 33.832 32.016 1.00 54.42 ? 348  ARG A NH1  1 
ATOM   2449 N  NH2  . ARG A 1 318 ? -33.532 35.396 33.301 1.00 61.41 ? 348  ARG A NH2  1 
ATOM   2450 N  N    . ILE A 1 319 ? -33.733 26.042 34.156 1.00 27.53 ? 349  ILE A N    1 
ATOM   2451 C  CA   . ILE A 1 319 ? -33.327 24.851 33.418 1.00 28.68 ? 349  ILE A CA   1 
ATOM   2452 C  C    . ILE A 1 319 ? -34.503 24.067 32.835 1.00 31.55 ? 349  ILE A C    1 
ATOM   2453 O  O    . ILE A 1 319 ? -35.309 23.499 33.573 1.00 32.22 ? 349  ILE A O    1 
ATOM   2454 C  CB   . ILE A 1 319 ? -32.428 23.936 34.284 1.00 26.99 ? 349  ILE A CB   1 
ATOM   2455 C  CG1  . ILE A 1 319 ? -31.111 24.651 34.584 1.00 20.88 ? 349  ILE A CG1  1 
ATOM   2456 C  CG2  . ILE A 1 319 ? -32.149 22.609 33.575 1.00 26.85 ? 349  ILE A CG2  1 
ATOM   2457 C  CD1  . ILE A 1 319 ? -30.191 23.871 35.472 1.00 18.96 ? 349  ILE A CD1  1 
ATOM   2458 N  N    . PRO A 1 320 ? -34.628 24.050 31.490 1.00 33.37 ? 350  PRO A N    1 
ATOM   2459 C  CA   . PRO A 1 320 ? -35.708 23.334 30.802 1.00 33.61 ? 350  PRO A CA   1 
ATOM   2460 C  C    . PRO A 1 320 ? -35.367 21.860 30.855 1.00 34.78 ? 350  PRO A C    1 
ATOM   2461 O  O    . PRO A 1 320 ? -34.367 21.454 30.286 1.00 32.46 ? 350  PRO A O    1 
ATOM   2462 C  CB   . PRO A 1 320 ? -35.591 23.835 29.356 1.00 31.41 ? 350  PRO A CB   1 
ATOM   2463 C  CG   . PRO A 1 320 ? -34.734 25.072 29.447 1.00 32.79 ? 350  PRO A CG   1 
ATOM   2464 C  CD   . PRO A 1 320 ? -33.754 24.707 30.508 1.00 33.04 ? 350  PRO A CD   1 
ATOM   2465 N  N    . ASP A 1 321 ? -36.198 21.056 31.509 1.00 39.85 ? 351  ASP A N    1 
ATOM   2466 C  CA   . ASP A 1 321 ? -35.940 19.619 31.625 1.00 43.23 ? 351  ASP A CA   1 
ATOM   2467 C  C    . ASP A 1 321 ? -35.709 18.915 30.278 1.00 42.99 ? 351  ASP A C    1 
ATOM   2468 O  O    . ASP A 1 321 ? -35.131 17.830 30.227 1.00 43.03 ? 351  ASP A O    1 
ATOM   2469 C  CB   . ASP A 1 321 ? -37.080 18.938 32.384 1.00 48.15 ? 351  ASP A CB   1 
ATOM   2470 C  CG   . ASP A 1 321 ? -36.586 18.124 33.563 1.00 53.54 ? 351  ASP A CG   1 
ATOM   2471 O  OD1  . ASP A 1 321 ? -35.756 17.212 33.354 1.00 59.17 ? 351  ASP A OD1  1 
ATOM   2472 O  OD2  . ASP A 1 321 ? -37.012 18.405 34.704 1.00 56.84 ? 351  ASP A OD2  1 
ATOM   2473 N  N    . SER A 1 322 ? -36.128 19.554 29.191 1.00 39.44 ? 352  SER A N    1 
ATOM   2474 C  CA   . SER A 1 322 ? -35.979 18.998 27.853 1.00 37.32 ? 352  SER A CA   1 
ATOM   2475 C  C    . SER A 1 322 ? -34.722 19.490 27.131 1.00 35.09 ? 352  SER A C    1 
ATOM   2476 O  O    . SER A 1 322 ? -34.432 19.068 26.011 1.00 34.42 ? 352  SER A O    1 
ATOM   2477 C  CB   . SER A 1 322 ? -37.224 19.325 27.031 1.00 38.56 ? 352  SER A CB   1 
ATOM   2478 O  OG   . SER A 1 322 ? -37.748 20.591 27.409 1.00 42.03 ? 352  SER A OG   1 
ATOM   2479 N  N    . ASP A 1 323 ? -33.970 20.371 27.777 1.00 32.45 ? 353  ASP A N    1 
ATOM   2480 C  CA   . ASP A 1 323 ? -32.755 20.908 27.184 1.00 30.12 ? 353  ASP A CA   1 
ATOM   2481 C  C    . ASP A 1 323 ? -31.665 19.839 27.165 1.00 27.23 ? 353  ASP A C    1 
ATOM   2482 O  O    . ASP A 1 323 ? -31.408 19.189 28.174 1.00 27.84 ? 353  ASP A O    1 
ATOM   2483 C  CB   . ASP A 1 323 ? -32.281 22.139 27.971 1.00 30.43 ? 353  ASP A CB   1 
ATOM   2484 C  CG   . ASP A 1 323 ? -31.082 22.820 27.330 1.00 25.71 ? 353  ASP A CG   1 
ATOM   2485 O  OD1  . ASP A 1 323 ? -31.277 23.574 26.353 1.00 21.51 ? 353  ASP A OD1  1 
ATOM   2486 O  OD2  . ASP A 1 323 ? -29.950 22.591 27.802 1.00 25.07 ? 353  ASP A OD2  1 
ATOM   2487 N  N    . PRO A 1 324 ? -30.982 19.672 26.020 1.00 26.16 ? 354  PRO A N    1 
ATOM   2488 C  CA   . PRO A 1 324 ? -29.912 18.677 25.878 1.00 25.03 ? 354  PRO A CA   1 
ATOM   2489 C  C    . PRO A 1 324 ? -28.888 18.715 27.015 1.00 27.09 ? 354  PRO A C    1 
ATOM   2490 O  O    . PRO A 1 324 ? -28.280 17.698 27.351 1.00 26.87 ? 354  PRO A O    1 
ATOM   2491 C  CB   . PRO A 1 324 ? -29.258 19.072 24.553 1.00 23.51 ? 354  PRO A CB   1 
ATOM   2492 C  CG   . PRO A 1 324 ? -30.410 19.594 23.760 1.00 26.08 ? 354  PRO A CG   1 
ATOM   2493 C  CD   . PRO A 1 324 ? -31.156 20.441 24.772 1.00 21.74 ? 354  PRO A CD   1 
ATOM   2494 N  N    . SER A 1 325 ? -28.703 19.885 27.615 1.00 29.03 ? 355  SER A N    1 
ATOM   2495 C  CA   . SER A 1 325 ? -27.723 20.021 28.681 1.00 29.54 ? 355  SER A CA   1 
ATOM   2496 C  C    . SER A 1 325 ? -28.276 20.054 30.096 1.00 27.24 ? 355  SER A C    1 
ATOM   2497 O  O    . SER A 1 325 ? -27.494 20.145 31.046 1.00 24.60 ? 355  SER A O    1 
ATOM   2498 C  CB   . SER A 1 325 ? -26.857 21.261 28.435 1.00 36.93 ? 355  SER A CB   1 
ATOM   2499 O  OG   . SER A 1 325 ? -26.163 21.162 27.201 1.00 41.82 ? 355  SER A OG   1 
ATOM   2500 N  N    . SER A 1 326 ? -29.598 19.937 30.237 1.00 25.52 ? 356  SER A N    1 
ATOM   2501 C  CA   . SER A 1 326 ? -30.275 19.975 31.541 1.00 30.08 ? 356  SER A CA   1 
ATOM   2502 C  C    . SER A 1 326 ? -29.539 19.311 32.694 1.00 32.40 ? 356  SER A C    1 
ATOM   2503 O  O    . SER A 1 326 ? -29.341 19.922 33.748 1.00 35.65 ? 356  SER A O    1 
ATOM   2504 C  CB   . SER A 1 326 ? -31.661 19.354 31.438 1.00 32.50 ? 356  SER A CB   1 
ATOM   2505 O  OG   . SER A 1 326 ? -32.445 20.066 30.514 1.00 44.07 ? 356  SER A OG   1 
ATOM   2506 N  N    . SER A 1 327 ? -29.167 18.050 32.506 1.00 32.94 ? 357  SER A N    1 
ATOM   2507 C  CA   . SER A 1 327 ? -28.457 17.298 33.528 1.00 33.59 ? 357  SER A CA   1 
ATOM   2508 C  C    . SER A 1 327 ? -27.093 17.908 33.836 1.00 32.64 ? 357  SER A C    1 
ATOM   2509 O  O    . SER A 1 327 ? -26.706 18.011 35.000 1.00 36.50 ? 357  SER A O    1 
ATOM   2510 C  CB   . SER A 1 327 ? -28.295 15.850 33.076 1.00 36.80 ? 357  SER A CB   1 
ATOM   2511 O  OG   . SER A 1 327 ? -29.551 15.304 32.707 1.00 43.38 ? 357  SER A OG   1 
ATOM   2512 N  N    . LYS A 1 328 ? -26.372 18.317 32.796 1.00 30.69 ? 358  LYS A N    1 
ATOM   2513 C  CA   . LYS A 1 328 ? -25.054 18.921 32.964 1.00 32.25 ? 358  LYS A CA   1 
ATOM   2514 C  C    . LYS A 1 328 ? -25.152 20.223 33.763 1.00 31.25 ? 358  LYS A C    1 
ATOM   2515 O  O    . LYS A 1 328 ? -24.440 20.411 34.755 1.00 34.68 ? 358  LYS A O    1 
ATOM   2516 C  CB   . LYS A 1 328 ? -24.413 19.245 31.612 1.00 35.61 ? 358  LYS A CB   1 
ATOM   2517 C  CG   . LYS A 1 328 ? -24.169 18.081 30.667 1.00 41.01 ? 358  LYS A CG   1 
ATOM   2518 C  CD   . LYS A 1 328 ? -23.390 18.596 29.458 1.00 44.08 ? 358  LYS A CD   1 
ATOM   2519 C  CE   . LYS A 1 328 ? -23.850 17.958 28.163 1.00 49.77 ? 358  LYS A CE   1 
ATOM   2520 N  NZ   . LYS A 1 328 ? -23.992 18.981 27.075 1.00 50.28 ? 358  LYS A NZ   1 
ATOM   2521 N  N    . THR A 1 329 ? -26.027 21.123 33.323 1.00 25.53 ? 359  THR A N    1 
ATOM   2522 C  CA   . THR A 1 329 ? -26.195 22.402 34.000 1.00 26.23 ? 359  THR A CA   1 
ATOM   2523 C  C    . THR A 1 329 ? -26.531 22.194 35.478 1.00 28.32 ? 359  THR A C    1 
ATOM   2524 O  O    . THR A 1 329 ? -25.945 22.840 36.355 1.00 25.17 ? 359  THR A O    1 
ATOM   2525 C  CB   . THR A 1 329 ? -27.280 23.249 33.328 1.00 24.64 ? 359  THR A CB   1 
ATOM   2526 O  OG1  . THR A 1 329 ? -27.249 23.021 31.914 1.00 25.11 ? 359  THR A OG1  1 
ATOM   2527 C  CG2  . THR A 1 329 ? -27.016 24.731 33.586 1.00 23.69 ? 359  THR A CG2  1 
ATOM   2528 N  N    . ARG A 1 330 ? -27.438 21.259 35.755 1.00 28.85 ? 360  ARG A N    1 
ATOM   2529 C  CA   . ARG A 1 330 ? -27.818 20.964 37.133 1.00 31.13 ? 360  ARG A CA   1 
ATOM   2530 C  C    . ARG A 1 330 ? -26.640 20.454 37.959 1.00 31.43 ? 360  ARG A C    1 
ATOM   2531 O  O    . ARG A 1 330 ? -26.448 20.856 39.110 1.00 29.33 ? 360  ARG A O    1 
ATOM   2532 C  CB   . ARG A 1 330 ? -28.930 19.922 37.180 1.00 31.66 ? 360  ARG A CB   1 
ATOM   2533 C  CG   . ARG A 1 330 ? -30.256 20.391 36.650 1.00 29.55 ? 360  ARG A CG   1 
ATOM   2534 C  CD   . ARG A 1 330 ? -31.340 19.445 37.090 1.00 30.01 ? 360  ARG A CD   1 
ATOM   2535 N  NE   . ARG A 1 330 ? -32.606 19.753 36.444 1.00 35.98 ? 360  ARG A NE   1 
ATOM   2536 C  CZ   . ARG A 1 330 ? -33.102 19.066 35.422 1.00 39.13 ? 360  ARG A CZ   1 
ATOM   2537 N  NH1  . ARG A 1 330 ? -32.435 18.024 34.935 1.00 42.82 ? 360  ARG A NH1  1 
ATOM   2538 N  NH2  . ARG A 1 330 ? -34.244 19.438 34.866 1.00 40.75 ? 360  ARG A NH2  1 
ATOM   2539 N  N    . GLN A 1 331 ? -25.849 19.564 37.373 1.00 32.21 ? 361  GLN A N    1 
ATOM   2540 C  CA   . GLN A 1 331 ? -24.722 19.011 38.095 1.00 33.52 ? 361  GLN A CA   1 
ATOM   2541 C  C    . GLN A 1 331 ? -23.633 20.011 38.448 1.00 33.33 ? 361  GLN A C    1 
ATOM   2542 O  O    . GLN A 1 331 ? -23.099 19.962 39.555 1.00 38.71 ? 361  GLN A O    1 
ATOM   2543 C  CB   . GLN A 1 331 ? -24.146 17.786 37.382 1.00 37.55 ? 361  GLN A CB   1 
ATOM   2544 C  CG   . GLN A 1 331 ? -24.531 16.475 38.065 1.00 44.05 ? 361  GLN A CG   1 
ATOM   2545 C  CD   . GLN A 1 331 ? -24.274 16.499 39.579 1.00 49.97 ? 361  GLN A CD   1 
ATOM   2546 O  OE1  . GLN A 1 331 ? -23.164 16.779 40.033 1.00 50.82 ? 361  GLN A OE1  1 
ATOM   2547 N  NE2  . GLN A 1 331 ? -25.307 16.205 40.359 1.00 47.45 ? 361  GLN A NE2  1 
ATOM   2548 N  N    . ILE A 1 332 ? -23.302 20.926 37.543 1.00 28.22 ? 362  ILE A N    1 
ATOM   2549 C  CA   . ILE A 1 332 ? -22.272 21.905 37.868 1.00 27.45 ? 362  ILE A CA   1 
ATOM   2550 C  C    . ILE A 1 332 ? -22.813 22.853 38.937 1.00 26.41 ? 362  ILE A C    1 
ATOM   2551 O  O    . ILE A 1 332 ? -22.076 23.305 39.809 1.00 30.08 ? 362  ILE A O    1 
ATOM   2552 C  CB   . ILE A 1 332 ? -21.773 22.701 36.622 1.00 24.34 ? 362  ILE A CB   1 
ATOM   2553 C  CG1  . ILE A 1 332 ? -20.636 23.651 37.014 1.00 27.16 ? 362  ILE A CG1  1 
ATOM   2554 C  CG2  . ILE A 1 332 ? -22.896 23.531 36.025 1.00 22.90 ? 362  ILE A CG2  1 
ATOM   2555 C  CD1  . ILE A 1 332 ? -19.506 23.007 37.797 1.00 24.52 ? 362  ILE A CD1  1 
ATOM   2556 N  N    . ILE A 1 333 ? -24.111 23.120 38.892 1.00 26.79 ? 363  ILE A N    1 
ATOM   2557 C  CA   . ILE A 1 333 ? -24.717 24.004 39.873 1.00 28.22 ? 363  ILE A CA   1 
ATOM   2558 C  C    . ILE A 1 333 ? -24.707 23.347 41.249 1.00 29.66 ? 363  ILE A C    1 
ATOM   2559 O  O    . ILE A 1 333 ? -24.370 23.992 42.237 1.00 29.65 ? 363  ILE A O    1 
ATOM   2560 C  CB   . ILE A 1 333 ? -26.121 24.470 39.425 1.00 25.29 ? 363  ILE A CB   1 
ATOM   2561 C  CG1  . ILE A 1 333 ? -25.953 25.540 38.329 1.00 24.05 ? 363  ILE A CG1  1 
ATOM   2562 C  CG2  . ILE A 1 333 ? -26.913 25.013 40.607 1.00 24.22 ? 363  ILE A CG2  1 
ATOM   2563 C  CD1  . ILE A 1 333 ? -27.236 26.091 37.760 1.00 17.10 ? 363  ILE A CD1  1 
ATOM   2564 N  N    . SER A 1 334 ? -24.987 22.048 41.301 1.00 33.98 ? 364  SER A N    1 
ATOM   2565 C  CA   . SER A 1 334 ? -24.967 21.322 42.567 1.00 36.23 ? 364  SER A CA   1 
ATOM   2566 C  C    . SER A 1 334 ? -23.548 21.330 43.116 1.00 34.35 ? 364  SER A C    1 
ATOM   2567 O  O    . SER A 1 334 ? -23.343 21.420 44.324 1.00 38.96 ? 364  SER A O    1 
ATOM   2568 C  CB   . SER A 1 334 ? -25.451 19.881 42.380 1.00 37.23 ? 364  SER A CB   1 
ATOM   2569 O  OG   . SER A 1 334 ? -26.843 19.838 42.122 1.00 41.02 ? 364  SER A OG   1 
ATOM   2570 N  N    . THR A 1 335 ? -22.573 21.237 42.224 1.00 33.47 ? 365  THR A N    1 
ATOM   2571 C  CA   . THR A 1 335 ? -21.175 21.258 42.615 1.00 37.38 ? 365  THR A CA   1 
ATOM   2572 C  C    . THR A 1 335 ? -20.842 22.593 43.274 1.00 39.06 ? 365  THR A C    1 
ATOM   2573 O  O    . THR A 1 335 ? -20.314 22.628 44.383 1.00 41.33 ? 365  THR A O    1 
ATOM   2574 C  CB   . THR A 1 335 ? -20.270 21.023 41.395 1.00 38.73 ? 365  THR A CB   1 
ATOM   2575 O  OG1  . THR A 1 335 ? -20.458 19.682 40.921 1.00 40.71 ? 365  THR A OG1  1 
ATOM   2576 C  CG2  . THR A 1 335 ? -18.808 21.250 41.743 1.00 38.74 ? 365  THR A CG2  1 
ATOM   2577 N  N    . ILE A 1 336 ? -21.196 23.690 42.611 1.00 40.59 ? 366  ILE A N    1 
ATOM   2578 C  CA   . ILE A 1 336 ? -20.937 25.027 43.148 1.00 40.36 ? 366  ILE A CA   1 
ATOM   2579 C  C    . ILE A 1 336 ? -21.638 25.188 44.506 1.00 38.46 ? 366  ILE A C    1 
ATOM   2580 O  O    . ILE A 1 336 ? -21.070 25.727 45.452 1.00 37.50 ? 366  ILE A O    1 
ATOM   2581 C  CB   . ILE A 1 336 ? -21.468 26.140 42.190 1.00 41.62 ? 366  ILE A CB   1 
ATOM   2582 C  CG1  . ILE A 1 336 ? -20.981 25.909 40.751 1.00 42.51 ? 366  ILE A CG1  1 
ATOM   2583 C  CG2  . ILE A 1 336 ? -21.088 27.525 42.707 1.00 41.07 ? 366  ILE A CG2  1 
ATOM   2584 C  CD1  . ILE A 1 336 ? -19.568 25.407 40.633 1.00 43.38 ? 366  ILE A CD1  1 
ATOM   2585 N  N    . ARG A 1 337 ? -22.870 24.697 44.579 1.00 37.60 ? 367  ARG A N    1 
ATOM   2586 C  CA   . ARG A 1 337 ? -23.697 24.773 45.779 1.00 39.28 ? 367  ARG A CA   1 
ATOM   2587 C  C    . ARG A 1 337 ? -23.123 24.115 47.022 1.00 42.79 ? 367  ARG A C    1 
ATOM   2588 O  O    . ARG A 1 337 ? -23.295 24.616 48.131 1.00 41.69 ? 367  ARG A O    1 
ATOM   2589 C  CB   . ARG A 1 337 ? -25.029 24.076 45.539 1.00 35.57 ? 367  ARG A CB   1 
ATOM   2590 C  CG   . ARG A 1 337 ? -26.106 24.841 44.862 1.00 32.16 ? 367  ARG A CG   1 
ATOM   2591 C  CD   . ARG A 1 337 ? -27.318 23.944 44.921 1.00 33.99 ? 367  ARG A CD   1 
ATOM   2592 N  NE   . ARG A 1 337 ? -28.503 24.492 44.278 1.00 33.32 ? 367  ARG A NE   1 
ATOM   2593 C  CZ   . ARG A 1 337 ? -29.460 23.738 43.755 1.00 36.96 ? 367  ARG A CZ   1 
ATOM   2594 N  NH1  . ARG A 1 337 ? -29.361 22.416 43.806 1.00 37.46 ? 367  ARG A NH1  1 
ATOM   2595 N  NH2  . ARG A 1 337 ? -30.514 24.298 43.184 1.00 40.00 ? 367  ARG A NH2  1 
ATOM   2596 N  N    . THR A 1 338 ? -22.547 22.934 46.845 1.00 45.93 ? 368  THR A N    1 
ATOM   2597 C  CA   . THR A 1 338 ? -22.023 22.164 47.962 1.00 49.91 ? 368  THR A CA   1 
ATOM   2598 C  C    . THR A 1 338 ? -20.504 22.128 48.050 1.00 52.64 ? 368  THR A C    1 
ATOM   2599 O  O    . THR A 1 338 ? -19.948 21.250 48.710 1.00 57.35 ? 368  THR A O    1 
ATOM   2600 C  CB   . THR A 1 338 ? -22.529 20.708 47.861 1.00 49.63 ? 368  THR A CB   1 
ATOM   2601 O  OG1  . THR A 1 338 ? -21.903 20.064 46.745 1.00 53.45 ? 368  THR A OG1  1 
ATOM   2602 C  CG2  . THR A 1 338 ? -24.026 20.678 47.629 1.00 47.18 ? 368  THR A CG2  1 
ATOM   2603 N  N    . GLN A 1 339 ? -19.826 23.093 47.442 1.00 54.59 ? 369  GLN A N    1 
ATOM   2604 C  CA   . GLN A 1 339 ? -18.375 23.070 47.453 1.00 58.16 ? 369  GLN A CA   1 
ATOM   2605 C  C    . GLN A 1 339 ? -17.671 23.972 48.469 1.00 62.46 ? 369  GLN A C    1 
ATOM   2606 O  O    . GLN A 1 339 ? -17.505 23.591 49.631 1.00 64.29 ? 369  GLN A O    1 
ATOM   2607 C  CB   . GLN A 1 339 ? -17.850 23.322 46.042 1.00 58.09 ? 369  GLN A CB   1 
ATOM   2608 C  CG   . GLN A 1 339 ? -16.595 22.551 45.703 1.00 57.40 ? 369  GLN A CG   1 
ATOM   2609 C  CD   . GLN A 1 339 ? -16.206 22.712 44.255 1.00 56.32 ? 369  GLN A CD   1 
ATOM   2610 O  OE1  . GLN A 1 339 ? -15.932 23.816 43.798 1.00 60.03 ? 369  GLN A OE1  1 
ATOM   2611 N  NE2  . GLN A 1 339 ? -16.181 21.612 43.523 1.00 54.95 ? 369  GLN A NE2  1 
ATOM   2612 N  N    . ASN A 1 340 ? -17.243 25.152 48.026 1.00 65.31 ? 370  ASN A N    1 
ATOM   2613 C  CA   . ASN A 1 340 ? -16.527 26.100 48.874 1.00 67.16 ? 370  ASN A CA   1 
ATOM   2614 C  C    . ASN A 1 340 ? -17.504 27.034 49.597 1.00 69.00 ? 370  ASN A C    1 
ATOM   2615 O  O    . ASN A 1 340 ? -17.841 28.113 49.063 1.00 67.89 ? 370  ASN A O    1 
ATOM   2616 C  CB   . ASN A 1 340 ? -15.535 26.900 48.016 1.00 68.12 ? 370  ASN A CB   1 
ATOM   2617 C  CG   . ASN A 1 340 ? -14.485 27.632 48.839 1.00 68.76 ? 370  ASN A CG   1 
ATOM   2618 O  OD1  . ASN A 1 340 ? -14.661 27.885 50.030 1.00 72.03 ? 370  ASN A OD1  1 
ATOM   2619 N  ND2  . ASN A 1 340 ? -13.379 27.977 48.196 1.00 68.78 ? 370  ASN A ND2  1 
ATOM   2620 O  OXT  . ASN A 1 340 ? -17.931 26.668 50.710 1.00 73.16 ? 370  ASN A OXT  1 
ATOM   2621 N  N    . ASN B 1 4   ? -24.432 51.628 84.576 1.00 34.23 ? 34   ASN B N    1 
ATOM   2622 C  CA   . ASN B 1 4   ? -24.425 52.340 83.274 1.00 34.67 ? 34   ASN B CA   1 
ATOM   2623 C  C    . ASN B 1 4   ? -25.836 52.636 82.768 1.00 33.16 ? 34   ASN B C    1 
ATOM   2624 O  O    . ASN B 1 4   ? -26.223 52.249 81.667 1.00 32.45 ? 34   ASN B O    1 
ATOM   2625 C  CB   . ASN B 1 4   ? -23.646 51.534 82.232 1.00 40.32 ? 34   ASN B CB   1 
ATOM   2626 C  CG   . ASN B 1 4   ? -24.168 50.124 82.077 1.00 43.25 ? 34   ASN B CG   1 
ATOM   2627 O  OD1  . ASN B 1 4   ? -25.299 49.822 82.450 1.00 41.59 ? 34   ASN B OD1  1 
ATOM   2628 N  ND2  . ASN B 1 4   ? -23.331 49.241 81.549 1.00 50.45 ? 34   ASN B ND2  1 
ATOM   2629 N  N    . SER B 1 5   ? -26.605 53.328 83.594 1.00 30.21 ? 35   SER B N    1 
ATOM   2630 C  CA   . SER B 1 5   ? -27.954 53.709 83.248 1.00 25.09 ? 35   SER B CA   1 
ATOM   2631 C  C    . SER B 1 5   ? -27.841 54.937 82.348 1.00 25.36 ? 35   SER B C    1 
ATOM   2632 O  O    . SER B 1 5   ? -26.787 55.575 82.282 1.00 24.23 ? 35   SER B O    1 
ATOM   2633 C  CB   . SER B 1 5   ? -28.733 54.038 84.519 1.00 24.34 ? 35   SER B CB   1 
ATOM   2634 O  OG   . SER B 1 5   ? -27.962 54.854 85.383 1.00 24.43 ? 35   SER B OG   1 
ATOM   2635 N  N    . LEU B 1 6   ? -28.916 55.255 81.644 1.00 24.78 ? 36   LEU B N    1 
ATOM   2636 C  CA   . LEU B 1 6   ? -28.919 56.396 80.750 1.00 24.17 ? 36   LEU B CA   1 
ATOM   2637 C  C    . LEU B 1 6   ? -29.656 57.548 81.414 1.00 25.42 ? 36   LEU B C    1 
ATOM   2638 O  O    . LEU B 1 6   ? -30.771 57.373 81.914 1.00 25.36 ? 36   LEU B O    1 
ATOM   2639 C  CB   . LEU B 1 6   ? -29.596 56.023 79.427 1.00 21.96 ? 36   LEU B CB   1 
ATOM   2640 C  CG   . LEU B 1 6   ? -29.026 54.802 78.698 1.00 20.98 ? 36   LEU B CG   1 
ATOM   2641 C  CD1  . LEU B 1 6   ? -29.818 54.554 77.415 1.00 20.98 ? 36   LEU B CD1  1 
ATOM   2642 C  CD2  . LEU B 1 6   ? -27.541 55.001 78.398 1.00 20.63 ? 36   LEU B CD2  1 
ATOM   2643 N  N    . SER B 1 7   ? -29.029 58.717 81.422 1.00 25.30 ? 37   SER B N    1 
ATOM   2644 C  CA   . SER B 1 7   ? -29.629 59.900 82.024 1.00 26.47 ? 37   SER B CA   1 
ATOM   2645 C  C    . SER B 1 7   ? -30.774 60.433 81.164 1.00 26.15 ? 37   SER B C    1 
ATOM   2646 O  O    . SER B 1 7   ? -30.769 60.280 79.939 1.00 30.38 ? 37   SER B O    1 
ATOM   2647 C  CB   . SER B 1 7   ? -28.573 61.000 82.214 1.00 26.49 ? 37   SER B CB   1 
ATOM   2648 O  OG   . SER B 1 7   ? -28.050 61.462 80.975 1.00 22.91 ? 37   SER B OG   1 
ATOM   2649 N  N    . ASN B 1 8   ? -31.757 61.052 81.803 1.00 22.77 ? 38   ASN B N    1 
ATOM   2650 C  CA   . ASN B 1 8   ? -32.871 61.632 81.078 1.00 22.51 ? 38   ASN B CA   1 
ATOM   2651 C  C    . ASN B 1 8   ? -32.362 62.782 80.221 1.00 21.28 ? 38   ASN B C    1 
ATOM   2652 O  O    . ASN B 1 8   ? -32.875 63.012 79.121 1.00 18.77 ? 38   ASN B O    1 
ATOM   2653 C  CB   . ASN B 1 8   ? -33.940 62.138 82.037 1.00 24.87 ? 38   ASN B CB   1 
ATOM   2654 C  CG   . ASN B 1 8   ? -34.661 61.018 82.736 1.00 31.62 ? 38   ASN B CG   1 
ATOM   2655 O  OD1  . ASN B 1 8   ? -34.875 61.066 83.951 1.00 34.02 ? 38   ASN B OD1  1 
ATOM   2656 N  ND2  . ASN B 1 8   ? -35.053 59.999 81.973 1.00 36.73 ? 38   ASN B ND2  1 
ATOM   2657 N  N    . SER B 1 9   ? -31.357 63.504 80.718 1.00 18.72 ? 39   SER B N    1 
ATOM   2658 C  CA   . SER B 1 9   ? -30.780 64.614 79.953 1.00 21.54 ? 39   SER B CA   1 
ATOM   2659 C  C    . SER B 1 9   ? -30.087 64.118 78.685 1.00 18.75 ? 39   SER B C    1 
ATOM   2660 O  O    . SER B 1 9   ? -30.178 64.767 77.646 1.00 20.00 ? 39   SER B O    1 
ATOM   2661 C  CB   . SER B 1 9   ? -29.821 65.474 80.801 1.00 17.80 ? 39   SER B CB   1 
ATOM   2662 O  OG   . SER B 1 9   ? -28.958 64.689 81.600 1.00 16.32 ? 39   SER B OG   1 
ATOM   2663 N  N    . LEU B 1 10  ? -29.406 62.972 78.758 1.00 19.73 ? 40   LEU B N    1 
ATOM   2664 C  CA   . LEU B 1 10  ? -28.738 62.441 77.567 1.00 18.28 ? 40   LEU B CA   1 
ATOM   2665 C  C    . LEU B 1 10  ? -29.809 61.983 76.590 1.00 16.98 ? 40   LEU B C    1 
ATOM   2666 O  O    . LEU B 1 10  ? -29.697 62.217 75.386 1.00 16.21 ? 40   LEU B O    1 
ATOM   2667 C  CB   . LEU B 1 10  ? -27.782 61.290 77.902 1.00 16.51 ? 40   LEU B CB   1 
ATOM   2668 C  CG   . LEU B 1 10  ? -26.822 60.879 76.771 1.00 15.54 ? 40   LEU B CG   1 
ATOM   2669 C  CD1  . LEU B 1 10  ? -25.891 62.027 76.391 1.00 10.28 ? 40   LEU B CD1  1 
ATOM   2670 C  CD2  . LEU B 1 10  ? -26.008 59.668 77.205 1.00 12.51 ? 40   LEU B CD2  1 
ATOM   2671 N  N    . LYS B 1 11  ? -30.877 61.383 77.113 1.00 16.01 ? 41   LYS B N    1 
ATOM   2672 C  CA   . LYS B 1 11  ? -31.974 60.926 76.259 1.00 17.49 ? 41   LYS B CA   1 
ATOM   2673 C  C    . LYS B 1 11  ? -32.580 62.121 75.533 1.00 17.49 ? 41   LYS B C    1 
ATOM   2674 O  O    . LYS B 1 11  ? -32.789 62.081 74.320 1.00 17.35 ? 41   LYS B O    1 
ATOM   2675 C  CB   . LYS B 1 11  ? -33.049 60.180 77.068 1.00 16.56 ? 41   LYS B CB   1 
ATOM   2676 C  CG   . LYS B 1 11  ? -32.648 58.759 77.475 1.00 14.51 ? 41   LYS B CG   1 
ATOM   2677 C  CD   . LYS B 1 11  ? -33.747 58.070 78.260 1.00 16.21 ? 41   LYS B CD   1 
ATOM   2678 C  CE   . LYS B 1 11  ? -33.417 56.602 78.475 1.00 18.56 ? 41   LYS B CE   1 
ATOM   2679 N  NZ   . LYS B 1 11  ? -34.445 55.905 79.301 1.00 18.21 ? 41   LYS B NZ   1 
ATOM   2680 N  N    . THR B 1 12  ? -32.810 63.201 76.273 1.00 15.94 ? 42   THR B N    1 
ATOM   2681 C  CA   . THR B 1 12  ? -33.368 64.410 75.694 1.00 14.43 ? 42   THR B CA   1 
ATOM   2682 C  C    . THR B 1 12  ? -32.415 64.973 74.635 1.00 12.00 ? 42   THR B C    1 
ATOM   2683 O  O    . THR B 1 12  ? -32.860 65.499 73.623 1.00 12.26 ? 42   THR B O    1 
ATOM   2684 C  CB   . THR B 1 12  ? -33.666 65.452 76.785 1.00 12.25 ? 42   THR B CB   1 
ATOM   2685 O  OG1  . THR B 1 12  ? -34.558 64.866 77.733 1.00 12.23 ? 42   THR B OG1  1 
ATOM   2686 C  CG2  . THR B 1 12  ? -34.324 66.697 76.204 1.00 12.13 ? 42   THR B CG2  1 
ATOM   2687 N  N    . CYS B 1 13  ? -31.113 64.813 74.849 1.00 11.38 ? 43   CYS B N    1 
ATOM   2688 C  CA   . CYS B 1 13  ? -30.123 65.289 73.895 1.00 14.44 ? 43   CYS B CA   1 
ATOM   2689 C  C    . CYS B 1 13  ? -30.263 64.535 72.574 1.00 14.36 ? 43   CYS B C    1 
ATOM   2690 O  O    . CYS B 1 13  ? -30.308 65.148 71.511 1.00 14.80 ? 43   CYS B O    1 
ATOM   2691 C  CB   . CYS B 1 13  ? -28.708 65.151 74.465 1.00 15.82 ? 43   CYS B CB   1 
ATOM   2692 S  SG   . CYS B 1 13  ? -28.237 66.517 75.585 1.00 15.65 ? 43   CYS B SG   1 
ATOM   2693 N  N    . TYR B 1 14  ? -30.409 63.215 72.645 1.00 13.07 ? 44   TYR B N    1 
ATOM   2694 C  CA   . TYR B 1 14  ? -30.580 62.407 71.442 1.00 12.66 ? 44   TYR B CA   1 
ATOM   2695 C  C    . TYR B 1 14  ? -31.917 62.671 70.778 1.00 11.20 ? 44   TYR B C    1 
ATOM   2696 O  O    . TYR B 1 14  ? -32.060 62.499 69.568 1.00 11.48 ? 44   TYR B O    1 
ATOM   2697 C  CB   . TYR B 1 14  ? -30.393 60.914 71.742 1.00 9.39  ? 44   TYR B CB   1 
ATOM   2698 C  CG   . TYR B 1 14  ? -28.938 60.531 71.764 1.00 8.48  ? 44   TYR B CG   1 
ATOM   2699 C  CD1  . TYR B 1 14  ? -28.230 60.349 70.572 1.00 8.47  ? 44   TYR B CD1  1 
ATOM   2700 C  CD2  . TYR B 1 14  ? -28.241 60.444 72.965 1.00 3.89  ? 44   TYR B CD2  1 
ATOM   2701 C  CE1  . TYR B 1 14  ? -26.859 60.095 70.581 1.00 11.52 ? 44   TYR B CE1  1 
ATOM   2702 C  CE2  . TYR B 1 14  ? -26.872 60.190 72.986 1.00 7.73  ? 44   TYR B CE2  1 
ATOM   2703 C  CZ   . TYR B 1 14  ? -26.187 60.020 71.794 1.00 12.04 ? 44   TYR B CZ   1 
ATOM   2704 O  OH   . TYR B 1 14  ? -24.836 59.788 71.815 1.00 13.09 ? 44   TYR B OH   1 
ATOM   2705 N  N    . LYS B 1 15  ? -32.900 63.077 71.570 1.00 11.58 ? 45   LYS B N    1 
ATOM   2706 C  CA   . LYS B 1 15  ? -34.208 63.401 71.040 1.00 13.19 ? 45   LYS B CA   1 
ATOM   2707 C  C    . LYS B 1 15  ? -34.020 64.651 70.180 1.00 18.65 ? 45   LYS B C    1 
ATOM   2708 O  O    . LYS B 1 15  ? -34.428 64.688 69.023 1.00 22.58 ? 45   LYS B O    1 
ATOM   2709 C  CB   . LYS B 1 15  ? -35.180 63.695 72.171 1.00 14.57 ? 45   LYS B CB   1 
ATOM   2710 C  CG   . LYS B 1 15  ? -36.598 63.926 71.705 1.00 16.39 ? 45   LYS B CG   1 
ATOM   2711 C  CD   . LYS B 1 15  ? -37.173 65.214 72.256 1.00 25.43 ? 45   LYS B CD   1 
ATOM   2712 C  CE   . LYS B 1 15  ? -37.114 65.238 73.765 1.00 28.02 ? 45   LYS B CE   1 
ATOM   2713 N  NZ   . LYS B 1 15  ? -38.001 66.284 74.338 1.00 34.83 ? 45   LYS B NZ   1 
ATOM   2714 N  N    . TYR B 1 16  ? -33.343 65.654 70.734 1.00 17.25 ? 46   TYR B N    1 
ATOM   2715 C  CA   . TYR B 1 16  ? -33.093 66.888 70.005 1.00 14.41 ? 46   TYR B CA   1 
ATOM   2716 C  C    . TYR B 1 16  ? -32.263 66.626 68.754 1.00 13.61 ? 46   TYR B C    1 
ATOM   2717 O  O    . TYR B 1 16  ? -32.512 67.205 67.700 1.00 13.37 ? 46   TYR B O    1 
ATOM   2718 C  CB   . TYR B 1 16  ? -32.394 67.913 70.904 1.00 13.24 ? 46   TYR B CB   1 
ATOM   2719 C  CG   . TYR B 1 16  ? -33.283 68.470 71.991 1.00 10.51 ? 46   TYR B CG   1 
ATOM   2720 C  CD1  . TYR B 1 16  ? -34.674 68.419 71.875 1.00 14.20 ? 46   TYR B CD1  1 
ATOM   2721 C  CD2  . TYR B 1 16  ? -32.734 69.056 73.132 1.00 15.37 ? 46   TYR B CD2  1 
ATOM   2722 C  CE1  . TYR B 1 16  ? -35.500 68.933 72.865 1.00 12.68 ? 46   TYR B CE1  1 
ATOM   2723 C  CE2  . TYR B 1 16  ? -33.553 69.576 74.135 1.00 11.58 ? 46   TYR B CE2  1 
ATOM   2724 C  CZ   . TYR B 1 16  ? -34.932 69.507 73.988 1.00 15.37 ? 46   TYR B CZ   1 
ATOM   2725 O  OH   . TYR B 1 16  ? -35.748 69.998 74.970 1.00 18.29 ? 46   TYR B OH   1 
ATOM   2726 N  N    . LEU B 1 17  ? -31.283 65.740 68.874 1.00 14.14 ? 47   LEU B N    1 
ATOM   2727 C  CA   . LEU B 1 17  ? -30.418 65.386 67.758 1.00 15.09 ? 47   LEU B CA   1 
ATOM   2728 C  C    . LEU B 1 17  ? -31.252 64.881 66.584 1.00 14.94 ? 47   LEU B C    1 
ATOM   2729 O  O    . LEU B 1 17  ? -31.043 65.287 65.439 1.00 17.10 ? 47   LEU B O    1 
ATOM   2730 C  CB   . LEU B 1 17  ? -29.427 64.299 68.178 1.00 14.56 ? 47   LEU B CB   1 
ATOM   2731 C  CG   . LEU B 1 17  ? -28.433 63.852 67.102 1.00 20.62 ? 47   LEU B CG   1 
ATOM   2732 C  CD1  . LEU B 1 17  ? -27.339 64.918 66.919 1.00 16.82 ? 47   LEU B CD1  1 
ATOM   2733 C  CD2  . LEU B 1 17  ? -27.826 62.510 67.499 1.00 15.90 ? 47   LEU B CD2  1 
ATOM   2734 N  N    . ASN B 1 18  ? -32.201 64.002 66.874 1.00 11.81 ? 48   ASN B N    1 
ATOM   2735 C  CA   . ASN B 1 18  ? -33.050 63.439 65.831 1.00 15.14 ? 48   ASN B CA   1 
ATOM   2736 C  C    . ASN B 1 18  ? -34.057 64.432 65.322 1.00 14.70 ? 48   ASN B C    1 
ATOM   2737 O  O    . ASN B 1 18  ? -34.507 64.348 64.189 1.00 14.97 ? 48   ASN B O    1 
ATOM   2738 C  CB   . ASN B 1 18  ? -33.740 62.174 66.326 1.00 10.83 ? 48   ASN B CB   1 
ATOM   2739 C  CG   . ASN B 1 18  ? -32.814 60.987 66.317 1.00 10.47 ? 48   ASN B CG   1 
ATOM   2740 O  OD1  . ASN B 1 18  ? -32.607 60.363 65.283 1.00 15.57 ? 48   ASN B OD1  1 
ATOM   2741 N  ND2  . ASN B 1 18  ? -32.208 60.698 67.453 1.00 5.95  ? 48   ASN B ND2  1 
ATOM   2742 N  N    . GLN B 1 19  ? -34.365 65.403 66.162 1.00 15.22 ? 49   GLN B N    1 
ATOM   2743 C  CA   . GLN B 1 19  ? -35.323 66.442 65.841 1.00 19.13 ? 49   GLN B CA   1 
ATOM   2744 C  C    . GLN B 1 19  ? -34.692 67.482 64.915 1.00 19.37 ? 49   GLN B C    1 
ATOM   2745 O  O    . GLN B 1 19  ? -35.368 68.111 64.103 1.00 18.84 ? 49   GLN B O    1 
ATOM   2746 C  CB   . GLN B 1 19  ? -35.753 67.095 67.150 1.00 22.54 ? 49   GLN B CB   1 
ATOM   2747 C  CG   . GLN B 1 19  ? -36.938 67.997 67.094 1.00 25.64 ? 49   GLN B CG   1 
ATOM   2748 C  CD   . GLN B 1 19  ? -37.315 68.473 68.473 1.00 27.18 ? 49   GLN B CD   1 
ATOM   2749 O  OE1  . GLN B 1 19  ? -37.549 67.672 69.374 1.00 28.86 ? 49   GLN B OE1  1 
ATOM   2750 N  NE2  . GLN B 1 19  ? -37.382 69.778 68.647 1.00 28.07 ? 49   GLN B NE2  1 
ATOM   2751 N  N    . THR B 1 20  ? -33.389 67.656 65.051 1.00 18.96 ? 50   THR B N    1 
ATOM   2752 C  CA   . THR B 1 20  ? -32.659 68.625 64.266 1.00 18.39 ? 50   THR B CA   1 
ATOM   2753 C  C    . THR B 1 20  ? -31.811 67.966 63.188 1.00 21.47 ? 50   THR B C    1 
ATOM   2754 O  O    . THR B 1 20  ? -31.038 68.636 62.514 1.00 23.85 ? 50   THR B O    1 
ATOM   2755 C  CB   . THR B 1 20  ? -31.749 69.456 65.176 1.00 18.98 ? 50   THR B CB   1 
ATOM   2756 O  OG1  . THR B 1 20  ? -30.828 68.588 65.842 1.00 20.30 ? 50   THR B OG1  1 
ATOM   2757 C  CG2  . THR B 1 20  ? -32.564 70.177 66.230 1.00 19.60 ? 50   THR B CG2  1 
ATOM   2758 N  N    . SER B 1 21  ? -31.925 66.652 63.046 1.00 23.93 ? 51   SER B N    1 
ATOM   2759 C  CA   . SER B 1 21  ? -31.168 65.939 62.026 1.00 27.44 ? 51   SER B CA   1 
ATOM   2760 C  C    . SER B 1 21  ? -32.068 64.890 61.380 1.00 28.21 ? 51   SER B C    1 
ATOM   2761 O  O    . SER B 1 21  ? -32.433 63.885 62.000 1.00 27.59 ? 51   SER B O    1 
ATOM   2762 C  CB   . SER B 1 21  ? -29.914 65.285 62.620 1.00 29.65 ? 51   SER B CB   1 
ATOM   2763 O  OG   . SER B 1 21  ? -28.999 64.901 61.601 1.00 30.91 ? 51   SER B OG   1 
ATOM   2764 N  N    . ARG B 1 22  ? -32.399 65.132 60.117 1.00 28.81 ? 52   ARG B N    1 
ATOM   2765 C  CA   . ARG B 1 22  ? -33.261 64.248 59.349 1.00 29.15 ? 52   ARG B CA   1 
ATOM   2766 C  C    . ARG B 1 22  ? -32.769 62.812 59.207 1.00 26.38 ? 52   ARG B C    1 
ATOM   2767 O  O    . ARG B 1 22  ? -33.562 61.888 59.336 1.00 28.48 ? 52   ARG B O    1 
ATOM   2768 C  CB   . ARG B 1 22  ? -33.551 64.847 57.965 1.00 32.77 ? 52   ARG B CB   1 
ATOM   2769 C  CG   . ARG B 1 22  ? -34.277 66.175 58.027 1.00 39.40 ? 52   ARG B CG   1 
ATOM   2770 C  CD   . ARG B 1 22  ? -34.741 66.646 56.664 1.00 47.37 ? 52   ARG B CD   1 
ATOM   2771 N  NE   . ARG B 1 22  ? -35.498 67.893 56.762 1.00 54.21 ? 52   ARG B NE   1 
ATOM   2772 C  CZ   . ARG B 1 22  ? -35.132 69.044 56.198 1.00 58.81 ? 52   ARG B CZ   1 
ATOM   2773 N  NH1  . ARG B 1 22  ? -34.011 69.122 55.484 1.00 57.70 ? 52   ARG B NH1  1 
ATOM   2774 N  NH2  . ARG B 1 22  ? -35.888 70.123 56.356 1.00 60.83 ? 52   ARG B NH2  1 
ATOM   2775 N  N    . SER B 1 23  ? -31.474 62.611 58.988 1.00 23.40 ? 53   SER B N    1 
ATOM   2776 C  CA   . SER B 1 23  ? -30.963 61.254 58.817 1.00 21.57 ? 53   SER B CA   1 
ATOM   2777 C  C    . SER B 1 23  ? -29.544 61.042 59.315 1.00 21.72 ? 53   SER B C    1 
ATOM   2778 O  O    . SER B 1 23  ? -29.128 59.910 59.579 1.00 25.26 ? 53   SER B O    1 
ATOM   2779 C  CB   . SER B 1 23  ? -31.039 60.855 57.342 1.00 23.30 ? 53   SER B CB   1 
ATOM   2780 O  OG   . SER B 1 23  ? -30.341 61.787 56.520 1.00 27.97 ? 53   SER B OG   1 
ATOM   2781 N  N    . PHE B 1 24  ? -28.792 62.127 59.446 1.00 20.17 ? 54   PHE B N    1 
ATOM   2782 C  CA   . PHE B 1 24  ? -27.412 62.026 59.897 1.00 16.92 ? 54   PHE B CA   1 
ATOM   2783 C  C    . PHE B 1 24  ? -27.262 61.615 61.374 1.00 17.06 ? 54   PHE B C    1 
ATOM   2784 O  O    . PHE B 1 24  ? -26.190 61.181 61.801 1.00 13.72 ? 54   PHE B O    1 
ATOM   2785 C  CB   . PHE B 1 24  ? -26.674 63.334 59.605 1.00 17.88 ? 54   PHE B CB   1 
ATOM   2786 C  CG   . PHE B 1 24  ? -25.192 63.178 59.541 1.00 20.04 ? 54   PHE B CG   1 
ATOM   2787 C  CD1  . PHE B 1 24  ? -24.625 62.174 58.755 1.00 23.70 ? 54   PHE B CD1  1 
ATOM   2788 C  CD2  . PHE B 1 24  ? -24.362 64.001 60.291 1.00 16.84 ? 54   PHE B CD2  1 
ATOM   2789 C  CE1  . PHE B 1 24  ? -23.255 61.989 58.719 1.00 23.55 ? 54   PHE B CE1  1 
ATOM   2790 C  CE2  . PHE B 1 24  ? -22.990 63.828 60.262 1.00 18.94 ? 54   PHE B CE2  1 
ATOM   2791 C  CZ   . PHE B 1 24  ? -22.432 62.816 59.475 1.00 24.13 ? 54   PHE B CZ   1 
ATOM   2792 N  N    . ALA B 1 25  ? -28.336 61.743 62.148 1.00 17.21 ? 55   ALA B N    1 
ATOM   2793 C  CA   . ALA B 1 25  ? -28.315 61.362 63.563 1.00 17.00 ? 55   ALA B CA   1 
ATOM   2794 C  C    . ALA B 1 25  ? -27.963 59.884 63.681 1.00 15.65 ? 55   ALA B C    1 
ATOM   2795 O  O    . ALA B 1 25  ? -27.188 59.494 64.548 1.00 16.34 ? 55   ALA B O    1 
ATOM   2796 C  CB   . ALA B 1 25  ? -29.681 61.626 64.212 1.00 14.41 ? 55   ALA B CB   1 
ATOM   2797 N  N    . ALA B 1 26  ? -28.494 59.079 62.767 1.00 16.34 ? 56   ALA B N    1 
ATOM   2798 C  CA   . ALA B 1 26  ? -28.255 57.638 62.759 1.00 15.63 ? 56   ALA B CA   1 
ATOM   2799 C  C    . ALA B 1 26  ? -26.789 57.296 62.625 1.00 12.00 ? 56   ALA B C    1 
ATOM   2800 O  O    . ALA B 1 26  ? -26.327 56.310 63.188 1.00 12.79 ? 56   ALA B O    1 
ATOM   2801 C  CB   . ALA B 1 26  ? -29.047 56.975 61.642 1.00 16.83 ? 56   ALA B CB   1 
ATOM   2802 N  N    . VAL B 1 27  ? -26.065 58.115 61.872 1.00 13.00 ? 57   VAL B N    1 
ATOM   2803 C  CA   . VAL B 1 27  ? -24.633 57.914 61.648 1.00 16.38 ? 57   VAL B CA   1 
ATOM   2804 C  C    . VAL B 1 27  ? -23.847 58.383 62.884 1.00 18.54 ? 57   VAL B C    1 
ATOM   2805 O  O    . VAL B 1 27  ? -22.898 57.724 63.320 1.00 19.28 ? 57   VAL B O    1 
ATOM   2806 C  CB   . VAL B 1 27  ? -24.162 58.654 60.367 1.00 16.19 ? 57   VAL B CB   1 
ATOM   2807 C  CG1  . VAL B 1 27  ? -22.695 58.384 60.096 1.00 15.47 ? 57   VAL B CG1  1 
ATOM   2808 C  CG2  . VAL B 1 27  ? -25.008 58.204 59.169 1.00 17.93 ? 57   VAL B CG2  1 
ATOM   2809 N  N    . ILE B 1 28  ? -24.260 59.512 63.453 1.00 18.63 ? 58   ILE B N    1 
ATOM   2810 C  CA   . ILE B 1 28  ? -23.639 60.037 64.662 1.00 13.57 ? 58   ILE B CA   1 
ATOM   2811 C  C    . ILE B 1 28  ? -23.832 58.975 65.745 1.00 13.26 ? 58   ILE B C    1 
ATOM   2812 O  O    . ILE B 1 28  ? -22.890 58.616 66.443 1.00 15.14 ? 58   ILE B O    1 
ATOM   2813 C  CB   . ILE B 1 28  ? -24.323 61.353 65.095 1.00 14.18 ? 58   ILE B CB   1 
ATOM   2814 C  CG1  . ILE B 1 28  ? -23.942 62.474 64.123 1.00 16.36 ? 58   ILE B CG1  1 
ATOM   2815 C  CG2  . ILE B 1 28  ? -23.983 61.702 66.550 1.00 12.31 ? 58   ILE B CG2  1 
ATOM   2816 C  CD1  . ILE B 1 28  ? -24.742 63.758 64.300 1.00 13.23 ? 58   ILE B CD1  1 
ATOM   2817 N  N    . GLN B 1 29  ? -25.043 58.429 65.833 1.00 12.09 ? 59   GLN B N    1 
ATOM   2818 C  CA   . GLN B 1 29  ? -25.361 57.393 66.815 1.00 13.93 ? 59   GLN B CA   1 
ATOM   2819 C  C    . GLN B 1 29  ? -24.565 56.106 66.586 1.00 14.37 ? 59   GLN B C    1 
ATOM   2820 O  O    . GLN B 1 29  ? -24.499 55.248 67.463 1.00 16.33 ? 59   GLN B O    1 
ATOM   2821 C  CB   . GLN B 1 29  ? -26.866 57.090 66.817 1.00 10.38 ? 59   GLN B CB   1 
ATOM   2822 C  CG   . GLN B 1 29  ? -27.727 58.171 67.472 1.00 13.47 ? 59   GLN B CG   1 
ATOM   2823 C  CD   . GLN B 1 29  ? -29.216 57.958 67.266 1.00 8.52  ? 59   GLN B CD   1 
ATOM   2824 O  OE1  . GLN B 1 29  ? -29.655 56.892 66.840 1.00 15.84 ? 59   GLN B OE1  1 
ATOM   2825 N  NE2  . GLN B 1 29  ? -30.004 58.956 67.615 1.00 7.50  ? 59   GLN B NE2  1 
ATOM   2826 N  N    . ALA B 1 30  ? -23.926 56.000 65.427 1.00 16.69 ? 60   ALA B N    1 
ATOM   2827 C  CA   . ALA B 1 30  ? -23.129 54.830 65.083 1.00 10.13 ? 60   ALA B CA   1 
ATOM   2828 C  C    . ALA B 1 30  ? -21.650 55.003 65.416 1.00 10.55 ? 60   ALA B C    1 
ATOM   2829 O  O    . ALA B 1 30  ? -20.868 54.062 65.268 1.00 11.19 ? 60   ALA B O    1 
ATOM   2830 C  CB   . ALA B 1 30  ? -23.292 54.514 63.602 1.00 12.90 ? 60   ALA B CB   1 
ATOM   2831 N  N    . LEU B 1 31  ? -21.253 56.201 65.829 1.00 10.69 ? 61   LEU B N    1 
ATOM   2832 C  CA   . LEU B 1 31  ? -19.855 56.469 66.173 1.00 10.56 ? 61   LEU B CA   1 
ATOM   2833 C  C    . LEU B 1 31  ? -19.406 55.676 67.407 1.00 14.37 ? 61   LEU B C    1 
ATOM   2834 O  O    . LEU B 1 31  ? -20.178 55.482 68.345 1.00 13.08 ? 61   LEU B O    1 
ATOM   2835 C  CB   . LEU B 1 31  ? -19.644 57.970 66.392 1.00 12.45 ? 61   LEU B CB   1 
ATOM   2836 C  CG   . LEU B 1 31  ? -19.654 58.863 65.142 1.00 12.65 ? 61   LEU B CG   1 
ATOM   2837 C  CD1  . LEU B 1 31  ? -19.825 60.327 65.513 1.00 11.68 ? 61   LEU B CD1  1 
ATOM   2838 C  CD2  . LEU B 1 31  ? -18.362 58.675 64.399 1.00 11.23 ? 61   LEU B CD2  1 
ATOM   2839 N  N    . ASP B 1 32  ? -18.157 55.212 67.388 1.00 14.55 ? 62   ASP B N    1 
ATOM   2840 C  CA   . ASP B 1 32  ? -17.591 54.424 68.486 1.00 15.65 ? 62   ASP B CA   1 
ATOM   2841 C  C    . ASP B 1 32  ? -17.297 55.219 69.764 1.00 16.92 ? 62   ASP B C    1 
ATOM   2842 O  O    . ASP B 1 32  ? -16.884 56.386 69.707 1.00 14.87 ? 62   ASP B O    1 
ATOM   2843 C  CB   . ASP B 1 32  ? -16.265 53.778 68.054 1.00 15.83 ? 62   ASP B CB   1 
ATOM   2844 C  CG   . ASP B 1 32  ? -16.434 52.653 67.049 1.00 13.54 ? 62   ASP B CG   1 
ATOM   2845 O  OD1  . ASP B 1 32  ? -17.571 52.198 66.796 1.00 13.99 ? 62   ASP B OD1  1 
ATOM   2846 O  OD2  . ASP B 1 32  ? -15.395 52.221 66.517 1.00 15.37 ? 62   ASP B OD2  1 
ATOM   2847 N  N    . GLY B 1 33  ? -17.433 54.533 70.898 1.00 16.18 ? 63   GLY B N    1 
ATOM   2848 C  CA   . GLY B 1 33  ? -17.142 55.089 72.210 1.00 14.81 ? 63   GLY B CA   1 
ATOM   2849 C  C    . GLY B 1 33  ? -17.507 56.521 72.533 1.00 15.57 ? 63   GLY B C    1 
ATOM   2850 O  O    . GLY B 1 33  ? -18.650 56.957 72.354 1.00 15.03 ? 63   GLY B O    1 
ATOM   2851 N  N    . GLU B 1 34  ? -16.523 57.253 73.047 1.00 17.52 ? 64   GLU B N    1 
ATOM   2852 C  CA   . GLU B 1 34  ? -16.712 58.648 73.425 1.00 19.58 ? 64   GLU B CA   1 
ATOM   2853 C  C    . GLU B 1 34  ? -17.130 59.559 72.285 1.00 19.23 ? 64   GLU B C    1 
ATOM   2854 O  O    . GLU B 1 34  ? -17.746 60.592 72.534 1.00 21.38 ? 64   GLU B O    1 
ATOM   2855 C  CB   . GLU B 1 34  ? -15.463 59.213 74.104 1.00 22.64 ? 64   GLU B CB   1 
ATOM   2856 C  CG   . GLU B 1 34  ? -15.261 58.721 75.547 1.00 23.64 ? 64   GLU B CG   1 
ATOM   2857 C  CD   . GLU B 1 34  ? -13.877 59.030 76.102 1.00 24.44 ? 64   GLU B CD   1 
ATOM   2858 O  OE1  . GLU B 1 34  ? -13.042 59.588 75.368 1.00 19.58 ? 64   GLU B OE1  1 
ATOM   2859 O  OE2  . GLU B 1 34  ? -13.615 58.695 77.274 1.00 30.32 ? 64   GLU B OE2  1 
ATOM   2860 N  N    . MET B 1 35  ? -16.816 59.185 71.047 1.00 18.09 ? 65   MET B N    1 
ATOM   2861 C  CA   . MET B 1 35  ? -17.182 60.013 69.892 1.00 19.60 ? 65   MET B CA   1 
ATOM   2862 C  C    . MET B 1 35  ? -18.692 60.169 69.755 1.00 17.18 ? 65   MET B C    1 
ATOM   2863 O  O    . MET B 1 35  ? -19.181 61.214 69.327 1.00 15.34 ? 65   MET B O    1 
ATOM   2864 C  CB   . MET B 1 35  ? -16.598 59.453 68.590 1.00 24.65 ? 65   MET B CB   1 
ATOM   2865 C  CG   . MET B 1 35  ? -15.072 59.528 68.478 1.00 32.09 ? 65   MET B CG   1 
ATOM   2866 S  SD   . MET B 1 35  ? -14.393 61.153 68.940 1.00 47.02 ? 65   MET B SD   1 
ATOM   2867 C  CE   . MET B 1 35  ? -15.205 62.195 67.754 1.00 46.94 ? 65   MET B CE   1 
ATOM   2868 N  N    . ARG B 1 36  ? -19.426 59.144 70.175 1.00 15.56 ? 66   ARG B N    1 
ATOM   2869 C  CA   . ARG B 1 36  ? -20.882 59.151 70.104 1.00 15.51 ? 66   ARG B CA   1 
ATOM   2870 C  C    . ARG B 1 36  ? -21.471 60.413 70.759 1.00 15.09 ? 66   ARG B C    1 
ATOM   2871 O  O    . ARG B 1 36  ? -22.005 61.289 70.071 1.00 16.85 ? 66   ARG B O    1 
ATOM   2872 C  CB   . ARG B 1 36  ? -21.423 57.880 70.775 1.00 12.96 ? 66   ARG B CB   1 
ATOM   2873 C  CG   . ARG B 1 36  ? -22.797 57.426 70.307 1.00 14.36 ? 66   ARG B CG   1 
ATOM   2874 C  CD   . ARG B 1 36  ? -23.219 56.149 71.038 1.00 9.87  ? 66   ARG B CD   1 
ATOM   2875 N  NE   . ARG B 1 36  ? -24.377 55.503 70.424 1.00 10.80 ? 66   ARG B NE   1 
ATOM   2876 C  CZ   . ARG B 1 36  ? -25.642 55.868 70.611 1.00 12.16 ? 66   ARG B CZ   1 
ATOM   2877 N  NH1  . ARG B 1 36  ? -25.940 56.888 71.405 1.00 13.62 ? 66   ARG B NH1  1 
ATOM   2878 N  NH2  . ARG B 1 36  ? -26.615 55.212 69.994 1.00 8.06  ? 66   ARG B NH2  1 
ATOM   2879 N  N    . ASN B 1 37  ? -21.315 60.538 72.077 1.00 16.95 ? 67   ASN B N    1 
ATOM   2880 C  CA   . ASN B 1 37  ? -21.852 61.694 72.811 1.00 13.32 ? 67   ASN B CA   1 
ATOM   2881 C  C    . ASN B 1 37  ? -21.144 63.006 72.488 1.00 10.52 ? 67   ASN B C    1 
ATOM   2882 O  O    . ASN B 1 37  ? -21.776 64.061 72.413 1.00 12.57 ? 67   ASN B O    1 
ATOM   2883 C  CB   . ASN B 1 37  ? -21.810 61.459 74.328 1.00 12.61 ? 67   ASN B CB   1 
ATOM   2884 C  CG   . ASN B 1 37  ? -22.654 60.270 74.772 1.00 10.15 ? 67   ASN B CG   1 
ATOM   2885 O  OD1  . ASN B 1 37  ? -23.650 59.928 74.149 1.00 13.99 ? 67   ASN B OD1  1 
ATOM   2886 N  ND2  . ASN B 1 37  ? -22.263 59.652 75.873 1.00 8.63  ? 67   ASN B ND2  1 
ATOM   2887 N  N    . ALA B 1 38  ? -19.832 62.948 72.302 1.00 8.53  ? 68   ALA B N    1 
ATOM   2888 C  CA   . ALA B 1 38  ? -19.081 64.152 71.998 1.00 10.37 ? 68   ALA B CA   1 
ATOM   2889 C  C    . ALA B 1 38  ? -19.603 64.809 70.719 1.00 12.21 ? 68   ALA B C    1 
ATOM   2890 O  O    . ALA B 1 38  ? -19.829 66.022 70.685 1.00 14.35 ? 68   ALA B O    1 
ATOM   2891 C  CB   . ALA B 1 38  ? -17.599 63.832 71.874 1.00 8.56  ? 68   ALA B CB   1 
ATOM   2892 N  N    . VAL B 1 39  ? -19.818 64.004 69.679 1.00 13.86 ? 69   VAL B N    1 
ATOM   2893 C  CA   . VAL B 1 39  ? -20.308 64.509 68.395 1.00 11.52 ? 69   VAL B CA   1 
ATOM   2894 C  C    . VAL B 1 39  ? -21.799 64.884 68.471 1.00 16.18 ? 69   VAL B C    1 
ATOM   2895 O  O    . VAL B 1 39  ? -22.224 65.878 67.877 1.00 17.23 ? 69   VAL B O    1 
ATOM   2896 C  CB   . VAL B 1 39  ? -20.007 63.505 67.257 1.00 13.27 ? 69   VAL B CB   1 
ATOM   2897 C  CG1  . VAL B 1 39  ? -20.759 63.879 65.982 1.00 13.43 ? 69   VAL B CG1  1 
ATOM   2898 C  CG2  . VAL B 1 39  ? -18.495 63.471 67.000 1.00 8.37  ? 69   VAL B CG2  1 
ATOM   2899 N  N    . CYS B 1 40  ? -22.576 64.116 69.237 1.00 16.63 ? 70   CYS B N    1 
ATOM   2900 C  CA   . CYS B 1 40  ? -23.993 64.420 69.428 1.00 14.40 ? 70   CYS B CA   1 
ATOM   2901 C  C    . CYS B 1 40  ? -24.115 65.825 70.017 1.00 13.05 ? 70   CYS B C    1 
ATOM   2902 O  O    . CYS B 1 40  ? -24.891 66.645 69.530 1.00 17.32 ? 70   CYS B O    1 
ATOM   2903 C  CB   . CYS B 1 40  ? -24.646 63.431 70.398 1.00 8.56  ? 70   CYS B CB   1 
ATOM   2904 S  SG   . CYS B 1 40  ? -26.332 63.919 70.915 1.00 12.44 ? 70   CYS B SG   1 
ATOM   2905 N  N    . ILE B 1 41  ? -23.309 66.113 71.037 1.00 13.07 ? 71   ILE B N    1 
ATOM   2906 C  CA   . ILE B 1 41  ? -23.337 67.418 71.703 1.00 10.29 ? 71   ILE B CA   1 
ATOM   2907 C  C    . ILE B 1 41  ? -22.803 68.521 70.790 1.00 6.56  ? 71   ILE B C    1 
ATOM   2908 O  O    . ILE B 1 41  ? -23.397 69.592 70.690 1.00 8.39  ? 71   ILE B O    1 
ATOM   2909 C  CB   . ILE B 1 41  ? -22.545 67.392 73.051 1.00 13.21 ? 71   ILE B CB   1 
ATOM   2910 C  CG1  . ILE B 1 41  ? -23.118 66.316 73.996 1.00 8.43  ? 71   ILE B CG1  1 
ATOM   2911 C  CG2  . ILE B 1 41  ? -22.587 68.775 73.724 1.00 12.22 ? 71   ILE B CG2  1 
ATOM   2912 C  CD1  . ILE B 1 41  ? -24.631 66.414 74.255 1.00 2.92  ? 71   ILE B CD1  1 
ATOM   2913 N  N    . PHE B 1 42  ? -21.696 68.243 70.110 1.00 6.65  ? 72   PHE B N    1 
ATOM   2914 C  CA   . PHE B 1 42  ? -21.087 69.191 69.178 1.00 10.33 ? 72   PHE B CA   1 
ATOM   2915 C  C    . PHE B 1 42  ? -22.157 69.622 68.170 1.00 12.15 ? 72   PHE B C    1 
ATOM   2916 O  O    . PHE B 1 42  ? -22.409 70.822 67.981 1.00 12.48 ? 72   PHE B O    1 
ATOM   2917 C  CB   . PHE B 1 42  ? -19.907 68.517 68.459 1.00 9.47  ? 72   PHE B CB   1 
ATOM   2918 C  CG   . PHE B 1 42  ? -19.022 69.469 67.680 1.00 13.12 ? 72   PHE B CG   1 
ATOM   2919 C  CD1  . PHE B 1 42  ? -18.889 70.807 68.056 1.00 13.65 ? 72   PHE B CD1  1 
ATOM   2920 C  CD2  . PHE B 1 42  ? -18.301 69.011 66.577 1.00 7.87  ? 72   PHE B CD2  1 
ATOM   2921 C  CE1  . PHE B 1 42  ? -18.044 71.676 67.339 1.00 18.13 ? 72   PHE B CE1  1 
ATOM   2922 C  CE2  . PHE B 1 42  ? -17.461 69.860 65.858 1.00 6.72  ? 72   PHE B CE2  1 
ATOM   2923 C  CZ   . PHE B 1 42  ? -17.329 71.193 66.234 1.00 15.19 ? 72   PHE B CZ   1 
ATOM   2924 N  N    . TYR B 1 43  ? -22.844 68.636 67.597 1.00 13.48 ? 73   TYR B N    1 
ATOM   2925 C  CA   . TYR B 1 43  ? -23.900 68.885 66.618 1.00 12.37 ? 73   TYR B CA   1 
ATOM   2926 C  C    . TYR B 1 43  ? -24.980 69.791 67.173 1.00 12.06 ? 73   TYR B C    1 
ATOM   2927 O  O    . TYR B 1 43  ? -25.366 70.760 66.532 1.00 16.94 ? 73   TYR B O    1 
ATOM   2928 C  CB   . TYR B 1 43  ? -24.547 67.571 66.174 1.00 15.69 ? 73   TYR B CB   1 
ATOM   2929 C  CG   . TYR B 1 43  ? -25.545 67.745 65.045 1.00 17.95 ? 73   TYR B CG   1 
ATOM   2930 C  CD1  . TYR B 1 43  ? -26.889 68.044 65.300 1.00 17.06 ? 73   TYR B CD1  1 
ATOM   2931 C  CD2  . TYR B 1 43  ? -25.143 67.617 63.721 1.00 16.95 ? 73   TYR B CD2  1 
ATOM   2932 C  CE1  . TYR B 1 43  ? -27.800 68.210 64.254 1.00 17.54 ? 73   TYR B CE1  1 
ATOM   2933 C  CE2  . TYR B 1 43  ? -26.042 67.784 62.674 1.00 15.60 ? 73   TYR B CE2  1 
ATOM   2934 C  CZ   . TYR B 1 43  ? -27.360 68.083 62.942 1.00 16.42 ? 73   TYR B CZ   1 
ATOM   2935 O  OH   . TYR B 1 43  ? -28.214 68.303 61.891 1.00 16.91 ? 73   TYR B OH   1 
ATOM   2936 N  N    . LEU B 1 44  ? -25.486 69.464 68.356 1.00 10.86 ? 74   LEU B N    1 
ATOM   2937 C  CA   . LEU B 1 44  ? -26.541 70.261 68.977 1.00 9.93  ? 74   LEU B CA   1 
ATOM   2938 C  C    . LEU B 1 44  ? -26.096 71.681 69.256 1.00 11.79 ? 74   LEU B C    1 
ATOM   2939 O  O    . LEU B 1 44  ? -26.849 72.633 69.039 1.00 13.76 ? 74   LEU B O    1 
ATOM   2940 C  CB   . LEU B 1 44  ? -26.995 69.612 70.273 1.00 9.85  ? 74   LEU B CB   1 
ATOM   2941 C  CG   . LEU B 1 44  ? -27.718 68.274 70.126 1.00 12.30 ? 74   LEU B CG   1 
ATOM   2942 C  CD1  . LEU B 1 44  ? -27.990 67.681 71.509 1.00 7.77  ? 74   LEU B CD1  1 
ATOM   2943 C  CD2  . LEU B 1 44  ? -29.007 68.482 69.316 1.00 7.20  ? 74   LEU B CD2  1 
ATOM   2944 N  N    . VAL B 1 45  ? -24.861 71.815 69.728 1.00 14.46 ? 75   VAL B N    1 
ATOM   2945 C  CA   . VAL B 1 45  ? -24.280 73.112 70.057 1.00 14.43 ? 75   VAL B CA   1 
ATOM   2946 C  C    . VAL B 1 45  ? -24.165 73.973 68.797 1.00 16.66 ? 75   VAL B C    1 
ATOM   2947 O  O    . VAL B 1 45  ? -24.514 75.164 68.809 1.00 17.80 ? 75   VAL B O    1 
ATOM   2948 C  CB   . VAL B 1 45  ? -22.920 72.906 70.788 1.00 15.78 ? 75   VAL B CB   1 
ATOM   2949 C  CG1  . VAL B 1 45  ? -22.001 74.075 70.600 1.00 19.08 ? 75   VAL B CG1  1 
ATOM   2950 C  CG2  . VAL B 1 45  ? -23.173 72.649 72.277 1.00 14.72 ? 75   VAL B CG2  1 
ATOM   2951 N  N    . LEU B 1 46  ? -23.748 73.347 67.698 1.00 16.99 ? 76   LEU B N    1 
ATOM   2952 C  CA   . LEU B 1 46  ? -23.613 74.027 66.402 1.00 17.20 ? 76   LEU B CA   1 
ATOM   2953 C  C    . LEU B 1 46  ? -25.001 74.408 65.903 1.00 14.70 ? 76   LEU B C    1 
ATOM   2954 O  O    . LEU B 1 46  ? -25.213 75.497 65.376 1.00 13.54 ? 76   LEU B O    1 
ATOM   2955 C  CB   . LEU B 1 46  ? -22.918 73.106 65.393 1.00 13.83 ? 76   LEU B CB   1 
ATOM   2956 C  CG   . LEU B 1 46  ? -21.471 72.752 65.736 1.00 13.83 ? 76   LEU B CG   1 
ATOM   2957 C  CD1  . LEU B 1 46  ? -21.005 71.555 64.915 1.00 13.22 ? 76   LEU B CD1  1 
ATOM   2958 C  CD2  . LEU B 1 46  ? -20.583 73.964 65.508 1.00 9.80  ? 76   LEU B CD2  1 
ATOM   2959 N  N    . ARG B 1 47  ? -25.952 73.521 66.154 1.00 15.98 ? 77   ARG B N    1 
ATOM   2960 C  CA   . ARG B 1 47  ? -27.343 73.709 65.778 1.00 19.92 ? 77   ARG B CA   1 
ATOM   2961 C  C    . ARG B 1 47  ? -27.896 74.959 66.472 1.00 20.67 ? 77   ARG B C    1 
ATOM   2962 O  O    . ARG B 1 47  ? -28.606 75.769 65.862 1.00 19.69 ? 77   ARG B O    1 
ATOM   2963 C  CB   . ARG B 1 47  ? -28.135 72.471 66.221 1.00 24.81 ? 77   ARG B CB   1 
ATOM   2964 C  CG   . ARG B 1 47  ? -29.303 72.082 65.357 1.00 31.36 ? 77   ARG B CG   1 
ATOM   2965 C  CD   . ARG B 1 47  ? -28.865 71.856 63.927 1.00 38.28 ? 77   ARG B CD   1 
ATOM   2966 N  NE   . ARG B 1 47  ? -29.161 73.017 63.102 1.00 42.44 ? 77   ARG B NE   1 
ATOM   2967 C  CZ   . ARG B 1 47  ? -30.058 73.018 62.126 1.00 51.28 ? 77   ARG B CZ   1 
ATOM   2968 N  NH1  . ARG B 1 47  ? -30.749 71.915 61.851 1.00 52.59 ? 77   ARG B NH1  1 
ATOM   2969 N  NH2  . ARG B 1 47  ? -30.298 74.134 61.450 1.00 58.55 ? 77   ARG B NH2  1 
ATOM   2970 N  N    . ALA B 1 48  ? -27.567 75.106 67.755 1.00 20.62 ? 78   ALA B N    1 
ATOM   2971 C  CA   . ALA B 1 48  ? -28.025 76.250 68.547 1.00 20.50 ? 78   ALA B CA   1 
ATOM   2972 C  C    . ALA B 1 48  ? -27.463 77.553 67.991 1.00 17.95 ? 78   ALA B C    1 
ATOM   2973 O  O    . ALA B 1 48  ? -28.192 78.535 67.800 1.00 17.12 ? 78   ALA B O    1 
ATOM   2974 C  CB   . ALA B 1 48  ? -27.616 76.077 70.009 1.00 17.06 ? 78   ALA B CB   1 
ATOM   2975 N  N    . LEU B 1 49  ? -26.170 77.531 67.691 1.00 19.94 ? 79   LEU B N    1 
ATOM   2976 C  CA   . LEU B 1 49  ? -25.462 78.692 67.162 1.00 22.04 ? 79   LEU B CA   1 
ATOM   2977 C  C    . LEU B 1 49  ? -26.005 79.122 65.791 1.00 21.76 ? 79   LEU B C    1 
ATOM   2978 O  O    . LEU B 1 49  ? -26.239 80.313 65.555 1.00 18.61 ? 79   LEU B O    1 
ATOM   2979 C  CB   . LEU B 1 49  ? -23.963 78.392 67.100 1.00 19.82 ? 79   LEU B CB   1 
ATOM   2980 C  CG   . LEU B 1 49  ? -22.970 79.549 67.047 1.00 24.26 ? 79   LEU B CG   1 
ATOM   2981 C  CD1  . LEU B 1 49  ? -23.278 80.572 68.126 1.00 25.15 ? 79   LEU B CD1  1 
ATOM   2982 C  CD2  . LEU B 1 49  ? -21.556 79.013 67.198 1.00 26.64 ? 79   LEU B CD2  1 
ATOM   2983 N  N    . ASP B 1 50  ? -26.251 78.153 64.912 1.00 21.87 ? 80   ASP B N    1 
ATOM   2984 C  CA   . ASP B 1 50  ? -26.786 78.447 63.583 1.00 22.05 ? 80   ASP B CA   1 
ATOM   2985 C  C    . ASP B 1 50  ? -28.175 79.043 63.716 1.00 22.45 ? 80   ASP B C    1 
ATOM   2986 O  O    . ASP B 1 50  ? -28.549 79.950 62.962 1.00 22.32 ? 80   ASP B O    1 
ATOM   2987 C  CB   . ASP B 1 50  ? -26.891 77.183 62.729 1.00 23.23 ? 80   ASP B CB   1 
ATOM   2988 C  CG   . ASP B 1 50  ? -25.571 76.462 62.577 1.00 26.89 ? 80   ASP B CG   1 
ATOM   2989 O  OD1  . ASP B 1 50  ? -24.511 77.123 62.537 1.00 31.09 ? 80   ASP B OD1  1 
ATOM   2990 O  OD2  . ASP B 1 50  ? -25.596 75.215 62.487 1.00 32.86 ? 80   ASP B OD2  1 
ATOM   2991 N  N    . THR B 1 51  ? -28.956 78.510 64.654 1.00 21.70 ? 81   THR B N    1 
ATOM   2992 C  CA   . THR B 1 51  ? -30.313 79.005 64.866 1.00 20.31 ? 81   THR B CA   1 
ATOM   2993 C  C    . THR B 1 51  ? -30.254 80.471 65.292 1.00 21.76 ? 81   THR B C    1 
ATOM   2994 O  O    . THR B 1 51  ? -31.054 81.284 64.834 1.00 22.06 ? 81   THR B O    1 
ATOM   2995 C  CB   . THR B 1 51  ? -31.092 78.134 65.903 1.00 21.34 ? 81   THR B CB   1 
ATOM   2996 O  OG1  . THR B 1 51  ? -31.233 76.797 65.399 1.00 17.86 ? 81   THR B OG1  1 
ATOM   2997 C  CG2  . THR B 1 51  ? -32.482 78.699 66.160 1.00 16.41 ? 81   THR B CG2  1 
ATOM   2998 N  N    . LEU B 1 52  ? -29.271 80.818 66.121 1.00 22.49 ? 82   LEU B N    1 
ATOM   2999 C  CA   . LEU B 1 52  ? -29.128 82.206 66.563 1.00 24.01 ? 82   LEU B CA   1 
ATOM   3000 C  C    . LEU B 1 52  ? -28.733 83.109 65.398 1.00 25.05 ? 82   LEU B C    1 
ATOM   3001 O  O    . LEU B 1 52  ? -29.243 84.223 65.274 1.00 24.46 ? 82   LEU B O    1 
ATOM   3002 C  CB   . LEU B 1 52  ? -28.084 82.331 67.677 1.00 23.04 ? 82   LEU B CB   1 
ATOM   3003 C  CG   . LEU B 1 52  ? -28.449 81.837 69.072 1.00 19.13 ? 82   LEU B CG   1 
ATOM   3004 C  CD1  . LEU B 1 52  ? -27.186 81.772 69.908 1.00 20.09 ? 82   LEU B CD1  1 
ATOM   3005 C  CD2  . LEU B 1 52  ? -29.485 82.756 69.710 1.00 14.35 ? 82   LEU B CD2  1 
ATOM   3006 N  N    . GLU B 1 53  ? -27.810 82.631 64.563 1.00 21.94 ? 83   GLU B N    1 
ATOM   3007 C  CA   . GLU B 1 53  ? -27.342 83.398 63.410 1.00 22.01 ? 83   GLU B CA   1 
ATOM   3008 C  C    . GLU B 1 53  ? -28.458 83.620 62.385 1.00 22.53 ? 83   GLU B C    1 
ATOM   3009 O  O    . GLU B 1 53  ? -28.595 84.714 61.835 1.00 21.42 ? 83   GLU B O    1 
ATOM   3010 C  CB   . GLU B 1 53  ? -26.154 82.697 62.737 1.00 19.81 ? 83   GLU B CB   1 
ATOM   3011 C  CG   . GLU B 1 53  ? -25.586 83.461 61.539 1.00 26.64 ? 83   GLU B CG   1 
ATOM   3012 C  CD   . GLU B 1 53  ? -24.781 82.589 60.590 1.00 24.41 ? 83   GLU B CD   1 
ATOM   3013 O  OE1  . GLU B 1 53  ? -25.181 81.433 60.349 1.00 28.24 ? 83   GLU B OE1  1 
ATOM   3014 O  OE2  . GLU B 1 53  ? -23.752 83.065 60.070 1.00 24.01 ? 83   GLU B OE2  1 
ATOM   3015 N  N    . ASP B 1 54  ? -29.245 82.574 62.139 1.00 23.72 ? 84   ASP B N    1 
ATOM   3016 C  CA   . ASP B 1 54  ? -30.350 82.609 61.176 1.00 26.44 ? 84   ASP B CA   1 
ATOM   3017 C  C    . ASP B 1 54  ? -31.520 83.500 61.567 1.00 27.04 ? 84   ASP B C    1 
ATOM   3018 O  O    . ASP B 1 54  ? -32.163 84.114 60.702 1.00 26.36 ? 84   ASP B O    1 
ATOM   3019 C  CB   . ASP B 1 54  ? -30.919 81.203 60.968 1.00 28.25 ? 84   ASP B CB   1 
ATOM   3020 C  CG   . ASP B 1 54  ? -29.952 80.266 60.282 1.00 33.88 ? 84   ASP B CG   1 
ATOM   3021 O  OD1  . ASP B 1 54  ? -28.939 80.742 59.715 1.00 34.30 ? 84   ASP B OD1  1 
ATOM   3022 O  OD2  . ASP B 1 54  ? -30.222 79.042 60.311 1.00 30.69 ? 84   ASP B OD2  1 
ATOM   3023 N  N    . ASP B 1 55  ? -31.828 83.500 62.860 1.00 24.46 ? 85   ASP B N    1 
ATOM   3024 C  CA   . ASP B 1 55  ? -32.947 84.244 63.409 1.00 24.57 ? 85   ASP B CA   1 
ATOM   3025 C  C    . ASP B 1 55  ? -32.903 85.756 63.193 1.00 25.12 ? 85   ASP B C    1 
ATOM   3026 O  O    . ASP B 1 55  ? -32.356 86.503 63.998 1.00 19.06 ? 85   ASP B O    1 
ATOM   3027 C  CB   . ASP B 1 55  ? -33.096 83.916 64.899 1.00 29.22 ? 85   ASP B CB   1 
ATOM   3028 C  CG   . ASP B 1 55  ? -34.528 84.032 65.389 1.00 29.82 ? 85   ASP B CG   1 
ATOM   3029 O  OD1  . ASP B 1 55  ? -35.331 84.775 64.772 1.00 35.06 ? 85   ASP B OD1  1 
ATOM   3030 O  OD2  . ASP B 1 55  ? -34.849 83.364 66.394 1.00 28.31 ? 85   ASP B OD2  1 
ATOM   3031 N  N    . MET B 1 56  ? -33.580 86.206 62.147 1.00 27.82 ? 86   MET B N    1 
ATOM   3032 C  CA   . MET B 1 56  ? -33.623 87.623 61.829 1.00 31.65 ? 86   MET B CA   1 
ATOM   3033 C  C    . MET B 1 56  ? -34.460 88.472 62.786 1.00 31.78 ? 86   MET B C    1 
ATOM   3034 O  O    . MET B 1 56  ? -34.425 89.700 62.702 1.00 34.22 ? 86   MET B O    1 
ATOM   3035 C  CB   . MET B 1 56  ? -34.079 87.822 60.386 1.00 30.03 ? 86   MET B CB   1 
ATOM   3036 C  CG   . MET B 1 56  ? -33.046 87.357 59.382 1.00 32.88 ? 86   MET B CG   1 
ATOM   3037 S  SD   . MET B 1 56  ? -31.529 88.309 59.516 1.00 35.43 ? 86   MET B SD   1 
ATOM   3038 C  CE   . MET B 1 56  ? -30.304 87.020 59.520 1.00 39.27 ? 86   MET B CE   1 
ATOM   3039 N  N    . THR B 1 57  ? -35.206 87.841 63.693 1.00 28.67 ? 87   THR B N    1 
ATOM   3040 C  CA   . THR B 1 57  ? -36.008 88.601 64.644 1.00 24.89 ? 87   THR B CA   1 
ATOM   3041 C  C    . THR B 1 57  ? -35.170 89.062 65.841 1.00 24.85 ? 87   THR B C    1 
ATOM   3042 O  O    . THR B 1 57  ? -35.630 89.848 66.667 1.00 28.21 ? 87   THR B O    1 
ATOM   3043 C  CB   . THR B 1 57  ? -37.233 87.811 65.156 1.00 24.91 ? 87   THR B CB   1 
ATOM   3044 O  OG1  . THR B 1 57  ? -36.801 86.653 65.886 1.00 24.25 ? 87   THR B OG1  1 
ATOM   3045 C  CG2  . THR B 1 57  ? -38.123 87.395 63.996 1.00 20.12 ? 87   THR B CG2  1 
ATOM   3046 N  N    . ILE B 1 58  ? -33.944 88.567 65.936 1.00 24.88 ? 88   ILE B N    1 
ATOM   3047 C  CA   . ILE B 1 58  ? -33.056 88.941 67.030 1.00 26.14 ? 88   ILE B CA   1 
ATOM   3048 C  C    . ILE B 1 58  ? -32.205 90.125 66.568 1.00 25.01 ? 88   ILE B C    1 
ATOM   3049 O  O    . ILE B 1 58  ? -31.282 89.963 65.769 1.00 23.63 ? 88   ILE B O    1 
ATOM   3050 C  CB   . ILE B 1 58  ? -32.128 87.766 67.429 1.00 27.05 ? 88   ILE B CB   1 
ATOM   3051 C  CG1  . ILE B 1 58  ? -32.953 86.507 67.731 1.00 25.85 ? 88   ILE B CG1  1 
ATOM   3052 C  CG2  . ILE B 1 58  ? -31.287 88.154 68.635 1.00 31.46 ? 88   ILE B CG2  1 
ATOM   3053 C  CD1  . ILE B 1 58  ? -32.108 85.258 67.922 1.00 20.95 ? 88   ILE B CD1  1 
ATOM   3054 N  N    . SER B 1 59  ? -32.517 91.310 67.085 1.00 28.02 ? 89   SER B N    1 
ATOM   3055 C  CA   . SER B 1 59  ? -31.804 92.535 66.718 1.00 30.02 ? 89   SER B CA   1 
ATOM   3056 C  C    . SER B 1 59  ? -30.294 92.381 66.858 1.00 28.61 ? 89   SER B C    1 
ATOM   3057 O  O    . SER B 1 59  ? -29.811 91.837 67.853 1.00 31.68 ? 89   SER B O    1 
ATOM   3058 C  CB   . SER B 1 59  ? -32.314 93.703 67.556 1.00 31.01 ? 89   SER B CB   1 
ATOM   3059 O  OG   . SER B 1 59  ? -32.325 93.373 68.931 1.00 36.47 ? 89   SER B OG   1 
ATOM   3060 N  N    . VAL B 1 60  ? -29.554 92.881 65.871 1.00 28.19 ? 90   VAL B N    1 
ATOM   3061 C  CA   . VAL B 1 60  ? -28.102 92.760 65.855 1.00 27.76 ? 90   VAL B CA   1 
ATOM   3062 C  C    . VAL B 1 60  ? -27.388 93.185 67.130 1.00 27.74 ? 90   VAL B C    1 
ATOM   3063 O  O    . VAL B 1 60  ? -26.385 92.581 67.500 1.00 25.59 ? 90   VAL B O    1 
ATOM   3064 C  CB   . VAL B 1 60  ? -27.452 93.477 64.632 1.00 28.19 ? 90   VAL B CB   1 
ATOM   3065 C  CG1  . VAL B 1 60  ? -27.881 92.813 63.333 1.00 26.58 ? 90   VAL B CG1  1 
ATOM   3066 C  CG2  . VAL B 1 60  ? -27.808 94.947 64.619 1.00 31.35 ? 90   VAL B CG2  1 
ATOM   3067 N  N    . GLU B 1 61  ? -27.909 94.188 67.827 1.00 31.85 ? 91   GLU B N    1 
ATOM   3068 C  CA   . GLU B 1 61  ? -27.234 94.633 69.042 1.00 36.04 ? 91   GLU B CA   1 
ATOM   3069 C  C    . GLU B 1 61  ? -27.311 93.578 70.148 1.00 35.47 ? 91   GLU B C    1 
ATOM   3070 O  O    . GLU B 1 61  ? -26.492 93.571 71.064 1.00 36.29 ? 91   GLU B O    1 
ATOM   3071 C  CB   . GLU B 1 61  ? -27.721 96.024 69.500 1.00 35.55 ? 91   GLU B CB   1 
ATOM   3072 C  CG   . GLU B 1 61  ? -28.733 96.059 70.632 1.00 35.43 ? 91   GLU B CG   1 
ATOM   3073 C  CD   . GLU B 1 61  ? -30.115 95.642 70.198 1.00 40.41 ? 91   GLU B CD   1 
ATOM   3074 O  OE1  . GLU B 1 61  ? -30.326 95.465 68.980 1.00 41.38 ? 91   GLU B OE1  1 
ATOM   3075 O  OE2  . GLU B 1 61  ? -30.996 95.499 71.074 1.00 43.54 ? 91   GLU B OE2  1 
ATOM   3076 N  N    . LYS B 1 62  ? -28.273 92.666 70.027 1.00 35.31 ? 92   LYS B N    1 
ATOM   3077 C  CA   . LYS B 1 62  ? -28.428 91.576 70.985 1.00 35.43 ? 92   LYS B CA   1 
ATOM   3078 C  C    . LYS B 1 62  ? -27.793 90.312 70.413 1.00 32.22 ? 92   LYS B C    1 
ATOM   3079 O  O    . LYS B 1 62  ? -27.126 89.561 71.126 1.00 31.09 ? 92   LYS B O    1 
ATOM   3080 C  CB   . LYS B 1 62  ? -29.906 91.312 71.283 1.00 37.61 ? 92   LYS B CB   1 
ATOM   3081 C  CG   . LYS B 1 62  ? -30.604 92.464 71.969 1.00 44.94 ? 92   LYS B CG   1 
ATOM   3082 C  CD   . LYS B 1 62  ? -32.074 92.177 72.185 1.00 48.12 ? 92   LYS B CD   1 
ATOM   3083 C  CE   . LYS B 1 62  ? -32.767 93.389 72.771 1.00 53.49 ? 92   LYS B CE   1 
ATOM   3084 N  NZ   . LYS B 1 62  ? -34.188 93.120 73.095 1.00 61.52 ? 92   LYS B NZ   1 
ATOM   3085 N  N    . LYS B 1 63  ? -27.979 90.098 69.116 1.00 27.14 ? 93   LYS B N    1 
ATOM   3086 C  CA   . LYS B 1 63  ? -27.439 88.923 68.445 1.00 25.07 ? 93   LYS B CA   1 
ATOM   3087 C  C    . LYS B 1 63  ? -25.911 88.842 68.550 1.00 25.32 ? 93   LYS B C    1 
ATOM   3088 O  O    . LYS B 1 63  ? -25.365 87.781 68.860 1.00 26.13 ? 93   LYS B O    1 
ATOM   3089 C  CB   . LYS B 1 63  ? -27.894 88.899 66.977 1.00 23.68 ? 93   LYS B CB   1 
ATOM   3090 C  CG   . LYS B 1 63  ? -27.569 87.608 66.233 1.00 20.72 ? 93   LYS B CG   1 
ATOM   3091 C  CD   . LYS B 1 63  ? -28.019 87.645 64.772 1.00 24.15 ? 93   LYS B CD   1 
ATOM   3092 C  CE   . LYS B 1 63  ? -29.441 87.138 64.583 1.00 19.93 ? 93   LYS B CE   1 
ATOM   3093 N  NZ   . LYS B 1 63  ? -29.761 86.957 63.122 1.00 17.21 ? 93   LYS B NZ   1 
ATOM   3094 N  N    . VAL B 1 64  ? -25.227 89.965 68.350 1.00 25.14 ? 94   VAL B N    1 
ATOM   3095 C  CA   . VAL B 1 64  ? -23.764 89.987 68.415 1.00 24.63 ? 94   VAL B CA   1 
ATOM   3096 C  C    . VAL B 1 64  ? -23.180 89.435 69.728 1.00 24.71 ? 94   VAL B C    1 
ATOM   3097 O  O    . VAL B 1 64  ? -22.242 88.631 69.698 1.00 23.39 ? 94   VAL B O    1 
ATOM   3098 C  CB   . VAL B 1 64  ? -23.205 91.391 68.100 1.00 23.50 ? 94   VAL B CB   1 
ATOM   3099 C  CG1  . VAL B 1 64  ? -21.691 91.409 68.266 1.00 22.22 ? 94   VAL B CG1  1 
ATOM   3100 C  CG2  . VAL B 1 64  ? -23.577 91.782 66.672 1.00 26.13 ? 94   VAL B CG2  1 
ATOM   3101 N  N    . PRO B 1 65  ? -23.663 89.915 70.891 1.00 23.33 ? 95   PRO B N    1 
ATOM   3102 C  CA   . PRO B 1 65  ? -23.127 89.388 72.154 1.00 22.76 ? 95   PRO B CA   1 
ATOM   3103 C  C    . PRO B 1 65  ? -23.409 87.886 72.247 1.00 21.69 ? 95   PRO B C    1 
ATOM   3104 O  O    . PRO B 1 65  ? -22.534 87.104 72.622 1.00 22.45 ? 95   PRO B O    1 
ATOM   3105 C  CB   . PRO B 1 65  ? -23.916 90.169 73.204 1.00 23.08 ? 95   PRO B CB   1 
ATOM   3106 C  CG   . PRO B 1 65  ? -24.088 91.508 72.540 1.00 21.29 ? 95   PRO B CG   1 
ATOM   3107 C  CD   . PRO B 1 65  ? -24.494 91.110 71.135 1.00 21.47 ? 95   PRO B CD   1 
ATOM   3108 N  N    . LEU B 1 66  ? -24.613 87.484 71.843 1.00 21.25 ? 96   LEU B N    1 
ATOM   3109 C  CA   . LEU B 1 66  ? -25.007 86.073 71.868 1.00 22.05 ? 96   LEU B CA   1 
ATOM   3110 C  C    . LEU B 1 66  ? -24.047 85.186 71.084 1.00 21.58 ? 96   LEU B C    1 
ATOM   3111 O  O    . LEU B 1 66  ? -23.608 84.147 71.583 1.00 17.71 ? 96   LEU B O    1 
ATOM   3112 C  CB   . LEU B 1 66  ? -26.425 85.893 71.319 1.00 25.73 ? 96   LEU B CB   1 
ATOM   3113 C  CG   . LEU B 1 66  ? -27.553 86.350 72.244 1.00 28.74 ? 96   LEU B CG   1 
ATOM   3114 C  CD1  . LEU B 1 66  ? -28.891 86.250 71.525 1.00 29.90 ? 96   LEU B CD1  1 
ATOM   3115 C  CD2  . LEU B 1 66  ? -27.542 85.527 73.524 1.00 30.07 ? 96   LEU B CD2  1 
ATOM   3116 N  N    . LEU B 1 67  ? -23.723 85.601 69.861 1.00 21.07 ? 97   LEU B N    1 
ATOM   3117 C  CA   . LEU B 1 67  ? -22.814 84.843 69.002 1.00 20.70 ? 97   LEU B CA   1 
ATOM   3118 C  C    . LEU B 1 67  ? -21.398 84.844 69.560 1.00 21.58 ? 97   LEU B C    1 
ATOM   3119 O  O    . LEU B 1 67  ? -20.721 83.816 69.580 1.00 22.96 ? 97   LEU B O    1 
ATOM   3120 C  CB   . LEU B 1 67  ? -22.803 85.426 67.588 1.00 18.76 ? 97   LEU B CB   1 
ATOM   3121 C  CG   . LEU B 1 67  ? -24.133 85.437 66.835 1.00 23.45 ? 97   LEU B CG   1 
ATOM   3122 C  CD1  . LEU B 1 67  ? -23.971 86.107 65.472 1.00 21.55 ? 97   LEU B CD1  1 
ATOM   3123 C  CD2  . LEU B 1 67  ? -24.641 84.014 66.675 1.00 21.12 ? 97   LEU B CD2  1 
ATOM   3124 N  N    . HIS B 1 68  ? -20.957 86.005 70.020 1.00 19.44 ? 98   HIS B N    1 
ATOM   3125 C  CA   . HIS B 1 68  ? -19.620 86.154 70.572 1.00 18.93 ? 98   HIS B CA   1 
ATOM   3126 C  C    . HIS B 1 68  ? -19.371 85.389 71.870 1.00 13.79 ? 98   HIS B C    1 
ATOM   3127 O  O    . HIS B 1 68  ? -18.304 84.829 72.056 1.00 14.11 ? 98   HIS B O    1 
ATOM   3128 C  CB   . HIS B 1 68  ? -19.323 87.640 70.814 1.00 22.70 ? 98   HIS B CB   1 
ATOM   3129 C  CG   . HIS B 1 68  ? -18.842 88.374 69.601 1.00 27.40 ? 98   HIS B CG   1 
ATOM   3130 N  ND1  . HIS B 1 68  ? -19.116 89.709 69.383 1.00 24.92 ? 98   HIS B ND1  1 
ATOM   3131 C  CD2  . HIS B 1 68  ? -18.057 87.978 68.573 1.00 27.91 ? 98   HIS B CD2  1 
ATOM   3132 C  CE1  . HIS B 1 68  ? -18.510 90.104 68.278 1.00 28.39 ? 98   HIS B CE1  1 
ATOM   3133 N  NE2  . HIS B 1 68  ? -17.860 89.074 67.768 1.00 28.04 ? 98   HIS B NE2  1 
ATOM   3134 N  N    . ASN B 1 69  ? -20.352 85.383 72.767 1.00 15.72 ? 99   ASN B N    1 
ATOM   3135 C  CA   . ASN B 1 69  ? -20.205 84.731 74.073 1.00 16.94 ? 99   ASN B CA   1 
ATOM   3136 C  C    . ASN B 1 69  ? -20.789 83.328 74.163 1.00 19.10 ? 99   ASN B C    1 
ATOM   3137 O  O    . ASN B 1 69  ? -20.804 82.732 75.249 1.00 15.61 ? 99   ASN B O    1 
ATOM   3138 C  CB   . ASN B 1 69  ? -20.844 85.594 75.169 1.00 18.37 ? 99   ASN B CB   1 
ATOM   3139 C  CG   . ASN B 1 69  ? -20.371 87.028 75.133 1.00 17.93 ? 99   ASN B CG   1 
ATOM   3140 O  OD1  . ASN B 1 69  ? -19.260 87.316 74.689 1.00 18.76 ? 99   ASN B OD1  1 
ATOM   3141 N  ND2  . ASN B 1 69  ? -21.211 87.939 75.602 1.00 20.59 ? 99   ASN B ND2  1 
ATOM   3142 N  N    . PHE B 1 70  ? -21.266 82.796 73.036 1.00 19.39 ? 100  PHE B N    1 
ATOM   3143 C  CA   . PHE B 1 70  ? -21.858 81.463 73.021 1.00 16.46 ? 100  PHE B CA   1 
ATOM   3144 C  C    . PHE B 1 70  ? -20.955 80.404 73.656 1.00 16.60 ? 100  PHE B C    1 
ATOM   3145 O  O    . PHE B 1 70  ? -21.422 79.575 74.440 1.00 11.89 ? 100  PHE B O    1 
ATOM   3146 C  CB   . PHE B 1 70  ? -22.235 81.039 71.608 1.00 15.37 ? 100  PHE B CB   1 
ATOM   3147 C  CG   . PHE B 1 70  ? -23.005 79.754 71.567 1.00 14.30 ? 100  PHE B CG   1 
ATOM   3148 C  CD1  . PHE B 1 70  ? -24.366 79.734 71.894 1.00 14.69 ? 100  PHE B CD1  1 
ATOM   3149 C  CD2  . PHE B 1 70  ? -22.364 78.552 71.264 1.00 10.83 ? 100  PHE B CD2  1 
ATOM   3150 C  CE1  . PHE B 1 70  ? -25.072 78.530 71.930 1.00 13.31 ? 100  PHE B CE1  1 
ATOM   3151 C  CE2  . PHE B 1 70  ? -23.058 77.340 71.296 1.00 11.25 ? 100  PHE B CE2  1 
ATOM   3152 C  CZ   . PHE B 1 70  ? -24.412 77.326 71.627 1.00 12.12 ? 100  PHE B CZ   1 
ATOM   3153 N  N    . HIS B 1 71  ? -19.669 80.436 73.312 1.00 14.44 ? 101  HIS B N    1 
ATOM   3154 C  CA   . HIS B 1 71  ? -18.694 79.499 73.864 1.00 14.90 ? 101  HIS B CA   1 
ATOM   3155 C  C    . HIS B 1 71  ? -18.716 79.505 75.403 1.00 15.32 ? 101  HIS B C    1 
ATOM   3156 O  O    . HIS B 1 71  ? -18.449 78.485 76.039 1.00 15.73 ? 101  HIS B O    1 
ATOM   3157 C  CB   . HIS B 1 71  ? -17.285 79.840 73.360 1.00 14.87 ? 101  HIS B CB   1 
ATOM   3158 C  CG   . HIS B 1 71  ? -16.720 81.102 73.941 1.00 13.76 ? 101  HIS B CG   1 
ATOM   3159 N  ND1  . HIS B 1 71  ? -17.178 82.352 73.594 1.00 14.22 ? 101  HIS B ND1  1 
ATOM   3160 C  CD2  . HIS B 1 71  ? -15.750 81.301 74.868 1.00 9.78  ? 101  HIS B CD2  1 
ATOM   3161 C  CE1  . HIS B 1 71  ? -16.522 83.271 74.284 1.00 8.25  ? 101  HIS B CE1  1 
ATOM   3162 N  NE2  . HIS B 1 71  ? -15.651 82.657 75.063 1.00 8.14  ? 101  HIS B NE2  1 
ATOM   3163 N  N    . SER B 1 72  ? -19.030 80.654 75.997 1.00 16.67 ? 102  SER B N    1 
ATOM   3164 C  CA   . SER B 1 72  ? -19.092 80.770 77.456 1.00 16.25 ? 102  SER B CA   1 
ATOM   3165 C  C    . SER B 1 72  ? -20.368 80.164 78.045 1.00 15.53 ? 102  SER B C    1 
ATOM   3166 O  O    . SER B 1 72  ? -20.333 79.538 79.114 1.00 14.05 ? 102  SER B O    1 
ATOM   3167 C  CB   . SER B 1 72  ? -18.975 82.229 77.881 1.00 11.38 ? 102  SER B CB   1 
ATOM   3168 O  OG   . SER B 1 72  ? -17.776 82.782 77.385 1.00 21.78 ? 102  SER B OG   1 
ATOM   3169 N  N    . PHE B 1 73  ? -21.478 80.312 77.326 1.00 13.24 ? 103  PHE B N    1 
ATOM   3170 C  CA   . PHE B 1 73  ? -22.773 79.784 77.770 1.00 14.27 ? 103  PHE B CA   1 
ATOM   3171 C  C    . PHE B 1 73  ? -22.755 78.263 77.975 1.00 14.75 ? 103  PHE B C    1 
ATOM   3172 O  O    . PHE B 1 73  ? -23.566 77.704 78.717 1.00 15.97 ? 103  PHE B O    1 
ATOM   3173 C  CB   . PHE B 1 73  ? -23.865 80.174 76.766 1.00 16.79 ? 103  PHE B CB   1 
ATOM   3174 C  CG   . PHE B 1 73  ? -23.970 81.662 76.516 1.00 19.26 ? 103  PHE B CG   1 
ATOM   3175 C  CD1  . PHE B 1 73  ? -23.553 82.585 77.479 1.00 14.89 ? 103  PHE B CD1  1 
ATOM   3176 C  CD2  . PHE B 1 73  ? -24.492 82.141 75.313 1.00 21.40 ? 103  PHE B CD2  1 
ATOM   3177 C  CE1  . PHE B 1 73  ? -23.658 83.958 77.245 1.00 16.08 ? 103  PHE B CE1  1 
ATOM   3178 C  CE2  . PHE B 1 73  ? -24.603 83.517 75.070 1.00 21.07 ? 103  PHE B CE2  1 
ATOM   3179 C  CZ   . PHE B 1 73  ? -24.185 84.427 76.036 1.00 15.55 ? 103  PHE B CZ   1 
ATOM   3180 N  N    . LEU B 1 74  ? -21.816 77.604 77.312 1.00 13.53 ? 104  LEU B N    1 
ATOM   3181 C  CA   . LEU B 1 74  ? -21.643 76.164 77.403 1.00 14.06 ? 104  LEU B CA   1 
ATOM   3182 C  C    . LEU B 1 74  ? -21.349 75.748 78.843 1.00 15.29 ? 104  LEU B C    1 
ATOM   3183 O  O    . LEU B 1 74  ? -21.681 74.640 79.264 1.00 14.22 ? 104  LEU B O    1 
ATOM   3184 C  CB   . LEU B 1 74  ? -20.454 75.751 76.529 1.00 12.12 ? 104  LEU B CB   1 
ATOM   3185 C  CG   . LEU B 1 74  ? -20.585 75.113 75.143 1.00 9.97  ? 104  LEU B CG   1 
ATOM   3186 C  CD1  . LEU B 1 74  ? -21.971 75.256 74.552 1.00 7.86  ? 104  LEU B CD1  1 
ATOM   3187 C  CD2  . LEU B 1 74  ? -19.530 75.708 74.259 1.00 2.00  ? 104  LEU B CD2  1 
ATOM   3188 N  N    . TYR B 1 75  ? -20.667 76.630 79.569 1.00 17.14 ? 105  TYR B N    1 
ATOM   3189 C  CA   . TYR B 1 75  ? -20.281 76.374 80.951 1.00 15.69 ? 105  TYR B CA   1 
ATOM   3190 C  C    . TYR B 1 75  ? -21.262 76.937 81.979 1.00 13.44 ? 105  TYR B C    1 
ATOM   3191 O  O    . TYR B 1 75  ? -21.116 76.713 83.177 1.00 18.05 ? 105  TYR B O    1 
ATOM   3192 C  CB   . TYR B 1 75  ? -18.885 76.938 81.191 1.00 14.06 ? 105  TYR B CB   1 
ATOM   3193 C  CG   . TYR B 1 75  ? -17.842 76.362 80.267 1.00 17.35 ? 105  TYR B CG   1 
ATOM   3194 C  CD1  . TYR B 1 75  ? -17.586 76.946 79.023 1.00 15.21 ? 105  TYR B CD1  1 
ATOM   3195 C  CD2  . TYR B 1 75  ? -17.100 75.237 80.637 1.00 17.60 ? 105  TYR B CD2  1 
ATOM   3196 C  CE1  . TYR B 1 75  ? -16.620 76.426 78.173 1.00 15.56 ? 105  TYR B CE1  1 
ATOM   3197 C  CE2  . TYR B 1 75  ? -16.125 74.710 79.795 1.00 16.54 ? 105  TYR B CE2  1 
ATOM   3198 C  CZ   . TYR B 1 75  ? -15.890 75.311 78.568 1.00 15.41 ? 105  TYR B CZ   1 
ATOM   3199 O  OH   . TYR B 1 75  ? -14.896 74.832 77.759 1.00 15.11 ? 105  TYR B OH   1 
ATOM   3200 N  N    . GLN B 1 76  ? -22.270 77.650 81.503 1.00 12.70 ? 106  GLN B N    1 
ATOM   3201 C  CA   . GLN B 1 76  ? -23.273 78.256 82.369 1.00 14.24 ? 106  GLN B CA   1 
ATOM   3202 C  C    . GLN B 1 76  ? -24.551 77.407 82.381 1.00 18.01 ? 106  GLN B C    1 
ATOM   3203 O  O    . GLN B 1 76  ? -25.394 77.519 81.489 1.00 14.56 ? 106  GLN B O    1 
ATOM   3204 C  CB   . GLN B 1 76  ? -23.549 79.675 81.875 1.00 18.32 ? 106  GLN B CB   1 
ATOM   3205 C  CG   . GLN B 1 76  ? -22.278 80.533 81.850 1.00 20.05 ? 106  GLN B CG   1 
ATOM   3206 C  CD   . GLN B 1 76  ? -22.477 81.885 81.209 1.00 17.10 ? 106  GLN B CD   1 
ATOM   3207 O  OE1  . GLN B 1 76  ? -23.589 82.402 81.154 1.00 19.44 ? 106  GLN B OE1  1 
ATOM   3208 N  NE2  . GLN B 1 76  ? -21.394 82.466 80.719 1.00 14.11 ? 106  GLN B NE2  1 
ATOM   3209 N  N    . PRO B 1 77  ? -24.734 76.595 83.439 1.00 18.82 ? 107  PRO B N    1 
ATOM   3210 C  CA   . PRO B 1 77  ? -25.860 75.681 83.672 1.00 19.88 ? 107  PRO B CA   1 
ATOM   3211 C  C    . PRO B 1 77  ? -27.256 76.249 83.483 1.00 22.30 ? 107  PRO B C    1 
ATOM   3212 O  O    . PRO B 1 77  ? -28.182 75.526 83.103 1.00 20.77 ? 107  PRO B O    1 
ATOM   3213 C  CB   . PRO B 1 77  ? -25.658 75.246 85.129 1.00 19.00 ? 107  PRO B CB   1 
ATOM   3214 C  CG   . PRO B 1 77  ? -24.191 75.333 85.308 1.00 22.89 ? 107  PRO B CG   1 
ATOM   3215 C  CD   . PRO B 1 77  ? -23.871 76.646 84.629 1.00 21.90 ? 107  PRO B CD   1 
ATOM   3216 N  N    . ASP B 1 78  ? -27.425 77.534 83.770 1.00 21.22 ? 108  ASP B N    1 
ATOM   3217 C  CA   . ASP B 1 78  ? -28.740 78.136 83.660 1.00 19.18 ? 108  ASP B CA   1 
ATOM   3218 C  C    . ASP B 1 78  ? -28.975 78.925 82.389 1.00 15.74 ? 108  ASP B C    1 
ATOM   3219 O  O    . ASP B 1 78  ? -30.086 79.401 82.161 1.00 15.27 ? 108  ASP B O    1 
ATOM   3220 C  CB   . ASP B 1 78  ? -29.020 78.998 84.891 1.00 24.68 ? 108  ASP B CB   1 
ATOM   3221 C  CG   . ASP B 1 78  ? -28.964 78.197 86.182 1.00 29.48 ? 108  ASP B CG   1 
ATOM   3222 O  OD1  . ASP B 1 78  ? -29.495 77.061 86.208 1.00 28.16 ? 108  ASP B OD1  1 
ATOM   3223 O  OD2  . ASP B 1 78  ? -28.377 78.694 87.168 1.00 34.97 ? 108  ASP B OD2  1 
ATOM   3224 N  N    . TRP B 1 79  ? -27.951 79.048 81.549 1.00 15.98 ? 109  TRP B N    1 
ATOM   3225 C  CA   . TRP B 1 79  ? -28.105 79.804 80.311 1.00 16.06 ? 109  TRP B CA   1 
ATOM   3226 C  C    . TRP B 1 79  ? -29.083 79.151 79.359 1.00 17.31 ? 109  TRP B C    1 
ATOM   3227 O  O    . TRP B 1 79  ? -29.071 77.930 79.158 1.00 18.57 ? 109  TRP B O    1 
ATOM   3228 C  CB   . TRP B 1 79  ? -26.771 80.026 79.585 1.00 15.18 ? 109  TRP B CB   1 
ATOM   3229 C  CG   . TRP B 1 79  ? -26.922 81.021 78.466 1.00 22.32 ? 109  TRP B CG   1 
ATOM   3230 C  CD1  . TRP B 1 79  ? -26.832 82.379 78.567 1.00 20.48 ? 109  TRP B CD1  1 
ATOM   3231 C  CD2  . TRP B 1 79  ? -27.326 80.747 77.108 1.00 24.10 ? 109  TRP B CD2  1 
ATOM   3232 N  NE1  . TRP B 1 79  ? -27.172 82.966 77.370 1.00 27.29 ? 109  TRP B NE1  1 
ATOM   3233 C  CE2  . TRP B 1 79  ? -27.483 81.991 76.460 1.00 22.36 ? 109  TRP B CE2  1 
ATOM   3234 C  CE3  . TRP B 1 79  ? -27.578 79.570 76.385 1.00 23.08 ? 109  TRP B CE3  1 
ATOM   3235 C  CZ2  . TRP B 1 79  ? -27.886 82.097 75.122 1.00 21.56 ? 109  TRP B CZ2  1 
ATOM   3236 C  CZ3  . TRP B 1 79  ? -27.977 79.671 75.056 1.00 20.24 ? 109  TRP B CZ3  1 
ATOM   3237 C  CH2  . TRP B 1 79  ? -28.129 80.930 74.438 1.00 25.38 ? 109  TRP B CH2  1 
ATOM   3238 N  N    . ARG B 1 80  ? -29.921 79.989 78.766 1.00 19.01 ? 110  ARG B N    1 
ATOM   3239 C  CA   . ARG B 1 80  ? -30.913 79.563 77.793 1.00 21.43 ? 110  ARG B CA   1 
ATOM   3240 C  C    . ARG B 1 80  ? -31.410 80.812 77.075 1.00 20.17 ? 110  ARG B C    1 
ATOM   3241 O  O    . ARG B 1 80  ? -31.222 81.924 77.560 1.00 18.10 ? 110  ARG B O    1 
ATOM   3242 C  CB   . ARG B 1 80  ? -32.080 78.846 78.478 1.00 22.76 ? 110  ARG B CB   1 
ATOM   3243 C  CG   . ARG B 1 80  ? -32.811 79.685 79.509 1.00 29.27 ? 110  ARG B CG   1 
ATOM   3244 C  CD   . ARG B 1 80  ? -34.102 79.019 79.926 1.00 34.11 ? 110  ARG B CD   1 
ATOM   3245 N  NE   . ARG B 1 80  ? -34.781 79.739 81.000 1.00 41.51 ? 110  ARG B NE   1 
ATOM   3246 C  CZ   . ARG B 1 80  ? -36.003 79.451 81.443 1.00 46.23 ? 110  ARG B CZ   1 
ATOM   3247 N  NH1  . ARG B 1 80  ? -36.702 78.453 80.916 1.00 45.77 ? 110  ARG B NH1  1 
ATOM   3248 N  NH2  . ARG B 1 80  ? -36.533 80.174 82.420 1.00 53.12 ? 110  ARG B NH2  1 
ATOM   3249 N  N    . PHE B 1 81  ? -31.986 80.627 75.893 1.00 20.84 ? 111  PHE B N    1 
ATOM   3250 C  CA   . PHE B 1 81  ? -32.528 81.737 75.128 1.00 16.30 ? 111  PHE B CA   1 
ATOM   3251 C  C    . PHE B 1 81  ? -33.972 81.372 74.780 1.00 19.44 ? 111  PHE B C    1 
ATOM   3252 O  O    . PHE B 1 81  ? -34.231 80.411 74.049 1.00 15.66 ? 111  PHE B O    1 
ATOM   3253 C  CB   . PHE B 1 81  ? -31.695 82.006 73.875 1.00 16.55 ? 111  PHE B CB   1 
ATOM   3254 C  CG   . PHE B 1 81  ? -32.085 83.266 73.150 1.00 18.62 ? 111  PHE B CG   1 
ATOM   3255 C  CD1  . PHE B 1 81  ? -31.667 84.512 73.614 1.00 18.99 ? 111  PHE B CD1  1 
ATOM   3256 C  CD2  . PHE B 1 81  ? -32.876 83.207 72.006 1.00 16.69 ? 111  PHE B CD2  1 
ATOM   3257 C  CE1  . PHE B 1 81  ? -32.031 85.682 72.940 1.00 18.46 ? 111  PHE B CE1  1 
ATOM   3258 C  CE2  . PHE B 1 81  ? -33.242 84.366 71.332 1.00 14.20 ? 111  PHE B CE2  1 
ATOM   3259 C  CZ   . PHE B 1 81  ? -32.821 85.602 71.798 1.00 12.98 ? 111  PHE B CZ   1 
ATOM   3260 N  N    . MET B 1 82  ? -34.902 82.152 75.320 1.00 18.41 ? 112  MET B N    1 
ATOM   3261 C  CA   . MET B 1 82  ? -36.330 81.918 75.149 1.00 22.28 ? 112  MET B CA   1 
ATOM   3262 C  C    . MET B 1 82  ? -37.045 82.700 74.052 1.00 21.48 ? 112  MET B C    1 
ATOM   3263 O  O    . MET B 1 82  ? -38.216 82.463 73.796 1.00 21.72 ? 112  MET B O    1 
ATOM   3264 C  CB   . MET B 1 82  ? -37.037 82.214 76.477 1.00 22.65 ? 112  MET B CB   1 
ATOM   3265 C  CG   . MET B 1 82  ? -36.466 81.488 77.677 1.00 19.77 ? 112  MET B CG   1 
ATOM   3266 S  SD   . MET B 1 82  ? -36.550 79.739 77.381 1.00 27.45 ? 112  MET B SD   1 
ATOM   3267 C  CE   . MET B 1 82  ? -38.336 79.531 77.307 1.00 25.28 ? 112  MET B CE   1 
ATOM   3268 N  N    . GLU B 1 83  ? -36.352 83.606 73.383 1.00 26.18 ? 113  GLU B N    1 
ATOM   3269 C  CA   . GLU B 1 83  ? -37.015 84.429 72.379 1.00 29.58 ? 113  GLU B CA   1 
ATOM   3270 C  C    . GLU B 1 83  ? -36.863 84.023 70.924 1.00 26.59 ? 113  GLU B C    1 
ATOM   3271 O  O    . GLU B 1 83  ? -37.290 84.762 70.040 1.00 27.45 ? 113  GLU B O    1 
ATOM   3272 C  CB   . GLU B 1 83  ? -36.558 85.880 72.548 1.00 38.84 ? 113  GLU B CB   1 
ATOM   3273 C  CG   . GLU B 1 83  ? -36.532 86.387 74.006 1.00 55.11 ? 113  GLU B CG   1 
ATOM   3274 C  CD   . GLU B 1 83  ? -37.893 86.903 74.490 1.00 64.79 ? 113  GLU B CD   1 
ATOM   3275 O  OE1  . GLU B 1 83  ? -38.856 86.960 73.683 1.00 71.91 ? 113  GLU B OE1  1 
ATOM   3276 O  OE2  . GLU B 1 83  ? -37.993 87.278 75.680 1.00 71.57 ? 113  GLU B OE2  1 
ATOM   3277 N  N    . SER B 1 84  ? -36.256 82.871 70.666 1.00 23.93 ? 114  SER B N    1 
ATOM   3278 C  CA   . SER B 1 84  ? -36.048 82.416 69.299 1.00 23.61 ? 114  SER B CA   1 
ATOM   3279 C  C    . SER B 1 84  ? -37.360 82.073 68.602 1.00 24.00 ? 114  SER B C    1 
ATOM   3280 O  O    . SER B 1 84  ? -38.262 81.496 69.205 1.00 23.53 ? 114  SER B O    1 
ATOM   3281 C  CB   . SER B 1 84  ? -35.108 81.212 69.275 1.00 24.25 ? 114  SER B CB   1 
ATOM   3282 O  OG   . SER B 1 84  ? -34.907 80.750 67.952 1.00 31.03 ? 114  SER B OG   1 
ATOM   3283 N  N    . LYS B 1 85  ? -37.468 82.455 67.334 1.00 23.15 ? 115  LYS B N    1 
ATOM   3284 C  CA   . LYS B 1 85  ? -38.667 82.179 66.553 1.00 25.64 ? 115  LYS B CA   1 
ATOM   3285 C  C    . LYS B 1 85  ? -38.295 81.323 65.345 1.00 24.03 ? 115  LYS B C    1 
ATOM   3286 O  O    . LYS B 1 85  ? -39.022 81.257 64.354 1.00 21.96 ? 115  LYS B O    1 
ATOM   3287 C  CB   . LYS B 1 85  ? -39.322 83.489 66.115 1.00 28.47 ? 115  LYS B CB   1 
ATOM   3288 C  CG   . LYS B 1 85  ? -39.823 84.338 67.265 1.00 34.11 ? 115  LYS B CG   1 
ATOM   3289 C  CD   . LYS B 1 85  ? -40.426 85.624 66.748 1.00 44.36 ? 115  LYS B CD   1 
ATOM   3290 C  CE   . LYS B 1 85  ? -41.197 86.355 67.843 1.00 51.81 ? 115  LYS B CE   1 
ATOM   3291 N  NZ   . LYS B 1 85  ? -41.557 87.748 67.445 1.00 51.59 ? 115  LYS B NZ   1 
ATOM   3292 N  N    . GLU B 1 86  ? -37.147 80.663 65.450 1.00 24.76 ? 116  GLU B N    1 
ATOM   3293 C  CA   . GLU B 1 86  ? -36.644 79.802 64.390 1.00 23.02 ? 116  GLU B CA   1 
ATOM   3294 C  C    . GLU B 1 86  ? -37.075 78.358 64.655 1.00 19.97 ? 116  GLU B C    1 
ATOM   3295 O  O    . GLU B 1 86  ? -37.439 78.019 65.783 1.00 20.52 ? 116  GLU B O    1 
ATOM   3296 C  CB   . GLU B 1 86  ? -35.126 79.920 64.331 1.00 22.67 ? 116  GLU B CB   1 
ATOM   3297 C  CG   . GLU B 1 86  ? -34.527 79.643 62.971 1.00 29.63 ? 116  GLU B CG   1 
ATOM   3298 C  CD   . GLU B 1 86  ? -34.780 80.733 61.929 1.00 23.81 ? 116  GLU B CD   1 
ATOM   3299 O  OE1  . GLU B 1 86  ? -35.560 81.680 62.151 1.00 24.17 ? 116  GLU B OE1  1 
ATOM   3300 O  OE2  . GLU B 1 86  ? -34.177 80.624 60.853 1.00 34.63 ? 116  GLU B OE2  1 
ATOM   3301 N  N    . LYS B 1 87  ? -37.027 77.513 63.628 1.00 16.78 ? 117  LYS B N    1 
ATOM   3302 C  CA   . LYS B 1 87  ? -37.438 76.115 63.745 1.00 16.33 ? 117  LYS B CA   1 
ATOM   3303 C  C    . LYS B 1 87  ? -36.887 75.304 64.936 1.00 14.98 ? 117  LYS B C    1 
ATOM   3304 O  O    . LYS B 1 87  ? -37.646 74.624 65.621 1.00 11.43 ? 117  LYS B O    1 
ATOM   3305 C  CB   . LYS B 1 87  ? -37.139 75.362 62.442 1.00 18.69 ? 117  LYS B CB   1 
ATOM   3306 C  CG   . LYS B 1 87  ? -37.540 73.882 62.482 1.00 21.91 ? 117  LYS B CG   1 
ATOM   3307 C  CD   . LYS B 1 87  ? -37.135 73.139 61.220 1.00 27.52 ? 117  LYS B CD   1 
ATOM   3308 C  CE   . LYS B 1 87  ? -37.477 71.662 61.346 1.00 36.57 ? 117  LYS B CE   1 
ATOM   3309 N  NZ   . LYS B 1 87  ? -37.171 70.892 60.102 1.00 44.18 ? 117  LYS B NZ   1 
ATOM   3310 N  N    . ASP B 1 88  ? -35.575 75.349 65.147 1.00 15.78 ? 118  ASP B N    1 
ATOM   3311 C  CA   . ASP B 1 88  ? -34.923 74.610 66.225 1.00 16.81 ? 118  ASP B CA   1 
ATOM   3312 C  C    . ASP B 1 88  ? -34.830 75.363 67.565 1.00 18.99 ? 118  ASP B C    1 
ATOM   3313 O  O    . ASP B 1 88  ? -33.970 75.067 68.404 1.00 18.12 ? 118  ASP B O    1 
ATOM   3314 C  CB   . ASP B 1 88  ? -33.518 74.182 65.779 1.00 19.62 ? 118  ASP B CB   1 
ATOM   3315 C  CG   . ASP B 1 88  ? -33.534 73.333 64.522 1.00 16.96 ? 118  ASP B CG   1 
ATOM   3316 O  OD1  . ASP B 1 88  ? -34.561 72.680 64.247 1.00 20.31 ? 118  ASP B OD1  1 
ATOM   3317 O  OD2  . ASP B 1 88  ? -32.509 73.303 63.816 1.00 19.86 ? 118  ASP B OD2  1 
ATOM   3318 N  N    . ARG B 1 89  ? -35.726 76.320 67.768 1.00 17.82 ? 119  ARG B N    1 
ATOM   3319 C  CA   . ARG B 1 89  ? -35.765 77.116 68.988 1.00 18.66 ? 119  ARG B CA   1 
ATOM   3320 C  C    . ARG B 1 89  ? -35.697 76.282 70.276 1.00 17.39 ? 119  ARG B C    1 
ATOM   3321 O  O    . ARG B 1 89  ? -35.108 76.721 71.262 1.00 17.06 ? 119  ARG B O    1 
ATOM   3322 C  CB   . ARG B 1 89  ? -37.024 77.981 68.981 1.00 20.83 ? 119  ARG B CB   1 
ATOM   3323 C  CG   . ARG B 1 89  ? -38.295 77.170 68.788 1.00 29.13 ? 119  ARG B CG   1 
ATOM   3324 C  CD   . ARG B 1 89  ? -39.472 78.034 68.403 1.00 32.54 ? 119  ARG B CD   1 
ATOM   3325 N  NE   . ARG B 1 89  ? -40.008 78.765 69.536 1.00 35.62 ? 119  ARG B NE   1 
ATOM   3326 C  CZ   . ARG B 1 89  ? -41.263 78.666 69.963 1.00 42.57 ? 119  ARG B CZ   1 
ATOM   3327 N  NH1  . ARG B 1 89  ? -42.121 77.860 69.349 1.00 42.08 ? 119  ARG B NH1  1 
ATOM   3328 N  NH2  . ARG B 1 89  ? -41.664 79.383 71.002 1.00 45.23 ? 119  ARG B NH2  1 
ATOM   3329 N  N    . GLN B 1 90  ? -36.247 75.067 70.251 1.00 16.27 ? 120  GLN B N    1 
ATOM   3330 C  CA   . GLN B 1 90  ? -36.239 74.177 71.425 1.00 19.68 ? 120  GLN B CA   1 
ATOM   3331 C  C    . GLN B 1 90  ? -34.847 73.924 71.999 1.00 18.13 ? 120  GLN B C    1 
ATOM   3332 O  O    . GLN B 1 90  ? -34.674 73.813 73.208 1.00 17.44 ? 120  GLN B O    1 
ATOM   3333 C  CB   . GLN B 1 90  ? -36.862 72.826 71.089 1.00 20.12 ? 120  GLN B CB   1 
ATOM   3334 C  CG   . GLN B 1 90  ? -38.048 72.457 71.964 1.00 37.85 ? 120  GLN B CG   1 
ATOM   3335 C  CD   . GLN B 1 90  ? -37.765 72.589 73.458 1.00 40.86 ? 120  GLN B CD   1 
ATOM   3336 O  OE1  . GLN B 1 90  ? -37.570 71.597 74.156 1.00 42.53 ? 120  GLN B OE1  1 
ATOM   3337 N  NE2  . GLN B 1 90  ? -37.801 73.813 73.959 1.00 44.01 ? 120  GLN B NE2  1 
ATOM   3338 N  N    . VAL B 1 91  ? -33.870 73.829 71.107 1.00 17.65 ? 121  VAL B N    1 
ATOM   3339 C  CA   . VAL B 1 91  ? -32.482 73.584 71.455 1.00 16.97 ? 121  VAL B CA   1 
ATOM   3340 C  C    . VAL B 1 91  ? -31.888 74.785 72.214 1.00 18.22 ? 121  VAL B C    1 
ATOM   3341 O  O    . VAL B 1 91  ? -30.927 74.640 72.973 1.00 16.14 ? 121  VAL B O    1 
ATOM   3342 C  CB   . VAL B 1 91  ? -31.702 73.238 70.156 1.00 19.65 ? 121  VAL B CB   1 
ATOM   3343 C  CG1  . VAL B 1 91  ? -30.589 74.226 69.872 1.00 24.08 ? 121  VAL B CG1  1 
ATOM   3344 C  CG2  . VAL B 1 91  ? -31.206 71.829 70.201 1.00 20.57 ? 121  VAL B CG2  1 
ATOM   3345 N  N    . LEU B 1 92  ? -32.464 75.967 72.005 1.00 17.35 ? 122  LEU B N    1 
ATOM   3346 C  CA   . LEU B 1 92  ? -32.013 77.174 72.696 1.00 18.47 ? 122  LEU B CA   1 
ATOM   3347 C  C    . LEU B 1 92  ? -32.773 77.309 74.011 1.00 18.20 ? 122  LEU B C    1 
ATOM   3348 O  O    . LEU B 1 92  ? -32.209 77.687 75.043 1.00 16.40 ? 122  LEU B O    1 
ATOM   3349 C  CB   . LEU B 1 92  ? -32.253 78.424 71.844 1.00 15.46 ? 122  LEU B CB   1 
ATOM   3350 C  CG   . LEU B 1 92  ? -31.195 78.840 70.825 1.00 14.69 ? 122  LEU B CG   1 
ATOM   3351 C  CD1  . LEU B 1 92  ? -29.846 78.966 71.506 1.00 11.92 ? 122  LEU B CD1  1 
ATOM   3352 C  CD2  . LEU B 1 92  ? -31.123 77.824 69.717 1.00 24.44 ? 122  LEU B CD2  1 
ATOM   3353 N  N    . GLU B 1 93  ? -34.064 77.007 73.947 1.00 20.18 ? 123  GLU B N    1 
ATOM   3354 C  CA   . GLU B 1 93  ? -34.953 77.067 75.094 1.00 22.68 ? 123  GLU B CA   1 
ATOM   3355 C  C    . GLU B 1 93  ? -34.521 76.086 76.175 1.00 19.16 ? 123  GLU B C    1 
ATOM   3356 O  O    . GLU B 1 93  ? -34.516 76.419 77.358 1.00 17.03 ? 123  GLU B O    1 
ATOM   3357 C  CB   . GLU B 1 93  ? -36.384 76.758 74.653 1.00 27.38 ? 123  GLU B CB   1 
ATOM   3358 C  CG   . GLU B 1 93  ? -37.364 76.560 75.802 1.00 42.15 ? 123  GLU B CG   1 
ATOM   3359 C  CD   . GLU B 1 93  ? -38.771 76.244 75.329 1.00 49.66 ? 123  GLU B CD   1 
ATOM   3360 O  OE1  . GLU B 1 93  ? -39.070 76.481 74.135 1.00 52.24 ? 123  GLU B OE1  1 
ATOM   3361 O  OE2  . GLU B 1 93  ? -39.578 75.752 76.152 1.00 53.59 ? 123  GLU B OE2  1 
ATOM   3362 N  N    . ASP B 1 94  ? -34.161 74.876 75.763 1.00 16.45 ? 124  ASP B N    1 
ATOM   3363 C  CA   . ASP B 1 94  ? -33.739 73.851 76.702 1.00 15.19 ? 124  ASP B CA   1 
ATOM   3364 C  C    . ASP B 1 94  ? -32.226 73.672 76.679 1.00 15.74 ? 124  ASP B C    1 
ATOM   3365 O  O    . ASP B 1 94  ? -31.722 72.584 76.945 1.00 14.39 ? 124  ASP B O    1 
ATOM   3366 C  CB   . ASP B 1 94  ? -34.441 72.519 76.385 1.00 19.35 ? 124  ASP B CB   1 
ATOM   3367 C  CG   . ASP B 1 94  ? -34.301 71.495 77.502 1.00 19.53 ? 124  ASP B CG   1 
ATOM   3368 O  OD1  . ASP B 1 94  ? -33.780 71.833 78.588 1.00 18.70 ? 124  ASP B OD1  1 
ATOM   3369 O  OD2  . ASP B 1 94  ? -34.706 70.340 77.296 1.00 18.54 ? 124  ASP B OD2  1 
ATOM   3370 N  N    . PHE B 1 95  ? -31.498 74.752 76.412 1.00 15.79 ? 125  PHE B N    1 
ATOM   3371 C  CA   . PHE B 1 95  ? -30.047 74.679 76.366 1.00 14.04 ? 125  PHE B CA   1 
ATOM   3372 C  C    . PHE B 1 95  ? -29.410 74.087 77.628 1.00 13.38 ? 125  PHE B C    1 
ATOM   3373 O  O    . PHE B 1 95  ? -28.408 73.382 77.526 1.00 17.82 ? 125  PHE B O    1 
ATOM   3374 C  CB   . PHE B 1 95  ? -29.419 76.033 76.013 1.00 9.93  ? 125  PHE B CB   1 
ATOM   3375 C  CG   . PHE B 1 95  ? -28.029 75.911 75.433 1.00 15.69 ? 125  PHE B CG   1 
ATOM   3376 C  CD1  . PHE B 1 95  ? -27.842 75.488 74.121 1.00 16.10 ? 125  PHE B CD1  1 
ATOM   3377 C  CD2  . PHE B 1 95  ? -26.903 76.154 76.215 1.00 13.44 ? 125  PHE B CD2  1 
ATOM   3378 C  CE1  . PHE B 1 95  ? -26.551 75.296 73.604 1.00 16.18 ? 125  PHE B CE1  1 
ATOM   3379 C  CE2  . PHE B 1 95  ? -25.622 75.966 75.706 1.00 15.59 ? 125  PHE B CE2  1 
ATOM   3380 C  CZ   . PHE B 1 95  ? -25.443 75.538 74.402 1.00 11.26 ? 125  PHE B CZ   1 
ATOM   3381 N  N    . PRO B 1 96  ? -29.961 74.366 78.829 1.00 15.06 ? 126  PRO B N    1 
ATOM   3382 C  CA   . PRO B 1 96  ? -29.386 73.810 80.067 1.00 15.61 ? 126  PRO B CA   1 
ATOM   3383 C  C    . PRO B 1 96  ? -29.218 72.282 80.027 1.00 13.63 ? 126  PRO B C    1 
ATOM   3384 O  O    . PRO B 1 96  ? -28.271 71.731 80.588 1.00 13.12 ? 126  PRO B O    1 
ATOM   3385 C  CB   . PRO B 1 96  ? -30.417 74.214 81.126 1.00 14.65 ? 126  PRO B CB   1 
ATOM   3386 C  CG   . PRO B 1 96  ? -30.872 75.544 80.648 1.00 15.50 ? 126  PRO B CG   1 
ATOM   3387 C  CD   . PRO B 1 96  ? -31.040 75.325 79.151 1.00 16.64 ? 126  PRO B CD   1 
ATOM   3388 N  N    . THR B 1 97  ? -30.146 71.601 79.371 1.00 12.94 ? 127  THR B N    1 
ATOM   3389 C  CA   . THR B 1 97  ? -30.086 70.155 79.261 1.00 13.81 ? 127  THR B CA   1 
ATOM   3390 C  C    . THR B 1 97  ? -28.899 69.752 78.391 1.00 14.34 ? 127  THR B C    1 
ATOM   3391 O  O    . THR B 1 97  ? -28.197 68.781 78.684 1.00 16.61 ? 127  THR B O    1 
ATOM   3392 C  CB   . THR B 1 97  ? -31.401 69.608 78.670 1.00 19.26 ? 127  THR B CB   1 
ATOM   3393 O  OG1  . THR B 1 97  ? -32.467 69.872 79.595 1.00 19.66 ? 127  THR B OG1  1 
ATOM   3394 C  CG2  . THR B 1 97  ? -31.310 68.096 78.391 1.00 15.94 ? 127  THR B CG2  1 
ATOM   3395 N  N    . ILE B 1 98  ? -28.645 70.547 77.360 1.00 13.90 ? 128  ILE B N    1 
ATOM   3396 C  CA   . ILE B 1 98  ? -27.543 70.296 76.442 1.00 12.79 ? 128  ILE B CA   1 
ATOM   3397 C  C    . ILE B 1 98  ? -26.194 70.618 77.080 1.00 9.82  ? 128  ILE B C    1 
ATOM   3398 O  O    . ILE B 1 98  ? -25.277 69.810 77.004 1.00 12.01 ? 128  ILE B O    1 
ATOM   3399 C  CB   . ILE B 1 98  ? -27.726 71.105 75.129 1.00 13.70 ? 128  ILE B CB   1 
ATOM   3400 C  CG1  . ILE B 1 98  ? -29.016 70.647 74.433 1.00 12.67 ? 128  ILE B CG1  1 
ATOM   3401 C  CG2  . ILE B 1 98  ? -26.487 70.953 74.207 1.00 9.58  ? 128  ILE B CG2  1 
ATOM   3402 C  CD1  . ILE B 1 98  ? -29.398 71.476 73.229 1.00 11.39 ? 128  ILE B CD1  1 
ATOM   3403 N  N    . SER B 1 99  ? -26.079 71.791 77.706 1.00 9.61  ? 129  SER B N    1 
ATOM   3404 C  CA   . SER B 1 99  ? -24.830 72.218 78.351 1.00 9.71  ? 129  SER B CA   1 
ATOM   3405 C  C    . SER B 1 99  ? -24.491 71.269 79.504 1.00 9.46  ? 129  SER B C    1 
ATOM   3406 O  O    . SER B 1 99  ? -23.324 71.018 79.810 1.00 11.38 ? 129  SER B O    1 
ATOM   3407 C  CB   . SER B 1 99  ? -24.962 73.657 78.866 1.00 12.68 ? 129  SER B CB   1 
ATOM   3408 O  OG   . SER B 1 99  ? -25.968 73.731 79.862 1.00 11.26 ? 129  SER B OG   1 
ATOM   3409 N  N    . LEU B 1 100 ? -25.526 70.738 80.141 1.00 11.72 ? 130  LEU B N    1 
ATOM   3410 C  CA   . LEU B 1 100 ? -25.341 69.785 81.215 1.00 14.55 ? 130  LEU B CA   1 
ATOM   3411 C  C    . LEU B 1 100 ? -24.556 68.592 80.666 1.00 17.50 ? 130  LEU B C    1 
ATOM   3412 O  O    . LEU B 1 100 ? -23.568 68.152 81.272 1.00 20.19 ? 130  LEU B O    1 
ATOM   3413 C  CB   . LEU B 1 100 ? -26.697 69.324 81.736 1.00 13.66 ? 130  LEU B CB   1 
ATOM   3414 C  CG   . LEU B 1 100 ? -26.656 68.370 82.923 1.00 18.12 ? 130  LEU B CG   1 
ATOM   3415 C  CD1  . LEU B 1 100 ? -25.838 69.006 84.027 1.00 18.31 ? 130  LEU B CD1  1 
ATOM   3416 C  CD2  . LEU B 1 100 ? -28.078 68.065 83.399 1.00 17.28 ? 130  LEU B CD2  1 
ATOM   3417 N  N    . GLU B 1 101 ? -24.980 68.090 79.503 1.00 16.62 ? 131  GLU B N    1 
ATOM   3418 C  CA   . GLU B 1 101 ? -24.314 66.953 78.871 1.00 9.68  ? 131  GLU B CA   1 
ATOM   3419 C  C    . GLU B 1 101 ? -22.962 67.339 78.308 1.00 9.43  ? 131  GLU B C    1 
ATOM   3420 O  O    . GLU B 1 101 ? -22.056 66.511 78.262 1.00 4.50  ? 131  GLU B O    1 
ATOM   3421 C  CB   . GLU B 1 101 ? -25.212 66.305 77.822 1.00 11.26 ? 131  GLU B CB   1 
ATOM   3422 C  CG   . GLU B 1 101 ? -26.360 65.513 78.449 1.00 6.78  ? 131  GLU B CG   1 
ATOM   3423 C  CD   . GLU B 1 101 ? -25.880 64.408 79.391 1.00 13.49 ? 131  GLU B CD   1 
ATOM   3424 O  OE1  . GLU B 1 101 ? -24.788 63.836 79.181 1.00 16.20 ? 131  GLU B OE1  1 
ATOM   3425 O  OE2  . GLU B 1 101 ? -26.602 64.097 80.357 1.00 23.86 ? 131  GLU B OE2  1 
ATOM   3426 N  N    . PHE B 1 102 ? -22.815 68.610 77.930 1.00 8.67  ? 132  PHE B N    1 
ATOM   3427 C  CA   . PHE B 1 102 ? -21.541 69.129 77.433 1.00 10.88 ? 132  PHE B CA   1 
ATOM   3428 C  C    . PHE B 1 102 ? -20.531 69.029 78.584 1.00 13.70 ? 132  PHE B C    1 
ATOM   3429 O  O    . PHE B 1 102 ? -19.399 68.578 78.398 1.00 14.02 ? 132  PHE B O    1 
ATOM   3430 C  CB   . PHE B 1 102 ? -21.689 70.606 77.001 1.00 8.15  ? 132  PHE B CB   1 
ATOM   3431 C  CG   . PHE B 1 102 ? -20.369 71.332 76.809 1.00 12.17 ? 132  PHE B CG   1 
ATOM   3432 C  CD1  . PHE B 1 102 ? -19.701 71.296 75.584 1.00 10.05 ? 132  PHE B CD1  1 
ATOM   3433 C  CD2  . PHE B 1 102 ? -19.780 72.031 77.864 1.00 9.60  ? 132  PHE B CD2  1 
ATOM   3434 C  CE1  . PHE B 1 102 ? -18.466 71.941 75.422 1.00 9.47  ? 132  PHE B CE1  1 
ATOM   3435 C  CE2  . PHE B 1 102 ? -18.544 72.678 77.711 1.00 9.40  ? 132  PHE B CE2  1 
ATOM   3436 C  CZ   . PHE B 1 102 ? -17.886 72.632 76.484 1.00 8.83  ? 132  PHE B CZ   1 
ATOM   3437 N  N    . ARG B 1 103 ? -20.954 69.438 79.778 1.00 14.68 ? 133  ARG B N    1 
ATOM   3438 C  CA   . ARG B 1 103 ? -20.078 69.409 80.946 1.00 15.36 ? 133  ARG B CA   1 
ATOM   3439 C  C    . ARG B 1 103 ? -19.698 67.994 81.401 1.00 14.50 ? 133  ARG B C    1 
ATOM   3440 O  O    . ARG B 1 103 ? -18.692 67.800 82.088 1.00 17.19 ? 133  ARG B O    1 
ATOM   3441 C  CB   . ARG B 1 103 ? -20.693 70.236 82.087 1.00 16.82 ? 133  ARG B CB   1 
ATOM   3442 C  CG   . ARG B 1 103 ? -20.737 71.746 81.772 1.00 21.63 ? 133  ARG B CG   1 
ATOM   3443 C  CD   . ARG B 1 103 ? -21.154 72.598 82.974 1.00 18.51 ? 133  ARG B CD   1 
ATOM   3444 N  NE   . ARG B 1 103 ? -22.436 72.166 83.508 1.00 13.71 ? 133  ARG B NE   1 
ATOM   3445 C  CZ   . ARG B 1 103 ? -23.610 72.585 83.057 1.00 13.55 ? 133  ARG B CZ   1 
ATOM   3446 N  NH1  . ARG B 1 103 ? -23.663 73.465 82.064 1.00 18.75 ? 133  ARG B NH1  1 
ATOM   3447 N  NH2  . ARG B 1 103 ? -24.728 72.077 83.554 1.00 9.34  ? 133  ARG B NH2  1 
ATOM   3448 N  N    . ASN B 1 104 ? -20.490 67.000 81.014 1.00 15.43 ? 134  ASN B N    1 
ATOM   3449 C  CA   . ASN B 1 104 ? -20.184 65.613 81.363 1.00 15.72 ? 134  ASN B CA   1 
ATOM   3450 C  C    . ASN B 1 104 ? -19.164 65.001 80.412 1.00 16.00 ? 134  ASN B C    1 
ATOM   3451 O  O    . ASN B 1 104 ? -18.725 63.873 80.612 1.00 17.07 ? 134  ASN B O    1 
ATOM   3452 C  CB   . ASN B 1 104 ? -21.441 64.748 81.365 1.00 20.98 ? 134  ASN B CB   1 
ATOM   3453 C  CG   . ASN B 1 104 ? -22.270 64.938 82.604 1.00 25.70 ? 134  ASN B CG   1 
ATOM   3454 O  OD1  . ASN B 1 104 ? -21.774 65.403 83.624 1.00 30.87 ? 134  ASN B OD1  1 
ATOM   3455 N  ND2  . ASN B 1 104 ? -23.541 64.559 82.534 1.00 29.80 ? 134  ASN B ND2  1 
ATOM   3456 N  N    . LEU B 1 105 ? -18.814 65.726 79.356 1.00 15.49 ? 135  LEU B N    1 
ATOM   3457 C  CA   . LEU B 1 105 ? -17.848 65.241 78.378 1.00 13.37 ? 135  LEU B CA   1 
ATOM   3458 C  C    . LEU B 1 105 ? -16.457 65.399 78.936 1.00 13.29 ? 135  LEU B C    1 
ATOM   3459 O  O    . LEU B 1 105 ? -16.230 66.220 79.826 1.00 12.28 ? 135  LEU B O    1 
ATOM   3460 C  CB   . LEU B 1 105 ? -17.943 66.042 77.075 1.00 10.98 ? 135  LEU B CB   1 
ATOM   3461 C  CG   . LEU B 1 105 ? -19.259 65.946 76.303 1.00 12.71 ? 135  LEU B CG   1 
ATOM   3462 C  CD1  . LEU B 1 105 ? -19.235 66.934 75.145 1.00 8.30  ? 135  LEU B CD1  1 
ATOM   3463 C  CD2  . LEU B 1 105 ? -19.498 64.512 75.816 1.00 13.72 ? 135  LEU B CD2  1 
ATOM   3464 N  N    . ALA B 1 106 ? -15.523 64.635 78.381 1.00 13.49 ? 136  ALA B N    1 
ATOM   3465 C  CA   . ALA B 1 106 ? -14.138 64.697 78.802 1.00 12.90 ? 136  ALA B CA   1 
ATOM   3466 C  C    . ALA B 1 106 ? -13.617 66.096 78.526 1.00 18.87 ? 136  ALA B C    1 
ATOM   3467 O  O    . ALA B 1 106 ? -13.950 66.707 77.497 1.00 19.60 ? 136  ALA B O    1 
ATOM   3468 C  CB   . ALA B 1 106 ? -13.307 63.674 78.049 1.00 13.63 ? 136  ALA B CB   1 
ATOM   3469 N  N    . GLU B 1 107 ? -12.785 66.583 79.441 1.00 15.47 ? 137  GLU B N    1 
ATOM   3470 C  CA   . GLU B 1 107 ? -12.193 67.904 79.349 1.00 14.39 ? 137  GLU B CA   1 
ATOM   3471 C  C    . GLU B 1 107 ? -11.644 68.230 77.965 1.00 15.98 ? 137  GLU B C    1 
ATOM   3472 O  O    . GLU B 1 107 ? -11.872 69.325 77.445 1.00 16.13 ? 137  GLU B O    1 
ATOM   3473 C  CB   . GLU B 1 107 ? -11.083 68.045 80.398 1.00 13.77 ? 137  GLU B CB   1 
ATOM   3474 C  CG   . GLU B 1 107 ? -11.598 68.035 81.827 1.00 11.56 ? 137  GLU B CG   1 
ATOM   3475 C  CD   . GLU B 1 107 ? -12.453 69.251 82.123 1.00 17.95 ? 137  GLU B CD   1 
ATOM   3476 O  OE1  . GLU B 1 107 ? -11.908 70.374 82.080 1.00 16.50 ? 137  GLU B OE1  1 
ATOM   3477 O  OE2  . GLU B 1 107 ? -13.668 69.090 82.381 1.00 16.51 ? 137  GLU B OE2  1 
ATOM   3478 N  N    . LYS B 1 108 ? -10.944 67.272 77.367 1.00 13.22 ? 138  LYS B N    1 
ATOM   3479 C  CA   . LYS B 1 108 ? -10.348 67.473 76.049 1.00 15.84 ? 138  LYS B CA   1 
ATOM   3480 C  C    . LYS B 1 108 ? -11.379 67.802 74.961 1.00 14.73 ? 138  LYS B C    1 
ATOM   3481 O  O    . LYS B 1 108 ? -11.108 68.618 74.074 1.00 14.37 ? 138  LYS B O    1 
ATOM   3482 C  CB   . LYS B 1 108 ? -9.473  66.269 75.658 1.00 12.87 ? 138  LYS B CB   1 
ATOM   3483 C  CG   . LYS B 1 108 ? -10.225 64.963 75.502 1.00 12.84 ? 138  LYS B CG   1 
ATOM   3484 C  CD   . LYS B 1 108 ? -9.259  63.800 75.351 1.00 16.97 ? 138  LYS B CD   1 
ATOM   3485 C  CE   . LYS B 1 108 ? -10.013 62.496 75.170 1.00 15.92 ? 138  LYS B CE   1 
ATOM   3486 N  NZ   . LYS B 1 108 ? -9.073  61.356 75.008 1.00 23.08 ? 138  LYS B NZ   1 
ATOM   3487 N  N    . TYR B 1 109 ? -12.574 67.220 75.064 1.00 13.53 ? 139  TYR B N    1 
ATOM   3488 C  CA   . TYR B 1 109 ? -13.627 67.479 74.083 1.00 14.85 ? 139  TYR B CA   1 
ATOM   3489 C  C    . TYR B 1 109 ? -14.246 68.841 74.317 1.00 15.99 ? 139  TYR B C    1 
ATOM   3490 O  O    . TYR B 1 109 ? -14.544 69.564 73.366 1.00 13.91 ? 139  TYR B O    1 
ATOM   3491 C  CB   . TYR B 1 109 ? -14.716 66.404 74.144 1.00 13.72 ? 139  TYR B CB   1 
ATOM   3492 C  CG   . TYR B 1 109 ? -14.190 65.019 73.897 1.00 10.49 ? 139  TYR B CG   1 
ATOM   3493 C  CD1  . TYR B 1 109 ? -13.235 64.785 72.914 1.00 10.47 ? 139  TYR B CD1  1 
ATOM   3494 C  CD2  . TYR B 1 109 ? -14.612 63.948 74.683 1.00 11.30 ? 139  TYR B CD2  1 
ATOM   3495 C  CE1  . TYR B 1 109 ? -12.703 63.515 72.725 1.00 9.74  ? 139  TYR B CE1  1 
ATOM   3496 C  CE2  . TYR B 1 109 ? -14.089 62.679 74.505 1.00 9.94  ? 139  TYR B CE2  1 
ATOM   3497 C  CZ   . TYR B 1 109 ? -13.134 62.471 73.527 1.00 11.99 ? 139  TYR B CZ   1 
ATOM   3498 O  OH   . TYR B 1 109 ? -12.587 61.224 73.378 1.00 14.49 ? 139  TYR B OH   1 
ATOM   3499 N  N    . GLN B 1 110 ? -14.487 69.159 75.588 1.00 18.29 ? 140  GLN B N    1 
ATOM   3500 C  CA   . GLN B 1 110 ? -15.060 70.447 75.972 1.00 18.53 ? 140  GLN B CA   1 
ATOM   3501 C  C    . GLN B 1 110 ? -14.229 71.570 75.348 1.00 17.32 ? 140  GLN B C    1 
ATOM   3502 O  O    . GLN B 1 110 ? -14.765 72.501 74.735 1.00 15.27 ? 140  GLN B O    1 
ATOM   3503 C  CB   . GLN B 1 110 ? -15.044 70.611 77.499 1.00 18.62 ? 140  GLN B CB   1 
ATOM   3504 C  CG   . GLN B 1 110 ? -16.052 69.768 78.263 1.00 17.89 ? 140  GLN B CG   1 
ATOM   3505 C  CD   . GLN B 1 110 ? -16.179 70.196 79.725 1.00 22.83 ? 140  GLN B CD   1 
ATOM   3506 O  OE1  . GLN B 1 110 ? -15.764 71.295 80.103 1.00 20.04 ? 140  GLN B OE1  1 
ATOM   3507 N  NE2  . GLN B 1 110 ? -16.759 69.331 80.547 1.00 21.60 ? 140  GLN B NE2  1 
ATOM   3508 N  N    . THR B 1 111 ? -12.915 71.460 75.502 1.00 14.45 ? 141  THR B N    1 
ATOM   3509 C  CA   . THR B 1 111 ? -11.993 72.447 74.973 1.00 18.81 ? 141  THR B CA   1 
ATOM   3510 C  C    . THR B 1 111 ? -12.107 72.638 73.452 1.00 16.31 ? 141  THR B C    1 
ATOM   3511 O  O    . THR B 1 111 ? -12.218 73.774 72.975 1.00 13.09 ? 141  THR B O    1 
ATOM   3512 C  CB   . THR B 1 111 ? -10.559 72.090 75.382 1.00 18.68 ? 141  THR B CB   1 
ATOM   3513 O  OG1  . THR B 1 111 ? -10.475 72.120 76.812 1.00 25.07 ? 141  THR B OG1  1 
ATOM   3514 C  CG2  . THR B 1 111 ? -9.554  73.083 74.792 1.00 20.18 ? 141  THR B CG2  1 
ATOM   3515 N  N    . VAL B 1 112 ? -12.088 71.535 72.705 1.00 15.16 ? 142  VAL B N    1 
ATOM   3516 C  CA   . VAL B 1 112 ? -12.209 71.582 71.242 1.00 14.73 ? 142  VAL B CA   1 
ATOM   3517 C  C    . VAL B 1 112 ? -13.520 72.255 70.827 1.00 13.74 ? 142  VAL B C    1 
ATOM   3518 O  O    . VAL B 1 112 ? -13.518 73.232 70.078 1.00 15.61 ? 142  VAL B O    1 
ATOM   3519 C  CB   . VAL B 1 112 ? -12.161 70.158 70.618 1.00 13.49 ? 142  VAL B CB   1 
ATOM   3520 C  CG1  . VAL B 1 112 ? -12.537 70.211 69.129 1.00 13.16 ? 142  VAL B CG1  1 
ATOM   3521 C  CG2  . VAL B 1 112 ? -10.788 69.534 70.820 1.00 3.91  ? 142  VAL B CG2  1 
ATOM   3522 N  N    . ILE B 1 113 ? -14.629 71.750 71.356 1.00 12.62 ? 143  ILE B N    1 
ATOM   3523 C  CA   . ILE B 1 113 ? -15.950 72.274 71.045 1.00 11.49 ? 143  ILE B CA   1 
ATOM   3524 C  C    . ILE B 1 113 ? -16.093 73.758 71.346 1.00 13.97 ? 143  ILE B C    1 
ATOM   3525 O  O    . ILE B 1 113 ? -16.530 74.519 70.493 1.00 17.96 ? 143  ILE B O    1 
ATOM   3526 C  CB   . ILE B 1 113 ? -17.050 71.457 71.774 1.00 11.82 ? 143  ILE B CB   1 
ATOM   3527 C  CG1  . ILE B 1 113 ? -17.081 70.025 71.216 1.00 13.69 ? 143  ILE B CG1  1 
ATOM   3528 C  CG2  . ILE B 1 113 ? -18.417 72.136 71.634 1.00 9.55  ? 143  ILE B CG2  1 
ATOM   3529 C  CD1  . ILE B 1 113 ? -17.925 69.045 72.017 1.00 10.61 ? 143  ILE B CD1  1 
ATOM   3530 N  N    . ALA B 1 114 ? -15.693 74.177 72.543 1.00 17.45 ? 144  ALA B N    1 
ATOM   3531 C  CA   . ALA B 1 114 ? -15.802 75.585 72.931 1.00 16.64 ? 144  ALA B CA   1 
ATOM   3532 C  C    . ALA B 1 114 ? -14.951 76.499 72.039 1.00 15.06 ? 144  ALA B C    1 
ATOM   3533 O  O    . ALA B 1 114 ? -15.417 77.553 71.591 1.00 14.29 ? 144  ALA B O    1 
ATOM   3534 C  CB   . ALA B 1 114 ? -15.431 75.764 74.406 1.00 10.92 ? 144  ALA B CB   1 
ATOM   3535 N  N    . ASP B 1 115 ? -13.719 76.086 71.758 1.00 14.22 ? 145  ASP B N    1 
ATOM   3536 C  CA   . ASP B 1 115 ? -12.840 76.882 70.910 1.00 16.83 ? 145  ASP B CA   1 
ATOM   3537 C  C    . ASP B 1 115 ? -13.462 77.120 69.539 1.00 15.96 ? 145  ASP B C    1 
ATOM   3538 O  O    . ASP B 1 115 ? -13.417 78.235 69.019 1.00 14.99 ? 145  ASP B O    1 
ATOM   3539 C  CB   . ASP B 1 115 ? -11.473 76.219 70.743 1.00 15.86 ? 145  ASP B CB   1 
ATOM   3540 C  CG   . ASP B 1 115 ? -10.537 77.043 69.865 1.00 24.17 ? 145  ASP B CG   1 
ATOM   3541 O  OD1  . ASP B 1 115 ? -10.305 78.229 70.188 1.00 27.78 ? 145  ASP B OD1  1 
ATOM   3542 O  OD2  . ASP B 1 115 ? -10.052 76.519 68.839 1.00 26.88 ? 145  ASP B OD2  1 
ATOM   3543 N  N    . ILE B 1 116 ? -14.028 76.067 68.956 1.00 17.79 ? 146  ILE B N    1 
ATOM   3544 C  CA   . ILE B 1 116 ? -14.670 76.163 67.647 1.00 17.13 ? 146  ILE B CA   1 
ATOM   3545 C  C    . ILE B 1 116 ? -15.894 77.074 67.725 1.00 18.32 ? 146  ILE B C    1 
ATOM   3546 O  O    . ILE B 1 116 ? -16.124 77.895 66.830 1.00 17.74 ? 146  ILE B O    1 
ATOM   3547 C  CB   . ILE B 1 116 ? -15.075 74.767 67.119 1.00 16.64 ? 146  ILE B CB   1 
ATOM   3548 C  CG1  . ILE B 1 116 ? -13.821 73.940 66.815 1.00 15.56 ? 146  ILE B CG1  1 
ATOM   3549 C  CG2  . ILE B 1 116 ? -15.977 74.894 65.893 1.00 15.75 ? 146  ILE B CG2  1 
ATOM   3550 C  CD1  . ILE B 1 116 ? -12.880 74.587 65.812 1.00 16.81 ? 146  ILE B CD1  1 
ATOM   3551 N  N    . CYS B 1 117 ? -16.673 76.942 68.797 1.00 15.59 ? 147  CYS B N    1 
ATOM   3552 C  CA   . CYS B 1 117 ? -17.846 77.787 68.976 1.00 15.68 ? 147  CYS B CA   1 
ATOM   3553 C  C    . CYS B 1 117 ? -17.462 79.263 69.080 1.00 16.15 ? 147  CYS B C    1 
ATOM   3554 O  O    . CYS B 1 117 ? -18.156 80.131 68.541 1.00 14.70 ? 147  CYS B O    1 
ATOM   3555 C  CB   . CYS B 1 117 ? -18.639 77.353 70.207 1.00 13.93 ? 147  CYS B CB   1 
ATOM   3556 S  SG   . CYS B 1 117 ? -19.624 75.868 69.927 1.00 19.28 ? 147  CYS B SG   1 
ATOM   3557 N  N    . ARG B 1 118 ? -16.339 79.528 69.746 1.00 15.17 ? 148  ARG B N    1 
ATOM   3558 C  CA   . ARG B 1 118 ? -15.832 80.882 69.931 1.00 17.60 ? 148  ARG B CA   1 
ATOM   3559 C  C    . ARG B 1 118 ? -15.441 81.512 68.596 1.00 19.59 ? 148  ARG B C    1 
ATOM   3560 O  O    . ARG B 1 118 ? -15.814 82.653 68.298 1.00 20.24 ? 148  ARG B O    1 
ATOM   3561 C  CB   . ARG B 1 118 ? -14.622 80.872 70.869 1.00 13.32 ? 148  ARG B CB   1 
ATOM   3562 C  CG   . ARG B 1 118 ? -14.037 82.257 71.142 1.00 19.30 ? 148  ARG B CG   1 
ATOM   3563 C  CD   . ARG B 1 118 ? -12.763 82.197 71.994 1.00 21.76 ? 148  ARG B CD   1 
ATOM   3564 N  NE   . ARG B 1 118 ? -11.707 81.378 71.388 1.00 26.45 ? 148  ARG B NE   1 
ATOM   3565 C  CZ   . ARG B 1 118 ? -11.057 81.687 70.266 1.00 28.74 ? 148  ARG B CZ   1 
ATOM   3566 N  NH1  . ARG B 1 118 ? -11.337 82.804 69.599 1.00 32.23 ? 148  ARG B NH1  1 
ATOM   3567 N  NH2  . ARG B 1 118 ? -10.120 80.872 69.806 1.00 21.33 ? 148  ARG B NH2  1 
ATOM   3568 N  N    . ARG B 1 119 ? -14.680 80.765 67.802 1.00 20.82 ? 149  ARG B N    1 
ATOM   3569 C  CA   . ARG B 1 119 ? -14.226 81.224 66.493 1.00 19.55 ? 149  ARG B CA   1 
ATOM   3570 C  C    . ARG B 1 119 ? -15.394 81.400 65.536 1.00 19.77 ? 149  ARG B C    1 
ATOM   3571 O  O    . ARG B 1 119 ? -15.475 82.386 64.800 1.00 23.98 ? 149  ARG B O    1 
ATOM   3572 C  CB   . ARG B 1 119 ? -13.258 80.210 65.914 1.00 19.72 ? 149  ARG B CB   1 
ATOM   3573 C  CG   . ARG B 1 119 ? -11.946 80.115 66.644 1.00 24.15 ? 149  ARG B CG   1 
ATOM   3574 C  CD   . ARG B 1 119 ? -11.242 78.860 66.211 1.00 31.45 ? 149  ARG B CD   1 
ATOM   3575 N  NE   . ARG B 1 119 ? -9.842  79.090 65.914 1.00 40.49 ? 149  ARG B NE   1 
ATOM   3576 C  CZ   . ARG B 1 119 ? -9.170  78.466 64.954 1.00 44.68 ? 149  ARG B CZ   1 
ATOM   3577 N  NH1  . ARG B 1 119 ? -9.775  77.571 64.184 1.00 42.54 ? 149  ARG B NH1  1 
ATOM   3578 N  NH2  . ARG B 1 119 ? -7.882  78.731 64.774 1.00 51.29 ? 149  ARG B NH2  1 
ATOM   3579 N  N    . MET B 1 120 ? -16.296 80.429 65.544 1.00 19.15 ? 150  MET B N    1 
ATOM   3580 C  CA   . MET B 1 120 ? -17.472 80.470 64.692 1.00 19.23 ? 150  MET B CA   1 
ATOM   3581 C  C    . MET B 1 120 ? -18.298 81.706 65.026 1.00 19.79 ? 150  MET B C    1 
ATOM   3582 O  O    . MET B 1 120 ? -18.663 82.467 64.129 1.00 17.46 ? 150  MET B O    1 
ATOM   3583 C  CB   . MET B 1 120 ? -18.296 79.198 64.887 1.00 19.65 ? 150  MET B CB   1 
ATOM   3584 C  CG   . MET B 1 120 ? -19.489 79.066 63.957 1.00 24.53 ? 150  MET B CG   1 
ATOM   3585 S  SD   . MET B 1 120 ? -20.186 77.400 64.018 1.00 27.35 ? 150  MET B SD   1 
ATOM   3586 C  CE   . MET B 1 120 ? -18.751 76.414 63.425 1.00 11.96 ? 150  MET B CE   1 
ATOM   3587 N  N    . GLY B 1 121 ? -18.553 81.923 66.317 1.00 20.70 ? 151  GLY B N    1 
ATOM   3588 C  CA   . GLY B 1 121 ? -19.322 83.079 66.755 1.00 20.18 ? 151  GLY B CA   1 
ATOM   3589 C  C    . GLY B 1 121 ? -18.751 84.392 66.246 1.00 19.00 ? 151  GLY B C    1 
ATOM   3590 O  O    . GLY B 1 121 ? -19.480 85.240 65.720 1.00 18.67 ? 151  GLY B O    1 
ATOM   3591 N  N    . ILE B 1 122 ? -17.442 84.559 66.398 1.00 19.62 ? 152  ILE B N    1 
ATOM   3592 C  CA   . ILE B 1 122 ? -16.750 85.756 65.934 1.00 21.17 ? 152  ILE B CA   1 
ATOM   3593 C  C    . ILE B 1 122 ? -17.047 85.938 64.437 1.00 23.87 ? 152  ILE B C    1 
ATOM   3594 O  O    . ILE B 1 122 ? -17.524 86.995 64.014 1.00 25.41 ? 152  ILE B O    1 
ATOM   3595 C  CB   . ILE B 1 122 ? -15.219 85.615 66.153 1.00 20.68 ? 152  ILE B CB   1 
ATOM   3596 C  CG1  . ILE B 1 122 ? -14.902 85.621 67.645 1.00 19.51 ? 152  ILE B CG1  1 
ATOM   3597 C  CG2  . ILE B 1 122 ? -14.452 86.732 65.447 1.00 17.67 ? 152  ILE B CG2  1 
ATOM   3598 C  CD1  . ILE B 1 122 ? -13.483 85.179 67.978 1.00 18.44 ? 152  ILE B CD1  1 
ATOM   3599 N  N    . GLY B 1 123 ? -16.834 84.877 63.660 1.00 23.26 ? 153  GLY B N    1 
ATOM   3600 C  CA   . GLY B 1 123 ? -17.076 84.934 62.227 1.00 22.95 ? 153  GLY B CA   1 
ATOM   3601 C  C    . GLY B 1 123 ? -18.505 85.247 61.815 1.00 22.18 ? 153  GLY B C    1 
ATOM   3602 O  O    . GLY B 1 123 ? -18.743 86.102 60.959 1.00 21.30 ? 153  GLY B O    1 
ATOM   3603 N  N    . MET B 1 124 ? -19.460 84.569 62.441 1.00 23.21 ? 154  MET B N    1 
ATOM   3604 C  CA   . MET B 1 124 ? -20.874 84.766 62.142 1.00 23.04 ? 154  MET B CA   1 
ATOM   3605 C  C    . MET B 1 124 ? -21.310 86.191 62.434 1.00 23.39 ? 154  MET B C    1 
ATOM   3606 O  O    . MET B 1 124 ? -22.145 86.760 61.724 1.00 22.42 ? 154  MET B O    1 
ATOM   3607 C  CB   . MET B 1 124 ? -21.732 83.769 62.933 1.00 21.76 ? 154  MET B CB   1 
ATOM   3608 C  CG   . MET B 1 124 ? -21.476 82.294 62.558 1.00 22.22 ? 154  MET B CG   1 
ATOM   3609 S  SD   . MET B 1 124 ? -22.504 81.078 63.438 1.00 23.08 ? 154  MET B SD   1 
ATOM   3610 C  CE   . MET B 1 124 ? -22.952 81.974 64.781 1.00 21.23 ? 154  MET B CE   1 
ATOM   3611 N  N    . ALA B 1 125 ? -20.722 86.783 63.464 1.00 24.54 ? 155  ALA B N    1 
ATOM   3612 C  CA   . ALA B 1 125 ? -21.073 88.147 63.823 1.00 26.02 ? 155  ALA B CA   1 
ATOM   3613 C  C    . ALA B 1 125 ? -20.505 89.125 62.806 1.00 26.37 ? 155  ALA B C    1 
ATOM   3614 O  O    . ALA B 1 125 ? -21.148 90.124 62.485 1.00 22.86 ? 155  ALA B O    1 
ATOM   3615 C  CB   . ALA B 1 125 ? -20.582 88.486 65.236 1.00 24.54 ? 155  ALA B CB   1 
ATOM   3616 N  N    . GLU B 1 126 ? -19.328 88.821 62.261 1.00 28.31 ? 156  GLU B N    1 
ATOM   3617 C  CA   . GLU B 1 126 ? -18.727 89.729 61.290 1.00 32.01 ? 156  GLU B CA   1 
ATOM   3618 C  C    . GLU B 1 126 ? -19.463 89.724 59.949 1.00 31.30 ? 156  GLU B C    1 
ATOM   3619 O  O    . GLU B 1 126 ? -19.466 90.727 59.237 1.00 31.00 ? 156  GLU B O    1 
ATOM   3620 C  CB   . GLU B 1 126 ? -17.218 89.479 61.123 1.00 34.31 ? 156  GLU B CB   1 
ATOM   3621 C  CG   . GLU B 1 126 ? -16.814 88.318 60.240 1.00 42.61 ? 156  GLU B CG   1 
ATOM   3622 C  CD   . GLU B 1 126 ? -15.305 88.263 60.007 1.00 45.64 ? 156  GLU B CD   1 
ATOM   3623 O  OE1  . GLU B 1 126 ? -14.557 87.938 60.956 1.00 43.22 ? 156  GLU B OE1  1 
ATOM   3624 O  OE2  . GLU B 1 126 ? -14.866 88.538 58.868 1.00 47.74 ? 156  GLU B OE2  1 
ATOM   3625 N  N    . PHE B 1 127 ? -20.139 88.621 59.643 1.00 29.11 ? 157  PHE B N    1 
ATOM   3626 C  CA   . PHE B 1 127 ? -20.893 88.510 58.398 1.00 27.57 ? 157  PHE B CA   1 
ATOM   3627 C  C    . PHE B 1 127 ? -22.350 88.939 58.493 1.00 25.51 ? 157  PHE B C    1 
ATOM   3628 O  O    . PHE B 1 127 ? -23.038 89.025 57.481 1.00 29.26 ? 157  PHE B O    1 
ATOM   3629 C  CB   . PHE B 1 127 ? -20.811 87.089 57.837 1.00 27.45 ? 157  PHE B CB   1 
ATOM   3630 C  CG   . PHE B 1 127 ? -19.647 86.878 56.919 1.00 31.62 ? 157  PHE B CG   1 
ATOM   3631 C  CD1  . PHE B 1 127 ? -18.408 86.482 57.423 1.00 31.57 ? 157  PHE B CD1  1 
ATOM   3632 C  CD2  . PHE B 1 127 ? -19.770 87.138 55.557 1.00 29.31 ? 157  PHE B CD2  1 
ATOM   3633 C  CE1  . PHE B 1 127 ? -17.308 86.353 56.587 1.00 30.30 ? 157  PHE B CE1  1 
ATOM   3634 C  CE2  . PHE B 1 127 ? -18.676 87.013 54.711 1.00 28.42 ? 157  PHE B CE2  1 
ATOM   3635 C  CZ   . PHE B 1 127 ? -17.441 86.622 55.225 1.00 31.83 ? 157  PHE B CZ   1 
ATOM   3636 N  N    . LEU B 1 128 ? -22.807 89.269 59.693 1.00 26.41 ? 158  LEU B N    1 
ATOM   3637 C  CA   . LEU B 1 128 ? -24.198 89.663 59.903 1.00 27.01 ? 158  LEU B CA   1 
ATOM   3638 C  C    . LEU B 1 128 ? -24.804 90.631 58.878 1.00 28.33 ? 158  LEU B C    1 
ATOM   3639 O  O    . LEU B 1 128 ? -25.891 90.377 58.363 1.00 30.36 ? 158  LEU B O    1 
ATOM   3640 C  CB   . LEU B 1 128 ? -24.375 90.179 61.329 1.00 25.05 ? 158  LEU B CB   1 
ATOM   3641 C  CG   . LEU B 1 128 ? -25.332 89.386 62.230 1.00 26.28 ? 158  LEU B CG   1 
ATOM   3642 C  CD1  . LEU B 1 128 ? -25.293 87.898 61.908 1.00 18.40 ? 158  LEU B CD1  1 
ATOM   3643 C  CD2  . LEU B 1 128 ? -25.007 89.655 63.706 1.00 20.80 ? 158  LEU B CD2  1 
ATOM   3644 N  N    . ASP B 1 129 ? -24.121 91.735 58.590 1.00 28.75 ? 159  ASP B N    1 
ATOM   3645 C  CA   . ASP B 1 129 ? -24.607 92.717 57.610 1.00 30.67 ? 159  ASP B CA   1 
ATOM   3646 C  C    . ASP B 1 129 ? -23.675 92.731 56.416 1.00 34.68 ? 159  ASP B C    1 
ATOM   3647 O  O    . ASP B 1 129 ? -23.484 93.770 55.781 1.00 33.35 ? 159  ASP B O    1 
ATOM   3648 C  CB   . ASP B 1 129 ? -24.603 94.124 58.204 1.00 30.74 ? 159  ASP B CB   1 
ATOM   3649 C  CG   . ASP B 1 129 ? -25.859 94.446 58.953 1.00 30.02 ? 159  ASP B CG   1 
ATOM   3650 O  OD1  . ASP B 1 129 ? -26.956 94.127 58.449 1.00 31.34 ? 159  ASP B OD1  1 
ATOM   3651 O  OD2  . ASP B 1 129 ? -25.744 95.046 60.041 1.00 33.36 ? 159  ASP B OD2  1 
ATOM   3652 N  N    . LYS B 1 130 ? -23.101 91.576 56.106 1.00 36.98 ? 160  LYS B N    1 
ATOM   3653 C  CA   . LYS B 1 130 ? -22.152 91.475 55.017 1.00 38.42 ? 160  LYS B CA   1 
ATOM   3654 C  C    . LYS B 1 130 ? -22.489 90.319 54.088 1.00 39.40 ? 160  LYS B C    1 
ATOM   3655 O  O    . LYS B 1 130 ? -22.316 89.158 54.456 1.00 41.71 ? 160  LYS B O    1 
ATOM   3656 C  CB   . LYS B 1 130 ? -20.749 91.306 55.608 1.00 38.22 ? 160  LYS B CB   1 
ATOM   3657 C  CG   . LYS B 1 130 ? -19.622 91.237 54.606 1.00 45.03 ? 160  LYS B CG   1 
ATOM   3658 C  CD   . LYS B 1 130 ? -18.266 91.295 55.302 1.00 45.57 ? 160  LYS B CD   1 
ATOM   3659 C  CE   . LYS B 1 130 ? -18.068 90.133 56.255 1.00 47.71 ? 160  LYS B CE   1 
ATOM   3660 N  NZ   . LYS B 1 130 ? -16.783 90.229 57.002 1.00 52.35 ? 160  LYS B NZ   1 
ATOM   3661 N  N    . HIS B 1 131 ? -23.030 90.646 52.914 1.00 37.34 ? 161  HIS B N    1 
ATOM   3662 C  CA   . HIS B 1 131 ? -23.366 89.642 51.903 1.00 36.40 ? 161  HIS B CA   1 
ATOM   3663 C  C    . HIS B 1 131 ? -22.057 89.146 51.278 1.00 35.64 ? 161  HIS B C    1 
ATOM   3664 O  O    . HIS B 1 131 ? -21.106 89.917 51.120 1.00 37.18 ? 161  HIS B O    1 
ATOM   3665 C  CB   . HIS B 1 131 ? -24.221 90.258 50.791 1.00 39.33 ? 161  HIS B CB   1 
ATOM   3666 C  CG   . HIS B 1 131 ? -25.698 90.105 50.991 1.00 44.72 ? 161  HIS B CG   1 
ATOM   3667 N  ND1  . HIS B 1 131 ? -26.404 89.029 50.500 1.00 46.52 ? 161  HIS B ND1  1 
ATOM   3668 C  CD2  . HIS B 1 131 ? -26.608 90.908 51.590 1.00 45.79 ? 161  HIS B CD2  1 
ATOM   3669 C  CE1  . HIS B 1 131 ? -27.686 89.174 50.788 1.00 45.97 ? 161  HIS B CE1  1 
ATOM   3670 N  NE2  . HIS B 1 131 ? -27.837 90.306 51.448 1.00 46.52 ? 161  HIS B NE2  1 
ATOM   3671 N  N    . VAL B 1 132 ? -22.009 87.875 50.904 1.00 30.86 ? 162  VAL B N    1 
ATOM   3672 C  CA   . VAL B 1 132 ? -20.815 87.318 50.286 1.00 31.23 ? 162  VAL B CA   1 
ATOM   3673 C  C    . VAL B 1 132 ? -20.599 87.901 48.886 1.00 29.87 ? 162  VAL B C    1 
ATOM   3674 O  O    . VAL B 1 132 ? -21.492 87.860 48.039 1.00 29.79 ? 162  VAL B O    1 
ATOM   3675 C  CB   . VAL B 1 132 ? -20.895 85.784 50.208 1.00 32.57 ? 162  VAL B CB   1 
ATOM   3676 C  CG1  . VAL B 1 132 ? -19.760 85.236 49.348 1.00 31.41 ? 162  VAL B CG1  1 
ATOM   3677 C  CG2  . VAL B 1 132 ? -20.841 85.197 51.614 1.00 34.16 ? 162  VAL B CG2  1 
ATOM   3678 N  N    . THR B 1 133 ? -19.416 88.454 48.648 1.00 28.35 ? 163  THR B N    1 
ATOM   3679 C  CA   . THR B 1 133 ? -19.115 89.045 47.351 1.00 28.11 ? 163  THR B CA   1 
ATOM   3680 C  C    . THR B 1 133 ? -18.095 88.248 46.538 1.00 23.71 ? 163  THR B C    1 
ATOM   3681 O  O    . THR B 1 133 ? -18.451 87.540 45.595 1.00 25.37 ? 163  THR B O    1 
ATOM   3682 C  CB   . THR B 1 133 ? -18.635 90.510 47.497 1.00 28.53 ? 163  THR B CB   1 
ATOM   3683 O  OG1  . THR B 1 133 ? -17.394 90.547 48.213 1.00 29.81 ? 163  THR B OG1  1 
ATOM   3684 C  CG2  . THR B 1 133 ? -19.669 91.334 48.250 1.00 31.78 ? 163  THR B CG2  1 
ATOM   3685 N  N    . SER B 1 134 ? -16.832 88.373 46.908 1.00 21.09 ? 164  SER B N    1 
ATOM   3686 C  CA   . SER B 1 134 ? -15.745 87.702 46.224 1.00 23.88 ? 164  SER B CA   1 
ATOM   3687 C  C    . SER B 1 134 ? -15.685 86.227 46.549 1.00 26.90 ? 164  SER B C    1 
ATOM   3688 O  O    . SER B 1 134 ? -16.283 85.772 47.527 1.00 25.74 ? 164  SER B O    1 
ATOM   3689 C  CB   . SER B 1 134 ? -14.427 88.339 46.640 1.00 27.52 ? 164  SER B CB   1 
ATOM   3690 O  OG   . SER B 1 134 ? -14.191 88.134 48.026 1.00 30.03 ? 164  SER B OG   1 
ATOM   3691 N  N    . GLU B 1 135 ? -14.916 85.487 45.758 1.00 26.78 ? 165  GLU B N    1 
ATOM   3692 C  CA   . GLU B 1 135 ? -14.754 84.062 45.995 1.00 31.67 ? 165  GLU B CA   1 
ATOM   3693 C  C    . GLU B 1 135 ? -13.974 83.867 47.295 1.00 31.73 ? 165  GLU B C    1 
ATOM   3694 O  O    . GLU B 1 135 ? -14.137 82.842 47.957 1.00 32.75 ? 165  GLU B O    1 
ATOM   3695 C  CB   . GLU B 1 135 ? -14.054 83.369 44.818 1.00 35.28 ? 165  GLU B CB   1 
ATOM   3696 C  CG   . GLU B 1 135 ? -14.899 83.315 43.537 1.00 41.38 ? 165  GLU B CG   1 
ATOM   3697 C  CD   . GLU B 1 135 ? -14.303 82.422 42.445 1.00 44.45 ? 165  GLU B CD   1 
ATOM   3698 O  OE1  . GLU B 1 135 ? -13.062 82.394 42.283 1.00 42.71 ? 165  GLU B OE1  1 
ATOM   3699 O  OE2  . GLU B 1 135 ? -15.086 81.744 41.744 1.00 43.26 ? 165  GLU B OE2  1 
ATOM   3700 N  N    . GLN B 1 136 ? -13.174 84.869 47.682 1.00 31.64 ? 166  GLN B N    1 
ATOM   3701 C  CA   . GLN B 1 136 ? -12.403 84.804 48.932 1.00 30.71 ? 166  GLN B CA   1 
ATOM   3702 C  C    . GLN B 1 136 ? -13.416 84.852 50.058 1.00 27.90 ? 166  GLN B C    1 
ATOM   3703 O  O    . GLN B 1 136 ? -13.381 84.034 50.976 1.00 29.90 ? 166  GLN B O    1 
ATOM   3704 C  CB   . GLN B 1 136 ? -11.466 86.010 49.133 1.00 32.26 ? 166  GLN B CB   1 
ATOM   3705 C  CG   . GLN B 1 136 ? -10.576 86.398 47.985 1.00 40.14 ? 166  GLN B CG   1 
ATOM   3706 C  CD   . GLN B 1 136 ? -11.287 87.276 46.993 1.00 42.90 ? 166  GLN B CD   1 
ATOM   3707 O  OE1  . GLN B 1 136 ? -11.964 86.778 46.089 1.00 48.10 ? 166  GLN B OE1  1 
ATOM   3708 N  NE2  . GLN B 1 136 ? -11.183 88.590 47.176 1.00 43.64 ? 166  GLN B NE2  1 
ATOM   3709 N  N    . GLU B 1 137 ? -14.315 85.826 49.976 1.00 26.42 ? 167  GLU B N    1 
ATOM   3710 C  CA   . GLU B 1 137 ? -15.345 86.016 50.982 1.00 28.14 ? 167  GLU B CA   1 
ATOM   3711 C  C    . GLU B 1 137 ? -16.254 84.796 51.117 1.00 27.65 ? 167  GLU B C    1 
ATOM   3712 O  O    . GLU B 1 137 ? -16.640 84.443 52.231 1.00 26.22 ? 167  GLU B O    1 
ATOM   3713 C  CB   . GLU B 1 137 ? -16.163 87.273 50.678 1.00 30.24 ? 167  GLU B CB   1 
ATOM   3714 C  CG   . GLU B 1 137 ? -17.123 87.657 51.798 1.00 42.81 ? 167  GLU B CG   1 
ATOM   3715 C  CD   . GLU B 1 137 ? -17.822 88.990 51.576 1.00 50.27 ? 167  GLU B CD   1 
ATOM   3716 O  OE1  . GLU B 1 137 ? -17.354 89.800 50.747 1.00 53.29 ? 167  GLU B OE1  1 
ATOM   3717 O  OE2  . GLU B 1 137 ? -18.847 89.234 52.246 1.00 53.06 ? 167  GLU B OE2  1 
ATOM   3718 N  N    . TRP B 1 138 ? -16.575 84.148 49.994 1.00 24.94 ? 168  TRP B N    1 
ATOM   3719 C  CA   . TRP B 1 138 ? -17.424 82.955 49.999 1.00 25.05 ? 168  TRP B CA   1 
ATOM   3720 C  C    . TRP B 1 138 ? -16.718 81.897 50.824 1.00 25.71 ? 168  TRP B C    1 
ATOM   3721 O  O    . TRP B 1 138 ? -17.341 81.186 51.614 1.00 28.17 ? 168  TRP B O    1 
ATOM   3722 C  CB   . TRP B 1 138 ? -17.645 82.422 48.575 1.00 25.63 ? 168  TRP B CB   1 
ATOM   3723 C  CG   . TRP B 1 138 ? -18.832 81.493 48.440 1.00 19.17 ? 168  TRP B CG   1 
ATOM   3724 C  CD1  . TRP B 1 138 ? -20.003 81.552 49.141 1.00 25.25 ? 168  TRP B CD1  1 
ATOM   3725 C  CD2  . TRP B 1 138 ? -18.972 80.409 47.514 1.00 20.46 ? 168  TRP B CD2  1 
ATOM   3726 N  NE1  . TRP B 1 138 ? -20.868 80.577 48.705 1.00 21.72 ? 168  TRP B NE1  1 
ATOM   3727 C  CE2  . TRP B 1 138 ? -20.266 79.858 47.708 1.00 23.32 ? 168  TRP B CE2  1 
ATOM   3728 C  CE3  . TRP B 1 138 ? -18.144 79.845 46.538 1.00 23.39 ? 168  TRP B CE3  1 
ATOM   3729 C  CZ2  . TRP B 1 138 ? -20.740 78.771 46.960 1.00 22.33 ? 168  TRP B CZ2  1 
ATOM   3730 C  CZ3  . TRP B 1 138 ? -18.617 78.762 45.793 1.00 23.17 ? 168  TRP B CZ3  1 
ATOM   3731 C  CH2  . TRP B 1 138 ? -19.904 78.240 46.012 1.00 23.06 ? 168  TRP B CH2  1 
ATOM   3732 N  N    . ASP B 1 139 ? -15.404 81.822 50.650 1.00 25.48 ? 169  ASP B N    1 
ATOM   3733 C  CA   . ASP B 1 139 ? -14.584 80.869 51.379 1.00 28.54 ? 169  ASP B CA   1 
ATOM   3734 C  C    . ASP B 1 139 ? -14.518 81.225 52.858 1.00 26.80 ? 169  ASP B C    1 
ATOM   3735 O  O    . ASP B 1 139 ? -14.572 80.336 53.701 1.00 26.86 ? 169  ASP B O    1 
ATOM   3736 C  CB   . ASP B 1 139 ? -13.172 80.810 50.790 1.00 29.48 ? 169  ASP B CB   1 
ATOM   3737 C  CG   . ASP B 1 139 ? -13.133 80.133 49.437 1.00 30.55 ? 169  ASP B CG   1 
ATOM   3738 O  OD1  . ASP B 1 139 ? -14.179 79.614 48.988 1.00 28.10 ? 169  ASP B OD1  1 
ATOM   3739 O  OD2  . ASP B 1 139 ? -12.041 80.110 48.827 1.00 34.88 ? 169  ASP B OD2  1 
ATOM   3740 N  N    . LYS B 1 140 ? -14.401 82.519 53.160 1.00 26.13 ? 170  LYS B N    1 
ATOM   3741 C  CA   . LYS B 1 140 ? -14.342 82.996 54.540 1.00 26.72 ? 170  LYS B CA   1 
ATOM   3742 C  C    . LYS B 1 140 ? -15.605 82.572 55.286 1.00 24.88 ? 170  LYS B C    1 
ATOM   3743 O  O    . LYS B 1 140 ? -15.537 82.009 56.377 1.00 24.55 ? 170  LYS B O    1 
ATOM   3744 C  CB   . LYS B 1 140 ? -14.256 84.521 54.583 1.00 32.79 ? 170  LYS B CB   1 
ATOM   3745 C  CG   . LYS B 1 140 ? -13.025 85.124 53.943 1.00 43.54 ? 170  LYS B CG   1 
ATOM   3746 C  CD   . LYS B 1 140 ? -11.772 84.880 54.766 1.00 46.63 ? 170  LYS B CD   1 
ATOM   3747 C  CE   . LYS B 1 140 ? -10.655 85.828 54.346 1.00 49.32 ? 170  LYS B CE   1 
ATOM   3748 N  NZ   . LYS B 1 140 ? -10.921 87.248 54.741 1.00 49.20 ? 170  LYS B NZ   1 
ATOM   3749 N  N    . TYR B 1 141 ? -16.757 82.844 54.685 1.00 20.72 ? 171  TYR B N    1 
ATOM   3750 C  CA   . TYR B 1 141 ? -18.032 82.498 55.289 1.00 24.20 ? 171  TYR B CA   1 
ATOM   3751 C  C    . TYR B 1 141 ? -18.167 80.986 55.459 1.00 24.08 ? 171  TYR B C    1 
ATOM   3752 O  O    . TYR B 1 141 ? -18.616 80.508 56.500 1.00 22.48 ? 171  TYR B O    1 
ATOM   3753 C  CB   . TYR B 1 141 ? -19.197 83.043 54.455 1.00 24.20 ? 171  TYR B CB   1 
ATOM   3754 C  CG   . TYR B 1 141 ? -20.532 82.832 55.126 1.00 29.90 ? 171  TYR B CG   1 
ATOM   3755 C  CD1  . TYR B 1 141 ? -20.851 83.512 56.308 1.00 30.94 ? 171  TYR B CD1  1 
ATOM   3756 C  CD2  . TYR B 1 141 ? -21.439 81.890 54.642 1.00 28.69 ? 171  TYR B CD2  1 
ATOM   3757 C  CE1  . TYR B 1 141 ? -22.031 83.251 56.994 1.00 31.48 ? 171  TYR B CE1  1 
ATOM   3758 C  CE2  . TYR B 1 141 ? -22.625 81.622 55.323 1.00 32.87 ? 171  TYR B CE2  1 
ATOM   3759 C  CZ   . TYR B 1 141 ? -22.912 82.304 56.499 1.00 31.84 ? 171  TYR B CZ   1 
ATOM   3760 O  OH   . TYR B 1 141 ? -24.073 82.031 57.182 1.00 34.08 ? 171  TYR B OH   1 
ATOM   3761 N  N    . CYS B 1 142 ? -17.794 80.235 54.430 1.00 22.93 ? 172  CYS B N    1 
ATOM   3762 C  CA   . CYS B 1 142 ? -17.870 78.782 54.493 1.00 21.87 ? 172  CYS B CA   1 
ATOM   3763 C  C    . CYS B 1 142 ? -16.950 78.237 55.584 1.00 19.84 ? 172  CYS B C    1 
ATOM   3764 O  O    . CYS B 1 142 ? -17.286 77.270 56.270 1.00 18.49 ? 172  CYS B O    1 
ATOM   3765 C  CB   . CYS B 1 142 ? -17.530 78.174 53.131 1.00 22.29 ? 172  CYS B CB   1 
ATOM   3766 S  SG   . CYS B 1 142 ? -18.856 78.370 51.923 1.00 24.10 ? 172  CYS B SG   1 
ATOM   3767 N  N    . HIS B 1 143 ? -15.791 78.861 55.742 1.00 15.39 ? 173  HIS B N    1 
ATOM   3768 C  CA   . HIS B 1 143 ? -14.841 78.450 56.765 1.00 19.42 ? 173  HIS B CA   1 
ATOM   3769 C  C    . HIS B 1 143 ? -15.490 78.596 58.147 1.00 20.62 ? 173  HIS B C    1 
ATOM   3770 O  O    . HIS B 1 143 ? -15.483 77.666 58.961 1.00 19.41 ? 173  HIS B O    1 
ATOM   3771 C  CB   . HIS B 1 143 ? -13.586 79.319 56.683 1.00 18.07 ? 173  HIS B CB   1 
ATOM   3772 C  CG   . HIS B 1 143 ? -12.655 79.159 57.845 1.00 18.50 ? 173  HIS B CG   1 
ATOM   3773 N  ND1  . HIS B 1 143 ? -11.834 78.065 57.998 1.00 19.29 ? 173  HIS B ND1  1 
ATOM   3774 C  CD2  . HIS B 1 143 ? -12.385 79.980 58.888 1.00 15.14 ? 173  HIS B CD2  1 
ATOM   3775 C  CE1  . HIS B 1 143 ? -11.094 78.215 59.083 1.00 16.97 ? 173  HIS B CE1  1 
ATOM   3776 N  NE2  . HIS B 1 143 ? -11.412 79.370 59.638 1.00 16.62 ? 173  HIS B NE2  1 
ATOM   3777 N  N    . TYR B 1 144 ? -16.113 79.746 58.370 1.00 19.81 ? 174  TYR B N    1 
ATOM   3778 C  CA   . TYR B 1 144 ? -16.758 80.047 59.640 1.00 20.43 ? 174  TYR B CA   1 
ATOM   3779 C  C    . TYR B 1 144 ? -17.890 79.117 60.023 1.00 19.82 ? 174  TYR B C    1 
ATOM   3780 O  O    . TYR B 1 144 ? -17.953 78.624 61.146 1.00 21.95 ? 174  TYR B O    1 
ATOM   3781 C  CB   . TYR B 1 144 ? -17.289 81.479 59.625 1.00 18.82 ? 174  TYR B CB   1 
ATOM   3782 C  CG   . TYR B 1 144 ? -16.218 82.526 59.781 1.00 22.56 ? 174  TYR B CG   1 
ATOM   3783 C  CD1  . TYR B 1 144 ? -15.157 82.337 60.670 1.00 24.36 ? 174  TYR B CD1  1 
ATOM   3784 C  CD2  . TYR B 1 144 ? -16.300 83.740 59.101 1.00 23.79 ? 174  TYR B CD2  1 
ATOM   3785 C  CE1  . TYR B 1 144 ? -14.217 83.333 60.887 1.00 26.96 ? 174  TYR B CE1  1 
ATOM   3786 C  CE2  . TYR B 1 144 ? -15.362 84.747 59.313 1.00 25.17 ? 174  TYR B CE2  1 
ATOM   3787 C  CZ   . TYR B 1 144 ? -14.332 84.538 60.211 1.00 25.98 ? 174  TYR B CZ   1 
ATOM   3788 O  OH   . TYR B 1 144 ? -13.451 85.556 60.485 1.00 30.87 ? 174  TYR B OH   1 
ATOM   3789 N  N    . VAL B 1 145 ? -18.779 78.873 59.072 1.00 18.16 ? 175  VAL B N    1 
ATOM   3790 C  CA   . VAL B 1 145 ? -19.950 78.054 59.305 1.00 15.78 ? 175  VAL B CA   1 
ATOM   3791 C  C    . VAL B 1 145 ? -19.789 76.557 59.082 1.00 16.68 ? 175  VAL B C    1 
ATOM   3792 O  O    . VAL B 1 145 ? -20.549 75.768 59.642 1.00 18.67 ? 175  VAL B O    1 
ATOM   3793 C  CB   . VAL B 1 145 ? -21.119 78.605 58.482 1.00 15.75 ? 175  VAL B CB   1 
ATOM   3794 C  CG1  . VAL B 1 145 ? -22.368 77.786 58.695 1.00 29.67 ? 175  VAL B CG1  1 
ATOM   3795 C  CG2  . VAL B 1 145 ? -21.372 80.049 58.890 1.00 15.16 ? 175  VAL B CG2  1 
ATOM   3796 N  N    . ALA B 1 146 ? -18.765 76.145 58.344 1.00 14.93 ? 176  ALA B N    1 
ATOM   3797 C  CA   . ALA B 1 146 ? -18.601 74.724 58.076 1.00 14.58 ? 176  ALA B CA   1 
ATOM   3798 C  C    . ALA B 1 146 ? -17.172 74.225 58.134 1.00 15.22 ? 176  ALA B C    1 
ATOM   3799 O  O    . ALA B 1 146 ? -16.930 73.081 58.532 1.00 15.77 ? 176  ALA B O    1 
ATOM   3800 C  CB   . ALA B 1 146 ? -19.238 74.372 56.721 1.00 11.15 ? 176  ALA B CB   1 
ATOM   3801 N  N    . GLY B 1 147 ? -16.227 75.065 57.713 1.00 18.52 ? 177  GLY B N    1 
ATOM   3802 C  CA   . GLY B 1 147 ? -14.819 74.688 57.738 1.00 16.55 ? 177  GLY B CA   1 
ATOM   3803 C  C    . GLY B 1 147 ? -14.378 74.422 59.165 1.00 15.29 ? 177  GLY B C    1 
ATOM   3804 O  O    . GLY B 1 147 ? -13.652 73.471 59.440 1.00 16.36 ? 177  GLY B O    1 
ATOM   3805 N  N    . LEU B 1 148 ? -14.862 75.249 60.086 1.00 17.43 ? 178  LEU B N    1 
ATOM   3806 C  CA   . LEU B 1 148 ? -14.538 75.095 61.497 1.00 17.33 ? 178  LEU B CA   1 
ATOM   3807 C  C    . LEU B 1 148 ? -15.168 73.818 62.072 1.00 16.79 ? 178  LEU B C    1 
ATOM   3808 O  O    . LEU B 1 148 ? -14.623 73.212 63.003 1.00 15.66 ? 178  LEU B O    1 
ATOM   3809 C  CB   . LEU B 1 148 ? -14.972 76.338 62.276 1.00 18.64 ? 178  LEU B CB   1 
ATOM   3810 C  CG   . LEU B 1 148 ? -14.083 77.573 62.073 1.00 13.43 ? 178  LEU B CG   1 
ATOM   3811 C  CD1  . LEU B 1 148 ? -14.646 78.724 62.854 1.00 12.71 ? 178  LEU B CD1  1 
ATOM   3812 C  CD2  . LEU B 1 148 ? -12.654 77.278 62.510 1.00 15.05 ? 178  LEU B CD2  1 
ATOM   3813 N  N    . VAL B 1 149 ? -16.289 73.386 61.492 1.00 16.69 ? 179  VAL B N    1 
ATOM   3814 C  CA   . VAL B 1 149 ? -16.951 72.161 61.951 1.00 16.98 ? 179  VAL B CA   1 
ATOM   3815 C  C    . VAL B 1 149 ? -16.063 70.977 61.606 1.00 16.01 ? 179  VAL B C    1 
ATOM   3816 O  O    . VAL B 1 149 ? -15.897 70.065 62.415 1.00 20.11 ? 179  VAL B O    1 
ATOM   3817 C  CB   . VAL B 1 149 ? -18.337 71.947 61.310 1.00 14.31 ? 179  VAL B CB   1 
ATOM   3818 C  CG1  . VAL B 1 149 ? -18.893 70.589 61.710 1.00 11.90 ? 179  VAL B CG1  1 
ATOM   3819 C  CG2  . VAL B 1 149 ? -19.286 73.036 61.743 1.00 14.56 ? 179  VAL B CG2  1 
ATOM   3820 N  N    . GLY B 1 150 ? -15.467 71.001 60.417 1.00 15.05 ? 180  GLY B N    1 
ATOM   3821 C  CA   . GLY B 1 150 ? -14.584 69.915 60.031 1.00 12.41 ? 180  GLY B CA   1 
ATOM   3822 C  C    . GLY B 1 150 ? -13.360 69.886 60.925 1.00 14.05 ? 180  GLY B C    1 
ATOM   3823 O  O    . GLY B 1 150 ? -12.938 68.830 61.397 1.00 13.24 ? 180  GLY B O    1 
ATOM   3824 N  N    . ILE B 1 151 ? -12.812 71.071 61.173 1.00 13.57 ? 181  ILE B N    1 
ATOM   3825 C  CA   . ILE B 1 151 ? -11.632 71.239 62.008 1.00 16.96 ? 181  ILE B CA   1 
ATOM   3826 C  C    . ILE B 1 151 ? -11.910 70.748 63.419 1.00 15.07 ? 181  ILE B C    1 
ATOM   3827 O  O    . ILE B 1 151 ? -11.105 70.003 63.983 1.00 17.76 ? 181  ILE B O    1 
ATOM   3828 C  CB   . ILE B 1 151 ? -11.150 72.727 61.998 1.00 17.94 ? 181  ILE B CB   1 
ATOM   3829 C  CG1  . ILE B 1 151 ? -10.556 73.055 60.617 1.00 19.36 ? 181  ILE B CG1  1 
ATOM   3830 C  CG2  . ILE B 1 151 ? -10.131 72.979 63.106 1.00 13.45 ? 181  ILE B CG2  1 
ATOM   3831 C  CD1  . ILE B 1 151 ? -10.207 74.508 60.394 1.00 17.35 ? 181  ILE B CD1  1 
ATOM   3832 N  N    . GLY B 1 152 ? -13.079 71.112 63.952 1.00 15.86 ? 182  GLY B N    1 
ATOM   3833 C  CA   . GLY B 1 152 ? -13.469 70.690 65.292 1.00 13.35 ? 182  GLY B CA   1 
ATOM   3834 C  C    . GLY B 1 152 ? -13.634 69.182 65.387 1.00 12.88 ? 182  GLY B C    1 
ATOM   3835 O  O    . GLY B 1 152 ? -13.111 68.545 66.302 1.00 11.68 ? 182  GLY B O    1 
ATOM   3836 N  N    . LEU B 1 153 ? -14.338 68.609 64.414 1.00 10.81 ? 183  LEU B N    1 
ATOM   3837 C  CA   . LEU B 1 153 ? -14.564 67.173 64.356 1.00 10.35 ? 183  LEU B CA   1 
ATOM   3838 C  C    . LEU B 1 153 ? -13.234 66.453 64.257 1.00 12.05 ? 183  LEU B C    1 
ATOM   3839 O  O    . LEU B 1 153 ? -13.017 65.423 64.910 1.00 13.16 ? 183  LEU B O    1 
ATOM   3840 C  CB   . LEU B 1 153 ? -15.446 66.813 63.146 1.00 12.23 ? 183  LEU B CB   1 
ATOM   3841 C  CG   . LEU B 1 153 ? -16.952 67.081 63.291 1.00 9.77  ? 183  LEU B CG   1 
ATOM   3842 C  CD1  . LEU B 1 153 ? -17.665 67.035 61.941 1.00 9.10  ? 183  LEU B CD1  1 
ATOM   3843 C  CD2  . LEU B 1 153 ? -17.551 66.061 64.264 1.00 5.57  ? 183  LEU B CD2  1 
ATOM   3844 N  N    . SER B 1 154 ? -12.331 67.017 63.463 1.00 15.92 ? 184  SER B N    1 
ATOM   3845 C  CA   . SER B 1 154 ? -11.018 66.431 63.265 1.00 15.10 ? 184  SER B CA   1 
ATOM   3846 C  C    . SER B 1 154 ? -10.225 66.430 64.554 1.00 15.42 ? 184  SER B C    1 
ATOM   3847 O  O    . SER B 1 154 ? -9.509  65.468 64.839 1.00 19.08 ? 184  SER B O    1 
ATOM   3848 C  CB   . SER B 1 154 ? -10.256 67.169 62.160 1.00 19.30 ? 184  SER B CB   1 
ATOM   3849 O  OG   . SER B 1 154 ? -10.948 67.081 60.924 1.00 19.04 ? 184  SER B OG   1 
ATOM   3850 N  N    . ARG B 1 155 ? -10.338 67.507 65.327 1.00 17.29 ? 185  ARG B N    1 
ATOM   3851 C  CA   . ARG B 1 155 ? -9.633  67.595 66.611 1.00 17.45 ? 185  ARG B CA   1 
ATOM   3852 C  C    . ARG B 1 155 ? -10.249 66.614 67.614 1.00 16.83 ? 185  ARG B C    1 
ATOM   3853 O  O    . ARG B 1 155 ? -9.549  66.088 68.470 1.00 16.60 ? 185  ARG B O    1 
ATOM   3854 C  CB   . ARG B 1 155 ? -9.645  69.028 67.161 1.00 15.38 ? 185  ARG B CB   1 
ATOM   3855 C  CG   . ARG B 1 155 ? -8.842  70.012 66.333 1.00 19.78 ? 185  ARG B CG   1 
ATOM   3856 C  CD   . ARG B 1 155 ? -8.404  71.220 67.145 1.00 26.37 ? 185  ARG B CD   1 
ATOM   3857 N  NE   . ARG B 1 155 ? -9.495  72.151 67.401 1.00 32.80 ? 185  ARG B NE   1 
ATOM   3858 C  CZ   . ARG B 1 155 ? -9.594  72.922 68.480 1.00 34.27 ? 185  ARG B CZ   1 
ATOM   3859 N  NH1  . ARG B 1 155 ? -8.670  72.887 69.429 1.00 30.97 ? 185  ARG B NH1  1 
ATOM   3860 N  NH2  . ARG B 1 155 ? -10.622 73.748 68.600 1.00 36.92 ? 185  ARG B NH2  1 
ATOM   3861 N  N    . LEU B 1 156 ? -11.554 66.358 67.498 1.00 16.21 ? 186  LEU B N    1 
ATOM   3862 C  CA   . LEU B 1 156 ? -12.225 65.401 68.375 1.00 14.68 ? 186  LEU B CA   1 
ATOM   3863 C  C    . LEU B 1 156 ? -11.715 63.986 68.081 1.00 18.47 ? 186  LEU B C    1 
ATOM   3864 O  O    . LEU B 1 156 ? -11.391 63.231 69.012 1.00 17.47 ? 186  LEU B O    1 
ATOM   3865 C  CB   . LEU B 1 156 ? -13.744 65.440 68.178 1.00 13.48 ? 186  LEU B CB   1 
ATOM   3866 C  CG   . LEU B 1 156 ? -14.509 66.671 68.674 1.00 17.09 ? 186  LEU B CG   1 
ATOM   3867 C  CD1  . LEU B 1 156 ? -15.991 66.474 68.413 1.00 11.23 ? 186  LEU B CD1  1 
ATOM   3868 C  CD2  . LEU B 1 156 ? -14.242 66.926 70.168 1.00 10.18 ? 186  LEU B CD2  1 
ATOM   3869 N  N    . PHE B 1 157 ? -11.659 63.637 66.790 1.00 14.23 ? 187  PHE B N    1 
ATOM   3870 C  CA   . PHE B 1 157 ? -11.189 62.328 66.335 1.00 15.03 ? 187  PHE B CA   1 
ATOM   3871 C  C    . PHE B 1 157 ? -9.790  62.058 66.851 1.00 12.58 ? 187  PHE B C    1 
ATOM   3872 O  O    . PHE B 1 157 ? -9.505  60.958 67.318 1.00 18.74 ? 187  PHE B O    1 
ATOM   3873 C  CB   . PHE B 1 157 ? -11.152 62.239 64.799 1.00 19.83 ? 187  PHE B CB   1 
ATOM   3874 C  CG   . PHE B 1 157 ? -12.488 62.427 64.128 1.00 21.95 ? 187  PHE B CG   1 
ATOM   3875 C  CD1  . PHE B 1 157 ? -13.670 62.009 64.743 1.00 17.94 ? 187  PHE B CD1  1 
ATOM   3876 C  CD2  . PHE B 1 157 ? -12.559 63.039 62.873 1.00 17.45 ? 187  PHE B CD2  1 
ATOM   3877 C  CE1  . PHE B 1 157 ? -14.904 62.205 64.112 1.00 18.35 ? 187  PHE B CE1  1 
ATOM   3878 C  CE2  . PHE B 1 157 ? -13.781 63.236 62.239 1.00 13.36 ? 187  PHE B CE2  1 
ATOM   3879 C  CZ   . PHE B 1 157 ? -14.955 62.822 62.857 1.00 16.52 ? 187  PHE B CZ   1 
ATOM   3880 N  N    . SER B 1 158 ? -8.901  63.038 66.711 1.00 13.16 ? 188  SER B N    1 
ATOM   3881 C  CA   . SER B 1 158 ? -7.529  62.882 67.184 1.00 15.23 ? 188  SER B CA   1 
ATOM   3882 C  C    . SER B 1 158 ? -7.488  62.814 68.714 1.00 17.82 ? 188  SER B C    1 
ATOM   3883 O  O    . SER B 1 158 ? -6.823  61.938 69.279 1.00 18.30 ? 188  SER B O    1 
ATOM   3884 C  CB   . SER B 1 158 ? -6.646  64.027 66.679 1.00 18.42 ? 188  SER B CB   1 
ATOM   3885 O  OG   . SER B 1 158 ? -6.535  63.997 65.264 1.00 25.78 ? 188  SER B OG   1 
ATOM   3886 N  N    . ALA B 1 159 ? -8.237  63.699 69.373 1.00 15.41 ? 189  ALA B N    1 
ATOM   3887 C  CA   . ALA B 1 159 ? -8.287  63.734 70.828 1.00 16.78 ? 189  ALA B CA   1 
ATOM   3888 C  C    . ALA B 1 159 ? -8.754  62.407 71.399 1.00 15.65 ? 189  ALA B C    1 
ATOM   3889 O  O    . ALA B 1 159 ? -8.263  61.984 72.439 1.00 17.01 ? 189  ALA B O    1 
ATOM   3890 C  CB   . ALA B 1 159 ? -9.178  64.863 71.315 1.00 15.45 ? 189  ALA B CB   1 
ATOM   3891 N  N    . SER B 1 160 ? -9.694  61.750 70.721 1.00 18.98 ? 190  SER B N    1 
ATOM   3892 C  CA   . SER B 1 160 ? -10.207 60.449 71.165 1.00 18.66 ? 190  SER B CA   1 
ATOM   3893 C  C    . SER B 1 160 ? -9.211  59.327 70.846 1.00 21.07 ? 190  SER B C    1 
ATOM   3894 O  O    . SER B 1 160 ? -9.298  58.218 71.384 1.00 21.18 ? 190  SER B O    1 
ATOM   3895 C  CB   . SER B 1 160 ? -11.558 60.147 70.505 1.00 17.65 ? 190  SER B CB   1 
ATOM   3896 O  OG   . SER B 1 160 ? -11.412 59.838 69.136 1.00 19.17 ? 190  SER B OG   1 
ATOM   3897 N  N    . GLU B 1 161 ? -8.260  59.636 69.973 1.00 20.55 ? 191  GLU B N    1 
ATOM   3898 C  CA   . GLU B 1 161 ? -7.238  58.693 69.551 1.00 20.66 ? 191  GLU B CA   1 
ATOM   3899 C  C    . GLU B 1 161 ? -7.749  57.577 68.658 1.00 17.52 ? 191  GLU B C    1 
ATOM   3900 O  O    . GLU B 1 161 ? -7.028  56.612 68.391 1.00 17.04 ? 191  GLU B O    1 
ATOM   3901 C  CB   . GLU B 1 161 ? -6.463  58.130 70.745 1.00 22.53 ? 191  GLU B CB   1 
ATOM   3902 C  CG   . GLU B 1 161 ? -5.647  59.182 71.471 1.00 24.87 ? 191  GLU B CG   1 
ATOM   3903 C  CD   . GLU B 1 161 ? -4.734  58.588 72.514 1.00 31.28 ? 191  GLU B CD   1 
ATOM   3904 O  OE1  . GLU B 1 161 ? -5.195  58.352 73.652 1.00 33.53 ? 191  GLU B OE1  1 
ATOM   3905 O  OE2  . GLU B 1 161 ? -3.548  58.359 72.191 1.00 38.24 ? 191  GLU B OE2  1 
ATOM   3906 N  N    . PHE B 1 162 ? -8.993  57.700 68.198 1.00 19.57 ? 192  PHE B N    1 
ATOM   3907 C  CA   . PHE B 1 162 ? -9.552  56.714 67.276 1.00 19.34 ? 192  PHE B CA   1 
ATOM   3908 C  C    . PHE B 1 162 ? -8.900  56.973 65.921 1.00 20.67 ? 192  PHE B C    1 
ATOM   3909 O  O    . PHE B 1 162 ? -8.851  56.085 65.070 1.00 21.73 ? 192  PHE B O    1 
ATOM   3910 C  CB   . PHE B 1 162 ? -11.070 56.856 67.146 1.00 21.83 ? 192  PHE B CB   1 
ATOM   3911 C  CG   . PHE B 1 162 ? -11.846 56.087 68.180 1.00 21.00 ? 192  PHE B CG   1 
ATOM   3912 C  CD1  . PHE B 1 162 ? -11.594 54.746 68.398 1.00 20.78 ? 192  PHE B CD1  1 
ATOM   3913 C  CD2  . PHE B 1 162 ? -12.841 56.705 68.920 1.00 26.65 ? 192  PHE B CD2  1 
ATOM   3914 C  CE1  . PHE B 1 162 ? -12.324 54.027 69.332 1.00 21.75 ? 192  PHE B CE1  1 
ATOM   3915 C  CE2  . PHE B 1 162 ? -13.579 55.997 69.859 1.00 23.88 ? 192  PHE B CE2  1 
ATOM   3916 C  CZ   . PHE B 1 162 ? -13.318 54.655 70.063 1.00 22.27 ? 192  PHE B CZ   1 
ATOM   3917 N  N    . GLU B 1 163 ? -8.417  58.202 65.730 1.00 19.03 ? 193  GLU B N    1 
ATOM   3918 C  CA   . GLU B 1 163 ? -7.750  58.600 64.498 1.00 19.33 ? 193  GLU B CA   1 
ATOM   3919 C  C    . GLU B 1 163 ? -6.379  59.171 64.797 1.00 20.02 ? 193  GLU B C    1 
ATOM   3920 O  O    . GLU B 1 163 ? -6.091  59.544 65.931 1.00 21.26 ? 193  GLU B O    1 
ATOM   3921 C  CB   . GLU B 1 163 ? -8.582  59.627 63.730 1.00 17.89 ? 193  GLU B CB   1 
ATOM   3922 C  CG   . GLU B 1 163 ? -9.912  59.094 63.224 1.00 15.59 ? 193  GLU B CG   1 
ATOM   3923 C  CD   . GLU B 1 163 ? -9.768  57.911 62.272 1.00 16.86 ? 193  GLU B CD   1 
ATOM   3924 O  OE1  . GLU B 1 163 ? -8.657  57.658 61.763 1.00 16.34 ? 193  GLU B OE1  1 
ATOM   3925 O  OE2  . GLU B 1 163 ? -10.779 57.232 62.028 1.00 18.99 ? 193  GLU B OE2  1 
ATOM   3926 N  N    . ASP B 1 164 ? -5.545  59.232 63.766 1.00 21.52 ? 194  ASP B N    1 
ATOM   3927 C  CA   . ASP B 1 164 ? -4.176  59.730 63.855 1.00 22.93 ? 194  ASP B CA   1 
ATOM   3928 C  C    . ASP B 1 164 ? -4.135  61.217 64.186 1.00 19.42 ? 194  ASP B C    1 
ATOM   3929 O  O    . ASP B 1 164 ? -5.004  61.968 63.747 1.00 25.71 ? 194  ASP B O    1 
ATOM   3930 C  CB   . ASP B 1 164 ? -3.485  59.497 62.509 1.00 28.65 ? 194  ASP B CB   1 
ATOM   3931 C  CG   . ASP B 1 164 ? -1.975  59.612 62.590 1.00 41.65 ? 194  ASP B CG   1 
ATOM   3932 O  OD1  . ASP B 1 164 ? -1.449  60.749 62.589 1.00 47.40 ? 194  ASP B OD1  1 
ATOM   3933 O  OD2  . ASP B 1 164 ? -1.311  58.555 62.639 1.00 47.46 ? 194  ASP B OD2  1 
ATOM   3934 N  N    . PRO B 1 165 ? -3.133  61.665 64.969 1.00 15.75 ? 195  PRO B N    1 
ATOM   3935 C  CA   . PRO B 1 165 ? -3.058  63.091 65.295 1.00 15.69 ? 195  PRO B CA   1 
ATOM   3936 C  C    . PRO B 1 165 ? -2.978  63.995 64.050 1.00 18.33 ? 195  PRO B C    1 
ATOM   3937 O  O    . PRO B 1 165 ? -3.418  65.143 64.092 1.00 20.12 ? 195  PRO B O    1 
ATOM   3938 C  CB   . PRO B 1 165 ? -1.804  63.189 66.175 1.00 11.01 ? 195  PRO B CB   1 
ATOM   3939 C  CG   . PRO B 1 165 ? -1.076  61.894 65.940 1.00 12.63 ? 195  PRO B CG   1 
ATOM   3940 C  CD   . PRO B 1 165 ? -2.166  60.904 65.775 1.00 11.23 ? 195  PRO B CD   1 
ATOM   3941 N  N    . LEU B 1 166 ? -2.465  63.469 62.936 1.00 18.48 ? 196  LEU B N    1 
ATOM   3942 C  CA   . LEU B 1 166 ? -2.369  64.245 61.695 1.00 19.59 ? 196  LEU B CA   1 
ATOM   3943 C  C    . LEU B 1 166 ? -3.742  64.780 61.307 1.00 18.24 ? 196  LEU B C    1 
ATOM   3944 O  O    . LEU B 1 166 ? -3.860  65.918 60.857 1.00 19.80 ? 196  LEU B O    1 
ATOM   3945 C  CB   . LEU B 1 166 ? -1.809  63.397 60.534 1.00 20.79 ? 196  LEU B CB   1 
ATOM   3946 C  CG   . LEU B 1 166 ? -1.821  63.979 59.098 1.00 21.95 ? 196  LEU B CG   1 
ATOM   3947 C  CD1  . LEU B 1 166 ? -0.989  65.257 58.992 1.00 16.89 ? 196  LEU B CD1  1 
ATOM   3948 C  CD2  . LEU B 1 166 ? -1.303  62.955 58.107 1.00 17.69 ? 196  LEU B CD2  1 
ATOM   3949 N  N    . VAL B 1 167 ? -4.776  63.971 61.525 1.00 15.30 ? 197  VAL B N    1 
ATOM   3950 C  CA   . VAL B 1 167 ? -6.142  64.357 61.191 1.00 16.14 ? 197  VAL B CA   1 
ATOM   3951 C  C    . VAL B 1 167 ? -6.530  65.704 61.812 1.00 19.16 ? 197  VAL B C    1 
ATOM   3952 O  O    . VAL B 1 167 ? -7.030  66.602 61.113 1.00 19.51 ? 197  VAL B O    1 
ATOM   3953 C  CB   . VAL B 1 167 ? -7.144  63.257 61.596 1.00 16.86 ? 197  VAL B CB   1 
ATOM   3954 C  CG1  . VAL B 1 167 ? -8.579  63.733 61.392 1.00 11.83 ? 197  VAL B CG1  1 
ATOM   3955 C  CG2  . VAL B 1 167 ? -6.890  61.997 60.771 1.00 11.79 ? 197  VAL B CG2  1 
ATOM   3956 N  N    . GLY B 1 168 ? -6.274  65.853 63.111 1.00 19.20 ? 198  GLY B N    1 
ATOM   3957 C  CA   . GLY B 1 168 ? -6.588  67.098 63.797 1.00 17.08 ? 198  GLY B CA   1 
ATOM   3958 C  C    . GLY B 1 168 ? -5.631  68.218 63.420 1.00 17.72 ? 198  GLY B C    1 
ATOM   3959 O  O    . GLY B 1 168 ? -5.980  69.399 63.461 1.00 14.58 ? 198  GLY B O    1 
ATOM   3960 N  N    . GLU B 1 169 ? -4.419  67.837 63.028 1.00 17.45 ? 199  GLU B N    1 
ATOM   3961 C  CA   . GLU B 1 169 ? -3.386  68.787 62.651 1.00 18.46 ? 199  GLU B CA   1 
ATOM   3962 C  C    . GLU B 1 169 ? -3.615  69.488 61.326 1.00 21.56 ? 199  GLU B C    1 
ATOM   3963 O  O    . GLU B 1 169 ? -3.445  70.712 61.219 1.00 19.22 ? 199  GLU B O    1 
ATOM   3964 C  CB   . GLU B 1 169 ? -2.031  68.085 62.599 1.00 16.40 ? 199  GLU B CB   1 
ATOM   3965 C  CG   . GLU B 1 169 ? -1.534  67.600 63.950 1.00 24.77 ? 199  GLU B CG   1 
ATOM   3966 C  CD   . GLU B 1 169 ? -0.206  66.875 63.861 1.00 28.15 ? 199  GLU B CD   1 
ATOM   3967 O  OE1  . GLU B 1 169 ? 0.319   66.707 62.737 1.00 33.97 ? 199  GLU B OE1  1 
ATOM   3968 O  OE2  . GLU B 1 169 ? 0.315   66.467 64.919 1.00 36.11 ? 199  GLU B OE2  1 
ATOM   3969 N  N    . ASP B 1 170 ? -3.956  68.704 60.307 1.00 21.44 ? 200  ASP B N    1 
ATOM   3970 C  CA   . ASP B 1 170 ? -4.159  69.240 58.970 1.00 20.12 ? 200  ASP B CA   1 
ATOM   3971 C  C    . ASP B 1 170 ? -5.477  69.999 58.841 1.00 20.03 ? 200  ASP B C    1 
ATOM   3972 O  O    . ASP B 1 170 ? -6.452  69.509 58.266 1.00 20.49 ? 200  ASP B O    1 
ATOM   3973 C  CB   . ASP B 1 170 ? -4.061  68.112 57.941 1.00 22.34 ? 200  ASP B CB   1 
ATOM   3974 C  CG   . ASP B 1 170 ? -3.869  68.624 56.520 1.00 24.50 ? 200  ASP B CG   1 
ATOM   3975 O  OD1  . ASP B 1 170 ? -4.118  69.825 56.263 1.00 23.18 ? 200  ASP B OD1  1 
ATOM   3976 O  OD2  . ASP B 1 170 ? -3.467  67.817 55.657 1.00 19.16 ? 200  ASP B OD2  1 
ATOM   3977 N  N    . THR B 1 171 ? -5.477  71.229 59.330 1.00 16.84 ? 201  THR B N    1 
ATOM   3978 C  CA   . THR B 1 171 ? -6.654  72.070 59.288 1.00 15.37 ? 201  THR B CA   1 
ATOM   3979 C  C    . THR B 1 171 ? -7.129  72.364 57.858 1.00 16.46 ? 201  THR B C    1 
ATOM   3980 O  O    . THR B 1 171 ? -8.332  72.453 57.608 1.00 16.11 ? 201  THR B O    1 
ATOM   3981 C  CB   . THR B 1 171 ? -6.402  73.381 60.059 1.00 16.63 ? 201  THR B CB   1 
ATOM   3982 O  OG1  . THR B 1 171 ? -5.268  74.054 59.503 1.00 17.93 ? 201  THR B OG1  1 
ATOM   3983 C  CG2  . THR B 1 171 ? -6.100  73.070 61.513 1.00 14.62 ? 201  THR B CG2  1 
ATOM   3984 N  N    . GLU B 1 172 ? -6.193  72.446 56.914 1.00 17.96 ? 202  GLU B N    1 
ATOM   3985 C  CA   . GLU B 1 172 ? -6.527  72.740 55.518 1.00 19.21 ? 202  GLU B CA   1 
ATOM   3986 C  C    . GLU B 1 172 ? -7.440  71.661 54.930 1.00 15.46 ? 202  GLU B C    1 
ATOM   3987 O  O    . GLU B 1 172 ? -8.488  71.956 54.346 1.00 13.92 ? 202  GLU B O    1 
ATOM   3988 C  CB   . GLU B 1 172 ? -5.255  72.883 54.680 1.00 21.77 ? 202  GLU B CB   1 
ATOM   3989 C  CG   . GLU B 1 172 ? -5.497  73.493 53.305 1.00 28.81 ? 202  GLU B CG   1 
ATOM   3990 C  CD   . GLU B 1 172 ? -5.982  74.932 53.386 1.00 32.01 ? 202  GLU B CD   1 
ATOM   3991 O  OE1  . GLU B 1 172 ? -5.208  75.798 53.839 1.00 40.85 ? 202  GLU B OE1  1 
ATOM   3992 O  OE2  . GLU B 1 172 ? -7.137  75.205 53.005 1.00 32.73 ? 202  GLU B OE2  1 
ATOM   3993 N  N    . ARG B 1 173 ? -7.048  70.412 55.126 1.00 15.53 ? 203  ARG B N    1 
ATOM   3994 C  CA   . ARG B 1 173 ? -7.814  69.265 54.659 1.00 16.95 ? 203  ARG B CA   1 
ATOM   3995 C  C    . ARG B 1 173 ? -9.223  69.266 55.299 1.00 17.25 ? 203  ARG B C    1 
ATOM   3996 O  O    . ARG B 1 173 ? -10.242 69.191 54.601 1.00 15.65 ? 203  ARG B O    1 
ATOM   3997 C  CB   . ARG B 1 173 ? -7.049  67.992 55.030 1.00 17.03 ? 203  ARG B CB   1 
ATOM   3998 C  CG   . ARG B 1 173 ? -6.791  67.007 53.895 1.00 26.29 ? 203  ARG B CG   1 
ATOM   3999 C  CD   . ARG B 1 173 ? -6.207  67.656 52.640 1.00 30.51 ? 203  ARG B CD   1 
ATOM   4000 N  NE   . ARG B 1 173 ? -5.101  68.571 52.901 1.00 33.24 ? 203  ARG B NE   1 
ATOM   4001 C  CZ   . ARG B 1 173 ? -3.855  68.412 52.457 1.00 33.49 ? 203  ARG B CZ   1 
ATOM   4002 N  NH1  . ARG B 1 173 ? -3.516  67.370 51.719 1.00 32.79 ? 203  ARG B NH1  1 
ATOM   4003 N  NH2  . ARG B 1 173 ? -2.939  69.320 52.756 1.00 42.50 ? 203  ARG B NH2  1 
ATOM   4004 N  N    . ALA B 1 174 ? -9.277  69.410 56.623 1.00 17.00 ? 204  ALA B N    1 
ATOM   4005 C  CA   . ALA B 1 174 ? -10.551 69.420 57.351 1.00 14.83 ? 204  ALA B CA   1 
ATOM   4006 C  C    . ALA B 1 174 ? -11.429 70.585 56.924 1.00 13.42 ? 204  ALA B C    1 
ATOM   4007 O  O    . ALA B 1 174 ? -12.662 70.469 56.888 1.00 10.18 ? 204  ALA B O    1 
ATOM   4008 C  CB   . ALA B 1 174 ? -10.301 69.481 58.861 1.00 10.57 ? 204  ALA B CB   1 
ATOM   4009 N  N    . ASN B 1 175 ? -10.790 71.709 56.601 1.00 13.92 ? 205  ASN B N    1 
ATOM   4010 C  CA   . ASN B 1 175 ? -11.503 72.911 56.177 1.00 15.31 ? 205  ASN B CA   1 
ATOM   4011 C  C    . ASN B 1 175 ? -12.185 72.695 54.827 1.00 16.87 ? 205  ASN B C    1 
ATOM   4012 O  O    . ASN B 1 175 ? -13.334 73.086 54.635 1.00 20.18 ? 205  ASN B O    1 
ATOM   4013 C  CB   . ASN B 1 175 ? -10.547 74.100 56.105 1.00 15.80 ? 205  ASN B CB   1 
ATOM   4014 C  CG   . ASN B 1 175 ? -11.257 75.399 55.775 1.00 19.88 ? 205  ASN B CG   1 
ATOM   4015 O  OD1  . ASN B 1 175 ? -12.137 75.851 56.522 1.00 19.80 ? 205  ASN B OD1  1 
ATOM   4016 N  ND2  . ASN B 1 175 ? -10.883 76.009 54.657 1.00 15.07 ? 205  ASN B ND2  1 
ATOM   4017 N  N    . SER B 1 176 ? -11.486 72.040 53.904 1.00 18.87 ? 206  SER B N    1 
ATOM   4018 C  CA   . SER B 1 176 ? -12.035 71.750 52.584 1.00 16.26 ? 206  SER B CA   1 
ATOM   4019 C  C    . SER B 1 176 ? -13.206 70.776 52.671 1.00 15.18 ? 206  SER B C    1 
ATOM   4020 O  O    . SER B 1 176 ? -14.136 70.850 51.868 1.00 17.36 ? 206  SER B O    1 
ATOM   4021 C  CB   . SER B 1 176 ? -10.948 71.195 51.669 1.00 17.05 ? 206  SER B CB   1 
ATOM   4022 O  OG   . SER B 1 176 ? -9.942  72.168 51.448 1.00 18.00 ? 206  SER B OG   1 
ATOM   4023 N  N    . MET B 1 177 ? -13.151 69.848 53.623 1.00 14.07 ? 207  MET B N    1 
ATOM   4024 C  CA   . MET B 1 177 ? -14.246 68.895 53.824 1.00 12.85 ? 207  MET B CA   1 
ATOM   4025 C  C    . MET B 1 177 ? -15.506 69.697 54.141 1.00 13.20 ? 207  MET B C    1 
ATOM   4026 O  O    . MET B 1 177 ? -16.588 69.406 53.631 1.00 13.85 ? 207  MET B O    1 
ATOM   4027 C  CB   . MET B 1 177 ? -13.945 67.955 54.998 1.00 14.39 ? 207  MET B CB   1 
ATOM   4028 C  CG   . MET B 1 177 ? -12.909 66.876 54.723 1.00 10.37 ? 207  MET B CG   1 
ATOM   4029 S  SD   . MET B 1 177 ? -13.589 65.442 53.857 1.00 13.68 ? 207  MET B SD   1 
ATOM   4030 C  CE   . MET B 1 177 ? -14.748 64.777 55.090 1.00 16.28 ? 207  MET B CE   1 
ATOM   4031 N  N    . GLY B 1 178 ? -15.344 70.720 54.975 1.00 15.27 ? 208  GLY B N    1 
ATOM   4032 C  CA   . GLY B 1 178 ? -16.458 71.564 55.358 1.00 13.83 ? 208  GLY B CA   1 
ATOM   4033 C  C    . GLY B 1 178 ? -16.911 72.474 54.234 1.00 17.23 ? 208  GLY B C    1 
ATOM   4034 O  O    . GLY B 1 178 ? -18.112 72.600 53.991 1.00 17.37 ? 208  GLY B O    1 
ATOM   4035 N  N    . LEU B 1 179 ? -15.960 73.113 53.551 1.00 17.43 ? 209  LEU B N    1 
ATOM   4036 C  CA   . LEU B 1 179 ? -16.279 74.009 52.442 1.00 20.88 ? 209  LEU B CA   1 
ATOM   4037 C  C    . LEU B 1 179 ? -17.046 73.281 51.349 1.00 19.37 ? 209  LEU B C    1 
ATOM   4038 O  O    . LEU B 1 179 ? -18.022 73.809 50.805 1.00 18.56 ? 209  LEU B O    1 
ATOM   4039 C  CB   . LEU B 1 179 ? -15.014 74.628 51.831 1.00 19.34 ? 209  LEU B CB   1 
ATOM   4040 C  CG   . LEU B 1 179 ? -14.144 75.605 52.636 1.00 24.16 ? 209  LEU B CG   1 
ATOM   4041 C  CD1  . LEU B 1 179 ? -13.699 76.739 51.724 1.00 22.72 ? 209  LEU B CD1  1 
ATOM   4042 C  CD2  . LEU B 1 179 ? -14.880 76.158 53.834 1.00 20.10 ? 209  LEU B CD2  1 
ATOM   4043 N  N    . PHE B 1 180 ? -16.630 72.054 51.059 1.00 16.93 ? 210  PHE B N    1 
ATOM   4044 C  CA   . PHE B 1 180 ? -17.281 71.279 50.024 1.00 16.71 ? 210  PHE B CA   1 
ATOM   4045 C  C    . PHE B 1 180 ? -18.753 71.041 50.332 1.00 19.95 ? 210  PHE B C    1 
ATOM   4046 O  O    . PHE B 1 180 ? -19.603 71.238 49.468 1.00 20.78 ? 210  PHE B O    1 
ATOM   4047 C  CB   . PHE B 1 180 ? -16.557 69.956 49.787 1.00 17.26 ? 210  PHE B CB   1 
ATOM   4048 C  CG   . PHE B 1 180 ? -17.068 69.199 48.591 1.00 23.92 ? 210  PHE B CG   1 
ATOM   4049 C  CD1  . PHE B 1 180 ? -16.828 69.669 47.302 1.00 24.06 ? 210  PHE B CD1  1 
ATOM   4050 C  CD2  . PHE B 1 180 ? -17.838 68.047 48.751 1.00 22.40 ? 210  PHE B CD2  1 
ATOM   4051 C  CE1  . PHE B 1 180 ? -17.349 69.003 46.188 1.00 27.21 ? 210  PHE B CE1  1 
ATOM   4052 C  CE2  . PHE B 1 180 ? -18.362 67.377 47.647 1.00 24.91 ? 210  PHE B CE2  1 
ATOM   4053 C  CZ   . PHE B 1 180 ? -18.120 67.857 46.362 1.00 27.72 ? 210  PHE B CZ   1 
ATOM   4054 N  N    . LEU B 1 181 ? -19.063 70.654 51.566 1.00 19.84 ? 211  LEU B N    1 
ATOM   4055 C  CA   . LEU B 1 181 ? -20.452 70.416 51.941 1.00 20.64 ? 211  LEU B CA   1 
ATOM   4056 C  C    . LEU B 1 181 ? -21.261 71.703 51.944 1.00 19.55 ? 211  LEU B C    1 
ATOM   4057 O  O    . LEU B 1 181 ? -22.418 71.715 51.524 1.00 22.28 ? 211  LEU B O    1 
ATOM   4058 C  CB   . LEU B 1 181 ? -20.562 69.766 53.330 1.00 16.94 ? 211  LEU B CB   1 
ATOM   4059 C  CG   . LEU B 1 181 ? -20.015 68.351 53.523 1.00 21.27 ? 211  LEU B CG   1 
ATOM   4060 C  CD1  . LEU B 1 181 ? -20.271 67.910 54.968 1.00 18.34 ? 211  LEU B CD1  1 
ATOM   4061 C  CD2  . LEU B 1 181 ? -20.657 67.376 52.536 1.00 12.06 ? 211  LEU B CD2  1 
ATOM   4062 N  N    . GLN B 1 182 ? -20.671 72.777 52.452 1.00 17.90 ? 212  GLN B N    1 
ATOM   4063 C  CA   . GLN B 1 182 ? -21.367 74.052 52.528 1.00 18.59 ? 212  GLN B CA   1 
ATOM   4064 C  C    . GLN B 1 182 ? -21.655 74.613 51.136 1.00 18.85 ? 212  GLN B C    1 
ATOM   4065 O  O    . GLN B 1 182 ? -22.762 75.088 50.864 1.00 20.08 ? 212  GLN B O    1 
ATOM   4066 C  CB   . GLN B 1 182 ? -20.558 75.048 53.374 1.00 19.26 ? 212  GLN B CB   1 
ATOM   4067 C  CG   . GLN B 1 182 ? -21.203 76.416 53.575 1.00 19.49 ? 212  GLN B CG   1 
ATOM   4068 C  CD   . GLN B 1 182 ? -22.539 76.338 54.276 1.00 24.55 ? 212  GLN B CD   1 
ATOM   4069 O  OE1  . GLN B 1 182 ? -22.822 75.377 54.985 1.00 29.17 ? 212  GLN B OE1  1 
ATOM   4070 N  NE2  . GLN B 1 182 ? -23.382 77.343 54.063 1.00 27.09 ? 212  GLN B NE2  1 
ATOM   4071 N  N    . LYS B 1 183 ? -20.670 74.537 50.251 1.00 18.60 ? 213  LYS B N    1 
ATOM   4072 C  CA   . LYS B 1 183 ? -20.839 75.041 48.892 1.00 19.49 ? 213  LYS B CA   1 
ATOM   4073 C  C    . LYS B 1 183 ? -21.940 74.321 48.136 1.00 19.90 ? 213  LYS B C    1 
ATOM   4074 O  O    . LYS B 1 183 ? -22.819 74.970 47.571 1.00 19.99 ? 213  LYS B O    1 
ATOM   4075 C  CB   . LYS B 1 183 ? -19.520 74.991 48.114 1.00 17.56 ? 213  LYS B CB   1 
ATOM   4076 C  CG   . LYS B 1 183 ? -18.544 76.078 48.544 1.00 21.59 ? 213  LYS B CG   1 
ATOM   4077 C  CD   . LYS B 1 183 ? -17.204 75.976 47.828 1.00 26.20 ? 213  LYS B CD   1 
ATOM   4078 C  CE   . LYS B 1 183 ? -16.365 77.234 48.064 1.00 28.40 ? 213  LYS B CE   1 
ATOM   4079 N  NZ   . LYS B 1 183 ? -14.958 77.147 47.544 1.00 24.40 ? 213  LYS B NZ   1 
ATOM   4080 N  N    . THR B 1 184 ? -21.952 72.991 48.166 1.00 22.07 ? 214  THR B N    1 
ATOM   4081 C  CA   . THR B 1 184 ? -23.004 72.300 47.433 1.00 23.26 ? 214  THR B CA   1 
ATOM   4082 C  C    . THR B 1 184 ? -24.366 72.593 48.029 1.00 25.36 ? 214  THR B C    1 
ATOM   4083 O  O    . THR B 1 184 ? -25.341 72.713 47.294 1.00 29.63 ? 214  THR B O    1 
ATOM   4084 C  CB   . THR B 1 184 ? -22.769 70.772 47.240 1.00 22.59 ? 214  THR B CB   1 
ATOM   4085 O  OG1  . THR B 1 184 ? -23.693 70.013 48.023 1.00 30.17 ? 214  THR B OG1  1 
ATOM   4086 C  CG2  . THR B 1 184 ? -21.364 70.383 47.558 1.00 11.86 ? 214  THR B CG2  1 
ATOM   4087 N  N    . ASN B 1 185 ? -24.429 72.774 49.347 1.00 25.68 ? 215  ASN B N    1 
ATOM   4088 C  CA   . ASN B 1 185 ? -25.694 73.088 50.006 1.00 24.24 ? 215  ASN B CA   1 
ATOM   4089 C  C    . ASN B 1 185 ? -26.193 74.437 49.503 1.00 25.25 ? 215  ASN B C    1 
ATOM   4090 O  O    . ASN B 1 185 ? -27.344 74.563 49.078 1.00 22.42 ? 215  ASN B O    1 
ATOM   4091 C  CB   . ASN B 1 185 ? -25.536 73.118 51.525 1.00 32.27 ? 215  ASN B CB   1 
ATOM   4092 C  CG   . ASN B 1 185 ? -25.759 71.751 52.165 1.00 36.92 ? 215  ASN B CG   1 
ATOM   4093 O  OD1  . ASN B 1 185 ? -26.862 71.213 52.128 1.00 40.38 ? 215  ASN B OD1  1 
ATOM   4094 N  ND2  . ASN B 1 185 ? -24.716 71.194 52.762 1.00 37.35 ? 215  ASN B ND2  1 
ATOM   4095 N  N    . ILE B 1 186 ? -25.306 75.428 49.511 1.00 21.87 ? 216  ILE B N    1 
ATOM   4096 C  CA   . ILE B 1 186 ? -25.620 76.778 49.039 1.00 25.35 ? 216  ILE B CA   1 
ATOM   4097 C  C    . ILE B 1 186 ? -26.091 76.755 47.564 1.00 26.57 ? 216  ILE B C    1 
ATOM   4098 O  O    . ILE B 1 186 ? -27.075 77.413 47.198 1.00 21.82 ? 216  ILE B O    1 
ATOM   4099 C  CB   . ILE B 1 186 ? -24.381 77.696 49.188 1.00 24.23 ? 216  ILE B CB   1 
ATOM   4100 C  CG1  . ILE B 1 186 ? -24.128 77.999 50.668 1.00 30.78 ? 216  ILE B CG1  1 
ATOM   4101 C  CG2  . ILE B 1 186 ? -24.540 78.968 48.379 1.00 23.78 ? 216  ILE B CG2  1 
ATOM   4102 C  CD1  . ILE B 1 186 ? -22.760 78.645 50.944 1.00 31.62 ? 216  ILE B CD1  1 
ATOM   4103 N  N    . ILE B 1 187 ? -25.384 76.000 46.728 1.00 26.13 ? 217  ILE B N    1 
ATOM   4104 C  CA   . ILE B 1 187 ? -25.732 75.877 45.314 1.00 26.91 ? 217  ILE B CA   1 
ATOM   4105 C  C    . ILE B 1 187 ? -27.119 75.253 45.168 1.00 28.28 ? 217  ILE B C    1 
ATOM   4106 O  O    . ILE B 1 187 ? -27.995 75.785 44.477 1.00 28.85 ? 217  ILE B O    1 
ATOM   4107 C  CB   . ILE B 1 187 ? -24.702 74.991 44.565 1.00 25.41 ? 217  ILE B CB   1 
ATOM   4108 C  CG1  . ILE B 1 187 ? -23.396 75.768 44.354 1.00 20.57 ? 217  ILE B CG1  1 
ATOM   4109 C  CG2  . ILE B 1 187 ? -25.289 74.487 43.249 1.00 23.01 ? 217  ILE B CG2  1 
ATOM   4110 C  CD1  . ILE B 1 187 ? -22.198 74.904 43.991 1.00 15.55 ? 217  ILE B CD1  1 
ATOM   4111 N  N    . ARG B 1 188 ? -27.308 74.131 45.846 1.00 27.99 ? 218  ARG B N    1 
ATOM   4112 C  CA   . ARG B 1 188 ? -28.560 73.391 45.813 1.00 31.18 ? 218  ARG B CA   1 
ATOM   4113 C  C    . ARG B 1 188 ? -29.753 74.188 46.346 1.00 32.03 ? 218  ARG B C    1 
ATOM   4114 O  O    . ARG B 1 188 ? -30.832 74.169 45.752 1.00 33.91 ? 218  ARG B O    1 
ATOM   4115 C  CB   . ARG B 1 188 ? -28.402 72.079 46.608 1.00 30.21 ? 218  ARG B CB   1 
ATOM   4116 C  CG   . ARG B 1 188 ? -29.668 71.249 46.749 1.00 30.47 ? 218  ARG B CG   1 
ATOM   4117 C  CD   . ARG B 1 188 ? -30.143 71.214 48.192 1.00 33.00 ? 218  ARG B CD   1 
ATOM   4118 N  NE   . ARG B 1 188 ? -29.399 70.247 48.991 1.00 34.55 ? 218  ARG B NE   1 
ATOM   4119 C  CZ   . ARG B 1 188 ? -29.117 70.377 50.287 1.00 35.00 ? 218  ARG B CZ   1 
ATOM   4120 N  NH1  . ARG B 1 188 ? -29.502 71.448 50.977 1.00 30.03 ? 218  ARG B NH1  1 
ATOM   4121 N  NH2  . ARG B 1 188 ? -28.466 69.403 50.907 1.00 38.25 ? 218  ARG B NH2  1 
ATOM   4122 N  N    . ASP B 1 189 ? -29.544 74.923 47.431 1.00 29.69 ? 219  ASP B N    1 
ATOM   4123 C  CA   . ASP B 1 189 ? -30.613 75.676 48.067 1.00 29.93 ? 219  ASP B CA   1 
ATOM   4124 C  C    . ASP B 1 189 ? -31.025 77.036 47.505 1.00 30.32 ? 219  ASP B C    1 
ATOM   4125 O  O    . ASP B 1 189 ? -31.894 77.694 48.081 1.00 31.15 ? 219  ASP B O    1 
ATOM   4126 C  CB   . ASP B 1 189 ? -30.316 75.810 49.560 1.00 30.39 ? 219  ASP B CB   1 
ATOM   4127 C  CG   . ASP B 1 189 ? -30.325 74.474 50.274 1.00 32.36 ? 219  ASP B CG   1 
ATOM   4128 O  OD1  . ASP B 1 189 ? -31.103 73.583 49.877 1.00 35.78 ? 219  ASP B OD1  1 
ATOM   4129 O  OD2  . ASP B 1 189 ? -29.558 74.312 51.242 1.00 38.35 ? 219  ASP B OD2  1 
ATOM   4130 N  N    . TYR B 1 190 ? -30.450 77.441 46.380 1.00 31.43 ? 220  TYR B N    1 
ATOM   4131 C  CA   . TYR B 1 190 ? -30.763 78.735 45.776 1.00 35.49 ? 220  TYR B CA   1 
ATOM   4132 C  C    . TYR B 1 190 ? -32.240 79.133 45.804 1.00 37.42 ? 220  TYR B C    1 
ATOM   4133 O  O    . TYR B 1 190 ? -32.587 80.188 46.341 1.00 36.31 ? 220  TYR B O    1 
ATOM   4134 C  CB   . TYR B 1 190 ? -30.242 78.803 44.332 1.00 38.60 ? 220  TYR B CB   1 
ATOM   4135 C  CG   . TYR B 1 190 ? -30.767 79.996 43.556 1.00 39.02 ? 220  TYR B CG   1 
ATOM   4136 C  CD1  . TYR B 1 190 ? -31.996 79.929 42.891 1.00 40.54 ? 220  TYR B CD1  1 
ATOM   4137 C  CD2  . TYR B 1 190 ? -30.073 81.206 43.540 1.00 37.44 ? 220  TYR B CD2  1 
ATOM   4138 C  CE1  . TYR B 1 190 ? -32.526 81.038 42.244 1.00 40.26 ? 220  TYR B CE1  1 
ATOM   4139 C  CE2  . TYR B 1 190 ? -30.596 82.322 42.888 1.00 37.48 ? 220  TYR B CE2  1 
ATOM   4140 C  CZ   . TYR B 1 190 ? -31.825 82.229 42.251 1.00 38.19 ? 220  TYR B CZ   1 
ATOM   4141 O  OH   . TYR B 1 190 ? -32.394 83.332 41.662 1.00 37.76 ? 220  TYR B OH   1 
ATOM   4142 N  N    . LEU B 1 191 ? -33.098 78.304 45.215 1.00 39.26 ? 221  LEU B N    1 
ATOM   4143 C  CA   . LEU B 1 191 ? -34.531 78.590 45.144 1.00 42.32 ? 221  LEU B CA   1 
ATOM   4144 C  C    . LEU B 1 191 ? -35.183 78.698 46.519 1.00 41.68 ? 221  LEU B C    1 
ATOM   4145 O  O    . LEU B 1 191 ? -35.874 79.674 46.806 1.00 43.65 ? 221  LEU B O    1 
ATOM   4146 C  CB   . LEU B 1 191 ? -35.249 77.537 44.288 1.00 45.08 ? 221  LEU B CB   1 
ATOM   4147 C  CG   . LEU B 1 191 ? -36.514 77.966 43.524 1.00 50.53 ? 221  LEU B CG   1 
ATOM   4148 C  CD1  . LEU B 1 191 ? -37.701 78.173 44.465 1.00 53.00 ? 221  LEU B CD1  1 
ATOM   4149 C  CD2  . LEU B 1 191 ? -36.223 79.235 42.723 1.00 51.55 ? 221  LEU B CD2  1 
ATOM   4150 N  N    . GLU B 1 192 ? -34.955 77.708 47.374 1.00 42.97 ? 222  GLU B N    1 
ATOM   4151 C  CA   . GLU B 1 192 ? -35.532 77.717 48.716 1.00 43.23 ? 222  GLU B CA   1 
ATOM   4152 C  C    . GLU B 1 192 ? -35.116 78.990 49.450 1.00 41.45 ? 222  GLU B C    1 
ATOM   4153 O  O    . GLU B 1 192 ? -35.940 79.645 50.097 1.00 39.76 ? 222  GLU B O    1 
ATOM   4154 C  CB   . GLU B 1 192 ? -35.082 76.489 49.509 1.00 44.55 ? 222  GLU B CB   1 
ATOM   4155 C  CG   . GLU B 1 192 ? -35.780 76.344 50.850 1.00 48.75 ? 222  GLU B CG   1 
ATOM   4156 C  CD   . GLU B 1 192 ? -35.318 75.130 51.631 1.00 54.47 ? 222  GLU B CD   1 
ATOM   4157 O  OE1  . GLU B 1 192 ? -34.866 74.150 50.995 1.00 55.63 ? 222  GLU B OE1  1 
ATOM   4158 O  OE2  . GLU B 1 192 ? -35.415 75.152 52.882 1.00 55.01 ? 222  GLU B OE2  1 
ATOM   4159 N  N    . ASP B 1 193 ? -33.845 79.353 49.312 1.00 38.45 ? 223  ASP B N    1 
ATOM   4160 C  CA   . ASP B 1 193 ? -33.330 80.555 49.952 1.00 41.29 ? 223  ASP B CA   1 
ATOM   4161 C  C    . ASP B 1 193 ? -34.073 81.787 49.436 1.00 40.51 ? 223  ASP B C    1 
ATOM   4162 O  O    . ASP B 1 193 ? -34.447 82.664 50.218 1.00 41.24 ? 223  ASP B O    1 
ATOM   4163 C  CB   . ASP B 1 193 ? -31.822 80.690 49.715 1.00 41.73 ? 223  ASP B CB   1 
ATOM   4164 C  CG   . ASP B 1 193 ? -31.015 79.663 50.492 1.00 43.97 ? 223  ASP B CG   1 
ATOM   4165 O  OD1  . ASP B 1 193 ? -31.580 78.635 50.912 1.00 46.29 ? 223  ASP B OD1  1 
ATOM   4166 O  OD2  . ASP B 1 193 ? -29.805 79.882 50.682 1.00 46.84 ? 223  ASP B OD2  1 
ATOM   4167 N  N    . GLN B 1 194 ? -34.323 81.827 48.130 1.00 37.44 ? 224  GLN B N    1 
ATOM   4168 C  CA   . GLN B 1 194 ? -35.036 82.947 47.531 1.00 37.46 ? 224  GLN B CA   1 
ATOM   4169 C  C    . GLN B 1 194 ? -36.369 83.167 48.240 1.00 36.89 ? 224  GLN B C    1 
ATOM   4170 O  O    . GLN B 1 194 ? -36.703 84.294 48.603 1.00 35.83 ? 224  GLN B O    1 
ATOM   4171 C  CB   . GLN B 1 194 ? -35.252 82.726 46.025 1.00 36.40 ? 224  GLN B CB   1 
ATOM   4172 C  CG   . GLN B 1 194 ? -34.007 82.956 45.169 1.00 35.81 ? 224  GLN B CG   1 
ATOM   4173 C  CD   . GLN B 1 194 ? -33.511 84.391 45.230 1.00 40.90 ? 224  GLN B CD   1 
ATOM   4174 O  OE1  . GLN B 1 194 ? -34.221 85.324 44.841 1.00 42.42 ? 224  GLN B OE1  1 
ATOM   4175 N  NE2  . GLN B 1 194 ? -32.286 84.577 45.705 1.00 41.77 ? 224  GLN B NE2  1 
ATOM   4176 N  N    . GLN B 1 195 ? -37.100 82.084 48.488 1.00 35.72 ? 225  GLN B N    1 
ATOM   4177 C  CA   . GLN B 1 195 ? -38.386 82.192 49.167 1.00 38.45 ? 225  GLN B CA   1 
ATOM   4178 C  C    . GLN B 1 195 ? -38.232 82.793 50.563 1.00 41.07 ? 225  GLN B C    1 
ATOM   4179 O  O    . GLN B 1 195 ? -39.071 83.583 51.006 1.00 43.18 ? 225  GLN B O    1 
ATOM   4180 C  CB   . GLN B 1 195 ? -39.069 80.824 49.283 1.00 37.79 ? 225  GLN B CB   1 
ATOM   4181 C  CG   . GLN B 1 195 ? -39.749 80.339 48.014 1.00 41.25 ? 225  GLN B CG   1 
ATOM   4182 C  CD   . GLN B 1 195 ? -40.679 79.157 48.253 1.00 41.11 ? 225  GLN B CD   1 
ATOM   4183 O  OE1  . GLN B 1 195 ? -41.803 79.124 47.751 1.00 43.80 ? 225  GLN B OE1  1 
ATOM   4184 N  NE2  . GLN B 1 195 ? -40.219 78.188 49.032 1.00 41.19 ? 225  GLN B NE2  1 
ATOM   4185 N  N    . GLY B 1 196 ? -37.155 82.419 51.247 1.00 41.73 ? 226  GLY B N    1 
ATOM   4186 C  CA   . GLY B 1 196 ? -36.917 82.907 52.591 1.00 42.17 ? 226  GLY B CA   1 
ATOM   4187 C  C    . GLY B 1 196 ? -36.134 84.202 52.651 1.00 42.86 ? 226  GLY B C    1 
ATOM   4188 O  O    . GLY B 1 196 ? -35.710 84.613 53.732 1.00 45.65 ? 226  GLY B O    1 
ATOM   4189 N  N    . GLY B 1 197 ? -35.921 84.830 51.497 1.00 41.00 ? 227  GLY B N    1 
ATOM   4190 C  CA   . GLY B 1 197 ? -35.189 86.086 51.450 1.00 38.91 ? 227  GLY B CA   1 
ATOM   4191 C  C    . GLY B 1 197 ? -33.712 85.971 51.762 1.00 36.67 ? 227  GLY B C    1 
ATOM   4192 O  O    . GLY B 1 197 ? -33.068 86.968 52.067 1.00 36.48 ? 227  GLY B O    1 
ATOM   4193 N  N    . ARG B 1 198 ? -33.165 84.766 51.633 1.00 38.68 ? 228  ARG B N    1 
ATOM   4194 C  CA   . ARG B 1 198 ? -31.752 84.513 51.921 1.00 40.59 ? 228  ARG B CA   1 
ATOM   4195 C  C    . ARG B 1 198 ? -30.898 84.432 50.646 1.00 38.26 ? 228  ARG B C    1 
ATOM   4196 O  O    . ARG B 1 198 ? -31.329 83.881 49.630 1.00 37.18 ? 228  ARG B O    1 
ATOM   4197 C  CB   . ARG B 1 198 ? -31.618 83.215 52.721 1.00 45.19 ? 228  ARG B CB   1 
ATOM   4198 C  CG   . ARG B 1 198 ? -32.622 83.091 53.858 1.00 49.15 ? 228  ARG B CG   1 
ATOM   4199 C  CD   . ARG B 1 198 ? -32.377 81.860 54.701 1.00 56.95 ? 228  ARG B CD   1 
ATOM   4200 N  NE   . ARG B 1 198 ? -32.610 80.610 53.983 1.00 64.45 ? 228  ARG B NE   1 
ATOM   4201 C  CZ   . ARG B 1 198 ? -31.830 79.534 54.088 1.00 72.26 ? 228  ARG B CZ   1 
ATOM   4202 N  NH1  . ARG B 1 198 ? -30.754 79.553 54.873 1.00 72.34 ? 228  ARG B NH1  1 
ATOM   4203 N  NH2  . ARG B 1 198 ? -32.148 78.418 53.443 1.00 75.75 ? 228  ARG B NH2  1 
ATOM   4204 N  N    . GLU B 1 199 ? -29.678 84.961 50.714 1.00 35.61 ? 229  GLU B N    1 
ATOM   4205 C  CA   . GLU B 1 199 ? -28.767 84.958 49.570 1.00 32.82 ? 229  GLU B CA   1 
ATOM   4206 C  C    . GLU B 1 199 ? -27.349 84.593 49.988 1.00 30.12 ? 229  GLU B C    1 
ATOM   4207 O  O    . GLU B 1 199 ? -26.745 85.263 50.827 1.00 29.83 ? 229  GLU B O    1 
ATOM   4208 C  CB   . GLU B 1 199 ? -28.764 86.324 48.889 1.00 34.55 ? 229  GLU B CB   1 
ATOM   4209 C  CG   . GLU B 1 199 ? -30.131 86.793 48.460 1.00 41.29 ? 229  GLU B CG   1 
ATOM   4210 C  CD   . GLU B 1 199 ? -30.076 87.880 47.414 1.00 48.42 ? 229  GLU B CD   1 
ATOM   4211 O  OE1  . GLU B 1 199 ? -29.249 88.815 47.548 1.00 49.63 ? 229  GLU B OE1  1 
ATOM   4212 O  OE2  . GLU B 1 199 ? -30.865 87.790 46.449 1.00 51.94 ? 229  GLU B OE2  1 
ATOM   4213 N  N    . PHE B 1 200 ? -26.805 83.555 49.366 1.00 30.15 ? 230  PHE B N    1 
ATOM   4214 C  CA   . PHE B 1 200 ? -25.468 83.083 49.696 1.00 28.54 ? 230  PHE B CA   1 
ATOM   4215 C  C    . PHE B 1 200 ? -24.542 83.021 48.493 1.00 28.99 ? 230  PHE B C    1 
ATOM   4216 O  O    . PHE B 1 200 ? -23.319 82.989 48.645 1.00 30.43 ? 230  PHE B O    1 
ATOM   4217 C  CB   . PHE B 1 200 ? -25.562 81.711 50.373 1.00 28.72 ? 230  PHE B CB   1 
ATOM   4218 C  CG   . PHE B 1 200 ? -26.195 81.760 51.735 1.00 28.91 ? 230  PHE B CG   1 
ATOM   4219 C  CD1  . PHE B 1 200 ? -25.471 82.211 52.835 1.00 34.18 ? 230  PHE B CD1  1 
ATOM   4220 C  CD2  . PHE B 1 200 ? -27.531 81.425 51.908 1.00 29.33 ? 230  PHE B CD2  1 
ATOM   4221 C  CE1  . PHE B 1 200 ? -26.071 82.336 54.082 1.00 33.79 ? 230  PHE B CE1  1 
ATOM   4222 C  CE2  . PHE B 1 200 ? -28.144 81.545 53.150 1.00 31.43 ? 230  PHE B CE2  1 
ATOM   4223 C  CZ   . PHE B 1 200 ? -27.415 82.003 54.239 1.00 33.18 ? 230  PHE B CZ   1 
ATOM   4224 N  N    . TRP B 1 201 ? -25.119 82.983 47.296 1.00 29.13 ? 231  TRP B N    1 
ATOM   4225 C  CA   . TRP B 1 201 ? -24.315 82.932 46.077 1.00 27.79 ? 231  TRP B CA   1 
ATOM   4226 C  C    . TRP B 1 201 ? -23.441 84.187 45.993 1.00 25.61 ? 231  TRP B C    1 
ATOM   4227 O  O    . TRP B 1 201 ? -23.929 85.308 46.140 1.00 24.91 ? 231  TRP B O    1 
ATOM   4228 C  CB   . TRP B 1 201 ? -25.217 82.790 44.844 1.00 25.81 ? 231  TRP B CB   1 
ATOM   4229 C  CG   . TRP B 1 201 ? -25.820 81.410 44.684 1.00 26.39 ? 231  TRP B CG   1 
ATOM   4230 C  CD1  . TRP B 1 201 ? -26.107 80.520 45.679 1.00 26.45 ? 231  TRP B CD1  1 
ATOM   4231 C  CD2  . TRP B 1 201 ? -26.167 80.755 43.453 1.00 27.34 ? 231  TRP B CD2  1 
ATOM   4232 N  NE1  . TRP B 1 201 ? -26.603 79.354 45.146 1.00 27.15 ? 231  TRP B NE1  1 
ATOM   4233 C  CE2  . TRP B 1 201 ? -26.651 79.470 43.783 1.00 26.87 ? 231  TRP B CE2  1 
ATOM   4234 C  CE3  . TRP B 1 201 ? -26.110 81.131 42.103 1.00 23.36 ? 231  TRP B CE3  1 
ATOM   4235 C  CZ2  . TRP B 1 201 ? -27.079 78.554 42.812 1.00 26.26 ? 231  TRP B CZ2  1 
ATOM   4236 C  CZ3  . TRP B 1 201 ? -26.533 80.221 41.139 1.00 26.98 ? 231  TRP B CZ3  1 
ATOM   4237 C  CH2  . TRP B 1 201 ? -27.012 78.946 41.500 1.00 27.03 ? 231  TRP B CH2  1 
ATOM   4238 N  N    . PRO B 1 202 ? -22.134 84.011 45.755 1.00 23.88 ? 232  PRO B N    1 
ATOM   4239 C  CA   . PRO B 1 202 ? -21.187 85.127 45.659 1.00 25.55 ? 232  PRO B CA   1 
ATOM   4240 C  C    . PRO B 1 202 ? -21.478 86.185 44.574 1.00 28.50 ? 232  PRO B C    1 
ATOM   4241 O  O    . PRO B 1 202 ? -21.600 85.876 43.386 1.00 27.11 ? 232  PRO B O    1 
ATOM   4242 C  CB   . PRO B 1 202 ? -19.847 84.420 45.453 1.00 21.31 ? 232  PRO B CB   1 
ATOM   4243 C  CG   . PRO B 1 202 ? -20.233 83.156 44.744 1.00 23.16 ? 232  PRO B CG   1 
ATOM   4244 C  CD   . PRO B 1 202 ? -21.477 82.725 45.454 1.00 22.31 ? 232  PRO B CD   1 
ATOM   4245 N  N    . GLN B 1 203 ? -21.574 87.437 45.012 1.00 32.23 ? 233  GLN B N    1 
ATOM   4246 C  CA   . GLN B 1 203 ? -21.844 88.582 44.148 1.00 35.71 ? 233  GLN B CA   1 
ATOM   4247 C  C    . GLN B 1 203 ? -20.945 88.681 42.929 1.00 38.17 ? 233  GLN B C    1 
ATOM   4248 O  O    . GLN B 1 203 ? -21.432 88.763 41.798 1.00 37.67 ? 233  GLN B O    1 
ATOM   4249 C  CB   . GLN B 1 203 ? -21.708 89.879 44.942 1.00 40.70 ? 233  GLN B CB   1 
ATOM   4250 C  CG   . GLN B 1 203 ? -23.000 90.426 45.500 1.00 49.73 ? 233  GLN B CG   1 
ATOM   4251 C  CD   . GLN B 1 203 ? -23.371 91.755 44.872 1.00 54.16 ? 233  GLN B CD   1 
ATOM   4252 O  OE1  . GLN B 1 203 ? -23.110 91.991 43.694 1.00 60.72 ? 233  GLN B OE1  1 
ATOM   4253 N  NE2  . GLN B 1 203 ? -23.955 92.640 45.662 1.00 55.43 ? 233  GLN B NE2  1 
ATOM   4254 N  N    . GLU B 1 204 ? -19.633 88.650 43.152 1.00 37.34 ? 234  GLU B N    1 
ATOM   4255 C  CA   . GLU B 1 204 ? -18.670 88.773 42.061 1.00 36.46 ? 234  GLU B CA   1 
ATOM   4256 C  C    . GLU B 1 204 ? -18.804 87.721 40.966 1.00 37.15 ? 234  GLU B C    1 
ATOM   4257 O  O    . GLU B 1 204 ? -18.089 87.765 39.964 1.00 37.34 ? 234  GLU B O    1 
ATOM   4258 C  CB   . GLU B 1 204 ? -17.239 88.844 42.601 1.00 36.70 ? 234  GLU B CB   1 
ATOM   4259 C  CG   . GLU B 1 204 ? -16.967 90.123 43.398 1.00 36.03 ? 234  GLU B CG   1 
ATOM   4260 C  CD   . GLU B 1 204 ? -15.523 90.269 43.855 1.00 40.73 ? 234  GLU B CD   1 
ATOM   4261 O  OE1  . GLU B 1 204 ? -14.679 89.391 43.551 1.00 43.06 ? 234  GLU B OE1  1 
ATOM   4262 O  OE2  . GLU B 1 204 ? -15.226 91.277 44.532 1.00 44.09 ? 234  GLU B OE2  1 
ATOM   4263 N  N    . VAL B 1 205 ? -19.708 86.769 41.170 1.00 36.53 ? 235  VAL B N    1 
ATOM   4264 C  CA   . VAL B 1 205 ? -19.956 85.739 40.180 1.00 35.11 ? 235  VAL B CA   1 
ATOM   4265 C  C    . VAL B 1 205 ? -21.306 86.020 39.518 1.00 36.28 ? 235  VAL B C    1 
ATOM   4266 O  O    . VAL B 1 205 ? -21.351 86.442 38.364 1.00 36.03 ? 235  VAL B O    1 
ATOM   4267 C  CB   . VAL B 1 205 ? -19.947 84.318 40.797 1.00 35.17 ? 235  VAL B CB   1 
ATOM   4268 C  CG1  . VAL B 1 205 ? -20.322 83.277 39.739 1.00 31.37 ? 235  VAL B CG1  1 
ATOM   4269 C  CG2  . VAL B 1 205 ? -18.572 84.006 41.394 1.00 29.78 ? 235  VAL B CG2  1 
ATOM   4270 N  N    . TRP B 1 206 ? -22.400 85.884 40.264 1.00 35.92 ? 236  TRP B N    1 
ATOM   4271 C  CA   . TRP B 1 206 ? -23.716 86.107 39.670 1.00 40.05 ? 236  TRP B CA   1 
ATOM   4272 C  C    . TRP B 1 206 ? -23.935 87.477 39.027 1.00 41.29 ? 236  TRP B C    1 
ATOM   4273 O  O    . TRP B 1 206 ? -24.706 87.588 38.068 1.00 39.63 ? 236  TRP B O    1 
ATOM   4274 C  CB   . TRP B 1 206 ? -24.859 85.764 40.640 1.00 38.70 ? 236  TRP B CB   1 
ATOM   4275 C  CG   . TRP B 1 206 ? -24.986 86.626 41.854 1.00 41.31 ? 236  TRP B CG   1 
ATOM   4276 C  CD1  . TRP B 1 206 ? -24.648 86.289 43.131 1.00 43.60 ? 236  TRP B CD1  1 
ATOM   4277 C  CD2  . TRP B 1 206 ? -25.526 87.955 41.919 1.00 41.77 ? 236  TRP B CD2  1 
ATOM   4278 N  NE1  . TRP B 1 206 ? -24.941 87.322 43.990 1.00 42.47 ? 236  TRP B NE1  1 
ATOM   4279 C  CE2  . TRP B 1 206 ? -25.479 88.358 43.275 1.00 42.87 ? 236  TRP B CE2  1 
ATOM   4280 C  CE3  . TRP B 1 206 ? -26.042 88.844 40.969 1.00 40.52 ? 236  TRP B CE3  1 
ATOM   4281 C  CZ2  . TRP B 1 206 ? -25.929 89.616 43.701 1.00 39.95 ? 236  TRP B CZ2  1 
ATOM   4282 C  CZ3  . TRP B 1 206 ? -26.488 90.095 41.394 1.00 40.65 ? 236  TRP B CZ3  1 
ATOM   4283 C  CH2  . TRP B 1 206 ? -26.428 90.467 42.749 1.00 37.20 ? 236  TRP B CH2  1 
ATOM   4284 N  N    . SER B 1 207 ? -23.233 88.498 39.522 1.00 42.28 ? 237  SER B N    1 
ATOM   4285 C  CA   . SER B 1 207 ? -23.364 89.857 38.994 1.00 41.74 ? 237  SER B CA   1 
ATOM   4286 C  C    . SER B 1 207 ? -22.972 89.898 37.527 1.00 43.30 ? 237  SER B C    1 
ATOM   4287 O  O    . SER B 1 207 ? -23.476 90.722 36.766 1.00 46.58 ? 237  SER B O    1 
ATOM   4288 C  CB   . SER B 1 207 ? -22.484 90.831 39.776 1.00 41.69 ? 237  SER B CB   1 
ATOM   4289 O  OG   . SER B 1 207 ? -21.108 90.549 39.574 1.00 44.30 ? 237  SER B OG   1 
ATOM   4290 N  N    . ARG B 1 208 ? -22.074 88.999 37.134 1.00 42.17 ? 238  ARG B N    1 
ATOM   4291 C  CA   . ARG B 1 208 ? -21.621 88.927 35.755 1.00 39.83 ? 238  ARG B CA   1 
ATOM   4292 C  C    . ARG B 1 208 ? -22.588 88.124 34.899 1.00 41.08 ? 238  ARG B C    1 
ATOM   4293 O  O    . ARG B 1 208 ? -22.245 87.710 33.792 1.00 43.98 ? 238  ARG B O    1 
ATOM   4294 C  CB   . ARG B 1 208 ? -20.246 88.279 35.683 1.00 37.82 ? 238  ARG B CB   1 
ATOM   4295 C  CG   . ARG B 1 208 ? -19.166 88.963 36.493 1.00 37.76 ? 238  ARG B CG   1 
ATOM   4296 C  CD   . ARG B 1 208 ? -17.845 88.232 36.308 1.00 38.49 ? 238  ARG B CD   1 
ATOM   4297 N  NE   . ARG B 1 208 ? -18.084 86.804 36.124 1.00 44.55 ? 238  ARG B NE   1 
ATOM   4298 C  CZ   . ARG B 1 208 ? -17.577 85.842 36.882 1.00 44.25 ? 238  ARG B CZ   1 
ATOM   4299 N  NH1  . ARG B 1 208 ? -16.774 86.123 37.896 1.00 43.75 ? 238  ARG B NH1  1 
ATOM   4300 N  NH2  . ARG B 1 208 ? -17.911 84.589 36.636 1.00 46.19 ? 238  ARG B NH2  1 
ATOM   4301 N  N    . TYR B 1 209 ? -23.777 87.863 35.427 1.00 41.03 ? 239  TYR B N    1 
ATOM   4302 C  CA   . TYR B 1 209 ? -24.781 87.100 34.704 1.00 41.23 ? 239  TYR B CA   1 
ATOM   4303 C  C    . TYR B 1 209 ? -26.110 87.830 34.771 1.00 43.77 ? 239  TYR B C    1 
ATOM   4304 O  O    . TYR B 1 209 ? -26.862 87.849 33.795 1.00 45.43 ? 239  TYR B O    1 
ATOM   4305 C  CB   . TYR B 1 209 ? -24.940 85.697 35.301 1.00 39.48 ? 239  TYR B CB   1 
ATOM   4306 C  CG   . TYR B 1 209 ? -23.757 84.772 35.105 1.00 35.81 ? 239  TYR B CG   1 
ATOM   4307 C  CD1  . TYR B 1 209 ? -22.680 84.789 35.987 1.00 31.69 ? 239  TYR B CD1  1 
ATOM   4308 C  CD2  . TYR B 1 209 ? -23.726 83.858 34.054 1.00 34.95 ? 239  TYR B CD2  1 
ATOM   4309 C  CE1  . TYR B 1 209 ? -21.603 83.925 35.830 1.00 32.29 ? 239  TYR B CE1  1 
ATOM   4310 C  CE2  . TYR B 1 209 ? -22.652 82.988 33.889 1.00 30.93 ? 239  TYR B CE2  1 
ATOM   4311 C  CZ   . TYR B 1 209 ? -21.596 83.028 34.781 1.00 31.89 ? 239  TYR B CZ   1 
ATOM   4312 O  OH   . TYR B 1 209 ? -20.525 82.178 34.624 1.00 34.32 ? 239  TYR B OH   1 
ATOM   4313 N  N    . VAL B 1 210 ? -26.402 88.418 35.928 1.00 44.33 ? 240  VAL B N    1 
ATOM   4314 C  CA   . VAL B 1 210 ? -27.647 89.151 36.132 1.00 46.09 ? 240  VAL B CA   1 
ATOM   4315 C  C    . VAL B 1 210 ? -27.467 90.358 37.056 1.00 48.19 ? 240  VAL B C    1 
ATOM   4316 O  O    . VAL B 1 210 ? -26.520 90.428 37.836 1.00 47.11 ? 240  VAL B O    1 
ATOM   4317 C  CB   . VAL B 1 210 ? -28.757 88.247 36.713 1.00 45.77 ? 240  VAL B CB   1 
ATOM   4318 C  CG1  . VAL B 1 210 ? -29.209 87.223 35.686 1.00 41.84 ? 240  VAL B CG1  1 
ATOM   4319 C  CG2  . VAL B 1 210 ? -28.264 87.555 37.966 1.00 47.66 ? 240  VAL B CG2  1 
ATOM   4320 N  N    . LYS B 1 211 ? -28.402 91.297 36.960 1.00 51.46 ? 241  LYS B N    1 
ATOM   4321 C  CA   . LYS B 1 211 ? -28.382 92.516 37.760 1.00 52.60 ? 241  LYS B CA   1 
ATOM   4322 C  C    . LYS B 1 211 ? -28.584 92.196 39.236 1.00 53.03 ? 241  LYS B C    1 
ATOM   4323 O  O    . LYS B 1 211 ? -27.875 92.710 40.096 1.00 55.39 ? 241  LYS B O    1 
ATOM   4324 C  CB   . LYS B 1 211 ? -29.495 93.464 37.304 1.00 53.89 ? 241  LYS B CB   1 
ATOM   4325 C  CG   . LYS B 1 211 ? -29.471 93.820 35.822 1.00 57.43 ? 241  LYS B CG   1 
ATOM   4326 C  CD   . LYS B 1 211 ? -30.715 94.615 35.429 1.00 60.80 ? 241  LYS B CD   1 
ATOM   4327 C  CE   . LYS B 1 211 ? -30.760 95.973 36.121 1.00 60.71 ? 241  LYS B CE   1 
ATOM   4328 N  NZ   . LYS B 1 211 ? -29.614 96.827 35.707 1.00 62.85 ? 241  LYS B NZ   1 
ATOM   4329 N  N    . LYS B 1 212 ? -29.576 91.364 39.523 1.00 51.47 ? 242  LYS B N    1 
ATOM   4330 C  CA   . LYS B 1 212 ? -29.881 90.986 40.892 1.00 51.71 ? 242  LYS B CA   1 
ATOM   4331 C  C    . LYS B 1 212 ? -29.960 89.474 41.066 1.00 52.27 ? 242  LYS B C    1 
ATOM   4332 O  O    . LYS B 1 212 ? -30.437 88.760 40.178 1.00 52.36 ? 242  LYS B O    1 
ATOM   4333 C  CB   . LYS B 1 212 ? -31.220 91.587 41.327 1.00 51.11 ? 242  LYS B CB   1 
ATOM   4334 C  CG   . LYS B 1 212 ? -31.196 93.046 41.743 1.00 53.66 ? 242  LYS B CG   1 
ATOM   4335 C  CD   . LYS B 1 212 ? -32.512 93.405 42.440 1.00 56.14 ? 242  LYS B CD   1 
ATOM   4336 C  CE   . LYS B 1 212 ? -32.473 94.794 43.073 1.00 58.79 ? 242  LYS B CE   1 
ATOM   4337 N  NZ   . LYS B 1 212 ? -33.679 95.054 43.922 1.00 59.11 ? 242  LYS B NZ   1 
ATOM   4338 N  N    . LEU B 1 213 ? -29.475 88.988 42.206 1.00 52.85 ? 243  LEU B N    1 
ATOM   4339 C  CA   . LEU B 1 213 ? -29.550 87.566 42.521 1.00 50.52 ? 243  LEU B CA   1 
ATOM   4340 C  C    . LEU B 1 213 ? -31.022 87.479 42.874 1.00 50.77 ? 243  LEU B C    1 
ATOM   4341 O  O    . LEU B 1 213 ? -31.502 88.201 43.753 1.00 54.30 ? 243  LEU B O    1 
ATOM   4342 C  CB   . LEU B 1 213 ? -28.679 87.230 43.735 1.00 49.07 ? 243  LEU B CB   1 
ATOM   4343 C  CG   . LEU B 1 213 ? -28.342 85.769 44.072 1.00 49.91 ? 243  LEU B CG   1 
ATOM   4344 C  CD1  . LEU B 1 213 ? -29.481 85.104 44.804 1.00 49.37 ? 243  LEU B CD1  1 
ATOM   4345 C  CD2  . LEU B 1 213 ? -27.965 84.993 42.823 1.00 46.59 ? 243  LEU B CD2  1 
ATOM   4346 N  N    . GLY B 1 214 ? -31.746 86.663 42.127 1.00 46.68 ? 244  GLY B N    1 
ATOM   4347 C  CA   . GLY B 1 214 ? -33.175 86.537 42.330 1.00 41.10 ? 244  GLY B CA   1 
ATOM   4348 C  C    . GLY B 1 214 ? -33.749 86.571 40.932 1.00 39.32 ? 244  GLY B C    1 
ATOM   4349 O  O    . GLY B 1 214 ? -34.783 85.967 40.643 1.00 37.79 ? 244  GLY B O    1 
ATOM   4350 N  N    . ASP B 1 215 ? -33.039 87.257 40.041 1.00 38.01 ? 245  ASP B N    1 
ATOM   4351 C  CA   . ASP B 1 215 ? -33.449 87.334 38.649 1.00 40.40 ? 245  ASP B CA   1 
ATOM   4352 C  C    . ASP B 1 215 ? -33.243 85.967 38.001 1.00 40.04 ? 245  ASP B C    1 
ATOM   4353 O  O    . ASP B 1 215 ? -33.762 85.720 36.914 1.00 39.33 ? 245  ASP B O    1 
ATOM   4354 C  CB   . ASP B 1 215 ? -32.667 88.419 37.898 1.00 40.54 ? 245  ASP B CB   1 
ATOM   4355 C  CG   . ASP B 1 215 ? -33.017 89.827 38.364 1.00 37.10 ? 245  ASP B CG   1 
ATOM   4356 O  OD1  . ASP B 1 215 ? -34.172 90.054 38.775 1.00 34.06 ? 245  ASP B OD1  1 
ATOM   4357 O  OD2  . ASP B 1 215 ? -32.134 90.709 38.317 1.00 34.83 ? 245  ASP B OD2  1 
ATOM   4358 N  N    . PHE B 1 216 ? -32.482 85.093 38.672 1.00 38.88 ? 246  PHE B N    1 
ATOM   4359 C  CA   . PHE B 1 216 ? -32.239 83.727 38.186 1.00 39.28 ? 246  PHE B CA   1 
ATOM   4360 C  C    . PHE B 1 216 ? -33.533 82.933 38.349 1.00 39.36 ? 246  PHE B C    1 
ATOM   4361 O  O    . PHE B 1 216 ? -33.771 81.963 37.633 1.00 39.66 ? 246  PHE B O    1 
ATOM   4362 C  CB   . PHE B 1 216 ? -31.138 83.017 38.990 1.00 37.55 ? 246  PHE B CB   1 
ATOM   4363 C  CG   . PHE B 1 216 ? -29.729 83.406 38.614 1.00 33.65 ? 246  PHE B CG   1 
ATOM   4364 C  CD1  . PHE B 1 216 ? -29.410 83.808 37.323 1.00 32.63 ? 246  PHE B CD1  1 
ATOM   4365 C  CD2  . PHE B 1 216 ? -28.709 83.331 39.562 1.00 32.35 ? 246  PHE B CD2  1 
ATOM   4366 C  CE1  . PHE B 1 216 ? -28.090 84.129 36.981 1.00 30.90 ? 246  PHE B CE1  1 
ATOM   4367 C  CE2  . PHE B 1 216 ? -27.391 83.650 39.232 1.00 31.49 ? 246  PHE B CE2  1 
ATOM   4368 C  CZ   . PHE B 1 216 ? -27.080 84.049 37.938 1.00 31.25 ? 246  PHE B CZ   1 
ATOM   4369 N  N    . ALA B 1 217 ? -34.347 83.332 39.324 1.00 42.76 ? 247  ALA B N    1 
ATOM   4370 C  CA   . ALA B 1 217 ? -35.625 82.673 39.579 1.00 47.68 ? 247  ALA B CA   1 
ATOM   4371 C  C    . ALA B 1 217 ? -36.652 83.169 38.566 1.00 51.64 ? 247  ALA B C    1 
ATOM   4372 O  O    . ALA B 1 217 ? -37.791 82.709 38.535 1.00 51.17 ? 247  ALA B O    1 
ATOM   4373 C  CB   . ALA B 1 217 ? -36.097 82.967 40.990 1.00 47.60 ? 247  ALA B CB   1 
ATOM   4374 N  N    . LYS B 1 218 ? -36.245 84.149 37.767 1.00 55.92 ? 248  LYS B N    1 
ATOM   4375 C  CA   . LYS B 1 218 ? -37.100 84.716 36.741 1.00 58.61 ? 248  LYS B CA   1 
ATOM   4376 C  C    . LYS B 1 218 ? -36.907 83.819 35.519 1.00 58.35 ? 248  LYS B C    1 
ATOM   4377 O  O    . LYS B 1 218 ? -35.801 83.718 34.983 1.00 58.91 ? 248  LYS B O    1 
ATOM   4378 C  CB   . LYS B 1 218 ? -36.658 86.152 36.445 1.00 61.20 ? 248  LYS B CB   1 
ATOM   4379 C  CG   . LYS B 1 218 ? -37.647 86.981 35.651 1.00 67.98 ? 248  LYS B CG   1 
ATOM   4380 C  CD   . LYS B 1 218 ? -37.168 88.423 35.532 1.00 72.76 ? 248  LYS B CD   1 
ATOM   4381 C  CE   . LYS B 1 218 ? -38.140 89.273 34.724 1.00 74.99 ? 248  LYS B CE   1 
ATOM   4382 N  NZ   . LYS B 1 218 ? -37.676 90.685 34.617 1.00 75.56 ? 248  LYS B NZ   1 
ATOM   4383 N  N    . PRO B 1 219 ? -37.990 83.171 35.053 1.00 57.84 ? 249  PRO B N    1 
ATOM   4384 C  CA   . PRO B 1 219 ? -38.002 82.262 33.898 1.00 56.55 ? 249  PRO B CA   1 
ATOM   4385 C  C    . PRO B 1 219 ? -37.264 82.759 32.657 1.00 55.12 ? 249  PRO B C    1 
ATOM   4386 O  O    . PRO B 1 219 ? -36.786 81.962 31.850 1.00 49.39 ? 249  PRO B O    1 
ATOM   4387 C  CB   . PRO B 1 219 ? -39.494 82.093 33.625 1.00 58.27 ? 249  PRO B CB   1 
ATOM   4388 C  CG   . PRO B 1 219 ? -40.082 82.164 34.995 1.00 58.31 ? 249  PRO B CG   1 
ATOM   4389 C  CD   . PRO B 1 219 ? -39.349 83.337 35.597 1.00 57.31 ? 249  PRO B CD   1 
ATOM   4390 N  N    . GLU B 1 220 ? -37.148 84.076 32.530 1.00 56.61 ? 250  GLU B N    1 
ATOM   4391 C  CA   . GLU B 1 220 ? -36.481 84.691 31.384 1.00 57.54 ? 250  GLU B CA   1 
ATOM   4392 C  C    . GLU B 1 220 ? -34.954 84.588 31.455 1.00 57.53 ? 250  GLU B C    1 
ATOM   4393 O  O    . GLU B 1 220 ? -34.277 84.593 30.423 1.00 57.80 ? 250  GLU B O    1 
ATOM   4394 C  CB   . GLU B 1 220 ? -36.882 86.169 31.257 1.00 57.80 ? 250  GLU B CB   1 
ATOM   4395 C  CG   . GLU B 1 220 ? -38.188 86.575 31.957 1.00 60.37 ? 250  GLU B CG   1 
ATOM   4396 C  CD   . GLU B 1 220 ? -39.389 85.725 31.559 1.00 63.38 ? 250  GLU B CD   1 
ATOM   4397 O  OE1  . GLU B 1 220 ? -39.692 85.628 30.347 1.00 62.00 ? 250  GLU B OE1  1 
ATOM   4398 O  OE2  . GLU B 1 220 ? -40.035 85.159 32.469 1.00 63.45 ? 250  GLU B OE2  1 
ATOM   4399 N  N    . ASN B 1 221 ? -34.418 84.473 32.669 1.00 55.96 ? 251  ASN B N    1 
ATOM   4400 C  CA   . ASN B 1 221 ? -32.971 84.404 32.866 1.00 54.58 ? 251  ASN B CA   1 
ATOM   4401 C  C    . ASN B 1 221 ? -32.395 83.028 33.178 1.00 55.60 ? 251  ASN B C    1 
ATOM   4402 O  O    . ASN B 1 221 ? -31.217 82.911 33.538 1.00 54.70 ? 251  ASN B O    1 
ATOM   4403 C  CB   . ASN B 1 221 ? -32.553 85.388 33.951 1.00 50.96 ? 251  ASN B CB   1 
ATOM   4404 C  CG   . ASN B 1 221 ? -32.914 86.802 33.602 1.00 46.75 ? 251  ASN B CG   1 
ATOM   4405 O  OD1  . ASN B 1 221 ? -32.362 87.376 32.672 1.00 47.77 ? 251  ASN B OD1  1 
ATOM   4406 N  ND2  . ASN B 1 221 ? -33.874 87.362 34.318 1.00 47.98 ? 251  ASN B ND2  1 
ATOM   4407 N  N    . ILE B 1 222 ? -33.195 81.985 32.976 1.00 55.18 ? 252  ILE B N    1 
ATOM   4408 C  CA   . ILE B 1 222 ? -32.755 80.626 33.257 1.00 53.35 ? 252  ILE B CA   1 
ATOM   4409 C  C    . ILE B 1 222 ? -31.497 80.193 32.508 1.00 51.09 ? 252  ILE B C    1 
ATOM   4410 O  O    . ILE B 1 222 ? -30.672 79.468 33.063 1.00 50.29 ? 252  ILE B O    1 
ATOM   4411 C  CB   . ILE B 1 222 ? -33.880 79.595 33.021 1.00 56.33 ? 252  ILE B CB   1 
ATOM   4412 C  CG1  . ILE B 1 222 ? -34.436 79.725 31.598 1.00 59.88 ? 252  ILE B CG1  1 
ATOM   4413 C  CG2  . ILE B 1 222 ? -34.973 79.776 34.068 1.00 58.30 ? 252  ILE B CG2  1 
ATOM   4414 C  CD1  . ILE B 1 222 ? -35.495 78.694 31.249 1.00 60.26 ? 252  ILE B CD1  1 
ATOM   4415 N  N    . ASP B 1 223 ? -31.328 80.655 31.272 1.00 48.60 ? 253  ASP B N    1 
ATOM   4416 C  CA   . ASP B 1 223 ? -30.151 80.281 30.489 1.00 47.85 ? 253  ASP B CA   1 
ATOM   4417 C  C    . ASP B 1 223 ? -28.870 80.729 31.173 1.00 45.68 ? 253  ASP B C    1 
ATOM   4418 O  O    . ASP B 1 223 ? -27.952 79.932 31.370 1.00 44.77 ? 253  ASP B O    1 
ATOM   4419 C  CB   . ASP B 1 223 ? -30.219 80.865 29.075 1.00 52.38 ? 253  ASP B CB   1 
ATOM   4420 C  CG   . ASP B 1 223 ? -31.167 80.096 28.166 1.00 57.36 ? 253  ASP B CG   1 
ATOM   4421 O  OD1  . ASP B 1 223 ? -31.116 78.841 28.154 1.00 55.15 ? 253  ASP B OD1  1 
ATOM   4422 O  OD2  . ASP B 1 223 ? -31.953 80.754 27.449 1.00 60.53 ? 253  ASP B OD2  1 
ATOM   4423 N  N    . LEU B 1 224 ? -28.818 82.004 31.541 1.00 44.27 ? 254  LEU B N    1 
ATOM   4424 C  CA   . LEU B 1 224 ? -27.653 82.562 32.219 1.00 44.85 ? 254  LEU B CA   1 
ATOM   4425 C  C    . LEU B 1 224 ? -27.541 82.025 33.648 1.00 41.12 ? 254  LEU B C    1 
ATOM   4426 O  O    . LEU B 1 224 ? -26.439 81.918 34.201 1.00 37.67 ? 254  LEU B O    1 
ATOM   4427 C  CB   . LEU B 1 224 ? -27.715 84.091 32.213 1.00 46.34 ? 254  LEU B CB   1 
ATOM   4428 C  CG   . LEU B 1 224 ? -27.392 84.710 30.851 1.00 45.84 ? 254  LEU B CG   1 
ATOM   4429 C  CD1  . LEU B 1 224 ? -27.521 86.216 30.916 1.00 50.03 ? 254  LEU B CD1  1 
ATOM   4430 C  CD2  . LEU B 1 224 ? -25.980 84.317 30.442 1.00 45.21 ? 254  LEU B CD2  1 
ATOM   4431 N  N    . ALA B 1 225 ? -28.690 81.676 34.222 1.00 36.57 ? 255  ALA B N    1 
ATOM   4432 C  CA   . ALA B 1 225 ? -28.764 81.118 35.561 1.00 34.27 ? 255  ALA B CA   1 
ATOM   4433 C  C    . ALA B 1 225 ? -27.964 79.829 35.592 1.00 34.76 ? 255  ALA B C    1 
ATOM   4434 O  O    . ALA B 1 225 ? -27.072 79.662 36.432 1.00 39.14 ? 255  ALA B O    1 
ATOM   4435 C  CB   . ALA B 1 225 ? -30.211 80.843 35.937 1.00 33.46 ? 255  ALA B CB   1 
ATOM   4436 N  N    . VAL B 1 226 ? -28.255 78.935 34.651 1.00 31.23 ? 256  VAL B N    1 
ATOM   4437 C  CA   . VAL B 1 226 ? -27.561 77.658 34.569 1.00 28.81 ? 256  VAL B CA   1 
ATOM   4438 C  C    . VAL B 1 226 ? -26.070 77.835 34.299 1.00 30.15 ? 256  VAL B C    1 
ATOM   4439 O  O    . VAL B 1 226 ? -25.251 77.010 34.709 1.00 30.05 ? 256  VAL B O    1 
ATOM   4440 C  CB   . VAL B 1 226 ? -28.222 76.718 33.523 1.00 29.28 ? 256  VAL B CB   1 
ATOM   4441 C  CG1  . VAL B 1 226 ? -27.352 75.492 33.263 1.00 29.30 ? 256  VAL B CG1  1 
ATOM   4442 C  CG2  . VAL B 1 226 ? -29.595 76.271 34.025 1.00 27.96 ? 256  VAL B CG2  1 
ATOM   4443 N  N    . GLN B 1 227 ? -25.703 78.925 33.640 1.00 31.55 ? 257  GLN B N    1 
ATOM   4444 C  CA   . GLN B 1 227 ? -24.296 79.171 33.365 1.00 33.17 ? 257  GLN B CA   1 
ATOM   4445 C  C    . GLN B 1 227 ? -23.570 79.448 34.677 1.00 32.44 ? 257  GLN B C    1 
ATOM   4446 O  O    . GLN B 1 227 ? -22.497 78.894 34.934 1.00 31.73 ? 257  GLN B O    1 
ATOM   4447 C  CB   . GLN B 1 227 ? -24.122 80.350 32.407 1.00 38.04 ? 257  GLN B CB   1 
ATOM   4448 C  CG   . GLN B 1 227 ? -24.601 80.084 30.981 1.00 42.68 ? 257  GLN B CG   1 
ATOM   4449 C  CD   . GLN B 1 227 ? -23.915 80.980 29.957 1.00 43.66 ? 257  GLN B CD   1 
ATOM   4450 O  OE1  . GLN B 1 227 ? -23.316 82.001 30.302 1.00 44.70 ? 257  GLN B OE1  1 
ATOM   4451 N  NE2  . GLN B 1 227 ? -23.965 80.577 28.699 1.00 43.14 ? 257  GLN B NE2  1 
ATOM   4452 N  N    . CYS B 1 228 ? -24.169 80.306 35.499 1.00 32.88 ? 258  CYS B N    1 
ATOM   4453 C  CA   . CYS B 1 228 ? -23.624 80.679 36.805 1.00 33.12 ? 258  CYS B CA   1 
ATOM   4454 C  C    . CYS B 1 228 ? -23.520 79.401 37.649 1.00 33.11 ? 258  CYS B C    1 
ATOM   4455 O  O    . CYS B 1 228 ? -22.463 79.081 38.209 1.00 29.21 ? 258  CYS B O    1 
ATOM   4456 C  CB   . CYS B 1 228 ? -24.569 81.682 37.477 1.00 32.02 ? 258  CYS B CB   1 
ATOM   4457 S  SG   . CYS B 1 228 ? -23.890 82.525 38.924 1.00 33.75 ? 258  CYS B SG   1 
ATOM   4458 N  N    . LEU B 1 229 ? -24.622 78.656 37.686 1.00 30.32 ? 259  LEU B N    1 
ATOM   4459 C  CA   . LEU B 1 229 ? -24.700 77.405 38.412 1.00 29.18 ? 259  LEU B CA   1 
ATOM   4460 C  C    . LEU B 1 229 ? -23.458 76.572 38.105 1.00 30.19 ? 259  LEU B C    1 
ATOM   4461 O  O    . LEU B 1 229 ? -22.688 76.226 39.001 1.00 32.12 ? 259  LEU B O    1 
ATOM   4462 C  CB   . LEU B 1 229 ? -25.970 76.653 37.994 1.00 23.09 ? 259  LEU B CB   1 
ATOM   4463 C  CG   . LEU B 1 229 ? -26.085 75.164 38.350 1.00 26.89 ? 259  LEU B CG   1 
ATOM   4464 C  CD1  . LEU B 1 229 ? -26.208 74.963 39.857 1.00 27.18 ? 259  LEU B CD1  1 
ATOM   4465 C  CD2  . LEU B 1 229 ? -27.274 74.564 37.630 1.00 24.84 ? 259  LEU B CD2  1 
ATOM   4466 N  N    . ASN B 1 230 ? -23.212 76.353 36.821 1.00 33.33 ? 260  ASN B N    1 
ATOM   4467 C  CA   . ASN B 1 230 ? -22.075 75.551 36.387 1.00 33.35 ? 260  ASN B CA   1 
ATOM   4468 C  C    . ASN B 1 230 ? -20.735 76.060 36.886 1.00 31.93 ? 260  ASN B C    1 
ATOM   4469 O  O    . ASN B 1 230 ? -19.840 75.264 37.185 1.00 28.43 ? 260  ASN B O    1 
ATOM   4470 C  CB   . ASN B 1 230 ? -22.072 75.398 34.861 1.00 32.57 ? 260  ASN B CB   1 
ATOM   4471 C  CG   . ASN B 1 230 ? -23.183 74.493 34.374 1.00 31.92 ? 260  ASN B CG   1 
ATOM   4472 O  OD1  . ASN B 1 230 ? -23.671 73.642 35.113 1.00 33.01 ? 260  ASN B OD1  1 
ATOM   4473 N  ND2  . ASN B 1 230 ? -23.605 74.682 33.137 1.00 40.32 ? 260  ASN B ND2  1 
ATOM   4474 N  N    . GLU B 1 231 ? -20.594 77.378 36.993 1.00 29.37 ? 261  GLU B N    1 
ATOM   4475 C  CA   . GLU B 1 231 ? -19.340 77.949 37.476 1.00 30.34 ? 261  GLU B CA   1 
ATOM   4476 C  C    . GLU B 1 231 ? -19.174 77.720 38.981 1.00 27.26 ? 261  GLU B C    1 
ATOM   4477 O  O    . GLU B 1 231 ? -18.073 77.419 39.444 1.00 23.90 ? 261  GLU B O    1 
ATOM   4478 C  CB   . GLU B 1 231 ? -19.246 79.440 37.161 1.00 29.34 ? 261  GLU B CB   1 
ATOM   4479 C  CG   . GLU B 1 231 ? -17.902 80.042 37.550 1.00 25.84 ? 261  GLU B CG   1 
ATOM   4480 C  CD   . GLU B 1 231 ? -17.831 81.531 37.314 1.00 26.66 ? 261  GLU B CD   1 
ATOM   4481 O  OE1  . GLU B 1 231 ? -18.755 82.081 36.681 1.00 29.75 ? 261  GLU B OE1  1 
ATOM   4482 O  OE2  . GLU B 1 231 ? -16.851 82.155 37.766 1.00 28.94 ? 261  GLU B OE2  1 
ATOM   4483 N  N    . LEU B 1 232 ? -20.258 77.877 39.739 1.00 24.74 ? 262  LEU B N    1 
ATOM   4484 C  CA   . LEU B 1 232 ? -20.193 77.652 41.184 1.00 26.06 ? 262  LEU B CA   1 
ATOM   4485 C  C    . LEU B 1 232 ? -19.849 76.181 41.443 1.00 25.92 ? 262  LEU B C    1 
ATOM   4486 O  O    . LEU B 1 232 ? -19.009 75.866 42.284 1.00 26.86 ? 262  LEU B O    1 
ATOM   4487 C  CB   . LEU B 1 232 ? -21.513 78.039 41.869 1.00 24.63 ? 262  LEU B CB   1 
ATOM   4488 C  CG   . LEU B 1 232 ? -21.758 79.508 42.259 1.00 24.65 ? 262  LEU B CG   1 
ATOM   4489 C  CD1  . LEU B 1 232 ? -20.571 80.384 41.915 1.00 23.60 ? 262  LEU B CD1  1 
ATOM   4490 C  CD2  . LEU B 1 232 ? -22.994 80.038 41.578 1.00 26.75 ? 262  LEU B CD2  1 
ATOM   4491 N  N    . ILE B 1 233 ? -20.449 75.290 40.661 1.00 26.43 ? 263  ILE B N    1 
ATOM   4492 C  CA   . ILE B 1 233 ? -20.203 73.862 40.788 1.00 23.08 ? 263  ILE B CA   1 
ATOM   4493 C  C    . ILE B 1 233 ? -18.737 73.544 40.496 1.00 24.31 ? 263  ILE B C    1 
ATOM   4494 O  O    . ILE B 1 233 ? -18.106 72.781 41.235 1.00 27.29 ? 263  ILE B O    1 
ATOM   4495 C  CB   . ILE B 1 233 ? -21.146 73.059 39.864 1.00 23.81 ? 263  ILE B CB   1 
ATOM   4496 C  CG1  . ILE B 1 233 ? -22.583 73.189 40.370 1.00 22.62 ? 263  ILE B CG1  1 
ATOM   4497 C  CG2  . ILE B 1 233 ? -20.735 71.587 39.793 1.00 22.05 ? 263  ILE B CG2  1 
ATOM   4498 C  CD1  . ILE B 1 233 ? -23.604 72.536 39.470 1.00 25.72 ? 263  ILE B CD1  1 
ATOM   4499 N  N    . THR B 1 234 ? -18.178 74.159 39.457 1.00 20.44 ? 264  THR B N    1 
ATOM   4500 C  CA   . THR B 1 234 ? -16.778 73.922 39.113 1.00 22.56 ? 264  THR B CA   1 
ATOM   4501 C  C    . THR B 1 234 ? -15.887 74.395 40.267 1.00 21.71 ? 264  THR B C    1 
ATOM   4502 O  O    . THR B 1 234 ? -14.853 73.793 40.561 1.00 22.46 ? 264  THR B O    1 
ATOM   4503 C  CB   . THR B 1 234 ? -16.391 74.645 37.799 1.00 27.55 ? 264  THR B CB   1 
ATOM   4504 O  OG1  . THR B 1 234 ? -17.285 74.240 36.751 1.00 32.64 ? 264  THR B OG1  1 
ATOM   4505 C  CG2  . THR B 1 234 ? -14.963 74.305 37.390 1.00 26.85 ? 264  THR B CG2  1 
ATOM   4506 N  N    . ASN B 1 235 ? -16.308 75.471 40.924 1.00 20.76 ? 265  ASN B N    1 
ATOM   4507 C  CA   . ASN B 1 235 ? -15.582 76.028 42.060 1.00 22.33 ? 265  ASN B CA   1 
ATOM   4508 C  C    . ASN B 1 235 ? -15.546 74.958 43.155 1.00 23.10 ? 265  ASN B C    1 
ATOM   4509 O  O    . ASN B 1 235 ? -14.474 74.572 43.631 1.00 24.85 ? 265  ASN B O    1 
ATOM   4510 C  CB   . ASN B 1 235 ? -16.300 77.290 42.555 1.00 18.96 ? 265  ASN B CB   1 
ATOM   4511 C  CG   . ASN B 1 235 ? -15.627 77.922 43.756 1.00 24.20 ? 265  ASN B CG   1 
ATOM   4512 O  OD1  . ASN B 1 235 ? -15.170 79.061 43.695 1.00 23.78 ? 265  ASN B OD1  1 
ATOM   4513 N  ND2  . ASN B 1 235 ? -15.620 77.217 44.872 1.00 22.91 ? 265  ASN B ND2  1 
ATOM   4514 N  N    . ALA B 1 236 ? -16.725 74.437 43.491 1.00 23.37 ? 266  ALA B N    1 
ATOM   4515 C  CA   . ALA B 1 236 ? -16.881 73.409 44.523 1.00 20.58 ? 266  ALA B CA   1 
ATOM   4516 C  C    . ALA B 1 236 ? -16.013 72.172 44.300 1.00 21.82 ? 266  ALA B C    1 
ATOM   4517 O  O    . ALA B 1 236 ? -15.365 71.688 45.234 1.00 26.23 ? 266  ALA B O    1 
ATOM   4518 C  CB   . ALA B 1 236 ? -18.345 73.007 44.632 1.00 13.67 ? 266  ALA B CB   1 
ATOM   4519 N  N    . LEU B 1 237 ? -15.975 71.680 43.063 1.00 22.87 ? 267  LEU B N    1 
ATOM   4520 C  CA   . LEU B 1 237 ? -15.194 70.484 42.715 1.00 23.09 ? 267  LEU B CA   1 
ATOM   4521 C  C    . LEU B 1 237 ? -13.714 70.557 43.092 1.00 21.14 ? 267  LEU B C    1 
ATOM   4522 O  O    . LEU B 1 237 ? -13.072 69.527 43.323 1.00 21.62 ? 267  LEU B O    1 
ATOM   4523 C  CB   . LEU B 1 237 ? -15.329 70.160 41.218 1.00 19.20 ? 267  LEU B CB   1 
ATOM   4524 C  CG   . LEU B 1 237 ? -16.748 69.957 40.660 1.00 21.74 ? 267  LEU B CG   1 
ATOM   4525 C  CD1  . LEU B 1 237 ? -16.679 69.730 39.137 1.00 25.45 ? 267  LEU B CD1  1 
ATOM   4526 C  CD2  . LEU B 1 237 ? -17.454 68.803 41.360 1.00 13.46 ? 267  LEU B CD2  1 
ATOM   4527 N  N    . HIS B 1 238 ? -13.175 71.766 43.185 1.00 21.07 ? 268  HIS B N    1 
ATOM   4528 C  CA   . HIS B 1 238 ? -11.769 71.939 43.535 1.00 24.81 ? 268  HIS B CA   1 
ATOM   4529 C  C    . HIS B 1 238 ? -11.394 71.399 44.906 1.00 28.67 ? 268  HIS B C    1 
ATOM   4530 O  O    . HIS B 1 238 ? -10.206 71.246 45.208 1.00 31.48 ? 268  HIS B O    1 
ATOM   4531 C  CB   . HIS B 1 238 ? -11.354 73.403 43.402 1.00 27.19 ? 268  HIS B CB   1 
ATOM   4532 C  CG   . HIS B 1 238 ? -11.138 73.831 41.985 1.00 29.93 ? 268  HIS B CG   1 
ATOM   4533 N  ND1  . HIS B 1 238 ? -12.180 74.126 41.128 1.00 28.31 ? 268  HIS B ND1  1 
ATOM   4534 C  CD2  . HIS B 1 238 ? -10.006 73.958 41.252 1.00 26.10 ? 268  HIS B CD2  1 
ATOM   4535 C  CE1  . HIS B 1 238 ? -11.699 74.413 39.934 1.00 31.66 ? 268  HIS B CE1  1 
ATOM   4536 N  NE2  . HIS B 1 238 ? -10.380 74.319 39.983 1.00 31.13 ? 268  HIS B NE2  1 
ATOM   4537 N  N    . HIS B 1 239 ? -12.403 71.086 45.722 1.00 27.29 ? 269  HIS B N    1 
ATOM   4538 C  CA   . HIS B 1 239 ? -12.176 70.554 47.063 1.00 22.85 ? 269  HIS B CA   1 
ATOM   4539 C  C    . HIS B 1 239 ? -12.118 69.032 47.115 1.00 25.53 ? 269  HIS B C    1 
ATOM   4540 O  O    . HIS B 1 239 ? -11.727 68.459 48.136 1.00 26.43 ? 269  HIS B O    1 
ATOM   4541 C  CB   . HIS B 1 239 ? -13.269 71.030 48.007 1.00 15.05 ? 269  HIS B CB   1 
ATOM   4542 C  CG   . HIS B 1 239 ? -13.281 72.508 48.213 1.00 9.67  ? 269  HIS B CG   1 
ATOM   4543 N  ND1  . HIS B 1 239 ? -14.366 73.294 47.893 1.00 16.65 ? 269  HIS B ND1  1 
ATOM   4544 C  CD2  . HIS B 1 239 ? -12.346 73.343 48.717 1.00 10.46 ? 269  HIS B CD2  1 
ATOM   4545 C  CE1  . HIS B 1 239 ? -14.098 74.553 48.192 1.00 11.37 ? 269  HIS B CE1  1 
ATOM   4546 N  NE2  . HIS B 1 239 ? -12.880 74.611 48.692 1.00 16.01 ? 269  HIS B NE2  1 
ATOM   4547 N  N    . ILE B 1 240 ? -12.509 68.376 46.023 1.00 23.78 ? 270  ILE B N    1 
ATOM   4548 C  CA   . ILE B 1 240 ? -12.516 66.916 45.969 1.00 20.42 ? 270  ILE B CA   1 
ATOM   4549 C  C    . ILE B 1 240 ? -11.148 66.312 46.281 1.00 18.66 ? 270  ILE B C    1 
ATOM   4550 O  O    . ILE B 1 240 ? -11.064 65.296 46.969 1.00 22.17 ? 270  ILE B O    1 
ATOM   4551 C  CB   . ILE B 1 240 ? -13.065 66.392 44.603 1.00 21.10 ? 270  ILE B CB   1 
ATOM   4552 C  CG1  . ILE B 1 240 ? -14.517 66.819 44.425 1.00 19.81 ? 270  ILE B CG1  1 
ATOM   4553 C  CG2  . ILE B 1 240 ? -12.998 64.875 44.524 1.00 14.90 ? 270  ILE B CG2  1 
ATOM   4554 C  CD1  . ILE B 1 240 ? -15.428 66.232 45.450 1.00 28.04 ? 270  ILE B CD1  1 
ATOM   4555 N  N    . PRO B 1 241 ? -10.057 66.929 45.787 1.00 18.85 ? 271  PRO B N    1 
ATOM   4556 C  CA   . PRO B 1 241 ? -8.727  66.380 46.072 1.00 16.19 ? 271  PRO B CA   1 
ATOM   4557 C  C    . PRO B 1 241 ? -8.482  66.272 47.576 1.00 18.17 ? 271  PRO B C    1 
ATOM   4558 O  O    . PRO B 1 241 ? -8.109  65.208 48.081 1.00 20.78 ? 271  PRO B O    1 
ATOM   4559 C  CB   . PRO B 1 241 ? -7.800  67.398 45.418 1.00 17.24 ? 271  PRO B CB   1 
ATOM   4560 C  CG   . PRO B 1 241 ? -8.606  67.842 44.231 1.00 19.22 ? 271  PRO B CG   1 
ATOM   4561 C  CD   . PRO B 1 241 ? -9.963  68.049 44.834 1.00 16.59 ? 271  PRO B CD   1 
ATOM   4562 N  N    . ASP B 1 242 ? -8.721  67.372 48.284 1.00 18.81 ? 272  ASP B N    1 
ATOM   4563 C  CA   . ASP B 1 242 ? -8.561  67.421 49.737 1.00 17.94 ? 272  ASP B CA   1 
ATOM   4564 C  C    . ASP B 1 242 ? -9.488  66.443 50.443 1.00 19.48 ? 272  ASP B C    1 
ATOM   4565 O  O    . ASP B 1 242 ? -9.107  65.842 51.448 1.00 18.73 ? 272  ASP B O    1 
ATOM   4566 C  CB   . ASP B 1 242 ? -8.831  68.829 50.255 1.00 16.49 ? 272  ASP B CB   1 
ATOM   4567 C  CG   . ASP B 1 242 ? -7.617  69.719 50.168 1.00 17.07 ? 272  ASP B CG   1 
ATOM   4568 O  OD1  . ASP B 1 242 ? -6.543  69.237 49.754 1.00 20.01 ? 272  ASP B OD1  1 
ATOM   4569 O  OD2  . ASP B 1 242 ? -7.735  70.902 50.525 1.00 21.46 ? 272  ASP B OD2  1 
ATOM   4570 N  N    . VAL B 1 243 ? -10.707 66.303 49.927 1.00 18.48 ? 273  VAL B N    1 
ATOM   4571 C  CA   . VAL B 1 243 ? -11.683 65.379 50.494 1.00 18.38 ? 273  VAL B CA   1 
ATOM   4572 C  C    . VAL B 1 243 ? -11.165 63.944 50.415 1.00 18.62 ? 273  VAL B C    1 
ATOM   4573 O  O    . VAL B 1 243 ? -11.277 63.180 51.379 1.00 18.86 ? 273  VAL B O    1 
ATOM   4574 C  CB   . VAL B 1 243 ? -13.051 65.482 49.770 1.00 15.71 ? 273  VAL B CB   1 
ATOM   4575 C  CG1  . VAL B 1 243 ? -13.967 64.339 50.187 1.00 15.50 ? 273  VAL B CG1  1 
ATOM   4576 C  CG2  . VAL B 1 243 ? -13.706 66.826 50.073 1.00 14.92 ? 273  VAL B CG2  1 
ATOM   4577 N  N    . ILE B 1 244 ? -10.588 63.584 49.272 1.00 18.75 ? 274  ILE B N    1 
ATOM   4578 C  CA   . ILE B 1 244 ? -10.051 62.241 49.082 1.00 20.53 ? 274  ILE B CA   1 
ATOM   4579 C  C    . ILE B 1 244 ? -8.853  62.015 50.001 1.00 21.17 ? 274  ILE B C    1 
ATOM   4580 O  O    . ILE B 1 244 ? -8.699  60.931 50.572 1.00 23.82 ? 274  ILE B O    1 
ATOM   4581 C  CB   . ILE B 1 244 ? -9.661  61.989 47.599 1.00 23.17 ? 274  ILE B CB   1 
ATOM   4582 C  CG1  . ILE B 1 244 ? -10.930 61.837 46.751 1.00 24.02 ? 274  ILE B CG1  1 
ATOM   4583 C  CG2  . ILE B 1 244 ? -8.791  60.740 47.467 1.00 19.16 ? 274  ILE B CG2  1 
ATOM   4584 C  CD1  . ILE B 1 244 ? -10.665 61.696 45.248 1.00 24.95 ? 274  ILE B CD1  1 
ATOM   4585 N  N    . THR B 1 245 ? -8.013  63.035 50.148 1.00 18.99 ? 275  THR B N    1 
ATOM   4586 C  CA   . THR B 1 245 ? -6.849  62.943 51.024 1.00 20.00 ? 275  THR B CA   1 
ATOM   4587 C  C    . THR B 1 245 ? -7.311  62.727 52.476 1.00 18.85 ? 275  THR B C    1 
ATOM   4588 O  O    . THR B 1 245 ? -6.819  61.836 53.165 1.00 21.20 ? 275  THR B O    1 
ATOM   4589 C  CB   . THR B 1 245 ? -6.007  64.237 50.955 1.00 21.49 ? 275  THR B CB   1 
ATOM   4590 O  OG1  . THR B 1 245 ? -5.567  64.453 49.609 1.00 22.12 ? 275  THR B OG1  1 
ATOM   4591 C  CG2  . THR B 1 245 ? -4.795  64.143 51.881 1.00 17.39 ? 275  THR B CG2  1 
ATOM   4592 N  N    . TYR B 1 246 ? -8.271  63.535 52.921 1.00 17.48 ? 276  TYR B N    1 
ATOM   4593 C  CA   . TYR B 1 246 ? -8.798  63.445 54.280 1.00 18.72 ? 276  TYR B CA   1 
ATOM   4594 C  C    . TYR B 1 246 ? -9.383  62.054 54.538 1.00 20.07 ? 276  TYR B C    1 
ATOM   4595 O  O    . TYR B 1 246 ? -8.995  61.380 55.494 1.00 19.51 ? 276  TYR B O    1 
ATOM   4596 C  CB   . TYR B 1 246 ? -9.871  64.517 54.499 1.00 18.59 ? 276  TYR B CB   1 
ATOM   4597 C  CG   . TYR B 1 246 ? -10.449 64.565 55.903 1.00 20.02 ? 276  TYR B CG   1 
ATOM   4598 C  CD1  . TYR B 1 246 ? -11.441 63.659 56.314 1.00 19.30 ? 276  TYR B CD1  1 
ATOM   4599 C  CD2  . TYR B 1 246 ? -10.005 65.515 56.823 1.00 17.09 ? 276  TYR B CD2  1 
ATOM   4600 C  CE1  . TYR B 1 246 ? -11.966 63.701 57.608 1.00 14.90 ? 276  TYR B CE1  1 
ATOM   4601 C  CE2  . TYR B 1 246 ? -10.526 65.564 58.115 1.00 17.82 ? 276  TYR B CE2  1 
ATOM   4602 C  CZ   . TYR B 1 246 ? -11.498 64.656 58.503 1.00 16.11 ? 276  TYR B CZ   1 
ATOM   4603 O  OH   . TYR B 1 246 ? -11.968 64.693 59.796 1.00 14.19 ? 276  TYR B OH   1 
ATOM   4604 N  N    . LEU B 1 247 ? -10.295 61.621 53.668 1.00 19.50 ? 277  LEU B N    1 
ATOM   4605 C  CA   . LEU B 1 247 ? -10.940 60.321 53.802 1.00 18.01 ? 277  LEU B CA   1 
ATOM   4606 C  C    . LEU B 1 247 ? -9.972  59.151 53.782 1.00 19.72 ? 277  LEU B C    1 
ATOM   4607 O  O    . LEU B 1 247 ? -10.223 58.134 54.425 1.00 22.83 ? 277  LEU B O    1 
ATOM   4608 C  CB   . LEU B 1 247 ? -11.995 60.116 52.709 1.00 17.63 ? 277  LEU B CB   1 
ATOM   4609 C  CG   . LEU B 1 247 ? -13.274 60.960 52.755 1.00 21.38 ? 277  LEU B CG   1 
ATOM   4610 C  CD1  . LEU B 1 247 ? -14.205 60.556 51.595 1.00 18.73 ? 277  LEU B CD1  1 
ATOM   4611 C  CD2  . LEU B 1 247 ? -13.978 60.790 54.105 1.00 15.79 ? 277  LEU B CD2  1 
ATOM   4612 N  N    . SER B 1 248 ? -8.868  59.281 53.052 1.00 22.18 ? 278  SER B N    1 
ATOM   4613 C  CA   . SER B 1 248 ? -7.903  58.190 52.963 1.00 21.76 ? 278  SER B CA   1 
ATOM   4614 C  C    . SER B 1 248 ? -7.076  58.002 54.238 1.00 21.46 ? 278  SER B C    1 
ATOM   4615 O  O    . SER B 1 248 ? -6.489  56.942 54.450 1.00 18.68 ? 278  SER B O    1 
ATOM   4616 C  CB   . SER B 1 248 ? -6.996  58.366 51.736 1.00 18.12 ? 278  SER B CB   1 
ATOM   4617 O  OG   . SER B 1 248 ? -6.226  59.547 51.828 1.00 18.64 ? 278  SER B OG   1 
ATOM   4618 N  N    . ARG B 1 249 ? -7.052  59.016 55.097 1.00 21.57 ? 279  ARG B N    1 
ATOM   4619 C  CA   . ARG B 1 249 ? -6.296  58.928 56.345 1.00 19.53 ? 279  ARG B CA   1 
ATOM   4620 C  C    . ARG B 1 249 ? -7.093  58.333 57.502 1.00 17.62 ? 279  ARG B C    1 
ATOM   4621 O  O    . ARG B 1 249 ? -6.536  58.095 58.576 1.00 18.00 ? 279  ARG B O    1 
ATOM   4622 C  CB   . ARG B 1 249 ? -5.783  60.307 56.753 1.00 16.44 ? 279  ARG B CB   1 
ATOM   4623 C  CG   . ARG B 1 249 ? -4.752  60.884 55.821 1.00 11.86 ? 279  ARG B CG   1 
ATOM   4624 C  CD   . ARG B 1 249 ? -4.630  62.381 56.045 1.00 18.11 ? 279  ARG B CD   1 
ATOM   4625 N  NE   . ARG B 1 249 ? -3.492  62.959 55.339 1.00 17.65 ? 279  ARG B NE   1 
ATOM   4626 C  CZ   . ARG B 1 249 ? -3.247  64.263 55.270 1.00 20.40 ? 279  ARG B CZ   1 
ATOM   4627 N  NH1  . ARG B 1 249 ? -4.066  65.126 55.859 1.00 15.24 ? 279  ARG B NH1  1 
ATOM   4628 N  NH2  . ARG B 1 249 ? -2.159  64.704 54.651 1.00 18.82 ? 279  ARG B NH2  1 
ATOM   4629 N  N    . LEU B 1 250 ? -8.388  58.105 57.298 1.00 18.64 ? 280  LEU B N    1 
ATOM   4630 C  CA   . LEU B 1 250 ? -9.238  57.550 58.359 1.00 20.78 ? 280  LEU B CA   1 
ATOM   4631 C  C    . LEU B 1 250 ? -9.031  56.046 58.557 1.00 21.89 ? 280  LEU B C    1 
ATOM   4632 O  O    . LEU B 1 250 ? -8.881  55.298 57.592 1.00 23.69 ? 280  LEU B O    1 
ATOM   4633 C  CB   . LEU B 1 250 ? -10.716 57.878 58.106 1.00 17.57 ? 280  LEU B CB   1 
ATOM   4634 C  CG   . LEU B 1 250 ? -11.046 59.380 58.023 1.00 16.68 ? 280  LEU B CG   1 
ATOM   4635 C  CD1  . LEU B 1 250 ? -12.506 59.564 57.643 1.00 12.38 ? 280  LEU B CD1  1 
ATOM   4636 C  CD2  . LEU B 1 250 ? -10.719 60.109 59.346 1.00 14.53 ? 280  LEU B CD2  1 
ATOM   4637 N  N    . ARG B 1 251 ? -9.016  55.619 59.818 1.00 20.54 ? 281  ARG B N    1 
ATOM   4638 C  CA   . ARG B 1 251 ? -8.791  54.220 60.177 1.00 22.57 ? 281  ARG B CA   1 
ATOM   4639 C  C    . ARG B 1 251 ? -9.989  53.582 60.874 1.00 20.79 ? 281  ARG B C    1 
ATOM   4640 O  O    . ARG B 1 251 ? -10.191 52.375 60.803 1.00 24.59 ? 281  ARG B O    1 
ATOM   4641 C  CB   . ARG B 1 251 ? -7.576  54.108 61.102 1.00 27.35 ? 281  ARG B CB   1 
ATOM   4642 C  CG   . ARG B 1 251 ? -6.293  54.708 60.557 1.00 32.68 ? 281  ARG B CG   1 
ATOM   4643 C  CD   . ARG B 1 251 ? -5.190  54.662 61.609 1.00 42.62 ? 281  ARG B CD   1 
ATOM   4644 N  NE   . ARG B 1 251 ? -3.963  55.314 61.154 1.00 52.47 ? 281  ARG B NE   1 
ATOM   4645 C  CZ   . ARG B 1 251 ? -2.735  54.953 61.521 1.00 57.43 ? 281  ARG B CZ   1 
ATOM   4646 N  NH1  . ARG B 1 251 ? -2.552  53.936 62.356 1.00 58.11 ? 281  ARG B NH1  1 
ATOM   4647 N  NH2  . ARG B 1 251 ? -1.682  55.622 61.065 1.00 58.58 ? 281  ARG B NH2  1 
ATOM   4648 N  N    . ASN B 1 252 ? -10.747 54.388 61.606 1.00 23.31 ? 282  ASN B N    1 
ATOM   4649 C  CA   . ASN B 1 252 ? -11.916 53.901 62.330 1.00 18.85 ? 282  ASN B CA   1 
ATOM   4650 C  C    . ASN B 1 252 ? -13.132 53.796 61.407 1.00 17.13 ? 282  ASN B C    1 
ATOM   4651 O  O    . ASN B 1 252 ? -13.524 54.774 60.782 1.00 16.30 ? 282  ASN B O    1 
ATOM   4652 C  CB   . ASN B 1 252 ? -12.221 54.823 63.516 1.00 15.50 ? 282  ASN B CB   1 
ATOM   4653 C  CG   . ASN B 1 252 ? -13.353 54.308 64.372 1.00 14.65 ? 282  ASN B CG   1 
ATOM   4654 O  OD1  . ASN B 1 252 ? -14.517 54.483 64.034 1.00 15.04 ? 282  ASN B OD1  1 
ATOM   4655 N  ND2  . ASN B 1 252 ? -13.017 53.632 65.471 1.00 17.06 ? 282  ASN B ND2  1 
ATOM   4656 N  N    . GLN B 1 253 ? -13.752 52.621 61.372 1.00 16.56 ? 283  GLN B N    1 
ATOM   4657 C  CA   . GLN B 1 253 ? -14.911 52.369 60.519 1.00 16.00 ? 283  GLN B CA   1 
ATOM   4658 C  C    . GLN B 1 253 ? -16.100 53.292 60.790 1.00 15.86 ? 283  GLN B C    1 
ATOM   4659 O  O    . GLN B 1 253 ? -16.704 53.810 59.848 1.00 18.38 ? 283  GLN B O    1 
ATOM   4660 C  CB   . GLN B 1 253 ? -15.333 50.894 60.623 1.00 12.33 ? 283  GLN B CB   1 
ATOM   4661 C  CG   . GLN B 1 253 ? -16.504 50.495 59.717 1.00 16.59 ? 283  GLN B CG   1 
ATOM   4662 C  CD   . GLN B 1 253 ? -16.103 50.364 58.259 1.00 18.35 ? 283  GLN B CD   1 
ATOM   4663 O  OE1  . GLN B 1 253 ? -15.432 49.415 57.880 1.00 17.90 ? 283  GLN B OE1  1 
ATOM   4664 N  NE2  . GLN B 1 253 ? -16.517 51.316 57.438 1.00 18.27 ? 283  GLN B NE2  1 
ATOM   4665 N  N    . SER B 1 254 ? -16.450 53.489 62.059 1.00 13.56 ? 284  SER B N    1 
ATOM   4666 C  CA   . SER B 1 254 ? -17.576 54.356 62.395 1.00 12.20 ? 284  SER B CA   1 
ATOM   4667 C  C    . SER B 1 254 ? -17.279 55.788 61.949 1.00 11.43 ? 284  SER B C    1 
ATOM   4668 O  O    . SER B 1 254 ? -18.164 56.480 61.426 1.00 9.32  ? 284  SER B O    1 
ATOM   4669 C  CB   . SER B 1 254 ? -17.926 54.286 63.902 1.00 11.70 ? 284  SER B CB   1 
ATOM   4670 O  OG   . SER B 1 254 ? -16.952 54.902 64.740 1.00 6.35  ? 284  SER B OG   1 
ATOM   4671 N  N    . VAL B 1 255 ? -16.024 56.202 62.099 1.00 11.76 ? 285  VAL B N    1 
ATOM   4672 C  CA   . VAL B 1 255 ? -15.598 57.547 61.691 1.00 13.58 ? 285  VAL B CA   1 
ATOM   4673 C  C    . VAL B 1 255 ? -15.625 57.677 60.168 1.00 15.70 ? 285  VAL B C    1 
ATOM   4674 O  O    . VAL B 1 255 ? -16.119 58.674 59.634 1.00 16.13 ? 285  VAL B O    1 
ATOM   4675 C  CB   . VAL B 1 255 ? -14.154 57.881 62.192 1.00 14.37 ? 285  VAL B CB   1 
ATOM   4676 C  CG1  . VAL B 1 255 ? -13.680 59.207 61.620 1.00 9.49  ? 285  VAL B CG1  1 
ATOM   4677 C  CG2  . VAL B 1 255 ? -14.133 57.978 63.704 1.00 11.78 ? 285  VAL B CG2  1 
ATOM   4678 N  N    . PHE B 1 256 ? -15.108 56.663 59.472 1.00 15.04 ? 286  PHE B N    1 
ATOM   4679 C  CA   . PHE B 1 256 ? -15.070 56.686 58.017 1.00 11.22 ? 286  PHE B CA   1 
ATOM   4680 C  C    . PHE B 1 256 ? -16.471 56.875 57.473 1.00 12.68 ? 286  PHE B C    1 
ATOM   4681 O  O    . PHE B 1 256 ? -16.711 57.784 56.676 1.00 13.76 ? 286  PHE B O    1 
ATOM   4682 C  CB   . PHE B 1 256 ? -14.460 55.404 57.445 1.00 13.33 ? 286  PHE B CB   1 
ATOM   4683 C  CG   . PHE B 1 256 ? -14.217 55.469 55.956 1.00 15.23 ? 286  PHE B CG   1 
ATOM   4684 C  CD1  . PHE B 1 256 ? -13.041 56.029 55.453 1.00 15.92 ? 286  PHE B CD1  1 
ATOM   4685 C  CD2  . PHE B 1 256 ? -15.188 55.034 55.056 1.00 18.25 ? 286  PHE B CD2  1 
ATOM   4686 C  CE1  . PHE B 1 256 ? -12.838 56.161 54.081 1.00 15.23 ? 286  PHE B CE1  1 
ATOM   4687 C  CE2  . PHE B 1 256 ? -14.996 55.162 53.679 1.00 16.08 ? 286  PHE B CE2  1 
ATOM   4688 C  CZ   . PHE B 1 256 ? -13.819 55.728 53.195 1.00 17.19 ? 286  PHE B CZ   1 
ATOM   4689 N  N    . ASN B 1 257 ? -17.405 56.048 57.941 1.00 11.65 ? 287  ASN B N    1 
ATOM   4690 C  CA   . ASN B 1 257 ? -18.795 56.141 57.498 1.00 14.06 ? 287  ASN B CA   1 
ATOM   4691 C  C    . ASN B 1 257 ? -19.330 57.549 57.736 1.00 15.85 ? 287  ASN B C    1 
ATOM   4692 O  O    . ASN B 1 257 ? -19.943 58.154 56.853 1.00 13.61 ? 287  ASN B O    1 
ATOM   4693 C  CB   . ASN B 1 257 ? -19.677 55.146 58.257 1.00 14.36 ? 287  ASN B CB   1 
ATOM   4694 C  CG   . ASN B 1 257 ? -19.356 53.716 57.933 1.00 16.21 ? 287  ASN B CG   1 
ATOM   4695 O  OD1  . ASN B 1 257 ? -18.399 53.433 57.219 1.00 20.57 ? 287  ASN B OD1  1 
ATOM   4696 N  ND2  . ASN B 1 257 ? -20.155 52.798 58.457 1.00 14.72 ? 287  ASN B ND2  1 
ATOM   4697 N  N    . PHE B 1 258 ? -19.081 58.051 58.945 1.00 13.76 ? 288  PHE B N    1 
ATOM   4698 C  CA   . PHE B 1 258 ? -19.514 59.370 59.376 1.00 15.36 ? 288  PHE B CA   1 
ATOM   4699 C  C    . PHE B 1 258 ? -18.996 60.481 58.467 1.00 14.37 ? 288  PHE B C    1 
ATOM   4700 O  O    . PHE B 1 258 ? -19.726 61.407 58.137 1.00 18.27 ? 288  PHE B O    1 
ATOM   4701 C  CB   . PHE B 1 258 ? -19.056 59.604 60.826 1.00 12.83 ? 288  PHE B CB   1 
ATOM   4702 C  CG   . PHE B 1 258 ? -19.348 60.984 61.353 1.00 16.48 ? 288  PHE B CG   1 
ATOM   4703 C  CD1  . PHE B 1 258 ? -20.602 61.297 61.869 1.00 14.43 ? 288  PHE B CD1  1 
ATOM   4704 C  CD2  . PHE B 1 258 ? -18.359 61.970 61.345 1.00 14.83 ? 288  PHE B CD2  1 
ATOM   4705 C  CE1  . PHE B 1 258 ? -20.871 62.576 62.368 1.00 14.48 ? 288  PHE B CE1  1 
ATOM   4706 C  CE2  . PHE B 1 258 ? -18.618 63.246 61.838 1.00 13.56 ? 288  PHE B CE2  1 
ATOM   4707 C  CZ   . PHE B 1 258 ? -19.881 63.549 62.352 1.00 12.85 ? 288  PHE B CZ   1 
ATOM   4708 N  N    . CYS B 1 259 ? -17.739 60.393 58.066 1.00 13.20 ? 289  CYS B N    1 
ATOM   4709 C  CA   . CYS B 1 259 ? -17.164 61.419 57.212 1.00 17.59 ? 289  CYS B CA   1 
ATOM   4710 C  C    . CYS B 1 259 ? -17.468 61.249 55.721 1.00 18.93 ? 289  CYS B C    1 
ATOM   4711 O  O    . CYS B 1 259 ? -17.794 62.222 55.040 1.00 21.82 ? 289  CYS B O    1 
ATOM   4712 C  CB   . CYS B 1 259 ? -15.653 61.494 57.426 1.00 11.32 ? 289  CYS B CB   1 
ATOM   4713 S  SG   . CYS B 1 259 ? -15.140 62.106 59.044 1.00 11.68 ? 289  CYS B SG   1 
ATOM   4714 N  N    . ALA B 1 260 ? -17.395 60.010 55.235 1.00 19.16 ? 290  ALA B N    1 
ATOM   4715 C  CA   . ALA B 1 260 ? -17.609 59.688 53.825 1.00 17.26 ? 290  ALA B CA   1 
ATOM   4716 C  C    . ALA B 1 260 ? -19.025 59.869 53.300 1.00 18.00 ? 290  ALA B C    1 
ATOM   4717 O  O    . ALA B 1 260 ? -19.211 60.480 52.252 1.00 19.72 ? 290  ALA B O    1 
ATOM   4718 C  CB   . ALA B 1 260 ? -17.124 58.269 53.539 1.00 15.12 ? 290  ALA B CB   1 
ATOM   4719 N  N    . ILE B 1 261 ? -20.018 59.363 54.034 1.00 18.76 ? 291  ILE B N    1 
ATOM   4720 C  CA   . ILE B 1 261 ? -21.416 59.454 53.617 1.00 17.49 ? 291  ILE B CA   1 
ATOM   4721 C  C    . ILE B 1 261 ? -21.841 60.851 53.137 1.00 20.26 ? 291  ILE B C    1 
ATOM   4722 O  O    . ILE B 1 261 ? -22.384 60.993 52.036 1.00 21.32 ? 291  ILE B O    1 
ATOM   4723 C  CB   . ILE B 1 261 ? -22.392 58.967 54.723 1.00 18.29 ? 291  ILE B CB   1 
ATOM   4724 C  CG1  . ILE B 1 261 ? -22.117 57.508 55.098 1.00 19.66 ? 291  ILE B CG1  1 
ATOM   4725 C  CG2  . ILE B 1 261 ? -23.834 59.156 54.276 1.00 21.04 ? 291  ILE B CG2  1 
ATOM   4726 C  CD1  . ILE B 1 261 ? -22.120 56.549 53.951 1.00 25.11 ? 291  ILE B CD1  1 
ATOM   4727 N  N    . PRO B 1 262 ? -21.617 61.899 53.955 1.00 20.56 ? 292  PRO B N    1 
ATOM   4728 C  CA   . PRO B 1 262 ? -22.015 63.238 53.508 1.00 18.83 ? 292  PRO B CA   1 
ATOM   4729 C  C    . PRO B 1 262 ? -21.245 63.706 52.267 1.00 19.64 ? 292  PRO B C    1 
ATOM   4730 O  O    . PRO B 1 262 ? -21.824 64.339 51.375 1.00 18.48 ? 292  PRO B O    1 
ATOM   4731 C  CB   . PRO B 1 262 ? -21.699 64.112 54.726 1.00 19.88 ? 292  PRO B CB   1 
ATOM   4732 C  CG   . PRO B 1 262 ? -21.868 63.172 55.862 1.00 20.48 ? 292  PRO B CG   1 
ATOM   4733 C  CD   . PRO B 1 262 ? -21.169 61.942 55.356 1.00 17.34 ? 292  PRO B CD   1 
ATOM   4734 N  N    . GLN B 1 263 ? -19.954 63.386 52.199 1.00 14.22 ? 293  GLN B N    1 
ATOM   4735 C  CA   . GLN B 1 263 ? -19.146 63.794 51.055 1.00 16.93 ? 293  GLN B CA   1 
ATOM   4736 C  C    . GLN B 1 263 ? -19.683 63.205 49.751 1.00 18.67 ? 293  GLN B C    1 
ATOM   4737 O  O    . GLN B 1 263 ? -19.831 63.915 48.758 1.00 20.40 ? 293  GLN B O    1 
ATOM   4738 C  CB   . GLN B 1 263 ? -17.668 63.419 51.249 1.00 17.10 ? 293  GLN B CB   1 
ATOM   4739 C  CG   . GLN B 1 263 ? -16.943 64.188 52.374 1.00 17.15 ? 293  GLN B CG   1 
ATOM   4740 C  CD   . GLN B 1 263 ? -16.967 65.711 52.207 1.00 18.25 ? 293  GLN B CD   1 
ATOM   4741 O  OE1  . GLN B 1 263 ? -16.808 66.238 51.100 1.00 22.65 ? 293  GLN B OE1  1 
ATOM   4742 N  NE2  . GLN B 1 263 ? -17.143 66.421 53.313 1.00 14.17 ? 293  GLN B NE2  1 
ATOM   4743 N  N    . VAL B 1 264 ? -20.022 61.921 49.770 1.00 19.35 ? 294  VAL B N    1 
ATOM   4744 C  CA   . VAL B 1 264 ? -20.540 61.254 48.584 1.00 20.42 ? 294  VAL B CA   1 
ATOM   4745 C  C    . VAL B 1 264 ? -21.925 61.781 48.232 1.00 22.90 ? 294  VAL B C    1 
ATOM   4746 O  O    . VAL B 1 264 ? -22.249 61.931 47.054 1.00 21.44 ? 294  VAL B O    1 
ATOM   4747 C  CB   . VAL B 1 264 ? -20.565 59.722 48.764 1.00 20.63 ? 294  VAL B CB   1 
ATOM   4748 C  CG1  . VAL B 1 264 ? -21.227 59.053 47.578 1.00 20.15 ? 294  VAL B CG1  1 
ATOM   4749 C  CG2  . VAL B 1 264 ? -19.145 59.205 48.912 1.00 19.29 ? 294  VAL B CG2  1 
ATOM   4750 N  N    . MET B 1 265 ? -22.733 62.073 49.253 1.00 25.41 ? 295  MET B N    1 
ATOM   4751 C  CA   . MET B 1 265 ? -24.078 62.619 49.050 1.00 24.57 ? 295  MET B CA   1 
ATOM   4752 C  C    . MET B 1 265 ? -23.993 64.009 48.415 1.00 23.11 ? 295  MET B C    1 
ATOM   4753 O  O    . MET B 1 265 ? -24.839 64.376 47.601 1.00 22.46 ? 295  MET B O    1 
ATOM   4754 C  CB   . MET B 1 265 ? -24.854 62.696 50.370 1.00 27.12 ? 295  MET B CB   1 
ATOM   4755 C  CG   . MET B 1 265 ? -25.405 61.359 50.852 1.00 37.68 ? 295  MET B CG   1 
ATOM   4756 S  SD   . MET B 1 265 ? -26.389 61.467 52.384 1.00 47.40 ? 295  MET B SD   1 
ATOM   4757 C  CE   . MET B 1 265 ? -27.959 62.143 51.769 1.00 42.15 ? 295  MET B CE   1 
ATOM   4758 N  N    . ALA B 1 266 ? -22.957 64.764 48.782 1.00 22.93 ? 296  ALA B N    1 
ATOM   4759 C  CA   . ALA B 1 266 ? -22.732 66.105 48.246 1.00 19.53 ? 296  ALA B CA   1 
ATOM   4760 C  C    . ALA B 1 266 ? -22.272 66.002 46.795 1.00 18.52 ? 296  ALA B C    1 
ATOM   4761 O  O    . ALA B 1 266 ? -22.750 66.724 45.930 1.00 17.71 ? 296  ALA B O    1 
ATOM   4762 C  CB   . ALA B 1 266 ? -21.688 66.838 49.082 1.00 17.58 ? 296  ALA B CB   1 
ATOM   4763 N  N    . ILE B 1 267 ? -21.332 65.101 46.531 1.00 20.96 ? 297  ILE B N    1 
ATOM   4764 C  CA   . ILE B 1 267 ? -20.835 64.912 45.172 1.00 20.90 ? 297  ILE B CA   1 
ATOM   4765 C  C    . ILE B 1 267 ? -21.992 64.445 44.284 1.00 18.94 ? 297  ILE B C    1 
ATOM   4766 O  O    . ILE B 1 267 ? -22.094 64.839 43.125 1.00 22.85 ? 297  ILE B O    1 
ATOM   4767 C  CB   . ILE B 1 267 ? -19.667 63.902 45.130 1.00 18.44 ? 297  ILE B CB   1 
ATOM   4768 C  CG1  . ILE B 1 267 ? -18.503 64.450 45.955 1.00 22.25 ? 297  ILE B CG1  1 
ATOM   4769 C  CG2  . ILE B 1 267 ? -19.204 63.689 43.692 1.00 25.06 ? 297  ILE B CG2  1 
ATOM   4770 C  CD1  . ILE B 1 267 ? -17.360 63.494 46.191 1.00 15.45 ? 297  ILE B CD1  1 
ATOM   4771 N  N    . ALA B 1 268 ? -22.890 63.651 44.854 1.00 17.56 ? 298  ALA B N    1 
ATOM   4772 C  CA   . ALA B 1 268 ? -24.041 63.153 44.122 1.00 17.54 ? 298  ALA B CA   1 
ATOM   4773 C  C    . ALA B 1 268 ? -24.992 64.292 43.789 1.00 17.04 ? 298  ALA B C    1 
ATOM   4774 O  O    . ALA B 1 268 ? -25.541 64.348 42.687 1.00 17.45 ? 298  ALA B O    1 
ATOM   4775 C  CB   . ALA B 1 268 ? -24.763 62.080 44.928 1.00 15.37 ? 298  ALA B CB   1 
ATOM   4776 N  N    . THR B 1 269 ? -25.183 65.208 44.731 1.00 16.88 ? 299  THR B N    1 
ATOM   4777 C  CA   . THR B 1 269 ? -26.077 66.334 44.509 1.00 23.00 ? 299  THR B CA   1 
ATOM   4778 C  C    . THR B 1 269 ? -25.516 67.299 43.464 1.00 24.21 ? 299  THR B C    1 
ATOM   4779 O  O    . THR B 1 269 ? -26.266 67.800 42.611 1.00 23.00 ? 299  THR B O    1 
ATOM   4780 C  CB   . THR B 1 269 ? -26.398 67.077 45.818 1.00 23.64 ? 299  THR B CB   1 
ATOM   4781 O  OG1  . THR B 1 269 ? -25.185 67.383 46.505 1.00 42.37 ? 299  THR B OG1  1 
ATOM   4782 C  CG2  . THR B 1 269 ? -27.235 66.212 46.726 1.00 25.23 ? 299  THR B CG2  1 
ATOM   4783 N  N    . LEU B 1 270 ? -24.206 67.547 43.517 1.00 22.11 ? 300  LEU B N    1 
ATOM   4784 C  CA   . LEU B 1 270 ? -23.559 68.432 42.550 1.00 21.55 ? 300  LEU B CA   1 
ATOM   4785 C  C    . LEU B 1 270 ? -23.753 67.865 41.157 1.00 23.29 ? 300  LEU B C    1 
ATOM   4786 O  O    . LEU B 1 270 ? -24.165 68.582 40.251 1.00 25.48 ? 300  LEU B O    1 
ATOM   4787 C  CB   . LEU B 1 270 ? -22.065 68.584 42.824 1.00 21.90 ? 300  LEU B CB   1 
ATOM   4788 C  CG   . LEU B 1 270 ? -21.649 69.548 43.935 1.00 23.46 ? 300  LEU B CG   1 
ATOM   4789 C  CD1  . LEU B 1 270 ? -20.146 69.746 43.869 1.00 24.13 ? 300  LEU B CD1  1 
ATOM   4790 C  CD2  . LEU B 1 270 ? -22.354 70.886 43.773 1.00 24.39 ? 300  LEU B CD2  1 
ATOM   4791 N  N    . ALA B 1 271 ? -23.504 66.565 41.004 1.00 24.95 ? 301  ALA B N    1 
ATOM   4792 C  CA   . ALA B 1 271 ? -23.669 65.888 39.717 1.00 24.20 ? 301  ALA B CA   1 
ATOM   4793 C  C    . ALA B 1 271 ? -25.114 66.001 39.233 1.00 24.35 ? 301  ALA B C    1 
ATOM   4794 O  O    . ALA B 1 271 ? -25.366 66.181 38.050 1.00 25.51 ? 301  ALA B O    1 
ATOM   4795 C  CB   . ALA B 1 271 ? -23.255 64.423 39.827 1.00 20.19 ? 301  ALA B CB   1 
ATOM   4796 N  N    . ALA B 1 272 ? -26.064 65.916 40.153 1.00 28.84 ? 302  ALA B N    1 
ATOM   4797 C  CA   . ALA B 1 272 ? -27.471 66.021 39.785 1.00 31.24 ? 302  ALA B CA   1 
ATOM   4798 C  C    . ALA B 1 272 ? -27.851 67.456 39.440 1.00 33.13 ? 302  ALA B C    1 
ATOM   4799 O  O    . ALA B 1 272 ? -28.692 67.687 38.569 1.00 35.34 ? 302  ALA B O    1 
ATOM   4800 C  CB   . ALA B 1 272 ? -28.359 65.505 40.910 1.00 31.33 ? 302  ALA B CB   1 
ATOM   4801 N  N    . CYS B 1 273 ? -27.240 68.414 40.134 1.00 32.73 ? 303  CYS B N    1 
ATOM   4802 C  CA   . CYS B 1 273 ? -27.517 69.835 39.917 1.00 29.77 ? 303  CYS B CA   1 
ATOM   4803 C  C    . CYS B 1 273 ? -26.817 70.417 38.691 1.00 28.48 ? 303  CYS B C    1 
ATOM   4804 O  O    . CYS B 1 273 ? -27.301 71.380 38.096 1.00 24.94 ? 303  CYS B O    1 
ATOM   4805 C  CB   . CYS B 1 273 ? -27.106 70.658 41.147 1.00 26.26 ? 303  CYS B CB   1 
ATOM   4806 S  SG   . CYS B 1 273 ? -28.097 70.424 42.634 1.00 26.55 ? 303  CYS B SG   1 
ATOM   4807 N  N    . TYR B 1 274 ? -25.674 69.843 38.333 1.00 29.25 ? 304  TYR B N    1 
ATOM   4808 C  CA   . TYR B 1 274 ? -24.884 70.332 37.212 1.00 32.99 ? 304  TYR B CA   1 
ATOM   4809 C  C    . TYR B 1 274 ? -25.670 70.486 35.914 1.00 35.22 ? 304  TYR B C    1 
ATOM   4810 O  O    . TYR B 1 274 ? -26.359 69.561 35.480 1.00 31.52 ? 304  TYR B O    1 
ATOM   4811 C  CB   . TYR B 1 274 ? -23.660 69.441 36.987 1.00 36.39 ? 304  TYR B CB   1 
ATOM   4812 C  CG   . TYR B 1 274 ? -22.762 69.940 35.884 1.00 39.58 ? 304  TYR B CG   1 
ATOM   4813 C  CD1  . TYR B 1 274 ? -21.890 71.005 36.100 1.00 37.30 ? 304  TYR B CD1  1 
ATOM   4814 C  CD2  . TYR B 1 274 ? -22.820 69.380 34.607 1.00 40.90 ? 304  TYR B CD2  1 
ATOM   4815 C  CE1  . TYR B 1 274 ? -21.103 71.506 35.073 1.00 44.25 ? 304  TYR B CE1  1 
ATOM   4816 C  CE2  . TYR B 1 274 ? -22.040 69.872 33.569 1.00 43.50 ? 304  TYR B CE2  1 
ATOM   4817 C  CZ   . TYR B 1 274 ? -21.185 70.934 33.806 1.00 46.00 ? 304  TYR B CZ   1 
ATOM   4818 O  OH   . TYR B 1 274 ? -20.426 71.430 32.774 1.00 44.95 ? 304  TYR B OH   1 
ATOM   4819 N  N    . ASN B 1 275 ? -25.566 71.676 35.320 1.00 37.07 ? 305  ASN B N    1 
ATOM   4820 C  CA   . ASN B 1 275 ? -26.236 72.016 34.063 1.00 37.90 ? 305  ASN B CA   1 
ATOM   4821 C  C    . ASN B 1 275 ? -27.710 71.637 34.135 1.00 36.48 ? 305  ASN B C    1 
ATOM   4822 O  O    . ASN B 1 275 ? -28.286 71.145 33.164 1.00 37.87 ? 305  ASN B O    1 
ATOM   4823 C  CB   . ASN B 1 275 ? -25.560 71.275 32.903 1.00 39.42 ? 305  ASN B CB   1 
ATOM   4824 C  CG   . ASN B 1 275 ? -25.779 71.955 31.573 1.00 42.26 ? 305  ASN B CG   1 
ATOM   4825 O  OD1  . ASN B 1 275 ? -25.378 73.107 31.381 1.00 42.95 ? 305  ASN B OD1  1 
ATOM   4826 N  ND2  . ASN B 1 275 ? -26.408 71.250 30.644 1.00 40.28 ? 305  ASN B ND2  1 
ATOM   4827 N  N    . ASN B 1 276 ? -28.322 71.877 35.287 1.00 33.34 ? 306  ASN B N    1 
ATOM   4828 C  CA   . ASN B 1 276 ? -29.712 71.515 35.483 1.00 33.99 ? 306  ASN B CA   1 
ATOM   4829 C  C    . ASN B 1 276 ? -30.592 72.715 35.809 1.00 32.83 ? 306  ASN B C    1 
ATOM   4830 O  O    . ASN B 1 276 ? -30.384 73.403 36.807 1.00 31.78 ? 306  ASN B O    1 
ATOM   4831 C  CB   . ASN B 1 276 ? -29.809 70.467 36.587 1.00 35.19 ? 306  ASN B CB   1 
ATOM   4832 C  CG   . ASN B 1 276 ? -31.133 69.766 36.600 1.00 35.08 ? 306  ASN B CG   1 
ATOM   4833 O  OD1  . ASN B 1 276 ? -32.132 70.295 36.102 1.00 38.19 ? 306  ASN B OD1  1 
ATOM   4834 N  ND2  . ASN B 1 276 ? -31.154 68.556 37.143 1.00 32.75 ? 306  ASN B ND2  1 
ATOM   4835 N  N    . GLN B 1 277 ? -31.613 72.918 34.987 1.00 32.38 ? 307  GLN B N    1 
ATOM   4836 C  CA   . GLN B 1 277 ? -32.534 74.037 35.154 1.00 36.55 ? 307  GLN B CA   1 
ATOM   4837 C  C    . GLN B 1 277 ? -33.507 73.881 36.314 1.00 35.25 ? 307  GLN B C    1 
ATOM   4838 O  O    . GLN B 1 277 ? -34.158 74.850 36.718 1.00 36.96 ? 307  GLN B O    1 
ATOM   4839 C  CB   . GLN B 1 277 ? -33.288 74.340 33.853 1.00 41.02 ? 307  GLN B CB   1 
ATOM   4840 C  CG   . GLN B 1 277 ? -33.397 73.169 32.885 1.00 53.05 ? 307  GLN B CG   1 
ATOM   4841 C  CD   . GLN B 1 277 ? -32.087 72.893 32.155 1.00 58.55 ? 307  GLN B CD   1 
ATOM   4842 O  OE1  . GLN B 1 277 ? -31.215 73.758 32.069 1.00 62.82 ? 307  GLN B OE1  1 
ATOM   4843 N  NE2  . GLN B 1 277 ? -31.949 71.688 31.625 1.00 61.68 ? 307  GLN B NE2  1 
ATOM   4844 N  N    . GLN B 1 278 ? -33.608 72.673 36.862 1.00 34.99 ? 308  GLN B N    1 
ATOM   4845 C  CA   . GLN B 1 278 ? -34.498 72.457 37.995 1.00 33.52 ? 308  GLN B CA   1 
ATOM   4846 C  C    . GLN B 1 278 ? -34.000 73.215 39.210 1.00 32.15 ? 308  GLN B C    1 
ATOM   4847 O  O    . GLN B 1 278 ? -34.789 73.602 40.062 1.00 33.30 ? 308  GLN B O    1 
ATOM   4848 C  CB   . GLN B 1 278 ? -34.650 70.978 38.324 1.00 36.82 ? 308  GLN B CB   1 
ATOM   4849 C  CG   . GLN B 1 278 ? -35.829 70.329 37.632 1.00 41.74 ? 308  GLN B CG   1 
ATOM   4850 C  CD   . GLN B 1 278 ? -37.147 71.015 37.958 1.00 41.82 ? 308  GLN B CD   1 
ATOM   4851 O  OE1  . GLN B 1 278 ? -37.792 70.707 38.958 1.00 42.35 ? 308  GLN B OE1  1 
ATOM   4852 N  NE2  . GLN B 1 278 ? -37.543 71.963 37.115 1.00 47.97 ? 308  GLN B NE2  1 
ATOM   4853 N  N    . VAL B 1 279 ? -32.700 73.487 39.248 1.00 29.86 ? 309  VAL B N    1 
ATOM   4854 C  CA   . VAL B 1 279 ? -32.102 74.220 40.361 1.00 30.50 ? 309  VAL B CA   1 
ATOM   4855 C  C    . VAL B 1 279 ? -32.839 75.531 40.624 1.00 32.78 ? 309  VAL B C    1 
ATOM   4856 O  O    . VAL B 1 279 ? -32.983 75.956 41.770 1.00 36.26 ? 309  VAL B O    1 
ATOM   4857 C  CB   . VAL B 1 279 ? -30.601 74.525 40.094 1.00 23.01 ? 309  VAL B CB   1 
ATOM   4858 C  CG1  . VAL B 1 279 ? -30.062 75.530 41.111 1.00 21.17 ? 309  VAL B CG1  1 
ATOM   4859 C  CG2  . VAL B 1 279 ? -29.794 73.238 40.151 1.00 22.72 ? 309  VAL B CG2  1 
ATOM   4860 N  N    . PHE B 1 280 ? -33.348 76.141 39.563 1.00 34.49 ? 310  PHE B N    1 
ATOM   4861 C  CA   . PHE B 1 280 ? -34.040 77.415 39.685 1.00 37.34 ? 310  PHE B CA   1 
ATOM   4862 C  C    . PHE B 1 280 ? -35.550 77.289 39.682 1.00 40.71 ? 310  PHE B C    1 
ATOM   4863 O  O    . PHE B 1 280 ? -36.271 78.287 39.636 1.00 39.41 ? 310  PHE B O    1 
ATOM   4864 C  CB   . PHE B 1 280 ? -33.546 78.351 38.590 1.00 30.87 ? 310  PHE B CB   1 
ATOM   4865 C  CG   . PHE B 1 280 ? -32.059 78.502 38.582 1.00 26.33 ? 310  PHE B CG   1 
ATOM   4866 C  CD1  . PHE B 1 280 ? -31.434 79.375 39.470 1.00 22.77 ? 310  PHE B CD1  1 
ATOM   4867 C  CD2  . PHE B 1 280 ? -31.276 77.714 37.747 1.00 24.00 ? 310  PHE B CD2  1 
ATOM   4868 C  CE1  . PHE B 1 280 ? -30.060 79.465 39.527 1.00 19.53 ? 310  PHE B CE1  1 
ATOM   4869 C  CE2  . PHE B 1 280 ? -29.898 77.794 37.793 1.00 22.51 ? 310  PHE B CE2  1 
ATOM   4870 C  CZ   . PHE B 1 280 ? -29.285 78.672 38.691 1.00 26.31 ? 310  PHE B CZ   1 
ATOM   4871 N  N    . LYS B 1 281 ? -36.011 76.050 39.810 1.00 44.95 ? 311  LYS B N    1 
ATOM   4872 C  CA   . LYS B 1 281 ? -37.426 75.737 39.828 1.00 49.27 ? 311  LYS B CA   1 
ATOM   4873 C  C    . LYS B 1 281 ? -37.777 74.891 41.043 1.00 51.96 ? 311  LYS B C    1 
ATOM   4874 O  O    . LYS B 1 281 ? -38.606 75.295 41.854 1.00 53.80 ? 311  LYS B O    1 
ATOM   4875 C  CB   . LYS B 1 281 ? -37.833 75.072 38.514 1.00 50.14 ? 311  LYS B CB   1 
ATOM   4876 C  CG   . LYS B 1 281 ? -38.211 76.102 37.464 1.00 55.42 ? 311  LYS B CG   1 
ATOM   4877 C  CD   . LYS B 1 281 ? -37.730 75.778 36.065 1.00 60.36 ? 311  LYS B CD   1 
ATOM   4878 C  CE   . LYS B 1 281 ? -38.144 76.912 35.125 1.00 65.49 ? 311  LYS B CE   1 
ATOM   4879 N  NZ   . LYS B 1 281 ? -37.600 76.803 33.745 1.00 70.05 ? 311  LYS B NZ   1 
ATOM   4880 N  N    . GLY B 1 282 ? -37.129 73.742 41.197 1.00 56.37 ? 312  GLY B N    1 
ATOM   4881 C  CA   . GLY B 1 282 ? -37.389 72.890 42.351 1.00 60.21 ? 312  GLY B CA   1 
ATOM   4882 C  C    . GLY B 1 282 ? -36.372 71.776 42.550 1.00 62.04 ? 312  GLY B C    1 
ATOM   4883 O  O    . GLY B 1 282 ? -35.324 71.750 41.903 1.00 63.52 ? 312  GLY B O    1 
ATOM   4884 N  N    . ALA B 1 283 ? -36.710 70.858 43.453 1.00 62.01 ? 313  ALA B N    1 
ATOM   4885 C  CA   . ALA B 1 283 ? -35.868 69.717 43.800 1.00 61.84 ? 313  ALA B CA   1 
ATOM   4886 C  C    . ALA B 1 283 ? -35.342 68.955 42.586 1.00 62.06 ? 313  ALA B C    1 
ATOM   4887 O  O    . ALA B 1 283 ? -36.072 68.721 41.619 1.00 62.17 ? 313  ALA B O    1 
ATOM   4888 C  CB   . ALA B 1 283 ? -36.634 68.774 44.721 1.00 60.88 ? 313  ALA B CB   1 
ATOM   4889 N  N    . VAL B 1 284 ? -34.068 68.581 42.651 1.00 60.21 ? 314  VAL B N    1 
ATOM   4890 C  CA   . VAL B 1 284 ? -33.428 67.840 41.576 1.00 59.53 ? 314  VAL B CA   1 
ATOM   4891 C  C    . VAL B 1 284 ? -33.758 66.358 41.685 1.00 58.05 ? 314  VAL B C    1 
ATOM   4892 O  O    . VAL B 1 284 ? -34.041 65.745 40.635 1.00 59.62 ? 314  VAL B O    1 
ATOM   4893 C  CB   . VAL B 1 284 ? -31.917 68.049 41.612 1.00 60.10 ? 314  VAL B CB   1 
ATOM   4894 N  N    . ALA B 1 298 ? -20.544 53.254 50.584 1.00 21.80 ? 328  ALA B N    1 
ATOM   4895 C  CA   . ALA B 1 298 ? -19.432 54.216 50.842 1.00 23.67 ? 328  ALA B CA   1 
ATOM   4896 C  C    . ALA B 1 298 ? -18.808 53.879 52.195 1.00 22.14 ? 328  ALA B C    1 
ATOM   4897 O  O    . ALA B 1 298 ? -18.589 54.759 53.025 1.00 21.05 ? 328  ALA B O    1 
ATOM   4898 C  CB   . ALA B 1 298 ? -19.976 55.656 50.837 1.00 20.63 ? 328  ALA B CB   1 
ATOM   4899 N  N    . THR B 1 299 ? -18.492 52.601 52.385 1.00 21.20 ? 329  THR B N    1 
ATOM   4900 C  CA   . THR B 1 299 ? -17.939 52.124 53.642 1.00 20.69 ? 329  THR B CA   1 
ATOM   4901 C  C    . THR B 1 299 ? -16.453 51.763 53.638 1.00 18.40 ? 329  THR B C    1 
ATOM   4902 O  O    . THR B 1 299 ? -15.904 51.383 54.671 1.00 16.72 ? 329  THR B O    1 
ATOM   4903 C  CB   . THR B 1 299 ? -18.779 50.956 54.152 1.00 24.02 ? 329  THR B CB   1 
ATOM   4904 O  OG1  . THR B 1 299 ? -18.959 50.008 53.090 1.00 26.09 ? 329  THR B OG1  1 
ATOM   4905 C  CG2  . THR B 1 299 ? -20.155 51.461 54.596 1.00 23.72 ? 329  THR B CG2  1 
ATOM   4906 N  N    . ASN B 1 300 ? -15.817 51.839 52.471 1.00 17.43 ? 330  ASN B N    1 
ATOM   4907 C  CA   . ASN B 1 300 ? -14.387 51.565 52.347 1.00 16.25 ? 330  ASN B CA   1 
ATOM   4908 C  C    . ASN B 1 300 ? -13.821 52.552 51.331 1.00 17.54 ? 330  ASN B C    1 
ATOM   4909 O  O    . ASN B 1 300 ? -14.521 52.950 50.395 1.00 18.06 ? 330  ASN B O    1 
ATOM   4910 C  CB   . ASN B 1 300 ? -14.096 50.095 51.983 1.00 17.97 ? 330  ASN B CB   1 
ATOM   4911 C  CG   . ASN B 1 300 ? -14.641 49.684 50.619 1.00 20.69 ? 330  ASN B CG   1 
ATOM   4912 O  OD1  . ASN B 1 300 ? -14.071 50.032 49.582 1.00 25.77 ? 330  ASN B OD1  1 
ATOM   4913 N  ND2  . ASN B 1 300 ? -15.702 48.881 50.617 1.00 11.84 ? 330  ASN B ND2  1 
ATOM   4914 N  N    . MET B 1 301 ? -12.579 52.978 51.541 1.00 17.84 ? 331  MET B N    1 
ATOM   4915 C  CA   . MET B 1 301 ? -11.939 53.963 50.675 1.00 20.98 ? 331  MET B CA   1 
ATOM   4916 C  C    . MET B 1 301 ? -11.900 53.660 49.175 1.00 22.17 ? 331  MET B C    1 
ATOM   4917 O  O    . MET B 1 301 ? -12.187 54.548 48.369 1.00 26.63 ? 331  MET B O    1 
ATOM   4918 C  CB   . MET B 1 301 ? -10.549 54.333 51.193 1.00 18.15 ? 331  MET B CB   1 
ATOM   4919 C  CG   . MET B 1 301 ? -10.039 55.665 50.637 1.00 21.43 ? 331  MET B CG   1 
ATOM   4920 S  SD   . MET B 1 301 ? -11.212 57.020 50.920 1.00 22.86 ? 331  MET B SD   1 
ATOM   4921 C  CE   . MET B 1 301 ? -10.910 58.044 49.496 1.00 25.18 ? 331  MET B CE   1 
ATOM   4922 N  N    . PRO B 1 302 ? -11.496 52.439 48.772 1.00 22.36 ? 332  PRO B N    1 
ATOM   4923 C  CA   . PRO B 1 302 ? -11.468 52.142 47.332 1.00 21.94 ? 332  PRO B CA   1 
ATOM   4924 C  C    . PRO B 1 302 ? -12.854 52.321 46.698 1.00 20.52 ? 332  PRO B C    1 
ATOM   4925 O  O    . PRO B 1 302 ? -12.977 52.899 45.615 1.00 20.21 ? 332  PRO B O    1 
ATOM   4926 C  CB   . PRO B 1 302 ? -11.004 50.687 47.297 1.00 18.12 ? 332  PRO B CB   1 
ATOM   4927 C  CG   . PRO B 1 302 ? -10.037 50.645 48.458 1.00 18.82 ? 332  PRO B CG   1 
ATOM   4928 C  CD   . PRO B 1 302 ? -10.836 51.359 49.534 1.00 20.13 ? 332  PRO B CD   1 
ATOM   4929 N  N    . ALA B 1 303 ? -13.893 51.860 47.391 1.00 16.08 ? 333  ALA B N    1 
ATOM   4930 C  CA   . ALA B 1 303 ? -15.256 52.003 46.892 1.00 17.10 ? 333  ALA B CA   1 
ATOM   4931 C  C    . ALA B 1 303 ? -15.683 53.466 46.824 1.00 18.63 ? 333  ALA B C    1 
ATOM   4932 O  O    . ALA B 1 303 ? -16.425 53.854 45.919 1.00 19.57 ? 333  ALA B O    1 
ATOM   4933 C  CB   . ALA B 1 303 ? -16.220 51.224 47.753 1.00 14.33 ? 333  ALA B CB   1 
ATOM   4934 N  N    . VAL B 1 304 ? -15.249 54.260 47.807 1.00 19.07 ? 334  VAL B N    1 
ATOM   4935 C  CA   . VAL B 1 304 ? -15.569 55.693 47.870 1.00 16.77 ? 334  VAL B CA   1 
ATOM   4936 C  C    . VAL B 1 304 ? -14.893 56.413 46.703 1.00 17.69 ? 334  VAL B C    1 
ATOM   4937 O  O    . VAL B 1 304 ? -15.503 57.257 46.045 1.00 17.28 ? 334  VAL B O    1 
ATOM   4938 C  CB   . VAL B 1 304 ? -15.116 56.327 49.225 1.00 17.22 ? 334  VAL B CB   1 
ATOM   4939 C  CG1  . VAL B 1 304 ? -15.273 57.855 49.203 1.00 11.30 ? 334  VAL B CG1  1 
ATOM   4940 C  CG2  . VAL B 1 304 ? -15.941 55.758 50.364 1.00 17.74 ? 334  VAL B CG2  1 
ATOM   4941 N  N    . LYS B 1 305 ? -13.641 56.053 46.443 1.00 16.61 ? 335  LYS B N    1 
ATOM   4942 C  CA   . LYS B 1 305 ? -12.880 56.635 45.345 1.00 20.13 ? 335  LYS B CA   1 
ATOM   4943 C  C    . LYS B 1 305 ? -13.594 56.367 44.018 1.00 19.60 ? 335  LYS B C    1 
ATOM   4944 O  O    . LYS B 1 305 ? -13.801 57.280 43.220 1.00 20.40 ? 335  LYS B O    1 
ATOM   4945 C  CB   . LYS B 1 305 ? -11.477 56.025 45.289 1.00 17.90 ? 335  LYS B CB   1 
ATOM   4946 C  CG   . LYS B 1 305 ? -10.447 56.653 46.206 1.00 16.86 ? 335  LYS B CG   1 
ATOM   4947 C  CD   . LYS B 1 305 ? -9.108  55.967 46.019 1.00 15.95 ? 335  LYS B CD   1 
ATOM   4948 C  CE   . LYS B 1 305 ? -7.996  56.666 46.773 1.00 22.15 ? 335  LYS B CE   1 
ATOM   4949 N  NZ   . LYS B 1 305 ? -6.716  55.901 46.706 1.00 11.90 ? 335  LYS B NZ   1 
ATOM   4950 N  N    . ALA B 1 306 ? -13.981 55.115 43.798 1.00 22.82 ? 336  ALA B N    1 
ATOM   4951 C  CA   . ALA B 1 306 ? -14.669 54.730 42.571 1.00 22.92 ? 336  ALA B CA   1 
ATOM   4952 C  C    . ALA B 1 306 ? -16.014 55.432 42.423 1.00 26.10 ? 336  ALA B C    1 
ATOM   4953 O  O    . ALA B 1 306 ? -16.354 55.906 41.338 1.00 27.19 ? 336  ALA B O    1 
ATOM   4954 C  CB   . ALA B 1 306 ? -14.852 53.231 42.519 1.00 25.18 ? 336  ALA B CB   1 
ATOM   4955 N  N    . ILE B 1 307 ? -16.783 55.499 43.506 1.00 25.71 ? 337  ILE B N    1 
ATOM   4956 C  CA   . ILE B 1 307 ? -18.091 56.159 43.473 1.00 22.74 ? 337  ILE B CA   1 
ATOM   4957 C  C    . ILE B 1 307 ? -17.940 57.636 43.105 1.00 23.60 ? 337  ILE B C    1 
ATOM   4958 O  O    . ILE B 1 307 ? -18.691 58.161 42.282 1.00 23.20 ? 337  ILE B O    1 
ATOM   4959 C  CB   . ILE B 1 307 ? -18.819 56.032 44.833 1.00 22.50 ? 337  ILE B CB   1 
ATOM   4960 C  CG1  . ILE B 1 307 ? -19.290 54.592 45.052 1.00 21.13 ? 337  ILE B CG1  1 
ATOM   4961 C  CG2  . ILE B 1 307 ? -19.985 57.000 44.910 1.00 21.67 ? 337  ILE B CG2  1 
ATOM   4962 C  CD1  . ILE B 1 307 ? -19.829 54.320 46.453 1.00 18.08 ? 337  ILE B CD1  1 
ATOM   4963 N  N    . ILE B 1 308 ? -16.973 58.303 43.726 1.00 21.11 ? 338  ILE B N    1 
ATOM   4964 C  CA   . ILE B 1 308 ? -16.728 59.713 43.451 1.00 22.95 ? 338  ILE B CA   1 
ATOM   4965 C  C    . ILE B 1 308 ? -16.316 59.850 41.989 1.00 21.02 ? 338  ILE B C    1 
ATOM   4966 O  O    . ILE B 1 308 ? -16.868 60.682 41.266 1.00 21.44 ? 338  ILE B O    1 
ATOM   4967 C  CB   . ILE B 1 308 ? -15.617 60.298 44.379 1.00 23.92 ? 338  ILE B CB   1 
ATOM   4968 C  CG1  . ILE B 1 308 ? -16.116 60.341 45.832 1.00 21.21 ? 338  ILE B CG1  1 
ATOM   4969 C  CG2  . ILE B 1 308 ? -15.170 61.682 43.890 1.00 17.06 ? 338  ILE B CG2  1 
ATOM   4970 C  CD1  . ILE B 1 308 ? -15.048 60.711 46.852 1.00 25.30 ? 338  ILE B CD1  1 
ATOM   4971 N  N    . TYR B 1 309 ? -15.366 59.019 41.558 1.00 17.19 ? 339  TYR B N    1 
ATOM   4972 C  CA   . TYR B 1 309 ? -14.893 59.039 40.172 1.00 21.11 ? 339  TYR B CA   1 
ATOM   4973 C  C    . TYR B 1 309 ? -16.050 58.934 39.184 1.00 20.07 ? 339  TYR B C    1 
ATOM   4974 O  O    . TYR B 1 309 ? -16.146 59.718 38.244 1.00 20.05 ? 339  TYR B O    1 
ATOM   4975 C  CB   . TYR B 1 309 ? -13.871 57.914 39.916 1.00 16.07 ? 339  TYR B CB   1 
ATOM   4976 C  CG   . TYR B 1 309 ? -12.558 58.145 40.621 1.00 18.20 ? 339  TYR B CG   1 
ATOM   4977 C  CD1  . TYR B 1 309 ? -12.105 59.440 40.866 1.00 21.47 ? 339  TYR B CD1  1 
ATOM   4978 C  CD2  . TYR B 1 309 ? -11.790 57.085 41.083 1.00 14.01 ? 339  TYR B CD2  1 
ATOM   4979 C  CE1  . TYR B 1 309 ? -10.923 59.669 41.559 1.00 21.23 ? 339  TYR B CE1  1 
ATOM   4980 C  CE2  . TYR B 1 309 ? -10.602 57.308 41.779 1.00 13.86 ? 339  TYR B CE2  1 
ATOM   4981 C  CZ   . TYR B 1 309 ? -10.182 58.600 42.012 1.00 16.44 ? 339  TYR B CZ   1 
ATOM   4982 O  OH   . TYR B 1 309 ? -9.032  58.852 42.712 1.00 21.37 ? 339  TYR B OH   1 
ATOM   4983 N  N    . GLN B 1 310 ? -16.969 58.016 39.439 1.00 22.29 ? 340  GLN B N    1 
ATOM   4984 C  CA   . GLN B 1 310 ? -18.096 57.848 38.550 1.00 27.86 ? 340  GLN B CA   1 
ATOM   4985 C  C    . GLN B 1 310 ? -18.935 59.117 38.460 1.00 28.97 ? 340  GLN B C    1 
ATOM   4986 O  O    . GLN B 1 310 ? -19.261 59.563 37.361 1.00 36.14 ? 340  GLN B O    1 
ATOM   4987 C  CB   . GLN B 1 310 ? -18.950 56.648 38.954 1.00 32.29 ? 340  GLN B CB   1 
ATOM   4988 C  CG   . GLN B 1 310 ? -19.920 56.223 37.860 1.00 41.62 ? 340  GLN B CG   1 
ATOM   4989 C  CD   . GLN B 1 310 ? -19.236 56.067 36.506 1.00 41.81 ? 340  GLN B CD   1 
ATOM   4990 O  OE1  . GLN B 1 310 ? -19.205 56.994 35.703 1.00 42.60 ? 340  GLN B OE1  1 
ATOM   4991 N  NE2  . GLN B 1 310 ? -18.713 54.885 36.244 1.00 45.24 ? 340  GLN B NE2  1 
ATOM   4992 N  N    . TYR B 1 311 ? -19.268 59.718 39.594 1.00 26.13 ? 341  TYR B N    1 
ATOM   4993 C  CA   . TYR B 1 311 ? -20.054 60.950 39.565 1.00 24.92 ? 341  TYR B CA   1 
ATOM   4994 C  C    . TYR B 1 311 ? -19.295 62.041 38.808 1.00 24.17 ? 341  TYR B C    1 
ATOM   4995 O  O    . TYR B 1 311 ? -19.895 62.891 38.148 1.00 28.07 ? 341  TYR B O    1 
ATOM   4996 C  CB   . TYR B 1 311 ? -20.375 61.428 40.979 1.00 26.15 ? 341  TYR B CB   1 
ATOM   4997 C  CG   . TYR B 1 311 ? -21.572 60.756 41.603 1.00 26.61 ? 341  TYR B CG   1 
ATOM   4998 C  CD1  . TYR B 1 311 ? -22.839 60.922 41.057 1.00 23.40 ? 341  TYR B CD1  1 
ATOM   4999 C  CD2  . TYR B 1 311 ? -21.439 59.953 42.741 1.00 25.21 ? 341  TYR B CD2  1 
ATOM   5000 C  CE1  . TYR B 1 311 ? -23.945 60.315 41.619 1.00 26.31 ? 341  TYR B CE1  1 
ATOM   5001 C  CE2  . TYR B 1 311 ? -22.550 59.335 43.314 1.00 27.28 ? 341  TYR B CE2  1 
ATOM   5002 C  CZ   . TYR B 1 311 ? -23.798 59.521 42.745 1.00 27.94 ? 341  TYR B CZ   1 
ATOM   5003 O  OH   . TYR B 1 311 ? -24.910 58.921 43.293 1.00 35.81 ? 341  TYR B OH   1 
ATOM   5004 N  N    . MET B 1 312 ? -17.973 61.997 38.887 1.00 22.56 ? 342  MET B N    1 
ATOM   5005 C  CA   . MET B 1 312 ? -17.128 62.962 38.211 1.00 25.12 ? 342  MET B CA   1 
ATOM   5006 C  C    . MET B 1 312 ? -17.308 62.821 36.694 1.00 27.17 ? 342  MET B C    1 
ATOM   5007 O  O    . MET B 1 312 ? -17.383 63.814 35.967 1.00 27.37 ? 342  MET B O    1 
ATOM   5008 C  CB   . MET B 1 312 ? -15.668 62.731 38.603 1.00 27.20 ? 342  MET B CB   1 
ATOM   5009 C  CG   . MET B 1 312 ? -14.901 63.988 38.995 1.00 37.57 ? 342  MET B CG   1 
ATOM   5010 S  SD   . MET B 1 312 ? -15.580 64.858 40.442 1.00 37.82 ? 342  MET B SD   1 
ATOM   5011 C  CE   . MET B 1 312 ? -16.744 65.960 39.668 1.00 38.13 ? 342  MET B CE   1 
ATOM   5012 N  N    . GLU B 1 313 ? -17.397 61.582 36.223 1.00 25.62 ? 343  GLU B N    1 
ATOM   5013 C  CA   . GLU B 1 313 ? -17.586 61.319 34.802 1.00 27.50 ? 343  GLU B CA   1 
ATOM   5014 C  C    . GLU B 1 313 ? -18.983 61.737 34.370 1.00 27.70 ? 343  GLU B C    1 
ATOM   5015 O  O    . GLU B 1 313 ? -19.191 62.160 33.228 1.00 26.00 ? 343  GLU B O    1 
ATOM   5016 C  CB   . GLU B 1 313 ? -17.342 59.843 34.492 1.00 25.92 ? 343  GLU B CB   1 
ATOM   5017 C  CG   . GLU B 1 313 ? -15.912 59.397 34.776 1.00 30.55 ? 343  GLU B CG   1 
ATOM   5018 C  CD   . GLU B 1 313 ? -14.859 60.283 34.099 1.00 35.62 ? 343  GLU B CD   1 
ATOM   5019 O  OE1  . GLU B 1 313 ? -15.107 60.794 32.986 1.00 39.91 ? 343  GLU B OE1  1 
ATOM   5020 O  OE2  . GLU B 1 313 ? -13.774 60.467 34.684 1.00 37.14 ? 343  GLU B OE2  1 
ATOM   5021 N  N    . GLU B 1 314 ? -19.916 61.670 35.317 1.00 29.43 ? 344  GLU B N    1 
ATOM   5022 C  CA   . GLU B 1 314 ? -21.309 62.043 35.099 1.00 32.85 ? 344  GLU B CA   1 
ATOM   5023 C  C    . GLU B 1 314 ? -21.358 63.514 34.691 1.00 35.22 ? 344  GLU B C    1 
ATOM   5024 O  O    . GLU B 1 314 ? -21.944 63.870 33.662 1.00 36.47 ? 344  GLU B O    1 
ATOM   5025 C  CB   . GLU B 1 314 ? -22.091 61.816 36.390 1.00 34.82 ? 344  GLU B CB   1 
ATOM   5026 C  CG   . GLU B 1 314 ? -23.565 61.560 36.210 1.00 45.74 ? 344  GLU B CG   1 
ATOM   5027 C  CD   . GLU B 1 314 ? -24.142 60.737 37.350 1.00 51.30 ? 344  GLU B CD   1 
ATOM   5028 O  OE1  . GLU B 1 314 ? -23.512 59.722 37.727 1.00 54.76 ? 344  GLU B OE1  1 
ATOM   5029 O  OE2  . GLU B 1 314 ? -25.224 61.097 37.864 1.00 54.93 ? 344  GLU B OE2  1 
ATOM   5030 N  N    . ILE B 1 315 ? -20.712 64.364 35.485 1.00 35.19 ? 345  ILE B N    1 
ATOM   5031 C  CA   . ILE B 1 315 ? -20.652 65.792 35.195 1.00 34.09 ? 345  ILE B CA   1 
ATOM   5032 C  C    . ILE B 1 315 ? -19.913 65.981 33.876 1.00 35.09 ? 345  ILE B C    1 
ATOM   5033 O  O    . ILE B 1 315 ? -20.337 66.757 33.015 1.00 33.20 ? 345  ILE B O    1 
ATOM   5034 C  CB   . ILE B 1 315 ? -19.908 66.568 36.313 1.00 30.65 ? 345  ILE B CB   1 
ATOM   5035 C  CG1  . ILE B 1 315 ? -20.784 66.621 37.572 1.00 34.98 ? 345  ILE B CG1  1 
ATOM   5036 C  CG2  . ILE B 1 315 ? -19.531 67.973 35.842 1.00 25.53 ? 345  ILE B CG2  1 
ATOM   5037 C  CD1  . ILE B 1 315 ? -20.167 67.367 38.739 1.00 35.39 ? 345  ILE B CD1  1 
ATOM   5038 N  N    . TYR B 1 316 ? -18.831 65.227 33.713 1.00 36.78 ? 346  TYR B N    1 
ATOM   5039 C  CA   . TYR B 1 316 ? -18.012 65.304 32.514 1.00 40.94 ? 346  TYR B CA   1 
ATOM   5040 C  C    . TYR B 1 316 ? -18.832 65.175 31.233 1.00 43.29 ? 346  TYR B C    1 
ATOM   5041 O  O    . TYR B 1 316 ? -18.739 66.025 30.347 1.00 44.23 ? 346  TYR B O    1 
ATOM   5042 C  CB   . TYR B 1 316 ? -16.907 64.247 32.548 1.00 41.31 ? 346  TYR B CB   1 
ATOM   5043 C  CG   . TYR B 1 316 ? -15.807 64.503 31.547 1.00 44.50 ? 346  TYR B CG   1 
ATOM   5044 C  CD1  . TYR B 1 316 ? -14.862 65.503 31.765 1.00 45.37 ? 346  TYR B CD1  1 
ATOM   5045 C  CD2  . TYR B 1 316 ? -15.722 63.759 30.373 1.00 47.56 ? 346  TYR B CD2  1 
ATOM   5046 C  CE1  . TYR B 1 316 ? -13.863 65.757 30.840 1.00 49.54 ? 346  TYR B CE1  1 
ATOM   5047 C  CE2  . TYR B 1 316 ? -14.726 64.002 29.441 1.00 48.78 ? 346  TYR B CE2  1 
ATOM   5048 C  CZ   . TYR B 1 316 ? -13.799 65.004 29.679 1.00 50.35 ? 346  TYR B CZ   1 
ATOM   5049 O  OH   . TYR B 1 316 ? -12.807 65.247 28.755 1.00 54.97 ? 346  TYR B OH   1 
ATOM   5050 N  N    . HIS B 1 317 ? -19.677 64.153 31.162 1.00 41.81 ? 347  HIS B N    1 
ATOM   5051 C  CA   . HIS B 1 317 ? -20.498 63.942 29.976 1.00 41.50 ? 347  HIS B CA   1 
ATOM   5052 C  C    . HIS B 1 317 ? -21.603 64.984 29.789 1.00 42.31 ? 347  HIS B C    1 
ATOM   5053 O  O    . HIS B 1 317 ? -22.181 65.084 28.711 1.00 44.01 ? 347  HIS B O    1 
ATOM   5054 C  CB   . HIS B 1 317 ? -21.094 62.538 29.989 1.00 40.79 ? 347  HIS B CB   1 
ATOM   5055 C  CG   . HIS B 1 317 ? -20.071 61.453 30.079 1.00 42.86 ? 347  HIS B CG   1 
ATOM   5056 N  ND1  . HIS B 1 317 ? -20.284 60.286 30.776 1.00 45.62 ? 347  HIS B ND1  1 
ATOM   5057 C  CD2  . HIS B 1 317 ? -18.811 61.373 29.583 1.00 43.77 ? 347  HIS B CD2  1 
ATOM   5058 C  CE1  . HIS B 1 317 ? -19.199 59.531 30.714 1.00 44.78 ? 347  HIS B CE1  1 
ATOM   5059 N  NE2  . HIS B 1 317 ? -18.293 60.170 29.996 1.00 42.88 ? 347  HIS B NE2  1 
ATOM   5060 N  N    . ARG B 1 318 ? -21.921 65.733 30.841 1.00 43.74 ? 348  ARG B N    1 
ATOM   5061 C  CA   . ARG B 1 318 ? -22.956 66.771 30.770 1.00 44.66 ? 348  ARG B CA   1 
ATOM   5062 C  C    . ARG B 1 318 ? -22.389 68.122 30.312 1.00 42.22 ? 348  ARG B C    1 
ATOM   5063 O  O    . ARG B 1 318 ? -23.147 69.032 29.975 1.00 43.02 ? 348  ARG B O    1 
ATOM   5064 C  CB   . ARG B 1 318 ? -23.609 66.983 32.144 1.00 49.70 ? 348  ARG B CB   1 
ATOM   5065 C  CG   . ARG B 1 318 ? -24.770 66.069 32.525 1.00 55.74 ? 348  ARG B CG   1 
ATOM   5066 C  CD   . ARG B 1 318 ? -25.353 66.547 33.862 1.00 61.85 ? 348  ARG B CD   1 
ATOM   5067 N  NE   . ARG B 1 318 ? -26.556 65.823 34.275 1.00 68.95 ? 348  ARG B NE   1 
ATOM   5068 C  CZ   . ARG B 1 318 ? -27.302 66.143 35.336 1.00 71.76 ? 348  ARG B CZ   1 
ATOM   5069 N  NH1  . ARG B 1 318 ? -26.973 67.172 36.106 1.00 70.24 ? 348  ARG B NH1  1 
ATOM   5070 N  NH2  . ARG B 1 318 ? -28.393 65.439 35.622 1.00 72.91 ? 348  ARG B NH2  1 
ATOM   5071 N  N    . ILE B 1 319 ? -21.068 68.263 30.340 1.00 39.62 ? 349  ILE B N    1 
ATOM   5072 C  CA   . ILE B 1 319 ? -20.405 69.513 29.975 1.00 39.73 ? 349  ILE B CA   1 
ATOM   5073 C  C    . ILE B 1 319 ? -20.742 70.059 28.581 1.00 43.05 ? 349  ILE B C    1 
ATOM   5074 O  O    . ILE B 1 319 ? -20.378 69.466 27.559 1.00 42.16 ? 349  ILE B O    1 
ATOM   5075 C  CB   . ILE B 1 319 ? -18.861 69.395 30.128 1.00 35.03 ? 349  ILE B CB   1 
ATOM   5076 C  CG1  . ILE B 1 319 ? -18.496 68.988 31.555 1.00 30.66 ? 349  ILE B CG1  1 
ATOM   5077 C  CG2  . ILE B 1 319 ? -18.181 70.727 29.809 1.00 35.96 ? 349  ILE B CG2  1 
ATOM   5078 C  CD1  . ILE B 1 319 ? -17.015 68.735 31.746 1.00 22.85 ? 349  ILE B CD1  1 
ATOM   5079 N  N    . PRO B 1 320 ? -21.463 71.196 28.526 1.00 45.42 ? 350  PRO B N    1 
ATOM   5080 C  CA   . PRO B 1 320 ? -21.835 71.808 27.247 1.00 46.11 ? 350  PRO B CA   1 
ATOM   5081 C  C    . PRO B 1 320 ? -20.673 72.632 26.709 1.00 47.57 ? 350  PRO B C    1 
ATOM   5082 O  O    . PRO B 1 320 ? -20.049 73.394 27.446 1.00 46.72 ? 350  PRO B O    1 
ATOM   5083 C  CB   . PRO B 1 320 ? -23.024 72.686 27.626 1.00 43.52 ? 350  PRO B CB   1 
ATOM   5084 C  CG   . PRO B 1 320 ? -22.664 73.150 28.987 1.00 47.72 ? 350  PRO B CG   1 
ATOM   5085 C  CD   . PRO B 1 320 ? -22.095 71.908 29.653 1.00 46.74 ? 350  PRO B CD   1 
ATOM   5086 N  N    . ASP B 1 321 ? -20.385 72.479 25.421 1.00 52.27 ? 351  ASP B N    1 
ATOM   5087 C  CA   . ASP B 1 321 ? -19.283 73.203 24.783 1.00 52.80 ? 351  ASP B CA   1 
ATOM   5088 C  C    . ASP B 1 321 ? -19.423 74.718 24.876 1.00 50.09 ? 351  ASP B C    1 
ATOM   5089 O  O    . ASP B 1 321 ? -18.438 75.433 25.049 1.00 49.70 ? 351  ASP B O    1 
ATOM   5090 C  CB   . ASP B 1 321 ? -19.152 72.786 23.315 1.00 54.14 ? 351  ASP B CB   1 
ATOM   5091 C  CG   . ASP B 1 321 ? -18.784 71.326 23.159 1.00 57.76 ? 351  ASP B CG   1 
ATOM   5092 O  OD1  . ASP B 1 321 ? -17.594 70.997 23.352 1.00 62.24 ? 351  ASP B OD1  1 
ATOM   5093 O  OD2  . ASP B 1 321 ? -19.682 70.510 22.852 1.00 57.70 ? 351  ASP B OD2  1 
ATOM   5094 N  N    . SER B 1 322 ? -20.660 75.192 24.791 1.00 47.31 ? 352  SER B N    1 
ATOM   5095 C  CA   . SER B 1 322 ? -20.949 76.616 24.844 1.00 46.27 ? 352  SER B CA   1 
ATOM   5096 C  C    . SER B 1 322 ? -20.866 77.228 26.240 1.00 44.90 ? 352  SER B C    1 
ATOM   5097 O  O    . SER B 1 322 ? -21.043 78.441 26.403 1.00 43.01 ? 352  SER B O    1 
ATOM   5098 C  CB   . SER B 1 322 ? -22.329 76.866 24.236 1.00 47.26 ? 352  SER B CB   1 
ATOM   5099 O  OG   . SER B 1 322 ? -23.209 75.793 24.535 1.00 54.05 ? 352  SER B OG   1 
ATOM   5100 N  N    . ASP B 1 323 ? -20.589 76.394 27.241 1.00 44.67 ? 353  ASP B N    1 
ATOM   5101 C  CA   . ASP B 1 323 ? -20.496 76.854 28.625 1.00 40.69 ? 353  ASP B CA   1 
ATOM   5102 C  C    . ASP B 1 323 ? -19.207 77.624 28.910 1.00 37.38 ? 353  ASP B C    1 
ATOM   5103 O  O    . ASP B 1 323 ? -18.108 77.138 28.638 1.00 38.21 ? 353  ASP B O    1 
ATOM   5104 C  CB   . ASP B 1 323 ? -20.612 75.675 29.590 1.00 41.30 ? 353  ASP B CB   1 
ATOM   5105 C  CG   . ASP B 1 323 ? -20.726 76.117 31.030 1.00 38.32 ? 353  ASP B CG   1 
ATOM   5106 O  OD1  . ASP B 1 323 ? -21.835 76.513 31.442 1.00 35.72 ? 353  ASP B OD1  1 
ATOM   5107 O  OD2  . ASP B 1 323 ? -19.702 76.094 31.740 1.00 40.07 ? 353  ASP B OD2  1 
ATOM   5108 N  N    . PRO B 1 324 ? -19.328 78.807 29.534 1.00 32.24 ? 354  PRO B N    1 
ATOM   5109 C  CA   . PRO B 1 324 ? -18.213 79.689 29.891 1.00 32.85 ? 354  PRO B CA   1 
ATOM   5110 C  C    . PRO B 1 324 ? -17.142 79.018 30.745 1.00 35.32 ? 354  PRO B C    1 
ATOM   5111 O  O    . PRO B 1 324 ? -15.977 79.413 30.708 1.00 34.65 ? 354  PRO B O    1 
ATOM   5112 C  CB   . PRO B 1 324 ? -18.901 80.802 30.676 1.00 32.74 ? 354  PRO B CB   1 
ATOM   5113 C  CG   . PRO B 1 324 ? -20.263 80.860 30.054 1.00 31.29 ? 354  PRO B CG   1 
ATOM   5114 C  CD   . PRO B 1 324 ? -20.612 79.406 29.937 1.00 30.36 ? 354  PRO B CD   1 
ATOM   5115 N  N    . SER B 1 325 ? -17.544 78.016 31.523 1.00 38.02 ? 355  SER B N    1 
ATOM   5116 C  CA   . SER B 1 325 ? -16.623 77.306 32.406 1.00 38.38 ? 355  SER B CA   1 
ATOM   5117 C  C    . SER B 1 325 ? -16.182 75.938 31.902 1.00 39.18 ? 355  SER B C    1 
ATOM   5118 O  O    . SER B 1 325 ? -15.214 75.383 32.422 1.00 38.91 ? 355  SER B O    1 
ATOM   5119 C  CB   . SER B 1 325 ? -17.253 77.143 33.794 1.00 39.25 ? 355  SER B CB   1 
ATOM   5120 O  OG   . SER B 1 325 ? -17.769 78.372 34.274 1.00 37.69 ? 355  SER B OG   1 
ATOM   5121 N  N    . SER B 1 326 ? -16.862 75.417 30.881 1.00 39.34 ? 356  SER B N    1 
ATOM   5122 C  CA   . SER B 1 326 ? -16.568 74.093 30.313 1.00 41.16 ? 356  SER B CA   1 
ATOM   5123 C  C    . SER B 1 326 ? -15.101 73.647 30.384 1.00 40.26 ? 356  SER B C    1 
ATOM   5124 O  O    . SER B 1 326 ? -14.810 72.491 30.694 1.00 36.37 ? 356  SER B O    1 
ATOM   5125 C  CB   . SER B 1 326 ? -17.070 74.013 28.864 1.00 44.84 ? 356  SER B CB   1 
ATOM   5126 O  OG   . SER B 1 326 ? -16.482 75.018 28.052 1.00 50.54 ? 356  SER B OG   1 
ATOM   5127 N  N    . SER B 1 327 ? -14.188 74.579 30.125 1.00 41.26 ? 357  SER B N    1 
ATOM   5128 C  CA   . SER B 1 327 ? -12.754 74.302 30.157 1.00 40.82 ? 357  SER B CA   1 
ATOM   5129 C  C    . SER B 1 327 ? -12.269 74.048 31.578 1.00 39.92 ? 357  SER B C    1 
ATOM   5130 O  O    . SER B 1 327 ? -11.567 73.066 31.830 1.00 36.27 ? 357  SER B O    1 
ATOM   5131 C  CB   . SER B 1 327 ? -11.975 75.470 29.545 1.00 44.33 ? 357  SER B CB   1 
ATOM   5132 O  OG   . SER B 1 327 ? -10.576 75.265 29.655 1.00 50.54 ? 357  SER B OG   1 
ATOM   5133 N  N    . LYS B 1 328 ? -12.644 74.937 32.499 1.00 38.77 ? 358  LYS B N    1 
ATOM   5134 C  CA   . LYS B 1 328 ? -12.251 74.815 33.900 1.00 37.38 ? 358  LYS B CA   1 
ATOM   5135 C  C    . LYS B 1 328 ? -12.777 73.493 34.435 1.00 35.29 ? 358  LYS B C    1 
ATOM   5136 O  O    . LYS B 1 328 ? -12.057 72.744 35.097 1.00 36.35 ? 358  LYS B O    1 
ATOM   5137 C  CB   . LYS B 1 328 ? -12.861 75.931 34.750 1.00 43.54 ? 358  LYS B CB   1 
ATOM   5138 C  CG   . LYS B 1 328 ? -12.787 77.340 34.191 1.00 49.33 ? 358  LYS B CG   1 
ATOM   5139 C  CD   . LYS B 1 328 ? -13.725 78.243 34.993 1.00 52.93 ? 358  LYS B CD   1 
ATOM   5140 C  CE   . LYS B 1 328 ? -13.933 79.598 34.344 1.00 56.89 ? 358  LYS B CE   1 
ATOM   5141 N  NZ   . LYS B 1 328 ? -14.978 80.382 35.069 1.00 58.08 ? 358  LYS B NZ   1 
ATOM   5142 N  N    . THR B 1 329 ? -14.038 73.207 34.129 1.00 33.56 ? 359  THR B N    1 
ATOM   5143 C  CA   . THR B 1 329 ? -14.680 71.986 34.590 1.00 33.15 ? 359  THR B CA   1 
ATOM   5144 C  C    . THR B 1 329 ? -13.920 70.754 34.124 1.00 35.18 ? 359  THR B C    1 
ATOM   5145 O  O    . THR B 1 329 ? -13.679 69.835 34.909 1.00 35.79 ? 359  THR B O    1 
ATOM   5146 C  CB   . THR B 1 329 ? -16.145 71.917 34.132 1.00 31.21 ? 359  THR B CB   1 
ATOM   5147 O  OG1  . THR B 1 329 ? -16.774 73.182 34.375 1.00 26.95 ? 359  THR B OG1  1 
ATOM   5148 C  CG2  . THR B 1 329 ? -16.891 70.848 34.910 1.00 28.11 ? 359  THR B CG2  1 
ATOM   5149 N  N    . ARG B 1 330 ? -13.492 70.761 32.867 1.00 35.23 ? 360  ARG B N    1 
ATOM   5150 C  CA   . ARG B 1 330 ? -12.747 69.629 32.331 1.00 37.38 ? 360  ARG B CA   1 
ATOM   5151 C  C    . ARG B 1 330 ? -11.390 69.487 33.004 1.00 34.29 ? 360  ARG B C    1 
ATOM   5152 O  O    . ARG B 1 330 ? -10.935 68.376 33.292 1.00 32.16 ? 360  ARG B O    1 
ATOM   5153 C  CB   . ARG B 1 330 ? -12.570 69.765 30.814 1.00 41.06 ? 360  ARG B CB   1 
ATOM   5154 C  CG   . ARG B 1 330 ? -13.871 69.669 30.040 1.00 44.16 ? 360  ARG B CG   1 
ATOM   5155 C  CD   . ARG B 1 330 ? -13.629 69.423 28.564 1.00 48.73 ? 360  ARG B CD   1 
ATOM   5156 N  NE   . ARG B 1 330 ? -14.875 69.493 27.808 1.00 50.52 ? 360  ARG B NE   1 
ATOM   5157 C  CZ   . ARG B 1 330 ? -15.275 70.569 27.139 1.00 51.09 ? 360  ARG B CZ   1 
ATOM   5158 N  NH1  . ARG B 1 330 ? -14.521 71.661 27.132 1.00 50.63 ? 360  ARG B NH1  1 
ATOM   5159 N  NH2  . ARG B 1 330 ? -16.444 70.567 26.509 1.00 50.98 ? 360  ARG B NH2  1 
ATOM   5160 N  N    . GLN B 1 331 ? -10.759 70.619 33.280 1.00 34.35 ? 361  GLN B N    1 
ATOM   5161 C  CA   . GLN B 1 331 ? -9.451  70.616 33.908 1.00 36.23 ? 361  GLN B CA   1 
ATOM   5162 C  C    . GLN B 1 331 ? -9.483  70.050 35.322 1.00 35.22 ? 361  GLN B C    1 
ATOM   5163 O  O    . GLN B 1 331 ? -8.633  69.237 35.685 1.00 36.14 ? 361  GLN B O    1 
ATOM   5164 C  CB   . GLN B 1 331 ? -8.858  72.021 33.936 1.00 40.51 ? 361  GLN B CB   1 
ATOM   5165 C  CG   . GLN B 1 331 ? -7.341  72.012 33.906 1.00 50.80 ? 361  GLN B CG   1 
ATOM   5166 C  CD   . GLN B 1 331 ? -6.723  73.178 34.639 1.00 54.91 ? 361  GLN B CD   1 
ATOM   5167 O  OE1  . GLN B 1 331 ? -7.322  74.246 34.761 1.00 58.96 ? 361  GLN B OE1  1 
ATOM   5168 N  NE2  . GLN B 1 331 ? -5.519  72.972 35.152 1.00 53.32 ? 361  GLN B NE2  1 
ATOM   5169 N  N    . ILE B 1 332 ? -10.446 70.481 36.132 1.00 33.86 ? 362  ILE B N    1 
ATOM   5170 C  CA   . ILE B 1 332 ? -10.527 69.988 37.503 1.00 31.39 ? 362  ILE B CA   1 
ATOM   5171 C  C    . ILE B 1 332 ? -10.824 68.482 37.514 1.00 30.52 ? 362  ILE B C    1 
ATOM   5172 O  O    . ILE B 1 332 ? -10.156 67.720 38.214 1.00 29.71 ? 362  ILE B O    1 
ATOM   5173 C  CB   . ILE B 1 332 ? -11.540 70.814 38.370 1.00 32.61 ? 362  ILE B CB   1 
ATOM   5174 C  CG1  . ILE B 1 332 ? -11.554 70.308 39.823 1.00 28.29 ? 362  ILE B CG1  1 
ATOM   5175 C  CG2  . ILE B 1 332 ? -12.938 70.808 37.747 1.00 26.74 ? 362  ILE B CG2  1 
ATOM   5176 C  CD1  . ILE B 1 332 ? -10.198 70.328 40.506 1.00 22.25 ? 362  ILE B CD1  1 
ATOM   5177 N  N    . ILE B 1 333 ? -11.760 68.049 36.674 1.00 30.12 ? 363  ILE B N    1 
ATOM   5178 C  CA   . ILE B 1 333 ? -12.105 66.632 36.586 1.00 29.03 ? 363  ILE B CA   1 
ATOM   5179 C  C    . ILE B 1 333 ? -10.889 65.806 36.165 1.00 29.91 ? 363  ILE B C    1 
ATOM   5180 O  O    . ILE B 1 333 ? -10.595 64.766 36.771 1.00 30.41 ? 363  ILE B O    1 
ATOM   5181 C  CB   . ILE B 1 333 ? -13.289 66.383 35.619 1.00 24.55 ? 363  ILE B CB   1 
ATOM   5182 C  CG1  . ILE B 1 333 ? -14.566 66.979 36.212 1.00 22.36 ? 363  ILE B CG1  1 
ATOM   5183 C  CG2  . ILE B 1 333 ? -13.462 64.885 35.355 1.00 26.22 ? 363  ILE B CG2  1 
ATOM   5184 C  CD1  . ILE B 1 333 ? -15.798 66.759 35.382 1.00 21.98 ? 363  ILE B CD1  1 
ATOM   5185 N  N    . SER B 1 334 ? -10.158 66.280 35.162 1.00 29.83 ? 364  SER B N    1 
ATOM   5186 C  CA   . SER B 1 334 ? -8.975  65.561 34.705 1.00 33.57 ? 364  SER B CA   1 
ATOM   5187 C  C    . SER B 1 334 ? -7.969  65.447 35.837 1.00 32.42 ? 364  SER B C    1 
ATOM   5188 O  O    . SER B 1 334 ? -7.272  64.435 35.963 1.00 33.05 ? 364  SER B O    1 
ATOM   5189 C  CB   . SER B 1 334 ? -8.350  66.255 33.496 1.00 36.65 ? 364  SER B CB   1 
ATOM   5190 O  OG   . SER B 1 334 ? -9.226  66.195 32.382 1.00 48.30 ? 364  SER B OG   1 
ATOM   5191 N  N    . THR B 1 335 ? -7.922  66.477 36.674 1.00 34.65 ? 365  THR B N    1 
ATOM   5192 C  CA   . THR B 1 335 ? -7.028  66.507 37.821 1.00 36.64 ? 365  THR B CA   1 
ATOM   5193 C  C    . THR B 1 335 ? -7.419  65.425 38.826 1.00 37.56 ? 365  THR B C    1 
ATOM   5194 O  O    . THR B 1 335 ? -6.548  64.777 39.410 1.00 37.61 ? 365  THR B O    1 
ATOM   5195 C  CB   . THR B 1 335 ? -7.044  67.891 38.507 1.00 37.86 ? 365  THR B CB   1 
ATOM   5196 O  OG1  . THR B 1 335 ? -6.356  68.841 37.678 1.00 35.48 ? 365  THR B OG1  1 
ATOM   5197 C  CG2  . THR B 1 335 ? -6.382  67.826 39.882 1.00 35.54 ? 365  THR B CG2  1 
ATOM   5198 N  N    . ILE B 1 336 ? -8.720  65.226 39.018 1.00 37.54 ? 366  ILE B N    1 
ATOM   5199 C  CA   . ILE B 1 336 ? -9.196  64.202 39.944 1.00 38.05 ? 366  ILE B CA   1 
ATOM   5200 C  C    . ILE B 1 336 ? -8.854  62.823 39.365 1.00 38.37 ? 366  ILE B C    1 
ATOM   5201 O  O    . ILE B 1 336 ? -8.373  61.947 40.075 1.00 36.97 ? 366  ILE B O    1 
ATOM   5202 C  CB   . ILE B 1 336 ? -10.736 64.275 40.170 1.00 41.24 ? 366  ILE B CB   1 
ATOM   5203 C  CG1  . ILE B 1 336 ? -11.195 65.713 40.442 1.00 39.95 ? 366  ILE B CG1  1 
ATOM   5204 C  CG2  . ILE B 1 336 ? -11.138 63.371 41.338 1.00 40.92 ? 366  ILE B CG2  1 
ATOM   5205 C  CD1  . ILE B 1 336 ? -10.626 66.317 41.684 1.00 40.26 ? 366  ILE B CD1  1 
ATOM   5206 N  N    . ARG B 1 337 ? -9.076  62.654 38.065 1.00 38.66 ? 367  ARG B N    1 
ATOM   5207 C  CA   . ARG B 1 337 ? -8.798  61.392 37.377 1.00 39.66 ? 367  ARG B CA   1 
ATOM   5208 C  C    . ARG B 1 337 ? -7.379  60.868 37.554 1.00 39.90 ? 367  ARG B C    1 
ATOM   5209 O  O    . ARG B 1 337 ? -7.179  59.744 37.995 1.00 38.49 ? 367  ARG B O    1 
ATOM   5210 C  CB   . ARG B 1 337 ? -9.003  61.537 35.872 1.00 40.93 ? 367  ARG B CB   1 
ATOM   5211 C  CG   . ARG B 1 337 ? -10.406 61.636 35.371 1.00 40.09 ? 367  ARG B CG   1 
ATOM   5212 C  CD   . ARG B 1 337 ? -10.341 61.683 33.861 1.00 40.89 ? 367  ARG B CD   1 
ATOM   5213 N  NE   . ARG B 1 337 ? -11.657 61.797 33.256 1.00 47.53 ? 367  ARG B NE   1 
ATOM   5214 C  CZ   . ARG B 1 337 ? -12.007 62.755 32.407 1.00 50.45 ? 367  ARG B CZ   1 
ATOM   5215 N  NH1  . ARG B 1 337 ? -11.135 63.693 32.051 1.00 50.14 ? 367  ARG B NH1  1 
ATOM   5216 N  NH2  . ARG B 1 337 ? -13.248 62.792 31.946 1.00 52.35 ? 367  ARG B NH2  1 
ATOM   5217 N  N    . THR B 1 338 ? -6.407  61.661 37.110 1.00 44.00 ? 368  THR B N    1 
ATOM   5218 C  CA   . THR B 1 338 ? -4.998  61.278 37.155 1.00 49.13 ? 368  THR B CA   1 
ATOM   5219 C  C    . THR B 1 338 ? -4.351  61.403 38.528 1.00 50.83 ? 368  THR B C    1 
ATOM   5220 O  O    . THR B 1 338 ? -3.242  60.910 38.748 1.00 50.16 ? 368  THR B O    1 
ATOM   5221 C  CB   . THR B 1 338 ? -4.185  62.097 36.132 1.00 48.31 ? 368  THR B CB   1 
ATOM   5222 O  OG1  . THR B 1 338 ? -4.146  63.470 36.535 1.00 53.71 ? 368  THR B OG1  1 
ATOM   5223 C  CG2  . THR B 1 338 ? -4.847  62.031 34.781 1.00 45.55 ? 368  THR B CG2  1 
ATOM   5224 N  N    . GLN B 1 339 ? -5.102  61.985 39.455 1.00 55.79 ? 369  GLN B N    1 
ATOM   5225 C  CA   . GLN B 1 339 ? -4.675  62.236 40.826 1.00 60.17 ? 369  GLN B CA   1 
ATOM   5226 C  C    . GLN B 1 339 ? -4.280  60.992 41.627 1.00 62.13 ? 369  GLN B C    1 
ATOM   5227 O  O    . GLN B 1 339 ? -3.180  60.470 41.447 1.00 63.60 ? 369  GLN B O    1 
ATOM   5228 C  CB   . GLN B 1 339 ? -5.787  63.008 41.523 1.00 61.66 ? 369  GLN B CB   1 
ATOM   5229 C  CG   . GLN B 1 339 ? -5.420  63.735 42.783 1.00 63.87 ? 369  GLN B CG   1 
ATOM   5230 C  CD   . GLN B 1 339 ? -6.526  64.678 43.194 1.00 64.30 ? 369  GLN B CD   1 
ATOM   5231 O  OE1  . GLN B 1 339 ? -7.482  64.287 43.871 1.00 62.16 ? 369  GLN B OE1  1 
ATOM   5232 N  NE2  . GLN B 1 339 ? -6.425  65.924 42.749 1.00 63.66 ? 369  GLN B NE2  1 
ATOM   5233 N  N    . ASN B 1 340 ? -5.149  60.542 42.530 1.00 65.14 ? 370  ASN B N    1 
ATOM   5234 C  CA   . ASN B 1 340 ? -4.867  59.369 43.358 1.00 67.51 ? 370  ASN B CA   1 
ATOM   5235 C  C    . ASN B 1 340 ? -6.161  58.767 43.912 1.00 68.47 ? 370  ASN B C    1 
ATOM   5236 O  O    . ASN B 1 340 ? -6.489  57.625 43.530 1.00 67.96 ? 370  ASN B O    1 
ATOM   5237 C  CB   . ASN B 1 340 ? -3.941  59.749 44.518 1.00 66.10 ? 370  ASN B CB   1 
ATOM   5238 C  CG   . ASN B 1 340 ? -3.320  58.536 45.199 1.00 65.84 ? 370  ASN B CG   1 
ATOM   5239 O  OD1  . ASN B 1 340 ? -4.009  57.592 45.590 1.00 62.54 ? 370  ASN B OD1  1 
ATOM   5240 N  ND2  . ASN B 1 340 ? -2.004  58.563 45.347 1.00 68.43 ? 370  ASN B ND2  1 
ATOM   5241 O  OXT  . ASN B 1 340 ? -6.834  59.449 44.714 1.00 70.60 ? 370  ASN B OXT  1 
ATOM   5242 N  N    . ASN C 1 8   ? -23.872 12.706 47.232 1.00 36.28 ? 38   ASN C N    1 
ATOM   5243 C  CA   . ASN C 1 8   ? -25.208 12.917 46.593 1.00 35.92 ? 38   ASN C CA   1 
ATOM   5244 C  C    . ASN C 1 8   ? -26.241 13.389 47.588 1.00 33.00 ? 38   ASN C C    1 
ATOM   5245 O  O    . ASN C 1 8   ? -27.089 14.209 47.253 1.00 34.34 ? 38   ASN C O    1 
ATOM   5246 C  CB   . ASN C 1 8   ? -25.711 11.639 45.913 1.00 38.43 ? 38   ASN C CB   1 
ATOM   5247 C  CG   . ASN C 1 8   ? -25.368 11.593 44.438 1.00 45.44 ? 38   ASN C CG   1 
ATOM   5248 O  OD1  . ASN C 1 8   ? -24.203 11.725 44.060 1.00 51.95 ? 38   ASN C OD1  1 
ATOM   5249 N  ND2  . ASN C 1 8   ? -26.379 11.432 43.596 1.00 48.25 ? 38   ASN C ND2  1 
ATOM   5250 N  N    . SER C 1 9   ? -26.167 12.882 48.815 1.00 28.97 ? 39   SER C N    1 
ATOM   5251 C  CA   . SER C 1 9   ? -27.113 13.274 49.851 1.00 24.57 ? 39   SER C CA   1 
ATOM   5252 C  C    . SER C 1 9   ? -26.856 14.707 50.305 1.00 20.47 ? 39   SER C C    1 
ATOM   5253 O  O    . SER C 1 9   ? -27.793 15.448 50.585 1.00 19.89 ? 39   SER C O    1 
ATOM   5254 C  CB   . SER C 1 9   ? -27.044 12.291 51.021 1.00 27.39 ? 39   SER C CB   1 
ATOM   5255 O  OG   . SER C 1 9   ? -25.732 11.758 51.142 1.00 34.35 ? 39   SER C OG   1 
ATOM   5256 N  N    . LEU C 1 10  ? -25.590 15.111 50.353 1.00 17.14 ? 40   LEU C N    1 
ATOM   5257 C  CA   . LEU C 1 10  ? -25.286 16.476 50.757 1.00 22.54 ? 40   LEU C CA   1 
ATOM   5258 C  C    . LEU C 1 10  ? -25.800 17.417 49.681 1.00 24.10 ? 40   LEU C C    1 
ATOM   5259 O  O    . LEU C 1 10  ? -26.369 18.466 49.981 1.00 30.11 ? 40   LEU C O    1 
ATOM   5260 C  CB   . LEU C 1 10  ? -23.791 16.693 50.968 1.00 23.77 ? 40   LEU C CB   1 
ATOM   5261 C  CG   . LEU C 1 10  ? -23.467 18.053 51.595 1.00 21.35 ? 40   LEU C CG   1 
ATOM   5262 C  CD1  . LEU C 1 10  ? -24.179 18.177 52.937 1.00 19.36 ? 40   LEU C CD1  1 
ATOM   5263 C  CD2  . LEU C 1 10  ? -21.965 18.209 51.758 1.00 21.85 ? 40   LEU C CD2  1 
ATOM   5264 N  N    . LYS C 1 11  ? -25.602 17.033 48.425 1.00 24.39 ? 41   LYS C N    1 
ATOM   5265 C  CA   . LYS C 1 11  ? -26.079 17.836 47.305 1.00 24.19 ? 41   LYS C CA   1 
ATOM   5266 C  C    . LYS C 1 11  ? -27.606 17.928 47.380 1.00 21.47 ? 41   LYS C C    1 
ATOM   5267 O  O    . LYS C 1 11  ? -28.174 19.009 47.273 1.00 26.60 ? 41   LYS C O    1 
ATOM   5268 C  CB   . LYS C 1 11  ? -25.631 17.224 45.976 1.00 27.40 ? 41   LYS C CB   1 
ATOM   5269 C  CG   . LYS C 1 11  ? -24.133 17.282 45.739 1.00 26.78 ? 41   LYS C CG   1 
ATOM   5270 C  CD   . LYS C 1 11  ? -23.800 16.800 44.341 1.00 36.20 ? 41   LYS C CD   1 
ATOM   5271 C  CE   . LYS C 1 11  ? -22.341 17.048 43.985 1.00 39.82 ? 41   LYS C CE   1 
ATOM   5272 N  NZ   . LYS C 1 11  ? -22.053 16.610 42.582 1.00 43.71 ? 41   LYS C NZ   1 
ATOM   5273 N  N    . THR C 1 12  ? -28.270 16.808 47.628 1.00 18.56 ? 42   THR C N    1 
ATOM   5274 C  CA   . THR C 1 12  ? -29.719 16.816 47.741 1.00 21.06 ? 42   THR C CA   1 
ATOM   5275 C  C    . THR C 1 12  ? -30.129 17.763 48.865 1.00 22.11 ? 42   THR C C    1 
ATOM   5276 O  O    . THR C 1 12  ? -31.109 18.501 48.737 1.00 24.54 ? 42   THR C O    1 
ATOM   5277 C  CB   . THR C 1 12  ? -30.266 15.410 48.013 1.00 23.50 ? 42   THR C CB   1 
ATOM   5278 O  OG1  . THR C 1 12  ? -29.831 14.532 46.966 1.00 26.28 ? 42   THR C OG1  1 
ATOM   5279 C  CG2  . THR C 1 12  ? -31.793 15.422 48.060 1.00 24.24 ? 42   THR C CG2  1 
ATOM   5280 N  N    . CYS C 1 13  ? -29.360 17.765 49.951 1.00 22.00 ? 43   CYS C N    1 
ATOM   5281 C  CA   . CYS C 1 13  ? -29.635 18.655 51.074 1.00 18.92 ? 43   CYS C CA   1 
ATOM   5282 C  C    . CYS C 1 13  ? -29.594 20.110 50.639 1.00 15.05 ? 43   CYS C C    1 
ATOM   5283 O  O    . CYS C 1 13  ? -30.472 20.889 50.998 1.00 18.30 ? 43   CYS C O    1 
ATOM   5284 C  CB   . CYS C 1 13  ? -28.650 18.421 52.218 1.00 21.64 ? 43   CYS C CB   1 
ATOM   5285 S  SG   . CYS C 1 13  ? -29.036 16.963 53.208 1.00 21.77 ? 43   CYS C SG   1 
ATOM   5286 N  N    . TYR C 1 14  ? -28.588 20.486 49.862 1.00 13.90 ? 44   TYR C N    1 
ATOM   5287 C  CA   . TYR C 1 14  ? -28.510 21.870 49.397 1.00 19.27 ? 44   TYR C CA   1 
ATOM   5288 C  C    . TYR C 1 14  ? -29.604 22.216 48.381 1.00 19.89 ? 44   TYR C C    1 
ATOM   5289 O  O    . TYR C 1 14  ? -30.022 23.369 48.289 1.00 23.55 ? 44   TYR C O    1 
ATOM   5290 C  CB   . TYR C 1 14  ? -27.127 22.194 48.848 1.00 19.11 ? 44   TYR C CB   1 
ATOM   5291 C  CG   . TYR C 1 14  ? -26.137 22.517 49.929 1.00 18.60 ? 44   TYR C CG   1 
ATOM   5292 C  CD1  . TYR C 1 14  ? -25.392 21.509 50.548 1.00 21.43 ? 44   TYR C CD1  1 
ATOM   5293 C  CD2  . TYR C 1 14  ? -25.950 23.827 50.351 1.00 15.98 ? 44   TYR C CD2  1 
ATOM   5294 C  CE1  . TYR C 1 14  ? -24.478 21.808 51.565 1.00 22.74 ? 44   TYR C CE1  1 
ATOM   5295 C  CE2  . TYR C 1 14  ? -25.046 24.135 51.361 1.00 20.21 ? 44   TYR C CE2  1 
ATOM   5296 C  CZ   . TYR C 1 14  ? -24.317 23.125 51.962 1.00 22.37 ? 44   TYR C CZ   1 
ATOM   5297 O  OH   . TYR C 1 14  ? -23.444 23.440 52.966 1.00 27.15 ? 44   TYR C OH   1 
ATOM   5298 N  N    . LYS C 1 15  ? -30.047 21.237 47.599 1.00 18.90 ? 45   LYS C N    1 
ATOM   5299 C  CA   . LYS C 1 15  ? -31.123 21.484 46.658 1.00 21.97 ? 45   LYS C CA   1 
ATOM   5300 C  C    . LYS C 1 15  ? -32.335 21.853 47.512 1.00 22.54 ? 45   LYS C C    1 
ATOM   5301 O  O    . LYS C 1 15  ? -32.962 22.892 47.296 1.00 27.07 ? 45   LYS C O    1 
ATOM   5302 C  CB   . LYS C 1 15  ? -31.437 20.241 45.828 1.00 25.19 ? 45   LYS C CB   1 
ATOM   5303 C  CG   . LYS C 1 15  ? -32.559 20.474 44.816 1.00 27.64 ? 45   LYS C CG   1 
ATOM   5304 C  CD   . LYS C 1 15  ? -33.523 19.308 44.767 1.00 29.79 ? 45   LYS C CD   1 
ATOM   5305 C  CE   . LYS C 1 15  ? -32.812 18.027 44.381 1.00 28.88 ? 45   LYS C CE   1 
ATOM   5306 N  NZ   . LYS C 1 15  ? -33.774 16.902 44.263 1.00 33.06 ? 45   LYS C NZ   1 
ATOM   5307 N  N    . TYR C 1 16  ? -32.628 21.028 48.517 1.00 24.06 ? 46   TYR C N    1 
ATOM   5308 C  CA   . TYR C 1 16  ? -33.745 21.285 49.426 1.00 20.81 ? 46   TYR C CA   1 
ATOM   5309 C  C    . TYR C 1 16  ? -33.618 22.639 50.096 1.00 18.04 ? 46   TYR C C    1 
ATOM   5310 O  O    . TYR C 1 16  ? -34.594 23.367 50.199 1.00 21.47 ? 46   TYR C O    1 
ATOM   5311 C  CB   . TYR C 1 16  ? -33.857 20.198 50.498 1.00 24.35 ? 46   TYR C CB   1 
ATOM   5312 C  CG   . TYR C 1 16  ? -34.288 18.853 49.968 1.00 26.17 ? 46   TYR C CG   1 
ATOM   5313 C  CD1  . TYR C 1 16  ? -34.815 18.726 48.681 1.00 25.66 ? 46   TYR C CD1  1 
ATOM   5314 C  CD2  . TYR C 1 16  ? -34.158 17.701 50.750 1.00 31.48 ? 46   TYR C CD2  1 
ATOM   5315 C  CE1  . TYR C 1 16  ? -35.203 17.485 48.181 1.00 30.52 ? 46   TYR C CE1  1 
ATOM   5316 C  CE2  . TYR C 1 16  ? -34.545 16.447 50.260 1.00 32.29 ? 46   TYR C CE2  1 
ATOM   5317 C  CZ   . TYR C 1 16  ? -35.066 16.351 48.973 1.00 34.60 ? 46   TYR C CZ   1 
ATOM   5318 O  OH   . TYR C 1 16  ? -35.449 15.129 48.478 1.00 34.50 ? 46   TYR C OH   1 
ATOM   5319 N  N    . LEU C 1 17  ? -32.417 22.980 50.542 1.00 17.67 ? 47   LEU C N    1 
ATOM   5320 C  CA   . LEU C 1 17  ? -32.192 24.267 51.196 1.00 20.31 ? 47   LEU C CA   1 
ATOM   5321 C  C    . LEU C 1 17  ? -32.638 25.393 50.263 1.00 21.66 ? 47   LEU C C    1 
ATOM   5322 O  O    . LEU C 1 17  ? -33.315 26.338 50.666 1.00 23.46 ? 47   LEU C O    1 
ATOM   5323 C  CB   . LEU C 1 17  ? -30.706 24.433 51.529 1.00 18.01 ? 47   LEU C CB   1 
ATOM   5324 C  CG   . LEU C 1 17  ? -30.283 25.751 52.189 1.00 19.95 ? 47   LEU C CG   1 
ATOM   5325 C  CD1  . LEU C 1 17  ? -30.811 25.790 53.618 1.00 15.59 ? 47   LEU C CD1  1 
ATOM   5326 C  CD2  . LEU C 1 17  ? -28.752 25.900 52.161 1.00 16.21 ? 47   LEU C CD2  1 
ATOM   5327 N  N    . ASN C 1 18  ? -32.287 25.251 48.996 1.00 22.51 ? 48   ASN C N    1 
ATOM   5328 C  CA   . ASN C 1 18  ? -32.630 26.243 48.003 1.00 22.90 ? 48   ASN C CA   1 
ATOM   5329 C  C    . ASN C 1 18  ? -34.107 26.276 47.674 1.00 23.49 ? 48   ASN C C    1 
ATOM   5330 O  O    . ASN C 1 18  ? -34.662 27.346 47.485 1.00 27.46 ? 48   ASN C O    1 
ATOM   5331 C  CB   . ASN C 1 18  ? -31.785 26.043 46.754 1.00 16.15 ? 48   ASN C CB   1 
ATOM   5332 C  CG   . ASN C 1 18  ? -30.396 26.590 46.924 1.00 13.58 ? 48   ASN C CG   1 
ATOM   5333 O  OD1  . ASN C 1 18  ? -30.205 27.796 46.949 1.00 16.29 ? 48   ASN C OD1  1 
ATOM   5334 N  ND2  . ASN C 1 18  ? -29.422 25.712 47.094 1.00 11.66 ? 48   ASN C ND2  1 
ATOM   5335 N  N    . GLN C 1 19  ? -34.756 25.120 47.621 1.00 27.23 ? 49   GLN C N    1 
ATOM   5336 C  CA   . GLN C 1 19  ? -36.180 25.109 47.322 1.00 30.51 ? 49   GLN C CA   1 
ATOM   5337 C  C    . GLN C 1 19  ? -37.020 25.466 48.547 1.00 32.78 ? 49   GLN C C    1 
ATOM   5338 O  O    . GLN C 1 19  ? -38.195 25.792 48.416 1.00 34.12 ? 49   GLN C O    1 
ATOM   5339 C  CB   . GLN C 1 19  ? -36.627 23.781 46.681 1.00 33.44 ? 49   GLN C CB   1 
ATOM   5340 C  CG   . GLN C 1 19  ? -36.377 22.520 47.486 1.00 38.72 ? 49   GLN C CG   1 
ATOM   5341 C  CD   . GLN C 1 19  ? -36.603 21.235 46.680 1.00 41.11 ? 49   GLN C CD   1 
ATOM   5342 O  OE1  . GLN C 1 19  ? -36.081 21.065 45.581 1.00 43.72 ? 49   GLN C OE1  1 
ATOM   5343 N  NE2  . GLN C 1 19  ? -37.344 20.312 47.254 1.00 42.67 ? 49   GLN C NE2  1 
ATOM   5344 N  N    . THR C 1 20  ? -36.415 25.449 49.731 1.00 34.65 ? 50   THR C N    1 
ATOM   5345 C  CA   . THR C 1 20  ? -37.140 25.793 50.953 1.00 36.22 ? 50   THR C CA   1 
ATOM   5346 C  C    . THR C 1 20  ? -36.807 27.196 51.451 1.00 34.97 ? 50   THR C C    1 
ATOM   5347 O  O    . THR C 1 20  ? -37.471 27.707 52.352 1.00 35.96 ? 50   THR C O    1 
ATOM   5348 C  CB   . THR C 1 20  ? -36.875 24.781 52.095 1.00 39.59 ? 50   THR C CB   1 
ATOM   5349 O  OG1  . THR C 1 20  ? -35.474 24.747 52.397 1.00 43.64 ? 50   THR C OG1  1 
ATOM   5350 C  CG2  . THR C 1 20  ? -37.347 23.385 51.697 1.00 39.01 ? 50   THR C CG2  1 
ATOM   5351 N  N    . SER C 1 21  ? -35.767 27.804 50.889 1.00 36.45 ? 51   SER C N    1 
ATOM   5352 C  CA   . SER C 1 21  ? -35.364 29.154 51.272 1.00 38.18 ? 51   SER C CA   1 
ATOM   5353 C  C    . SER C 1 21  ? -35.349 30.095 50.072 1.00 40.70 ? 51   SER C C    1 
ATOM   5354 O  O    . SER C 1 21  ? -34.467 30.006 49.217 1.00 41.80 ? 51   SER C O    1 
ATOM   5355 C  CB   . SER C 1 21  ? -33.979 29.144 51.918 1.00 34.28 ? 51   SER C CB   1 
ATOM   5356 O  OG   . SER C 1 21  ? -33.625 30.448 52.345 1.00 34.40 ? 51   SER C OG   1 
ATOM   5357 N  N    . ARG C 1 22  ? -36.280 31.048 50.069 1.00 46.28 ? 52   ARG C N    1 
ATOM   5358 C  CA   . ARG C 1 22  ? -36.411 32.030 48.986 1.00 45.96 ? 52   ARG C CA   1 
ATOM   5359 C  C    . ARG C 1 22  ? -35.127 32.778 48.629 1.00 45.10 ? 52   ARG C C    1 
ATOM   5360 O  O    . ARG C 1 22  ? -34.825 32.951 47.450 1.00 50.06 ? 52   ARG C O    1 
ATOM   5361 C  CB   . ARG C 1 22  ? -37.500 33.064 49.315 1.00 46.82 ? 52   ARG C CB   1 
ATOM   5362 C  CG   . ARG C 1 22  ? -38.895 32.495 49.542 1.00 49.02 ? 52   ARG C CG   1 
ATOM   5363 C  CD   . ARG C 1 22  ? -39.588 32.085 48.248 1.00 49.10 ? 52   ARG C CD   1 
ATOM   5364 N  NE   . ARG C 1 22  ? -40.914 31.515 48.504 1.00 52.04 ? 52   ARG C NE   1 
ATOM   5365 C  CZ   . ARG C 1 22  ? -41.985 32.218 48.870 1.00 53.57 ? 52   ARG C CZ   1 
ATOM   5366 N  NH1  . ARG C 1 22  ? -41.916 33.535 49.024 1.00 53.89 ? 52   ARG C NH1  1 
ATOM   5367 N  NH2  . ARG C 1 22  ? -43.132 31.595 49.107 1.00 58.30 ? 52   ARG C NH2  1 
ATOM   5368 N  N    . SER C 1 23  ? -34.370 33.220 49.630 1.00 42.24 ? 53   SER C N    1 
ATOM   5369 C  CA   . SER C 1 23  ? -33.150 33.977 49.356 1.00 38.96 ? 53   SER C CA   1 
ATOM   5370 C  C    . SER C 1 23  ? -32.023 33.786 50.366 1.00 36.34 ? 53   SER C C    1 
ATOM   5371 O  O    . SER C 1 23  ? -30.879 34.175 50.111 1.00 38.70 ? 53   SER C O    1 
ATOM   5372 C  CB   . SER C 1 23  ? -33.485 35.464 49.297 1.00 40.50 ? 53   SER C CB   1 
ATOM   5373 O  OG   . SER C 1 23  ? -34.000 35.883 50.550 1.00 40.15 ? 53   SER C OG   1 
ATOM   5374 N  N    . PHE C 1 24  ? -32.335 33.192 51.511 1.00 30.26 ? 54   PHE C N    1 
ATOM   5375 C  CA   . PHE C 1 24  ? -31.325 32.999 52.541 1.00 25.19 ? 54   PHE C CA   1 
ATOM   5376 C  C    . PHE C 1 24  ? -30.320 31.868 52.273 1.00 21.12 ? 54   PHE C C    1 
ATOM   5377 O  O    . PHE C 1 24  ? -29.203 31.897 52.787 1.00 22.92 ? 54   PHE C O    1 
ATOM   5378 C  CB   . PHE C 1 24  ? -32.005 32.816 53.897 1.00 24.76 ? 54   PHE C CB   1 
ATOM   5379 C  CG   . PHE C 1 24  ? -31.213 33.360 55.034 1.00 26.36 ? 54   PHE C CG   1 
ATOM   5380 C  CD1  . PHE C 1 24  ? -30.695 34.649 54.975 1.00 29.07 ? 54   PHE C CD1  1 
ATOM   5381 C  CD2  . PHE C 1 24  ? -30.977 32.590 56.165 1.00 28.27 ? 54   PHE C CD2  1 
ATOM   5382 C  CE1  . PHE C 1 24  ? -29.955 35.165 56.023 1.00 28.17 ? 54   PHE C CE1  1 
ATOM   5383 C  CE2  . PHE C 1 24  ? -30.239 33.098 57.223 1.00 26.55 ? 54   PHE C CE2  1 
ATOM   5384 C  CZ   . PHE C 1 24  ? -29.725 34.385 57.154 1.00 28.74 ? 54   PHE C CZ   1 
ATOM   5385 N  N    . ALA C 1 25  ? -30.702 30.889 51.458 1.00 16.68 ? 55   ALA C N    1 
ATOM   5386 C  CA   . ALA C 1 25  ? -29.819 29.770 51.136 1.00 16.51 ? 55   ALA C CA   1 
ATOM   5387 C  C    . ALA C 1 25  ? -28.460 30.239 50.651 1.00 18.97 ? 55   ALA C C    1 
ATOM   5388 O  O    . ALA C 1 25  ? -27.441 29.627 50.975 1.00 22.36 ? 55   ALA C O    1 
ATOM   5389 C  CB   . ALA C 1 25  ? -30.455 28.871 50.092 1.00 17.48 ? 55   ALA C CB   1 
ATOM   5390 N  N    . ALA C 1 26  ? -28.440 31.332 49.890 1.00 19.12 ? 56   ALA C N    1 
ATOM   5391 C  CA   . ALA C 1 26  ? -27.192 31.893 49.366 1.00 18.19 ? 56   ALA C CA   1 
ATOM   5392 C  C    . ALA C 1 26  ? -26.309 32.402 50.501 1.00 15.62 ? 56   ALA C C    1 
ATOM   5393 O  O    . ALA C 1 26  ? -25.080 32.284 50.450 1.00 13.04 ? 56   ALA C O    1 
ATOM   5394 C  CB   . ALA C 1 26  ? -27.490 33.030 48.394 1.00 17.50 ? 56   ALA C CB   1 
ATOM   5395 N  N    . VAL C 1 27  ? -26.946 32.980 51.519 1.00 15.06 ? 57   VAL C N    1 
ATOM   5396 C  CA   . VAL C 1 27  ? -26.233 33.518 52.687 1.00 15.36 ? 57   VAL C CA   1 
ATOM   5397 C  C    . VAL C 1 27  ? -25.640 32.372 53.496 1.00 11.79 ? 57   VAL C C    1 
ATOM   5398 O  O    . VAL C 1 27  ? -24.495 32.444 53.939 1.00 13.64 ? 57   VAL C O    1 
ATOM   5399 C  CB   . VAL C 1 27  ? -27.177 34.370 53.585 1.00 19.09 ? 57   VAL C CB   1 
ATOM   5400 C  CG1  . VAL C 1 27  ? -26.376 35.110 54.654 1.00 15.67 ? 57   VAL C CG1  1 
ATOM   5401 C  CG2  . VAL C 1 27  ? -27.959 35.364 52.725 1.00 23.48 ? 57   VAL C CG2  1 
ATOM   5402 N  N    . ILE C 1 28  ? -26.418 31.307 53.656 1.00 12.00 ? 58   ILE C N    1 
ATOM   5403 C  CA   . ILE C 1 28  ? -25.979 30.121 54.384 1.00 15.40 ? 58   ILE C CA   1 
ATOM   5404 C  C    . ILE C 1 28  ? -24.821 29.470 53.640 1.00 16.59 ? 58   ILE C C    1 
ATOM   5405 O  O    . ILE C 1 28  ? -23.806 29.111 54.248 1.00 18.35 ? 58   ILE C O    1 
ATOM   5406 C  CB   . ILE C 1 28  ? -27.126 29.089 54.538 1.00 14.14 ? 58   ILE C CB   1 
ATOM   5407 C  CG1  . ILE C 1 28  ? -28.213 29.648 55.461 1.00 13.90 ? 58   ILE C CG1  1 
ATOM   5408 C  CG2  . ILE C 1 28  ? -26.584 27.768 55.066 1.00 16.52 ? 58   ILE C CG2  1 
ATOM   5409 C  CD1  . ILE C 1 28  ? -29.446 28.804 55.543 1.00 15.61 ? 58   ILE C CD1  1 
ATOM   5410 N  N    . GLN C 1 29  ? -24.949 29.375 52.318 1.00 17.63 ? 59   GLN C N    1 
ATOM   5411 C  CA   . GLN C 1 29  ? -23.906 28.774 51.484 1.00 18.98 ? 59   GLN C CA   1 
ATOM   5412 C  C    . GLN C 1 29  ? -22.598 29.564 51.540 1.00 19.46 ? 59   GLN C C    1 
ATOM   5413 O  O    . GLN C 1 29  ? -21.543 29.070 51.131 1.00 21.79 ? 59   GLN C O    1 
ATOM   5414 C  CB   . GLN C 1 29  ? -24.377 28.650 50.034 1.00 15.69 ? 59   GLN C CB   1 
ATOM   5415 C  CG   . GLN C 1 29  ? -25.263 27.447 49.747 1.00 16.17 ? 59   GLN C CG   1 
ATOM   5416 C  CD   . GLN C 1 29  ? -25.840 27.467 48.335 1.00 19.38 ? 59   GLN C CD   1 
ATOM   5417 O  OE1  . GLN C 1 29  ? -25.203 27.948 47.393 1.00 20.83 ? 59   GLN C OE1  1 
ATOM   5418 N  NE2  . GLN C 1 29  ? -27.028 26.906 48.176 1.00 16.43 ? 59   GLN C NE2  1 
ATOM   5419 N  N    . ALA C 1 30  ? -22.667 30.786 52.060 1.00 17.18 ? 60   ALA C N    1 
ATOM   5420 C  CA   . ALA C 1 30  ? -21.486 31.629 52.155 1.00 16.92 ? 60   ALA C CA   1 
ATOM   5421 C  C    . ALA C 1 30  ? -20.747 31.536 53.492 1.00 20.37 ? 60   ALA C C    1 
ATOM   5422 O  O    . ALA C 1 30  ? -19.697 32.163 53.652 1.00 22.73 ? 60   ALA C O    1 
ATOM   5423 C  CB   . ALA C 1 30  ? -21.856 33.067 51.857 1.00 18.96 ? 60   ALA C CB   1 
ATOM   5424 N  N    . LEU C 1 31  ? -21.277 30.754 54.437 1.00 18.20 ? 61   LEU C N    1 
ATOM   5425 C  CA   . LEU C 1 31  ? -20.647 30.590 55.753 1.00 17.14 ? 61   LEU C CA   1 
ATOM   5426 C  C    . LEU C 1 31  ? -19.322 29.833 55.673 1.00 16.99 ? 61   LEU C C    1 
ATOM   5427 O  O    . LEU C 1 31  ? -19.211 28.857 54.939 1.00 18.17 ? 61   LEU C O    1 
ATOM   5428 C  CB   . LEU C 1 31  ? -21.591 29.865 56.722 1.00 12.81 ? 61   LEU C CB   1 
ATOM   5429 C  CG   . LEU C 1 31  ? -22.768 30.664 57.265 1.00 9.03  ? 61   LEU C CG   1 
ATOM   5430 C  CD1  . LEU C 1 31  ? -23.830 29.725 57.792 1.00 9.62  ? 61   LEU C CD1  1 
ATOM   5431 C  CD2  . LEU C 1 31  ? -22.299 31.641 58.337 1.00 10.42 ? 61   LEU C CD2  1 
ATOM   5432 N  N    . ASP C 1 32  ? -18.342 30.272 56.461 1.00 15.78 ? 62   ASP C N    1 
ATOM   5433 C  CA   . ASP C 1 32  ? -17.017 29.654 56.501 1.00 17.68 ? 62   ASP C CA   1 
ATOM   5434 C  C    . ASP C 1 32  ? -16.997 28.215 57.006 1.00 18.95 ? 62   ASP C C    1 
ATOM   5435 O  O    . ASP C 1 32  ? -17.689 27.857 57.968 1.00 22.06 ? 62   ASP C O    1 
ATOM   5436 C  CB   . ASP C 1 32  ? -16.066 30.443 57.409 1.00 20.97 ? 62   ASP C CB   1 
ATOM   5437 C  CG   . ASP C 1 32  ? -15.712 31.813 56.868 1.00 25.21 ? 62   ASP C CG   1 
ATOM   5438 O  OD1  . ASP C 1 32  ? -16.041 32.137 55.711 1.00 26.70 ? 62   ASP C OD1  1 
ATOM   5439 O  OD2  . ASP C 1 32  ? -15.072 32.575 57.618 1.00 24.82 ? 62   ASP C OD2  1 
ATOM   5440 N  N    . GLY C 1 33  ? -16.120 27.427 56.400 1.00 19.78 ? 63   GLY C N    1 
ATOM   5441 C  CA   . GLY C 1 33  ? -15.927 26.043 56.785 1.00 17.26 ? 63   GLY C CA   1 
ATOM   5442 C  C    . GLY C 1 33  ? -17.114 25.237 57.253 1.00 18.53 ? 63   GLY C C    1 
ATOM   5443 O  O    . GLY C 1 33  ? -18.185 25.248 56.634 1.00 17.06 ? 63   GLY C O    1 
ATOM   5444 N  N    . GLU C 1 34  ? -16.908 24.542 58.370 1.00 17.13 ? 64   GLU C N    1 
ATOM   5445 C  CA   . GLU C 1 34  ? -17.909 23.668 58.973 1.00 20.69 ? 64   GLU C CA   1 
ATOM   5446 C  C    . GLU C 1 34  ? -19.263 24.292 59.296 1.00 20.45 ? 64   GLU C C    1 
ATOM   5447 O  O    . GLU C 1 34  ? -20.249 23.577 59.486 1.00 24.03 ? 64   GLU C O    1 
ATOM   5448 C  CB   . GLU C 1 34  ? -17.332 22.997 60.222 1.00 22.65 ? 64   GLU C CB   1 
ATOM   5449 C  CG   . GLU C 1 34  ? -16.220 21.999 59.916 1.00 28.29 ? 64   GLU C CG   1 
ATOM   5450 C  CD   . GLU C 1 34  ? -15.503 21.488 61.159 1.00 30.55 ? 64   GLU C CD   1 
ATOM   5451 O  OE1  . GLU C 1 34  ? -16.103 21.485 62.247 1.00 33.14 ? 64   GLU C OE1  1 
ATOM   5452 O  OE2  . GLU C 1 34  ? -14.329 21.083 61.044 1.00 37.30 ? 64   GLU C OE2  1 
ATOM   5453 N  N    . MET C 1 35  ? -19.324 25.614 59.378 1.00 21.81 ? 65   MET C N    1 
ATOM   5454 C  CA   . MET C 1 35  ? -20.591 26.260 59.683 1.00 19.41 ? 65   MET C CA   1 
ATOM   5455 C  C    . MET C 1 35  ? -21.577 26.037 58.553 1.00 18.01 ? 65   MET C C    1 
ATOM   5456 O  O    . MET C 1 35  ? -22.758 25.782 58.787 1.00 20.44 ? 65   MET C O    1 
ATOM   5457 C  CB   . MET C 1 35  ? -20.394 27.751 59.916 1.00 19.30 ? 65   MET C CB   1 
ATOM   5458 C  CG   . MET C 1 35  ? -19.652 28.065 61.194 1.00 19.74 ? 65   MET C CG   1 
ATOM   5459 S  SD   . MET C 1 35  ? -19.235 29.791 61.321 1.00 23.05 ? 65   MET C SD   1 
ATOM   5460 C  CE   . MET C 1 35  ? -19.431 30.046 63.013 1.00 31.43 ? 65   MET C CE   1 
ATOM   5461 N  N    . ARG C 1 36  ? -21.073 26.074 57.327 1.00 17.53 ? 66   ARG C N    1 
ATOM   5462 C  CA   . ARG C 1 36  ? -21.907 25.900 56.148 1.00 19.53 ? 66   ARG C CA   1 
ATOM   5463 C  C    . ARG C 1 36  ? -22.837 24.687 56.259 1.00 19.42 ? 66   ARG C C    1 
ATOM   5464 O  O    . ARG C 1 36  ? -24.058 24.844 56.385 1.00 20.12 ? 66   ARG C O    1 
ATOM   5465 C  CB   . ARG C 1 36  ? -21.019 25.789 54.915 1.00 20.65 ? 66   ARG C CB   1 
ATOM   5466 C  CG   . ARG C 1 36  ? -21.696 26.200 53.641 1.00 24.70 ? 66   ARG C CG   1 
ATOM   5467 C  CD   . ARG C 1 36  ? -20.808 25.923 52.450 1.00 32.84 ? 66   ARG C CD   1 
ATOM   5468 N  NE   . ARG C 1 36  ? -21.448 26.356 51.217 1.00 42.62 ? 66   ARG C NE   1 
ATOM   5469 C  CZ   . ARG C 1 36  ? -21.080 25.970 50.003 1.00 47.68 ? 66   ARG C CZ   1 
ATOM   5470 N  NH1  . ARG C 1 36  ? -20.069 25.127 49.850 1.00 53.90 ? 66   ARG C NH1  1 
ATOM   5471 N  NH2  . ARG C 1 36  ? -21.720 26.436 48.939 1.00 50.37 ? 66   ARG C NH2  1 
ATOM   5472 N  N    . ASN C 1 37  ? -22.259 23.488 56.281 1.00 18.10 ? 67   ASN C N    1 
ATOM   5473 C  CA   . ASN C 1 37  ? -23.050 22.261 56.381 1.00 19.07 ? 67   ASN C CA   1 
ATOM   5474 C  C    . ASN C 1 37  ? -23.919 22.192 57.628 1.00 19.18 ? 67   ASN C C    1 
ATOM   5475 O  O    . ASN C 1 37  ? -25.083 21.786 57.552 1.00 20.60 ? 67   ASN C O    1 
ATOM   5476 C  CB   . ASN C 1 37  ? -22.148 21.026 56.350 1.00 23.08 ? 67   ASN C CB   1 
ATOM   5477 C  CG   . ASN C 1 37  ? -21.603 20.736 54.976 1.00 24.68 ? 67   ASN C CG   1 
ATOM   5478 O  OD1  . ASN C 1 37  ? -21.786 21.512 54.048 1.00 21.05 ? 67   ASN C OD1  1 
ATOM   5479 N  ND2  . ASN C 1 37  ? -20.975 19.587 54.826 1.00 27.25 ? 67   ASN C ND2  1 
ATOM   5480 N  N    . ALA C 1 38  ? -23.343 22.551 58.776 1.00 18.77 ? 68   ALA C N    1 
ATOM   5481 C  CA   . ALA C 1 38  ? -24.065 22.524 60.047 1.00 16.54 ? 68   ALA C CA   1 
ATOM   5482 C  C    . ALA C 1 38  ? -25.324 23.377 59.976 1.00 13.48 ? 68   ALA C C    1 
ATOM   5483 O  O    . ALA C 1 38  ? -26.407 22.924 60.333 1.00 14.71 ? 68   ALA C O    1 
ATOM   5484 C  CB   . ALA C 1 38  ? -23.165 23.005 61.171 1.00 21.76 ? 68   ALA C CB   1 
ATOM   5485 N  N    . VAL C 1 39  ? -25.181 24.602 59.482 1.00 15.64 ? 69   VAL C N    1 
ATOM   5486 C  CA   . VAL C 1 39  ? -26.311 25.522 59.359 1.00 15.17 ? 69   VAL C CA   1 
ATOM   5487 C  C    . VAL C 1 39  ? -27.318 25.071 58.301 1.00 17.54 ? 69   VAL C C    1 
ATOM   5488 O  O    . VAL C 1 39  ? -28.527 25.243 58.473 1.00 20.43 ? 69   VAL C O    1 
ATOM   5489 C  CB   . VAL C 1 39  ? -25.837 26.953 59.062 1.00 14.56 ? 69   VAL C CB   1 
ATOM   5490 C  CG1  . VAL C 1 39  ? -27.041 27.879 58.893 1.00 15.12 ? 69   VAL C CG1  1 
ATOM   5491 C  CG2  . VAL C 1 39  ? -24.926 27.440 60.191 1.00 7.33  ? 69   VAL C CG2  1 
ATOM   5492 N  N    . CYS C 1 40  ? -26.825 24.492 57.210 1.00 20.37 ? 70   CYS C N    1 
ATOM   5493 C  CA   . CYS C 1 40  ? -27.706 23.987 56.156 1.00 18.94 ? 70   CYS C CA   1 
ATOM   5494 C  C    . CYS C 1 40  ? -28.587 22.870 56.732 1.00 19.84 ? 70   CYS C C    1 
ATOM   5495 O  O    . CYS C 1 40  ? -29.814 22.888 56.588 1.00 17.35 ? 70   CYS C O    1 
ATOM   5496 C  CB   . CYS C 1 40  ? -26.887 23.441 54.986 1.00 19.71 ? 70   CYS C CB   1 
ATOM   5497 S  SG   . CYS C 1 40  ? -27.892 22.535 53.802 1.00 18.89 ? 70   CYS C SG   1 
ATOM   5498 N  N    . ILE C 1 41  ? -27.959 21.918 57.421 1.00 17.72 ? 71   ILE C N    1 
ATOM   5499 C  CA   . ILE C 1 41  ? -28.695 20.814 58.026 1.00 17.45 ? 71   ILE C CA   1 
ATOM   5500 C  C    . ILE C 1 41  ? -29.614 21.339 59.131 1.00 16.10 ? 71   ILE C C    1 
ATOM   5501 O  O    . ILE C 1 41  ? -30.788 20.973 59.208 1.00 16.46 ? 71   ILE C O    1 
ATOM   5502 C  CB   . ILE C 1 41  ? -27.736 19.736 58.576 1.00 18.97 ? 71   ILE C CB   1 
ATOM   5503 C  CG1  . ILE C 1 41  ? -26.903 19.162 57.429 1.00 21.94 ? 71   ILE C CG1  1 
ATOM   5504 C  CG2  . ILE C 1 41  ? -28.513 18.616 59.253 1.00 14.26 ? 71   ILE C CG2  1 
ATOM   5505 C  CD1  . ILE C 1 41  ? -27.737 18.667 56.239 1.00 22.22 ? 71   ILE C CD1  1 
ATOM   5506 N  N    . PHE C 1 42  ? -29.093 22.225 59.964 1.00 12.97 ? 72   PHE C N    1 
ATOM   5507 C  CA   . PHE C 1 42  ? -29.893 22.796 61.035 1.00 15.83 ? 72   PHE C CA   1 
ATOM   5508 C  C    . PHE C 1 42  ? -31.134 23.492 60.443 1.00 17.41 ? 72   PHE C C    1 
ATOM   5509 O  O    . PHE C 1 42  ? -32.259 23.266 60.896 1.00 19.07 ? 72   PHE C O    1 
ATOM   5510 C  CB   . PHE C 1 42  ? -29.040 23.776 61.848 1.00 16.16 ? 72   PHE C CB   1 
ATOM   5511 C  CG   . PHE C 1 42  ? -29.674 24.219 63.133 1.00 19.42 ? 72   PHE C CG   1 
ATOM   5512 C  CD1  . PHE C 1 42  ? -30.484 23.351 63.861 1.00 19.91 ? 72   PHE C CD1  1 
ATOM   5513 C  CD2  . PHE C 1 42  ? -29.442 25.502 63.628 1.00 19.63 ? 72   PHE C CD2  1 
ATOM   5514 C  CE1  . PHE C 1 42  ? -31.057 23.748 65.065 1.00 22.25 ? 72   PHE C CE1  1 
ATOM   5515 C  CE2  . PHE C 1 42  ? -30.008 25.914 64.827 1.00 25.52 ? 72   PHE C CE2  1 
ATOM   5516 C  CZ   . PHE C 1 42  ? -30.820 25.032 65.552 1.00 26.52 ? 72   PHE C CZ   1 
ATOM   5517 N  N    . TYR C 1 43  ? -30.943 24.269 59.379 1.00 19.99 ? 73   TYR C N    1 
ATOM   5518 C  CA   . TYR C 1 43  ? -32.054 24.975 58.727 1.00 19.29 ? 73   TYR C CA   1 
ATOM   5519 C  C    . TYR C 1 43  ? -33.095 23.973 58.194 1.00 19.29 ? 73   TYR C C    1 
ATOM   5520 O  O    . TYR C 1 43  ? -34.310 24.159 58.364 1.00 19.48 ? 73   TYR C O    1 
ATOM   5521 C  CB   . TYR C 1 43  ? -31.519 25.868 57.587 1.00 17.71 ? 73   TYR C CB   1 
ATOM   5522 C  CG   . TYR C 1 43  ? -32.548 26.765 56.943 1.00 20.52 ? 73   TYR C CG   1 
ATOM   5523 C  CD1  . TYR C 1 43  ? -33.447 26.268 55.987 1.00 24.66 ? 73   TYR C CD1  1 
ATOM   5524 C  CD2  . TYR C 1 43  ? -32.645 28.108 57.300 1.00 19.98 ? 73   TYR C CD2  1 
ATOM   5525 C  CE1  . TYR C 1 43  ? -34.420 27.091 55.409 1.00 22.56 ? 73   TYR C CE1  1 
ATOM   5526 C  CE2  . TYR C 1 43  ? -33.607 28.938 56.733 1.00 22.97 ? 73   TYR C CE2  1 
ATOM   5527 C  CZ   . TYR C 1 43  ? -34.490 28.424 55.791 1.00 24.05 ? 73   TYR C CZ   1 
ATOM   5528 O  OH   . TYR C 1 43  ? -35.444 29.250 55.243 1.00 29.34 ? 73   TYR C OH   1 
ATOM   5529 N  N    . LEU C 1 44  ? -32.618 22.902 57.566 1.00 17.31 ? 74   LEU C N    1 
ATOM   5530 C  CA   . LEU C 1 44  ? -33.503 21.879 57.011 1.00 17.45 ? 74   LEU C CA   1 
ATOM   5531 C  C    . LEU C 1 44  ? -34.252 21.114 58.083 1.00 19.93 ? 74   LEU C C    1 
ATOM   5532 O  O    . LEU C 1 44  ? -35.415 20.762 57.901 1.00 21.72 ? 74   LEU C O    1 
ATOM   5533 C  CB   . LEU C 1 44  ? -32.712 20.898 56.147 1.00 18.99 ? 74   LEU C CB   1 
ATOM   5534 C  CG   . LEU C 1 44  ? -32.101 21.483 54.873 1.00 16.93 ? 74   LEU C CG   1 
ATOM   5535 C  CD1  . LEU C 1 44  ? -31.376 20.389 54.108 1.00 16.69 ? 74   LEU C CD1  1 
ATOM   5536 C  CD2  . LEU C 1 44  ? -33.194 22.113 54.018 1.00 15.27 ? 74   LEU C CD2  1 
ATOM   5537 N  N    . VAL C 1 45  ? -33.578 20.858 59.199 1.00 21.06 ? 75   VAL C N    1 
ATOM   5538 C  CA   . VAL C 1 45  ? -34.171 20.133 60.312 1.00 20.18 ? 75   VAL C CA   1 
ATOM   5539 C  C    . VAL C 1 45  ? -35.271 20.977 60.959 1.00 19.90 ? 75   VAL C C    1 
ATOM   5540 O  O    . VAL C 1 45  ? -36.382 20.492 61.215 1.00 18.15 ? 75   VAL C O    1 
ATOM   5541 C  CB   . VAL C 1 45  ? -33.081 19.728 61.327 1.00 22.41 ? 75   VAL C CB   1 
ATOM   5542 C  CG1  . VAL C 1 45  ? -33.690 19.345 62.648 1.00 31.35 ? 75   VAL C CG1  1 
ATOM   5543 C  CG2  . VAL C 1 45  ? -32.292 18.550 60.778 1.00 23.79 ? 75   VAL C CG2  1 
ATOM   5544 N  N    . LEU C 1 46  ? -34.976 22.253 61.174 1.00 20.84 ? 76   LEU C N    1 
ATOM   5545 C  CA   . LEU C 1 46  ? -35.950 23.170 61.753 1.00 22.71 ? 76   LEU C CA   1 
ATOM   5546 C  C    . LEU C 1 46  ? -37.122 23.289 60.780 1.00 24.77 ? 76   LEU C C    1 
ATOM   5547 O  O    . LEU C 1 46  ? -38.283 23.300 61.187 1.00 26.56 ? 76   LEU C O    1 
ATOM   5548 C  CB   . LEU C 1 46  ? -35.310 24.543 61.991 1.00 19.81 ? 76   LEU C CB   1 
ATOM   5549 C  CG   . LEU C 1 46  ? -34.161 24.571 63.003 1.00 22.04 ? 76   LEU C CG   1 
ATOM   5550 C  CD1  . LEU C 1 46  ? -33.393 25.872 62.885 1.00 16.09 ? 76   LEU C CD1  1 
ATOM   5551 C  CD2  . LEU C 1 46  ? -34.697 24.356 64.423 1.00 24.43 ? 76   LEU C CD2  1 
ATOM   5552 N  N    . ARG C 1 47  ? -36.808 23.318 59.488 1.00 28.06 ? 77   ARG C N    1 
ATOM   5553 C  CA   . ARG C 1 47  ? -37.822 23.422 58.448 1.00 28.73 ? 77   ARG C CA   1 
ATOM   5554 C  C    . ARG C 1 47  ? -38.775 22.229 58.468 1.00 29.85 ? 77   ARG C C    1 
ATOM   5555 O  O    . ARG C 1 47  ? -39.972 22.378 58.223 1.00 29.58 ? 77   ARG C O    1 
ATOM   5556 C  CB   . ARG C 1 47  ? -37.161 23.534 57.073 1.00 33.53 ? 77   ARG C CB   1 
ATOM   5557 C  CG   . ARG C 1 47  ? -38.065 24.131 56.018 1.00 38.83 ? 77   ARG C CG   1 
ATOM   5558 C  CD   . ARG C 1 47  ? -38.475 25.542 56.423 1.00 41.55 ? 77   ARG C CD   1 
ATOM   5559 N  NE   . ARG C 1 47  ? -39.597 26.033 55.637 1.00 44.50 ? 77   ARG C NE   1 
ATOM   5560 C  CZ   . ARG C 1 47  ? -39.592 27.173 54.955 1.00 46.08 ? 77   ARG C CZ   1 
ATOM   5561 N  NH1  . ARG C 1 47  ? -38.524 27.959 54.955 1.00 44.50 ? 77   ARG C NH1  1 
ATOM   5562 N  NH2  . ARG C 1 47  ? -40.672 27.531 54.277 1.00 50.83 ? 77   ARG C NH2  1 
ATOM   5563 N  N    . ALA C 1 48  ? -38.242 21.045 58.747 1.00 30.37 ? 78   ALA C N    1 
ATOM   5564 C  CA   . ALA C 1 48  ? -39.056 19.834 58.815 1.00 30.06 ? 78   ALA C CA   1 
ATOM   5565 C  C    . ALA C 1 48  ? -39.975 19.904 60.030 1.00 30.31 ? 78   ALA C C    1 
ATOM   5566 O  O    . ALA C 1 48  ? -41.180 19.629 59.946 1.00 30.47 ? 78   ALA C O    1 
ATOM   5567 C  CB   . ALA C 1 48  ? -38.159 18.603 58.903 1.00 31.21 ? 78   ALA C CB   1 
ATOM   5568 N  N    . LEU C 1 49  ? -39.408 20.316 61.153 1.00 29.99 ? 79   LEU C N    1 
ATOM   5569 C  CA   . LEU C 1 49  ? -40.163 20.426 62.387 1.00 33.60 ? 79   LEU C CA   1 
ATOM   5570 C  C    . LEU C 1 49  ? -41.273 21.472 62.272 1.00 37.34 ? 79   LEU C C    1 
ATOM   5571 O  O    . LEU C 1 49  ? -42.389 21.254 62.748 1.00 40.12 ? 79   LEU C O    1 
ATOM   5572 C  CB   . LEU C 1 49  ? -39.219 20.754 63.546 1.00 31.85 ? 79   LEU C CB   1 
ATOM   5573 C  CG   . LEU C 1 49  ? -39.783 20.695 64.962 1.00 33.88 ? 79   LEU C CG   1 
ATOM   5574 C  CD1  . LEU C 1 49  ? -40.686 19.477 65.131 1.00 32.49 ? 79   LEU C CD1  1 
ATOM   5575 C  CD2  . LEU C 1 49  ? -38.634 20.673 65.964 1.00 37.03 ? 79   LEU C CD2  1 
ATOM   5576 N  N    . ASP C 1 50  ? -40.975 22.591 61.617 1.00 37.62 ? 80   ASP C N    1 
ATOM   5577 C  CA   . ASP C 1 50  ? -41.957 23.653 61.442 1.00 38.08 ? 80   ASP C CA   1 
ATOM   5578 C  C    . ASP C 1 50  ? -43.116 23.210 60.562 1.00 38.03 ? 80   ASP C C    1 
ATOM   5579 O  O    . ASP C 1 50  ? -44.279 23.496 60.860 1.00 39.25 ? 80   ASP C O    1 
ATOM   5580 C  CB   . ASP C 1 50  ? -41.295 24.906 60.876 1.00 44.10 ? 80   ASP C CB   1 
ATOM   5581 C  CG   . ASP C 1 50  ? -40.746 25.805 61.959 1.00 52.85 ? 80   ASP C CG   1 
ATOM   5582 O  OD1  . ASP C 1 50  ? -41.542 26.593 62.517 1.00 59.26 ? 80   ASP C OD1  1 
ATOM   5583 O  OD2  . ASP C 1 50  ? -39.537 25.720 62.272 1.00 53.97 ? 80   ASP C OD2  1 
ATOM   5584 N  N    . THR C 1 51  ? -42.806 22.497 59.487 1.00 37.07 ? 81   THR C N    1 
ATOM   5585 C  CA   . THR C 1 51  ? -43.835 22.002 58.585 1.00 36.94 ? 81   THR C CA   1 
ATOM   5586 C  C    . THR C 1 51  ? -44.809 21.170 59.426 1.00 41.40 ? 81   THR C C    1 
ATOM   5587 O  O    . THR C 1 51  ? -46.033 21.370 59.371 1.00 40.04 ? 81   THR C O    1 
ATOM   5588 C  CB   . THR C 1 51  ? -43.209 21.154 57.456 1.00 36.15 ? 81   THR C CB   1 
ATOM   5589 O  OG1  . THR C 1 51  ? -42.298 21.966 56.701 1.00 33.45 ? 81   THR C OG1  1 
ATOM   5590 C  CG2  . THR C 1 51  ? -44.275 20.613 56.531 1.00 35.45 ? 81   THR C CG2  1 
ATOM   5591 N  N    . LEU C 1 52  ? -44.246 20.303 60.265 1.00 42.71 ? 82   LEU C N    1 
ATOM   5592 C  CA   . LEU C 1 52  ? -45.034 19.452 61.148 1.00 43.82 ? 82   LEU C CA   1 
ATOM   5593 C  C    . LEU C 1 52  ? -45.905 20.244 62.124 1.00 44.10 ? 82   LEU C C    1 
ATOM   5594 O  O    . LEU C 1 52  ? -47.113 20.013 62.211 1.00 44.58 ? 82   LEU C O    1 
ATOM   5595 C  CB   . LEU C 1 52  ? -44.119 18.526 61.957 1.00 42.05 ? 82   LEU C CB   1 
ATOM   5596 C  CG   . LEU C 1 52  ? -43.462 17.331 61.275 1.00 43.89 ? 82   LEU C CG   1 
ATOM   5597 C  CD1  . LEU C 1 52  ? -42.455 16.717 62.227 1.00 42.69 ? 82   LEU C CD1  1 
ATOM   5598 C  CD2  . LEU C 1 52  ? -44.519 16.310 60.880 1.00 44.22 ? 82   LEU C CD2  1 
ATOM   5599 N  N    . GLU C 1 53  ? -45.302 21.199 62.828 1.00 43.19 ? 83   GLU C N    1 
ATOM   5600 C  CA   . GLU C 1 53  ? -46.046 21.963 63.825 1.00 44.75 ? 83   GLU C CA   1 
ATOM   5601 C  C    . GLU C 1 53  ? -47.159 22.866 63.315 1.00 46.65 ? 83   GLU C C    1 
ATOM   5602 O  O    . GLU C 1 53  ? -48.187 23.011 63.981 1.00 44.86 ? 83   GLU C O    1 
ATOM   5603 C  CB   . GLU C 1 53  ? -45.107 22.759 64.736 1.00 44.74 ? 83   GLU C CB   1 
ATOM   5604 C  CG   . GLU C 1 53  ? -44.826 24.212 64.301 1.00 47.33 ? 83   GLU C CG   1 
ATOM   5605 C  CD   . GLU C 1 53  ? -44.984 25.195 65.449 1.00 45.78 ? 83   GLU C CD   1 
ATOM   5606 O  OE1  . GLU C 1 53  ? -45.882 25.007 66.298 1.00 45.88 ? 83   GLU C OE1  1 
ATOM   5607 O  OE2  . GLU C 1 53  ? -44.221 26.174 65.493 1.00 44.80 ? 83   GLU C OE2  1 
ATOM   5608 N  N    . ASP C 1 54  ? -46.976 23.480 62.149 1.00 49.03 ? 84   ASP C N    1 
ATOM   5609 C  CA   . ASP C 1 54  ? -48.024 24.360 61.633 1.00 49.85 ? 84   ASP C CA   1 
ATOM   5610 C  C    . ASP C 1 54  ? -49.029 23.650 60.734 1.00 49.24 ? 84   ASP C C    1 
ATOM   5611 O  O    . ASP C 1 54  ? -50.011 24.255 60.294 1.00 50.09 ? 84   ASP C O    1 
ATOM   5612 C  CB   . ASP C 1 54  ? -47.452 25.625 60.956 1.00 51.76 ? 84   ASP C CB   1 
ATOM   5613 C  CG   . ASP C 1 54  ? -46.521 25.324 59.783 1.00 53.14 ? 84   ASP C CG   1 
ATOM   5614 O  OD1  . ASP C 1 54  ? -46.895 24.545 58.881 1.00 55.54 ? 84   ASP C OD1  1 
ATOM   5615 O  OD2  . ASP C 1 54  ? -45.421 25.919 59.741 1.00 53.02 ? 84   ASP C OD2  1 
ATOM   5616 N  N    . ASP C 1 55  ? -48.802 22.363 60.491 1.00 47.48 ? 85   ASP C N    1 
ATOM   5617 C  CA   . ASP C 1 55  ? -49.695 21.573 59.659 1.00 45.84 ? 85   ASP C CA   1 
ATOM   5618 C  C    . ASP C 1 55  ? -50.994 21.309 60.412 1.00 48.45 ? 85   ASP C C    1 
ATOM   5619 O  O    . ASP C 1 55  ? -51.159 20.266 61.046 1.00 48.99 ? 85   ASP C O    1 
ATOM   5620 C  CB   . ASP C 1 55  ? -49.028 20.251 59.265 1.00 44.96 ? 85   ASP C CB   1 
ATOM   5621 C  CG   . ASP C 1 55  ? -49.854 19.445 58.274 1.00 42.30 ? 85   ASP C CG   1 
ATOM   5622 O  OD1  . ASP C 1 55  ? -51.012 19.824 58.006 1.00 41.35 ? 85   ASP C OD1  1 
ATOM   5623 O  OD2  . ASP C 1 55  ? -49.343 18.427 57.758 1.00 43.24 ? 85   ASP C OD2  1 
ATOM   5624 N  N    . MET C 1 56  ? -51.945 22.226 60.270 1.00 50.05 ? 86   MET C N    1 
ATOM   5625 C  CA   . MET C 1 56  ? -53.234 22.115 60.940 1.00 51.54 ? 86   MET C CA   1 
ATOM   5626 C  C    . MET C 1 56  ? -54.089 20.916 60.553 1.00 53.57 ? 86   MET C C    1 
ATOM   5627 O  O    . MET C 1 56  ? -55.142 20.703 61.147 1.00 56.47 ? 86   MET C O    1 
ATOM   5628 C  CB   . MET C 1 56  ? -54.045 23.402 60.775 1.00 54.75 ? 86   MET C CB   1 
ATOM   5629 C  CG   . MET C 1 56  ? -53.435 24.604 61.467 1.00 56.95 ? 86   MET C CG   1 
ATOM   5630 S  SD   . MET C 1 56  ? -52.863 24.190 63.127 1.00 62.85 ? 86   MET C SD   1 
ATOM   5631 C  CE   . MET C 1 56  ? -54.412 23.853 63.952 1.00 64.45 ? 86   MET C CE   1 
ATOM   5632 N  N    . THR C 1 57  ? -53.669 20.147 59.554 1.00 53.88 ? 87   THR C N    1 
ATOM   5633 C  CA   . THR C 1 57  ? -54.444 18.974 59.170 1.00 55.00 ? 87   THR C CA   1 
ATOM   5634 C  C    . THR C 1 57  ? -54.017 17.747 59.975 1.00 55.66 ? 87   THR C C    1 
ATOM   5635 O  O    . THR C 1 57  ? -54.589 16.666 59.822 1.00 56.15 ? 87   THR C O    1 
ATOM   5636 C  CB   . THR C 1 57  ? -54.343 18.674 57.667 1.00 55.72 ? 87   THR C CB   1 
ATOM   5637 O  OG1  . THR C 1 57  ? -53.000 18.308 57.333 1.00 59.02 ? 87   THR C OG1  1 
ATOM   5638 C  CG2  . THR C 1 57  ? -54.748 19.898 56.860 1.00 55.50 ? 87   THR C CG2  1 
ATOM   5639 N  N    . ILE C 1 58  ? -52.978 17.904 60.791 1.00 55.97 ? 88   ILE C N    1 
ATOM   5640 C  CA   . ILE C 1 58  ? -52.502 16.814 61.631 1.00 55.43 ? 88   ILE C CA   1 
ATOM   5641 C  C    . ILE C 1 58  ? -53.189 16.956 62.981 1.00 55.39 ? 88   ILE C C    1 
ATOM   5642 O  O    . ILE C 1 58  ? -53.186 18.035 63.579 1.00 52.84 ? 88   ILE C O    1 
ATOM   5643 C  CB   . ILE C 1 58  ? -50.967 16.854 61.840 1.00 55.69 ? 88   ILE C CB   1 
ATOM   5644 C  CG1  . ILE C 1 58  ? -50.241 16.789 60.499 1.00 56.26 ? 88   ILE C CG1  1 
ATOM   5645 C  CG2  . ILE C 1 58  ? -50.522 15.665 62.687 1.00 55.78 ? 88   ILE C CG2  1 
ATOM   5646 C  CD1  . ILE C 1 58  ? -48.724 16.799 60.622 1.00 57.97 ? 88   ILE C CD1  1 
ATOM   5647 N  N    . SER C 1 59  ? -53.789 15.868 63.448 1.00 56.76 ? 89   SER C N    1 
ATOM   5648 C  CA   . SER C 1 59  ? -54.492 15.854 64.725 1.00 58.90 ? 89   SER C CA   1 
ATOM   5649 C  C    . SER C 1 59  ? -53.530 16.065 65.893 1.00 59.47 ? 89   SER C C    1 
ATOM   5650 O  O    . SER C 1 59  ? -52.531 15.350 66.019 1.00 59.09 ? 89   SER C O    1 
ATOM   5651 C  CB   . SER C 1 59  ? -55.211 14.518 64.892 1.00 60.10 ? 89   SER C CB   1 
ATOM   5652 O  OG   . SER C 1 59  ? -55.780 14.104 63.663 1.00 64.31 ? 89   SER C OG   1 
ATOM   5653 N  N    . VAL C 1 60  ? -53.859 17.013 66.766 1.00 58.85 ? 90   VAL C N    1 
ATOM   5654 C  CA   . VAL C 1 60  ? -53.038 17.315 67.936 1.00 59.96 ? 90   VAL C CA   1 
ATOM   5655 C  C    . VAL C 1 60  ? -52.613 16.046 68.665 1.00 62.10 ? 90   VAL C C    1 
ATOM   5656 O  O    . VAL C 1 60  ? -51.525 15.976 69.235 1.00 65.10 ? 90   VAL C O    1 
ATOM   5657 C  CB   . VAL C 1 60  ? -53.785 18.221 68.942 1.00 57.63 ? 90   VAL C CB   1 
ATOM   5658 C  CG1  . VAL C 1 60  ? -54.093 19.568 68.314 1.00 58.74 ? 90   VAL C CG1  1 
ATOM   5659 C  CG2  . VAL C 1 60  ? -55.066 17.551 69.406 1.00 60.22 ? 90   VAL C CG2  1 
ATOM   5660 N  N    . GLU C 1 61  ? -53.466 15.030 68.589 1.00 63.19 ? 91   GLU C N    1 
ATOM   5661 C  CA   . GLU C 1 61  ? -53.234 13.746 69.237 1.00 63.15 ? 91   GLU C CA   1 
ATOM   5662 C  C    . GLU C 1 61  ? -52.004 13.006 68.731 1.00 61.89 ? 91   GLU C C    1 
ATOM   5663 O  O    . GLU C 1 61  ? -51.127 12.652 69.520 1.00 61.90 ? 91   GLU C O    1 
ATOM   5664 C  CB   . GLU C 1 61  ? -54.478 12.870 69.094 1.00 65.10 ? 91   GLU C CB   1 
ATOM   5665 C  CG   . GLU C 1 61  ? -55.731 13.511 69.679 1.00 68.72 ? 91   GLU C CG   1 
ATOM   5666 C  CD   . GLU C 1 61  ? -56.998 12.756 69.343 1.00 72.46 ? 91   GLU C CD   1 
ATOM   5667 O  OE1  . GLU C 1 61  ? -56.926 11.535 69.081 1.00 76.53 ? 91   GLU C OE1  1 
ATOM   5668 O  OE2  . GLU C 1 61  ? -58.074 13.389 69.343 1.00 74.87 ? 91   GLU C OE2  1 
ATOM   5669 N  N    . LYS C 1 62  ? -51.936 12.780 67.421 1.00 60.40 ? 92   LYS C N    1 
ATOM   5670 C  CA   . LYS C 1 62  ? -50.796 12.072 66.838 1.00 60.00 ? 92   LYS C CA   1 
ATOM   5671 C  C    . LYS C 1 62  ? -49.612 13.025 66.681 1.00 56.20 ? 92   LYS C C    1 
ATOM   5672 O  O    . LYS C 1 62  ? -48.452 12.603 66.636 1.00 50.64 ? 92   LYS C O    1 
ATOM   5673 C  CB   . LYS C 1 62  ? -51.165 11.462 65.478 1.00 64.11 ? 92   LYS C CB   1 
ATOM   5674 C  CG   . LYS C 1 62  ? -51.081 12.422 64.292 1.00 67.55 ? 92   LYS C CG   1 
ATOM   5675 C  CD   . LYS C 1 62  ? -51.131 11.676 62.955 1.00 71.26 ? 92   LYS C CD   1 
ATOM   5676 C  CE   . LYS C 1 62  ? -50.090 10.553 62.869 1.00 71.18 ? 92   LYS C CE   1 
ATOM   5677 N  NZ   . LYS C 1 62  ? -48.688 11.011 63.109 1.00 68.73 ? 92   LYS C NZ   1 
ATOM   5678 N  N    . LYS C 1 63  ? -49.934 14.313 66.619 1.00 54.49 ? 93   LYS C N    1 
ATOM   5679 C  CA   . LYS C 1 63  ? -48.959 15.381 66.458 1.00 51.50 ? 93   LYS C CA   1 
ATOM   5680 C  C    . LYS C 1 63  ? -47.990 15.468 67.632 1.00 49.22 ? 93   LYS C C    1 
ATOM   5681 O  O    . LYS C 1 63  ? -46.772 15.536 67.433 1.00 50.85 ? 93   LYS C O    1 
ATOM   5682 C  CB   . LYS C 1 63  ? -49.692 16.714 66.306 1.00 50.96 ? 93   LYS C CB   1 
ATOM   5683 C  CG   . LYS C 1 63  ? -49.108 17.649 65.271 1.00 53.80 ? 93   LYS C CG   1 
ATOM   5684 C  CD   . LYS C 1 63  ? -50.007 18.859 65.110 1.00 54.32 ? 93   LYS C CD   1 
ATOM   5685 C  CE   . LYS C 1 63  ? -49.663 19.661 63.872 1.00 54.75 ? 93   LYS C CE   1 
ATOM   5686 N  NZ   . LYS C 1 63  ? -50.490 20.895 63.785 1.00 54.15 ? 93   LYS C NZ   1 
ATOM   5687 N  N    . VAL C 1 64  ? -48.527 15.453 68.850 1.00 43.78 ? 94   VAL C N    1 
ATOM   5688 C  CA   . VAL C 1 64  ? -47.707 15.557 70.051 1.00 40.18 ? 94   VAL C CA   1 
ATOM   5689 C  C    . VAL C 1 64  ? -46.465 14.661 70.052 1.00 39.20 ? 94   VAL C C    1 
ATOM   5690 O  O    . VAL C 1 64  ? -45.358 15.148 70.305 1.00 39.40 ? 94   VAL C O    1 
ATOM   5691 C  CB   . VAL C 1 64  ? -48.543 15.351 71.335 1.00 37.86 ? 94   VAL C CB   1 
ATOM   5692 C  CG1  . VAL C 1 64  ? -47.641 15.340 72.562 1.00 36.36 ? 94   VAL C CG1  1 
ATOM   5693 C  CG2  . VAL C 1 64  ? -49.569 16.457 71.459 1.00 33.85 ? 94   VAL C CG2  1 
ATOM   5694 N  N    . PRO C 1 65  ? -46.623 13.349 69.780 1.00 36.23 ? 95   PRO C N    1 
ATOM   5695 C  CA   . PRO C 1 65  ? -45.443 12.480 69.770 1.00 37.47 ? 95   PRO C CA   1 
ATOM   5696 C  C    . PRO C 1 65  ? -44.473 12.849 68.644 1.00 37.07 ? 95   PRO C C    1 
ATOM   5697 O  O    . PRO C 1 65  ? -43.257 12.738 68.808 1.00 37.94 ? 95   PRO C O    1 
ATOM   5698 C  CB   . PRO C 1 65  ? -46.043 11.088 69.559 1.00 33.17 ? 95   PRO C CB   1 
ATOM   5699 C  CG   . PRO C 1 65  ? -47.364 11.199 70.205 1.00 35.28 ? 95   PRO C CG   1 
ATOM   5700 C  CD   . PRO C 1 65  ? -47.849 12.539 69.702 1.00 35.97 ? 95   PRO C CD   1 
ATOM   5701 N  N    . LEU C 1 66  ? -45.019 13.278 67.507 1.00 36.13 ? 96   LEU C N    1 
ATOM   5702 C  CA   . LEU C 1 66  ? -44.212 13.675 66.353 1.00 34.38 ? 96   LEU C CA   1 
ATOM   5703 C  C    . LEU C 1 66  ? -43.280 14.808 66.748 1.00 31.57 ? 96   LEU C C    1 
ATOM   5704 O  O    . LEU C 1 66  ? -42.083 14.764 66.481 1.00 33.85 ? 96   LEU C O    1 
ATOM   5705 C  CB   . LEU C 1 66  ? -45.108 14.140 65.200 1.00 33.74 ? 96   LEU C CB   1 
ATOM   5706 C  CG   . LEU C 1 66  ? -45.929 13.102 64.434 1.00 33.15 ? 96   LEU C CG   1 
ATOM   5707 C  CD1  . LEU C 1 66  ? -46.864 13.805 63.468 1.00 35.48 ? 96   LEU C CD1  1 
ATOM   5708 C  CD2  . LEU C 1 66  ? -45.002 12.153 63.680 1.00 34.68 ? 96   LEU C CD2  1 
ATOM   5709 N  N    . LEU C 1 67  ? -43.834 15.806 67.422 1.00 31.88 ? 97   LEU C N    1 
ATOM   5710 C  CA   . LEU C 1 67  ? -43.063 16.956 67.863 1.00 34.66 ? 97   LEU C CA   1 
ATOM   5711 C  C    . LEU C 1 67  ? -42.091 16.593 68.987 1.00 35.65 ? 97   LEU C C    1 
ATOM   5712 O  O    . LEU C 1 67  ? -40.938 17.038 68.982 1.00 35.02 ? 97   LEU C O    1 
ATOM   5713 C  CB   . LEU C 1 67  ? -44.011 18.085 68.274 1.00 37.68 ? 97   LEU C CB   1 
ATOM   5714 C  CG   . LEU C 1 67  ? -44.944 18.549 67.140 1.00 39.45 ? 97   LEU C CG   1 
ATOM   5715 C  CD1  . LEU C 1 67  ? -45.959 19.557 67.651 1.00 40.30 ? 97   LEU C CD1  1 
ATOM   5716 C  CD2  . LEU C 1 67  ? -44.134 19.150 65.995 1.00 37.76 ? 97   LEU C CD2  1 
ATOM   5717 N  N    . HIS C 1 68  ? -42.541 15.746 69.915 1.00 35.81 ? 98   HIS C N    1 
ATOM   5718 C  CA   . HIS C 1 68  ? -41.716 15.294 71.039 1.00 33.61 ? 98   HIS C CA   1 
ATOM   5719 C  C    . HIS C 1 68  ? -40.560 14.417 70.599 1.00 32.35 ? 98   HIS C C    1 
ATOM   5720 O  O    . HIS C 1 68  ? -39.440 14.570 71.081 1.00 35.91 ? 98   HIS C O    1 
ATOM   5721 C  CB   . HIS C 1 68  ? -42.543 14.486 72.039 1.00 35.59 ? 98   HIS C CB   1 
ATOM   5722 C  CG   . HIS C 1 68  ? -43.304 15.321 73.016 1.00 36.03 ? 98   HIS C CG   1 
ATOM   5723 N  ND1  . HIS C 1 68  ? -44.442 14.871 73.647 1.00 38.21 ? 98   HIS C ND1  1 
ATOM   5724 C  CD2  . HIS C 1 68  ? -43.084 16.572 73.479 1.00 37.81 ? 98   HIS C CD2  1 
ATOM   5725 C  CE1  . HIS C 1 68  ? -44.891 15.810 74.460 1.00 37.92 ? 98   HIS C CE1  1 
ATOM   5726 N  NE2  . HIS C 1 68  ? -44.087 16.851 74.377 1.00 38.81 ? 98   HIS C NE2  1 
ATOM   5727 N  N    . ASN C 1 69  ? -40.837 13.495 69.685 1.00 29.36 ? 99   ASN C N    1 
ATOM   5728 C  CA   . ASN C 1 69  ? -39.826 12.561 69.206 1.00 30.07 ? 99   ASN C CA   1 
ATOM   5729 C  C    . ASN C 1 69  ? -38.981 13.015 68.027 1.00 25.18 ? 99   ASN C C    1 
ATOM   5730 O  O    . ASN C 1 69  ? -38.039 12.325 67.639 1.00 23.36 ? 99   ASN C O    1 
ATOM   5731 C  CB   . ASN C 1 69  ? -40.469 11.211 68.887 1.00 34.35 ? 99   ASN C CB   1 
ATOM   5732 C  CG   . ASN C 1 69  ? -41.013 10.526 70.115 1.00 35.55 ? 99   ASN C CG   1 
ATOM   5733 O  OD1  . ASN C 1 69  ? -40.324 10.394 71.129 1.00 37.48 ? 99   ASN C OD1  1 
ATOM   5734 N  ND2  . ASN C 1 69  ? -42.247 10.066 70.027 1.00 35.50 ? 99   ASN C ND2  1 
ATOM   5735 N  N    . PHE C 1 70  ? -39.298 14.176 67.468 1.00 24.21 ? 100  PHE C N    1 
ATOM   5736 C  CA   . PHE C 1 70  ? -38.550 14.684 66.330 1.00 26.04 ? 100  PHE C CA   1 
ATOM   5737 C  C    . PHE C 1 70  ? -37.027 14.581 66.508 1.00 28.11 ? 100  PHE C C    1 
ATOM   5738 O  O    . PHE C 1 70  ? -36.308 14.181 65.584 1.00 29.53 ? 100  PHE C O    1 
ATOM   5739 C  CB   . PHE C 1 70  ? -38.966 16.121 66.001 1.00 24.07 ? 100  PHE C CB   1 
ATOM   5740 C  CG   . PHE C 1 70  ? -38.385 16.626 64.717 1.00 22.74 ? 100  PHE C CG   1 
ATOM   5741 C  CD1  . PHE C 1 70  ? -38.943 16.256 63.501 1.00 20.22 ? 100  PHE C CD1  1 
ATOM   5742 C  CD2  . PHE C 1 70  ? -37.242 17.422 64.718 1.00 25.90 ? 100  PHE C CD2  1 
ATOM   5743 C  CE1  . PHE C 1 70  ? -38.373 16.670 62.300 1.00 20.52 ? 100  PHE C CE1  1 
ATOM   5744 C  CE2  . PHE C 1 70  ? -36.663 17.843 63.520 1.00 26.42 ? 100  PHE C CE2  1 
ATOM   5745 C  CZ   . PHE C 1 70  ? -37.230 17.462 62.311 1.00 19.73 ? 100  PHE C CZ   1 
ATOM   5746 N  N    . HIS C 1 71  ? -36.535 14.890 67.704 1.00 29.82 ? 101  HIS C N    1 
ATOM   5747 C  CA   . HIS C 1 71  ? -35.099 14.808 67.959 1.00 26.74 ? 101  HIS C CA   1 
ATOM   5748 C  C    . HIS C 1 71  ? -34.556 13.383 67.783 1.00 24.71 ? 101  HIS C C    1 
ATOM   5749 O  O    . HIS C 1 71  ? -33.411 13.194 67.369 1.00 23.67 ? 101  HIS C O    1 
ATOM   5750 C  CB   . HIS C 1 71  ? -34.759 15.345 69.355 1.00 29.73 ? 101  HIS C CB   1 
ATOM   5751 C  CG   . HIS C 1 71  ? -35.207 14.462 70.477 1.00 33.26 ? 101  HIS C CG   1 
ATOM   5752 N  ND1  . HIS C 1 71  ? -36.513 14.413 70.916 1.00 35.43 ? 101  HIS C ND1  1 
ATOM   5753 C  CD2  . HIS C 1 71  ? -34.517 13.595 71.253 1.00 32.02 ? 101  HIS C CD2  1 
ATOM   5754 C  CE1  . HIS C 1 71  ? -36.608 13.555 71.914 1.00 36.91 ? 101  HIS C CE1  1 
ATOM   5755 N  NE2  . HIS C 1 71  ? -35.411 13.043 72.140 1.00 37.47 ? 101  HIS C NE2  1 
ATOM   5756 N  N    . SER C 1 72  ? -35.368 12.376 68.090 1.00 25.58 ? 102  SER C N    1 
ATOM   5757 C  CA   . SER C 1 72  ? -34.915 10.998 67.930 1.00 28.23 ? 102  SER C CA   1 
ATOM   5758 C  C    . SER C 1 72  ? -34.923 10.564 66.464 1.00 26.41 ? 102  SER C C    1 
ATOM   5759 O  O    . SER C 1 72  ? -34.124 9.721  66.056 1.00 24.74 ? 102  SER C O    1 
ATOM   5760 C  CB   . SER C 1 72  ? -35.725 10.041 68.812 1.00 28.05 ? 102  SER C CB   1 
ATOM   5761 O  OG   . SER C 1 72  ? -37.078 10.437 68.900 1.00 36.50 ? 102  SER C OG   1 
ATOM   5762 N  N    . PHE C 1 73  ? -35.787 11.182 65.662 1.00 27.65 ? 103  PHE C N    1 
ATOM   5763 C  CA   . PHE C 1 73  ? -35.864 10.871 64.229 1.00 26.66 ? 103  PHE C CA   1 
ATOM   5764 C  C    . PHE C 1 73  ? -34.543 11.195 63.533 1.00 24.95 ? 103  PHE C C    1 
ATOM   5765 O  O    . PHE C 1 73  ? -34.208 10.602 62.499 1.00 26.05 ? 103  PHE C O    1 
ATOM   5766 C  CB   . PHE C 1 73  ? -37.009 11.650 63.572 1.00 24.60 ? 103  PHE C CB   1 
ATOM   5767 C  CG   . PHE C 1 73  ? -38.356 11.333 64.143 1.00 21.37 ? 103  PHE C CG   1 
ATOM   5768 C  CD1  . PHE C 1 73  ? -38.578 10.123 64.804 1.00 20.79 ? 103  PHE C CD1  1 
ATOM   5769 C  CD2  . PHE C 1 73  ? -39.398 12.241 64.029 1.00 18.56 ? 103  PHE C CD2  1 
ATOM   5770 C  CE1  . PHE C 1 73  ? -39.818 9.829  65.342 1.00 23.55 ? 103  PHE C CE1  1 
ATOM   5771 C  CE2  . PHE C 1 73  ? -40.645 11.959 64.561 1.00 22.60 ? 103  PHE C CE2  1 
ATOM   5772 C  CZ   . PHE C 1 73  ? -40.858 10.749 65.222 1.00 24.43 ? 103  PHE C CZ   1 
ATOM   5773 N  N    . LEU C 1 74  ? -33.810 12.149 64.102 1.00 21.65 ? 104  LEU C N    1 
ATOM   5774 C  CA   . LEU C 1 74  ? -32.509 12.555 63.584 1.00 22.98 ? 104  LEU C CA   1 
ATOM   5775 C  C    . LEU C 1 74  ? -31.540 11.366 63.547 1.00 25.09 ? 104  LEU C C    1 
ATOM   5776 O  O    . LEU C 1 74  ? -30.614 11.328 62.737 1.00 23.99 ? 104  LEU C O    1 
ATOM   5777 C  CB   . LEU C 1 74  ? -31.918 13.637 64.493 1.00 24.66 ? 104  LEU C CB   1 
ATOM   5778 C  CG   . LEU C 1 74  ? -31.962 15.139 64.177 1.00 24.72 ? 104  LEU C CG   1 
ATOM   5779 C  CD1  . LEU C 1 74  ? -32.874 15.454 63.024 1.00 23.39 ? 104  LEU C CD1  1 
ATOM   5780 C  CD2  . LEU C 1 74  ? -32.366 15.902 65.427 1.00 21.59 ? 104  LEU C CD2  1 
ATOM   5781 N  N    . TYR C 1 75  ? -31.756 10.413 64.451 1.00 28.65 ? 105  TYR C N    1 
ATOM   5782 C  CA   . TYR C 1 75  ? -30.909 9.232  64.572 1.00 27.90 ? 105  TYR C CA   1 
ATOM   5783 C  C    . TYR C 1 75  ? -31.561 7.964  64.020 1.00 28.47 ? 105  TYR C C    1 
ATOM   5784 O  O    . TYR C 1 75  ? -31.030 6.864  64.180 1.00 26.83 ? 105  TYR C O    1 
ATOM   5785 C  CB   . TYR C 1 75  ? -30.527 9.040  66.044 1.00 29.06 ? 105  TYR C CB   1 
ATOM   5786 C  CG   . TYR C 1 75  ? -29.683 10.171 66.597 1.00 30.73 ? 105  TYR C CG   1 
ATOM   5787 C  CD1  . TYR C 1 75  ? -28.328 10.257 66.287 1.00 31.14 ? 105  TYR C CD1  1 
ATOM   5788 C  CD2  . TYR C 1 75  ? -30.242 11.170 67.405 1.00 25.74 ? 105  TYR C CD2  1 
ATOM   5789 C  CE1  . TYR C 1 75  ? -27.546 11.307 66.756 1.00 32.35 ? 105  TYR C CE1  1 
ATOM   5790 C  CE2  . TYR C 1 75  ? -29.463 12.227 67.883 1.00 24.62 ? 105  TYR C CE2  1 
ATOM   5791 C  CZ   . TYR C 1 75  ? -28.115 12.284 67.553 1.00 28.91 ? 105  TYR C CZ   1 
ATOM   5792 O  OH   . TYR C 1 75  ? -27.310 13.300 68.017 1.00 33.17 ? 105  TYR C OH   1 
ATOM   5793 N  N    . GLN C 1 76  ? -32.721 8.116  63.393 1.00 29.85 ? 106  GLN C N    1 
ATOM   5794 C  CA   . GLN C 1 76  ? -33.438 6.987  62.811 1.00 32.07 ? 106  GLN C CA   1 
ATOM   5795 C  C    . GLN C 1 76  ? -33.388 7.100  61.291 1.00 30.18 ? 106  GLN C C    1 
ATOM   5796 O  O    . GLN C 1 76  ? -34.230 7.758  60.690 1.00 30.07 ? 106  GLN C O    1 
ATOM   5797 C  CB   . GLN C 1 76  ? -34.880 6.968  63.309 1.00 35.18 ? 106  GLN C CB   1 
ATOM   5798 C  CG   . GLN C 1 76  ? -34.982 6.700  64.796 1.00 42.92 ? 106  GLN C CG   1 
ATOM   5799 C  CD   . GLN C 1 76  ? -36.404 6.684  65.289 1.00 47.00 ? 106  GLN C CD   1 
ATOM   5800 O  OE1  . GLN C 1 76  ? -37.332 6.352  64.548 1.00 50.73 ? 106  GLN C OE1  1 
ATOM   5801 N  NE2  . GLN C 1 76  ? -36.587 7.028  66.557 1.00 51.48 ? 106  GLN C NE2  1 
ATOM   5802 N  N    . PRO C 1 77  ? -32.440 6.383  60.652 1.00 30.44 ? 107  PRO C N    1 
ATOM   5803 C  CA   . PRO C 1 77  ? -32.187 6.340  59.207 1.00 30.08 ? 107  PRO C CA   1 
ATOM   5804 C  C    . PRO C 1 77  ? -33.383 6.163  58.275 1.00 31.12 ? 107  PRO C C    1 
ATOM   5805 O  O    . PRO C 1 77  ? -33.347 6.623  57.135 1.00 30.89 ? 107  PRO C O    1 
ATOM   5806 C  CB   . PRO C 1 77  ? -31.200 5.176  59.076 1.00 29.91 ? 107  PRO C CB   1 
ATOM   5807 C  CG   . PRO C 1 77  ? -30.447 5.227  60.365 1.00 25.76 ? 107  PRO C CG   1 
ATOM   5808 C  CD   . PRO C 1 77  ? -31.576 5.411  61.346 1.00 27.58 ? 107  PRO C CD   1 
ATOM   5809 N  N    . ASP C 1 78  ? -34.434 5.495  58.744 1.00 30.55 ? 108  ASP C N    1 
ATOM   5810 C  CA   . ASP C 1 78  ? -35.616 5.260  57.917 1.00 28.16 ? 108  ASP C CA   1 
ATOM   5811 C  C    . ASP C 1 78  ? -36.810 6.152  58.223 1.00 28.61 ? 108  ASP C C    1 
ATOM   5812 O  O    . ASP C 1 78  ? -37.837 6.049  57.549 1.00 30.13 ? 108  ASP C O    1 
ATOM   5813 C  CB   . ASP C 1 78  ? -36.080 3.804  58.036 1.00 26.86 ? 108  ASP C CB   1 
ATOM   5814 C  CG   . ASP C 1 78  ? -35.043 2.811  57.565 1.00 30.10 ? 108  ASP C CG   1 
ATOM   5815 O  OD1  . ASP C 1 78  ? -34.013 3.221  56.991 1.00 32.40 ? 108  ASP C OD1  1 
ATOM   5816 O  OD2  . ASP C 1 78  ? -35.268 1.600  57.771 1.00 35.92 ? 108  ASP C OD2  1 
ATOM   5817 N  N    . TRP C 1 79  ? -36.719 7.009  59.234 1.00 25.54 ? 109  TRP C N    1 
ATOM   5818 C  CA   . TRP C 1 79  ? -37.876 7.837  59.542 1.00 27.65 ? 109  TRP C CA   1 
ATOM   5819 C  C    . TRP C 1 79  ? -38.215 8.842  58.448 1.00 29.86 ? 109  TRP C C    1 
ATOM   5820 O  O    . TRP C 1 79  ? -37.333 9.486  57.879 1.00 32.39 ? 109  TRP C O    1 
ATOM   5821 C  CB   . TRP C 1 79  ? -37.740 8.567  60.880 1.00 21.61 ? 109  TRP C CB   1 
ATOM   5822 C  CG   . TRP C 1 79  ? -39.011 9.270  61.242 1.00 20.36 ? 109  TRP C CG   1 
ATOM   5823 C  CD1  . TRP C 1 79  ? -40.097 8.725  61.866 1.00 23.16 ? 109  TRP C CD1  1 
ATOM   5824 C  CD2  . TRP C 1 79  ? -39.388 10.610 60.882 1.00 22.73 ? 109  TRP C CD2  1 
ATOM   5825 N  NE1  . TRP C 1 79  ? -41.135 9.633  61.899 1.00 23.46 ? 109  TRP C NE1  1 
ATOM   5826 C  CE2  . TRP C 1 79  ? -40.726 10.796 61.300 1.00 24.49 ? 109  TRP C CE2  1 
ATOM   5827 C  CE3  . TRP C 1 79  ? -38.727 11.668 60.238 1.00 24.53 ? 109  TRP C CE3  1 
ATOM   5828 C  CZ2  . TRP C 1 79  ? -41.420 11.995 61.091 1.00 26.25 ? 109  TRP C CZ2  1 
ATOM   5829 C  CZ3  . TRP C 1 79  ? -39.416 12.863 60.031 1.00 24.93 ? 109  TRP C CZ3  1 
ATOM   5830 C  CH2  . TRP C 1 79  ? -40.751 13.014 60.457 1.00 24.84 ? 109  TRP C CH2  1 
ATOM   5831 N  N    . ARG C 1 80  ? -39.508 8.951  58.162 1.00 31.91 ? 110  ARG C N    1 
ATOM   5832 C  CA   . ARG C 1 80  ? -40.033 9.886  57.182 1.00 33.46 ? 110  ARG C CA   1 
ATOM   5833 C  C    . ARG C 1 80  ? -41.515 10.051 57.487 1.00 36.25 ? 110  ARG C C    1 
ATOM   5834 O  O    . ARG C 1 80  ? -42.123 9.188  58.134 1.00 35.21 ? 110  ARG C O    1 
ATOM   5835 C  CB   . ARG C 1 80  ? -39.853 9.361  55.759 1.00 34.76 ? 110  ARG C CB   1 
ATOM   5836 C  CG   . ARG C 1 80  ? -40.719 8.168  55.398 1.00 38.34 ? 110  ARG C CG   1 
ATOM   5837 C  CD   . ARG C 1 80  ? -40.521 7.787  53.937 1.00 43.04 ? 110  ARG C CD   1 
ATOM   5838 N  NE   . ARG C 1 80  ? -39.108 7.640  53.597 1.00 47.73 ? 110  ARG C NE   1 
ATOM   5839 C  CZ   . ARG C 1 80  ? -38.572 8.006  52.434 1.00 51.66 ? 110  ARG C CZ   1 
ATOM   5840 N  NH1  . ARG C 1 80  ? -39.324 8.544  51.482 1.00 52.89 ? 110  ARG C NH1  1 
ATOM   5841 N  NH2  . ARG C 1 80  ? -37.271 7.858  52.232 1.00 54.27 ? 110  ARG C NH2  1 
ATOM   5842 N  N    . PHE C 1 81  ? -42.083 11.180 57.077 1.00 38.03 ? 111  PHE C N    1 
ATOM   5843 C  CA   . PHE C 1 81  ? -43.503 11.437 57.287 1.00 41.89 ? 111  PHE C CA   1 
ATOM   5844 C  C    . PHE C 1 81  ? -44.124 11.712 55.918 1.00 45.45 ? 111  PHE C C    1 
ATOM   5845 O  O    . PHE C 1 81  ? -43.840 12.731 55.288 1.00 45.25 ? 111  PHE C O    1 
ATOM   5846 C  CB   . PHE C 1 81  ? -43.701 12.621 58.229 1.00 39.12 ? 111  PHE C CB   1 
ATOM   5847 C  CG   . PHE C 1 81  ? -45.127 12.838 58.646 1.00 38.97 ? 111  PHE C CG   1 
ATOM   5848 C  CD1  . PHE C 1 81  ? -45.675 12.112 59.696 1.00 36.40 ? 111  PHE C CD1  1 
ATOM   5849 C  CD2  . PHE C 1 81  ? -45.905 13.815 58.032 1.00 40.08 ? 111  PHE C CD2  1 
ATOM   5850 C  CE1  . PHE C 1 81  ? -46.970 12.359 60.140 1.00 35.36 ? 111  PHE C CE1  1 
ATOM   5851 C  CE2  . PHE C 1 81  ? -47.202 14.072 58.469 1.00 41.87 ? 111  PHE C CE2  1 
ATOM   5852 C  CZ   . PHE C 1 81  ? -47.735 13.341 59.527 1.00 40.14 ? 111  PHE C CZ   1 
ATOM   5853 N  N    . MET C 1 82  ? -44.949 10.777 55.455 1.00 49.80 ? 112  MET C N    1 
ATOM   5854 C  CA   . MET C 1 82  ? -45.602 10.878 54.153 1.00 52.06 ? 112  MET C CA   1 
ATOM   5855 C  C    . MET C 1 82  ? -46.995 11.495 54.197 1.00 54.89 ? 112  MET C C    1 
ATOM   5856 O  O    . MET C 1 82  ? -47.594 11.740 53.155 1.00 58.37 ? 112  MET C O    1 
ATOM   5857 C  CB   . MET C 1 82  ? -45.708 9.491  53.516 1.00 52.30 ? 112  MET C CB   1 
ATOM   5858 C  CG   . MET C 1 82  ? -44.397 8.741  53.439 1.00 56.87 ? 112  MET C CG   1 
ATOM   5859 S  SD   . MET C 1 82  ? -43.145 9.696  52.596 1.00 58.79 ? 112  MET C SD   1 
ATOM   5860 C  CE   . MET C 1 82  ? -43.605 9.375  50.874 1.00 56.38 ? 112  MET C CE   1 
ATOM   5861 N  N    . GLU C 1 83  ? -47.508 11.762 55.391 1.00 56.73 ? 113  GLU C N    1 
ATOM   5862 C  CA   . GLU C 1 83  ? -48.851 12.314 55.513 1.00 58.15 ? 113  GLU C CA   1 
ATOM   5863 C  C    . GLU C 1 83  ? -48.942 13.831 55.462 1.00 57.59 ? 113  GLU C C    1 
ATOM   5864 O  O    . GLU C 1 83  ? -50.019 14.385 55.670 1.00 59.31 ? 113  GLU C O    1 
ATOM   5865 C  CB   . GLU C 1 83  ? -49.520 11.814 56.799 1.00 61.78 ? 113  GLU C CB   1 
ATOM   5866 C  CG   . GLU C 1 83  ? -49.668 10.298 56.902 1.00 65.92 ? 113  GLU C CG   1 
ATOM   5867 C  CD   . GLU C 1 83  ? -50.305 9.854  58.217 1.00 70.82 ? 113  GLU C CD   1 
ATOM   5868 O  OE1  . GLU C 1 83  ? -50.225 10.605 59.216 1.00 71.07 ? 113  GLU C OE1  1 
ATOM   5869 O  OE2  . GLU C 1 83  ? -50.884 8.745  58.254 1.00 74.74 ? 113  GLU C OE2  1 
ATOM   5870 N  N    . SER C 1 84  ? -47.835 14.512 55.185 1.00 56.96 ? 114  SER C N    1 
ATOM   5871 C  CA   . SER C 1 84  ? -47.869 15.970 55.146 1.00 57.19 ? 114  SER C CA   1 
ATOM   5872 C  C    . SER C 1 84  ? -48.477 16.531 53.864 1.00 60.10 ? 114  SER C C    1 
ATOM   5873 O  O    . SER C 1 84  ? -48.209 16.046 52.762 1.00 60.83 ? 114  SER C O    1 
ATOM   5874 C  CB   . SER C 1 84  ? -46.476 16.556 55.366 1.00 54.36 ? 114  SER C CB   1 
ATOM   5875 O  OG   . SER C 1 84  ? -46.542 17.968 55.472 1.00 47.94 ? 114  SER C OG   1 
ATOM   5876 N  N    . LYS C 1 85  ? -49.281 17.573 54.022 1.00 62.09 ? 115  LYS C N    1 
ATOM   5877 C  CA   . LYS C 1 85  ? -49.929 18.224 52.893 1.00 65.50 ? 115  LYS C CA   1 
ATOM   5878 C  C    . LYS C 1 85  ? -49.604 19.721 52.977 1.00 65.23 ? 115  LYS C C    1 
ATOM   5879 O  O    . LYS C 1 85  ? -50.457 20.579 52.738 1.00 66.56 ? 115  LYS C O    1 
ATOM   5880 C  CB   . LYS C 1 85  ? -51.441 17.967 52.959 1.00 67.18 ? 115  LYS C CB   1 
ATOM   5881 C  CG   . LYS C 1 85  ? -52.224 18.377 51.729 1.00 69.87 ? 115  LYS C CG   1 
ATOM   5882 C  CD   . LYS C 1 85  ? -53.687 17.979 51.867 1.00 70.52 ? 115  LYS C CD   1 
ATOM   5883 C  CE   . LYS C 1 85  ? -54.537 18.602 50.774 1.00 68.26 ? 115  LYS C CE   1 
ATOM   5884 N  NZ   . LYS C 1 85  ? -54.510 20.086 50.853 1.00 65.37 ? 115  LYS C NZ   1 
ATOM   5885 N  N    . GLU C 1 86  ? -48.381 20.012 53.412 1.00 63.64 ? 116  GLU C N    1 
ATOM   5886 C  CA   . GLU C 1 86  ? -47.886 21.378 53.551 1.00 60.30 ? 116  GLU C CA   1 
ATOM   5887 C  C    . GLU C 1 86  ? -46.867 21.583 52.424 1.00 56.81 ? 116  GLU C C    1 
ATOM   5888 O  O    . GLU C 1 86  ? -46.375 20.609 51.851 1.00 55.60 ? 116  GLU C O    1 
ATOM   5889 C  CB   . GLU C 1 86  ? -47.222 21.547 54.922 1.00 63.34 ? 116  GLU C CB   1 
ATOM   5890 C  CG   . GLU C 1 86  ? -47.100 22.986 55.414 1.00 69.07 ? 116  GLU C CG   1 
ATOM   5891 C  CD   . GLU C 1 86  ? -48.441 23.607 55.776 1.00 72.21 ? 116  GLU C CD   1 
ATOM   5892 O  OE1  . GLU C 1 86  ? -49.190 22.996 56.569 1.00 72.61 ? 116  GLU C OE1  1 
ATOM   5893 O  OE2  . GLU C 1 86  ? -48.742 24.714 55.275 1.00 74.26 ? 116  GLU C OE2  1 
ATOM   5894 N  N    . LYS C 1 87  ? -46.529 22.834 52.125 1.00 52.87 ? 117  LYS C N    1 
ATOM   5895 C  CA   . LYS C 1 87  ? -45.588 23.143 51.046 1.00 50.48 ? 117  LYS C CA   1 
ATOM   5896 C  C    . LYS C 1 87  ? -44.253 22.390 51.059 1.00 48.77 ? 117  LYS C C    1 
ATOM   5897 O  O    . LYS C 1 87  ? -43.864 21.778 50.063 1.00 46.88 ? 117  LYS C O    1 
ATOM   5898 C  CB   . LYS C 1 87  ? -45.309 24.649 50.982 1.00 51.35 ? 117  LYS C CB   1 
ATOM   5899 C  CG   . LYS C 1 87  ? -44.262 25.006 49.933 1.00 56.11 ? 117  LYS C CG   1 
ATOM   5900 C  CD   . LYS C 1 87  ? -44.067 26.500 49.746 1.00 58.23 ? 117  LYS C CD   1 
ATOM   5901 C  CE   . LYS C 1 87  ? -43.035 26.761 48.649 1.00 57.99 ? 117  LYS C CE   1 
ATOM   5902 N  NZ   . LYS C 1 87  ? -42.886 28.205 48.329 1.00 58.63 ? 117  LYS C NZ   1 
ATOM   5903 N  N    . ASP C 1 88  ? -43.555 22.429 52.187 1.00 46.16 ? 118  ASP C N    1 
ATOM   5904 C  CA   . ASP C 1 88  ? -42.257 21.775 52.290 1.00 43.42 ? 118  ASP C CA   1 
ATOM   5905 C  C    . ASP C 1 88  ? -42.302 20.288 52.655 1.00 41.28 ? 118  ASP C C    1 
ATOM   5906 O  O    . ASP C 1 88  ? -41.310 19.730 53.127 1.00 40.66 ? 118  ASP C O    1 
ATOM   5907 C  CB   . ASP C 1 88  ? -41.370 22.549 53.268 1.00 41.05 ? 118  ASP C CB   1 
ATOM   5908 C  CG   . ASP C 1 88  ? -41.204 24.010 52.875 1.00 40.28 ? 118  ASP C CG   1 
ATOM   5909 O  OD1  . ASP C 1 88  ? -40.774 24.291 51.735 1.00 33.15 ? 118  ASP C OD1  1 
ATOM   5910 O  OD2  . ASP C 1 88  ? -41.512 24.881 53.709 1.00 40.43 ? 118  ASP C OD2  1 
ATOM   5911 N  N    . ARG C 1 89  ? -43.422 19.632 52.362 1.00 39.83 ? 119  ARG C N    1 
ATOM   5912 C  CA   . ARG C 1 89  ? -43.600 18.212 52.661 1.00 39.74 ? 119  ARG C CA   1 
ATOM   5913 C  C    . ARG C 1 89  ? -42.426 17.340 52.195 1.00 37.48 ? 119  ARG C C    1 
ATOM   5914 O  O    . ARG C 1 89  ? -42.172 16.280 52.759 1.00 39.43 ? 119  ARG C O    1 
ATOM   5915 C  CB   . ARG C 1 89  ? -44.918 17.704 52.061 1.00 42.13 ? 119  ARG C CB   1 
ATOM   5916 C  CG   . ARG C 1 89  ? -45.065 17.961 50.566 1.00 50.77 ? 119  ARG C CG   1 
ATOM   5917 C  CD   . ARG C 1 89  ? -46.476 17.700 50.073 1.00 55.75 ? 119  ARG C CD   1 
ATOM   5918 N  NE   . ARG C 1 89  ? -46.785 16.274 50.025 1.00 64.43 ? 119  ARG C NE   1 
ATOM   5919 C  CZ   . ARG C 1 89  ? -47.287 15.652 48.962 1.00 66.95 ? 119  ARG C CZ   1 
ATOM   5920 N  NH1  . ARG C 1 89  ? -47.546 16.328 47.848 1.00 68.26 ? 119  ARG C NH1  1 
ATOM   5921 N  NH2  . ARG C 1 89  ? -47.513 14.344 49.009 1.00 69.81 ? 119  ARG C NH2  1 
ATOM   5922 N  N    . GLN C 1 90  ? -41.696 17.809 51.189 1.00 34.45 ? 120  GLN C N    1 
ATOM   5923 C  CA   . GLN C 1 90  ? -40.544 17.093 50.640 1.00 32.29 ? 120  GLN C CA   1 
ATOM   5924 C  C    . GLN C 1 90  ? -39.448 16.873 51.680 1.00 29.71 ? 120  GLN C C    1 
ATOM   5925 O  O    . GLN C 1 90  ? -38.749 15.857 51.665 1.00 27.68 ? 120  GLN C O    1 
ATOM   5926 C  CB   . GLN C 1 90  ? -39.974 17.870 49.447 1.00 36.28 ? 120  GLN C CB   1 
ATOM   5927 C  CG   . GLN C 1 90  ? -38.616 17.400 48.953 1.00 37.07 ? 120  GLN C CG   1 
ATOM   5928 C  CD   . GLN C 1 90  ? -38.673 16.168 48.072 1.00 43.24 ? 120  GLN C CD   1 
ATOM   5929 O  OE1  . GLN C 1 90  ? -37.792 15.964 47.243 1.00 48.83 ? 120  GLN C OE1  1 
ATOM   5930 N  NE2  . GLN C 1 90  ? -39.714 15.354 48.225 1.00 47.38 ? 120  GLN C NE2  1 
ATOM   5931 N  N    . VAL C 1 91  ? -39.303 17.841 52.574 1.00 25.77 ? 121  VAL C N    1 
ATOM   5932 C  CA   . VAL C 1 91  ? -38.304 17.778 53.631 1.00 27.76 ? 121  VAL C CA   1 
ATOM   5933 C  C    . VAL C 1 91  ? -38.660 16.663 54.638 1.00 28.67 ? 121  VAL C C    1 
ATOM   5934 O  O    . VAL C 1 91  ? -37.782 16.050 55.244 1.00 27.29 ? 121  VAL C O    1 
ATOM   5935 C  CB   . VAL C 1 91  ? -38.184 19.170 54.310 1.00 27.36 ? 121  VAL C CB   1 
ATOM   5936 C  CG1  . VAL C 1 91  ? -39.167 19.313 55.464 1.00 27.09 ? 121  VAL C CG1  1 
ATOM   5937 C  CG2  . VAL C 1 91  ? -36.754 19.444 54.716 1.00 27.14 ? 121  VAL C CG2  1 
ATOM   5938 N  N    . LEU C 1 92  ? -39.955 16.385 54.765 1.00 31.25 ? 122  LEU C N    1 
ATOM   5939 C  CA   . LEU C 1 92  ? -40.478 15.352 55.660 1.00 30.59 ? 122  LEU C CA   1 
ATOM   5940 C  C    . LEU C 1 92  ? -40.488 13.996 54.974 1.00 31.76 ? 122  LEU C C    1 
ATOM   5941 O  O    . LEU C 1 92  ? -40.213 12.970 55.597 1.00 33.31 ? 122  LEU C O    1 
ATOM   5942 C  CB   . LEU C 1 92  ? -41.904 15.699 56.080 1.00 29.17 ? 122  LEU C CB   1 
ATOM   5943 C  CG   . LEU C 1 92  ? -42.153 16.203 57.501 1.00 29.40 ? 122  LEU C CG   1 
ATOM   5944 C  CD1  . LEU C 1 92  ? -40.858 16.487 58.238 1.00 29.87 ? 122  LEU C CD1  1 
ATOM   5945 C  CD2  . LEU C 1 92  ? -43.025 17.428 57.436 1.00 26.04 ? 122  LEU C CD2  1 
ATOM   5946 N  N    . GLU C 1 93  ? -40.831 13.998 53.692 1.00 32.13 ? 123  GLU C N    1 
ATOM   5947 C  CA   . GLU C 1 93  ? -40.888 12.780 52.898 1.00 29.89 ? 123  GLU C CA   1 
ATOM   5948 C  C    . GLU C 1 93  ? -39.502 12.213 52.648 1.00 27.31 ? 123  GLU C C    1 
ATOM   5949 O  O    . GLU C 1 93  ? -39.331 11.001 52.543 1.00 29.08 ? 123  GLU C O    1 
ATOM   5950 C  CB   . GLU C 1 93  ? -41.580 13.050 51.567 1.00 31.62 ? 123  GLU C CB   1 
ATOM   5951 C  CG   . GLU C 1 93  ? -43.008 13.543 51.709 1.00 33.89 ? 123  GLU C CG   1 
ATOM   5952 C  CD   . GLU C 1 93  ? -43.703 13.754 50.377 1.00 33.52 ? 123  GLU C CD   1 
ATOM   5953 O  OE1  . GLU C 1 93  ? -43.060 13.587 49.320 1.00 38.54 ? 123  GLU C OE1  1 
ATOM   5954 O  OE2  . GLU C 1 93  ? -44.905 14.086 50.389 1.00 35.28 ? 123  GLU C OE2  1 
ATOM   5955 N  N    . ASP C 1 94  ? -38.510 13.086 52.540 1.00 25.13 ? 124  ASP C N    1 
ATOM   5956 C  CA   . ASP C 1 94  ? -37.148 12.631 52.301 1.00 25.82 ? 124  ASP C CA   1 
ATOM   5957 C  C    . ASP C 1 94  ? -36.222 12.936 53.475 1.00 24.61 ? 124  ASP C C    1 
ATOM   5958 O  O    . ASP C 1 94  ? -35.032 13.224 53.296 1.00 23.86 ? 124  ASP C O    1 
ATOM   5959 C  CB   . ASP C 1 94  ? -36.595 13.238 51.007 1.00 25.55 ? 124  ASP C CB   1 
ATOM   5960 C  CG   . ASP C 1 94  ? -35.357 12.517 50.514 1.00 26.24 ? 124  ASP C CG   1 
ATOM   5961 O  OD1  . ASP C 1 94  ? -35.263 11.287 50.713 1.00 34.65 ? 124  ASP C OD1  1 
ATOM   5962 O  OD2  . ASP C 1 94  ? -34.469 13.168 49.931 1.00 29.18 ? 124  ASP C OD2  1 
ATOM   5963 N  N    . PHE C 1 95  ? -36.751 12.810 54.686 1.00 27.14 ? 125  PHE C N    1 
ATOM   5964 C  CA   . PHE C 1 95  ? -35.953 13.070 55.876 1.00 27.28 ? 125  PHE C CA   1 
ATOM   5965 C  C    . PHE C 1 95  ? -34.698 12.197 55.942 1.00 27.35 ? 125  PHE C C    1 
ATOM   5966 O  O    . PHE C 1 95  ? -33.631 12.689 56.310 1.00 28.27 ? 125  PHE C O    1 
ATOM   5967 C  CB   . PHE C 1 95  ? -36.783 12.930 57.152 1.00 28.77 ? 125  PHE C CB   1 
ATOM   5968 C  CG   . PHE C 1 95  ? -36.249 13.734 58.299 1.00 29.94 ? 125  PHE C CG   1 
ATOM   5969 C  CD1  . PHE C 1 95  ? -36.318 15.130 58.276 1.00 27.54 ? 125  PHE C CD1  1 
ATOM   5970 C  CD2  . PHE C 1 95  ? -35.659 13.108 59.397 1.00 30.74 ? 125  PHE C CD2  1 
ATOM   5971 C  CE1  . PHE C 1 95  ? -35.807 15.894 59.331 1.00 27.36 ? 125  PHE C CE1  1 
ATOM   5972 C  CE2  . PHE C 1 95  ? -35.141 13.865 60.465 1.00 29.47 ? 125  PHE C CE2  1 
ATOM   5973 C  CZ   . PHE C 1 95  ? -35.214 15.259 60.431 1.00 25.95 ? 125  PHE C CZ   1 
ATOM   5974 N  N    . PRO C 1 96  ? -34.790 10.909 55.539 1.00 26.94 ? 126  PRO C N    1 
ATOM   5975 C  CA   . PRO C 1 96  ? -33.612 10.036 55.580 1.00 27.19 ? 126  PRO C CA   1 
ATOM   5976 C  C    . PRO C 1 96  ? -32.372 10.645 54.932 1.00 25.81 ? 126  PRO C C    1 
ATOM   5977 O  O    . PRO C 1 96  ? -31.247 10.398 55.367 1.00 25.67 ? 126  PRO C O    1 
ATOM   5978 C  CB   . PRO C 1 96  ? -34.090 8.799  54.826 1.00 24.52 ? 126  PRO C CB   1 
ATOM   5979 C  CG   . PRO C 1 96  ? -35.486 8.685  55.303 1.00 24.10 ? 126  PRO C CG   1 
ATOM   5980 C  CD   . PRO C 1 96  ? -35.980 10.121 55.160 1.00 26.22 ? 126  PRO C CD   1 
ATOM   5981 N  N    . THR C 1 97  ? -32.580 11.462 53.910 1.00 24.72 ? 127  THR C N    1 
ATOM   5982 C  CA   . THR C 1 97  ? -31.474 12.098 53.215 1.00 26.40 ? 127  THR C CA   1 
ATOM   5983 C  C    . THR C 1 97  ? -30.856 13.181 54.104 1.00 26.34 ? 127  THR C C    1 
ATOM   5984 O  O    . THR C 1 97  ? -29.634 13.361 54.132 1.00 25.70 ? 127  THR C O    1 
ATOM   5985 C  CB   . THR C 1 97  ? -31.959 12.709 51.876 1.00 26.33 ? 127  THR C CB   1 
ATOM   5986 O  OG1  . THR C 1 97  ? -32.597 11.687 51.101 1.00 27.51 ? 127  THR C OG1  1 
ATOM   5987 C  CG2  . THR C 1 97  ? -30.792 13.276 51.077 1.00 26.20 ? 127  THR C CG2  1 
ATOM   5988 N  N    . ILE C 1 98  ? -31.716 13.865 54.852 1.00 26.91 ? 128  ILE C N    1 
ATOM   5989 C  CA   . ILE C 1 98  ? -31.306 14.939 55.747 1.00 24.64 ? 128  ILE C CA   1 
ATOM   5990 C  C    . ILE C 1 98  ? -30.705 14.390 57.043 1.00 25.43 ? 128  ILE C C    1 
ATOM   5991 O  O    . ILE C 1 98  ? -29.640 14.844 57.472 1.00 22.98 ? 128  ILE C O    1 
ATOM   5992 C  CB   . ILE C 1 98  ? -32.504 15.867 56.059 1.00 25.54 ? 128  ILE C CB   1 
ATOM   5993 C  CG1  . ILE C 1 98  ? -32.985 16.524 54.761 1.00 20.62 ? 128  ILE C CG1  1 
ATOM   5994 C  CG2  . ILE C 1 98  ? -32.131 16.910 57.123 1.00 22.35 ? 128  ILE C CG2  1 
ATOM   5995 C  CD1  . ILE C 1 98  ? -34.263 17.284 54.922 1.00 19.44 ? 128  ILE C CD1  1 
ATOM   5996 N  N    . SER C 1 99  ? -31.370 13.403 57.649 1.00 22.78 ? 129  SER C N    1 
ATOM   5997 C  CA   . SER C 1 99  ? -30.877 12.800 58.881 1.00 19.19 ? 129  SER C CA   1 
ATOM   5998 C  C    . SER C 1 99  ? -29.515 12.147 58.637 1.00 17.76 ? 129  SER C C    1 
ATOM   5999 O  O    . SER C 1 99  ? -28.631 12.197 59.489 1.00 20.86 ? 129  SER C O    1 
ATOM   6000 C  CB   . SER C 1 99  ? -31.880 11.786 59.415 1.00 16.48 ? 129  SER C CB   1 
ATOM   6001 O  OG   . SER C 1 99  ? -32.026 10.719 58.513 1.00 23.49 ? 129  SER C OG   1 
ATOM   6002 N  N    . LEU C 1 100 ? -29.326 11.594 57.448 1.00 20.48 ? 130  LEU C N    1 
ATOM   6003 C  CA   . LEU C 1 100 ? -28.060 10.973 57.084 1.00 22.96 ? 130  LEU C CA   1 
ATOM   6004 C  C    . LEU C 1 100 ? -26.934 12.011 57.138 1.00 23.57 ? 130  LEU C C    1 
ATOM   6005 O  O    . LEU C 1 100 ? -25.826 11.721 57.601 1.00 24.88 ? 130  LEU C O    1 
ATOM   6006 C  CB   . LEU C 1 100 ? -28.148 10.370 55.674 1.00 25.46 ? 130  LEU C CB   1 
ATOM   6007 C  CG   . LEU C 1 100 ? -26.883 9.772  55.041 1.00 28.70 ? 130  LEU C CG   1 
ATOM   6008 C  CD1  . LEU C 1 100 ? -26.450 8.510  55.780 1.00 30.25 ? 130  LEU C CD1  1 
ATOM   6009 C  CD2  . LEU C 1 100 ? -27.156 9.452  53.583 1.00 29.72 ? 130  LEU C CD2  1 
ATOM   6010 N  N    . GLU C 1 101 ? -27.204 13.212 56.636 1.00 21.83 ? 131  GLU C N    1 
ATOM   6011 C  CA   . GLU C 1 101 ? -26.195 14.262 56.657 1.00 21.34 ? 131  GLU C CA   1 
ATOM   6012 C  C    . GLU C 1 101 ? -26.040 14.826 58.064 1.00 19.09 ? 131  GLU C C    1 
ATOM   6013 O  O    . GLU C 1 101 ? -24.942 15.215 58.468 1.00 16.67 ? 131  GLU C O    1 
ATOM   6014 C  CB   . GLU C 1 101 ? -26.510 15.365 55.641 1.00 23.37 ? 131  GLU C CB   1 
ATOM   6015 C  CG   . GLU C 1 101 ? -26.320 14.926 54.183 1.00 22.19 ? 131  GLU C CG   1 
ATOM   6016 C  CD   . GLU C 1 101 ? -24.940 14.337 53.907 1.00 21.82 ? 131  GLU C CD   1 
ATOM   6017 O  OE1  . GLU C 1 101 ? -23.918 15.021 54.130 1.00 27.60 ? 131  GLU C OE1  1 
ATOM   6018 O  OE2  . GLU C 1 101 ? -24.874 13.178 53.463 1.00 25.16 ? 131  GLU C OE2  1 
ATOM   6019 N  N    . PHE C 1 102 ? -27.131 14.842 58.822 1.00 19.56 ? 132  PHE C N    1 
ATOM   6020 C  CA   . PHE C 1 102 ? -27.072 15.320 60.198 1.00 23.94 ? 132  PHE C CA   1 
ATOM   6021 C  C    . PHE C 1 102 ? -26.043 14.456 60.920 1.00 26.06 ? 132  PHE C C    1 
ATOM   6022 O  O    . PHE C 1 102 ? -25.130 14.968 61.570 1.00 28.06 ? 132  PHE C O    1 
ATOM   6023 C  CB   . PHE C 1 102 ? -28.427 15.178 60.891 1.00 20.15 ? 132  PHE C CB   1 
ATOM   6024 C  CG   . PHE C 1 102 ? -28.354 15.310 62.398 1.00 25.38 ? 132  PHE C CG   1 
ATOM   6025 C  CD1  . PHE C 1 102 ? -28.201 16.560 62.999 1.00 18.37 ? 132  PHE C CD1  1 
ATOM   6026 C  CD2  . PHE C 1 102 ? -28.452 14.180 63.216 1.00 25.10 ? 132  PHE C CD2  1 
ATOM   6027 C  CE1  . PHE C 1 102 ? -28.148 16.681 64.396 1.00 21.46 ? 132  PHE C CE1  1 
ATOM   6028 C  CE2  . PHE C 1 102 ? -28.400 14.294 64.615 1.00 25.37 ? 132  PHE C CE2  1 
ATOM   6029 C  CZ   . PHE C 1 102 ? -28.250 15.547 65.205 1.00 19.75 ? 132  PHE C CZ   1 
ATOM   6030 N  N    . ARG C 1 103 ? -26.169 13.143 60.749 1.00 25.85 ? 133  ARG C N    1 
ATOM   6031 C  CA   . ARG C 1 103 ? -25.263 12.192 61.371 1.00 23.44 ? 133  ARG C CA   1 
ATOM   6032 C  C    . ARG C 1 103 ? -23.837 12.245 60.836 1.00 23.57 ? 133  ARG C C    1 
ATOM   6033 O  O    . ARG C 1 103 ? -22.921 11.759 61.490 1.00 30.55 ? 133  ARG C O    1 
ATOM   6034 C  CB   . ARG C 1 103 ? -25.837 10.783 61.287 1.00 19.92 ? 133  ARG C CB   1 
ATOM   6035 C  CG   . ARG C 1 103 ? -27.146 10.642 62.039 1.00 18.26 ? 133  ARG C CG   1 
ATOM   6036 C  CD   . ARG C 1 103 ? -27.662 9.221  62.003 1.00 20.68 ? 133  ARG C CD   1 
ATOM   6037 N  NE   . ARG C 1 103 ? -27.876 8.734  60.641 1.00 20.11 ? 133  ARG C NE   1 
ATOM   6038 C  CZ   . ARG C 1 103 ? -29.056 8.677  60.034 1.00 21.07 ? 133  ARG C CZ   1 
ATOM   6039 N  NH1  . ARG C 1 103 ? -30.157 9.087  60.649 1.00 19.86 ? 133  ARG C NH1  1 
ATOM   6040 N  NH2  . ARG C 1 103 ? -29.133 8.193  58.806 1.00 26.11 ? 133  ARG C NH2  1 
ATOM   6041 N  N    . ASN C 1 104 ? -23.640 12.862 59.673 1.00 23.32 ? 134  ASN C N    1 
ATOM   6042 C  CA   . ASN C 1 104 ? -22.304 12.997 59.096 1.00 22.99 ? 134  ASN C CA   1 
ATOM   6043 C  C    . ASN C 1 104 ? -21.611 14.223 59.669 1.00 23.91 ? 134  ASN C C    1 
ATOM   6044 O  O    . ASN C 1 104 ? -20.464 14.514 59.323 1.00 23.17 ? 134  ASN C O    1 
ATOM   6045 C  CB   . ASN C 1 104 ? -22.372 13.164 57.580 1.00 32.43 ? 134  ASN C CB   1 
ATOM   6046 C  CG   . ASN C 1 104 ? -22.579 11.859 56.856 1.00 40.35 ? 134  ASN C CG   1 
ATOM   6047 O  OD1  . ASN C 1 104 ? -22.873 10.834 57.468 1.00 47.75 ? 134  ASN C OD1  1 
ATOM   6048 N  ND2  . ASN C 1 104 ? -22.450 11.892 55.534 1.00 41.94 ? 134  ASN C ND2  1 
ATOM   6049 N  N    . LEU C 1 105 ? -22.337 15.007 60.459 1.00 23.97 ? 135  LEU C N    1 
ATOM   6050 C  CA   . LEU C 1 105 ? -21.748 16.197 61.068 1.00 22.74 ? 135  LEU C CA   1 
ATOM   6051 C  C    . LEU C 1 105 ? -20.903 15.795 62.276 1.00 21.52 ? 135  LEU C C    1 
ATOM   6052 O  O    . LEU C 1 105 ? -21.105 14.728 62.870 1.00 16.02 ? 135  LEU C O    1 
ATOM   6053 C  CB   . LEU C 1 105 ? -22.841 17.176 61.520 1.00 18.24 ? 135  LEU C CB   1 
ATOM   6054 C  CG   . LEU C 1 105 ? -23.781 17.802 60.488 1.00 18.59 ? 135  LEU C CG   1 
ATOM   6055 C  CD1  . LEU C 1 105 ? -24.852 18.599 61.205 1.00 16.89 ? 135  LEU C CD1  1 
ATOM   6056 C  CD2  . LEU C 1 105 ? -23.010 18.701 59.551 1.00 14.19 ? 135  LEU C CD2  1 
ATOM   6057 N  N    . ALA C 1 106 ? -19.949 16.647 62.635 1.00 24.55 ? 136  ALA C N    1 
ATOM   6058 C  CA   . ALA C 1 106 ? -19.118 16.386 63.802 1.00 25.40 ? 136  ALA C CA   1 
ATOM   6059 C  C    . ALA C 1 106 ? -20.047 16.302 65.017 1.00 24.38 ? 136  ALA C C    1 
ATOM   6060 O  O    . ALA C 1 106 ? -21.080 16.980 65.074 1.00 20.97 ? 136  ALA C O    1 
ATOM   6061 C  CB   . ALA C 1 106 ? -18.083 17.505 63.993 1.00 22.01 ? 136  ALA C CB   1 
ATOM   6062 N  N    . GLU C 1 107 ? -19.673 15.453 65.968 1.00 26.02 ? 137  GLU C N    1 
ATOM   6063 C  CA   . GLU C 1 107 ? -20.423 15.228 67.204 1.00 28.28 ? 137  GLU C CA   1 
ATOM   6064 C  C    . GLU C 1 107 ? -20.858 16.525 67.899 1.00 24.60 ? 137  GLU C C    1 
ATOM   6065 O  O    . GLU C 1 107 ? -21.997 16.634 68.347 1.00 26.09 ? 137  GLU C O    1 
ATOM   6066 C  CB   . GLU C 1 107 ? -19.570 14.385 68.165 1.00 36.34 ? 137  GLU C CB   1 
ATOM   6067 C  CG   . GLU C 1 107 ? -20.226 14.034 69.497 1.00 47.64 ? 137  GLU C CG   1 
ATOM   6068 C  CD   . GLU C 1 107 ? -19.218 13.885 70.639 1.00 56.01 ? 137  GLU C CD   1 
ATOM   6069 O  OE1  . GLU C 1 107 ? -18.011 13.668 70.374 1.00 61.30 ? 137  GLU C OE1  1 
ATOM   6070 O  OE2  . GLU C 1 107 ? -19.637 13.995 71.813 1.00 57.90 ? 137  GLU C OE2  1 
ATOM   6071 N  N    . LYS C 1 108 ? -19.951 17.495 67.995 1.00 22.32 ? 138  LYS C N    1 
ATOM   6072 C  CA   . LYS C 1 108 ? -20.255 18.775 68.635 1.00 21.50 ? 138  LYS C CA   1 
ATOM   6073 C  C    . LYS C 1 108 ? -21.445 19.522 68.020 1.00 22.39 ? 138  LYS C C    1 
ATOM   6074 O  O    . LYS C 1 108 ? -22.171 20.225 68.724 1.00 21.79 ? 138  LYS C O    1 
ATOM   6075 C  CB   . LYS C 1 108 ? -19.020 19.679 68.667 1.00 20.34 ? 138  LYS C CB   1 
ATOM   6076 C  CG   . LYS C 1 108 ? -18.364 19.954 67.323 1.00 21.02 ? 138  LYS C CG   1 
ATOM   6077 C  CD   . LYS C 1 108 ? -17.122 20.786 67.544 1.00 20.91 ? 138  LYS C CD   1 
ATOM   6078 C  CE   . LYS C 1 108 ? -16.387 21.087 66.264 1.00 24.42 ? 138  LYS C CE   1 
ATOM   6079 N  NZ   . LYS C 1 108 ? -15.200 21.950 66.546 1.00 24.32 ? 138  LYS C NZ   1 
ATOM   6080 N  N    . TYR C 1 109 ? -21.655 19.353 66.718 1.00 23.61 ? 139  TYR C N    1 
ATOM   6081 C  CA   . TYR C 1 109 ? -22.774 19.995 66.030 1.00 22.68 ? 139  TYR C CA   1 
ATOM   6082 C  C    . TYR C 1 109 ? -24.062 19.203 66.253 1.00 22.59 ? 139  TYR C C    1 
ATOM   6083 O  O    . TYR C 1 109 ? -25.133 19.772 66.510 1.00 24.66 ? 139  TYR C O    1 
ATOM   6084 C  CB   . TYR C 1 109 ? -22.462 20.141 64.538 1.00 18.81 ? 139  TYR C CB   1 
ATOM   6085 C  CG   . TYR C 1 109 ? -21.224 20.977 64.302 1.00 19.88 ? 139  TYR C CG   1 
ATOM   6086 C  CD1  . TYR C 1 109 ? -20.985 22.129 65.061 1.00 22.60 ? 139  TYR C CD1  1 
ATOM   6087 C  CD2  . TYR C 1 109 ? -20.266 20.599 63.368 1.00 17.09 ? 139  TYR C CD2  1 
ATOM   6088 C  CE1  . TYR C 1 109 ? -19.824 22.878 64.898 1.00 15.71 ? 139  TYR C CE1  1 
ATOM   6089 C  CE2  . TYR C 1 109 ? -19.100 21.342 63.201 1.00 16.31 ? 139  TYR C CE2  1 
ATOM   6090 C  CZ   . TYR C 1 109 ? -18.889 22.476 63.970 1.00 14.92 ? 139  TYR C CZ   1 
ATOM   6091 O  OH   . TYR C 1 109 ? -17.742 23.208 63.820 1.00 15.66 ? 139  TYR C OH   1 
ATOM   6092 N  N    . GLN C 1 110 ? -23.945 17.883 66.189 1.00 20.17 ? 140  GLN C N    1 
ATOM   6093 C  CA   . GLN C 1 110 ? -25.089 17.009 66.400 1.00 18.50 ? 140  GLN C CA   1 
ATOM   6094 C  C    . GLN C 1 110 ? -25.713 17.240 67.777 1.00 18.52 ? 140  GLN C C    1 
ATOM   6095 O  O    . GLN C 1 110 ? -26.936 17.284 67.916 1.00 18.43 ? 140  GLN C O    1 
ATOM   6096 C  CB   . GLN C 1 110 ? -24.662 15.542 66.272 1.00 20.93 ? 140  GLN C CB   1 
ATOM   6097 C  CG   . GLN C 1 110 ? -24.121 15.133 64.899 1.00 21.60 ? 140  GLN C CG   1 
ATOM   6098 C  CD   . GLN C 1 110 ? -23.968 13.624 64.778 1.00 21.28 ? 140  GLN C CD   1 
ATOM   6099 O  OE1  . GLN C 1 110 ? -24.708 12.869 65.407 1.00 26.07 ? 140  GLN C OE1  1 
ATOM   6100 N  NE2  . GLN C 1 110 ? -23.019 13.181 63.972 1.00 14.88 ? 140  GLN C NE2  1 
ATOM   6101 N  N    . THR C 1 111 ? -24.866 17.362 68.793 1.00 18.49 ? 141  THR C N    1 
ATOM   6102 C  CA   . THR C 1 111 ? -25.325 17.585 70.159 1.00 20.83 ? 141  THR C CA   1 
ATOM   6103 C  C    . THR C 1 111 ? -26.163 18.858 70.278 1.00 18.39 ? 141  THR C C    1 
ATOM   6104 O  O    . THR C 1 111 ? -27.232 18.853 70.904 1.00 18.13 ? 141  THR C O    1 
ATOM   6105 C  CB   . THR C 1 111 ? -24.128 17.672 71.130 1.00 23.40 ? 141  THR C CB   1 
ATOM   6106 O  OG1  . THR C 1 111 ? -23.274 16.538 70.936 1.00 27.70 ? 141  THR C OG1  1 
ATOM   6107 C  CG2  . THR C 1 111 ? -24.610 17.699 72.580 1.00 25.51 ? 141  THR C CG2  1 
ATOM   6108 N  N    . VAL C 1 112 ? -25.690 19.940 69.666 1.00 21.15 ? 142  VAL C N    1 
ATOM   6109 C  CA   . VAL C 1 112 ? -26.406 21.215 69.712 1.00 21.14 ? 142  VAL C CA   1 
ATOM   6110 C  C    . VAL C 1 112 ? -27.738 21.093 68.992 1.00 22.19 ? 142  VAL C C    1 
ATOM   6111 O  O    . VAL C 1 112 ? -28.793 21.344 69.578 1.00 24.42 ? 142  VAL C O    1 
ATOM   6112 C  CB   . VAL C 1 112 ? -25.605 22.360 69.055 1.00 18.67 ? 142  VAL C CB   1 
ATOM   6113 C  CG1  . VAL C 1 112 ? -26.371 23.669 69.179 1.00 14.28 ? 142  VAL C CG1  1 
ATOM   6114 C  CG2  . VAL C 1 112 ? -24.240 22.493 69.703 1.00 21.36 ? 142  VAL C CG2  1 
ATOM   6115 N  N    . ILE C 1 113 ? -27.693 20.659 67.736 1.00 22.32 ? 143  ILE C N    1 
ATOM   6116 C  CA   . ILE C 1 113 ? -28.910 20.518 66.939 1.00 22.27 ? 143  ILE C CA   1 
ATOM   6117 C  C    . ILE C 1 113 ? -29.957 19.619 67.611 1.00 23.07 ? 143  ILE C C    1 
ATOM   6118 O  O    . ILE C 1 113 ? -31.099 20.041 67.810 1.00 26.18 ? 143  ILE C O    1 
ATOM   6119 C  CB   . ILE C 1 113 ? -28.575 20.047 65.489 1.00 22.67 ? 143  ILE C CB   1 
ATOM   6120 C  CG1  . ILE C 1 113 ? -27.702 21.111 64.800 1.00 21.51 ? 143  ILE C CG1  1 
ATOM   6121 C  CG2  . ILE C 1 113 ? -29.862 19.797 64.683 1.00 19.02 ? 143  ILE C CG2  1 
ATOM   6122 C  CD1  . ILE C 1 113 ? -27.209 20.735 63.411 1.00 21.57 ? 143  ILE C CD1  1 
ATOM   6123 N  N    . ALA C 1 114 ? -29.562 18.409 68.002 1.00 22.07 ? 144  ALA C N    1 
ATOM   6124 C  CA   . ALA C 1 114 ? -30.486 17.487 68.663 1.00 21.31 ? 144  ALA C CA   1 
ATOM   6125 C  C    . ALA C 1 114 ? -31.087 18.095 69.930 1.00 21.54 ? 144  ALA C C    1 
ATOM   6126 O  O    . ALA C 1 114 ? -32.288 17.938 70.186 1.00 19.32 ? 144  ALA C O    1 
ATOM   6127 C  CB   . ALA C 1 114 ? -29.784 16.186 68.996 1.00 22.58 ? 144  ALA C CB   1 
ATOM   6128 N  N    . ASP C 1 115 ? -30.265 18.811 70.703 1.00 24.40 ? 145  ASP C N    1 
ATOM   6129 C  CA   . ASP C 1 115 ? -30.730 19.442 71.943 1.00 22.20 ? 145  ASP C CA   1 
ATOM   6130 C  C    . ASP C 1 115 ? -31.796 20.490 71.668 1.00 22.16 ? 145  ASP C C    1 
ATOM   6131 O  O    . ASP C 1 115 ? -32.846 20.503 72.312 1.00 21.79 ? 145  ASP C O    1 
ATOM   6132 C  CB   . ASP C 1 115 ? -29.577 20.089 72.720 1.00 26.32 ? 145  ASP C CB   1 
ATOM   6133 C  CG   . ASP C 1 115 ? -30.053 20.763 74.019 1.00 31.78 ? 145  ASP C CG   1 
ATOM   6134 O  OD1  . ASP C 1 115 ? -30.783 20.105 74.799 1.00 33.79 ? 145  ASP C OD1  1 
ATOM   6135 O  OD2  . ASP C 1 115 ? -29.728 21.950 74.250 1.00 24.40 ? 145  ASP C OD2  1 
ATOM   6136 N  N    . ILE C 1 116 ? -31.523 21.370 70.709 1.00 22.90 ? 146  ILE C N    1 
ATOM   6137 C  CA   . ILE C 1 116 ? -32.478 22.415 70.348 1.00 24.49 ? 146  ILE C CA   1 
ATOM   6138 C  C    . ILE C 1 116 ? -33.792 21.807 69.845 1.00 23.73 ? 146  ILE C C    1 
ATOM   6139 O  O    . ILE C 1 116 ? -34.868 22.175 70.315 1.00 22.39 ? 146  ILE C O    1 
ATOM   6140 C  CB   . ILE C 1 116 ? -31.877 23.388 69.306 1.00 23.96 ? 146  ILE C CB   1 
ATOM   6141 C  CG1  . ILE C 1 116 ? -30.801 24.254 69.970 1.00 23.47 ? 146  ILE C CG1  1 
ATOM   6142 C  CG2  . ILE C 1 116 ? -32.959 24.261 68.697 1.00 23.77 ? 146  ILE C CG2  1 
ATOM   6143 C  CD1  . ILE C 1 116 ? -31.245 24.886 71.298 1.00 21.77 ? 146  ILE C CD1  1 
ATOM   6144 N  N    . CYS C 1 117 ? -33.695 20.842 68.934 1.00 24.33 ? 147  CYS C N    1 
ATOM   6145 C  CA   . CYS C 1 117 ? -34.871 20.171 68.395 1.00 24.20 ? 147  CYS C CA   1 
ATOM   6146 C  C    . CYS C 1 117 ? -35.695 19.496 69.489 1.00 25.88 ? 147  CYS C C    1 
ATOM   6147 O  O    . CYS C 1 117 ? -36.925 19.455 69.404 1.00 28.70 ? 147  CYS C O    1 
ATOM   6148 C  CB   . CYS C 1 117 ? -34.461 19.112 67.366 1.00 28.52 ? 147  CYS C CB   1 
ATOM   6149 S  SG   . CYS C 1 117 ? -33.949 19.736 65.751 1.00 21.93 ? 147  CYS C SG   1 
ATOM   6150 N  N    . ARG C 1 118 ? -35.022 18.942 70.495 1.00 24.18 ? 148  ARG C N    1 
ATOM   6151 C  CA   . ARG C 1 118 ? -35.714 18.262 71.588 1.00 24.45 ? 148  ARG C CA   1 
ATOM   6152 C  C    . ARG C 1 118 ? -36.547 19.237 72.403 1.00 24.58 ? 148  ARG C C    1 
ATOM   6153 O  O    . ARG C 1 118 ? -37.764 19.080 72.540 1.00 26.10 ? 148  ARG C O    1 
ATOM   6154 C  CB   . ARG C 1 118 ? -34.713 17.557 72.507 1.00 21.93 ? 148  ARG C CB   1 
ATOM   6155 C  CG   . ARG C 1 118 ? -35.367 16.842 73.670 1.00 23.51 ? 148  ARG C CG   1 
ATOM   6156 C  CD   . ARG C 1 118 ? -34.359 16.096 74.532 1.00 28.71 ? 148  ARG C CD   1 
ATOM   6157 N  NE   . ARG C 1 118 ? -33.350 16.967 75.138 1.00 30.12 ? 148  ARG C NE   1 
ATOM   6158 C  CZ   . ARG C 1 118 ? -33.591 17.839 76.114 1.00 30.18 ? 148  ARG C CZ   1 
ATOM   6159 N  NH1  . ARG C 1 118 ? -34.811 17.976 76.614 1.00 25.83 ? 148  ARG C NH1  1 
ATOM   6160 N  NH2  . ARG C 1 118 ? -32.603 18.578 76.596 1.00 32.54 ? 148  ARG C NH2  1 
ATOM   6161 N  N    . ARG C 1 119 ? -35.880 20.262 72.917 1.00 25.67 ? 149  ARG C N    1 
ATOM   6162 C  CA   . ARG C 1 119 ? -36.519 21.278 73.732 1.00 24.91 ? 149  ARG C CA   1 
ATOM   6163 C  C    . ARG C 1 119 ? -37.592 22.003 72.938 1.00 27.68 ? 149  ARG C C    1 
ATOM   6164 O  O    . ARG C 1 119 ? -38.660 22.316 73.459 1.00 32.66 ? 149  ARG C O    1 
ATOM   6165 C  CB   . ARG C 1 119 ? -35.457 22.249 74.234 1.00 25.44 ? 149  ARG C CB   1 
ATOM   6166 C  CG   . ARG C 1 119 ? -34.406 21.569 75.089 1.00 20.67 ? 149  ARG C CG   1 
ATOM   6167 C  CD   . ARG C 1 119 ? -33.130 22.370 75.160 1.00 24.92 ? 149  ARG C CD   1 
ATOM   6168 N  NE   . ARG C 1 119 ? -33.315 23.665 75.813 1.00 26.47 ? 149  ARG C NE   1 
ATOM   6169 C  CZ   . ARG C 1 119 ? -32.347 24.565 75.958 1.00 24.53 ? 149  ARG C CZ   1 
ATOM   6170 N  NH1  . ARG C 1 119 ? -31.131 24.319 75.490 1.00 20.55 ? 149  ARG C NH1  1 
ATOM   6171 N  NH2  . ARG C 1 119 ? -32.591 25.698 76.606 1.00 25.14 ? 149  ARG C NH2  1 
ATOM   6172 N  N    . MET C 1 120 ? -37.322 22.233 71.660 1.00 29.76 ? 150  MET C N    1 
ATOM   6173 C  CA   . MET C 1 120 ? -38.276 22.909 70.795 1.00 32.17 ? 150  MET C CA   1 
ATOM   6174 C  C    . MET C 1 120 ? -39.570 22.102 70.702 1.00 31.76 ? 150  MET C C    1 
ATOM   6175 O  O    . MET C 1 120 ? -40.654 22.643 70.912 1.00 33.14 ? 150  MET C O    1 
ATOM   6176 C  CB   . MET C 1 120 ? -37.670 23.117 69.401 1.00 35.17 ? 150  MET C CB   1 
ATOM   6177 C  CG   . MET C 1 120 ? -38.399 24.151 68.566 1.00 41.20 ? 150  MET C CG   1 
ATOM   6178 S  SD   . MET C 1 120 ? -37.329 24.924 67.335 1.00 41.68 ? 150  MET C SD   1 
ATOM   6179 C  CE   . MET C 1 120 ? -38.030 24.237 65.853 1.00 41.20 ? 150  MET C CE   1 
ATOM   6180 N  N    . GLY C 1 121 ? -39.440 20.806 70.415 1.00 31.29 ? 151  GLY C N    1 
ATOM   6181 C  CA   . GLY C 1 121 ? -40.589 19.919 70.291 1.00 31.80 ? 151  GLY C CA   1 
ATOM   6182 C  C    . GLY C 1 121 ? -41.473 19.894 71.523 1.00 31.86 ? 151  GLY C C    1 
ATOM   6183 O  O    . GLY C 1 121 ? -42.703 19.828 71.425 1.00 29.46 ? 151  GLY C O    1 
ATOM   6184 N  N    . ILE C 1 122 ? -40.837 19.918 72.687 1.00 31.96 ? 152  ILE C N    1 
ATOM   6185 C  CA   . ILE C 1 122 ? -41.553 19.935 73.956 1.00 33.54 ? 152  ILE C CA   1 
ATOM   6186 C  C    . ILE C 1 122 ? -42.460 21.166 73.959 1.00 34.02 ? 152  ILE C C    1 
ATOM   6187 O  O    . ILE C 1 122 ? -43.671 21.056 74.143 1.00 32.96 ? 152  ILE C O    1 
ATOM   6188 C  CB   . ILE C 1 122 ? -40.568 20.048 75.137 1.00 32.59 ? 152  ILE C CB   1 
ATOM   6189 C  CG1  . ILE C 1 122 ? -39.717 18.784 75.240 1.00 32.55 ? 152  ILE C CG1  1 
ATOM   6190 C  CG2  . ILE C 1 122 ? -41.314 20.308 76.429 1.00 38.11 ? 152  ILE C CG2  1 
ATOM   6191 C  CD1  . ILE C 1 122 ? -40.514 17.537 75.537 1.00 36.27 ? 152  ILE C CD1  1 
ATOM   6192 N  N    . GLY C 1 123 ? -41.853 22.326 73.698 1.00 35.87 ? 153  GLY C N    1 
ATOM   6193 C  CA   . GLY C 1 123 ? -42.564 23.593 73.670 1.00 31.46 ? 153  GLY C CA   1 
ATOM   6194 C  C    . GLY C 1 123 ? -43.689 23.699 72.663 1.00 31.46 ? 153  GLY C C    1 
ATOM   6195 O  O    . GLY C 1 123 ? -44.759 24.209 72.987 1.00 32.62 ? 153  GLY C O    1 
ATOM   6196 N  N    . MET C 1 124 ? -43.462 23.226 71.444 1.00 32.68 ? 154  MET C N    1 
ATOM   6197 C  CA   . MET C 1 124 ? -44.494 23.278 70.410 1.00 35.76 ? 154  MET C CA   1 
ATOM   6198 C  C    . MET C 1 124 ? -45.722 22.478 70.824 1.00 35.75 ? 154  MET C C    1 
ATOM   6199 O  O    . MET C 1 124 ? -46.854 22.940 70.679 1.00 35.89 ? 154  MET C O    1 
ATOM   6200 C  CB   . MET C 1 124 ? -43.949 22.774 69.073 1.00 33.36 ? 154  MET C CB   1 
ATOM   6201 C  CG   . MET C 1 124 ? -42.963 23.735 68.423 1.00 37.59 ? 154  MET C CG   1 
ATOM   6202 S  SD   . MET C 1 124 ? -42.290 23.101 66.884 1.00 39.37 ? 154  MET C SD   1 
ATOM   6203 C  CE   . MET C 1 124 ? -41.534 21.654 67.530 1.00 48.55 ? 154  MET C CE   1 
ATOM   6204 N  N    . ALA C 1 125 ? -45.493 21.281 71.351 1.00 38.13 ? 155  ALA C N    1 
ATOM   6205 C  CA   . ALA C 1 125 ? -46.585 20.435 71.808 1.00 38.31 ? 155  ALA C CA   1 
ATOM   6206 C  C    . ALA C 1 125 ? -47.334 21.208 72.890 1.00 38.30 ? 155  ALA C C    1 
ATOM   6207 O  O    . ALA C 1 125 ? -48.560 21.260 72.879 1.00 41.45 ? 155  ALA C O    1 
ATOM   6208 C  CB   . ALA C 1 125 ? -46.041 19.122 72.363 1.00 36.73 ? 155  ALA C CB   1 
ATOM   6209 N  N    . GLU C 1 126 ? -46.579 21.874 73.764 1.00 38.27 ? 156  GLU C N    1 
ATOM   6210 C  CA   . GLU C 1 126 ? -47.129 22.673 74.860 1.00 39.72 ? 156  GLU C CA   1 
ATOM   6211 C  C    . GLU C 1 126 ? -48.203 23.669 74.392 1.00 41.50 ? 156  GLU C C    1 
ATOM   6212 O  O    . GLU C 1 126 ? -49.262 23.790 75.011 1.00 43.71 ? 156  GLU C O    1 
ATOM   6213 C  CB   . GLU C 1 126 ? -45.994 23.414 75.568 1.00 40.17 ? 156  GLU C CB   1 
ATOM   6214 C  CG   . GLU C 1 126 ? -46.383 24.119 76.855 1.00 44.59 ? 156  GLU C CG   1 
ATOM   6215 C  CD   . GLU C 1 126 ? -45.197 24.789 77.542 1.00 49.29 ? 156  GLU C CD   1 
ATOM   6216 O  OE1  . GLU C 1 126 ? -44.070 24.245 77.483 1.00 49.46 ? 156  GLU C OE1  1 
ATOM   6217 O  OE2  . GLU C 1 126 ? -45.393 25.864 78.148 1.00 52.04 ? 156  GLU C OE2  1 
ATOM   6218 N  N    . PHE C 1 127 ? -47.937 24.371 73.295 1.00 40.48 ? 157  PHE C N    1 
ATOM   6219 C  CA   . PHE C 1 127 ? -48.890 25.337 72.751 1.00 38.72 ? 157  PHE C CA   1 
ATOM   6220 C  C    . PHE C 1 127 ? -49.748 24.737 71.642 1.00 41.00 ? 157  PHE C C    1 
ATOM   6221 O  O    . PHE C 1 127 ? -50.500 25.452 70.982 1.00 41.10 ? 157  PHE C O    1 
ATOM   6222 C  CB   . PHE C 1 127 ? -48.157 26.551 72.181 1.00 34.27 ? 157  PHE C CB   1 
ATOM   6223 C  CG   . PHE C 1 127 ? -47.463 27.382 73.206 1.00 27.42 ? 157  PHE C CG   1 
ATOM   6224 C  CD1  . PHE C 1 127 ? -46.212 27.019 73.681 1.00 24.95 ? 157  PHE C CD1  1 
ATOM   6225 C  CD2  . PHE C 1 127 ? -48.063 28.528 73.703 1.00 24.54 ? 157  PHE C CD2  1 
ATOM   6226 C  CE1  . PHE C 1 127 ? -45.560 27.791 74.629 1.00 26.07 ? 157  PHE C CE1  1 
ATOM   6227 C  CE2  . PHE C 1 127 ? -47.419 29.308 74.649 1.00 27.86 ? 157  PHE C CE2  1 
ATOM   6228 C  CZ   . PHE C 1 127 ? -46.167 28.935 75.119 1.00 28.41 ? 157  PHE C CZ   1 
ATOM   6229 N  N    . LEU C 1 128 ? -49.639 23.430 71.429 1.00 44.28 ? 158  LEU C N    1 
ATOM   6230 C  CA   . LEU C 1 128 ? -50.403 22.775 70.372 1.00 48.96 ? 158  LEU C CA   1 
ATOM   6231 C  C    . LEU C 1 128 ? -51.913 22.961 70.540 1.00 53.02 ? 158  LEU C C    1 
ATOM   6232 O  O    . LEU C 1 128 ? -52.670 22.877 69.569 1.00 56.70 ? 158  LEU C O    1 
ATOM   6233 C  CB   . LEU C 1 128 ? -50.025 21.293 70.277 1.00 47.24 ? 158  LEU C CB   1 
ATOM   6234 C  CG   . LEU C 1 128 ? -50.329 20.565 68.963 1.00 47.60 ? 158  LEU C CG   1 
ATOM   6235 C  CD1  . LEU C 1 128 ? -49.875 21.390 67.766 1.00 47.20 ? 158  LEU C CD1  1 
ATOM   6236 C  CD2  . LEU C 1 128 ? -49.643 19.215 68.966 1.00 43.27 ? 158  LEU C CD2  1 
ATOM   6237 N  N    . ASP C 1 129 ? -52.340 23.231 71.770 1.00 54.36 ? 159  ASP C N    1 
ATOM   6238 C  CA   . ASP C 1 129 ? -53.752 23.454 72.072 1.00 56.88 ? 159  ASP C CA   1 
ATOM   6239 C  C    . ASP C 1 129 ? -53.955 24.807 72.759 1.00 56.20 ? 159  ASP C C    1 
ATOM   6240 O  O    . ASP C 1 129 ? -55.034 25.398 72.702 1.00 55.94 ? 159  ASP C O    1 
ATOM   6241 C  CB   . ASP C 1 129 ? -54.321 22.306 72.925 1.00 58.28 ? 159  ASP C CB   1 
ATOM   6242 C  CG   . ASP C 1 129 ? -53.507 22.030 74.191 1.00 59.88 ? 159  ASP C CG   1 
ATOM   6243 O  OD1  . ASP C 1 129 ? -52.391 22.570 74.352 1.00 60.52 ? 159  ASP C OD1  1 
ATOM   6244 O  OD2  . ASP C 1 129 ? -53.993 21.243 75.031 1.00 62.14 ? 159  ASP C OD2  1 
ATOM   6245 N  N    . LYS C 1 130 ? -52.903 25.276 73.415 1.00 55.24 ? 160  LYS C N    1 
ATOM   6246 C  CA   . LYS C 1 130 ? -52.902 26.558 74.109 1.00 54.45 ? 160  LYS C CA   1 
ATOM   6247 C  C    . LYS C 1 130 ? -52.465 27.564 73.028 1.00 56.24 ? 160  LYS C C    1 
ATOM   6248 O  O    . LYS C 1 130 ? -51.526 27.299 72.284 1.00 57.67 ? 160  LYS C O    1 
ATOM   6249 C  CB   . LYS C 1 130 ? -51.887 26.475 75.250 1.00 50.83 ? 160  LYS C CB   1 
ATOM   6250 C  CG   . LYS C 1 130 ? -51.864 27.643 76.202 1.00 48.70 ? 160  LYS C CG   1 
ATOM   6251 C  CD   . LYS C 1 130 ? -50.924 27.357 77.367 1.00 43.54 ? 160  LYS C CD   1 
ATOM   6252 C  CE   . LYS C 1 130 ? -49.542 26.958 76.885 1.00 42.03 ? 160  LYS C CE   1 
ATOM   6253 N  NZ   . LYS C 1 130 ? -48.547 26.913 77.986 1.00 40.40 ? 160  LYS C NZ   1 
ATOM   6254 N  N    . HIS C 1 131 ? -53.109 28.722 72.944 1.00 55.76 ? 161  HIS C N    1 
ATOM   6255 C  CA   . HIS C 1 131 ? -52.759 29.661 71.884 1.00 53.94 ? 161  HIS C CA   1 
ATOM   6256 C  C    . HIS C 1 131 ? -52.252 31.060 72.258 1.00 53.52 ? 161  HIS C C    1 
ATOM   6257 O  O    . HIS C 1 131 ? -52.640 32.055 71.639 1.00 56.43 ? 161  HIS C O    1 
ATOM   6258 C  CB   . HIS C 1 131 ? -53.933 29.756 70.907 1.00 56.59 ? 161  HIS C CB   1 
ATOM   6259 C  CG   . HIS C 1 131 ? -54.365 28.432 70.357 1.00 59.96 ? 161  HIS C CG   1 
ATOM   6260 N  ND1  . HIS C 1 131 ? -55.663 27.971 70.453 1.00 64.27 ? 161  HIS C ND1  1 
ATOM   6261 C  CD2  . HIS C 1 131 ? -53.672 27.456 69.725 1.00 62.56 ? 161  HIS C CD2  1 
ATOM   6262 C  CE1  . HIS C 1 131 ? -55.749 26.774 69.905 1.00 62.80 ? 161  HIS C CE1  1 
ATOM   6263 N  NE2  . HIS C 1 131 ? -54.553 26.436 69.455 1.00 62.46 ? 161  HIS C NE2  1 
ATOM   6264 N  N    . VAL C 1 132 ? -51.343 31.128 73.228 1.00 49.49 ? 162  VAL C N    1 
ATOM   6265 C  CA   . VAL C 1 132 ? -50.760 32.403 73.675 1.00 44.77 ? 162  VAL C CA   1 
ATOM   6266 C  C    . VAL C 1 132 ? -51.761 33.390 74.274 1.00 41.48 ? 162  VAL C C    1 
ATOM   6267 O  O    . VAL C 1 132 ? -52.499 34.067 73.557 1.00 38.57 ? 162  VAL C O    1 
ATOM   6268 C  CB   . VAL C 1 132 ? -50.007 33.133 72.532 1.00 45.06 ? 162  VAL C CB   1 
ATOM   6269 C  CG1  . VAL C 1 132 ? -49.307 34.376 73.075 1.00 37.46 ? 162  VAL C CG1  1 
ATOM   6270 C  CG2  . VAL C 1 132 ? -49.008 32.200 71.868 1.00 43.28 ? 162  VAL C CG2  1 
ATOM   6271 N  N    . THR C 1 133 ? -51.747 33.500 75.594 1.00 39.11 ? 163  THR C N    1 
ATOM   6272 C  CA   . THR C 1 133 ? -52.640 34.413 76.282 1.00 36.36 ? 163  THR C CA   1 
ATOM   6273 C  C    . THR C 1 133 ? -51.910 35.685 76.675 1.00 34.93 ? 163  THR C C    1 
ATOM   6274 O  O    . THR C 1 133 ? -52.111 36.725 76.060 1.00 36.90 ? 163  THR C O    1 
ATOM   6275 C  CB   . THR C 1 133 ? -53.269 33.757 77.524 1.00 38.92 ? 163  THR C CB   1 
ATOM   6276 O  OG1  . THR C 1 133 ? -52.251 33.088 78.287 1.00 40.93 ? 163  THR C OG1  1 
ATOM   6277 C  CG2  . THR C 1 133 ? -54.348 32.761 77.103 1.00 37.21 ? 163  THR C CG2  1 
ATOM   6278 N  N    . SER C 1 134 ? -51.004 35.588 77.640 1.00 33.94 ? 164  SER C N    1 
ATOM   6279 C  CA   . SER C 1 134 ? -50.270 36.754 78.112 1.00 34.63 ? 164  SER C CA   1 
ATOM   6280 C  C    . SER C 1 134 ? -49.025 37.080 77.287 1.00 36.25 ? 164  SER C C    1 
ATOM   6281 O  O    . SER C 1 134 ? -48.578 36.272 76.470 1.00 37.56 ? 164  SER C O    1 
ATOM   6282 C  CB   . SER C 1 134 ? -49.874 36.555 79.571 1.00 33.88 ? 164  SER C CB   1 
ATOM   6283 O  OG   . SER C 1 134 ? -48.941 35.498 79.690 1.00 35.17 ? 164  SER C OG   1 
ATOM   6284 N  N    . GLU C 1 135 ? -48.453 38.257 77.543 1.00 36.38 ? 165  GLU C N    1 
ATOM   6285 C  CA   . GLU C 1 135 ? -47.252 38.712 76.856 1.00 33.77 ? 165  GLU C CA   1 
ATOM   6286 C  C    . GLU C 1 135 ? -46.075 37.853 77.253 1.00 33.85 ? 165  GLU C C    1 
ATOM   6287 O  O    . GLU C 1 135 ? -45.258 37.486 76.405 1.00 32.90 ? 165  GLU C O    1 
ATOM   6288 C  CB   . GLU C 1 135 ? -46.957 40.175 77.178 1.00 35.43 ? 165  GLU C CB   1 
ATOM   6289 C  CG   . GLU C 1 135 ? -48.001 41.138 76.649 1.00 39.25 ? 165  GLU C CG   1 
ATOM   6290 C  CD   . GLU C 1 135 ? -47.558 42.579 76.747 1.00 39.98 ? 165  GLU C CD   1 
ATOM   6291 O  OE1  . GLU C 1 135 ? -46.778 43.020 75.877 1.00 37.84 ? 165  GLU C OE1  1 
ATOM   6292 O  OE2  . GLU C 1 135 ? -47.997 43.273 77.688 1.00 43.74 ? 165  GLU C OE2  1 
ATOM   6293 N  N    . GLN C 1 136 ? -45.998 37.508 78.538 1.00 32.80 ? 166  GLN C N    1 
ATOM   6294 C  CA   . GLN C 1 136 ? -44.908 36.659 79.014 1.00 37.83 ? 166  GLN C CA   1 
ATOM   6295 C  C    . GLN C 1 136 ? -45.005 35.329 78.259 1.00 35.49 ? 166  GLN C C    1 
ATOM   6296 O  O    . GLN C 1 136 ? -43.997 34.769 77.814 1.00 33.99 ? 166  GLN C O    1 
ATOM   6297 C  CB   . GLN C 1 136 ? -45.007 36.429 80.528 1.00 43.73 ? 166  GLN C CB   1 
ATOM   6298 C  CG   . GLN C 1 136 ? -43.795 35.701 81.120 1.00 54.53 ? 166  GLN C CG   1 
ATOM   6299 C  CD   . GLN C 1 136 ? -43.895 35.481 82.625 1.00 58.04 ? 166  GLN C CD   1 
ATOM   6300 O  OE1  . GLN C 1 136 ? -43.735 36.411 83.415 1.00 58.51 ? 166  GLN C OE1  1 
ATOM   6301 N  NE2  . GLN C 1 136 ? -44.143 34.241 83.025 1.00 61.36 ? 166  GLN C NE2  1 
ATOM   6302 N  N    . GLU C 1 137 ? -46.239 34.883 78.047 1.00 32.83 ? 167  GLU C N    1 
ATOM   6303 C  CA   . GLU C 1 137 ? -46.512 33.643 77.337 1.00 33.22 ? 167  GLU C CA   1 
ATOM   6304 C  C    . GLU C 1 137 ? -46.110 33.759 75.865 1.00 30.65 ? 167  GLU C C    1 
ATOM   6305 O  O    . GLU C 1 137 ? -45.791 32.758 75.223 1.00 28.06 ? 167  GLU C O    1 
ATOM   6306 C  CB   . GLU C 1 137 ? -47.999 33.294 77.455 1.00 37.25 ? 167  GLU C CB   1 
ATOM   6307 C  CG   . GLU C 1 137 ? -48.351 31.858 77.079 1.00 46.59 ? 167  GLU C CG   1 
ATOM   6308 C  CD   . GLU C 1 137 ? -47.957 30.830 78.136 1.00 48.12 ? 167  GLU C CD   1 
ATOM   6309 O  OE1  . GLU C 1 137 ? -46.955 31.025 78.859 1.00 48.70 ? 167  GLU C OE1  1 
ATOM   6310 O  OE2  . GLU C 1 137 ? -48.658 29.806 78.239 1.00 52.56 ? 167  GLU C OE2  1 
ATOM   6311 N  N    . TRP C 1 138 ? -46.146 34.980 75.334 1.00 30.26 ? 168  TRP C N    1 
ATOM   6312 C  CA   . TRP C 1 138 ? -45.780 35.241 73.942 1.00 27.96 ? 168  TRP C CA   1 
ATOM   6313 C  C    . TRP C 1 138 ? -44.277 35.046 73.807 1.00 30.50 ? 168  TRP C C    1 
ATOM   6314 O  O    . TRP C 1 138 ? -43.791 34.502 72.808 1.00 28.58 ? 168  TRP C O    1 
ATOM   6315 C  CB   . TRP C 1 138 ? -46.145 36.672 73.550 1.00 27.74 ? 168  TRP C CB   1 
ATOM   6316 C  CG   . TRP C 1 138 ? -46.198 36.903 72.070 1.00 27.46 ? 168  TRP C CG   1 
ATOM   6317 C  CD1  . TRP C 1 138 ? -46.508 35.983 71.105 1.00 25.65 ? 168  TRP C CD1  1 
ATOM   6318 C  CD2  . TRP C 1 138 ? -46.001 38.149 71.387 1.00 27.94 ? 168  TRP C CD2  1 
ATOM   6319 N  NE1  . TRP C 1 138 ? -46.526 36.580 69.874 1.00 23.71 ? 168  TRP C NE1  1 
ATOM   6320 C  CE2  . TRP C 1 138 ? -46.216 37.908 70.012 1.00 27.69 ? 168  TRP C CE2  1 
ATOM   6321 C  CE3  . TRP C 1 138 ? -45.669 39.448 71.805 1.00 27.73 ? 168  TRP C CE3  1 
ATOM   6322 C  CZ2  . TRP C 1 138 ? -46.110 38.923 69.043 1.00 27.74 ? 168  TRP C CZ2  1 
ATOM   6323 C  CZ3  . TRP C 1 138 ? -45.565 40.460 70.839 1.00 31.43 ? 168  TRP C CZ3  1 
ATOM   6324 C  CH2  . TRP C 1 138 ? -45.785 40.187 69.476 1.00 28.84 ? 168  TRP C CH2  1 
ATOM   6325 N  N    . ASP C 1 139 ? -43.545 35.495 74.822 1.00 28.70 ? 169  ASP C N    1 
ATOM   6326 C  CA   . ASP C 1 139 ? -42.101 35.343 74.834 1.00 32.50 ? 169  ASP C CA   1 
ATOM   6327 C  C    . ASP C 1 139 ? -41.788 33.847 74.910 1.00 36.46 ? 169  ASP C C    1 
ATOM   6328 O  O    . ASP C 1 139 ? -40.957 33.337 74.157 1.00 32.36 ? 169  ASP C O    1 
ATOM   6329 C  CB   . ASP C 1 139 ? -41.502 36.081 76.037 1.00 32.59 ? 169  ASP C CB   1 
ATOM   6330 C  CG   . ASP C 1 139 ? -41.518 37.598 75.869 1.00 36.92 ? 169  ASP C CG   1 
ATOM   6331 O  OD1  . ASP C 1 139 ? -42.233 38.113 74.984 1.00 38.51 ? 169  ASP C OD1  1 
ATOM   6332 O  OD2  . ASP C 1 139 ? -40.805 38.286 76.630 1.00 39.25 ? 169  ASP C OD2  1 
ATOM   6333 N  N    . LYS C 1 140 ? -42.510 33.149 75.786 1.00 39.08 ? 170  LYS C N    1 
ATOM   6334 C  CA   . LYS C 1 140 ? -42.353 31.713 75.992 1.00 38.53 ? 170  LYS C CA   1 
ATOM   6335 C  C    . LYS C 1 140 ? -42.445 30.967 74.664 1.00 36.04 ? 170  LYS C C    1 
ATOM   6336 O  O    . LYS C 1 140 ? -41.531 30.224 74.298 1.00 37.53 ? 170  LYS C O    1 
ATOM   6337 C  CB   . LYS C 1 140 ? -43.442 31.206 76.945 1.00 41.51 ? 170  LYS C CB   1 
ATOM   6338 C  CG   . LYS C 1 140 ? -43.297 29.754 77.388 1.00 48.50 ? 170  LYS C CG   1 
ATOM   6339 C  CD   . LYS C 1 140 ? -42.257 29.607 78.495 1.00 51.02 ? 170  LYS C CD   1 
ATOM   6340 C  CE   . LYS C 1 140 ? -42.158 28.166 78.990 1.00 50.48 ? 170  LYS C CE   1 
ATOM   6341 N  NZ   . LYS C 1 140 ? -43.475 27.595 79.389 1.00 49.18 ? 170  LYS C NZ   1 
ATOM   6342 N  N    . TYR C 1 141 ? -43.539 31.182 73.939 1.00 31.74 ? 171  TYR C N    1 
ATOM   6343 C  CA   . TYR C 1 141 ? -43.735 30.521 72.656 1.00 31.61 ? 171  TYR C CA   1 
ATOM   6344 C  C    . TYR C 1 141 ? -42.591 30.869 71.703 1.00 31.61 ? 171  TYR C C    1 
ATOM   6345 O  O    . TYR C 1 141 ? -41.879 29.979 71.231 1.00 31.73 ? 171  TYR C O    1 
ATOM   6346 C  CB   . TYR C 1 141 ? -45.094 30.894 72.052 1.00 32.08 ? 171  TYR C CB   1 
ATOM   6347 C  CG   . TYR C 1 141 ? -45.326 30.272 70.698 1.00 38.58 ? 171  TYR C CG   1 
ATOM   6348 C  CD1  . TYR C 1 141 ? -45.420 28.886 70.549 1.00 40.00 ? 171  TYR C CD1  1 
ATOM   6349 C  CD2  . TYR C 1 141 ? -45.375 31.062 69.550 1.00 40.67 ? 171  TYR C CD2  1 
ATOM   6350 C  CE1  . TYR C 1 141 ? -45.542 28.303 69.287 1.00 38.91 ? 171  TYR C CE1  1 
ATOM   6351 C  CE2  . TYR C 1 141 ? -45.495 30.491 68.287 1.00 39.26 ? 171  TYR C CE2  1 
ATOM   6352 C  CZ   . TYR C 1 141 ? -45.576 29.116 68.160 1.00 39.08 ? 171  TYR C CZ   1 
ATOM   6353 O  OH   . TYR C 1 141 ? -45.656 28.563 66.902 1.00 40.95 ? 171  TYR C OH   1 
ATOM   6354 N  N    . CYS C 1 142 ? -42.374 32.165 71.485 1.00 30.45 ? 172  CYS C N    1 
ATOM   6355 C  CA   . CYS C 1 142 ? -41.303 32.641 70.611 1.00 27.76 ? 172  CYS C CA   1 
ATOM   6356 C  C    . CYS C 1 142 ? -39.935 32.092 71.003 1.00 25.99 ? 172  CYS C C    1 
ATOM   6357 O  O    . CYS C 1 142 ? -39.054 31.953 70.155 1.00 24.47 ? 172  CYS C O    1 
ATOM   6358 C  CB   . CYS C 1 142 ? -41.265 34.171 70.592 1.00 25.03 ? 172  CYS C CB   1 
ATOM   6359 S  SG   . CYS C 1 142 ? -42.722 34.895 69.854 1.00 24.67 ? 172  CYS C SG   1 
ATOM   6360 N  N    . HIS C 1 143 ? -39.747 31.798 72.284 1.00 29.30 ? 173  HIS C N    1 
ATOM   6361 C  CA   . HIS C 1 143 ? -38.485 31.241 72.761 1.00 34.11 ? 173  HIS C CA   1 
ATOM   6362 C  C    . HIS C 1 143 ? -38.333 29.838 72.209 1.00 34.93 ? 173  HIS C C    1 
ATOM   6363 O  O    . HIS C 1 143 ? -37.247 29.434 71.787 1.00 36.50 ? 173  HIS C O    1 
ATOM   6364 C  CB   . HIS C 1 143 ? -38.452 31.171 74.290 1.00 33.89 ? 173  HIS C CB   1 
ATOM   6365 C  CG   . HIS C 1 143 ? -37.339 30.327 74.833 1.00 36.44 ? 173  HIS C CG   1 
ATOM   6366 N  ND1  . HIS C 1 143 ? -36.031 30.762 74.895 1.00 37.24 ? 173  HIS C ND1  1 
ATOM   6367 C  CD2  . HIS C 1 143 ? -37.338 29.071 75.345 1.00 36.92 ? 173  HIS C CD2  1 
ATOM   6368 C  CE1  . HIS C 1 143 ? -35.275 29.816 75.420 1.00 37.95 ? 173  HIS C CE1  1 
ATOM   6369 N  NE2  . HIS C 1 143 ? -36.044 28.778 75.702 1.00 38.52 ? 173  HIS C NE2  1 
ATOM   6370 N  N    . TYR C 1 144 ? -39.432 29.100 72.216 1.00 33.39 ? 174  TYR C N    1 
ATOM   6371 C  CA   . TYR C 1 144 ? -39.421 27.731 71.738 1.00 36.28 ? 174  TYR C CA   1 
ATOM   6372 C  C    . TYR C 1 144 ? -39.125 27.611 70.251 1.00 34.20 ? 174  TYR C C    1 
ATOM   6373 O  O    . TYR C 1 144 ? -38.174 26.944 69.850 1.00 31.28 ? 174  TYR C O    1 
ATOM   6374 C  CB   . TYR C 1 144 ? -40.753 27.049 72.078 1.00 36.00 ? 174  TYR C CB   1 
ATOM   6375 C  CG   . TYR C 1 144 ? -40.879 26.677 73.538 1.00 35.44 ? 174  TYR C CG   1 
ATOM   6376 C  CD1  . TYR C 1 144 ? -39.834 26.028 74.194 1.00 33.46 ? 174  TYR C CD1  1 
ATOM   6377 C  CD2  . TYR C 1 144 ? -42.038 26.961 74.263 1.00 33.40 ? 174  TYR C CD2  1 
ATOM   6378 C  CE1  . TYR C 1 144 ? -39.939 25.664 75.524 1.00 32.80 ? 174  TYR C CE1  1 
ATOM   6379 C  CE2  . TYR C 1 144 ? -42.151 26.597 75.604 1.00 29.93 ? 174  TYR C CE2  1 
ATOM   6380 C  CZ   . TYR C 1 144 ? -41.091 25.948 76.221 1.00 31.96 ? 174  TYR C CZ   1 
ATOM   6381 O  OH   . TYR C 1 144 ? -41.179 25.546 77.532 1.00 39.70 ? 174  TYR C OH   1 
ATOM   6382 N  N    . VAL C 1 145 ? -39.911 28.319 69.451 1.00 35.93 ? 175  VAL C N    1 
ATOM   6383 C  CA   . VAL C 1 145 ? -39.795 28.280 68.000 1.00 34.45 ? 175  VAL C CA   1 
ATOM   6384 C  C    . VAL C 1 145 ? -38.656 29.077 67.362 1.00 30.82 ? 175  VAL C C    1 
ATOM   6385 O  O    . VAL C 1 145 ? -38.191 28.714 66.281 1.00 30.94 ? 175  VAL C O    1 
ATOM   6386 C  CB   . VAL C 1 145 ? -41.137 28.689 67.348 1.00 36.02 ? 175  VAL C CB   1 
ATOM   6387 C  CG1  . VAL C 1 145 ? -41.057 28.573 65.824 1.00 43.43 ? 175  VAL C CG1  1 
ATOM   6388 C  CG2  . VAL C 1 145 ? -42.258 27.806 67.879 1.00 34.95 ? 175  VAL C CG2  1 
ATOM   6389 N  N    . ALA C 1 146 ? -38.188 30.137 68.018 1.00 27.11 ? 176  ALA C N    1 
ATOM   6390 C  CA   . ALA C 1 146 ? -37.128 30.962 67.438 1.00 23.44 ? 176  ALA C CA   1 
ATOM   6391 C  C    . ALA C 1 146 ? -35.970 31.295 68.366 1.00 20.74 ? 176  ALA C C    1 
ATOM   6392 O  O    . ALA C 1 146 ? -34.814 31.306 67.943 1.00 21.18 ? 176  ALA C O    1 
ATOM   6393 C  CB   . ALA C 1 146 ? -37.726 32.245 66.857 1.00 24.31 ? 176  ALA C CB   1 
ATOM   6394 N  N    . GLY C 1 147 ? -36.271 31.610 69.620 1.00 21.78 ? 177  GLY C N    1 
ATOM   6395 C  CA   . GLY C 1 147 ? -35.212 31.931 70.561 1.00 22.65 ? 177  GLY C CA   1 
ATOM   6396 C  C    . GLY C 1 147 ? -34.211 30.792 70.645 1.00 24.94 ? 177  GLY C C    1 
ATOM   6397 O  O    . GLY C 1 147 ? -32.998 31.011 70.658 1.00 24.95 ? 177  GLY C O    1 
ATOM   6398 N  N    . LEU C 1 148 ? -34.722 29.564 70.668 1.00 27.44 ? 178  LEU C N    1 
ATOM   6399 C  CA   . LEU C 1 148 ? -33.878 28.375 70.731 1.00 25.52 ? 178  LEU C CA   1 
ATOM   6400 C  C    . LEU C 1 148 ? -33.030 28.234 69.464 1.00 23.96 ? 178  LEU C C    1 
ATOM   6401 O  O    . LEU C 1 148 ? -31.942 27.651 69.498 1.00 21.71 ? 178  LEU C O    1 
ATOM   6402 C  CB   . LEU C 1 148 ? -34.733 27.121 70.976 1.00 23.37 ? 178  LEU C CB   1 
ATOM   6403 C  CG   . LEU C 1 148 ? -35.168 26.865 72.429 1.00 18.66 ? 178  LEU C CG   1 
ATOM   6404 C  CD1  . LEU C 1 148 ? -36.228 25.802 72.504 1.00 21.18 ? 178  LEU C CD1  1 
ATOM   6405 C  CD2  . LEU C 1 148 ? -33.990 26.449 73.250 1.00 13.79 ? 178  LEU C CD2  1 
ATOM   6406 N  N    . VAL C 1 149 ? -33.518 28.782 68.353 1.00 22.21 ? 179  VAL C N    1 
ATOM   6407 C  CA   . VAL C 1 149 ? -32.779 28.731 67.094 1.00 22.98 ? 179  VAL C CA   1 
ATOM   6408 C  C    . VAL C 1 149 ? -31.551 29.634 67.235 1.00 23.36 ? 179  VAL C C    1 
ATOM   6409 O  O    . VAL C 1 149 ? -30.428 29.228 66.921 1.00 25.43 ? 179  VAL C O    1 
ATOM   6410 C  CB   . VAL C 1 149 ? -33.661 29.167 65.888 1.00 22.26 ? 179  VAL C CB   1 
ATOM   6411 C  CG1  . VAL C 1 149 ? -32.822 29.261 64.605 1.00 19.72 ? 179  VAL C CG1  1 
ATOM   6412 C  CG2  . VAL C 1 149 ? -34.817 28.172 65.698 1.00 17.44 ? 179  VAL C CG2  1 
ATOM   6413 N  N    . GLY C 1 150 ? -31.759 30.822 67.794 1.00 20.35 ? 180  GLY C N    1 
ATOM   6414 C  CA   . GLY C 1 150 ? -30.657 31.741 68.004 1.00 17.56 ? 180  GLY C CA   1 
ATOM   6415 C  C    . GLY C 1 150 ? -29.642 31.138 68.951 1.00 17.99 ? 180  GLY C C    1 
ATOM   6416 O  O    . GLY C 1 150 ? -28.439 31.319 68.777 1.00 19.63 ? 180  GLY C O    1 
ATOM   6417 N  N    . ILE C 1 151 ? -30.133 30.442 69.974 1.00 20.51 ? 181  ILE C N    1 
ATOM   6418 C  CA   . ILE C 1 151 ? -29.280 29.773 70.959 1.00 18.94 ? 181  ILE C CA   1 
ATOM   6419 C  C    . ILE C 1 151 ? -28.436 28.702 70.244 1.00 20.39 ? 181  ILE C C    1 
ATOM   6420 O  O    . ILE C 1 151 ? -27.206 28.654 70.382 1.00 18.34 ? 181  ILE C O    1 
ATOM   6421 C  CB   . ILE C 1 151 ? -30.143 29.063 72.034 1.00 19.87 ? 181  ILE C CB   1 
ATOM   6422 C  CG1  . ILE C 1 151 ? -31.034 30.066 72.766 1.00 21.99 ? 181  ILE C CG1  1 
ATOM   6423 C  CG2  . ILE C 1 151 ? -29.268 28.284 72.996 1.00 20.23 ? 181  ILE C CG2  1 
ATOM   6424 C  CD1  . ILE C 1 151 ? -30.295 31.091 73.522 1.00 20.41 ? 181  ILE C CD1  1 
ATOM   6425 N  N    . GLY C 1 152 ? -29.118 27.852 69.473 1.00 22.58 ? 182  GLY C N    1 
ATOM   6426 C  CA   . GLY C 1 152 ? -28.458 26.786 68.739 1.00 21.16 ? 182  GLY C CA   1 
ATOM   6427 C  C    . GLY C 1 152 ? -27.402 27.340 67.806 1.00 22.57 ? 182  GLY C C    1 
ATOM   6428 O  O    . GLY C 1 152 ? -26.240 26.926 67.867 1.00 23.03 ? 182  GLY C O    1 
ATOM   6429 N  N    . LEU C 1 153 ? -27.799 28.279 66.949 1.00 20.80 ? 183  LEU C N    1 
ATOM   6430 C  CA   . LEU C 1 153 ? -26.867 28.908 66.014 1.00 21.45 ? 183  LEU C CA   1 
ATOM   6431 C  C    . LEU C 1 153 ? -25.653 29.411 66.777 1.00 20.25 ? 183  LEU C C    1 
ATOM   6432 O  O    . LEU C 1 153 ? -24.519 29.062 66.445 1.00 24.09 ? 183  LEU C O    1 
ATOM   6433 C  CB   . LEU C 1 153 ? -27.537 30.074 65.274 1.00 20.03 ? 183  LEU C CB   1 
ATOM   6434 C  CG   . LEU C 1 153 ? -28.575 29.692 64.214 1.00 21.68 ? 183  LEU C CG   1 
ATOM   6435 C  CD1  . LEU C 1 153 ? -29.294 30.932 63.747 1.00 19.98 ? 183  LEU C CD1  1 
ATOM   6436 C  CD2  . LEU C 1 153 ? -27.911 28.968 63.032 1.00 19.27 ? 183  LEU C CD2  1 
ATOM   6437 N  N    . SER C 1 154 ? -25.902 30.177 67.837 1.00 22.59 ? 184  SER C N    1 
ATOM   6438 C  CA   . SER C 1 154 ? -24.831 30.720 68.664 1.00 24.81 ? 184  SER C CA   1 
ATOM   6439 C  C    . SER C 1 154 ? -23.877 29.620 69.123 1.00 23.49 ? 184  SER C C    1 
ATOM   6440 O  O    . SER C 1 154 ? -22.662 29.740 68.969 1.00 24.41 ? 184  SER C O    1 
ATOM   6441 C  CB   . SER C 1 154 ? -25.415 31.460 69.873 1.00 28.29 ? 184  SER C CB   1 
ATOM   6442 O  OG   . SER C 1 154 ? -26.128 32.620 69.477 1.00 25.65 ? 184  SER C OG   1 
ATOM   6443 N  N    . ARG C 1 155 ? -24.431 28.533 69.647 1.00 24.16 ? 185  ARG C N    1 
ATOM   6444 C  CA   . ARG C 1 155 ? -23.623 27.410 70.110 1.00 24.30 ? 185  ARG C CA   1 
ATOM   6445 C  C    . ARG C 1 155 ? -22.831 26.781 68.950 1.00 23.31 ? 185  ARG C C    1 
ATOM   6446 O  O    . ARG C 1 155 ? -21.662 26.409 69.111 1.00 21.93 ? 185  ARG C O    1 
ATOM   6447 C  CB   . ARG C 1 155 ? -24.506 26.372 70.825 1.00 26.67 ? 185  ARG C CB   1 
ATOM   6448 C  CG   . ARG C 1 155 ? -25.241 26.940 72.046 1.00 27.18 ? 185  ARG C CG   1 
ATOM   6449 C  CD   . ARG C 1 155 ? -25.672 25.872 73.030 1.00 31.40 ? 185  ARG C CD   1 
ATOM   6450 N  NE   . ARG C 1 155 ? -26.859 25.144 72.600 1.00 32.78 ? 185  ARG C NE   1 
ATOM   6451 C  CZ   . ARG C 1 155 ? -27.074 23.856 72.853 1.00 34.60 ? 185  ARG C CZ   1 
ATOM   6452 N  NH1  . ARG C 1 155 ? -26.180 23.150 73.531 1.00 31.49 ? 185  ARG C NH1  1 
ATOM   6453 N  NH2  . ARG C 1 155 ? -28.188 23.272 72.429 1.00 35.82 ? 185  ARG C NH2  1 
ATOM   6454 N  N    . LEU C 1 156 ? -23.446 26.704 67.773 1.00 22.85 ? 186  LEU C N    1 
ATOM   6455 C  CA   . LEU C 1 156 ? -22.757 26.159 66.608 1.00 23.22 ? 186  LEU C CA   1 
ATOM   6456 C  C    . LEU C 1 156 ? -21.607 27.095 66.230 1.00 24.86 ? 186  LEU C C    1 
ATOM   6457 O  O    . LEU C 1 156 ? -20.523 26.632 65.864 1.00 25.77 ? 186  LEU C O    1 
ATOM   6458 C  CB   . LEU C 1 156 ? -23.706 25.994 65.419 1.00 22.19 ? 186  LEU C CB   1 
ATOM   6459 C  CG   . LEU C 1 156 ? -24.851 24.981 65.523 1.00 19.32 ? 186  LEU C CG   1 
ATOM   6460 C  CD1  . LEU C 1 156 ? -25.659 25.042 64.236 1.00 21.57 ? 186  LEU C CD1  1 
ATOM   6461 C  CD2  . LEU C 1 156 ? -24.318 23.577 65.767 1.00 13.48 ? 186  LEU C CD2  1 
ATOM   6462 N  N    . PHE C 1 157 ? -21.833 28.406 66.339 1.00 23.59 ? 187  PHE C N    1 
ATOM   6463 C  CA   . PHE C 1 157 ? -20.798 29.396 66.025 1.00 25.77 ? 187  PHE C CA   1 
ATOM   6464 C  C    . PHE C 1 157 ? -19.585 29.222 66.947 1.00 27.55 ? 187  PHE C C    1 
ATOM   6465 O  O    . PHE C 1 157 ? -18.427 29.259 66.497 1.00 24.80 ? 187  PHE C O    1 
ATOM   6466 C  CB   . PHE C 1 157 ? -21.330 30.830 66.178 1.00 25.17 ? 187  PHE C CB   1 
ATOM   6467 C  CG   . PHE C 1 157 ? -22.421 31.199 65.201 1.00 21.86 ? 187  PHE C CG   1 
ATOM   6468 C  CD1  . PHE C 1 157 ? -22.572 30.517 63.993 1.00 17.15 ? 187  PHE C CD1  1 
ATOM   6469 C  CD2  . PHE C 1 157 ? -23.311 32.231 65.505 1.00 20.98 ? 187  PHE C CD2  1 
ATOM   6470 C  CE1  . PHE C 1 157 ? -23.596 30.850 63.104 1.00 22.05 ? 187  PHE C CE1  1 
ATOM   6471 C  CE2  . PHE C 1 157 ? -24.341 32.577 64.628 1.00 23.32 ? 187  PHE C CE2  1 
ATOM   6472 C  CZ   . PHE C 1 157 ? -24.486 31.884 63.421 1.00 23.48 ? 187  PHE C CZ   1 
ATOM   6473 N  N    . SER C 1 158 ? -19.856 29.048 68.240 1.00 27.53 ? 188  SER C N    1 
ATOM   6474 C  CA   . SER C 1 158 ? -18.791 28.873 69.221 1.00 28.46 ? 188  SER C CA   1 
ATOM   6475 C  C    . SER C 1 158 ? -18.137 27.499 69.112 1.00 26.63 ? 188  SER C C    1 
ATOM   6476 O  O    . SER C 1 158 ? -16.932 27.366 69.333 1.00 27.57 ? 188  SER C O    1 
ATOM   6477 C  CB   . SER C 1 158 ? -19.315 29.101 70.644 1.00 29.39 ? 188  SER C CB   1 
ATOM   6478 O  OG   . SER C 1 158 ? -19.748 30.438 70.840 1.00 32.39 ? 188  SER C OG   1 
ATOM   6479 N  N    . ALA C 1 159 ? -18.918 26.483 68.750 1.00 24.60 ? 189  ALA C N    1 
ATOM   6480 C  CA   . ALA C 1 159 ? -18.368 25.132 68.621 1.00 23.82 ? 189  ALA C CA   1 
ATOM   6481 C  C    . ALA C 1 159 ? -17.318 25.080 67.522 1.00 22.01 ? 189  ALA C C    1 
ATOM   6482 O  O    . ALA C 1 159 ? -16.258 24.486 67.697 1.00 25.83 ? 189  ALA C O    1 
ATOM   6483 C  CB   . ALA C 1 159 ? -19.480 24.112 68.350 1.00 17.47 ? 189  ALA C CB   1 
ATOM   6484 N  N    . SER C 1 160 ? -17.596 25.761 66.416 1.00 21.52 ? 190  SER C N    1 
ATOM   6485 C  CA   . SER C 1 160 ? -16.692 25.794 65.271 1.00 21.41 ? 190  SER C CA   1 
ATOM   6486 C  C    . SER C 1 160 ? -15.435 26.633 65.499 1.00 24.50 ? 190  SER C C    1 
ATOM   6487 O  O    . SER C 1 160 ? -14.491 26.579 64.696 1.00 21.94 ? 190  SER C O    1 
ATOM   6488 C  CB   . SER C 1 160 ? -17.429 26.366 64.067 1.00 22.56 ? 190  SER C CB   1 
ATOM   6489 O  OG   . SER C 1 160 ? -17.736 27.737 64.287 1.00 20.11 ? 190  SER C OG   1 
ATOM   6490 N  N    . GLU C 1 161 ? -15.470 27.465 66.540 1.00 25.03 ? 191  GLU C N    1 
ATOM   6491 C  CA   . GLU C 1 161 ? -14.371 28.362 66.895 1.00 26.84 ? 191  GLU C CA   1 
ATOM   6492 C  C    . GLU C 1 161 ? -14.224 29.600 65.997 1.00 26.73 ? 191  GLU C C    1 
ATOM   6493 O  O    . GLU C 1 161 ? -13.238 30.327 66.102 1.00 28.15 ? 191  GLU C O    1 
ATOM   6494 C  CB   . GLU C 1 161 ? -13.041 27.607 66.981 1.00 28.99 ? 191  GLU C CB   1 
ATOM   6495 C  CG   . GLU C 1 161 ? -12.798 26.930 68.313 1.00 38.90 ? 191  GLU C CG   1 
ATOM   6496 C  CD   . GLU C 1 161 ? -12.580 25.442 68.186 1.00 44.25 ? 191  GLU C CD   1 
ATOM   6497 O  OE1  . GLU C 1 161 ? -11.943 24.999 67.207 1.00 46.27 ? 191  GLU C OE1  1 
ATOM   6498 O  OE2  . GLU C 1 161 ? -13.051 24.707 69.077 1.00 53.04 ? 191  GLU C OE2  1 
ATOM   6499 N  N    . PHE C 1 162 ? -15.184 29.846 65.109 1.00 26.57 ? 192  PHE C N    1 
ATOM   6500 C  CA   . PHE C 1 162 ? -15.101 31.037 64.255 1.00 26.61 ? 192  PHE C CA   1 
ATOM   6501 C  C    . PHE C 1 162 ? -15.541 32.259 65.067 1.00 26.85 ? 192  PHE C C    1 
ATOM   6502 O  O    . PHE C 1 162 ? -15.215 33.402 64.732 1.00 27.13 ? 192  PHE C O    1 
ATOM   6503 C  CB   . PHE C 1 162 ? -15.959 30.892 62.989 1.00 21.88 ? 192  PHE C CB   1 
ATOM   6504 C  CG   . PHE C 1 162 ? -15.354 29.990 61.936 1.00 18.12 ? 192  PHE C CG   1 
ATOM   6505 C  CD1  . PHE C 1 162 ? -14.210 30.371 61.249 1.00 16.70 ? 192  PHE C CD1  1 
ATOM   6506 C  CD2  . PHE C 1 162 ? -15.943 28.767 61.624 1.00 17.97 ? 192  PHE C CD2  1 
ATOM   6507 C  CE1  . PHE C 1 162 ? -13.665 29.552 60.265 1.00 17.98 ? 192  PHE C CE1  1 
ATOM   6508 C  CE2  . PHE C 1 162 ? -15.408 27.939 60.642 1.00 14.16 ? 192  PHE C CE2  1 
ATOM   6509 C  CZ   . PHE C 1 162 ? -14.268 28.331 59.961 1.00 13.36 ? 192  PHE C CZ   1 
ATOM   6510 N  N    . GLU C 1 163 ? -16.300 31.998 66.126 1.00 26.43 ? 193  GLU C N    1 
ATOM   6511 C  CA   . GLU C 1 163 ? -16.784 33.038 67.019 1.00 27.83 ? 193  GLU C CA   1 
ATOM   6512 C  C    . GLU C 1 163 ? -16.346 32.652 68.424 1.00 32.10 ? 193  GLU C C    1 
ATOM   6513 O  O    . GLU C 1 163 ? -16.040 31.485 68.691 1.00 31.46 ? 193  GLU C O    1 
ATOM   6514 C  CB   . GLU C 1 163 ? -18.313 33.147 66.971 1.00 26.83 ? 193  GLU C CB   1 
ATOM   6515 C  CG   . GLU C 1 163 ? -18.893 33.660 65.650 1.00 26.45 ? 193  GLU C CG   1 
ATOM   6516 C  CD   . GLU C 1 163 ? -18.436 35.062 65.294 1.00 26.00 ? 193  GLU C CD   1 
ATOM   6517 O  OE1  . GLU C 1 163 ? -17.952 35.794 66.179 1.00 29.04 ? 193  GLU C OE1  1 
ATOM   6518 O  OE2  . GLU C 1 163 ? -18.570 35.446 64.117 1.00 27.89 ? 193  GLU C OE2  1 
ATOM   6519 N  N    . ASP C 1 164 ? -16.328 33.634 69.318 1.00 34.19 ? 194  ASP C N    1 
ATOM   6520 C  CA   . ASP C 1 164 ? -15.924 33.423 70.698 1.00 33.51 ? 194  ASP C CA   1 
ATOM   6521 C  C    . ASP C 1 164 ? -16.968 32.685 71.532 1.00 31.86 ? 194  ASP C C    1 
ATOM   6522 O  O    . ASP C 1 164 ? -18.167 32.765 71.256 1.00 28.65 ? 194  ASP C O    1 
ATOM   6523 C  CB   . ASP C 1 164 ? -15.623 34.767 71.351 1.00 39.74 ? 194  ASP C CB   1 
ATOM   6524 C  CG   . ASP C 1 164 ? -14.157 34.960 71.609 1.00 46.38 ? 194  ASP C CG   1 
ATOM   6525 O  OD1  . ASP C 1 164 ? -13.426 35.261 70.642 1.00 50.13 ? 194  ASP C OD1  1 
ATOM   6526 O  OD2  . ASP C 1 164 ? -13.736 34.791 72.776 1.00 49.75 ? 194  ASP C OD2  1 
ATOM   6527 N  N    . PRO C 1 165 ? -16.523 31.997 72.602 1.00 31.96 ? 195  PRO C N    1 
ATOM   6528 C  CA   . PRO C 1 165 ? -17.402 31.243 73.503 1.00 31.88 ? 195  PRO C CA   1 
ATOM   6529 C  C    . PRO C 1 165 ? -18.538 32.091 74.090 1.00 32.58 ? 195  PRO C C    1 
ATOM   6530 O  O    . PRO C 1 165 ? -19.613 31.566 74.401 1.00 32.83 ? 195  PRO C O    1 
ATOM   6531 C  CB   . PRO C 1 165 ? -16.440 30.774 74.590 1.00 30.10 ? 195  PRO C CB   1 
ATOM   6532 C  CG   . PRO C 1 165 ? -15.173 30.561 73.830 1.00 29.17 ? 195  PRO C CG   1 
ATOM   6533 C  CD   . PRO C 1 165 ? -15.109 31.803 72.980 1.00 29.99 ? 195  PRO C CD   1 
ATOM   6534 N  N    . LEU C 1 166 ? -18.304 33.399 74.214 1.00 34.22 ? 196  LEU C N    1 
ATOM   6535 C  CA   . LEU C 1 166 ? -19.300 34.335 74.750 1.00 34.53 ? 196  LEU C CA   1 
ATOM   6536 C  C    . LEU C 1 166 ? -20.575 34.283 73.921 1.00 31.62 ? 196  LEU C C    1 
ATOM   6537 O  O    . LEU C 1 166 ? -21.672 34.354 74.470 1.00 33.34 ? 196  LEU C O    1 
ATOM   6538 C  CB   . LEU C 1 166 ? -18.747 35.772 74.743 1.00 37.18 ? 196  LEU C CB   1 
ATOM   6539 C  CG   . LEU C 1 166 ? -19.372 36.888 75.605 1.00 39.43 ? 196  LEU C CG   1 
ATOM   6540 C  CD1  . LEU C 1 166 ? -18.594 38.185 75.407 1.00 36.89 ? 196  LEU C CD1  1 
ATOM   6541 C  CD2  . LEU C 1 166 ? -20.828 37.121 75.286 1.00 39.47 ? 196  LEU C CD2  1 
ATOM   6542 N  N    . VAL C 1 167 ? -20.426 34.155 72.603 1.00 30.29 ? 197  VAL C N    1 
ATOM   6543 C  CA   . VAL C 1 167 ? -21.574 34.100 71.698 1.00 26.89 ? 197  VAL C CA   1 
ATOM   6544 C  C    . VAL C 1 167 ? -22.500 32.954 72.092 1.00 27.59 ? 197  VAL C C    1 
ATOM   6545 O  O    . VAL C 1 167 ? -23.707 33.149 72.244 1.00 27.43 ? 197  VAL C O    1 
ATOM   6546 C  CB   . VAL C 1 167 ? -21.129 33.931 70.233 1.00 25.13 ? 197  VAL C CB   1 
ATOM   6547 C  CG1  . VAL C 1 167 ? -22.342 33.891 69.327 1.00 25.81 ? 197  VAL C CG1  1 
ATOM   6548 C  CG2  . VAL C 1 167 ? -20.206 35.080 69.824 1.00 24.23 ? 197  VAL C CG2  1 
ATOM   6549 N  N    . GLY C 1 168 ? -21.927 31.763 72.265 1.00 27.67 ? 198  GLY C N    1 
ATOM   6550 C  CA   . GLY C 1 168 ? -22.721 30.614 72.664 1.00 27.55 ? 198  GLY C CA   1 
ATOM   6551 C  C    . GLY C 1 168 ? -23.206 30.713 74.104 1.00 26.23 ? 198  GLY C C    1 
ATOM   6552 O  O    . GLY C 1 168 ? -24.317 30.296 74.413 1.00 27.78 ? 198  GLY C O    1 
ATOM   6553 N  N    . GLU C 1 169 ? -22.385 31.297 74.973 1.00 27.09 ? 199  GLU C N    1 
ATOM   6554 C  CA   . GLU C 1 169 ? -22.703 31.446 76.399 1.00 29.55 ? 199  GLU C CA   1 
ATOM   6555 C  C    . GLU C 1 169 ? -23.876 32.372 76.717 1.00 27.42 ? 199  GLU C C    1 
ATOM   6556 O  O    . GLU C 1 169 ? -24.730 32.044 77.544 1.00 23.98 ? 199  GLU C O    1 
ATOM   6557 C  CB   . GLU C 1 169 ? -21.461 31.923 77.174 1.00 31.05 ? 199  GLU C CB   1 
ATOM   6558 C  CG   . GLU C 1 169 ? -20.311 30.922 77.229 1.00 34.48 ? 199  GLU C CG   1 
ATOM   6559 C  CD   . GLU C 1 169 ? -18.983 31.557 77.634 1.00 41.15 ? 199  GLU C CD   1 
ATOM   6560 O  OE1  . GLU C 1 169 ? -18.908 32.805 77.728 1.00 46.25 ? 199  GLU C OE1  1 
ATOM   6561 O  OE2  . GLU C 1 169 ? -18.002 30.807 77.842 1.00 40.94 ? 199  GLU C OE2  1 
ATOM   6562 N  N    . ASP C 1 170 ? -23.899 33.548 76.103 1.00 27.09 ? 200  ASP C N    1 
ATOM   6563 C  CA   . ASP C 1 170 ? -24.975 34.492 76.364 1.00 27.43 ? 200  ASP C CA   1 
ATOM   6564 C  C    . ASP C 1 170 ? -26.253 34.056 75.656 1.00 30.37 ? 200  ASP C C    1 
ATOM   6565 O  O    . ASP C 1 170 ? -26.562 34.497 74.548 1.00 32.89 ? 200  ASP C O    1 
ATOM   6566 C  CB   . ASP C 1 170 ? -24.569 35.905 75.943 1.00 28.11 ? 200  ASP C CB   1 
ATOM   6567 C  CG   . ASP C 1 170 ? -25.519 36.967 76.461 1.00 23.73 ? 200  ASP C CG   1 
ATOM   6568 O  OD1  . ASP C 1 170 ? -26.606 36.622 76.965 1.00 28.72 ? 200  ASP C OD1  1 
ATOM   6569 O  OD2  . ASP C 1 170 ? -25.177 38.160 76.368 1.00 24.64 ? 200  ASP C OD2  1 
ATOM   6570 N  N    . THR C 1 171 ? -27.018 33.213 76.332 1.00 28.72 ? 201  THR C N    1 
ATOM   6571 C  CA   . THR C 1 171 ? -28.253 32.703 75.777 1.00 26.85 ? 201  THR C CA   1 
ATOM   6572 C  C    . THR C 1 171 ? -29.321 33.773 75.688 1.00 27.08 ? 201  THR C C    1 
ATOM   6573 O  O    . THR C 1 171 ? -30.167 33.739 74.792 1.00 29.37 ? 201  THR C O    1 
ATOM   6574 C  CB   . THR C 1 171 ? -28.770 31.506 76.593 1.00 28.13 ? 201  THR C CB   1 
ATOM   6575 O  OG1  . THR C 1 171 ? -28.792 31.850 77.988 1.00 32.36 ? 201  THR C OG1  1 
ATOM   6576 C  CG2  . THR C 1 171 ? -27.877 30.295 76.367 1.00 22.23 ? 201  THR C CG2  1 
ATOM   6577 N  N    . GLU C 1 172 ? -29.285 34.722 76.613 1.00 26.25 ? 202  GLU C N    1 
ATOM   6578 C  CA   . GLU C 1 172 ? -30.259 35.811 76.634 1.00 27.84 ? 202  GLU C CA   1 
ATOM   6579 C  C    . GLU C 1 172 ? -30.218 36.579 75.307 1.00 23.69 ? 202  GLU C C    1 
ATOM   6580 O  O    . GLU C 1 172 ? -31.240 36.752 74.627 1.00 18.03 ? 202  GLU C O    1 
ATOM   6581 C  CB   . GLU C 1 172 ? -29.943 36.757 77.798 1.00 35.60 ? 202  GLU C CB   1 
ATOM   6582 C  CG   . GLU C 1 172 ? -30.917 37.916 77.979 1.00 43.79 ? 202  GLU C CG   1 
ATOM   6583 C  CD   . GLU C 1 172 ? -32.232 37.498 78.612 1.00 48.00 ? 202  GLU C CD   1 
ATOM   6584 O  OE1  . GLU C 1 172 ? -32.919 36.612 78.057 1.00 50.86 ? 202  GLU C OE1  1 
ATOM   6585 O  OE2  . GLU C 1 172 ? -32.577 38.067 79.669 1.00 53.47 ? 202  GLU C OE2  1 
ATOM   6586 N  N    . ARG C 1 173 ? -29.013 37.014 74.952 1.00 21.74 ? 203  ARG C N    1 
ATOM   6587 C  CA   . ARG C 1 173 ? -28.758 37.757 73.729 1.00 25.10 ? 203  ARG C CA   1 
ATOM   6588 C  C    . ARG C 1 173 ? -29.191 36.972 72.491 1.00 25.15 ? 203  ARG C C    1 
ATOM   6589 O  O    . ARG C 1 173 ? -29.867 37.512 71.605 1.00 24.86 ? 203  ARG C O    1 
ATOM   6590 C  CB   . ARG C 1 173 ? -27.272 38.087 73.652 1.00 26.17 ? 203  ARG C CB   1 
ATOM   6591 C  CG   . ARG C 1 173 ? -26.966 39.562 73.554 1.00 34.18 ? 203  ARG C CG   1 
ATOM   6592 C  CD   . ARG C 1 173 ? -27.729 40.377 74.582 1.00 35.20 ? 203  ARG C CD   1 
ATOM   6593 N  NE   . ARG C 1 173 ? -27.457 39.953 75.947 1.00 39.70 ? 203  ARG C NE   1 
ATOM   6594 C  CZ   . ARG C 1 173 ? -26.836 40.697 76.857 1.00 43.00 ? 203  ARG C CZ   1 
ATOM   6595 N  NH1  . ARG C 1 173 ? -26.413 41.923 76.565 1.00 41.99 ? 203  ARG C NH1  1 
ATOM   6596 N  NH2  . ARG C 1 173 ? -26.641 40.205 78.072 1.00 47.79 ? 203  ARG C NH2  1 
ATOM   6597 N  N    . ALA C 1 174 ? -28.818 35.694 72.444 1.00 25.33 ? 204  ALA C N    1 
ATOM   6598 C  CA   . ALA C 1 174 ? -29.179 34.821 71.326 1.00 24.43 ? 204  ALA C CA   1 
ATOM   6599 C  C    . ALA C 1 174 ? -30.688 34.604 71.258 1.00 22.96 ? 204  ALA C C    1 
ATOM   6600 O  O    . ALA C 1 174 ? -31.265 34.533 70.176 1.00 25.36 ? 204  ALA C O    1 
ATOM   6601 C  CB   . ALA C 1 174 ? -28.457 33.490 71.442 1.00 20.17 ? 204  ALA C CB   1 
ATOM   6602 N  N    . ASN C 1 175 ? -31.333 34.525 72.415 1.00 23.22 ? 205  ASN C N    1 
ATOM   6603 C  CA   . ASN C 1 175 ? -32.776 34.325 72.463 1.00 22.30 ? 205  ASN C CA   1 
ATOM   6604 C  C    . ASN C 1 175 ? -33.499 35.544 71.916 1.00 23.10 ? 205  ASN C C    1 
ATOM   6605 O  O    . ASN C 1 175 ? -34.471 35.419 71.170 1.00 25.89 ? 205  ASN C O    1 
ATOM   6606 C  CB   . ASN C 1 175 ? -33.236 34.043 73.898 1.00 22.85 ? 205  ASN C CB   1 
ATOM   6607 C  CG   . ASN C 1 175 ? -34.735 33.826 73.997 1.00 23.68 ? 205  ASN C CG   1 
ATOM   6608 O  OD1  . ASN C 1 175 ? -35.299 32.944 73.348 1.00 18.55 ? 205  ASN C OD1  1 
ATOM   6609 N  ND2  . ASN C 1 175 ? -35.392 34.646 74.805 1.00 29.49 ? 205  ASN C ND2  1 
ATOM   6610 N  N    . SER C 1 176 ? -33.016 36.729 72.275 1.00 26.43 ? 206  SER C N    1 
ATOM   6611 C  CA   . SER C 1 176 ? -33.620 37.974 71.804 1.00 25.81 ? 206  SER C CA   1 
ATOM   6612 C  C    . SER C 1 176 ? -33.585 38.083 70.276 1.00 23.42 ? 206  SER C C    1 
ATOM   6613 O  O    . SER C 1 176 ? -34.546 38.545 69.665 1.00 24.19 ? 206  SER C O    1 
ATOM   6614 C  CB   . SER C 1 176 ? -32.926 39.165 72.447 1.00 28.00 ? 206  SER C CB   1 
ATOM   6615 O  OG   . SER C 1 176 ? -33.108 39.128 73.852 1.00 29.88 ? 206  SER C OG   1 
ATOM   6616 N  N    . MET C 1 177 ? -32.481 37.651 69.671 1.00 22.38 ? 207  MET C N    1 
ATOM   6617 C  CA   . MET C 1 177 ? -32.331 37.664 68.216 1.00 21.69 ? 207  MET C CA   1 
ATOM   6618 C  C    . MET C 1 177 ? -33.481 36.875 67.608 1.00 19.51 ? 207  MET C C    1 
ATOM   6619 O  O    . MET C 1 177 ? -34.076 37.281 66.610 1.00 20.89 ? 207  MET C O    1 
ATOM   6620 C  CB   . MET C 1 177 ? -31.013 37.005 67.823 1.00 20.88 ? 207  MET C CB   1 
ATOM   6621 C  CG   . MET C 1 177 ? -29.787 37.778 68.235 1.00 18.56 ? 207  MET C CG   1 
ATOM   6622 S  SD   . MET C 1 177 ? -29.447 39.105 67.061 1.00 23.72 ? 207  MET C SD   1 
ATOM   6623 C  CE   . MET C 1 177 ? -28.843 38.138 65.598 1.00 21.93 ? 207  MET C CE   1 
ATOM   6624 N  N    . GLY C 1 178 ? -33.815 35.760 68.248 1.00 20.58 ? 208  GLY C N    1 
ATOM   6625 C  CA   . GLY C 1 178 ? -34.899 34.926 67.770 1.00 19.72 ? 208  GLY C CA   1 
ATOM   6626 C  C    . GLY C 1 178 ? -36.262 35.532 68.023 1.00 18.94 ? 208  GLY C C    1 
ATOM   6627 O  O    . GLY C 1 178 ? -37.148 35.476 67.158 1.00 15.32 ? 208  GLY C O    1 
ATOM   6628 N  N    . LEU C 1 179 ? -36.439 36.102 69.214 1.00 18.43 ? 209  LEU C N    1 
ATOM   6629 C  CA   . LEU C 1 179 ? -37.707 36.723 69.580 1.00 19.45 ? 209  LEU C CA   1 
ATOM   6630 C  C    . LEU C 1 179 ? -38.030 37.893 68.655 1.00 19.13 ? 209  LEU C C    1 
ATOM   6631 O  O    . LEU C 1 179 ? -39.191 38.102 68.286 1.00 19.31 ? 209  LEU C O    1 
ATOM   6632 C  CB   . LEU C 1 179 ? -37.686 37.209 71.037 1.00 24.59 ? 209  LEU C CB   1 
ATOM   6633 C  CG   . LEU C 1 179 ? -37.687 36.246 72.238 1.00 25.74 ? 209  LEU C CG   1 
ATOM   6634 C  CD1  . LEU C 1 179 ? -38.778 36.677 73.200 1.00 23.70 ? 209  LEU C CD1  1 
ATOM   6635 C  CD2  . LEU C 1 179 ? -37.923 34.814 71.816 1.00 28.00 ? 209  LEU C CD2  1 
ATOM   6636 N  N    . PHE C 1 180 ? -37.002 38.635 68.250 1.00 17.07 ? 210  PHE C N    1 
ATOM   6637 C  CA   . PHE C 1 180 ? -37.239 39.770 67.380 1.00 18.64 ? 210  PHE C CA   1 
ATOM   6638 C  C    . PHE C 1 180 ? -37.797 39.341 66.035 1.00 21.30 ? 210  PHE C C    1 
ATOM   6639 O  O    . PHE C 1 180 ? -38.847 39.830 65.616 1.00 20.95 ? 210  PHE C O    1 
ATOM   6640 C  CB   . PHE C 1 180 ? -35.984 40.616 67.187 1.00 19.10 ? 210  PHE C CB   1 
ATOM   6641 C  CG   . PHE C 1 180 ? -36.262 41.936 66.525 1.00 25.85 ? 210  PHE C CG   1 
ATOM   6642 C  CD1  . PHE C 1 180 ? -37.215 42.807 67.059 1.00 28.64 ? 210  PHE C CD1  1 
ATOM   6643 C  CD2  . PHE C 1 180 ? -35.634 42.284 65.336 1.00 29.55 ? 210  PHE C CD2  1 
ATOM   6644 C  CE1  . PHE C 1 180 ? -37.541 44.003 66.416 1.00 24.96 ? 210  PHE C CE1  1 
ATOM   6645 C  CE2  . PHE C 1 180 ? -35.954 43.476 64.687 1.00 31.80 ? 210  PHE C CE2  1 
ATOM   6646 C  CZ   . PHE C 1 180 ? -36.912 44.337 65.228 1.00 28.82 ? 210  PHE C CZ   1 
ATOM   6647 N  N    . LEU C 1 181 ? -37.125 38.398 65.377 1.00 21.81 ? 211  LEU C N    1 
ATOM   6648 C  CA   . LEU C 1 181 ? -37.574 37.904 64.071 1.00 21.54 ? 211  LEU C CA   1 
ATOM   6649 C  C    . LEU C 1 181 ? -38.953 37.259 64.130 1.00 20.39 ? 211  LEU C C    1 
ATOM   6650 O  O    . LEU C 1 181 ? -39.809 37.533 63.285 1.00 23.61 ? 211  LEU C O    1 
ATOM   6651 C  CB   . LEU C 1 181 ? -36.564 36.906 63.493 1.00 18.32 ? 211  LEU C CB   1 
ATOM   6652 C  CG   . LEU C 1 181 ? -35.153 37.447 63.256 1.00 15.90 ? 211  LEU C CG   1 
ATOM   6653 C  CD1  . LEU C 1 181 ? -34.203 36.343 62.834 1.00 18.96 ? 211  LEU C CD1  1 
ATOM   6654 C  CD2  . LEU C 1 181 ? -35.216 38.519 62.202 1.00 18.64 ? 211  LEU C CD2  1 
ATOM   6655 N  N    . GLN C 1 182 ? -39.181 36.429 65.142 1.00 22.92 ? 212  GLN C N    1 
ATOM   6656 C  CA   . GLN C 1 182 ? -40.462 35.739 65.281 1.00 23.37 ? 212  GLN C CA   1 
ATOM   6657 C  C    . GLN C 1 182 ? -41.650 36.671 65.492 1.00 22.93 ? 212  GLN C C    1 
ATOM   6658 O  O    . GLN C 1 182 ? -42.693 36.526 64.836 1.00 19.26 ? 212  GLN C O    1 
ATOM   6659 C  CB   . GLN C 1 182 ? -40.422 34.722 66.418 1.00 23.21 ? 212  GLN C CB   1 
ATOM   6660 C  CG   . GLN C 1 182 ? -41.578 33.752 66.359 1.00 19.61 ? 212  GLN C CG   1 
ATOM   6661 C  CD   . GLN C 1 182 ? -41.605 33.025 65.048 1.00 22.19 ? 212  GLN C CD   1 
ATOM   6662 O  OE1  . GLN C 1 182 ? -40.618 32.411 64.655 1.00 27.71 ? 212  GLN C OE1  1 
ATOM   6663 N  NE2  . GLN C 1 182 ? -42.715 33.128 64.333 1.00 25.15 ? 212  GLN C NE2  1 
ATOM   6664 N  N    . LYS C 1 183 ? -41.507 37.603 66.429 1.00 23.34 ? 213  LYS C N    1 
ATOM   6665 C  CA   . LYS C 1 183 ? -42.582 38.544 66.709 1.00 23.83 ? 213  LYS C CA   1 
ATOM   6666 C  C    . LYS C 1 183 ? -42.945 39.381 65.484 1.00 21.63 ? 213  LYS C C    1 
ATOM   6667 O  O    . LYS C 1 183 ? -44.130 39.554 65.198 1.00 21.73 ? 213  LYS C O    1 
ATOM   6668 C  CB   . LYS C 1 183 ? -42.232 39.436 67.898 1.00 24.14 ? 213  LYS C CB   1 
ATOM   6669 C  CG   . LYS C 1 183 ? -42.160 38.691 69.225 1.00 26.50 ? 213  LYS C CG   1 
ATOM   6670 C  CD   . LYS C 1 183 ? -42.011 39.663 70.390 1.00 25.63 ? 213  LYS C CD   1 
ATOM   6671 C  CE   . LYS C 1 183 ? -41.868 38.935 71.711 1.00 23.00 ? 213  LYS C CE   1 
ATOM   6672 N  NZ   . LYS C 1 183 ? -41.720 39.882 72.842 1.00 18.44 ? 213  LYS C NZ   1 
ATOM   6673 N  N    . THR C 1 184 ? -41.951 39.845 64.721 1.00 20.61 ? 214  THR C N    1 
ATOM   6674 C  CA   . THR C 1 184 ? -42.266 40.641 63.541 1.00 20.66 ? 214  THR C CA   1 
ATOM   6675 C  C    . THR C 1 184 ? -43.005 39.783 62.515 1.00 22.74 ? 214  THR C C    1 
ATOM   6676 O  O    . THR C 1 184 ? -43.955 40.249 61.890 1.00 25.36 ? 214  THR C O    1 
ATOM   6677 C  CB   . THR C 1 184 ? -41.031 41.358 62.904 1.00 23.04 ? 214  THR C CB   1 
ATOM   6678 O  OG1  . THR C 1 184 ? -40.460 40.557 61.864 1.00 33.55 ? 214  THR C OG1  1 
ATOM   6679 C  CG2  . THR C 1 184 ? -39.976 41.671 63.945 1.00 11.88 ? 214  THR C CG2  1 
ATOM   6680 N  N    . ASN C 1 185 ? -42.603 38.519 62.379 1.00 23.61 ? 215  ASN C N    1 
ATOM   6681 C  CA   . ASN C 1 185 ? -43.270 37.597 61.451 1.00 23.21 ? 215  ASN C CA   1 
ATOM   6682 C  C    . ASN C 1 185 ? -44.719 37.379 61.880 1.00 21.88 ? 215  ASN C C    1 
ATOM   6683 O  O    . ASN C 1 185 ? -45.646 37.455 61.068 1.00 22.48 ? 215  ASN C O    1 
ATOM   6684 C  CB   . ASN C 1 185 ? -42.543 36.250 61.403 1.00 24.57 ? 215  ASN C CB   1 
ATOM   6685 C  CG   . ASN C 1 185 ? -41.407 36.240 60.412 1.00 23.64 ? 215  ASN C CG   1 
ATOM   6686 O  OD1  . ASN C 1 185 ? -41.597 36.577 59.253 1.00 36.35 ? 215  ASN C OD1  1 
ATOM   6687 N  ND2  . ASN C 1 185 ? -40.214 35.886 60.866 1.00 24.76 ? 215  ASN C ND2  1 
ATOM   6688 N  N    . ILE C 1 186 ? -44.910 37.134 63.171 1.00 22.27 ? 216  ILE C N    1 
ATOM   6689 C  CA   . ILE C 1 186 ? -46.238 36.914 63.734 1.00 20.73 ? 216  ILE C CA   1 
ATOM   6690 C  C    . ILE C 1 186 ? -47.091 38.159 63.523 1.00 18.72 ? 216  ILE C C    1 
ATOM   6691 O  O    . ILE C 1 186 ? -48.289 38.064 63.260 1.00 21.14 ? 216  ILE C O    1 
ATOM   6692 C  CB   . ILE C 1 186 ? -46.150 36.544 65.257 1.00 24.07 ? 216  ILE C CB   1 
ATOM   6693 C  CG1  . ILE C 1 186 ? -45.590 35.122 65.409 1.00 17.32 ? 216  ILE C CG1  1 
ATOM   6694 C  CG2  . ILE C 1 186 ? -47.525 36.661 65.942 1.00 19.89 ? 216  ILE C CG2  1 
ATOM   6695 C  CD1  . ILE C 1 186 ? -45.433 34.666 66.824 1.00 18.53 ? 216  ILE C CD1  1 
ATOM   6696 N  N    . ILE C 1 187 ? -46.465 39.326 63.617 1.00 19.05 ? 217  ILE C N    1 
ATOM   6697 C  CA   . ILE C 1 187 ? -47.172 40.585 63.425 1.00 16.93 ? 217  ILE C CA   1 
ATOM   6698 C  C    . ILE C 1 187 ? -47.568 40.785 61.957 1.00 19.63 ? 217  ILE C C    1 
ATOM   6699 O  O    . ILE C 1 187 ? -48.737 41.048 61.644 1.00 18.46 ? 217  ILE C O    1 
ATOM   6700 C  CB   . ILE C 1 187 ? -46.310 41.768 63.926 1.00 17.81 ? 217  ILE C CB   1 
ATOM   6701 C  CG1  . ILE C 1 187 ? -46.256 41.749 65.467 1.00 11.71 ? 217  ILE C CG1  1 
ATOM   6702 C  CG2  . ILE C 1 187 ? -46.853 43.086 63.382 1.00 13.03 ? 217  ILE C CG2  1 
ATOM   6703 C  CD1  . ILE C 1 187 ? -45.160 42.620 66.086 1.00 11.21 ? 217  ILE C CD1  1 
ATOM   6704 N  N    . ARG C 1 188 ? -46.595 40.622 61.063 1.00 21.23 ? 218  ARG C N    1 
ATOM   6705 C  CA   . ARG C 1 188 ? -46.811 40.778 59.630 1.00 22.10 ? 218  ARG C CA   1 
ATOM   6706 C  C    . ARG C 1 188 ? -47.757 39.732 59.041 1.00 24.68 ? 218  ARG C C    1 
ATOM   6707 O  O    . ARG C 1 188 ? -48.526 40.039 58.131 1.00 25.14 ? 218  ARG C O    1 
ATOM   6708 C  CB   . ARG C 1 188 ? -45.472 40.745 58.891 1.00 24.49 ? 218  ARG C CB   1 
ATOM   6709 C  CG   . ARG C 1 188 ? -45.587 40.709 57.366 1.00 28.29 ? 218  ARG C CG   1 
ATOM   6710 C  CD   . ARG C 1 188 ? -45.007 39.415 56.810 1.00 28.77 ? 218  ARG C CD   1 
ATOM   6711 N  NE   . ARG C 1 188 ? -43.561 39.332 56.980 1.00 27.63 ? 218  ARG C NE   1 
ATOM   6712 C  CZ   . ARG C 1 188 ? -42.882 38.201 57.150 1.00 29.94 ? 218  ARG C CZ   1 
ATOM   6713 N  NH1  . ARG C 1 188 ? -43.507 37.032 57.189 1.00 32.95 ? 218  ARG C NH1  1 
ATOM   6714 N  NH2  . ARG C 1 188 ? -41.563 38.233 57.246 1.00 34.28 ? 218  ARG C NH2  1 
ATOM   6715 N  N    . ASP C 1 189 ? -47.728 38.512 59.573 1.00 26.12 ? 219  ASP C N    1 
ATOM   6716 C  CA   . ASP C 1 189 ? -48.587 37.440 59.062 1.00 29.74 ? 219  ASP C CA   1 
ATOM   6717 C  C    . ASP C 1 189 ? -49.955 37.285 59.731 1.00 31.57 ? 219  ASP C C    1 
ATOM   6718 O  O    . ASP C 1 189 ? -50.542 36.198 59.680 1.00 33.27 ? 219  ASP C O    1 
ATOM   6719 C  CB   . ASP C 1 189 ? -47.860 36.095 59.123 1.00 31.57 ? 219  ASP C CB   1 
ATOM   6720 C  CG   . ASP C 1 189 ? -46.593 36.069 58.292 1.00 34.55 ? 219  ASP C CG   1 
ATOM   6721 O  OD1  . ASP C 1 189 ? -46.561 36.716 57.224 1.00 33.72 ? 219  ASP C OD1  1 
ATOM   6722 O  OD2  . ASP C 1 189 ? -45.626 35.392 58.711 1.00 35.28 ? 219  ASP C OD2  1 
ATOM   6723 N  N    . TYR C 1 190 ? -50.490 38.353 60.319 1.00 28.90 ? 220  TYR C N    1 
ATOM   6724 C  CA   . TYR C 1 190 ? -51.783 38.248 60.978 1.00 28.44 ? 220  TYR C CA   1 
ATOM   6725 C  C    . TYR C 1 190 ? -52.887 37.670 60.090 1.00 32.23 ? 220  TYR C C    1 
ATOM   6726 O  O    . TYR C 1 190 ? -53.474 36.635 60.422 1.00 33.40 ? 220  TYR C O    1 
ATOM   6727 C  CB   . TYR C 1 190 ? -52.246 39.588 61.552 1.00 25.65 ? 220  TYR C CB   1 
ATOM   6728 C  CG   . TYR C 1 190 ? -53.723 39.575 61.888 1.00 20.91 ? 220  TYR C CG   1 
ATOM   6729 C  CD1  . TYR C 1 190 ? -54.201 38.874 62.991 1.00 21.43 ? 220  TYR C CD1  1 
ATOM   6730 C  CD2  . TYR C 1 190 ? -54.652 40.161 61.029 1.00 22.43 ? 220  TYR C CD2  1 
ATOM   6731 C  CE1  . TYR C 1 190 ? -55.571 38.745 63.218 1.00 24.48 ? 220  TYR C CE1  1 
ATOM   6732 C  CE2  . TYR C 1 190 ? -56.017 40.039 61.245 1.00 22.95 ? 220  TYR C CE2  1 
ATOM   6733 C  CZ   . TYR C 1 190 ? -56.474 39.329 62.337 1.00 25.65 ? 220  TYR C CZ   1 
ATOM   6734 O  OH   . TYR C 1 190 ? -57.833 39.183 62.530 1.00 30.78 ? 220  TYR C OH   1 
ATOM   6735 N  N    . LEU C 1 191 ? -53.190 38.344 58.983 1.00 30.92 ? 221  LEU C N    1 
ATOM   6736 C  CA   . LEU C 1 191 ? -54.248 37.888 58.083 1.00 34.45 ? 221  LEU C CA   1 
ATOM   6737 C  C    . LEU C 1 191 ? -53.983 36.479 57.554 1.00 37.39 ? 221  LEU C C    1 
ATOM   6738 O  O    . LEU C 1 191 ? -54.898 35.657 57.466 1.00 38.00 ? 221  LEU C O    1 
ATOM   6739 C  CB   . LEU C 1 191 ? -54.420 38.857 56.915 1.00 32.91 ? 221  LEU C CB   1 
ATOM   6740 C  CG   . LEU C 1 191 ? -55.781 38.758 56.227 1.00 34.15 ? 221  LEU C CG   1 
ATOM   6741 C  CD1  . LEU C 1 191 ? -56.879 39.148 57.193 1.00 32.12 ? 221  LEU C CD1  1 
ATOM   6742 C  CD2  . LEU C 1 191 ? -55.819 39.662 55.029 1.00 33.52 ? 221  LEU C CD2  1 
ATOM   6743 N  N    . GLU C 1 192 ? -52.724 36.195 57.236 1.00 39.79 ? 222  GLU C N    1 
ATOM   6744 C  CA   . GLU C 1 192 ? -52.336 34.891 56.723 1.00 41.24 ? 222  GLU C CA   1 
ATOM   6745 C  C    . GLU C 1 192 ? -52.654 33.793 57.727 1.00 43.17 ? 222  GLU C C    1 
ATOM   6746 O  O    . GLU C 1 192 ? -53.304 32.803 57.385 1.00 45.48 ? 222  GLU C O    1 
ATOM   6747 C  CB   . GLU C 1 192 ? -50.846 34.866 56.387 1.00 41.49 ? 222  GLU C CB   1 
ATOM   6748 C  CG   . GLU C 1 192 ? -50.385 33.545 55.801 1.00 42.88 ? 222  GLU C CG   1 
ATOM   6749 C  CD   . GLU C 1 192 ? -48.955 33.585 55.327 1.00 44.57 ? 222  GLU C CD   1 
ATOM   6750 O  OE1  . GLU C 1 192 ? -48.736 34.020 54.176 1.00 46.22 ? 222  GLU C OE1  1 
ATOM   6751 O  OE2  . GLU C 1 192 ? -48.053 33.183 56.099 1.00 44.14 ? 222  GLU C OE2  1 
ATOM   6752 N  N    . ASP C 1 193 ? -52.207 33.977 58.965 1.00 43.25 ? 223  ASP C N    1 
ATOM   6753 C  CA   . ASP C 1 193 ? -52.446 32.997 60.017 1.00 41.00 ? 223  ASP C CA   1 
ATOM   6754 C  C    . ASP C 1 193 ? -53.925 32.845 60.303 1.00 39.56 ? 223  ASP C C    1 
ATOM   6755 O  O    . ASP C 1 193 ? -54.430 31.727 60.414 1.00 39.59 ? 223  ASP C O    1 
ATOM   6756 C  CB   . ASP C 1 193 ? -51.704 33.390 61.291 1.00 42.01 ? 223  ASP C CB   1 
ATOM   6757 C  CG   . ASP C 1 193 ? -50.209 33.226 61.164 1.00 45.14 ? 223  ASP C CG   1 
ATOM   6758 O  OD1  . ASP C 1 193 ? -49.746 32.777 60.094 1.00 50.06 ? 223  ASP C OD1  1 
ATOM   6759 O  OD2  . ASP C 1 193 ? -49.490 33.533 62.139 1.00 47.51 ? 223  ASP C OD2  1 
ATOM   6760 N  N    . GLN C 1 194 ? -54.626 33.970 60.373 1.00 38.83 ? 224  GLN C N    1 
ATOM   6761 C  CA   . GLN C 1 194 ? -56.055 33.955 60.642 1.00 41.03 ? 224  GLN C CA   1 
ATOM   6762 C  C    . GLN C 1 194 ? -56.748 33.047 59.634 1.00 40.33 ? 224  GLN C C    1 
ATOM   6763 O  O    . GLN C 1 194 ? -57.385 32.061 60.002 1.00 41.85 ? 224  GLN C O    1 
ATOM   6764 C  CB   . GLN C 1 194 ? -56.625 35.378 60.573 1.00 39.20 ? 224  GLN C CB   1 
ATOM   6765 C  CG   . GLN C 1 194 ? -57.721 35.650 61.593 1.00 40.12 ? 224  GLN C CG   1 
ATOM   6766 C  CD   . GLN C 1 194 ? -57.308 35.260 63.007 1.00 43.09 ? 224  GLN C CD   1 
ATOM   6767 O  OE1  . GLN C 1 194 ? -58.140 34.827 63.806 1.00 44.57 ? 224  GLN C OE1  1 
ATOM   6768 N  NE2  . GLN C 1 194 ? -56.017 35.401 63.319 1.00 48.16 ? 224  GLN C NE2  1 
ATOM   6769 N  N    . GLN C 1 195 ? -56.521 33.332 58.359 1.00 40.92 ? 225  GLN C N    1 
ATOM   6770 C  CA   . GLN C 1 195 ? -57.109 32.568 57.265 1.00 41.11 ? 225  GLN C CA   1 
ATOM   6771 C  C    . GLN C 1 195 ? -56.723 31.087 57.291 1.00 40.14 ? 225  GLN C C    1 
ATOM   6772 O  O    . GLN C 1 195 ? -57.494 30.230 56.855 1.00 37.49 ? 225  GLN C O    1 
ATOM   6773 C  CB   . GLN C 1 195 ? -56.728 33.224 55.937 1.00 40.17 ? 225  GLN C CB   1 
ATOM   6774 C  CG   . GLN C 1 195 ? -57.279 34.647 55.827 1.00 40.64 ? 225  GLN C CG   1 
ATOM   6775 C  CD   . GLN C 1 195 ? -56.710 35.441 54.664 1.00 41.32 ? 225  GLN C CD   1 
ATOM   6776 O  OE1  . GLN C 1 195 ? -57.419 36.227 54.037 1.00 37.71 ? 225  GLN C OE1  1 
ATOM   6777 N  NE2  . GLN C 1 195 ? -55.419 35.272 54.398 1.00 38.15 ? 225  GLN C NE2  1 
ATOM   6778 N  N    . GLY C 1 196 ? -55.544 30.795 57.831 1.00 42.34 ? 226  GLY C N    1 
ATOM   6779 C  CA   . GLY C 1 196 ? -55.078 29.423 57.917 1.00 43.24 ? 226  GLY C CA   1 
ATOM   6780 C  C    . GLY C 1 196 ? -55.422 28.754 59.238 1.00 45.91 ? 226  GLY C C    1 
ATOM   6781 O  O    . GLY C 1 196 ? -54.812 27.744 59.605 1.00 45.32 ? 226  GLY C O    1 
ATOM   6782 N  N    . GLY C 1 197 ? -56.363 29.343 59.974 1.00 45.15 ? 227  GLY C N    1 
ATOM   6783 C  CA   . GLY C 1 197 ? -56.788 28.783 61.246 1.00 44.43 ? 227  GLY C CA   1 
ATOM   6784 C  C    . GLY C 1 197 ? -55.767 28.751 62.372 1.00 45.06 ? 227  GLY C C    1 
ATOM   6785 O  O    . GLY C 1 197 ? -55.778 27.831 63.193 1.00 44.90 ? 227  GLY C O    1 
ATOM   6786 N  N    . ARG C 1 198 ? -54.881 29.742 62.413 1.00 43.36 ? 228  ARG C N    1 
ATOM   6787 C  CA   . ARG C 1 198 ? -53.872 29.834 63.465 1.00 42.42 ? 228  ARG C CA   1 
ATOM   6788 C  C    . ARG C 1 198 ? -53.942 31.219 64.106 1.00 39.60 ? 228  ARG C C    1 
ATOM   6789 O  O    . ARG C 1 198 ? -54.288 32.199 63.441 1.00 41.64 ? 228  ARG C O    1 
ATOM   6790 C  CB   . ARG C 1 198 ? -52.476 29.574 62.902 1.00 47.24 ? 228  ARG C CB   1 
ATOM   6791 C  CG   . ARG C 1 198 ? -52.191 28.107 62.614 1.00 53.56 ? 228  ARG C CG   1 
ATOM   6792 C  CD   . ARG C 1 198 ? -50.735 27.900 62.209 1.00 58.10 ? 228  ARG C CD   1 
ATOM   6793 N  NE   . ARG C 1 198 ? -50.424 28.593 60.965 1.00 59.32 ? 228  ARG C NE   1 
ATOM   6794 C  CZ   . ARG C 1 198 ? -50.543 28.051 59.756 1.00 62.85 ? 228  ARG C CZ   1 
ATOM   6795 N  NH1  . ARG C 1 198 ? -50.955 26.795 59.615 1.00 62.09 ? 228  ARG C NH1  1 
ATOM   6796 N  NH2  . ARG C 1 198 ? -50.281 28.781 58.681 1.00 66.33 ? 228  ARG C NH2  1 
ATOM   6797 N  N    . GLU C 1 199 ? -53.639 31.296 65.398 1.00 35.45 ? 229  GLU C N    1 
ATOM   6798 C  CA   . GLU C 1 199 ? -53.688 32.563 66.132 1.00 32.02 ? 229  GLU C CA   1 
ATOM   6799 C  C    . GLU C 1 199 ? -52.485 32.646 67.060 1.00 28.79 ? 229  GLU C C    1 
ATOM   6800 O  O    . GLU C 1 199 ? -52.319 31.796 67.934 1.00 28.88 ? 229  GLU C O    1 
ATOM   6801 C  CB   . GLU C 1 199 ? -54.988 32.645 66.945 1.00 34.70 ? 229  GLU C CB   1 
ATOM   6802 C  CG   . GLU C 1 199 ? -56.265 32.558 66.093 1.00 38.38 ? 229  GLU C CG   1 
ATOM   6803 C  CD   . GLU C 1 199 ? -57.556 32.735 66.886 1.00 40.99 ? 229  GLU C CD   1 
ATOM   6804 O  OE1  . GLU C 1 199 ? -57.562 32.521 68.119 1.00 40.61 ? 229  GLU C OE1  1 
ATOM   6805 O  OE2  . GLU C 1 199 ? -58.576 33.092 66.261 1.00 41.51 ? 229  GLU C OE2  1 
ATOM   6806 N  N    . PHE C 1 200 ? -51.638 33.652 66.861 1.00 26.69 ? 230  PHE C N    1 
ATOM   6807 C  CA   . PHE C 1 200 ? -50.435 33.804 67.681 1.00 25.50 ? 230  PHE C CA   1 
ATOM   6808 C  C    . PHE C 1 200 ? -50.309 35.118 68.452 1.00 22.01 ? 230  PHE C C    1 
ATOM   6809 O  O    . PHE C 1 200 ? -49.374 35.298 69.238 1.00 19.32 ? 230  PHE C O    1 
ATOM   6810 C  CB   . PHE C 1 200 ? -49.183 33.580 66.830 1.00 30.86 ? 230  PHE C CB   1 
ATOM   6811 C  CG   . PHE C 1 200 ? -49.080 32.193 66.276 1.00 39.06 ? 230  PHE C CG   1 
ATOM   6812 C  CD1  . PHE C 1 200 ? -48.529 31.165 67.037 1.00 39.45 ? 230  PHE C CD1  1 
ATOM   6813 C  CD2  . PHE C 1 200 ? -49.586 31.897 65.010 1.00 41.04 ? 230  PHE C CD2  1 
ATOM   6814 C  CE1  . PHE C 1 200 ? -48.489 29.865 66.547 1.00 42.03 ? 230  PHE C CE1  1 
ATOM   6815 C  CE2  . PHE C 1 200 ? -49.551 30.601 64.513 1.00 40.68 ? 230  PHE C CE2  1 
ATOM   6816 C  CZ   . PHE C 1 200 ? -49.004 29.582 65.281 1.00 41.91 ? 230  PHE C CZ   1 
ATOM   6817 N  N    . TRP C 1 201 ? -51.215 36.052 68.193 1.00 21.99 ? 231  TRP C N    1 
ATOM   6818 C  CA   . TRP C 1 201 ? -51.190 37.330 68.891 1.00 22.80 ? 231  TRP C CA   1 
ATOM   6819 C  C    . TRP C 1 201 ? -51.662 37.108 70.325 1.00 24.67 ? 231  TRP C C    1 
ATOM   6820 O  O    . TRP C 1 201 ? -52.725 36.523 70.551 1.00 23.23 ? 231  TRP C O    1 
ATOM   6821 C  CB   . TRP C 1 201 ? -52.083 38.348 68.180 1.00 22.20 ? 231  TRP C CB   1 
ATOM   6822 C  CG   . TRP C 1 201 ? -51.453 38.954 66.957 1.00 20.63 ? 231  TRP C CG   1 
ATOM   6823 C  CD1  . TRP C 1 201 ? -50.430 38.433 66.209 1.00 22.32 ? 231  TRP C CD1  1 
ATOM   6824 C  CD2  . TRP C 1 201 ? -51.793 40.206 66.354 1.00 20.97 ? 231  TRP C CD2  1 
ATOM   6825 N  NE1  . TRP C 1 201 ? -50.111 39.289 65.175 1.00 20.27 ? 231  TRP C NE1  1 
ATOM   6826 C  CE2  . TRP C 1 201 ? -50.928 40.385 65.239 1.00 19.41 ? 231  TRP C CE2  1 
ATOM   6827 C  CE3  . TRP C 1 201 ? -52.737 41.201 66.639 1.00 20.01 ? 231  TRP C CE3  1 
ATOM   6828 C  CZ2  . TRP C 1 201 ? -50.985 41.515 64.423 1.00 17.62 ? 231  TRP C CZ2  1 
ATOM   6829 C  CZ3  . TRP C 1 201 ? -52.791 42.327 65.824 1.00 18.24 ? 231  TRP C CZ3  1 
ATOM   6830 C  CH2  . TRP C 1 201 ? -51.917 42.473 64.729 1.00 18.81 ? 231  TRP C CH2  1 
ATOM   6831 N  N    . PRO C 1 202 ? -50.881 37.587 71.312 1.00 25.04 ? 232  PRO C N    1 
ATOM   6832 C  CA   . PRO C 1 202 ? -51.226 37.433 72.731 1.00 24.20 ? 232  PRO C CA   1 
ATOM   6833 C  C    . PRO C 1 202 ? -52.626 37.965 73.058 1.00 24.66 ? 232  PRO C C    1 
ATOM   6834 O  O    . PRO C 1 202 ? -52.961 39.120 72.768 1.00 20.82 ? 232  PRO C O    1 
ATOM   6835 C  CB   . PRO C 1 202 ? -50.117 38.220 73.439 1.00 21.66 ? 232  PRO C CB   1 
ATOM   6836 C  CG   . PRO C 1 202 ? -49.749 39.268 72.440 1.00 21.59 ? 232  PRO C CG   1 
ATOM   6837 C  CD   . PRO C 1 202 ? -49.724 38.485 71.153 1.00 24.66 ? 232  PRO C CD   1 
ATOM   6838 N  N    . GLN C 1 203 ? -53.441 37.093 73.642 1.00 24.74 ? 233  GLN C N    1 
ATOM   6839 C  CA   . GLN C 1 203 ? -54.811 37.414 74.011 1.00 24.67 ? 233  GLN C CA   1 
ATOM   6840 C  C    . GLN C 1 203 ? -54.904 38.588 74.985 1.00 24.00 ? 233  GLN C C    1 
ATOM   6841 O  O    . GLN C 1 203 ? -55.795 39.419 74.872 1.00 22.19 ? 233  GLN C O    1 
ATOM   6842 C  CB   . GLN C 1 203 ? -55.487 36.153 74.563 1.00 26.84 ? 233  GLN C CB   1 
ATOM   6843 C  CG   . GLN C 1 203 ? -56.923 36.314 75.016 1.00 30.46 ? 233  GLN C CG   1 
ATOM   6844 C  CD   . GLN C 1 203 ? -57.021 36.665 76.488 1.00 34.29 ? 233  GLN C CD   1 
ATOM   6845 O  OE1  . GLN C 1 203 ? -56.027 36.617 77.214 1.00 35.16 ? 233  GLN C OE1  1 
ATOM   6846 N  NE2  . GLN C 1 203 ? -58.220 37.009 76.938 1.00 31.89 ? 233  GLN C NE2  1 
ATOM   6847 N  N    . GLU C 1 204 ? -53.957 38.673 75.910 1.00 25.10 ? 234  GLU C N    1 
ATOM   6848 C  CA   . GLU C 1 204 ? -53.915 39.751 76.898 1.00 29.63 ? 234  GLU C CA   1 
ATOM   6849 C  C    . GLU C 1 204 ? -53.915 41.121 76.211 1.00 28.75 ? 234  GLU C C    1 
ATOM   6850 O  O    . GLU C 1 204 ? -54.434 42.102 76.744 1.00 27.00 ? 234  GLU C O    1 
ATOM   6851 C  CB   . GLU C 1 204 ? -52.671 39.586 77.786 1.00 32.80 ? 234  GLU C CB   1 
ATOM   6852 C  CG   . GLU C 1 204 ? -52.235 40.847 78.532 1.00 43.39 ? 234  GLU C CG   1 
ATOM   6853 C  CD   . GLU C 1 204 ? -51.133 40.599 79.558 1.00 44.65 ? 234  GLU C CD   1 
ATOM   6854 O  OE1  . GLU C 1 204 ? -50.104 39.981 79.210 1.00 44.09 ? 234  GLU C OE1  1 
ATOM   6855 O  OE2  . GLU C 1 204 ? -51.295 41.044 80.715 1.00 44.86 ? 234  GLU C OE2  1 
ATOM   6856 N  N    . VAL C 1 205 ? -53.342 41.174 75.013 1.00 26.58 ? 235  VAL C N    1 
ATOM   6857 C  CA   . VAL C 1 205 ? -53.274 42.413 74.255 1.00 24.12 ? 235  VAL C CA   1 
ATOM   6858 C  C    . VAL C 1 205 ? -54.477 42.632 73.351 1.00 21.99 ? 235  VAL C C    1 
ATOM   6859 O  O    . VAL C 1 205 ? -55.136 43.667 73.441 1.00 23.43 ? 235  VAL C O    1 
ATOM   6860 C  CB   . VAL C 1 205 ? -51.982 42.510 73.416 1.00 22.89 ? 235  VAL C CB   1 
ATOM   6861 C  CG1  . VAL C 1 205 ? -51.949 43.833 72.648 1.00 15.23 ? 235  VAL C CG1  1 
ATOM   6862 C  CG2  . VAL C 1 205 ? -50.766 42.394 74.329 1.00 16.98 ? 235  VAL C CG2  1 
ATOM   6863 N  N    . TRP C 1 206 ? -54.789 41.664 72.496 1.00 20.23 ? 236  TRP C N    1 
ATOM   6864 C  CA   . TRP C 1 206 ? -55.922 41.857 71.600 1.00 18.61 ? 236  TRP C CA   1 
ATOM   6865 C  C    . TRP C 1 206 ? -57.274 41.918 72.294 1.00 17.97 ? 236  TRP C C    1 
ATOM   6866 O  O    . TRP C 1 206 ? -58.204 42.543 71.775 1.00 20.63 ? 236  TRP C O    1 
ATOM   6867 C  CB   . TRP C 1 206 ? -55.925 40.858 70.427 1.00 17.90 ? 236  TRP C CB   1 
ATOM   6868 C  CG   . TRP C 1 206 ? -56.080 39.415 70.775 1.00 14.06 ? 236  TRP C CG   1 
ATOM   6869 C  CD1  . TRP C 1 206 ? -55.121 38.453 70.680 1.00 15.96 ? 236  TRP C CD1  1 
ATOM   6870 C  CD2  . TRP C 1 206 ? -57.286 38.745 71.179 1.00 15.32 ? 236  TRP C CD2  1 
ATOM   6871 N  NE1  . TRP C 1 206 ? -55.655 37.223 70.989 1.00 17.46 ? 236  TRP C NE1  1 
ATOM   6872 C  CE2  . TRP C 1 206 ? -56.981 37.374 71.300 1.00 13.69 ? 236  TRP C CE2  1 
ATOM   6873 C  CE3  . TRP C 1 206 ? -58.596 39.172 71.456 1.00 17.22 ? 236  TRP C CE3  1 
ATOM   6874 C  CZ2  . TRP C 1 206 ? -57.935 36.426 71.674 1.00 18.61 ? 236  TRP C CZ2  1 
ATOM   6875 C  CZ3  . TRP C 1 206 ? -59.543 38.230 71.831 1.00 17.57 ? 236  TRP C CZ3  1 
ATOM   6876 C  CH2  . TRP C 1 206 ? -59.206 36.873 71.940 1.00 16.83 ? 236  TRP C CH2  1 
ATOM   6877 N  N    . SER C 1 207 ? -57.383 41.319 73.478 1.00 17.96 ? 237  SER C N    1 
ATOM   6878 C  CA   . SER C 1 207 ? -58.646 41.351 74.217 1.00 19.09 ? 237  SER C CA   1 
ATOM   6879 C  C    . SER C 1 207 ? -58.958 42.772 74.688 1.00 16.63 ? 237  SER C C    1 
ATOM   6880 O  O    . SER C 1 207 ? -60.100 43.088 75.024 1.00 17.10 ? 237  SER C O    1 
ATOM   6881 C  CB   . SER C 1 207 ? -58.647 40.359 75.392 1.00 18.38 ? 237  SER C CB   1 
ATOM   6882 O  OG   . SER C 1 207 ? -57.574 40.587 76.298 1.00 18.91 ? 237  SER C OG   1 
ATOM   6883 N  N    . ARG C 1 208 ? -57.947 43.637 74.698 1.00 16.35 ? 238  ARG C N    1 
ATOM   6884 C  CA   . ARG C 1 208 ? -58.145 45.031 75.093 1.00 18.35 ? 238  ARG C CA   1 
ATOM   6885 C  C    . ARG C 1 208 ? -59.007 45.714 74.029 1.00 16.14 ? 238  ARG C C    1 
ATOM   6886 O  O    . ARG C 1 208 ? -59.676 46.707 74.306 1.00 18.08 ? 238  ARG C O    1 
ATOM   6887 C  CB   . ARG C 1 208 ? -56.810 45.786 75.171 1.00 13.04 ? 238  ARG C CB   1 
ATOM   6888 C  CG   . ARG C 1 208 ? -55.848 45.356 76.266 1.00 15.69 ? 238  ARG C CG   1 
ATOM   6889 C  CD   . ARG C 1 208 ? -54.520 46.092 76.075 1.00 17.18 ? 238  ARG C CD   1 
ATOM   6890 N  NE   . ARG C 1 208 ? -53.596 45.909 77.191 1.00 27.68 ? 238  ARG C NE   1 
ATOM   6891 C  CZ   . ARG C 1 208 ? -52.470 45.202 77.133 1.00 28.27 ? 238  ARG C CZ   1 
ATOM   6892 N  NH1  . ARG C 1 208 ? -52.117 44.600 76.014 1.00 36.41 ? 238  ARG C NH1  1 
ATOM   6893 N  NH2  . ARG C 1 208 ? -51.694 45.091 78.197 1.00 37.04 ? 238  ARG C NH2  1 
ATOM   6894 N  N    . TYR C 1 209 ? -59.039 45.123 72.839 1.00 15.36 ? 239  TYR C N    1 
ATOM   6895 C  CA   . TYR C 1 209 ? -59.754 45.688 71.703 1.00 13.55 ? 239  TYR C CA   1 
ATOM   6896 C  C    . TYR C 1 209 ? -60.977 44.925 71.213 1.00 16.03 ? 239  TYR C C    1 
ATOM   6897 O  O    . TYR C 1 209 ? -62.034 45.518 70.987 1.00 15.89 ? 239  TYR C O    1 
ATOM   6898 C  CB   . TYR C 1 209 ? -58.765 45.852 70.543 1.00 15.75 ? 239  TYR C CB   1 
ATOM   6899 C  CG   . TYR C 1 209 ? -57.514 46.614 70.921 1.00 15.46 ? 239  TYR C CG   1 
ATOM   6900 C  CD1  . TYR C 1 209 ? -57.492 48.009 70.902 1.00 20.97 ? 239  TYR C CD1  1 
ATOM   6901 C  CD2  . TYR C 1 209 ? -56.362 45.945 71.332 1.00 17.57 ? 239  TYR C CD2  1 
ATOM   6902 C  CE1  . TYR C 1 209 ? -56.356 48.723 71.287 1.00 15.20 ? 239  TYR C CE1  1 
ATOM   6903 C  CE2  . TYR C 1 209 ? -55.221 46.651 71.721 1.00 16.95 ? 239  TYR C CE2  1 
ATOM   6904 C  CZ   . TYR C 1 209 ? -55.233 48.041 71.692 1.00 15.56 ? 239  TYR C CZ   1 
ATOM   6905 O  OH   . TYR C 1 209 ? -54.122 48.757 72.058 1.00 20.67 ? 239  TYR C OH   1 
ATOM   6906 N  N    . VAL C 1 210 ? -60.831 43.618 71.005 1.00 20.97 ? 240  VAL C N    1 
ATOM   6907 C  CA   . VAL C 1 210 ? -61.943 42.806 70.504 1.00 21.73 ? 240  VAL C CA   1 
ATOM   6908 C  C    . VAL C 1 210 ? -62.221 41.528 71.284 1.00 23.05 ? 240  VAL C C    1 
ATOM   6909 O  O    . VAL C 1 210 ? -61.409 41.076 72.097 1.00 22.35 ? 240  VAL C O    1 
ATOM   6910 C  CB   . VAL C 1 210 ? -61.740 42.430 69.018 1.00 18.66 ? 240  VAL C CB   1 
ATOM   6911 C  CG1  . VAL C 1 210 ? -61.782 43.674 68.145 1.00 20.04 ? 240  VAL C CG1  1 
ATOM   6912 C  CG2  . VAL C 1 210 ? -60.424 41.691 68.838 1.00 16.87 ? 240  VAL C CG2  1 
ATOM   6913 N  N    . LYS C 1 211 ? -63.374 40.938 70.993 1.00 25.70 ? 241  LYS C N    1 
ATOM   6914 C  CA   . LYS C 1 211 ? -63.813 39.710 71.637 1.00 26.75 ? 241  LYS C CA   1 
ATOM   6915 C  C    . LYS C 1 211 ? -63.014 38.503 71.177 1.00 27.14 ? 241  LYS C C    1 
ATOM   6916 O  O    . LYS C 1 211 ? -62.792 37.577 71.954 1.00 27.74 ? 241  LYS C O    1 
ATOM   6917 C  CB   . LYS C 1 211 ? -65.309 39.503 71.390 1.00 25.79 ? 241  LYS C CB   1 
ATOM   6918 C  CG   . LYS C 1 211 ? -66.129 40.652 71.929 1.00 32.79 ? 241  LYS C CG   1 
ATOM   6919 C  CD   . LYS C 1 211 ? -67.605 40.497 71.665 1.00 41.27 ? 241  LYS C CD   1 
ATOM   6920 C  CE   . LYS C 1 211 ? -68.364 41.674 72.267 1.00 48.48 ? 241  LYS C CE   1 
ATOM   6921 N  NZ   . LYS C 1 211 ? -68.122 41.807 73.741 1.00 55.07 ? 241  LYS C NZ   1 
ATOM   6922 N  N    . LYS C 1 212 ? -62.551 38.526 69.930 1.00 27.43 ? 242  LYS C N    1 
ATOM   6923 C  CA   . LYS C 1 212 ? -61.759 37.425 69.393 1.00 27.05 ? 242  LYS C CA   1 
ATOM   6924 C  C    . LYS C 1 212 ? -60.822 37.926 68.281 1.00 24.19 ? 242  LYS C C    1 
ATOM   6925 O  O    . LYS C 1 212 ? -61.211 38.772 67.468 1.00 19.75 ? 242  LYS C O    1 
ATOM   6926 C  CB   . LYS C 1 212 ? -62.686 36.314 68.892 1.00 33.41 ? 242  LYS C CB   1 
ATOM   6927 C  CG   . LYS C 1 212 ? -63.252 36.560 67.510 1.00 42.27 ? 242  LYS C CG   1 
ATOM   6928 C  CD   . LYS C 1 212 ? -64.696 36.105 67.381 1.00 48.48 ? 242  LYS C CD   1 
ATOM   6929 C  CE   . LYS C 1 212 ? -64.930 35.388 66.054 1.00 49.90 ? 242  LYS C CE   1 
ATOM   6930 N  NZ   . LYS C 1 212 ? -64.073 35.915 64.953 1.00 50.71 ? 242  LYS C NZ   1 
ATOM   6931 N  N    . LEU C 1 213 ? -59.595 37.402 68.257 1.00 22.39 ? 243  LEU C N    1 
ATOM   6932 C  CA   . LEU C 1 213 ? -58.561 37.778 67.290 1.00 23.99 ? 243  LEU C CA   1 
ATOM   6933 C  C    . LEU C 1 213 ? -59.045 38.034 65.874 1.00 25.07 ? 243  LEU C C    1 
ATOM   6934 O  O    . LEU C 1 213 ? -58.761 39.086 65.296 1.00 29.60 ? 243  LEU C O    1 
ATOM   6935 C  CB   . LEU C 1 213 ? -57.446 36.727 67.245 1.00 23.31 ? 243  LEU C CB   1 
ATOM   6936 C  CG   . LEU C 1 213 ? -55.988 37.185 67.425 1.00 22.87 ? 243  LEU C CG   1 
ATOM   6937 C  CD1  . LEU C 1 213 ? -55.053 36.094 66.970 1.00 18.10 ? 243  LEU C CD1  1 
ATOM   6938 C  CD2  . LEU C 1 213 ? -55.695 38.448 66.651 1.00 23.95 ? 243  LEU C CD2  1 
ATOM   6939 N  N    . GLY C 1 214 ? -59.765 37.069 65.316 1.00 23.47 ? 244  GLY C N    1 
ATOM   6940 C  CA   . GLY C 1 214 ? -60.270 37.199 63.958 1.00 24.10 ? 244  GLY C CA   1 
ATOM   6941 C  C    . GLY C 1 214 ? -61.106 38.432 63.663 1.00 25.87 ? 244  GLY C C    1 
ATOM   6942 O  O    . GLY C 1 214 ? -61.300 38.772 62.498 1.00 29.38 ? 244  GLY C O    1 
ATOM   6943 N  N    . ASP C 1 215 ? -61.605 39.098 64.703 1.00 28.50 ? 245  ASP C N    1 
ATOM   6944 C  CA   . ASP C 1 215 ? -62.410 40.304 64.530 1.00 25.63 ? 245  ASP C CA   1 
ATOM   6945 C  C    . ASP C 1 215 ? -61.603 41.410 63.878 1.00 24.29 ? 245  ASP C C    1 
ATOM   6946 O  O    . ASP C 1 215 ? -62.172 42.302 63.255 1.00 23.30 ? 245  ASP C O    1 
ATOM   6947 C  CB   . ASP C 1 215 ? -62.965 40.795 65.868 1.00 32.07 ? 245  ASP C CB   1 
ATOM   6948 C  CG   . ASP C 1 215 ? -63.948 39.818 66.490 1.00 33.49 ? 245  ASP C CG   1 
ATOM   6949 O  OD1  . ASP C 1 215 ? -64.479 38.960 65.759 1.00 35.02 ? 245  ASP C OD1  1 
ATOM   6950 O  OD2  . ASP C 1 215 ? -64.184 39.902 67.714 1.00 35.58 ? 245  ASP C OD2  1 
ATOM   6951 N  N    . PHE C 1 216 ? -60.282 41.366 64.044 1.00 25.27 ? 246  PHE C N    1 
ATOM   6952 C  CA   . PHE C 1 216 ? -59.392 42.354 63.436 1.00 27.82 ? 246  PHE C CA   1 
ATOM   6953 C  C    . PHE C 1 216 ? -59.474 42.277 61.909 1.00 31.30 ? 246  PHE C C    1 
ATOM   6954 O  O    . PHE C 1 216 ? -59.219 43.262 61.213 1.00 34.03 ? 246  PHE C O    1 
ATOM   6955 C  CB   . PHE C 1 216 ? -57.939 42.115 63.866 1.00 26.12 ? 246  PHE C CB   1 
ATOM   6956 C  CG   . PHE C 1 216 ? -57.623 42.583 65.260 1.00 28.24 ? 246  PHE C CG   1 
ATOM   6957 C  CD1  . PHE C 1 216 ? -58.415 43.545 65.897 1.00 30.14 ? 246  PHE C CD1  1 
ATOM   6958 C  CD2  . PHE C 1 216 ? -56.506 42.088 65.930 1.00 28.02 ? 246  PHE C CD2  1 
ATOM   6959 C  CE1  . PHE C 1 216 ? -58.097 44.002 67.183 1.00 24.71 ? 246  PHE C CE1  1 
ATOM   6960 C  CE2  . PHE C 1 216 ? -56.182 42.538 67.210 1.00 25.81 ? 246  PHE C CE2  1 
ATOM   6961 C  CZ   . PHE C 1 216 ? -56.980 43.499 67.837 1.00 24.12 ? 246  PHE C CZ   1 
ATOM   6962 N  N    . ALA C 1 217 ? -59.804 41.100 61.388 1.00 31.59 ? 247  ALA C N    1 
ATOM   6963 C  CA   . ALA C 1 217 ? -59.914 40.904 59.951 1.00 29.80 ? 247  ALA C CA   1 
ATOM   6964 C  C    . ALA C 1 217 ? -61.169 41.569 59.410 1.00 31.13 ? 247  ALA C C    1 
ATOM   6965 O  O    . ALA C 1 217 ? -61.334 41.707 58.194 1.00 34.98 ? 247  ALA C O    1 
ATOM   6966 C  CB   . ALA C 1 217 ? -59.914 39.426 59.626 1.00 27.85 ? 247  ALA C CB   1 
ATOM   6967 N  N    . LYS C 1 218 ? -62.062 41.962 60.312 1.00 31.79 ? 248  LYS C N    1 
ATOM   6968 C  CA   . LYS C 1 218 ? -63.300 42.625 59.923 1.00 33.05 ? 248  LYS C CA   1 
ATOM   6969 C  C    . LYS C 1 218 ? -63.060 44.122 59.700 1.00 34.89 ? 248  LYS C C    1 
ATOM   6970 O  O    . LYS C 1 218 ? -62.601 44.829 60.599 1.00 32.95 ? 248  LYS C O    1 
ATOM   6971 C  CB   . LYS C 1 218 ? -64.374 42.419 60.989 1.00 35.13 ? 248  LYS C CB   1 
ATOM   6972 C  CG   . LYS C 1 218 ? -64.711 40.967 61.286 1.00 34.93 ? 248  LYS C CG   1 
ATOM   6973 C  CD   . LYS C 1 218 ? -65.973 40.891 62.137 1.00 42.68 ? 248  LYS C CD   1 
ATOM   6974 C  CE   . LYS C 1 218 ? -66.425 39.462 62.368 1.00 46.37 ? 248  LYS C CE   1 
ATOM   6975 N  NZ   . LYS C 1 218 ? -65.532 38.747 63.309 1.00 50.88 ? 248  LYS C NZ   1 
ATOM   6976 N  N    . PRO C 1 219 ? -63.430 44.631 58.514 1.00 36.16 ? 249  PRO C N    1 
ATOM   6977 C  CA   . PRO C 1 219 ? -63.282 46.030 58.102 1.00 34.72 ? 249  PRO C CA   1 
ATOM   6978 C  C    . PRO C 1 219 ? -63.716 47.068 59.129 1.00 35.18 ? 249  PRO C C    1 
ATOM   6979 O  O    . PRO C 1 219 ? -63.060 48.099 59.297 1.00 36.14 ? 249  PRO C O    1 
ATOM   6980 C  CB   . PRO C 1 219 ? -64.152 46.101 56.850 1.00 36.39 ? 249  PRO C CB   1 
ATOM   6981 C  CG   . PRO C 1 219 ? -63.961 44.748 56.252 1.00 36.83 ? 249  PRO C CG   1 
ATOM   6982 C  CD   . PRO C 1 219 ? -64.100 43.850 57.457 1.00 36.97 ? 249  PRO C CD   1 
ATOM   6983 N  N    . GLU C 1 220 ? -64.816 46.806 59.821 1.00 33.58 ? 250  GLU C N    1 
ATOM   6984 C  CA   . GLU C 1 220 ? -65.314 47.756 60.806 1.00 34.16 ? 250  GLU C CA   1 
ATOM   6985 C  C    . GLU C 1 220 ? -64.411 47.897 62.038 1.00 33.22 ? 250  GLU C C    1 
ATOM   6986 O  O    . GLU C 1 220 ? -64.553 48.844 62.821 1.00 33.64 ? 250  GLU C O    1 
ATOM   6987 C  CB   . GLU C 1 220 ? -66.754 47.416 61.220 1.00 35.64 ? 250  GLU C CB   1 
ATOM   6988 C  CG   . GLU C 1 220 ? -66.969 46.015 61.789 1.00 38.56 ? 250  GLU C CG   1 
ATOM   6989 C  CD   . GLU C 1 220 ? -67.257 44.963 60.726 1.00 43.25 ? 250  GLU C CD   1 
ATOM   6990 O  OE1  . GLU C 1 220 ? -67.175 45.275 59.512 1.00 39.38 ? 250  GLU C OE1  1 
ATOM   6991 O  OE2  . GLU C 1 220 ? -67.577 43.816 61.115 1.00 42.04 ? 250  GLU C OE2  1 
ATOM   6992 N  N    . ASN C 1 221 ? -63.432 47.009 62.157 1.00 29.30 ? 251  ASN C N    1 
ATOM   6993 C  CA   . ASN C 1 221 ? -62.532 47.038 63.296 1.00 27.08 ? 251  ASN C CA   1 
ATOM   6994 C  C    . ASN C 1 221 ? -61.101 47.496 63.023 1.00 23.82 ? 251  ASN C C    1 
ATOM   6995 O  O    . ASN C 1 221 ? -60.246 47.325 63.892 1.00 21.05 ? 251  ASN C O    1 
ATOM   6996 C  CB   . ASN C 1 221 ? -62.489 45.660 63.968 1.00 28.25 ? 251  ASN C CB   1 
ATOM   6997 C  CG   . ASN C 1 221 ? -63.777 45.307 64.691 1.00 26.61 ? 251  ASN C CG   1 
ATOM   6998 O  OD1  . ASN C 1 221 ? -64.558 46.174 65.080 1.00 28.60 ? 251  ASN C OD1  1 
ATOM   6999 N  ND2  . ASN C 1 221 ? -63.994 44.021 64.886 1.00 31.84 ? 251  ASN C ND2  1 
ATOM   7000 N  N    . ILE C 1 222 ? -60.824 48.115 61.874 1.00 24.93 ? 252  ILE C N    1 
ATOM   7001 C  CA   . ILE C 1 222 ? -59.438 48.528 61.602 1.00 27.44 ? 252  ILE C CA   1 
ATOM   7002 C  C    . ILE C 1 222 ? -58.779 49.433 62.630 1.00 28.30 ? 252  ILE C C    1 
ATOM   7003 O  O    . ILE C 1 222 ? -57.643 49.182 63.036 1.00 27.47 ? 252  ILE C O    1 
ATOM   7004 C  CB   . ILE C 1 222 ? -59.197 49.179 60.208 1.00 26.03 ? 252  ILE C CB   1 
ATOM   7005 C  CG1  . ILE C 1 222 ? -60.494 49.669 59.586 1.00 25.25 ? 252  ILE C CG1  1 
ATOM   7006 C  CG2  . ILE C 1 222 ? -58.324 48.270 59.344 1.00 22.90 ? 252  ILE C CG2  1 
ATOM   7007 C  CD1  . ILE C 1 222 ? -60.782 51.119 59.875 1.00 31.17 ? 252  ILE C CD1  1 
ATOM   7008 N  N    . ASP C 1 223 ? -59.466 50.495 63.034 1.00 25.03 ? 253  ASP C N    1 
ATOM   7009 C  CA   . ASP C 1 223 ? -58.884 51.411 63.998 1.00 21.87 ? 253  ASP C CA   1 
ATOM   7010 C  C    . ASP C 1 223 ? -58.405 50.670 65.246 1.00 18.88 ? 253  ASP C C    1 
ATOM   7011 O  O    . ASP C 1 223 ? -57.246 50.786 65.619 1.00 19.90 ? 253  ASP C O    1 
ATOM   7012 C  CB   . ASP C 1 223 ? -59.856 52.549 64.293 1.00 24.41 ? 253  ASP C CB   1 
ATOM   7013 C  CG   . ASP C 1 223 ? -60.133 53.402 63.056 1.00 23.95 ? 253  ASP C CG   1 
ATOM   7014 O  OD1  . ASP C 1 223 ? -59.236 53.502 62.197 1.00 27.70 ? 253  ASP C OD1  1 
ATOM   7015 O  OD2  . ASP C 1 223 ? -61.241 53.960 62.930 1.00 28.30 ? 253  ASP C OD2  1 
ATOM   7016 N  N    . LEU C 1 224 ? -59.253 49.823 65.815 1.00 18.22 ? 254  LEU C N    1 
ATOM   7017 C  CA   . LEU C 1 224 ? -58.873 49.030 66.990 1.00 18.29 ? 254  LEU C CA   1 
ATOM   7018 C  C    . LEU C 1 224 ? -57.698 48.116 66.627 1.00 17.35 ? 254  LEU C C    1 
ATOM   7019 O  O    . LEU C 1 224 ? -56.755 47.944 67.406 1.00 17.44 ? 254  LEU C O    1 
ATOM   7020 C  CB   . LEU C 1 224 ? -60.045 48.158 67.436 1.00 14.80 ? 254  LEU C CB   1 
ATOM   7021 C  CG   . LEU C 1 224 ? -61.275 48.861 67.990 1.00 16.30 ? 254  LEU C CG   1 
ATOM   7022 C  CD1  . LEU C 1 224 ? -62.434 47.878 68.071 1.00 20.27 ? 254  LEU C CD1  1 
ATOM   7023 C  CD2  . LEU C 1 224 ? -60.950 49.455 69.358 1.00 16.24 ? 254  LEU C CD2  1 
ATOM   7024 N  N    . ALA C 1 225 ? -57.771 47.535 65.431 1.00 18.76 ? 255  ALA C N    1 
ATOM   7025 C  CA   . ALA C 1 225 ? -56.746 46.625 64.928 1.00 17.23 ? 255  ALA C CA   1 
ATOM   7026 C  C    . ALA C 1 225 ? -55.387 47.308 64.815 1.00 14.87 ? 255  ALA C C    1 
ATOM   7027 O  O    . ALA C 1 225 ? -54.373 46.734 65.214 1.00 16.20 ? 255  ALA C O    1 
ATOM   7028 C  CB   . ALA C 1 225 ? -57.171 46.049 63.566 1.00 16.53 ? 255  ALA C CB   1 
ATOM   7029 N  N    . VAL C 1 226 ? -55.378 48.541 64.310 1.00 13.91 ? 256  VAL C N    1 
ATOM   7030 C  CA   . VAL C 1 226 ? -54.143 49.309 64.133 1.00 15.09 ? 256  VAL C CA   1 
ATOM   7031 C  C    . VAL C 1 226 ? -53.541 49.679 65.481 1.00 17.33 ? 256  VAL C C    1 
ATOM   7032 O  O    . VAL C 1 226 ? -52.319 49.694 65.645 1.00 17.78 ? 256  VAL C O    1 
ATOM   7033 C  CB   . VAL C 1 226 ? -54.385 50.567 63.270 1.00 14.81 ? 256  VAL C CB   1 
ATOM   7034 C  CG1  . VAL C 1 226 ? -53.117 51.427 63.188 1.00 7.45  ? 256  VAL C CG1  1 
ATOM   7035 C  CG2  . VAL C 1 226 ? -54.831 50.145 61.884 1.00 13.55 ? 256  VAL C CG2  1 
ATOM   7036 N  N    . GLN C 1 227 ? -54.402 49.944 66.456 1.00 18.06 ? 257  GLN C N    1 
ATOM   7037 C  CA   . GLN C 1 227 ? -53.939 50.264 67.797 1.00 19.01 ? 257  GLN C CA   1 
ATOM   7038 C  C    . GLN C 1 227 ? -53.200 49.046 68.356 1.00 16.23 ? 257  GLN C C    1 
ATOM   7039 O  O    . GLN C 1 227 ? -52.083 49.160 68.876 1.00 19.28 ? 257  GLN C O    1 
ATOM   7040 C  CB   . GLN C 1 227 ? -55.121 50.626 68.698 1.00 16.26 ? 257  GLN C CB   1 
ATOM   7041 C  CG   . GLN C 1 227 ? -55.820 51.920 68.306 1.00 23.15 ? 257  GLN C CG   1 
ATOM   7042 C  CD   . GLN C 1 227 ? -56.802 52.402 69.361 1.00 25.00 ? 257  GLN C CD   1 
ATOM   7043 O  OE1  . GLN C 1 227 ? -57.001 51.739 70.377 1.00 32.37 ? 257  GLN C OE1  1 
ATOM   7044 N  NE2  . GLN C 1 227 ? -57.408 53.561 69.131 1.00 16.17 ? 257  GLN C NE2  1 
ATOM   7045 N  N    . CYS C 1 228 ? -53.819 47.876 68.215 1.00 18.09 ? 258  CYS C N    1 
ATOM   7046 C  CA   . CYS C 1 228 ? -53.240 46.624 68.699 1.00 16.15 ? 258  CYS C CA   1 
ATOM   7047 C  C    . CYS C 1 228 ? -51.922 46.370 67.987 1.00 13.86 ? 258  CYS C C    1 
ATOM   7048 O  O    . CYS C 1 228 ? -50.917 46.025 68.608 1.00 12.67 ? 258  CYS C O    1 
ATOM   7049 C  CB   . CYS C 1 228 ? -54.208 45.465 68.462 1.00 17.64 ? 258  CYS C CB   1 
ATOM   7050 S  SG   . CYS C 1 228 ? -53.701 43.928 69.253 1.00 22.40 ? 258  CYS C SG   1 
ATOM   7051 N  N    . LEU C 1 229 ? -51.918 46.612 66.683 1.00 19.42 ? 259  LEU C N    1 
ATOM   7052 C  CA   . LEU C 1 229 ? -50.721 46.438 65.862 1.00 18.38 ? 259  LEU C CA   1 
ATOM   7053 C  C    . LEU C 1 229 ? -49.571 47.278 66.421 1.00 17.23 ? 259  LEU C C    1 
ATOM   7054 O  O    . LEU C 1 229 ? -48.468 46.773 66.654 1.00 16.60 ? 259  LEU C O    1 
ATOM   7055 C  CB   . LEU C 1 229 ? -51.029 46.871 64.426 1.00 18.53 ? 259  LEU C CB   1 
ATOM   7056 C  CG   . LEU C 1 229 ? -49.906 47.112 63.419 1.00 13.54 ? 259  LEU C CG   1 
ATOM   7057 C  CD1  . LEU C 1 229 ? -49.266 45.803 62.995 1.00 11.80 ? 259  LEU C CD1  1 
ATOM   7058 C  CD2  . LEU C 1 229 ? -50.504 47.816 62.232 1.00 12.97 ? 259  LEU C CD2  1 
ATOM   7059 N  N    . ASN C 1 230 ? -49.849 48.556 66.662 1.00 17.38 ? 260  ASN C N    1 
ATOM   7060 C  CA   . ASN C 1 230 ? -48.845 49.474 67.183 1.00 14.44 ? 260  ASN C CA   1 
ATOM   7061 C  C    . ASN C 1 230 ? -48.331 49.012 68.535 1.00 13.59 ? 260  ASN C C    1 
ATOM   7062 O  O    . ASN C 1 230 ? -47.143 49.107 68.818 1.00 10.83 ? 260  ASN C O    1 
ATOM   7063 C  CB   . ASN C 1 230 ? -49.413 50.895 67.245 1.00 13.95 ? 260  ASN C CB   1 
ATOM   7064 C  CG   . ASN C 1 230 ? -49.699 51.460 65.853 1.00 18.07 ? 260  ASN C CG   1 
ATOM   7065 O  OD1  . ASN C 1 230 ? -49.370 50.826 64.844 1.00 13.93 ? 260  ASN C OD1  1 
ATOM   7066 N  ND2  . ASN C 1 230 ? -50.318 52.641 65.790 1.00 13.43 ? 260  ASN C ND2  1 
ATOM   7067 N  N    . GLU C 1 231 ? -49.228 48.465 69.351 1.00 17.57 ? 261  GLU C N    1 
ATOM   7068 C  CA   . GLU C 1 231 ? -48.863 47.958 70.667 1.00 16.04 ? 261  GLU C CA   1 
ATOM   7069 C  C    . GLU C 1 231 ? -47.934 46.752 70.541 1.00 14.25 ? 261  GLU C C    1 
ATOM   7070 O  O    . GLU C 1 231 ? -46.925 46.666 71.243 1.00 15.05 ? 261  GLU C O    1 
ATOM   7071 C  CB   . GLU C 1 231 ? -50.113 47.586 71.464 1.00 17.55 ? 261  GLU C CB   1 
ATOM   7072 C  CG   . GLU C 1 231 ? -49.807 47.209 72.898 1.00 25.48 ? 261  GLU C CG   1 
ATOM   7073 C  CD   . GLU C 1 231 ? -51.042 47.120 73.781 1.00 34.06 ? 261  GLU C CD   1 
ATOM   7074 O  OE1  . GLU C 1 231 ? -52.132 47.621 73.413 1.00 23.41 ? 261  GLU C OE1  1 
ATOM   7075 O  OE2  . GLU C 1 231 ? -50.902 46.542 74.873 1.00 41.19 ? 261  GLU C OE2  1 
ATOM   7076 N  N    . LEU C 1 232 ? -48.266 45.833 69.641 1.00 14.54 ? 262  LEU C N    1 
ATOM   7077 C  CA   . LEU C 1 232 ? -47.440 44.647 69.423 1.00 17.52 ? 262  LEU C CA   1 
ATOM   7078 C  C    . LEU C 1 232 ? -46.045 45.018 68.906 1.00 16.94 ? 262  LEU C C    1 
ATOM   7079 O  O    . LEU C 1 232 ? -45.036 44.484 69.371 1.00 18.32 ? 262  LEU C O    1 
ATOM   7080 C  CB   . LEU C 1 232 ? -48.129 43.666 68.451 1.00 16.29 ? 262  LEU C CB   1 
ATOM   7081 C  CG   . LEU C 1 232 ? -48.987 42.516 69.008 1.00 14.28 ? 262  LEU C CG   1 
ATOM   7082 C  CD1  . LEU C 1 232 ? -48.940 42.457 70.524 1.00 14.45 ? 262  LEU C CD1  1 
ATOM   7083 C  CD2  . LEU C 1 232 ? -50.407 42.659 68.534 1.00 19.36 ? 262  LEU C CD2  1 
ATOM   7084 N  N    . ILE C 1 233 ? -45.985 45.953 67.967 1.00 17.21 ? 263  ILE C N    1 
ATOM   7085 C  CA   . ILE C 1 233 ? -44.701 46.384 67.416 1.00 17.32 ? 263  ILE C CA   1 
ATOM   7086 C  C    . ILE C 1 233 ? -43.821 47.014 68.502 1.00 14.27 ? 263  ILE C C    1 
ATOM   7087 O  O    . ILE C 1 233 ? -42.613 46.774 68.546 1.00 15.05 ? 263  ILE C O    1 
ATOM   7088 C  CB   . ILE C 1 233 ? -44.911 47.361 66.222 1.00 19.83 ? 263  ILE C CB   1 
ATOM   7089 C  CG1  . ILE C 1 233 ? -45.523 46.589 65.044 1.00 19.02 ? 263  ILE C CG1  1 
ATOM   7090 C  CG2  . ILE C 1 233 ? -43.592 48.047 65.830 1.00 17.50 ? 263  ILE C CG2  1 
ATOM   7091 C  CD1  . ILE C 1 233 ? -45.926 47.443 63.864 1.00 14.93 ? 263  ILE C CD1  1 
ATOM   7092 N  N    . THR C 1 234 ? -44.430 47.816 69.374 1.00 12.06 ? 264  THR C N    1 
ATOM   7093 C  CA   . THR C 1 234 ? -43.721 48.461 70.480 1.00 11.01 ? 264  THR C CA   1 
ATOM   7094 C  C    . THR C 1 234 ? -43.085 47.391 71.379 1.00 9.89  ? 264  THR C C    1 
ATOM   7095 O  O    . THR C 1 234 ? -41.948 47.526 71.821 1.00 9.83  ? 264  THR C O    1 
ATOM   7096 C  CB   . THR C 1 234 ? -44.688 49.348 71.292 1.00 10.11 ? 264  THR C CB   1 
ATOM   7097 O  OG1  . THR C 1 234 ? -45.321 50.262 70.392 1.00 10.11 ? 264  THR C OG1  1 
ATOM   7098 C  CG2  . THR C 1 234 ? -43.951 50.135 72.383 1.00 8.48  ? 264  THR C CG2  1 
ATOM   7099 N  N    . ASN C 1 235 ? -43.823 46.313 71.611 1.00 13.93 ? 265  ASN C N    1 
ATOM   7100 C  CA   . ASN C 1 235 ? -43.349 45.188 72.409 1.00 16.05 ? 265  ASN C CA   1 
ATOM   7101 C  C    . ASN C 1 235 ? -42.084 44.616 71.736 1.00 18.76 ? 265  ASN C C    1 
ATOM   7102 O  O    . ASN C 1 235 ? -41.042 44.449 72.381 1.00 16.30 ? 265  ASN C O    1 
ATOM   7103 C  CB   . ASN C 1 235 ? -44.456 44.125 72.449 1.00 15.92 ? 265  ASN C CB   1 
ATOM   7104 C  CG   . ASN C 1 235 ? -44.075 42.883 73.240 1.00 16.57 ? 265  ASN C CG   1 
ATOM   7105 O  OD1  . ASN C 1 235 ? -44.851 42.411 74.074 1.00 20.42 ? 265  ASN C OD1  1 
ATOM   7106 N  ND2  . ASN C 1 235 ? -42.939 42.293 72.918 1.00 10.78 ? 265  ASN C ND2  1 
ATOM   7107 N  N    . ALA C 1 236 ? -42.187 44.330 70.435 1.00 19.58 ? 266  ALA C N    1 
ATOM   7108 C  CA   . ALA C 1 236 ? -41.083 43.766 69.644 1.00 17.74 ? 266  ALA C CA   1 
ATOM   7109 C  C    . ALA C 1 236 ? -39.857 44.671 69.592 1.00 16.69 ? 266  ALA C C    1 
ATOM   7110 O  O    . ALA C 1 236 ? -38.719 44.195 69.567 1.00 16.68 ? 266  ALA C O    1 
ATOM   7111 C  CB   . ALA C 1 236 ? -41.561 43.439 68.229 1.00 16.54 ? 266  ALA C CB   1 
ATOM   7112 N  N    . LEU C 1 237 ? -40.081 45.978 69.609 1.00 14.20 ? 267  LEU C N    1 
ATOM   7113 C  CA   . LEU C 1 237 ? -38.976 46.922 69.580 1.00 13.20 ? 267  LEU C CA   1 
ATOM   7114 C  C    . LEU C 1 237 ? -38.016 46.776 70.756 1.00 16.29 ? 267  LEU C C    1 
ATOM   7115 O  O    . LEU C 1 237 ? -36.845 47.153 70.660 1.00 19.98 ? 267  LEU C O    1 
ATOM   7116 C  CB   . LEU C 1 237 ? -39.504 48.350 69.521 1.00 16.08 ? 267  LEU C CB   1 
ATOM   7117 C  CG   . LEU C 1 237 ? -40.131 48.747 68.188 1.00 10.48 ? 267  LEU C CG   1 
ATOM   7118 C  CD1  . LEU C 1 237 ? -40.590 50.180 68.277 1.00 9.68  ? 267  LEU C CD1  1 
ATOM   7119 C  CD2  . LEU C 1 237 ? -39.098 48.569 67.084 1.00 9.41  ? 267  LEU C CD2  1 
ATOM   7120 N  N    . HIS C 1 238 ? -38.495 46.205 71.858 1.00 17.75 ? 268  HIS C N    1 
ATOM   7121 C  CA   . HIS C 1 238 ? -37.657 46.020 73.043 1.00 16.34 ? 268  HIS C CA   1 
ATOM   7122 C  C    . HIS C 1 238 ? -36.475 45.073 72.876 1.00 14.14 ? 268  HIS C C    1 
ATOM   7123 O  O    . HIS C 1 238 ? -35.531 45.121 73.661 1.00 14.92 ? 268  HIS C O    1 
ATOM   7124 C  CB   . HIS C 1 238 ? -38.518 45.616 74.244 1.00 20.17 ? 268  HIS C CB   1 
ATOM   7125 C  CG   . HIS C 1 238 ? -39.392 46.721 74.745 1.00 19.94 ? 268  HIS C CG   1 
ATOM   7126 N  ND1  . HIS C 1 238 ? -40.514 47.144 74.072 1.00 19.99 ? 268  HIS C ND1  1 
ATOM   7127 C  CD2  . HIS C 1 238 ? -39.271 47.532 75.825 1.00 22.94 ? 268  HIS C CD2  1 
ATOM   7128 C  CE1  . HIS C 1 238 ? -41.048 48.174 74.709 1.00 21.54 ? 268  HIS C CE1  1 
ATOM   7129 N  NE2  . HIS C 1 238 ? -40.313 48.427 75.775 1.00 21.13 ? 268  HIS C NE2  1 
ATOM   7130 N  N    . HIS C 1 239 ? -36.495 44.257 71.826 1.00 14.71 ? 269  HIS C N    1 
ATOM   7131 C  CA   . HIS C 1 239 ? -35.411 43.311 71.566 1.00 16.16 ? 269  HIS C CA   1 
ATOM   7132 C  C    . HIS C 1 239 ? -34.235 43.901 70.813 1.00 16.39 ? 269  HIS C C    1 
ATOM   7133 O  O    . HIS C 1 239 ? -33.140 43.343 70.844 1.00 18.97 ? 269  HIS C O    1 
ATOM   7134 C  CB   . HIS C 1 239 ? -35.939 42.072 70.847 1.00 15.67 ? 269  HIS C CB   1 
ATOM   7135 C  CG   . HIS C 1 239 ? -36.943 41.319 71.653 1.00 14.70 ? 269  HIS C CG   1 
ATOM   7136 N  ND1  . HIS C 1 239 ? -38.260 41.192 71.269 1.00 18.54 ? 269  HIS C ND1  1 
ATOM   7137 C  CD2  . HIS C 1 239 ? -36.853 40.755 72.877 1.00 9.43  ? 269  HIS C CD2  1 
ATOM   7138 C  CE1  . HIS C 1 239 ? -38.939 40.590 72.226 1.00 12.76 ? 269  HIS C CE1  1 
ATOM   7139 N  NE2  . HIS C 1 239 ? -38.111 40.314 73.214 1.00 12.55 ? 269  HIS C NE2  1 
ATOM   7140 N  N    . ILE C 1 240 ? -34.441 45.058 70.192 1.00 18.32 ? 270  ILE C N    1 
ATOM   7141 C  CA   . ILE C 1 240 ? -33.379 45.731 69.442 1.00 15.76 ? 270  ILE C CA   1 
ATOM   7142 C  C    . ILE C 1 240 ? -32.105 45.923 70.280 1.00 15.16 ? 270  ILE C C    1 
ATOM   7143 O  O    . ILE C 1 240 ? -30.999 45.685 69.789 1.00 18.96 ? 270  ILE C O    1 
ATOM   7144 C  CB   . ILE C 1 240 ? -33.864 47.101 68.881 1.00 19.93 ? 270  ILE C CB   1 
ATOM   7145 C  CG1  . ILE C 1 240 ? -35.070 46.906 67.957 1.00 18.57 ? 270  ILE C CG1  1 
ATOM   7146 C  CG2  . ILE C 1 240 ? -32.733 47.818 68.151 1.00 13.87 ? 270  ILE C CG2  1 
ATOM   7147 C  CD1  . ILE C 1 240 ? -34.726 46.263 66.649 1.00 28.75 ? 270  ILE C CD1  1 
ATOM   7148 N  N    . PRO C 1 241 ? -32.229 46.383 71.540 1.00 15.34 ? 271  PRO C N    1 
ATOM   7149 C  CA   . PRO C 1 241 ? -31.009 46.560 72.337 1.00 15.25 ? 271  PRO C CA   1 
ATOM   7150 C  C    . PRO C 1 241 ? -30.134 45.301 72.369 1.00 16.49 ? 271  PRO C C    1 
ATOM   7151 O  O    . PRO C 1 241 ? -28.905 45.380 72.209 1.00 12.91 ? 271  PRO C O    1 
ATOM   7152 C  CB   . PRO C 1 241 ? -31.561 46.908 73.716 1.00 20.91 ? 271  PRO C CB   1 
ATOM   7153 C  CG   . PRO C 1 241 ? -32.776 47.733 73.367 1.00 17.77 ? 271  PRO C CG   1 
ATOM   7154 C  CD   . PRO C 1 241 ? -33.404 46.933 72.252 1.00 13.78 ? 271  PRO C CD   1 
ATOM   7155 N  N    . ASP C 1 242 ? -30.771 44.146 72.561 1.00 18.39 ? 272  ASP C N    1 
ATOM   7156 C  CA   . ASP C 1 242 ? -30.069 42.861 72.599 1.00 19.27 ? 272  ASP C CA   1 
ATOM   7157 C  C    . ASP C 1 242 ? -29.518 42.465 71.223 1.00 18.86 ? 272  ASP C C    1 
ATOM   7158 O  O    . ASP C 1 242 ? -28.414 41.924 71.111 1.00 17.83 ? 272  ASP C O    1 
ATOM   7159 C  CB   . ASP C 1 242 ? -30.986 41.767 73.145 1.00 20.93 ? 272  ASP C CB   1 
ATOM   7160 C  CG   . ASP C 1 242 ? -30.939 41.660 74.668 1.00 21.05 ? 272  ASP C CG   1 
ATOM   7161 O  OD1  . ASP C 1 242 ? -30.197 42.428 75.312 1.00 21.18 ? 272  ASP C OD1  1 
ATOM   7162 O  OD2  . ASP C 1 242 ? -31.635 40.788 75.222 1.00 23.62 ? 272  ASP C OD2  1 
ATOM   7163 N  N    . VAL C 1 243 ? -30.295 42.741 70.183 1.00 18.21 ? 273  VAL C N    1 
ATOM   7164 C  CA   . VAL C 1 243 ? -29.887 42.460 68.809 1.00 17.21 ? 273  VAL C CA   1 
ATOM   7165 C  C    . VAL C 1 243 ? -28.617 43.265 68.480 1.00 17.59 ? 273  VAL C C    1 
ATOM   7166 O  O    . VAL C 1 243 ? -27.652 42.720 67.935 1.00 16.64 ? 273  VAL C O    1 
ATOM   7167 C  CB   . VAL C 1 243 ? -31.024 42.828 67.824 1.00 15.43 ? 273  VAL C CB   1 
ATOM   7168 C  CG1  . VAL C 1 243 ? -30.507 42.882 66.405 1.00 14.01 ? 273  VAL C CG1  1 
ATOM   7169 C  CG2  . VAL C 1 243 ? -32.166 41.824 67.943 1.00 6.06  ? 273  VAL C CG2  1 
ATOM   7170 N  N    . ILE C 1 244 ? -28.599 44.549 68.849 1.00 17.94 ? 274  ILE C N    1 
ATOM   7171 C  CA   . ILE C 1 244 ? -27.432 45.394 68.594 1.00 16.74 ? 274  ILE C CA   1 
ATOM   7172 C  C    . ILE C 1 244 ? -26.217 44.887 69.361 1.00 18.11 ? 274  ILE C C    1 
ATOM   7173 O  O    . ILE C 1 244 ? -25.089 44.961 68.862 1.00 21.88 ? 274  ILE C O    1 
ATOM   7174 C  CB   . ILE C 1 244 ? -27.677 46.874 68.957 1.00 17.79 ? 274  ILE C CB   1 
ATOM   7175 C  CG1  . ILE C 1 244 ? -28.791 47.466 68.084 1.00 17.02 ? 274  ILE C CG1  1 
ATOM   7176 C  CG2  . ILE C 1 244 ? -26.386 47.668 68.791 1.00 12.85 ? 274  ILE C CG2  1 
ATOM   7177 C  CD1  . ILE C 1 244 ? -28.990 48.968 68.265 1.00 12.50 ? 274  ILE C CD1  1 
ATOM   7178 N  N    . THR C 1 245 ? -26.448 44.366 70.566 1.00 16.67 ? 275  THR C N    1 
ATOM   7179 C  CA   . THR C 1 245 ? -25.365 43.818 71.382 1.00 18.37 ? 275  THR C CA   1 
ATOM   7180 C  C    . THR C 1 245 ? -24.852 42.507 70.790 1.00 15.23 ? 275  THR C C    1 
ATOM   7181 O  O    . THR C 1 245 ? -23.641 42.296 70.662 1.00 12.14 ? 275  THR C O    1 
ATOM   7182 C  CB   . THR C 1 245 ? -25.808 43.591 72.847 1.00 21.24 ? 275  THR C CB   1 
ATOM   7183 O  OG1  . THR C 1 245 ? -26.105 44.857 73.453 1.00 21.12 ? 275  THR C OG1  1 
ATOM   7184 C  CG2  . THR C 1 245 ? -24.699 42.910 73.648 1.00 17.28 ? 275  THR C CG2  1 
ATOM   7185 N  N    . TYR C 1 246 ? -25.774 41.636 70.405 1.00 16.60 ? 276  TYR C N    1 
ATOM   7186 C  CA   . TYR C 1 246 ? -25.391 40.359 69.820 1.00 19.17 ? 276  TYR C CA   1 
ATOM   7187 C  C    . TYR C 1 246 ? -24.559 40.583 68.557 1.00 16.35 ? 276  TYR C C    1 
ATOM   7188 O  O    . TYR C 1 246 ? -23.482 40.005 68.403 1.00 17.71 ? 276  TYR C O    1 
ATOM   7189 C  CB   . TYR C 1 246 ? -26.632 39.524 69.484 1.00 20.28 ? 276  TYR C CB   1 
ATOM   7190 C  CG   . TYR C 1 246 ? -26.313 38.159 68.905 1.00 23.14 ? 276  TYR C CG   1 
ATOM   7191 C  CD1  . TYR C 1 246 ? -25.959 38.012 67.564 1.00 23.93 ? 276  TYR C CD1  1 
ATOM   7192 C  CD2  . TYR C 1 246 ? -26.347 37.019 69.703 1.00 21.39 ? 276  TYR C CD2  1 
ATOM   7193 C  CE1  . TYR C 1 246 ? -25.644 36.759 67.029 1.00 25.10 ? 276  TYR C CE1  1 
ATOM   7194 C  CE2  . TYR C 1 246 ? -26.034 35.765 69.182 1.00 26.06 ? 276  TYR C CE2  1 
ATOM   7195 C  CZ   . TYR C 1 246 ? -25.683 35.641 67.841 1.00 24.80 ? 276  TYR C CZ   1 
ATOM   7196 O  OH   . TYR C 1 246 ? -25.381 34.406 67.314 1.00 23.37 ? 276  TYR C OH   1 
ATOM   7197 N  N    . LEU C 1 247 ? -25.060 41.422 67.655 1.00 18.56 ? 277  LEU C N    1 
ATOM   7198 C  CA   . LEU C 1 247 ? -24.365 41.692 66.399 1.00 14.22 ? 277  LEU C CA   1 
ATOM   7199 C  C    . LEU C 1 247 ? -23.005 42.335 66.595 1.00 15.89 ? 277  LEU C C    1 
ATOM   7200 O  O    . LEU C 1 247 ? -22.058 41.993 65.887 1.00 16.64 ? 277  LEU C O    1 
ATOM   7201 C  CB   . LEU C 1 247 ? -25.234 42.534 65.458 1.00 12.24 ? 277  LEU C CB   1 
ATOM   7202 C  CG   . LEU C 1 247 ? -26.563 41.921 64.993 1.00 12.63 ? 277  LEU C CG   1 
ATOM   7203 C  CD1  . LEU C 1 247 ? -27.297 42.868 64.044 1.00 9.68  ? 277  LEU C CD1  1 
ATOM   7204 C  CD2  . LEU C 1 247 ? -26.310 40.600 64.310 1.00 7.01  ? 277  LEU C CD2  1 
ATOM   7205 N  N    . SER C 1 248 ? -22.874 43.186 67.609 1.00 16.48 ? 278  SER C N    1 
ATOM   7206 C  CA   . SER C 1 248 ? -21.604 43.866 67.862 1.00 19.61 ? 278  SER C CA   1 
ATOM   7207 C  C    . SER C 1 248 ? -20.480 42.941 68.345 1.00 20.19 ? 278  SER C C    1 
ATOM   7208 O  O    . SER C 1 248 ? -19.302 43.297 68.278 1.00 21.18 ? 278  SER C O    1 
ATOM   7209 C  CB   . SER C 1 248 ? -21.793 45.018 68.860 1.00 20.52 ? 278  SER C CB   1 
ATOM   7210 O  OG   . SER C 1 248 ? -21.968 44.530 70.184 1.00 28.07 ? 278  SER C OG   1 
ATOM   7211 N  N    . ARG C 1 249 ? -20.834 41.769 68.852 1.00 20.01 ? 279  ARG C N    1 
ATOM   7212 C  CA   . ARG C 1 249 ? -19.822 40.841 69.336 1.00 21.57 ? 279  ARG C CA   1 
ATOM   7213 C  C    . ARG C 1 249 ? -19.257 39.938 68.244 1.00 19.30 ? 279  ARG C C    1 
ATOM   7214 O  O    . ARG C 1 249 ? -18.207 39.327 68.428 1.00 21.85 ? 279  ARG C O    1 
ATOM   7215 C  CB   . ARG C 1 249 ? -20.395 39.970 70.453 1.00 25.50 ? 279  ARG C CB   1 
ATOM   7216 C  CG   . ARG C 1 249 ? -20.784 40.724 71.700 1.00 33.77 ? 279  ARG C CG   1 
ATOM   7217 C  CD   . ARG C 1 249 ? -21.329 39.768 72.734 1.00 40.77 ? 279  ARG C CD   1 
ATOM   7218 N  NE   . ARG C 1 249 ? -21.808 40.448 73.935 1.00 42.37 ? 279  ARG C NE   1 
ATOM   7219 C  CZ   . ARG C 1 249 ? -22.777 39.981 74.714 1.00 38.18 ? 279  ARG C CZ   1 
ATOM   7220 N  NH1  . ARG C 1 249 ? -23.364 38.831 74.413 1.00 31.45 ? 279  ARG C NH1  1 
ATOM   7221 N  NH2  . ARG C 1 249 ? -23.146 40.653 75.795 1.00 38.05 ? 279  ARG C NH2  1 
ATOM   7222 N  N    . LEU C 1 250 ? -19.952 39.843 67.117 1.00 19.74 ? 280  LEU C N    1 
ATOM   7223 C  CA   . LEU C 1 250 ? -19.504 38.971 66.036 1.00 19.45 ? 280  LEU C CA   1 
ATOM   7224 C  C    . LEU C 1 250 ? -18.169 39.416 65.451 1.00 21.93 ? 280  LEU C C    1 
ATOM   7225 O  O    . LEU C 1 250 ? -17.915 40.615 65.277 1.00 20.12 ? 280  LEU C O    1 
ATOM   7226 C  CB   . LEU C 1 250 ? -20.579 38.855 64.947 1.00 16.09 ? 280  LEU C CB   1 
ATOM   7227 C  CG   . LEU C 1 250 ? -21.953 38.367 65.429 1.00 17.38 ? 280  LEU C CG   1 
ATOM   7228 C  CD1  . LEU C 1 250 ? -22.928 38.336 64.276 1.00 13.27 ? 280  LEU C CD1  1 
ATOM   7229 C  CD2  . LEU C 1 250 ? -21.854 36.983 66.086 1.00 17.67 ? 280  LEU C CD2  1 
ATOM   7230 N  N    . ARG C 1 251 ? -17.310 38.437 65.187 1.00 21.35 ? 281  ARG C N    1 
ATOM   7231 C  CA   . ARG C 1 251 ? -15.989 38.694 64.632 1.00 23.52 ? 281  ARG C CA   1 
ATOM   7232 C  C    . ARG C 1 251 ? -15.792 38.084 63.236 1.00 21.31 ? 281  ARG C C    1 
ATOM   7233 O  O    . ARG C 1 251 ? -14.843 38.426 62.538 1.00 21.43 ? 281  ARG C O    1 
ATOM   7234 C  CB   . ARG C 1 251 ? -14.912 38.156 65.587 1.00 29.85 ? 281  ARG C CB   1 
ATOM   7235 C  CG   . ARG C 1 251 ? -14.765 36.639 65.577 1.00 39.28 ? 281  ARG C CG   1 
ATOM   7236 C  CD   . ARG C 1 251 ? -13.627 36.162 66.466 1.00 45.35 ? 281  ARG C CD   1 
ATOM   7237 N  NE   . ARG C 1 251 ? -13.160 34.833 66.063 1.00 49.41 ? 281  ARG C NE   1 
ATOM   7238 C  CZ   . ARG C 1 251 ? -12.747 33.891 66.906 1.00 49.02 ? 281  ARG C CZ   1 
ATOM   7239 N  NH1  . ARG C 1 251 ? -12.739 34.112 68.213 1.00 53.12 ? 281  ARG C NH1  1 
ATOM   7240 N  NH2  . ARG C 1 251 ? -12.322 32.728 66.439 1.00 49.61 ? 281  ARG C NH2  1 
ATOM   7241 N  N    . ASN C 1 252 ? -16.677 37.176 62.838 1.00 18.73 ? 282  ASN C N    1 
ATOM   7242 C  CA   . ASN C 1 252 ? -16.573 36.516 61.540 1.00 17.46 ? 282  ASN C CA   1 
ATOM   7243 C  C    . ASN C 1 252 ? -17.509 37.205 60.550 1.00 17.25 ? 282  ASN C C    1 
ATOM   7244 O  O    . ASN C 1 252 ? -18.695 37.375 60.838 1.00 16.89 ? 282  ASN C O    1 
ATOM   7245 C  CB   . ASN C 1 252 ? -16.935 35.029 61.685 1.00 18.89 ? 282  ASN C CB   1 
ATOM   7246 C  CG   . ASN C 1 252 ? -16.783 34.250 60.395 1.00 17.01 ? 282  ASN C CG   1 
ATOM   7247 O  OD1  . ASN C 1 252 ? -17.636 34.312 59.513 1.00 15.70 ? 282  ASN C OD1  1 
ATOM   7248 N  ND2  . ASN C 1 252 ? -15.717 33.477 60.298 1.00 16.52 ? 282  ASN C ND2  1 
ATOM   7249 N  N    . GLN C 1 253 ? -16.984 37.587 59.386 1.00 13.36 ? 283  GLN C N    1 
ATOM   7250 C  CA   . GLN C 1 253 ? -17.779 38.268 58.372 1.00 12.89 ? 283  GLN C CA   1 
ATOM   7251 C  C    . GLN C 1 253 ? -18.939 37.422 57.832 1.00 18.39 ? 283  GLN C C    1 
ATOM   7252 O  O    . GLN C 1 253 ? -20.084 37.896 57.772 1.00 20.28 ? 283  GLN C O    1 
ATOM   7253 C  CB   . GLN C 1 253 ? -16.880 38.733 57.224 1.00 16.31 ? 283  GLN C CB   1 
ATOM   7254 C  CG   . GLN C 1 253 ? -17.584 39.571 56.172 1.00 12.91 ? 283  GLN C CG   1 
ATOM   7255 C  CD   . GLN C 1 253 ? -17.891 40.969 56.654 1.00 15.32 ? 283  GLN C CD   1 
ATOM   7256 O  OE1  . GLN C 1 253 ? -16.980 41.729 56.980 1.00 21.97 ? 283  GLN C OE1  1 
ATOM   7257 N  NE2  . GLN C 1 253 ? -19.169 41.325 56.691 1.00 10.93 ? 283  GLN C NE2  1 
ATOM   7258 N  N    . SER C 1 254 ? -18.668 36.169 57.464 1.00 18.38 ? 284  SER C N    1 
ATOM   7259 C  CA   . SER C 1 254 ? -19.731 35.313 56.936 1.00 16.12 ? 284  SER C CA   1 
ATOM   7260 C  C    . SER C 1 254 ? -20.852 35.155 57.972 1.00 15.40 ? 284  SER C C    1 
ATOM   7261 O  O    . SER C 1 254 ? -22.033 35.247 57.638 1.00 13.21 ? 284  SER C O    1 
ATOM   7262 C  CB   . SER C 1 254 ? -19.181 33.947 56.465 1.00 16.29 ? 284  SER C CB   1 
ATOM   7263 O  OG   . SER C 1 254 ? -18.777 33.098 57.533 1.00 11.87 ? 284  SER C OG   1 
ATOM   7264 N  N    . VAL C 1 255 ? -20.479 34.960 59.236 1.00 18.38 ? 285  VAL C N    1 
ATOM   7265 C  CA   . VAL C 1 255 ? -21.470 34.829 60.311 1.00 17.30 ? 285  VAL C CA   1 
ATOM   7266 C  C    . VAL C 1 255 ? -22.215 36.146 60.461 1.00 15.38 ? 285  VAL C C    1 
ATOM   7267 O  O    . VAL C 1 255 ? -23.450 36.166 60.538 1.00 17.33 ? 285  VAL C O    1 
ATOM   7268 C  CB   . VAL C 1 255 ? -20.814 34.474 61.664 1.00 17.37 ? 285  VAL C CB   1 
ATOM   7269 C  CG1  . VAL C 1 255 ? -21.811 34.624 62.800 1.00 15.81 ? 285  VAL C CG1  1 
ATOM   7270 C  CG2  . VAL C 1 255 ? -20.300 33.052 61.630 1.00 19.14 ? 285  VAL C CG2  1 
ATOM   7271 N  N    . PHE C 1 256 ? -21.466 37.247 60.438 1.00 18.29 ? 286  PHE C N    1 
ATOM   7272 C  CA   . PHE C 1 256 ? -22.053 38.578 60.579 1.00 18.92 ? 286  PHE C CA   1 
ATOM   7273 C  C    . PHE C 1 256 ? -23.121 38.847 59.529 1.00 17.28 ? 286  PHE C C    1 
ATOM   7274 O  O    . PHE C 1 256 ? -24.217 39.307 59.859 1.00 17.17 ? 286  PHE C O    1 
ATOM   7275 C  CB   . PHE C 1 256 ? -20.984 39.678 60.531 1.00 20.32 ? 286  PHE C CB   1 
ATOM   7276 C  CG   . PHE C 1 256 ? -21.530 41.054 60.812 1.00 22.71 ? 286  PHE C CG   1 
ATOM   7277 C  CD1  . PHE C 1 256 ? -22.046 41.839 59.782 1.00 22.75 ? 286  PHE C CD1  1 
ATOM   7278 C  CD2  . PHE C 1 256 ? -21.599 41.534 62.115 1.00 18.50 ? 286  PHE C CD2  1 
ATOM   7279 C  CE1  . PHE C 1 256 ? -22.626 43.076 60.053 1.00 23.28 ? 286  PHE C CE1  1 
ATOM   7280 C  CE2  . PHE C 1 256 ? -22.175 42.765 62.389 1.00 17.31 ? 286  PHE C CE2  1 
ATOM   7281 C  CZ   . PHE C 1 256 ? -22.691 43.534 61.356 1.00 19.02 ? 286  PHE C CZ   1 
ATOM   7282 N  N    . ASN C 1 257 ? -22.797 38.580 58.267 1.00 17.62 ? 287  ASN C N    1 
ATOM   7283 C  CA   . ASN C 1 257 ? -23.749 38.786 57.171 1.00 19.90 ? 287  ASN C CA   1 
ATOM   7284 C  C    . ASN C 1 257 ? -24.998 37.961 57.465 1.00 17.86 ? 287  ASN C C    1 
ATOM   7285 O  O    . ASN C 1 257 ? -26.119 38.467 57.441 1.00 19.58 ? 287  ASN C O    1 
ATOM   7286 C  CB   . ASN C 1 257 ? -23.148 38.334 55.835 1.00 18.22 ? 287  ASN C CB   1 
ATOM   7287 C  CG   . ASN C 1 257 ? -22.032 39.237 55.347 1.00 23.52 ? 287  ASN C CG   1 
ATOM   7288 O  OD1  . ASN C 1 257 ? -21.677 40.233 55.985 1.00 22.91 ? 287  ASN C OD1  1 
ATOM   7289 N  ND2  . ASN C 1 257 ? -21.484 38.902 54.188 1.00 22.45 ? 287  ASN C ND2  1 
ATOM   7290 N  N    . PHE C 1 258 ? -24.771 36.689 57.763 1.00 19.67 ? 288  PHE C N    1 
ATOM   7291 C  CA   . PHE C 1 258 ? -25.814 35.725 58.092 1.00 20.26 ? 288  PHE C CA   1 
ATOM   7292 C  C    . PHE C 1 258 ? -26.755 36.257 59.190 1.00 19.80 ? 288  PHE C C    1 
ATOM   7293 O  O    . PHE C 1 258 ? -27.979 36.180 59.062 1.00 18.51 ? 288  PHE C O    1 
ATOM   7294 C  CB   . PHE C 1 258 ? -25.129 34.408 58.511 1.00 17.80 ? 288  PHE C CB   1 
ATOM   7295 C  CG   . PHE C 1 258 ? -26.070 33.324 58.959 1.00 20.56 ? 288  PHE C CG   1 
ATOM   7296 C  CD1  . PHE C 1 258 ? -26.952 32.726 58.064 1.00 20.38 ? 288  PHE C CD1  1 
ATOM   7297 C  CD2  . PHE C 1 258 ? -26.052 32.881 60.284 1.00 22.40 ? 288  PHE C CD2  1 
ATOM   7298 C  CE1  . PHE C 1 258 ? -27.804 31.700 58.479 1.00 22.79 ? 288  PHE C CE1  1 
ATOM   7299 C  CE2  . PHE C 1 258 ? -26.896 31.858 60.709 1.00 22.81 ? 288  PHE C CE2  1 
ATOM   7300 C  CZ   . PHE C 1 258 ? -27.778 31.265 59.802 1.00 24.51 ? 288  PHE C CZ   1 
ATOM   7301 N  N    . CYS C 1 259 ? -26.185 36.839 60.242 1.00 20.38 ? 289  CYS C N    1 
ATOM   7302 C  CA   . CYS C 1 259 ? -26.981 37.368 61.352 1.00 17.86 ? 289  CYS C CA   1 
ATOM   7303 C  C    . CYS C 1 259 ? -27.621 38.748 61.145 1.00 14.00 ? 289  CYS C C    1 
ATOM   7304 O  O    . CYS C 1 259 ? -28.770 38.963 61.524 1.00 12.28 ? 289  CYS C O    1 
ATOM   7305 C  CB   . CYS C 1 259 ? -26.151 37.373 62.633 1.00 14.59 ? 289  CYS C CB   1 
ATOM   7306 S  SG   . CYS C 1 259 ? -25.700 35.729 63.214 1.00 16.78 ? 289  CYS C SG   1 
ATOM   7307 N  N    . ALA C 1 260 ? -26.889 39.675 60.542 1.00 17.41 ? 290  ALA C N    1 
ATOM   7308 C  CA   . ALA C 1 260 ? -27.392 41.033 60.314 1.00 20.71 ? 290  ALA C CA   1 
ATOM   7309 C  C    . ALA C 1 260 ? -28.576 41.142 59.352 1.00 21.35 ? 290  ALA C C    1 
ATOM   7310 O  O    . ALA C 1 260 ? -29.578 41.794 59.666 1.00 22.97 ? 290  ALA C O    1 
ATOM   7311 C  CB   . ALA C 1 260 ? -26.262 41.941 59.856 1.00 18.26 ? 290  ALA C CB   1 
ATOM   7312 N  N    . ILE C 1 261 ? -28.463 40.481 58.201 1.00 23.99 ? 291  ILE C N    1 
ATOM   7313 C  CA   . ILE C 1 261 ? -29.495 40.498 57.158 1.00 22.10 ? 291  ILE C CA   1 
ATOM   7314 C  C    . ILE C 1 261 ? -30.928 40.282 57.672 1.00 21.30 ? 291  ILE C C    1 
ATOM   7315 O  O    . ILE C 1 261 ? -31.812 41.103 57.407 1.00 22.75 ? 291  ILE C O    1 
ATOM   7316 C  CB   . ILE C 1 261 ? -29.177 39.465 56.026 1.00 21.38 ? 291  ILE C CB   1 
ATOM   7317 C  CG1  . ILE C 1 261 ? -27.798 39.727 55.415 1.00 23.45 ? 291  ILE C CG1  1 
ATOM   7318 C  CG2  . ILE C 1 261 ? -30.233 39.515 54.945 1.00 18.73 ? 291  ILE C CG2  1 
ATOM   7319 C  CD1  . ILE C 1 261 ? -27.618 41.084 54.822 1.00 25.44 ? 291  ILE C CD1  1 
ATOM   7320 N  N    . PRO C 1 262 ? -31.187 39.169 58.386 1.00 16.89 ? 292  PRO C N    1 
ATOM   7321 C  CA   . PRO C 1 262 ? -32.537 38.918 58.902 1.00 16.27 ? 292  PRO C CA   1 
ATOM   7322 C  C    . PRO C 1 262 ? -33.035 40.033 59.825 1.00 17.87 ? 292  PRO C C    1 
ATOM   7323 O  O    . PRO C 1 262 ? -34.195 40.444 59.750 1.00 19.01 ? 292  PRO C O    1 
ATOM   7324 C  CB   . PRO C 1 262 ? -32.361 37.614 59.675 1.00 15.82 ? 292  PRO C CB   1 
ATOM   7325 C  CG   . PRO C 1 262 ? -31.294 36.923 58.929 1.00 13.36 ? 292  PRO C CG   1 
ATOM   7326 C  CD   . PRO C 1 262 ? -30.306 38.032 58.692 1.00 14.97 ? 292  PRO C CD   1 
ATOM   7327 N  N    . GLN C 1 263 ? -32.153 40.521 60.689 1.00 18.19 ? 293  GLN C N    1 
ATOM   7328 C  CA   . GLN C 1 263 ? -32.502 41.583 61.631 1.00 18.74 ? 293  GLN C CA   1 
ATOM   7329 C  C    . GLN C 1 263 ? -32.895 42.883 60.919 1.00 18.15 ? 293  GLN C C    1 
ATOM   7330 O  O    . GLN C 1 263 ? -33.903 43.520 61.262 1.00 14.06 ? 293  GLN C O    1 
ATOM   7331 C  CB   . GLN C 1 263 ? -31.338 41.834 62.599 1.00 17.79 ? 293  GLN C CB   1 
ATOM   7332 C  CG   . GLN C 1 263 ? -31.022 40.659 63.535 1.00 19.27 ? 293  GLN C CG   1 
ATOM   7333 C  CD   . GLN C 1 263 ? -32.232 40.182 64.324 1.00 18.88 ? 293  GLN C CD   1 
ATOM   7334 O  OE1  . GLN C 1 263 ? -33.127 40.957 64.655 1.00 18.03 ? 293  GLN C OE1  1 
ATOM   7335 N  NE2  . GLN C 1 263 ? -32.279 38.890 64.595 1.00 23.69 ? 293  GLN C NE2  1 
ATOM   7336 N  N    . VAL C 1 264 ? -32.112 43.263 59.912 1.00 15.35 ? 294  VAL C N    1 
ATOM   7337 C  CA   . VAL C 1 264 ? -32.390 44.473 59.157 1.00 11.90 ? 294  VAL C CA   1 
ATOM   7338 C  C    . VAL C 1 264 ? -33.706 44.315 58.405 1.00 13.46 ? 294  VAL C C    1 
ATOM   7339 O  O    . VAL C 1 264 ? -34.537 45.230 58.382 1.00 13.45 ? 294  VAL C O    1 
ATOM   7340 C  CB   . VAL C 1 264 ? -31.228 44.820 58.201 1.00 11.76 ? 294  VAL C CB   1 
ATOM   7341 C  CG1  . VAL C 1 264 ? -31.579 46.022 57.358 1.00 16.46 ? 294  VAL C CG1  1 
ATOM   7342 C  CG2  . VAL C 1 264 ? -29.972 45.118 59.001 1.00 7.87  ? 294  VAL C CG2  1 
ATOM   7343 N  N    . MET C 1 265 ? -33.931 43.128 57.849 1.00 17.08 ? 295  MET C N    1 
ATOM   7344 C  CA   . MET C 1 265 ? -35.166 42.858 57.113 1.00 23.51 ? 295  MET C CA   1 
ATOM   7345 C  C    . MET C 1 265 ? -36.380 42.882 58.046 1.00 23.60 ? 295  MET C C    1 
ATOM   7346 O  O    . MET C 1 265 ? -37.461 43.319 57.656 1.00 25.03 ? 295  MET C O    1 
ATOM   7347 C  CB   . MET C 1 265 ? -35.070 41.532 56.348 1.00 26.33 ? 295  MET C CB   1 
ATOM   7348 C  CG   . MET C 1 265 ? -34.082 41.591 55.176 1.00 37.91 ? 295  MET C CG   1 
ATOM   7349 S  SD   . MET C 1 265 ? -33.916 40.048 54.210 1.00 49.85 ? 295  MET C SD   1 
ATOM   7350 C  CE   . MET C 1 265 ? -35.575 39.954 53.415 1.00 42.55 ? 295  MET C CE   1 
ATOM   7351 N  N    . ALA C 1 266 ? -36.183 42.449 59.288 1.00 24.21 ? 296  ALA C N    1 
ATOM   7352 C  CA   . ALA C 1 266 ? -37.251 42.448 60.282 1.00 21.69 ? 296  ALA C CA   1 
ATOM   7353 C  C    . ALA C 1 266 ? -37.603 43.891 60.673 1.00 21.37 ? 296  ALA C C    1 
ATOM   7354 O  O    . ALA C 1 266 ? -38.773 44.285 60.626 1.00 18.16 ? 296  ALA C O    1 
ATOM   7355 C  CB   . ALA C 1 266 ? -36.821 41.655 61.511 1.00 23.24 ? 296  ALA C CB   1 
ATOM   7356 N  N    . ILE C 1 267 ? -36.597 44.686 61.038 1.00 21.85 ? 297  ILE C N    1 
ATOM   7357 C  CA   . ILE C 1 267 ? -36.855 46.076 61.418 1.00 24.85 ? 297  ILE C CA   1 
ATOM   7358 C  C    . ILE C 1 267 ? -37.510 46.803 60.239 1.00 24.65 ? 297  ILE C C    1 
ATOM   7359 O  O    . ILE C 1 267 ? -38.448 47.586 60.424 1.00 23.26 ? 297  ILE C O    1 
ATOM   7360 C  CB   . ILE C 1 267 ? -35.571 46.832 61.869 1.00 26.09 ? 297  ILE C CB   1 
ATOM   7361 C  CG1  . ILE C 1 267 ? -34.613 47.017 60.695 1.00 35.57 ? 297  ILE C CG1  1 
ATOM   7362 C  CG2  . ILE C 1 267 ? -34.867 46.063 62.961 1.00 36.03 ? 297  ILE C CG2  1 
ATOM   7363 C  CD1  . ILE C 1 267 ? -33.267 47.593 61.057 1.00 38.18 ? 297  ILE C CD1  1 
ATOM   7364 N  N    . ALA C 1 268 ? -37.043 46.506 59.027 1.00 19.02 ? 298  ALA C N    1 
ATOM   7365 C  CA   . ALA C 1 268 ? -37.598 47.114 57.832 1.00 15.62 ? 298  ALA C CA   1 
ATOM   7366 C  C    . ALA C 1 268 ? -39.088 46.789 57.774 1.00 15.51 ? 298  ALA C C    1 
ATOM   7367 O  O    . ALA C 1 268 ? -39.915 47.662 57.519 1.00 17.68 ? 298  ALA C O    1 
ATOM   7368 C  CB   . ALA C 1 268 ? -36.889 46.586 56.603 1.00 18.53 ? 298  ALA C CB   1 
ATOM   7369 N  N    . THR C 1 269 ? -39.426 45.540 58.069 1.00 16.86 ? 299  THR C N    1 
ATOM   7370 C  CA   . THR C 1 269 ? -40.814 45.095 58.065 1.00 19.53 ? 299  THR C CA   1 
ATOM   7371 C  C    . THR C 1 269 ? -41.654 45.781 59.137 1.00 19.98 ? 299  THR C C    1 
ATOM   7372 O  O    . THR C 1 269 ? -42.776 46.203 58.857 1.00 21.24 ? 299  THR C O    1 
ATOM   7373 C  CB   . THR C 1 269 ? -40.900 43.571 58.251 1.00 24.22 ? 299  THR C CB   1 
ATOM   7374 O  OG1  . THR C 1 269 ? -40.129 42.928 57.225 1.00 27.37 ? 299  THR C OG1  1 
ATOM   7375 C  CG2  . THR C 1 269 ? -42.357 43.093 58.186 1.00 18.93 ? 299  THR C CG2  1 
ATOM   7376 N  N    . LEU C 1 270 ? -41.121 45.901 60.355 1.00 18.75 ? 300  LEU C N    1 
ATOM   7377 C  CA   . LEU C 1 270 ? -41.855 46.549 61.450 1.00 19.40 ? 300  LEU C CA   1 
ATOM   7378 C  C    . LEU C 1 270 ? -42.134 48.009 61.146 1.00 17.00 ? 300  LEU C C    1 
ATOM   7379 O  O    . LEU C 1 270 ? -43.236 48.507 61.394 1.00 18.94 ? 300  LEU C O    1 
ATOM   7380 C  CB   . LEU C 1 270 ? -41.090 46.450 62.771 1.00 19.11 ? 300  LEU C CB   1 
ATOM   7381 C  CG   . LEU C 1 270 ? -41.081 45.082 63.446 1.00 17.47 ? 300  LEU C CG   1 
ATOM   7382 C  CD1  . LEU C 1 270 ? -40.346 45.193 64.762 1.00 19.55 ? 300  LEU C CD1  1 
ATOM   7383 C  CD2  . LEU C 1 270 ? -42.500 44.594 63.669 1.00 13.40 ? 300  LEU C CD2  1 
ATOM   7384 N  N    . ALA C 1 271 ? -41.127 48.689 60.609 1.00 16.52 ? 301  ALA C N    1 
ATOM   7385 C  CA   . ALA C 1 271 ? -41.243 50.091 60.241 1.00 14.50 ? 301  ALA C CA   1 
ATOM   7386 C  C    . ALA C 1 271 ? -42.288 50.246 59.129 1.00 16.69 ? 301  ALA C C    1 
ATOM   7387 O  O    . ALA C 1 271 ? -42.986 51.253 59.064 1.00 18.20 ? 301  ALA C O    1 
ATOM   7388 C  CB   . ALA C 1 271 ? -39.888 50.626 59.797 1.00 13.22 ? 301  ALA C CB   1 
ATOM   7389 N  N    . ALA C 1 272 ? -42.420 49.226 58.282 1.00 17.52 ? 302  ALA C N    1 
ATOM   7390 C  CA   . ALA C 1 272 ? -43.391 49.253 57.189 1.00 14.19 ? 302  ALA C CA   1 
ATOM   7391 C  C    . ALA C 1 272 ? -44.802 48.927 57.690 1.00 14.69 ? 302  ALA C C    1 
ATOM   7392 O  O    . ALA C 1 272 ? -45.798 49.453 57.181 1.00 13.58 ? 302  ALA C O    1 
ATOM   7393 C  CB   . ALA C 1 272 ? -42.973 48.283 56.095 1.00 12.39 ? 302  ALA C CB   1 
ATOM   7394 N  N    . CYS C 1 273 ? -44.886 48.061 58.696 1.00 15.71 ? 303  CYS C N    1 
ATOM   7395 C  CA   . CYS C 1 273 ? -46.178 47.675 59.267 1.00 16.00 ? 303  CYS C CA   1 
ATOM   7396 C  C    . CYS C 1 273 ? -46.702 48.683 60.277 1.00 16.31 ? 303  CYS C C    1 
ATOM   7397 O  O    . CYS C 1 273 ? -47.913 48.807 60.444 1.00 18.01 ? 303  CYS C O    1 
ATOM   7398 C  CB   . CYS C 1 273 ? -46.093 46.314 59.962 1.00 14.29 ? 303  CYS C CB   1 
ATOM   7399 S  SG   . CYS C 1 273 ? -45.862 44.899 58.872 1.00 19.60 ? 303  CYS C SG   1 
ATOM   7400 N  N    . TYR C 1 274 ? -45.803 49.396 60.955 1.00 15.55 ? 304  TYR C N    1 
ATOM   7401 C  CA   . TYR C 1 274 ? -46.216 50.350 61.980 1.00 14.76 ? 304  TYR C CA   1 
ATOM   7402 C  C    . TYR C 1 274 ? -47.330 51.304 61.566 1.00 17.06 ? 304  TYR C C    1 
ATOM   7403 O  O    . TYR C 1 274 ? -47.208 52.038 60.584 1.00 15.83 ? 304  TYR C O    1 
ATOM   7404 C  CB   . TYR C 1 274 ? -45.025 51.135 62.531 1.00 14.66 ? 304  TYR C CB   1 
ATOM   7405 C  CG   . TYR C 1 274 ? -45.416 52.032 63.685 1.00 20.04 ? 304  TYR C CG   1 
ATOM   7406 C  CD1  . TYR C 1 274 ? -45.643 51.502 64.958 1.00 19.91 ? 304  TYR C CD1  1 
ATOM   7407 C  CD2  . TYR C 1 274 ? -45.662 53.388 63.484 1.00 18.88 ? 304  TYR C CD2  1 
ATOM   7408 C  CE1  . TYR C 1 274 ? -46.115 52.295 65.985 1.00 16.48 ? 304  TYR C CE1  1 
ATOM   7409 C  CE2  . TYR C 1 274 ? -46.135 54.188 64.509 1.00 16.95 ? 304  TYR C CE2  1 
ATOM   7410 C  CZ   . TYR C 1 274 ? -46.367 53.639 65.746 1.00 17.58 ? 304  TYR C CZ   1 
ATOM   7411 O  OH   . TYR C 1 274 ? -46.911 54.427 66.724 1.00 17.94 ? 304  TYR C OH   1 
ATOM   7412 N  N    . ASN C 1 275 ? -48.430 51.256 62.317 1.00 12.21 ? 305  ASN C N    1 
ATOM   7413 C  CA   . ASN C 1 275 ? -49.583 52.115 62.082 1.00 14.35 ? 305  ASN C CA   1 
ATOM   7414 C  C    . ASN C 1 275 ? -50.132 51.966 60.664 1.00 16.92 ? 305  ASN C C    1 
ATOM   7415 O  O    . ASN C 1 275 ? -50.715 52.904 60.113 1.00 18.22 ? 305  ASN C O    1 
ATOM   7416 C  CB   . ASN C 1 275 ? -49.195 53.572 62.326 1.00 8.73  ? 305  ASN C CB   1 
ATOM   7417 C  CG   . ASN C 1 275 ? -50.388 54.444 62.591 1.00 16.56 ? 305  ASN C CG   1 
ATOM   7418 O  OD1  . ASN C 1 275 ? -51.193 54.152 63.477 1.00 16.47 ? 305  ASN C OD1  1 
ATOM   7419 N  ND2  . ASN C 1 275 ? -50.519 55.522 61.834 1.00 18.63 ? 305  ASN C ND2  1 
ATOM   7420 N  N    . ASN C 1 276 ? -50.033 50.758 60.120 1.00 16.70 ? 306  ASN C N    1 
ATOM   7421 C  CA   . ASN C 1 276 ? -50.449 50.487 58.745 1.00 17.03 ? 306  ASN C CA   1 
ATOM   7422 C  C    . ASN C 1 276 ? -51.643 49.548 58.633 1.00 19.24 ? 306  ASN C C    1 
ATOM   7423 O  O    . ASN C 1 276 ? -51.534 48.349 58.907 1.00 18.25 ? 306  ASN C O    1 
ATOM   7424 C  CB   . ASN C 1 276 ? -49.243 49.898 57.998 1.00 15.88 ? 306  ASN C CB   1 
ATOM   7425 C  CG   . ASN C 1 276 ? -49.475 49.737 56.505 1.00 21.49 ? 306  ASN C CG   1 
ATOM   7426 O  OD1  . ASN C 1 276 ? -50.594 49.843 56.009 1.00 19.67 ? 306  ASN C OD1  1 
ATOM   7427 N  ND2  . ASN C 1 276 ? -48.402 49.464 55.782 1.00 20.68 ? 306  ASN C ND2  1 
ATOM   7428 N  N    . GLN C 1 277 ? -52.773 50.090 58.191 1.00 22.66 ? 307  GLN C N    1 
ATOM   7429 C  CA   . GLN C 1 277 ? -53.999 49.307 58.022 1.00 27.99 ? 307  GLN C CA   1 
ATOM   7430 C  C    . GLN C 1 277 ? -53.829 48.071 57.139 1.00 29.66 ? 307  GLN C C    1 
ATOM   7431 O  O    . GLN C 1 277 ? -54.479 47.052 57.364 1.00 30.22 ? 307  GLN C O    1 
ATOM   7432 C  CB   . GLN C 1 277 ? -55.104 50.164 57.405 1.00 28.15 ? 307  GLN C CB   1 
ATOM   7433 C  CG   . GLN C 1 277 ? -55.646 51.263 58.289 1.00 35.04 ? 307  GLN C CG   1 
ATOM   7434 C  CD   . GLN C 1 277 ? -56.796 52.003 57.637 1.00 36.69 ? 307  GLN C CD   1 
ATOM   7435 O  OE1  . GLN C 1 277 ? -56.947 53.209 57.809 1.00 42.08 ? 307  GLN C OE1  1 
ATOM   7436 N  NE2  . GLN C 1 277 ? -57.620 51.280 56.891 1.00 37.97 ? 307  GLN C NE2  1 
ATOM   7437 N  N    . GLN C 1 278 ? -52.965 48.169 56.130 1.00 32.06 ? 308  GLN C N    1 
ATOM   7438 C  CA   . GLN C 1 278 ? -52.743 47.070 55.194 1.00 32.04 ? 308  GLN C CA   1 
ATOM   7439 C  C    . GLN C 1 278 ? -52.415 45.735 55.842 1.00 33.97 ? 308  GLN C C    1 
ATOM   7440 O  O    . GLN C 1 278 ? -52.692 44.688 55.258 1.00 35.44 ? 308  GLN C O    1 
ATOM   7441 C  CB   . GLN C 1 278 ? -51.677 47.439 54.157 1.00 32.52 ? 308  GLN C CB   1 
ATOM   7442 C  CG   . GLN C 1 278 ? -52.055 48.641 53.296 1.00 37.54 ? 308  GLN C CG   1 
ATOM   7443 C  CD   . GLN C 1 278 ? -53.443 48.507 52.688 1.00 42.69 ? 308  GLN C CD   1 
ATOM   7444 O  OE1  . GLN C 1 278 ? -53.771 47.489 52.073 1.00 44.70 ? 308  GLN C OE1  1 
ATOM   7445 N  NE2  . GLN C 1 278 ? -54.266 49.535 52.858 1.00 39.57 ? 308  GLN C NE2  1 
ATOM   7446 N  N    . VAL C 1 279 ? -51.876 45.762 57.061 1.00 31.02 ? 309  VAL C N    1 
ATOM   7447 C  CA   . VAL C 1 279 ? -51.539 44.526 57.762 1.00 27.44 ? 309  VAL C CA   1 
ATOM   7448 C  C    . VAL C 1 279 ? -52.772 43.646 57.925 1.00 26.99 ? 309  VAL C C    1 
ATOM   7449 O  O    . VAL C 1 279 ? -52.689 42.421 57.849 1.00 25.18 ? 309  VAL C O    1 
ATOM   7450 C  CB   . VAL C 1 279 ? -50.902 44.807 59.138 1.00 26.39 ? 309  VAL C CB   1 
ATOM   7451 C  CG1  . VAL C 1 279 ? -50.848 43.530 59.985 1.00 18.67 ? 309  VAL C CG1  1 
ATOM   7452 C  CG2  . VAL C 1 279 ? -49.498 45.339 58.941 1.00 22.97 ? 309  VAL C CG2  1 
ATOM   7453 N  N    . PHE C 1 280 ? -53.921 44.287 58.095 1.00 29.05 ? 310  PHE C N    1 
ATOM   7454 C  CA   . PHE C 1 280 ? -55.179 43.573 58.270 1.00 30.90 ? 310  PHE C CA   1 
ATOM   7455 C  C    . PHE C 1 280 ? -55.933 43.392 56.951 1.00 33.55 ? 310  PHE C C    1 
ATOM   7456 O  O    . PHE C 1 280 ? -57.011 42.805 56.920 1.00 33.39 ? 310  PHE C O    1 
ATOM   7457 C  CB   . PHE C 1 280 ? -56.028 44.297 59.318 1.00 26.84 ? 310  PHE C CB   1 
ATOM   7458 C  CG   . PHE C 1 280 ? -55.293 44.534 60.612 1.00 24.19 ? 310  PHE C CG   1 
ATOM   7459 C  CD1  . PHE C 1 280 ? -55.174 43.515 61.556 1.00 17.66 ? 310  PHE C CD1  1 
ATOM   7460 C  CD2  . PHE C 1 280 ? -54.652 45.748 60.847 1.00 19.66 ? 310  PHE C CD2  1 
ATOM   7461 C  CE1  . PHE C 1 280 ? -54.423 43.696 62.705 1.00 18.34 ? 310  PHE C CE1  1 
ATOM   7462 C  CE2  . PHE C 1 280 ? -53.895 45.942 61.996 1.00 20.63 ? 310  PHE C CE2  1 
ATOM   7463 C  CZ   . PHE C 1 280 ? -53.779 44.913 62.929 1.00 20.26 ? 310  PHE C CZ   1 
ATOM   7464 N  N    . LYS C 1 281 ? -55.346 43.884 55.863 1.00 37.40 ? 311  LYS C N    1 
ATOM   7465 C  CA   . LYS C 1 281 ? -55.936 43.761 54.534 1.00 40.19 ? 311  LYS C CA   1 
ATOM   7466 C  C    . LYS C 1 281 ? -55.158 42.746 53.698 1.00 41.26 ? 311  LYS C C    1 
ATOM   7467 O  O    . LYS C 1 281 ? -55.701 42.151 52.766 1.00 44.92 ? 311  LYS C O    1 
ATOM   7468 C  CB   . LYS C 1 281 ? -55.936 45.110 53.826 1.00 41.70 ? 311  LYS C CB   1 
ATOM   7469 C  CG   . LYS C 1 281 ? -56.799 46.163 54.486 1.00 44.16 ? 311  LYS C CG   1 
ATOM   7470 C  CD   . LYS C 1 281 ? -58.150 46.261 53.816 1.00 50.86 ? 311  LYS C CD   1 
ATOM   7471 C  CE   . LYS C 1 281 ? -58.875 47.527 54.277 1.00 58.94 ? 311  LYS C CE   1 
ATOM   7472 N  NZ   . LYS C 1 281 ? -60.214 47.673 53.654 1.00 66.07 ? 311  LYS C NZ   1 
ATOM   7473 N  N    . GLY C 1 282 ? -53.892 42.540 54.045 1.00 41.40 ? 312  GLY C N    1 
ATOM   7474 C  CA   . GLY C 1 282 ? -53.066 41.597 53.320 1.00 40.84 ? 312  GLY C CA   1 
ATOM   7475 C  C    . GLY C 1 282 ? -51.597 41.772 53.638 1.00 42.90 ? 312  GLY C C    1 
ATOM   7476 O  O    . GLY C 1 282 ? -51.239 42.246 54.718 1.00 40.92 ? 312  GLY C O    1 
ATOM   7477 N  N    . ALA C 1 283 ? -50.744 41.347 52.713 1.00 46.54 ? 313  ALA C N    1 
ATOM   7478 C  CA   . ALA C 1 283 ? -49.301 41.474 52.881 1.00 50.43 ? 313  ALA C CA   1 
ATOM   7479 C  C    . ALA C 1 283 ? -48.857 42.738 52.154 1.00 53.12 ? 313  ALA C C    1 
ATOM   7480 O  O    . ALA C 1 283 ? -49.478 43.140 51.164 1.00 55.93 ? 313  ALA C O    1 
ATOM   7481 C  CB   . ALA C 1 283 ? -48.593 40.258 52.311 1.00 51.04 ? 313  ALA C CB   1 
ATOM   7482 N  N    . VAL C 1 284 ? -47.793 43.363 52.641 1.00 54.34 ? 314  VAL C N    1 
ATOM   7483 C  CA   . VAL C 1 284 ? -47.295 44.587 52.028 1.00 56.10 ? 314  VAL C CA   1 
ATOM   7484 C  C    . VAL C 1 284 ? -45.793 44.772 52.234 1.00 55.67 ? 314  VAL C C    1 
ATOM   7485 O  O    . VAL C 1 284 ? -45.147 43.876 52.822 1.00 54.25 ? 314  VAL C O    1 
ATOM   7486 C  CB   . VAL C 1 284 ? -48.058 45.788 52.578 1.00 58.30 ? 314  VAL C CB   1 
ATOM   7487 N  N    . ALA C 1 298 ? -25.184 46.377 55.138 1.00 26.51 ? 328  ALA C N    1 
ATOM   7488 C  CA   . ALA C 1 298 ? -25.296 45.681 56.454 1.00 26.12 ? 328  ALA C CA   1 
ATOM   7489 C  C    . ALA C 1 298 ? -24.201 44.631 56.584 1.00 23.40 ? 328  ALA C C    1 
ATOM   7490 O  O    . ALA C 1 298 ? -24.474 43.482 56.914 1.00 22.89 ? 328  ALA C O    1 
ATOM   7491 C  CB   . ALA C 1 298 ? -26.678 45.029 56.600 1.00 24.33 ? 328  ALA C CB   1 
ATOM   7492 N  N    . THR C 1 299 ? -22.962 45.046 56.337 1.00 22.36 ? 329  THR C N    1 
ATOM   7493 C  CA   . THR C 1 299 ? -21.822 44.148 56.405 1.00 20.58 ? 329  THR C CA   1 
ATOM   7494 C  C    . THR C 1 299 ? -20.754 44.607 57.393 1.00 21.27 ? 329  THR C C    1 
ATOM   7495 O  O    . THR C 1 299 ? -19.662 44.041 57.448 1.00 18.31 ? 329  THR C O    1 
ATOM   7496 C  CB   . THR C 1 299 ? -21.199 43.979 55.021 1.00 23.12 ? 329  THR C CB   1 
ATOM   7497 O  OG1  . THR C 1 299 ? -20.955 45.275 54.454 1.00 20.72 ? 329  THR C OG1  1 
ATOM   7498 C  CG2  . THR C 1 299 ? -22.140 43.181 54.118 1.00 21.45 ? 329  THR C CG2  1 
ATOM   7499 N  N    . ASN C 1 300 ? -21.041 45.687 58.106 1.00 20.51 ? 330  ASN C N    1 
ATOM   7500 C  CA   . ASN C 1 300 ? -20.131 46.202 59.117 1.00 22.53 ? 330  ASN C CA   1 
ATOM   7501 C  C    . ASN C 1 300 ? -21.040 46.798 60.178 1.00 22.75 ? 330  ASN C C    1 
ATOM   7502 O  O    . ASN C 1 300 ? -22.097 47.341 59.851 1.00 24.54 ? 330  ASN C O    1 
ATOM   7503 C  CB   . ASN C 1 300 ? -19.094 47.203 58.549 1.00 24.42 ? 330  ASN C CB   1 
ATOM   7504 C  CG   . ASN C 1 300 ? -19.708 48.502 58.046 1.00 27.39 ? 330  ASN C CG   1 
ATOM   7505 O  OD1  . ASN C 1 300 ? -19.963 49.429 58.817 1.00 21.63 ? 330  ASN C OD1  1 
ATOM   7506 N  ND2  . ASN C 1 300 ? -19.891 48.594 56.740 1.00 27.52 ? 330  ASN C ND2  1 
ATOM   7507 N  N    . MET C 1 301 ? -20.667 46.630 61.443 1.00 19.04 ? 331  MET C N    1 
ATOM   7508 C  CA   . MET C 1 301 ? -21.496 47.085 62.551 1.00 17.35 ? 331  MET C CA   1 
ATOM   7509 C  C    . MET C 1 301 ? -21.939 48.557 62.549 1.00 15.17 ? 331  MET C C    1 
ATOM   7510 O  O    . MET C 1 301 ? -23.125 48.843 62.748 1.00 16.40 ? 331  MET C O    1 
ATOM   7511 C  CB   . MET C 1 301 ? -20.878 46.668 63.889 1.00 17.29 ? 331  MET C CB   1 
ATOM   7512 C  CG   . MET C 1 301 ? -21.870 46.636 65.035 1.00 19.26 ? 331  MET C CG   1 
ATOM   7513 S  SD   . MET C 1 301 ? -23.221 45.495 64.698 1.00 17.47 ? 331  MET C SD   1 
ATOM   7514 C  CE   . MET C 1 301 ? -24.621 46.316 65.407 1.00 12.54 ? 331  MET C CE   1 
ATOM   7515 N  N    . PRO C 1 302 ? -21.020 49.508 62.311 1.00 15.28 ? 332  PRO C N    1 
ATOM   7516 C  CA   . PRO C 1 302 ? -21.440 50.914 62.302 1.00 14.45 ? 332  PRO C CA   1 
ATOM   7517 C  C    . PRO C 1 302 ? -22.534 51.182 61.250 1.00 16.51 ? 332  PRO C C    1 
ATOM   7518 O  O    . PRO C 1 302 ? -23.420 52.020 61.453 1.00 14.05 ? 332  PRO C O    1 
ATOM   7519 C  CB   . PRO C 1 302 ? -20.146 51.650 61.983 1.00 14.85 ? 332  PRO C CB   1 
ATOM   7520 C  CG   . PRO C 1 302 ? -19.107 50.779 62.647 1.00 13.38 ? 332  PRO C CG   1 
ATOM   7521 C  CD   . PRO C 1 302 ? -19.547 49.405 62.211 1.00 13.23 ? 332  PRO C CD   1 
ATOM   7522 N  N    . ALA C 1 303 ? -22.471 50.463 60.133 1.00 17.18 ? 333  ALA C N    1 
ATOM   7523 C  CA   . ALA C 1 303 ? -23.467 50.615 59.077 1.00 15.80 ? 333  ALA C CA   1 
ATOM   7524 C  C    . ALA C 1 303 ? -24.785 49.983 59.523 1.00 16.92 ? 333  ALA C C    1 
ATOM   7525 O  O    . ALA C 1 303 ? -25.856 50.546 59.306 1.00 15.89 ? 333  ALA C O    1 
ATOM   7526 C  CB   . ALA C 1 303 ? -22.982 49.967 57.795 1.00 17.06 ? 333  ALA C CB   1 
ATOM   7527 N  N    . VAL C 1 304 ? -24.704 48.822 60.169 1.00 17.06 ? 334  VAL C N    1 
ATOM   7528 C  CA   . VAL C 1 304 ? -25.902 48.135 60.653 1.00 17.40 ? 334  VAL C CA   1 
ATOM   7529 C  C    . VAL C 1 304 ? -26.646 48.979 61.694 1.00 13.37 ? 334  VAL C C    1 
ATOM   7530 O  O    . VAL C 1 304 ? -27.874 49.077 61.650 1.00 12.48 ? 334  VAL C O    1 
ATOM   7531 C  CB   . VAL C 1 304 ? -25.573 46.728 61.235 1.00 15.86 ? 334  VAL C CB   1 
ATOM   7532 C  CG1  . VAL C 1 304 ? -26.810 46.102 61.840 1.00 13.56 ? 334  VAL C CG1  1 
ATOM   7533 C  CG2  . VAL C 1 304 ? -25.067 45.822 60.129 1.00 17.52 ? 334  VAL C CG2  1 
ATOM   7534 N  N    . LYS C 1 305 ? -25.903 49.599 62.610 1.00 12.55 ? 335  LYS C N    1 
ATOM   7535 C  CA   . LYS C 1 305 ? -26.500 50.443 63.644 1.00 10.70 ? 335  LYS C CA   1 
ATOM   7536 C  C    . LYS C 1 305 ? -27.252 51.570 62.974 1.00 11.15 ? 335  LYS C C    1 
ATOM   7537 O  O    . LYS C 1 305 ? -28.428 51.790 63.249 1.00 12.74 ? 335  LYS C O    1 
ATOM   7538 C  CB   . LYS C 1 305 ? -25.428 51.054 64.542 1.00 10.53 ? 335  LYS C CB   1 
ATOM   7539 C  CG   . LYS C 1 305 ? -24.756 50.095 65.476 1.00 17.24 ? 335  LYS C CG   1 
ATOM   7540 C  CD   . LYS C 1 305 ? -23.717 50.828 66.293 1.00 16.65 ? 335  LYS C CD   1 
ATOM   7541 C  CE   . LYS C 1 305 ? -23.284 50.009 67.501 1.00 17.25 ? 335  LYS C CE   1 
ATOM   7542 N  NZ   . LYS C 1 305 ? -22.372 50.794 68.366 1.00 17.32 ? 335  LYS C NZ   1 
ATOM   7543 N  N    . ALA C 1 306 ? -26.560 52.274 62.081 1.00 13.60 ? 336  ALA C N    1 
ATOM   7544 C  CA   . ALA C 1 306 ? -27.143 53.389 61.350 1.00 10.01 ? 336  ALA C CA   1 
ATOM   7545 C  C    . ALA C 1 306 ? -28.430 52.985 60.654 1.00 10.90 ? 336  ALA C C    1 
ATOM   7546 O  O    . ALA C 1 306 ? -29.425 53.708 60.726 1.00 12.61 ? 336  ALA C O    1 
ATOM   7547 C  CB   . ALA C 1 306 ? -26.149 53.918 60.333 1.00 8.88  ? 336  ALA C CB   1 
ATOM   7548 N  N    . ILE C 1 307 ? -28.407 51.834 59.974 1.00 13.91 ? 337  ILE C N    1 
ATOM   7549 C  CA   . ILE C 1 307 ? -29.577 51.329 59.250 1.00 9.78  ? 337  ILE C CA   1 
ATOM   7550 C  C    . ILE C 1 307 ? -30.732 51.132 60.219 1.00 10.39 ? 337  ILE C C    1 
ATOM   7551 O  O    . ILE C 1 307 ? -31.850 51.563 59.953 1.00 14.12 ? 337  ILE C O    1 
ATOM   7552 C  CB   . ILE C 1 307 ? -29.294 49.959 58.550 1.00 15.16 ? 337  ILE C CB   1 
ATOM   7553 C  CG1  . ILE C 1 307 ? -28.106 50.053 57.585 1.00 17.61 ? 337  ILE C CG1  1 
ATOM   7554 C  CG2  . ILE C 1 307 ? -30.533 49.464 57.836 1.00 14.50 ? 337  ILE C CG2  1 
ATOM   7555 C  CD1  . ILE C 1 307 ? -28.129 51.250 56.656 1.00 25.08 ? 337  ILE C CD1  1 
ATOM   7556 N  N    . ILE C 1 308 ? -30.456 50.459 61.335 1.00 14.68 ? 338  ILE C N    1 
ATOM   7557 C  CA   . ILE C 1 308 ? -31.464 50.192 62.370 1.00 16.08 ? 338  ILE C CA   1 
ATOM   7558 C  C    . ILE C 1 308 ? -32.013 51.499 62.933 1.00 13.33 ? 338  ILE C C    1 
ATOM   7559 O  O    . ILE C 1 308 ? -33.236 51.691 63.007 1.00 11.16 ? 338  ILE C O    1 
ATOM   7560 C  CB   . ILE C 1 308 ? -30.878 49.353 63.541 1.00 19.27 ? 338  ILE C CB   1 
ATOM   7561 C  CG1  . ILE C 1 308 ? -30.443 47.974 63.039 1.00 18.83 ? 338  ILE C CG1  1 
ATOM   7562 C  CG2  . ILE C 1 308 ? -31.917 49.191 64.646 1.00 19.51 ? 338  ILE C CG2  1 
ATOM   7563 C  CD1  . ILE C 1 308 ? -29.666 47.158 64.068 1.00 19.13 ? 338  ILE C CD1  1 
ATOM   7564 N  N    . TYR C 1 309 ? -31.106 52.412 63.275 1.00 12.39 ? 339  TYR C N    1 
ATOM   7565 C  CA   . TYR C 1 309 ? -31.496 53.711 63.830 1.00 17.43 ? 339  TYR C CA   1 
ATOM   7566 C  C    . TYR C 1 309 ? -32.387 54.484 62.875 1.00 19.07 ? 339  TYR C C    1 
ATOM   7567 O  O    . TYR C 1 309 ? -33.357 55.121 63.300 1.00 20.59 ? 339  TYR C O    1 
ATOM   7568 C  CB   . TYR C 1 309 ? -30.266 54.558 64.182 1.00 15.22 ? 339  TYR C CB   1 
ATOM   7569 C  CG   . TYR C 1 309 ? -29.421 53.978 65.293 1.00 12.34 ? 339  TYR C CG   1 
ATOM   7570 C  CD1  . TYR C 1 309 ? -30.005 53.264 66.336 1.00 15.20 ? 339  TYR C CD1  1 
ATOM   7571 C  CD2  . TYR C 1 309 ? -28.041 54.156 65.310 1.00 12.70 ? 339  TYR C CD2  1 
ATOM   7572 C  CE1  . TYR C 1 309 ? -29.239 52.749 67.370 1.00 13.07 ? 339  TYR C CE1  1 
ATOM   7573 C  CE2  . TYR C 1 309 ? -27.259 53.637 66.341 1.00 13.71 ? 339  TYR C CE2  1 
ATOM   7574 C  CZ   . TYR C 1 309 ? -27.867 52.938 67.368 1.00 16.07 ? 339  TYR C CZ   1 
ATOM   7575 O  OH   . TYR C 1 309 ? -27.120 52.437 68.409 1.00 16.48 ? 339  TYR C OH   1 
ATOM   7576 N  N    . GLN C 1 310 ? -32.082 54.410 61.582 1.00 19.19 ? 340  GLN C N    1 
ATOM   7577 C  CA   . GLN C 1 310 ? -32.886 55.130 60.612 1.00 18.62 ? 340  GLN C CA   1 
ATOM   7578 C  C    . GLN C 1 310 ? -34.283 54.533 60.537 1.00 16.27 ? 340  GLN C C    1 
ATOM   7579 O  O    . GLN C 1 310 ? -35.265 55.265 60.416 1.00 15.12 ? 340  GLN C O    1 
ATOM   7580 C  CB   . GLN C 1 310 ? -32.201 55.174 59.244 1.00 23.33 ? 340  GLN C CB   1 
ATOM   7581 C  CG   . GLN C 1 310 ? -32.904 56.085 58.236 1.00 37.81 ? 340  GLN C CG   1 
ATOM   7582 C  CD   . GLN C 1 310 ? -33.269 57.457 58.817 1.00 47.99 ? 340  GLN C CD   1 
ATOM   7583 O  OE1  . GLN C 1 310 ? -32.436 58.135 59.424 1.00 46.05 ? 340  GLN C OE1  1 
ATOM   7584 N  NE2  . GLN C 1 310 ? -34.525 57.865 58.631 1.00 50.00 ? 340  GLN C NE2  1 
ATOM   7585 N  N    . TYR C 1 311 ? -34.392 53.216 60.677 1.00 15.39 ? 341  TYR C N    1 
ATOM   7586 C  CA   . TYR C 1 311 ? -35.713 52.589 60.642 1.00 18.98 ? 341  TYR C CA   1 
ATOM   7587 C  C    . TYR C 1 311 ? -36.525 52.966 61.874 1.00 16.33 ? 341  TYR C C    1 
ATOM   7588 O  O    . TYR C 1 311 ? -37.747 53.116 61.807 1.00 13.31 ? 341  TYR C O    1 
ATOM   7589 C  CB   . TYR C 1 311 ? -35.613 51.068 60.486 1.00 20.86 ? 341  TYR C CB   1 
ATOM   7590 C  CG   . TYR C 1 311 ? -35.469 50.636 59.047 1.00 18.28 ? 341  TYR C CG   1 
ATOM   7591 C  CD1  . TYR C 1 311 ? -36.450 50.944 58.109 1.00 18.24 ? 341  TYR C CD1  1 
ATOM   7592 C  CD2  . TYR C 1 311 ? -34.352 49.927 58.625 1.00 21.99 ? 341  TYR C CD2  1 
ATOM   7593 C  CE1  . TYR C 1 311 ? -36.318 50.553 56.777 1.00 22.16 ? 341  TYR C CE1  1 
ATOM   7594 C  CE2  . TYR C 1 311 ? -34.209 49.532 57.304 1.00 23.77 ? 341  TYR C CE2  1 
ATOM   7595 C  CZ   . TYR C 1 311 ? -35.197 49.845 56.385 1.00 22.66 ? 341  TYR C CZ   1 
ATOM   7596 O  OH   . TYR C 1 311 ? -35.061 49.436 55.079 1.00 28.49 ? 341  TYR C OH   1 
ATOM   7597 N  N    . MET C 1 312 ? -35.832 53.147 62.993 1.00 18.81 ? 342  MET C N    1 
ATOM   7598 C  CA   . MET C 1 312 ? -36.470 53.552 64.247 1.00 21.75 ? 342  MET C CA   1 
ATOM   7599 C  C    . MET C 1 312 ? -37.105 54.922 64.046 1.00 18.24 ? 342  MET C C    1 
ATOM   7600 O  O    . MET C 1 312 ? -38.231 55.184 64.483 1.00 16.39 ? 342  MET C O    1 
ATOM   7601 C  CB   . MET C 1 312 ? -35.431 53.644 65.366 1.00 24.16 ? 342  MET C CB   1 
ATOM   7602 C  CG   . MET C 1 312 ? -35.752 52.809 66.568 1.00 33.70 ? 342  MET C CG   1 
ATOM   7603 S  SD   . MET C 1 312 ? -35.449 51.084 66.241 1.00 47.43 ? 342  MET C SD   1 
ATOM   7604 C  CE   . MET C 1 312 ? -36.936 50.599 65.393 1.00 45.12 ? 342  MET C CE   1 
ATOM   7605 N  N    . GLU C 1 313 ? -36.374 55.796 63.367 1.00 15.87 ? 343  GLU C N    1 
ATOM   7606 C  CA   . GLU C 1 313 ? -36.872 57.129 63.106 1.00 19.22 ? 343  GLU C CA   1 
ATOM   7607 C  C    . GLU C 1 313 ? -38.084 57.119 62.176 1.00 21.90 ? 343  GLU C C    1 
ATOM   7608 O  O    . GLU C 1 313 ? -38.953 57.990 62.274 1.00 23.60 ? 343  GLU C O    1 
ATOM   7609 C  CB   . GLU C 1 313 ? -35.748 58.023 62.603 1.00 19.39 ? 343  GLU C CB   1 
ATOM   7610 C  CG   . GLU C 1 313 ? -34.642 58.208 63.657 1.00 23.19 ? 343  GLU C CG   1 
ATOM   7611 C  CD   . GLU C 1 313 ? -35.194 58.519 65.052 1.00 22.27 ? 343  GLU C CD   1 
ATOM   7612 O  OE1  . GLU C 1 313 ? -36.011 59.456 65.189 1.00 18.25 ? 343  GLU C OE1  1 
ATOM   7613 O  OE2  . GLU C 1 313 ? -34.823 57.808 66.007 1.00 20.91 ? 343  GLU C OE2  1 
ATOM   7614 N  N    . GLU C 1 314 ? -38.171 56.103 61.319 1.00 21.03 ? 344  GLU C N    1 
ATOM   7615 C  CA   . GLU C 1 314 ? -39.311 55.965 60.420 1.00 21.40 ? 344  GLU C CA   1 
ATOM   7616 C  C    . GLU C 1 314 ? -40.550 55.754 61.295 1.00 16.24 ? 344  GLU C C    1 
ATOM   7617 O  O    . GLU C 1 314 ? -41.576 56.403 61.104 1.00 16.53 ? 344  GLU C O    1 
ATOM   7618 C  CB   . GLU C 1 314 ? -39.122 54.770 59.477 1.00 27.37 ? 344  GLU C CB   1 
ATOM   7619 C  CG   . GLU C 1 314 ? -40.151 54.711 58.336 1.00 45.41 ? 344  GLU C CG   1 
ATOM   7620 C  CD   . GLU C 1 314 ? -40.056 53.448 57.478 1.00 52.82 ? 344  GLU C CD   1 
ATOM   7621 O  OE1  . GLU C 1 314 ? -38.955 52.857 57.387 1.00 57.65 ? 344  GLU C OE1  1 
ATOM   7622 O  OE2  . GLU C 1 314 ? -41.091 53.047 56.890 1.00 55.61 ? 344  GLU C OE2  1 
ATOM   7623 N  N    . ILE C 1 315 ? -40.423 54.877 62.288 1.00 15.42 ? 345  ILE C N    1 
ATOM   7624 C  CA   . ILE C 1 315 ? -41.512 54.584 63.217 1.00 14.48 ? 345  ILE C CA   1 
ATOM   7625 C  C    . ILE C 1 315 ? -41.838 55.811 64.063 1.00 13.41 ? 345  ILE C C    1 
ATOM   7626 O  O    . ILE C 1 315 ? -43.006 56.189 64.195 1.00 11.02 ? 345  ILE C O    1 
ATOM   7627 C  CB   . ILE C 1 315 ? -41.161 53.381 64.166 1.00 17.50 ? 345  ILE C CB   1 
ATOM   7628 C  CG1  . ILE C 1 315 ? -41.130 52.068 63.363 1.00 18.48 ? 345  ILE C CG1  1 
ATOM   7629 C  CG2  . ILE C 1 315 ? -42.175 53.280 65.321 1.00 10.25 ? 345  ILE C CG2  1 
ATOM   7630 C  CD1  . ILE C 1 315 ? -40.681 50.840 64.163 1.00 17.17 ? 345  ILE C CD1  1 
ATOM   7631 N  N    . TYR C 1 316 ? -40.800 56.451 64.596 1.00 14.13 ? 346  TYR C N    1 
ATOM   7632 C  CA   . TYR C 1 316 ? -40.976 57.633 65.439 1.00 20.20 ? 346  TYR C CA   1 
ATOM   7633 C  C    . TYR C 1 316 ? -41.871 58.697 64.802 1.00 20.63 ? 346  TYR C C    1 
ATOM   7634 O  O    . TYR C 1 316 ? -42.825 59.171 65.422 1.00 20.56 ? 346  TYR C O    1 
ATOM   7635 C  CB   . TYR C 1 316 ? -39.623 58.243 65.813 1.00 21.15 ? 346  TYR C CB   1 
ATOM   7636 C  CG   . TYR C 1 316 ? -39.714 59.266 66.928 1.00 24.77 ? 346  TYR C CG   1 
ATOM   7637 C  CD1  . TYR C 1 316 ? -39.683 58.866 68.270 1.00 24.84 ? 346  TYR C CD1  1 
ATOM   7638 C  CD2  . TYR C 1 316 ? -39.810 60.633 66.645 1.00 21.42 ? 346  TYR C CD2  1 
ATOM   7639 C  CE1  . TYR C 1 316 ? -39.737 59.800 69.304 1.00 25.62 ? 346  TYR C CE1  1 
ATOM   7640 C  CE2  . TYR C 1 316 ? -39.866 61.579 67.673 1.00 26.33 ? 346  TYR C CE2  1 
ATOM   7641 C  CZ   . TYR C 1 316 ? -39.825 61.154 68.999 1.00 28.24 ? 346  TYR C CZ   1 
ATOM   7642 O  OH   . TYR C 1 316 ? -39.839 62.080 70.018 1.00 30.58 ? 346  TYR C OH   1 
ATOM   7643 N  N    . HIS C 1 317 ? -41.574 59.049 63.557 1.00 20.81 ? 347  HIS C N    1 
ATOM   7644 C  CA   . HIS C 1 317 ? -42.354 60.048 62.846 1.00 18.01 ? 347  HIS C CA   1 
ATOM   7645 C  C    . HIS C 1 317 ? -43.803 59.626 62.606 1.00 16.29 ? 347  HIS C C    1 
ATOM   7646 O  O    . HIS C 1 317 ? -44.677 60.477 62.463 1.00 16.62 ? 347  HIS C O    1 
ATOM   7647 C  CB   . HIS C 1 317 ? -41.664 60.402 61.530 1.00 22.85 ? 347  HIS C CB   1 
ATOM   7648 C  CG   . HIS C 1 317 ? -40.328 61.042 61.714 1.00 27.61 ? 347  HIS C CG   1 
ATOM   7649 N  ND1  . HIS C 1 317 ? -39.157 60.478 61.251 1.00 32.97 ? 347  HIS C ND1  1 
ATOM   7650 C  CD2  . HIS C 1 317 ? -39.966 62.182 62.364 1.00 28.34 ? 347  HIS C CD2  1 
ATOM   7651 C  CE1  . HIS C 1 317 ? -38.133 61.230 61.607 1.00 33.07 ? 347  HIS C CE1  1 
ATOM   7652 N  NE2  . HIS C 1 317 ? -38.602 62.268 62.287 1.00 28.86 ? 347  HIS C NE2  1 
ATOM   7653 N  N    . ARG C 1 318 ? -44.064 58.322 62.596 1.00 16.05 ? 348  ARG C N    1 
ATOM   7654 C  CA   . ARG C 1 318 ? -45.412 57.815 62.369 1.00 19.51 ? 348  ARG C CA   1 
ATOM   7655 C  C    . ARG C 1 318 ? -46.273 57.689 63.618 1.00 19.01 ? 348  ARG C C    1 
ATOM   7656 O  O    . ARG C 1 318 ? -47.471 57.408 63.498 1.00 19.84 ? 348  ARG C O    1 
ATOM   7657 C  CB   . ARG C 1 318 ? -45.392 56.437 61.710 1.00 20.67 ? 348  ARG C CB   1 
ATOM   7658 C  CG   . ARG C 1 318 ? -45.105 56.384 60.226 1.00 29.47 ? 348  ARG C CG   1 
ATOM   7659 C  CD   . ARG C 1 318 ? -45.378 54.963 59.767 1.00 35.96 ? 348  ARG C CD   1 
ATOM   7660 N  NE   . ARG C 1 318 ? -44.747 54.623 58.500 1.00 46.09 ? 348  ARG C NE   1 
ATOM   7661 C  CZ   . ARG C 1 318 ? -44.849 53.430 57.915 1.00 51.68 ? 348  ARG C CZ   1 
ATOM   7662 N  NH1  . ARG C 1 318 ? -45.562 52.464 58.486 1.00 45.89 ? 348  ARG C NH1  1 
ATOM   7663 N  NH2  . ARG C 1 318 ? -44.234 53.198 56.760 1.00 56.37 ? 348  ARG C NH2  1 
ATOM   7664 N  N    . ILE C 1 319 ? -45.685 57.847 64.804 1.00 18.30 ? 349  ILE C N    1 
ATOM   7665 C  CA   . ILE C 1 319 ? -46.458 57.706 66.041 1.00 12.93 ? 349  ILE C CA   1 
ATOM   7666 C  C    . ILE C 1 319 ? -47.655 58.653 66.044 1.00 14.58 ? 349  ILE C C    1 
ATOM   7667 O  O    . ILE C 1 319 ? -47.498 59.876 66.026 1.00 16.64 ? 349  ILE C O    1 
ATOM   7668 C  CB   . ILE C 1 319 ? -45.597 57.929 67.293 1.00 13.84 ? 349  ILE C CB   1 
ATOM   7669 C  CG1  . ILE C 1 319 ? -44.431 56.935 67.313 1.00 7.49  ? 349  ILE C CG1  1 
ATOM   7670 C  CG2  . ILE C 1 319 ? -46.451 57.740 68.557 1.00 9.64  ? 349  ILE C CG2  1 
ATOM   7671 C  CD1  . ILE C 1 319 ? -43.450 57.177 68.454 1.00 5.67  ? 349  ILE C CD1  1 
ATOM   7672 N  N    . PRO C 1 320 ? -48.869 58.093 66.009 1.00 13.02 ? 350  PRO C N    1 
ATOM   7673 C  CA   . PRO C 1 320 ? -50.101 58.883 65.999 1.00 15.55 ? 350  PRO C CA   1 
ATOM   7674 C  C    . PRO C 1 320 ? -50.508 59.420 67.373 1.00 17.34 ? 350  PRO C C    1 
ATOM   7675 O  O    . PRO C 1 320 ? -50.138 58.851 68.412 1.00 20.74 ? 350  PRO C O    1 
ATOM   7676 C  CB   . PRO C 1 320 ? -51.126 57.888 65.460 1.00 11.42 ? 350  PRO C CB   1 
ATOM   7677 C  CG   . PRO C 1 320 ? -50.677 56.612 66.055 1.00 13.71 ? 350  PRO C CG   1 
ATOM   7678 C  CD   . PRO C 1 320 ? -49.168 56.650 65.923 1.00 13.99 ? 350  PRO C CD   1 
ATOM   7679 N  N    . ASP C 1 321 ? -51.237 60.530 67.382 1.00 13.15 ? 351  ASP C N    1 
ATOM   7680 C  CA   . ASP C 1 321 ? -51.714 61.099 68.639 1.00 14.48 ? 351  ASP C CA   1 
ATOM   7681 C  C    . ASP C 1 321 ? -52.837 60.196 69.095 1.00 12.96 ? 351  ASP C C    1 
ATOM   7682 O  O    . ASP C 1 321 ? -53.336 59.401 68.304 1.00 16.44 ? 351  ASP C O    1 
ATOM   7683 C  CB   . ASP C 1 321 ? -52.257 62.510 68.436 1.00 14.98 ? 351  ASP C CB   1 
ATOM   7684 C  CG   . ASP C 1 321 ? -51.159 63.551 68.292 1.00 19.97 ? 351  ASP C CG   1 
ATOM   7685 O  OD1  . ASP C 1 321 ? -50.070 63.381 68.884 1.00 21.29 ? 351  ASP C OD1  1 
ATOM   7686 O  OD2  . ASP C 1 321 ? -51.400 64.556 67.595 1.00 20.49 ? 351  ASP C OD2  1 
ATOM   7687 N  N    . SER C 1 322 ? -53.229 60.311 70.362 1.00 10.80 ? 352  SER C N    1 
ATOM   7688 C  CA   . SER C 1 322 ? -54.307 59.502 70.929 1.00 8.82  ? 352  SER C CA   1 
ATOM   7689 C  C    . SER C 1 322 ? -54.159 58.004 70.643 1.00 9.10  ? 352  SER C C    1 
ATOM   7690 O  O    . SER C 1 322 ? -55.128 57.323 70.324 1.00 10.05 ? 352  SER C O    1 
ATOM   7691 C  CB   . SER C 1 322 ? -55.671 60.012 70.451 1.00 10.15 ? 352  SER C CB   1 
ATOM   7692 O  OG   . SER C 1 322 ? -55.884 61.363 70.837 1.00 8.49  ? 352  SER C OG   1 
ATOM   7693 N  N    . ASP C 1 323 ? -52.938 57.508 70.803 1.00 12.10 ? 353  ASP C N    1 
ATOM   7694 C  CA   . ASP C 1 323 ? -52.615 56.107 70.590 1.00 13.34 ? 353  ASP C CA   1 
ATOM   7695 C  C    . ASP C 1 323 ? -52.192 55.535 71.942 1.00 13.84 ? 353  ASP C C    1 
ATOM   7696 O  O    . ASP C 1 323 ? -51.227 55.999 72.553 1.00 11.68 ? 353  ASP C O    1 
ATOM   7697 C  CB   . ASP C 1 323 ? -51.488 55.968 69.562 1.00 14.48 ? 353  ASP C CB   1 
ATOM   7698 C  CG   . ASP C 1 323 ? -51.022 54.525 69.395 1.00 18.61 ? 353  ASP C CG   1 
ATOM   7699 O  OD1  . ASP C 1 323 ? -51.689 53.757 68.660 1.00 15.82 ? 353  ASP C OD1  1 
ATOM   7700 O  OD2  . ASP C 1 323 ? -49.989 54.167 70.007 1.00 15.68 ? 353  ASP C OD2  1 
ATOM   7701 N  N    . PRO C 1 324 ? -52.859 54.465 72.386 1.00 14.89 ? 354  PRO C N    1 
ATOM   7702 C  CA   . PRO C 1 324 ? -52.557 53.839 73.674 1.00 14.68 ? 354  PRO C CA   1 
ATOM   7703 C  C    . PRO C 1 324 ? -51.113 53.516 74.023 1.00 15.33 ? 354  PRO C C    1 
ATOM   7704 O  O    . PRO C 1 324 ? -50.731 53.604 75.183 1.00 15.22 ? 354  PRO C O    1 
ATOM   7705 C  CB   . PRO C 1 324 ? -53.458 52.600 73.688 1.00 16.64 ? 354  PRO C CB   1 
ATOM   7706 C  CG   . PRO C 1 324 ? -53.757 52.352 72.239 1.00 22.22 ? 354  PRO C CG   1 
ATOM   7707 C  CD   . PRO C 1 324 ? -53.913 53.724 71.673 1.00 14.45 ? 354  PRO C CD   1 
ATOM   7708 N  N    . SER C 1 325 ? -50.297 53.158 73.041 1.00 14.98 ? 355  SER C N    1 
ATOM   7709 C  CA   . SER C 1 325 ? -48.920 52.813 73.345 1.00 12.04 ? 355  SER C CA   1 
ATOM   7710 C  C    . SER C 1 325 ? -47.882 53.855 72.931 1.00 12.81 ? 355  SER C C    1 
ATOM   7711 O  O    . SER C 1 325 ? -46.684 53.683 73.200 1.00 12.70 ? 355  SER C O    1 
ATOM   7712 C  CB   . SER C 1 325 ? -48.592 51.448 72.732 1.00 18.46 ? 355  SER C CB   1 
ATOM   7713 O  OG   . SER C 1 325 ? -49.022 51.382 71.382 1.00 27.60 ? 355  SER C OG   1 
ATOM   7714 N  N    . SER C 1 326 ? -48.342 54.968 72.362 1.00 12.88 ? 356  SER C N    1 
ATOM   7715 C  CA   . SER C 1 326 ? -47.443 56.030 71.889 1.00 17.85 ? 356  SER C CA   1 
ATOM   7716 C  C    . SER C 1 326 ? -46.318 56.387 72.859 1.00 17.42 ? 356  SER C C    1 
ATOM   7717 O  O    . SER C 1 326 ? -45.144 56.433 72.478 1.00 18.09 ? 356  SER C O    1 
ATOM   7718 C  CB   . SER C 1 326 ? -48.240 57.290 71.503 1.00 13.17 ? 356  SER C CB   1 
ATOM   7719 O  OG   . SER C 1 326 ? -49.144 57.690 72.526 1.00 16.45 ? 356  SER C OG   1 
ATOM   7720 N  N    . SER C 1 327 ? -46.675 56.569 74.123 1.00 18.77 ? 357  SER C N    1 
ATOM   7721 C  CA   . SER C 1 327 ? -45.704 56.930 75.139 1.00 20.76 ? 357  SER C CA   1 
ATOM   7722 C  C    . SER C 1 327 ? -44.637 55.847 75.312 1.00 18.02 ? 357  SER C C    1 
ATOM   7723 O  O    . SER C 1 327 ? -43.452 56.148 75.443 1.00 17.22 ? 357  SER C O    1 
ATOM   7724 C  CB   . SER C 1 327 ? -46.423 57.207 76.458 1.00 25.10 ? 357  SER C CB   1 
ATOM   7725 O  OG   . SER C 1 327 ? -45.557 57.840 77.386 1.00 39.73 ? 357  SER C OG   1 
ATOM   7726 N  N    . LYS C 1 328 ? -45.055 54.587 75.255 1.00 18.40 ? 358  LYS C N    1 
ATOM   7727 C  CA   . LYS C 1 328 ? -44.130 53.469 75.402 1.00 17.87 ? 358  LYS C CA   1 
ATOM   7728 C  C    . LYS C 1 328 ? -43.267 53.332 74.140 1.00 15.62 ? 358  LYS C C    1 
ATOM   7729 O  O    . LYS C 1 328 ? -42.088 52.969 74.222 1.00 13.99 ? 358  LYS C O    1 
ATOM   7730 C  CB   . LYS C 1 328 ? -44.886 52.162 75.666 1.00 21.56 ? 358  LYS C CB   1 
ATOM   7731 C  CG   . LYS C 1 328 ? -45.814 52.153 76.897 1.00 32.07 ? 358  LYS C CG   1 
ATOM   7732 C  CD   . LYS C 1 328 ? -47.224 52.649 76.567 1.00 41.13 ? 358  LYS C CD   1 
ATOM   7733 C  CE   . LYS C 1 328 ? -47.462 54.051 77.101 1.00 44.75 ? 358  LYS C CE   1 
ATOM   7734 N  NZ   . LYS C 1 328 ? -48.457 54.809 76.290 1.00 50.35 ? 358  LYS C NZ   1 
ATOM   7735 N  N    . THR C 1 329 ? -43.849 53.649 72.982 1.00 13.79 ? 359  THR C N    1 
ATOM   7736 C  CA   . THR C 1 329 ? -43.131 53.565 71.711 1.00 15.34 ? 359  THR C CA   1 
ATOM   7737 C  C    . THR C 1 329 ? -41.967 54.548 71.738 1.00 15.65 ? 359  THR C C    1 
ATOM   7738 O  O    . THR C 1 329 ? -40.823 54.209 71.396 1.00 13.76 ? 359  THR C O    1 
ATOM   7739 C  CB   . THR C 1 329 ? -44.055 53.870 70.500 1.00 15.50 ? 359  THR C CB   1 
ATOM   7740 O  OG1  . THR C 1 329 ? -45.278 53.128 70.625 1.00 15.99 ? 359  THR C OG1  1 
ATOM   7741 C  CG2  . THR C 1 329 ? -43.372 53.463 69.186 1.00 8.56  ? 359  THR C CG2  1 
ATOM   7742 N  N    . ARG C 1 330 ? -42.244 55.754 72.211 1.00 17.06 ? 360  ARG C N    1 
ATOM   7743 C  CA   . ARG C 1 330 ? -41.204 56.763 72.296 1.00 19.06 ? 360  ARG C CA   1 
ATOM   7744 C  C    . ARG C 1 330 ? -40.150 56.414 73.323 1.00 16.86 ? 360  ARG C C    1 
ATOM   7745 O  O    . ARG C 1 330 ? -38.972 56.678 73.110 1.00 19.49 ? 360  ARG C O    1 
ATOM   7746 C  CB   . ARG C 1 330 ? -41.799 58.125 72.627 1.00 21.41 ? 360  ARG C CB   1 
ATOM   7747 C  CG   . ARG C 1 330 ? -42.571 58.700 71.496 1.00 25.18 ? 360  ARG C CG   1 
ATOM   7748 C  CD   . ARG C 1 330 ? -43.001 60.097 71.792 1.00 31.42 ? 360  ARG C CD   1 
ATOM   7749 N  NE   . ARG C 1 330 ? -44.433 60.209 71.588 1.00 36.63 ? 360  ARG C NE   1 
ATOM   7750 C  CZ   . ARG C 1 330 ? -45.327 60.130 72.562 1.00 39.89 ? 360  ARG C CZ   1 
ATOM   7751 N  NH1  . ARG C 1 330 ? -44.936 59.946 73.817 1.00 40.89 ? 360  ARG C NH1  1 
ATOM   7752 N  NH2  . ARG C 1 330 ? -46.613 60.236 72.276 1.00 43.11 ? 360  ARG C NH2  1 
ATOM   7753 N  N    . GLN C 1 331 ? -40.575 55.831 74.438 1.00 16.74 ? 361  GLN C N    1 
ATOM   7754 C  CA   . GLN C 1 331 ? -39.658 55.465 75.503 1.00 16.17 ? 361  GLN C CA   1 
ATOM   7755 C  C    . GLN C 1 331 ? -38.621 54.449 75.041 1.00 10.36 ? 361  GLN C C    1 
ATOM   7756 O  O    . GLN C 1 331 ? -37.432 54.630 75.287 1.00 8.34  ? 361  GLN C O    1 
ATOM   7757 C  CB   . GLN C 1 331 ? -40.419 54.928 76.722 1.00 21.46 ? 361  GLN C CB   1 
ATOM   7758 C  CG   . GLN C 1 331 ? -39.888 55.470 78.046 1.00 35.72 ? 361  GLN C CG   1 
ATOM   7759 C  CD   . GLN C 1 331 ? -40.013 54.478 79.206 1.00 45.27 ? 361  GLN C CD   1 
ATOM   7760 O  OE1  . GLN C 1 331 ? -41.119 54.137 79.639 1.00 43.45 ? 361  GLN C OE1  1 
ATOM   7761 N  NE2  . GLN C 1 331 ? -38.870 54.021 79.719 1.00 45.04 ? 361  GLN C NE2  1 
ATOM   7762 N  N    . ILE C 1 332 ? -39.057 53.385 74.370 1.00 10.24 ? 362  ILE C N    1 
ATOM   7763 C  CA   . ILE C 1 332 ? -38.107 52.379 73.905 1.00 9.79  ? 362  ILE C CA   1 
ATOM   7764 C  C    . ILE C 1 332 ? -37.206 52.957 72.806 1.00 12.23 ? 362  ILE C C    1 
ATOM   7765 O  O    . ILE C 1 332 ? -35.985 52.759 72.824 1.00 10.36 ? 362  ILE C O    1 
ATOM   7766 C  CB   . ILE C 1 332 ? -38.811 51.029 73.480 1.00 11.04 ? 362  ILE C CB   1 
ATOM   7767 C  CG1  . ILE C 1 332 ? -37.767 49.992 73.039 1.00 9.07  ? 362  ILE C CG1  1 
ATOM   7768 C  CG2  . ILE C 1 332 ? -39.856 51.260 72.384 1.00 9.09  ? 362  ILE C CG2  1 
ATOM   7769 C  CD1  . ILE C 1 332 ? -36.769 49.612 74.106 1.00 3.92  ? 362  ILE C CD1  1 
ATOM   7770 N  N    . ILE C 1 333 ? -37.786 53.737 71.895 1.00 14.11 ? 363  ILE C N    1 
ATOM   7771 C  CA   . ILE C 1 333 ? -36.991 54.353 70.831 1.00 14.44 ? 363  ILE C CA   1 
ATOM   7772 C  C    . ILE C 1 333 ? -35.958 55.284 71.457 1.00 14.93 ? 363  ILE C C    1 
ATOM   7773 O  O    . ILE C 1 333 ? -34.793 55.270 71.075 1.00 15.69 ? 363  ILE C O    1 
ATOM   7774 C  CB   . ILE C 1 333 ? -37.886 55.130 69.813 1.00 16.52 ? 363  ILE C CB   1 
ATOM   7775 C  CG1  . ILE C 1 333 ? -38.696 54.130 68.977 1.00 12.87 ? 363  ILE C CG1  1 
ATOM   7776 C  CG2  . ILE C 1 333 ? -37.036 56.046 68.910 1.00 9.35  ? 363  ILE C CG2  1 
ATOM   7777 C  CD1  . ILE C 1 333 ? -39.669 54.767 68.011 1.00 16.54 ? 363  ILE C CD1  1 
ATOM   7778 N  N    . SER C 1 334 ? -36.376 56.049 72.461 1.00 13.25 ? 364  SER C N    1 
ATOM   7779 C  CA   . SER C 1 334 ? -35.471 56.958 73.135 1.00 13.35 ? 364  SER C CA   1 
ATOM   7780 C  C    . SER C 1 334 ? -34.338 56.148 73.740 1.00 13.45 ? 364  SER C C    1 
ATOM   7781 O  O    . SER C 1 334 ? -33.190 56.573 73.722 1.00 15.48 ? 364  SER C O    1 
ATOM   7782 C  CB   . SER C 1 334 ? -36.206 57.751 74.215 1.00 14.86 ? 364  SER C CB   1 
ATOM   7783 O  OG   . SER C 1 334 ? -35.295 58.489 75.012 1.00 15.79 ? 364  SER C OG   1 
ATOM   7784 N  N    . THR C 1 335 ? -34.653 54.960 74.242 1.00 16.26 ? 365  THR C N    1 
ATOM   7785 C  CA   . THR C 1 335 ? -33.633 54.101 74.815 1.00 12.83 ? 365  THR C CA   1 
ATOM   7786 C  C    . THR C 1 335 ? -32.670 53.635 73.727 1.00 13.32 ? 365  THR C C    1 
ATOM   7787 O  O    . THR C 1 335 ? -31.452 53.712 73.914 1.00 10.10 ? 365  THR C O    1 
ATOM   7788 C  CB   . THR C 1 335 ? -34.257 52.901 75.560 1.00 13.19 ? 365  THR C CB   1 
ATOM   7789 O  OG1  . THR C 1 335 ? -34.978 53.388 76.695 1.00 14.56 ? 365  THR C OG1  1 
ATOM   7790 C  CG2  . THR C 1 335 ? -33.185 51.958 76.060 1.00 16.51 ? 365  THR C CG2  1 
ATOM   7791 N  N    . ILE C 1 336 ? -33.206 53.236 72.570 1.00 15.69 ? 366  ILE C N    1 
ATOM   7792 C  CA   . ILE C 1 336 ? -32.376 52.759 71.448 1.00 17.17 ? 366  ILE C CA   1 
ATOM   7793 C  C    . ILE C 1 336 ? -31.467 53.859 70.911 1.00 18.12 ? 366  ILE C C    1 
ATOM   7794 O  O    . ILE C 1 336 ? -30.335 53.598 70.517 1.00 22.44 ? 366  ILE C O    1 
ATOM   7795 C  CB   . ILE C 1 336 ? -33.209 52.277 70.233 1.00 22.86 ? 366  ILE C CB   1 
ATOM   7796 C  CG1  . ILE C 1 336 ? -34.399 51.407 70.657 1.00 27.91 ? 366  ILE C CG1  1 
ATOM   7797 C  CG2  . ILE C 1 336 ? -32.316 51.519 69.270 1.00 14.30 ? 366  ILE C CG2  1 
ATOM   7798 C  CD1  . ILE C 1 336 ? -34.026 50.113 71.298 1.00 34.40 ? 366  ILE C CD1  1 
ATOM   7799 N  N    . ARG C 1 337 ? -31.979 55.082 70.865 1.00 16.54 ? 367  ARG C N    1 
ATOM   7800 C  CA   . ARG C 1 337 ? -31.203 56.211 70.363 1.00 15.84 ? 367  ARG C CA   1 
ATOM   7801 C  C    . ARG C 1 337 ? -29.993 56.519 71.228 1.00 16.99 ? 367  ARG C C    1 
ATOM   7802 O  O    . ARG C 1 337 ? -28.916 56.825 70.712 1.00 15.61 ? 367  ARG C O    1 
ATOM   7803 C  CB   . ARG C 1 337 ? -32.039 57.489 70.352 1.00 12.03 ? 367  ARG C CB   1 
ATOM   7804 C  CG   . ARG C 1 337 ? -33.146 57.587 69.343 1.00 11.84 ? 367  ARG C CG   1 
ATOM   7805 C  CD   . ARG C 1 337 ? -33.980 58.799 69.707 1.00 11.97 ? 367  ARG C CD   1 
ATOM   7806 N  NE   . ARG C 1 337 ? -34.964 59.147 68.694 1.00 15.01 ? 367  ARG C NE   1 
ATOM   7807 C  CZ   . ARG C 1 337 ? -35.891 60.081 68.853 1.00 13.61 ? 367  ARG C CZ   1 
ATOM   7808 N  NH1  . ARG C 1 337 ? -35.975 60.752 69.992 1.00 15.18 ? 367  ARG C NH1  1 
ATOM   7809 N  NH2  . ARG C 1 337 ? -36.692 60.393 67.847 1.00 17.45 ? 367  ARG C NH2  1 
ATOM   7810 N  N    . THR C 1 338 ? -30.188 56.515 72.545 1.00 17.21 ? 368  THR C N    1 
ATOM   7811 C  CA   . THR C 1 338 ? -29.104 56.885 73.452 1.00 17.68 ? 368  THR C CA   1 
ATOM   7812 C  C    . THR C 1 338 ? -28.237 55.784 74.044 1.00 16.98 ? 368  THR C C    1 
ATOM   7813 O  O    . THR C 1 338 ? -27.164 56.062 74.577 1.00 16.21 ? 368  THR C O    1 
ATOM   7814 C  CB   . THR C 1 338 ? -29.576 57.954 74.520 1.00 17.45 ? 368  THR C CB   1 
ATOM   7815 O  OG1  . THR C 1 338 ? -29.122 57.624 75.835 1.00 20.77 ? 368  THR C OG1  1 
ATOM   7816 C  CG2  . THR C 1 338 ? -31.044 58.111 74.516 1.00 2.00  ? 368  THR C CG2  1 
ATOM   7817 N  N    . GLN C 1 339 ? -28.646 54.538 73.841 1.00 18.14 ? 369  GLN C N    1 
ATOM   7818 C  CA   . GLN C 1 339 ? -27.899 53.403 74.346 1.00 24.36 ? 369  GLN C CA   1 
ATOM   7819 C  C    . GLN C 1 339 ? -26.498 53.316 73.733 1.00 29.88 ? 369  GLN C C    1 
ATOM   7820 O  O    . GLN C 1 339 ? -25.555 53.827 74.318 1.00 32.70 ? 369  GLN C O    1 
ATOM   7821 C  CB   . GLN C 1 339 ? -28.675 52.111 74.116 1.00 27.05 ? 369  GLN C CB   1 
ATOM   7822 C  CG   . GLN C 1 339 ? -28.131 50.909 74.880 1.00 38.04 ? 369  GLN C CG   1 
ATOM   7823 C  CD   . GLN C 1 339 ? -28.297 51.032 76.390 1.00 41.97 ? 369  GLN C CD   1 
ATOM   7824 O  OE1  . GLN C 1 339 ? -29.363 51.383 76.889 1.00 46.25 ? 369  GLN C OE1  1 
ATOM   7825 N  NE2  . GLN C 1 339 ? -27.236 50.747 77.119 1.00 40.39 ? 369  GLN C NE2  1 
ATOM   7826 N  N    . ASN C 1 340 ? -26.347 52.675 72.576 1.00 34.30 ? 370  ASN C N    1 
ATOM   7827 C  CA   . ASN C 1 340 ? -25.022 52.539 71.947 1.00 47.41 ? 370  ASN C CA   1 
ATOM   7828 C  C    . ASN C 1 340 ? -25.099 52.085 70.498 1.00 48.99 ? 370  ASN C C    1 
ATOM   7829 O  O    . ASN C 1 340 ? -25.678 51.005 70.252 1.00 53.18 ? 370  ASN C O    1 
ATOM   7830 C  CB   . ASN C 1 340 ? -24.127 51.550 72.710 1.00 47.68 ? 370  ASN C CB   1 
ATOM   7831 C  CG   . ASN C 1 340 ? -23.655 52.086 74.030 1.00 47.79 ? 370  ASN C CG   1 
ATOM   7832 O  OD1  . ASN C 1 340 ? -23.063 53.164 74.102 1.00 46.19 ? 370  ASN C OD1  1 
ATOM   7833 N  ND2  . ASN C 1 340 ? -23.970 51.370 75.096 1.00 55.58 ? 370  ASN C ND2  1 
ATOM   7834 O  OXT  . ASN C 1 340 ? -24.546 52.792 69.633 1.00 47.61 ? 370  ASN C OXT  1 
HETATM 7835 C  C1   . IN0 D 2 .   ? -9.825  43.323 32.429 1.00 26.63 ? 991  IN0 A C1   1 
HETATM 7836 C  C7   . IN0 D 2 .   ? -10.819 42.538 33.305 1.00 25.72 ? 991  IN0 A C7   1 
HETATM 7837 C  C17  . IN0 D 2 .   ? -10.233 41.857 34.551 1.00 21.94 ? 991  IN0 A C17  1 
HETATM 7838 C  C28  . IN0 D 2 .   ? -10.264 42.511 35.805 1.00 23.19 ? 991  IN0 A C28  1 
HETATM 7839 C  C27  . IN0 D 2 .   ? -9.756  41.876 36.952 1.00 25.31 ? 991  IN0 A C27  1 
HETATM 7840 C  C26  . IN0 D 2 .   ? -9.217  40.575 36.849 1.00 27.91 ? 991  IN0 A C26  1 
HETATM 7841 C  C16  . IN0 D 2 .   ? -9.182  39.911 35.606 1.00 25.78 ? 991  IN0 A C16  1 
HETATM 7842 C  C29  . IN0 D 2 .   ? -8.675  38.599 35.514 1.00 21.18 ? 991  IN0 A C29  1 
HETATM 7843 C  C30  . IN0 D 2 .   ? -8.663  37.934 34.277 1.00 20.69 ? 991  IN0 A C30  1 
HETATM 7844 C  C31  . IN0 D 2 .   ? -9.148  38.574 33.126 1.00 24.97 ? 991  IN0 A C31  1 
HETATM 7845 C  C33  . IN0 D 2 .   ? -9.655  39.877 33.212 1.00 25.51 ? 991  IN0 A C33  1 
HETATM 7846 C  C15  . IN0 D 2 .   ? -9.685  40.554 34.448 1.00 24.64 ? 991  IN0 A C15  1 
HETATM 7847 O  O6   . IN0 D 2 .   ? -11.965 43.353 33.639 1.00 25.55 ? 991  IN0 A O6   1 
HETATM 7848 C  C5   . IN0 D 2 .   ? -12.540 44.073 32.525 1.00 23.82 ? 991  IN0 A C5   1 
HETATM 7849 C  C14  . IN0 D 2 .   ? -13.954 44.568 32.938 1.00 27.56 ? 991  IN0 A C14  1 
HETATM 7850 C  C11  . IN0 D 2 .   ? -14.452 45.714 32.096 1.00 32.17 ? 991  IN0 A C11  1 
HETATM 7851 O  O58  . IN0 D 2 .   ? -13.684 46.603 31.771 1.00 32.76 ? 991  IN0 A O58  1 
HETATM 7852 N  N23  . IN0 D 2 .   ? -15.755 45.702 31.727 1.00 42.57 ? 991  IN0 A N23  1 
HETATM 7853 C  C38  . IN0 D 2 .   ? -16.295 46.788 30.900 1.00 51.62 ? 991  IN0 A C38  1 
HETATM 7854 C  C61  . IN0 D 2 .   ? -16.862 46.285 29.547 1.00 59.17 ? 991  IN0 A C61  1 
HETATM 7855 C  C62  . IN0 D 2 .   ? -17.630 47.378 28.831 1.00 67.11 ? 991  IN0 A C62  1 
HETATM 7856 O  O64  . IN0 D 2 .   ? -18.944 47.151 28.639 1.00 70.83 ? 991  IN0 A O64  1 
HETATM 7857 O  O63  . IN0 D 2 .   ? -17.087 48.414 28.452 1.00 69.40 ? 991  IN0 A O63  1 
HETATM 7858 C  C60  . IN0 D 2 .   ? -17.375 47.536 31.651 1.00 55.00 ? 991  IN0 A C60  1 
HETATM 7859 O  O66  . IN0 D 2 .   ? -18.333 46.837 32.285 1.00 58.14 ? 991  IN0 A O66  1 
HETATM 7860 O  O65  . IN0 D 2 .   ? -17.372 48.761 31.666 1.00 57.41 ? 991  IN0 A O65  1 
HETATM 7861 C  C4   . IN0 D 2 .   ? -12.558 43.229 31.256 1.00 24.82 ? 991  IN0 A C4   1 
HETATM 7862 O  O13  . IN0 D 2 .   ? -13.618 42.715 30.931 1.00 18.66 ? 991  IN0 A O13  1 
HETATM 7863 N  N3   . IN0 D 2 .   ? -11.387 43.076 30.543 1.00 25.42 ? 991  IN0 A N3   1 
HETATM 7864 C  C2   . IN0 D 2 .   ? -10.139 43.561 31.070 1.00 25.90 ? 991  IN0 A C2   1 
HETATM 7865 C  C8   . IN0 D 2 .   ? -9.230  44.248 30.251 1.00 21.71 ? 991  IN0 A C8   1 
HETATM 7866 C  C9   . IN0 D 2 .   ? -8.036  44.728 30.784 1.00 24.49 ? 991  IN0 A C9   1 
HETATM 7867 C  C20  . IN0 D 2 .   ? -7.731  44.524 32.144 1.00 22.96 ? 991  IN0 A C20  1 
HETATM 7868 CL CL36 . IN0 D 2 .   ? -6.249  45.149 32.800 1.00 23.81 ? 991  IN0 A CL36 1 
HETATM 7869 C  C21  . IN0 D 2 .   ? -8.621  43.812 32.964 1.00 25.93 ? 991  IN0 A C21  1 
HETATM 7870 C  C43  . IN0 D 2 .   ? -11.426 42.494 29.189 1.00 23.15 ? 991  IN0 A C43  1 
HETATM 7871 C  C10  . IN0 D 2 .   ? -11.142 40.971 28.998 1.00 26.44 ? 991  IN0 A C10  1 
HETATM 7872 C  C32  . IN0 D 2 .   ? -12.203 40.110 29.757 1.00 24.79 ? 991  IN0 A C32  1 
HETATM 7873 C  C25  . IN0 D 2 .   ? -11.194 40.586 27.485 1.00 21.08 ? 991  IN0 A C25  1 
HETATM 7874 C  C24  . IN0 D 2 .   ? -9.730  40.586 29.554 1.00 22.45 ? 991  IN0 A C24  1 
HETATM 7875 C  C1   . IN0 E 2 .   ? -21.940 68.136 59.821 1.00 17.05 ? 992  IN0 B C1   1 
HETATM 7876 C  C7   . IN0 E 2 .   ? -21.527 67.450 58.480 1.00 13.73 ? 992  IN0 B C7   1 
HETATM 7877 C  C17  . IN0 E 2 .   ? -20.199 66.668 58.494 1.00 12.02 ? 992  IN0 B C17  1 
HETATM 7878 C  C28  . IN0 E 2 .   ? -20.230 65.275 58.688 1.00 12.36 ? 992  IN0 B C28  1 
HETATM 7879 C  C27  . IN0 E 2 .   ? -19.050 64.524 58.698 1.00 10.34 ? 992  IN0 B C27  1 
HETATM 7880 C  C26  . IN0 E 2 .   ? -17.823 65.166 58.508 1.00 9.32  ? 992  IN0 B C26  1 
HETATM 7881 C  C16  . IN0 E 2 .   ? -17.766 66.552 58.302 1.00 7.87  ? 992  IN0 B C16  1 
HETATM 7882 C  C29  . IN0 E 2 .   ? -16.526 67.173 58.096 1.00 11.59 ? 992  IN0 B C29  1 
HETATM 7883 C  C30  . IN0 E 2 .   ? -16.457 68.558 57.900 1.00 9.33  ? 992  IN0 B C30  1 
HETATM 7884 C  C31  . IN0 E 2 .   ? -17.629 69.330 57.920 1.00 11.16 ? 992  IN0 B C31  1 
HETATM 7885 C  C33  . IN0 E 2 .   ? -18.869 68.715 58.119 1.00 12.66 ? 992  IN0 B C33  1 
HETATM 7886 C  C15  . IN0 E 2 .   ? -18.949 67.320 58.308 1.00 12.16 ? 992  IN0 B C15  1 
HETATM 7887 O  O6   . IN0 E 2 .   ? -22.585 66.591 58.001 1.00 16.21 ? 992  IN0 B O6   1 
HETATM 7888 C  C5   . IN0 E 2 .   ? -23.904 67.127 58.187 1.00 18.48 ? 992  IN0 B C5   1 
HETATM 7889 C  C14  . IN0 E 2 .   ? -24.930 66.201 57.501 1.00 22.16 ? 992  IN0 B C14  1 
HETATM 7890 C  C11  . IN0 E 2 .   ? -26.358 66.629 57.750 1.00 28.38 ? 992  IN0 B C11  1 
HETATM 7891 O  O58  . IN0 E 2 .   ? -26.663 67.113 58.821 1.00 30.61 ? 992  IN0 B O58  1 
HETATM 7892 N  N23  . IN0 E 2 .   ? -27.242 66.445 56.747 1.00 33.84 ? 992  IN0 B N23  1 
HETATM 7893 C  C38  . IN0 E 2 .   ? -28.642 66.868 56.880 1.00 43.59 ? 992  IN0 B C38  1 
HETATM 7894 C  C61  . IN0 E 2 .   ? -29.365 66.900 55.509 1.00 51.28 ? 992  IN0 B C61  1 
HETATM 7895 C  C62  . IN0 E 2 .   ? -28.635 66.054 54.494 1.00 55.67 ? 992  IN0 B C62  1 
HETATM 7896 O  O64  . IN0 E 2 .   ? -28.079 66.720 53.469 1.00 62.08 ? 992  IN0 B O64  1 
HETATM 7897 O  O63  . IN0 E 2 .   ? -28.547 64.833 54.606 1.00 58.16 ? 992  IN0 B O63  1 
HETATM 7898 C  C60  . IN0 E 2 .   ? -29.407 65.957 57.815 1.00 44.72 ? 992  IN0 B C60  1 
HETATM 7899 O  O66  . IN0 E 2 .   ? -29.693 64.709 57.414 1.00 47.88 ? 992  IN0 B O66  1 
HETATM 7900 O  O65  . IN0 E 2 .   ? -29.762 66.364 58.911 1.00 48.29 ? 992  IN0 B O65  1 
HETATM 7901 C  C4   . IN0 E 2 .   ? -23.979 68.572 57.720 1.00 19.77 ? 992  IN0 B C4   1 
HETATM 7902 O  O13  . IN0 E 2 .   ? -24.367 68.792 56.590 1.00 22.09 ? 992  IN0 B O13  1 
HETATM 7903 N  N3   . IN0 E 2 .   ? -23.583 69.543 58.597 1.00 19.34 ? 992  IN0 B N3   1 
HETATM 7904 C  C2   . IN0 E 2 .   ? -22.945 69.152 59.836 1.00 18.46 ? 992  IN0 B C2   1 
HETATM 7905 C  C8   . IN0 E 2 .   ? -23.309 69.756 61.060 1.00 18.07 ? 992  IN0 B C8   1 
HETATM 7906 C  C9   . IN0 E 2 .   ? -22.709 69.342 62.259 1.00 16.93 ? 992  IN0 B C9   1 
HETATM 7907 C  C20  . IN0 E 2 .   ? -21.742 68.324 62.257 1.00 17.54 ? 992  IN0 B C20  1 
HETATM 7908 CL CL36 . IN0 E 2 .   ? -21.029 67.784 63.760 1.00 17.49 ? 992  IN0 B CL36 1 
HETATM 7909 C  C21  . IN0 E 2 .   ? -21.352 67.730 61.038 1.00 17.79 ? 992  IN0 B C21  1 
HETATM 7910 C  C43  . IN0 E 2 .   ? -23.858 70.962 58.297 1.00 14.12 ? 992  IN0 B C43  1 
HETATM 7911 C  C10  . IN0 E 2 .   ? -22.686 71.914 57.842 1.00 17.39 ? 992  IN0 B C10  1 
HETATM 7912 C  C32  . IN0 E 2 .   ? -22.042 71.419 56.511 1.00 16.32 ? 992  IN0 B C32  1 
HETATM 7913 C  C25  . IN0 E 2 .   ? -23.188 73.371 57.619 1.00 12.65 ? 992  IN0 B C25  1 
HETATM 7914 C  C24  . IN0 E 2 .   ? -21.557 71.967 58.914 1.00 18.16 ? 992  IN0 B C24  1 
HETATM 7915 C  C1   . IN0 F 2 .   ? -33.056 31.356 60.860 1.00 25.70 ? 995  IN0 C C1   1 
HETATM 7916 C  C7   . IN0 F 2 .   ? -32.918 32.891 61.059 1.00 21.50 ? 995  IN0 C C7   1 
HETATM 7917 C  C17  . IN0 F 2 .   ? -31.656 33.359 61.786 1.00 21.46 ? 995  IN0 C C17  1 
HETATM 7918 C  C28  . IN0 F 2 .   ? -30.471 33.631 61.065 1.00 18.78 ? 995  IN0 C C28  1 
HETATM 7919 C  C27  . IN0 F 2 .   ? -29.316 34.073 61.736 1.00 15.08 ? 995  IN0 C C27  1 
HETATM 7920 C  C26  . IN0 F 2 .   ? -29.350 34.261 63.128 1.00 17.81 ? 995  IN0 C C26  1 
HETATM 7921 C  C16  . IN0 F 2 .   ? -30.537 34.008 63.851 1.00 19.36 ? 995  IN0 C C16  1 
HETATM 7922 C  C29  . IN0 F 2 .   ? -30.590 34.245 65.227 1.00 15.48 ? 995  IN0 C C29  1 
HETATM 7923 C  C30  . IN0 F 2 .   ? -31.770 33.995 65.941 1.00 14.90 ? 995  IN0 C C30  1 
HETATM 7924 C  C31  . IN0 F 2 .   ? -32.901 33.499 65.288 1.00 11.04 ? 995  IN0 C C31  1 
HETATM 7925 C  C33  . IN0 F 2 .   ? -32.860 33.271 63.918 1.00 17.10 ? 995  IN0 C C33  1 
HETATM 7926 C  C15  . IN0 F 2 .   ? -31.686 33.537 63.186 1.00 19.99 ? 995  IN0 C C15  1 
HETATM 7927 O  O6   . IN0 F 2 .   ? -33.067 33.610 59.818 1.00 24.82 ? 995  IN0 C O6   1 
HETATM 7928 C  C5   . IN0 F 2 .   ? -34.032 33.038 58.912 1.00 27.02 ? 995  IN0 C C5   1 
HETATM 7929 C  C14  . IN0 F 2 .   ? -34.156 33.971 57.687 1.00 27.86 ? 995  IN0 C C14  1 
HETATM 7930 C  C11  . IN0 F 2 .   ? -34.984 33.369 56.581 1.00 36.35 ? 995  IN0 C C11  1 
HETATM 7931 O  O58  . IN0 F 2 .   ? -35.085 32.147 56.485 1.00 37.70 ? 995  IN0 C O58  1 
HETATM 7932 N  N23  . IN0 F 2 .   ? -35.598 34.223 55.734 1.00 40.91 ? 995  IN0 C N23  1 
HETATM 7933 C  C38  . IN0 F 2 .   ? -36.406 33.694 54.643 1.00 48.84 ? 995  IN0 C C38  1 
HETATM 7934 C  C61  . IN0 F 2 .   ? -37.937 33.836 54.914 1.00 52.20 ? 995  IN0 C C61  1 
HETATM 7935 C  C62  . IN0 F 2 .   ? -38.578 34.967 54.150 1.00 55.57 ? 995  IN0 C C62  1 
HETATM 7936 O  O64  . IN0 F 2 .   ? -38.444 36.190 54.682 1.00 56.89 ? 995  IN0 C O64  1 
HETATM 7937 O  O63  . IN0 F 2 .   ? -39.189 34.775 53.105 1.00 60.35 ? 995  IN0 C O63  1 
HETATM 7938 C  C60  . IN0 F 2 .   ? -35.997 34.360 53.327 1.00 51.60 ? 995  IN0 C C60  1 
HETATM 7939 O  O66  . IN0 F 2 .   ? -35.963 35.707 53.247 1.00 51.60 ? 995  IN0 C O66  1 
HETATM 7940 O  O65  . IN0 F 2 .   ? -35.690 33.667 52.361 1.00 55.45 ? 995  IN0 C O65  1 
HETATM 7941 C  C4   . IN0 F 2 .   ? -35.373 32.749 59.602 1.00 27.60 ? 995  IN0 C C4   1 
HETATM 7942 O  O13  . IN0 F 2 .   ? -36.311 33.506 59.388 1.00 28.08 ? 995  IN0 C O13  1 
HETATM 7943 N  N3   . IN0 F 2 .   ? -35.453 31.653 60.428 1.00 27.77 ? 995  IN0 C N3   1 
HETATM 7944 C  C2   . IN0 F 2 .   ? -34.324 30.793 60.561 1.00 25.34 ? 995  IN0 C C2   1 
HETATM 7945 C  C8   . IN0 F 2 .   ? -34.463 29.414 60.414 1.00 25.39 ? 995  IN0 C C8   1 
HETATM 7946 C  C9   . IN0 F 2 .   ? -33.344 28.584 60.514 1.00 27.59 ? 995  IN0 C C9   1 
HETATM 7947 C  C20  . IN0 F 2 .   ? -32.078 29.127 60.767 1.00 25.33 ? 995  IN0 C C20  1 
HETATM 7948 CL CL36 . IN0 F 2 .   ? -30.690 28.082 60.843 1.00 24.95 ? 995  IN0 C CL36 1 
HETATM 7949 C  C21  . IN0 F 2 .   ? -31.933 30.514 60.956 1.00 24.81 ? 995  IN0 C C21  1 
HETATM 7950 C  C43  . IN0 F 2 .   ? -36.740 31.277 61.052 1.00 29.76 ? 995  IN0 C C43  1 
HETATM 7951 C  C10  . IN0 F 2 .   ? -37.022 31.640 62.559 1.00 30.35 ? 995  IN0 C C10  1 
HETATM 7952 C  C32  . IN0 F 2 .   ? -36.980 33.190 62.778 1.00 27.75 ? 995  IN0 C C32  1 
HETATM 7953 C  C25  . IN0 F 2 .   ? -38.427 31.139 63.002 1.00 29.80 ? 995  IN0 C C25  1 
HETATM 7954 C  C24  . IN0 F 2 .   ? -35.972 30.983 63.509 1.00 28.46 ? 995  IN0 C C24  1 
HETATM 7955 O  O    . HOH G 3 .   ? -6.813  53.232 46.719 1.00 13.55 ? 992  HOH A O    1 
HETATM 7956 O  O    . HOH G 3 .   ? -20.408 35.310 15.902 1.00 13.06 ? 993  HOH A O    1 
HETATM 7957 O  O    . HOH G 3 .   ? -13.221 26.265 38.326 1.00 17.75 ? 994  HOH A O    1 
HETATM 7958 O  O    . HOH G 3 .   ? -6.920  48.632 49.520 1.00 23.65 ? 995  HOH A O    1 
HETATM 7959 O  O    . HOH G 3 .   ? -10.548 49.378 43.217 1.00 17.94 ? 996  HOH A O    1 
HETATM 7960 O  O    . HOH G 3 .   ? 2.772   40.786 20.349 1.00 24.88 ? 997  HOH A O    1 
HETATM 7961 O  O    . HOH G 3 .   ? -12.340 39.709 37.272 1.00 18.73 ? 998  HOH A O    1 
HETATM 7962 O  O    . HOH G 3 .   ? -29.146 23.752 30.176 1.00 18.93 ? 999  HOH A O    1 
HETATM 7963 O  O    . HOH G 3 .   ? -25.444 38.416 20.707 1.00 24.31 ? 1000 HOH A O    1 
HETATM 7964 O  O    . HOH G 3 .   ? -3.773  33.256 41.149 1.00 27.23 ? 1001 HOH A O    1 
HETATM 7965 O  O    . HOH G 3 .   ? -18.968 35.557 19.836 1.00 23.78 ? 1002 HOH A O    1 
HETATM 7966 O  O    . HOH G 3 .   ? -21.147 31.265 9.505  1.00 15.12 ? 1003 HOH A O    1 
HETATM 7967 O  O    . HOH G 3 .   ? -18.769 26.594 46.310 1.00 32.50 ? 1004 HOH A O    1 
HETATM 7968 O  O    . HOH G 3 .   ? -2.539  38.028 49.061 1.00 30.56 ? 1005 HOH A O    1 
HETATM 7969 O  O    . HOH G 3 .   ? -34.902 21.603 24.114 1.00 27.30 ? 1006 HOH A O    1 
HETATM 7970 O  O    . HOH G 3 .   ? 3.856   37.874 19.528 1.00 35.85 ? 1007 HOH A O    1 
HETATM 7971 O  O    . HOH G 3 .   ? -27.342 20.693 44.850 1.00 26.52 ? 1008 HOH A O    1 
HETATM 7972 O  O    . HOH G 3 .   ? -7.510  27.597 34.343 1.00 19.08 ? 1009 HOH A O    1 
HETATM 7973 O  O    . HOH G 3 .   ? -10.409 26.080 43.043 1.00 31.73 ? 1010 HOH A O    1 
HETATM 7974 O  O    . HOH G 3 .   ? -6.232  54.914 44.052 1.00 45.55 ? 1011 HOH A O    1 
HETATM 7975 O  O    . HOH G 3 .   ? -0.839  34.647 37.458 1.00 38.84 ? 1012 HOH A O    1 
HETATM 7976 O  O    . HOH G 3 .   ? -32.367 32.548 15.795 1.00 24.60 ? 1013 HOH A O    1 
HETATM 7977 O  O    . HOH G 3 .   ? -27.002 28.614 44.866 1.00 28.58 ? 1014 HOH A O    1 
HETATM 7978 O  O    . HOH G 3 .   ? -36.283 27.000 15.635 1.00 29.80 ? 1015 HOH A O    1 
HETATM 7979 O  O    . HOH G 3 .   ? -2.115  58.084 38.849 1.00 33.20 ? 1016 HOH A O    1 
HETATM 7980 O  O    . HOH G 3 .   ? -11.212 38.810 15.971 1.00 35.82 ? 1017 HOH A O    1 
HETATM 7981 O  O    . HOH G 3 .   ? -29.186 41.088 37.389 1.00 33.78 ? 1018 HOH A O    1 
HETATM 7982 O  O    . HOH G 3 .   ? -29.278 39.030 35.365 1.00 25.27 ? 1019 HOH A O    1 
HETATM 7983 O  O    . HOH G 3 .   ? -17.701 41.438 33.535 1.00 18.79 ? 1020 HOH A O    1 
HETATM 7984 O  O    . HOH G 3 .   ? -15.106 55.754 32.868 1.00 37.40 ? 1021 HOH A O    1 
HETATM 7985 O  O    . HOH G 3 .   ? -19.106 33.781 17.509 1.00 21.83 ? 1022 HOH A O    1 
HETATM 7986 O  O    . HOH G 3 .   ? -17.558 44.850 52.689 1.00 32.70 ? 1023 HOH A O    1 
HETATM 7987 O  O    . HOH G 3 .   ? -10.558 37.623 49.918 1.00 23.37 ? 1024 HOH A O    1 
HETATM 7988 O  O    . HOH G 3 .   ? -18.695 48.577 49.797 1.00 35.16 ? 1025 HOH A O    1 
HETATM 7989 O  O    . HOH G 3 .   ? -16.706 39.942 23.468 1.00 37.74 ? 1026 HOH A O    1 
HETATM 7990 O  O    . HOH G 3 .   ? -11.639 26.541 35.917 1.00 32.85 ? 1027 HOH A O    1 
HETATM 7991 O  O    . HOH G 3 .   ? -11.171 56.286 19.469 1.00 28.85 ? 1028 HOH A O    1 
HETATM 7992 O  O    . HOH G 3 .   ? 7.967   39.148 17.731 1.00 29.97 ? 1029 HOH A O    1 
HETATM 7993 O  O    . HOH G 3 .   ? -16.789 29.205 13.649 1.00 30.23 ? 1030 HOH A O    1 
HETATM 7994 O  O    . HOH G 3 .   ? -15.255 19.837 21.832 1.00 28.34 ? 1031 HOH A O    1 
HETATM 7995 O  O    . HOH G 3 .   ? -14.800 44.677 53.048 1.00 26.48 ? 1032 HOH A O    1 
HETATM 7996 O  O    . HOH G 3 .   ? -7.260  41.064 26.023 1.00 30.76 ? 1033 HOH A O    1 
HETATM 7997 O  O    . HOH G 3 .   ? 5.716   51.512 38.453 1.00 30.49 ? 1034 HOH A O    1 
HETATM 7998 O  O    . HOH G 3 .   ? -14.212 40.189 24.851 1.00 36.24 ? 1035 HOH A O    1 
HETATM 7999 O  O    . HOH G 3 .   ? -2.076  45.716 50.402 1.00 36.46 ? 1036 HOH A O    1 
HETATM 8000 O  O    . HOH G 3 .   ? -22.902 36.473 52.935 1.00 22.94 ? 1037 HOH A O    1 
HETATM 8001 O  O    . HOH G 3 .   ? 3.233   52.350 38.656 1.00 20.47 ? 1038 HOH A O    1 
HETATM 8002 O  O    . HOH G 3 .   ? -6.778  46.977 51.594 1.00 30.17 ? 1039 HOH A O    1 
HETATM 8003 O  O    . HOH G 3 .   ? -28.682 25.049 9.744  1.00 28.78 ? 1040 HOH A O    1 
HETATM 8004 O  O    . HOH G 3 .   ? -21.451 22.081 9.930  1.00 20.78 ? 1041 HOH A O    1 
HETATM 8005 O  O    . HOH G 3 .   ? 9.819   38.024 20.013 1.00 30.69 ? 1042 HOH A O    1 
HETATM 8006 O  O    . HOH G 3 .   ? 3.811   36.904 32.778 1.00 25.08 ? 1043 HOH A O    1 
HETATM 8007 O  O    . HOH G 3 .   ? -19.600 29.224 10.752 1.00 30.55 ? 1044 HOH A O    1 
HETATM 8008 O  O    . HOH G 3 .   ? -24.580 41.117 20.319 1.00 27.19 ? 1045 HOH A O    1 
HETATM 8009 O  O    . HOH G 3 .   ? -10.685 31.462 15.952 1.00 25.02 ? 1046 HOH A O    1 
HETATM 8010 O  O    . HOH G 3 .   ? -20.559 20.875 26.495 1.00 28.55 ? 1047 HOH A O    1 
HETATM 8011 O  O    . HOH G 3 .   ? 4.944   53.128 20.664 1.00 37.13 ? 1048 HOH A O    1 
HETATM 8012 O  O    . HOH G 3 .   ? -33.978 23.974 25.223 1.00 43.33 ? 1049 HOH A O    1 
HETATM 8013 O  O    . HOH G 3 .   ? -36.093 30.687 25.628 1.00 29.13 ? 1050 HOH A O    1 
HETATM 8014 O  O    . HOH G 3 .   ? -9.548  25.606 17.151 1.00 24.66 ? 1051 HOH A O    1 
HETATM 8015 O  O    . HOH G 3 .   ? -23.127 20.517 11.130 1.00 18.94 ? 1052 HOH A O    1 
HETATM 8016 O  O    . HOH G 3 .   ? -14.431 25.477 26.699 1.00 36.01 ? 1053 HOH A O    1 
HETATM 8017 O  O    . HOH G 3 .   ? -8.720  24.521 37.130 1.00 55.54 ? 1054 HOH A O    1 
HETATM 8018 O  O    . HOH G 3 .   ? -17.204 44.092 34.211 1.00 29.83 ? 1055 HOH A O    1 
HETATM 8019 O  O    . HOH G 3 .   ? -13.848 57.078 36.142 1.00 34.28 ? 1056 HOH A O    1 
HETATM 8020 O  O    . HOH G 3 .   ? -2.870  54.722 46.686 1.00 31.70 ? 1057 HOH A O    1 
HETATM 8021 O  O    . HOH G 3 .   ? -21.839 22.101 28.490 1.00 21.97 ? 1058 HOH A O    1 
HETATM 8022 O  O    . HOH G 3 .   ? -23.617 42.408 22.534 1.00 33.85 ? 1059 HOH A O    1 
HETATM 8023 O  O    . HOH G 3 .   ? -29.773 20.576 41.809 1.00 43.00 ? 1060 HOH A O    1 
HETATM 8024 O  O    . HOH G 3 .   ? -16.005 34.448 52.134 1.00 38.10 ? 1061 HOH A O    1 
HETATM 8025 O  O    . HOH G 3 .   ? -27.212 39.296 23.868 1.00 35.07 ? 1062 HOH A O    1 
HETATM 8026 O  O    . HOH G 3 .   ? -18.576 22.332 10.418 1.00 26.54 ? 1063 HOH A O    1 
HETATM 8027 O  O    . HOH G 3 .   ? -20.795 20.658 7.605  1.00 20.36 ? 1064 HOH A O    1 
HETATM 8028 O  O    . HOH G 3 .   ? 8.341   39.359 26.804 1.00 29.60 ? 1065 HOH A O    1 
HETATM 8029 O  O    . HOH G 3 .   ? 6.562   57.219 23.092 1.00 35.26 ? 1066 HOH A O    1 
HETATM 8030 O  O    . HOH G 3 .   ? 8.968   39.966 29.486 1.00 24.46 ? 1067 HOH A O    1 
HETATM 8031 O  O    . HOH G 3 .   ? -25.238 18.219 12.309 1.00 57.55 ? 1068 HOH A O    1 
HETATM 8032 O  O    . HOH G 3 .   ? -7.334  48.477 7.654  1.00 31.94 ? 1069 HOH A O    1 
HETATM 8033 O  O    . HOH G 3 .   ? -16.455 27.605 52.770 1.00 38.91 ? 1070 HOH A O    1 
HETATM 8034 O  O    . HOH G 3 .   ? -21.484 18.443 10.423 1.00 29.92 ? 1071 HOH A O    1 
HETATM 8035 O  O    . HOH G 3 .   ? -17.977 19.190 21.710 1.00 27.83 ? 1072 HOH A O    1 
HETATM 8036 O  O    . HOH G 3 .   ? -34.271 25.456 15.524 1.00 23.69 ? 1073 HOH A O    1 
HETATM 8037 O  O    . HOH G 3 .   ? -14.763 44.737 11.920 1.00 52.81 ? 1074 HOH A O    1 
HETATM 8038 O  O    . HOH G 3 .   ? -15.791 41.407 31.440 1.00 39.70 ? 1075 HOH A O    1 
HETATM 8039 O  O    . HOH G 3 .   ? -13.596 33.200 51.630 1.00 36.97 ? 1076 HOH A O    1 
HETATM 8040 O  O    . HOH G 3 .   ? -28.030 22.496 25.585 1.00 30.02 ? 1077 HOH A O    1 
HETATM 8041 O  O    . HOH G 3 .   ? -14.126 27.297 45.173 1.00 26.02 ? 1078 HOH A O    1 
HETATM 8042 O  O    . HOH G 3 .   ? -13.847 24.180 29.068 1.00 37.70 ? 1079 HOH A O    1 
HETATM 8043 O  O    . HOH G 3 .   ? -34.077 24.661 12.815 1.00 33.71 ? 1080 HOH A O    1 
HETATM 8044 O  O    . HOH G 3 .   ? 0.787   32.778 15.757 1.00 34.85 ? 1081 HOH A O    1 
HETATM 8045 O  O    . HOH G 3 .   ? -19.335 18.351 8.186  1.00 39.30 ? 1082 HOH A O    1 
HETATM 8046 O  O    . HOH G 3 .   ? -14.340 21.698 14.849 1.00 37.92 ? 1083 HOH A O    1 
HETATM 8047 O  O    . HOH G 3 .   ? -34.439 25.520 22.558 1.00 26.80 ? 1084 HOH A O    1 
HETATM 8048 O  O    . HOH G 3 .   ? 3.774   33.102 38.011 1.00 43.47 ? 1085 HOH A O    1 
HETATM 8049 O  O    . HOH G 3 .   ? -15.735 55.223 35.531 1.00 50.61 ? 1086 HOH A O    1 
HETATM 8050 O  O    . HOH G 3 .   ? -39.562 28.379 19.351 1.00 49.52 ? 1087 HOH A O    1 
HETATM 8051 O  O    . HOH G 3 .   ? -29.617 15.737 29.392 1.00 45.74 ? 1088 HOH A O    1 
HETATM 8052 O  O    . HOH G 3 .   ? -16.520 20.042 14.422 1.00 23.27 ? 1089 HOH A O    1 
HETATM 8053 O  O    . HOH G 3 .   ? -10.501 39.937 24.441 1.00 28.68 ? 1090 HOH A O    1 
HETATM 8054 O  O    . HOH G 3 .   ? -5.384  63.291 23.142 1.00 42.45 ? 1091 HOH A O    1 
HETATM 8055 O  O    . HOH G 3 .   ? -15.666 24.107 31.242 1.00 28.05 ? 1092 HOH A O    1 
HETATM 8056 O  O    . HOH G 3 .   ? -27.257 26.763 6.388  1.00 39.61 ? 1093 HOH A O    1 
HETATM 8057 O  O    . HOH G 3 .   ? -10.849 38.687 22.025 1.00 30.56 ? 1094 HOH A O    1 
HETATM 8058 O  O    . HOH G 3 .   ? 8.721   56.920 29.453 1.00 37.98 ? 1095 HOH A O    1 
HETATM 8059 O  O    . HOH G 3 .   ? -4.175  46.390 52.704 1.00 47.08 ? 1096 HOH A O    1 
HETATM 8060 O  O    . HOH G 3 .   ? -11.024 33.656 52.155 1.00 46.14 ? 1097 HOH A O    1 
HETATM 8061 O  O    . HOH G 3 .   ? -39.972 31.014 19.257 1.00 38.97 ? 1098 HOH A O    1 
HETATM 8062 O  O    . HOH G 3 .   ? -33.546 37.283 31.129 1.00 51.66 ? 1099 HOH A O    1 
HETATM 8063 O  O    . HOH G 3 .   ? -19.699 40.396 31.351 1.00 23.77 ? 1100 HOH A O    1 
HETATM 8064 O  O    . HOH G 3 .   ? -17.318 22.081 30.562 1.00 27.14 ? 1101 HOH A O    1 
HETATM 8065 O  O    . HOH G 3 .   ? -10.152 36.055 15.575 1.00 27.87 ? 1102 HOH A O    1 
HETATM 8066 O  O    . HOH G 3 .   ? -7.764  35.875 16.833 1.00 38.65 ? 1103 HOH A O    1 
HETATM 8067 O  O    . HOH G 3 .   ? 3.984   54.976 36.982 1.00 37.19 ? 1104 HOH A O    1 
HETATM 8068 O  O    . HOH G 3 .   ? -4.986  32.805 43.590 1.00 46.36 ? 1105 HOH A O    1 
HETATM 8069 O  O    . HOH G 3 .   ? 3.364   55.229 34.051 1.00 36.90 ? 1106 HOH A O    1 
HETATM 8070 O  O    . HOH G 3 .   ? -20.019 21.073 30.888 1.00 48.96 ? 1107 HOH A O    1 
HETATM 8071 O  O    . HOH G 3 .   ? -5.881  35.561 44.310 1.00 23.50 ? 1108 HOH A O    1 
HETATM 8072 O  O    . HOH G 3 .   ? 0.210   54.194 40.332 1.00 30.34 ? 1109 HOH A O    1 
HETATM 8073 O  O    . HOH G 3 .   ? -13.604 48.483 12.109 1.00 52.06 ? 1110 HOH A O    1 
HETATM 8074 O  O    . HOH G 3 .   ? -36.347 23.303 22.160 1.00 57.84 ? 1111 HOH A O    1 
HETATM 8075 O  O    . HOH G 3 .   ? -1.040  63.189 22.937 1.00 41.82 ? 1112 HOH A O    1 
HETATM 8076 O  O    . HOH G 3 .   ? -4.055  23.894 21.607 1.00 53.07 ? 1113 HOH A O    1 
HETATM 8077 O  O    . HOH G 3 .   ? -14.871 30.697 15.710 1.00 40.02 ? 1114 HOH A O    1 
HETATM 8078 O  O    . HOH G 3 .   ? -18.437 17.412 19.742 1.00 52.74 ? 1115 HOH A O    1 
HETATM 8079 O  O    . HOH G 3 .   ? 3.104   63.321 32.169 1.00 44.19 ? 1116 HOH A O    1 
HETATM 8080 O  O    . HOH H 3 .   ? -20.772 56.078 61.868 1.00 9.87  ? 993  HOH B O    1 
HETATM 8081 O  O    . HOH H 3 .   ? -12.949 50.361 44.395 1.00 21.46 ? 994  HOH B O    1 
HETATM 8082 O  O    . HOH H 3 .   ? -37.495 73.564 68.144 1.00 18.13 ? 995  HOH B O    1 
HETATM 8083 O  O    . HOH H 3 .   ? -26.899 76.173 79.721 1.00 17.14 ? 996  HOH B O    1 
HETATM 8084 O  O    . HOH H 3 .   ? -16.673 86.240 74.183 1.00 23.63 ? 997  HOH B O    1 
HETATM 8085 O  O    . HOH H 3 .   ? -34.262 66.446 80.405 1.00 20.56 ? 998  HOH B O    1 
HETATM 8086 O  O    . HOH H 3 .   ? -20.166 58.462 73.806 1.00 14.43 ? 999  HOH B O    1 
HETATM 8087 O  O    . HOH H 3 .   ? -9.673  55.226 54.713 1.00 23.13 ? 1000 HOH B O    1 
HETATM 8088 O  O    . HOH H 3 .   ? -20.177 51.995 66.824 1.00 9.41  ? 1001 HOH B O    1 
HETATM 8089 O  O    . HOH H 3 .   ? -33.319 61.407 62.704 1.00 19.13 ? 1002 HOH B O    1 
HETATM 8090 O  O    . HOH H 3 .   ? -15.452 51.291 63.967 1.00 15.51 ? 1003 HOH B O    1 
HETATM 8091 O  O    . HOH H 3 .   ? -25.658 79.880 84.522 1.00 19.00 ? 1004 HOH B O    1 
HETATM 8092 O  O    . HOH H 3 .   ? -19.085 73.753 33.066 1.00 24.99 ? 1005 HOH B O    1 
HETATM 8093 O  O    . HOH H 3 .   ? -7.364  67.023 58.280 1.00 15.19 ? 1006 HOH B O    1 
HETATM 8094 O  O    . HOH H 3 .   ? -25.114 61.369 80.873 1.00 27.66 ? 1007 HOH B O    1 
HETATM 8095 O  O    . HOH H 3 .   ? -35.373 84.603 60.625 1.00 21.13 ? 1008 HOH B O    1 
HETATM 8096 O  O    . HOH H 3 .   ? -19.150 81.921 70.841 1.00 21.51 ? 1009 HOH B O    1 
HETATM 8097 O  O    . HOH H 3 .   ? -38.936 65.177 68.875 1.00 25.89 ? 1010 HOH B O    1 
HETATM 8098 O  O    . HOH H 3 .   ? -33.393 57.567 82.057 1.00 28.40 ? 1011 HOH B O    1 
HETATM 8099 O  O    . HOH H 3 .   ? -5.212  66.979 48.751 1.00 27.40 ? 1012 HOH B O    1 
HETATM 8100 O  O    . HOH H 3 .   ? -28.135 82.112 47.308 1.00 28.40 ? 1013 HOH B O    1 
HETATM 8101 O  O    . HOH H 3 .   ? -8.420  53.679 48.963 1.00 35.03 ? 1014 HOH B O    1 
HETATM 8102 O  O    . HOH H 3 .   ? -8.851  70.300 47.300 1.00 19.78 ? 1015 HOH B O    1 
HETATM 8103 O  O    . HOH H 3 .   ? -35.775 68.605 79.269 1.00 26.94 ? 1016 HOH B O    1 
HETATM 8104 O  O    . HOH H 3 .   ? -33.525 76.524 63.736 1.00 28.77 ? 1017 HOH B O    1 
HETATM 8105 O  O    . HOH H 3 .   ? -32.930 53.348 79.583 1.00 33.62 ? 1018 HOH B O    1 
HETATM 8106 O  O    . HOH H 3 .   ? -7.253  67.187 69.104 1.00 22.41 ? 1019 HOH B O    1 
HETATM 8107 O  O    . HOH H 3 .   ? -22.493 63.836 77.681 1.00 19.63 ? 1020 HOH B O    1 
HETATM 8108 O  O    . HOH H 3 .   ? -9.420  72.701 48.474 1.00 22.09 ? 1021 HOH B O    1 
HETATM 8109 O  O    . HOH H 3 .   ? -27.247 73.064 82.818 1.00 15.60 ? 1022 HOH B O    1 
HETATM 8110 O  O    . HOH H 3 .   ? -32.556 78.152 61.492 1.00 26.95 ? 1023 HOH B O    1 
HETATM 8111 O  O    . HOH H 3 .   ? -31.271 53.722 82.115 1.00 26.43 ? 1024 HOH B O    1 
HETATM 8112 O  O    . HOH H 3 .   ? -22.288 53.760 68.439 1.00 19.63 ? 1025 HOH B O    1 
HETATM 8113 O  O    . HOH H 3 .   ? -7.938  69.809 61.599 1.00 24.80 ? 1026 HOH B O    1 
HETATM 8114 O  O    . HOH H 3 .   ? -18.302 61.252 75.240 1.00 18.00 ? 1027 HOH B O    1 
HETATM 8115 O  O    . HOH H 3 .   ? -25.871 53.296 86.268 1.00 20.15 ? 1028 HOH B O    1 
HETATM 8116 O  O    . HOH H 3 .   ? -9.588  74.690 52.475 1.00 19.96 ? 1029 HOH B O    1 
HETATM 8117 O  O    . HOH H 3 .   ? -6.128  58.012 61.207 1.00 25.26 ? 1030 HOH B O    1 
HETATM 8118 O  O    . HOH H 3 .   ? -13.073 90.328 48.964 1.00 27.75 ? 1031 HOH B O    1 
HETATM 8119 O  O    . HOH H 3 .   ? -26.330 58.935 80.893 1.00 27.56 ? 1032 HOH B O    1 
HETATM 8120 O  O    . HOH H 3 .   ? -34.321 60.193 73.022 1.00 26.23 ? 1033 HOH B O    1 
HETATM 8121 O  O    . HOH H 3 .   ? -39.845 81.999 71.199 1.00 31.37 ? 1034 HOH B O    1 
HETATM 8122 O  O    . HOH H 3 .   ? -22.373 75.327 61.604 1.00 35.44 ? 1035 HOH B O    1 
HETATM 8123 O  O    . HOH H 3 .   ? -2.970  56.751 63.677 1.00 31.41 ? 1036 HOH B O    1 
HETATM 8124 O  O    . HOH H 3 .   ? -3.068  72.449 57.476 1.00 27.07 ? 1037 HOH B O    1 
HETATM 8125 O  O    . HOH H 3 .   ? -15.276 48.207 55.095 1.00 23.15 ? 1038 HOH B O    1 
HETATM 8126 O  O    . HOH H 3 .   ? -6.905  70.221 69.504 1.00 30.89 ? 1039 HOH B O    1 
HETATM 8127 O  O    . HOH H 3 .   ? -20.380 78.222 33.544 1.00 33.20 ? 1040 HOH B O    1 
HETATM 8128 O  O    . HOH H 3 .   ? -22.601 68.182 84.124 1.00 31.20 ? 1041 HOH B O    1 
HETATM 8129 O  O    . HOH H 3 .   ? -6.609  64.847 57.102 1.00 24.69 ? 1042 HOH B O    1 
HETATM 8130 O  O    . HOH H 3 .   ? -31.647 72.847 59.208 1.00 42.01 ? 1043 HOH B O    1 
HETATM 8131 O  O    . HOH H 3 .   ? -12.959 50.510 63.006 1.00 17.94 ? 1044 HOH B O    1 
HETATM 8132 O  O    . HOH H 3 .   ? -16.482 62.220 76.895 1.00 12.96 ? 1045 HOH B O    1 
HETATM 8133 O  O    . HOH H 3 .   ? -8.202  62.821 57.740 1.00 10.42 ? 1046 HOH B O    1 
HETATM 8134 O  O    . HOH H 3 .   ? -18.966 58.757 76.401 1.00 18.09 ? 1047 HOH B O    1 
HETATM 8135 O  O    . HOH H 3 .   ? -7.773  61.418 42.668 1.00 30.13 ? 1048 HOH B O    1 
HETATM 8136 O  O    . HOH H 3 .   ? -25.903 81.995 82.700 1.00 22.83 ? 1049 HOH B O    1 
HETATM 8137 O  O    . HOH H 3 .   ? -18.919 52.150 71.073 1.00 17.66 ? 1050 HOH B O    1 
HETATM 8138 O  O    . HOH H 3 .   ? -10.001 64.885 78.721 1.00 19.92 ? 1051 HOH B O    1 
HETATM 8139 O  O    . HOH H 3 .   ? -6.181  63.433 46.335 1.00 31.63 ? 1052 HOH B O    1 
HETATM 8140 O  O    . HOH H 3 .   ? -36.513 78.171 60.840 1.00 28.62 ? 1053 HOH B O    1 
HETATM 8141 O  O    . HOH H 3 .   ? -28.442 79.545 48.110 1.00 26.53 ? 1054 HOH B O    1 
HETATM 8142 O  O    . HOH H 3 .   ? -18.311 64.971 55.263 1.00 23.64 ? 1055 HOH B O    1 
HETATM 8143 O  O    . HOH H 3 .   ? -3.747  65.892 66.531 1.00 33.00 ? 1056 HOH B O    1 
HETATM 8144 O  O    . HOH H 3 .   ? -17.050 89.428 65.219 1.00 25.48 ? 1057 HOH B O    1 
HETATM 8145 O  O    . HOH H 3 .   ? -36.387 87.029 68.548 1.00 37.42 ? 1058 HOH B O    1 
HETATM 8146 O  O    . HOH H 3 .   ? -31.693 83.368 30.387 1.00 35.76 ? 1059 HOH B O    1 
HETATM 8147 O  O    . HOH H 3 .   ? -13.311 72.204 80.947 1.00 23.57 ? 1060 HOH B O    1 
HETATM 8148 O  O    . HOH H 3 .   ? -5.620  67.836 67.125 1.00 27.90 ? 1061 HOH B O    1 
HETATM 8149 O  O    . HOH H 3 .   ? -9.969  53.401 65.484 1.00 31.83 ? 1062 HOH B O    1 
HETATM 8150 O  O    . HOH H 3 .   ? -16.735 84.698 70.057 1.00 27.70 ? 1063 HOH B O    1 
HETATM 8151 O  O    . HOH H 3 .   ? -20.251 54.649 72.479 1.00 18.88 ? 1064 HOH B O    1 
HETATM 8152 O  O    . HOH H 3 .   ? -7.970  71.688 71.784 1.00 37.43 ? 1065 HOH B O    1 
HETATM 8153 O  O    . HOH H 3 .   ? -34.518 76.293 80.469 1.00 41.49 ? 1066 HOH B O    1 
HETATM 8154 O  O    . HOH H 3 .   ? -37.315 63.624 65.575 1.00 31.57 ? 1067 HOH B O    1 
HETATM 8155 O  O    . HOH H 3 .   ? -25.978 57.981 83.526 1.00 22.05 ? 1068 HOH B O    1 
HETATM 8156 O  O    . HOH H 3 .   ? -23.437 85.780 59.725 1.00 26.30 ? 1069 HOH B O    1 
HETATM 8157 O  O    . HOH H 3 .   ? -12.577 76.726 44.943 1.00 41.10 ? 1070 HOH B O    1 
HETATM 8158 O  O    . HOH H 3 .   ? -32.696 75.611 44.515 1.00 44.05 ? 1071 HOH B O    1 
HETATM 8159 O  O    . HOH H 3 .   ? -0.930  72.318 59.240 1.00 34.00 ? 1072 HOH B O    1 
HETATM 8160 O  O    . HOH H 3 .   ? -0.669  67.345 55.339 1.00 34.03 ? 1073 HOH B O    1 
HETATM 8161 O  O    . HOH H 3 .   ? -22.901 52.313 86.461 1.00 47.21 ? 1074 HOH B O    1 
HETATM 8162 O  O    . HOH H 3 .   ? -32.629 78.696 83.276 1.00 36.42 ? 1075 HOH B O    1 
HETATM 8163 O  O    . HOH H 3 .   ? -31.713 90.306 63.163 1.00 22.00 ? 1076 HOH B O    1 
HETATM 8164 O  O    . HOH H 3 .   ? -8.514  69.265 73.787 1.00 24.87 ? 1077 HOH B O    1 
HETATM 8165 O  O    . HOH H 3 .   ? -11.570 64.678 81.241 1.00 23.57 ? 1078 HOH B O    1 
HETATM 8166 O  O    . HOH H 3 .   ? -21.166 61.651 78.109 1.00 27.27 ? 1079 HOH B O    1 
HETATM 8167 O  O    . HOH H 3 .   ? -10.535 59.175 75.668 1.00 31.72 ? 1080 HOH B O    1 
HETATM 8168 O  O    . HOH H 3 .   ? -26.189 68.590 30.262 1.00 36.91 ? 1081 HOH B O    1 
HETATM 8169 O  O    . HOH H 3 .   ? -33.587 67.280 38.161 1.00 30.02 ? 1082 HOH B O    1 
HETATM 8170 O  O    . HOH H 3 .   ? -31.327 58.178 64.127 1.00 39.67 ? 1083 HOH B O    1 
HETATM 8171 O  O    . HOH H 3 .   ? -33.445 54.953 82.825 1.00 38.95 ? 1084 HOH B O    1 
HETATM 8172 O  O    . HOH H 3 .   ? -37.527 68.309 75.918 1.00 35.99 ? 1085 HOH B O    1 
HETATM 8173 O  O    . HOH H 3 .   ? -12.912 59.420 36.953 1.00 31.44 ? 1086 HOH B O    1 
HETATM 8174 O  O    . HOH H 3 .   ? -36.285 80.498 72.097 1.00 27.08 ? 1087 HOH B O    1 
HETATM 8175 O  O    . HOH H 3 .   ? -7.210  71.349 37.835 1.00 45.29 ? 1088 HOH B O    1 
HETATM 8176 O  O    . HOH H 3 .   ? -28.793 89.620 62.198 1.00 20.08 ? 1089 HOH B O    1 
HETATM 8177 O  O    . HOH H 3 .   ? -6.664  73.581 50.011 1.00 32.53 ? 1090 HOH B O    1 
HETATM 8178 O  O    . HOH H 3 .   ? -18.683 50.205 68.897 1.00 33.10 ? 1091 HOH B O    1 
HETATM 8179 O  O    . HOH H 3 .   ? -7.441  76.058 62.842 1.00 23.45 ? 1092 HOH B O    1 
HETATM 8180 O  O    . HOH H 3 .   ? -4.777  70.290 67.075 1.00 39.87 ? 1093 HOH B O    1 
HETATM 8181 O  O    . HOH H 3 .   ? -15.187 80.260 46.347 1.00 40.13 ? 1094 HOH B O    1 
HETATM 8182 O  O    . HOH H 3 .   ? -25.275 70.821 63.726 1.00 15.16 ? 1095 HOH B O    1 
HETATM 8183 O  O    . HOH H 3 .   ? -5.176  72.129 68.974 1.00 27.43 ? 1096 HOH B O    1 
HETATM 8184 O  O    . HOH H 3 .   ? -28.179 89.966 59.456 1.00 33.26 ? 1097 HOH B O    1 
HETATM 8185 O  O    . HOH H 3 .   ? -17.003 55.951 75.692 1.00 34.87 ? 1098 HOH B O    1 
HETATM 8186 O  O    . HOH H 3 .   ? -39.731 75.260 71.935 1.00 42.13 ? 1099 HOH B O    1 
HETATM 8187 O  O    . HOH H 3 .   ? -11.995 77.446 42.132 1.00 48.99 ? 1100 HOH B O    1 
HETATM 8188 O  O    . HOH H 3 .   ? -34.689 73.770 80.059 1.00 46.03 ? 1101 HOH B O    1 
HETATM 8189 O  O    . HOH H 3 .   ? -23.933 73.031 62.094 1.00 40.50 ? 1102 HOH B O    1 
HETATM 8190 O  O    . HOH H 3 .   ? -2.033  70.987 54.553 1.00 30.94 ? 1103 HOH B O    1 
HETATM 8191 O  O    . HOH H 3 .   ? -35.219 88.606 70.211 1.00 32.98 ? 1104 HOH B O    1 
HETATM 8192 O  O    . HOH H 3 .   ? -31.623 61.317 84.792 1.00 32.43 ? 1105 HOH B O    1 
HETATM 8193 O  O    . HOH H 3 .   ? -11.153 83.263 52.243 1.00 28.60 ? 1106 HOH B O    1 
HETATM 8194 O  O    . HOH H 3 .   ? -12.699 91.912 45.303 1.00 36.26 ? 1107 HOH B O    1 
HETATM 8195 O  O    . HOH H 3 .   ? -1.911  73.572 55.149 1.00 24.41 ? 1108 HOH B O    1 
HETATM 8196 O  O    . HOH H 3 .   ? -11.542 78.644 53.882 1.00 34.70 ? 1109 HOH B O    1 
HETATM 8197 O  O    . HOH H 3 .   ? -0.957  69.666 58.921 1.00 26.03 ? 1110 HOH B O    1 
HETATM 8198 O  O    . HOH H 3 .   ? -26.935 49.748 85.721 1.00 32.59 ? 1111 HOH B O    1 
HETATM 8199 O  O    . HOH H 3 .   ? -0.333  69.864 56.298 1.00 38.77 ? 1112 HOH B O    1 
HETATM 8200 O  O    . HOH H 3 .   ? -31.293 63.909 83.664 1.00 42.58 ? 1113 HOH B O    1 
HETATM 8201 O  O    . HOH H 3 .   ? -15.005 55.753 77.730 1.00 39.96 ? 1114 HOH B O    1 
HETATM 8202 O  O    . HOH H 3 .   ? -23.932 48.541 85.443 1.00 51.21 ? 1115 HOH B O    1 
HETATM 8203 O  O    . HOH H 3 .   ? -11.384 81.432 54.675 1.00 37.17 ? 1116 HOH B O    1 
HETATM 8204 O  O    . HOH H 3 .   ? -11.554 89.519 44.681 1.00 39.49 ? 1117 HOH B O    1 
HETATM 8205 O  O    . HOH H 3 .   ? -2.603  75.973 54.145 1.00 24.42 ? 1118 HOH B O    1 
HETATM 8206 O  O    . HOH H 3 .   ? -17.004 48.299 53.090 1.00 33.62 ? 1119 HOH B O    1 
HETATM 8207 O  O    . HOH H 3 .   ? -12.636 73.640 78.546 1.00 33.47 ? 1120 HOH B O    1 
HETATM 8208 O  O    . HOH H 3 .   ? -26.724 51.468 88.068 1.00 31.95 ? 1121 HOH B O    1 
HETATM 8209 O  O    . HOH H 3 .   ? -28.026 64.031 83.987 1.00 36.80 ? 1122 HOH B O    1 
HETATM 8210 O  O    . HOH H 3 .   ? -34.057 76.232 59.918 1.00 42.20 ? 1123 HOH B O    1 
HETATM 8211 O  O    . HOH H 3 .   ? -30.831 82.506 47.090 1.00 42.20 ? 1124 HOH B O    1 
HETATM 8212 O  O    . HOH H 3 .   ? -26.264 47.235 84.192 1.00 47.66 ? 1125 HOH B O    1 
HETATM 8213 O  O    . HOH H 3 .   ? -24.140 68.064 53.550 1.00 51.45 ? 1126 HOH B O    1 
HETATM 8214 O  O    . HOH H 3 .   ? -15.039 80.806 39.196 1.00 51.42 ? 1127 HOH B O    1 
HETATM 8215 O  O    . HOH H 3 .   ? -18.225 61.691 79.227 1.00 35.95 ? 1128 HOH B O    1 
HETATM 8216 O  O    . HOH H 3 .   ? -5.534  71.685 64.880 1.00 31.44 ? 1129 HOH B O    1 
HETATM 8217 O  O    . HOH H 3 .   ? -31.457 75.790 84.487 1.00 37.48 ? 1130 HOH B O    1 
HETATM 8218 O  O    . HOH H 3 .   ? -13.153 77.844 31.260 1.00 48.09 ? 1131 HOH B O    1 
HETATM 8219 O  O    . HOH H 3 .   ? -17.653 62.274 82.443 1.00 32.05 ? 1132 HOH B O    1 
HETATM 8220 O  O    . HOH H 3 .   ? -15.511 78.123 39.021 1.00 49.89 ? 1133 HOH B O    1 
HETATM 8221 O  O    . HOH H 3 .   ? -12.707 79.179 46.084 1.00 45.94 ? 1134 HOH B O    1 
HETATM 8222 O  O    . HOH H 3 .   ? -26.482 72.369 61.304 1.00 44.46 ? 1135 HOH B O    1 
HETATM 8223 O  O    . HOH H 3 .   ? -18.639 80.838 81.025 1.00 27.80 ? 1136 HOH B O    1 
HETATM 8224 O  O    . HOH H 3 .   ? -36.314 71.269 65.890 1.00 35.16 ? 1137 HOH B O    1 
HETATM 8225 O  O    . HOH H 3 .   ? -33.466 96.344 70.239 1.00 45.41 ? 1138 HOH B O    1 
HETATM 8226 O  O    . HOH H 3 .   ? -24.168 54.934 81.362 1.00 56.89 ? 1139 HOH B O    1 
HETATM 8227 O  O    . HOH H 3 .   ? -38.905 88.066 68.521 1.00 51.60 ? 1140 HOH B O    1 
HETATM 8228 O  O    . HOH H 3 .   ? -17.657 59.050 79.228 1.00 47.69 ? 1141 HOH B O    1 
HETATM 8229 O  O    . HOH H 3 .   ? -7.881  74.391 65.331 1.00 24.21 ? 1142 HOH B O    1 
HETATM 8230 O  O    . HOH H 3 .   ? -14.196 45.714 55.665 1.00 63.28 ? 1143 HOH B O    1 
HETATM 8231 O  O    . HOH H 3 .   ? -4.322  60.462 67.886 1.00 55.44 ? 1144 HOH B O    1 
HETATM 8232 O  O    . HOH I 3 .   ? -51.284 51.426 70.272 1.00 9.52  ? 996  HOH C O    1 
HETATM 8233 O  O    . HOH I 3 .   ? -28.267 51.859 70.679 1.00 9.60  ? 997  HOH C O    1 
HETATM 8234 O  O    . HOH I 3 .   ? -47.569 53.411 69.069 1.00 13.03 ? 998  HOH C O    1 
HETATM 8235 O  O    . HOH I 3 .   ? -30.869 37.288 62.696 1.00 16.30 ? 999  HOH C O    1 
HETATM 8236 O  O    . HOH I 3 .   ? -24.683 57.221 73.927 1.00 18.46 ? 1000 HOH C O    1 
HETATM 8237 O  O    . HOH I 3 .   ? -60.018 45.599 60.183 1.00 24.26 ? 1001 HOH C O    1 
HETATM 8238 O  O    . HOH I 3 .   ? -21.533 52.814 71.104 1.00 18.23 ? 1002 HOH C O    1 
HETATM 8239 O  O    . HOH I 3 .   ? -15.727 35.178 56.930 1.00 17.80 ? 1003 HOH C O    1 
HETATM 8240 O  O    . HOH I 3 .   ? -28.365 44.429 75.349 1.00 19.12 ? 1004 HOH C O    1 
HETATM 8241 O  O    . HOH I 3 .   ? -33.123 44.004 74.214 1.00 29.60 ? 1005 HOH C O    1 
HETATM 8242 O  O    . HOH I 3 .   ? -36.848 63.280 68.169 1.00 12.44 ? 1006 HOH C O    1 
HETATM 8243 O  O    . HOH I 3 .   ? -49.765 35.788 63.510 1.00 19.54 ? 1007 HOH C O    1 
HETATM 8244 O  O    . HOH I 3 .   ? -19.745 42.709 64.826 1.00 18.93 ? 1008 HOH C O    1 
HETATM 8245 O  O    . HOH I 3 .   ? -28.486 26.059 75.162 1.00 19.97 ? 1009 HOH C O    1 
HETATM 8246 O  O    . HOH I 3 .   ? -64.991 42.187 69.084 1.00 31.93 ? 1010 HOH C O    1 
HETATM 8247 O  O    . HOH I 3 .   ? -16.819 32.204 53.356 1.00 25.06 ? 1011 HOH C O    1 
HETATM 8248 O  O    . HOH I 3 .   ? -44.368 39.794 74.975 1.00 23.50 ? 1012 HOH C O    1 
HETATM 8249 O  O    . HOH I 3 .   ? -34.446 10.027 59.070 1.00 27.86 ? 1013 HOH C O    1 
HETATM 8250 O  O    . HOH I 3 .   ? -22.516 34.307 54.834 1.00 15.16 ? 1014 HOH C O    1 
HETATM 8251 O  O    . HOH I 3 .   ? -27.685 47.809 72.769 1.00 22.61 ? 1015 HOH C O    1 
HETATM 8252 O  O    . HOH I 3 .   ? -17.210 25.468 54.035 1.00 27.39 ? 1016 HOH C O    1 
HETATM 8253 O  O    . HOH I 3 .   ? -36.061 61.730 63.760 1.00 22.90 ? 1017 HOH C O    1 
HETATM 8254 O  O    . HOH I 3 .   ? -51.230 40.215 58.101 1.00 21.55 ? 1018 HOH C O    1 
HETATM 8255 O  O    . HOH I 3 .   ? -28.170 51.274 79.710 1.00 25.38 ? 1019 HOH C O    1 
HETATM 8256 O  O    . HOH I 3 .   ? -16.537 36.362 68.222 1.00 29.03 ? 1020 HOH C O    1 
HETATM 8257 O  O    . HOH I 3 .   ? -31.678 59.600 61.679 1.00 30.60 ? 1021 HOH C O    1 
HETATM 8258 O  O    . HOH I 3 .   ? -20.223 22.775 51.736 1.00 25.90 ? 1022 HOH C O    1 
HETATM 8259 O  O    . HOH I 3 .   ? -31.169 8.216  57.033 1.00 26.93 ? 1023 HOH C O    1 
HETATM 8260 O  O    . HOH I 3 .   ? -28.602 29.761 46.915 1.00 19.87 ? 1024 HOH C O    1 
HETATM 8261 O  O    . HOH I 3 .   ? -62.160 44.740 74.904 1.00 24.31 ? 1025 HOH C O    1 
HETATM 8262 O  O    . HOH I 3 .   ? -41.159 42.901 74.700 1.00 37.34 ? 1026 HOH C O    1 
HETATM 8263 O  O    . HOH I 3 .   ? -22.157 54.281 60.234 1.00 15.69 ? 1027 HOH C O    1 
HETATM 8264 O  O    . HOH I 3 .   ? -26.394 31.412 73.179 1.00 31.34 ? 1028 HOH C O    1 
HETATM 8265 O  O    . HOH I 3 .   ? -47.870 61.747 67.745 1.00 28.71 ? 1029 HOH C O    1 
HETATM 8266 O  O    . HOH I 3 .   ? -14.466 30.573 53.384 1.00 37.46 ? 1030 HOH C O    1 
HETATM 8267 O  O    . HOH I 3 .   ? -52.772 30.227 56.098 1.00 43.24 ? 1031 HOH C O    1 
HETATM 8268 O  O    . HOH I 3 .   ? -23.007 13.559 50.091 1.00 34.15 ? 1032 HOH C O    1 
HETATM 8269 O  O    . HOH I 3 .   ? -16.829 44.464 56.512 1.00 26.32 ? 1033 HOH C O    1 
HETATM 8270 O  O    . HOH I 3 .   ? -48.414 54.277 58.454 1.00 39.69 ? 1034 HOH C O    1 
HETATM 8271 O  O    . HOH I 3 .   ? -18.618 29.121 52.132 1.00 26.86 ? 1035 HOH C O    1 
HETATM 8272 O  O    . HOH I 3 .   ? -37.579 36.207 59.788 1.00 30.67 ? 1036 HOH C O    1 
HETATM 8273 O  O    . HOH I 3 .   ? -34.613 41.467 74.598 1.00 33.50 ? 1037 HOH C O    1 
HETATM 8274 O  O    . HOH I 3 .   ? -45.195 19.164 75.597 1.00 40.49 ? 1038 HOH C O    1 
HETATM 8275 O  O    . HOH I 3 .   ? -41.316 6.342  58.809 1.00 39.68 ? 1039 HOH C O    1 
HETATM 8276 O  O    . HOH I 3 .   ? -47.647 59.850 74.715 1.00 54.37 ? 1040 HOH C O    1 
HETATM 8277 O  O    . HOH I 3 .   ? -22.001 48.454 54.750 1.00 38.07 ? 1041 HOH C O    1 
HETATM 8278 O  O    . HOH I 3 .   ? -48.969 42.171 56.264 1.00 46.16 ? 1042 HOH C O    1 
HETATM 8279 O  O    . HOH I 3 .   ? -53.221 20.369 65.151 1.00 45.56 ? 1043 HOH C O    1 
HETATM 8280 O  O    . HOH I 3 .   ? -39.018 38.596 59.715 1.00 29.95 ? 1044 HOH C O    1 
HETATM 8281 O  O    . HOH I 3 .   ? -29.303 49.695 71.858 1.00 10.96 ? 1045 HOH C O    1 
HETATM 8282 O  O    . HOH I 3 .   ? -39.800 50.135 55.629 1.00 33.43 ? 1046 HOH C O    1 
HETATM 8283 O  O    . HOH I 3 .   ? -42.773 30.317 46.766 1.00 31.65 ? 1047 HOH C O    1 
HETATM 8284 O  O    . HOH I 3 .   ? -14.236 37.175 58.763 1.00 27.14 ? 1048 HOH C O    1 
HETATM 8285 O  O    . HOH I 3 .   ? -25.318 35.473 72.476 1.00 27.84 ? 1049 HOH C O    1 
HETATM 8286 O  O    . HOH I 3 .   ? -32.588 56.392 65.789 1.00 20.05 ? 1050 HOH C O    1 
HETATM 8287 O  O    . HOH I 3 .   ? -14.344 28.023 54.288 1.00 28.66 ? 1051 HOH C O    1 
HETATM 8288 O  O    . HOH I 3 .   ? -36.766 56.028 77.614 1.00 21.37 ? 1052 HOH C O    1 
HETATM 8289 O  O    . HOH I 3 .   ? -47.592 64.657 69.088 1.00 23.84 ? 1053 HOH C O    1 
HETATM 8290 O  O    . HOH I 3 .   ? -38.029 16.726 69.384 1.00 33.19 ? 1054 HOH C O    1 
HETATM 8291 O  O    . HOH I 3 .   ? -35.555 25.779 76.917 1.00 31.26 ? 1055 HOH C O    1 
HETATM 8292 O  O    . HOH I 3 .   ? -16.747 38.607 70.790 1.00 35.36 ? 1056 HOH C O    1 
HETATM 8293 O  O    . HOH I 3 .   ? -13.711 33.917 62.047 1.00 24.92 ? 1057 HOH C O    1 
HETATM 8294 O  O    . HOH I 3 .   ? -60.933 34.692 66.141 1.00 27.53 ? 1058 HOH C O    1 
HETATM 8295 O  O    . HOH I 3 .   ? -48.224 60.841 70.145 1.00 26.82 ? 1059 HOH C O    1 
HETATM 8296 O  O    . HOH I 3 .   ? -30.605 27.731 76.426 1.00 36.76 ? 1060 HOH C O    1 
HETATM 8297 O  O    . HOH I 3 .   ? -62.606 51.204 62.663 1.00 37.90 ? 1061 HOH C O    1 
HETATM 8298 O  O    . HOH I 3 .   ? -15.935 29.734 70.774 1.00 34.84 ? 1062 HOH C O    1 
HETATM 8299 O  O    . HOH I 3 .   ? -63.874 42.721 73.792 1.00 34.00 ? 1063 HOH C O    1 
HETATM 8300 O  O    . HOH I 3 .   ? -34.654 14.848 45.861 1.00 31.79 ? 1064 HOH C O    1 
HETATM 8301 O  O    . HOH I 3 .   ? -55.994 42.415 78.980 1.00 24.18 ? 1065 HOH C O    1 
HETATM 8302 O  O    . HOH I 3 .   ? -19.653 28.653 73.876 1.00 25.48 ? 1066 HOH C O    1 
HETATM 8303 O  O    . HOH I 3 .   ? -53.631 54.163 66.967 1.00 22.93 ? 1067 HOH C O    1 
HETATM 8304 O  O    . HOH I 3 .   ? -51.866 54.760 77.277 1.00 12.47 ? 1068 HOH C O    1 
HETATM 8305 O  O    . HOH I 3 .   ? -20.967 17.333 56.555 1.00 22.65 ? 1069 HOH C O    1 
HETATM 8306 O  O    . HOH I 3 .   ? -23.407 16.274 56.677 1.00 27.53 ? 1070 HOH C O    1 
HETATM 8307 O  O    . HOH I 3 .   ? -45.572 61.454 65.394 1.00 28.06 ? 1071 HOH C O    1 
HETATM 8308 O  O    . HOH I 3 .   ? -24.641 9.424  58.464 1.00 27.07 ? 1072 HOH C O    1 
HETATM 8309 O  O    . HOH I 3 .   ? -62.649 46.925 73.404 1.00 22.55 ? 1073 HOH C O    1 
HETATM 8310 O  O    . HOH I 3 .   ? -50.676 19.482 55.430 1.00 44.36 ? 1074 HOH C O    1 
HETATM 8311 O  O    . HOH I 3 .   ? -14.250 35.670 54.400 1.00 32.37 ? 1075 HOH C O    1 
HETATM 8312 O  O    . HOH I 3 .   ? -62.796 49.972 65.290 1.00 33.28 ? 1076 HOH C O    1 
HETATM 8313 O  O    . HOH I 3 .   ? -55.159 56.138 67.870 1.00 34.81 ? 1077 HOH C O    1 
HETATM 8314 O  O    . HOH I 3 .   ? -62.301 40.650 74.727 1.00 25.47 ? 1078 HOH C O    1 
HETATM 8315 O  O    . HOH I 3 .   ? -19.444 22.907 55.851 1.00 34.48 ? 1079 HOH C O    1 
HETATM 8316 O  O    . HOH I 3 .   ? -39.529 16.635 72.717 1.00 32.03 ? 1080 HOH C O    1 
HETATM 8317 O  O    . HOH I 3 .   ? -18.530 46.156 55.340 1.00 28.83 ? 1081 HOH C O    1 
HETATM 8318 O  O    . HOH I 3 .   ? -34.359 37.208 75.456 1.00 41.72 ? 1082 HOH C O    1 
HETATM 8319 O  O    . HOH I 3 .   ? -53.347 54.010 59.791 1.00 44.16 ? 1083 HOH C O    1 
HETATM 8320 O  O    . HOH I 3 .   ? -37.811 31.073 52.583 1.00 35.59 ? 1084 HOH C O    1 
HETATM 8321 O  O    . HOH I 3 .   ? -33.291 11.786 47.736 1.00 28.03 ? 1085 HOH C O    1 
HETATM 8322 O  O    . HOH I 3 .   ? -53.674 54.728 64.371 1.00 36.91 ? 1086 HOH C O    1 
HETATM 8323 O  O    . HOH I 3 .   ? -66.058 42.740 75.627 1.00 35.07 ? 1087 HOH C O    1 
HETATM 8324 O  O    . HOH I 3 .   ? -55.001 59.065 66.274 1.00 25.02 ? 1088 HOH C O    1 
HETATM 8325 O  O    . HOH I 3 .   ? -62.145 43.846 77.690 1.00 17.41 ? 1089 HOH C O    1 
HETATM 8326 O  O    . HOH I 3 .   ? -65.054 46.206 74.249 1.00 18.41 ? 1090 HOH C O    1 
HETATM 8327 O  O    . HOH I 3 .   ? -55.868 53.261 64.771 1.00 23.01 ? 1091 HOH C O    1 
HETATM 8328 O  O    . HOH I 3 .   ? -31.146 15.648 44.115 1.00 37.04 ? 1092 HOH C O    1 
HETATM 8329 O  O    . HOH I 3 .   ? -46.347 46.740 73.894 1.00 21.52 ? 1093 HOH C O    1 
HETATM 8330 O  O    . HOH I 3 .   ? -43.550 61.150 67.093 1.00 22.55 ? 1094 HOH C O    1 
HETATM 8331 O  O    . HOH I 3 .   ? -18.155 28.356 76.367 1.00 40.34 ? 1095 HOH C O    1 
HETATM 8332 O  O    . HOH I 3 .   ? -30.767 16.480 73.452 1.00 34.20 ? 1096 HOH C O    1 
HETATM 8333 O  O    . HOH I 3 .   ? -28.146 16.596 72.376 1.00 33.71 ? 1097 HOH C O    1 
HETATM 8334 O  O    . HOH I 3 .   ? -57.216 54.622 66.480 1.00 45.84 ? 1098 HOH C O    1 
HETATM 8335 O  O    . HOH I 3 .   ? -52.005 35.680 64.967 1.00 40.26 ? 1099 HOH C O    1 
HETATM 8336 O  O    . HOH I 3 .   ? -61.615 41.210 77.454 1.00 25.04 ? 1100 HOH C O    1 
HETATM 8337 O  O    . HOH I 3 .   ? -20.781 16.423 71.460 1.00 37.82 ? 1101 HOH C O    1 
HETATM 8338 O  O    . HOH I 3 .   ? -59.698 34.742 68.895 1.00 36.94 ? 1102 HOH C O    1 
HETATM 8339 O  O    . HOH I 3 .   ? -65.424 48.836 65.481 1.00 53.12 ? 1103 HOH C O    1 
HETATM 8340 O  O    . HOH I 3 .   ? -65.587 44.119 72.397 1.00 35.86 ? 1104 HOH C O    1 
HETATM 8341 O  O    . HOH I 3 .   ? -42.507 45.444 75.707 1.00 35.55 ? 1105 HOH C O    1 
HETATM 8342 O  O    . HOH I 3 .   ? -59.079 41.001 78.603 1.00 24.12 ? 1106 HOH C O    1 
HETATM 8343 O  O    . HOH I 3 .   ? -65.764 45.978 76.819 1.00 20.86 ? 1107 HOH C O    1 
HETATM 8344 O  O    . HOH I 3 .   ? -45.492 61.373 69.474 1.00 24.80 ? 1108 HOH C O    1 
HETATM 8345 O  O    . HOH I 3 .   ? -20.011 49.395 65.577 1.00 23.18 ? 1109 HOH C O    1 
HETATM 8346 O  O    . HOH I 3 .   ? -44.033 23.954 54.812 1.00 45.97 ? 1110 HOH C O    1 
HETATM 8347 O  O    . HOH I 3 .   ? -64.789 43.773 77.890 1.00 38.18 ? 1111 HOH C O    1 
HETATM 8348 O  O    . HOH I 3 .   ? -54.458 57.184 63.933 1.00 42.36 ? 1112 HOH C O    1 
HETATM 8349 O  O    . HOH I 3 .   ? -19.979 47.667 67.773 1.00 28.13 ? 1113 HOH C O    1 
HETATM 8350 O  O    . HOH I 3 .   ? -44.232 47.435 75.294 1.00 36.50 ? 1114 HOH C O    1 
HETATM 8351 O  O    . HOH I 3 .   ? -56.843 30.404 70.217 1.00 48.93 ? 1115 HOH C O    1 
HETATM 8352 O  O    . HOH I 3 .   ? -30.080 51.233 81.733 1.00 46.06 ? 1116 HOH C O    1 
HETATM 8353 O  O    . HOH I 3 .   ? -23.831 37.662 72.219 1.00 31.47 ? 1117 HOH C O    1 
HETATM 8354 O  O    . HOH I 3 .   ? -48.383 37.013 55.598 1.00 37.79 ? 1118 HOH C O    1 
HETATM 8355 O  O    . HOH I 3 .   ? -30.786 49.151 76.143 1.00 42.03 ? 1119 HOH C O    1 
HETATM 8356 O  O    . HOH I 3 .   ? -37.659 52.829 54.913 1.00 43.80 ? 1120 HOH C O    1 
HETATM 8357 O  O    . HOH I 3 .   ? -30.992 50.346 73.772 1.00 57.08 ? 1121 HOH C O    1 
HETATM 8358 O  O    . HOH I 3 .   ? -22.999 37.527 69.531 1.00 22.49 ? 1122 HOH C O    1 
HETATM 8359 O  O    . HOH I 3 .   ? -37.180 59.546 59.552 1.00 38.97 ? 1123 HOH C O    1 
HETATM 8360 O  O    . HOH I 3 .   ? -39.568 59.836 58.472 1.00 42.82 ? 1124 HOH C O    1 
HETATM 8361 O  O    . HOH I 3 .   ? -46.180 46.371 54.974 1.00 40.28 ? 1125 HOH C O    1 
HETATM 8362 O  O    . HOH I 3 .   ? -53.349 52.612 77.132 1.00 52.65 ? 1126 HOH C O    1 
HETATM 8363 O  O    . HOH I 3 .   ? -50.610 38.050 56.396 1.00 50.02 ? 1127 HOH C O    1 
HETATM 8364 O  O    . HOH I 3 .   ? -24.107 54.219 76.399 1.00 54.41 ? 1128 HOH C O    1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   31  ?   ?   ?   A . n 
A 1 2   ASP 2   32  ?   ?   ?   A . n 
A 1 3   ARG 3   33  ?   ?   ?   A . n 
A 1 4   ASN 4   34  ?   ?   ?   A . n 
A 1 5   SER 5   35  ?   ?   ?   A . n 
A 1 6   LEU 6   36  ?   ?   ?   A . n 
A 1 7   SER 7   37  ?   ?   ?   A . n 
A 1 8   ASN 8   38  38  ASN ASN A . n 
A 1 9   SER 9   39  39  SER SER A . n 
A 1 10  LEU 10  40  40  LEU LEU A . n 
A 1 11  LYS 11  41  41  LYS LYS A . n 
A 1 12  THR 12  42  42  THR THR A . n 
A 1 13  CYS 13  43  43  CYS CYS A . n 
A 1 14  TYR 14  44  44  TYR TYR A . n 
A 1 15  LYS 15  45  45  LYS LYS A . n 
A 1 16  TYR 16  46  46  TYR TYR A . n 
A 1 17  LEU 17  47  47  LEU LEU A . n 
A 1 18  ASN 18  48  48  ASN ASN A . n 
A 1 19  GLN 19  49  49  GLN GLN A . n 
A 1 20  THR 20  50  50  THR THR A . n 
A 1 21  SER 21  51  51  SER SER A . n 
A 1 22  ARG 22  52  52  ARG ARG A . n 
A 1 23  SER 23  53  53  SER SER A . n 
A 1 24  PHE 24  54  54  PHE PHE A . n 
A 1 25  ALA 25  55  55  ALA ALA A . n 
A 1 26  ALA 26  56  56  ALA ALA A . n 
A 1 27  VAL 27  57  57  VAL VAL A . n 
A 1 28  ILE 28  58  58  ILE ILE A . n 
A 1 29  GLN 29  59  59  GLN GLN A . n 
A 1 30  ALA 30  60  60  ALA ALA A . n 
A 1 31  LEU 31  61  61  LEU LEU A . n 
A 1 32  ASP 32  62  62  ASP ASP A . n 
A 1 33  GLY 33  63  63  GLY GLY A . n 
A 1 34  GLU 34  64  64  GLU GLU A . n 
A 1 35  MET 35  65  65  MET MET A . n 
A 1 36  ARG 36  66  66  ARG ARG A . n 
A 1 37  ASN 37  67  67  ASN ASN A . n 
A 1 38  ALA 38  68  68  ALA ALA A . n 
A 1 39  VAL 39  69  69  VAL VAL A . n 
A 1 40  CYS 40  70  70  CYS CYS A . n 
A 1 41  ILE 41  71  71  ILE ILE A . n 
A 1 42  PHE 42  72  72  PHE PHE A . n 
A 1 43  TYR 43  73  73  TYR TYR A . n 
A 1 44  LEU 44  74  74  LEU LEU A . n 
A 1 45  VAL 45  75  75  VAL VAL A . n 
A 1 46  LEU 46  76  76  LEU LEU A . n 
A 1 47  ARG 47  77  77  ARG ARG A . n 
A 1 48  ALA 48  78  78  ALA ALA A . n 
A 1 49  LEU 49  79  79  LEU LEU A . n 
A 1 50  ASP 50  80  80  ASP ASP A . n 
A 1 51  THR 51  81  81  THR THR A . n 
A 1 52  LEU 52  82  82  LEU LEU A . n 
A 1 53  GLU 53  83  83  GLU GLU A . n 
A 1 54  ASP 54  84  84  ASP ASP A . n 
A 1 55  ASP 55  85  85  ASP ASP A . n 
A 1 56  MET 56  86  86  MET MET A . n 
A 1 57  THR 57  87  87  THR THR A . n 
A 1 58  ILE 58  88  88  ILE ILE A . n 
A 1 59  SER 59  89  89  SER SER A . n 
A 1 60  VAL 60  90  90  VAL VAL A . n 
A 1 61  GLU 61  91  91  GLU GLU A . n 
A 1 62  LYS 62  92  92  LYS LYS A . n 
A 1 63  LYS 63  93  93  LYS LYS A . n 
A 1 64  VAL 64  94  94  VAL VAL A . n 
A 1 65  PRO 65  95  95  PRO PRO A . n 
A 1 66  LEU 66  96  96  LEU LEU A . n 
A 1 67  LEU 67  97  97  LEU LEU A . n 
A 1 68  HIS 68  98  98  HIS HIS A . n 
A 1 69  ASN 69  99  99  ASN ASN A . n 
A 1 70  PHE 70  100 100 PHE PHE A . n 
A 1 71  HIS 71  101 101 HIS HIS A . n 
A 1 72  SER 72  102 102 SER SER A . n 
A 1 73  PHE 73  103 103 PHE PHE A . n 
A 1 74  LEU 74  104 104 LEU LEU A . n 
A 1 75  TYR 75  105 105 TYR TYR A . n 
A 1 76  GLN 76  106 106 GLN GLN A . n 
A 1 77  PRO 77  107 107 PRO PRO A . n 
A 1 78  ASP 78  108 108 ASP ASP A . n 
A 1 79  TRP 79  109 109 TRP TRP A . n 
A 1 80  ARG 80  110 110 ARG ARG A . n 
A 1 81  PHE 81  111 111 PHE PHE A . n 
A 1 82  MET 82  112 112 MET MET A . n 
A 1 83  GLU 83  113 113 GLU GLU A . n 
A 1 84  SER 84  114 114 SER SER A . n 
A 1 85  LYS 85  115 115 LYS LYS A . n 
A 1 86  GLU 86  116 116 GLU GLU A . n 
A 1 87  LYS 87  117 117 LYS LYS A . n 
A 1 88  ASP 88  118 118 ASP ASP A . n 
A 1 89  ARG 89  119 119 ARG ARG A . n 
A 1 90  GLN 90  120 120 GLN GLN A . n 
A 1 91  VAL 91  121 121 VAL VAL A . n 
A 1 92  LEU 92  122 122 LEU LEU A . n 
A 1 93  GLU 93  123 123 GLU GLU A . n 
A 1 94  ASP 94  124 124 ASP ASP A . n 
A 1 95  PHE 95  125 125 PHE PHE A . n 
A 1 96  PRO 96  126 126 PRO PRO A . n 
A 1 97  THR 97  127 127 THR THR A . n 
A 1 98  ILE 98  128 128 ILE ILE A . n 
A 1 99  SER 99  129 129 SER SER A . n 
A 1 100 LEU 100 130 130 LEU LEU A . n 
A 1 101 GLU 101 131 131 GLU GLU A . n 
A 1 102 PHE 102 132 132 PHE PHE A . n 
A 1 103 ARG 103 133 133 ARG ARG A . n 
A 1 104 ASN 104 134 134 ASN ASN A . n 
A 1 105 LEU 105 135 135 LEU LEU A . n 
A 1 106 ALA 106 136 136 ALA ALA A . n 
A 1 107 GLU 107 137 137 GLU GLU A . n 
A 1 108 LYS 108 138 138 LYS LYS A . n 
A 1 109 TYR 109 139 139 TYR TYR A . n 
A 1 110 GLN 110 140 140 GLN GLN A . n 
A 1 111 THR 111 141 141 THR THR A . n 
A 1 112 VAL 112 142 142 VAL VAL A . n 
A 1 113 ILE 113 143 143 ILE ILE A . n 
A 1 114 ALA 114 144 144 ALA ALA A . n 
A 1 115 ASP 115 145 145 ASP ASP A . n 
A 1 116 ILE 116 146 146 ILE ILE A . n 
A 1 117 CYS 117 147 147 CYS CYS A . n 
A 1 118 ARG 118 148 148 ARG ARG A . n 
A 1 119 ARG 119 149 149 ARG ARG A . n 
A 1 120 MET 120 150 150 MET MET A . n 
A 1 121 GLY 121 151 151 GLY GLY A . n 
A 1 122 ILE 122 152 152 ILE ILE A . n 
A 1 123 GLY 123 153 153 GLY GLY A . n 
A 1 124 MET 124 154 154 MET MET A . n 
A 1 125 ALA 125 155 155 ALA ALA A . n 
A 1 126 GLU 126 156 156 GLU GLU A . n 
A 1 127 PHE 127 157 157 PHE PHE A . n 
A 1 128 LEU 128 158 158 LEU LEU A . n 
A 1 129 ASP 129 159 159 ASP ASP A . n 
A 1 130 LYS 130 160 160 LYS LYS A . n 
A 1 131 HIS 131 161 161 HIS HIS A . n 
A 1 132 VAL 132 162 162 VAL VAL A . n 
A 1 133 THR 133 163 163 THR THR A . n 
A 1 134 SER 134 164 164 SER SER A . n 
A 1 135 GLU 135 165 165 GLU GLU A . n 
A 1 136 GLN 136 166 166 GLN GLN A . n 
A 1 137 GLU 137 167 167 GLU GLU A . n 
A 1 138 TRP 138 168 168 TRP TRP A . n 
A 1 139 ASP 139 169 169 ASP ASP A . n 
A 1 140 LYS 140 170 170 LYS LYS A . n 
A 1 141 TYR 141 171 171 TYR TYR A . n 
A 1 142 CYS 142 172 172 CYS CYS A . n 
A 1 143 HIS 143 173 173 HIS HIS A . n 
A 1 144 TYR 144 174 174 TYR TYR A . n 
A 1 145 VAL 145 175 175 VAL VAL A . n 
A 1 146 ALA 146 176 176 ALA ALA A . n 
A 1 147 GLY 147 177 177 GLY GLY A . n 
A 1 148 LEU 148 178 178 LEU LEU A . n 
A 1 149 VAL 149 179 179 VAL VAL A . n 
A 1 150 GLY 150 180 180 GLY GLY A . n 
A 1 151 ILE 151 181 181 ILE ILE A . n 
A 1 152 GLY 152 182 182 GLY GLY A . n 
A 1 153 LEU 153 183 183 LEU LEU A . n 
A 1 154 SER 154 184 184 SER SER A . n 
A 1 155 ARG 155 185 185 ARG ARG A . n 
A 1 156 LEU 156 186 186 LEU LEU A . n 
A 1 157 PHE 157 187 187 PHE PHE A . n 
A 1 158 SER 158 188 188 SER SER A . n 
A 1 159 ALA 159 189 189 ALA ALA A . n 
A 1 160 SER 160 190 190 SER SER A . n 
A 1 161 GLU 161 191 191 GLU GLU A . n 
A 1 162 PHE 162 192 192 PHE PHE A . n 
A 1 163 GLU 163 193 193 GLU GLU A . n 
A 1 164 ASP 164 194 194 ASP ASP A . n 
A 1 165 PRO 165 195 195 PRO PRO A . n 
A 1 166 LEU 166 196 196 LEU LEU A . n 
A 1 167 VAL 167 197 197 VAL VAL A . n 
A 1 168 GLY 168 198 198 GLY GLY A . n 
A 1 169 GLU 169 199 199 GLU GLU A . n 
A 1 170 ASP 170 200 200 ASP ASP A . n 
A 1 171 THR 171 201 201 THR THR A . n 
A 1 172 GLU 172 202 202 GLU GLU A . n 
A 1 173 ARG 173 203 203 ARG ARG A . n 
A 1 174 ALA 174 204 204 ALA ALA A . n 
A 1 175 ASN 175 205 205 ASN ASN A . n 
A 1 176 SER 176 206 206 SER SER A . n 
A 1 177 MET 177 207 207 MET MET A . n 
A 1 178 GLY 178 208 208 GLY GLY A . n 
A 1 179 LEU 179 209 209 LEU LEU A . n 
A 1 180 PHE 180 210 210 PHE PHE A . n 
A 1 181 LEU 181 211 211 LEU LEU A . n 
A 1 182 GLN 182 212 212 GLN GLN A . n 
A 1 183 LYS 183 213 213 LYS LYS A . n 
A 1 184 THR 184 214 214 THR THR A . n 
A 1 185 ASN 185 215 215 ASN ASN A . n 
A 1 186 ILE 186 216 216 ILE ILE A . n 
A 1 187 ILE 187 217 217 ILE ILE A . n 
A 1 188 ARG 188 218 218 ARG ARG A . n 
A 1 189 ASP 189 219 219 ASP ASP A . n 
A 1 190 TYR 190 220 220 TYR TYR A . n 
A 1 191 LEU 191 221 221 LEU LEU A . n 
A 1 192 GLU 192 222 222 GLU GLU A . n 
A 1 193 ASP 193 223 223 ASP ASP A . n 
A 1 194 GLN 194 224 224 GLN GLN A . n 
A 1 195 GLN 195 225 225 GLN GLN A . n 
A 1 196 GLY 196 226 226 GLY GLY A . n 
A 1 197 GLY 197 227 227 GLY GLY A . n 
A 1 198 ARG 198 228 228 ARG ARG A . n 
A 1 199 GLU 199 229 229 GLU GLU A . n 
A 1 200 PHE 200 230 230 PHE PHE A . n 
A 1 201 TRP 201 231 231 TRP TRP A . n 
A 1 202 PRO 202 232 232 PRO PRO A . n 
A 1 203 GLN 203 233 233 GLN GLN A . n 
A 1 204 GLU 204 234 234 GLU GLU A . n 
A 1 205 VAL 205 235 235 VAL VAL A . n 
A 1 206 TRP 206 236 236 TRP TRP A . n 
A 1 207 SER 207 237 237 SER SER A . n 
A 1 208 ARG 208 238 238 ARG ARG A . n 
A 1 209 TYR 209 239 239 TYR TYR A . n 
A 1 210 VAL 210 240 240 VAL VAL A . n 
A 1 211 LYS 211 241 241 LYS LYS A . n 
A 1 212 LYS 212 242 242 LYS LYS A . n 
A 1 213 LEU 213 243 243 LEU LEU A . n 
A 1 214 GLY 214 244 244 GLY GLY A . n 
A 1 215 ASP 215 245 245 ASP ASP A . n 
A 1 216 PHE 216 246 246 PHE PHE A . n 
A 1 217 ALA 217 247 247 ALA ALA A . n 
A 1 218 LYS 218 248 248 LYS LYS A . n 
A 1 219 PRO 219 249 249 PRO PRO A . n 
A 1 220 GLU 220 250 250 GLU GLU A . n 
A 1 221 ASN 221 251 251 ASN ASN A . n 
A 1 222 ILE 222 252 252 ILE ILE A . n 
A 1 223 ASP 223 253 253 ASP ASP A . n 
A 1 224 LEU 224 254 254 LEU LEU A . n 
A 1 225 ALA 225 255 255 ALA ALA A . n 
A 1 226 VAL 226 256 256 VAL VAL A . n 
A 1 227 GLN 227 257 257 GLN GLN A . n 
A 1 228 CYS 228 258 258 CYS CYS A . n 
A 1 229 LEU 229 259 259 LEU LEU A . n 
A 1 230 ASN 230 260 260 ASN ASN A . n 
A 1 231 GLU 231 261 261 GLU GLU A . n 
A 1 232 LEU 232 262 262 LEU LEU A . n 
A 1 233 ILE 233 263 263 ILE ILE A . n 
A 1 234 THR 234 264 264 THR THR A . n 
A 1 235 ASN 235 265 265 ASN ASN A . n 
A 1 236 ALA 236 266 266 ALA ALA A . n 
A 1 237 LEU 237 267 267 LEU LEU A . n 
A 1 238 HIS 238 268 268 HIS HIS A . n 
A 1 239 HIS 239 269 269 HIS HIS A . n 
A 1 240 ILE 240 270 270 ILE ILE A . n 
A 1 241 PRO 241 271 271 PRO PRO A . n 
A 1 242 ASP 242 272 272 ASP ASP A . n 
A 1 243 VAL 243 273 273 VAL VAL A . n 
A 1 244 ILE 244 274 274 ILE ILE A . n 
A 1 245 THR 245 275 275 THR THR A . n 
A 1 246 TYR 246 276 276 TYR TYR A . n 
A 1 247 LEU 247 277 277 LEU LEU A . n 
A 1 248 SER 248 278 278 SER SER A . n 
A 1 249 ARG 249 279 279 ARG ARG A . n 
A 1 250 LEU 250 280 280 LEU LEU A . n 
A 1 251 ARG 251 281 281 ARG ARG A . n 
A 1 252 ASN 252 282 282 ASN ASN A . n 
A 1 253 GLN 253 283 283 GLN GLN A . n 
A 1 254 SER 254 284 284 SER SER A . n 
A 1 255 VAL 255 285 285 VAL VAL A . n 
A 1 256 PHE 256 286 286 PHE PHE A . n 
A 1 257 ASN 257 287 287 ASN ASN A . n 
A 1 258 PHE 258 288 288 PHE PHE A . n 
A 1 259 CYS 259 289 289 CYS CYS A . n 
A 1 260 ALA 260 290 290 ALA ALA A . n 
A 1 261 ILE 261 291 291 ILE ILE A . n 
A 1 262 PRO 262 292 292 PRO PRO A . n 
A 1 263 GLN 263 293 293 GLN GLN A . n 
A 1 264 VAL 264 294 294 VAL VAL A . n 
A 1 265 MET 265 295 295 MET MET A . n 
A 1 266 ALA 266 296 296 ALA ALA A . n 
A 1 267 ILE 267 297 297 ILE ILE A . n 
A 1 268 ALA 268 298 298 ALA ALA A . n 
A 1 269 THR 269 299 299 THR THR A . n 
A 1 270 LEU 270 300 300 LEU LEU A . n 
A 1 271 ALA 271 301 301 ALA ALA A . n 
A 1 272 ALA 272 302 302 ALA ALA A . n 
A 1 273 CYS 273 303 303 CYS CYS A . n 
A 1 274 TYR 274 304 304 TYR TYR A . n 
A 1 275 ASN 275 305 305 ASN ASN A . n 
A 1 276 ASN 276 306 306 ASN ASN A . n 
A 1 277 GLN 277 307 307 GLN GLN A . n 
A 1 278 GLN 278 308 308 GLN GLN A . n 
A 1 279 VAL 279 309 309 VAL VAL A . n 
A 1 280 PHE 280 310 310 PHE PHE A . n 
A 1 281 LYS 281 311 311 LYS LYS A . n 
A 1 282 GLY 282 312 312 GLY GLY A . n 
A 1 283 ALA 283 313 313 ALA ALA A . n 
A 1 284 VAL 284 314 314 VAL VAL A . n 
A 1 285 LYS 285 315 315 LYS LYS A . n 
A 1 286 ILE 286 316 316 ILE ILE A . n 
A 1 287 ARG 287 317 ?   ?   ?   A . n 
A 1 288 LYS 288 318 ?   ?   ?   A . n 
A 1 289 GLY 289 319 ?   ?   ?   A . n 
A 1 290 GLN 290 320 ?   ?   ?   A . n 
A 1 291 ALA 291 321 ?   ?   ?   A . n 
A 1 292 VAL 292 322 ?   ?   ?   A . n 
A 1 293 THR 293 323 ?   ?   ?   A . n 
A 1 294 LEU 294 324 ?   ?   ?   A . n 
A 1 295 MET 295 325 ?   ?   ?   A . n 
A 1 296 MET 296 326 ?   ?   ?   A . n 
A 1 297 ASP 297 327 327 ASP ASP A . n 
A 1 298 ALA 298 328 328 ALA ALA A . n 
A 1 299 THR 299 329 329 THR THR A . n 
A 1 300 ASN 300 330 330 ASN ASN A . n 
A 1 301 MET 301 331 331 MET MET A . n 
A 1 302 PRO 302 332 332 PRO PRO A . n 
A 1 303 ALA 303 333 333 ALA ALA A . n 
A 1 304 VAL 304 334 334 VAL VAL A . n 
A 1 305 LYS 305 335 335 LYS LYS A . n 
A 1 306 ALA 306 336 336 ALA ALA A . n 
A 1 307 ILE 307 337 337 ILE ILE A . n 
A 1 308 ILE 308 338 338 ILE ILE A . n 
A 1 309 TYR 309 339 339 TYR TYR A . n 
A 1 310 GLN 310 340 340 GLN GLN A . n 
A 1 311 TYR 311 341 341 TYR TYR A . n 
A 1 312 MET 312 342 342 MET MET A . n 
A 1 313 GLU 313 343 343 GLU GLU A . n 
A 1 314 GLU 314 344 344 GLU GLU A . n 
A 1 315 ILE 315 345 345 ILE ILE A . n 
A 1 316 TYR 316 346 346 TYR TYR A . n 
A 1 317 HIS 317 347 347 HIS HIS A . n 
A 1 318 ARG 318 348 348 ARG ARG A . n 
A 1 319 ILE 319 349 349 ILE ILE A . n 
A 1 320 PRO 320 350 350 PRO PRO A . n 
A 1 321 ASP 321 351 351 ASP ASP A . n 
A 1 322 SER 322 352 352 SER SER A . n 
A 1 323 ASP 323 353 353 ASP ASP A . n 
A 1 324 PRO 324 354 354 PRO PRO A . n 
A 1 325 SER 325 355 355 SER SER A . n 
A 1 326 SER 326 356 356 SER SER A . n 
A 1 327 SER 327 357 357 SER SER A . n 
A 1 328 LYS 328 358 358 LYS LYS A . n 
A 1 329 THR 329 359 359 THR THR A . n 
A 1 330 ARG 330 360 360 ARG ARG A . n 
A 1 331 GLN 331 361 361 GLN GLN A . n 
A 1 332 ILE 332 362 362 ILE ILE A . n 
A 1 333 ILE 333 363 363 ILE ILE A . n 
A 1 334 SER 334 364 364 SER SER A . n 
A 1 335 THR 335 365 365 THR THR A . n 
A 1 336 ILE 336 366 366 ILE ILE A . n 
A 1 337 ARG 337 367 367 ARG ARG A . n 
A 1 338 THR 338 368 368 THR THR A . n 
A 1 339 GLN 339 369 369 GLN GLN A . n 
A 1 340 ASN 340 370 370 ASN ASN A . n 
B 1 1   MET 1   31  ?   ?   ?   B . n 
B 1 2   ASP 2   32  ?   ?   ?   B . n 
B 1 3   ARG 3   33  ?   ?   ?   B . n 
B 1 4   ASN 4   34  34  ASN ASN B . n 
B 1 5   SER 5   35  35  SER SER B . n 
B 1 6   LEU 6   36  36  LEU LEU B . n 
B 1 7   SER 7   37  37  SER SER B . n 
B 1 8   ASN 8   38  38  ASN ASN B . n 
B 1 9   SER 9   39  39  SER SER B . n 
B 1 10  LEU 10  40  40  LEU LEU B . n 
B 1 11  LYS 11  41  41  LYS LYS B . n 
B 1 12  THR 12  42  42  THR THR B . n 
B 1 13  CYS 13  43  43  CYS CYS B . n 
B 1 14  TYR 14  44  44  TYR TYR B . n 
B 1 15  LYS 15  45  45  LYS LYS B . n 
B 1 16  TYR 16  46  46  TYR TYR B . n 
B 1 17  LEU 17  47  47  LEU LEU B . n 
B 1 18  ASN 18  48  48  ASN ASN B . n 
B 1 19  GLN 19  49  49  GLN GLN B . n 
B 1 20  THR 20  50  50  THR THR B . n 
B 1 21  SER 21  51  51  SER SER B . n 
B 1 22  ARG 22  52  52  ARG ARG B . n 
B 1 23  SER 23  53  53  SER SER B . n 
B 1 24  PHE 24  54  54  PHE PHE B . n 
B 1 25  ALA 25  55  55  ALA ALA B . n 
B 1 26  ALA 26  56  56  ALA ALA B . n 
B 1 27  VAL 27  57  57  VAL VAL B . n 
B 1 28  ILE 28  58  58  ILE ILE B . n 
B 1 29  GLN 29  59  59  GLN GLN B . n 
B 1 30  ALA 30  60  60  ALA ALA B . n 
B 1 31  LEU 31  61  61  LEU LEU B . n 
B 1 32  ASP 32  62  62  ASP ASP B . n 
B 1 33  GLY 33  63  63  GLY GLY B . n 
B 1 34  GLU 34  64  64  GLU GLU B . n 
B 1 35  MET 35  65  65  MET MET B . n 
B 1 36  ARG 36  66  66  ARG ARG B . n 
B 1 37  ASN 37  67  67  ASN ASN B . n 
B 1 38  ALA 38  68  68  ALA ALA B . n 
B 1 39  VAL 39  69  69  VAL VAL B . n 
B 1 40  CYS 40  70  70  CYS CYS B . n 
B 1 41  ILE 41  71  71  ILE ILE B . n 
B 1 42  PHE 42  72  72  PHE PHE B . n 
B 1 43  TYR 43  73  73  TYR TYR B . n 
B 1 44  LEU 44  74  74  LEU LEU B . n 
B 1 45  VAL 45  75  75  VAL VAL B . n 
B 1 46  LEU 46  76  76  LEU LEU B . n 
B 1 47  ARG 47  77  77  ARG ARG B . n 
B 1 48  ALA 48  78  78  ALA ALA B . n 
B 1 49  LEU 49  79  79  LEU LEU B . n 
B 1 50  ASP 50  80  80  ASP ASP B . n 
B 1 51  THR 51  81  81  THR THR B . n 
B 1 52  LEU 52  82  82  LEU LEU B . n 
B 1 53  GLU 53  83  83  GLU GLU B . n 
B 1 54  ASP 54  84  84  ASP ASP B . n 
B 1 55  ASP 55  85  85  ASP ASP B . n 
B 1 56  MET 56  86  86  MET MET B . n 
B 1 57  THR 57  87  87  THR THR B . n 
B 1 58  ILE 58  88  88  ILE ILE B . n 
B 1 59  SER 59  89  89  SER SER B . n 
B 1 60  VAL 60  90  90  VAL VAL B . n 
B 1 61  GLU 61  91  91  GLU GLU B . n 
B 1 62  LYS 62  92  92  LYS LYS B . n 
B 1 63  LYS 63  93  93  LYS LYS B . n 
B 1 64  VAL 64  94  94  VAL VAL B . n 
B 1 65  PRO 65  95  95  PRO PRO B . n 
B 1 66  LEU 66  96  96  LEU LEU B . n 
B 1 67  LEU 67  97  97  LEU LEU B . n 
B 1 68  HIS 68  98  98  HIS HIS B . n 
B 1 69  ASN 69  99  99  ASN ASN B . n 
B 1 70  PHE 70  100 100 PHE PHE B . n 
B 1 71  HIS 71  101 101 HIS HIS B . n 
B 1 72  SER 72  102 102 SER SER B . n 
B 1 73  PHE 73  103 103 PHE PHE B . n 
B 1 74  LEU 74  104 104 LEU LEU B . n 
B 1 75  TYR 75  105 105 TYR TYR B . n 
B 1 76  GLN 76  106 106 GLN GLN B . n 
B 1 77  PRO 77  107 107 PRO PRO B . n 
B 1 78  ASP 78  108 108 ASP ASP B . n 
B 1 79  TRP 79  109 109 TRP TRP B . n 
B 1 80  ARG 80  110 110 ARG ARG B . n 
B 1 81  PHE 81  111 111 PHE PHE B . n 
B 1 82  MET 82  112 112 MET MET B . n 
B 1 83  GLU 83  113 113 GLU GLU B . n 
B 1 84  SER 84  114 114 SER SER B . n 
B 1 85  LYS 85  115 115 LYS LYS B . n 
B 1 86  GLU 86  116 116 GLU GLU B . n 
B 1 87  LYS 87  117 117 LYS LYS B . n 
B 1 88  ASP 88  118 118 ASP ASP B . n 
B 1 89  ARG 89  119 119 ARG ARG B . n 
B 1 90  GLN 90  120 120 GLN GLN B . n 
B 1 91  VAL 91  121 121 VAL VAL B . n 
B 1 92  LEU 92  122 122 LEU LEU B . n 
B 1 93  GLU 93  123 123 GLU GLU B . n 
B 1 94  ASP 94  124 124 ASP ASP B . n 
B 1 95  PHE 95  125 125 PHE PHE B . n 
B 1 96  PRO 96  126 126 PRO PRO B . n 
B 1 97  THR 97  127 127 THR THR B . n 
B 1 98  ILE 98  128 128 ILE ILE B . n 
B 1 99  SER 99  129 129 SER SER B . n 
B 1 100 LEU 100 130 130 LEU LEU B . n 
B 1 101 GLU 101 131 131 GLU GLU B . n 
B 1 102 PHE 102 132 132 PHE PHE B . n 
B 1 103 ARG 103 133 133 ARG ARG B . n 
B 1 104 ASN 104 134 134 ASN ASN B . n 
B 1 105 LEU 105 135 135 LEU LEU B . n 
B 1 106 ALA 106 136 136 ALA ALA B . n 
B 1 107 GLU 107 137 137 GLU GLU B . n 
B 1 108 LYS 108 138 138 LYS LYS B . n 
B 1 109 TYR 109 139 139 TYR TYR B . n 
B 1 110 GLN 110 140 140 GLN GLN B . n 
B 1 111 THR 111 141 141 THR THR B . n 
B 1 112 VAL 112 142 142 VAL VAL B . n 
B 1 113 ILE 113 143 143 ILE ILE B . n 
B 1 114 ALA 114 144 144 ALA ALA B . n 
B 1 115 ASP 115 145 145 ASP ASP B . n 
B 1 116 ILE 116 146 146 ILE ILE B . n 
B 1 117 CYS 117 147 147 CYS CYS B . n 
B 1 118 ARG 118 148 148 ARG ARG B . n 
B 1 119 ARG 119 149 149 ARG ARG B . n 
B 1 120 MET 120 150 150 MET MET B . n 
B 1 121 GLY 121 151 151 GLY GLY B . n 
B 1 122 ILE 122 152 152 ILE ILE B . n 
B 1 123 GLY 123 153 153 GLY GLY B . n 
B 1 124 MET 124 154 154 MET MET B . n 
B 1 125 ALA 125 155 155 ALA ALA B . n 
B 1 126 GLU 126 156 156 GLU GLU B . n 
B 1 127 PHE 127 157 157 PHE PHE B . n 
B 1 128 LEU 128 158 158 LEU LEU B . n 
B 1 129 ASP 129 159 159 ASP ASP B . n 
B 1 130 LYS 130 160 160 LYS LYS B . n 
B 1 131 HIS 131 161 161 HIS HIS B . n 
B 1 132 VAL 132 162 162 VAL VAL B . n 
B 1 133 THR 133 163 163 THR THR B . n 
B 1 134 SER 134 164 164 SER SER B . n 
B 1 135 GLU 135 165 165 GLU GLU B . n 
B 1 136 GLN 136 166 166 GLN GLN B . n 
B 1 137 GLU 137 167 167 GLU GLU B . n 
B 1 138 TRP 138 168 168 TRP TRP B . n 
B 1 139 ASP 139 169 169 ASP ASP B . n 
B 1 140 LYS 140 170 170 LYS LYS B . n 
B 1 141 TYR 141 171 171 TYR TYR B . n 
B 1 142 CYS 142 172 172 CYS CYS B . n 
B 1 143 HIS 143 173 173 HIS HIS B . n 
B 1 144 TYR 144 174 174 TYR TYR B . n 
B 1 145 VAL 145 175 175 VAL VAL B . n 
B 1 146 ALA 146 176 176 ALA ALA B . n 
B 1 147 GLY 147 177 177 GLY GLY B . n 
B 1 148 LEU 148 178 178 LEU LEU B . n 
B 1 149 VAL 149 179 179 VAL VAL B . n 
B 1 150 GLY 150 180 180 GLY GLY B . n 
B 1 151 ILE 151 181 181 ILE ILE B . n 
B 1 152 GLY 152 182 182 GLY GLY B . n 
B 1 153 LEU 153 183 183 LEU LEU B . n 
B 1 154 SER 154 184 184 SER SER B . n 
B 1 155 ARG 155 185 185 ARG ARG B . n 
B 1 156 LEU 156 186 186 LEU LEU B . n 
B 1 157 PHE 157 187 187 PHE PHE B . n 
B 1 158 SER 158 188 188 SER SER B . n 
B 1 159 ALA 159 189 189 ALA ALA B . n 
B 1 160 SER 160 190 190 SER SER B . n 
B 1 161 GLU 161 191 191 GLU GLU B . n 
B 1 162 PHE 162 192 192 PHE PHE B . n 
B 1 163 GLU 163 193 193 GLU GLU B . n 
B 1 164 ASP 164 194 194 ASP ASP B . n 
B 1 165 PRO 165 195 195 PRO PRO B . n 
B 1 166 LEU 166 196 196 LEU LEU B . n 
B 1 167 VAL 167 197 197 VAL VAL B . n 
B 1 168 GLY 168 198 198 GLY GLY B . n 
B 1 169 GLU 169 199 199 GLU GLU B . n 
B 1 170 ASP 170 200 200 ASP ASP B . n 
B 1 171 THR 171 201 201 THR THR B . n 
B 1 172 GLU 172 202 202 GLU GLU B . n 
B 1 173 ARG 173 203 203 ARG ARG B . n 
B 1 174 ALA 174 204 204 ALA ALA B . n 
B 1 175 ASN 175 205 205 ASN ASN B . n 
B 1 176 SER 176 206 206 SER SER B . n 
B 1 177 MET 177 207 207 MET MET B . n 
B 1 178 GLY 178 208 208 GLY GLY B . n 
B 1 179 LEU 179 209 209 LEU LEU B . n 
B 1 180 PHE 180 210 210 PHE PHE B . n 
B 1 181 LEU 181 211 211 LEU LEU B . n 
B 1 182 GLN 182 212 212 GLN GLN B . n 
B 1 183 LYS 183 213 213 LYS LYS B . n 
B 1 184 THR 184 214 214 THR THR B . n 
B 1 185 ASN 185 215 215 ASN ASN B . n 
B 1 186 ILE 186 216 216 ILE ILE B . n 
B 1 187 ILE 187 217 217 ILE ILE B . n 
B 1 188 ARG 188 218 218 ARG ARG B . n 
B 1 189 ASP 189 219 219 ASP ASP B . n 
B 1 190 TYR 190 220 220 TYR TYR B . n 
B 1 191 LEU 191 221 221 LEU LEU B . n 
B 1 192 GLU 192 222 222 GLU GLU B . n 
B 1 193 ASP 193 223 223 ASP ASP B . n 
B 1 194 GLN 194 224 224 GLN GLN B . n 
B 1 195 GLN 195 225 225 GLN GLN B . n 
B 1 196 GLY 196 226 226 GLY GLY B . n 
B 1 197 GLY 197 227 227 GLY GLY B . n 
B 1 198 ARG 198 228 228 ARG ARG B . n 
B 1 199 GLU 199 229 229 GLU GLU B . n 
B 1 200 PHE 200 230 230 PHE PHE B . n 
B 1 201 TRP 201 231 231 TRP TRP B . n 
B 1 202 PRO 202 232 232 PRO PRO B . n 
B 1 203 GLN 203 233 233 GLN GLN B . n 
B 1 204 GLU 204 234 234 GLU GLU B . n 
B 1 205 VAL 205 235 235 VAL VAL B . n 
B 1 206 TRP 206 236 236 TRP TRP B . n 
B 1 207 SER 207 237 237 SER SER B . n 
B 1 208 ARG 208 238 238 ARG ARG B . n 
B 1 209 TYR 209 239 239 TYR TYR B . n 
B 1 210 VAL 210 240 240 VAL VAL B . n 
B 1 211 LYS 211 241 241 LYS LYS B . n 
B 1 212 LYS 212 242 242 LYS LYS B . n 
B 1 213 LEU 213 243 243 LEU LEU B . n 
B 1 214 GLY 214 244 244 GLY GLY B . n 
B 1 215 ASP 215 245 245 ASP ASP B . n 
B 1 216 PHE 216 246 246 PHE PHE B . n 
B 1 217 ALA 217 247 247 ALA ALA B . n 
B 1 218 LYS 218 248 248 LYS LYS B . n 
B 1 219 PRO 219 249 249 PRO PRO B . n 
B 1 220 GLU 220 250 250 GLU GLU B . n 
B 1 221 ASN 221 251 251 ASN ASN B . n 
B 1 222 ILE 222 252 252 ILE ILE B . n 
B 1 223 ASP 223 253 253 ASP ASP B . n 
B 1 224 LEU 224 254 254 LEU LEU B . n 
B 1 225 ALA 225 255 255 ALA ALA B . n 
B 1 226 VAL 226 256 256 VAL VAL B . n 
B 1 227 GLN 227 257 257 GLN GLN B . n 
B 1 228 CYS 228 258 258 CYS CYS B . n 
B 1 229 LEU 229 259 259 LEU LEU B . n 
B 1 230 ASN 230 260 260 ASN ASN B . n 
B 1 231 GLU 231 261 261 GLU GLU B . n 
B 1 232 LEU 232 262 262 LEU LEU B . n 
B 1 233 ILE 233 263 263 ILE ILE B . n 
B 1 234 THR 234 264 264 THR THR B . n 
B 1 235 ASN 235 265 265 ASN ASN B . n 
B 1 236 ALA 236 266 266 ALA ALA B . n 
B 1 237 LEU 237 267 267 LEU LEU B . n 
B 1 238 HIS 238 268 268 HIS HIS B . n 
B 1 239 HIS 239 269 269 HIS HIS B . n 
B 1 240 ILE 240 270 270 ILE ILE B . n 
B 1 241 PRO 241 271 271 PRO PRO B . n 
B 1 242 ASP 242 272 272 ASP ASP B . n 
B 1 243 VAL 243 273 273 VAL VAL B . n 
B 1 244 ILE 244 274 274 ILE ILE B . n 
B 1 245 THR 245 275 275 THR THR B . n 
B 1 246 TYR 246 276 276 TYR TYR B . n 
B 1 247 LEU 247 277 277 LEU LEU B . n 
B 1 248 SER 248 278 278 SER SER B . n 
B 1 249 ARG 249 279 279 ARG ARG B . n 
B 1 250 LEU 250 280 280 LEU LEU B . n 
B 1 251 ARG 251 281 281 ARG ARG B . n 
B 1 252 ASN 252 282 282 ASN ASN B . n 
B 1 253 GLN 253 283 283 GLN GLN B . n 
B 1 254 SER 254 284 284 SER SER B . n 
B 1 255 VAL 255 285 285 VAL VAL B . n 
B 1 256 PHE 256 286 286 PHE PHE B . n 
B 1 257 ASN 257 287 287 ASN ASN B . n 
B 1 258 PHE 258 288 288 PHE PHE B . n 
B 1 259 CYS 259 289 289 CYS CYS B . n 
B 1 260 ALA 260 290 290 ALA ALA B . n 
B 1 261 ILE 261 291 291 ILE ILE B . n 
B 1 262 PRO 262 292 292 PRO PRO B . n 
B 1 263 GLN 263 293 293 GLN GLN B . n 
B 1 264 VAL 264 294 294 VAL VAL B . n 
B 1 265 MET 265 295 295 MET MET B . n 
B 1 266 ALA 266 296 296 ALA ALA B . n 
B 1 267 ILE 267 297 297 ILE ILE B . n 
B 1 268 ALA 268 298 298 ALA ALA B . n 
B 1 269 THR 269 299 299 THR THR B . n 
B 1 270 LEU 270 300 300 LEU LEU B . n 
B 1 271 ALA 271 301 301 ALA ALA B . n 
B 1 272 ALA 272 302 302 ALA ALA B . n 
B 1 273 CYS 273 303 303 CYS CYS B . n 
B 1 274 TYR 274 304 304 TYR TYR B . n 
B 1 275 ASN 275 305 305 ASN ASN B . n 
B 1 276 ASN 276 306 306 ASN ASN B . n 
B 1 277 GLN 277 307 307 GLN GLN B . n 
B 1 278 GLN 278 308 308 GLN GLN B . n 
B 1 279 VAL 279 309 309 VAL VAL B . n 
B 1 280 PHE 280 310 310 PHE PHE B . n 
B 1 281 LYS 281 311 311 LYS LYS B . n 
B 1 282 GLY 282 312 312 GLY ALA B . n 
B 1 283 ALA 283 313 313 ALA ALA B . n 
B 1 284 VAL 284 314 314 VAL ALA B . n 
B 1 285 LYS 285 315 ?   ?   ?   B . n 
B 1 286 ILE 286 316 ?   ?   ?   B . n 
B 1 287 ARG 287 317 ?   ?   ?   B . n 
B 1 288 LYS 288 318 ?   ?   ?   B . n 
B 1 289 GLY 289 319 ?   ?   ?   B . n 
B 1 290 GLN 290 320 ?   ?   ?   B . n 
B 1 291 ALA 291 321 ?   ?   ?   B . n 
B 1 292 VAL 292 322 ?   ?   ?   B . n 
B 1 293 THR 293 323 ?   ?   ?   B . n 
B 1 294 LEU 294 324 ?   ?   ?   B . n 
B 1 295 MET 295 325 ?   ?   ?   B . n 
B 1 296 MET 296 326 ?   ?   ?   B . n 
B 1 297 ASP 297 327 ?   ?   ?   B . n 
B 1 298 ALA 298 328 328 ALA ALA B . n 
B 1 299 THR 299 329 329 THR THR B . n 
B 1 300 ASN 300 330 330 ASN ASN B . n 
B 1 301 MET 301 331 331 MET MET B . n 
B 1 302 PRO 302 332 332 PRO PRO B . n 
B 1 303 ALA 303 333 333 ALA ALA B . n 
B 1 304 VAL 304 334 334 VAL VAL B . n 
B 1 305 LYS 305 335 335 LYS LYS B . n 
B 1 306 ALA 306 336 336 ALA ALA B . n 
B 1 307 ILE 307 337 337 ILE ILE B . n 
B 1 308 ILE 308 338 338 ILE ILE B . n 
B 1 309 TYR 309 339 339 TYR TYR B . n 
B 1 310 GLN 310 340 340 GLN GLN B . n 
B 1 311 TYR 311 341 341 TYR TYR B . n 
B 1 312 MET 312 342 342 MET MET B . n 
B 1 313 GLU 313 343 343 GLU GLU B . n 
B 1 314 GLU 314 344 344 GLU GLU B . n 
B 1 315 ILE 315 345 345 ILE ILE B . n 
B 1 316 TYR 316 346 346 TYR TYR B . n 
B 1 317 HIS 317 347 347 HIS HIS B . n 
B 1 318 ARG 318 348 348 ARG ARG B . n 
B 1 319 ILE 319 349 349 ILE ILE B . n 
B 1 320 PRO 320 350 350 PRO PRO B . n 
B 1 321 ASP 321 351 351 ASP ASP B . n 
B 1 322 SER 322 352 352 SER SER B . n 
B 1 323 ASP 323 353 353 ASP ASP B . n 
B 1 324 PRO 324 354 354 PRO PRO B . n 
B 1 325 SER 325 355 355 SER SER B . n 
B 1 326 SER 326 356 356 SER SER B . n 
B 1 327 SER 327 357 357 SER SER B . n 
B 1 328 LYS 328 358 358 LYS LYS B . n 
B 1 329 THR 329 359 359 THR THR B . n 
B 1 330 ARG 330 360 360 ARG ARG B . n 
B 1 331 GLN 331 361 361 GLN GLN B . n 
B 1 332 ILE 332 362 362 ILE ILE B . n 
B 1 333 ILE 333 363 363 ILE ILE B . n 
B 1 334 SER 334 364 364 SER SER B . n 
B 1 335 THR 335 365 365 THR THR B . n 
B 1 336 ILE 336 366 366 ILE ILE B . n 
B 1 337 ARG 337 367 367 ARG ARG B . n 
B 1 338 THR 338 368 368 THR THR B . n 
B 1 339 GLN 339 369 369 GLN GLN B . n 
B 1 340 ASN 340 370 370 ASN ASN B . n 
C 1 1   MET 1   31  ?   ?   ?   C . n 
C 1 2   ASP 2   32  ?   ?   ?   C . n 
C 1 3   ARG 3   33  ?   ?   ?   C . n 
C 1 4   ASN 4   34  ?   ?   ?   C . n 
C 1 5   SER 5   35  ?   ?   ?   C . n 
C 1 6   LEU 6   36  ?   ?   ?   C . n 
C 1 7   SER 7   37  ?   ?   ?   C . n 
C 1 8   ASN 8   38  38  ASN ASN C . n 
C 1 9   SER 9   39  39  SER SER C . n 
C 1 10  LEU 10  40  40  LEU LEU C . n 
C 1 11  LYS 11  41  41  LYS LYS C . n 
C 1 12  THR 12  42  42  THR THR C . n 
C 1 13  CYS 13  43  43  CYS CYS C . n 
C 1 14  TYR 14  44  44  TYR TYR C . n 
C 1 15  LYS 15  45  45  LYS LYS C . n 
C 1 16  TYR 16  46  46  TYR TYR C . n 
C 1 17  LEU 17  47  47  LEU LEU C . n 
C 1 18  ASN 18  48  48  ASN ASN C . n 
C 1 19  GLN 19  49  49  GLN GLN C . n 
C 1 20  THR 20  50  50  THR THR C . n 
C 1 21  SER 21  51  51  SER SER C . n 
C 1 22  ARG 22  52  52  ARG ARG C . n 
C 1 23  SER 23  53  53  SER SER C . n 
C 1 24  PHE 24  54  54  PHE PHE C . n 
C 1 25  ALA 25  55  55  ALA ALA C . n 
C 1 26  ALA 26  56  56  ALA ALA C . n 
C 1 27  VAL 27  57  57  VAL VAL C . n 
C 1 28  ILE 28  58  58  ILE ILE C . n 
C 1 29  GLN 29  59  59  GLN GLN C . n 
C 1 30  ALA 30  60  60  ALA ALA C . n 
C 1 31  LEU 31  61  61  LEU LEU C . n 
C 1 32  ASP 32  62  62  ASP ASP C . n 
C 1 33  GLY 33  63  63  GLY GLY C . n 
C 1 34  GLU 34  64  64  GLU GLU C . n 
C 1 35  MET 35  65  65  MET MET C . n 
C 1 36  ARG 36  66  66  ARG ARG C . n 
C 1 37  ASN 37  67  67  ASN ASN C . n 
C 1 38  ALA 38  68  68  ALA ALA C . n 
C 1 39  VAL 39  69  69  VAL VAL C . n 
C 1 40  CYS 40  70  70  CYS CYS C . n 
C 1 41  ILE 41  71  71  ILE ILE C . n 
C 1 42  PHE 42  72  72  PHE PHE C . n 
C 1 43  TYR 43  73  73  TYR TYR C . n 
C 1 44  LEU 44  74  74  LEU LEU C . n 
C 1 45  VAL 45  75  75  VAL VAL C . n 
C 1 46  LEU 46  76  76  LEU LEU C . n 
C 1 47  ARG 47  77  77  ARG ARG C . n 
C 1 48  ALA 48  78  78  ALA ALA C . n 
C 1 49  LEU 49  79  79  LEU LEU C . n 
C 1 50  ASP 50  80  80  ASP ASP C . n 
C 1 51  THR 51  81  81  THR THR C . n 
C 1 52  LEU 52  82  82  LEU LEU C . n 
C 1 53  GLU 53  83  83  GLU GLU C . n 
C 1 54  ASP 54  84  84  ASP ASP C . n 
C 1 55  ASP 55  85  85  ASP ASP C . n 
C 1 56  MET 56  86  86  MET MET C . n 
C 1 57  THR 57  87  87  THR THR C . n 
C 1 58  ILE 58  88  88  ILE ILE C . n 
C 1 59  SER 59  89  89  SER SER C . n 
C 1 60  VAL 60  90  90  VAL VAL C . n 
C 1 61  GLU 61  91  91  GLU GLU C . n 
C 1 62  LYS 62  92  92  LYS LYS C . n 
C 1 63  LYS 63  93  93  LYS LYS C . n 
C 1 64  VAL 64  94  94  VAL VAL C . n 
C 1 65  PRO 65  95  95  PRO PRO C . n 
C 1 66  LEU 66  96  96  LEU LEU C . n 
C 1 67  LEU 67  97  97  LEU LEU C . n 
C 1 68  HIS 68  98  98  HIS HIS C . n 
C 1 69  ASN 69  99  99  ASN ASN C . n 
C 1 70  PHE 70  100 100 PHE PHE C . n 
C 1 71  HIS 71  101 101 HIS HIS C . n 
C 1 72  SER 72  102 102 SER SER C . n 
C 1 73  PHE 73  103 103 PHE PHE C . n 
C 1 74  LEU 74  104 104 LEU LEU C . n 
C 1 75  TYR 75  105 105 TYR TYR C . n 
C 1 76  GLN 76  106 106 GLN GLN C . n 
C 1 77  PRO 77  107 107 PRO PRO C . n 
C 1 78  ASP 78  108 108 ASP ASP C . n 
C 1 79  TRP 79  109 109 TRP TRP C . n 
C 1 80  ARG 80  110 110 ARG ARG C . n 
C 1 81  PHE 81  111 111 PHE PHE C . n 
C 1 82  MET 82  112 112 MET MET C . n 
C 1 83  GLU 83  113 113 GLU GLU C . n 
C 1 84  SER 84  114 114 SER SER C . n 
C 1 85  LYS 85  115 115 LYS LYS C . n 
C 1 86  GLU 86  116 116 GLU GLU C . n 
C 1 87  LYS 87  117 117 LYS LYS C . n 
C 1 88  ASP 88  118 118 ASP ASP C . n 
C 1 89  ARG 89  119 119 ARG ARG C . n 
C 1 90  GLN 90  120 120 GLN GLN C . n 
C 1 91  VAL 91  121 121 VAL VAL C . n 
C 1 92  LEU 92  122 122 LEU LEU C . n 
C 1 93  GLU 93  123 123 GLU GLU C . n 
C 1 94  ASP 94  124 124 ASP ASP C . n 
C 1 95  PHE 95  125 125 PHE PHE C . n 
C 1 96  PRO 96  126 126 PRO PRO C . n 
C 1 97  THR 97  127 127 THR THR C . n 
C 1 98  ILE 98  128 128 ILE ILE C . n 
C 1 99  SER 99  129 129 SER SER C . n 
C 1 100 LEU 100 130 130 LEU LEU C . n 
C 1 101 GLU 101 131 131 GLU GLU C . n 
C 1 102 PHE 102 132 132 PHE PHE C . n 
C 1 103 ARG 103 133 133 ARG ARG C . n 
C 1 104 ASN 104 134 134 ASN ASN C . n 
C 1 105 LEU 105 135 135 LEU LEU C . n 
C 1 106 ALA 106 136 136 ALA ALA C . n 
C 1 107 GLU 107 137 137 GLU GLU C . n 
C 1 108 LYS 108 138 138 LYS LYS C . n 
C 1 109 TYR 109 139 139 TYR TYR C . n 
C 1 110 GLN 110 140 140 GLN GLN C . n 
C 1 111 THR 111 141 141 THR THR C . n 
C 1 112 VAL 112 142 142 VAL VAL C . n 
C 1 113 ILE 113 143 143 ILE ILE C . n 
C 1 114 ALA 114 144 144 ALA ALA C . n 
C 1 115 ASP 115 145 145 ASP ASP C . n 
C 1 116 ILE 116 146 146 ILE ILE C . n 
C 1 117 CYS 117 147 147 CYS CYS C . n 
C 1 118 ARG 118 148 148 ARG ARG C . n 
C 1 119 ARG 119 149 149 ARG ARG C . n 
C 1 120 MET 120 150 150 MET MET C . n 
C 1 121 GLY 121 151 151 GLY GLY C . n 
C 1 122 ILE 122 152 152 ILE ILE C . n 
C 1 123 GLY 123 153 153 GLY GLY C . n 
C 1 124 MET 124 154 154 MET MET C . n 
C 1 125 ALA 125 155 155 ALA ALA C . n 
C 1 126 GLU 126 156 156 GLU GLU C . n 
C 1 127 PHE 127 157 157 PHE PHE C . n 
C 1 128 LEU 128 158 158 LEU LEU C . n 
C 1 129 ASP 129 159 159 ASP ASP C . n 
C 1 130 LYS 130 160 160 LYS LYS C . n 
C 1 131 HIS 131 161 161 HIS HIS C . n 
C 1 132 VAL 132 162 162 VAL VAL C . n 
C 1 133 THR 133 163 163 THR THR C . n 
C 1 134 SER 134 164 164 SER SER C . n 
C 1 135 GLU 135 165 165 GLU GLU C . n 
C 1 136 GLN 136 166 166 GLN GLN C . n 
C 1 137 GLU 137 167 167 GLU GLU C . n 
C 1 138 TRP 138 168 168 TRP TRP C . n 
C 1 139 ASP 139 169 169 ASP ASP C . n 
C 1 140 LYS 140 170 170 LYS LYS C . n 
C 1 141 TYR 141 171 171 TYR TYR C . n 
C 1 142 CYS 142 172 172 CYS CYS C . n 
C 1 143 HIS 143 173 173 HIS HIS C . n 
C 1 144 TYR 144 174 174 TYR TYR C . n 
C 1 145 VAL 145 175 175 VAL VAL C . n 
C 1 146 ALA 146 176 176 ALA ALA C . n 
C 1 147 GLY 147 177 177 GLY GLY C . n 
C 1 148 LEU 148 178 178 LEU LEU C . n 
C 1 149 VAL 149 179 179 VAL VAL C . n 
C 1 150 GLY 150 180 180 GLY GLY C . n 
C 1 151 ILE 151 181 181 ILE ILE C . n 
C 1 152 GLY 152 182 182 GLY GLY C . n 
C 1 153 LEU 153 183 183 LEU LEU C . n 
C 1 154 SER 154 184 184 SER SER C . n 
C 1 155 ARG 155 185 185 ARG ARG C . n 
C 1 156 LEU 156 186 186 LEU LEU C . n 
C 1 157 PHE 157 187 187 PHE PHE C . n 
C 1 158 SER 158 188 188 SER SER C . n 
C 1 159 ALA 159 189 189 ALA ALA C . n 
C 1 160 SER 160 190 190 SER SER C . n 
C 1 161 GLU 161 191 191 GLU GLU C . n 
C 1 162 PHE 162 192 192 PHE PHE C . n 
C 1 163 GLU 163 193 193 GLU GLU C . n 
C 1 164 ASP 164 194 194 ASP ASP C . n 
C 1 165 PRO 165 195 195 PRO PRO C . n 
C 1 166 LEU 166 196 196 LEU LEU C . n 
C 1 167 VAL 167 197 197 VAL VAL C . n 
C 1 168 GLY 168 198 198 GLY GLY C . n 
C 1 169 GLU 169 199 199 GLU GLU C . n 
C 1 170 ASP 170 200 200 ASP ASP C . n 
C 1 171 THR 171 201 201 THR THR C . n 
C 1 172 GLU 172 202 202 GLU GLU C . n 
C 1 173 ARG 173 203 203 ARG ARG C . n 
C 1 174 ALA 174 204 204 ALA ALA C . n 
C 1 175 ASN 175 205 205 ASN ASN C . n 
C 1 176 SER 176 206 206 SER SER C . n 
C 1 177 MET 177 207 207 MET MET C . n 
C 1 178 GLY 178 208 208 GLY GLY C . n 
C 1 179 LEU 179 209 209 LEU LEU C . n 
C 1 180 PHE 180 210 210 PHE PHE C . n 
C 1 181 LEU 181 211 211 LEU LEU C . n 
C 1 182 GLN 182 212 212 GLN GLN C . n 
C 1 183 LYS 183 213 213 LYS LYS C . n 
C 1 184 THR 184 214 214 THR THR C . n 
C 1 185 ASN 185 215 215 ASN ASN C . n 
C 1 186 ILE 186 216 216 ILE ILE C . n 
C 1 187 ILE 187 217 217 ILE ILE C . n 
C 1 188 ARG 188 218 218 ARG ARG C . n 
C 1 189 ASP 189 219 219 ASP ASP C . n 
C 1 190 TYR 190 220 220 TYR TYR C . n 
C 1 191 LEU 191 221 221 LEU LEU C . n 
C 1 192 GLU 192 222 222 GLU GLU C . n 
C 1 193 ASP 193 223 223 ASP ASP C . n 
C 1 194 GLN 194 224 224 GLN GLN C . n 
C 1 195 GLN 195 225 225 GLN GLN C . n 
C 1 196 GLY 196 226 226 GLY GLY C . n 
C 1 197 GLY 197 227 227 GLY GLY C . n 
C 1 198 ARG 198 228 228 ARG ARG C . n 
C 1 199 GLU 199 229 229 GLU GLU C . n 
C 1 200 PHE 200 230 230 PHE PHE C . n 
C 1 201 TRP 201 231 231 TRP TRP C . n 
C 1 202 PRO 202 232 232 PRO PRO C . n 
C 1 203 GLN 203 233 233 GLN GLN C . n 
C 1 204 GLU 204 234 234 GLU GLU C . n 
C 1 205 VAL 205 235 235 VAL VAL C . n 
C 1 206 TRP 206 236 236 TRP TRP C . n 
C 1 207 SER 207 237 237 SER SER C . n 
C 1 208 ARG 208 238 238 ARG ARG C . n 
C 1 209 TYR 209 239 239 TYR TYR C . n 
C 1 210 VAL 210 240 240 VAL VAL C . n 
C 1 211 LYS 211 241 241 LYS LYS C . n 
C 1 212 LYS 212 242 242 LYS LYS C . n 
C 1 213 LEU 213 243 243 LEU LEU C . n 
C 1 214 GLY 214 244 244 GLY GLY C . n 
C 1 215 ASP 215 245 245 ASP ASP C . n 
C 1 216 PHE 216 246 246 PHE PHE C . n 
C 1 217 ALA 217 247 247 ALA ALA C . n 
C 1 218 LYS 218 248 248 LYS LYS C . n 
C 1 219 PRO 219 249 249 PRO PRO C . n 
C 1 220 GLU 220 250 250 GLU GLU C . n 
C 1 221 ASN 221 251 251 ASN ASN C . n 
C 1 222 ILE 222 252 252 ILE ILE C . n 
C 1 223 ASP 223 253 253 ASP ASP C . n 
C 1 224 LEU 224 254 254 LEU LEU C . n 
C 1 225 ALA 225 255 255 ALA ALA C . n 
C 1 226 VAL 226 256 256 VAL VAL C . n 
C 1 227 GLN 227 257 257 GLN GLN C . n 
C 1 228 CYS 228 258 258 CYS CYS C . n 
C 1 229 LEU 229 259 259 LEU LEU C . n 
C 1 230 ASN 230 260 260 ASN ASN C . n 
C 1 231 GLU 231 261 261 GLU GLU C . n 
C 1 232 LEU 232 262 262 LEU LEU C . n 
C 1 233 ILE 233 263 263 ILE ILE C . n 
C 1 234 THR 234 264 264 THR THR C . n 
C 1 235 ASN 235 265 265 ASN ASN C . n 
C 1 236 ALA 236 266 266 ALA ALA C . n 
C 1 237 LEU 237 267 267 LEU LEU C . n 
C 1 238 HIS 238 268 268 HIS HIS C . n 
C 1 239 HIS 239 269 269 HIS HIS C . n 
C 1 240 ILE 240 270 270 ILE ILE C . n 
C 1 241 PRO 241 271 271 PRO PRO C . n 
C 1 242 ASP 242 272 272 ASP ASP C . n 
C 1 243 VAL 243 273 273 VAL VAL C . n 
C 1 244 ILE 244 274 274 ILE ILE C . n 
C 1 245 THR 245 275 275 THR THR C . n 
C 1 246 TYR 246 276 276 TYR TYR C . n 
C 1 247 LEU 247 277 277 LEU LEU C . n 
C 1 248 SER 248 278 278 SER SER C . n 
C 1 249 ARG 249 279 279 ARG ARG C . n 
C 1 250 LEU 250 280 280 LEU LEU C . n 
C 1 251 ARG 251 281 281 ARG ARG C . n 
C 1 252 ASN 252 282 282 ASN ASN C . n 
C 1 253 GLN 253 283 283 GLN GLN C . n 
C 1 254 SER 254 284 284 SER SER C . n 
C 1 255 VAL 255 285 285 VAL VAL C . n 
C 1 256 PHE 256 286 286 PHE PHE C . n 
C 1 257 ASN 257 287 287 ASN ASN C . n 
C 1 258 PHE 258 288 288 PHE PHE C . n 
C 1 259 CYS 259 289 289 CYS CYS C . n 
C 1 260 ALA 260 290 290 ALA ALA C . n 
C 1 261 ILE 261 291 291 ILE ILE C . n 
C 1 262 PRO 262 292 292 PRO PRO C . n 
C 1 263 GLN 263 293 293 GLN GLN C . n 
C 1 264 VAL 264 294 294 VAL VAL C . n 
C 1 265 MET 265 295 295 MET MET C . n 
C 1 266 ALA 266 296 296 ALA ALA C . n 
C 1 267 ILE 267 297 297 ILE ILE C . n 
C 1 268 ALA 268 298 298 ALA ALA C . n 
C 1 269 THR 269 299 299 THR THR C . n 
C 1 270 LEU 270 300 300 LEU LEU C . n 
C 1 271 ALA 271 301 301 ALA ALA C . n 
C 1 272 ALA 272 302 302 ALA ALA C . n 
C 1 273 CYS 273 303 303 CYS CYS C . n 
C 1 274 TYR 274 304 304 TYR TYR C . n 
C 1 275 ASN 275 305 305 ASN ASN C . n 
C 1 276 ASN 276 306 306 ASN ASN C . n 
C 1 277 GLN 277 307 307 GLN GLN C . n 
C 1 278 GLN 278 308 308 GLN GLN C . n 
C 1 279 VAL 279 309 309 VAL VAL C . n 
C 1 280 PHE 280 310 310 PHE PHE C . n 
C 1 281 LYS 281 311 311 LYS LYS C . n 
C 1 282 GLY 282 312 312 GLY GLY C . n 
C 1 283 ALA 283 313 313 ALA ALA C . n 
C 1 284 VAL 284 314 314 VAL ALA C . n 
C 1 285 LYS 285 315 ?   ?   ?   C . n 
C 1 286 ILE 286 316 ?   ?   ?   C . n 
C 1 287 ARG 287 317 ?   ?   ?   C . n 
C 1 288 LYS 288 318 ?   ?   ?   C . n 
C 1 289 GLY 289 319 ?   ?   ?   C . n 
C 1 290 GLN 290 320 ?   ?   ?   C . n 
C 1 291 ALA 291 321 ?   ?   ?   C . n 
C 1 292 VAL 292 322 ?   ?   ?   C . n 
C 1 293 THR 293 323 ?   ?   ?   C . n 
C 1 294 LEU 294 324 ?   ?   ?   C . n 
C 1 295 MET 295 325 ?   ?   ?   C . n 
C 1 296 MET 296 326 ?   ?   ?   C . n 
C 1 297 ASP 297 327 ?   ?   ?   C . n 
C 1 298 ALA 298 328 328 ALA ALA C . n 
C 1 299 THR 299 329 329 THR THR C . n 
C 1 300 ASN 300 330 330 ASN ASN C . n 
C 1 301 MET 301 331 331 MET MET C . n 
C 1 302 PRO 302 332 332 PRO PRO C . n 
C 1 303 ALA 303 333 333 ALA ALA C . n 
C 1 304 VAL 304 334 334 VAL VAL C . n 
C 1 305 LYS 305 335 335 LYS LYS C . n 
C 1 306 ALA 306 336 336 ALA ALA C . n 
C 1 307 ILE 307 337 337 ILE ILE C . n 
C 1 308 ILE 308 338 338 ILE ILE C . n 
C 1 309 TYR 309 339 339 TYR TYR C . n 
C 1 310 GLN 310 340 340 GLN GLN C . n 
C 1 311 TYR 311 341 341 TYR TYR C . n 
C 1 312 MET 312 342 342 MET MET C . n 
C 1 313 GLU 313 343 343 GLU GLU C . n 
C 1 314 GLU 314 344 344 GLU GLU C . n 
C 1 315 ILE 315 345 345 ILE ILE C . n 
C 1 316 TYR 316 346 346 TYR TYR C . n 
C 1 317 HIS 317 347 347 HIS HIS C . n 
C 1 318 ARG 318 348 348 ARG ARG C . n 
C 1 319 ILE 319 349 349 ILE ILE C . n 
C 1 320 PRO 320 350 350 PRO PRO C . n 
C 1 321 ASP 321 351 351 ASP ASP C . n 
C 1 322 SER 322 352 352 SER SER C . n 
C 1 323 ASP 323 353 353 ASP ASP C . n 
C 1 324 PRO 324 354 354 PRO PRO C . n 
C 1 325 SER 325 355 355 SER SER C . n 
C 1 326 SER 326 356 356 SER SER C . n 
C 1 327 SER 327 357 357 SER SER C . n 
C 1 328 LYS 328 358 358 LYS LYS C . n 
C 1 329 THR 329 359 359 THR THR C . n 
C 1 330 ARG 330 360 360 ARG ARG C . n 
C 1 331 GLN 331 361 361 GLN GLN C . n 
C 1 332 ILE 332 362 362 ILE ILE C . n 
C 1 333 ILE 333 363 363 ILE ILE C . n 
C 1 334 SER 334 364 364 SER SER C . n 
C 1 335 THR 335 365 365 THR THR C . n 
C 1 336 ILE 336 366 366 ILE ILE C . n 
C 1 337 ARG 337 367 367 ARG ARG C . n 
C 1 338 THR 338 368 368 THR THR C . n 
C 1 339 GLN 339 369 369 GLN GLN C . n 
C 1 340 ASN 340 370 370 ASN ASN C . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 2 IN0 1   991  991  IN0 IN1 A . 
E 2 IN0 1   992  992  IN0 IN1 B . 
F 2 IN0 1   995  993  IN0 IN1 C . 
G 3 HOH 1   992  4    HOH HOH A . 
G 3 HOH 2   993  9    HOH HOH A . 
G 3 HOH 3   994  14   HOH HOH A . 
G 3 HOH 4   995  18   HOH HOH A . 
G 3 HOH 5   996  22   HOH HOH A . 
G 3 HOH 6   997  24   HOH HOH A . 
G 3 HOH 7   998  26   HOH HOH A . 
G 3 HOH 8   999  32   HOH HOH A . 
G 3 HOH 9   1000 36   HOH HOH A . 
G 3 HOH 10  1001 39   HOH HOH A . 
G 3 HOH 11  1002 47   HOH HOH A . 
G 3 HOH 12  1003 60   HOH HOH A . 
G 3 HOH 13  1004 65   HOH HOH A . 
G 3 HOH 14  1005 74   HOH HOH A . 
G 3 HOH 15  1006 82   HOH HOH A . 
G 3 HOH 16  1007 87   HOH HOH A . 
G 3 HOH 17  1008 89   HOH HOH A . 
G 3 HOH 18  1009 94   HOH HOH A . 
G 3 HOH 19  1010 95   HOH HOH A . 
G 3 HOH 20  1011 104  HOH HOH A . 
G 3 HOH 21  1012 106  HOH HOH A . 
G 3 HOH 22  1013 109  HOH HOH A . 
G 3 HOH 23  1014 111  HOH HOH A . 
G 3 HOH 24  1015 119  HOH HOH A . 
G 3 HOH 25  1016 125  HOH HOH A . 
G 3 HOH 26  1017 131  HOH HOH A . 
G 3 HOH 27  1018 135  HOH HOH A . 
G 3 HOH 28  1019 138  HOH HOH A . 
G 3 HOH 29  1020 140  HOH HOH A . 
G 3 HOH 30  1021 146  HOH HOH A . 
G 3 HOH 31  1022 148  HOH HOH A . 
G 3 HOH 32  1023 153  HOH HOH A . 
G 3 HOH 33  1024 155  HOH HOH A . 
G 3 HOH 34  1025 159  HOH HOH A . 
G 3 HOH 35  1026 160  HOH HOH A . 
G 3 HOH 36  1027 162  HOH HOH A . 
G 3 HOH 37  1028 163  HOH HOH A . 
G 3 HOH 38  1029 165  HOH HOH A . 
G 3 HOH 39  1030 166  HOH HOH A . 
G 3 HOH 40  1031 169  HOH HOH A . 
G 3 HOH 41  1032 170  HOH HOH A . 
G 3 HOH 42  1033 180  HOH HOH A . 
G 3 HOH 43  1034 181  HOH HOH A . 
G 3 HOH 44  1035 182  HOH HOH A . 
G 3 HOH 45  1036 191  HOH HOH A . 
G 3 HOH 46  1037 194  HOH HOH A . 
G 3 HOH 47  1038 208  HOH HOH A . 
G 3 HOH 48  1039 221  HOH HOH A . 
G 3 HOH 49  1040 235  HOH HOH A . 
G 3 HOH 50  1041 237  HOH HOH A . 
G 3 HOH 51  1042 240  HOH HOH A . 
G 3 HOH 52  1043 241  HOH HOH A . 
G 3 HOH 53  1044 246  HOH HOH A . 
G 3 HOH 54  1045 249  HOH HOH A . 
G 3 HOH 55  1046 250  HOH HOH A . 
G 3 HOH 56  1047 255  HOH HOH A . 
G 3 HOH 57  1048 259  HOH HOH A . 
G 3 HOH 58  1049 266  HOH HOH A . 
G 3 HOH 59  1050 269  HOH HOH A . 
G 3 HOH 60  1051 273  HOH HOH A . 
G 3 HOH 61  1052 285  HOH HOH A . 
G 3 HOH 62  1053 287  HOH HOH A . 
G 3 HOH 63  1054 299  HOH HOH A . 
G 3 HOH 64  1055 302  HOH HOH A . 
G 3 HOH 65  1056 306  HOH HOH A . 
G 3 HOH 66  1057 312  HOH HOH A . 
G 3 HOH 67  1058 315  HOH HOH A . 
G 3 HOH 68  1059 318  HOH HOH A . 
G 3 HOH 69  1060 321  HOH HOH A . 
G 3 HOH 70  1061 324  HOH HOH A . 
G 3 HOH 71  1062 328  HOH HOH A . 
G 3 HOH 72  1063 337  HOH HOH A . 
G 3 HOH 73  1064 341  HOH HOH A . 
G 3 HOH 74  1065 357  HOH HOH A . 
G 3 HOH 75  1066 359  HOH HOH A . 
G 3 HOH 76  1067 366  HOH HOH A . 
G 3 HOH 77  1068 373  HOH HOH A . 
G 3 HOH 78  1069 374  HOH HOH A . 
G 3 HOH 79  1070 384  HOH HOH A . 
G 3 HOH 80  1071 385  HOH HOH A . 
G 3 HOH 81  1072 419  HOH HOH A . 
G 3 HOH 82  1073 420  HOH HOH A . 
G 3 HOH 83  1074 421  HOH HOH A . 
G 3 HOH 84  1075 422  HOH HOH A . 
G 3 HOH 85  1076 428  HOH HOH A . 
G 3 HOH 86  1077 439  HOH HOH A . 
G 3 HOH 87  1078 465  HOH HOH A . 
G 3 HOH 88  1079 497  HOH HOH A . 
G 3 HOH 89  1080 503  HOH HOH A . 
G 3 HOH 90  1081 506  HOH HOH A . 
G 3 HOH 91  1082 507  HOH HOH A . 
G 3 HOH 92  1083 512  HOH HOH A . 
G 3 HOH 93  1084 517  HOH HOH A . 
G 3 HOH 94  1085 522  HOH HOH A . 
G 3 HOH 95  1086 524  HOH HOH A . 
G 3 HOH 96  1087 528  HOH HOH A . 
G 3 HOH 97  1088 541  HOH HOH A . 
G 3 HOH 98  1089 547  HOH HOH A . 
G 3 HOH 99  1090 548  HOH HOH A . 
G 3 HOH 100 1091 568  HOH HOH A . 
G 3 HOH 101 1092 580  HOH HOH A . 
G 3 HOH 102 1093 599  HOH HOH A . 
G 3 HOH 103 1094 611  HOH HOH A . 
G 3 HOH 104 1095 616  HOH HOH A . 
G 3 HOH 105 1096 622  HOH HOH A . 
G 3 HOH 106 1097 623  HOH HOH A . 
G 3 HOH 107 1098 624  HOH HOH A . 
G 3 HOH 108 1099 625  HOH HOH A . 
G 3 HOH 109 1100 631  HOH HOH A . 
G 3 HOH 110 1101 651  HOH HOH A . 
G 3 HOH 111 1102 665  HOH HOH A . 
G 3 HOH 112 1103 668  HOH HOH A . 
G 3 HOH 113 1104 669  HOH HOH A . 
G 3 HOH 114 1105 673  HOH HOH A . 
G 3 HOH 115 1106 675  HOH HOH A . 
G 3 HOH 116 1107 694  HOH HOH A . 
G 3 HOH 117 1108 714  HOH HOH A . 
G 3 HOH 118 1109 764  HOH HOH A . 
G 3 HOH 119 1110 773  HOH HOH A . 
G 3 HOH 120 1111 790  HOH HOH A . 
G 3 HOH 121 1112 820  HOH HOH A . 
G 3 HOH 122 1113 855  HOH HOH A . 
G 3 HOH 123 1114 856  HOH HOH A . 
G 3 HOH 124 1115 929  HOH HOH A . 
G 3 HOH 125 1116 981  HOH HOH A . 
H 3 HOH 1   993  1    HOH HOH B . 
H 3 HOH 2   994  2    HOH HOH B . 
H 3 HOH 3   995  8    HOH HOH B . 
H 3 HOH 4   996  11   HOH HOH B . 
H 3 HOH 5   997  15   HOH HOH B . 
H 3 HOH 6   998  16   HOH HOH B . 
H 3 HOH 7   999  19   HOH HOH B . 
H 3 HOH 8   1000 21   HOH HOH B . 
H 3 HOH 9   1001 23   HOH HOH B . 
H 3 HOH 10  1002 29   HOH HOH B . 
H 3 HOH 11  1003 31   HOH HOH B . 
H 3 HOH 12  1004 34   HOH HOH B . 
H 3 HOH 13  1005 37   HOH HOH B . 
H 3 HOH 14  1006 42   HOH HOH B . 
H 3 HOH 15  1007 43   HOH HOH B . 
H 3 HOH 16  1008 44   HOH HOH B . 
H 3 HOH 17  1009 49   HOH HOH B . 
H 3 HOH 18  1010 52   HOH HOH B . 
H 3 HOH 19  1011 53   HOH HOH B . 
H 3 HOH 20  1012 59   HOH HOH B . 
H 3 HOH 21  1013 66   HOH HOH B . 
H 3 HOH 22  1014 68   HOH HOH B . 
H 3 HOH 23  1015 71   HOH HOH B . 
H 3 HOH 24  1016 75   HOH HOH B . 
H 3 HOH 25  1017 78   HOH HOH B . 
H 3 HOH 26  1018 80   HOH HOH B . 
H 3 HOH 27  1019 83   HOH HOH B . 
H 3 HOH 28  1020 86   HOH HOH B . 
H 3 HOH 29  1021 91   HOH HOH B . 
H 3 HOH 30  1022 96   HOH HOH B . 
H 3 HOH 31  1023 97   HOH HOH B . 
H 3 HOH 32  1024 99   HOH HOH B . 
H 3 HOH 33  1025 107  HOH HOH B . 
H 3 HOH 34  1026 110  HOH HOH B . 
H 3 HOH 35  1027 115  HOH HOH B . 
H 3 HOH 36  1028 117  HOH HOH B . 
H 3 HOH 37  1029 122  HOH HOH B . 
H 3 HOH 38  1030 124  HOH HOH B . 
H 3 HOH 39  1031 132  HOH HOH B . 
H 3 HOH 40  1032 133  HOH HOH B . 
H 3 HOH 41  1033 136  HOH HOH B . 
H 3 HOH 42  1034 137  HOH HOH B . 
H 3 HOH 43  1035 147  HOH HOH B . 
H 3 HOH 44  1036 149  HOH HOH B . 
H 3 HOH 45  1037 150  HOH HOH B . 
H 3 HOH 46  1038 156  HOH HOH B . 
H 3 HOH 47  1039 158  HOH HOH B . 
H 3 HOH 48  1040 161  HOH HOH B . 
H 3 HOH 49  1041 186  HOH HOH B . 
H 3 HOH 50  1042 190  HOH HOH B . 
H 3 HOH 51  1043 193  HOH HOH B . 
H 3 HOH 52  1044 201  HOH HOH B . 
H 3 HOH 53  1045 202  HOH HOH B . 
H 3 HOH 54  1046 207  HOH HOH B . 
H 3 HOH 55  1047 213  HOH HOH B . 
H 3 HOH 56  1048 214  HOH HOH B . 
H 3 HOH 57  1049 215  HOH HOH B . 
H 3 HOH 58  1050 218  HOH HOH B . 
H 3 HOH 59  1051 223  HOH HOH B . 
H 3 HOH 60  1052 226  HOH HOH B . 
H 3 HOH 61  1053 232  HOH HOH B . 
H 3 HOH 62  1054 233  HOH HOH B . 
H 3 HOH 63  1055 234  HOH HOH B . 
H 3 HOH 64  1056 239  HOH HOH B . 
H 3 HOH 65  1057 243  HOH HOH B . 
H 3 HOH 66  1058 245  HOH HOH B . 
H 3 HOH 67  1059 247  HOH HOH B . 
H 3 HOH 68  1060 252  HOH HOH B . 
H 3 HOH 69  1061 253  HOH HOH B . 
H 3 HOH 70  1062 257  HOH HOH B . 
H 3 HOH 71  1063 258  HOH HOH B . 
H 3 HOH 72  1064 260  HOH HOH B . 
H 3 HOH 73  1065 271  HOH HOH B . 
H 3 HOH 74  1066 272  HOH HOH B . 
H 3 HOH 75  1067 274  HOH HOH B . 
H 3 HOH 76  1068 276  HOH HOH B . 
H 3 HOH 77  1069 277  HOH HOH B . 
H 3 HOH 78  1070 279  HOH HOH B . 
H 3 HOH 79  1071 292  HOH HOH B . 
H 3 HOH 80  1072 297  HOH HOH B . 
H 3 HOH 81  1073 320  HOH HOH B . 
H 3 HOH 82  1074 322  HOH HOH B . 
H 3 HOH 83  1075 326  HOH HOH B . 
H 3 HOH 84  1076 345  HOH HOH B . 
H 3 HOH 85  1077 356  HOH HOH B . 
H 3 HOH 86  1078 365  HOH HOH B . 
H 3 HOH 87  1079 370  HOH HOH B . 
H 3 HOH 88  1080 387  HOH HOH B . 
H 3 HOH 89  1081 389  HOH HOH B . 
H 3 HOH 90  1082 392  HOH HOH B . 
H 3 HOH 91  1083 404  HOH HOH B . 
H 3 HOH 92  1084 409  HOH HOH B . 
H 3 HOH 93  1085 413  HOH HOH B . 
H 3 HOH 94  1086 426  HOH HOH B . 
H 3 HOH 95  1087 430  HOH HOH B . 
H 3 HOH 96  1088 432  HOH HOH B . 
H 3 HOH 97  1089 451  HOH HOH B . 
H 3 HOH 98  1090 468  HOH HOH B . 
H 3 HOH 99  1091 473  HOH HOH B . 
H 3 HOH 100 1092 476  HOH HOH B . 
H 3 HOH 101 1093 481  HOH HOH B . 
H 3 HOH 102 1094 521  HOH HOH B . 
H 3 HOH 103 1095 543  HOH HOH B . 
H 3 HOH 104 1096 555  HOH HOH B . 
H 3 HOH 105 1097 570  HOH HOH B . 
H 3 HOH 106 1098 584  HOH HOH B . 
H 3 HOH 107 1099 593  HOH HOH B . 
H 3 HOH 108 1100 594  HOH HOH B . 
H 3 HOH 109 1101 609  HOH HOH B . 
H 3 HOH 110 1102 617  HOH HOH B . 
H 3 HOH 111 1103 620  HOH HOH B . 
H 3 HOH 112 1104 626  HOH HOH B . 
H 3 HOH 113 1105 627  HOH HOH B . 
H 3 HOH 114 1106 632  HOH HOH B . 
H 3 HOH 115 1107 637  HOH HOH B . 
H 3 HOH 116 1108 641  HOH HOH B . 
H 3 HOH 117 1109 644  HOH HOH B . 
H 3 HOH 118 1110 647  HOH HOH B . 
H 3 HOH 119 1111 661  HOH HOH B . 
H 3 HOH 120 1112 671  HOH HOH B . 
H 3 HOH 121 1113 678  HOH HOH B . 
H 3 HOH 122 1114 688  HOH HOH B . 
H 3 HOH 123 1115 691  HOH HOH B . 
H 3 HOH 124 1116 696  HOH HOH B . 
H 3 HOH 125 1117 702  HOH HOH B . 
H 3 HOH 126 1118 708  HOH HOH B . 
H 3 HOH 127 1119 725  HOH HOH B . 
H 3 HOH 128 1120 736  HOH HOH B . 
H 3 HOH 129 1121 742  HOH HOH B . 
H 3 HOH 130 1122 747  HOH HOH B . 
H 3 HOH 131 1123 752  HOH HOH B . 
H 3 HOH 132 1124 755  HOH HOH B . 
H 3 HOH 133 1125 767  HOH HOH B . 
H 3 HOH 134 1126 776  HOH HOH B . 
H 3 HOH 135 1127 778  HOH HOH B . 
H 3 HOH 136 1128 779  HOH HOH B . 
H 3 HOH 137 1129 782  HOH HOH B . 
H 3 HOH 138 1130 784  HOH HOH B . 
H 3 HOH 139 1131 791  HOH HOH B . 
H 3 HOH 140 1132 816  HOH HOH B . 
H 3 HOH 141 1133 850  HOH HOH B . 
H 3 HOH 142 1134 860  HOH HOH B . 
H 3 HOH 143 1135 863  HOH HOH B . 
H 3 HOH 144 1136 879  HOH HOH B . 
H 3 HOH 145 1137 890  HOH HOH B . 
H 3 HOH 146 1138 902  HOH HOH B . 
H 3 HOH 147 1139 913  HOH HOH B . 
H 3 HOH 148 1140 918  HOH HOH B . 
H 3 HOH 149 1141 930  HOH HOH B . 
H 3 HOH 150 1142 937  HOH HOH B . 
H 3 HOH 151 1143 987  HOH HOH B . 
H 3 HOH 152 1144 997  HOH HOH B . 
I 3 HOH 1   996  3    HOH HOH C . 
I 3 HOH 2   997  7    HOH HOH C . 
I 3 HOH 3   998  10   HOH HOH C . 
I 3 HOH 4   999  13   HOH HOH C . 
I 3 HOH 5   1000 17   HOH HOH C . 
I 3 HOH 6   1001 20   HOH HOH C . 
I 3 HOH 7   1002 25   HOH HOH C . 
I 3 HOH 8   1003 27   HOH HOH C . 
I 3 HOH 9   1004 40   HOH HOH C . 
I 3 HOH 10  1005 45   HOH HOH C . 
I 3 HOH 11  1006 48   HOH HOH C . 
I 3 HOH 12  1007 51   HOH HOH C . 
I 3 HOH 13  1008 54   HOH HOH C . 
I 3 HOH 14  1009 55   HOH HOH C . 
I 3 HOH 15  1010 56   HOH HOH C . 
I 3 HOH 16  1011 57   HOH HOH C . 
I 3 HOH 17  1012 58   HOH HOH C . 
I 3 HOH 18  1013 63   HOH HOH C . 
I 3 HOH 19  1014 67   HOH HOH C . 
I 3 HOH 20  1015 70   HOH HOH C . 
I 3 HOH 21  1016 72   HOH HOH C . 
I 3 HOH 22  1017 73   HOH HOH C . 
I 3 HOH 23  1018 76   HOH HOH C . 
I 3 HOH 24  1019 79   HOH HOH C . 
I 3 HOH 25  1020 85   HOH HOH C . 
I 3 HOH 26  1021 88   HOH HOH C . 
I 3 HOH 27  1022 90   HOH HOH C . 
I 3 HOH 28  1023 92   HOH HOH C . 
I 3 HOH 29  1024 100  HOH HOH C . 
I 3 HOH 30  1025 103  HOH HOH C . 
I 3 HOH 31  1026 105  HOH HOH C . 
I 3 HOH 32  1027 108  HOH HOH C . 
I 3 HOH 33  1028 112  HOH HOH C . 
I 3 HOH 34  1029 113  HOH HOH C . 
I 3 HOH 35  1030 118  HOH HOH C . 
I 3 HOH 36  1031 121  HOH HOH C . 
I 3 HOH 37  1032 123  HOH HOH C . 
I 3 HOH 38  1033 126  HOH HOH C . 
I 3 HOH 39  1034 127  HOH HOH C . 
I 3 HOH 40  1035 128  HOH HOH C . 
I 3 HOH 41  1036 130  HOH HOH C . 
I 3 HOH 42  1037 134  HOH HOH C . 
I 3 HOH 43  1038 144  HOH HOH C . 
I 3 HOH 44  1039 145  HOH HOH C . 
I 3 HOH 45  1040 151  HOH HOH C . 
I 3 HOH 46  1041 157  HOH HOH C . 
I 3 HOH 47  1042 185  HOH HOH C . 
I 3 HOH 48  1043 187  HOH HOH C . 
I 3 HOH 49  1044 197  HOH HOH C . 
I 3 HOH 50  1045 200  HOH HOH C . 
I 3 HOH 51  1046 220  HOH HOH C . 
I 3 HOH 52  1047 222  HOH HOH C . 
I 3 HOH 53  1048 225  HOH HOH C . 
I 3 HOH 54  1049 229  HOH HOH C . 
I 3 HOH 55  1050 236  HOH HOH C . 
I 3 HOH 56  1051 238  HOH HOH C . 
I 3 HOH 57  1052 248  HOH HOH C . 
I 3 HOH 58  1053 251  HOH HOH C . 
I 3 HOH 59  1054 256  HOH HOH C . 
I 3 HOH 60  1055 262  HOH HOH C . 
I 3 HOH 61  1056 263  HOH HOH C . 
I 3 HOH 62  1057 265  HOH HOH C . 
I 3 HOH 63  1058 270  HOH HOH C . 
I 3 HOH 64  1059 288  HOH HOH C . 
I 3 HOH 65  1060 290  HOH HOH C . 
I 3 HOH 66  1061 294  HOH HOH C . 
I 3 HOH 67  1062 296  HOH HOH C . 
I 3 HOH 68  1063 303  HOH HOH C . 
I 3 HOH 69  1064 316  HOH HOH C . 
I 3 HOH 70  1065 330  HOH HOH C . 
I 3 HOH 71  1066 336  HOH HOH C . 
I 3 HOH 72  1067 338  HOH HOH C . 
I 3 HOH 73  1068 339  HOH HOH C . 
I 3 HOH 74  1069 340  HOH HOH C . 
I 3 HOH 75  1070 342  HOH HOH C . 
I 3 HOH 76  1071 347  HOH HOH C . 
I 3 HOH 77  1072 348  HOH HOH C . 
I 3 HOH 78  1073 355  HOH HOH C . 
I 3 HOH 79  1074 361  HOH HOH C . 
I 3 HOH 80  1075 376  HOH HOH C . 
I 3 HOH 81  1076 379  HOH HOH C . 
I 3 HOH 82  1077 391  HOH HOH C . 
I 3 HOH 83  1078 403  HOH HOH C . 
I 3 HOH 84  1079 405  HOH HOH C . 
I 3 HOH 85  1080 408  HOH HOH C . 
I 3 HOH 86  1081 411  HOH HOH C . 
I 3 HOH 87  1082 412  HOH HOH C . 
I 3 HOH 88  1083 427  HOH HOH C . 
I 3 HOH 89  1084 429  HOH HOH C . 
I 3 HOH 90  1085 433  HOH HOH C . 
I 3 HOH 91  1086 435  HOH HOH C . 
I 3 HOH 92  1087 440  HOH HOH C . 
I 3 HOH 93  1088 442  HOH HOH C . 
I 3 HOH 94  1089 443  HOH HOH C . 
I 3 HOH 95  1090 447  HOH HOH C . 
I 3 HOH 96  1091 448  HOH HOH C . 
I 3 HOH 97  1092 452  HOH HOH C . 
I 3 HOH 98  1093 454  HOH HOH C . 
I 3 HOH 99  1094 458  HOH HOH C . 
I 3 HOH 100 1095 462  HOH HOH C . 
I 3 HOH 101 1096 472  HOH HOH C . 
I 3 HOH 102 1097 474  HOH HOH C . 
I 3 HOH 103 1098 492  HOH HOH C . 
I 3 HOH 104 1099 496  HOH HOH C . 
I 3 HOH 105 1100 504  HOH HOH C . 
I 3 HOH 106 1101 523  HOH HOH C . 
I 3 HOH 107 1102 532  HOH HOH C . 
I 3 HOH 108 1103 533  HOH HOH C . 
I 3 HOH 109 1104 536  HOH HOH C . 
I 3 HOH 110 1105 540  HOH HOH C . 
I 3 HOH 111 1106 544  HOH HOH C . 
I 3 HOH 112 1107 549  HOH HOH C . 
I 3 HOH 113 1108 551  HOH HOH C . 
I 3 HOH 114 1109 575  HOH HOH C . 
I 3 HOH 115 1110 589  HOH HOH C . 
I 3 HOH 116 1111 605  HOH HOH C . 
I 3 HOH 117 1112 610  HOH HOH C . 
I 3 HOH 118 1113 645  HOH HOH C . 
I 3 HOH 119 1114 654  HOH HOH C . 
I 3 HOH 120 1115 674  HOH HOH C . 
I 3 HOH 121 1116 701  HOH HOH C . 
I 3 HOH 122 1117 800  HOH HOH C . 
I 3 HOH 123 1118 829  HOH HOH C . 
I 3 HOH 124 1119 844  HOH HOH C . 
I 3 HOH 125 1120 858  HOH HOH C . 
I 3 HOH 126 1121 859  HOH HOH C . 
I 3 HOH 127 1122 866  HOH HOH C . 
I 3 HOH 128 1123 909  HOH HOH C . 
I 3 HOH 129 1124 977  HOH HOH C . 
I 3 HOH 130 1125 984  HOH HOH C . 
I 3 HOH 131 1126 993  HOH HOH C . 
I 3 HOH 132 1127 996  HOH HOH C . 
I 3 HOH 133 1128 1001 HOH HOH C . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? monomeric 1 
2 author_defined_assembly ? monomeric 1 
3 author_defined_assembly ? monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,D,G 
2 1 B,E,H 
3 1 C,F,I 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2000-10-18 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2018-01-31 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Experimental preparation'  
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            exptl_crystal_grow 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_exptl_crystal_grow.pdbx_details' 
2 4 'Structure model' '_exptl_crystal_grow.temp'         
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
MLPHARE   phasing          .     ? 1 
X-PLOR    refinement       3.851 ? 2 
DENZO     'data reduction' .     ? 3 
SCALEPACK 'data scaling'   .     ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 LYS A 115 ? ? -96.56  35.50   
2  1 ASP A 118 ? ? -95.96  49.68   
3  1 THR A 163 ? ? -91.36  -82.46  
4  1 ALA A 176 ? ? -137.13 -37.12  
5  1 GLU A 191 ? ? 80.36   6.40    
6  1 ALA A 328 ? ? -72.71  43.66   
7  1 GLN A 369 ? ? -99.95  -97.23  
8  1 SER B 53  ? ? -148.21 -20.50  
9  1 ASP B 85  ? ? -59.80  95.83   
10 1 THR B 163 ? ? -109.90 -76.72  
11 1 ALA B 176 ? ? -139.60 -34.67  
12 1 GLU B 234 ? ? -57.92  -4.46   
13 1 VAL B 235 ? ? -107.08 -67.91  
14 1 TYR B 239 ? ? -131.67 -38.80  
15 1 LYS B 311 ? ? -127.96 -56.99  
16 1 GLN B 369 ? ? -59.41  -103.80 
17 1 SER C 53  ? ? -147.90 -13.35  
18 1 VAL C 162 ? ? 62.53   103.85  
19 1 THR C 163 ? ? -100.74 -70.17  
20 1 ALA C 176 ? ? -132.30 -41.34  
21 1 GLN C 369 ? ? -62.53  -86.65  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 B VAL 314 ? CG1 ? B VAL 284 CG1 
2 1 Y 1 B VAL 314 ? CG2 ? B VAL 284 CG2 
3 1 Y 1 C VAL 314 ? CG1 ? C VAL 284 CG1 
4 1 Y 1 C VAL 314 ? CG2 ? C VAL 284 CG2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 31  ? A MET 1   
2  1 Y 1 A ASP 32  ? A ASP 2   
3  1 Y 1 A ARG 33  ? A ARG 3   
4  1 Y 1 A ASN 34  ? A ASN 4   
5  1 Y 1 A SER 35  ? A SER 5   
6  1 Y 1 A LEU 36  ? A LEU 6   
7  1 Y 1 A SER 37  ? A SER 7   
8  1 Y 1 A ARG 317 ? A ARG 287 
9  1 Y 1 A LYS 318 ? A LYS 288 
10 1 Y 1 A GLY 319 ? A GLY 289 
11 1 Y 1 A GLN 320 ? A GLN 290 
12 1 Y 1 A ALA 321 ? A ALA 291 
13 1 Y 1 A VAL 322 ? A VAL 292 
14 1 Y 1 A THR 323 ? A THR 293 
15 1 Y 1 A LEU 324 ? A LEU 294 
16 1 Y 1 A MET 325 ? A MET 295 
17 1 Y 1 A MET 326 ? A MET 296 
18 1 Y 1 B MET 31  ? B MET 1   
19 1 Y 1 B ASP 32  ? B ASP 2   
20 1 Y 1 B ARG 33  ? B ARG 3   
21 1 Y 1 B LYS 315 ? B LYS 285 
22 1 Y 1 B ILE 316 ? B ILE 286 
23 1 Y 1 B ARG 317 ? B ARG 287 
24 1 Y 1 B LYS 318 ? B LYS 288 
25 1 Y 1 B GLY 319 ? B GLY 289 
26 1 Y 1 B GLN 320 ? B GLN 290 
27 1 Y 1 B ALA 321 ? B ALA 291 
28 1 Y 1 B VAL 322 ? B VAL 292 
29 1 Y 1 B THR 323 ? B THR 293 
30 1 Y 1 B LEU 324 ? B LEU 294 
31 1 Y 1 B MET 325 ? B MET 295 
32 1 Y 1 B MET 326 ? B MET 296 
33 1 Y 1 B ASP 327 ? B ASP 297 
34 1 Y 1 C MET 31  ? C MET 1   
35 1 Y 1 C ASP 32  ? C ASP 2   
36 1 Y 1 C ARG 33  ? C ARG 3   
37 1 Y 1 C ASN 34  ? C ASN 4   
38 1 Y 1 C SER 35  ? C SER 5   
39 1 Y 1 C LEU 36  ? C LEU 6   
40 1 Y 1 C SER 37  ? C SER 7   
41 1 Y 1 C LYS 315 ? C LYS 285 
42 1 Y 1 C ILE 316 ? C ILE 286 
43 1 Y 1 C ARG 317 ? C ARG 287 
44 1 Y 1 C LYS 318 ? C LYS 288 
45 1 Y 1 C GLY 319 ? C GLY 289 
46 1 Y 1 C GLN 320 ? C GLN 290 
47 1 Y 1 C ALA 321 ? C ALA 291 
48 1 Y 1 C VAL 322 ? C VAL 292 
49 1 Y 1 C THR 323 ? C THR 293 
50 1 Y 1 C LEU 324 ? C LEU 294 
51 1 Y 1 C MET 325 ? C MET 295 
52 1 Y 1 C MET 326 ? C MET 296 
53 1 Y 1 C ASP 327 ? C ASP 297 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 
;N-{2-[TRANS-7-CHLORO-1-(2,2-DIMETHYL-PROPYL) -5-NAPHTHALEN-1-YL-2-OXO-1,2,3,5-TETRAHYDRO-BENZO[E] [1,4]OXAZEPIN-3-YL]-ACETYL}-ASPARTIC ACID
;
IN0 
3 water HOH 
#