data_1FFJ
# 
_entry.id   1FFJ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1FFJ         
RCSB  RCSB011541   
WWPDB D_1000011541 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1CB9 
_pdbx_database_related.details        '1CB9 is the Solution Structure of Cardiotoxin from Naja oxiana (major form)' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1FFJ 
_pdbx_database_status.recvd_initial_deposition_date   2000-07-25 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Dubovskii, P.V.'  1 
'Dementieva, D.V.' 2 
'Bocharov, E.V.'   3 
'Utkin, Y.N.'      4 
'Arseniev, A.S.'   5 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Membrane binding motif of the P-type cardiotoxin.' J.Mol.Biol.    305 137 149 2001 JMOBAK UK 0022-2836 0070 ? 11114253 
10.1006/jmbi.2000.4283           
1       
;Two forms of Cytotoxin II (cardiotoxin) from Naja naja oxiana in Aqueous Solution. Spatial Structures with Tightly Bound Water Molecules
;
Eur.J.Biochem. 263 152 162 1999 EJBCAI IX 0014-2956 0262 ? ?        10.1046/j.1432-1327.1999.00478.x 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Dubovskii, P.V.'  1 
primary 'Dementieva, D.V.' 2 
primary 'Bocharov, E.V.'   3 
primary 'Utkin, Y.N.'      4 
primary 'Arseniev, A.S.'   5 
1       'Dementieva, D.V.' 6 
1       'Bocharov, E.V.'   7 
1       'Arseniev, A.S.'   8 
# 
_cell.entry_id           1FFJ 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1FFJ 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer nat 'CYTOTOXIN 2' 6648.238 1 ? ? 1 ? 
2 water   nat water         18.015   2 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        CARDIOTOXIN 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       LKCKKLVPLFSKTCPAGKNLCYKMFMVAAPHVPVKRGCIDVCPKSSLLVKYVCCNTDKCN 
_entity_poly.pdbx_seq_one_letter_code_can   LKCKKLVPLFSKTCPAGKNLCYKMFMVAAPHVPVKRGCIDVCPKSSLLVKYVCCNTDKCN 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  LEU n 
1 2  LYS n 
1 3  CYS n 
1 4  LYS n 
1 5  LYS n 
1 6  LEU n 
1 7  VAL n 
1 8  PRO n 
1 9  LEU n 
1 10 PHE n 
1 11 SER n 
1 12 LYS n 
1 13 THR n 
1 14 CYS n 
1 15 PRO n 
1 16 ALA n 
1 17 GLY n 
1 18 LYS n 
1 19 ASN n 
1 20 LEU n 
1 21 CYS n 
1 22 TYR n 
1 23 LYS n 
1 24 MET n 
1 25 PHE n 
1 26 MET n 
1 27 VAL n 
1 28 ALA n 
1 29 ALA n 
1 30 PRO n 
1 31 HIS n 
1 32 VAL n 
1 33 PRO n 
1 34 VAL n 
1 35 LYS n 
1 36 ARG n 
1 37 GLY n 
1 38 CYS n 
1 39 ILE n 
1 40 ASP n 
1 41 VAL n 
1 42 CYS n 
1 43 PRO n 
1 44 LYS n 
1 45 SER n 
1 46 SER n 
1 47 LEU n 
1 48 LEU n 
1 49 VAL n 
1 50 LYS n 
1 51 TYR n 
1 52 VAL n 
1 53 CYS n 
1 54 CYS n 
1 55 ASN n 
1 56 THR n 
1 57 ASP n 
1 58 LYS n 
1 59 CYS n 
1 60 ASN n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                'Central Asian cobra' 
_entity_src_nat.pdbx_organism_scientific   'Naja oxiana' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      8657 
_entity_src_nat.genus                      Naja 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             VENOM 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_code                    CX2_NAJOX 
_struct_ref.db_name                    UNP 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P01441 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   LKCKKLVPLFSKTCPAGKNLCYKMFMVAAPHVPVKRGCIDVCPKSSLLVKYVCCNTDKCN 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1FFJ 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 60 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P01441 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  60 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       60 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
1  1 1 '2D NOESY' 
2  1 1 TOCSY      
3  1 1 DQF-COSY   
4  1 1 ROESY      
5  2 1 DQF-COSY   
6  2 1 '2D NOESY' 
7  2 1 TOCSY      
8  1 2 ROESY      
9  1 2 DQF-COSY   
10 1 2 '2D NOESY' 
# 
loop_
_pdbx_nmr_exptl_sample_conditions.conditions_id 
_pdbx_nmr_exptl_sample_conditions.temperature 
_pdbx_nmr_exptl_sample_conditions.pressure 
_pdbx_nmr_exptl_sample_conditions.pH 
_pdbx_nmr_exptl_sample_conditions.ionic_strength 
_pdbx_nmr_exptl_sample_conditions.pressure_units 
_pdbx_nmr_exptl_sample_conditions.temperature_units 
1 318 ambient 5.5 '0M NaCl' ? K 
2 303 ambient 5.5 '0M NaCl' ? K 
# 
loop_
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solvent_system 
1 '3mM Cardiotoxin (cytotoxin II); 120 mM perdeuterated dodecylphosphocholine' '90% H2O/10% D2O' 
2 '3mM Cardiotoxin (cytotoxin II); 120 mM perdeuterated dodecylphosphocholine' '100% D2O'        
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.type              ? 
_pdbx_nmr_spectrometer.manufacturer      Varian 
_pdbx_nmr_spectrometer.model             UNITY 
_pdbx_nmr_spectrometer.field_strength    600 
# 
_pdbx_nmr_refine.entry_id           1FFJ 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.details            
;structures are based on a total of 368 NOE-derived constraints, 154 dihedral angle restraints, 248 distance restraints from hydrogen bonds and disulfides
;
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   1FFJ 
_pdbx_nmr_details.text       
;This structure was determined using standard 2D homonuclear techniques. Sites of tightly bound water molecules were determined as in Dementieva et al., Eur.J.Biochem.1999,263,152-162.
;
# 
_pdbx_nmr_ensemble.entry_id                                      1FFJ 
_pdbx_nmr_ensemble.conformers_calculated_total_number            220 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'target function' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             1FFJ 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'fewest violations' 
# 
loop_
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
VNMR  6.1A   collection           'Varian software'                1 
XEASY 1.2.11 'data analysis'      'Xia, T. & Bartels, C.'          2 
DYANA 1.5    'structure solution' 'Guentert, P. & Mumenthaler, C.' 3 
DYANA 1.5    refinement           'Guentert, P. & Mumenthaler, C.' 4 
# 
_exptl.entry_id          1FFJ 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  1FFJ 
_struct.title                     'NMR STRUCTURE OF CARDIOTOXIN IN DPC-MICELLE' 
_struct.pdbx_descriptor           'CYTOTOXIN 2' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1FFJ 
_struct_keywords.pdbx_keywords   TOXIN 
_struct_keywords.text            'all-beta sheet protein, membrane perturbation, TOXIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 3  SG ? ? ? 1_555 A CYS 21 SG ? ? A CYS 3  A CYS 21 1_555 ? ? ? ? ? ? ? 2.034 ? 
disulf2 disulf ? ? A CYS 14 SG ? ? ? 1_555 A CYS 38 SG ? ? A CYS 14 A CYS 38 1_555 ? ? ? ? ? ? ? 1.979 ? 
disulf3 disulf ? ? A CYS 42 SG ? ? ? 1_555 A CYS 53 SG ? ? A CYS 42 A CYS 53 1_555 ? ? ? ? ? ? ? 2.080 ? 
disulf4 disulf ? ? A CYS 54 SG ? ? ? 1_555 A CYS 59 SG ? ? A CYS 54 A CYS 59 1_555 ? ? ? ? ? ? ? 2.088 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LYS A 2  ? LYS A 4  ? LYS A 2  LYS A 4  
A 2 SER A 11 ? THR A 13 ? SER A 11 THR A 13 
B 1 PRO A 33 ? ILE A 39 ? PRO A 33 ILE A 39 
B 2 LEU A 20 ? MET A 26 ? LEU A 20 MET A 26 
B 3 VAL A 49 ? CYS A 54 ? VAL A 49 CYS A 54 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O CYS A 3  ? O CYS A 3  N LYS A 12 ? N LYS A 12 
B 1 2 N ILE A 39 ? N ILE A 39 O LEU A 20 ? O LEU A 20 
B 2 3 O PHE A 25 ? O PHE A 25 N LYS A 50 ? N LYS A 50 
# 
_database_PDB_matrix.entry_id          1FFJ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1FFJ 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N    . LEU A 1 1  ? -12.258 7.658   -0.899  1.00 0.00 ? 1  LEU A N    1  
ATOM   2     C CA   . LEU A 1 1  ? -11.668 6.481   -1.514  1.00 0.00 ? 1  LEU A CA   1  
ATOM   3     C C    . LEU A 1 1  ? -11.954 5.257   -0.642  1.00 0.00 ? 1  LEU A C    1  
ATOM   4     O O    . LEU A 1 1  ? -11.775 5.301   0.574   1.00 0.00 ? 1  LEU A O    1  
ATOM   5     C CB   . LEU A 1 1  ? -10.180 6.708   -1.787  1.00 0.00 ? 1  LEU A CB   1  
ATOM   6     C CG   . LEU A 1 1  ? -9.813  7.103   -3.218  1.00 0.00 ? 1  LEU A CG   1  
ATOM   7     C CD1  . LEU A 1 1  ? -8.519  7.920   -3.247  1.00 0.00 ? 1  LEU A CD1  1  
ATOM   8     C CD2  . LEU A 1 1  ? -9.734  5.873   -4.124  1.00 0.00 ? 1  LEU A CD2  1  
ATOM   9     H H    . LEU A 1 1  ? -12.146 7.717   0.093   1.00 0.00 ? 1  LEU A H    1  
ATOM   10    H HA   . LEU A 1 1  ? -12.154 6.339   -2.479  1.00 0.00 ? 1  LEU A HA   1  
ATOM   11    H HB2  . LEU A 1 1  ? -9.822  7.486   -1.113  1.00 0.00 ? 1  LEU A HB2  1  
ATOM   12    H HB3  . LEU A 1 1  ? -9.641  5.795   -1.534  1.00 0.00 ? 1  LEU A HB3  1  
ATOM   13    H HG   . LEU A 1 1  ? -10.605 7.741   -3.610  1.00 0.00 ? 1  LEU A HG   1  
ATOM   14    H HD11 . LEU A 1 1  ? -8.138  8.032   -2.232  1.00 0.00 ? 1  LEU A HD11 1  
ATOM   15    H HD12 . LEU A 1 1  ? -7.778  7.405   -3.859  1.00 0.00 ? 1  LEU A HD12 1  
ATOM   16    H HD21 . LEU A 1 1  ? -10.474 5.139   -3.805  1.00 0.00 ? 1  LEU A HD21 1  
ATOM   17    H HD22 . LEU A 1 1  ? -9.934  6.167   -5.154  1.00 0.00 ? 1  LEU A HD22 1  
ATOM   18    N N    . LYS A 1 2  ? -12.394 4.193   -1.297  1.00 0.00 ? 2  LYS A N    1  
ATOM   19    C CA   . LYS A 1 2  ? -12.706 2.959   -0.596  1.00 0.00 ? 2  LYS A CA   1  
ATOM   20    C C    . LYS A 1 2  ? -11.719 1.871   -1.023  1.00 0.00 ? 2  LYS A C    1  
ATOM   21    O O    . LYS A 1 2  ? -11.844 1.305   -2.108  1.00 0.00 ? 2  LYS A O    1  
ATOM   22    C CB   . LYS A 1 2  ? -14.172 2.577   -0.811  1.00 0.00 ? 2  LYS A CB   1  
ATOM   23    C CG   . LYS A 1 2  ? -14.429 2.183   -2.267  1.00 0.00 ? 2  LYS A CG   1  
ATOM   24    C CD   . LYS A 1 2  ? -15.791 2.693   -2.741  1.00 0.00 ? 2  LYS A CD   1  
ATOM   25    C CE   . LYS A 1 2  ? -16.104 2.191   -4.152  1.00 0.00 ? 2  LYS A CE   1  
ATOM   26    N NZ   . LYS A 1 2  ? -16.358 3.329   -5.063  1.00 0.00 ? 2  LYS A NZ   1  
ATOM   27    H H    . LYS A 1 2  ? -12.537 4.165   -2.286  1.00 0.00 ? 2  LYS A H    1  
ATOM   28    H HA   . LYS A 1 2  ? -12.575 3.146   0.469   1.00 0.00 ? 2  LYS A HA   1  
ATOM   29    H HB2  . LYS A 1 2  ? -14.437 1.748   -0.154  1.00 0.00 ? 2  LYS A HB2  1  
ATOM   30    H HB3  . LYS A 1 2  ? -14.814 3.415   -0.539  1.00 0.00 ? 2  LYS A HB3  1  
ATOM   31    H HG2  . LYS A 1 2  ? -13.643 2.592   -2.902  1.00 0.00 ? 2  LYS A HG2  1  
ATOM   32    H HG3  . LYS A 1 2  ? -14.388 1.099   -2.366  1.00 0.00 ? 2  LYS A HG3  1  
ATOM   33    H HD2  . LYS A 1 2  ? -16.568 2.360   -2.052  1.00 0.00 ? 2  LYS A HD2  1  
ATOM   34    H HD3  . LYS A 1 2  ? -15.800 3.783   -2.729  1.00 0.00 ? 2  LYS A HD3  1  
ATOM   35    H HE2  . LYS A 1 2  ? -15.270 1.597   -4.526  1.00 0.00 ? 2  LYS A HE2  1  
ATOM   36    H HE3  . LYS A 1 2  ? -16.975 1.536   -4.126  1.00 0.00 ? 2  LYS A HE3  1  
ATOM   37    H HZ1  . LYS A 1 2  ? -16.093 4.182   -4.613  1.00 0.00 ? 2  LYS A HZ1  1  
ATOM   38    H HZ2  . LYS A 1 2  ? -15.822 3.213   -5.899  1.00 0.00 ? 2  LYS A HZ2  1  
ATOM   39    N N    . CYS A 1 3  ? -10.759 1.611   -0.148  1.00 0.00 ? 3  CYS A N    1  
ATOM   40    C CA   . CYS A 1 3  ? -9.751  0.601   -0.420  1.00 0.00 ? 3  CYS A CA   1  
ATOM   41    C C    . CYS A 1 3  ? -10.021 -0.604  0.483   1.00 0.00 ? 3  CYS A C    1  
ATOM   42    O O    . CYS A 1 3  ? -10.947 -0.582  1.292   1.00 0.00 ? 3  CYS A O    1  
ATOM   43    C CB   . CYS A 1 3  ? -8.335  1.149   -0.231  1.00 0.00 ? 3  CYS A CB   1  
ATOM   44    S SG   . CYS A 1 3  ? -7.642  2.006   -1.692  1.00 0.00 ? 3  CYS A SG   1  
ATOM   45    H H    . CYS A 1 3  ? -10.664 2.076   0.733   1.00 0.00 ? 3  CYS A H    1  
ATOM   46    H HA   . CYS A 1 3  ? -9.856  0.329   -1.471  1.00 0.00 ? 3  CYS A HA   1  
ATOM   47    H HB2  . CYS A 1 3  ? -8.338  1.842   0.611   1.00 0.00 ? 3  CYS A HB2  1  
ATOM   48    H HB3  . CYS A 1 3  ? -7.674  0.325   0.037   1.00 0.00 ? 3  CYS A HB3  1  
ATOM   49    N N    . LYS A 1 4  ? -9.196  -1.627  0.314   1.00 0.00 ? 4  LYS A N    1  
ATOM   50    C CA   . LYS A 1 4  ? -9.335  -2.839  1.103   1.00 0.00 ? 4  LYS A CA   1  
ATOM   51    C C    . LYS A 1 4  ? -8.460  -2.731  2.353   1.00 0.00 ? 4  LYS A C    1  
ATOM   52    O O    . LYS A 1 4  ? -7.426  -2.063  2.336   1.00 0.00 ? 4  LYS A O    1  
ATOM   53    C CB   . LYS A 1 4  ? -9.037  -4.072  0.248   1.00 0.00 ? 4  LYS A CB   1  
ATOM   54    C CG   . LYS A 1 4  ? -10.285 -4.529  -0.509  1.00 0.00 ? 4  LYS A CG   1  
ATOM   55    C CD   . LYS A 1 4  ? -11.021 -5.628  0.259   1.00 0.00 ? 4  LYS A CD   1  
ATOM   56    C CE   . LYS A 1 4  ? -12.534 -5.517  0.061   1.00 0.00 ? 4  LYS A CE   1  
ATOM   57    N NZ   . LYS A 1 4  ? -13.083 -6.786  -0.466  1.00 0.00 ? 4  LYS A NZ   1  
ATOM   58    H H    . LYS A 1 4  ? -8.445  -1.637  -0.347  1.00 0.00 ? 4  LYS A H    1  
ATOM   59    H HA   . LYS A 1 4  ? -10.377 -2.907  1.416   1.00 0.00 ? 4  LYS A HA   1  
ATOM   60    H HB2  . LYS A 1 4  ? -8.240  -3.845  -0.460  1.00 0.00 ? 4  LYS A HB2  1  
ATOM   61    H HB3  . LYS A 1 4  ? -8.677  -4.881  0.884   1.00 0.00 ? 4  LYS A HB3  1  
ATOM   62    H HG2  . LYS A 1 4  ? -10.951 -3.680  -0.664  1.00 0.00 ? 4  LYS A HG2  1  
ATOM   63    H HG3  . LYS A 1 4  ? -10.002 -4.897  -1.496  1.00 0.00 ? 4  LYS A HG3  1  
ATOM   64    H HD2  . LYS A 1 4  ? -10.678 -6.606  -0.080  1.00 0.00 ? 4  LYS A HD2  1  
ATOM   65    H HD3  . LYS A 1 4  ? -10.783 -5.557  1.320   1.00 0.00 ? 4  LYS A HD3  1  
ATOM   66    H HE2  . LYS A 1 4  ? -13.014 -5.272  1.009   1.00 0.00 ? 4  LYS A HE2  1  
ATOM   67    H HE3  . LYS A 1 4  ? -12.758 -4.703  -0.629  1.00 0.00 ? 4  LYS A HE3  1  
ATOM   68    H HZ1  . LYS A 1 4  ? -14.068 -6.819  -0.297  1.00 0.00 ? 4  LYS A HZ1  1  
ATOM   69    H HZ2  . LYS A 1 4  ? -12.912 -6.840  -1.450  1.00 0.00 ? 4  LYS A HZ2  1  
ATOM   70    N N    . LYS A 1 5  ? -8.905  -3.397  3.408   1.00 0.00 ? 5  LYS A N    1  
ATOM   71    C CA   . LYS A 1 5  ? -8.175  -3.384  4.664   1.00 0.00 ? 5  LYS A CA   1  
ATOM   72    C C    . LYS A 1 5  ? -7.071  -4.442  4.619   1.00 0.00 ? 5  LYS A C    1  
ATOM   73    O O    . LYS A 1 5  ? -6.812  -5.029  3.569   1.00 0.00 ? 5  LYS A O    1  
ATOM   74    C CB   . LYS A 1 5  ? -9.136  -3.549  5.844   1.00 0.00 ? 5  LYS A CB   1  
ATOM   75    C CG   . LYS A 1 5  ? -9.896  -2.250  6.117   1.00 0.00 ? 5  LYS A CG   1  
ATOM   76    C CD   . LYS A 1 5  ? -9.577  -1.710  7.513   1.00 0.00 ? 5  LYS A CD   1  
ATOM   77    C CE   . LYS A 1 5  ? -8.609  -0.528  7.435   1.00 0.00 ? 5  LYS A CE   1  
ATOM   78    N NZ   . LYS A 1 5  ? -8.240  -0.071  8.793   1.00 0.00 ? 5  LYS A NZ   1  
ATOM   79    H H    . LYS A 1 5  ? -9.746  -3.938  3.414   1.00 0.00 ? 5  LYS A H    1  
ATOM   80    H HA   . LYS A 1 5  ? -7.710  -2.404  4.762   1.00 0.00 ? 5  LYS A HA   1  
ATOM   81    H HB2  . LYS A 1 5  ? -9.843  -4.351  5.633   1.00 0.00 ? 5  LYS A HB2  1  
ATOM   82    H HB3  . LYS A 1 5  ? -8.578  -3.842  6.734   1.00 0.00 ? 5  LYS A HB3  1  
ATOM   83    H HG2  . LYS A 1 5  ? -9.632  -1.505  5.366   1.00 0.00 ? 5  LYS A HG2  1  
ATOM   84    H HG3  . LYS A 1 5  ? -10.968 -2.426  6.028   1.00 0.00 ? 5  LYS A HG3  1  
ATOM   85    H HD2  . LYS A 1 5  ? -10.498 -1.399  8.005   1.00 0.00 ? 5  LYS A HD2  1  
ATOM   86    H HD3  . LYS A 1 5  ? -9.142  -2.502  8.122   1.00 0.00 ? 5  LYS A HD3  1  
ATOM   87    H HE2  . LYS A 1 5  ? -7.713  -0.820  6.887   1.00 0.00 ? 5  LYS A HE2  1  
ATOM   88    H HE3  . LYS A 1 5  ? -9.069  0.291   6.882   1.00 0.00 ? 5  LYS A HE3  1  
ATOM   89    H HZ1  . LYS A 1 5  ? -7.495  -0.639  9.146   1.00 0.00 ? 5  LYS A HZ1  1  
ATOM   90    H HZ2  . LYS A 1 5  ? -7.942  0.883   8.755   1.00 0.00 ? 5  LYS A HZ2  1  
ATOM   91    N N    . LEU A 1 6  ? -6.450  -4.654  5.770   1.00 0.00 ? 6  LEU A N    1  
ATOM   92    C CA   . LEU A 1 6  ? -5.379  -5.631  5.874   1.00 0.00 ? 6  LEU A CA   1  
ATOM   93    C C    . LEU A 1 6  ? -5.815  -6.932  5.198   1.00 0.00 ? 6  LEU A C    1  
ATOM   94    O O    . LEU A 1 6  ? -5.272  -7.309  4.160   1.00 0.00 ? 6  LEU A O    1  
ATOM   95    C CB   . LEU A 1 6  ? -4.956  -5.808  7.333   1.00 0.00 ? 6  LEU A CB   1  
ATOM   96    C CG   . LEU A 1 6  ? -3.853  -4.871  7.830   1.00 0.00 ? 6  LEU A CG   1  
ATOM   97    C CD1  . LEU A 1 6  ? -4.448  -3.650  8.534   1.00 0.00 ? 6  LEU A CD1  1  
ATOM   98    C CD2  . LEU A 1 6  ? -2.859  -5.619  8.721   1.00 0.00 ? 6  LEU A CD2  1  
ATOM   99    H H    . LEU A 1 6  ? -6.667  -4.172  6.619   1.00 0.00 ? 6  LEU A H    1  
ATOM   100   H HA   . LEU A 1 6  ? -4.520  -5.233  5.335   1.00 0.00 ? 6  LEU A HA   1  
ATOM   101   H HB2  . LEU A 1 6  ? -5.834  -5.671  7.965   1.00 0.00 ? 6  LEU A HB2  1  
ATOM   102   H HB3  . LEU A 1 6  ? -4.621  -6.836  7.472   1.00 0.00 ? 6  LEU A HB3  1  
ATOM   103   H HG   . LEU A 1 6  ? -3.300  -4.506  6.965   1.00 0.00 ? 6  LEU A HG   1  
ATOM   104   H HD11 . LEU A 1 6  ? -3.643  -3.038  8.943   1.00 0.00 ? 6  LEU A HD11 1  
ATOM   105   H HD12 . LEU A 1 6  ? -5.023  -3.062  7.819   1.00 0.00 ? 6  LEU A HD12 1  
ATOM   106   H HD21 . LEU A 1 6  ? -3.338  -5.873  9.667   1.00 0.00 ? 6  LEU A HD21 1  
ATOM   107   H HD22 . LEU A 1 6  ? -2.537  -6.531  8.220   1.00 0.00 ? 6  LEU A HD22 1  
ATOM   108   N N    . VAL A 1 7  ? -6.791  -7.584  5.813   1.00 0.00 ? 7  VAL A N    1  
ATOM   109   C CA   . VAL A 1 7  ? -7.306  -8.835  5.283   1.00 0.00 ? 7  VAL A CA   1  
ATOM   110   C C    . VAL A 1 7  ? -8.382  -8.537  4.237   1.00 0.00 ? 7  VAL A C    1  
ATOM   111   O O    . VAL A 1 7  ? -9.211  -7.649  4.430   1.00 0.00 ? 7  VAL A O    1  
ATOM   112   C CB   . VAL A 1 7  ? -7.811  -9.718  6.426   1.00 0.00 ? 7  VAL A CB   1  
ATOM   113   C CG1  . VAL A 1 7  ? -8.373  -11.038 5.892   1.00 0.00 ? 7  VAL A CG1  1  
ATOM   114   C CG2  . VAL A 1 7  ? -6.707  -9.968  7.455   1.00 0.00 ? 7  VAL A CG2  1  
ATOM   115   H H    . VAL A 1 7  ? -7.227  -7.271  6.656   1.00 0.00 ? 7  VAL A H    1  
ATOM   116   H HA   . VAL A 1 7  ? -6.478  -9.352  4.798   1.00 0.00 ? 7  VAL A HA   1  
ATOM   117   H HB   . VAL A 1 7  ? -8.622  -9.188  6.926   1.00 0.00 ? 7  VAL A HB   1  
ATOM   118   H HG11 . VAL A 1 7  ? -8.967  -11.520 6.668   1.00 0.00 ? 7  VAL A HG11 1  
ATOM   119   H HG12 . VAL A 1 7  ? -9.001  -10.840 5.023   1.00 0.00 ? 7  VAL A HG12 1  
ATOM   120   H HG21 . VAL A 1 7  ? -7.024  -10.752 8.144   1.00 0.00 ? 7  VAL A HG21 1  
ATOM   121   H HG22 . VAL A 1 7  ? -5.797  -10.281 6.943   1.00 0.00 ? 7  VAL A HG22 1  
ATOM   122   N N    . PRO A 1 8  ? -8.333  -9.316  3.124   1.00 0.00 ? 8  PRO A N    1  
ATOM   123   C CA   . PRO A 1 8  ? -9.293  -9.145  2.047   1.00 0.00 ? 8  PRO A CA   1  
ATOM   124   C C    . PRO A 1 8  ? -10.657 -9.721  2.432   1.00 0.00 ? 8  PRO A C    1  
ATOM   125   O O    . PRO A 1 8  ? -11.212 -10.547 1.710   1.00 0.00 ? 8  PRO A O    1  
ATOM   126   C CB   . PRO A 1 8  ? -8.670  -9.843  0.849   1.00 0.00 ? 8  PRO A CB   1  
ATOM   127   C CG   . PRO A 1 8  ? -7.610  -10.774 1.415   1.00 0.00 ? 8  PRO A CG   1  
ATOM   128   C CD   . PRO A 1 8  ? -7.365  -10.378 2.862   1.00 0.00 ? 8  PRO A CD   1  
ATOM   129   H HA   . PRO A 1 8  ? -9.447  -8.172  1.871   1.00 0.00 ? 8  PRO A HA   1  
ATOM   130   H HB2  . PRO A 1 8  ? -9.420  -10.401 0.289   1.00 0.00 ? 8  PRO A HB2  1  
ATOM   131   H HB3  . PRO A 1 8  ? -8.229  -9.121  0.162   1.00 0.00 ? 8  PRO A HB3  1  
ATOM   132   H HG2  . PRO A 1 8  ? -7.940  -11.811 1.353   1.00 0.00 ? 8  PRO A HG2  1  
ATOM   133   H HG3  . PRO A 1 8  ? -6.688  -10.699 0.837   1.00 0.00 ? 8  PRO A HG3  1  
ATOM   134   H HD2  . PRO A 1 8  ? -7.513  -11.223 3.534   1.00 0.00 ? 8  PRO A HD2  1  
ATOM   135   H HD3  . PRO A 1 8  ? -6.344  -10.028 3.009   1.00 0.00 ? 8  PRO A HD3  1  
ATOM   136   N N    . LEU A 1 9  ? -11.158 -9.261  3.569   1.00 0.00 ? 9  LEU A N    1  
ATOM   137   C CA   . LEU A 1 9  ? -12.447 -9.720  4.059   1.00 0.00 ? 9  LEU A CA   1  
ATOM   138   C C    . LEU A 1 9  ? -13.420 -8.540  4.105   1.00 0.00 ? 9  LEU A C    1  
ATOM   139   O O    . LEU A 1 9  ? -14.609 -8.701  3.834   1.00 0.00 ? 9  LEU A O    1  
ATOM   140   C CB   . LEU A 1 9  ? -12.286 -10.437 5.401   1.00 0.00 ? 9  LEU A CB   1  
ATOM   141   C CG   . LEU A 1 9  ? -12.005 -11.939 5.330   1.00 0.00 ? 9  LEU A CG   1  
ATOM   142   C CD1  . LEU A 1 9  ? -11.679 -12.502 6.714   1.00 0.00 ? 9  LEU A CD1  1  
ATOM   143   C CD2  . LEU A 1 9  ? -13.166 -12.683 4.667   1.00 0.00 ? 9  LEU A CD2  1  
ATOM   144   H H    . LEU A 1 9  ? -10.700 -8.589  4.151   1.00 0.00 ? 9  LEU A H    1  
ATOM   145   H HA   . LEU A 1 9  ? -12.825 -10.452 3.346   1.00 0.00 ? 9  LEU A HA   1  
ATOM   146   H HB2  . LEU A 1 9  ? -11.473 -9.961  5.949   1.00 0.00 ? 9  LEU A HB2  1  
ATOM   147   H HB3  . LEU A 1 9  ? -13.195 -10.284 5.983   1.00 0.00 ? 9  LEU A HB3  1  
ATOM   148   H HG   . LEU A 1 9  ? -11.125 -12.093 4.704   1.00 0.00 ? 9  LEU A HG   1  
ATOM   149   H HD11 . LEU A 1 9  ? -10.959 -13.315 6.616   1.00 0.00 ? 9  LEU A HD11 1  
ATOM   150   H HD12 . LEU A 1 9  ? -11.254 -11.714 7.336   1.00 0.00 ? 9  LEU A HD12 1  
ATOM   151   H HD21 . LEU A 1 9  ? -13.714 -13.247 5.422   1.00 0.00 ? 9  LEU A HD21 1  
ATOM   152   H HD22 . LEU A 1 9  ? -13.835 -11.964 4.193   1.00 0.00 ? 9  LEU A HD22 1  
ATOM   153   N N    . PHE A 1 10 ? -12.878 -7.381  4.449   1.00 0.00 ? 10 PHE A N    1  
ATOM   154   C CA   . PHE A 1 10 ? -13.684 -6.175  4.534   1.00 0.00 ? 10 PHE A CA   1  
ATOM   155   C C    . PHE A 1 10 ? -12.959 -4.986  3.900   1.00 0.00 ? 10 PHE A C    1  
ATOM   156   O O    . PHE A 1 10 ? -11.751 -5.039  3.674   1.00 0.00 ? 10 PHE A O    1  
ATOM   157   C CB   . PHE A 1 10 ? -13.905 -5.888  6.020   1.00 0.00 ? 10 PHE A CB   1  
ATOM   158   C CG   . PHE A 1 10 ? -14.282 -7.122  6.843   1.00 0.00 ? 10 PHE A CG   1  
ATOM   159   C CD1  . PHE A 1 10 ? -13.308 -7.925  7.348   1.00 0.00 ? 10 PHE A CD1  1  
ATOM   160   C CD2  . PHE A 1 10 ? -15.591 -7.415  7.068   1.00 0.00 ? 10 PHE A CD2  1  
ATOM   161   C CE1  . PHE A 1 10 ? -13.658 -9.071  8.111   1.00 0.00 ? 10 PHE A CE1  1  
ATOM   162   C CE2  . PHE A 1 10 ? -15.941 -8.561  7.831   1.00 0.00 ? 10 PHE A CE2  1  
ATOM   163   C CZ   . PHE A 1 10 ? -14.967 -9.364  8.336   1.00 0.00 ? 10 PHE A CZ   1  
ATOM   164   H H    . PHE A 1 10 ? -11.910 -7.259  4.667   1.00 0.00 ? 10 PHE A H    1  
ATOM   165   H HA   . PHE A 1 10 ? -14.610 -6.365  3.991   1.00 0.00 ? 10 PHE A HA   1  
ATOM   166   H HB2  . PHE A 1 10 ? -12.997 -5.451  6.435   1.00 0.00 ? 10 PHE A HB2  1  
ATOM   167   H HB3  . PHE A 1 10 ? -14.693 -5.141  6.123   1.00 0.00 ? 10 PHE A HB3  1  
ATOM   168   H HD1  . PHE A 1 10 ? -12.259 -7.690  7.168   1.00 0.00 ? 10 PHE A HD1  1  
ATOM   169   H HD2  . PHE A 1 10 ? -16.371 -6.771  6.662   1.00 0.00 ? 10 PHE A HD2  1  
ATOM   170   H HE1  . PHE A 1 10 ? -12.877 -9.715  8.517   1.00 0.00 ? 10 PHE A HE1  1  
ATOM   171   H HE2  . PHE A 1 10 ? -16.989 -8.796  8.011   1.00 0.00 ? 10 PHE A HE2  1  
ATOM   172   H HZ   . PHE A 1 10 ? -15.235 -10.243 8.922   1.00 0.00 ? 10 PHE A HZ   1  
ATOM   173   N N    . SER A 1 11 ? -13.727 -3.941  3.630   1.00 0.00 ? 11 SER A N    1  
ATOM   174   C CA   . SER A 1 11 ? -13.174 -2.741  3.026   1.00 0.00 ? 11 SER A CA   1  
ATOM   175   C C    . SER A 1 11 ? -13.484 -1.524  3.900   1.00 0.00 ? 11 SER A C    1  
ATOM   176   O O    . SER A 1 11 ? -14.476 -1.515  4.628   1.00 0.00 ? 11 SER A O    1  
ATOM   177   C CB   . SER A 1 11 ? -13.721 -2.532  1.613   1.00 0.00 ? 11 SER A CB   1  
ATOM   178   O OG   . SER A 1 11 ? -15.138 -2.675  1.562   1.00 0.00 ? 11 SER A OG   1  
ATOM   179   H H    . SER A 1 11 ? -14.709 -3.905  3.816   1.00 0.00 ? 11 SER A H    1  
ATOM   180   H HA   . SER A 1 11 ? -12.098 -2.912  2.977   1.00 0.00 ? 11 SER A HA   1  
ATOM   181   H HB2  . SER A 1 11 ? -13.444 -1.539  1.260   1.00 0.00 ? 11 SER A HB2  1  
ATOM   182   H HB3  . SER A 1 11 ? -13.260 -3.251  0.935   1.00 0.00 ? 11 SER A HB3  1  
ATOM   183   H HG   . SER A 1 11 ? -15.510 -2.724  2.489   1.00 0.00 ? 11 SER A HG   1  
ATOM   184   N N    . LYS A 1 12 ? -12.617 -0.527  3.800   1.00 0.00 ? 12 LYS A N    1  
ATOM   185   C CA   . LYS A 1 12 ? -12.786 0.692   4.573   1.00 0.00 ? 12 LYS A CA   1  
ATOM   186   C C    . LYS A 1 12 ? -12.354 1.891   3.727   1.00 0.00 ? 12 LYS A C    1  
ATOM   187   O O    . LYS A 1 12 ? -11.629 1.734   2.745   1.00 0.00 ? 12 LYS A O    1  
ATOM   188   C CB   . LYS A 1 12 ? -12.051 0.585   5.910   1.00 0.00 ? 12 LYS A CB   1  
ATOM   189   C CG   . LYS A 1 12 ? -12.980 0.928   7.076   1.00 0.00 ? 12 LYS A CG   1  
ATOM   190   C CD   . LYS A 1 12 ? -13.543 -0.341  7.719   1.00 0.00 ? 12 LYS A CD   1  
ATOM   191   C CE   . LYS A 1 12 ? -13.613 -0.200  9.241   1.00 0.00 ? 12 LYS A CE   1  
ATOM   192   N NZ   . LYS A 1 12 ? -15.022 -0.169  9.695   1.00 0.00 ? 12 LYS A NZ   1  
ATOM   193   H H    . LYS A 1 12 ? -11.813 -0.542  3.206   1.00 0.00 ? 12 LYS A H    1  
ATOM   194   H HA   . LYS A 1 12 ? -13.849 0.793   4.796   1.00 0.00 ? 12 LYS A HA   1  
ATOM   195   H HB2  . LYS A 1 12 ? -11.661 -0.425  6.035   1.00 0.00 ? 12 LYS A HB2  1  
ATOM   196   H HB3  . LYS A 1 12 ? -11.194 1.259   5.913   1.00 0.00 ? 12 LYS A HB3  1  
ATOM   197   H HG2  . LYS A 1 12 ? -12.436 1.507   7.822   1.00 0.00 ? 12 LYS A HG2  1  
ATOM   198   H HG3  . LYS A 1 12 ? -13.799 1.554   6.722   1.00 0.00 ? 12 LYS A HG3  1  
ATOM   199   H HD2  . LYS A 1 12 ? -14.539 -0.543  7.323   1.00 0.00 ? 12 LYS A HD2  1  
ATOM   200   H HD3  . LYS A 1 12 ? -12.917 -1.194  7.458   1.00 0.00 ? 12 LYS A HD3  1  
ATOM   201   H HE2  . LYS A 1 12 ? -13.091 -1.032  9.714   1.00 0.00 ? 12 LYS A HE2  1  
ATOM   202   H HE3  . LYS A 1 12 ? -13.105 0.713   9.551   1.00 0.00 ? 12 LYS A HE3  1  
ATOM   203   H HZ1  . LYS A 1 12 ? -15.628 -0.202  8.900   1.00 0.00 ? 12 LYS A HZ1  1  
ATOM   204   H HZ2  . LYS A 1 12 ? -15.200 -0.959  10.283  1.00 0.00 ? 12 LYS A HZ2  1  
ATOM   205   N N    . THR A 1 13 ? -12.815 3.063   4.138   1.00 0.00 ? 13 THR A N    1  
ATOM   206   C CA   . THR A 1 13 ? -12.485 4.288   3.431   1.00 0.00 ? 13 THR A CA   1  
ATOM   207   C C    . THR A 1 13 ? -11.363 5.036   4.154   1.00 0.00 ? 13 THR A C    1  
ATOM   208   O O    . THR A 1 13 ? -11.408 5.203   5.371   1.00 0.00 ? 13 THR A O    1  
ATOM   209   C CB   . THR A 1 13 ? -13.767 5.110   3.285   1.00 0.00 ? 13 THR A CB   1  
ATOM   210   O OG1  . THR A 1 13 ? -14.577 4.337   2.404   1.00 0.00 ? 13 THR A OG1  1  
ATOM   211   C CG2  . THR A 1 13 ? -13.539 6.421   2.528   1.00 0.00 ? 13 THR A CG2  1  
ATOM   212   H H    . THR A 1 13 ? -13.404 3.182   4.938   1.00 0.00 ? 13 THR A H    1  
ATOM   213   H HA   . THR A 1 13 ? -12.108 4.023   2.443   1.00 0.00 ? 13 THR A HA   1  
ATOM   214   H HB   . THR A 1 13 ? -14.223 5.296   4.257   1.00 0.00 ? 13 THR A HB   1  
ATOM   215   H HG1  . THR A 1 13 ? -15.378 4.866   2.123   1.00 0.00 ? 13 THR A HG1  1  
ATOM   216   H HG21 . THR A 1 13 ? -13.588 6.234   1.456   1.00 0.00 ? 13 THR A HG21 1  
ATOM   217   H HG22 . THR A 1 13 ? -14.310 7.140   2.807   1.00 0.00 ? 13 THR A HG22 1  
ATOM   218   N N    . CYS A 1 14 ? -10.382 5.465   3.373   1.00 0.00 ? 14 CYS A N    1  
ATOM   219   C CA   . CYS A 1 14 ? -9.250  6.190   3.924   1.00 0.00 ? 14 CYS A CA   1  
ATOM   220   C C    . CYS A 1 14 ? -9.690  7.630   4.197   1.00 0.00 ? 14 CYS A C    1  
ATOM   221   O O    . CYS A 1 14 ? -10.002 8.375   3.270   1.00 0.00 ? 14 CYS A O    1  
ATOM   222   C CB   . CYS A 1 14 ? -8.035  6.131   2.996   1.00 0.00 ? 14 CYS A CB   1  
ATOM   223   S SG   . CYS A 1 14 ? -7.828  4.548   2.102   1.00 0.00 ? 14 CYS A SG   1  
ATOM   224   H H    . CYS A 1 14 ? -10.353 5.324   2.383   1.00 0.00 ? 14 CYS A H    1  
ATOM   225   H HA   . CYS A 1 14 ? -8.976  5.686   4.850   1.00 0.00 ? 14 CYS A HA   1  
ATOM   226   H HB2  . CYS A 1 14 ? -8.113  6.936   2.266   1.00 0.00 ? 14 CYS A HB2  1  
ATOM   227   H HB3  . CYS A 1 14 ? -7.137  6.321   3.584   1.00 0.00 ? 14 CYS A HB3  1  
ATOM   228   N N    . PRO A 1 15 ? -9.700  7.988   5.509   1.00 0.00 ? 15 PRO A N    1  
ATOM   229   C CA   . PRO A 1 15 ? -10.096 9.325   5.917   1.00 0.00 ? 15 PRO A CA   1  
ATOM   230   C C    . PRO A 1 15 ? -8.992  10.340  5.613   1.00 0.00 ? 15 PRO A C    1  
ATOM   231   O O    . PRO A 1 15 ? -7.890  9.964   5.219   1.00 0.00 ? 15 PRO A O    1  
ATOM   232   C CB   . PRO A 1 15 ? -10.404 9.209   7.401   1.00 0.00 ? 15 PRO A CB   1  
ATOM   233   C CG   . PRO A 1 15 ? -9.727  7.931   7.868   1.00 0.00 ? 15 PRO A CG   1  
ATOM   234   C CD   . PRO A 1 15 ? -9.336  7.132   6.635   1.00 0.00 ? 15 PRO A CD   1  
ATOM   235   H HA   . PRO A 1 15 ? -10.894 9.625   5.395   1.00 0.00 ? 15 PRO A HA   1  
ATOM   236   H HB2  . PRO A 1 15 ? -10.026 10.073  7.947   1.00 0.00 ? 15 PRO A HB2  1  
ATOM   237   H HB3  . PRO A 1 15 ? -11.479 9.168   7.575   1.00 0.00 ? 15 PRO A HB3  1  
ATOM   238   H HG2  . PRO A 1 15 ? -8.847  8.162   8.468   1.00 0.00 ? 15 PRO A HG2  1  
ATOM   239   H HG3  . PRO A 1 15 ? -10.400 7.352   8.501   1.00 0.00 ? 15 PRO A HG3  1  
ATOM   240   H HD2  . PRO A 1 15 ? -8.270  6.905   6.632   1.00 0.00 ? 15 PRO A HD2  1  
ATOM   241   H HD3  . PRO A 1 15 ? -9.865  6.180   6.596   1.00 0.00 ? 15 PRO A HD3  1  
ATOM   242   N N    . ALA A 1 16 ? -9.328  11.607  5.808   1.00 0.00 ? 16 ALA A N    1  
ATOM   243   C CA   . ALA A 1 16 ? -8.379  12.679  5.560   1.00 0.00 ? 16 ALA A CA   1  
ATOM   244   C C    . ALA A 1 16 ? -6.999  12.263  6.074   1.00 0.00 ? 16 ALA A C    1  
ATOM   245   O O    . ALA A 1 16 ? -6.893  11.578  7.090   1.00 0.00 ? 16 ALA A O    1  
ATOM   246   C CB   . ALA A 1 16 ? -8.881  13.968  6.215   1.00 0.00 ? 16 ALA A CB   1  
ATOM   247   H H    . ALA A 1 16 ? -10.227 11.905  6.130   1.00 0.00 ? 16 ALA A H    1  
ATOM   248   H HA   . ALA A 1 16 ? -8.325  12.832  4.482   1.00 0.00 ? 16 ALA A HA   1  
ATOM   249   H HB1  . ALA A 1 16 ? -9.966  14.021  6.127   1.00 0.00 ? 16 ALA A HB1  1  
ATOM   250   H HB2  . ALA A 1 16 ? -8.602  13.972  7.269   1.00 0.00 ? 16 ALA A HB2  1  
ATOM   251   N N    . GLY A 1 17 ? -5.978  12.695  5.349   1.00 0.00 ? 17 GLY A N    1  
ATOM   252   C CA   . GLY A 1 17 ? -4.610  12.375  5.720   1.00 0.00 ? 17 GLY A CA   1  
ATOM   253   C C    . GLY A 1 17 ? -4.009  11.345  4.761   1.00 0.00 ? 17 GLY A C    1  
ATOM   254   O O    . GLY A 1 17 ? -2.936  11.564  4.201   1.00 0.00 ? 17 GLY A O    1  
ATOM   255   H H    . GLY A 1 17 ? -6.073  13.252  4.524   1.00 0.00 ? 17 GLY A H    1  
ATOM   256   H HA2  . GLY A 1 17 ? -4.005  13.282  5.710   1.00 0.00 ? 17 GLY A HA2  1  
ATOM   257   H HA3  . GLY A 1 17 ? -4.586  11.987  6.738   1.00 0.00 ? 17 GLY A HA3  1  
ATOM   258   N N    . LYS A 1 18 ? -4.726  10.243  4.602   1.00 0.00 ? 18 LYS A N    1  
ATOM   259   C CA   . LYS A 1 18 ? -4.277  9.178   3.722   1.00 0.00 ? 18 LYS A CA   1  
ATOM   260   C C    . LYS A 1 18 ? -5.117  9.191   2.443   1.00 0.00 ? 18 LYS A C    1  
ATOM   261   O O    . LYS A 1 18 ? -6.175  8.567   2.384   1.00 0.00 ? 18 LYS A O    1  
ATOM   262   C CB   . LYS A 1 18 ? -4.293  7.834   4.454   1.00 0.00 ? 18 LYS A CB   1  
ATOM   263   C CG   . LYS A 1 18 ? -5.528  7.713   5.350   1.00 0.00 ? 18 LYS A CG   1  
ATOM   264   C CD   . LYS A 1 18 ? -5.240  8.245   6.755   1.00 0.00 ? 18 LYS A CD   1  
ATOM   265   C CE   . LYS A 1 18 ? -5.473  7.162   7.810   1.00 0.00 ? 18 LYS A CE   1  
ATOM   266   N NZ   . LYS A 1 18 ? -4.233  6.909   8.577   1.00 0.00 ? 18 LYS A NZ   1  
ATOM   267   H H    . LYS A 1 18 ? -5.598  10.072  5.062   1.00 0.00 ? 18 LYS A H    1  
ATOM   268   H HA   . LYS A 1 18 ? -3.241  9.388   3.457   1.00 0.00 ? 18 LYS A HA   1  
ATOM   269   H HB2  . LYS A 1 18 ? -4.284  7.020   3.729   1.00 0.00 ? 18 LYS A HB2  1  
ATOM   270   H HB3  . LYS A 1 18 ? -3.391  7.734   5.056   1.00 0.00 ? 18 LYS A HB3  1  
ATOM   271   H HG2  . LYS A 1 18 ? -6.357  8.267   4.910   1.00 0.00 ? 18 LYS A HG2  1  
ATOM   272   H HG3  . LYS A 1 18 ? -5.838  6.669   5.408   1.00 0.00 ? 18 LYS A HG3  1  
ATOM   273   H HD2  . LYS A 1 18 ? -4.209  8.596   6.811   1.00 0.00 ? 18 LYS A HD2  1  
ATOM   274   H HD3  . LYS A 1 18 ? -5.880  9.102   6.961   1.00 0.00 ? 18 LYS A HD3  1  
ATOM   275   H HE2  . LYS A 1 18 ? -6.270  7.470   8.487   1.00 0.00 ? 18 LYS A HE2  1  
ATOM   276   H HE3  . LYS A 1 18 ? -5.803  6.241   7.328   1.00 0.00 ? 18 LYS A HE3  1  
ATOM   277   H HZ1  . LYS A 1 18 ? -4.281  7.387   9.454   1.00 0.00 ? 18 LYS A HZ1  1  
ATOM   278   H HZ2  . LYS A 1 18 ? -4.134  5.927   8.737   1.00 0.00 ? 18 LYS A HZ2  1  
ATOM   279   N N    . ASN A 1 19 ? -4.614  9.910   1.450   1.00 0.00 ? 19 ASN A N    1  
ATOM   280   C CA   . ASN A 1 19 ? -5.305  10.013  0.176   1.00 0.00 ? 19 ASN A CA   1  
ATOM   281   C C    . ASN A 1 19 ? -4.716  8.995   -0.802  1.00 0.00 ? 19 ASN A C    1  
ATOM   282   O O    . ASN A 1 19 ? -5.063  8.990   -1.983  1.00 0.00 ? 19 ASN A O    1  
ATOM   283   C CB   . ASN A 1 19 ? -5.134  11.407  -0.432  1.00 0.00 ? 19 ASN A CB   1  
ATOM   284   C CG   . ASN A 1 19 ? -5.994  12.435  0.304   1.00 0.00 ? 19 ASN A CG   1  
ATOM   285   O OD1  . ASN A 1 19 ? -5.697  12.853  1.411   1.00 0.00 ? 19 ASN A OD1  1  
ATOM   286   N ND2  . ASN A 1 19 ? -7.075  12.819  -0.371  1.00 0.00 ? 19 ASN A ND2  1  
ATOM   287   H H    . ASN A 1 19 ? -3.753  10.415  1.506   1.00 0.00 ? 19 ASN A H    1  
ATOM   288   H HA   . ASN A 1 19 ? -6.353  9.817   0.402   1.00 0.00 ? 19 ASN A HA   1  
ATOM   289   H HB2  . ASN A 1 19 ? -4.086  11.702  -0.384  1.00 0.00 ? 19 ASN A HB2  1  
ATOM   290   H HB3  . ASN A 1 19 ? -5.410  11.384  -1.487  1.00 0.00 ? 19 ASN A HB3  1  
ATOM   291   H HD21 . ASN A 1 19 ? -7.260  12.437  -1.276  1.00 0.00 ? 19 ASN A HD21 1  
ATOM   292   H HD22 . ASN A 1 19 ? -7.701  13.490  0.027   1.00 0.00 ? 19 ASN A HD22 1  
ATOM   293   N N    . LEU A 1 20 ? -3.836  8.156   -0.276  1.00 0.00 ? 20 LEU A N    1  
ATOM   294   C CA   . LEU A 1 20 ? -3.196  7.136   -1.088  1.00 0.00 ? 20 LEU A CA   1  
ATOM   295   C C    . LEU A 1 20 ? -3.141  5.824   -0.301  1.00 0.00 ? 20 LEU A C    1  
ATOM   296   O O    . LEU A 1 20 ? -2.712  5.805   0.852   1.00 0.00 ? 20 LEU A O    1  
ATOM   297   C CB   . LEU A 1 20 ? -1.828  7.618   -1.574  1.00 0.00 ? 20 LEU A CB   1  
ATOM   298   C CG   . LEU A 1 20 ? -1.825  8.912   -2.392  1.00 0.00 ? 20 LEU A CG   1  
ATOM   299   C CD1  . LEU A 1 20 ? -0.958  9.981   -1.724  1.00 0.00 ? 20 LEU A CD1  1  
ATOM   300   C CD2  . LEU A 1 20 ? -1.396  8.646   -3.836  1.00 0.00 ? 20 LEU A CD2  1  
ATOM   301   H H    . LEU A 1 20 ? -3.559  8.167   0.685   1.00 0.00 ? 20 LEU A H    1  
ATOM   302   H HA   . LEU A 1 20 ? -3.817  6.983   -1.970  1.00 0.00 ? 20 LEU A HA   1  
ATOM   303   H HB2  . LEU A 1 20 ? -1.184  7.759   -0.706  1.00 0.00 ? 20 LEU A HB2  1  
ATOM   304   H HB3  . LEU A 1 20 ? -1.380  6.829   -2.179  1.00 0.00 ? 20 LEU A HB3  1  
ATOM   305   H HG   . LEU A 1 20 ? -2.844  9.297   -2.425  1.00 0.00 ? 20 LEU A HG   1  
ATOM   306   H HD11 . LEU A 1 20 ? -0.813  9.727   -0.674  1.00 0.00 ? 20 LEU A HD11 1  
ATOM   307   H HD12 . LEU A 1 20 ? 0.010   10.028  -2.223  1.00 0.00 ? 20 LEU A HD12 1  
ATOM   308   H HD21 . LEU A 1 20 ? -1.764  9.447   -4.478  1.00 0.00 ? 20 LEU A HD21 1  
ATOM   309   H HD22 . LEU A 1 20 ? -0.308  8.608   -3.891  1.00 0.00 ? 20 LEU A HD22 1  
ATOM   310   N N    . CYS A 1 21 ? -3.582  4.760   -0.956  1.00 0.00 ? 21 CYS A N    1  
ATOM   311   C CA   . CYS A 1 21 ? -3.588  3.448   -0.332  1.00 0.00 ? 21 CYS A CA   1  
ATOM   312   C C    . CYS A 1 21 ? -2.216  2.806   -0.548  1.00 0.00 ? 21 CYS A C    1  
ATOM   313   O O    . CYS A 1 21 ? -1.623  2.945   -1.617  1.00 0.00 ? 21 CYS A O    1  
ATOM   314   C CB   . CYS A 1 21 ? -4.719  2.570   -0.872  1.00 0.00 ? 21 CYS A CB   1  
ATOM   315   S SG   . CYS A 1 21 ? -6.380  3.336   -0.811  1.00 0.00 ? 21 CYS A SG   1  
ATOM   316   H H    . CYS A 1 21 ? -3.929  4.784   -1.893  1.00 0.00 ? 21 CYS A H    1  
ATOM   317   H HA   . CYS A 1 21 ? -3.778  3.606   0.730   1.00 0.00 ? 21 CYS A HA   1  
ATOM   318   H HB2  . CYS A 1 21 ? -4.494  2.306   -1.905  1.00 0.00 ? 21 CYS A HB2  1  
ATOM   319   H HB3  . CYS A 1 21 ? -4.742  1.641   -0.303  1.00 0.00 ? 21 CYS A HB3  1  
ATOM   320   N N    . TYR A 1 22 ? -1.751  2.118   0.484   1.00 0.00 ? 22 TYR A N    1  
ATOM   321   C CA   . TYR A 1 22 ? -0.460  1.455   0.421   1.00 0.00 ? 22 TYR A CA   1  
ATOM   322   C C    . TYR A 1 22 ? -0.604  -0.050  0.652   1.00 0.00 ? 22 TYR A C    1  
ATOM   323   O O    . TYR A 1 22 ? -1.564  -0.496  1.279   1.00 0.00 ? 22 TYR A O    1  
ATOM   324   C CB   . TYR A 1 22 ? 0.378   2.054   1.552   1.00 0.00 ? 22 TYR A CB   1  
ATOM   325   C CG   . TYR A 1 22 ? -0.001  1.546   2.945   1.00 0.00 ? 22 TYR A CG   1  
ATOM   326   C CD1  . TYR A 1 22 ? 0.539   0.368   3.420   1.00 0.00 ? 22 TYR A CD1  1  
ATOM   327   C CD2  . TYR A 1 22 ? -0.884  2.265   3.725   1.00 0.00 ? 22 TYR A CD2  1  
ATOM   328   C CE1  . TYR A 1 22 ? 0.181   -0.110  4.730   1.00 0.00 ? 22 TYR A CE1  1  
ATOM   329   C CE2  . TYR A 1 22 ? -1.241  1.787   5.035   1.00 0.00 ? 22 TYR A CE2  1  
ATOM   330   C CZ   . TYR A 1 22 ? -0.691  0.623   5.473   1.00 0.00 ? 22 TYR A CZ   1  
ATOM   331   O OH   . TYR A 1 22 ? -1.029  0.171   6.711   1.00 0.00 ? 22 TYR A OH   1  
ATOM   332   H H    . TYR A 1 22 ? -2.239  2.010   1.350   1.00 0.00 ? 22 TYR A H    1  
ATOM   333   H HA   . TYR A 1 22 ? -0.043  1.624   -0.572  1.00 0.00 ? 22 TYR A HA   1  
ATOM   334   H HB2  . TYR A 1 22 ? 1.430   1.831   1.370   1.00 0.00 ? 22 TYR A HB2  1  
ATOM   335   H HB3  . TYR A 1 22 ? 0.275   3.139   1.532   1.00 0.00 ? 22 TYR A HB3  1  
ATOM   336   H HD1  . TYR A 1 22 ? 1.236   -0.199  2.804   1.00 0.00 ? 22 TYR A HD1  1  
ATOM   337   H HD2  . TYR A 1 22 ? -1.311  3.195   3.349   1.00 0.00 ? 22 TYR A HD2  1  
ATOM   338   H HE1  . TYR A 1 22 ? 0.600   -1.038  5.118   1.00 0.00 ? 22 TYR A HE1  1  
ATOM   339   H HE2  . TYR A 1 22 ? -1.937  2.345   5.661   1.00 0.00 ? 22 TYR A HE2  1  
ATOM   340   H HH   . TYR A 1 22 ? -0.976  -0.827  6.736   1.00 0.00 ? 22 TYR A HH   1  
ATOM   341   N N    . LYS A 1 23 ? 0.364   -0.792  0.134   1.00 0.00 ? 23 LYS A N    1  
ATOM   342   C CA   . LYS A 1 23 ? 0.356   -2.238  0.276   1.00 0.00 ? 23 LYS A CA   1  
ATOM   343   C C    . LYS A 1 23 ? 1.778   -2.726  0.561   1.00 0.00 ? 23 LYS A C    1  
ATOM   344   O O    . LYS A 1 23 ? 2.691   -2.483  -0.227  1.00 0.00 ? 23 LYS A O    1  
ATOM   345   C CB   . LYS A 1 23 ? -0.285  -2.894  -0.949  1.00 0.00 ? 23 LYS A CB   1  
ATOM   346   C CG   . LYS A 1 23 ? 0.617   -2.759  -2.178  1.00 0.00 ? 23 LYS A CG   1  
ATOM   347   C CD   . LYS A 1 23 ? -0.202  -2.413  -3.423  1.00 0.00 ? 23 LYS A CD   1  
ATOM   348   C CE   . LYS A 1 23 ? -0.460  -3.659  -4.272  1.00 0.00 ? 23 LYS A CE   1  
ATOM   349   N NZ   . LYS A 1 23 ? -0.156  -3.389  -5.695  1.00 0.00 ? 23 LYS A NZ   1  
ATOM   350   H H    . LYS A 1 23 ? 1.141   -0.421  -0.374  1.00 0.00 ? 23 LYS A H    1  
ATOM   351   H HA   . LYS A 1 23 ? -0.270  -2.479  1.135   1.00 0.00 ? 23 LYS A HA   1  
ATOM   352   H HB2  . LYS A 1 23 ? -0.473  -3.948  -0.746  1.00 0.00 ? 23 LYS A HB2  1  
ATOM   353   H HB3  . LYS A 1 23 ? -1.251  -2.431  -1.150  1.00 0.00 ? 23 LYS A HB3  1  
ATOM   354   H HG2  . LYS A 1 23 ? 1.363   -1.984  -2.002  1.00 0.00 ? 23 LYS A HG2  1  
ATOM   355   H HG3  . LYS A 1 23 ? 1.157   -3.691  -2.340  1.00 0.00 ? 23 LYS A HG3  1  
ATOM   356   H HD2  . LYS A 1 23 ? -1.151  -1.967  -3.127  1.00 0.00 ? 23 LYS A HD2  1  
ATOM   357   H HD3  . LYS A 1 23 ? 0.329   -1.668  -4.016  1.00 0.00 ? 23 LYS A HD3  1  
ATOM   358   H HE2  . LYS A 1 23 ? 0.154   -4.485  -3.913  1.00 0.00 ? 23 LYS A HE2  1  
ATOM   359   H HE3  . LYS A 1 23 ? -1.501  -3.968  -4.169  1.00 0.00 ? 23 LYS A HE3  1  
ATOM   360   H HZ1  . LYS A 1 23 ? -0.628  -2.557  -5.985  1.00 0.00 ? 23 LYS A HZ1  1  
ATOM   361   H HZ2  . LYS A 1 23 ? 0.831   -3.269  -5.808  1.00 0.00 ? 23 LYS A HZ2  1  
ATOM   362   N N    . MET A 1 24 ? 1.921   -3.404  1.690   1.00 0.00 ? 24 MET A N    1  
ATOM   363   C CA   . MET A 1 24 ? 3.217   -3.928  2.089   1.00 0.00 ? 24 MET A CA   1  
ATOM   364   C C    . MET A 1 24 ? 3.274   -5.446  1.906   1.00 0.00 ? 24 MET A C    1  
ATOM   365   O O    . MET A 1 24 ? 2.475   -6.176  2.490   1.00 0.00 ? 24 MET A O    1  
ATOM   366   C CB   . MET A 1 24 ? 3.479   -3.580  3.555   1.00 0.00 ? 24 MET A CB   1  
ATOM   367   C CG   . MET A 1 24 ? 3.696   -2.076  3.731   1.00 0.00 ? 24 MET A CG   1  
ATOM   368   S SD   . MET A 1 24 ? 3.156   -1.567  5.355   1.00 0.00 ? 24 MET A SD   1  
ATOM   369   C CE   . MET A 1 24 ? 4.173   -0.117  5.580   1.00 0.00 ? 24 MET A CE   1  
ATOM   370   H H    . MET A 1 24 ? 1.174   -3.597  2.325   1.00 0.00 ? 24 MET A H    1  
ATOM   371   H HA   . MET A 1 24 ? 3.942   -3.448  1.431   1.00 0.00 ? 24 MET A HA   1  
ATOM   372   H HB2  . MET A 1 24 ? 2.636   -3.903  4.166   1.00 0.00 ? 24 MET A HB2  1  
ATOM   373   H HB3  . MET A 1 24 ? 4.355   -4.122  3.910   1.00 0.00 ? 24 MET A HB3  1  
ATOM   374   H HG2  . MET A 1 24 ? 4.751   -1.834  3.598   1.00 0.00 ? 24 MET A HG2  1  
ATOM   375   H HG3  . MET A 1 24 ? 3.145   -1.528  2.967   1.00 0.00 ? 24 MET A HG3  1  
ATOM   376   H HE1  . MET A 1 24 ? 4.621   0.164   4.627   1.00 0.00 ? 24 MET A HE1  1  
ATOM   377   H HE2  . MET A 1 24 ? 3.559   0.704   5.949   1.00 0.00 ? 24 MET A HE2  1  
ATOM   378   N N    . PHE A 1 25 ? 4.228   -5.876  1.093   1.00 0.00 ? 25 PHE A N    1  
ATOM   379   C CA   . PHE A 1 25 ? 4.400   -7.294  0.826   1.00 0.00 ? 25 PHE A CA   1  
ATOM   380   C C    . PHE A 1 25 ? 5.883   -7.666  0.776   1.00 0.00 ? 25 PHE A C    1  
ATOM   381   O O    . PHE A 1 25 ? 6.727   -6.829  0.458   1.00 0.00 ? 25 PHE A O    1  
ATOM   382   C CB   . PHE A 1 25 ? 3.771   -7.572  -0.541  1.00 0.00 ? 25 PHE A CB   1  
ATOM   383   C CG   . PHE A 1 25 ? 4.680   -7.235  -1.725  1.00 0.00 ? 25 PHE A CG   1  
ATOM   384   C CD1  . PHE A 1 25 ? 4.806   -5.947  -2.140  1.00 0.00 ? 25 PHE A CD1  1  
ATOM   385   C CD2  . PHE A 1 25 ? 5.361   -8.225  -2.361  1.00 0.00 ? 25 PHE A CD2  1  
ATOM   386   C CE1  . PHE A 1 25 ? 5.650   -5.634  -3.239  1.00 0.00 ? 25 PHE A CE1  1  
ATOM   387   C CE2  . PHE A 1 25 ? 6.205   -7.913  -3.460  1.00 0.00 ? 25 PHE A CE2  1  
ATOM   388   C CZ   . PHE A 1 25 ? 6.331   -6.624  -3.876  1.00 0.00 ? 25 PHE A CZ   1  
ATOM   389   H H    . PHE A 1 25 ? 4.874   -5.276  0.622   1.00 0.00 ? 25 PHE A H    1  
ATOM   390   H HA   . PHE A 1 25 ? 3.918   -7.837  1.639   1.00 0.00 ? 25 PHE A HA   1  
ATOM   391   H HB2  . PHE A 1 25 ? 3.495   -8.625  -0.595  1.00 0.00 ? 25 PHE A HB2  1  
ATOM   392   H HB3  . PHE A 1 25 ? 2.849   -6.996  -0.629  1.00 0.00 ? 25 PHE A HB3  1  
ATOM   393   H HD1  . PHE A 1 25 ? 4.260   -5.153  -1.629  1.00 0.00 ? 25 PHE A HD1  1  
ATOM   394   H HD2  . PHE A 1 25 ? 5.259   -9.258  -2.028  1.00 0.00 ? 25 PHE A HD2  1  
ATOM   395   H HE1  . PHE A 1 25 ? 5.752   -4.602  -3.572  1.00 0.00 ? 25 PHE A HE1  1  
ATOM   396   H HE2  . PHE A 1 25 ? 6.751   -8.707  -3.971  1.00 0.00 ? 25 PHE A HE2  1  
ATOM   397   H HZ   . PHE A 1 25 ? 6.979   -6.385  -4.719  1.00 0.00 ? 25 PHE A HZ   1  
ATOM   398   N N    . MET A 1 26 ? 6.156   -8.923  1.095   1.00 0.00 ? 26 MET A N    1  
ATOM   399   C CA   . MET A 1 26 ? 7.523   -9.416  1.090   1.00 0.00 ? 26 MET A CA   1  
ATOM   400   C C    . MET A 1 26 ? 7.890   -10.001 -0.275  1.00 0.00 ? 26 MET A C    1  
ATOM   401   O O    . MET A 1 26 ? 7.028   -10.511 -0.989  1.00 0.00 ? 26 MET A O    1  
ATOM   402   C CB   . MET A 1 26 ? 7.681   -10.493 2.166   1.00 0.00 ? 26 MET A CB   1  
ATOM   403   C CG   . MET A 1 26 ? 7.458   -9.909  3.563   1.00 0.00 ? 26 MET A CG   1  
ATOM   404   S SD   . MET A 1 26 ? 6.947   -11.197 4.688   1.00 0.00 ? 26 MET A SD   1  
ATOM   405   C CE   . MET A 1 26 ? 8.526   -11.632 5.399   1.00 0.00 ? 26 MET A CE   1  
ATOM   406   H H    . MET A 1 26 ? 5.464   -9.598  1.353   1.00 0.00 ? 26 MET A H    1  
ATOM   407   H HA   . MET A 1 26 ? 8.148   -8.549  1.302   1.00 0.00 ? 26 MET A HA   1  
ATOM   408   H HB2  . MET A 1 26 ? 6.969   -11.298 1.987   1.00 0.00 ? 26 MET A HB2  1  
ATOM   409   H HB3  . MET A 1 26 ? 8.678   -10.930 2.105   1.00 0.00 ? 26 MET A HB3  1  
ATOM   410   H HG2  . MET A 1 26 ? 8.376   -9.444  3.922   1.00 0.00 ? 26 MET A HG2  1  
ATOM   411   H HG3  . MET A 1 26 ? 6.700   -9.128  3.523   1.00 0.00 ? 26 MET A HG3  1  
ATOM   412   H HE1  . MET A 1 26 ? 9.223   -10.804 5.270   1.00 0.00 ? 26 MET A HE1  1  
ATOM   413   H HE2  . MET A 1 26 ? 8.401   -11.840 6.462   1.00 0.00 ? 26 MET A HE2  1  
ATOM   414   N N    . VAL A 1 27 ? 9.172   -9.908  -0.597  1.00 0.00 ? 27 VAL A N    1  
ATOM   415   C CA   . VAL A 1 27 ? 9.664   -10.421 -1.864  1.00 0.00 ? 27 VAL A CA   1  
ATOM   416   C C    . VAL A 1 27 ? 9.382   -11.923 -1.946  1.00 0.00 ? 27 VAL A C    1  
ATOM   417   O O    . VAL A 1 27 ? 9.472   -12.517 -3.019  1.00 0.00 ? 27 VAL A O    1  
ATOM   418   C CB   . VAL A 1 27 ? 11.148  -10.082 -2.026  1.00 0.00 ? 27 VAL A CB   1  
ATOM   419   C CG1  . VAL A 1 27 ? 11.999  -10.851 -1.014  1.00 0.00 ? 27 VAL A CG1  1  
ATOM   420   C CG2  . VAL A 1 27 ? 11.619  -10.351 -3.456  1.00 0.00 ? 27 VAL A CG2  1  
ATOM   421   H H    . VAL A 1 27 ? 9.867   -9.492  -0.011  1.00 0.00 ? 27 VAL A H    1  
ATOM   422   H HA   . VAL A 1 27 ? 9.114   -9.917  -2.659  1.00 0.00 ? 27 VAL A HA   1  
ATOM   423   H HB   . VAL A 1 27 ? 11.271  -9.017  -1.827  1.00 0.00 ? 27 VAL A HB   1  
ATOM   424   H HG11 . VAL A 1 27 ? 11.378  -11.151 -0.170  1.00 0.00 ? 27 VAL A HG11 1  
ATOM   425   H HG12 . VAL A 1 27 ? 12.417  -11.738 -1.490  1.00 0.00 ? 27 VAL A HG12 1  
ATOM   426   H HG21 . VAL A 1 27 ? 12.531  -9.786  -3.651  1.00 0.00 ? 27 VAL A HG21 1  
ATOM   427   H HG22 . VAL A 1 27 ? 11.819  -11.416 -3.579  1.00 0.00 ? 27 VAL A HG22 1  
ATOM   428   N N    . ALA A 1 28 ? 9.046   -12.492 -0.798  1.00 0.00 ? 28 ALA A N    1  
ATOM   429   C CA   . ALA A 1 28 ? 8.750   -13.913 -0.726  1.00 0.00 ? 28 ALA A CA   1  
ATOM   430   C C    . ALA A 1 28 ? 8.001   -14.338 -1.990  1.00 0.00 ? 28 ALA A C    1  
ATOM   431   O O    . ALA A 1 28 ? 8.264   -15.406 -2.542  1.00 0.00 ? 28 ALA A O    1  
ATOM   432   C CB   . ALA A 1 28 ? 7.956   -14.205 0.549   1.00 0.00 ? 28 ALA A CB   1  
ATOM   433   H H    . ALA A 1 28 ? 8.976   -12.001 0.070   1.00 0.00 ? 28 ALA A H    1  
ATOM   434   H HA   . ALA A 1 28 ? 9.699   -14.448 -0.678  1.00 0.00 ? 28 ALA A HA   1  
ATOM   435   H HB1  . ALA A 1 28 ? 8.076   -13.379 1.250   1.00 0.00 ? 28 ALA A HB1  1  
ATOM   436   H HB2  . ALA A 1 28 ? 6.900   -14.320 0.301   1.00 0.00 ? 28 ALA A HB2  1  
ATOM   437   N N    . ALA A 1 29 ? 7.083   -13.481 -2.412  1.00 0.00 ? 29 ALA A N    1  
ATOM   438   C CA   . ALA A 1 29 ? 6.294   -13.755 -3.601  1.00 0.00 ? 29 ALA A CA   1  
ATOM   439   C C    . ALA A 1 29 ? 5.900   -12.432 -4.262  1.00 0.00 ? 29 ALA A C    1  
ATOM   440   O O    . ALA A 1 29 ? 5.782   -11.409 -3.590  1.00 0.00 ? 29 ALA A O    1  
ATOM   441   C CB   . ALA A 1 29 ? 5.078   -14.603 -3.223  1.00 0.00 ? 29 ALA A CB   1  
ATOM   442   H H    . ALA A 1 29 ? 6.876   -12.615 -1.957  1.00 0.00 ? 29 ALA A H    1  
ATOM   443   H HA   . ALA A 1 29 ? 6.919   -14.324 -4.290  1.00 0.00 ? 29 ALA A HA   1  
ATOM   444   H HB1  . ALA A 1 29 ? 4.171   -14.116 -3.579  1.00 0.00 ? 29 ALA A HB1  1  
ATOM   445   H HB2  . ALA A 1 29 ? 5.166   -15.588 -3.682  1.00 0.00 ? 29 ALA A HB2  1  
ATOM   446   N N    . PRO A 1 30 ? 5.702   -12.498 -5.606  1.00 0.00 ? 30 PRO A N    1  
ATOM   447   C CA   . PRO A 1 30 ? 5.324   -11.318 -6.365  1.00 0.00 ? 30 PRO A CA   1  
ATOM   448   C C    . PRO A 1 30 ? 3.854   -10.964 -6.131  1.00 0.00 ? 30 PRO A C    1  
ATOM   449   O O    . PRO A 1 30 ? 3.432   -9.840  -6.400  1.00 0.00 ? 30 PRO A O    1  
ATOM   450   C CB   . PRO A 1 30 ? 5.627   -11.668 -7.813  1.00 0.00 ? 30 PRO A CB   1  
ATOM   451   C CG   . PRO A 1 30 ? 5.725   -13.184 -7.864  1.00 0.00 ? 30 PRO A CG   1  
ATOM   452   C CD   . PRO A 1 30 ? 5.833   -13.692 -6.435  1.00 0.00 ? 30 PRO A CD   1  
ATOM   453   H HA   . PRO A 1 30 ? 5.849   -10.525 -6.058  1.00 0.00 ? 30 PRO A HA   1  
ATOM   454   H HB2  . PRO A 1 30 ? 4.842   -11.305 -8.475  1.00 0.00 ? 30 PRO A HB2  1  
ATOM   455   H HB3  . PRO A 1 30 ? 6.559   -11.205 -8.140  1.00 0.00 ? 30 PRO A HB3  1  
ATOM   456   H HG2  . PRO A 1 30 ? 4.848   -13.607 -8.354  1.00 0.00 ? 30 PRO A HG2  1  
ATOM   457   H HG3  . PRO A 1 30 ? 6.594   -13.491 -8.445  1.00 0.00 ? 30 PRO A HG3  1  
ATOM   458   H HD2  . PRO A 1 30 ? 5.050   -14.417 -6.212  1.00 0.00 ? 30 PRO A HD2  1  
ATOM   459   H HD3  . PRO A 1 30 ? 6.787   -14.191 -6.264  1.00 0.00 ? 30 PRO A HD3  1  
ATOM   460   N N    . HIS A 1 31 ? 3.114   -11.944 -5.633  1.00 0.00 ? 31 HIS A N    1  
ATOM   461   C CA   . HIS A 1 31 ? 1.700   -11.749 -5.360  1.00 0.00 ? 31 HIS A CA   1  
ATOM   462   C C    . HIS A 1 31 ? 1.341   -12.404 -4.024  1.00 0.00 ? 31 HIS A C    1  
ATOM   463   O O    . HIS A 1 31 ? 0.580   -13.370 -3.987  1.00 0.00 ? 31 HIS A O    1  
ATOM   464   C CB   . HIS A 1 31 ? 0.847   -12.263 -6.521  1.00 0.00 ? 31 HIS A CB   1  
ATOM   465   C CG   . HIS A 1 31 ? -0.590  -11.800 -6.479  1.00 0.00 ? 31 HIS A CG   1  
ATOM   466   N ND1  . HIS A 1 31 ? -1.561  -12.292 -7.333  1.00 0.00 ? 31 HIS A ND1  1  
ATOM   467   C CD2  . HIS A 1 31 ? -1.209  -10.887 -5.677  1.00 0.00 ? 31 HIS A CD2  1  
ATOM   468   C CE1  . HIS A 1 31 ? -2.709  -11.695 -7.050  1.00 0.00 ? 31 HIS A CE1  1  
ATOM   469   N NE2  . HIS A 1 31 ? -2.489  -10.824 -6.023  1.00 0.00 ? 31 HIS A NE2  1  
ATOM   470   H H    . HIS A 1 31 ? 3.465   -12.855 -5.417  1.00 0.00 ? 31 HIS A H    1  
ATOM   471   H HA   . HIS A 1 31 ? 1.542   -10.674 -5.281  1.00 0.00 ? 31 HIS A HA   1  
ATOM   472   H HB2  . HIS A 1 31 ? 1.295   -11.938 -7.460  1.00 0.00 ? 31 HIS A HB2  1  
ATOM   473   H HB3  . HIS A 1 31 ? 0.867   -13.353 -6.518  1.00 0.00 ? 31 HIS A HB3  1  
ATOM   474   H HD1  . HIS A 1 31 ? -1.420  -12.982 -8.044  1.00 0.00 ? 31 HIS A HD1  1  
ATOM   475   H HD2  . HIS A 1 31 ? -0.733  -10.308 -4.885  1.00 0.00 ? 31 HIS A HD2  1  
ATOM   476   H HE1  . HIS A 1 31 ? -3.662  -11.868 -7.549  1.00 0.00 ? 31 HIS A HE1  1  
ATOM   477   N N    . VAL A 1 32 ? 1.905   -11.852 -2.960  1.00 0.00 ? 32 VAL A N    1  
ATOM   478   C CA   . VAL A 1 32 ? 1.654   -12.370 -1.626  1.00 0.00 ? 32 VAL A CA   1  
ATOM   479   C C    . VAL A 1 32 ? 1.898   -11.263 -0.599  1.00 0.00 ? 32 VAL A C    1  
ATOM   480   O O    . VAL A 1 32 ? 2.999   -11.138 -0.066  1.00 0.00 ? 32 VAL A O    1  
ATOM   481   C CB   . VAL A 1 32 ? 2.509   -13.615 -1.379  1.00 0.00 ? 32 VAL A CB   1  
ATOM   482   C CG1  . VAL A 1 32 ? 2.558   -13.959 0.111   1.00 0.00 ? 32 VAL A CG1  1  
ATOM   483   C CG2  . VAL A 1 32 ? 2.001   -14.802 -2.199  1.00 0.00 ? 32 VAL A CG2  1  
ATOM   484   H H    . VAL A 1 32 ? 2.523   -11.067 -2.999  1.00 0.00 ? 32 VAL A H    1  
ATOM   485   H HA   . VAL A 1 32 ? 0.606   -12.667 -1.581  1.00 0.00 ? 32 VAL A HA   1  
ATOM   486   H HB   . VAL A 1 32 ? 3.526   -13.393 -1.705  1.00 0.00 ? 32 VAL A HB   1  
ATOM   487   H HG11 . VAL A 1 32 ? 3.567   -13.794 0.490   1.00 0.00 ? 32 VAL A HG11 1  
ATOM   488   H HG12 . VAL A 1 32 ? 1.858   -13.324 0.654   1.00 0.00 ? 32 VAL A HG12 1  
ATOM   489   H HG21 . VAL A 1 32 ? 2.272   -14.663 -3.246  1.00 0.00 ? 32 VAL A HG21 1  
ATOM   490   H HG22 . VAL A 1 32 ? 2.452   -15.721 -1.826  1.00 0.00 ? 32 VAL A HG22 1  
ATOM   491   N N    . PRO A 1 33 ? 0.825   -10.467 -0.346  1.00 0.00 ? 33 PRO A N    1  
ATOM   492   C CA   . PRO A 1 33 ? 0.912   -9.375  0.608   1.00 0.00 ? 33 PRO A CA   1  
ATOM   493   C C    . PRO A 1 33 ? 0.905   -9.899  2.045   1.00 0.00 ? 33 PRO A C    1  
ATOM   494   O O    . PRO A 1 33 ? 0.469   -11.021 2.298   1.00 0.00 ? 33 PRO A O    1  
ATOM   495   C CB   . PRO A 1 33 ? -0.280  -8.484  0.295   1.00 0.00 ? 33 PRO A CB   1  
ATOM   496   C CG   . PRO A 1 33 ? -1.244  -9.344  -0.505  1.00 0.00 ? 33 PRO A CG   1  
ATOM   497   C CD   . PRO A 1 33 ? -0.495  -10.586 -0.959  1.00 0.00 ? 33 PRO A CD   1  
ATOM   498   H HA   . PRO A 1 33 ? 1.778   -8.887  0.499   1.00 0.00 ? 33 PRO A HA   1  
ATOM   499   H HB2  . PRO A 1 33 ? -0.747  -8.122  1.211   1.00 0.00 ? 33 PRO A HB2  1  
ATOM   500   H HB3  . PRO A 1 33 ? 0.027   -7.607  -0.275  1.00 0.00 ? 33 PRO A HB3  1  
ATOM   501   H HG2  . PRO A 1 33 ? -2.106  -9.619  0.103   1.00 0.00 ? 33 PRO A HG2  1  
ATOM   502   H HG3  . PRO A 1 33 ? -1.624  -8.792  -1.365  1.00 0.00 ? 33 PRO A HG3  1  
ATOM   503   H HD2  . PRO A 1 33 ? -1.002  -11.495 -0.634  1.00 0.00 ? 33 PRO A HD2  1  
ATOM   504   H HD3  . PRO A 1 33 ? -0.425  -10.631 -2.045  1.00 0.00 ? 33 PRO A HD3  1  
ATOM   505   N N    . VAL A 1 34 ? 1.394   -9.063  2.949   1.00 0.00 ? 34 VAL A N    1  
ATOM   506   C CA   . VAL A 1 34 ? 1.450   -9.429  4.354   1.00 0.00 ? 34 VAL A CA   1  
ATOM   507   C C    . VAL A 1 34 ? 0.466   -8.561  5.142   1.00 0.00 ? 34 VAL A C    1  
ATOM   508   O O    . VAL A 1 34 ? -0.156  -9.031  6.093   1.00 0.00 ? 34 VAL A O    1  
ATOM   509   C CB   . VAL A 1 34 ? 2.888   -9.318  4.866   1.00 0.00 ? 34 VAL A CB   1  
ATOM   510   C CG1  . VAL A 1 34 ? 3.412   -7.888  4.724   1.00 0.00 ? 34 VAL A CG1  1  
ATOM   511   C CG2  . VAL A 1 34 ? 2.992   -9.799  6.315   1.00 0.00 ? 34 VAL A CG2  1  
ATOM   512   H H    . VAL A 1 34 ? 1.747   -8.152  2.735   1.00 0.00 ? 34 VAL A H    1  
ATOM   513   H HA   . VAL A 1 34 ? 1.142   -10.471 4.435   1.00 0.00 ? 34 VAL A HA   1  
ATOM   514   H HB   . VAL A 1 34 ? 3.513   -9.966  4.253   1.00 0.00 ? 34 VAL A HB   1  
ATOM   515   H HG11 . VAL A 1 34 ? 2.657   -7.187  5.080   1.00 0.00 ? 34 VAL A HG11 1  
ATOM   516   H HG12 . VAL A 1 34 ? 4.321   -7.773  5.315   1.00 0.00 ? 34 VAL A HG12 1  
ATOM   517   H HG21 . VAL A 1 34 ? 3.354   -10.827 6.332   1.00 0.00 ? 34 VAL A HG21 1  
ATOM   518   H HG22 . VAL A 1 34 ? 3.686   -9.160  6.861   1.00 0.00 ? 34 VAL A HG22 1  
ATOM   519   N N    . LYS A 1 35 ? 0.356   -7.311  4.716   1.00 0.00 ? 35 LYS A N    1  
ATOM   520   C CA   . LYS A 1 35 ? -0.541  -6.374  5.370   1.00 0.00 ? 35 LYS A CA   1  
ATOM   521   C C    . LYS A 1 35 ? -0.688  -5.124  4.500   1.00 0.00 ? 35 LYS A C    1  
ATOM   522   O O    . LYS A 1 35 ? 0.240   -4.747  3.787   1.00 0.00 ? 35 LYS A O    1  
ATOM   523   C CB   . LYS A 1 35 ? -0.065  -6.080  6.794   1.00 0.00 ? 35 LYS A CB   1  
ATOM   524   C CG   . LYS A 1 35 ? 1.192   -5.208  6.782   1.00 0.00 ? 35 LYS A CG   1  
ATOM   525   C CD   . LYS A 1 35 ? 1.522   -4.702  8.188   1.00 0.00 ? 35 LYS A CD   1  
ATOM   526   C CE   . LYS A 1 35 ? 0.801   -3.384  8.480   1.00 0.00 ? 35 LYS A CE   1  
ATOM   527   N NZ   . LYS A 1 35 ? 1.743   -2.394  9.048   1.00 0.00 ? 35 LYS A NZ   1  
ATOM   528   H H    . LYS A 1 35 ? 0.866   -6.938  3.941   1.00 0.00 ? 35 LYS A H    1  
ATOM   529   H HA   . LYS A 1 35 ? -1.515  -6.857  5.449   1.00 0.00 ? 35 LYS A HA   1  
ATOM   530   H HB2  . LYS A 1 35 ? -0.856  -5.578  7.350   1.00 0.00 ? 35 LYS A HB2  1  
ATOM   531   H HB3  . LYS A 1 35 ? 0.143   -7.017  7.312   1.00 0.00 ? 35 LYS A HB3  1  
ATOM   532   H HG2  . LYS A 1 35 ? 2.033   -5.781  6.391   1.00 0.00 ? 35 LYS A HG2  1  
ATOM   533   H HG3  . LYS A 1 35 ? 1.045   -4.361  6.112   1.00 0.00 ? 35 LYS A HG3  1  
ATOM   534   H HD2  . LYS A 1 35 ? 1.230   -5.451  8.925   1.00 0.00 ? 35 LYS A HD2  1  
ATOM   535   H HD3  . LYS A 1 35 ? 2.598   -4.562  8.285   1.00 0.00 ? 35 LYS A HD3  1  
ATOM   536   H HE2  . LYS A 1 35 ? 0.362   -2.993  7.562   1.00 0.00 ? 35 LYS A HE2  1  
ATOM   537   H HE3  . LYS A 1 35 ? -0.018  -3.558  9.177   1.00 0.00 ? 35 LYS A HE3  1  
ATOM   538   H HZ1  . LYS A 1 35 ? 1.230   -1.699  9.552   1.00 0.00 ? 35 LYS A HZ1  1  
ATOM   539   H HZ2  . LYS A 1 35 ? 2.378   -2.855  9.668   1.00 0.00 ? 35 LYS A HZ2  1  
ATOM   540   N N    . ARG A 1 36 ? -1.858  -4.486  4.564   1.00 0.00 ? 36 ARG A N    1  
ATOM   541   C CA   . ARG A 1 36 ? -2.122  -3.291  3.788   1.00 0.00 ? 36 ARG A CA   1  
ATOM   542   C C    . ARG A 1 36 ? -2.947  -2.313  4.612   1.00 0.00 ? 36 ARG A C    1  
ATOM   543   O O    . ARG A 1 36 ? -3.468  -2.672  5.666   1.00 0.00 ? 36 ARG A O    1  
ATOM   544   C CB   . ARG A 1 36 ? -2.855  -3.670  2.505   1.00 0.00 ? 36 ARG A CB   1  
ATOM   545   C CG   . ARG A 1 36 ? -2.052  -4.729  1.754   1.00 0.00 ? 36 ARG A CG   1  
ATOM   546   C CD   . ARG A 1 36 ? -2.705  -4.998  0.401   1.00 0.00 ? 36 ARG A CD   1  
ATOM   547   N NE   . ARG A 1 36 ? -3.867  -5.875  0.544   1.00 0.00 ? 36 ARG A NE   1  
ATOM   548   C CZ   . ARG A 1 36 ? -4.342  -6.620  -0.463  1.00 0.00 ? 36 ARG A CZ   1  
ATOM   549   N NH1  . ARG A 1 36 ? -3.747  -6.582  -1.663  1.00 0.00 ? 36 ARG A NH1  1  
ATOM   550   N NH2  . ARG A 1 36 ? -5.412  -7.403  -0.271  1.00 0.00 ? 36 ARG A NH2  1  
ATOM   551   H H    . ARG A 1 36 ? -2.589  -4.838  5.166   1.00 0.00 ? 36 ARG A H    1  
ATOM   552   H HA   . ARG A 1 36 ? -1.173  -2.821  3.528   1.00 0.00 ? 36 ARG A HA   1  
ATOM   553   H HB2  . ARG A 1 36 ? -3.839  -4.068  2.753   1.00 0.00 ? 36 ARG A HB2  1  
ATOM   554   H HB3  . ARG A 1 36 ? -2.968  -2.787  1.877   1.00 0.00 ? 36 ARG A HB3  1  
ATOM   555   H HG2  . ARG A 1 36 ? -1.034  -4.371  1.601   1.00 0.00 ? 36 ARG A HG2  1  
ATOM   556   H HG3  . ARG A 1 36 ? -2.030  -5.649  2.336   1.00 0.00 ? 36 ARG A HG3  1  
ATOM   557   H HD2  . ARG A 1 36 ? -3.023  -4.052  -0.037  1.00 0.00 ? 36 ARG A HD2  1  
ATOM   558   H HD3  . ARG A 1 36 ? -1.978  -5.472  -0.259  1.00 0.00 ? 36 ARG A HD3  1  
ATOM   559   H HE   . ARG A 1 36 ? -4.322  -5.911  1.445   1.00 0.00 ? 36 ARG A HE   1  
ATOM   560   H HH11 . ARG A 1 36 ? -2.941  -5.992  -1.809  1.00 0.00 ? 36 ARG A HH11 1  
ATOM   561   H HH12 . ARG A 1 36 ? -4.106  -7.144  -2.422  1.00 0.00 ? 36 ARG A HH12 1  
ATOM   562   H HH21 . ARG A 1 36 ? -5.861  -7.432  0.634   1.00 0.00 ? 36 ARG A HH21 1  
ATOM   563   H HH22 . ARG A 1 36 ? -5.770  -7.965  -1.030  1.00 0.00 ? 36 ARG A HH22 1  
ATOM   564   N N    . GLY A 1 37 ? -3.045  -1.093  4.102   1.00 0.00 ? 37 GLY A N    1  
ATOM   565   C CA   . GLY A 1 37 ? -3.803  -0.057  4.783   1.00 0.00 ? 37 GLY A CA   1  
ATOM   566   C C    . GLY A 1 37 ? -3.832  1.232   3.959   1.00 0.00 ? 37 GLY A C    1  
ATOM   567   O O    . GLY A 1 37 ? -3.708  1.194   2.736   1.00 0.00 ? 37 GLY A O    1  
ATOM   568   H H    . GLY A 1 37 ? -2.618  -0.810  3.244   1.00 0.00 ? 37 GLY A H    1  
ATOM   569   H HA2  . GLY A 1 37 ? -4.822  -0.403  4.958   1.00 0.00 ? 37 GLY A HA2  1  
ATOM   570   H HA3  . GLY A 1 37 ? -3.361  0.141   5.759   1.00 0.00 ? 37 GLY A HA3  1  
ATOM   571   N N    . CYS A 1 38 ? -3.995  2.342   4.662   1.00 0.00 ? 38 CYS A N    1  
ATOM   572   C CA   . CYS A 1 38 ? -4.042  3.641   4.011   1.00 0.00 ? 38 CYS A CA   1  
ATOM   573   C C    . CYS A 1 38 ? -2.969  4.532   4.640   1.00 0.00 ? 38 CYS A C    1  
ATOM   574   O O    . CYS A 1 38 ? -2.724  4.461   5.844   1.00 0.00 ? 38 CYS A O    1  
ATOM   575   C CB   . CYS A 1 38 ? -5.433  4.271   4.104   1.00 0.00 ? 38 CYS A CB   1  
ATOM   576   S SG   . CYS A 1 38 ? -6.755  3.341   3.246   1.00 0.00 ? 38 CYS A SG   1  
ATOM   577   H H    . CYS A 1 38 ? -4.095  2.365   5.657   1.00 0.00 ? 38 CYS A H    1  
ATOM   578   H HA   . CYS A 1 38 ? -3.833  3.469   2.956   1.00 0.00 ? 38 CYS A HA   1  
ATOM   579   H HB2  . CYS A 1 38 ? -5.702  4.370   5.156   1.00 0.00 ? 38 CYS A HB2  1  
ATOM   580   H HB3  . CYS A 1 38 ? -5.389  5.278   3.690   1.00 0.00 ? 38 CYS A HB3  1  
ATOM   581   N N    . ILE A 1 39 ? -2.356  5.350   3.797   1.00 0.00 ? 39 ILE A N    1  
ATOM   582   C CA   . ILE A 1 39 ? -1.315  6.254   4.255   1.00 0.00 ? 39 ILE A CA   1  
ATOM   583   C C    . ILE A 1 39 ? -1.300  7.500   3.366   1.00 0.00 ? 39 ILE A C    1  
ATOM   584   O O    . ILE A 1 39 ? -2.083  7.604   2.424   1.00 0.00 ? 39 ILE A O    1  
ATOM   585   C CB   . ILE A 1 39 ? 0.031   5.530   4.323   1.00 0.00 ? 39 ILE A CB   1  
ATOM   586   C CG1  . ILE A 1 39 ? 0.844   5.997   5.532   1.00 0.00 ? 39 ILE A CG1  1  
ATOM   587   C CG2  . ILE A 1 39 ? 0.807   5.691   3.014   1.00 0.00 ? 39 ILE A CG2  1  
ATOM   588   C CD1  . ILE A 1 39 ? 0.728   5.002   6.688   1.00 0.00 ? 39 ILE A CD1  1  
ATOM   589   H H    . ILE A 1 39 ? -2.561  5.402   2.820   1.00 0.00 ? 39 ILE A H    1  
ATOM   590   H HA   . ILE A 1 39 ? -1.569  6.558   5.271   1.00 0.00 ? 39 ILE A HA   1  
ATOM   591   H HB   . ILE A 1 39 ? -0.160  4.466   4.455   1.00 0.00 ? 39 ILE A HB   1  
ATOM   592   H HG12 . ILE A 1 39 ? 1.891   6.111   5.250   1.00 0.00 ? 39 ILE A HG12 1  
ATOM   593   H HG13 . ILE A 1 39 ? 0.493   6.977   5.855   1.00 0.00 ? 39 ILE A HG13 1  
ATOM   594   H HG21 . ILE A 1 39 ? 1.798   5.251   3.123   1.00 0.00 ? 39 ILE A HG21 1  
ATOM   595   H HG22 . ILE A 1 39 ? 0.271   5.187   2.210   1.00 0.00 ? 39 ILE A HG22 1  
ATOM   596   H HD11 . ILE A 1 39 ? -0.322  4.868   6.949   1.00 0.00 ? 39 ILE A HD11 1  
ATOM   597   H HD12 . ILE A 1 39 ? 1.152   4.044   6.387   1.00 0.00 ? 39 ILE A HD12 1  
ATOM   598   N N    . ASP A 1 40 ? -0.404  8.441   3.671   1.00 0.00 ? 40 ASP A N    1  
ATOM   599   C CA   . ASP A 1 40 ? -0.291  9.666   2.906   1.00 0.00 ? 40 ASP A CA   1  
ATOM   600   C C    . ASP A 1 40 ? 0.973   9.630   2.059   1.00 0.00 ? 40 ASP A C    1  
ATOM   601   O O    . ASP A 1 40 ? 0.928   9.902   0.862   1.00 0.00 ? 40 ASP A O    1  
ATOM   602   C CB   . ASP A 1 40 ? -0.271  10.859  3.858   1.00 0.00 ? 40 ASP A CB   1  
ATOM   603   C CG   . ASP A 1 40 ? -0.627  12.145  3.125   1.00 0.00 ? 40 ASP A CG   1  
ATOM   604   O OD1  . ASP A 1 40 ? -1.148  12.029  1.995   1.00 0.00 ? 40 ASP A OD1  1  
ATOM   605   O OD2  . ASP A 1 40 ? -0.371  13.220  3.709   1.00 0.00 ? 40 ASP A OD2  1  
ATOM   606   H H    . ASP A 1 40 ? 0.217   8.306   4.456   1.00 0.00 ? 40 ASP A H    1  
ATOM   607   H HA   . ASP A 1 40 ? -1.156  9.754   2.247   1.00 0.00 ? 40 ASP A HA   1  
ATOM   608   H HB2  . ASP A 1 40 ? -0.993  10.692  4.657   1.00 0.00 ? 40 ASP A HB2  1  
ATOM   609   H HB3  . ASP A 1 40 ? 0.725   10.957  4.288   1.00 0.00 ? 40 ASP A HB3  1  
ATOM   610   H HD2  . ASP A 1 40 ? -0.618  13.993  3.196   1.00 0.00 ? 40 ASP A HD2  1  
ATOM   611   N N    . VAL A 1 41 ? 2.076   9.291   2.712   1.00 0.00 ? 41 VAL A N    1  
ATOM   612   C CA   . VAL A 1 41 ? 3.356   9.217   2.029   1.00 0.00 ? 41 VAL A CA   1  
ATOM   613   C C    . VAL A 1 41 ? 3.812   7.757   1.968   1.00 0.00 ? 41 VAL A C    1  
ATOM   614   O O    . VAL A 1 41 ? 3.548   6.982   2.885   1.00 0.00 ? 41 VAL A O    1  
ATOM   615   C CB   . VAL A 1 41 ? 4.371   10.132  2.717   1.00 0.00 ? 41 VAL A CB   1  
ATOM   616   C CG1  . VAL A 1 41 ? 4.791   9.562   4.073   1.00 0.00 ? 41 VAL A CG1  1  
ATOM   617   C CG2  . VAL A 1 41 ? 5.588   10.372  1.822   1.00 0.00 ? 41 VAL A CG2  1  
ATOM   618   H H    . VAL A 1 41 ? 2.104   9.071   3.687   1.00 0.00 ? 41 VAL A H    1  
ATOM   619   H HA   . VAL A 1 41 ? 3.207   9.581   1.012   1.00 0.00 ? 41 VAL A HA   1  
ATOM   620   H HB   . VAL A 1 41 ? 3.889   11.094  2.892   1.00 0.00 ? 41 VAL A HB   1  
ATOM   621   H HG11 . VAL A 1 41 ? 5.687   10.077  4.422   1.00 0.00 ? 41 VAL A HG11 1  
ATOM   622   H HG12 . VAL A 1 41 ? 3.986   9.707   4.794   1.00 0.00 ? 41 VAL A HG12 1  
ATOM   623   H HG21 . VAL A 1 41 ? 5.254   10.658  0.824   1.00 0.00 ? 41 VAL A HG21 1  
ATOM   624   H HG22 . VAL A 1 41 ? 6.198   11.170  2.244   1.00 0.00 ? 41 VAL A HG22 1  
ATOM   625   N N    . CYS A 1 42 ? 4.489   7.428   0.877   1.00 0.00 ? 42 CYS A N    1  
ATOM   626   C CA   . CYS A 1 42 ? 4.984   6.076   0.684   1.00 0.00 ? 42 CYS A CA   1  
ATOM   627   C C    . CYS A 1 42 ? 6.391   5.990   1.280   1.00 0.00 ? 42 CYS A C    1  
ATOM   628   O O    . CYS A 1 42 ? 7.220   6.869   1.052   1.00 0.00 ? 42 CYS A O    1  
ATOM   629   C CB   . CYS A 1 42 ? 4.963   5.670   -0.791  1.00 0.00 ? 42 CYS A CB   1  
ATOM   630   S SG   . CYS A 1 42 ? 4.181   4.051   -1.131  1.00 0.00 ? 42 CYS A SG   1  
ATOM   631   H H    . CYS A 1 42 ? 4.699   8.065   0.136   1.00 0.00 ? 42 CYS A H    1  
ATOM   632   H HA   . CYS A 1 42 ? 4.299   5.413   1.213   1.00 0.00 ? 42 CYS A HA   1  
ATOM   633   H HB2  . CYS A 1 42 ? 4.436   6.439   -1.357  1.00 0.00 ? 42 CYS A HB2  1  
ATOM   634   H HB3  . CYS A 1 42 ? 5.988   5.648   -1.162  1.00 0.00 ? 42 CYS A HB3  1  
ATOM   635   N N    . PRO A 1 43 ? 6.623   4.893   2.051   1.00 0.00 ? 43 PRO A N    1  
ATOM   636   C CA   . PRO A 1 43 ? 7.915   4.681   2.681   1.00 0.00 ? 43 PRO A CA   1  
ATOM   637   C C    . PRO A 1 43 ? 8.955   4.224   1.656   1.00 0.00 ? 43 PRO A C    1  
ATOM   638   O O    . PRO A 1 43 ? 8.607   3.845   0.539   1.00 0.00 ? 43 PRO A O    1  
ATOM   639   C CB   . PRO A 1 43 ? 7.658   3.650   3.767   1.00 0.00 ? 43 PRO A CB   1  
ATOM   640   C CG   . PRO A 1 43 ? 6.342   2.981   3.405   1.00 0.00 ? 43 PRO A CG   1  
ATOM   641   C CD   . PRO A 1 43 ? 5.665   3.831   2.342   1.00 0.00 ? 43 PRO A CD   1  
ATOM   642   H HA   . PRO A 1 43 ? 8.262   5.539   3.058   1.00 0.00 ? 43 PRO A HA   1  
ATOM   643   H HB2  . PRO A 1 43 ? 8.467   2.921   3.813   1.00 0.00 ? 43 PRO A HB2  1  
ATOM   644   H HB3  . PRO A 1 43 ? 7.599   4.122   4.748   1.00 0.00 ? 43 PRO A HB3  1  
ATOM   645   H HG2  . PRO A 1 43 ? 6.516   1.972   3.033   1.00 0.00 ? 43 PRO A HG2  1  
ATOM   646   H HG3  . PRO A 1 43 ? 5.705   2.891   4.285   1.00 0.00 ? 43 PRO A HG3  1  
ATOM   647   H HD2  . PRO A 1 43 ? 5.440   3.245   1.451   1.00 0.00 ? 43 PRO A HD2  1  
ATOM   648   H HD3  . PRO A 1 43 ? 4.720   4.238   2.703   1.00 0.00 ? 43 PRO A HD3  1  
ATOM   649   N N    . LYS A 1 44 ? 10.212  4.275   2.074   1.00 0.00 ? 44 LYS A N    1  
ATOM   650   C CA   . LYS A 1 44 ? 11.306  3.870   1.207   1.00 0.00 ? 44 LYS A CA   1  
ATOM   651   C C    . LYS A 1 44 ? 11.185  2.375   0.904   1.00 0.00 ? 44 LYS A C    1  
ATOM   652   O O    . LYS A 1 44 ? 10.823  1.589   1.778   1.00 0.00 ? 44 LYS A O    1  
ATOM   653   C CB   . LYS A 1 44 ? 12.650  4.267   1.820   1.00 0.00 ? 44 LYS A CB   1  
ATOM   654   C CG   . LYS A 1 44 ? 13.813  3.687   1.013   1.00 0.00 ? 44 LYS A CG   1  
ATOM   655   C CD   . LYS A 1 44 ? 14.027  4.473   -0.282  1.00 0.00 ? 44 LYS A CD   1  
ATOM   656   C CE   . LYS A 1 44 ? 15.404  4.178   -0.881  1.00 0.00 ? 44 LYS A CE   1  
ATOM   657   N NZ   . LYS A 1 44 ? 15.272  3.349   -2.100  1.00 0.00 ? 44 LYS A NZ   1  
ATOM   658   H H    . LYS A 1 44 ? 10.487  4.584   2.984   1.00 0.00 ? 44 LYS A H    1  
ATOM   659   H HA   . LYS A 1 44 ? 11.202  4.422   0.272   1.00 0.00 ? 44 LYS A HA   1  
ATOM   660   H HB2  . LYS A 1 44 ? 12.732  5.354   1.854   1.00 0.00 ? 44 LYS A HB2  1  
ATOM   661   H HB3  . LYS A 1 44 ? 12.704  3.912   2.849   1.00 0.00 ? 44 LYS A HB3  1  
ATOM   662   H HG2  . LYS A 1 44 ? 14.724  3.711   1.612   1.00 0.00 ? 44 LYS A HG2  1  
ATOM   663   H HG3  . LYS A 1 44 ? 13.613  2.642   0.779   1.00 0.00 ? 44 LYS A HG3  1  
ATOM   664   H HD2  . LYS A 1 44 ? 13.251  4.214   -1.002  1.00 0.00 ? 44 LYS A HD2  1  
ATOM   665   H HD3  . LYS A 1 44 ? 13.935  5.541   -0.084  1.00 0.00 ? 44 LYS A HD3  1  
ATOM   666   H HE2  . LYS A 1 44 ? 15.910  5.113   -1.123  1.00 0.00 ? 44 LYS A HE2  1  
ATOM   667   H HE3  . LYS A 1 44 ? 16.023  3.661   -0.148  1.00 0.00 ? 44 LYS A HE3  1  
ATOM   668   H HZ1  . LYS A 1 44 ? 15.952  2.616   -2.080  1.00 0.00 ? 44 LYS A HZ1  1  
ATOM   669   H HZ2  . LYS A 1 44 ? 14.355  2.953   -2.136  1.00 0.00 ? 44 LYS A HZ2  1  
ATOM   670   N N    . SER A 1 45 ? 11.495  2.028   -0.336  1.00 0.00 ? 45 SER A N    1  
ATOM   671   C CA   . SER A 1 45 ? 11.426  0.642   -0.765  1.00 0.00 ? 45 SER A CA   1  
ATOM   672   C C    . SER A 1 45 ? 12.796  -0.022  -0.611  1.00 0.00 ? 45 SER A C    1  
ATOM   673   O O    . SER A 1 45 ? 13.805  0.515   -1.066  1.00 0.00 ? 45 SER A O    1  
ATOM   674   C CB   . SER A 1 45 ? 10.945  0.536   -2.213  1.00 0.00 ? 45 SER A CB   1  
ATOM   675   O OG   . SER A 1 45 ? 9.536   0.337   -2.294  1.00 0.00 ? 45 SER A OG   1  
ATOM   676   H H    . SER A 1 45 ? 11.789  2.674   -1.041  1.00 0.00 ? 45 SER A H    1  
ATOM   677   H HA   . SER A 1 45 ? 10.697  0.172   -0.105  1.00 0.00 ? 45 SER A HA   1  
ATOM   678   H HB2  . SER A 1 45 ? 11.214  1.445   -2.752  1.00 0.00 ? 45 SER A HB2  1  
ATOM   679   H HB3  . SER A 1 45 ? 11.457  -0.290  -2.706  1.00 0.00 ? 45 SER A HB3  1  
ATOM   680   H HG   . SER A 1 45 ? 9.339   -0.523  -2.764  1.00 0.00 ? 45 SER A HG   1  
ATOM   681   N N    . SER A 1 46 ? 12.788  -1.181  0.032   1.00 0.00 ? 46 SER A N    1  
ATOM   682   C CA   . SER A 1 46 ? 14.017  -1.924  0.252   1.00 0.00 ? 46 SER A CA   1  
ATOM   683   C C    . SER A 1 46 ? 14.010  -3.206  -0.583  1.00 0.00 ? 46 SER A C    1  
ATOM   684   O O    . SER A 1 46 ? 13.006  -3.535  -1.213  1.00 0.00 ? 46 SER A O    1  
ATOM   685   C CB   . SER A 1 46 ? 14.202  -2.256  1.733   1.00 0.00 ? 46 SER A CB   1  
ATOM   686   O OG   . SER A 1 46 ? 13.490  -3.432  2.110   1.00 0.00 ? 46 SER A OG   1  
ATOM   687   H H    . SER A 1 46 ? 11.963  -1.611  0.399   1.00 0.00 ? 46 SER A H    1  
ATOM   688   H HA   . SER A 1 46 ? 14.817  -1.260  -0.074  1.00 0.00 ? 46 SER A HA   1  
ATOM   689   H HB2  . SER A 1 46 ? 15.263  -2.392  1.945   1.00 0.00 ? 46 SER A HB2  1  
ATOM   690   H HB3  . SER A 1 46 ? 13.862  -1.417  2.339   1.00 0.00 ? 46 SER A HB3  1  
ATOM   691   H HG   . SER A 1 46 ? 13.510  -3.541  3.104   1.00 0.00 ? 46 SER A HG   1  
ATOM   692   N N    . LEU A 1 47 ? 15.141  -3.895  -0.561  1.00 0.00 ? 47 LEU A N    1  
ATOM   693   C CA   . LEU A 1 47 ? 15.278  -5.133  -1.308  1.00 0.00 ? 47 LEU A CA   1  
ATOM   694   C C    . LEU A 1 47 ? 14.459  -6.230  -0.624  1.00 0.00 ? 47 LEU A C    1  
ATOM   695   O O    . LEU A 1 47 ? 13.717  -6.958  -1.282  1.00 0.00 ? 47 LEU A O    1  
ATOM   696   C CB   . LEU A 1 47 ? 16.754  -5.491  -1.488  1.00 0.00 ? 47 LEU A CB   1  
ATOM   697   C CG   . LEU A 1 47 ? 17.476  -4.798  -2.646  1.00 0.00 ? 47 LEU A CG   1  
ATOM   698   C CD1  . LEU A 1 47 ? 18.991  -4.975  -2.532  1.00 0.00 ? 47 LEU A CD1  1  
ATOM   699   C CD2  . LEU A 1 47 ? 16.942  -5.286  -3.995  1.00 0.00 ? 47 LEU A CD2  1  
ATOM   700   H H    . LEU A 1 47 ? 15.953  -3.620  -0.046  1.00 0.00 ? 47 LEU A H    1  
ATOM   701   H HA   . LEU A 1 47 ? 14.864  -4.963  -2.302  1.00 0.00 ? 47 LEU A HA   1  
ATOM   702   H HB2  . LEU A 1 47 ? 17.281  -5.252  -0.564  1.00 0.00 ? 47 LEU A HB2  1  
ATOM   703   H HB3  . LEU A 1 47 ? 16.832  -6.569  -1.630  1.00 0.00 ? 47 LEU A HB3  1  
ATOM   704   H HG   . LEU A 1 47 ? 17.271  -3.730  -2.586  1.00 0.00 ? 47 LEU A HG   1  
ATOM   705   H HD11 . LEU A 1 47 ? 19.411  -4.147  -1.961  1.00 0.00 ? 47 LEU A HD11 1  
ATOM   706   H HD12 . LEU A 1 47 ? 19.211  -5.914  -2.024  1.00 0.00 ? 47 LEU A HD12 1  
ATOM   707   H HD21 . LEU A 1 47 ? 15.894  -5.006  -4.093  1.00 0.00 ? 47 LEU A HD21 1  
ATOM   708   H HD22 . LEU A 1 47 ? 17.518  -4.829  -4.800  1.00 0.00 ? 47 LEU A HD22 1  
ATOM   709   N N    . LEU A 1 48 ? 14.620  -6.313  0.688   1.00 0.00 ? 48 LEU A N    1  
ATOM   710   C CA   . LEU A 1 48 ? 13.905  -7.308  1.469   1.00 0.00 ? 48 LEU A CA   1  
ATOM   711   C C    . LEU A 1 48 ? 12.405  -7.184  1.194   1.00 0.00 ? 48 LEU A C    1  
ATOM   712   O O    . LEU A 1 48 ? 11.793  -8.100  0.646   1.00 0.00 ? 48 LEU A O    1  
ATOM   713   C CB   . LEU A 1 48 ? 14.270  -7.191  2.950   1.00 0.00 ? 48 LEU A CB   1  
ATOM   714   C CG   . LEU A 1 48 ? 14.196  -8.485  3.763   1.00 0.00 ? 48 LEU A CG   1  
ATOM   715   C CD1  . LEU A 1 48 ? 15.588  -9.088  3.962   1.00 0.00 ? 48 LEU A CD1  1  
ATOM   716   C CD2  . LEU A 1 48 ? 13.475  -8.256  5.093   1.00 0.00 ? 48 LEU A CD2  1  
ATOM   717   H H    . LEU A 1 48 ? 15.226  -5.717  1.216   1.00 0.00 ? 48 LEU A H    1  
ATOM   718   H HA   . LEU A 1 48 ? 14.238  -8.289  1.131   1.00 0.00 ? 48 LEU A HA   1  
ATOM   719   H HB2  . LEU A 1 48 ? 15.284  -6.796  3.024   1.00 0.00 ? 48 LEU A HB2  1  
ATOM   720   H HB3  . LEU A 1 48 ? 13.608  -6.458  3.410   1.00 0.00 ? 48 LEU A HB3  1  
ATOM   721   H HG   . LEU A 1 48 ? 13.609  -9.210  3.199   1.00 0.00 ? 48 LEU A HG   1  
ATOM   722   H HD11 . LEU A 1 48 ? 16.345  -8.329  3.760   1.00 0.00 ? 48 LEU A HD11 1  
ATOM   723   H HD12 . LEU A 1 48 ? 15.690  -9.437  4.990   1.00 0.00 ? 48 LEU A HD12 1  
ATOM   724   H HD21 . LEU A 1 48 ? 13.264  -7.194  5.214   1.00 0.00 ? 48 LEU A HD21 1  
ATOM   725   H HD22 . LEU A 1 48 ? 12.540  -8.816  5.100   1.00 0.00 ? 48 LEU A HD22 1  
ATOM   726   N N    . VAL A 1 49 ? 11.856  -6.044  1.587   1.00 0.00 ? 49 VAL A N    1  
ATOM   727   C CA   . VAL A 1 49 ? 10.439  -5.789  1.389   1.00 0.00 ? 49 VAL A CA   1  
ATOM   728   C C    . VAL A 1 49 ? 10.267  -4.589  0.456   1.00 0.00 ? 49 VAL A C    1  
ATOM   729   O O    . VAL A 1 49 ? 11.167  -3.760  0.333   1.00 0.00 ? 49 VAL A O    1  
ATOM   730   C CB   . VAL A 1 49 ? 9.749   -5.598  2.741   1.00 0.00 ? 49 VAL A CB   1  
ATOM   731   C CG1  . VAL A 1 49 ? 9.973   -6.811  3.647   1.00 0.00 ? 49 VAL A CG1  1  
ATOM   732   C CG2  . VAL A 1 49 ? 10.219  -4.311  3.421   1.00 0.00 ? 49 VAL A CG2  1  
ATOM   733   H H    . VAL A 1 49 ? 12.361  -5.305  2.032   1.00 0.00 ? 49 VAL A H    1  
ATOM   734   H HA   . VAL A 1 49 ? 10.010  -6.670  0.912   1.00 0.00 ? 49 VAL A HA   1  
ATOM   735   H HB   . VAL A 1 49 ? 8.677   -5.509  2.560   1.00 0.00 ? 49 VAL A HB   1  
ATOM   736   H HG11 . VAL A 1 49 ? 9.979   -7.719  3.044   1.00 0.00 ? 49 VAL A HG11 1  
ATOM   737   H HG12 . VAL A 1 49 ? 10.930  -6.709  4.160   1.00 0.00 ? 49 VAL A HG12 1  
ATOM   738   H HG21 . VAL A 1 49 ? 10.194  -4.441  4.503   1.00 0.00 ? 49 VAL A HG21 1  
ATOM   739   H HG22 . VAL A 1 49 ? 11.238  -4.085  3.105   1.00 0.00 ? 49 VAL A HG22 1  
ATOM   740   N N    . LYS A 1 50 ? 9.105   -4.535  -0.179  1.00 0.00 ? 50 LYS A N    1  
ATOM   741   C CA   . LYS A 1 50 ? 8.803   -3.451  -1.097  1.00 0.00 ? 50 LYS A CA   1  
ATOM   742   C C    . LYS A 1 50 ? 7.390   -2.934  -0.823  1.00 0.00 ? 50 LYS A C    1  
ATOM   743   O O    . LYS A 1 50 ? 6.534   -3.679  -0.347  1.00 0.00 ? 50 LYS A O    1  
ATOM   744   C CB   . LYS A 1 50 ? 9.025   -3.897  -2.544  1.00 0.00 ? 50 LYS A CB   1  
ATOM   745   C CG   . LYS A 1 50 ? 10.422  -3.508  -3.030  1.00 0.00 ? 50 LYS A CG   1  
ATOM   746   C CD   . LYS A 1 50 ? 10.629  -3.916  -4.490  1.00 0.00 ? 50 LYS A CD   1  
ATOM   747   C CE   . LYS A 1 50 ? 11.134  -2.737  -5.323  1.00 0.00 ? 50 LYS A CE   1  
ATOM   748   N NZ   . LYS A 1 50 ? 11.725  -3.215  -6.593  1.00 0.00 ? 50 LYS A NZ   1  
ATOM   749   H H    . LYS A 1 50 ? 8.378   -5.214  -0.073  1.00 0.00 ? 50 LYS A H    1  
ATOM   750   H HA   . LYS A 1 50 ? 9.511   -2.646  -0.896  1.00 0.00 ? 50 LYS A HA   1  
ATOM   751   H HB2  . LYS A 1 50 ? 8.897   -4.977  -2.619  1.00 0.00 ? 50 LYS A HB2  1  
ATOM   752   H HB3  . LYS A 1 50 ? 8.272   -3.442  -3.188  1.00 0.00 ? 50 LYS A HB3  1  
ATOM   753   H HG2  . LYS A 1 50 ? 10.561  -2.432  -2.927  1.00 0.00 ? 50 LYS A HG2  1  
ATOM   754   H HG3  . LYS A 1 50 ? 11.175  -3.988  -2.405  1.00 0.00 ? 50 LYS A HG3  1  
ATOM   755   H HD2  . LYS A 1 50 ? 11.343  -4.737  -4.544  1.00 0.00 ? 50 LYS A HD2  1  
ATOM   756   H HD3  . LYS A 1 50 ? 9.690   -4.283  -4.905  1.00 0.00 ? 50 LYS A HD3  1  
ATOM   757   H HE2  . LYS A 1 50 ? 10.312  -2.053  -5.532  1.00 0.00 ? 50 LYS A HE2  1  
ATOM   758   H HE3  . LYS A 1 50 ? 11.879  -2.177  -4.757  1.00 0.00 ? 50 LYS A HE3  1  
ATOM   759   H HZ1  . LYS A 1 50 ? 12.376  -3.949  -6.402  1.00 0.00 ? 50 LYS A HZ1  1  
ATOM   760   H HZ2  . LYS A 1 50 ? 11.000  -3.558  -7.189  1.00 0.00 ? 50 LYS A HZ2  1  
ATOM   761   N N    . TYR A 1 51 ? 7.188   -1.662  -1.135  1.00 0.00 ? 51 TYR A N    1  
ATOM   762   C CA   . TYR A 1 51 ? 5.893   -1.037  -0.928  1.00 0.00 ? 51 TYR A CA   1  
ATOM   763   C C    . TYR A 1 51 ? 5.415   -0.331  -2.198  1.00 0.00 ? 51 TYR A C    1  
ATOM   764   O O    . TYR A 1 51 ? 6.222   0.213   -2.951  1.00 0.00 ? 51 TYR A O    1  
ATOM   765   C CB   . TYR A 1 51 ? 6.099   0.004   0.174   1.00 0.00 ? 51 TYR A CB   1  
ATOM   766   C CG   . TYR A 1 51 ? 6.920   -0.500  1.361   1.00 0.00 ? 51 TYR A CG   1  
ATOM   767   C CD1  . TYR A 1 51 ? 6.674   -1.751  1.889   1.00 0.00 ? 51 TYR A CD1  1  
ATOM   768   C CD2  . TYR A 1 51 ? 7.908   0.296   1.905   1.00 0.00 ? 51 TYR A CD2  1  
ATOM   769   C CE1  . TYR A 1 51 ? 7.447   -2.226  3.008   1.00 0.00 ? 51 TYR A CE1  1  
ATOM   770   C CE2  . TYR A 1 51 ? 8.681   -0.179  3.023   1.00 0.00 ? 51 TYR A CE2  1  
ATOM   771   C CZ   . TYR A 1 51 ? 8.412   -1.416  3.519   1.00 0.00 ? 51 TYR A CZ   1  
ATOM   772   O OH   . TYR A 1 51 ? 9.143   -1.865  4.575   1.00 0.00 ? 51 TYR A OH   1  
ATOM   773   H H    . TYR A 1 51 ? 7.889   -1.064  -1.522  1.00 0.00 ? 51 TYR A H    1  
ATOM   774   H HA   . TYR A 1 51 ? 5.180   -1.819  -0.666  1.00 0.00 ? 51 TYR A HA   1  
ATOM   775   H HB2  . TYR A 1 51 ? 6.594   0.877   -0.253  1.00 0.00 ? 51 TYR A HB2  1  
ATOM   776   H HB3  . TYR A 1 51 ? 5.124   0.335   0.533   1.00 0.00 ? 51 TYR A HB3  1  
ATOM   777   H HD1  . TYR A 1 51 ? 5.894   -2.380  1.460   1.00 0.00 ? 51 TYR A HD1  1  
ATOM   778   H HD2  . TYR A 1 51 ? 8.102   1.284   1.488   1.00 0.00 ? 51 TYR A HD2  1  
ATOM   779   H HE1  . TYR A 1 51 ? 7.263   -3.212  3.434   1.00 0.00 ? 51 TYR A HE1  1  
ATOM   780   H HE2  . TYR A 1 51 ? 9.464   0.439   3.462   1.00 0.00 ? 51 TYR A HE2  1  
ATOM   781   H HH   . TYR A 1 51 ? 9.206   -1.153  5.274   1.00 0.00 ? 51 TYR A HH   1  
ATOM   782   N N    . VAL A 1 52 ? 4.106   -0.363  -2.399  1.00 0.00 ? 52 VAL A N    1  
ATOM   783   C CA   . VAL A 1 52 ? 3.512   0.267   -3.565  1.00 0.00 ? 52 VAL A CA   1  
ATOM   784   C C    . VAL A 1 52 ? 2.366   1.178   -3.119  1.00 0.00 ? 52 VAL A C    1  
ATOM   785   O O    . VAL A 1 52 ? 1.623   0.841   -2.198  1.00 0.00 ? 52 VAL A O    1  
ATOM   786   C CB   . VAL A 1 52 ? 3.071   -0.800  -4.569  1.00 0.00 ? 52 VAL A CB   1  
ATOM   787   C CG1  . VAL A 1 52 ? 2.210   -0.189  -5.677  1.00 0.00 ? 52 VAL A CG1  1  
ATOM   788   C CG2  . VAL A 1 52 ? 4.279   -1.534  -5.154  1.00 0.00 ? 52 VAL A CG2  1  
ATOM   789   H H    . VAL A 1 52 ? 3.457   -0.808  -1.782  1.00 0.00 ? 52 VAL A H    1  
ATOM   790   H HA   . VAL A 1 52 ? 4.281   0.877   -4.037  1.00 0.00 ? 52 VAL A HA   1  
ATOM   791   H HB   . VAL A 1 52 ? 2.462   -1.530  -4.036  1.00 0.00 ? 52 VAL A HB   1  
ATOM   792   H HG11 . VAL A 1 52 ? 2.698   0.707   -6.063  1.00 0.00 ? 52 VAL A HG11 1  
ATOM   793   H HG12 . VAL A 1 52 ? 2.088   -0.912  -6.483  1.00 0.00 ? 52 VAL A HG12 1  
ATOM   794   H HG21 . VAL A 1 52 ? 3.941   -2.429  -5.677  1.00 0.00 ? 52 VAL A HG21 1  
ATOM   795   H HG22 . VAL A 1 52 ? 4.798   -0.879  -5.854  1.00 0.00 ? 52 VAL A HG22 1  
ATOM   796   N N    . CYS A 1 53 ? 2.259   2.314   -3.793  1.00 0.00 ? 53 CYS A N    1  
ATOM   797   C CA   . CYS A 1 53 ? 1.216   3.275   -3.478  1.00 0.00 ? 53 CYS A CA   1  
ATOM   798   C C    . CYS A 1 53 ? 0.407   3.541   -4.749  1.00 0.00 ? 53 CYS A C    1  
ATOM   799   O O    . CYS A 1 53 ? 0.927   3.417   -5.857  1.00 0.00 ? 53 CYS A O    1  
ATOM   800   C CB   . CYS A 1 53 ? 1.794   4.564   -2.889  1.00 0.00 ? 53 CYS A CB   1  
ATOM   801   S SG   . CYS A 1 53 ? 2.149   4.496   -1.095  1.00 0.00 ? 53 CYS A SG   1  
ATOM   802   H H    . CYS A 1 53 ? 2.867   2.580   -4.541  1.00 0.00 ? 53 CYS A H    1  
ATOM   803   H HA   . CYS A 1 53 ? 0.591   2.819   -2.710  1.00 0.00 ? 53 CYS A HA   1  
ATOM   804   H HB2  . CYS A 1 53 ? 2.715   4.807   -3.418  1.00 0.00 ? 53 CYS A HB2  1  
ATOM   805   H HB3  . CYS A 1 53 ? 1.094   5.378   -3.076  1.00 0.00 ? 53 CYS A HB3  1  
ATOM   806   N N    . CYS A 1 54 ? -0.851  3.902   -4.547  1.00 0.00 ? 54 CYS A N    1  
ATOM   807   C CA   . CYS A 1 54 ? -1.737  4.187   -5.663  1.00 0.00 ? 54 CYS A CA   1  
ATOM   808   C C    . CYS A 1 54 ? -2.942  4.966   -5.134  1.00 0.00 ? 54 CYS A C    1  
ATOM   809   O O    . CYS A 1 54 ? -3.445  4.677   -4.049  1.00 0.00 ? 54 CYS A O    1  
ATOM   810   C CB   . CYS A 1 54 ? -2.159  2.909   -6.391  1.00 0.00 ? 54 CYS A CB   1  
ATOM   811   S SG   . CYS A 1 54 ? -2.122  1.394   -5.365  1.00 0.00 ? 54 CYS A SG   1  
ATOM   812   H H    . CYS A 1 54 ? -1.266  4.001   -3.642  1.00 0.00 ? 54 CYS A H    1  
ATOM   813   H HA   . CYS A 1 54 ? -1.166  4.789   -6.370  1.00 0.00 ? 54 CYS A HA   1  
ATOM   814   H HB2  . CYS A 1 54 ? -3.168  3.044   -6.778  1.00 0.00 ? 54 CYS A HB2  1  
ATOM   815   H HB3  . CYS A 1 54 ? -1.504  2.764   -7.251  1.00 0.00 ? 54 CYS A HB3  1  
ATOM   816   N N    . ASN A 1 55 ? -3.371  5.939   -5.924  1.00 0.00 ? 55 ASN A N    1  
ATOM   817   C CA   . ASN A 1 55 ? -4.508  6.763   -5.549  1.00 0.00 ? 55 ASN A CA   1  
ATOM   818   C C    . ASN A 1 55 ? -5.726  6.351   -6.378  1.00 0.00 ? 55 ASN A C    1  
ATOM   819   O O    . ASN A 1 55 ? -6.241  7.143   -7.166  1.00 0.00 ? 55 ASN A O    1  
ATOM   820   C CB   . ASN A 1 55 ? -4.230  8.242   -5.819  1.00 0.00 ? 55 ASN A CB   1  
ATOM   821   C CG   . ASN A 1 55 ? -3.705  8.451   -7.242  1.00 0.00 ? 55 ASN A CG   1  
ATOM   822   O OD1  . ASN A 1 55 ? -4.455  8.621   -8.189  1.00 0.00 ? 55 ASN A OD1  1  
ATOM   823   N ND2  . ASN A 1 55 ? -2.379  8.427   -7.338  1.00 0.00 ? 55 ASN A ND2  1  
ATOM   824   H H    . ASN A 1 55 ? -2.956  6.168   -6.805  1.00 0.00 ? 55 ASN A H    1  
ATOM   825   H HA   . ASN A 1 55 ? -4.650  6.586   -4.482  1.00 0.00 ? 55 ASN A HA   1  
ATOM   826   H HB2  . ASN A 1 55 ? -5.143  8.820   -5.676  1.00 0.00 ? 55 ASN A HB2  1  
ATOM   827   H HB3  . ASN A 1 55 ? -3.500  8.617   -5.101  1.00 0.00 ? 55 ASN A HB3  1  
ATOM   828   H HD21 . ASN A 1 55 ? -1.821  8.283   -6.521  1.00 0.00 ? 55 ASN A HD21 1  
ATOM   829   H HD22 . ASN A 1 55 ? -1.940  8.554   -8.228  1.00 0.00 ? 55 ASN A HD22 1  
ATOM   830   N N    . THR A 1 56 ? -6.151  5.113   -6.172  1.00 0.00 ? 56 THR A N    1  
ATOM   831   C CA   . THR A 1 56 ? -7.299  4.587   -6.890  1.00 0.00 ? 56 THR A CA   1  
ATOM   832   C C    . THR A 1 56 ? -8.129  3.680   -5.979  1.00 0.00 ? 56 THR A C    1  
ATOM   833   O O    . THR A 1 56 ? -7.666  3.273   -4.915  1.00 0.00 ? 56 THR A O    1  
ATOM   834   C CB   . THR A 1 56 ? -6.787  3.881   -8.147  1.00 0.00 ? 56 THR A CB   1  
ATOM   835   O OG1  . THR A 1 56 ? -5.847  2.931   -7.653  1.00 0.00 ? 56 THR A OG1  1  
ATOM   836   C CG2  . THR A 1 56 ? -5.953  4.803   -9.038  1.00 0.00 ? 56 THR A CG2  1  
ATOM   837   H H    . THR A 1 56 ? -5.727  4.476   -5.529  1.00 0.00 ? 56 THR A H    1  
ATOM   838   H HA   . THR A 1 56 ? -7.938  5.423   -7.177  1.00 0.00 ? 56 THR A HA   1  
ATOM   839   H HB   . THR A 1 56 ? -7.611  3.438   -8.708  1.00 0.00 ? 56 THR A HB   1  
ATOM   840   H HG1  . THR A 1 56 ? -6.259  2.021   -7.632  1.00 0.00 ? 56 THR A HG1  1  
ATOM   841   H HG21 . THR A 1 56 ? -5.609  4.250   -9.912  1.00 0.00 ? 56 THR A HG21 1  
ATOM   842   H HG22 . THR A 1 56 ? -6.563  5.648   -9.359  1.00 0.00 ? 56 THR A HG22 1  
ATOM   843   N N    . ASP A 1 57 ? -9.355  3.368   -6.403  1.00 0.00 ? 57 ASP A N    1  
ATOM   844   C CA   . ASP A 1 57 ? -10.238 2.518   -5.629  1.00 0.00 ? 57 ASP A CA   1  
ATOM   845   C C    . ASP A 1 57 ? -9.701  1.094   -5.615  1.00 0.00 ? 57 ASP A C    1  
ATOM   846   O O    . ASP A 1 57 ? -9.248  0.590   -6.641  1.00 0.00 ? 57 ASP A O    1  
ATOM   847   C CB   . ASP A 1 57 ? -11.640 2.562   -6.231  1.00 0.00 ? 57 ASP A CB   1  
ATOM   848   C CG   . ASP A 1 57 ? -12.521 3.554   -5.485  1.00 0.00 ? 57 ASP A CG   1  
ATOM   849   O OD1  . ASP A 1 57 ? -12.269 3.739   -4.275  1.00 0.00 ? 57 ASP A OD1  1  
ATOM   850   O OD2  . ASP A 1 57 ? -13.431 4.108   -6.139  1.00 0.00 ? 57 ASP A OD2  1  
ATOM   851   H H    . ASP A 1 57 ? -9.688  3.729   -7.285  1.00 0.00 ? 57 ASP A H    1  
ATOM   852   H HA   . ASP A 1 57 ? -10.281 2.890   -4.606  1.00 0.00 ? 57 ASP A HA   1  
ATOM   853   H HB2  . ASP A 1 57 ? -11.572 2.859   -7.277  1.00 0.00 ? 57 ASP A HB2  1  
ATOM   854   H HB3  . ASP A 1 57 ? -12.087 1.570   -6.169  1.00 0.00 ? 57 ASP A HB3  1  
ATOM   855   H HD2  . ASP A 1 57 ? -13.950 4.721   -5.614  1.00 0.00 ? 57 ASP A HD2  1  
ATOM   856   N N    . LYS A 1 58 ? -9.768  0.481   -4.442  1.00 0.00 ? 58 LYS A N    1  
ATOM   857   C CA   . LYS A 1 58 ? -9.290  -0.882  -4.283  1.00 0.00 ? 58 LYS A CA   1  
ATOM   858   C C    . LYS A 1 58 ? -7.996  -1.061  -5.080  1.00 0.00 ? 58 LYS A C    1  
ATOM   859   O O    . LYS A 1 58 ? -7.886  -1.976  -5.894  1.00 0.00 ? 58 LYS A O    1  
ATOM   860   C CB   . LYS A 1 58 ? -10.387 -1.881  -4.659  1.00 0.00 ? 58 LYS A CB   1  
ATOM   861   C CG   . LYS A 1 58 ? -10.806 -1.710  -6.120  1.00 0.00 ? 58 LYS A CG   1  
ATOM   862   C CD   . LYS A 1 58 ? -11.909 -2.703  -6.493  1.00 0.00 ? 58 LYS A CD   1  
ATOM   863   C CE   . LYS A 1 58 ? -12.117 -2.747  -8.009  1.00 0.00 ? 58 LYS A CE   1  
ATOM   864   N NZ   . LYS A 1 58 ? -13.003 -3.874  -8.377  1.00 0.00 ? 58 LYS A NZ   1  
ATOM   865   H H    . LYS A 1 58 ? -10.138 0.899   -3.613  1.00 0.00 ? 58 LYS A H    1  
ATOM   866   H HA   . LYS A 1 58 ? -9.068  -1.029  -3.226  1.00 0.00 ? 58 LYS A HA   1  
ATOM   867   H HB2  . LYS A 1 58 ? -10.029 -2.898  -4.496  1.00 0.00 ? 58 LYS A HB2  1  
ATOM   868   H HB3  . LYS A 1 58 ? -11.251 -1.740  -4.010  1.00 0.00 ? 58 LYS A HB3  1  
ATOM   869   H HG2  . LYS A 1 58 ? -11.158 -0.692  -6.285  1.00 0.00 ? 58 LYS A HG2  1  
ATOM   870   H HG3  . LYS A 1 58 ? -9.944  -1.858  -6.770  1.00 0.00 ? 58 LYS A HG3  1  
ATOM   871   H HD2  . LYS A 1 58 ? -11.648 -3.696  -6.129  1.00 0.00 ? 58 LYS A HD2  1  
ATOM   872   H HD3  . LYS A 1 58 ? -12.840 -2.419  -6.003  1.00 0.00 ? 58 LYS A HD3  1  
ATOM   873   H HE2  . LYS A 1 58 ? -12.552 -1.808  -8.350  1.00 0.00 ? 58 LYS A HE2  1  
ATOM   874   H HE3  . LYS A 1 58 ? -11.155 -2.854  -8.511  1.00 0.00 ? 58 LYS A HE3  1  
ATOM   875   H HZ1  . LYS A 1 58 ? -12.527 -4.477  -9.018  1.00 0.00 ? 58 LYS A HZ1  1  
ATOM   876   H HZ2  . LYS A 1 58 ? -13.248 -4.388  -7.555  1.00 0.00 ? 58 LYS A HZ2  1  
ATOM   877   N N    . CYS A 1 59 ? -7.049  -0.172  -4.816  1.00 0.00 ? 59 CYS A N    1  
ATOM   878   C CA   . CYS A 1 59 ? -5.767  -0.220  -5.498  1.00 0.00 ? 59 CYS A CA   1  
ATOM   879   C C    . CYS A 1 59 ? -4.845  -1.162  -4.722  1.00 0.00 ? 59 CYS A C    1  
ATOM   880   O O    . CYS A 1 59 ? -4.176  -2.009  -5.313  1.00 0.00 ? 59 CYS A O    1  
ATOM   881   C CB   . CYS A 1 59 ? -5.157  1.174   -5.656  1.00 0.00 ? 59 CYS A CB   1  
ATOM   882   S SG   . CYS A 1 59 ? -3.941  1.629   -4.367  1.00 0.00 ? 59 CYS A SG   1  
ATOM   883   H H    . CYS A 1 59 ? -7.147  0.569   -4.152  1.00 0.00 ? 59 CYS A H    1  
ATOM   884   H HA   . CYS A 1 59 ? -5.960  -0.606  -6.500  1.00 0.00 ? 59 CYS A HA   1  
ATOM   885   H HB2  . CYS A 1 59 ? -4.673  1.236   -6.630  1.00 0.00 ? 59 CYS A HB2  1  
ATOM   886   H HB3  . CYS A 1 59 ? -5.962  1.909   -5.652  1.00 0.00 ? 59 CYS A HB3  1  
ATOM   887   N N    . ASN A 1 60 ? -4.839  -0.984  -3.409  1.00 0.00 ? 60 ASN A N    1  
ATOM   888   C CA   . ASN A 1 60 ? -4.010  -1.807  -2.545  1.00 0.00 ? 60 ASN A CA   1  
ATOM   889   C C    . ASN A 1 60 ? -4.761  -3.094  -2.200  1.00 0.00 ? 60 ASN A C    1  
ATOM   890   O O    . ASN A 1 60 ? -4.300  -4.190  -2.515  1.00 0.00 ? 60 ASN A O    1  
ATOM   891   C CB   . ASN A 1 60 ? -3.688  -1.083  -1.237  1.00 0.00 ? 60 ASN A CB   1  
ATOM   892   C CG   . ASN A 1 60 ? -4.890  -1.100  -0.290  1.00 0.00 ? 60 ASN A CG   1  
ATOM   893   O OD1  . ASN A 1 60 ? -6.033  -1.229  -0.698  1.00 0.00 ? 60 ASN A OD1  1  
ATOM   894   N ND2  . ASN A 1 60 ? -4.570  -0.964  0.993   1.00 0.00 ? 60 ASN A ND2  1  
ATOM   895   H H    . ASN A 1 60 ? -5.386  -0.293  -2.936  1.00 0.00 ? 60 ASN A H    1  
ATOM   896   H HA   . ASN A 1 60 ? -3.100  -1.995  -3.116  1.00 0.00 ? 60 ASN A HA   1  
ATOM   897   H HB2  . ASN A 1 60 ? -2.834  -1.558  -0.754  1.00 0.00 ? 60 ASN A HB2  1  
ATOM   898   H HB3  . ASN A 1 60 ? -3.402  -0.052  -1.448  1.00 0.00 ? 60 ASN A HB3  1  
ATOM   899   H HD21 . ASN A 1 60 ? -3.612  -0.862  1.262   1.00 0.00 ? 60 ASN A HD21 1  
ATOM   900   H HD22 . ASN A 1 60 ? -5.287  -0.963  1.690   1.00 0.00 ? 60 ASN A HD22 1  
HETATM 901   O O    . HOH B 2 .  ? 4.803   -10.725 2.132   1.00 0.00 ? 61 HOH A O    1  
HETATM 902   H H1   . HOH B 2 .  ? 5.551   -11.197 2.498   1.00 0.00 ? 61 HOH A H1   1  
HETATM 903   H H2   . HOH B 2 .  ? 4.224   -11.413 1.804   1.00 0.00 ? 61 HOH A H2   1  
HETATM 904   O O    . HOH B 2 .  ? 7.998   -16.438 -5.593  1.00 0.00 ? 62 HOH A O    1  
HETATM 905   H H1   . HOH B 2 .  ? 8.076   -16.486 -6.546  1.00 0.00 ? 62 HOH A H1   1  
HETATM 906   H H2   . HOH B 2 .  ? 7.757   -17.326 -5.328  1.00 0.00 ? 62 HOH A H2   1  
ATOM   907   N N    . LEU A 1 1  ? -12.199 7.451   -1.614  1.00 0.00 ? 1  LEU A N    2  
ATOM   908   C CA   . LEU A 1 1  ? -11.096 6.749   -0.981  1.00 0.00 ? 1  LEU A CA   2  
ATOM   909   C C    . LEU A 1 1  ? -11.609 5.439   -0.380  1.00 0.00 ? 1  LEU A C    2  
ATOM   910   O O    . LEU A 1 1  ? -11.680 5.298   0.840   1.00 0.00 ? 1  LEU A O    2  
ATOM   911   C CB   . LEU A 1 1  ? -10.393 7.656   0.030   1.00 0.00 ? 1  LEU A CB   2  
ATOM   912   C CG   . LEU A 1 1  ? -9.169  8.415   -0.487  1.00 0.00 ? 1  LEU A CG   2  
ATOM   913   C CD1  . LEU A 1 1  ? -8.080  7.446   -0.952  1.00 0.00 ? 1  LEU A CD1  2  
ATOM   914   C CD2  . LEU A 1 1  ? -9.561  9.406   -1.584  1.00 0.00 ? 1  LEU A CD2  2  
ATOM   915   H H    . LEU A 1 1  ? -12.315 8.402   -1.327  1.00 0.00 ? 1  LEU A H    2  
ATOM   916   H HA   . LEU A 1 1  ? -10.371 6.511   -1.759  1.00 0.00 ? 1  LEU A HA   2  
ATOM   917   H HB2  . LEU A 1 1  ? -11.116 8.383   0.401   1.00 0.00 ? 1  LEU A HB2  2  
ATOM   918   H HB3  . LEU A 1 1  ? -10.087 7.049   0.882   1.00 0.00 ? 1  LEU A HB3  2  
ATOM   919   H HG   . LEU A 1 1  ? -8.753  8.994   0.338   1.00 0.00 ? 1  LEU A HG   2  
ATOM   920   H HD11 . LEU A 1 1  ? -7.870  7.615   -2.008  1.00 0.00 ? 1  LEU A HD11 2  
ATOM   921   H HD12 . LEU A 1 1  ? -7.173  7.612   -0.370  1.00 0.00 ? 1  LEU A HD12 2  
ATOM   922   H HD21 . LEU A 1 1  ? -9.586  8.893   -2.545  1.00 0.00 ? 1  LEU A HD21 2  
ATOM   923   H HD22 . LEU A 1 1  ? -10.546 9.818   -1.366  1.00 0.00 ? 1  LEU A HD22 2  
ATOM   924   N N    . LYS A 1 2  ? -11.952 4.514   -1.263  1.00 0.00 ? 2  LYS A N    2  
ATOM   925   C CA   . LYS A 1 2  ? -12.456 3.220   -0.835  1.00 0.00 ? 2  LYS A CA   2  
ATOM   926   C C    . LYS A 1 2  ? -11.490 2.124   -1.290  1.00 0.00 ? 2  LYS A C    2  
ATOM   927   O O    . LYS A 1 2  ? -11.393 1.833   -2.481  1.00 0.00 ? 2  LYS A O    2  
ATOM   928   C CB   . LYS A 1 2  ? -13.892 3.016   -1.323  1.00 0.00 ? 2  LYS A CB   2  
ATOM   929   C CG   . LYS A 1 2  ? -14.899 3.361   -0.225  1.00 0.00 ? 2  LYS A CG   2  
ATOM   930   C CD   . LYS A 1 2  ? -15.858 4.461   -0.687  1.00 0.00 ? 2  LYS A CD   2  
ATOM   931   C CE   . LYS A 1 2  ? -16.984 4.668   0.327   1.00 0.00 ? 2  LYS A CE   2  
ATOM   932   N NZ   . LYS A 1 2  ? -18.047 3.655   0.136   1.00 0.00 ? 2  LYS A NZ   2  
ATOM   933   H H    . LYS A 1 2  ? -11.891 4.636   -2.254  1.00 0.00 ? 2  LYS A H    2  
ATOM   934   H HA   . LYS A 1 2  ? -12.485 3.225   0.255   1.00 0.00 ? 2  LYS A HA   2  
ATOM   935   H HB2  . LYS A 1 2  ? -14.075 3.639   -2.199  1.00 0.00 ? 2  LYS A HB2  2  
ATOM   936   H HB3  . LYS A 1 2  ? -14.030 1.980   -1.635  1.00 0.00 ? 2  LYS A HB3  2  
ATOM   937   H HG2  . LYS A 1 2  ? -15.466 2.471   0.047   1.00 0.00 ? 2  LYS A HG2  2  
ATOM   938   H HG3  . LYS A 1 2  ? -14.370 3.688   0.670   1.00 0.00 ? 2  LYS A HG3  2  
ATOM   939   H HD2  . LYS A 1 2  ? -15.310 5.393   -0.822  1.00 0.00 ? 2  LYS A HD2  2  
ATOM   940   H HD3  . LYS A 1 2  ? -16.280 4.196   -1.656  1.00 0.00 ? 2  LYS A HD3  2  
ATOM   941   H HE2  . LYS A 1 2  ? -16.587 4.600   1.340   1.00 0.00 ? 2  LYS A HE2  2  
ATOM   942   H HE3  . LYS A 1 2  ? -17.403 5.668   0.216   1.00 0.00 ? 2  LYS A HE3  2  
ATOM   943   H HZ1  . LYS A 1 2  ? -18.303 3.269   1.022   1.00 0.00 ? 2  LYS A HZ1  2  
ATOM   944   H HZ2  . LYS A 1 2  ? -18.846 4.086   -0.283  1.00 0.00 ? 2  LYS A HZ2  2  
ATOM   945   N N    . CYS A 1 3  ? -10.799 1.548   -0.318  1.00 0.00 ? 3  CYS A N    2  
ATOM   946   C CA   . CYS A 1 3  ? -9.844  0.491   -0.603  1.00 0.00 ? 3  CYS A CA   2  
ATOM   947   C C    . CYS A 1 3  ? -10.116 -0.674  0.351   1.00 0.00 ? 3  CYS A C    2  
ATOM   948   O O    . CYS A 1 3  ? -11.072 -0.637  1.124   1.00 0.00 ? 3  CYS A O    2  
ATOM   949   C CB   . CYS A 1 3  ? -8.401  0.989   -0.498  1.00 0.00 ? 3  CYS A CB   2  
ATOM   950   S SG   . CYS A 1 3  ? -7.821  1.969   -1.931  1.00 0.00 ? 3  CYS A SG   2  
ATOM   951   H H    . CYS A 1 3  ? -10.884 1.791   0.649   1.00 0.00 ? 3  CYS A H    2  
ATOM   952   H HA   . CYS A 1 3  ? -10.009 0.191   -1.638  1.00 0.00 ? 3  CYS A HA   2  
ATOM   953   H HB2  . CYS A 1 3  ? -8.306  1.597   0.402   1.00 0.00 ? 3  CYS A HB2  2  
ATOM   954   H HB3  . CYS A 1 3  ? -7.743  0.129   -0.374  1.00 0.00 ? 3  CYS A HB3  2  
ATOM   955   N N    . LYS A 1 4  ? -9.259  -1.680  0.265   1.00 0.00 ? 4  LYS A N    2  
ATOM   956   C CA   . LYS A 1 4  ? -9.395  -2.854  1.111   1.00 0.00 ? 4  LYS A CA   2  
ATOM   957   C C    . LYS A 1 4  ? -8.512  -2.689  2.349   1.00 0.00 ? 4  LYS A C    2  
ATOM   958   O O    . LYS A 1 4  ? -7.495  -1.999  2.304   1.00 0.00 ? 4  LYS A O    2  
ATOM   959   C CB   . LYS A 1 4  ? -9.104  -4.126  0.312   1.00 0.00 ? 4  LYS A CB   2  
ATOM   960   C CG   . LYS A 1 4  ? -10.345 -4.587  -0.456  1.00 0.00 ? 4  LYS A CG   2  
ATOM   961   C CD   . LYS A 1 4  ? -10.326 -6.102  -0.668  1.00 0.00 ? 4  LYS A CD   2  
ATOM   962   C CE   . LYS A 1 4  ? -10.172 -6.447  -2.150  1.00 0.00 ? 4  LYS A CE   2  
ATOM   963   N NZ   . LYS A 1 4  ? -11.398 -7.100  -2.661  1.00 0.00 ? 4  LYS A NZ   2  
ATOM   964   H H    . LYS A 1 4  ? -8.484  -1.702  -0.367  1.00 0.00 ? 4  LYS A H    2  
ATOM   965   H HA   . LYS A 1 4  ? -10.435 -2.906  1.432   1.00 0.00 ? 4  LYS A HA   2  
ATOM   966   H HB2  . LYS A 1 4  ? -8.287  -3.944  -0.385  1.00 0.00 ? 4  LYS A HB2  2  
ATOM   967   H HB3  . LYS A 1 4  ? -8.775  -4.916  0.988   1.00 0.00 ? 4  LYS A HB3  2  
ATOM   968   H HG2  . LYS A 1 4  ? -11.243 -4.304  0.094   1.00 0.00 ? 4  LYS A HG2  2  
ATOM   969   H HG3  . LYS A 1 4  ? -10.388 -4.082  -1.420  1.00 0.00 ? 4  LYS A HG3  2  
ATOM   970   H HD2  . LYS A 1 4  ? -9.506  -6.543  -0.101  1.00 0.00 ? 4  LYS A HD2  2  
ATOM   971   H HD3  . LYS A 1 4  ? -11.249 -6.538  -0.284  1.00 0.00 ? 4  LYS A HD3  2  
ATOM   972   H HE2  . LYS A 1 4  ? -9.971  -5.540  -2.721  1.00 0.00 ? 4  LYS A HE2  2  
ATOM   973   H HE3  . LYS A 1 4  ? -9.316  -7.107  -2.289  1.00 0.00 ? 4  LYS A HE3  2  
ATOM   974   H HZ1  . LYS A 1 4  ? -11.432 -8.045  -2.338  1.00 0.00 ? 4  LYS A HZ1  2  
ATOM   975   H HZ2  . LYS A 1 4  ? -12.202 -6.605  -2.330  1.00 0.00 ? 4  LYS A HZ2  2  
ATOM   976   N N    . LYS A 1 5  ? -8.933  -3.336  3.426   1.00 0.00 ? 5  LYS A N    2  
ATOM   977   C CA   . LYS A 1 5  ? -8.193  -3.270  4.675   1.00 0.00 ? 5  LYS A CA   2  
ATOM   978   C C    . LYS A 1 5  ? -7.115  -4.356  4.682   1.00 0.00 ? 5  LYS A C    2  
ATOM   979   O O    . LYS A 1 5  ? -6.877  -5.007  3.666   1.00 0.00 ? 5  LYS A O    2  
ATOM   980   C CB   . LYS A 1 5  ? -9.148  -3.343  5.868   1.00 0.00 ? 5  LYS A CB   2  
ATOM   981   C CG   . LYS A 1 5  ? -9.924  -2.035  6.030   1.00 0.00 ? 5  LYS A CG   2  
ATOM   982   C CD   . LYS A 1 5  ? -9.333  -1.182  7.154   1.00 0.00 ? 5  LYS A CD   2  
ATOM   983   C CE   . LYS A 1 5  ? -9.666  -1.774  8.525   1.00 0.00 ? 5  LYS A CE   2  
ATOM   984   N NZ   . LYS A 1 5  ? -9.152  -0.902  9.605   1.00 0.00 ? 5  LYS A NZ   2  
ATOM   985   H H    . LYS A 1 5  ? -9.761  -3.896  3.455   1.00 0.00 ? 5  LYS A H    2  
ATOM   986   H HA   . LYS A 1 5  ? -7.703  -2.297  4.714   1.00 0.00 ? 5  LYS A HA   2  
ATOM   987   H HB2  . LYS A 1 5  ? -9.845  -4.170  5.731   1.00 0.00 ? 5  LYS A HB2  2  
ATOM   988   H HB3  . LYS A 1 5  ? -8.584  -3.551  6.778   1.00 0.00 ? 5  LYS A HB3  2  
ATOM   989   H HG2  . LYS A 1 5  ? -9.902  -1.477  5.094   1.00 0.00 ? 5  LYS A HG2  2  
ATOM   990   H HG3  . LYS A 1 5  ? -10.970 -2.253  6.246   1.00 0.00 ? 5  LYS A HG3  2  
ATOM   991   H HD2  . LYS A 1 5  ? -8.251  -1.117  7.035   1.00 0.00 ? 5  LYS A HD2  2  
ATOM   992   H HD3  . LYS A 1 5  ? -9.723  -0.166  7.088   1.00 0.00 ? 5  LYS A HD3  2  
ATOM   993   H HE2  . LYS A 1 5  ? -10.745 -1.889  8.626   1.00 0.00 ? 5  LYS A HE2  2  
ATOM   994   H HE3  . LYS A 1 5  ? -9.230  -2.769  8.614   1.00 0.00 ? 5  LYS A HE3  2  
ATOM   995   H HZ1  . LYS A 1 5  ? -8.790  -0.058  9.208   1.00 0.00 ? 5  LYS A HZ1  2  
ATOM   996   H HZ2  . LYS A 1 5  ? -9.894  -0.682  10.237  1.00 0.00 ? 5  LYS A HZ2  2  
ATOM   997   N N    . LEU A 1 6  ? -6.492  -4.520  5.840   1.00 0.00 ? 6  LEU A N    2  
ATOM   998   C CA   . LEU A 1 6  ? -5.446  -5.516  5.993   1.00 0.00 ? 6  LEU A CA   2  
ATOM   999   C C    . LEU A 1 6  ? -5.876  -6.812  5.303   1.00 0.00 ? 6  LEU A C    2  
ATOM   1000  O O    . LEU A 1 6  ? -5.296  -7.203  4.291   1.00 0.00 ? 6  LEU A O    2  
ATOM   1001  C CB   . LEU A 1 6  ? -5.088  -5.695  7.470   1.00 0.00 ? 6  LEU A CB   2  
ATOM   1002  C CG   . LEU A 1 6  ? -3.977  -4.790  8.006   1.00 0.00 ? 6  LEU A CG   2  
ATOM   1003  C CD1  . LEU A 1 6  ? -4.540  -3.443  8.463   1.00 0.00 ? 6  LEU A CD1  2  
ATOM   1004  C CD2  . LEU A 1 6  ? -3.188  -5.488  9.115   1.00 0.00 ? 6  LEU A CD2  2  
ATOM   1005  H H    . LEU A 1 6  ? -6.692  -3.987  6.663   1.00 0.00 ? 6  LEU A H    2  
ATOM   1006  H HA   . LEU A 1 6  ? -4.557  -5.136  5.490   1.00 0.00 ? 6  LEU A HA   2  
ATOM   1007  H HB2  . LEU A 1 6  ? -5.986  -5.525  8.064   1.00 0.00 ? 6  LEU A HB2  2  
ATOM   1008  H HB3  . LEU A 1 6  ? -4.793  -6.732  7.629   1.00 0.00 ? 6  LEU A HB3  2  
ATOM   1009  H HG   . LEU A 1 6  ? -3.279  -4.588  7.193   1.00 0.00 ? 6  LEU A HG   2  
ATOM   1010  H HD11 . LEU A 1 6  ? -5.034  -3.564  9.427   1.00 0.00 ? 6  LEU A HD11 2  
ATOM   1011  H HD12 . LEU A 1 6  ? -3.727  -2.723  8.559   1.00 0.00 ? 6  LEU A HD12 2  
ATOM   1012  H HD21 . LEU A 1 6  ? -2.121  -5.348  8.945   1.00 0.00 ? 6  LEU A HD21 2  
ATOM   1013  H HD22 . LEU A 1 6  ? -3.462  -5.060  10.080  1.00 0.00 ? 6  LEU A HD22 2  
ATOM   1014  N N    . VAL A 1 7  ? -6.890  -7.442  5.878   1.00 0.00 ? 7  VAL A N    2  
ATOM   1015  C CA   . VAL A 1 7  ? -7.405  -8.686  5.331   1.00 0.00 ? 7  VAL A CA   2  
ATOM   1016  C C    . VAL A 1 7  ? -8.392  -8.372  4.205   1.00 0.00 ? 7  VAL A C    2  
ATOM   1017  O O    . VAL A 1 7  ? -9.252  -7.505  4.352   1.00 0.00 ? 7  VAL A O    2  
ATOM   1018  C CB   . VAL A 1 7  ? -8.020  -9.533  6.447   1.00 0.00 ? 7  VAL A CB   2  
ATOM   1019  C CG1  . VAL A 1 7  ? -8.703  -10.778 5.877   1.00 0.00 ? 7  VAL A CG1  2  
ATOM   1020  C CG2  . VAL A 1 7  ? -6.968  -9.914  7.490   1.00 0.00 ? 7  VAL A CG2  2  
ATOM   1021  H H    . VAL A 1 7  ? -7.356  -7.117  6.701   1.00 0.00 ? 7  VAL A H    2  
ATOM   1022  H HA   . VAL A 1 7  ? -6.562  -9.236  4.915   1.00 0.00 ? 7  VAL A HA   2  
ATOM   1023  H HB   . VAL A 1 7  ? -8.782  -8.931  6.944   1.00 0.00 ? 7  VAL A HB   2  
ATOM   1024  H HG11 . VAL A 1 7  ? -8.869  -10.644 4.808   1.00 0.00 ? 7  VAL A HG11 2  
ATOM   1025  H HG12 . VAL A 1 7  ? -8.067  -11.648 6.039   1.00 0.00 ? 7  VAL A HG12 2  
ATOM   1026  H HG21 . VAL A 1 7  ? -6.475  -9.013  7.855   1.00 0.00 ? 7  VAL A HG21 2  
ATOM   1027  H HG22 . VAL A 1 7  ? -7.450  -10.427 8.322   1.00 0.00 ? 7  VAL A HG22 2  
ATOM   1028  N N    . PRO A 1 8  ? -8.232  -9.114  3.077   1.00 0.00 ? 8  PRO A N    2  
ATOM   1029  C CA   . PRO A 1 8  ? -9.098  -8.924  1.926   1.00 0.00 ? 8  PRO A CA   2  
ATOM   1030  C C    . PRO A 1 8  ? -10.479 -9.536  2.173   1.00 0.00 ? 8  PRO A C    2  
ATOM   1031  O O    . PRO A 1 8  ? -10.952 -10.349 1.381   1.00 0.00 ? 8  PRO A O    2  
ATOM   1032  C CB   . PRO A 1 8  ? -8.360  -9.573  0.766   1.00 0.00 ? 8  PRO A CB   2  
ATOM   1033  C CG   . PRO A 1 8  ? -7.334  -10.503 1.393   1.00 0.00 ? 8  PRO A CG   2  
ATOM   1034  C CD   . PRO A 1 8  ? -7.224  -10.150 2.867   1.00 0.00 ? 8  PRO A CD   2  
ATOM   1035  H HA   . PRO A 1 8  ? -9.256  -7.950  1.767   1.00 0.00 ? 8  PRO A HA   2  
ATOM   1036  H HB2  . PRO A 1 8  ? -9.048  -10.124 0.125   1.00 0.00 ? 8  PRO A HB2  2  
ATOM   1037  H HB3  . PRO A 1 8  ? -7.877  -8.821  0.142   1.00 0.00 ? 8  PRO A HB3  2  
ATOM   1038  H HG2  . PRO A 1 8  ? -7.637  -11.543 1.271   1.00 0.00 ? 8  PRO A HG2  2  
ATOM   1039  H HG3  . PRO A 1 8  ? -6.368  -10.393 0.900   1.00 0.00 ? 8  PRO A HG3  2  
ATOM   1040  H HD2  . PRO A 1 8  ? -7.412  -11.019 3.498   1.00 0.00 ? 8  PRO A HD2  2  
ATOM   1041  H HD3  . PRO A 1 8  ? -6.226  -9.787  3.114   1.00 0.00 ? 8  PRO A HD3  2  
ATOM   1042  N N    . LEU A 1 9  ? -11.087 -9.121  3.275   1.00 0.00 ? 9  LEU A N    2  
ATOM   1043  C CA   . LEU A 1 9  ? -12.403 -9.617  3.636   1.00 0.00 ? 9  LEU A CA   2  
ATOM   1044  C C    . LEU A 1 9  ? -13.402 -8.458  3.625   1.00 0.00 ? 9  LEU A C    2  
ATOM   1045  O O    . LEU A 1 9  ? -14.561 -8.635  3.254   1.00 0.00 ? 9  LEU A O    2  
ATOM   1046  C CB   . LEU A 1 9  ? -12.346 -10.368 4.968   1.00 0.00 ? 9  LEU A CB   2  
ATOM   1047  C CG   . LEU A 1 9  ? -11.829 -11.806 4.906   1.00 0.00 ? 9  LEU A CG   2  
ATOM   1048  C CD1  . LEU A 1 9  ? -11.643 -12.383 6.311   1.00 0.00 ? 9  LEU A CD1  2  
ATOM   1049  C CD2  . LEU A 1 9  ? -12.742 -12.680 4.044   1.00 0.00 ? 9  LEU A CD2  2  
ATOM   1050  H H    . LEU A 1 9  ? -10.695 -8.459  3.914   1.00 0.00 ? 9  LEU A H    2  
ATOM   1051  H HA   . LEU A 1 9  ? -12.702 -10.337 2.873   1.00 0.00 ? 9  LEU A HA   2  
ATOM   1052  H HB2  . LEU A 1 9  ? -11.713 -9.804  5.653   1.00 0.00 ? 9  LEU A HB2  2  
ATOM   1053  H HB3  . LEU A 1 9  ? -13.348 -10.381 5.398   1.00 0.00 ? 9  LEU A HB3  2  
ATOM   1054  H HG   . LEU A 1 9  ? -10.849 -11.797 4.429   1.00 0.00 ? 9  LEU A HG   2  
ATOM   1055  H HD11 . LEU A 1 9  ? -10.608 -12.701 6.438   1.00 0.00 ? 9  LEU A HD11 2  
ATOM   1056  H HD12 . LEU A 1 9  ? -11.882 -11.620 7.051   1.00 0.00 ? 9  LEU A HD12 2  
ATOM   1057  H HD21 . LEU A 1 9  ? -12.420 -12.627 3.004   1.00 0.00 ? 9  LEU A HD21 2  
ATOM   1058  H HD22 . LEU A 1 9  ? -12.688 -13.713 4.389   1.00 0.00 ? 9  LEU A HD22 2  
ATOM   1059  N N    . PHE A 1 10 ? -12.915 -7.296  4.037   1.00 0.00 ? 10 PHE A N    2  
ATOM   1060  C CA   . PHE A 1 10 ? -13.750 -6.108  4.080   1.00 0.00 ? 10 PHE A CA   2  
ATOM   1061  C C    . PHE A 1 10 ? -13.004 -4.893  3.523   1.00 0.00 ? 10 PHE A C    2  
ATOM   1062  O O    . PHE A 1 10 ? -11.798 -4.954  3.291   1.00 0.00 ? 10 PHE A O    2  
ATOM   1063  C CB   . PHE A 1 10 ? -14.090 -5.853  5.549   1.00 0.00 ? 10 PHE A CB   2  
ATOM   1064  C CG   . PHE A 1 10 ? -14.492 -7.111  6.322   1.00 0.00 ? 10 PHE A CG   2  
ATOM   1065  C CD1  . PHE A 1 10 ? -13.535 -7.908  6.869   1.00 0.00 ? 10 PHE A CD1  2  
ATOM   1066  C CD2  . PHE A 1 10 ? -15.806 -7.431  6.463   1.00 0.00 ? 10 PHE A CD2  2  
ATOM   1067  C CE1  . PHE A 1 10 ? -13.908 -9.075  7.586   1.00 0.00 ? 10 PHE A CE1  2  
ATOM   1068  C CE2  . PHE A 1 10 ? -16.179 -8.599  7.180   1.00 0.00 ? 10 PHE A CE2  2  
ATOM   1069  C CZ   . PHE A 1 10 ? -15.223 -9.396  7.727   1.00 0.00 ? 10 PHE A CZ   2  
ATOM   1070  H H    . PHE A 1 10 ? -11.971 -7.160  4.337   1.00 0.00 ? 10 PHE A H    2  
ATOM   1071  H HA   . PHE A 1 10 ? -14.627 -6.307  3.464   1.00 0.00 ? 10 PHE A HA   2  
ATOM   1072  H HB2  . PHE A 1 10 ? -13.228 -5.399  6.038   1.00 0.00 ? 10 PHE A HB2  2  
ATOM   1073  H HB3  . PHE A 1 10 ? -14.905 -5.130  5.603   1.00 0.00 ? 10 PHE A HB3  2  
ATOM   1074  H HD1  . PHE A 1 10 ? -12.482 -7.651  6.756   1.00 0.00 ? 10 PHE A HD1  2  
ATOM   1075  H HD2  . PHE A 1 10 ? -16.573 -6.792  6.025   1.00 0.00 ? 10 PHE A HD2  2  
ATOM   1076  H HE1  . PHE A 1 10 ? -13.142 -9.714  8.024   1.00 0.00 ? 10 PHE A HE1  2  
ATOM   1077  H HE2  . PHE A 1 10 ? -17.233 -8.856  7.293   1.00 0.00 ? 10 PHE A HE2  2  
ATOM   1078  H HZ   . PHE A 1 10 ? -15.509 -10.292 8.277   1.00 0.00 ? 10 PHE A HZ   2  
ATOM   1079  N N    . SER A 1 11 ? -13.753 -3.819  3.325   1.00 0.00 ? 11 SER A N    2  
ATOM   1080  C CA   . SER A 1 11 ? -13.178 -2.592  2.800   1.00 0.00 ? 11 SER A CA   2  
ATOM   1081  C C    . SER A 1 11 ? -13.539 -1.414  3.707   1.00 0.00 ? 11 SER A C    2  
ATOM   1082  O O    . SER A 1 11 ? -14.592 -1.417  4.345   1.00 0.00 ? 11 SER A O    2  
ATOM   1083  C CB   . SER A 1 11 ? -13.656 -2.327  1.371   1.00 0.00 ? 11 SER A CB   2  
ATOM   1084  O OG   . SER A 1 11 ? -15.060 -2.531  1.231   1.00 0.00 ? 11 SER A OG   2  
ATOM   1085  H H    . SER A 1 11 ? -14.734 -3.778  3.516   1.00 0.00 ? 11 SER A H    2  
ATOM   1086  H HA   . SER A 1 11 ? -12.101 -2.756  2.797   1.00 0.00 ? 11 SER A HA   2  
ATOM   1087  H HB2  . SER A 1 11 ? -13.409 -1.303  1.090   1.00 0.00 ? 11 SER A HB2  2  
ATOM   1088  H HB3  . SER A 1 11 ? -13.124 -2.984  0.683   1.00 0.00 ? 11 SER A HB3  2  
ATOM   1089  H HG   . SER A 1 11 ? -15.334 -3.365  1.711   1.00 0.00 ? 11 SER A HG   2  
ATOM   1090  N N    . LYS A 1 12 ? -12.647 -0.436  3.737   1.00 0.00 ? 12 LYS A N    2  
ATOM   1091  C CA   . LYS A 1 12 ? -12.858 0.745   4.556   1.00 0.00 ? 12 LYS A CA   2  
ATOM   1092  C C    . LYS A 1 12 ? -12.525 1.995   3.738   1.00 0.00 ? 12 LYS A C    2  
ATOM   1093  O O    . LYS A 1 12 ? -12.136 1.894   2.575   1.00 0.00 ? 12 LYS A O    2  
ATOM   1094  C CB   . LYS A 1 12 ? -12.071 0.639   5.864   1.00 0.00 ? 12 LYS A CB   2  
ATOM   1095  C CG   . LYS A 1 12 ? -12.952 0.988   7.065   1.00 0.00 ? 12 LYS A CG   2  
ATOM   1096  C CD   . LYS A 1 12 ? -12.111 1.155   8.332   1.00 0.00 ? 12 LYS A CD   2  
ATOM   1097  C CE   . LYS A 1 12 ? -12.865 0.645   9.562   1.00 0.00 ? 12 LYS A CE   2  
ATOM   1098  N NZ   . LYS A 1 12 ? -12.379 1.321   10.785  1.00 0.00 ? 12 LYS A NZ   2  
ATOM   1099  H H    . LYS A 1 12 ? -11.793 -0.442  3.216   1.00 0.00 ? 12 LYS A H    2  
ATOM   1100  H HA   . LYS A 1 12 ? -13.916 0.776   4.819   1.00 0.00 ? 12 LYS A HA   2  
ATOM   1101  H HB2  . LYS A 1 12 ? -11.680 -0.372  5.977   1.00 0.00 ? 12 LYS A HB2  2  
ATOM   1102  H HB3  . LYS A 1 12 ? -11.212 1.310   5.831   1.00 0.00 ? 12 LYS A HB3  2  
ATOM   1103  H HG2  . LYS A 1 12 ? -13.499 1.909   6.863   1.00 0.00 ? 12 LYS A HG2  2  
ATOM   1104  H HG3  . LYS A 1 12 ? -13.693 0.204   7.217   1.00 0.00 ? 12 LYS A HG3  2  
ATOM   1105  H HD2  . LYS A 1 12 ? -11.173 0.611   8.224   1.00 0.00 ? 12 LYS A HD2  2  
ATOM   1106  H HD3  . LYS A 1 12 ? -11.856 2.206   8.468   1.00 0.00 ? 12 LYS A HD3  2  
ATOM   1107  H HE2  . LYS A 1 12 ? -13.934 0.824   9.440   1.00 0.00 ? 12 LYS A HE2  2  
ATOM   1108  H HE3  . LYS A 1 12 ? -12.731 -0.432  9.657   1.00 0.00 ? 12 LYS A HE3  2  
ATOM   1109  H HZ1  . LYS A 1 12 ? -11.530 0.889   11.090  1.00 0.00 ? 12 LYS A HZ1  2  
ATOM   1110  H HZ2  . LYS A 1 12 ? -12.209 2.286   10.587  1.00 0.00 ? 12 LYS A HZ2  2  
ATOM   1111  N N    . THR A 1 13 ? -12.690 3.143   4.377   1.00 0.00 ? 13 THR A N    2  
ATOM   1112  C CA   . THR A 1 13 ? -12.412 4.410   3.723   1.00 0.00 ? 13 THR A CA   2  
ATOM   1113  C C    . THR A 1 13 ? -11.278 5.144   4.441   1.00 0.00 ? 13 THR A C    2  
ATOM   1114  O O    . THR A 1 13 ? -11.311 5.303   5.660   1.00 0.00 ? 13 THR A O    2  
ATOM   1115  C CB   . THR A 1 13 ? -13.715 5.211   3.668   1.00 0.00 ? 13 THR A CB   2  
ATOM   1116  O OG1  . THR A 1 13 ? -14.499 4.531   2.692   1.00 0.00 ? 13 THR A OG1  2  
ATOM   1117  C CG2  . THR A 1 13 ? -13.519 6.610   3.081   1.00 0.00 ? 13 THR A CG2  2  
ATOM   1118  H H    . THR A 1 13 ? -13.007 3.217   5.323   1.00 0.00 ? 13 THR A H    2  
ATOM   1119  H HA   . THR A 1 13 ? -12.068 4.205   2.709   1.00 0.00 ? 13 THR A HA   2  
ATOM   1120  H HB   . THR A 1 13 ? -14.181 5.263   4.652   1.00 0.00 ? 13 THR A HB   2  
ATOM   1121  H HG1  . THR A 1 13 ? -14.544 3.555   2.907   1.00 0.00 ? 13 THR A HG1  2  
ATOM   1122  H HG21 . THR A 1 13 ? -12.777 6.568   2.283   1.00 0.00 ? 13 THR A HG21 2  
ATOM   1123  H HG22 . THR A 1 13 ? -14.466 6.971   2.678   1.00 0.00 ? 13 THR A HG22 2  
ATOM   1124  N N    . CYS A 1 14 ? -10.301 5.572   3.655   1.00 0.00 ? 14 CYS A N    2  
ATOM   1125  C CA   . CYS A 1 14 ? -9.159  6.285   4.200   1.00 0.00 ? 14 CYS A CA   2  
ATOM   1126  C C    . CYS A 1 14 ? -9.627  7.672   4.646   1.00 0.00 ? 14 CYS A C    2  
ATOM   1127  O O    . CYS A 1 14 ? -10.147 8.444   3.842   1.00 0.00 ? 14 CYS A O    2  
ATOM   1128  C CB   . CYS A 1 14 ? -8.009  6.367   3.194   1.00 0.00 ? 14 CYS A CB   2  
ATOM   1129  S SG   . CYS A 1 14 ? -7.782  4.870   2.166   1.00 0.00 ? 14 CYS A SG   2  
ATOM   1130  H H    . CYS A 1 14 ? -10.282 5.439   2.664   1.00 0.00 ? 14 CYS A H    2  
ATOM   1131  H HA   . CYS A 1 14 ? -8.805  5.704   5.052   1.00 0.00 ? 14 CYS A HA   2  
ATOM   1132  H HB2  . CYS A 1 14 ? -8.180  7.219   2.537   1.00 0.00 ? 14 CYS A HB2  2  
ATOM   1133  H HB3  . CYS A 1 14 ? -7.084  6.562   3.736   1.00 0.00 ? 14 CYS A HB3  2  
ATOM   1134  N N    . PRO A 1 15 ? -9.420  7.954   5.960   1.00 0.00 ? 15 PRO A N    2  
ATOM   1135  C CA   . PRO A 1 15 ? -9.815  9.234   6.523   1.00 0.00 ? 15 PRO A CA   2  
ATOM   1136  C C    . PRO A 1 15 ? -8.847  10.341  6.098   1.00 0.00 ? 15 PRO A C    2  
ATOM   1137  O O    . PRO A 1 15 ? -7.760  10.061  5.596   1.00 0.00 ? 15 PRO A O    2  
ATOM   1138  C CB   . PRO A 1 15 ? -9.840  9.013   8.026   1.00 0.00 ? 15 PRO A CB   2  
ATOM   1139  C CG   . PRO A 1 15 ? -9.014  7.761   8.277   1.00 0.00 ? 15 PRO A CG   2  
ATOM   1140  C CD   . PRO A 1 15 ? -8.807  7.064   6.942   1.00 0.00 ? 15 PRO A CD   2  
ATOM   1141  H HA   . PRO A 1 15 ? -10.711 9.505   6.173   1.00 0.00 ? 15 PRO A HA   2  
ATOM   1142  H HB2  . PRO A 1 15 ? -9.421  9.869   8.554   1.00 0.00 ? 15 PRO A HB2  2  
ATOM   1143  H HB3  . PRO A 1 15 ? -10.861 8.885   8.385   1.00 0.00 ? 15 PRO A HB3  2  
ATOM   1144  H HG2  . PRO A 1 15 ? -8.055  8.021   8.725   1.00 0.00 ? 15 PRO A HG2  2  
ATOM   1145  H HG3  . PRO A 1 15 ? -9.525  7.101   8.978   1.00 0.00 ? 15 PRO A HG3  2  
ATOM   1146  H HD2  . PRO A 1 15 ? -7.748  6.914   6.734   1.00 0.00 ? 15 PRO A HD2  2  
ATOM   1147  H HD3  . PRO A 1 15 ? -9.276  6.080   6.933   1.00 0.00 ? 15 PRO A HD3  2  
ATOM   1148  N N    . ALA A 1 16 ? -9.279  11.575  6.314   1.00 0.00 ? 16 ALA A N    2  
ATOM   1149  C CA   . ALA A 1 16 ? -8.465  12.725  5.960   1.00 0.00 ? 16 ALA A CA   2  
ATOM   1150  C C    . ALA A 1 16 ? -7.005  12.441  6.319   1.00 0.00 ? 16 ALA A C    2  
ATOM   1151  O O    . ALA A 1 16 ? -6.720  11.872  7.371   1.00 0.00 ? 16 ALA A O    2  
ATOM   1152  C CB   . ALA A 1 16 ? -9.006  13.971  6.665   1.00 0.00 ? 16 ALA A CB   2  
ATOM   1153  H H    . ALA A 1 16 ? -10.165 11.794  6.723   1.00 0.00 ? 16 ALA A H    2  
ATOM   1154  H HA   . ALA A 1 16 ? -8.544  12.869  4.883   1.00 0.00 ? 16 ALA A HA   2  
ATOM   1155  H HB1  . ALA A 1 16 ? -9.127  13.763  7.728   1.00 0.00 ? 16 ALA A HB1  2  
ATOM   1156  H HB2  . ALA A 1 16 ? -8.307  14.796  6.533   1.00 0.00 ? 16 ALA A HB2  2  
ATOM   1157  N N    . GLY A 1 17 ? -6.118  12.851  5.423   1.00 0.00 ? 17 GLY A N    2  
ATOM   1158  C CA   . GLY A 1 17 ? -4.695  12.648  5.632   1.00 0.00 ? 17 GLY A CA   2  
ATOM   1159  C C    . GLY A 1 17 ? -4.148  11.580  4.682   1.00 0.00 ? 17 GLY A C    2  
ATOM   1160  O O    . GLY A 1 17 ? -3.226  11.843  3.912   1.00 0.00 ? 17 GLY A O    2  
ATOM   1161  H H    . GLY A 1 17 ? -6.358  13.313  4.570   1.00 0.00 ? 17 GLY A H    2  
ATOM   1162  H HA2  . GLY A 1 17 ? -4.163  13.586  5.475   1.00 0.00 ? 17 GLY A HA2  2  
ATOM   1163  H HA3  . GLY A 1 17 ? -4.514  12.348  6.664   1.00 0.00 ? 17 GLY A HA3  2  
ATOM   1164  N N    . LYS A 1 18 ? -4.740  10.398  4.768   1.00 0.00 ? 18 LYS A N    2  
ATOM   1165  C CA   . LYS A 1 18 ? -4.324  9.289   3.926   1.00 0.00 ? 18 LYS A CA   2  
ATOM   1166  C C    . LYS A 1 18 ? -5.269  9.182   2.728   1.00 0.00 ? 18 LYS A C    2  
ATOM   1167  O O    . LYS A 1 18 ? -6.341  8.587   2.829   1.00 0.00 ? 18 LYS A O    2  
ATOM   1168  C CB   . LYS A 1 18 ? -4.222  8.002   4.746   1.00 0.00 ? 18 LYS A CB   2  
ATOM   1169  C CG   . LYS A 1 18 ? -5.376  7.896   5.745   1.00 0.00 ? 18 LYS A CG   2  
ATOM   1170  C CD   . LYS A 1 18 ? -4.994  8.514   7.091   1.00 0.00 ? 18 LYS A CD   2  
ATOM   1171  C CE   . LYS A 1 18 ? -4.661  7.430   8.118   1.00 0.00 ? 18 LYS A CE   2  
ATOM   1172  N NZ   . LYS A 1 18 ? -3.389  7.743   8.808   1.00 0.00 ? 18 LYS A NZ   2  
ATOM   1173  H H    . LYS A 1 18 ? -5.489  10.192  5.398   1.00 0.00 ? 18 LYS A H    2  
ATOM   1174  H HA   . LYS A 1 18 ? -3.323  9.517   3.558   1.00 0.00 ? 18 LYS A HA   2  
ATOM   1175  H HB2  . LYS A 1 18 ? -4.233  7.139   4.080   1.00 0.00 ? 18 LYS A HB2  2  
ATOM   1176  H HB3  . LYS A 1 18 ? -3.272  7.980   5.279   1.00 0.00 ? 18 LYS A HB3  2  
ATOM   1177  H HG2  . LYS A 1 18 ? -6.256  8.400   5.345   1.00 0.00 ? 18 LYS A HG2  2  
ATOM   1178  H HG3  . LYS A 1 18 ? -5.645  6.849   5.885   1.00 0.00 ? 18 LYS A HG3  2  
ATOM   1179  H HD2  . LYS A 1 18 ? -4.137  9.174   6.962   1.00 0.00 ? 18 LYS A HD2  2  
ATOM   1180  H HD3  . LYS A 1 18 ? -5.816  9.128   7.460   1.00 0.00 ? 18 LYS A HD3  2  
ATOM   1181  H HE2  . LYS A 1 18 ? -5.467  7.351   8.848   1.00 0.00 ? 18 LYS A HE2  2  
ATOM   1182  H HE3  . LYS A 1 18 ? -4.584  6.463   7.622   1.00 0.00 ? 18 LYS A HE3  2  
ATOM   1183  H HZ1  . LYS A 1 18 ? -2.763  6.969   8.719   1.00 0.00 ? 18 LYS A HZ1  2  
ATOM   1184  H HZ2  . LYS A 1 18 ? -2.977  8.555   8.394   1.00 0.00 ? 18 LYS A HZ2  2  
ATOM   1185  N N    . ASN A 1 19 ? -4.838  9.768   1.620   1.00 0.00 ? 19 ASN A N    2  
ATOM   1186  C CA   . ASN A 1 19 ? -5.633  9.746   0.404   1.00 0.00 ? 19 ASN A CA   2  
ATOM   1187  C C    . ASN A 1 19 ? -5.003  8.772   -0.594  1.00 0.00 ? 19 ASN A C    2  
ATOM   1188  O O    . ASN A 1 19 ? -5.389  8.737   -1.761  1.00 0.00 ? 19 ASN A O    2  
ATOM   1189  C CB   . ASN A 1 19 ? -5.678  11.129  -0.250  1.00 0.00 ? 19 ASN A CB   2  
ATOM   1190  C CG   . ASN A 1 19 ? -6.859  11.946  0.277   1.00 0.00 ? 19 ASN A CG   2  
ATOM   1191  O OD1  . ASN A 1 19 ? -7.971  11.462  0.412   1.00 0.00 ? 19 ASN A OD1  2  
ATOM   1192  N ND2  . ASN A 1 19 ? -6.558  13.208  0.565   1.00 0.00 ? 19 ASN A ND2  2  
ATOM   1193  H H    . ASN A 1 19 ? -3.965  10.251  1.546   1.00 0.00 ? 19 ASN A H    2  
ATOM   1194  H HA   . ASN A 1 19 ? -6.629  9.435   0.718   1.00 0.00 ? 19 ASN A HA   2  
ATOM   1195  H HB2  . ASN A 1 19 ? -4.747  11.659  -0.051  1.00 0.00 ? 19 ASN A HB2  2  
ATOM   1196  H HB3  . ASN A 1 19 ? -5.759  11.021  -1.331  1.00 0.00 ? 19 ASN A HB3  2  
ATOM   1197  H HD21 . ASN A 1 19 ? -5.625  13.543  0.431   1.00 0.00 ? 19 ASN A HD21 2  
ATOM   1198  H HD22 . ASN A 1 19 ? -7.264  13.824  0.917   1.00 0.00 ? 19 ASN A HD22 2  
ATOM   1199  N N    . LEU A 1 20 ? -4.044  8.004   -0.097  1.00 0.00 ? 20 LEU A N    2  
ATOM   1200  C CA   . LEU A 1 20 ? -3.358  7.031   -0.931  1.00 0.00 ? 20 LEU A CA   2  
ATOM   1201  C C    . LEU A 1 20 ? -3.350  5.675   -0.223  1.00 0.00 ? 20 LEU A C    2  
ATOM   1202  O O    . LEU A 1 20 ? -3.012  5.588   0.957   1.00 0.00 ? 20 LEU A O    2  
ATOM   1203  C CB   . LEU A 1 20 ? -1.964  7.537   -1.306  1.00 0.00 ? 20 LEU A CB   2  
ATOM   1204  C CG   . LEU A 1 20 ? -1.916  8.670   -2.334  1.00 0.00 ? 20 LEU A CG   2  
ATOM   1205  C CD1  . LEU A 1 20 ? -1.046  9.826   -1.836  1.00 0.00 ? 20 LEU A CD1  2  
ATOM   1206  C CD2  . LEU A 1 20 ? -1.455  8.153   -3.699  1.00 0.00 ? 20 LEU A CD2  2  
ATOM   1207  H H    . LEU A 1 20 ? -3.736  8.038   0.853   1.00 0.00 ? 20 LEU A H    2  
ATOM   1208  H HA   . LEU A 1 20 ? -3.926  6.935   -1.856  1.00 0.00 ? 20 LEU A HA   2  
ATOM   1209  H HB2  . LEU A 1 20 ? -1.465  7.876   -0.398  1.00 0.00 ? 20 LEU A HB2  2  
ATOM   1210  H HB3  . LEU A 1 20 ? -1.386  6.698   -1.693  1.00 0.00 ? 20 LEU A HB3  2  
ATOM   1211  H HG   . LEU A 1 20 ? -2.926  9.059   -2.462  1.00 0.00 ? 20 LEU A HG   2  
ATOM   1212  H HD11 . LEU A 1 20 ? -0.061  9.447   -1.561  1.00 0.00 ? 20 LEU A HD11 2  
ATOM   1213  H HD12 . LEU A 1 20 ? -0.942  10.569  -2.627  1.00 0.00 ? 20 LEU A HD12 2  
ATOM   1214  H HD21 . LEU A 1 20 ? -0.489  7.659   -3.593  1.00 0.00 ? 20 LEU A HD21 2  
ATOM   1215  H HD22 . LEU A 1 20 ? -2.187  7.442   -4.083  1.00 0.00 ? 20 LEU A HD22 2  
ATOM   1216  N N    . CYS A 1 21 ? -3.725  4.650   -0.973  1.00 0.00 ? 21 CYS A N    2  
ATOM   1217  C CA   . CYS A 1 21 ? -3.766  3.302   -0.433  1.00 0.00 ? 21 CYS A CA   2  
ATOM   1218  C C    . CYS A 1 21 ? -2.408  2.642   -0.684  1.00 0.00 ? 21 CYS A C    2  
ATOM   1219  O O    . CYS A 1 21 ? -1.867  2.729   -1.785  1.00 0.00 ? 21 CYS A O    2  
ATOM   1220  C CB   . CYS A 1 21 ? -4.915  2.487   -1.029  1.00 0.00 ? 21 CYS A CB   2  
ATOM   1221  S SG   . CYS A 1 21 ? -6.553  3.299   -0.951  1.00 0.00 ? 21 CYS A SG   2  
ATOM   1222  H H    . CYS A 1 21 ? -3.999  4.729   -1.932  1.00 0.00 ? 21 CYS A H    2  
ATOM   1223  H HA   . CYS A 1 21 ? -3.957  3.399   0.636   1.00 0.00 ? 21 CYS A HA   2  
ATOM   1224  H HB2  . CYS A 1 21 ? -4.684  2.267   -2.071  1.00 0.00 ? 21 CYS A HB2  2  
ATOM   1225  H HB3  . CYS A 1 21 ? -4.974  1.532   -0.508  1.00 0.00 ? 21 CYS A HB3  2  
ATOM   1226  N N    . TYR A 1 22 ? -1.897  1.999   0.355   1.00 0.00 ? 22 TYR A N    2  
ATOM   1227  C CA   . TYR A 1 22 ? -0.613  1.325   0.260   1.00 0.00 ? 22 TYR A CA   2  
ATOM   1228  C C    . TYR A 1 22 ? -0.748  -0.161  0.597   1.00 0.00 ? 22 TYR A C    2  
ATOM   1229  O O    . TYR A 1 22 ? -1.727  -0.575  1.216   1.00 0.00 ? 22 TYR A O    2  
ATOM   1230  C CB   . TYR A 1 22 ? 0.290   1.992   1.300   1.00 0.00 ? 22 TYR A CB   2  
ATOM   1231  C CG   . TYR A 1 22 ? 0.103   1.458   2.721   1.00 0.00 ? 22 TYR A CG   2  
ATOM   1232  C CD1  . TYR A 1 22 ? 0.736   0.295   3.111   1.00 0.00 ? 22 TYR A CD1  2  
ATOM   1233  C CD2  . TYR A 1 22 ? -0.699  2.139   3.614   1.00 0.00 ? 22 TYR A CD2  2  
ATOM   1234  C CE1  . TYR A 1 22 ? 0.560   -0.207  4.448   1.00 0.00 ? 22 TYR A CE1  2  
ATOM   1235  C CE2  . TYR A 1 22 ? -0.876  1.636   4.952   1.00 0.00 ? 22 TYR A CE2  2  
ATOM   1236  C CZ   . TYR A 1 22 ? -0.237  0.488   5.303   1.00 0.00 ? 22 TYR A CZ   2  
ATOM   1237  O OH   . TYR A 1 22 ? -0.404  0.014   6.567   1.00 0.00 ? 22 TYR A OH   2  
ATOM   1238  H H    . TYR A 1 22 ? -2.344  1.933   1.247   1.00 0.00 ? 22 TYR A H    2  
ATOM   1239  H HA   . TYR A 1 22 ? -0.255  1.427   -0.764  1.00 0.00 ? 22 TYR A HA   2  
ATOM   1240  H HB2  . TYR A 1 22 ? 1.330   1.853   1.005   1.00 0.00 ? 22 TYR A HB2  2  
ATOM   1241  H HB3  . TYR A 1 22 ? 0.099   3.065   1.297   1.00 0.00 ? 22 TYR A HB3  2  
ATOM   1242  H HD1  . TYR A 1 22 ? 1.370   -0.243  2.405   1.00 0.00 ? 22 TYR A HD1  2  
ATOM   1243  H HD2  . TYR A 1 22 ? -1.199  3.057   3.306   1.00 0.00 ? 22 TYR A HD2  2  
ATOM   1244  H HE1  . TYR A 1 22 ? 1.054   -1.124  4.769   1.00 0.00 ? 22 TYR A HE1  2  
ATOM   1245  H HE2  . TYR A 1 22 ? -1.506  2.165   5.667   1.00 0.00 ? 22 TYR A HE2  2  
ATOM   1246  H HH   . TYR A 1 22 ? -1.373  0.029   6.813   1.00 0.00 ? 22 TYR A HH   2  
ATOM   1247  N N    . LYS A 1 23 ? 0.251   -0.924  0.176   1.00 0.00 ? 23 LYS A N    2  
ATOM   1248  C CA   . LYS A 1 23 ? 0.257   -2.355  0.426   1.00 0.00 ? 23 LYS A CA   2  
ATOM   1249  C C    . LYS A 1 23 ? 1.694   -2.821  0.663   1.00 0.00 ? 23 LYS A C    2  
ATOM   1250  O O    . LYS A 1 23 ? 2.570   -2.595  -0.171  1.00 0.00 ? 23 LYS A O    2  
ATOM   1251  C CB   . LYS A 1 23 ? -0.452  -3.099  -0.708  1.00 0.00 ? 23 LYS A CB   2  
ATOM   1252  C CG   . LYS A 1 23 ? 0.207   -2.800  -2.056  1.00 0.00 ? 23 LYS A CG   2  
ATOM   1253  C CD   . LYS A 1 23 ? -0.846  -2.535  -3.134  1.00 0.00 ? 23 LYS A CD   2  
ATOM   1254  C CE   . LYS A 1 23 ? -0.289  -2.830  -4.529  1.00 0.00 ? 23 LYS A CE   2  
ATOM   1255  N NZ   . LYS A 1 23 ? -1.368  -2.774  -5.540  1.00 0.00 ? 23 LYS A NZ   2  
ATOM   1256  H H    . LYS A 1 23 ? 1.044   -0.579  -0.326  1.00 0.00 ? 23 LYS A H    2  
ATOM   1257  H HA   . LYS A 1 23 ? -0.318  -2.530  1.335   1.00 0.00 ? 23 LYS A HA   2  
ATOM   1258  H HB2  . LYS A 1 23 ? -0.425  -4.172  -0.517  1.00 0.00 ? 23 LYS A HB2  2  
ATOM   1259  H HB3  . LYS A 1 23 ? -1.502  -2.807  -0.739  1.00 0.00 ? 23 LYS A HB3  2  
ATOM   1260  H HG2  . LYS A 1 23 ? 0.861   -1.933  -1.961  1.00 0.00 ? 23 LYS A HG2  2  
ATOM   1261  H HG3  . LYS A 1 23 ? 0.834   -3.641  -2.353  1.00 0.00 ? 23 LYS A HG3  2  
ATOM   1262  H HD2  . LYS A 1 23 ? -1.723  -3.156  -2.951  1.00 0.00 ? 23 LYS A HD2  2  
ATOM   1263  H HD3  . LYS A 1 23 ? -1.173  -1.497  -3.081  1.00 0.00 ? 23 LYS A HD3  2  
ATOM   1264  H HE2  . LYS A 1 23 ? 0.488   -2.107  -4.777  1.00 0.00 ? 23 LYS A HE2  2  
ATOM   1265  H HE3  . LYS A 1 23 ? 0.177   -3.815  -4.540  1.00 0.00 ? 23 LYS A HE3  2  
ATOM   1266  H HZ1  . LYS A 1 23 ? -1.303  -1.917  -6.051  1.00 0.00 ? 23 LYS A HZ1  2  
ATOM   1267  H HZ2  . LYS A 1 23 ? -1.275  -3.546  -6.170  1.00 0.00 ? 23 LYS A HZ2  2  
ATOM   1268  N N    . MET A 1 24 ? 1.893   -3.464  1.805   1.00 0.00 ? 24 MET A N    2  
ATOM   1269  C CA   . MET A 1 24 ? 3.210   -3.964  2.163   1.00 0.00 ? 24 MET A CA   2  
ATOM   1270  C C    . MET A 1 24 ? 3.293   -5.479  1.967   1.00 0.00 ? 24 MET A C    2  
ATOM   1271  O O    . MET A 1 24 ? 2.519   -6.228  2.561   1.00 0.00 ? 24 MET A O    2  
ATOM   1272  C CB   . MET A 1 24 ? 3.506   -3.620  3.624   1.00 0.00 ? 24 MET A CB   2  
ATOM   1273  C CG   . MET A 1 24 ? 3.529   -2.106  3.838   1.00 0.00 ? 24 MET A CG   2  
ATOM   1274  S SD   . MET A 1 24 ? 3.451   -1.734  5.582   1.00 0.00 ? 24 MET A SD   2  
ATOM   1275  C CE   . MET A 1 24 ? 5.182   -1.456  5.918   1.00 0.00 ? 24 MET A CE   2  
ATOM   1276  H H    . MET A 1 24 ? 1.176   -3.643  2.478   1.00 0.00 ? 24 MET A H    2  
ATOM   1277  H HA   . MET A 1 24 ? 3.906   -3.464  1.489   1.00 0.00 ? 24 MET A HA   2  
ATOM   1278  H HB2  . MET A 1 24 ? 2.751   -4.071  4.268   1.00 0.00 ? 24 MET A HB2  2  
ATOM   1279  H HB3  . MET A 1 24 ? 4.467   -4.047  3.914   1.00 0.00 ? 24 MET A HB3  2  
ATOM   1280  H HG2  . MET A 1 24 ? 4.438   -1.683  3.408   1.00 0.00 ? 24 MET A HG2  2  
ATOM   1281  H HG3  . MET A 1 24 ? 2.688   -1.644  3.321   1.00 0.00 ? 24 MET A HG3  2  
ATOM   1282  H HE1  . MET A 1 24 ? 5.529   -2.180  6.655   1.00 0.00 ? 24 MET A HE1  2  
ATOM   1283  H HE2  . MET A 1 24 ? 5.754   -1.572  4.997   1.00 0.00 ? 24 MET A HE2  2  
ATOM   1284  N N    . PHE A 1 25 ? 4.237   -5.884  1.131   1.00 0.00 ? 25 PHE A N    2  
ATOM   1285  C CA   . PHE A 1 25 ? 4.431   -7.297  0.850   1.00 0.00 ? 25 PHE A CA   2  
ATOM   1286  C C    . PHE A 1 25 ? 5.920   -7.638  0.760   1.00 0.00 ? 25 PHE A C    2  
ATOM   1287  O O    . PHE A 1 25 ? 6.727   -6.810  0.340   1.00 0.00 ? 25 PHE A O    2  
ATOM   1288  C CB   . PHE A 1 25 ? 3.773   -7.577  -0.503  1.00 0.00 ? 25 PHE A CB   2  
ATOM   1289  C CG   . PHE A 1 25 ? 4.285   -6.691  -1.640  1.00 0.00 ? 25 PHE A CG   2  
ATOM   1290  C CD1  . PHE A 1 25 ? 5.536   -6.879  -2.139  1.00 0.00 ? 25 PHE A CD1  2  
ATOM   1291  C CD2  . PHE A 1 25 ? 3.489   -5.714  -2.152  1.00 0.00 ? 25 PHE A CD2  2  
ATOM   1292  C CE1  . PHE A 1 25 ? 6.011   -6.057  -3.194  1.00 0.00 ? 25 PHE A CE1  2  
ATOM   1293  C CE2  . PHE A 1 25 ? 3.963   -4.892  -3.207  1.00 0.00 ? 25 PHE A CE2  2  
ATOM   1294  C CZ   . PHE A 1 25 ? 5.214   -5.080  -3.706  1.00 0.00 ? 25 PHE A CZ   2  
ATOM   1295  H H    . PHE A 1 25 ? 4.862   -5.268  0.652   1.00 0.00 ? 25 PHE A H    2  
ATOM   1296  H HA   . PHE A 1 25 ? 3.981   -7.855  1.670   1.00 0.00 ? 25 PHE A HA   2  
ATOM   1297  H HB2  . PHE A 1 25 ? 3.940   -8.622  -0.767  1.00 0.00 ? 25 PHE A HB2  2  
ATOM   1298  H HB3  . PHE A 1 25 ? 2.696   -7.441  -0.406  1.00 0.00 ? 25 PHE A HB3  2  
ATOM   1299  H HD1  . PHE A 1 25 ? 6.174   -7.662  -1.729  1.00 0.00 ? 25 PHE A HD1  2  
ATOM   1300  H HD2  . PHE A 1 25 ? 2.486   -5.563  -1.752  1.00 0.00 ? 25 PHE A HD2  2  
ATOM   1301  H HE1  . PHE A 1 25 ? 7.013   -6.208  -3.594  1.00 0.00 ? 25 PHE A HE1  2  
ATOM   1302  H HE2  . PHE A 1 25 ? 3.325   -4.109  -3.617  1.00 0.00 ? 25 PHE A HE2  2  
ATOM   1303  H HZ   . PHE A 1 25 ? 5.579   -4.448  -4.516  1.00 0.00 ? 25 PHE A HZ   2  
ATOM   1304  N N    . MET A 1 26 ? 6.239   -8.860  1.160   1.00 0.00 ? 26 MET A N    2  
ATOM   1305  C CA   . MET A 1 26 ? 7.617   -9.322  1.130   1.00 0.00 ? 26 MET A CA   2  
ATOM   1306  C C    . MET A 1 26 ? 7.977   -9.883  -0.247  1.00 0.00 ? 26 MET A C    2  
ATOM   1307  O O    . MET A 1 26 ? 7.131   -10.463 -0.926  1.00 0.00 ? 26 MET A O    2  
ATOM   1308  C CB   . MET A 1 26 ? 7.815   -10.406 2.191   1.00 0.00 ? 26 MET A CB   2  
ATOM   1309  C CG   . MET A 1 26 ? 7.668   -9.828  3.600   1.00 0.00 ? 26 MET A CG   2  
ATOM   1310  S SD   . MET A 1 26 ? 8.121   -11.055 4.814   1.00 0.00 ? 26 MET A SD   2  
ATOM   1311  C CE   . MET A 1 26 ? 8.804   -10.000 6.082   1.00 0.00 ? 26 MET A CE   2  
ATOM   1312  H H    . MET A 1 26 ? 5.577   -9.528  1.500   1.00 0.00 ? 26 MET A H    2  
ATOM   1313  H HA   . MET A 1 26 ? 8.225   -8.442  1.343   1.00 0.00 ? 26 MET A HA   2  
ATOM   1314  H HB2  . MET A 1 26 ? 7.086   -11.202 2.044   1.00 0.00 ? 26 MET A HB2  2  
ATOM   1315  H HB3  . MET A 1 26 ? 8.803   -10.853 2.079   1.00 0.00 ? 26 MET A HB3  2  
ATOM   1316  H HG2  . MET A 1 26 ? 8.301   -8.946  3.709   1.00 0.00 ? 26 MET A HG2  2  
ATOM   1317  H HG3  . MET A 1 26 ? 6.640   -9.504  3.764   1.00 0.00 ? 26 MET A HG3  2  
ATOM   1318  H HE1  . MET A 1 26 ? 9.427   -10.593 6.752   1.00 0.00 ? 26 MET A HE1  2  
ATOM   1319  H HE2  . MET A 1 26 ? 9.409   -9.220  5.619   1.00 0.00 ? 26 MET A HE2  2  
ATOM   1320  N N    . VAL A 1 27 ? 9.234   -9.690  -0.618  1.00 0.00 ? 27 VAL A N    2  
ATOM   1321  C CA   . VAL A 1 27 ? 9.717   -10.170 -1.902  1.00 0.00 ? 27 VAL A CA   2  
ATOM   1322  C C    . VAL A 1 27 ? 9.556   -11.690 -1.967  1.00 0.00 ? 27 VAL A C    2  
ATOM   1323  O O    . VAL A 1 27 ? 9.657   -12.283 -3.040  1.00 0.00 ? 27 VAL A O    2  
ATOM   1324  C CB   . VAL A 1 27 ? 11.160  -9.712  -2.123  1.00 0.00 ? 27 VAL A CB   2  
ATOM   1325  C CG1  . VAL A 1 27 ? 12.104  -10.366 -1.112  1.00 0.00 ? 27 VAL A CG1  2  
ATOM   1326  C CG2  . VAL A 1 27 ? 11.612  -9.994  -3.557  1.00 0.00 ? 27 VAL A CG2  2  
ATOM   1327  H H    . VAL A 1 27 ? 9.916   -9.217  -0.060  1.00 0.00 ? 27 VAL A H    2  
ATOM   1328  H HA   . VAL A 1 27 ? 9.097   -9.718  -2.676  1.00 0.00 ? 27 VAL A HA   2  
ATOM   1329  H HB   . VAL A 1 27 ? 11.197  -8.634  -1.967  1.00 0.00 ? 27 VAL A HB   2  
ATOM   1330  H HG11 . VAL A 1 27 ? 12.515  -11.281 -1.538  1.00 0.00 ? 27 VAL A HG11 2  
ATOM   1331  H HG12 . VAL A 1 27 ? 12.916  -9.679  -0.875  1.00 0.00 ? 27 VAL A HG12 2  
ATOM   1332  H HG21 . VAL A 1 27 ? 12.373  -10.774 -3.551  1.00 0.00 ? 27 VAL A HG21 2  
ATOM   1333  H HG22 . VAL A 1 27 ? 10.757  -10.324 -4.149  1.00 0.00 ? 27 VAL A HG22 2  
ATOM   1334  N N    . ALA A 1 28 ? 9.307   -12.277 -0.806  1.00 0.00 ? 28 ALA A N    2  
ATOM   1335  C CA   . ALA A 1 28 ? 9.131   -13.716 -0.718  1.00 0.00 ? 28 ALA A CA   2  
ATOM   1336  C C    . ALA A 1 28 ? 8.385   -14.212 -1.958  1.00 0.00 ? 28 ALA A C    2  
ATOM   1337  O O    . ALA A 1 28 ? 8.692   -15.279 -2.486  1.00 0.00 ? 28 ALA A O    2  
ATOM   1338  C CB   . ALA A 1 28 ? 8.398   -14.062 0.580   1.00 0.00 ? 28 ALA A CB   2  
ATOM   1339  H H    . ALA A 1 28 ? 9.226   -11.787 0.062   1.00 0.00 ? 28 ALA A H    2  
ATOM   1340  H HA   . ALA A 1 28 ? 10.121  -14.171 -0.693  1.00 0.00 ? 28 ALA A HA   2  
ATOM   1341  H HB1  . ALA A 1 28 ? 7.360   -13.736 0.509   1.00 0.00 ? 28 ALA A HB1  2  
ATOM   1342  H HB2  . ALA A 1 28 ? 8.430   -15.140 0.739   1.00 0.00 ? 28 ALA A HB2  2  
ATOM   1343  N N    . ALA A 1 29 ? 7.420   -13.412 -2.388  1.00 0.00 ? 29 ALA A N    2  
ATOM   1344  C CA   . ALA A 1 29 ? 6.628   -13.756 -3.557  1.00 0.00 ? 29 ALA A CA   2  
ATOM   1345  C C    . ALA A 1 29 ? 5.939   -12.497 -4.089  1.00 0.00 ? 29 ALA A C    2  
ATOM   1346  O O    . ALA A 1 29 ? 5.627   -11.586 -3.324  1.00 0.00 ? 29 ALA A O    2  
ATOM   1347  C CB   . ALA A 1 29 ? 5.630   -14.856 -3.192  1.00 0.00 ? 29 ALA A CB   2  
ATOM   1348  H H    . ALA A 1 29 ? 7.176   -12.545 -1.953  1.00 0.00 ? 29 ALA A H    2  
ATOM   1349  H HA   . ALA A 1 29 ? 7.308   -14.137 -4.318  1.00 0.00 ? 29 ALA A HA   2  
ATOM   1350  H HB1  . ALA A 1 29 ? 4.704   -14.404 -2.837  1.00 0.00 ? 29 ALA A HB1  2  
ATOM   1351  H HB2  . ALA A 1 29 ? 5.423   -15.466 -4.072  1.00 0.00 ? 29 ALA A HB2  2  
ATOM   1352  N N    . PRO A 1 30 ? 5.717   -12.488 -5.430  1.00 0.00 ? 30 PRO A N    2  
ATOM   1353  C CA   . PRO A 1 30 ? 5.071   -11.356 -6.074  1.00 0.00 ? 30 PRO A CA   2  
ATOM   1354  C C    . PRO A 1 30 ? 3.567   -11.349 -5.789  1.00 0.00 ? 30 PRO A C    2  
ATOM   1355  O O    . PRO A 1 30 ? 2.866   -10.410 -6.163  1.00 0.00 ? 30 PRO A O    2  
ATOM   1356  C CB   . PRO A 1 30 ? 5.395   -11.506 -7.551  1.00 0.00 ? 30 PRO A CB   2  
ATOM   1357  C CG   . PRO A 1 30 ? 5.813   -12.955 -7.742  1.00 0.00 ? 30 PRO A CG   2  
ATOM   1358  C CD   . PRO A 1 30 ? 6.073   -13.549 -6.367  1.00 0.00 ? 30 PRO A CD   2  
ATOM   1359  H HA   . PRO A 1 30 ? 5.424   -10.498 -5.702  1.00 0.00 ? 30 PRO A HA   2  
ATOM   1360  H HB2  . PRO A 1 30 ? 4.529   -11.265 -8.168  1.00 0.00 ? 30 PRO A HB2  2  
ATOM   1361  H HB3  . PRO A 1 30 ? 6.195   -10.827 -7.846  1.00 0.00 ? 30 PRO A HB3  2  
ATOM   1362  H HG2  . PRO A 1 30 ? 5.032   -13.513 -8.257  1.00 0.00 ? 30 PRO A HG2  2  
ATOM   1363  H HG3  . PRO A 1 30 ? 6.709   -13.016 -8.359  1.00 0.00 ? 30 PRO A HG3  2  
ATOM   1364  H HD2  . PRO A 1 30 ? 5.470   -14.442 -6.201  1.00 0.00 ? 30 PRO A HD2  2  
ATOM   1365  H HD3  . PRO A 1 30 ? 7.116   -13.844 -6.254  1.00 0.00 ? 30 PRO A HD3  2  
ATOM   1366  N N    . HIS A 1 31 ? 3.117   -12.406 -5.131  1.00 0.00 ? 31 HIS A N    2  
ATOM   1367  C CA   . HIS A 1 31 ? 1.710   -12.533 -4.792  1.00 0.00 ? 31 HIS A CA   2  
ATOM   1368  C C    . HIS A 1 31 ? 1.571   -13.104 -3.379  1.00 0.00 ? 31 HIS A C    2  
ATOM   1369  O O    . HIS A 1 31 ? 1.020   -14.188 -3.195  1.00 0.00 ? 31 HIS A O    2  
ATOM   1370  C CB   . HIS A 1 31 ? 0.971   -13.365 -5.843  1.00 0.00 ? 31 HIS A CB   2  
ATOM   1371  C CG   . HIS A 1 31 ? -0.490  -13.013 -5.989  1.00 0.00 ? 31 HIS A CG   2  
ATOM   1372  N ND1  . HIS A 1 31 ? -1.382  -13.795 -6.702  1.00 0.00 ? 31 HIS A ND1  2  
ATOM   1373  C CD2  . HIS A 1 31 ? -1.205  -11.957 -5.505  1.00 0.00 ? 31 HIS A CD2  2  
ATOM   1374  C CE1  . HIS A 1 31 ? -2.577  -13.225 -6.644  1.00 0.00 ? 31 HIS A CE1  2  
ATOM   1375  N NE2  . HIS A 1 31 ? -2.465  -12.086 -5.903  1.00 0.00 ? 31 HIS A NE2  2  
ATOM   1376  H H    . HIS A 1 31 ? 3.694   -13.166 -4.831  1.00 0.00 ? 31 HIS A H    2  
ATOM   1377  H HA   . HIS A 1 31 ? 1.291   -11.527 -4.811  1.00 0.00 ? 31 HIS A HA   2  
ATOM   1378  H HB2  . HIS A 1 31 ? 1.463   -13.235 -6.806  1.00 0.00 ? 31 HIS A HB2  2  
ATOM   1379  H HB3  . HIS A 1 31 ? 1.056   -14.420 -5.581  1.00 0.00 ? 31 HIS A HB3  2  
ATOM   1380  H HD1  . HIS A 1 31 ? -1.162  -14.646 -7.179  1.00 0.00 ? 31 HIS A HD1  2  
ATOM   1381  H HD2  . HIS A 1 31 ? -0.808  -11.145 -4.896  1.00 0.00 ? 31 HIS A HD2  2  
ATOM   1382  H HE1  . HIS A 1 31 ? -3.489  -13.601 -7.108  1.00 0.00 ? 31 HIS A HE1  2  
ATOM   1383  N N    . VAL A 1 32 ? 2.081   -12.349 -2.418  1.00 0.00 ? 32 VAL A N    2  
ATOM   1384  C CA   . VAL A 1 32 ? 2.022   -12.765 -1.027  1.00 0.00 ? 32 VAL A CA   2  
ATOM   1385  C C    . VAL A 1 32 ? 2.138   -11.535 -0.125  1.00 0.00 ? 32 VAL A C    2  
ATOM   1386  O O    . VAL A 1 32 ? 3.205   -11.263 0.424   1.00 0.00 ? 32 VAL A O    2  
ATOM   1387  C CB   . VAL A 1 32 ? 3.099   -13.815 -0.749  1.00 0.00 ? 32 VAL A CB   2  
ATOM   1388  C CG1  . VAL A 1 32 ? 3.342   -13.967 0.754   1.00 0.00 ? 32 VAL A CG1  2  
ATOM   1389  C CG2  . VAL A 1 32 ? 2.733   -15.158 -1.383  1.00 0.00 ? 32 VAL A CG2  2  
ATOM   1390  H H    . VAL A 1 32 ? 2.528   -11.468 -2.576  1.00 0.00 ? 32 VAL A H    2  
ATOM   1391  H HA   . VAL A 1 32 ? 1.049   -13.229 -0.865  1.00 0.00 ? 32 VAL A HA   2  
ATOM   1392  H HB   . VAL A 1 32 ? 4.028   -13.472 -1.205  1.00 0.00 ? 32 VAL A HB   2  
ATOM   1393  H HG11 . VAL A 1 32 ? 4.333   -13.585 1.002   1.00 0.00 ? 32 VAL A HG11 2  
ATOM   1394  H HG12 . VAL A 1 32 ? 2.588   -13.402 1.302   1.00 0.00 ? 32 VAL A HG12 2  
ATOM   1395  H HG21 . VAL A 1 32 ? 2.874   -15.101 -2.463  1.00 0.00 ? 32 VAL A HG21 2  
ATOM   1396  H HG22 . VAL A 1 32 ? 3.374   -15.940 -0.975  1.00 0.00 ? 32 VAL A HG22 2  
ATOM   1397  N N    . PRO A 1 33 ? 0.997   -10.806 0.003   1.00 0.00 ? 33 PRO A N    2  
ATOM   1398  C CA   . PRO A 1 33 ? 0.962   -9.611  0.829   1.00 0.00 ? 33 PRO A CA   2  
ATOM   1399  C C    . PRO A 1 33 ? 0.938   -9.973  2.315   1.00 0.00 ? 33 PRO A C    2  
ATOM   1400  O O    . PRO A 1 33 ? 0.288   -10.939 2.713   1.00 0.00 ? 33 PRO A O    2  
ATOM   1401  C CB   . PRO A 1 33 ? -0.282  -8.860  0.381   1.00 0.00 ? 33 PRO A CB   2  
ATOM   1402  C CG   . PRO A 1 33 ? -1.144  -9.879  -0.347  1.00 0.00 ? 33 PRO A CG   2  
ATOM   1403  C CD   . PRO A 1 33 ? -0.284  -11.099 -0.633  1.00 0.00 ? 33 PRO A CD   2  
ATOM   1404  H HA   . PRO A 1 33 ? 1.791   -9.070  0.692   1.00 0.00 ? 33 PRO A HA   2  
ATOM   1405  H HB2  . PRO A 1 33 ? -0.812  -8.438  1.235   1.00 0.00 ? 33 PRO A HB2  2  
ATOM   1406  H HB3  . PRO A 1 33 ? -0.021  -8.030  -0.275  1.00 0.00 ? 33 PRO A HB3  2  
ATOM   1407  H HG2  . PRO A 1 33 ? -2.006  -10.154 0.262   1.00 0.00 ? 33 PRO A HG2  2  
ATOM   1408  H HG3  . PRO A 1 33 ? -1.531  -9.458  -1.275  1.00 0.00 ? 33 PRO A HG3  2  
ATOM   1409  H HD2  . PRO A 1 33 ? -0.731  -12.004 -0.223  1.00 0.00 ? 33 PRO A HD2  2  
ATOM   1410  H HD3  . PRO A 1 33 ? -0.167  -11.258 -1.705  1.00 0.00 ? 33 PRO A HD3  2  
ATOM   1411  N N    . VAL A 1 34 ? 1.656   -9.179  3.096   1.00 0.00 ? 34 VAL A N    2  
ATOM   1412  C CA   . VAL A 1 34 ? 1.726   -9.403  4.530   1.00 0.00 ? 34 VAL A CA   2  
ATOM   1413  C C    . VAL A 1 34 ? 0.612   -8.614  5.220   1.00 0.00 ? 34 VAL A C    2  
ATOM   1414  O O    . VAL A 1 34 ? 0.024   -9.084  6.193   1.00 0.00 ? 34 VAL A O    2  
ATOM   1415  C CB   . VAL A 1 34 ? 3.120   -9.046  5.048   1.00 0.00 ? 34 VAL A CB   2  
ATOM   1416  C CG1  . VAL A 1 34 ? 3.491   -7.608  4.680   1.00 0.00 ? 34 VAL A CG1  2  
ATOM   1417  C CG2  . VAL A 1 34 ? 3.217   -9.267  6.559   1.00 0.00 ? 34 VAL A CG2  2  
ATOM   1418  H H    . VAL A 1 34 ? 2.182   -8.395  2.765   1.00 0.00 ? 34 VAL A H    2  
ATOM   1419  H HA   . VAL A 1 34 ? 1.562   -10.466 4.705   1.00 0.00 ? 34 VAL A HA   2  
ATOM   1420  H HB   . VAL A 1 34 ? 3.837   -9.711  4.566   1.00 0.00 ? 34 VAL A HB   2  
ATOM   1421  H HG11 . VAL A 1 34 ? 2.606   -6.976  4.749   1.00 0.00 ? 34 VAL A HG11 2  
ATOM   1422  H HG12 . VAL A 1 34 ? 4.254   -7.242  5.366   1.00 0.00 ? 34 VAL A HG12 2  
ATOM   1423  H HG21 . VAL A 1 34 ? 2.898   -10.281 6.799   1.00 0.00 ? 34 VAL A HG21 2  
ATOM   1424  H HG22 . VAL A 1 34 ? 4.249   -9.125  6.881   1.00 0.00 ? 34 VAL A HG22 2  
ATOM   1425  N N    . LYS A 1 35 ? 0.355   -7.427  4.690   1.00 0.00 ? 35 LYS A N    2  
ATOM   1426  C CA   . LYS A 1 35 ? -0.678  -6.568  5.243   1.00 0.00 ? 35 LYS A CA   2  
ATOM   1427  C C    . LYS A 1 35 ? -0.879  -5.362  4.323   1.00 0.00 ? 35 LYS A C    2  
ATOM   1428  O O    . LYS A 1 35 ? -0.118  -5.164  3.378   1.00 0.00 ? 35 LYS A O    2  
ATOM   1429  C CB   . LYS A 1 35 ? -0.345  -6.190  6.688   1.00 0.00 ? 35 LYS A CB   2  
ATOM   1430  C CG   . LYS A 1 35 ? 0.814   -5.192  6.740   1.00 0.00 ? 35 LYS A CG   2  
ATOM   1431  C CD   . LYS A 1 35 ? 0.392   -3.898  7.439   1.00 0.00 ? 35 LYS A CD   2  
ATOM   1432  C CE   . LYS A 1 35 ? 1.495   -3.394  8.371   1.00 0.00 ? 35 LYS A CE   2  
ATOM   1433  N NZ   . LYS A 1 35 ? 1.317   -1.952  8.652   1.00 0.00 ? 35 LYS A NZ   2  
ATOM   1434  H H    . LYS A 1 35 ? 0.838   -7.052  3.899   1.00 0.00 ? 35 LYS A H    2  
ATOM   1435  H HA   . LYS A 1 35 ? -1.604  -7.143  5.266   1.00 0.00 ? 35 LYS A HA   2  
ATOM   1436  H HB2  . LYS A 1 35 ? -1.223  -5.758  7.167   1.00 0.00 ? 35 LYS A HB2  2  
ATOM   1437  H HB3  . LYS A 1 35 ? -0.083  -7.086  7.250   1.00 0.00 ? 35 LYS A HB3  2  
ATOM   1438  H HG2  . LYS A 1 35 ? 1.658   -5.637  7.268   1.00 0.00 ? 35 LYS A HG2  2  
ATOM   1439  H HG3  . LYS A 1 35 ? 1.152   -4.969  5.728   1.00 0.00 ? 35 LYS A HG3  2  
ATOM   1440  H HD2  . LYS A 1 35 ? 0.163   -3.136  6.694   1.00 0.00 ? 35 LYS A HD2  2  
ATOM   1441  H HD3  . LYS A 1 35 ? -0.521  -4.070  8.010   1.00 0.00 ? 35 LYS A HD3  2  
ATOM   1442  H HE2  . LYS A 1 35 ? 1.477   -3.957  9.304   1.00 0.00 ? 35 LYS A HE2  2  
ATOM   1443  H HE3  . LYS A 1 35 ? 2.471   -3.564  7.915   1.00 0.00 ? 35 LYS A HE3  2  
ATOM   1444  H HZ1  . LYS A 1 35 ? 1.148   -1.464  7.796   1.00 0.00 ? 35 LYS A HZ1  2  
ATOM   1445  H HZ2  . LYS A 1 35 ? 0.539   -1.825  9.267   1.00 0.00 ? 35 LYS A HZ2  2  
ATOM   1446  N N    . ARG A 1 36 ? -1.907  -4.559  4.605   1.00 0.00 ? 36 ARG A N    2  
ATOM   1447  C CA   . ARG A 1 36 ? -2.204  -3.386  3.809   1.00 0.00 ? 36 ARG A CA   2  
ATOM   1448  C C    . ARG A 1 36 ? -2.955  -2.366  4.653   1.00 0.00 ? 36 ARG A C    2  
ATOM   1449  O O    . ARG A 1 36 ? -3.415  -2.682  5.747   1.00 0.00 ? 36 ARG A O    2  
ATOM   1450  C CB   . ARG A 1 36 ? -3.030  -3.793  2.592   1.00 0.00 ? 36 ARG A CB   2  
ATOM   1451  C CG   . ARG A 1 36 ? -2.216  -4.745  1.720   1.00 0.00 ? 36 ARG A CG   2  
ATOM   1452  C CD   . ARG A 1 36 ? -3.048  -5.167  0.513   1.00 0.00 ? 36 ARG A CD   2  
ATOM   1453  N NE   . ARG A 1 36 ? -4.011  -6.207  0.876   1.00 0.00 ? 36 ARG A NE   2  
ATOM   1454  C CZ   . ARG A 1 36 ? -4.531  -7.059  -0.017  1.00 0.00 ? 36 ARG A CZ   2  
ATOM   1455  N NH1  . ARG A 1 36 ? -4.171  -6.981  -1.306  1.00 0.00 ? 36 ARG A NH1  2  
ATOM   1456  N NH2  . ARG A 1 36 ? -5.411  -7.990  0.377   1.00 0.00 ? 36 ARG A NH2  2  
ATOM   1457  H H    . ARG A 1 36 ? -2.503  -4.767  5.394   1.00 0.00 ? 36 ARG A H    2  
ATOM   1458  H HA   . ARG A 1 36 ? -1.268  -2.943  3.468   1.00 0.00 ? 36 ARG A HA   2  
ATOM   1459  H HB2  . ARG A 1 36 ? -3.941  -4.292  2.922   1.00 0.00 ? 36 ARG A HB2  2  
ATOM   1460  H HB3  . ARG A 1 36 ? -3.290  -2.905  2.016   1.00 0.00 ? 36 ARG A HB3  2  
ATOM   1461  H HG2  . ARG A 1 36 ? -1.311  -4.241  1.379   1.00 0.00 ? 36 ARG A HG2  2  
ATOM   1462  H HG3  . ARG A 1 36 ? -1.944  -5.627  2.300   1.00 0.00 ? 36 ARG A HG3  2  
ATOM   1463  H HD2  . ARG A 1 36 ? -3.586  -4.300  0.129   1.00 0.00 ? 36 ARG A HD2  2  
ATOM   1464  H HD3  . ARG A 1 36 ? -2.385  -5.550  -0.263  1.00 0.00 ? 36 ARG A HD3  2  
ATOM   1465  H HE   . ARG A 1 36 ? -4.289  -6.274  1.845   1.00 0.00 ? 36 ARG A HE   2  
ATOM   1466  H HH11 . ARG A 1 36 ? -3.508  -6.280  -1.603  1.00 0.00 ? 36 ARG A HH11 2  
ATOM   1467  H HH12 . ARG A 1 36 ? -4.563  -7.624  -1.979  1.00 0.00 ? 36 ARG A HH12 2  
ATOM   1468  H HH21 . ARG A 1 36 ? -5.682  -8.049  1.348   1.00 0.00 ? 36 ARG A HH21 2  
ATOM   1469  H HH22 . ARG A 1 36 ? -5.802  -8.632  -0.297  1.00 0.00 ? 36 ARG A HH22 2  
ATOM   1470  N N    . GLY A 1 37 ? -3.057  -1.159  4.114   1.00 0.00 ? 37 GLY A N    2  
ATOM   1471  C CA   . GLY A 1 37 ? -3.749  -0.087  4.809   1.00 0.00 ? 37 GLY A CA   2  
ATOM   1472  C C    . GLY A 1 37 ? -3.675  1.219   4.015   1.00 0.00 ? 37 GLY A C    2  
ATOM   1473  O O    . GLY A 1 37 ? -3.224  1.229   2.870   1.00 0.00 ? 37 GLY A O    2  
ATOM   1474  H H    . GLY A 1 37 ? -2.679  -0.910  3.222   1.00 0.00 ? 37 GLY A H    2  
ATOM   1475  H HA2  . GLY A 1 37 ? -4.792  -0.363  4.965   1.00 0.00 ? 37 GLY A HA2  2  
ATOM   1476  H HA3  . GLY A 1 37 ? -3.306  0.058   5.795   1.00 0.00 ? 37 GLY A HA3  2  
ATOM   1477  N N    . CYS A 1 38 ? -4.125  2.289   4.653   1.00 0.00 ? 38 CYS A N    2  
ATOM   1478  C CA   . CYS A 1 38 ? -4.115  3.597   4.021   1.00 0.00 ? 38 CYS A CA   2  
ATOM   1479  C C    . CYS A 1 38 ? -2.984  4.422   4.639   1.00 0.00 ? 38 CYS A C    2  
ATOM   1480  O O    . CYS A 1 38 ? -2.564  4.159   5.765   1.00 0.00 ? 38 CYS A O    2  
ATOM   1481  C CB   . CYS A 1 38 ? -5.469  4.298   4.150   1.00 0.00 ? 38 CYS A CB   2  
ATOM   1482  S SG   . CYS A 1 38 ? -6.831  3.514   3.212   1.00 0.00 ? 38 CYS A SG   2  
ATOM   1483  H H    . CYS A 1 38 ? -4.490  2.273   5.584   1.00 0.00 ? 38 CYS A H    2  
ATOM   1484  H HA   . CYS A 1 38 ? -3.936  3.430   2.959   1.00 0.00 ? 38 CYS A HA   2  
ATOM   1485  H HB2  . CYS A 1 38 ? -5.745  4.333   5.203   1.00 0.00 ? 38 CYS A HB2  2  
ATOM   1486  H HB3  . CYS A 1 38 ? -5.362  5.329   3.814   1.00 0.00 ? 38 CYS A HB3  2  
ATOM   1487  N N    . ILE A 1 39 ? -2.524  5.402   3.876   1.00 0.00 ? 39 ILE A N    2  
ATOM   1488  C CA   . ILE A 1 39 ? -1.451  6.267   4.336   1.00 0.00 ? 39 ILE A CA   2  
ATOM   1489  C C    . ILE A 1 39 ? -1.452  7.556   3.511   1.00 0.00 ? 39 ILE A C    2  
ATOM   1490  O O    . ILE A 1 39 ? -2.301  7.739   2.640   1.00 0.00 ? 39 ILE A O    2  
ATOM   1491  C CB   . ILE A 1 39 ? -0.115  5.522   4.311   1.00 0.00 ? 39 ILE A CB   2  
ATOM   1492  C CG1  . ILE A 1 39 ? 0.780   5.961   5.471   1.00 0.00 ? 39 ILE A CG1  2  
ATOM   1493  C CG2  . ILE A 1 39 ? 0.580   5.687   2.957   1.00 0.00 ? 39 ILE A CG2  2  
ATOM   1494  C CD1  . ILE A 1 39 ? 0.871   4.868   6.538   1.00 0.00 ? 39 ILE A CD1  2  
ATOM   1495  H H    . ILE A 1 39 ? -2.872  5.609   2.962   1.00 0.00 ? 39 ILE A H    2  
ATOM   1496  H HA   . ILE A 1 39 ? -1.658  6.522   5.375   1.00 0.00 ? 39 ILE A HA   2  
ATOM   1497  H HB   . ILE A 1 39 ? -0.314  4.459   4.442   1.00 0.00 ? 39 ILE A HB   2  
ATOM   1498  H HG12 . ILE A 1 39 ? 1.777   6.195   5.098   1.00 0.00 ? 39 ILE A HG12 2  
ATOM   1499  H HG13 . ILE A 1 39 ? 0.384   6.875   5.915   1.00 0.00 ? 39 ILE A HG13 2  
ATOM   1500  H HG21 . ILE A 1 39 ? 1.573   5.240   3.002   1.00 0.00 ? 39 ILE A HG21 2  
ATOM   1501  H HG22 . ILE A 1 39 ? -0.007  5.190   2.185   1.00 0.00 ? 39 ILE A HG22 2  
ATOM   1502  H HD11 . ILE A 1 39 ? -0.001  4.219   6.468   1.00 0.00 ? 39 ILE A HD11 2  
ATOM   1503  H HD12 . ILE A 1 39 ? 1.776   4.280   6.379   1.00 0.00 ? 39 ILE A HD12 2  
ATOM   1504  N N    . ASP A 1 40 ? -0.496  8.445   3.790   1.00 0.00 ? 40 ASP A N    2  
ATOM   1505  C CA   . ASP A 1 40 ? -0.392  9.704   3.080   1.00 0.00 ? 40 ASP A CA   2  
ATOM   1506  C C    . ASP A 1 40 ? 0.819   9.676   2.158   1.00 0.00 ? 40 ASP A C    2  
ATOM   1507  O O    . ASP A 1 40 ? 0.717   10.031  0.986   1.00 0.00 ? 40 ASP A O    2  
ATOM   1508  C CB   . ASP A 1 40 ? -0.281  10.846  4.085   1.00 0.00 ? 40 ASP A CB   2  
ATOM   1509  C CG   . ASP A 1 40 ? 0.625   10.462  5.246   1.00 0.00 ? 40 ASP A CG   2  
ATOM   1510  O OD1  . ASP A 1 40 ? 0.071   10.026  6.278   1.00 0.00 ? 40 ASP A OD1  2  
ATOM   1511  O OD2  . ASP A 1 40 ? 1.855   10.613  5.080   1.00 0.00 ? 40 ASP A OD2  2  
ATOM   1512  H H    . ASP A 1 40 ? 0.178   8.246   4.515   1.00 0.00 ? 40 ASP A H    2  
ATOM   1513  H HA   . ASP A 1 40 ? -1.290  9.847   2.479   1.00 0.00 ? 40 ASP A HA   2  
ATOM   1514  H HB2  . ASP A 1 40 ? 0.130   11.724  3.586   1.00 0.00 ? 40 ASP A HB2  2  
ATOM   1515  H HB3  . ASP A 1 40 ? -1.273  11.083  4.469   1.00 0.00 ? 40 ASP A HB3  2  
ATOM   1516  H HD2  . ASP A 1 40 ? 2.372   10.354  5.847   1.00 0.00 ? 40 ASP A HD2  2  
ATOM   1517  N N    . VAL A 1 41 ? 1.942   9.251   2.720   1.00 0.00 ? 41 VAL A N    2  
ATOM   1518  C CA   . VAL A 1 41 ? 3.176   9.173   1.958   1.00 0.00 ? 41 VAL A CA   2  
ATOM   1519  C C    . VAL A 1 41 ? 3.632   7.714   1.881   1.00 0.00 ? 41 VAL A C    2  
ATOM   1520  O O    . VAL A 1 41 ? 3.361   6.927   2.787   1.00 0.00 ? 41 VAL A O    2  
ATOM   1521  C CB   . VAL A 1 41 ? 4.230   10.097  2.571   1.00 0.00 ? 41 VAL A CB   2  
ATOM   1522  C CG1  . VAL A 1 41 ? 3.755   11.552  2.561   1.00 0.00 ? 41 VAL A CG1  2  
ATOM   1523  C CG2  . VAL A 1 41 ? 4.594   9.649   3.988   1.00 0.00 ? 41 VAL A CG2  2  
ATOM   1524  H H    . VAL A 1 41 ? 2.016   8.964   3.675   1.00 0.00 ? 41 VAL A H    2  
ATOM   1525  H HA   . VAL A 1 41 ? 2.963   9.527   0.949   1.00 0.00 ? 41 VAL A HA   2  
ATOM   1526  H HB   . VAL A 1 41 ? 5.129   10.034  1.958   1.00 0.00 ? 41 VAL A HB   2  
ATOM   1527  H HG11 . VAL A 1 41 ? 3.050   11.709  3.377   1.00 0.00 ? 41 VAL A HG11 2  
ATOM   1528  H HG12 . VAL A 1 41 ? 4.612   12.214  2.689   1.00 0.00 ? 41 VAL A HG12 2  
ATOM   1529  H HG21 . VAL A 1 41 ? 5.173   8.726   3.940   1.00 0.00 ? 41 VAL A HG21 2  
ATOM   1530  H HG22 . VAL A 1 41 ? 5.188   10.424  4.473   1.00 0.00 ? 41 VAL A HG22 2  
ATOM   1531  N N    . CYS A 1 42 ? 4.317   7.398   0.792   1.00 0.00 ? 42 CYS A N    2  
ATOM   1532  C CA   . CYS A 1 42 ? 4.813   6.048   0.586   1.00 0.00 ? 42 CYS A CA   2  
ATOM   1533  C C    . CYS A 1 42 ? 6.256   5.984   1.091   1.00 0.00 ? 42 CYS A C    2  
ATOM   1534  O O    . CYS A 1 42 ? 7.062   6.863   0.791   1.00 0.00 ? 42 CYS A O    2  
ATOM   1535  C CB   . CYS A 1 42 ? 4.702   5.622   -0.879  1.00 0.00 ? 42 CYS A CB   2  
ATOM   1536  S SG   . CYS A 1 42 ? 4.175   3.889   -1.137  1.00 0.00 ? 42 CYS A SG   2  
ATOM   1537  H H    . CYS A 1 42 ? 4.533   8.044   0.060   1.00 0.00 ? 42 CYS A H    2  
ATOM   1538  H HA   . CYS A 1 42 ? 4.170   5.386   1.166   1.00 0.00 ? 42 CYS A HA   2  
ATOM   1539  H HB2  . CYS A 1 42 ? 3.994   6.281   -1.382  1.00 0.00 ? 42 CYS A HB2  2  
ATOM   1540  H HB3  . CYS A 1 42 ? 5.670   5.768   -1.360  1.00 0.00 ? 42 CYS A HB3  2  
ATOM   1541  N N    . PRO A 1 43 ? 6.545   4.907   1.870   1.00 0.00 ? 43 PRO A N    2  
ATOM   1542  C CA   . PRO A 1 43 ? 7.876   4.717   2.420   1.00 0.00 ? 43 PRO A CA   2  
ATOM   1543  C C    . PRO A 1 43 ? 8.852   4.242   1.341   1.00 0.00 ? 43 PRO A C    2  
ATOM   1544  O O    . PRO A 1 43 ? 8.435   3.758   0.290   1.00 0.00 ? 43 PRO A O    2  
ATOM   1545  C CB   . PRO A 1 43 ? 7.698   3.709   3.543   1.00 0.00 ? 43 PRO A CB   2  
ATOM   1546  C CG   . PRO A 1 43 ? 6.366   3.025   3.282   1.00 0.00 ? 43 PRO A CG   2  
ATOM   1547  C CD   . PRO A 1 43 ? 5.615   3.846   2.246   1.00 0.00 ? 43 PRO A CD   2  
ATOM   1548  H HA   . PRO A 1 43 ? 8.241   5.585   2.755   1.00 0.00 ? 43 PRO A HA   2  
ATOM   1549  H HB2  . PRO A 1 43 ? 8.513   2.986   3.553   1.00 0.00 ? 43 PRO A HB2  2  
ATOM   1550  H HB3  . PRO A 1 43 ? 7.699   4.203   4.515   1.00 0.00 ? 43 PRO A HB3  2  
ATOM   1551  H HG2  . PRO A 1 43 ? 6.523   2.008   2.922   1.00 0.00 ? 43 PRO A HG2  2  
ATOM   1552  H HG3  . PRO A 1 43 ? 5.787   2.951   4.203   1.00 0.00 ? 43 PRO A HG3  2  
ATOM   1553  H HD2  . PRO A 1 43 ? 5.338   3.238   1.384   1.00 0.00 ? 43 PRO A HD2  2  
ATOM   1554  H HD3  . PRO A 1 43 ? 4.693   4.255   2.658   1.00 0.00 ? 43 PRO A HD3  2  
ATOM   1555  N N    . LYS A 1 44 ? 10.134  4.398   1.638   1.00 0.00 ? 44 LYS A N    2  
ATOM   1556  C CA   . LYS A 1 44 ? 11.173  3.992   0.707   1.00 0.00 ? 44 LYS A CA   2  
ATOM   1557  C C    . LYS A 1 44 ? 11.123  2.473   0.524   1.00 0.00 ? 44 LYS A C    2  
ATOM   1558  O O    . LYS A 1 44 ? 10.877  1.738   1.479   1.00 0.00 ? 44 LYS A O    2  
ATOM   1559  C CB   . LYS A 1 44 ? 12.537  4.511   1.166   1.00 0.00 ? 44 LYS A CB   2  
ATOM   1560  C CG   . LYS A 1 44 ? 13.656  3.981   0.267   1.00 0.00 ? 44 LYS A CG   2  
ATOM   1561  C CD   . LYS A 1 44 ? 14.879  4.900   0.314   1.00 0.00 ? 44 LYS A CD   2  
ATOM   1562  C CE   . LYS A 1 44 ? 15.475  5.090   -1.082  1.00 0.00 ? 44 LYS A CE   2  
ATOM   1563  N NZ   . LYS A 1 44 ? 16.826  5.688   -0.991  1.00 0.00 ? 44 LYS A NZ   2  
ATOM   1564  H H    . LYS A 1 44 ? 10.466  4.793   2.495   1.00 0.00 ? 44 LYS A H    2  
ATOM   1565  H HA   . LYS A 1 44 ? 10.955  4.462   -0.252  1.00 0.00 ? 44 LYS A HA   2  
ATOM   1566  H HB2  . LYS A 1 44 ? 12.539  5.601   1.151   1.00 0.00 ? 44 LYS A HB2  2  
ATOM   1567  H HB3  . LYS A 1 44 ? 12.718  4.207   2.196   1.00 0.00 ? 44 LYS A HB3  2  
ATOM   1568  H HG2  . LYS A 1 44 ? 13.939  2.978   0.585   1.00 0.00 ? 44 LYS A HG2  2  
ATOM   1569  H HG3  . LYS A 1 44 ? 13.296  3.901   -0.759  1.00 0.00 ? 44 LYS A HG3  2  
ATOM   1570  H HD2  . LYS A 1 44 ? 14.595  5.868   0.727   1.00 0.00 ? 44 LYS A HD2  2  
ATOM   1571  H HD3  . LYS A 1 44 ? 15.630  4.477   0.980   1.00 0.00 ? 44 LYS A HD3  2  
ATOM   1572  H HE2  . LYS A 1 44 ? 15.530  4.130   -1.595  1.00 0.00 ? 44 LYS A HE2  2  
ATOM   1573  H HE3  . LYS A 1 44 ? 14.826  5.733   -1.677  1.00 0.00 ? 44 LYS A HE3  2  
ATOM   1574  H HZ1  . LYS A 1 44 ? 17.350  5.455   -1.811  1.00 0.00 ? 44 LYS A HZ1  2  
ATOM   1575  H HZ2  . LYS A 1 44 ? 16.747  6.682   -0.918  1.00 0.00 ? 44 LYS A HZ2  2  
ATOM   1576  N N    . SER A 1 45 ? 11.360  2.049   -0.708  1.00 0.00 ? 45 SER A N    2  
ATOM   1577  C CA   . SER A 1 45 ? 11.345  0.632   -1.028  1.00 0.00 ? 45 SER A CA   2  
ATOM   1578  C C    . SER A 1 45 ? 12.730  0.027   -0.790  1.00 0.00 ? 45 SER A C    2  
ATOM   1579  O O    . SER A 1 45 ? 13.745  0.689   -1.002  1.00 0.00 ? 45 SER A O    2  
ATOM   1580  C CB   . SER A 1 45 ? 10.905  0.398   -2.475  1.00 0.00 ? 45 SER A CB   2  
ATOM   1581  O OG   . SER A 1 45 ? 9.532   0.026   -2.562  1.00 0.00 ? 45 SER A OG   2  
ATOM   1582  H H    . SER A 1 45 ? 11.559  2.654   -1.479  1.00 0.00 ? 45 SER A H    2  
ATOM   1583  H HA   . SER A 1 45 ? 10.613  0.191   -0.351  1.00 0.00 ? 45 SER A HA   2  
ATOM   1584  H HB2  . SER A 1 45 ? 11.072  1.306   -3.055  1.00 0.00 ? 45 SER A HB2  2  
ATOM   1585  H HB3  . SER A 1 45 ? 11.522  -0.382  -2.920  1.00 0.00 ? 45 SER A HB3  2  
ATOM   1586  H HG   . SER A 1 45 ? 8.980   0.613   -1.970  1.00 0.00 ? 45 SER A HG   2  
ATOM   1587  N N    . SER A 1 46 ? 12.727  -1.224  -0.353  1.00 0.00 ? 46 SER A N    2  
ATOM   1588  C CA   . SER A 1 46 ? 13.971  -1.925  -0.084  1.00 0.00 ? 46 SER A CA   2  
ATOM   1589  C C    . SER A 1 46 ? 14.020  -3.229  -0.882  1.00 0.00 ? 46 SER A C    2  
ATOM   1590  O O    . SER A 1 46 ? 13.048  -3.593  -1.543  1.00 0.00 ? 46 SER A O    2  
ATOM   1591  C CB   . SER A 1 46 ? 14.130  -2.211  1.411   1.00 0.00 ? 46 SER A CB   2  
ATOM   1592  O OG   . SER A 1 46 ? 13.205  -3.195  1.867   1.00 0.00 ? 46 SER A OG   2  
ATOM   1593  H H    . SER A 1 46 ? 11.897  -1.755  -0.183  1.00 0.00 ? 46 SER A H    2  
ATOM   1594  H HA   . SER A 1 46 ? 14.761  -1.248  -0.409  1.00 0.00 ? 46 SER A HA   2  
ATOM   1595  H HB2  . SER A 1 46 ? 15.147  -2.550  1.609   1.00 0.00 ? 46 SER A HB2  2  
ATOM   1596  H HB3  . SER A 1 46 ? 13.986  -1.289  1.974   1.00 0.00 ? 46 SER A HB3  2  
ATOM   1597  H HG   . SER A 1 46 ? 12.647  -3.520  1.103   1.00 0.00 ? 46 SER A HG   2  
ATOM   1598  N N    . LEU A 1 47 ? 15.160  -3.897  -0.795  1.00 0.00 ? 47 LEU A N    2  
ATOM   1599  C CA   . LEU A 1 47 ? 15.348  -5.153  -1.501  1.00 0.00 ? 47 LEU A CA   2  
ATOM   1600  C C    . LEU A 1 47 ? 14.542  -6.251  -0.804  1.00 0.00 ? 47 LEU A C    2  
ATOM   1601  O O    . LEU A 1 47 ? 13.717  -6.914  -1.432  1.00 0.00 ? 47 LEU A O    2  
ATOM   1602  C CB   . LEU A 1 47 ? 16.838  -5.475  -1.634  1.00 0.00 ? 47 LEU A CB   2  
ATOM   1603  C CG   . LEU A 1 47 ? 17.571  -4.791  -2.790  1.00 0.00 ? 47 LEU A CG   2  
ATOM   1604  C CD1  . LEU A 1 47 ? 19.085  -4.979  -2.665  1.00 0.00 ? 47 LEU A CD1  2  
ATOM   1605  C CD2  . LEU A 1 47 ? 17.042  -5.279  -4.140  1.00 0.00 ? 47 LEU A CD2  2  
ATOM   1606  H H    . LEU A 1 47 ? 15.946  -3.594  -0.255  1.00 0.00 ? 47 LEU A H    2  
ATOM   1607  H HA   . LEU A 1 47 ? 14.955  -5.023  -2.509  1.00 0.00 ? 47 LEU A HA   2  
ATOM   1608  H HB2  . LEU A 1 47 ? 17.333  -5.202  -0.702  1.00 0.00 ? 47 LEU A HB2  2  
ATOM   1609  H HB3  . LEU A 1 47 ? 16.947  -6.554  -1.748  1.00 0.00 ? 47 LEU A HB3  2  
ATOM   1610  H HG   . LEU A 1 47 ? 17.374  -3.721  -2.734  1.00 0.00 ? 47 LEU A HG   2  
ATOM   1611  H HD11 . LEU A 1 47 ? 19.453  -5.543  -3.522  1.00 0.00 ? 47 LEU A HD11 2  
ATOM   1612  H HD12 . LEU A 1 47 ? 19.571  -4.003  -2.637  1.00 0.00 ? 47 LEU A HD12 2  
ATOM   1613  H HD21 . LEU A 1 47 ? 17.754  -5.979  -4.577  1.00 0.00 ? 47 LEU A HD21 2  
ATOM   1614  H HD22 . LEU A 1 47 ? 16.084  -5.777  -3.996  1.00 0.00 ? 47 LEU A HD22 2  
ATOM   1615  N N    . LEU A 1 48 ? 14.807  -6.408  0.484   1.00 0.00 ? 48 LEU A N    2  
ATOM   1616  C CA   . LEU A 1 48 ? 14.116  -7.414  1.273   1.00 0.00 ? 48 LEU A CA   2  
ATOM   1617  C C    . LEU A 1 48 ? 12.607  -7.270  1.067   1.00 0.00 ? 48 LEU A C    2  
ATOM   1618  O O    . LEU A 1 48 ? 11.963  -8.166  0.524   1.00 0.00 ? 48 LEU A O    2  
ATOM   1619  C CB   . LEU A 1 48 ? 14.547  -7.334  2.739   1.00 0.00 ? 48 LEU A CB   2  
ATOM   1620  C CG   . LEU A 1 48 ? 14.397  -8.621  3.554   1.00 0.00 ? 48 LEU A CG   2  
ATOM   1621  C CD1  . LEU A 1 48 ? 15.720  -9.387  3.616   1.00 0.00 ? 48 LEU A CD1  2  
ATOM   1622  C CD2  . LEU A 1 48 ? 13.840  -8.326  4.948   1.00 0.00 ? 48 LEU A CD2  2  
ATOM   1623  H H    . LEU A 1 48 ? 15.479  -5.865  0.987   1.00 0.00 ? 48 LEU A H    2  
ATOM   1624  H HA   . LEU A 1 48 ? 14.424  -8.391  0.900   1.00 0.00 ? 48 LEU A HA   2  
ATOM   1625  H HB2  . LEU A 1 48 ? 15.591  -7.025  2.774   1.00 0.00 ? 48 LEU A HB2  2  
ATOM   1626  H HB3  . LEU A 1 48 ? 13.966  -6.550  3.226   1.00 0.00 ? 48 LEU A HB3  2  
ATOM   1627  H HG   . LEU A 1 48 ? 13.677  -9.263  3.048   1.00 0.00 ? 48 LEU A HG   2  
ATOM   1628  H HD11 . LEU A 1 48 ? 15.562  -10.412 3.280   1.00 0.00 ? 48 LEU A HD11 2  
ATOM   1629  H HD12 . LEU A 1 48 ? 16.452  -8.902  2.969   1.00 0.00 ? 48 LEU A HD12 2  
ATOM   1630  H HD21 . LEU A 1 48 ? 12.771  -8.535  4.963   1.00 0.00 ? 48 LEU A HD21 2  
ATOM   1631  H HD22 . LEU A 1 48 ? 14.344  -8.955  5.681   1.00 0.00 ? 48 LEU A HD22 2  
ATOM   1632  N N    . VAL A 1 49 ? 12.087  -6.135  1.512   1.00 0.00 ? 49 VAL A N    2  
ATOM   1633  C CA   . VAL A 1 49 ? 10.666  -5.862  1.382   1.00 0.00 ? 49 VAL A CA   2  
ATOM   1634  C C    . VAL A 1 49 ? 10.463  -4.667  0.448   1.00 0.00 ? 49 VAL A C    2  
ATOM   1635  O O    . VAL A 1 49 ? 11.390  -3.892  0.217   1.00 0.00 ? 49 VAL A O    2  
ATOM   1636  C CB   . VAL A 1 49 ? 10.046  -5.652  2.765   1.00 0.00 ? 49 VAL A CB   2  
ATOM   1637  C CG1  . VAL A 1 49 ? 8.549   -5.351  2.655   1.00 0.00 ? 49 VAL A CG1  2  
ATOM   1638  C CG2  . VAL A 1 49 ? 10.297  -6.861  3.669   1.00 0.00 ? 49 VAL A CG2  2  
ATOM   1639  H H    . VAL A 1 49 ? 12.618  -5.412  1.952   1.00 0.00 ? 49 VAL A H    2  
ATOM   1640  H HA   . VAL A 1 49 ? 10.202  -6.741  0.934   1.00 0.00 ? 49 VAL A HA   2  
ATOM   1641  H HB   . VAL A 1 49 ? 10.528  -4.787  3.221   1.00 0.00 ? 49 VAL A HB   2  
ATOM   1642  H HG11 . VAL A 1 49 ? 8.108   -5.333  3.652   1.00 0.00 ? 49 VAL A HG11 2  
ATOM   1643  H HG12 . VAL A 1 49 ? 8.408   -4.382  2.177   1.00 0.00 ? 49 VAL A HG12 2  
ATOM   1644  H HG21 . VAL A 1 49 ? 9.567   -6.868  4.478   1.00 0.00 ? 49 VAL A HG21 2  
ATOM   1645  H HG22 . VAL A 1 49 ? 10.202  -7.776  3.085   1.00 0.00 ? 49 VAL A HG22 2  
ATOM   1646  N N    . LYS A 1 50 ? 9.246   -4.556  -0.063  1.00 0.00 ? 50 LYS A N    2  
ATOM   1647  C CA   . LYS A 1 50 ? 8.910   -3.469  -0.966  1.00 0.00 ? 50 LYS A CA   2  
ATOM   1648  C C    . LYS A 1 50 ? 7.477   -3.008  -0.692  1.00 0.00 ? 50 LYS A C    2  
ATOM   1649  O O    . LYS A 1 50 ? 6.662   -3.773  -0.179  1.00 0.00 ? 50 LYS A O    2  
ATOM   1650  C CB   . LYS A 1 50 ? 9.155   -3.884  -2.419  1.00 0.00 ? 50 LYS A CB   2  
ATOM   1651  C CG   . LYS A 1 50 ? 10.257  -3.034  -3.053  1.00 0.00 ? 50 LYS A CG   2  
ATOM   1652  C CD   . LYS A 1 50 ? 10.008  -2.842  -4.551  1.00 0.00 ? 50 LYS A CD   2  
ATOM   1653  C CE   . LYS A 1 50 ? 11.009  -3.647  -5.381  1.00 0.00 ? 50 LYS A CE   2  
ATOM   1654  N NZ   . LYS A 1 50 ? 10.314  -4.702  -6.152  1.00 0.00 ? 50 LYS A NZ   2  
ATOM   1655  H H    . LYS A 1 50 ? 8.498   -5.191  0.131   1.00 0.00 ? 50 LYS A H    2  
ATOM   1656  H HA   . LYS A 1 50 ? 9.587   -2.643  -0.749  1.00 0.00 ? 50 LYS A HA   2  
ATOM   1657  H HB2  . LYS A 1 50 ? 9.434   -4.937  -2.458  1.00 0.00 ? 50 LYS A HB2  2  
ATOM   1658  H HB3  . LYS A 1 50 ? 8.233   -3.778  -2.991  1.00 0.00 ? 50 LYS A HB3  2  
ATOM   1659  H HG2  . LYS A 1 50 ? 10.301  -2.063  -2.561  1.00 0.00 ? 50 LYS A HG2  2  
ATOM   1660  H HG3  . LYS A 1 50 ? 11.224  -3.513  -2.901  1.00 0.00 ? 50 LYS A HG3  2  
ATOM   1661  H HD2  . LYS A 1 50 ? 8.993   -3.154  -4.797  1.00 0.00 ? 50 LYS A HD2  2  
ATOM   1662  H HD3  . LYS A 1 50 ? 10.087  -1.785  -4.804  1.00 0.00 ? 50 LYS A HD3  2  
ATOM   1663  H HE2  . LYS A 1 50 ? 11.543  -2.984  -6.061  1.00 0.00 ? 50 LYS A HE2  2  
ATOM   1664  H HE3  . LYS A 1 50 ? 11.754  -4.099  -4.726  1.00 0.00 ? 50 LYS A HE3  2  
ATOM   1665  H HZ1  . LYS A 1 50 ? 10.899  -5.511  -6.212  1.00 0.00 ? 50 LYS A HZ1  2  
ATOM   1666  H HZ2  . LYS A 1 50 ? 9.459   -4.943  -5.692  1.00 0.00 ? 50 LYS A HZ2  2  
ATOM   1667  N N    . TYR A 1 51 ? 7.214   -1.758  -1.045  1.00 0.00 ? 51 TYR A N    2  
ATOM   1668  C CA   . TYR A 1 51 ? 5.894   -1.186  -0.844  1.00 0.00 ? 51 TYR A CA   2  
ATOM   1669  C C    . TYR A 1 51 ? 5.419   -0.448  -2.097  1.00 0.00 ? 51 TYR A C    2  
ATOM   1670  O O    . TYR A 1 51 ? 6.229   0.096   -2.846  1.00 0.00 ? 51 TYR A O    2  
ATOM   1671  C CB   . TYR A 1 51 ? 6.040   -0.181  0.301   1.00 0.00 ? 51 TYR A CB   2  
ATOM   1672  C CG   . TYR A 1 51 ? 6.961   -0.653  1.429   1.00 0.00 ? 51 TYR A CG   2  
ATOM   1673  C CD1  . TYR A 1 51 ? 6.751   -1.881  2.023   1.00 0.00 ? 51 TYR A CD1  2  
ATOM   1674  C CD2  . TYR A 1 51 ? 8.000   0.150   1.852   1.00 0.00 ? 51 TYR A CD2  2  
ATOM   1675  C CE1  . TYR A 1 51 ? 7.617   -2.324  3.084   1.00 0.00 ? 51 TYR A CE1  2  
ATOM   1676  C CE2  . TYR A 1 51 ? 8.866   -0.293  2.914   1.00 0.00 ? 51 TYR A CE2  2  
ATOM   1677  C CZ   . TYR A 1 51 ? 8.632   -1.509  3.477   1.00 0.00 ? 51 TYR A CZ   2  
ATOM   1678  O OH   . TYR A 1 51 ? 9.450   -1.927  4.480   1.00 0.00 ? 51 TYR A OH   2  
ATOM   1679  H H    . TYR A 1 51 ? 7.883   -1.142  -1.462  1.00 0.00 ? 51 TYR A H    2  
ATOM   1680  H HA   . TYR A 1 51 ? 5.203   -2.001  -0.627  1.00 0.00 ? 51 TYR A HA   2  
ATOM   1681  H HB2  . TYR A 1 51 ? 6.425   0.757   -0.100  1.00 0.00 ? 51 TYR A HB2  2  
ATOM   1682  H HB3  . TYR A 1 51 ? 5.054   0.029   0.715   1.00 0.00 ? 51 TYR A HB3  2  
ATOM   1683  H HD1  . TYR A 1 51 ? 5.930   -2.515  1.688   1.00 0.00 ? 51 TYR A HD1  2  
ATOM   1684  H HD2  . TYR A 1 51 ? 8.166   1.120   1.383   1.00 0.00 ? 51 TYR A HD2  2  
ATOM   1685  H HE1  . TYR A 1 51 ? 7.463   -3.292  3.562   1.00 0.00 ? 51 TYR A HE1  2  
ATOM   1686  H HE2  . TYR A 1 51 ? 9.691   0.331   3.258   1.00 0.00 ? 51 TYR A HE2  2  
ATOM   1687  H HH   . TYR A 1 51 ? 8.964   -1.896  5.353   1.00 0.00 ? 51 TYR A HH   2  
ATOM   1688  N N    . VAL A 1 52 ? 4.107   -0.452  -2.286  1.00 0.00 ? 52 VAL A N    2  
ATOM   1689  C CA   . VAL A 1 52 ? 3.515   0.211   -3.435  1.00 0.00 ? 52 VAL A CA   2  
ATOM   1690  C C    . VAL A 1 52 ? 2.388   1.132   -2.963  1.00 0.00 ? 52 VAL A C    2  
ATOM   1691  O O    . VAL A 1 52 ? 1.808   0.913   -1.901  1.00 0.00 ? 52 VAL A O    2  
ATOM   1692  C CB   . VAL A 1 52 ? 3.049   -0.829  -4.456  1.00 0.00 ? 52 VAL A CB   2  
ATOM   1693  C CG1  . VAL A 1 52 ? 2.063   -0.216  -5.453  1.00 0.00 ? 52 VAL A CG1  2  
ATOM   1694  C CG2  . VAL A 1 52 ? 4.240   -1.460  -5.180  1.00 0.00 ? 52 VAL A CG2  2  
ATOM   1695  H H    . VAL A 1 52 ? 3.455   -0.896  -1.672  1.00 0.00 ? 52 VAL A H    2  
ATOM   1696  H HA   . VAL A 1 52 ? 4.291   0.817   -3.902  1.00 0.00 ? 52 VAL A HA   2  
ATOM   1697  H HB   . VAL A 1 52 ? 2.529   -1.620  -3.915  1.00 0.00 ? 52 VAL A HB   2  
ATOM   1698  H HG11 . VAL A 1 52 ? 1.101   -0.061  -4.964  1.00 0.00 ? 52 VAL A HG11 2  
ATOM   1699  H HG12 . VAL A 1 52 ? 2.450   0.740   -5.804  1.00 0.00 ? 52 VAL A HG12 2  
ATOM   1700  H HG21 . VAL A 1 52 ? 4.253   -2.533  -4.992  1.00 0.00 ? 52 VAL A HG21 2  
ATOM   1701  H HG22 . VAL A 1 52 ? 4.151   -1.279  -6.251  1.00 0.00 ? 52 VAL A HG22 2  
ATOM   1702  N N    . CYS A 1 53 ? 2.113   2.142   -3.775  1.00 0.00 ? 53 CYS A N    2  
ATOM   1703  C CA   . CYS A 1 53 ? 1.066   3.097   -3.453  1.00 0.00 ? 53 CYS A CA   2  
ATOM   1704  C C    . CYS A 1 53 ? 0.310   3.432   -4.740  1.00 0.00 ? 53 CYS A C    2  
ATOM   1705  O O    . CYS A 1 53 ? 0.841   3.266   -5.838  1.00 0.00 ? 53 CYS A O    2  
ATOM   1706  C CB   . CYS A 1 53 ? 1.631   4.349   -2.780  1.00 0.00 ? 53 CYS A CB   2  
ATOM   1707  S SG   . CYS A 1 53 ? 2.114   4.127   -1.029  1.00 0.00 ? 53 CYS A SG   2  
ATOM   1708  H H    . CYS A 1 53 ? 2.590   2.312   -4.637  1.00 0.00 ? 53 CYS A H    2  
ATOM   1709  H HA   . CYS A 1 53 ? 0.408   2.609   -2.734  1.00 0.00 ? 53 CYS A HA   2  
ATOM   1710  H HB2  . CYS A 1 53 ? 2.501   4.686   -3.342  1.00 0.00 ? 53 CYS A HB2  2  
ATOM   1711  H HB3  . CYS A 1 53 ? 0.886   5.143   -2.839  1.00 0.00 ? 53 CYS A HB3  2  
ATOM   1712  N N    . CYS A 1 54 ? -0.917  3.899   -4.564  1.00 0.00 ? 54 CYS A N    2  
ATOM   1713  C CA   . CYS A 1 54 ? -1.751  4.260   -5.697  1.00 0.00 ? 54 CYS A CA   2  
ATOM   1714  C C    . CYS A 1 54 ? -2.970  5.023   -5.174  1.00 0.00 ? 54 CYS A C    2  
ATOM   1715  O O    . CYS A 1 54 ? -3.475  4.726   -4.092  1.00 0.00 ? 54 CYS A O    2  
ATOM   1716  C CB   . CYS A 1 54 ? -2.155  3.032   -6.516  1.00 0.00 ? 54 CYS A CB   2  
ATOM   1717  S SG   . CYS A 1 54 ? -2.159  1.457   -5.585  1.00 0.00 ? 54 CYS A SG   2  
ATOM   1718  H H    . CYS A 1 54 ? -1.341  4.032   -3.668  1.00 0.00 ? 54 CYS A H    2  
ATOM   1719  H HA   . CYS A 1 54 ? -1.145  4.895   -6.343  1.00 0.00 ? 54 CYS A HA   2  
ATOM   1720  H HB2  . CYS A 1 54 ? -3.151  3.198   -6.926  1.00 0.00 ? 54 CYS A HB2  2  
ATOM   1721  H HB3  . CYS A 1 54 ? -1.474  2.936   -7.361  1.00 0.00 ? 54 CYS A HB3  2  
ATOM   1722  N N    . ASN A 1 55 ? -3.406  5.992   -5.965  1.00 0.00 ? 55 ASN A N    2  
ATOM   1723  C CA   . ASN A 1 55 ? -4.556  6.799   -5.595  1.00 0.00 ? 55 ASN A CA   2  
ATOM   1724  C C    . ASN A 1 55 ? -5.745  6.423   -6.482  1.00 0.00 ? 55 ASN A C    2  
ATOM   1725  O O    . ASN A 1 55 ? -6.157  7.204   -7.337  1.00 0.00 ? 55 ASN A O    2  
ATOM   1726  C CB   . ASN A 1 55 ? -4.270  8.289   -5.794  1.00 0.00 ? 55 ASN A CB   2  
ATOM   1727  C CG   . ASN A 1 55 ? -3.926  8.590   -7.254  1.00 0.00 ? 55 ASN A CG   2  
ATOM   1728  O OD1  . ASN A 1 55 ? -3.364  7.775   -7.968  1.00 0.00 ? 55 ASN A OD1  2  
ATOM   1729  N ND2  . ASN A 1 55 ? -4.292  9.803   -7.657  1.00 0.00 ? 55 ASN A ND2  2  
ATOM   1730  H H    . ASN A 1 55 ? -2.990  6.227   -6.843  1.00 0.00 ? 55 ASN A H    2  
ATOM   1731  H HA   . ASN A 1 55 ? -4.735  6.578   -4.543  1.00 0.00 ? 55 ASN A HA   2  
ATOM   1732  H HB2  . ASN A 1 55 ? -5.140  8.873   -5.494  1.00 0.00 ? 55 ASN A HB2  2  
ATOM   1733  H HB3  . ASN A 1 55 ? -3.444  8.593   -5.152  1.00 0.00 ? 55 ASN A HB3  2  
ATOM   1734  H HD21 . ASN A 1 55 ? -4.750  10.425  -7.021  1.00 0.00 ? 55 ASN A HD21 2  
ATOM   1735  H HD22 . ASN A 1 55 ? -4.110  10.095  -8.597  1.00 0.00 ? 55 ASN A HD22 2  
ATOM   1736  N N    . THR A 1 56 ? -6.262  5.226   -6.247  1.00 0.00 ? 56 THR A N    2  
ATOM   1737  C CA   . THR A 1 56 ? -7.395  4.737   -7.013  1.00 0.00 ? 56 THR A CA   2  
ATOM   1738  C C    . THR A 1 56 ? -8.241  3.783   -6.166  1.00 0.00 ? 56 THR A C    2  
ATOM   1739  O O    . THR A 1 56 ? -7.743  3.189   -5.211  1.00 0.00 ? 56 THR A O    2  
ATOM   1740  C CB   . THR A 1 56 ? -6.858  4.097   -8.295  1.00 0.00 ? 56 THR A CB   2  
ATOM   1741  O OG1  . THR A 1 56 ? -6.110  2.974   -7.836  1.00 0.00 ? 56 THR A OG1  2  
ATOM   1742  C CG2  . THR A 1 56 ? -5.820  4.975   -8.997  1.00 0.00 ? 56 THR A CG2  2  
ATOM   1743  H H    . THR A 1 56 ? -5.921  4.596   -5.549  1.00 0.00 ? 56 THR A H    2  
ATOM   1744  H HA   . THR A 1 56 ? -8.030  5.586   -7.268  1.00 0.00 ? 56 THR A HA   2  
ATOM   1745  H HB   . THR A 1 56 ? -7.672  3.840   -8.973  1.00 0.00 ? 56 THR A HB   2  
ATOM   1746  H HG1  . THR A 1 56 ? -6.704  2.172   -7.769  1.00 0.00 ? 56 THR A HG1  2  
ATOM   1747  H HG21 . THR A 1 56 ? -4.931  5.057   -8.371  1.00 0.00 ? 56 THR A HG21 2  
ATOM   1748  H HG22 . THR A 1 56 ? -5.550  4.525   -9.952  1.00 0.00 ? 56 THR A HG22 2  
ATOM   1749  N N    . ASP A 1 57 ? -9.519  3.642   -6.522  1.00 0.00 ? 57 ASP A N    2  
ATOM   1750  C CA   . ASP A 1 57 ? -10.422 2.769   -5.799  1.00 0.00 ? 57 ASP A CA   2  
ATOM   1751  C C    . ASP A 1 57 ? -9.999  1.319   -5.988  1.00 0.00 ? 57 ASP A C    2  
ATOM   1752  O O    . ASP A 1 57 ? -9.898  0.843   -7.117  1.00 0.00 ? 57 ASP A O    2  
ATOM   1753  C CB   . ASP A 1 57 ? -11.847 2.986   -6.298  1.00 0.00 ? 57 ASP A CB   2  
ATOM   1754  C CG   . ASP A 1 57 ? -12.611 3.922   -5.372  1.00 0.00 ? 57 ASP A CG   2  
ATOM   1755  O OD1  . ASP A 1 57 ? -12.089 4.176   -4.265  1.00 0.00 ? 57 ASP A OD1  2  
ATOM   1756  O OD2  . ASP A 1 57 ? -13.703 4.366   -5.788  1.00 0.00 ? 57 ASP A OD2  2  
ATOM   1757  H H    . ASP A 1 57 ? -9.879  4.153   -7.315  1.00 0.00 ? 57 ASP A H    2  
ATOM   1758  H HA   . ASP A 1 57 ? -10.378 3.014   -4.737  1.00 0.00 ? 57 ASP A HA   2  
ATOM   1759  H HB2  . ASP A 1 57 ? -11.814 3.420   -7.297  1.00 0.00 ? 57 ASP A HB2  2  
ATOM   1760  H HB3  . ASP A 1 57 ? -12.362 2.027   -6.341  1.00 0.00 ? 57 ASP A HB3  2  
ATOM   1761  H HD2  . ASP A 1 57 ? -14.135 4.948   -5.159  1.00 0.00 ? 57 ASP A HD2  2  
ATOM   1762  N N    . LYS A 1 58 ? -9.761  0.653   -4.868  1.00 0.00 ? 58 LYS A N    2  
ATOM   1763  C CA   . LYS A 1 58 ? -9.348  -0.740  -4.899  1.00 0.00 ? 58 LYS A CA   2  
ATOM   1764  C C    . LYS A 1 58 ? -8.024  -0.858  -5.657  1.00 0.00 ? 58 LYS A C    2  
ATOM   1765  O O    . LYS A 1 58 ? -7.899  -1.671  -6.572  1.00 0.00 ? 58 LYS A O    2  
ATOM   1766  C CB   . LYS A 1 58 ? -10.465 -1.616  -5.472  1.00 0.00 ? 58 LYS A CB   2  
ATOM   1767  C CG   . LYS A 1 58 ? -11.501 -1.955  -4.398  1.00 0.00 ? 58 LYS A CG   2  
ATOM   1768  C CD   . LYS A 1 58 ? -12.679 -2.726  -4.997  1.00 0.00 ? 58 LYS A CD   2  
ATOM   1769  C CE   . LYS A 1 58 ? -13.898 -2.668  -4.073  1.00 0.00 ? 58 LYS A CE   2  
ATOM   1770  N NZ   . LYS A 1 58 ? -15.103 -3.162  -4.775  1.00 0.00 ? 58 LYS A NZ   2  
ATOM   1771  H H    . LYS A 1 58 ? -9.845  1.048   -3.953  1.00 0.00 ? 58 LYS A H    2  
ATOM   1772  H HA   . LYS A 1 58 ? -9.187  -1.056  -3.869  1.00 0.00 ? 58 LYS A HA   2  
ATOM   1773  H HB2  . LYS A 1 58 ? -10.950 -1.100  -6.300  1.00 0.00 ? 58 LYS A HB2  2  
ATOM   1774  H HB3  . LYS A 1 58 ? -10.040 -2.535  -5.875  1.00 0.00 ? 58 LYS A HB3  2  
ATOM   1775  H HG2  . LYS A 1 58 ? -11.035 -2.549  -3.612  1.00 0.00 ? 58 LYS A HG2  2  
ATOM   1776  H HG3  . LYS A 1 58 ? -11.861 -1.037  -3.933  1.00 0.00 ? 58 LYS A HG3  2  
ATOM   1777  H HD2  . LYS A 1 58 ? -12.935 -2.307  -5.970  1.00 0.00 ? 58 LYS A HD2  2  
ATOM   1778  H HD3  . LYS A 1 58 ? -12.392 -3.764  -5.162  1.00 0.00 ? 58 LYS A HD3  2  
ATOM   1779  H HE2  . LYS A 1 58 ? -13.716 -3.270  -3.183  1.00 0.00 ? 58 LYS A HE2  2  
ATOM   1780  H HE3  . LYS A 1 58 ? -14.059 -1.644  -3.738  1.00 0.00 ? 58 LYS A HE3  2  
ATOM   1781  H HZ1  . LYS A 1 58 ? -15.381 -2.498  -5.470  1.00 0.00 ? 58 LYS A HZ1  2  
ATOM   1782  H HZ2  . LYS A 1 58 ? -14.899 -4.037  -5.214  1.00 0.00 ? 58 LYS A HZ2  2  
ATOM   1783  N N    . CYS A 1 59 ? -7.070  -0.036  -5.248  1.00 0.00 ? 59 CYS A N    2  
ATOM   1784  C CA   . CYS A 1 59 ? -5.760  -0.038  -5.876  1.00 0.00 ? 59 CYS A CA   2  
ATOM   1785  C C    . CYS A 1 59 ? -4.878  -1.053  -5.146  1.00 0.00 ? 59 CYS A C    2  
ATOM   1786  O O    . CYS A 1 59 ? -4.180  -1.844  -5.779  1.00 0.00 ? 59 CYS A O    2  
ATOM   1787  C CB   . CYS A 1 59 ? -5.135  1.358   -5.886  1.00 0.00 ? 59 CYS A CB   2  
ATOM   1788  S SG   . CYS A 1 59 ? -3.931  1.670   -4.544  1.00 0.00 ? 59 CYS A SG   2  
ATOM   1789  H H    . CYS A 1 59 ? -7.180  0.622   -4.503  1.00 0.00 ? 59 CYS A H    2  
ATOM   1790  H HA   . CYS A 1 59 ? -5.911  -0.334  -6.914  1.00 0.00 ? 59 CYS A HA   2  
ATOM   1791  H HB2  . CYS A 1 59 ? -4.637  1.512   -6.844  1.00 0.00 ? 59 CYS A HB2  2  
ATOM   1792  H HB3  . CYS A 1 59 ? -5.932  2.098   -5.819  1.00 0.00 ? 59 CYS A HB3  2  
ATOM   1793  N N    . ASN A 1 60 ? -4.939  -0.998  -3.823  1.00 0.00 ? 60 ASN A N    2  
ATOM   1794  C CA   . ASN A 1 60 ? -4.155  -1.902  -3.000  1.00 0.00 ? 60 ASN A CA   2  
ATOM   1795  C C    . ASN A 1 60 ? -4.969  -3.167  -2.721  1.00 0.00 ? 60 ASN A C    2  
ATOM   1796  O O    . ASN A 1 60 ? -4.767  -4.195  -3.366  1.00 0.00 ? 60 ASN A O    2  
ATOM   1797  C CB   . ASN A 1 60 ? -3.804  -1.260  -1.656  1.00 0.00 ? 60 ASN A CB   2  
ATOM   1798  C CG   . ASN A 1 60 ? -5.003  -1.288  -0.706  1.00 0.00 ? 60 ASN A CG   2  
ATOM   1799  O OD1  . ASN A 1 60 ? -6.146  -1.424  -1.111  1.00 0.00 ? 60 ASN A OD1  2  
ATOM   1800  N ND2  . ASN A 1 60 ? -4.680  -1.151  0.577   1.00 0.00 ? 60 ASN A ND2  2  
ATOM   1801  H H    . ASN A 1 60 ? -5.509  -0.352  -3.316  1.00 0.00 ? 60 ASN A H    2  
ATOM   1802  H HA   . ASN A 1 60 ? -3.253  -2.106  -3.577  1.00 0.00 ? 60 ASN A HA   2  
ATOM   1803  H HB2  . ASN A 1 60 ? -2.965  -1.789  -1.204  1.00 0.00 ? 60 ASN A HB2  2  
ATOM   1804  H HB3  . ASN A 1 60 ? -3.484  -0.230  -1.814  1.00 0.00 ? 60 ASN A HB3  2  
ATOM   1805  H HD21 . ASN A 1 60 ? -3.722  -1.042  0.842   1.00 0.00 ? 60 ASN A HD21 2  
ATOM   1806  H HD22 . ASN A 1 60 ? -5.395  -1.156  1.276   1.00 0.00 ? 60 ASN A HD22 2  
HETATM 1807  O O    . HOH B 2 .  ? 4.970   -10.309 2.261   1.00 0.00 ? 61 HOH A O    2  
HETATM 1808  H H1   . HOH B 2 .  ? 5.653   -10.887 2.599   1.00 0.00 ? 61 HOH A H1   2  
HETATM 1809  H H2   . HOH B 2 .  ? 4.289   -10.903 1.945   1.00 0.00 ? 61 HOH A H2   2  
HETATM 1810  O O    . HOH B 2 .  ? 10.161  -14.133 -5.537  1.00 0.00 ? 62 HOH A O    2  
HETATM 1811  H H1   . HOH B 2 .  ? 9.250   -13.890 -5.704  1.00 0.00 ? 62 HOH A H1   2  
HETATM 1812  H H2   . HOH B 2 .  ? 10.611  -13.298 -5.405  1.00 0.00 ? 62 HOH A H2   2  
ATOM   1813  N N    . LEU A 1 1  ? -12.601 7.455   -1.807  1.00 0.00 ? 1  LEU A N    3  
ATOM   1814  C CA   . LEU A 1 1  ? -11.363 7.076   -1.148  1.00 0.00 ? 1  LEU A CA   3  
ATOM   1815  C C    . LEU A 1 1  ? -11.613 5.852   -0.265  1.00 0.00 ? 1  LEU A C    3  
ATOM   1816  O O    . LEU A 1 1  ? -11.594 5.952   0.961   1.00 0.00 ? 1  LEU A O    3  
ATOM   1817  C CB   . LEU A 1 1  ? -10.772 8.268   -0.393  1.00 0.00 ? 1  LEU A CB   3  
ATOM   1818  C CG   . LEU A 1 1  ? -10.196 9.392   -1.257  1.00 0.00 ? 1  LEU A CG   3  
ATOM   1819  C CD1  . LEU A 1 1  ? -11.245 10.474  -1.520  1.00 0.00 ? 1  LEU A CD1  3  
ATOM   1820  C CD2  . LEU A 1 1  ? -8.923  9.966   -0.634  1.00 0.00 ? 1  LEU A CD2  3  
ATOM   1821  H H    . LEU A 1 1  ? -13.420 7.393   -1.236  1.00 0.00 ? 1  LEU A H    3  
ATOM   1822  H HA   . LEU A 1 1  ? -10.650 6.802   -1.925  1.00 0.00 ? 1  LEU A HA   3  
ATOM   1823  H HB2  . LEU A 1 1  ? -11.548 8.690   0.246   1.00 0.00 ? 1  LEU A HB2  3  
ATOM   1824  H HB3  . LEU A 1 1  ? -9.983  7.902   0.264   1.00 0.00 ? 1  LEU A HB3  3  
ATOM   1825  H HG   . LEU A 1 1  ? -9.919  8.971   -2.224  1.00 0.00 ? 1  LEU A HG   3  
ATOM   1826  H HD11 . LEU A 1 1  ? -12.162 10.011  -1.885  1.00 0.00 ? 1  LEU A HD11 3  
ATOM   1827  H HD12 . LEU A 1 1  ? -11.454 11.010  -0.593  1.00 0.00 ? 1  LEU A HD12 3  
ATOM   1828  H HD21 . LEU A 1 1  ? -8.874  9.684   0.418   1.00 0.00 ? 1  LEU A HD21 3  
ATOM   1829  H HD22 . LEU A 1 1  ? -8.052  9.571   -1.156  1.00 0.00 ? 1  LEU A HD22 3  
ATOM   1830  N N    . LYS A 1 2  ? -11.843 4.725   -0.922  1.00 0.00 ? 2  LYS A N    3  
ATOM   1831  C CA   . LYS A 1 2  ? -12.097 3.483   -0.212  1.00 0.00 ? 2  LYS A CA   3  
ATOM   1832  C C    . LYS A 1 2  ? -11.104 2.419   -0.683  1.00 0.00 ? 2  LYS A C    3  
ATOM   1833  O O    . LYS A 1 2  ? -10.987 2.160   -1.880  1.00 0.00 ? 2  LYS A O    3  
ATOM   1834  C CB   . LYS A 1 2  ? -13.562 3.068   -0.366  1.00 0.00 ? 2  LYS A CB   3  
ATOM   1835  C CG   . LYS A 1 2  ? -14.430 3.709   0.718   1.00 0.00 ? 2  LYS A CG   3  
ATOM   1836  C CD   . LYS A 1 2  ? -15.869 3.891   0.232   1.00 0.00 ? 2  LYS A CD   3  
ATOM   1837  C CE   . LYS A 1 2  ? -16.621 4.894   1.109   1.00 0.00 ? 2  LYS A CE   3  
ATOM   1838  N NZ   . LYS A 1 2  ? -18.007 5.074   0.619   1.00 0.00 ? 2  LYS A NZ   3  
ATOM   1839  H H    . LYS A 1 2  ? -11.857 4.652   -1.920  1.00 0.00 ? 2  LYS A H    3  
ATOM   1840  H HA   . LYS A 1 2  ? -11.925 3.671   0.847   1.00 0.00 ? 2  LYS A HA   3  
ATOM   1841  H HB2  . LYS A 1 2  ? -13.926 3.363   -1.350  1.00 0.00 ? 2  LYS A HB2  3  
ATOM   1842  H HB3  . LYS A 1 2  ? -13.644 1.983   -0.309  1.00 0.00 ? 2  LYS A HB3  3  
ATOM   1843  H HG2  . LYS A 1 2  ? -14.421 3.085   1.612   1.00 0.00 ? 2  LYS A HG2  3  
ATOM   1844  H HG3  . LYS A 1 2  ? -14.012 4.675   1.000   1.00 0.00 ? 2  LYS A HG3  3  
ATOM   1845  H HD2  . LYS A 1 2  ? -15.867 4.237   -0.802  1.00 0.00 ? 2  LYS A HD2  3  
ATOM   1846  H HD3  . LYS A 1 2  ? -16.386 2.932   0.246   1.00 0.00 ? 2  LYS A HD3  3  
ATOM   1847  H HE2  . LYS A 1 2  ? -16.636 4.544   2.141   1.00 0.00 ? 2  LYS A HE2  3  
ATOM   1848  H HE3  . LYS A 1 2  ? -16.101 5.852   1.104   1.00 0.00 ? 2  LYS A HE3  3  
ATOM   1849  H HZ1  . LYS A 1 2  ? -18.332 4.217   0.219   1.00 0.00 ? 2  LYS A HZ1  3  
ATOM   1850  H HZ2  . LYS A 1 2  ? -18.599 5.331   1.383   1.00 0.00 ? 2  LYS A HZ2  3  
ATOM   1851  N N    . CYS A 1 3  ? -10.414 1.831   0.283   1.00 0.00 ? 3  CYS A N    3  
ATOM   1852  C CA   . CYS A 1 3  ? -9.434  0.801   -0.018  1.00 0.00 ? 3  CYS A CA   3  
ATOM   1853  C C    . CYS A 1 3  ? -9.796  -0.454  0.779   1.00 0.00 ? 3  CYS A C    3  
ATOM   1854  O O    . CYS A 1 3  ? -10.670 -0.414  1.643   1.00 0.00 ? 3  CYS A O    3  
ATOM   1855  C CB   . CYS A 1 3  ? -8.009  1.272   0.276   1.00 0.00 ? 3  CYS A CB   3  
ATOM   1856  S SG   . CYS A 1 3  ? -7.687  3.032   -0.109  1.00 0.00 ? 3  CYS A SG   3  
ATOM   1857  H H    . CYS A 1 3  ? -10.515 2.047   1.254   1.00 0.00 ? 3  CYS A H    3  
ATOM   1858  H HA   . CYS A 1 3  ? -9.498  0.611   -1.090  1.00 0.00 ? 3  CYS A HA   3  
ATOM   1859  H HB2  . CYS A 1 3  ? -7.795  1.101   1.331   1.00 0.00 ? 3  CYS A HB2  3  
ATOM   1860  H HB3  . CYS A 1 3  ? -7.312  0.657   -0.294  1.00 0.00 ? 3  CYS A HB3  3  
ATOM   1861  N N    . LYS A 1 4  ? -9.106  -1.539  0.459   1.00 0.00 ? 4  LYS A N    3  
ATOM   1862  C CA   . LYS A 1 4  ? -9.344  -2.803  1.135   1.00 0.00 ? 4  LYS A CA   3  
ATOM   1863  C C    . LYS A 1 4  ? -8.444  -2.894  2.369   1.00 0.00 ? 4  LYS A C    3  
ATOM   1864  O O    . LYS A 1 4  ? -7.300  -2.444  2.342   1.00 0.00 ? 4  LYS A O    3  
ATOM   1865  C CB   . LYS A 1 4  ? -9.172  -3.971  0.162   1.00 0.00 ? 4  LYS A CB   3  
ATOM   1866  C CG   . LYS A 1 4  ? -10.455 -4.212  -0.637  1.00 0.00 ? 4  LYS A CG   3  
ATOM   1867  C CD   . LYS A 1 4  ? -11.254 -5.378  -0.052  1.00 0.00 ? 4  LYS A CD   3  
ATOM   1868  C CE   . LYS A 1 4  ? -12.561 -5.586  -0.819  1.00 0.00 ? 4  LYS A CE   3  
ATOM   1869  N NZ   . LYS A 1 4  ? -13.550 -6.294  0.024   1.00 0.00 ? 4  LYS A NZ   3  
ATOM   1870  H H    . LYS A 1 4  ? -8.397  -1.563  -0.245  1.00 0.00 ? 4  LYS A H    3  
ATOM   1871  H HA   . LYS A 1 4  ? -10.383 -2.808  1.463   1.00 0.00 ? 4  LYS A HA   3  
ATOM   1872  H HB2  . LYS A 1 4  ? -8.348  -3.763  -0.521  1.00 0.00 ? 4  LYS A HB2  3  
ATOM   1873  H HB3  . LYS A 1 4  ? -8.908  -4.873  0.713   1.00 0.00 ? 4  LYS A HB3  3  
ATOM   1874  H HG2  . LYS A 1 4  ? -11.065 -3.310  -0.633  1.00 0.00 ? 4  LYS A HG2  3  
ATOM   1875  H HG3  . LYS A 1 4  ? -10.205 -4.423  -1.677  1.00 0.00 ? 4  LYS A HG3  3  
ATOM   1876  H HD2  . LYS A 1 4  ? -10.657 -6.289  -0.091  1.00 0.00 ? 4  LYS A HD2  3  
ATOM   1877  H HD3  . LYS A 1 4  ? -11.471 -5.184  0.998   1.00 0.00 ? 4  LYS A HD3  3  
ATOM   1878  H HE2  . LYS A 1 4  ? -12.964 -4.623  -1.131  1.00 0.00 ? 4  LYS A HE2  3  
ATOM   1879  H HE3  . LYS A 1 4  ? -12.371 -6.161  -1.726  1.00 0.00 ? 4  LYS A HE3  3  
ATOM   1880  H HZ1  . LYS A 1 4  ? -14.138 -6.859  -0.554  1.00 0.00 ? 4  LYS A HZ1  3  
ATOM   1881  H HZ2  . LYS A 1 4  ? -13.072 -6.876  0.682   1.00 0.00 ? 4  LYS A HZ2  3  
ATOM   1882  N N    . LYS A 1 5  ? -8.996  -3.479  3.422   1.00 0.00 ? 5  LYS A N    3  
ATOM   1883  C CA   . LYS A 1 5  ? -8.258  -3.635  4.664   1.00 0.00 ? 5  LYS A CA   3  
ATOM   1884  C C    . LYS A 1 5  ? -7.315  -4.833  4.545   1.00 0.00 ? 5  LYS A C    3  
ATOM   1885  O O    . LYS A 1 5  ? -7.144  -5.388  3.461   1.00 0.00 ? 5  LYS A O    3  
ATOM   1886  C CB   . LYS A 1 5  ? -9.220  -3.724  5.851   1.00 0.00 ? 5  LYS A CB   3  
ATOM   1887  C CG   . LYS A 1 5  ? -9.884  -2.372  6.121   1.00 0.00 ? 5  LYS A CG   3  
ATOM   1888  C CD   . LYS A 1 5  ? -10.680 -2.404  7.427   1.00 0.00 ? 5  LYS A CD   3  
ATOM   1889  C CE   . LYS A 1 5  ? -12.083 -2.970  7.201   1.00 0.00 ? 5  LYS A CE   3  
ATOM   1890  N NZ   . LYS A 1 5  ? -12.773 -3.180  8.494   1.00 0.00 ? 5  LYS A NZ   3  
ATOM   1891  H H    . LYS A 1 5  ? -9.928  -3.842  3.436   1.00 0.00 ? 5  LYS A H    3  
ATOM   1892  H HA   . LYS A 1 5  ? -7.658  -2.735  4.802   1.00 0.00 ? 5  LYS A HA   3  
ATOM   1893  H HB2  . LYS A 1 5  ? -9.984  -4.475  5.650   1.00 0.00 ? 5  LYS A HB2  3  
ATOM   1894  H HB3  . LYS A 1 5  ? -8.678  -4.051  6.739   1.00 0.00 ? 5  LYS A HB3  3  
ATOM   1895  H HG2  . LYS A 1 5  ? -9.124  -1.593  6.173   1.00 0.00 ? 5  LYS A HG2  3  
ATOM   1896  H HG3  . LYS A 1 5  ? -10.546 -2.116  5.294   1.00 0.00 ? 5  LYS A HG3  3  
ATOM   1897  H HD2  . LYS A 1 5  ? -10.154 -3.011  8.164   1.00 0.00 ? 5  LYS A HD2  3  
ATOM   1898  H HD3  . LYS A 1 5  ? -10.752 -1.397  7.838   1.00 0.00 ? 5  LYS A HD3  3  
ATOM   1899  H HE2  . LYS A 1 5  ? -12.662 -2.286  6.580   1.00 0.00 ? 5  LYS A HE2  3  
ATOM   1900  H HE3  . LYS A 1 5  ? -12.018 -3.914  6.659   1.00 0.00 ? 5  LYS A HE3  3  
ATOM   1901  H HZ1  . LYS A 1 5  ? -13.476 -3.883  8.386   1.00 0.00 ? 5  LYS A HZ1  3  
ATOM   1902  H HZ2  . LYS A 1 5  ? -12.109 -3.475  9.181   1.00 0.00 ? 5  LYS A HZ2  3  
ATOM   1903  N N    . LEU A 1 6  ? -6.728  -5.198  5.676   1.00 0.00 ? 6  LEU A N    3  
ATOM   1904  C CA   . LEU A 1 6  ? -5.807  -6.321  5.712   1.00 0.00 ? 6  LEU A CA   3  
ATOM   1905  C C    . LEU A 1 6  ? -6.352  -7.451  4.835   1.00 0.00 ? 6  LEU A C    3  
ATOM   1906  O O    . LEU A 1 6  ? -5.817  -7.720  3.761   1.00 0.00 ? 6  LEU A O    3  
ATOM   1907  C CB   . LEU A 1 6  ? -5.532  -6.742  7.157   1.00 0.00 ? 6  LEU A CB   3  
ATOM   1908  C CG   . LEU A 1 6  ? -4.365  -6.037  7.850   1.00 0.00 ? 6  LEU A CG   3  
ATOM   1909  C CD1  . LEU A 1 6  ? -4.809  -4.703  8.452   1.00 0.00 ? 6  LEU A CD1  3  
ATOM   1910  C CD2  . LEU A 1 6  ? -3.716  -6.949  8.894   1.00 0.00 ? 6  LEU A CD2  3  
ATOM   1911  H H    . LEU A 1 6  ? -6.873  -4.742  6.554   1.00 0.00 ? 6  LEU A H    3  
ATOM   1912  H HA   . LEU A 1 6  ? -4.861  -5.982  5.290   1.00 0.00 ? 6  LEU A HA   3  
ATOM   1913  H HB2  . LEU A 1 6  ? -6.435  -6.570  7.743   1.00 0.00 ? 6  LEU A HB2  3  
ATOM   1914  H HB3  . LEU A 1 6  ? -5.343  -7.816  7.172   1.00 0.00 ? 6  LEU A HB3  3  
ATOM   1915  H HG   . LEU A 1 6  ? -3.606  -5.815  7.100   1.00 0.00 ? 6  LEU A HG   3  
ATOM   1916  H HD11 . LEU A 1 6  ? -4.922  -3.966  7.657   1.00 0.00 ? 6  LEU A HD11 3  
ATOM   1917  H HD12 . LEU A 1 6  ? -5.763  -4.835  8.963   1.00 0.00 ? 6  LEU A HD12 3  
ATOM   1918  H HD21 . LEU A 1 6  ? -2.750  -6.536  9.187   1.00 0.00 ? 6  LEU A HD21 3  
ATOM   1919  H HD22 . LEU A 1 6  ? -4.362  -7.017  9.769   1.00 0.00 ? 6  LEU A HD22 3  
ATOM   1920  N N    . VAL A 1 7  ? -7.409  -8.081  5.327   1.00 0.00 ? 7  VAL A N    3  
ATOM   1921  C CA   . VAL A 1 7  ? -8.032  -9.175  4.601   1.00 0.00 ? 7  VAL A CA   3  
ATOM   1922  C C    . VAL A 1 7  ? -9.009  -8.607  3.570   1.00 0.00 ? 7  VAL A C    3  
ATOM   1923  O O    . VAL A 1 7  ? -9.778  -7.697  3.875   1.00 0.00 ? 7  VAL A O    3  
ATOM   1924  C CB   . VAL A 1 7  ? -8.695  -10.143 5.583   1.00 0.00 ? 7  VAL A CB   3  
ATOM   1925  C CG1  . VAL A 1 7  ? -9.417  -11.269 4.840   1.00 0.00 ? 7  VAL A CG1  3  
ATOM   1926  C CG2  . VAL A 1 7  ? -7.672  -10.707 6.572   1.00 0.00 ? 7  VAL A CG2  3  
ATOM   1927  H H    . VAL A 1 7  ? -7.837  -7.856  6.201   1.00 0.00 ? 7  VAL A H    3  
ATOM   1928  H HA   . VAL A 1 7  ? -7.242  -9.714  4.077   1.00 0.00 ? 7  VAL A HA   3  
ATOM   1929  H HB   . VAL A 1 7  ? -9.439  -9.586  6.152   1.00 0.00 ? 7  VAL A HB   3  
ATOM   1930  H HG11 . VAL A 1 7  ? -8.754  -12.129 4.751   1.00 0.00 ? 7  VAL A HG11 3  
ATOM   1931  H HG12 . VAL A 1 7  ? -10.311 -11.555 5.394   1.00 0.00 ? 7  VAL A HG12 3  
ATOM   1932  H HG21 . VAL A 1 7  ? -7.651  -11.794 6.493   1.00 0.00 ? 7  VAL A HG21 3  
ATOM   1933  H HG22 . VAL A 1 7  ? -6.685  -10.306 6.342   1.00 0.00 ? 7  VAL A HG22 3  
ATOM   1934  N N    . PRO A 1 8  ? -8.945  -9.183  2.340   1.00 0.00 ? 8  PRO A N    3  
ATOM   1935  C CA   . PRO A 1 8  ? -9.815  -8.743  1.262   1.00 0.00 ? 8  PRO A CA   3  
ATOM   1936  C C    . PRO A 1 8  ? -11.242 -9.256  1.466   1.00 0.00 ? 8  PRO A C    3  
ATOM   1937  O O    . PRO A 1 8  ? -11.809 -9.894  0.580   1.00 0.00 ? 8  PRO A O    3  
ATOM   1938  C CB   . PRO A 1 8  ? -9.168  -9.275  -0.007  1.00 0.00 ? 8  PRO A CB   3  
ATOM   1939  C CG   . PRO A 1 8  ? -8.223  -10.379 0.438   1.00 0.00 ? 8  PRO A CG   3  
ATOM   1940  C CD   . PRO A 1 8  ? -8.047  -10.263 1.943   1.00 0.00 ? 8  PRO A CD   3  
ATOM   1941  H HA   . PRO A 1 8  ? -9.881  -7.745  1.254   1.00 0.00 ? 8  PRO A HA   3  
ATOM   1942  H HB2  . PRO A 1 8  ? -9.920  -9.658  -0.697  1.00 0.00 ? 8  PRO A HB2  3  
ATOM   1943  H HB3  . PRO A 1 8  ? -8.629  -8.486  -0.530  1.00 0.00 ? 8  PRO A HB3  3  
ATOM   1944  H HG2  . PRO A 1 8  ? -8.627  -11.356 0.175   1.00 0.00 ? 8  PRO A HG2  3  
ATOM   1945  H HG3  . PRO A 1 8  ? -7.262  -10.285 -0.067  1.00 0.00 ? 8  PRO A HG3  3  
ATOM   1946  H HD2  . PRO A 1 8  ? -8.303  -11.196 2.445   1.00 0.00 ? 8  PRO A HD2  3  
ATOM   1947  H HD3  . PRO A 1 8  ? -7.013  -10.034 2.205   1.00 0.00 ? 8  PRO A HD3  3  
ATOM   1948  N N    . LEU A 1 9  ? -11.782 -8.957  2.638   1.00 0.00 ? 9  LEU A N    3  
ATOM   1949  C CA   . LEU A 1 9  ? -13.132 -9.379  2.970   1.00 0.00 ? 9  LEU A CA   3  
ATOM   1950  C C    . LEU A 1 9  ? -14.014 -8.145  3.170   1.00 0.00 ? 9  LEU A C    3  
ATOM   1951  O O    . LEU A 1 9  ? -15.194 -8.157  2.823   1.00 0.00 ? 9  LEU A O    3  
ATOM   1952  C CB   . LEU A 1 9  ? -13.118 -10.326 4.171   1.00 0.00 ? 9  LEU A CB   3  
ATOM   1953  C CG   . LEU A 1 9  ? -12.816 -11.794 3.865   1.00 0.00 ? 9  LEU A CG   3  
ATOM   1954  C CD1  . LEU A 1 9  ? -13.022 -12.666 5.105   1.00 0.00 ? 9  LEU A CD1  3  
ATOM   1955  C CD2  . LEU A 1 9  ? -13.641 -12.287 2.674   1.00 0.00 ? 9  LEU A CD2  3  
ATOM   1956  H H    . LEU A 1 9  ? -11.314 -8.437  3.353   1.00 0.00 ? 9  LEU A H    3  
ATOM   1957  H HA   . LEU A 1 9  ? -13.516 -9.944  2.120   1.00 0.00 ? 9  LEU A HA   3  
ATOM   1958  H HB2  . LEU A 1 9  ? -12.377 -9.964  4.885   1.00 0.00 ? 9  LEU A HB2  3  
ATOM   1959  H HB3  . LEU A 1 9  ? -14.088 -10.270 4.664   1.00 0.00 ? 9  LEU A HB3  3  
ATOM   1960  H HG   . LEU A 1 9  ? -11.766 -11.876 3.585   1.00 0.00 ? 9  LEU A HG   3  
ATOM   1961  H HD11 . LEU A 1 9  ? -14.006 -12.467 5.530   1.00 0.00 ? 9  LEU A HD11 3  
ATOM   1962  H HD12 . LEU A 1 9  ? -12.953 -13.718 4.826   1.00 0.00 ? 9  LEU A HD12 3  
ATOM   1963  H HD21 . LEU A 1 9  ? -13.090 -12.106 1.751   1.00 0.00 ? 9  LEU A HD21 3  
ATOM   1964  H HD22 . LEU A 1 9  ? -13.831 -13.355 2.781   1.00 0.00 ? 9  LEU A HD22 3  
ATOM   1965  N N    . PHE A 1 10 ? -13.407 -7.108  3.728   1.00 0.00 ? 10 PHE A N    3  
ATOM   1966  C CA   . PHE A 1 10 ? -14.121 -5.868  3.978   1.00 0.00 ? 10 PHE A CA   3  
ATOM   1967  C C    . PHE A 1 10 ? -13.271 -4.657  3.589   1.00 0.00 ? 10 PHE A C    3  
ATOM   1968  O O    . PHE A 1 10 ? -12.044 -4.735  3.574   1.00 0.00 ? 10 PHE A O    3  
ATOM   1969  C CB   . PHE A 1 10 ? -14.410 -5.813  5.480   1.00 0.00 ? 10 PHE A CB   3  
ATOM   1970  C CG   . PHE A 1 10 ? -14.940 -7.126  6.060   1.00 0.00 ? 10 PHE A CG   3  
ATOM   1971  C CD1  . PHE A 1 10 ? -14.070 -8.085  6.476   1.00 0.00 ? 10 PHE A CD1  3  
ATOM   1972  C CD2  . PHE A 1 10 ? -16.280 -7.333  6.159   1.00 0.00 ? 10 PHE A CD2  3  
ATOM   1973  C CE1  . PHE A 1 10 ? -14.562 -9.303  7.015   1.00 0.00 ? 10 PHE A CE1  3  
ATOM   1974  C CE2  . PHE A 1 10 ? -16.772 -8.551  6.698   1.00 0.00 ? 10 PHE A CE2  3  
ATOM   1975  C CZ   . PHE A 1 10 ? -15.903 -9.511  7.114   1.00 0.00 ? 10 PHE A CZ   3  
ATOM   1976  H H    . PHE A 1 10 ? -12.446 -7.106  4.007   1.00 0.00 ? 10 PHE A H    3  
ATOM   1977  H HA   . PHE A 1 10 ? -15.024 -5.886  3.368   1.00 0.00 ? 10 PHE A HA   3  
ATOM   1978  H HB2  . PHE A 1 10 ? -13.495 -5.538  6.005   1.00 0.00 ? 10 PHE A HB2  3  
ATOM   1979  H HB3  . PHE A 1 10 ? -15.136 -5.023  5.671   1.00 0.00 ? 10 PHE A HB3  3  
ATOM   1980  H HD1  . PHE A 1 10 ? -12.996 -7.919  6.397   1.00 0.00 ? 10 PHE A HD1  3  
ATOM   1981  H HD2  . PHE A 1 10 ? -16.977 -6.564  5.825   1.00 0.00 ? 10 PHE A HD2  3  
ATOM   1982  H HE1  . PHE A 1 10 ? -13.866 -10.072 7.349   1.00 0.00 ? 10 PHE A HE1  3  
ATOM   1983  H HE2  . PHE A 1 10 ? -17.846 -8.718  6.777   1.00 0.00 ? 10 PHE A HE2  3  
ATOM   1984  H HZ   . PHE A 1 10 ? -16.280 -10.446 7.527   1.00 0.00 ? 10 PHE A HZ   3  
ATOM   1985  N N    . SER A 1 11 ? -13.957 -3.565  3.285   1.00 0.00 ? 11 SER A N    3  
ATOM   1986  C CA   . SER A 1 11 ? -13.280 -2.339  2.897   1.00 0.00 ? 11 SER A CA   3  
ATOM   1987  C C    . SER A 1 11 ? -13.577 -1.234  3.913   1.00 0.00 ? 11 SER A C    3  
ATOM   1988  O O    . SER A 1 11 ? -14.592 -1.280  4.607   1.00 0.00 ? 11 SER A O    3  
ATOM   1989  C CB   . SER A 1 11 ? -13.701 -1.898  1.494   1.00 0.00 ? 11 SER A CB   3  
ATOM   1990  O OG   . SER A 1 11 ? -15.115 -1.934  1.324   1.00 0.00 ? 11 SER A OG   3  
ATOM   1991  H H    . SER A 1 11 ? -14.956 -3.510  3.300   1.00 0.00 ? 11 SER A H    3  
ATOM   1992  H HA   . SER A 1 11 ? -12.218 -2.584  2.897   1.00 0.00 ? 11 SER A HA   3  
ATOM   1993  H HB2  . SER A 1 11 ? -13.340 -0.886  1.309   1.00 0.00 ? 11 SER A HB2  3  
ATOM   1994  H HB3  . SER A 1 11 ? -13.230 -2.545  0.754   1.00 0.00 ? 11 SER A HB3  3  
ATOM   1995  H HG   . SER A 1 11 ? -15.567 -1.561  2.135   1.00 0.00 ? 11 SER A HG   3  
ATOM   1996  N N    . LYS A 1 12 ? -12.674 -0.266  3.967   1.00 0.00 ? 12 LYS A N    3  
ATOM   1997  C CA   . LYS A 1 12 ? -12.826 0.849   4.886   1.00 0.00 ? 12 LYS A CA   3  
ATOM   1998  C C    . LYS A 1 12 ? -12.406 2.142   4.186   1.00 0.00 ? 12 LYS A C    3  
ATOM   1999  O O    . LYS A 1 12 ? -11.631 2.112   3.231   1.00 0.00 ? 12 LYS A O    3  
ATOM   2000  C CB   . LYS A 1 12 ? -12.067 0.579   6.187   1.00 0.00 ? 12 LYS A CB   3  
ATOM   2001  C CG   . LYS A 1 12 ? -13.033 0.426   7.364   1.00 0.00 ? 12 LYS A CG   3  
ATOM   2002  C CD   . LYS A 1 12 ? -13.050 1.689   8.227   1.00 0.00 ? 12 LYS A CD   3  
ATOM   2003  C CE   . LYS A 1 12 ? -13.694 1.416   9.587   1.00 0.00 ? 12 LYS A CE   3  
ATOM   2004  N NZ   . LYS A 1 12 ? -12.674 0.976   10.565  1.00 0.00 ? 12 LYS A NZ   3  
ATOM   2005  H H    . LYS A 1 12 ? -11.851 -0.236  3.399   1.00 0.00 ? 12 LYS A H    3  
ATOM   2006  H HA   . LYS A 1 12 ? -13.884 0.921   5.140   1.00 0.00 ? 12 LYS A HA   3  
ATOM   2007  H HB2  . LYS A 1 12 ? -11.469 -0.327  6.083   1.00 0.00 ? 12 LYS A HB2  3  
ATOM   2008  H HB3  . LYS A 1 12 ? -11.374 1.397   6.384   1.00 0.00 ? 12 LYS A HB3  3  
ATOM   2009  H HG2  . LYS A 1 12 ? -14.036 0.222   6.991   1.00 0.00 ? 12 LYS A HG2  3  
ATOM   2010  H HG3  . LYS A 1 12 ? -12.738 -0.430  7.972   1.00 0.00 ? 12 LYS A HG3  3  
ATOM   2011  H HD2  . LYS A 1 12 ? -12.032 2.051   8.369   1.00 0.00 ? 12 LYS A HD2  3  
ATOM   2012  H HD3  . LYS A 1 12 ? -13.599 2.478   7.712   1.00 0.00 ? 12 LYS A HD3  3  
ATOM   2013  H HE2  . LYS A 1 12 ? -14.190 2.316   9.949   1.00 0.00 ? 12 LYS A HE2  3  
ATOM   2014  H HE3  . LYS A 1 12 ? -14.462 0.649   9.485   1.00 0.00 ? 12 LYS A HE3  3  
ATOM   2015  H HZ1  . LYS A 1 12 ? -13.111 0.802   11.447  1.00 0.00 ? 12 LYS A HZ1  3  
ATOM   2016  H HZ2  . LYS A 1 12 ? -12.238 0.138   10.238  1.00 0.00 ? 12 LYS A HZ2  3  
ATOM   2017  N N    . THR A 1 13 ? -12.934 3.248   4.688   1.00 0.00 ? 13 THR A N    3  
ATOM   2018  C CA   . THR A 1 13 ? -12.624 4.550   4.123   1.00 0.00 ? 13 THR A CA   3  
ATOM   2019  C C    . THR A 1 13 ? -11.406 5.159   4.822   1.00 0.00 ? 13 THR A C    3  
ATOM   2020  O O    . THR A 1 13 ? -11.313 5.133   6.048   1.00 0.00 ? 13 THR A O    3  
ATOM   2021  C CB   . THR A 1 13 ? -13.878 5.420   4.221   1.00 0.00 ? 13 THR A CB   3  
ATOM   2022  O OG1  . THR A 1 13 ? -14.819 4.771   3.370   1.00 0.00 ? 13 THR A OG1  3  
ATOM   2023  C CG2  . THR A 1 13 ? -13.687 6.798   3.583   1.00 0.00 ? 13 THR A CG2  3  
ATOM   2024  H H    . THR A 1 13 ? -13.563 3.265   5.466   1.00 0.00 ? 13 THR A H    3  
ATOM   2025  H HA   . THR A 1 13 ? -12.356 4.415   3.075   1.00 0.00 ? 13 THR A HA   3  
ATOM   2026  H HB   . THR A 1 13 ? -14.208 5.513   5.256   1.00 0.00 ? 13 THR A HB   3  
ATOM   2027  H HG1  . THR A 1 13 ? -15.059 3.876   3.746   1.00 0.00 ? 13 THR A HG1  3  
ATOM   2028  H HG21 . THR A 1 13 ? -14.488 7.463   3.907   1.00 0.00 ? 13 THR A HG21 3  
ATOM   2029  H HG22 . THR A 1 13 ? -12.726 7.210   3.889   1.00 0.00 ? 13 THR A HG22 3  
ATOM   2030  N N    . CYS A 1 14 ? -10.503 5.691   4.012   1.00 0.00 ? 14 CYS A N    3  
ATOM   2031  C CA   . CYS A 1 14 ? -9.296  6.305   4.537   1.00 0.00 ? 14 CYS A CA   3  
ATOM   2032  C C    . CYS A 1 14 ? -9.640  7.720   5.005   1.00 0.00 ? 14 CYS A C    3  
ATOM   2033  O O    . CYS A 1 14 ? -10.359 8.446   4.321   1.00 0.00 ? 14 CYS A O    3  
ATOM   2034  C CB   . CYS A 1 14 ? -8.166  6.304   3.506   1.00 0.00 ? 14 CYS A CB   3  
ATOM   2035  S SG   . CYS A 1 14 ? -7.964  4.733   2.589   1.00 0.00 ? 14 CYS A SG   3  
ATOM   2036  H H    . CYS A 1 14 ? -10.587 5.708   3.016   1.00 0.00 ? 14 CYS A H    3  
ATOM   2037  H HA   . CYS A 1 14 ? -8.970  5.689   5.376   1.00 0.00 ? 14 CYS A HA   3  
ATOM   2038  H HB2  . CYS A 1 14 ? -8.346  7.106   2.789   1.00 0.00 ? 14 CYS A HB2  3  
ATOM   2039  H HB3  . CYS A 1 14 ? -7.229  6.535   4.013   1.00 0.00 ? 14 CYS A HB3  3  
ATOM   2040  N N    . PRO A 1 15 ? -9.098  8.079   6.200   1.00 0.00 ? 15 PRO A N    3  
ATOM   2041  C CA   . PRO A 1 15 ? -9.341  9.394   6.767   1.00 0.00 ? 15 PRO A CA   3  
ATOM   2042  C C    . PRO A 1 15 ? -8.528  10.465  6.037   1.00 0.00 ? 15 PRO A C    3  
ATOM   2043  O O    . PRO A 1 15 ? -7.752  10.153  5.135   1.00 0.00 ? 15 PRO A O    3  
ATOM   2044  C CB   . PRO A 1 15 ? -8.968  9.264   8.235   1.00 0.00 ? 15 PRO A CB   3  
ATOM   2045  C CG   . PRO A 1 15 ? -8.096  8.024   8.335   1.00 0.00 ? 15 PRO A CG   3  
ATOM   2046  C CD   . PRO A 1 15 ? -8.242  7.245   7.038   1.00 0.00 ? 15 PRO A CD   3  
ATOM   2047  H HA   . PRO A 1 15 ? -10.300 9.652   6.649   1.00 0.00 ? 15 PRO A HA   3  
ATOM   2048  H HB2  . PRO A 1 15 ? -8.432  10.148  8.582   1.00 0.00 ? 15 PRO A HB2  3  
ATOM   2049  H HB3  . PRO A 1 15 ? -9.858  9.167   8.857   1.00 0.00 ? 15 PRO A HB3  3  
ATOM   2050  H HG2  . PRO A 1 15 ? -7.055  8.301   8.499   1.00 0.00 ? 15 PRO A HG2  3  
ATOM   2051  H HG3  . PRO A 1 15 ? -8.400  7.411   9.184   1.00 0.00 ? 15 PRO A HG3  3  
ATOM   2052  H HD2  . PRO A 1 15 ? -7.273  7.074   6.568   1.00 0.00 ? 15 PRO A HD2  3  
ATOM   2053  H HD3  . PRO A 1 15 ? -8.689  6.267   7.212   1.00 0.00 ? 15 PRO A HD3  3  
ATOM   2054  N N    . ALA A 1 16 ? -8.734  11.706  6.453   1.00 0.00 ? 16 ALA A N    3  
ATOM   2055  C CA   . ALA A 1 16 ? -8.029  12.825  5.850   1.00 0.00 ? 16 ALA A CA   3  
ATOM   2056  C C    . ALA A 1 16 ? -6.521  12.594  5.964   1.00 0.00 ? 16 ALA A C    3  
ATOM   2057  O O    . ALA A 1 16 ? -6.044  12.072  6.971   1.00 0.00 ? 16 ALA A O    3  
ATOM   2058  C CB   . ALA A 1 16 ? -8.472  14.127  6.519   1.00 0.00 ? 16 ALA A CB   3  
ATOM   2059  H H    . ALA A 1 16 ? -9.367  11.951  7.188   1.00 0.00 ? 16 ALA A H    3  
ATOM   2060  H HA   . ALA A 1 16 ? -8.304  12.860  4.796   1.00 0.00 ? 16 ALA A HA   3  
ATOM   2061  H HB1  . ALA A 1 16 ? -7.599  14.750  6.716   1.00 0.00 ? 16 ALA A HB1  3  
ATOM   2062  H HB2  . ALA A 1 16 ? -9.158  14.660  5.860   1.00 0.00 ? 16 ALA A HB2  3  
ATOM   2063  N N    . GLY A 1 17 ? -5.813  12.995  4.919   1.00 0.00 ? 17 GLY A N    3  
ATOM   2064  C CA   . GLY A 1 17 ? -4.369  12.838  4.889   1.00 0.00 ? 17 GLY A CA   3  
ATOM   2065  C C    . GLY A 1 17 ? -3.967  11.606  4.076   1.00 0.00 ? 17 GLY A C    3  
ATOM   2066  O O    . GLY A 1 17 ? -3.014  11.654  3.299   1.00 0.00 ? 17 GLY A O    3  
ATOM   2067  H H    . GLY A 1 17 ? -6.209  13.418  4.104   1.00 0.00 ? 17 GLY A H    3  
ATOM   2068  H HA2  . GLY A 1 17 ? -3.911  13.728  4.457   1.00 0.00 ? 17 GLY A HA2  3  
ATOM   2069  H HA3  . GLY A 1 17 ? -3.988  12.746  5.907   1.00 0.00 ? 17 GLY A HA3  3  
ATOM   2070  N N    . LYS A 1 18 ? -4.714  10.531  4.281   1.00 0.00 ? 18 LYS A N    3  
ATOM   2071  C CA   . LYS A 1 18 ? -4.448  9.289   3.576   1.00 0.00 ? 18 LYS A CA   3  
ATOM   2072  C C    . LYS A 1 18 ? -5.365  9.194   2.356   1.00 0.00 ? 18 LYS A C    3  
ATOM   2073  O O    . LYS A 1 18 ? -6.495  8.718   2.459   1.00 0.00 ? 18 LYS A O    3  
ATOM   2074  C CB   . LYS A 1 18 ? -4.567  8.097   4.529   1.00 0.00 ? 18 LYS A CB   3  
ATOM   2075  C CG   . LYS A 1 18 ? -4.108  8.474   5.939   1.00 0.00 ? 18 LYS A CG   3  
ATOM   2076  C CD   . LYS A 1 18 ? -3.636  7.240   6.710   1.00 0.00 ? 18 LYS A CD   3  
ATOM   2077  C CE   . LYS A 1 18 ? -4.412  7.082   8.019   1.00 0.00 ? 18 LYS A CE   3  
ATOM   2078  N NZ   . LYS A 1 18 ? -3.603  6.345   9.016   1.00 0.00 ? 18 LYS A NZ   3  
ATOM   2079  H H    . LYS A 1 18 ? -5.488  10.501  4.915   1.00 0.00 ? 18 LYS A H    3  
ATOM   2080  H HA   . LYS A 1 18 ? -3.415  9.324   3.231   1.00 0.00 ? 18 LYS A HA   3  
ATOM   2081  H HB2  . LYS A 1 18 ? -5.600  7.751   4.559   1.00 0.00 ? 18 LYS A HB2  3  
ATOM   2082  H HB3  . LYS A 1 18 ? -3.965  7.268   4.156   1.00 0.00 ? 18 LYS A HB3  3  
ATOM   2083  H HG2  . LYS A 1 18 ? -3.298  9.201   5.879   1.00 0.00 ? 18 LYS A HG2  3  
ATOM   2084  H HG3  . LYS A 1 18 ? -4.927  8.952   6.476   1.00 0.00 ? 18 LYS A HG3  3  
ATOM   2085  H HD2  . LYS A 1 18 ? -3.768  6.349   6.095   1.00 0.00 ? 18 LYS A HD2  3  
ATOM   2086  H HD3  . LYS A 1 18 ? -2.571  7.324   6.923   1.00 0.00 ? 18 LYS A HD3  3  
ATOM   2087  H HE2  . LYS A 1 18 ? -4.679  8.063   8.412   1.00 0.00 ? 18 LYS A HE2  3  
ATOM   2088  H HE3  . LYS A 1 18 ? -5.345  6.549   7.834   1.00 0.00 ? 18 LYS A HE3  3  
ATOM   2089  H HZ1  . LYS A 1 18 ? -3.913  5.395   9.060   1.00 0.00 ? 18 LYS A HZ1  3  
ATOM   2090  H HZ2  . LYS A 1 18 ? -2.640  6.369   8.747   1.00 0.00 ? 18 LYS A HZ2  3  
ATOM   2091  N N    . ASN A 1 19 ? -4.845  9.654   1.227   1.00 0.00 ? 19 ASN A N    3  
ATOM   2092  C CA   . ASN A 1 19 ? -5.603  9.626   -0.012  1.00 0.00 ? 19 ASN A CA   3  
ATOM   2093  C C    . ASN A 1 19 ? -4.981  8.602   -0.963  1.00 0.00 ? 19 ASN A C    3  
ATOM   2094  O O    . ASN A 1 19 ? -5.299  8.579   -2.151  1.00 0.00 ? 19 ASN A O    3  
ATOM   2095  C CB   . ASN A 1 19 ? -5.576  10.991  -0.704  1.00 0.00 ? 19 ASN A CB   3  
ATOM   2096  C CG   . ASN A 1 19 ? -6.691  11.896  -0.175  1.00 0.00 ? 19 ASN A CG   3  
ATOM   2097  O OD1  . ASN A 1 19 ? -7.129  11.786  0.959   1.00 0.00 ? 19 ASN A OD1  3  
ATOM   2098  N ND2  . ASN A 1 19 ? -7.123  12.793  -1.055  1.00 0.00 ? 19 ASN A ND2  3  
ATOM   2099  H H    . ASN A 1 19 ? -3.925  10.039  1.152   1.00 0.00 ? 19 ASN A H    3  
ATOM   2100  H HA   . ASN A 1 19 ? -6.619  9.361   0.279   1.00 0.00 ? 19 ASN A HA   3  
ATOM   2101  H HB2  . ASN A 1 19 ? -4.609  11.466  -0.542  1.00 0.00 ? 19 ASN A HB2  3  
ATOM   2102  H HB3  . ASN A 1 19 ? -5.690  10.859  -1.780  1.00 0.00 ? 19 ASN A HB3  3  
ATOM   2103  H HD21 . ASN A 1 19 ? -6.720  12.831  -1.970  1.00 0.00 ? 19 ASN A HD21 3  
ATOM   2104  H HD22 . ASN A 1 19 ? -7.851  13.432  -0.803  1.00 0.00 ? 19 ASN A HD22 3  
ATOM   2105  N N    . LEU A 1 20 ? -4.104  7.780   -0.405  1.00 0.00 ? 20 LEU A N    3  
ATOM   2106  C CA   . LEU A 1 20 ? -3.434  6.756   -1.188  1.00 0.00 ? 20 LEU A CA   3  
ATOM   2107  C C    . LEU A 1 20 ? -3.362  5.463   -0.374  1.00 0.00 ? 20 LEU A C    3  
ATOM   2108  O O    . LEU A 1 20 ? -2.948  5.477   0.784   1.00 0.00 ? 20 LEU A O    3  
ATOM   2109  C CB   . LEU A 1 20 ? -2.071  7.256   -1.670  1.00 0.00 ? 20 LEU A CB   3  
ATOM   2110  C CG   . LEU A 1 20 ? -2.094  8.455   -2.620  1.00 0.00 ? 20 LEU A CG   3  
ATOM   2111  C CD1  . LEU A 1 20 ? -1.501  9.697   -1.951  1.00 0.00 ? 20 LEU A CD1  3  
ATOM   2112  C CD2  . LEU A 1 20 ? -1.392  8.124   -3.939  1.00 0.00 ? 20 LEU A CD2  3  
ATOM   2113  H H    . LEU A 1 20 ? -3.851  7.806   0.562   1.00 0.00 ? 20 LEU A H    3  
ATOM   2114  H HA   . LEU A 1 20 ? -4.042  6.573   -2.074  1.00 0.00 ? 20 LEU A HA   3  
ATOM   2115  H HB2  . LEU A 1 20 ? -1.474  7.521   -0.798  1.00 0.00 ? 20 LEU A HB2  3  
ATOM   2116  H HB3  . LEU A 1 20 ? -1.560  6.433   -2.169  1.00 0.00 ? 20 LEU A HB3  3  
ATOM   2117  H HG   . LEU A 1 20 ? -3.133  8.683   -2.858  1.00 0.00 ? 20 LEU A HG   3  
ATOM   2118  H HD11 . LEU A 1 20 ? -1.867  10.591  -2.455  1.00 0.00 ? 20 LEU A HD11 3  
ATOM   2119  H HD12 . LEU A 1 20 ? -1.800  9.722   -0.903  1.00 0.00 ? 20 LEU A HD12 3  
ATOM   2120  H HD21 . LEU A 1 20 ? -1.790  7.191   -4.338  1.00 0.00 ? 20 LEU A HD21 3  
ATOM   2121  H HD22 . LEU A 1 20 ? -1.564  8.928   -4.654  1.00 0.00 ? 20 LEU A HD22 3  
ATOM   2122  N N    . CYS A 1 21 ? -3.771  4.376   -1.012  1.00 0.00 ? 21 CYS A N    3  
ATOM   2123  C CA   . CYS A 1 21 ? -3.758  3.077   -0.361  1.00 0.00 ? 21 CYS A CA   3  
ATOM   2124  C C    . CYS A 1 21 ? -2.355  2.483   -0.501  1.00 0.00 ? 21 CYS A C    3  
ATOM   2125  O O    . CYS A 1 21 ? -1.747  2.562   -1.568  1.00 0.00 ? 21 CYS A O    3  
ATOM   2126  C CB   . CYS A 1 21 ? -4.831  2.147   -0.932  1.00 0.00 ? 21 CYS A CB   3  
ATOM   2127  S SG   . CYS A 1 21 ? -6.324  2.995   -1.564  1.00 0.00 ? 21 CYS A SG   3  
ATOM   2128  H H    . CYS A 1 21 ? -4.107  4.373   -1.954  1.00 0.00 ? 21 CYS A H    3  
ATOM   2129  H HA   . CYS A 1 21 ? -4.003  3.249   0.687   1.00 0.00 ? 21 CYS A HA   3  
ATOM   2130  H HB2  . CYS A 1 21 ? -4.392  1.563   -1.741  1.00 0.00 ? 21 CYS A HB2  3  
ATOM   2131  H HB3  . CYS A 1 21 ? -5.131  1.442   -0.157  1.00 0.00 ? 21 CYS A HB3  3  
ATOM   2132  N N    . TYR A 1 22 ? -1.881  1.903   0.591   1.00 0.00 ? 22 TYR A N    3  
ATOM   2133  C CA   . TYR A 1 22 ? -0.561  1.296   0.604   1.00 0.00 ? 22 TYR A CA   3  
ATOM   2134  C C    . TYR A 1 22 ? -0.648  -0.203  0.896   1.00 0.00 ? 22 TYR A C    3  
ATOM   2135  O O    . TYR A 1 22 ? -1.578  -0.656  1.561   1.00 0.00 ? 22 TYR A O    3  
ATOM   2136  C CB   . TYR A 1 22 ? 0.207   1.980   1.737   1.00 0.00 ? 22 TYR A CB   3  
ATOM   2137  C CG   . TYR A 1 22 ? -0.021  1.350   3.112   1.00 0.00 ? 22 TYR A CG   3  
ATOM   2138  C CD1  . TYR A 1 22 ? 0.731   0.262   3.506   1.00 0.00 ? 22 TYR A CD1  3  
ATOM   2139  C CD2  . TYR A 1 22 ? -0.979  1.869   3.959   1.00 0.00 ? 22 TYR A CD2  3  
ATOM   2140  C CE1  . TYR A 1 22 ? 0.517   -0.332  4.800   1.00 0.00 ? 22 TYR A CE1  3  
ATOM   2141  C CE2  . TYR A 1 22 ? -1.194  1.276   5.254   1.00 0.00 ? 22 TYR A CE2  3  
ATOM   2142  C CZ   . TYR A 1 22 ? -0.435  0.204   5.610   1.00 0.00 ? 22 TYR A CZ   3  
ATOM   2143  O OH   . TYR A 1 22 ? -0.638  -0.356  6.833   1.00 0.00 ? 22 TYR A OH   3  
ATOM   2144  H H    . TYR A 1 22 ? -2.382  1.843   1.455   1.00 0.00 ? 22 TYR A H    3  
ATOM   2145  H HA   . TYR A 1 22 ? -0.114  1.442   -0.380  1.00 0.00 ? 22 TYR A HA   3  
ATOM   2146  H HB2  . TYR A 1 22 ? 1.272   1.953   1.508   1.00 0.00 ? 22 TYR A HB2  3  
ATOM   2147  H HB3  . TYR A 1 22 ? -0.084  3.030   1.777   1.00 0.00 ? 22 TYR A HB3  3  
ATOM   2148  H HD1  . TYR A 1 22 ? 1.488   -0.148  2.837   1.00 0.00 ? 22 TYR A HD1  3  
ATOM   2149  H HD2  . TYR A 1 22 ? -1.573  2.729   3.648   1.00 0.00 ? 22 TYR A HD2  3  
ATOM   2150  H HE1  . TYR A 1 22 ? 1.104   -1.191  5.123   1.00 0.00 ? 22 TYR A HE1  3  
ATOM   2151  H HE2  . TYR A 1 22 ? -1.947  1.676   5.932   1.00 0.00 ? 22 TYR A HE2  3  
ATOM   2152  H HH   . TYR A 1 22 ? -1.524  -0.819  6.854   1.00 0.00 ? 22 TYR A HH   3  
ATOM   2153  N N    . LYS A 1 23 ? 0.333   -0.932  0.384   1.00 0.00 ? 23 LYS A N    3  
ATOM   2154  C CA   . LYS A 1 23 ? 0.378   -2.370  0.581   1.00 0.00 ? 23 LYS A CA   3  
ATOM   2155  C C    . LYS A 1 23 ? 1.815   -2.794  0.890   1.00 0.00 ? 23 LYS A C    3  
ATOM   2156  O O    . LYS A 1 23 ? 2.725   -2.535  0.103   1.00 0.00 ? 23 LYS A O    3  
ATOM   2157  C CB   . LYS A 1 23 ? -0.232  -3.095  -0.621  1.00 0.00 ? 23 LYS A CB   3  
ATOM   2158  C CG   . LYS A 1 23 ? 0.830   -3.381  -1.685  1.00 0.00 ? 23 LYS A CG   3  
ATOM   2159  C CD   . LYS A 1 23 ? 0.186   -3.607  -3.054  1.00 0.00 ? 23 LYS A CD   3  
ATOM   2160  C CE   . LYS A 1 23 ? 1.045   -4.533  -3.918  1.00 0.00 ? 23 LYS A CE   3  
ATOM   2161  N NZ   . LYS A 1 23 ? 0.737   -5.950  -3.623  1.00 0.00 ? 23 LYS A NZ   3  
ATOM   2162  H H    . LYS A 1 23 ? 1.085   -0.555  -0.157  1.00 0.00 ? 23 LYS A H    3  
ATOM   2163  H HA   . LYS A 1 23 ? -0.244  -2.601  1.446   1.00 0.00 ? 23 LYS A HA   3  
ATOM   2164  H HB2  . LYS A 1 23 ? -0.686  -4.031  -0.294  1.00 0.00 ? 23 LYS A HB2  3  
ATOM   2165  H HB3  . LYS A 1 23 ? -1.029  -2.488  -1.050  1.00 0.00 ? 23 LYS A HB3  3  
ATOM   2166  H HG2  . LYS A 1 23 ? 1.528   -2.547  -1.740  1.00 0.00 ? 23 LYS A HG2  3  
ATOM   2167  H HG3  . LYS A 1 23 ? 1.406   -4.262  -1.401  1.00 0.00 ? 23 LYS A HG3  3  
ATOM   2168  H HD2  . LYS A 1 23 ? -0.807  -4.039  -2.927  1.00 0.00 ? 23 LYS A HD2  3  
ATOM   2169  H HD3  . LYS A 1 23 ? 0.054   -2.650  -3.560  1.00 0.00 ? 23 LYS A HD3  3  
ATOM   2170  H HE2  . LYS A 1 23 ? 0.864   -4.327  -4.973  1.00 0.00 ? 23 LYS A HE2  3  
ATOM   2171  H HE3  . LYS A 1 23 ? 2.101   -4.337  -3.732  1.00 0.00 ? 23 LYS A HE3  3  
ATOM   2172  H HZ1  . LYS A 1 23 ? 1.590   -6.466  -3.541  1.00 0.00 ? 23 LYS A HZ1  3  
ATOM   2173  H HZ2  . LYS A 1 23 ? 0.228   -6.009  -2.764  1.00 0.00 ? 23 LYS A HZ2  3  
ATOM   2174  N N    . MET A 1 24 ? 1.975   -3.437  2.037   1.00 0.00 ? 24 MET A N    3  
ATOM   2175  C CA   . MET A 1 24 ? 3.287   -3.899  2.460   1.00 0.00 ? 24 MET A CA   3  
ATOM   2176  C C    . MET A 1 24 ? 3.408   -5.417  2.311   1.00 0.00 ? 24 MET A C    3  
ATOM   2177  O O    . MET A 1 24 ? 2.657   -6.166  2.934   1.00 0.00 ? 24 MET A O    3  
ATOM   2178  C CB   . MET A 1 24 ? 3.519   -3.508  3.920   1.00 0.00 ? 24 MET A CB   3  
ATOM   2179  C CG   . MET A 1 24 ? 3.691   -1.994  4.062   1.00 0.00 ? 24 MET A CG   3  
ATOM   2180  S SD   . MET A 1 24 ? 3.720   -1.542  5.789   1.00 0.00 ? 24 MET A SD   3  
ATOM   2181  C CE   . MET A 1 24 ? 4.911   -0.213  5.742   1.00 0.00 ? 24 MET A CE   3  
ATOM   2182  H H    . MET A 1 24 ? 1.230   -3.644  2.671   1.00 0.00 ? 24 MET A H    3  
ATOM   2183  H HA   . MET A 1 24 ? 3.998   -3.404  1.798   1.00 0.00 ? 24 MET A HA   3  
ATOM   2184  H HB2  . MET A 1 24 ? 2.677   -3.840  4.528   1.00 0.00 ? 24 MET A HB2  3  
ATOM   2185  H HB3  . MET A 1 24 ? 4.406   -4.015  4.300   1.00 0.00 ? 24 MET A HB3  3  
ATOM   2186  H HG2  . MET A 1 24 ? 4.616   -1.678  3.580   1.00 0.00 ? 24 MET A HG2  3  
ATOM   2187  H HG3  . MET A 1 24 ? 2.875   -1.478  3.557   1.00 0.00 ? 24 MET A HG3  3  
ATOM   2188  H HE1  . MET A 1 24 ? 4.583   0.592   6.398   1.00 0.00 ? 24 MET A HE1  3  
ATOM   2189  H HE2  . MET A 1 24 ? 5.881   -0.582  6.076   1.00 0.00 ? 24 MET A HE2  3  
ATOM   2190  N N    . PHE A 1 25 ? 4.358   -5.824  1.484   1.00 0.00 ? 25 PHE A N    3  
ATOM   2191  C CA   . PHE A 1 25 ? 4.587   -7.239  1.246   1.00 0.00 ? 25 PHE A CA   3  
ATOM   2192  C C    . PHE A 1 25 ? 6.084   -7.556  1.224   1.00 0.00 ? 25 PHE A C    3  
ATOM   2193  O O    . PHE A 1 25 ? 6.915   -6.654  1.321   1.00 0.00 ? 25 PHE A O    3  
ATOM   2194  C CB   . PHE A 1 25 ? 3.989   -7.565  -0.124  1.00 0.00 ? 25 PHE A CB   3  
ATOM   2195  C CG   . PHE A 1 25 ? 4.628   -6.796  -1.281  1.00 0.00 ? 25 PHE A CG   3  
ATOM   2196  C CD1  . PHE A 1 25 ? 5.743   -7.283  -1.889  1.00 0.00 ? 25 PHE A CD1  3  
ATOM   2197  C CD2  . PHE A 1 25 ? 4.080   -5.624  -1.703  1.00 0.00 ? 25 PHE A CD2  3  
ATOM   2198  C CE1  . PHE A 1 25 ? 6.336   -6.569  -2.963  1.00 0.00 ? 25 PHE A CE1  3  
ATOM   2199  C CE2  . PHE A 1 25 ? 4.673   -4.910  -2.778  1.00 0.00 ? 25 PHE A CE2  3  
ATOM   2200  C CZ   . PHE A 1 25 ? 5.788   -5.398  -3.385  1.00 0.00 ? 25 PHE A CZ   3  
ATOM   2201  H H    . PHE A 1 25 ? 4.965   -5.208  0.981   1.00 0.00 ? 25 PHE A H    3  
ATOM   2202  H HA   . PHE A 1 25 ? 4.114   -7.785  2.062   1.00 0.00 ? 25 PHE A HA   3  
ATOM   2203  H HB2  . PHE A 1 25 ? 4.093   -8.634  -0.310  1.00 0.00 ? 25 PHE A HB2  3  
ATOM   2204  H HB3  . PHE A 1 25 ? 2.920   -7.349  -0.103  1.00 0.00 ? 25 PHE A HB3  3  
ATOM   2205  H HD1  . PHE A 1 25 ? 6.181   -8.222  -1.551  1.00 0.00 ? 25 PHE A HD1  3  
ATOM   2206  H HD2  . PHE A 1 25 ? 3.187   -5.234  -1.217  1.00 0.00 ? 25 PHE A HD2  3  
ATOM   2207  H HE1  . PHE A 1 25 ? 7.229   -6.960  -3.450  1.00 0.00 ? 25 PHE A HE1  3  
ATOM   2208  H HE2  . PHE A 1 25 ? 4.235   -3.971  -3.116  1.00 0.00 ? 25 PHE A HE2  3  
ATOM   2209  H HZ   . PHE A 1 25 ? 6.244   -4.849  -4.210  1.00 0.00 ? 25 PHE A HZ   3  
ATOM   2210  N N    . MET A 1 26 ? 6.382   -8.841  1.095   1.00 0.00 ? 26 MET A N    3  
ATOM   2211  C CA   . MET A 1 26 ? 7.764   -9.288  1.059   1.00 0.00 ? 26 MET A CA   3  
ATOM   2212  C C    . MET A 1 26 ? 8.155   -9.747  -0.348  1.00 0.00 ? 26 MET A C    3  
ATOM   2213  O O    . MET A 1 26 ? 7.310   -10.216 -1.109  1.00 0.00 ? 26 MET A O    3  
ATOM   2214  C CB   . MET A 1 26 ? 7.953   -10.443 2.044   1.00 0.00 ? 26 MET A CB   3  
ATOM   2215  C CG   . MET A 1 26 ? 7.916   -9.943  3.489   1.00 0.00 ? 26 MET A CG   3  
ATOM   2216  S SD   . MET A 1 26 ? 7.337   -11.240 4.570   1.00 0.00 ? 26 MET A SD   3  
ATOM   2217  C CE   . MET A 1 26 ? 6.487   -10.263 5.798   1.00 0.00 ? 26 MET A CE   3  
ATOM   2218  H H    . MET A 1 26 ? 5.701   -9.568  1.017   1.00 0.00 ? 26 MET A H    3  
ATOM   2219  H HA   . MET A 1 26 ? 8.360   -8.421  1.344   1.00 0.00 ? 26 MET A HA   3  
ATOM   2220  H HB2  . MET A 1 26 ? 7.171   -11.187 1.893   1.00 0.00 ? 26 MET A HB2  3  
ATOM   2221  H HB3  . MET A 1 26 ? 8.905   -10.938 1.851   1.00 0.00 ? 26 MET A HB3  3  
ATOM   2222  H HG2  . MET A 1 26 ? 8.911   -9.619  3.796   1.00 0.00 ? 26 MET A HG2  3  
ATOM   2223  H HG3  . MET A 1 26 ? 7.261   -9.075  3.566   1.00 0.00 ? 26 MET A HG3  3  
ATOM   2224  H HE1  . MET A 1 26 ? 5.595   -10.795 6.131   1.00 0.00 ? 26 MET A HE1  3  
ATOM   2225  H HE2  . MET A 1 26 ? 7.147   -10.094 6.649   1.00 0.00 ? 26 MET A HE2  3  
ATOM   2226  N N    . VAL A 1 27 ? 9.437   -9.597  -0.650  1.00 0.00 ? 27 VAL A N    3  
ATOM   2227  C CA   . VAL A 1 27 ? 9.950   -9.990  -1.951  1.00 0.00 ? 27 VAL A CA   3  
ATOM   2228  C C    . VAL A 1 27 ? 9.684   -11.481 -2.170  1.00 0.00 ? 27 VAL A C    3  
ATOM   2229  O O    . VAL A 1 27 ? 9.781   -11.974 -3.293  1.00 0.00 ? 27 VAL A O    3  
ATOM   2230  C CB   . VAL A 1 27 ? 11.431  -9.624  -2.061  1.00 0.00 ? 27 VAL A CB   3  
ATOM   2231  C CG1  . VAL A 1 27 ? 12.290  -10.547 -1.195  1.00 0.00 ? 27 VAL A CG1  3  
ATOM   2232  C CG2  . VAL A 1 27 ? 11.896  -9.652  -3.519  1.00 0.00 ? 27 VAL A CG2  3  
ATOM   2233  H H    . VAL A 1 27 ? 10.117  -9.215  -0.025  1.00 0.00 ? 27 VAL A H    3  
ATOM   2234  H HA   . VAL A 1 27 ? 9.405   -9.422  -2.705  1.00 0.00 ? 27 VAL A HA   3  
ATOM   2235  H HB   . VAL A 1 27 ? 11.554  -8.607  -1.690  1.00 0.00 ? 27 VAL A HB   3  
ATOM   2236  H HG11 . VAL A 1 27 ? 12.939  -9.947  -0.557  1.00 0.00 ? 27 VAL A HG11 3  
ATOM   2237  H HG12 . VAL A 1 27 ? 11.644  -11.167 -0.573  1.00 0.00 ? 27 VAL A HG12 3  
ATOM   2238  H HG21 . VAL A 1 27 ? 12.127  -8.638  -3.846  1.00 0.00 ? 27 VAL A HG21 3  
ATOM   2239  H HG22 . VAL A 1 27 ? 12.787  -10.273 -3.604  1.00 0.00 ? 27 VAL A HG22 3  
ATOM   2240  N N    . ALA A 1 28 ? 9.355   -12.157 -1.079  1.00 0.00 ? 28 ALA A N    3  
ATOM   2241  C CA   . ALA A 1 28 ? 9.075   -13.582 -1.138  1.00 0.00 ? 28 ALA A CA   3  
ATOM   2242  C C    . ALA A 1 28 ? 8.340   -13.899 -2.442  1.00 0.00 ? 28 ALA A C    3  
ATOM   2243  O O    . ALA A 1 28 ? 8.652   -14.883 -3.110  1.00 0.00 ? 28 ALA A O    3  
ATOM   2244  C CB   . ALA A 1 28 ? 8.274   -13.996 0.098   1.00 0.00 ? 28 ALA A CB   3  
ATOM   2245  H H    . ALA A 1 28 ? 9.278   -11.748 -0.170  1.00 0.00 ? 28 ALA A H    3  
ATOM   2246  H HA   . ALA A 1 28 ? 10.029  -14.108 -1.130  1.00 0.00 ? 28 ALA A HA   3  
ATOM   2247  H HB1  . ALA A 1 28 ? 7.249   -14.228 -0.193  1.00 0.00 ? 28 ALA A HB1  3  
ATOM   2248  H HB2  . ALA A 1 28 ? 8.731   -14.876 0.550   1.00 0.00 ? 28 ALA A HB2  3  
ATOM   2249  N N    . ALA A 1 29 ? 7.378   -13.047 -2.764  1.00 0.00 ? 29 ALA A N    3  
ATOM   2250  C CA   . ALA A 1 29 ? 6.596   -13.225 -3.976  1.00 0.00 ? 29 ALA A CA   3  
ATOM   2251  C C    . ALA A 1 29 ? 6.048   -11.870 -4.428  1.00 0.00 ? 29 ALA A C    3  
ATOM   2252  O O    . ALA A 1 29 ? 5.851   -10.972 -3.610  1.00 0.00 ? 29 ALA A O    3  
ATOM   2253  C CB   . ALA A 1 29 ? 5.486   -14.247 -3.723  1.00 0.00 ? 29 ALA A CB   3  
ATOM   2254  H H    . ALA A 1 29 ? 7.130   -12.250 -2.214  1.00 0.00 ? 29 ALA A H    3  
ATOM   2255  H HA   . ALA A 1 29 ? 7.262   -13.614 -4.746  1.00 0.00 ? 29 ALA A HA   3  
ATOM   2256  H HB1  . ALA A 1 29 ? 5.771   -15.207 -4.154  1.00 0.00 ? 29 ALA A HB1  3  
ATOM   2257  H HB2  . ALA A 1 29 ? 5.336   -14.362 -2.649  1.00 0.00 ? 29 ALA A HB2  3  
ATOM   2258  N N    . PRO A 1 30 ? 5.812   -11.761 -5.762  1.00 0.00 ? 30 PRO A N    3  
ATOM   2259  C CA   . PRO A 1 30 ? 5.291   -10.531 -6.333  1.00 0.00 ? 30 PRO A CA   3  
ATOM   2260  C C    . PRO A 1 30 ? 3.802   -10.369 -6.020  1.00 0.00 ? 30 PRO A C    3  
ATOM   2261  O O    . PRO A 1 30 ? 3.221   -9.314  -6.274  1.00 0.00 ? 30 PRO A O    3  
ATOM   2262  C CB   . PRO A 1 30 ? 5.577   -10.635 -7.822  1.00 0.00 ? 30 PRO A CB   3  
ATOM   2263  C CG   . PRO A 1 30 ? 5.825   -12.109 -8.096  1.00 0.00 ? 30 PRO A CG   3  
ATOM   2264  C CD   . PRO A 1 30 ? 6.033   -12.804 -6.760  1.00 0.00 ? 30 PRO A CD   3  
ATOM   2265  H HA   . PRO A 1 30 ? 5.743   -9.739  -5.922  1.00 0.00 ? 30 PRO A HA   3  
ATOM   2266  H HB2  . PRO A 1 30 ? 4.737   -10.264 -8.408  1.00 0.00 ? 30 PRO A HB2  3  
ATOM   2267  H HB3  . PRO A 1 30 ? 6.446   -10.035 -8.095  1.00 0.00 ? 30 PRO A HB3  3  
ATOM   2268  H HG2  . PRO A 1 30 ? 4.979   -12.546 -8.626  1.00 0.00 ? 30 PRO A HG2  3  
ATOM   2269  H HG3  . PRO A 1 30 ? 6.701   -12.237 -8.733  1.00 0.00 ? 30 PRO A HG3  3  
ATOM   2270  H HD2  . PRO A 1 30 ? 5.335   -13.630 -6.631  1.00 0.00 ? 30 PRO A HD2  3  
ATOM   2271  H HD3  . PRO A 1 30 ? 7.038   -13.220 -6.683  1.00 0.00 ? 30 PRO A HD3  3  
ATOM   2272  N N    . HIS A 1 31 ? 3.225   -11.430 -5.475  1.00 0.00 ? 31 HIS A N    3  
ATOM   2273  C CA   . HIS A 1 31 ? 1.815   -11.419 -5.125  1.00 0.00 ? 31 HIS A CA   3  
ATOM   2274  C C    . HIS A 1 31 ? 1.605   -12.182 -3.816  1.00 0.00 ? 31 HIS A C    3  
ATOM   2275  O O    . HIS A 1 31 ? 1.002   -13.254 -3.807  1.00 0.00 ? 31 HIS A O    3  
ATOM   2276  C CB   . HIS A 1 31 ? 0.967   -11.969 -6.274  1.00 0.00 ? 31 HIS A CB   3  
ATOM   2277  C CG   . HIS A 1 31 ? -0.473  -11.514 -6.246  1.00 0.00 ? 31 HIS A CG   3  
ATOM   2278  N ND1  . HIS A 1 31 ? -1.232  -11.499 -5.088  1.00 0.00 ? 31 HIS A ND1  3  
ATOM   2279  C CD2  . HIS A 1 31 ? -1.284  -11.059 -7.244  1.00 0.00 ? 31 HIS A CD2  3  
ATOM   2280  C CE1  . HIS A 1 31 ? -2.443  -11.053 -5.388  1.00 0.00 ? 31 HIS A CE1  3  
ATOM   2281  N NE2  . HIS A 1 31 ? -2.474  -10.782 -6.724  1.00 0.00 ? 31 HIS A NE2  3  
ATOM   2282  H H    . HIS A 1 31 ? 3.705   -12.284 -5.272  1.00 0.00 ? 31 HIS A H    3  
ATOM   2283  H HA   . HIS A 1 31 ? 1.538   -10.376 -4.977  1.00 0.00 ? 31 HIS A HA   3  
ATOM   2284  H HB2  . HIS A 1 31 ? 1.414   -11.665 -7.220  1.00 0.00 ? 31 HIS A HB2  3  
ATOM   2285  H HB3  . HIS A 1 31 ? 0.994   -13.058 -6.244  1.00 0.00 ? 31 HIS A HB3  3  
ATOM   2286  H HD1  . HIS A 1 31 ? -0.919  -11.776 -4.180  1.00 0.00 ? 31 HIS A HD1  3  
ATOM   2287  H HD2  . HIS A 1 31 ? -1.002  -10.943 -8.290  1.00 0.00 ? 31 HIS A HD2  3  
ATOM   2288  H HE1  . HIS A 1 31 ? -3.270  -10.926 -4.689  1.00 0.00 ? 31 HIS A HE1  3  
ATOM   2289  N N    . VAL A 1 32 ? 2.115   -11.599 -2.741  1.00 0.00 ? 32 VAL A N    3  
ATOM   2290  C CA   . VAL A 1 32 ? 1.990   -12.210 -1.428  1.00 0.00 ? 32 VAL A CA   3  
ATOM   2291  C C    . VAL A 1 32 ? 2.136   -11.132 -0.353  1.00 0.00 ? 32 VAL A C    3  
ATOM   2292  O O    . VAL A 1 32 ? 3.195   -11.000 0.260   1.00 0.00 ? 32 VAL A O    3  
ATOM   2293  C CB   . VAL A 1 32 ? 3.007   -13.344 -1.280  1.00 0.00 ? 32 VAL A CB   3  
ATOM   2294  C CG1  . VAL A 1 32 ? 3.287   -13.641 0.194   1.00 0.00 ? 32 VAL A CG1  3  
ATOM   2295  C CG2  . VAL A 1 32 ? 2.537   -14.601 -2.014  1.00 0.00 ? 32 VAL A CG2  3  
ATOM   2296  H H    . VAL A 1 32 ? 2.604   -10.727 -2.756  1.00 0.00 ? 32 VAL A H    3  
ATOM   2297  H HA   . VAL A 1 32 ? 0.992   -12.642 -1.360  1.00 0.00 ? 32 VAL A HA   3  
ATOM   2298  H HB   . VAL A 1 32 ? 3.941   -13.018 -1.739  1.00 0.00 ? 32 VAL A HB   3  
ATOM   2299  H HG11 . VAL A 1 32 ? 2.385   -13.458 0.779   1.00 0.00 ? 32 VAL A HG11 3  
ATOM   2300  H HG12 . VAL A 1 32 ? 3.586   -14.683 0.305   1.00 0.00 ? 32 VAL A HG12 3  
ATOM   2301  H HG21 . VAL A 1 32 ? 1.451   -14.670 -1.957  1.00 0.00 ? 32 VAL A HG21 3  
ATOM   2302  H HG22 . VAL A 1 32 ? 2.843   -14.549 -3.059  1.00 0.00 ? 32 VAL A HG22 3  
ATOM   2303  N N    . PRO A 1 33 ? 1.029   -10.368 -0.150  1.00 0.00 ? 33 PRO A N    3  
ATOM   2304  C CA   . PRO A 1 33 ? 1.024   -9.306  0.841   1.00 0.00 ? 33 PRO A CA   3  
ATOM   2305  C C    . PRO A 1 33 ? 0.931   -9.878  2.257   1.00 0.00 ? 33 PRO A C    3  
ATOM   2306  O O    . PRO A 1 33 ? 0.452   -10.994 2.449   1.00 0.00 ? 33 PRO A O    3  
ATOM   2307  C CB   . PRO A 1 33 ? -0.164  -8.432  0.474   1.00 0.00 ? 33 PRO A CB   3  
ATOM   2308  C CG   . PRO A 1 33 ? -1.050  -9.286  -0.418  1.00 0.00 ? 33 PRO A CG   3  
ATOM   2309  C CD   . PRO A 1 33 ? -0.242  -10.496 -0.857  1.00 0.00 ? 33 PRO A CD   3  
ATOM   2310  H HA   . PRO A 1 33 ? 1.883   -8.796  0.808   1.00 0.00 ? 33 PRO A HA   3  
ATOM   2311  H HB2  . PRO A 1 33 ? -0.702  -8.110  1.366   1.00 0.00 ? 33 PRO A HB2  3  
ATOM   2312  H HB3  . PRO A 1 33 ? 0.160   -7.530  -0.045  1.00 0.00 ? 33 PRO A HB3  3  
ATOM   2313  H HG2  . PRO A 1 33 ? -1.945  -9.599  0.119   1.00 0.00 ? 33 PRO A HG2  3  
ATOM   2314  H HG3  . PRO A 1 33 ? -1.383  -8.714  -1.285  1.00 0.00 ? 33 PRO A HG3  3  
ATOM   2315  H HD2  . PRO A 1 33 ? -0.748  -11.426 -0.597  1.00 0.00 ? 33 PRO A HD2  3  
ATOM   2316  H HD3  . PRO A 1 33 ? -0.095  -10.504 -1.937  1.00 0.00 ? 33 PRO A HD3  3  
ATOM   2317  N N    . VAL A 1 34 ? 1.396   -9.086  3.212   1.00 0.00 ? 34 VAL A N    3  
ATOM   2318  C CA   . VAL A 1 34 ? 1.371   -9.499  4.605   1.00 0.00 ? 34 VAL A CA   3  
ATOM   2319  C C    . VAL A 1 34 ? 0.389   -8.616  5.377   1.00 0.00 ? 34 VAL A C    3  
ATOM   2320  O O    . VAL A 1 34 ? -0.366  -9.106  6.216   1.00 0.00 ? 34 VAL A O    3  
ATOM   2321  C CB   . VAL A 1 34 ? 2.786   -9.469  5.185   1.00 0.00 ? 34 VAL A CB   3  
ATOM   2322  C CG1  . VAL A 1 34 ? 3.398   -8.072  5.064   1.00 0.00 ? 34 VAL A CG1  3  
ATOM   2323  C CG2  . VAL A 1 34 ? 2.793   -9.946  6.639   1.00 0.00 ? 34 VAL A CG2  3  
ATOM   2324  H H    . VAL A 1 34 ? 1.783   -8.179  3.047   1.00 0.00 ? 34 VAL A H    3  
ATOM   2325  H HA   . VAL A 1 34 ? 1.015   -10.529 4.636   1.00 0.00 ? 34 VAL A HA   3  
ATOM   2326  H HB   . VAL A 1 34 ? 3.401   -10.155 4.604   1.00 0.00 ? 34 VAL A HB   3  
ATOM   2327  H HG11 . VAL A 1 34 ? 4.339   -8.038  5.613   1.00 0.00 ? 34 VAL A HG11 3  
ATOM   2328  H HG12 . VAL A 1 34 ? 3.582   -7.846  4.014   1.00 0.00 ? 34 VAL A HG12 3  
ATOM   2329  H HG21 . VAL A 1 34 ? 1.993   -10.671 6.787   1.00 0.00 ? 34 VAL A HG21 3  
ATOM   2330  H HG22 . VAL A 1 34 ? 3.752   -10.413 6.863   1.00 0.00 ? 34 VAL A HG22 3  
ATOM   2331  N N    . LYS A 1 35 ? 0.430   -7.329  5.067   1.00 0.00 ? 35 LYS A N    3  
ATOM   2332  C CA   . LYS A 1 35 ? -0.447  -6.372  5.721   1.00 0.00 ? 35 LYS A CA   3  
ATOM   2333  C C    . LYS A 1 35 ? -0.676  -5.178  4.792   1.00 0.00 ? 35 LYS A C    3  
ATOM   2334  O O    . LYS A 1 35 ? 0.163   -4.878  3.944   1.00 0.00 ? 35 LYS A O    3  
ATOM   2335  C CB   . LYS A 1 35 ? 0.110   -5.986  7.093   1.00 0.00 ? 35 LYS A CB   3  
ATOM   2336  C CG   . LYS A 1 35 ? -0.750  -4.904  7.749   1.00 0.00 ? 35 LYS A CG   3  
ATOM   2337  C CD   . LYS A 1 35 ? -0.092  -4.382  9.028   1.00 0.00 ? 35 LYS A CD   3  
ATOM   2338  C CE   . LYS A 1 35 ? -0.789  -3.113  9.524   1.00 0.00 ? 35 LYS A CE   3  
ATOM   2339  N NZ   . LYS A 1 35 ? -0.735  -3.036  11.001  1.00 0.00 ? 35 LYS A NZ   3  
ATOM   2340  H H    . LYS A 1 35 ? 1.047   -6.938  4.383   1.00 0.00 ? 35 LYS A H    3  
ATOM   2341  H HA   . LYS A 1 35 ? -1.403  -6.868  5.889   1.00 0.00 ? 35 LYS A HA   3  
ATOM   2342  H HB2  . LYS A 1 35 ? 0.147   -6.866  7.735   1.00 0.00 ? 35 LYS A HB2  3  
ATOM   2343  H HB3  . LYS A 1 35 ? 1.134   -5.627  6.986   1.00 0.00 ? 35 LYS A HB3  3  
ATOM   2344  H HG2  . LYS A 1 35 ? -0.900  -4.081  7.050   1.00 0.00 ? 35 LYS A HG2  3  
ATOM   2345  H HG3  . LYS A 1 35 ? -1.735  -5.309  7.981   1.00 0.00 ? 35 LYS A HG3  3  
ATOM   2346  H HD2  . LYS A 1 35 ? -0.133  -5.149  9.801   1.00 0.00 ? 35 LYS A HD2  3  
ATOM   2347  H HD3  . LYS A 1 35 ? 0.961   -4.173  8.841   1.00 0.00 ? 35 LYS A HD3  3  
ATOM   2348  H HE2  . LYS A 1 35 ? -0.310  -2.235  9.090   1.00 0.00 ? 35 LYS A HE2  3  
ATOM   2349  H HE3  . LYS A 1 35 ? -1.827  -3.107  9.191   1.00 0.00 ? 35 LYS A HE3  3  
ATOM   2350  H HZ1  . LYS A 1 35 ? -1.137  -2.172  11.304  1.00 0.00 ? 35 LYS A HZ1  3  
ATOM   2351  H HZ2  . LYS A 1 35 ? -1.248  -3.799  11.393  1.00 0.00 ? 35 LYS A HZ2  3  
ATOM   2352  N N    . ARG A 1 36 ? -1.814  -4.502  4.958   1.00 0.00 ? 36 ARG A N    3  
ATOM   2353  C CA   . ARG A 1 36 ? -2.148  -3.353  4.140   1.00 0.00 ? 36 ARG A CA   3  
ATOM   2354  C C    . ARG A 1 36 ? -2.879  -2.317  4.981   1.00 0.00 ? 36 ARG A C    3  
ATOM   2355  O O    . ARG A 1 36 ? -3.268  -2.596  6.113   1.00 0.00 ? 36 ARG A O    3  
ATOM   2356  C CB   . ARG A 1 36 ? -3.011  -3.801  2.964   1.00 0.00 ? 36 ARG A CB   3  
ATOM   2357  C CG   . ARG A 1 36 ? -2.177  -4.662  2.019   1.00 0.00 ? 36 ARG A CG   3  
ATOM   2358  C CD   . ARG A 1 36 ? -2.675  -6.103  2.071   1.00 0.00 ? 36 ARG A CD   3  
ATOM   2359  N NE   . ARG A 1 36 ? -4.060  -6.198  1.611   1.00 0.00 ? 36 ARG A NE   3  
ATOM   2360  C CZ   . ARG A 1 36 ? -4.626  -7.356  1.243   1.00 0.00 ? 36 ARG A CZ   3  
ATOM   2361  N NH1  . ARG A 1 36 ? -3.917  -8.492  1.291   1.00 0.00 ? 36 ARG A NH1  3  
ATOM   2362  N NH2  . ARG A 1 36 ? -5.900  -7.377  0.829   1.00 0.00 ? 36 ARG A NH2  3  
ATOM   2363  H H    . ARG A 1 36 ? -2.469  -4.791  5.669   1.00 0.00 ? 36 ARG A H    3  
ATOM   2364  H HA   . ARG A 1 36 ? -1.228  -2.912  3.756   1.00 0.00 ? 36 ARG A HA   3  
ATOM   2365  H HB2  . ARG A 1 36 ? -3.857  -4.381  3.334   1.00 0.00 ? 36 ARG A HB2  3  
ATOM   2366  H HB3  . ARG A 1 36 ? -3.378  -2.925  2.429   1.00 0.00 ? 36 ARG A HB3  3  
ATOM   2367  H HG2  . ARG A 1 36 ? -2.272  -4.281  1.002   1.00 0.00 ? 36 ARG A HG2  3  
ATOM   2368  H HG3  . ARG A 1 36 ? -1.131  -4.627  2.324   1.00 0.00 ? 36 ARG A HG3  3  
ATOM   2369  H HD2  . ARG A 1 36 ? -2.043  -6.723  1.435   1.00 0.00 ? 36 ARG A HD2  3  
ATOM   2370  H HD3  . ARG A 1 36 ? -2.614  -6.466  3.098   1.00 0.00 ? 36 ARG A HD3  3  
ATOM   2371  H HE   . ARG A 1 36 ? -4.603  -5.347  1.572   1.00 0.00 ? 36 ARG A HE   3  
ATOM   2372  H HH11 . ARG A 1 36 ? -2.957  -8.476  1.603   1.00 0.00 ? 36 ARG A HH11 3  
ATOM   2373  H HH12 . ARG A 1 36 ? -4.344  -9.365  1.014   1.00 0.00 ? 36 ARG A HH12 3  
ATOM   2374  H HH21 . ARG A 1 36 ? -6.434  -6.521  0.793   1.00 0.00 ? 36 ARG A HH21 3  
ATOM   2375  H HH22 . ARG A 1 36 ? -6.326  -8.250  0.552   1.00 0.00 ? 36 ARG A HH22 3  
ATOM   2376  N N    . GLY A 1 37 ? -3.047  -1.138  4.398   1.00 0.00 ? 37 GLY A N    3  
ATOM   2377  C CA   . GLY A 1 37 ? -3.729  -0.055  5.085   1.00 0.00 ? 37 GLY A CA   3  
ATOM   2378  C C    . GLY A 1 37 ? -3.714  1.223   4.243   1.00 0.00 ? 37 GLY A C    3  
ATOM   2379  O O    . GLY A 1 37 ? -3.313  1.200   3.080   1.00 0.00 ? 37 GLY A O    3  
ATOM   2380  H H    . GLY A 1 37 ? -2.727  -0.920  3.476   1.00 0.00 ? 37 GLY A H    3  
ATOM   2381  H HA2  . GLY A 1 37 ? -4.758  -0.344  5.296   1.00 0.00 ? 37 GLY A HA2  3  
ATOM   2382  H HA3  . GLY A 1 37 ? -3.247  0.133   6.044   1.00 0.00 ? 37 GLY A HA3  3  
ATOM   2383  N N    . CYS A 1 38 ? -4.157  2.307   4.863   1.00 0.00 ? 38 CYS A N    3  
ATOM   2384  C CA   . CYS A 1 38 ? -4.201  3.591   4.185   1.00 0.00 ? 38 CYS A CA   3  
ATOM   2385  C C    . CYS A 1 38 ? -3.002  4.421   4.651   1.00 0.00 ? 38 CYS A C    3  
ATOM   2386  O O    . CYS A 1 38 ? -2.534  4.264   5.777   1.00 0.00 ? 38 CYS A O    3  
ATOM   2387  C CB   . CYS A 1 38 ? -5.526  4.316   4.431   1.00 0.00 ? 38 CYS A CB   3  
ATOM   2388  S SG   . CYS A 1 38 ? -7.000  3.469   3.754   1.00 0.00 ? 38 CYS A SG   3  
ATOM   2389  H H    . CYS A 1 38 ? -4.482  2.317   5.809   1.00 0.00 ? 38 CYS A H    3  
ATOM   2390  H HA   . CYS A 1 38 ? -4.137  3.384   3.117   1.00 0.00 ? 38 CYS A HA   3  
ATOM   2391  H HB2  . CYS A 1 38 ? -5.659  4.446   5.505   1.00 0.00 ? 38 CYS A HB2  3  
ATOM   2392  H HB3  . CYS A 1 38 ? -5.465  5.313   3.994   1.00 0.00 ? 38 CYS A HB3  3  
ATOM   2393  N N    . ILE A 1 39 ? -2.540  5.285   3.760   1.00 0.00 ? 39 ILE A N    3  
ATOM   2394  C CA   . ILE A 1 39 ? -1.404  6.140   4.065   1.00 0.00 ? 39 ILE A CA   3  
ATOM   2395  C C    . ILE A 1 39 ? -1.452  7.382   3.173   1.00 0.00 ? 39 ILE A C    3  
ATOM   2396  O O    . ILE A 1 39 ? -2.306  7.487   2.294   1.00 0.00 ? 39 ILE A O    3  
ATOM   2397  C CB   . ILE A 1 39 ? -0.097  5.353   3.954   1.00 0.00 ? 39 ILE A CB   3  
ATOM   2398  C CG1  . ILE A 1 39 ? 0.856   5.710   5.097   1.00 0.00 ? 39 ILE A CG1  3  
ATOM   2399  C CG2  . ILE A 1 39 ? 0.551   5.556   2.583   1.00 0.00 ? 39 ILE A CG2  3  
ATOM   2400  C CD1  . ILE A 1 39 ? 0.473   4.972   6.381   1.00 0.00 ? 39 ILE A CD1  3  
ATOM   2401  H H    . ILE A 1 39 ? -2.926  5.407   2.845   1.00 0.00 ? 39 ILE A H    3  
ATOM   2402  H HA   . ILE A 1 39 ? -1.503  6.456   5.103   1.00 0.00 ? 39 ILE A HA   3  
ATOM   2403  H HB   . ILE A 1 39 ? -0.328  4.292   4.047   1.00 0.00 ? 39 ILE A HB   3  
ATOM   2404  H HG12 . ILE A 1 39 ? 1.878   5.453   4.816   1.00 0.00 ? 39 ILE A HG12 3  
ATOM   2405  H HG13 . ILE A 1 39 ? 0.834   6.786   5.271   1.00 0.00 ? 39 ILE A HG13 3  
ATOM   2406  H HG21 . ILE A 1 39 ? 1.542   5.103   2.579   1.00 0.00 ? 39 ILE A HG21 3  
ATOM   2407  H HG22 . ILE A 1 39 ? -0.067  5.087   1.816   1.00 0.00 ? 39 ILE A HG22 3  
ATOM   2408  H HD11 . ILE A 1 39 ? 0.003   4.022   6.128   1.00 0.00 ? 39 ILE A HD11 3  
ATOM   2409  H HD12 . ILE A 1 39 ? 1.368   4.787   6.975   1.00 0.00 ? 39 ILE A HD12 3  
ATOM   2410  N N    . ASP A 1 40 ? -0.532  8.320   3.405   1.00 0.00 ? 40 ASP A N    3  
ATOM   2411  C CA   . ASP A 1 40 ? -0.474  9.543   2.629   1.00 0.00 ? 40 ASP A CA   3  
ATOM   2412  C C    . ASP A 1 40 ? 0.717   9.495   1.682   1.00 0.00 ? 40 ASP A C    3  
ATOM   2413  O O    . ASP A 1 40 ? 0.579   9.782   0.495   1.00 0.00 ? 40 ASP A O    3  
ATOM   2414  C CB   . ASP A 1 40 ? -0.367  10.738  3.572   1.00 0.00 ? 40 ASP A CB   3  
ATOM   2415  C CG   . ASP A 1 40 ? 0.901   10.658  4.410   1.00 0.00 ? 40 ASP A CG   3  
ATOM   2416  O OD1  . ASP A 1 40 ? 1.207   9.537   4.871   1.00 0.00 ? 40 ASP A OD1  3  
ATOM   2417  O OD2  . ASP A 1 40 ? 1.541   11.719  4.574   1.00 0.00 ? 40 ASP A OD2  3  
ATOM   2418  H H    . ASP A 1 40 ? 0.147   8.185   4.140   1.00 0.00 ? 40 ASP A H    3  
ATOM   2419  H HA   . ASP A 1 40 ? -1.388  9.635   2.043   1.00 0.00 ? 40 ASP A HA   3  
ATOM   2420  H HB2  . ASP A 1 40 ? -0.351  11.657  2.985   1.00 0.00 ? 40 ASP A HB2  3  
ATOM   2421  H HB3  . ASP A 1 40 ? -1.233  10.750  4.234   1.00 0.00 ? 40 ASP A HB3  3  
ATOM   2422  H HD2  . ASP A 1 40 ? 2.329   11.603  5.110   1.00 0.00 ? 40 ASP A HD2  3  
ATOM   2423  N N    . VAL A 1 41 ? 1.863   9.129   2.239   1.00 0.00 ? 41 VAL A N    3  
ATOM   2424  C CA   . VAL A 1 41 ? 3.081   9.040   1.452   1.00 0.00 ? 41 VAL A CA   3  
ATOM   2425  C C    . VAL A 1 41 ? 3.657   7.628   1.570   1.00 0.00 ? 41 VAL A C    3  
ATOM   2426  O O    . VAL A 1 41 ? 3.540   6.991   2.615   1.00 0.00 ? 41 VAL A O    3  
ATOM   2427  C CB   . VAL A 1 41 ? 4.067   10.126  1.890   1.00 0.00 ? 41 VAL A CB   3  
ATOM   2428  C CG1  . VAL A 1 41 ? 5.425   9.940   1.210   1.00 0.00 ? 41 VAL A CG1  3  
ATOM   2429  C CG2  . VAL A 1 41 ? 3.503   11.521  1.616   1.00 0.00 ? 41 VAL A CG2  3  
ATOM   2430  H H    . VAL A 1 41 ? 1.966   8.897   3.206   1.00 0.00 ? 41 VAL A H    3  
ATOM   2431  H HA   . VAL A 1 41 ? 2.815   9.226   0.412   1.00 0.00 ? 41 VAL A HA   3  
ATOM   2432  H HB   . VAL A 1 41 ? 4.215   10.030  2.966   1.00 0.00 ? 41 VAL A HB   3  
ATOM   2433  H HG11 . VAL A 1 41 ? 6.102   9.419   1.887   1.00 0.00 ? 41 VAL A HG11 3  
ATOM   2434  H HG12 . VAL A 1 41 ? 5.298   9.352   0.301   1.00 0.00 ? 41 VAL A HG12 3  
ATOM   2435  H HG21 . VAL A 1 41 ? 3.892   11.891  0.667   1.00 0.00 ? 41 VAL A HG21 3  
ATOM   2436  H HG22 . VAL A 1 41 ? 2.415   11.470  1.567   1.00 0.00 ? 41 VAL A HG22 3  
ATOM   2437  N N    . CYS A 1 42 ? 4.266   7.179   0.482   1.00 0.00 ? 42 CYS A N    3  
ATOM   2438  C CA   . CYS A 1 42 ? 4.860   5.854   0.450   1.00 0.00 ? 42 CYS A CA   3  
ATOM   2439  C C    . CYS A 1 42 ? 6.330   5.976   0.857   1.00 0.00 ? 42 CYS A C    3  
ATOM   2440  O O    . CYS A 1 42 ? 7.033   6.873   0.395   1.00 0.00 ? 42 CYS A O    3  
ATOM   2441  C CB   . CYS A 1 42 ? 4.701   5.196   -0.923  1.00 0.00 ? 42 CYS A CB   3  
ATOM   2442  S SG   . CYS A 1 42 ? 4.027   3.495   -0.884  1.00 0.00 ? 42 CYS A SG   3  
ATOM   2443  H H    . CYS A 1 42 ? 4.357   7.704   -0.365  1.00 0.00 ? 42 CYS A H    3  
ATOM   2444  H HA   . CYS A 1 42 ? 4.309   5.246   1.167   1.00 0.00 ? 42 CYS A HA   3  
ATOM   2445  H HB2  . CYS A 1 42 ? 4.047   5.817   -1.534  1.00 0.00 ? 42 CYS A HB2  3  
ATOM   2446  H HB3  . CYS A 1 42 ? 5.673   5.175   -1.415  1.00 0.00 ? 42 CYS A HB3  3  
ATOM   2447  N N    . PRO A 1 43 ? 6.762   5.036   1.740   1.00 0.00 ? 43 PRO A N    3  
ATOM   2448  C CA   . PRO A 1 43 ? 8.135   5.030   2.215   1.00 0.00 ? 43 PRO A CA   3  
ATOM   2449  C C    . PRO A 1 43 ? 9.085   4.504   1.137   1.00 0.00 ? 43 PRO A C    3  
ATOM   2450  O O    . PRO A 1 43 ? 8.647   4.100   0.061   1.00 0.00 ? 43 PRO A O    3  
ATOM   2451  C CB   . PRO A 1 43 ? 8.116   4.165   3.464   1.00 0.00 ? 43 PRO A CB   3  
ATOM   2452  C CG   . PRO A 1 43 ? 6.839   3.344   3.382   1.00 0.00 ? 43 PRO A CG   3  
ATOM   2453  C CD   . PRO A 1 43 ? 5.957   3.959   2.308   1.00 0.00 ? 43 PRO A CD   3  
ATOM   2454  H HA   . PRO A 1 43 ? 8.438   5.963   2.414   1.00 0.00 ? 43 PRO A HA   3  
ATOM   2455  H HB2  . PRO A 1 43 ? 8.993   3.520   3.506   1.00 0.00 ? 43 PRO A HB2  3  
ATOM   2456  H HB3  . PRO A 1 43 ? 8.129   4.779   4.365   1.00 0.00 ? 43 PRO A HB3  3  
ATOM   2457  H HG2  . PRO A 1 43 ? 7.068   2.306   3.141   1.00 0.00 ? 43 PRO A HG2  3  
ATOM   2458  H HG3  . PRO A 1 43 ? 6.325   3.341   4.344   1.00 0.00 ? 43 PRO A HG3  3  
ATOM   2459  H HD2  . PRO A 1 43 ? 5.686   3.225   1.550   1.00 0.00 ? 43 PRO A HD2  3  
ATOM   2460  H HD3  . PRO A 1 43 ? 5.027   4.339   2.730   1.00 0.00 ? 43 PRO A HD3  3  
ATOM   2461  N N    . LYS A 1 44 ? 10.369  4.525   1.464   1.00 0.00 ? 44 LYS A N    3  
ATOM   2462  C CA   . LYS A 1 44 ? 11.385  4.055   0.537   1.00 0.00 ? 44 LYS A CA   3  
ATOM   2463  C C    . LYS A 1 44 ? 11.317  2.529   0.444   1.00 0.00 ? 44 LYS A C    3  
ATOM   2464  O O    . LYS A 1 44 ? 11.197  1.847   1.460   1.00 0.00 ? 44 LYS A O    3  
ATOM   2465  C CB   . LYS A 1 44 ? 12.763  4.586   0.938   1.00 0.00 ? 44 LYS A CB   3  
ATOM   2466  C CG   . LYS A 1 44 ? 13.861  3.975   0.065   1.00 0.00 ? 44 LYS A CG   3  
ATOM   2467  C CD   . LYS A 1 44 ? 14.125  4.840   -1.169  1.00 0.00 ? 44 LYS A CD   3  
ATOM   2468  C CE   . LYS A 1 44 ? 15.368  4.359   -1.920  1.00 0.00 ? 44 LYS A CE   3  
ATOM   2469  N NZ   . LYS A 1 44 ? 14.997  3.833   -3.252  1.00 0.00 ? 44 LYS A NZ   3  
ATOM   2470  H H    . LYS A 1 44 ? 10.718  4.855   2.341   1.00 0.00 ? 44 LYS A H    3  
ATOM   2471  H HA   . LYS A 1 44 ? 11.152  4.472   -0.442  1.00 0.00 ? 44 LYS A HA   3  
ATOM   2472  H HB2  . LYS A 1 44 ? 12.780  5.672   0.844   1.00 0.00 ? 44 LYS A HB2  3  
ATOM   2473  H HB3  . LYS A 1 44 ? 12.955  4.355   1.986   1.00 0.00 ? 44 LYS A HB3  3  
ATOM   2474  H HG2  . LYS A 1 44 ? 14.778  3.874   0.646   1.00 0.00 ? 44 LYS A HG2  3  
ATOM   2475  H HG3  . LYS A 1 44 ? 13.568  2.972   -0.245  1.00 0.00 ? 44 LYS A HG3  3  
ATOM   2476  H HD2  . LYS A 1 44 ? 13.260  4.809   -1.831  1.00 0.00 ? 44 LYS A HD2  3  
ATOM   2477  H HD3  . LYS A 1 44 ? 14.258  5.880   -0.867  1.00 0.00 ? 44 LYS A HD3  3  
ATOM   2478  H HE2  . LYS A 1 44 ? 16.074  5.182   -2.031  1.00 0.00 ? 44 LYS A HE2  3  
ATOM   2479  H HE3  . LYS A 1 44 ? 15.871  3.583   -1.343  1.00 0.00 ? 44 LYS A HE3  3  
ATOM   2480  H HZ1  . LYS A 1 44 ? 14.833  4.595   -3.878  1.00 0.00 ? 44 LYS A HZ1  3  
ATOM   2481  H HZ2  . LYS A 1 44 ? 15.741  3.266   -3.606  1.00 0.00 ? 44 LYS A HZ2  3  
ATOM   2482  N N    . SER A 1 45 ? 11.398  2.039   -0.784  1.00 0.00 ? 45 SER A N    3  
ATOM   2483  C CA   . SER A 1 45 ? 11.347  0.607   -1.023  1.00 0.00 ? 45 SER A CA   3  
ATOM   2484  C C    . SER A 1 45 ? 12.727  -0.011  -0.793  1.00 0.00 ? 45 SER A C    3  
ATOM   2485  O O    . SER A 1 45 ? 13.741  0.557   -1.197  1.00 0.00 ? 45 SER A O    3  
ATOM   2486  C CB   . SER A 1 45 ? 10.859  0.302   -2.441  1.00 0.00 ? 45 SER A CB   3  
ATOM   2487  O OG   . SER A 1 45 ? 9.437   0.225   -2.511  1.00 0.00 ? 45 SER A OG   3  
ATOM   2488  H H    . SER A 1 45 ? 11.496  2.602   -1.605  1.00 0.00 ? 45 SER A H    3  
ATOM   2489  H HA   . SER A 1 45 ? 10.629  0.219   -0.301  1.00 0.00 ? 45 SER A HA   3  
ATOM   2490  H HB2  . SER A 1 45 ? 11.214  1.077   -3.121  1.00 0.00 ? 45 SER A HB2  3  
ATOM   2491  H HB3  . SER A 1 45 ? 11.290  -0.640  -2.778  1.00 0.00 ? 45 SER A HB3  3  
ATOM   2492  H HG   . SER A 1 45 ? 9.109   0.704   -3.325  1.00 0.00 ? 45 SER A HG   3  
ATOM   2493  N N    . SER A 1 46 ? 12.722  -1.167  -0.145  1.00 0.00 ? 46 SER A N    3  
ATOM   2494  C CA   . SER A 1 46 ? 13.962  -1.868  0.144   1.00 0.00 ? 46 SER A CA   3  
ATOM   2495  C C    . SER A 1 46 ? 14.005  -3.191  -0.624  1.00 0.00 ? 46 SER A C    3  
ATOM   2496  O O    . SER A 1 46 ? 13.064  -3.529  -1.339  1.00 0.00 ? 46 SER A O    3  
ATOM   2497  C CB   . SER A 1 46 ? 14.115  -2.120  1.645   1.00 0.00 ? 46 SER A CB   3  
ATOM   2498  O OG   . SER A 1 46 ? 13.309  -3.208  2.089   1.00 0.00 ? 46 SER A OG   3  
ATOM   2499  H H    . SER A 1 46 ? 11.893  -1.622  0.180   1.00 0.00 ? 46 SER A H    3  
ATOM   2500  H HA   . SER A 1 46 ? 14.756  -1.203  -0.195  1.00 0.00 ? 46 SER A HA   3  
ATOM   2501  H HB2  . SER A 1 46 ? 15.161  -2.327  1.873   1.00 0.00 ? 46 SER A HB2  3  
ATOM   2502  H HB3  . SER A 1 46 ? 13.841  -1.219  2.194   1.00 0.00 ? 46 SER A HB3  3  
ATOM   2503  H HG   . SER A 1 46 ? 12.456  -3.237  1.568   1.00 0.00 ? 46 SER A HG   3  
ATOM   2504  N N    . LEU A 1 47 ? 15.108  -3.904  -0.449  1.00 0.00 ? 47 LEU A N    3  
ATOM   2505  C CA   . LEU A 1 47 ? 15.287  -5.182  -1.116  1.00 0.00 ? 47 LEU A CA   3  
ATOM   2506  C C    . LEU A 1 47 ? 14.513  -6.261  -0.357  1.00 0.00 ? 47 LEU A C    3  
ATOM   2507  O O    . LEU A 1 47 ? 13.754  -7.023  -0.955  1.00 0.00 ? 47 LEU A O    3  
ATOM   2508  C CB   . LEU A 1 47 ? 16.775  -5.496  -1.284  1.00 0.00 ? 47 LEU A CB   3  
ATOM   2509  C CG   . LEU A 1 47 ? 17.513  -4.693  -2.358  1.00 0.00 ? 47 LEU A CG   3  
ATOM   2510  C CD1  . LEU A 1 47 ? 19.028  -4.794  -2.173  1.00 0.00 ? 47 LEU A CD1  3  
ATOM   2511  C CD2  . LEU A 1 47 ? 17.076  -5.122  -3.760  1.00 0.00 ? 47 LEU A CD2  3  
ATOM   2512  H H    . LEU A 1 47 ? 15.870  -3.622  0.135   1.00 0.00 ? 47 LEU A H    3  
ATOM   2513  H HA   . LEU A 1 47 ? 14.862  -5.091  -2.116  1.00 0.00 ? 47 LEU A HA   3  
ATOM   2514  H HB2  . LEU A 1 47 ? 17.272  -5.328  -0.328  1.00 0.00 ? 47 LEU A HB2  3  
ATOM   2515  H HB3  . LEU A 1 47 ? 16.879  -6.556  -1.515  1.00 0.00 ? 47 LEU A HB3  3  
ATOM   2516  H HG   . LEU A 1 47 ? 17.244  -3.643  -2.244  1.00 0.00 ? 47 LEU A HG   3  
ATOM   2517  H HD11 . LEU A 1 47 ? 19.269  -5.711  -1.635  1.00 0.00 ? 47 LEU A HD11 3  
ATOM   2518  H HD12 . LEU A 1 47 ? 19.513  -4.808  -3.149  1.00 0.00 ? 47 LEU A HD12 3  
ATOM   2519  H HD21 . LEU A 1 47 ? 17.162  -4.277  -4.442  1.00 0.00 ? 47 LEU A HD21 3  
ATOM   2520  H HD22 . LEU A 1 47 ? 17.715  -5.935  -4.106  1.00 0.00 ? 47 LEU A HD22 3  
ATOM   2521  N N    . LEU A 1 48 ? 14.732  -6.293  0.950   1.00 0.00 ? 48 LEU A N    3  
ATOM   2522  C CA   . LEU A 1 48 ? 14.065  -7.267  1.797   1.00 0.00 ? 48 LEU A CA   3  
ATOM   2523  C C    . LEU A 1 48 ? 12.556  -7.201  1.551   1.00 0.00 ? 48 LEU A C    3  
ATOM   2524  O O    . LEU A 1 48 ? 11.935  -8.205  1.205   1.00 0.00 ? 48 LEU A O    3  
ATOM   2525  C CB   . LEU A 1 48 ? 14.459  -7.062  3.261   1.00 0.00 ? 48 LEU A CB   3  
ATOM   2526  C CG   . LEU A 1 48 ? 13.814  -8.017  4.268   1.00 0.00 ? 48 LEU A CG   3  
ATOM   2527  C CD1  . LEU A 1 48 ? 14.471  -9.397  4.214   1.00 0.00 ? 48 LEU A CD1  3  
ATOM   2528  C CD2  . LEU A 1 48 ? 13.841  -7.425  5.679   1.00 0.00 ? 48 LEU A CD2  3  
ATOM   2529  H H    . LEU A 1 48 ? 15.351  -5.671  1.428   1.00 0.00 ? 48 LEU A H    3  
ATOM   2530  H HA   . LEU A 1 48 ? 14.420  -8.254  1.502   1.00 0.00 ? 48 LEU A HA   3  
ATOM   2531  H HB2  . LEU A 1 48 ? 15.541  -7.157  3.342   1.00 0.00 ? 48 LEU A HB2  3  
ATOM   2532  H HB3  . LEU A 1 48 ? 14.206  -6.041  3.545   1.00 0.00 ? 48 LEU A HB3  3  
ATOM   2533  H HG   . LEU A 1 48 ? 12.767  -8.147  3.994   1.00 0.00 ? 48 LEU A HG   3  
ATOM   2534  H HD11 . LEU A 1 48 ? 15.555  -9.285  4.242   1.00 0.00 ? 48 LEU A HD11 3  
ATOM   2535  H HD12 . LEU A 1 48 ? 14.145  -9.989  5.069   1.00 0.00 ? 48 LEU A HD12 3  
ATOM   2536  H HD21 . LEU A 1 48 ? 13.798  -8.230  6.412   1.00 0.00 ? 48 LEU A HD21 3  
ATOM   2537  H HD22 . LEU A 1 48 ? 14.761  -6.856  5.817   1.00 0.00 ? 48 LEU A HD22 3  
ATOM   2538  N N    . VAL A 1 49 ? 12.009  -6.009  1.740   1.00 0.00 ? 49 VAL A N    3  
ATOM   2539  C CA   . VAL A 1 49 ? 10.585  -5.799  1.543   1.00 0.00 ? 49 VAL A CA   3  
ATOM   2540  C C    . VAL A 1 49 ? 10.374  -4.598  0.618   1.00 0.00 ? 49 VAL A C    3  
ATOM   2541  O O    . VAL A 1 49 ? 11.211  -3.699  0.563   1.00 0.00 ? 49 VAL A O    3  
ATOM   2542  C CB   . VAL A 1 49 ? 9.887   -5.642  2.895   1.00 0.00 ? 49 VAL A CB   3  
ATOM   2543  C CG1  . VAL A 1 49 ? 9.802   -6.983  3.627   1.00 0.00 ? 49 VAL A CG1  3  
ATOM   2544  C CG2  . VAL A 1 49 ? 10.591  -4.591  3.757   1.00 0.00 ? 49 VAL A CG2  3  
ATOM   2545  H H    . VAL A 1 49 ? 12.521  -5.197  2.021   1.00 0.00 ? 49 VAL A H    3  
ATOM   2546  H HA   . VAL A 1 49 ? 10.185  -6.690  1.058   1.00 0.00 ? 49 VAL A HA   3  
ATOM   2547  H HB   . VAL A 1 49 ? 8.870   -5.297  2.710   1.00 0.00 ? 49 VAL A HB   3  
ATOM   2548  H HG11 . VAL A 1 49 ? 8.800   -7.110  4.038   1.00 0.00 ? 49 VAL A HG11 3  
ATOM   2549  H HG12 . VAL A 1 49 ? 10.012  -7.793  2.928   1.00 0.00 ? 49 VAL A HG12 3  
ATOM   2550  H HG21 . VAL A 1 49 ? 11.605  -4.923  3.978   1.00 0.00 ? 49 VAL A HG21 3  
ATOM   2551  H HG22 . VAL A 1 49 ? 10.628  -3.645  3.217   1.00 0.00 ? 49 VAL A HG22 3  
ATOM   2552  N N    . LYS A 1 50 ? 9.251   -4.623  -0.084  1.00 0.00 ? 50 LYS A N    3  
ATOM   2553  C CA   . LYS A 1 50 ? 8.919   -3.548  -1.003  1.00 0.00 ? 50 LYS A CA   3  
ATOM   2554  C C    . LYS A 1 50 ? 7.508   -3.040  -0.699  1.00 0.00 ? 50 LYS A C    3  
ATOM   2555  O O    . LYS A 1 50 ? 6.704   -3.752  -0.099  1.00 0.00 ? 50 LYS A O    3  
ATOM   2556  C CB   . LYS A 1 50 ? 9.110   -4.003  -2.451  1.00 0.00 ? 50 LYS A CB   3  
ATOM   2557  C CG   . LYS A 1 50 ? 9.654   -2.864  -3.316  1.00 0.00 ? 50 LYS A CG   3  
ATOM   2558  C CD   . LYS A 1 50 ? 9.337   -3.099  -4.795  1.00 0.00 ? 50 LYS A CD   3  
ATOM   2559  C CE   . LYS A 1 50 ? 8.896   -1.801  -5.474  1.00 0.00 ? 50 LYS A CE   3  
ATOM   2560  N NZ   . LYS A 1 50 ? 9.498   -1.691  -6.822  1.00 0.00 ? 50 LYS A NZ   3  
ATOM   2561  H H    . LYS A 1 50 ? 8.575   -5.359  -0.033  1.00 0.00 ? 50 LYS A H    3  
ATOM   2562  H HA   . LYS A 1 50 ? 9.624   -2.736  -0.824  1.00 0.00 ? 50 LYS A HA   3  
ATOM   2563  H HB2  . LYS A 1 50 ? 9.797   -4.848  -2.483  1.00 0.00 ? 50 LYS A HB2  3  
ATOM   2564  H HB3  . LYS A 1 50 ? 8.159   -4.349  -2.856  1.00 0.00 ? 50 LYS A HB3  3  
ATOM   2565  H HG2  . LYS A 1 50 ? 9.220   -1.918  -2.993  1.00 0.00 ? 50 LYS A HG2  3  
ATOM   2566  H HG3  . LYS A 1 50 ? 10.733  -2.782  -3.180  1.00 0.00 ? 50 LYS A HG3  3  
ATOM   2567  H HD2  . LYS A 1 50 ? 10.217  -3.497  -5.300  1.00 0.00 ? 50 LYS A HD2  3  
ATOM   2568  H HD3  . LYS A 1 50 ? 8.550   -3.847  -4.887  1.00 0.00 ? 50 LYS A HD3  3  
ATOM   2569  H HE2  . LYS A 1 50 ? 7.809   -1.775  -5.551  1.00 0.00 ? 50 LYS A HE2  3  
ATOM   2570  H HE3  . LYS A 1 50 ? 9.193   -0.946  -4.866  1.00 0.00 ? 50 LYS A HE3  3  
ATOM   2571  H HZ1  . LYS A 1 50 ? 9.622   -2.605  -7.207  1.00 0.00 ? 50 LYS A HZ1  3  
ATOM   2572  H HZ2  . LYS A 1 50 ? 8.893   -1.158  -7.414  1.00 0.00 ? 50 LYS A HZ2  3  
ATOM   2573  N N    . TYR A 1 51 ? 7.250   -1.813  -1.128  1.00 0.00 ? 51 TYR A N    3  
ATOM   2574  C CA   . TYR A 1 51 ? 5.950   -1.202  -0.909  1.00 0.00 ? 51 TYR A CA   3  
ATOM   2575  C C    . TYR A 1 51 ? 5.403   -0.598  -2.204  1.00 0.00 ? 51 TYR A C    3  
ATOM   2576  O O    . TYR A 1 51 ? 6.162   -0.073  -3.017  1.00 0.00 ? 51 TYR A O    3  
ATOM   2577  C CB   . TYR A 1 51 ? 6.177   -0.080  0.106   1.00 0.00 ? 51 TYR A CB   3  
ATOM   2578  C CG   . TYR A 1 51 ? 7.137   -0.451  1.239   1.00 0.00 ? 51 TYR A CG   3  
ATOM   2579  C CD1  . TYR A 1 51 ? 6.936   -1.608  1.963   1.00 0.00 ? 51 TYR A CD1  3  
ATOM   2580  C CD2  . TYR A 1 51 ? 8.204   0.373   1.536   1.00 0.00 ? 51 TYR A CD2  3  
ATOM   2581  C CE1  . TYR A 1 51 ? 7.840   -1.957  3.028   1.00 0.00 ? 51 TYR A CE1  3  
ATOM   2582  C CE2  . TYR A 1 51 ? 9.108   0.024   2.601   1.00 0.00 ? 51 TYR A CE2  3  
ATOM   2583  C CZ   . TYR A 1 51 ? 8.881   -1.124  3.295   1.00 0.00 ? 51 TYR A CZ   3  
ATOM   2584  O OH   . TYR A 1 51 ? 9.734   -1.453  4.301   1.00 0.00 ? 51 TYR A OH   3  
ATOM   2585  H H    . TYR A 1 51 ? 7.909   -1.241  -1.615  1.00 0.00 ? 51 TYR A H    3  
ATOM   2586  H HA   . TYR A 1 51 ? 5.268   -1.978  -0.562  1.00 0.00 ? 51 TYR A HA   3  
ATOM   2587  H HB2  . TYR A 1 51 ? 6.566   0.794   -0.414  1.00 0.00 ? 51 TYR A HB2  3  
ATOM   2588  H HB3  . TYR A 1 51 ? 5.217   0.206   0.537   1.00 0.00 ? 51 TYR A HB3  3  
ATOM   2589  H HD1  . TYR A 1 51 ? 6.094   -2.259  1.728   1.00 0.00 ? 51 TYR A HD1  3  
ATOM   2590  H HD2  . TYR A 1 51 ? 8.362   1.287   0.964   1.00 0.00 ? 51 TYR A HD2  3  
ATOM   2591  H HE1  . TYR A 1 51 ? 7.693   -2.868  3.608   1.00 0.00 ? 51 TYR A HE1  3  
ATOM   2592  H HE2  . TYR A 1 51 ? 9.954   0.665   2.847   1.00 0.00 ? 51 TYR A HE2  3  
ATOM   2593  H HH   . TYR A 1 51 ? 9.587   -0.850  5.086   1.00 0.00 ? 51 TYR A HH   3  
ATOM   2594  N N    . VAL A 1 52 ? 4.090   -0.693  -2.356  1.00 0.00 ? 52 VAL A N    3  
ATOM   2595  C CA   . VAL A 1 52 ? 3.433   -0.163  -3.538  1.00 0.00 ? 52 VAL A CA   3  
ATOM   2596  C C    . VAL A 1 52 ? 2.250   0.709   -3.111  1.00 0.00 ? 52 VAL A C    3  
ATOM   2597  O O    . VAL A 1 52 ? 1.433   0.294   -2.291  1.00 0.00 ? 52 VAL A O    3  
ATOM   2598  C CB   . VAL A 1 52 ? 3.027   -1.307  -4.469  1.00 0.00 ? 52 VAL A CB   3  
ATOM   2599  C CG1  . VAL A 1 52 ? 2.151   -0.797  -5.615  1.00 0.00 ? 52 VAL A CG1  3  
ATOM   2600  C CG2  . VAL A 1 52 ? 4.258   -2.042  -5.004  1.00 0.00 ? 52 VAL A CG2  3  
ATOM   2601  H H    . VAL A 1 52 ? 3.480   -1.122  -1.689  1.00 0.00 ? 52 VAL A H    3  
ATOM   2602  H HA   . VAL A 1 52 ? 4.156   0.460   -4.065  1.00 0.00 ? 52 VAL A HA   3  
ATOM   2603  H HB   . VAL A 1 52 ? 2.439   -2.018  -3.889  1.00 0.00 ? 52 VAL A HB   3  
ATOM   2604  H HG11 . VAL A 1 52 ? 2.642   -1.004  -6.566  1.00 0.00 ? 52 VAL A HG11 3  
ATOM   2605  H HG12 . VAL A 1 52 ? 1.186   -1.302  -5.587  1.00 0.00 ? 52 VAL A HG12 3  
ATOM   2606  H HG21 . VAL A 1 52 ? 4.540   -1.622  -5.970  1.00 0.00 ? 52 VAL A HG21 3  
ATOM   2607  H HG22 . VAL A 1 52 ? 5.084   -1.925  -4.302  1.00 0.00 ? 52 VAL A HG22 3  
ATOM   2608  N N    . CYS A 1 53 ? 2.197   1.901   -3.687  1.00 0.00 ? 53 CYS A N    3  
ATOM   2609  C CA   . CYS A 1 53 ? 1.127   2.835   -3.376  1.00 0.00 ? 53 CYS A CA   3  
ATOM   2610  C C    . CYS A 1 53 ? 0.369   3.143   -4.669  1.00 0.00 ? 53 CYS A C    3  
ATOM   2611  O O    . CYS A 1 53 ? 0.920   3.020   -5.761  1.00 0.00 ? 53 CYS A O    3  
ATOM   2612  C CB   . CYS A 1 53 ? 1.661   4.105   -2.710  1.00 0.00 ? 53 CYS A CB   3  
ATOM   2613  S SG   . CYS A 1 53 ? 1.977   3.955   -0.914  1.00 0.00 ? 53 CYS A SG   3  
ATOM   2614  H H    . CYS A 1 53 ? 2.865   2.231   -4.353  1.00 0.00 ? 53 CYS A H    3  
ATOM   2615  H HA   . CYS A 1 53 ? 0.478   2.338   -2.655  1.00 0.00 ? 53 CYS A HA   3  
ATOM   2616  H HB2  . CYS A 1 53 ? 2.588   4.395   -3.205  1.00 0.00 ? 53 CYS A HB2  3  
ATOM   2617  H HB3  . CYS A 1 53 ? 0.946   4.911   -2.873  1.00 0.00 ? 53 CYS A HB3  3  
ATOM   2618  N N    . CYS A 1 54 ? -0.884  3.539   -4.501  1.00 0.00 ? 54 CYS A N    3  
ATOM   2619  C CA   . CYS A 1 54 ? -1.724  3.867   -5.641  1.00 0.00 ? 54 CYS A CA   3  
ATOM   2620  C C    . CYS A 1 54 ? -2.929  4.664   -5.136  1.00 0.00 ? 54 CYS A C    3  
ATOM   2621  O O    . CYS A 1 54 ? -3.403  4.441   -4.023  1.00 0.00 ? 54 CYS A O    3  
ATOM   2622  C CB   . CYS A 1 54 ? -2.151  2.613   -6.408  1.00 0.00 ? 54 CYS A CB   3  
ATOM   2623  S SG   . CYS A 1 54 ? -2.150  1.072   -5.422  1.00 0.00 ? 54 CYS A SG   3  
ATOM   2624  H H    . CYS A 1 54 ? -1.326  3.637   -3.609  1.00 0.00 ? 54 CYS A H    3  
ATOM   2625  H HA   . CYS A 1 54 ? -1.116  4.469   -6.315  1.00 0.00 ? 54 CYS A HA   3  
ATOM   2626  H HB2  . CYS A 1 54 ? -3.152  2.772   -6.807  1.00 0.00 ? 54 CYS A HB2  3  
ATOM   2627  H HB3  . CYS A 1 54 ? -1.484  2.483   -7.261  1.00 0.00 ? 54 CYS A HB3  3  
ATOM   2628  N N    . ASN A 1 55 ? -3.389  5.577   -5.979  1.00 0.00 ? 55 ASN A N    3  
ATOM   2629  C CA   . ASN A 1 55 ? -4.529  6.408   -5.633  1.00 0.00 ? 55 ASN A CA   3  
ATOM   2630  C C    . ASN A 1 55 ? -5.746  5.963   -6.447  1.00 0.00 ? 55 ASN A C    3  
ATOM   2631  O O    . ASN A 1 55 ? -6.266  6.726   -7.259  1.00 0.00 ? 55 ASN A O    3  
ATOM   2632  C CB   . ASN A 1 55 ? -4.256  7.879   -5.956  1.00 0.00 ? 55 ASN A CB   3  
ATOM   2633  C CG   . ASN A 1 55 ? -3.692  8.034   -7.370  1.00 0.00 ? 55 ASN A CG   3  
ATOM   2634  O OD1  . ASN A 1 55 ? -3.722  7.124   -8.182  1.00 0.00 ? 55 ASN A OD1  3  
ATOM   2635  N ND2  . ASN A 1 55 ? -3.177  9.235   -7.617  1.00 0.00 ? 55 ASN A ND2  3  
ATOM   2636  H H    . ASN A 1 55 ? -2.997  5.751   -6.883  1.00 0.00 ? 55 ASN A H    3  
ATOM   2637  H HA   . ASN A 1 55 ? -4.670  6.269   -4.561  1.00 0.00 ? 55 ASN A HA   3  
ATOM   2638  H HB2  . ASN A 1 55 ? -5.179  8.452   -5.864  1.00 0.00 ? 55 ASN A HB2  3  
ATOM   2639  H HB3  . ASN A 1 55 ? -3.553  8.290   -5.232  1.00 0.00 ? 55 ASN A HB3  3  
ATOM   2640  H HD21 . ASN A 1 55 ? -3.183  9.938   -6.907  1.00 0.00 ? 55 ASN A HD21 3  
ATOM   2641  H HD22 . ASN A 1 55 ? -2.782  9.434   -8.515  1.00 0.00 ? 55 ASN A HD22 3  
ATOM   2642  N N    . THR A 1 56 ? -6.164  4.730   -6.200  1.00 0.00 ? 56 THR A N    3  
ATOM   2643  C CA   . THR A 1 56 ? -7.309  4.174   -6.900  1.00 0.00 ? 56 THR A CA   3  
ATOM   2644  C C    . THR A 1 56 ? -8.154  3.324   -5.949  1.00 0.00 ? 56 THR A C    3  
ATOM   2645  O O    . THR A 1 56 ? -7.628  2.730   -5.009  1.00 0.00 ? 56 THR A O    3  
ATOM   2646  C CB   . THR A 1 56 ? -6.792  3.397   -8.112  1.00 0.00 ? 56 THR A CB   3  
ATOM   2647  O OG1  . THR A 1 56 ? -5.777  2.552   -7.576  1.00 0.00 ? 56 THR A OG1  3  
ATOM   2648  C CG2  . THR A 1 56 ? -6.045  4.291   -9.105  1.00 0.00 ? 56 THR A CG2  3  
ATOM   2649  H H    . THR A 1 56 ? -5.734  4.116   -5.537  1.00 0.00 ? 56 THR A H    3  
ATOM   2650  H HA   . THR A 1 56 ? -7.939  4.998   -7.237  1.00 0.00 ? 56 THR A HA   3  
ATOM   2651  H HB   . THR A 1 56 ? -7.602  2.859   -8.604  1.00 0.00 ? 56 THR A HB   3  
ATOM   2652  H HG1  . THR A 1 56 ? -5.917  1.612   -7.885  1.00 0.00 ? 56 THR A HG1  3  
ATOM   2653  H HG21 . THR A 1 56 ? -6.294  3.990   -10.123 1.00 0.00 ? 56 THR A HG21 3  
ATOM   2654  H HG22 . THR A 1 56 ? -6.339  5.329   -8.951  1.00 0.00 ? 56 THR A HG22 3  
ATOM   2655  N N    . ASP A 1 57 ? -9.464  3.270   -6.198  1.00 0.00 ? 57 ASP A N    3  
ATOM   2656  C CA   . ASP A 1 57 ? -10.369 2.500   -5.370  1.00 0.00 ? 57 ASP A CA   3  
ATOM   2657  C C    . ASP A 1 57 ? -10.006 1.024   -5.444  1.00 0.00 ? 57 ASP A C    3  
ATOM   2658  O O    . ASP A 1 57 ? -9.991  0.441   -6.526  1.00 0.00 ? 57 ASP A O    3  
ATOM   2659  C CB   . ASP A 1 57 ? -11.804 2.729   -5.837  1.00 0.00 ? 57 ASP A CB   3  
ATOM   2660  C CG   . ASP A 1 57 ? -12.453 3.868   -5.064  1.00 0.00 ? 57 ASP A CG   3  
ATOM   2661  O OD1  . ASP A 1 57 ? -12.128 3.996   -3.863  1.00 0.00 ? 57 ASP A OD1  3  
ATOM   2662  O OD2  . ASP A 1 57 ? -13.261 4.589   -5.687  1.00 0.00 ? 57 ASP A OD2  3  
ATOM   2663  H H    . ASP A 1 57 ? -9.846  3.777   -6.984  1.00 0.00 ? 57 ASP A H    3  
ATOM   2664  H HA   . ASP A 1 57 ? -10.276 2.835   -4.336  1.00 0.00 ? 57 ASP A HA   3  
ATOM   2665  H HB2  . ASP A 1 57 ? -11.800 2.974   -6.899  1.00 0.00 ? 57 ASP A HB2  3  
ATOM   2666  H HB3  . ASP A 1 57 ? -12.381 1.817   -5.681  1.00 0.00 ? 57 ASP A HB3  3  
ATOM   2667  H HD2  . ASP A 1 57 ? -13.635 5.288   -5.146  1.00 0.00 ? 57 ASP A HD2  3  
ATOM   2668  N N    . LYS A 1 58 ? -9.722  0.457   -4.280  1.00 0.00 ? 58 LYS A N    3  
ATOM   2669  C CA   . LYS A 1 58 ? -9.358  -0.948  -4.203  1.00 0.00 ? 58 LYS A CA   3  
ATOM   2670  C C    . LYS A 1 58 ? -8.109  -1.195  -5.052  1.00 0.00 ? 58 LYS A C    3  
ATOM   2671  O O    . LYS A 1 58 ? -8.109  -2.062  -5.925  1.00 0.00 ? 58 LYS A O    3  
ATOM   2672  C CB   . LYS A 1 58 ? -10.547 -1.832  -4.586  1.00 0.00 ? 58 LYS A CB   3  
ATOM   2673  C CG   . LYS A 1 58 ? -10.924 -2.771  -3.439  1.00 0.00 ? 58 LYS A CG   3  
ATOM   2674  C CD   . LYS A 1 58 ? -11.271 -4.166  -3.963  1.00 0.00 ? 58 LYS A CD   3  
ATOM   2675  C CE   . LYS A 1 58 ? -12.777 -4.306  -4.192  1.00 0.00 ? 58 LYS A CE   3  
ATOM   2676  N NZ   . LYS A 1 58 ? -13.046 -5.195  -5.345  1.00 0.00 ? 58 LYS A NZ   3  
ATOM   2677  H H    . LYS A 1 58 ? -9.737  0.938   -3.404  1.00 0.00 ? 58 LYS A H    3  
ATOM   2678  H HA   . LYS A 1 58 ? -9.116  -1.166  -3.162  1.00 0.00 ? 58 LYS A HA   3  
ATOM   2679  H HB2  . LYS A 1 58 ? -11.401 -1.206  -4.845  1.00 0.00 ? 58 LYS A HB2  3  
ATOM   2680  H HB3  . LYS A 1 58 ? -10.300 -2.415  -5.472  1.00 0.00 ? 58 LYS A HB3  3  
ATOM   2681  H HG2  . LYS A 1 58 ? -10.096 -2.840  -2.733  1.00 0.00 ? 58 LYS A HG2  3  
ATOM   2682  H HG3  . LYS A 1 58 ? -11.774 -2.361  -2.893  1.00 0.00 ? 58 LYS A HG3  3  
ATOM   2683  H HD2  . LYS A 1 58 ? -10.739 -4.350  -4.897  1.00 0.00 ? 58 LYS A HD2  3  
ATOM   2684  H HD3  . LYS A 1 58 ? -10.936 -4.920  -3.251  1.00 0.00 ? 58 LYS A HD3  3  
ATOM   2685  H HE2  . LYS A 1 58 ? -13.251 -4.709  -3.297  1.00 0.00 ? 58 LYS A HE2  3  
ATOM   2686  H HE3  . LYS A 1 58 ? -13.217 -3.325  -4.371  1.00 0.00 ? 58 LYS A HE3  3  
ATOM   2687  H HZ1  . LYS A 1 58 ? -12.244 -5.218  -5.941  1.00 0.00 ? 58 LYS A HZ1  3  
ATOM   2688  H HZ2  . LYS A 1 58 ? -13.243 -6.118  -5.015  1.00 0.00 ? 58 LYS A HZ2  3  
ATOM   2689  N N    . CYS A 1 59 ? -7.075  -0.417  -4.767  1.00 0.00 ? 59 CYS A N    3  
ATOM   2690  C CA   . CYS A 1 59 ? -5.823  -0.540  -5.494  1.00 0.00 ? 59 CYS A CA   3  
ATOM   2691  C C    . CYS A 1 59 ? -4.960  -1.588  -4.789  1.00 0.00 ? 59 CYS A C    3  
ATOM   2692  O O    . CYS A 1 59 ? -4.412  -2.481  -5.434  1.00 0.00 ? 59 CYS A O    3  
ATOM   2693  C CB   . CYS A 1 59 ? -5.104  0.805   -5.614  1.00 0.00 ? 59 CYS A CB   3  
ATOM   2694  S SG   . CYS A 1 59 ? -3.860  1.129   -4.312  1.00 0.00 ? 59 CYS A SG   3  
ATOM   2695  H H    . CYS A 1 59 ? -7.084  0.286   -4.056  1.00 0.00 ? 59 CYS A H    3  
ATOM   2696  H HA   . CYS A 1 59 ? -6.078  -0.863  -6.504  1.00 0.00 ? 59 CYS A HA   3  
ATOM   2697  H HB2  . CYS A 1 59 ? -4.613  0.854   -6.586  1.00 0.00 ? 59 CYS A HB2  3  
ATOM   2698  H HB3  . CYS A 1 59 ? -5.848  1.602   -5.592  1.00 0.00 ? 59 CYS A HB3  3  
ATOM   2699  N N    . ASN A 1 60 ? -4.865  -1.444  -3.476  1.00 0.00 ? 60 ASN A N    3  
ATOM   2700  C CA   . ASN A 1 60 ? -4.077  -2.367  -2.677  1.00 0.00 ? 60 ASN A CA   3  
ATOM   2701  C C    . ASN A 1 60 ? -4.927  -3.593  -2.337  1.00 0.00 ? 60 ASN A C    3  
ATOM   2702  O O    . ASN A 1 60 ? -6.121  -3.626  -2.628  1.00 0.00 ? 60 ASN A O    3  
ATOM   2703  C CB   . ASN A 1 60 ? -3.635  -1.719  -1.363  1.00 0.00 ? 60 ASN A CB   3  
ATOM   2704  C CG   . ASN A 1 60 ? -4.794  -1.654  -0.366  1.00 0.00 ? 60 ASN A CG   3  
ATOM   2705  O OD1  . ASN A 1 60 ? -5.959  -1.715  -0.724  1.00 0.00 ? 60 ASN A OD1  3  
ATOM   2706  N ND2  . ASN A 1 60 ? -4.411  -1.527  0.901   1.00 0.00 ? 60 ASN A ND2  3  
ATOM   2707  H H    . ASN A 1 60 ? -5.313  -0.714  -2.959  1.00 0.00 ? 60 ASN A H    3  
ATOM   2708  H HA   . ASN A 1 60 ? -3.214  -2.616  -3.294  1.00 0.00 ? 60 ASN A HA   3  
ATOM   2709  H HB2  . ASN A 1 60 ? -2.811  -2.289  -0.932  1.00 0.00 ? 60 ASN A HB2  3  
ATOM   2710  H HB3  . ASN A 1 60 ? -3.260  -0.714  -1.557  1.00 0.00 ? 60 ASN A HB3  3  
ATOM   2711  H HD21 . ASN A 1 60 ? -3.438  -1.482  1.127   1.00 0.00 ? 60 ASN A HD21 3  
ATOM   2712  H HD22 . ASN A 1 60 ? -5.096  -1.475  1.627   1.00 0.00 ? 60 ASN A HD22 3  
HETATM 2713  O O    . HOH B 2 .  ? 5.040   -10.656 2.154   1.00 0.00 ? 61 HOH A O    3  
HETATM 2714  H H1   . HOH B 2 .  ? 4.969   -11.362 1.511   1.00 0.00 ? 61 HOH A H1   3  
HETATM 2715  H H2   . HOH B 2 .  ? 4.138   -10.362 2.286   1.00 0.00 ? 61 HOH A H2   3  
HETATM 2716  O O    . HOH B 2 .  ? 5.631   -16.718 -6.169  1.00 0.00 ? 62 HOH A O    3  
HETATM 2717  H H1   . HOH B 2 .  ? 5.440   -15.804 -5.956  1.00 0.00 ? 62 HOH A H1   3  
HETATM 2718  H H2   . HOH B 2 .  ? 5.049   -16.918 -6.903  1.00 0.00 ? 62 HOH A H2   3  
ATOM   2719  N N    . LEU A 1 1  ? -11.359 7.947   -0.569  1.00 0.00 ? 1  LEU A N    4  
ATOM   2720  C CA   . LEU A 1 1  ? -11.283 6.763   -1.407  1.00 0.00 ? 1  LEU A CA   4  
ATOM   2721  C C    . LEU A 1 1  ? -11.553 5.522   -0.555  1.00 0.00 ? 1  LEU A C    4  
ATOM   2722  O O    . LEU A 1 1  ? -11.281 5.517   0.645   1.00 0.00 ? 1  LEU A O    4  
ATOM   2723  C CB   . LEU A 1 1  ? -9.947  6.719   -2.152  1.00 0.00 ? 1  LEU A CB   4  
ATOM   2724  C CG   . LEU A 1 1  ? -9.854  7.578   -3.415  1.00 0.00 ? 1  LEU A CG   4  
ATOM   2725  C CD1  . LEU A 1 1  ? -8.596  8.448   -3.394  1.00 0.00 ? 1  LEU A CD1  4  
ATOM   2726  C CD2  . LEU A 1 1  ? -9.933  6.712   -4.674  1.00 0.00 ? 1  LEU A CD2  4  
ATOM   2727  H H    . LEU A 1 1  ? -12.216 8.458   -0.635  1.00 0.00 ? 1  LEU A H    4  
ATOM   2728  H HA   . LEU A 1 1  ? -12.068 6.844   -2.159  1.00 0.00 ? 1  LEU A HA   4  
ATOM   2729  H HB2  . LEU A 1 1  ? -9.160  7.031   -1.465  1.00 0.00 ? 1  LEU A HB2  4  
ATOM   2730  H HB3  . LEU A 1 1  ? -9.740  5.684   -2.425  1.00 0.00 ? 1  LEU A HB3  4  
ATOM   2731  H HG   . LEU A 1 1  ? -10.711 8.251   -3.433  1.00 0.00 ? 1  LEU A HG   4  
ATOM   2732  H HD11 . LEU A 1 1  ? -7.936  8.152   -4.210  1.00 0.00 ? 1  LEU A HD11 4  
ATOM   2733  H HD12 . LEU A 1 1  ? -8.876  9.495   -3.516  1.00 0.00 ? 1  LEU A HD12 4  
ATOM   2734  H HD21 . LEU A 1 1  ? -9.698  5.679   -4.419  1.00 0.00 ? 1  LEU A HD21 4  
ATOM   2735  H HD22 . LEU A 1 1  ? -10.939 6.765   -5.089  1.00 0.00 ? 1  LEU A HD22 4  
ATOM   2736  N N    . LYS A 1 2  ? -12.085 4.499   -1.208  1.00 0.00 ? 2  LYS A N    4  
ATOM   2737  C CA   . LYS A 1 2  ? -12.396 3.255   -0.525  1.00 0.00 ? 2  LYS A CA   4  
ATOM   2738  C C    . LYS A 1 2  ? -11.401 2.177   -0.961  1.00 0.00 ? 2  LYS A C    4  
ATOM   2739  O O    . LYS A 1 2  ? -11.308 1.856   -2.145  1.00 0.00 ? 2  LYS A O    4  
ATOM   2740  C CB   . LYS A 1 2  ? -13.859 2.869   -0.751  1.00 0.00 ? 2  LYS A CB   4  
ATOM   2741  C CG   . LYS A 1 2  ? -14.132 2.601   -2.232  1.00 0.00 ? 2  LYS A CG   4  
ATOM   2742  C CD   . LYS A 1 2  ? -15.606 2.262   -2.465  1.00 0.00 ? 2  LYS A CD   4  
ATOM   2743  C CE   . LYS A 1 2  ? -15.897 2.078   -3.956  1.00 0.00 ? 2  LYS A CE   4  
ATOM   2744  N NZ   . LYS A 1 2  ? -16.152 0.652   -4.262  1.00 0.00 ? 2  LYS A NZ   4  
ATOM   2745  H H    . LYS A 1 2  ? -12.304 4.511   -2.184  1.00 0.00 ? 2  LYS A H    4  
ATOM   2746  H HA   . LYS A 1 2  ? -12.270 3.428   0.544   1.00 0.00 ? 2  LYS A HA   4  
ATOM   2747  H HB2  . LYS A 1 2  ? -14.100 1.982   -0.166  1.00 0.00 ? 2  LYS A HB2  4  
ATOM   2748  H HB3  . LYS A 1 2  ? -14.508 3.670   -0.397  1.00 0.00 ? 2  LYS A HB3  4  
ATOM   2749  H HG2  . LYS A 1 2  ? -13.859 3.477   -2.821  1.00 0.00 ? 2  LYS A HG2  4  
ATOM   2750  H HG3  . LYS A 1 2  ? -13.507 1.777   -2.578  1.00 0.00 ? 2  LYS A HG3  4  
ATOM   2751  H HD2  . LYS A 1 2  ? -15.864 1.351   -1.925  1.00 0.00 ? 2  LYS A HD2  4  
ATOM   2752  H HD3  . LYS A 1 2  ? -16.233 3.059   -2.065  1.00 0.00 ? 2  LYS A HD3  4  
ATOM   2753  H HE2  . LYS A 1 2  ? -16.762 2.677   -4.241  1.00 0.00 ? 2  LYS A HE2  4  
ATOM   2754  H HE3  . LYS A 1 2  ? -15.053 2.437   -4.545  1.00 0.00 ? 2  LYS A HE3  4  
ATOM   2755  H HZ1  . LYS A 1 2  ? -16.049 0.109   -3.428  1.00 0.00 ? 2  LYS A HZ1  4  
ATOM   2756  H HZ2  . LYS A 1 2  ? -17.082 0.548   -4.615  1.00 0.00 ? 2  LYS A HZ2  4  
ATOM   2757  N N    . CYS A 1 3  ? -10.683 1.648   0.018   1.00 0.00 ? 3  CYS A N    4  
ATOM   2758  C CA   . CYS A 1 3  ? -9.699  0.613   -0.250  1.00 0.00 ? 3  CYS A CA   4  
ATOM   2759  C C    . CYS A 1 3  ? -9.979  -0.569  0.681   1.00 0.00 ? 3  CYS A C    4  
ATOM   2760  O O    . CYS A 1 3  ? -10.934 -0.541  1.455   1.00 0.00 ? 3  CYS A O    4  
ATOM   2761  C CB   . CYS A 1 3  ? -8.270  1.137   -0.093  1.00 0.00 ? 3  CYS A CB   4  
ATOM   2762  S SG   . CYS A 1 3  ? -7.564  1.902   -1.598  1.00 0.00 ? 3  CYS A SG   4  
ATOM   2763  H H    . CYS A 1 3  ? -10.765 1.915   0.979   1.00 0.00 ? 3  CYS A H    4  
ATOM   2764  H HA   . CYS A 1 3  ? -9.826  0.323   -1.293  1.00 0.00 ? 3  CYS A HA   4  
ATOM   2765  H HB2  . CYS A 1 3  ? -8.253  1.870   0.713   1.00 0.00 ? 3  CYS A HB2  4  
ATOM   2766  H HB3  . CYS A 1 3  ? -7.627  0.312   0.214   1.00 0.00 ? 3  CYS A HB3  4  
ATOM   2767  N N    . LYS A 1 4  ? -9.129  -1.579  0.574   1.00 0.00 ? 4  LYS A N    4  
ATOM   2768  C CA   . LYS A 1 4  ? -9.273  -2.769  1.396   1.00 0.00 ? 4  LYS A CA   4  
ATOM   2769  C C    . LYS A 1 4  ? -8.410  -2.623  2.651   1.00 0.00 ? 4  LYS A C    4  
ATOM   2770  O O    . LYS A 1 4  ? -7.322  -2.051  2.598   1.00 0.00 ? 4  LYS A O    4  
ATOM   2771  C CB   . LYS A 1 4  ? -8.964  -4.025  0.580   1.00 0.00 ? 4  LYS A CB   4  
ATOM   2772  C CG   . LYS A 1 4  ? -10.102 -4.341  -0.393  1.00 0.00 ? 4  LYS A CG   4  
ATOM   2773  C CD   . LYS A 1 4  ? -10.719 -5.707  -0.090  1.00 0.00 ? 4  LYS A CD   4  
ATOM   2774  C CE   . LYS A 1 4  ? -12.068 -5.868  -0.794  1.00 0.00 ? 4  LYS A CE   4  
ATOM   2775  N NZ   . LYS A 1 4  ? -12.968 -6.734  0.001   1.00 0.00 ? 4  LYS A NZ   4  
ATOM   2776  H H    . LYS A 1 4  ? -8.354  -1.594  -0.059  1.00 0.00 ? 4  LYS A H    4  
ATOM   2777  H HA   . LYS A 1 4  ? -10.317 -2.831  1.701   1.00 0.00 ? 4  LYS A HA   4  
ATOM   2778  H HB2  . LYS A 1 4  ? -8.036  -3.885  0.026   1.00 0.00 ? 4  LYS A HB2  4  
ATOM   2779  H HB3  . LYS A 1 4  ? -8.809  -4.870  1.251   1.00 0.00 ? 4  LYS A HB3  4  
ATOM   2780  H HG2  . LYS A 1 4  ? -10.868 -3.568  -0.324  1.00 0.00 ? 4  LYS A HG2  4  
ATOM   2781  H HG3  . LYS A 1 4  ? -9.726  -4.326  -1.415  1.00 0.00 ? 4  LYS A HG3  4  
ATOM   2782  H HD2  . LYS A 1 4  ? -10.040 -6.497  -0.412  1.00 0.00 ? 4  LYS A HD2  4  
ATOM   2783  H HD3  . LYS A 1 4  ? -10.851 -5.820  0.987   1.00 0.00 ? 4  LYS A HD3  4  
ATOM   2784  H HE2  . LYS A 1 4  ? -12.529 -4.891  -0.938  1.00 0.00 ? 4  LYS A HE2  4  
ATOM   2785  H HE3  . LYS A 1 4  ? -11.919 -6.299  -1.783  1.00 0.00 ? 4  LYS A HE3  4  
ATOM   2786  H HZ1  . LYS A 1 4  ? -13.869 -6.306  0.069   1.00 0.00 ? 4  LYS A HZ1  4  
ATOM   2787  H HZ2  . LYS A 1 4  ? -13.055 -7.624  -0.447  1.00 0.00 ? 4  LYS A HZ2  4  
ATOM   2788  N N    . LYS A 1 5  ? -8.927  -3.151  3.751   1.00 0.00 ? 5  LYS A N    4  
ATOM   2789  C CA   . LYS A 1 5  ? -8.217  -3.087  5.017   1.00 0.00 ? 5  LYS A CA   4  
ATOM   2790  C C    . LYS A 1 5  ? -7.157  -4.190  5.059   1.00 0.00 ? 5  LYS A C    4  
ATOM   2791  O O    . LYS A 1 5  ? -6.943  -4.888  4.069   1.00 0.00 ? 5  LYS A O    4  
ATOM   2792  C CB   . LYS A 1 5  ? -9.202  -3.137  6.187   1.00 0.00 ? 5  LYS A CB   4  
ATOM   2793  C CG   . LYS A 1 5  ? -10.078 -1.882  6.219   1.00 0.00 ? 5  LYS A CG   4  
ATOM   2794  C CD   . LYS A 1 5  ? -10.279 -1.392  7.654   1.00 0.00 ? 5  LYS A CD   4  
ATOM   2795  C CE   . LYS A 1 5  ? -11.382 -2.187  8.356   1.00 0.00 ? 5  LYS A CE   4  
ATOM   2796  N NZ   . LYS A 1 5  ? -12.091 -1.336  9.338   1.00 0.00 ? 5  LYS A NZ   4  
ATOM   2797  H H    . LYS A 1 5  ? -9.812  -3.615  3.785   1.00 0.00 ? 5  LYS A H    4  
ATOM   2798  H HA   . LYS A 1 5  ? -7.713  -2.122  5.061   1.00 0.00 ? 5  LYS A HA   4  
ATOM   2799  H HB2  . LYS A 1 5  ? -9.832  -4.022  6.100   1.00 0.00 ? 5  LYS A HB2  4  
ATOM   2800  H HB3  . LYS A 1 5  ? -8.655  -3.227  7.125   1.00 0.00 ? 5  LYS A HB3  4  
ATOM   2801  H HG2  . LYS A 1 5  ? -9.615  -1.096  5.624   1.00 0.00 ? 5  LYS A HG2  4  
ATOM   2802  H HG3  . LYS A 1 5  ? -11.045 -2.098  5.766   1.00 0.00 ? 5  LYS A HG3  4  
ATOM   2803  H HD2  . LYS A 1 5  ? -9.347  -1.488  8.210   1.00 0.00 ? 5  LYS A HD2  4  
ATOM   2804  H HD3  . LYS A 1 5  ? -10.538 -0.333  7.648   1.00 0.00 ? 5  LYS A HD3  4  
ATOM   2805  H HE2  . LYS A 1 5  ? -12.088 -2.569  7.619   1.00 0.00 ? 5  LYS A HE2  4  
ATOM   2806  H HE3  . LYS A 1 5  ? -10.949 -3.052  8.861   1.00 0.00 ? 5  LYS A HE3  4  
ATOM   2807  H HZ1  . LYS A 1 5  ? -11.613 -0.462  9.427   1.00 0.00 ? 5  LYS A HZ1  4  
ATOM   2808  H HZ2  . LYS A 1 5  ? -13.027 -1.174  9.024   1.00 0.00 ? 5  LYS A HZ2  4  
ATOM   2809  N N    . LEU A 1 6  ? -6.522  -4.313  6.215   1.00 0.00 ? 6  LEU A N    4  
ATOM   2810  C CA   . LEU A 1 6  ? -5.490  -5.318  6.399   1.00 0.00 ? 6  LEU A CA   4  
ATOM   2811  C C    . LEU A 1 6  ? -5.939  -6.629  5.750   1.00 0.00 ? 6  LEU A C    4  
ATOM   2812  O O    . LEU A 1 6  ? -5.385  -7.044  4.734   1.00 0.00 ? 6  LEU A O    4  
ATOM   2813  C CB   . LEU A 1 6  ? -5.134  -5.457  7.881   1.00 0.00 ? 6  LEU A CB   4  
ATOM   2814  C CG   . LEU A 1 6  ? -4.008  -4.553  8.387   1.00 0.00 ? 6  LEU A CG   4  
ATOM   2815  C CD1  . LEU A 1 6  ? -4.568  -3.385  9.203   1.00 0.00 ? 6  LEU A CD1  4  
ATOM   2816  C CD2  . LEU A 1 6  ? -2.972  -5.357  9.174   1.00 0.00 ? 6  LEU A CD2  4  
ATOM   2817  H H    . LEU A 1 6  ? -6.702  -3.741  7.016   1.00 0.00 ? 6  LEU A H    4  
ATOM   2818  H HA   . LEU A 1 6  ? -4.596  -4.967  5.885   1.00 0.00 ? 6  LEU A HA   4  
ATOM   2819  H HB2  . LEU A 1 6  ? -6.029  -5.254  8.469   1.00 0.00 ? 6  LEU A HB2  4  
ATOM   2820  H HB3  . LEU A 1 6  ? -4.855  -6.493  8.072   1.00 0.00 ? 6  LEU A HB3  4  
ATOM   2821  H HG   . LEU A 1 6  ? -3.498  -4.126  7.524   1.00 0.00 ? 6  LEU A HG   4  
ATOM   2822  H HD11 . LEU A 1 6  ? -5.084  -3.771  10.082  1.00 0.00 ? 6  LEU A HD11 4  
ATOM   2823  H HD12 . LEU A 1 6  ? -3.750  -2.736  9.517   1.00 0.00 ? 6  LEU A HD12 4  
ATOM   2824  H HD21 . LEU A 1 6  ? -2.112  -5.564  8.536   1.00 0.00 ? 6  LEU A HD21 4  
ATOM   2825  H HD22 . LEU A 1 6  ? -2.649  -4.782  10.043  1.00 0.00 ? 6  LEU A HD22 4  
ATOM   2826  N N    . VAL A 1 7  ? -6.940  -7.243  6.364   1.00 0.00 ? 7  VAL A N    4  
ATOM   2827  C CA   . VAL A 1 7  ? -7.470  -8.498  5.858   1.00 0.00 ? 7  VAL A CA   4  
ATOM   2828  C C    . VAL A 1 7  ? -8.480  -8.209  4.746   1.00 0.00 ? 7  VAL A C    4  
ATOM   2829  O O    . VAL A 1 7  ? -9.329  -7.330  4.886   1.00 0.00 ? 7  VAL A O    4  
ATOM   2830  C CB   . VAL A 1 7  ? -8.064  -9.316  7.007   1.00 0.00 ? 7  VAL A CB   4  
ATOM   2831  C CG1  . VAL A 1 7  ? -8.639  -10.640 6.498   1.00 0.00 ? 7  VAL A CG1  4  
ATOM   2832  C CG2  . VAL A 1 7  ? -7.025  -9.555  8.104   1.00 0.00 ? 7  VAL A CG2  4  
ATOM   2833  H H    . VAL A 1 7  ? -7.385  -6.899  7.190   1.00 0.00 ? 7  VAL A H    4  
ATOM   2834  H HA   . VAL A 1 7  ? -6.637  -9.062  5.438   1.00 0.00 ? 7  VAL A HA   4  
ATOM   2835  H HB   . VAL A 1 7  ? -8.882  -8.740  7.440   1.00 0.00 ? 7  VAL A HB   4  
ATOM   2836  H HG11 . VAL A 1 7  ? -7.845  -11.227 6.036   1.00 0.00 ? 7  VAL A HG11 4  
ATOM   2837  H HG12 . VAL A 1 7  ? -9.064  -11.196 7.333   1.00 0.00 ? 7  VAL A HG12 4  
ATOM   2838  H HG21 . VAL A 1 7  ? -7.224  -10.510 8.591   1.00 0.00 ? 7  VAL A HG21 4  
ATOM   2839  H HG22 . VAL A 1 7  ? -6.028  -9.574  7.663   1.00 0.00 ? 7  VAL A HG22 4  
ATOM   2840  N N    . PRO A 1 8  ? -8.351  -8.985  3.636   1.00 0.00 ? 8  PRO A N    4  
ATOM   2841  C CA   . PRO A 1 8  ? -9.242  -8.821  2.501   1.00 0.00 ? 8  PRO A CA   4  
ATOM   2842  C C    . PRO A 1 8  ? -10.622 -9.412  2.796   1.00 0.00 ? 8  PRO A C    4  
ATOM   2843  O O    . PRO A 1 8  ? -11.122 -10.241 2.037   1.00 0.00 ? 8  PRO A O    4  
ATOM   2844  C CB   . PRO A 1 8  ? -8.537  -9.510  1.344   1.00 0.00 ? 8  PRO A CB   4  
ATOM   2845  C CG   . PRO A 1 8  ? -7.505  -10.431 1.974   1.00 0.00 ? 8  PRO A CG   4  
ATOM   2846  C CD   . PRO A 1 8  ? -7.358  -10.036 3.435   1.00 0.00 ? 8  PRO A CD   4  
ATOM   2847  H HA   . PRO A 1 8  ? -9.395  -7.850  2.317   1.00 0.00 ? 8  PRO A HA   4  
ATOM   2848  H HB2  . PRO A 1 8  ? -9.243  -10.074 0.735   1.00 0.00 ? 8  PRO A HB2  4  
ATOM   2849  H HB3  . PRO A 1 8  ? -8.061  -8.781  0.687   1.00 0.00 ? 8  PRO A HB3  4  
ATOM   2850  H HG2  . PRO A 1 8  ? -7.819  -11.471 1.890   1.00 0.00 ? 8  PRO A HG2  4  
ATOM   2851  H HG3  . PRO A 1 8  ? -6.549  -10.344 1.457   1.00 0.00 ? 8  PRO A HG3  4  
ATOM   2852  H HD2  . PRO A 1 8  ? -7.539  -10.884 4.095   1.00 0.00 ? 8  PRO A HD2  4  
ATOM   2853  H HD3  . PRO A 1 8  ? -6.351  -9.675  3.648   1.00 0.00 ? 8  PRO A HD3  4  
ATOM   2854  N N    . LEU A 1 9  ? -11.199 -8.963  3.901   1.00 0.00 ? 9  LEU A N    4  
ATOM   2855  C CA   . LEU A 1 9  ? -12.511 -9.437  4.307   1.00 0.00 ? 9  LEU A CA   4  
ATOM   2856  C C    . LEU A 1 9  ? -13.503 -8.272  4.272   1.00 0.00 ? 9  LEU A C    4  
ATOM   2857  O O    . LEU A 1 9  ? -14.673 -8.458  3.943   1.00 0.00 ? 9  LEU A O    4  
ATOM   2858  C CB   . LEU A 1 9  ? -12.432 -10.136 5.665   1.00 0.00 ? 9  LEU A CB   4  
ATOM   2859  C CG   . LEU A 1 9  ? -11.892 -11.568 5.652   1.00 0.00 ? 9  LEU A CG   4  
ATOM   2860  C CD1  . LEU A 1 9  ? -11.554 -12.039 7.067   1.00 0.00 ? 9  LEU A CD1  4  
ATOM   2861  C CD2  . LEU A 1 9  ? -12.867 -12.515 4.949   1.00 0.00 ? 9  LEU A CD2  4  
ATOM   2862  H H    . LEU A 1 9  ? -10.786 -8.288  4.513   1.00 0.00 ? 9  LEU A H    4  
ATOM   2863  H HA   . LEU A 1 9  ? -12.829 -10.183 3.578   1.00 0.00 ? 9  LEU A HA   4  
ATOM   2864  H HB2  . LEU A 1 9  ? -11.803 -9.538  6.324   1.00 0.00 ? 9  LEU A HB2  4  
ATOM   2865  H HB3  . LEU A 1 9  ? -13.430 -10.150 6.103   1.00 0.00 ? 9  LEU A HB3  4  
ATOM   2866  H HG   . LEU A 1 9  ? -10.964 -11.578 5.079   1.00 0.00 ? 9  LEU A HG   4  
ATOM   2867  H HD11 . LEU A 1 9  ? -12.291 -12.774 7.391   1.00 0.00 ? 9  LEU A HD11 4  
ATOM   2868  H HD12 . LEU A 1 9  ? -10.563 -12.493 7.072   1.00 0.00 ? 9  LEU A HD12 4  
ATOM   2869  H HD21 . LEU A 1 9  ? -13.833 -12.024 4.837   1.00 0.00 ? 9  LEU A HD21 4  
ATOM   2870  H HD22 . LEU A 1 9  ? -12.475 -12.776 3.966   1.00 0.00 ? 9  LEU A HD22 4  
ATOM   2871  N N    . PHE A 1 10 ? -12.998 -7.096  4.616   1.00 0.00 ? 10 PHE A N    4  
ATOM   2872  C CA   . PHE A 1 10 ? -13.824 -5.901  4.628   1.00 0.00 ? 10 PHE A CA   4  
ATOM   2873  C C    . PHE A 1 10 ? -13.059 -4.700  4.070   1.00 0.00 ? 10 PHE A C    4  
ATOM   2874  O O    . PHE A 1 10 ? -11.830 -4.674  4.099   1.00 0.00 ? 10 PHE A O    4  
ATOM   2875  C CB   . PHE A 1 10 ? -14.190 -5.626  6.088   1.00 0.00 ? 10 PHE A CB   4  
ATOM   2876  C CG   . PHE A 1 10 ? -14.588 -6.875  6.876   1.00 0.00 ? 10 PHE A CG   4  
ATOM   2877  C CD1  . PHE A 1 10 ? -13.628 -7.677  7.409   1.00 0.00 ? 10 PHE A CD1  4  
ATOM   2878  C CD2  . PHE A 1 10 ? -15.902 -7.183  7.044   1.00 0.00 ? 10 PHE A CD2  4  
ATOM   2879  C CE1  . PHE A 1 10 ? -13.997 -8.836  8.141   1.00 0.00 ? 10 PHE A CE1  4  
ATOM   2880  C CE2  . PHE A 1 10 ? -16.271 -8.343  7.776   1.00 0.00 ? 10 PHE A CE2  4  
ATOM   2881  C CZ   . PHE A 1 10 ? -15.311 -9.145  8.309   1.00 0.00 ? 10 PHE A CZ   4  
ATOM   2882  H H    . PHE A 1 10 ? -12.045 -6.953  4.882   1.00 0.00 ? 10 PHE A H    4  
ATOM   2883  H HA   . PHE A 1 10 ? -14.692 -6.102  3.998   1.00 0.00 ? 10 PHE A HA   4  
ATOM   2884  H HB2  . PHE A 1 10 ? -13.342 -5.152  6.581   1.00 0.00 ? 10 PHE A HB2  4  
ATOM   2885  H HB3  . PHE A 1 10 ? -15.014 -4.913  6.116   1.00 0.00 ? 10 PHE A HB3  4  
ATOM   2886  H HD1  . PHE A 1 10 ? -12.575 -7.430  7.275   1.00 0.00 ? 10 PHE A HD1  4  
ATOM   2887  H HD2  . PHE A 1 10 ? -16.672 -6.540  6.617   1.00 0.00 ? 10 PHE A HD2  4  
ATOM   2888  H HE1  . PHE A 1 10 ? -13.228 -9.479  8.569   1.00 0.00 ? 10 PHE A HE1  4  
ATOM   2889  H HE2  . PHE A 1 10 ? -17.324 -8.590  7.911   1.00 0.00 ? 10 PHE A HE2  4  
ATOM   2890  H HZ   . PHE A 1 10 ? -15.594 -10.035 8.871   1.00 0.00 ? 10 PHE A HZ   4  
ATOM   2891  N N    . SER A 1 11 ? -13.818 -3.732  3.577   1.00 0.00 ? 11 SER A N    4  
ATOM   2892  C CA   . SER A 1 11 ? -13.227 -2.531  3.014   1.00 0.00 ? 11 SER A CA   4  
ATOM   2893  C C    . SER A 1 11 ? -13.678 -1.304  3.808   1.00 0.00 ? 11 SER A C    4  
ATOM   2894  O O    . SER A 1 11 ? -14.764 -1.299  4.387   1.00 0.00 ? 11 SER A O    4  
ATOM   2895  C CB   . SER A 1 11 ? -13.599 -2.373  1.538   1.00 0.00 ? 11 SER A CB   4  
ATOM   2896  O OG   . SER A 1 11 ? -14.992 -2.576  1.314   1.00 0.00 ? 11 SER A OG   4  
ATOM   2897  H H    . SER A 1 11 ? -14.818 -3.761  3.558   1.00 0.00 ? 11 SER A H    4  
ATOM   2898  H HA   . SER A 1 11 ? -12.150 -2.670  3.103   1.00 0.00 ? 11 SER A HA   4  
ATOM   2899  H HB2  . SER A 1 11 ? -13.319 -1.376  1.198   1.00 0.00 ? 11 SER A HB2  4  
ATOM   2900  H HB3  . SER A 1 11 ? -13.029 -3.085  0.942   1.00 0.00 ? 11 SER A HB3  4  
ATOM   2901  H HG   . SER A 1 11 ? -15.176 -3.547  1.163   1.00 0.00 ? 11 SER A HG   4  
ATOM   2902  N N    . LYS A 1 12 ? -12.821 -0.293  3.812   1.00 0.00 ? 12 LYS A N    4  
ATOM   2903  C CA   . LYS A 1 12 ? -13.118 0.937   4.526   1.00 0.00 ? 12 LYS A CA   4  
ATOM   2904  C C    . LYS A 1 12 ? -12.518 2.121   3.766   1.00 0.00 ? 12 LYS A C    4  
ATOM   2905  O O    . LYS A 1 12 ? -11.562 1.957   3.009   1.00 0.00 ? 12 LYS A O    4  
ATOM   2906  C CB   . LYS A 1 12 ? -12.650 0.839   5.980   1.00 0.00 ? 12 LYS A CB   4  
ATOM   2907  C CG   . LYS A 1 12 ? -13.801 0.425   6.899   1.00 0.00 ? 12 LYS A CG   4  
ATOM   2908  C CD   . LYS A 1 12 ? -13.930 1.387   8.082   1.00 0.00 ? 12 LYS A CD   4  
ATOM   2909  C CE   . LYS A 1 12 ? -15.255 1.178   8.817   1.00 0.00 ? 12 LYS A CE   4  
ATOM   2910  N NZ   . LYS A 1 12 ? -15.026 0.517   10.121  1.00 0.00 ? 12 LYS A NZ   4  
ATOM   2911  H H    . LYS A 1 12 ? -11.940 -0.305  3.339   1.00 0.00 ? 12 LYS A H    4  
ATOM   2912  H HA   . LYS A 1 12 ? -14.202 1.052   4.544   1.00 0.00 ? 12 LYS A HA   4  
ATOM   2913  H HB2  . LYS A 1 12 ? -11.840 0.114   6.057   1.00 0.00 ? 12 LYS A HB2  4  
ATOM   2914  H HB3  . LYS A 1 12 ? -12.249 1.799   6.302   1.00 0.00 ? 12 LYS A HB3  4  
ATOM   2915  H HG2  . LYS A 1 12 ? -14.734 0.409   6.336   1.00 0.00 ? 12 LYS A HG2  4  
ATOM   2916  H HG3  . LYS A 1 12 ? -13.632 -0.587  7.266   1.00 0.00 ? 12 LYS A HG3  4  
ATOM   2917  H HD2  . LYS A 1 12 ? -13.100 1.235   8.772   1.00 0.00 ? 12 LYS A HD2  4  
ATOM   2918  H HD3  . LYS A 1 12 ? -13.865 2.416   7.728   1.00 0.00 ? 12 LYS A HD3  4  
ATOM   2919  H HE2  . LYS A 1 12 ? -15.749 2.138   8.970   1.00 0.00 ? 12 LYS A HE2  4  
ATOM   2920  H HE3  . LYS A 1 12 ? -15.924 0.570   8.207   1.00 0.00 ? 12 LYS A HE3  4  
ATOM   2921  H HZ1  . LYS A 1 12 ? -15.904 0.367   10.578  1.00 0.00 ? 12 LYS A HZ1  4  
ATOM   2922  H HZ2  . LYS A 1 12 ? -14.572 -0.361  9.975   1.00 0.00 ? 12 LYS A HZ2  4  
ATOM   2923  N N    . THR A 1 13 ? -13.103 3.288   3.993   1.00 0.00 ? 13 THR A N    4  
ATOM   2924  C CA   . THR A 1 13 ? -12.638 4.499   3.339   1.00 0.00 ? 13 THR A CA   4  
ATOM   2925  C C    . THR A 1 13 ? -11.608 5.216   4.214   1.00 0.00 ? 13 THR A C    4  
ATOM   2926  O O    . THR A 1 13 ? -11.876 5.515   5.376   1.00 0.00 ? 13 THR A O    4  
ATOM   2927  C CB   . THR A 1 13 ? -13.860 5.359   3.011   1.00 0.00 ? 13 THR A CB   4  
ATOM   2928  O OG1  . THR A 1 13 ? -14.442 4.718   1.879   1.00 0.00 ? 13 THR A OG1  4  
ATOM   2929  C CG2  . THR A 1 13 ? -13.478 6.748   2.498   1.00 0.00 ? 13 THR A CG2  4  
ATOM   2930  H H    . THR A 1 13 ? -13.880 3.413   4.610   1.00 0.00 ? 13 THR A H    4  
ATOM   2931  H HA   . THR A 1 13 ? -12.133 4.218   2.415   1.00 0.00 ? 13 THR A HA   4  
ATOM   2932  H HB   . THR A 1 13 ? -14.527 5.431   3.871   1.00 0.00 ? 13 THR A HB   4  
ATOM   2933  H HG1  . THR A 1 13 ? -14.683 3.775   2.106   1.00 0.00 ? 13 THR A HG1  4  
ATOM   2934  H HG21 . THR A 1 13 ? -12.400 6.882   2.581   1.00 0.00 ? 13 THR A HG21 4  
ATOM   2935  H HG22 . THR A 1 13 ? -13.778 6.845   1.454   1.00 0.00 ? 13 THR A HG22 4  
ATOM   2936  N N    . CYS A 1 14 ? -10.451 5.471   3.621   1.00 0.00 ? 14 CYS A N    4  
ATOM   2937  C CA   . CYS A 1 14 ? -9.379  6.147   4.332   1.00 0.00 ? 14 CYS A CA   4  
ATOM   2938  C C    . CYS A 1 14 ? -9.854  7.556   4.690   1.00 0.00 ? 14 CYS A C    4  
ATOM   2939  O O    . CYS A 1 14 ? -10.520 8.212   3.891   1.00 0.00 ? 14 CYS A O    4  
ATOM   2940  C CB   . CYS A 1 14 ? -8.085  6.171   3.515   1.00 0.00 ? 14 CYS A CB   4  
ATOM   2941  S SG   . CYS A 1 14 ? -7.764  4.656   2.540   1.00 0.00 ? 14 CYS A SG   4  
ATOM   2942  H H    . CYS A 1 14 ? -10.241 5.224   2.675   1.00 0.00 ? 14 CYS A H    4  
ATOM   2943  H HA   . CYS A 1 14 ? -9.183  5.564   5.232   1.00 0.00 ? 14 CYS A HA   4  
ATOM   2944  H HB2  . CYS A 1 14 ? -8.118  7.023   2.835   1.00 0.00 ? 14 CYS A HB2  4  
ATOM   2945  H HB3  . CYS A 1 14 ? -7.247  6.335   4.192   1.00 0.00 ? 14 CYS A HB3  4  
ATOM   2946  N N    . PRO A 1 15 ? -9.483  7.991   5.924   1.00 0.00 ? 15 PRO A N    4  
ATOM   2947  C CA   . PRO A 1 15 ? -9.865  9.310   6.399   1.00 0.00 ? 15 PRO A CA   4  
ATOM   2948  C C    . PRO A 1 15 ? -9.026  10.399  5.725   1.00 0.00 ? 15 PRO A C    4  
ATOM   2949  O O    . PRO A 1 15 ? -8.156  10.100  4.908   1.00 0.00 ? 15 PRO A O    4  
ATOM   2950  C CB   . PRO A 1 15 ? -9.671  9.258   7.905   1.00 0.00 ? 15 PRO A CB   4  
ATOM   2951  C CG   . PRO A 1 15 ? -8.753  8.075   8.167   1.00 0.00 ? 15 PRO A CG   4  
ATOM   2952  C CD   . PRO A 1 15 ? -8.694  7.241   6.897   1.00 0.00 ? 15 PRO A CD   4  
ATOM   2953  H HA   . PRO A 1 15 ? -10.814 9.506   6.154   1.00 0.00 ? 15 PRO A HA   4  
ATOM   2954  H HB2  . PRO A 1 15 ? -9.230  10.184  8.275   1.00 0.00 ? 15 PRO A HB2  4  
ATOM   2955  H HB3  . PRO A 1 15 ? -10.625 9.133   8.418   1.00 0.00 ? 15 PRO A HB3  4  
ATOM   2956  H HG2  . PRO A 1 15 ? -7.756  8.420   8.443   1.00 0.00 ? 15 PRO A HG2  4  
ATOM   2957  H HG3  . PRO A 1 15 ? -9.126  7.479   8.999   1.00 0.00 ? 15 PRO A HG3  4  
ATOM   2958  H HD2  . PRO A 1 15 ? -7.668  7.109   6.557   1.00 0.00 ? 15 PRO A HD2  4  
ATOM   2959  H HD3  . PRO A 1 15 ? -9.107  6.245   7.059   1.00 0.00 ? 15 PRO A HD3  4  
ATOM   2960  N N    . ALA A 1 16 ? -9.317  11.638  6.093   1.00 0.00 ? 16 ALA A N    4  
ATOM   2961  C CA   . ALA A 1 16 ? -8.601  12.772  5.534   1.00 0.00 ? 16 ALA A CA   4  
ATOM   2962  C C    . ALA A 1 16 ? -7.101  12.593  5.779   1.00 0.00 ? 16 ALA A C    4  
ATOM   2963  O O    . ALA A 1 16 ? -6.695  12.092  6.826   1.00 0.00 ? 16 ALA A O    4  
ATOM   2964  C CB   . ALA A 1 16 ? -9.140  14.067  6.144   1.00 0.00 ? 16 ALA A CB   4  
ATOM   2965  H H    . ALA A 1 16 ? -10.027 11.872  6.758   1.00 0.00 ? 16 ALA A H    4  
ATOM   2966  H HA   . ALA A 1 16 ? -8.787  12.786  4.460   1.00 0.00 ? 16 ALA A HA   4  
ATOM   2967  H HB1  . ALA A 1 16 ? -8.705  14.922  5.626   1.00 0.00 ? 16 ALA A HB1  4  
ATOM   2968  H HB2  . ALA A 1 16 ? -10.225 14.093  6.041   1.00 0.00 ? 16 ALA A HB2  4  
ATOM   2969  N N    . GLY A 1 17 ? -6.320  13.011  4.794   1.00 0.00 ? 17 GLY A N    4  
ATOM   2970  C CA   . GLY A 1 17 ? -4.874  12.903  4.889   1.00 0.00 ? 17 GLY A CA   4  
ATOM   2971  C C    . GLY A 1 17 ? -4.364  11.677  4.129   1.00 0.00 ? 17 GLY A C    4  
ATOM   2972  O O    . GLY A 1 17 ? -3.361  11.753  3.422   1.00 0.00 ? 17 GLY A O    4  
ATOM   2973  H H    . GLY A 1 17 ? -6.658  13.417  3.945   1.00 0.00 ? 17 GLY A H    4  
ATOM   2974  H HA2  . GLY A 1 17 ? -4.411  13.804  4.485   1.00 0.00 ? 17 GLY A HA2  4  
ATOM   2975  H HA3  . GLY A 1 17 ? -4.578  12.835  5.936   1.00 0.00 ? 17 GLY A HA3  4  
ATOM   2976  N N    . LYS A 1 18 ? -5.080  10.575  4.301   1.00 0.00 ? 18 LYS A N    4  
ATOM   2977  C CA   . LYS A 1 18 ? -4.713  9.334   3.640   1.00 0.00 ? 18 LYS A CA   4  
ATOM   2978  C C    . LYS A 1 18 ? -5.441  9.241   2.298   1.00 0.00 ? 18 LYS A C    4  
ATOM   2979  O O    . LYS A 1 18 ? -6.546  8.706   2.222   1.00 0.00 ? 18 LYS A O    4  
ATOM   2980  C CB   . LYS A 1 18 ? -4.969  8.140   4.562   1.00 0.00 ? 18 LYS A CB   4  
ATOM   2981  C CG   . LYS A 1 18 ? -4.522  8.446   5.993   1.00 0.00 ? 18 LYS A CG   4  
ATOM   2982  C CD   . LYS A 1 18 ? -4.041  7.178   6.701   1.00 0.00 ? 18 LYS A CD   4  
ATOM   2983  C CE   . LYS A 1 18 ? -4.500  7.156   8.160   1.00 0.00 ? 18 LYS A CE   4  
ATOM   2984  N NZ   . LYS A 1 18 ? -4.859  5.780   8.570   1.00 0.00 ? 18 LYS A NZ   4  
ATOM   2985  H H    . LYS A 1 18 ? -5.895  10.521  4.878   1.00 0.00 ? 18 LYS A H    4  
ATOM   2986  H HA   . LYS A 1 18 ? -3.640  9.370   3.450   1.00 0.00 ? 18 LYS A HA   4  
ATOM   2987  H HB2  . LYS A 1 18 ? -6.030  7.890   4.554   1.00 0.00 ? 18 LYS A HB2  4  
ATOM   2988  H HB3  . LYS A 1 18 ? -4.434  7.267   4.190   1.00 0.00 ? 18 LYS A HB3  4  
ATOM   2989  H HG2  . LYS A 1 18 ? -3.721  9.185   5.977   1.00 0.00 ? 18 LYS A HG2  4  
ATOM   2990  H HG3  . LYS A 1 18 ? -5.350  8.886   6.550   1.00 0.00 ? 18 LYS A HG3  4  
ATOM   2991  H HD2  . LYS A 1 18 ? -4.424  6.300   6.182   1.00 0.00 ? 18 LYS A HD2  4  
ATOM   2992  H HD3  . LYS A 1 18 ? -2.953  7.124   6.658   1.00 0.00 ? 18 LYS A HD3  4  
ATOM   2993  H HE2  . LYS A 1 18 ? -3.708  7.539   8.803   1.00 0.00 ? 18 LYS A HE2  4  
ATOM   2994  H HE3  . LYS A 1 18 ? -5.359  7.815   8.287   1.00 0.00 ? 18 LYS A HE3  4  
ATOM   2995  H HZ1  . LYS A 1 18 ? -5.691  5.803   9.123   1.00 0.00 ? 18 LYS A HZ1  4  
ATOM   2996  H HZ2  . LYS A 1 18 ? -5.015  5.220   7.756   1.00 0.00 ? 18 LYS A HZ2  4  
ATOM   2997  N N    . ASN A 1 19 ? -4.792  9.771   1.271   1.00 0.00 ? 19 ASN A N    4  
ATOM   2998  C CA   . ASN A 1 19 ? -5.364  9.755   -0.064  1.00 0.00 ? 19 ASN A CA   4  
ATOM   2999  C C    . ASN A 1 19 ? -4.589  8.763   -0.934  1.00 0.00 ? 19 ASN A C    4  
ATOM   3000  O O    . ASN A 1 19 ? -4.763  8.732   -2.151  1.00 0.00 ? 19 ASN A O    4  
ATOM   3001  C CB   . ASN A 1 19 ? -5.269  11.134  -0.721  1.00 0.00 ? 19 ASN A CB   4  
ATOM   3002  C CG   . ASN A 1 19 ? -6.510  11.974  -0.414  1.00 0.00 ? 19 ASN A CG   4  
ATOM   3003  O OD1  . ASN A 1 19 ? -6.580  12.688  0.573   1.00 0.00 ? 19 ASN A OD1  4  
ATOM   3004  N ND2  . ASN A 1 19 ? -7.483  11.849  -1.312  1.00 0.00 ? 19 ASN A ND2  4  
ATOM   3005  H H    . ASN A 1 19 ? -3.894  10.205  1.341   1.00 0.00 ? 19 ASN A H    4  
ATOM   3006  H HA   . ASN A 1 19 ? -6.405  9.464   0.073   1.00 0.00 ? 19 ASN A HA   4  
ATOM   3007  H HB2  . ASN A 1 19 ? -4.378  11.650  -0.363  1.00 0.00 ? 19 ASN A HB2  4  
ATOM   3008  H HB3  . ASN A 1 19 ? -5.159  11.020  -1.799  1.00 0.00 ? 19 ASN A HB3  4  
ATOM   3009  H HD21 . ASN A 1 19 ? -7.361  11.246  -2.101  1.00 0.00 ? 19 ASN A HD21 4  
ATOM   3010  H HD22 . ASN A 1 19 ? -8.336  12.359  -1.200  1.00 0.00 ? 19 ASN A HD22 4  
ATOM   3011  N N    . LEU A 1 20 ? -3.751  7.976   -0.275  1.00 0.00 ? 20 LEU A N    4  
ATOM   3012  C CA   . LEU A 1 20 ? -2.949  6.985   -0.973  1.00 0.00 ? 20 LEU A CA   4  
ATOM   3013  C C    . LEU A 1 20 ? -3.034  5.651   -0.229  1.00 0.00 ? 20 LEU A C    4  
ATOM   3014  O O    . LEU A 1 20 ? -2.849  5.601   0.986   1.00 0.00 ? 20 LEU A O    4  
ATOM   3015  C CB   . LEU A 1 20 ? -1.519  7.493   -1.165  1.00 0.00 ? 20 LEU A CB   4  
ATOM   3016  C CG   . LEU A 1 20 ? -1.341  8.633   -2.170  1.00 0.00 ? 20 LEU A CG   4  
ATOM   3017  C CD1  . LEU A 1 20 ? -0.023  9.372   -1.933  1.00 0.00 ? 20 LEU A CD1  4  
ATOM   3018  C CD2  . LEU A 1 20 ? -1.460  8.121   -3.607  1.00 0.00 ? 20 LEU A CD2  4  
ATOM   3019  H H    . LEU A 1 20 ? -3.616  8.008   0.715   1.00 0.00 ? 20 LEU A H    4  
ATOM   3020  H HA   . LEU A 1 20 ? -3.381  6.855   -1.965  1.00 0.00 ? 20 LEU A HA   4  
ATOM   3021  H HB2  . LEU A 1 20 ? -1.139  7.824   -0.199  1.00 0.00 ? 20 LEU A HB2  4  
ATOM   3022  H HB3  . LEU A 1 20 ? -0.897  6.655   -1.482  1.00 0.00 ? 20 LEU A HB3  4  
ATOM   3023  H HG   . LEU A 1 20 ? -2.146  9.352   -2.017  1.00 0.00 ? 20 LEU A HG   4  
ATOM   3024  H HD11 . LEU A 1 20 ? 0.787   8.840   -2.431  1.00 0.00 ? 20 LEU A HD11 4  
ATOM   3025  H HD12 . LEU A 1 20 ? -0.095  10.383  -2.336  1.00 0.00 ? 20 LEU A HD12 4  
ATOM   3026  H HD21 . LEU A 1 20 ? -1.874  8.906   -4.240  1.00 0.00 ? 20 LEU A HD21 4  
ATOM   3027  H HD22 . LEU A 1 20 ? -0.474  7.840   -3.976  1.00 0.00 ? 20 LEU A HD22 4  
ATOM   3028  N N    . CYS A 1 21 ? -3.313  4.603   -0.989  1.00 0.00 ? 21 CYS A N    4  
ATOM   3029  C CA   . CYS A 1 21 ? -3.424  3.272   -0.417  1.00 0.00 ? 21 CYS A CA   4  
ATOM   3030  C C    . CYS A 1 21 ? -2.079  2.563   -0.585  1.00 0.00 ? 21 CYS A C    4  
ATOM   3031  O O    . CYS A 1 21 ? -1.513  2.550   -1.677  1.00 0.00 ? 21 CYS A O    4  
ATOM   3032  C CB   . CYS A 1 21 ? -4.570  2.479   -1.047  1.00 0.00 ? 21 CYS A CB   4  
ATOM   3033  S SG   . CYS A 1 21 ? -6.221  3.252   -0.881  1.00 0.00 ? 21 CYS A SG   4  
ATOM   3034  H H    . CYS A 1 21 ? -3.462  4.652   -1.976  1.00 0.00 ? 21 CYS A H    4  
ATOM   3035  H HA   . CYS A 1 21 ? -3.663  3.404   0.639   1.00 0.00 ? 21 CYS A HA   4  
ATOM   3036  H HB2  . CYS A 1 21 ? -4.356  2.337   -2.106  1.00 0.00 ? 21 CYS A HB2  4  
ATOM   3037  H HB3  . CYS A 1 21 ? -4.601  1.488   -0.593  1.00 0.00 ? 21 CYS A HB3  4  
ATOM   3038  N N    . TYR A 1 22 ? -1.607  1.990   0.512   1.00 0.00 ? 22 TYR A N    4  
ATOM   3039  C CA   . TYR A 1 22 ? -0.339  1.280   0.500   1.00 0.00 ? 22 TYR A CA   4  
ATOM   3040  C C    . TYR A 1 22 ? -0.549  -0.222  0.701   1.00 0.00 ? 22 TYR A C    4  
ATOM   3041  O O    . TYR A 1 22 ? -1.539  -0.639  1.301   1.00 0.00 ? 22 TYR A O    4  
ATOM   3042  C CB   . TYR A 1 22 ? 0.466   1.833   1.678   1.00 0.00 ? 22 TYR A CB   4  
ATOM   3043  C CG   . TYR A 1 22 ? 0.164   1.150   3.013   1.00 0.00 ? 22 TYR A CG   4  
ATOM   3044  C CD1  . TYR A 1 22 ? 0.718   -0.081  3.299   1.00 0.00 ? 22 TYR A CD1  4  
ATOM   3045  C CD2  . TYR A 1 22 ? -0.664  1.764   3.931   1.00 0.00 ? 22 TYR A CD2  4  
ATOM   3046  C CE1  . TYR A 1 22 ? 0.434   -0.724  4.556   1.00 0.00 ? 22 TYR A CE1  4  
ATOM   3047  C CE2  . TYR A 1 22 ? -0.948  1.121   5.188   1.00 0.00 ? 22 TYR A CE2  4  
ATOM   3048  C CZ   . TYR A 1 22 ? -0.385  -0.091  5.438   1.00 0.00 ? 22 TYR A CZ   4  
ATOM   3049  O OH   . TYR A 1 22 ? -0.654  -0.699  6.625   1.00 0.00 ? 22 TYR A OH   4  
ATOM   3050  H H    . TYR A 1 22 ? -2.074  2.005   1.396   1.00 0.00 ? 22 TYR A H    4  
ATOM   3051  H HA   . TYR A 1 22 ? 0.130   1.447   -0.470  1.00 0.00 ? 22 TYR A HA   4  
ATOM   3052  H HB2  . TYR A 1 22 ? 1.529   1.728   1.460   1.00 0.00 ? 22 TYR A HB2  4  
ATOM   3053  H HB3  . TYR A 1 22 ? 0.264   2.900   1.774   1.00 0.00 ? 22 TYR A HB3  4  
ATOM   3054  H HD1  . TYR A 1 22 ? 1.372   -0.566  2.574   1.00 0.00 ? 22 TYR A HD1  4  
ATOM   3055  H HD2  . TYR A 1 22 ? -1.102  2.736   3.705   1.00 0.00 ? 22 TYR A HD2  4  
ATOM   3056  H HE1  . TYR A 1 22 ? 0.866   -1.696  4.795   1.00 0.00 ? 22 TYR A HE1  4  
ATOM   3057  H HE2  . TYR A 1 22 ? -1.600  1.595   5.921   1.00 0.00 ? 22 TYR A HE2  4  
ATOM   3058  H HH   . TYR A 1 22 ? 0.150   -1.204  6.940   1.00 0.00 ? 22 TYR A HH   4  
ATOM   3059  N N    . LYS A 1 23 ? 0.399   -0.993  0.189   1.00 0.00 ? 23 LYS A N    4  
ATOM   3060  C CA   . LYS A 1 23 ? 0.330   -2.440  0.305   1.00 0.00 ? 23 LYS A CA   4  
ATOM   3061  C C    . LYS A 1 23 ? 1.727   -2.991  0.597   1.00 0.00 ? 23 LYS A C    4  
ATOM   3062  O O    . LYS A 1 23 ? 2.638   -2.846  -0.216  1.00 0.00 ? 23 LYS A O    4  
ATOM   3063  C CB   . LYS A 1 23 ? -0.323  -3.047  -0.938  1.00 0.00 ? 23 LYS A CB   4  
ATOM   3064  C CG   . LYS A 1 23 ? -0.078  -4.556  -1.005  1.00 0.00 ? 23 LYS A CG   4  
ATOM   3065  C CD   . LYS A 1 23 ? -0.419  -5.106  -2.392  1.00 0.00 ? 23 LYS A CD   4  
ATOM   3066  C CE   . LYS A 1 23 ? 0.842   -5.266  -3.243  1.00 0.00 ? 23 LYS A CE   4  
ATOM   3067  N NZ   . LYS A 1 23 ? 0.789   -6.527  -4.016  1.00 0.00 ? 23 LYS A NZ   4  
ATOM   3068  H H    . LYS A 1 23 ? 1.200   -0.646  -0.297  1.00 0.00 ? 23 LYS A H    4  
ATOM   3069  H HA   . LYS A 1 23 ? -0.316  -2.669  1.153   1.00 0.00 ? 23 LYS A HA   4  
ATOM   3070  H HB2  . LYS A 1 23 ? -1.395  -2.849  -0.925  1.00 0.00 ? 23 LYS A HB2  4  
ATOM   3071  H HB3  . LYS A 1 23 ? 0.077   -2.570  -1.833  1.00 0.00 ? 23 LYS A HB3  4  
ATOM   3072  H HG2  . LYS A 1 23 ? 0.965   -4.769  -0.772  1.00 0.00 ? 23 LYS A HG2  4  
ATOM   3073  H HG3  . LYS A 1 23 ? -0.682  -5.060  -0.251  1.00 0.00 ? 23 LYS A HG3  4  
ATOM   3074  H HD2  . LYS A 1 23 ? -0.919  -6.069  -2.292  1.00 0.00 ? 23 LYS A HD2  4  
ATOM   3075  H HD3  . LYS A 1 23 ? -1.117  -4.434  -2.892  1.00 0.00 ? 23 LYS A HD3  4  
ATOM   3076  H HE2  . LYS A 1 23 ? 0.940   -4.420  -3.923  1.00 0.00 ? 23 LYS A HE2  4  
ATOM   3077  H HE3  . LYS A 1 23 ? 1.724   -5.263  -2.602  1.00 0.00 ? 23 LYS A HE3  4  
ATOM   3078  H HZ1  . LYS A 1 23 ? 0.956   -6.333  -4.983  1.00 0.00 ? 23 LYS A HZ1  4  
ATOM   3079  H HZ2  . LYS A 1 23 ? 1.488   -7.156  -3.677  1.00 0.00 ? 23 LYS A HZ2  4  
ATOM   3080  N N    . MET A 1 24 ? 1.852   -3.611  1.761   1.00 0.00 ? 24 MET A N    4  
ATOM   3081  C CA   . MET A 1 24 ? 3.122   -4.185  2.171   1.00 0.00 ? 24 MET A CA   4  
ATOM   3082  C C    . MET A 1 24 ? 3.174   -5.682  1.860   1.00 0.00 ? 24 MET A C    4  
ATOM   3083  O O    . MET A 1 24 ? 2.301   -6.438  2.282   1.00 0.00 ? 24 MET A O    4  
ATOM   3084  C CB   . MET A 1 24 ? 3.320   -3.969  3.673   1.00 0.00 ? 24 MET A CB   4  
ATOM   3085  C CG   . MET A 1 24 ? 3.615   -2.499  3.981   1.00 0.00 ? 24 MET A CG   4  
ATOM   3086  S SD   . MET A 1 24 ? 4.294   -2.345  5.625   1.00 0.00 ? 24 MET A SD   4  
ATOM   3087  C CE   . MET A 1 24 ? 3.197   -1.109  6.299   1.00 0.00 ? 24 MET A CE   4  
ATOM   3088  H H    . MET A 1 24 ? 1.106   -3.725  2.418   1.00 0.00 ? 24 MET A H    4  
ATOM   3089  H HA   . MET A 1 24 ? 3.881   -3.659  1.592   1.00 0.00 ? 24 MET A HA   4  
ATOM   3090  H HB2  . MET A 1 24 ? 2.425   -4.283  4.210   1.00 0.00 ? 24 MET A HB2  4  
ATOM   3091  H HB3  . MET A 1 24 ? 4.141   -4.591  4.029   1.00 0.00 ? 24 MET A HB3  4  
ATOM   3092  H HG2  . MET A 1 24 ? 4.318   -2.100  3.250   1.00 0.00 ? 24 MET A HG2  4  
ATOM   3093  H HG3  . MET A 1 24 ? 2.702   -1.911  3.900   1.00 0.00 ? 24 MET A HG3  4  
ATOM   3094  H HE1  . MET A 1 24 ? 2.717   -0.566  5.484   1.00 0.00 ? 24 MET A HE1  4  
ATOM   3095  H HE2  . MET A 1 24 ? 2.436   -1.593  6.910   1.00 0.00 ? 24 MET A HE2  4  
ATOM   3096  N N    . PHE A 1 25 ? 4.207   -6.065  1.124   1.00 0.00 ? 25 PHE A N    4  
ATOM   3097  C CA   . PHE A 1 25 ? 4.385   -7.458  0.751   1.00 0.00 ? 25 PHE A CA   4  
ATOM   3098  C C    . PHE A 1 25 ? 5.867   -7.838  0.740   1.00 0.00 ? 25 PHE A C    4  
ATOM   3099  O O    . PHE A 1 25 ? 6.719   -7.020  0.398   1.00 0.00 ? 25 PHE A O    4  
ATOM   3100  C CB   . PHE A 1 25 ? 3.819   -7.618  -0.662  1.00 0.00 ? 25 PHE A CB   4  
ATOM   3101  C CG   . PHE A 1 25 ? 4.782   -7.188  -1.770  1.00 0.00 ? 25 PHE A CG   4  
ATOM   3102  C CD1  . PHE A 1 25 ? 5.649   -8.089  -2.306  1.00 0.00 ? 25 PHE A CD1  4  
ATOM   3103  C CD2  . PHE A 1 25 ? 4.772   -5.904  -2.219  1.00 0.00 ? 25 PHE A CD2  4  
ATOM   3104  C CE1  . PHE A 1 25 ? 6.543   -7.690  -3.335  1.00 0.00 ? 25 PHE A CE1  4  
ATOM   3105  C CE2  . PHE A 1 25 ? 5.666   -5.505  -3.248  1.00 0.00 ? 25 PHE A CE2  4  
ATOM   3106  C CZ   . PHE A 1 25 ? 6.533   -6.406  -3.784  1.00 0.00 ? 25 PHE A CZ   4  
ATOM   3107  H H    . PHE A 1 25 ? 4.913   -5.443  0.784   1.00 0.00 ? 25 PHE A H    4  
ATOM   3108  H HA   . PHE A 1 25 ? 3.862   -8.061  1.493   1.00 0.00 ? 25 PHE A HA   4  
ATOM   3109  H HB2  . PHE A 1 25 ? 3.546   -8.662  -0.817  1.00 0.00 ? 25 PHE A HB2  4  
ATOM   3110  H HB3  . PHE A 1 25 ? 2.903   -7.034  -0.744  1.00 0.00 ? 25 PHE A HB3  4  
ATOM   3111  H HD1  . PHE A 1 25 ? 5.657   -9.118  -1.946  1.00 0.00 ? 25 PHE A HD1  4  
ATOM   3112  H HD2  . PHE A 1 25 ? 4.078   -5.182  -1.790  1.00 0.00 ? 25 PHE A HD2  4  
ATOM   3113  H HE1  . PHE A 1 25 ? 7.237   -8.412  -3.764  1.00 0.00 ? 25 PHE A HE1  4  
ATOM   3114  H HE2  . PHE A 1 25 ? 5.658   -4.476  -3.608  1.00 0.00 ? 25 PHE A HE2  4  
ATOM   3115  H HZ   . PHE A 1 25 ? 7.219   -6.099  -4.573  1.00 0.00 ? 25 PHE A HZ   4  
ATOM   3116  N N    . MET A 1 26 ? 6.128   -9.081  1.120   1.00 0.00 ? 26 MET A N    4  
ATOM   3117  C CA   . MET A 1 26 ? 7.493   -9.579  1.158   1.00 0.00 ? 26 MET A CA   4  
ATOM   3118  C C    . MET A 1 26 ? 7.970   -9.979  -0.239  1.00 0.00 ? 26 MET A C    4  
ATOM   3119  O O    . MET A 1 26 ? 7.179   -10.438 -1.062  1.00 0.00 ? 26 MET A O    4  
ATOM   3120  C CB   . MET A 1 26 ? 7.567   -10.791 2.090   1.00 0.00 ? 26 MET A CB   4  
ATOM   3121  C CG   . MET A 1 26 ? 7.301   -10.385 3.540   1.00 0.00 ? 26 MET A CG   4  
ATOM   3122  S SD   . MET A 1 26 ? 8.406   -11.264 4.633   1.00 0.00 ? 26 MET A SD   4  
ATOM   3123  C CE   . MET A 1 26 ? 7.222   -11.975 5.764   1.00 0.00 ? 26 MET A CE   4  
ATOM   3124  H H    . MET A 1 26 ? 5.429   -9.740  1.397   1.00 0.00 ? 26 MET A H    4  
ATOM   3125  H HA   . MET A 1 26 ? 8.096   -8.753  1.534   1.00 0.00 ? 26 MET A HA   4  
ATOM   3126  H HB2  . MET A 1 26 ? 6.837   -11.539 1.778   1.00 0.00 ? 26 MET A HB2  4  
ATOM   3127  H HB3  . MET A 1 26 ? 8.551   -11.254 2.012   1.00 0.00 ? 26 MET A HB3  4  
ATOM   3128  H HG2  . MET A 1 26 ? 7.441   -9.310  3.657   1.00 0.00 ? 26 MET A HG2  4  
ATOM   3129  H HG3  . MET A 1 26 ? 6.266   -10.602 3.804   1.00 0.00 ? 26 MET A HG3  4  
ATOM   3130  H HE1  . MET A 1 26 ? 7.601   -11.898 6.783   1.00 0.00 ? 26 MET A HE1  4  
ATOM   3131  H HE2  . MET A 1 26 ? 6.277   -11.437 5.686   1.00 0.00 ? 26 MET A HE2  4  
ATOM   3132  N N    . VAL A 1 27 ? 9.262   -9.791  -0.465  1.00 0.00 ? 27 VAL A N    4  
ATOM   3133  C CA   . VAL A 1 27 ? 9.854   -10.126 -1.748  1.00 0.00 ? 27 VAL A CA   4  
ATOM   3134  C C    . VAL A 1 27 ? 9.656   -11.618 -2.022  1.00 0.00 ? 27 VAL A C    4  
ATOM   3135  O O    . VAL A 1 27 ? 9.840   -12.075 -3.150  1.00 0.00 ? 27 VAL A O    4  
ATOM   3136  C CB   . VAL A 1 27 ? 11.325  -9.703  -1.773  1.00 0.00 ? 27 VAL A CB   4  
ATOM   3137  C CG1  . VAL A 1 27 ? 12.169  -10.606 -0.871  1.00 0.00 ? 27 VAL A CG1  4  
ATOM   3138  C CG2  . VAL A 1 27 ? 11.869  -9.693  -3.202  1.00 0.00 ? 27 VAL A CG2  4  
ATOM   3139  H H    . VAL A 1 27 ? 9.899   -9.417  0.210   1.00 0.00 ? 27 VAL A H    4  
ATOM   3140  H HA   . VAL A 1 27 ? 9.327   -9.556  -2.513  1.00 0.00 ? 27 VAL A HA   4  
ATOM   3141  H HB   . VAL A 1 27 ? 11.388  -8.687  -1.383  1.00 0.00 ? 27 VAL A HB   4  
ATOM   3142  H HG11 . VAL A 1 27 ? 13.224  -10.474 -1.111  1.00 0.00 ? 27 VAL A HG11 4  
ATOM   3143  H HG12 . VAL A 1 27 ? 11.998  -10.341 0.172   1.00 0.00 ? 27 VAL A HG12 4  
ATOM   3144  H HG21 . VAL A 1 27 ? 12.263  -10.679 -3.449  1.00 0.00 ? 27 VAL A HG21 4  
ATOM   3145  H HG22 . VAL A 1 27 ? 11.066  -9.440  -3.895  1.00 0.00 ? 27 VAL A HG22 4  
ATOM   3146  N N    . ALA A 1 28 ? 9.285   -12.336 -0.973  1.00 0.00 ? 28 ALA A N    4  
ATOM   3147  C CA   . ALA A 1 28 ? 9.060   -13.767 -1.086  1.00 0.00 ? 28 ALA A CA   4  
ATOM   3148  C C    . ALA A 1 28 ? 8.414   -14.072 -2.439  1.00 0.00 ? 28 ALA A C    4  
ATOM   3149  O O    . ALA A 1 28 ? 8.760   -15.057 -3.088  1.00 0.00 ? 28 ALA A O    4  
ATOM   3150  C CB   . ALA A 1 28 ? 8.206   -14.244 0.090   1.00 0.00 ? 28 ALA A CB   4  
ATOM   3151  H H    . ALA A 1 28 ? 9.138   -11.956 -0.059  1.00 0.00 ? 28 ALA A H    4  
ATOM   3152  H HA   . ALA A 1 28 ? 10.031  -14.260 -1.037  1.00 0.00 ? 28 ALA A HA   4  
ATOM   3153  H HB1  . ALA A 1 28 ? 7.228   -13.764 0.047   1.00 0.00 ? 28 ALA A HB1  4  
ATOM   3154  H HB2  . ALA A 1 28 ? 8.082   -15.326 0.033   1.00 0.00 ? 28 ALA A HB2  4  
ATOM   3155  N N    . ALA A 1 29 ? 7.485   -13.208 -2.823  1.00 0.00 ? 29 ALA A N    4  
ATOM   3156  C CA   . ALA A 1 29 ? 6.787   -13.372 -4.086  1.00 0.00 ? 29 ALA A CA   4  
ATOM   3157  C C    . ALA A 1 29 ? 6.289   -12.009 -4.570  1.00 0.00 ? 29 ALA A C    4  
ATOM   3158  O O    . ALA A 1 29 ? 6.024   -11.119 -3.763  1.00 0.00 ? 29 ALA A O    4  
ATOM   3159  C CB   . ALA A 1 29 ? 5.649   -14.381 -3.914  1.00 0.00 ? 29 ALA A CB   4  
ATOM   3160  H H    . ALA A 1 29 ? 7.209   -12.409 -2.288  1.00 0.00 ? 29 ALA A H    4  
ATOM   3161  H HA   . ALA A 1 29 ? 7.500   -13.767 -4.810  1.00 0.00 ? 29 ALA A HA   4  
ATOM   3162  H HB1  . ALA A 1 29 ? 5.960   -15.349 -4.305  1.00 0.00 ? 29 ALA A HB1  4  
ATOM   3163  H HB2  . ALA A 1 29 ? 5.407   -14.477 -2.855  1.00 0.00 ? 29 ALA A HB2  4  
ATOM   3164  N N    . PRO A 1 30 ? 6.173   -11.885 -5.919  1.00 0.00 ? 30 PRO A N    4  
ATOM   3165  C CA   . PRO A 1 30 ? 5.712   -10.645 -6.520  1.00 0.00 ? 30 PRO A CA   4  
ATOM   3166  C C    . PRO A 1 30 ? 4.201   -10.478 -6.341  1.00 0.00 ? 30 PRO A C    4  
ATOM   3167  O O    . PRO A 1 30 ? 3.683   -9.365  -6.419  1.00 0.00 ? 30 PRO A O    4  
ATOM   3168  C CB   . PRO A 1 30 ? 6.130   -10.735 -7.979  1.00 0.00 ? 30 PRO A CB   4  
ATOM   3169  C CG   . PRO A 1 30 ? 6.394   -12.208 -8.247  1.00 0.00 ? 30 PRO A CG   4  
ATOM   3170  C CD   . PRO A 1 30 ? 6.478   -12.918 -6.905  1.00 0.00 ? 30 PRO A CD   4  
ATOM   3171  H HA   . PRO A 1 30 ? 6.130   -9.860  -6.062  1.00 0.00 ? 30 PRO A HA   4  
ATOM   3172  H HB2  . PRO A 1 30 ? 5.347   -10.353 -8.634  1.00 0.00 ? 30 PRO A HB2  4  
ATOM   3173  H HB3  . PRO A 1 30 ? 7.022   -10.138 -8.167  1.00 0.00 ? 30 PRO A HB3  4  
ATOM   3174  H HG2  . PRO A 1 30 ? 5.596   -12.634 -8.855  1.00 0.00 ? 30 PRO A HG2  4  
ATOM   3175  H HG3  . PRO A 1 30 ? 7.322   -12.334 -8.804  1.00 0.00 ? 30 PRO A HG3  4  
ATOM   3176  H HD2  . PRO A 1 30 ? 5.766   -13.741 -6.848  1.00 0.00 ? 30 PRO A HD2  4  
ATOM   3177  H HD3  . PRO A 1 30 ? 7.469   -13.341 -6.742  1.00 0.00 ? 30 PRO A HD3  4  
ATOM   3178  N N    . HIS A 1 31 ? 3.538   -11.600 -6.103  1.00 0.00 ? 31 HIS A N    4  
ATOM   3179  C CA   . HIS A 1 31 ? 2.098   -11.591 -5.912  1.00 0.00 ? 31 HIS A CA   4  
ATOM   3180  C C    . HIS A 1 31 ? 1.747   -12.337 -4.623  1.00 0.00 ? 31 HIS A C    4  
ATOM   3181  O O    . HIS A 1 31 ? 1.049   -13.349 -4.657  1.00 0.00 ? 31 HIS A O    4  
ATOM   3182  C CB   . HIS A 1 31 ? 1.383   -12.161 -7.139  1.00 0.00 ? 31 HIS A CB   4  
ATOM   3183  C CG   . HIS A 1 31 ? -0.099  -11.873 -7.176  1.00 0.00 ? 31 HIS A CG   4  
ATOM   3184  N ND1  . HIS A 1 31 ? -0.972  -12.314 -6.196  1.00 0.00 ? 31 HIS A ND1  4  
ATOM   3185  C CD2  . HIS A 1 31 ? -0.851  -11.186 -8.081  1.00 0.00 ? 31 HIS A CD2  4  
ATOM   3186  C CE1  . HIS A 1 31 ? -2.192  -11.905 -6.510  1.00 0.00 ? 31 HIS A CE1  4  
ATOM   3187  N NE2  . HIS A 1 31 ? -2.116  -11.206 -7.678  1.00 0.00 ? 31 HIS A NE2  4  
ATOM   3188  H H    . HIS A 1 31 ? 3.967   -12.501 -6.041  1.00 0.00 ? 31 HIS A H    4  
ATOM   3189  H HA   . HIS A 1 31 ? 1.802   -10.547 -5.810  1.00 0.00 ? 31 HIS A HA   4  
ATOM   3190  H HB2  . HIS A 1 31 ? 1.845   -11.751 -8.038  1.00 0.00 ? 31 HIS A HB2  4  
ATOM   3191  H HB3  . HIS A 1 31 ? 1.535   -13.240 -7.167  1.00 0.00 ? 31 HIS A HB3  4  
ATOM   3192  H HD1  . HIS A 1 31 ? -0.724  -12.850 -5.390  1.00 0.00 ? 31 HIS A HD1  4  
ATOM   3193  H HD2  . HIS A 1 31 ? -0.477  -10.701 -8.984  1.00 0.00 ? 31 HIS A HD2  4  
ATOM   3194  H HE1  . HIS A 1 31 ? -3.099  -12.093 -5.934  1.00 0.00 ? 31 HIS A HE1  4  
ATOM   3195  N N    . VAL A 1 32 ? 2.247   -11.807 -3.516  1.00 0.00 ? 32 VAL A N    4  
ATOM   3196  C CA   . VAL A 1 32 ? 1.995   -12.410 -2.218  1.00 0.00 ? 32 VAL A CA   4  
ATOM   3197  C C    . VAL A 1 32 ? 2.071   -11.331 -1.136  1.00 0.00 ? 32 VAL A C    4  
ATOM   3198  O O    . VAL A 1 32 ? 3.112   -11.152 -0.505  1.00 0.00 ? 32 VAL A O    4  
ATOM   3199  C CB   . VAL A 1 32 ? 2.969   -13.565 -1.980  1.00 0.00 ? 32 VAL A CB   4  
ATOM   3200  C CG1  . VAL A 1 32 ? 2.934   -14.020 -0.519  1.00 0.00 ? 32 VAL A CG1  4  
ATOM   3201  C CG2  . VAL A 1 32 ? 2.677   -14.733 -2.925  1.00 0.00 ? 32 VAL A CG2  4  
ATOM   3202  H H    . VAL A 1 32 ? 2.813   -10.984 -3.497  1.00 0.00 ? 32 VAL A H    4  
ATOM   3203  H HA   . VAL A 1 32 ? 0.985   -12.819 -2.236  1.00 0.00 ? 32 VAL A HA   4  
ATOM   3204  H HB   . VAL A 1 32 ? 3.975   -13.205 -2.194  1.00 0.00 ? 32 VAL A HB   4  
ATOM   3205  H HG11 . VAL A 1 32 ? 3.781   -13.591 0.016   1.00 0.00 ? 32 VAL A HG11 4  
ATOM   3206  H HG12 . VAL A 1 32 ? 2.005   -13.685 -0.057  1.00 0.00 ? 32 VAL A HG12 4  
ATOM   3207  H HG21 . VAL A 1 32 ? 1.633   -15.029 -2.824  1.00 0.00 ? 32 VAL A HG21 4  
ATOM   3208  H HG22 . VAL A 1 32 ? 2.870   -14.425 -3.953  1.00 0.00 ? 32 VAL A HG22 4  
ATOM   3209  N N    . PRO A 1 33 ? 0.926   -10.621 -0.951  1.00 0.00 ? 33 PRO A N    4  
ATOM   3210  C CA   . PRO A 1 33 ? 0.853   -9.564  0.044   1.00 0.00 ? 33 PRO A CA   4  
ATOM   3211  C C    . PRO A 1 33 ? 0.763   -10.146 1.456   1.00 0.00 ? 33 PRO A C    4  
ATOM   3212  O O    . PRO A 1 33 ? 0.268   -11.257 1.644   1.00 0.00 ? 33 PRO A O    4  
ATOM   3213  C CB   . PRO A 1 33 ? -0.368  -8.746  -0.341  1.00 0.00 ? 33 PRO A CB   4  
ATOM   3214  C CG   . PRO A 1 33 ? -1.197  -9.636  -1.251  1.00 0.00 ? 33 PRO A CG   4  
ATOM   3215  C CD   . PRO A 1 33 ? -0.325  -10.805 -1.680  1.00 0.00 ? 33 PRO A CD   4  
ATOM   3216  H HA   . PRO A 1 33 ? 1.688   -9.014  0.028   1.00 0.00 ? 33 PRO A HA   4  
ATOM   3217  H HB2  . PRO A 1 33 ? -0.936  -8.453  0.543   1.00 0.00 ? 33 PRO A HB2  4  
ATOM   3218  H HB3  . PRO A 1 33 ? -0.078  -7.827  -0.851  1.00 0.00 ? 33 PRO A HB3  4  
ATOM   3219  H HG2  . PRO A 1 33 ? -2.086  -9.994  -0.730  1.00 0.00 ? 33 PRO A HG2  4  
ATOM   3220  H HG3  . PRO A 1 33 ? -1.542  -9.078  -2.122  1.00 0.00 ? 33 PRO A HG3  4  
ATOM   3221  H HD2  . PRO A 1 33 ? -0.791  -11.759 -1.432  1.00 0.00 ? 33 PRO A HD2  4  
ATOM   3222  H HD3  . PRO A 1 33 ? -0.160  -10.802 -2.757  1.00 0.00 ? 33 PRO A HD3  4  
ATOM   3223  N N    . VAL A 1 34 ? 1.248   -9.369  2.414   1.00 0.00 ? 34 VAL A N    4  
ATOM   3224  C CA   . VAL A 1 34 ? 1.228   -9.793  3.803   1.00 0.00 ? 34 VAL A CA   4  
ATOM   3225  C C    . VAL A 1 34 ? 0.158   -9.002  4.558   1.00 0.00 ? 34 VAL A C    4  
ATOM   3226  O O    . VAL A 1 34 ? -0.466  -9.520  5.483   1.00 0.00 ? 34 VAL A O    4  
ATOM   3227  C CB   . VAL A 1 34 ? 2.622   -9.647  4.415   1.00 0.00 ? 34 VAL A CB   4  
ATOM   3228  C CG1  . VAL A 1 34 ? 3.110   -8.199  4.330   1.00 0.00 ? 34 VAL A CG1  4  
ATOM   3229  C CG2  . VAL A 1 34 ? 2.642   -10.148 5.861   1.00 0.00 ? 34 VAL A CG2  4  
ATOM   3230  H H    . VAL A 1 34 ? 1.648   -8.467  2.253   1.00 0.00 ? 34 VAL A H    4  
ATOM   3231  H HA   . VAL A 1 34 ? 0.960   -10.850 3.821   1.00 0.00 ? 34 VAL A HA   4  
ATOM   3232  H HB   . VAL A 1 34 ? 3.308   -10.266 3.837   1.00 0.00 ? 34 VAL A HB   4  
ATOM   3233  H HG11 . VAL A 1 34 ? 3.798   -8.097  3.491   1.00 0.00 ? 34 VAL A HG11 4  
ATOM   3234  H HG12 . VAL A 1 34 ? 2.256   -7.537  4.183   1.00 0.00 ? 34 VAL A HG12 4  
ATOM   3235  H HG21 . VAL A 1 34 ? 2.834   -11.221 5.871   1.00 0.00 ? 34 VAL A HG21 4  
ATOM   3236  H HG22 . VAL A 1 34 ? 3.428   -9.633  6.413   1.00 0.00 ? 34 VAL A HG22 4  
ATOM   3237  N N    . LYS A 1 35 ? -0.021  -7.759  4.136   1.00 0.00 ? 35 LYS A N    4  
ATOM   3238  C CA   . LYS A 1 35 ? -1.005  -6.891  4.761   1.00 0.00 ? 35 LYS A CA   4  
ATOM   3239  C C    . LYS A 1 35 ? -1.128  -5.600  3.949   1.00 0.00 ? 35 LYS A C    4  
ATOM   3240  O O    . LYS A 1 35 ? -0.375  -5.384  3.001   1.00 0.00 ? 35 LYS A O    4  
ATOM   3241  C CB   . LYS A 1 35 ? -0.658  -6.661  6.233   1.00 0.00 ? 35 LYS A CB   4  
ATOM   3242  C CG   . LYS A 1 35 ? 0.540   -5.720  6.374   1.00 0.00 ? 35 LYS A CG   4  
ATOM   3243  C CD   . LYS A 1 35 ? 1.564   -6.280  7.363   1.00 0.00 ? 35 LYS A CD   4  
ATOM   3244  C CE   . LYS A 1 35 ? 2.748   -5.325  7.527   1.00 0.00 ? 35 LYS A CE   4  
ATOM   3245  N NZ   . LYS A 1 35 ? 2.728   -4.700  8.868   1.00 0.00 ? 35 LYS A NZ   4  
ATOM   3246  H H    . LYS A 1 35 ? 0.490   -7.345  3.383   1.00 0.00 ? 35 LYS A H    4  
ATOM   3247  H HA   . LYS A 1 35 ? -1.963  -7.409  4.733   1.00 0.00 ? 35 LYS A HA   4  
ATOM   3248  H HB2  . LYS A 1 35 ? -1.519  -6.239  6.752   1.00 0.00 ? 35 LYS A HB2  4  
ATOM   3249  H HB3  . LYS A 1 35 ? -0.435  -7.614  6.711   1.00 0.00 ? 35 LYS A HB3  4  
ATOM   3250  H HG2  . LYS A 1 35 ? 1.010   -5.576  5.401   1.00 0.00 ? 35 LYS A HG2  4  
ATOM   3251  H HG3  . LYS A 1 35 ? 0.200   -4.741  6.712   1.00 0.00 ? 35 LYS A HG3  4  
ATOM   3252  H HD2  . LYS A 1 35 ? 1.088   -6.445  8.330   1.00 0.00 ? 35 LYS A HD2  4  
ATOM   3253  H HD3  . LYS A 1 35 ? 1.919   -7.250  7.014   1.00 0.00 ? 35 LYS A HD3  4  
ATOM   3254  H HE2  . LYS A 1 35 ? 3.682   -5.868  7.386   1.00 0.00 ? 35 LYS A HE2  4  
ATOM   3255  H HE3  . LYS A 1 35 ? 2.709   -4.553  6.758   1.00 0.00 ? 35 LYS A HE3  4  
ATOM   3256  H HZ1  . LYS A 1 35 ? 3.666   -4.524  9.168   1.00 0.00 ? 35 LYS A HZ1  4  
ATOM   3257  H HZ2  . LYS A 1 35 ? 2.223   -3.838  8.826   1.00 0.00 ? 35 LYS A HZ2  4  
ATOM   3258  N N    . ARG A 1 36 ? -2.081  -4.745  4.326   1.00 0.00 ? 36 ARG A N    4  
ATOM   3259  C CA   . ARG A 1 36 ? -2.299  -3.489  3.638   1.00 0.00 ? 36 ARG A CA   4  
ATOM   3260  C C    . ARG A 1 36 ? -2.843  -2.454  4.613   1.00 0.00 ? 36 ARG A C    4  
ATOM   3261  O O    . ARG A 1 36 ? -3.141  -2.777  5.760   1.00 0.00 ? 36 ARG A O    4  
ATOM   3262  C CB   . ARG A 1 36 ? -3.272  -3.706  2.482   1.00 0.00 ? 36 ARG A CB   4  
ATOM   3263  C CG   . ARG A 1 36 ? -2.600  -4.551  1.404   1.00 0.00 ? 36 ARG A CG   4  
ATOM   3264  C CD   . ARG A 1 36 ? -3.604  -4.853  0.295   1.00 0.00 ? 36 ARG A CD   4  
ATOM   3265  N NE   . ARG A 1 36 ? -4.576  -5.858  0.725   1.00 0.00 ? 36 ARG A NE   4  
ATOM   3266  C CZ   . ARG A 1 36 ? -4.352  -7.175  0.624   1.00 0.00 ? 36 ARG A CZ   4  
ATOM   3267  N NH1  . ARG A 1 36 ? -3.196  -7.621  0.112   1.00 0.00 ? 36 ARG A NH1  4  
ATOM   3268  N NH2  . ARG A 1 36 ? -5.283  -8.047  1.035   1.00 0.00 ? 36 ARG A NH2  4  
ATOM   3269  H H    . ARG A 1 36 ? -2.674  -4.971  5.113   1.00 0.00 ? 36 ARG A H    4  
ATOM   3270  H HA   . ARG A 1 36 ? -1.349  -3.134  3.239   1.00 0.00 ? 36 ARG A HA   4  
ATOM   3271  H HB2  . ARG A 1 36 ? -4.161  -4.220  2.847   1.00 0.00 ? 36 ARG A HB2  4  
ATOM   3272  H HB3  . ARG A 1 36 ? -3.557  -2.741  2.062   1.00 0.00 ? 36 ARG A HB3  4  
ATOM   3273  H HG2  . ARG A 1 36 ? -1.753  -4.005  0.989   1.00 0.00 ? 36 ARG A HG2  4  
ATOM   3274  H HG3  . ARG A 1 36 ? -2.250  -5.486  1.841   1.00 0.00 ? 36 ARG A HG3  4  
ATOM   3275  H HD2  . ARG A 1 36 ? -4.130  -3.936  0.030   1.00 0.00 ? 36 ARG A HD2  4  
ATOM   3276  H HD3  . ARG A 1 36 ? -3.069  -5.224  -0.580  1.00 0.00 ? 36 ARG A HD3  4  
ATOM   3277  H HE   . ARG A 1 36 ? -5.450  -5.532  1.113   1.00 0.00 ? 36 ARG A HE   4  
ATOM   3278  H HH11 . ARG A 1 36 ? -2.494  -6.964  -0.197  1.00 0.00 ? 36 ARG A HH11 4  
ATOM   3279  H HH12 . ARG A 1 36 ? -3.027  -8.613  0.036   1.00 0.00 ? 36 ARG A HH12 4  
ATOM   3280  H HH21 . ARG A 1 36 ? -6.154  -7.711  1.421   1.00 0.00 ? 36 ARG A HH21 4  
ATOM   3281  H HH22 . ARG A 1 36 ? -5.114  -9.039  0.959   1.00 0.00 ? 36 ARG A HH22 4  
ATOM   3282  N N    . GLY A 1 37 ? -2.957  -1.228  4.123   1.00 0.00 ? 37 GLY A N    4  
ATOM   3283  C CA   . GLY A 1 37 ? -3.463  -0.140  4.942   1.00 0.00 ? 37 GLY A CA   4  
ATOM   3284  C C    . GLY A 1 37 ? -3.495  1.171   4.154   1.00 0.00 ? 37 GLY A C    4  
ATOM   3285  O O    . GLY A 1 37 ? -3.134  1.202   2.978   1.00 0.00 ? 37 GLY A O    4  
ATOM   3286  H H    . GLY A 1 37 ? -2.712  -0.974  3.187   1.00 0.00 ? 37 GLY A H    4  
ATOM   3287  H HA2  . GLY A 1 37 ? -4.466  -0.381  5.295   1.00 0.00 ? 37 GLY A HA2  4  
ATOM   3288  H HA3  . GLY A 1 37 ? -2.834  -0.022  5.825   1.00 0.00 ? 37 GLY A HA3  4  
ATOM   3289  N N    . CYS A 1 38 ? -3.929  2.223   4.833   1.00 0.00 ? 38 CYS A N    4  
ATOM   3290  C CA   . CYS A 1 38 ? -4.013  3.533   4.211   1.00 0.00 ? 38 CYS A CA   4  
ATOM   3291  C C    . CYS A 1 38 ? -2.853  4.386   4.728   1.00 0.00 ? 38 CYS A C    4  
ATOM   3292  O O    . CYS A 1 38 ? -2.341  4.146   5.821   1.00 0.00 ? 38 CYS A O    4  
ATOM   3293  C CB   . CYS A 1 38 ? -5.368  4.196   4.468   1.00 0.00 ? 38 CYS A CB   4  
ATOM   3294  S SG   . CYS A 1 38 ? -6.790  3.376   3.659   1.00 0.00 ? 38 CYS A SG   4  
ATOM   3295  H H    . CYS A 1 38 ? -4.221  2.189   5.789   1.00 0.00 ? 38 CYS A H    4  
ATOM   3296  H HA   . CYS A 1 38 ? -3.928  3.375   3.136   1.00 0.00 ? 38 CYS A HA   4  
ATOM   3297  H HB2  . CYS A 1 38 ? -5.545  4.222   5.543   1.00 0.00 ? 38 CYS A HB2  4  
ATOM   3298  H HB3  . CYS A 1 38 ? -5.321  5.230   4.128   1.00 0.00 ? 38 CYS A HB3  4  
ATOM   3299  N N    . ILE A 1 39 ? -2.472  5.363   3.919   1.00 0.00 ? 39 ILE A N    4  
ATOM   3300  C CA   . ILE A 1 39 ? -1.381  6.252   4.281   1.00 0.00 ? 39 ILE A CA   4  
ATOM   3301  C C    . ILE A 1 39 ? -1.491  7.544   3.469   1.00 0.00 ? 39 ILE A C    4  
ATOM   3302  O O    . ILE A 1 39 ? -2.394  7.689   2.647   1.00 0.00 ? 39 ILE A O    4  
ATOM   3303  C CB   . ILE A 1 39 ? -0.036  5.541   4.127   1.00 0.00 ? 39 ILE A CB   4  
ATOM   3304  C CG1  . ILE A 1 39 ? 0.933   5.953   5.237   1.00 0.00 ? 39 ILE A CG1  4  
ATOM   3305  C CG2  . ILE A 1 39 ? 0.553   5.778   2.734   1.00 0.00 ? 39 ILE A CG2  4  
ATOM   3306  C CD1  . ILE A 1 39 ? 1.132   4.816   6.241   1.00 0.00 ? 39 ILE A CD1  4  
ATOM   3307  H H    . ILE A 1 39 ? -2.893  5.551   3.032   1.00 0.00 ? 39 ILE A H    4  
ATOM   3308  H HA   . ILE A 1 39 ? -1.497  6.497   5.337   1.00 0.00 ? 39 ILE A HA   4  
ATOM   3309  H HB   . ILE A 1 39 ? -0.203  4.468   4.227   1.00 0.00 ? 39 ILE A HB   4  
ATOM   3310  H HG12 . ILE A 1 39 ? 1.894   6.230   4.801   1.00 0.00 ? 39 ILE A HG12 4  
ATOM   3311  H HG13 . ILE A 1 39 ? 0.550   6.835   5.750   1.00 0.00 ? 39 ILE A HG13 4  
ATOM   3312  H HG21 . ILE A 1 39 ? 1.560   5.364   2.690   1.00 0.00 ? 39 ILE A HG21 4  
ATOM   3313  H HG22 . ILE A 1 39 ? -0.073  5.291   1.987   1.00 0.00 ? 39 ILE A HG22 4  
ATOM   3314  H HD11 . ILE A 1 39 ? 1.320   5.234   7.230   1.00 0.00 ? 39 ILE A HD11 4  
ATOM   3315  H HD12 . ILE A 1 39 ? 0.235   4.198   6.272   1.00 0.00 ? 39 ILE A HD12 4  
ATOM   3316  N N    . ASP A 1 40 ? -0.568  8.479   3.705   1.00 0.00 ? 40 ASP A N    4  
ATOM   3317  C CA   . ASP A 1 40 ? -0.565  9.745   3.001   1.00 0.00 ? 40 ASP A CA   4  
ATOM   3318  C C    . ASP A 1 40 ? 0.663   9.835   2.107   1.00 0.00 ? 40 ASP A C    4  
ATOM   3319  O O    . ASP A 1 40 ? 0.606   10.421  1.028   1.00 0.00 ? 40 ASP A O    4  
ATOM   3320  C CB   . ASP A 1 40 ? -0.583  10.888  4.012   1.00 0.00 ? 40 ASP A CB   4  
ATOM   3321  C CG   . ASP A 1 40 ? 0.409   10.633  5.138   1.00 0.00 ? 40 ASP A CG   4  
ATOM   3322  O OD1  . ASP A 1 40 ? 0.215   9.621   5.846   1.00 0.00 ? 40 ASP A OD1  4  
ATOM   3323  O OD2  . ASP A 1 40 ? 1.342   11.455  5.270   1.00 0.00 ? 40 ASP A OD2  4  
ATOM   3324  H H    . ASP A 1 40 ? 0.153   8.310   4.391   1.00 0.00 ? 40 ASP A H    4  
ATOM   3325  H HA   . ASP A 1 40 ? -1.460  9.808   2.380   1.00 0.00 ? 40 ASP A HA   4  
ATOM   3326  H HB2  . ASP A 1 40 ? -0.320  11.818  3.507   1.00 0.00 ? 40 ASP A HB2  4  
ATOM   3327  H HB3  . ASP A 1 40 ? -1.585  10.980  4.431   1.00 0.00 ? 40 ASP A HB3  4  
ATOM   3328  H HD2  . ASP A 1 40 ? 1.932   11.239  5.996   1.00 0.00 ? 40 ASP A HD2  4  
ATOM   3329  N N    . VAL A 1 41 ? 1.749   9.245   2.585   1.00 0.00 ? 41 VAL A N    4  
ATOM   3330  C CA   . VAL A 1 41 ? 2.995   9.252   1.838   1.00 0.00 ? 41 VAL A CA   4  
ATOM   3331  C C    . VAL A 1 41 ? 3.544   7.826   1.755   1.00 0.00 ? 41 VAL A C    4  
ATOM   3332  O O    . VAL A 1 41 ? 3.345   7.027   2.669   1.00 0.00 ? 41 VAL A O    4  
ATOM   3333  C CB   . VAL A 1 41 ? 3.980   10.236  2.471   1.00 0.00 ? 41 VAL A CB   4  
ATOM   3334  C CG1  . VAL A 1 41 ? 4.487   9.715   3.817   1.00 0.00 ? 41 VAL A CG1  4  
ATOM   3335  C CG2  . VAL A 1 41 ? 5.145   10.533  1.524   1.00 0.00 ? 41 VAL A CG2  4  
ATOM   3336  H H    . VAL A 1 41 ? 1.787   8.770   3.465   1.00 0.00 ? 41 VAL A H    4  
ATOM   3337  H HA   . VAL A 1 41 ? 2.771   9.601   0.829   1.00 0.00 ? 41 VAL A HA   4  
ATOM   3338  H HB   . VAL A 1 41 ? 3.450   11.171  2.653   1.00 0.00 ? 41 VAL A HB   4  
ATOM   3339  H HG11 . VAL A 1 41 ? 5.564   9.871   3.885   1.00 0.00 ? 41 VAL A HG11 4  
ATOM   3340  H HG12 . VAL A 1 41 ? 3.990   10.251  4.625   1.00 0.00 ? 41 VAL A HG12 4  
ATOM   3341  H HG21 . VAL A 1 41 ? 5.469   9.608   1.047   1.00 0.00 ? 41 VAL A HG21 4  
ATOM   3342  H HG22 . VAL A 1 41 ? 4.821   11.241  0.761   1.00 0.00 ? 41 VAL A HG22 4  
ATOM   3343  N N    . CYS A 1 42 ? 4.223   7.551   0.652   1.00 0.00 ? 42 CYS A N    4  
ATOM   3344  C CA   . CYS A 1 42 ? 4.802   6.235   0.438   1.00 0.00 ? 42 CYS A CA   4  
ATOM   3345  C C    . CYS A 1 42 ? 6.190   6.211   1.083   1.00 0.00 ? 42 CYS A C    4  
ATOM   3346  O O    . CYS A 1 42 ? 7.000   7.107   0.854   1.00 0.00 ? 42 CYS A O    4  
ATOM   3347  C CB   . CYS A 1 42 ? 4.857   5.875   -1.048  1.00 0.00 ? 42 CYS A CB   4  
ATOM   3348  S SG   . CYS A 1 42 ? 4.570   4.107   -1.420  1.00 0.00 ? 42 CYS A SG   4  
ATOM   3349  H H    . CYS A 1 42 ? 4.380   8.206   -0.087  1.00 0.00 ? 42 CYS A H    4  
ATOM   3350  H HA   . CYS A 1 42 ? 4.138   5.519   0.922   1.00 0.00 ? 42 CYS A HA   4  
ATOM   3351  H HB2  . CYS A 1 42 ? 4.113   6.469   -1.579  1.00 0.00 ? 42 CYS A HB2  4  
ATOM   3352  H HB3  . CYS A 1 42 ? 5.832   6.161   -1.441  1.00 0.00 ? 42 CYS A HB3  4  
ATOM   3353  N N    . PRO A 1 43 ? 6.427   5.147   1.897   1.00 0.00 ? 43 PRO A N    4  
ATOM   3354  C CA   . PRO A 1 43 ? 7.702   4.994   2.576   1.00 0.00 ? 43 PRO A CA   4  
ATOM   3355  C C    . PRO A 1 43 ? 8.790   4.535   1.603   1.00 0.00 ? 43 PRO A C    4  
ATOM   3356  O O    . PRO A 1 43 ? 8.555   4.453   0.398   1.00 0.00 ? 43 PRO A O    4  
ATOM   3357  C CB   . PRO A 1 43 ? 7.438   3.991   3.687   1.00 0.00 ? 43 PRO A CB   4  
ATOM   3358  C CG   . PRO A 1 43 ? 6.155   3.272   3.304   1.00 0.00 ? 43 PRO A CG   4  
ATOM   3359  C CD   . PRO A 1 43 ? 5.490   4.066   2.191   1.00 0.00 ? 43 PRO A CD   4  
ATOM   3360  H HA   . PRO A 1 43 ? 8.011   5.874   2.936   1.00 0.00 ? 43 PRO A HA   4  
ATOM   3361  H HB2  . PRO A 1 43 ? 8.266   3.288   3.784   1.00 0.00 ? 43 PRO A HB2  4  
ATOM   3362  H HB3  . PRO A 1 43 ? 7.332   4.493   4.649   1.00 0.00 ? 43 PRO A HB3  4  
ATOM   3363  H HG2  . PRO A 1 43 ? 6.371   2.257   2.971   1.00 0.00 ? 43 PRO A HG2  4  
ATOM   3364  H HG3  . PRO A 1 43 ? 5.491   3.191   4.164   1.00 0.00 ? 43 PRO A HG3  4  
ATOM   3365  H HD2  . PRO A 1 43 ? 5.313   3.446   1.313   1.00 0.00 ? 43 PRO A HD2  4  
ATOM   3366  H HD3  . PRO A 1 43 ? 4.522   4.456   2.506   1.00 0.00 ? 43 PRO A HD3  4  
ATOM   3367  N N    . LYS A 1 44 ? 9.957   4.249   2.161   1.00 0.00 ? 44 LYS A N    4  
ATOM   3368  C CA   . LYS A 1 44 ? 11.081  3.801   1.358   1.00 0.00 ? 44 LYS A CA   4  
ATOM   3369  C C    . LYS A 1 44 ? 10.931  2.306   1.067   1.00 0.00 ? 44 LYS A C    4  
ATOM   3370  O O    . LYS A 1 44 ? 10.458  1.550   1.914   1.00 0.00 ? 44 LYS A O    4  
ATOM   3371  C CB   . LYS A 1 44 ? 12.403  4.165   2.036   1.00 0.00 ? 44 LYS A CB   4  
ATOM   3372  C CG   . LYS A 1 44 ? 13.595  3.645   1.229   1.00 0.00 ? 44 LYS A CG   4  
ATOM   3373  C CD   . LYS A 1 44 ? 14.887  4.352   1.643   1.00 0.00 ? 44 LYS A CD   4  
ATOM   3374  C CE   . LYS A 1 44 ? 15.821  4.533   0.445   1.00 0.00 ? 44 LYS A CE   4  
ATOM   3375  N NZ   . LYS A 1 44 ? 16.560  3.280   0.171   1.00 0.00 ? 44 LYS A NZ   4  
ATOM   3376  H H    . LYS A 1 44 ? 10.139  4.318   3.142   1.00 0.00 ? 44 LYS A H    4  
ATOM   3377  H HA   . LYS A 1 44 ? 11.044  4.342   0.413   1.00 0.00 ? 44 LYS A HA   4  
ATOM   3378  H HB2  . LYS A 1 44 ? 12.476  5.248   2.142   1.00 0.00 ? 44 LYS A HB2  4  
ATOM   3379  H HB3  . LYS A 1 44 ? 12.429  3.745   3.041   1.00 0.00 ? 44 LYS A HB3  4  
ATOM   3380  H HG2  . LYS A 1 44 ? 13.699  2.571   1.380   1.00 0.00 ? 44 LYS A HG2  4  
ATOM   3381  H HG3  . LYS A 1 44 ? 13.415  3.802   0.166   1.00 0.00 ? 44 LYS A HG3  4  
ATOM   3382  H HD2  . LYS A 1 44 ? 14.652  5.325   2.075   1.00 0.00 ? 44 LYS A HD2  4  
ATOM   3383  H HD3  . LYS A 1 44 ? 15.391  3.773   2.417   1.00 0.00 ? 44 LYS A HD3  4  
ATOM   3384  H HE2  . LYS A 1 44 ? 15.244  4.821   -0.433  1.00 0.00 ? 44 LYS A HE2  4  
ATOM   3385  H HE3  . LYS A 1 44 ? 16.525  5.341   0.643   1.00 0.00 ? 44 LYS A HE3  4  
ATOM   3386  H HZ1  . LYS A 1 44 ? 17.542  3.468   0.156   1.00 0.00 ? 44 LYS A HZ1  4  
ATOM   3387  H HZ2  . LYS A 1 44 ? 16.360  2.611   0.886   1.00 0.00 ? 44 LYS A HZ2  4  
ATOM   3388  N N    . SER A 1 45 ? 11.343  1.925   -0.134  1.00 0.00 ? 45 SER A N    4  
ATOM   3389  C CA   . SER A 1 45 ? 11.260  0.535   -0.547  1.00 0.00 ? 45 SER A CA   4  
ATOM   3390  C C    . SER A 1 45 ? 12.641  -0.118  -0.467  1.00 0.00 ? 45 SER A C    4  
ATOM   3391  O O    . SER A 1 45 ? 13.603  0.385   -1.046  1.00 0.00 ? 45 SER A O    4  
ATOM   3392  C CB   . SER A 1 45 ? 10.696  0.414   -1.964  1.00 0.00 ? 45 SER A CB   4  
ATOM   3393  O OG   . SER A 1 45 ? 9.279   0.265   -1.964  1.00 0.00 ? 45 SER A OG   4  
ATOM   3394  H H    . SER A 1 45 ? 11.726  2.547   -0.817  1.00 0.00 ? 45 SER A H    4  
ATOM   3395  H HA   . SER A 1 45 ? 10.573  0.065   0.158   1.00 0.00 ? 45 SER A HA   4  
ATOM   3396  H HB2  . SER A 1 45 ? 10.968  1.299   -2.539  1.00 0.00 ? 45 SER A HB2  4  
ATOM   3397  H HB3  . SER A 1 45 ? 11.151  -0.442  -2.463  1.00 0.00 ? 45 SER A HB3  4  
ATOM   3398  H HG   . SER A 1 45 ? 8.929   0.325   -1.030  1.00 0.00 ? 45 SER A HG   4  
ATOM   3399  N N    . SER A 1 46 ? 12.696  -1.228  0.254   1.00 0.00 ? 46 SER A N    4  
ATOM   3400  C CA   . SER A 1 46 ? 13.943  -1.955  0.416   1.00 0.00 ? 46 SER A CA   4  
ATOM   3401  C C    . SER A 1 46 ? 13.924  -3.225  -0.436  1.00 0.00 ? 46 SER A C    4  
ATOM   3402  O O    . SER A 1 46 ? 12.909  -3.549  -1.051  1.00 0.00 ? 46 SER A O    4  
ATOM   3403  C CB   . SER A 1 46 ? 14.189  -2.305  1.885   1.00 0.00 ? 46 SER A CB   4  
ATOM   3404  O OG   . SER A 1 46 ? 13.392  -3.406  2.312   1.00 0.00 ? 46 SER A OG   4  
ATOM   3405  H H    . SER A 1 46 ? 11.908  -1.631  0.721   1.00 0.00 ? 46 SER A H    4  
ATOM   3406  H HA   . SER A 1 46 ? 14.721  -1.274  0.071   1.00 0.00 ? 46 SER A HA   4  
ATOM   3407  H HB2  . SER A 1 46 ? 15.243  -2.543  2.029   1.00 0.00 ? 46 SER A HB2  4  
ATOM   3408  H HB3  . SER A 1 46 ? 13.971  -1.437  2.506   1.00 0.00 ? 46 SER A HB3  4  
ATOM   3409  H HG   . SER A 1 46 ? 13.972  -4.202  2.485   1.00 0.00 ? 46 SER A HG   4  
ATOM   3410  N N    . LEU A 1 47 ? 15.058  -3.910  -0.446  1.00 0.00 ? 47 LEU A N    4  
ATOM   3411  C CA   . LEU A 1 47 ? 15.184  -5.138  -1.213  1.00 0.00 ? 47 LEU A CA   4  
ATOM   3412  C C    . LEU A 1 47 ? 14.372  -6.243  -0.536  1.00 0.00 ? 47 LEU A C    4  
ATOM   3413  O O    . LEU A 1 47 ? 13.569  -6.914  -1.183  1.00 0.00 ? 47 LEU A O    4  
ATOM   3414  C CB   . LEU A 1 47 ? 16.658  -5.494  -1.416  1.00 0.00 ? 47 LEU A CB   4  
ATOM   3415  C CG   . LEU A 1 47 ? 17.367  -4.786  -2.572  1.00 0.00 ? 47 LEU A CG   4  
ATOM   3416  C CD1  . LEU A 1 47 ? 18.886  -4.923  -2.451  1.00 0.00 ? 47 LEU A CD1  4  
ATOM   3417  C CD2  . LEU A 1 47 ? 16.852  -5.291  -3.922  1.00 0.00 ? 47 LEU A CD2  4  
ATOM   3418  H H    . LEU A 1 47 ? 15.879  -3.640  0.057   1.00 0.00 ? 47 LEU A H    4  
ATOM   3419  H HA   . LEU A 1 47 ? 14.759  -4.952  -2.200  1.00 0.00 ? 47 LEU A HA   4  
ATOM   3420  H HB2  . LEU A 1 47 ? 17.196  -5.269  -0.494  1.00 0.00 ? 47 LEU A HB2  4  
ATOM   3421  H HB3  . LEU A 1 47 ? 16.733  -6.570  -1.573  1.00 0.00 ? 47 LEU A HB3  4  
ATOM   3422  H HG   . LEU A 1 47 ? 17.134  -3.723  -2.516  1.00 0.00 ? 47 LEU A HG   4  
ATOM   3423  H HD11 . LEU A 1 47 ? 19.158  -5.027  -1.401  1.00 0.00 ? 47 LEU A HD11 4  
ATOM   3424  H HD12 . LEU A 1 47 ? 19.216  -5.804  -3.001  1.00 0.00 ? 47 LEU A HD12 4  
ATOM   3425  H HD21 . LEU A 1 47 ? 17.076  -6.353  -4.022  1.00 0.00 ? 47 LEU A HD21 4  
ATOM   3426  H HD22 . LEU A 1 47 ? 15.774  -5.141  -3.978  1.00 0.00 ? 47 LEU A HD22 4  
ATOM   3427  N N    . LEU A 1 48 ? 14.608  -6.398  0.759   1.00 0.00 ? 48 LEU A N    4  
ATOM   3428  C CA   . LEU A 1 48 ? 13.908  -7.411  1.531   1.00 0.00 ? 48 LEU A CA   4  
ATOM   3429  C C    . LEU A 1 48 ? 12.401  -7.254  1.323   1.00 0.00 ? 48 LEU A C    4  
ATOM   3430  O O    . LEU A 1 48 ? 11.752  -8.138  0.766   1.00 0.00 ? 48 LEU A O    4  
ATOM   3431  C CB   . LEU A 1 48 ? 14.335  -7.355  2.999   1.00 0.00 ? 48 LEU A CB   4  
ATOM   3432  C CG   . LEU A 1 48 ? 14.315  -8.686  3.755   1.00 0.00 ? 48 LEU A CG   4  
ATOM   3433  C CD1  . LEU A 1 48 ? 12.904  -9.275  3.789   1.00 0.00 ? 48 LEU A CD1  4  
ATOM   3434  C CD2  . LEU A 1 48 ? 15.332  -9.666  3.166   1.00 0.00 ? 48 LEU A CD2  4  
ATOM   3435  H H    . LEU A 1 48 ? 15.263  -5.849  1.278   1.00 0.00 ? 48 LEU A H    4  
ATOM   3436  H HA   . LEU A 1 48 ? 14.211  -8.384  1.144   1.00 0.00 ? 48 LEU A HA   4  
ATOM   3437  H HB2  . LEU A 1 48 ? 15.345  -6.948  3.048   1.00 0.00 ? 48 LEU A HB2  4  
ATOM   3438  H HB3  . LEU A 1 48 ? 13.683  -6.654  3.520   1.00 0.00 ? 48 LEU A HB3  4  
ATOM   3439  H HG   . LEU A 1 48 ? 14.610  -8.497  4.787   1.00 0.00 ? 48 LEU A HG   4  
ATOM   3440  H HD11 . LEU A 1 48 ? 12.623  -9.486  4.821   1.00 0.00 ? 48 LEU A HD11 4  
ATOM   3441  H HD12 . LEU A 1 48 ? 12.201  -8.561  3.359   1.00 0.00 ? 48 LEU A HD12 4  
ATOM   3442  H HD21 . LEU A 1 48 ? 15.648  -9.316  2.183   1.00 0.00 ? 48 LEU A HD21 4  
ATOM   3443  H HD22 . LEU A 1 48 ? 16.198  -9.731  3.825   1.00 0.00 ? 48 LEU A HD22 4  
ATOM   3444  N N    . VAL A 1 49 ? 11.888  -6.121  1.781   1.00 0.00 ? 49 VAL A N    4  
ATOM   3445  C CA   . VAL A 1 49 ? 10.469  -5.836  1.651   1.00 0.00 ? 49 VAL A CA   4  
ATOM   3446  C C    . VAL A 1 49 ? 10.275  -4.649  0.706   1.00 0.00 ? 49 VAL A C    4  
ATOM   3447  O O    . VAL A 1 49 ? 11.124  -3.762  0.636   1.00 0.00 ? 49 VAL A O    4  
ATOM   3448  C CB   . VAL A 1 49 ? 9.853   -5.607  3.033   1.00 0.00 ? 49 VAL A CB   4  
ATOM   3449  C CG1  . VAL A 1 49 ? 9.907   -6.882  3.877   1.00 0.00 ? 49 VAL A CG1  4  
ATOM   3450  C CG2  . VAL A 1 49 ? 10.540  -4.444  3.753   1.00 0.00 ? 49 VAL A CG2  4  
ATOM   3451  H H    . VAL A 1 49 ? 12.422  -5.407  2.232   1.00 0.00 ? 49 VAL A H    4  
ATOM   3452  H HA   . VAL A 1 49 ? 9.995   -6.715  1.213   1.00 0.00 ? 49 VAL A HA   4  
ATOM   3453  H HB   . VAL A 1 49 ? 8.805   -5.342  2.893   1.00 0.00 ? 49 VAL A HB   4  
ATOM   3454  H HG11 . VAL A 1 49 ? 10.935  -7.068  4.189   1.00 0.00 ? 49 VAL A HG11 4  
ATOM   3455  H HG12 . VAL A 1 49 ? 9.276   -6.763  4.757   1.00 0.00 ? 49 VAL A HG12 4  
ATOM   3456  H HG21 . VAL A 1 49 ? 9.960   -4.169  4.634   1.00 0.00 ? 49 VAL A HG21 4  
ATOM   3457  H HG22 . VAL A 1 49 ? 11.542  -4.746  4.057   1.00 0.00 ? 49 VAL A HG22 4  
ATOM   3458  N N    . LYS A 1 50 ? 9.153   -4.671  0.002   1.00 0.00 ? 50 LYS A N    4  
ATOM   3459  C CA   . LYS A 1 50 ? 8.837   -3.608  -0.936  1.00 0.00 ? 50 LYS A CA   4  
ATOM   3460  C C    . LYS A 1 50 ? 7.431   -3.078  -0.645  1.00 0.00 ? 50 LYS A C    4  
ATOM   3461  O O    . LYS A 1 50 ? 6.611   -3.777  -0.053  1.00 0.00 ? 50 LYS A O    4  
ATOM   3462  C CB   . LYS A 1 50 ? 9.026   -4.090  -2.376  1.00 0.00 ? 50 LYS A CB   4  
ATOM   3463  C CG   . LYS A 1 50 ? 10.270  -3.459  -3.006  1.00 0.00 ? 50 LYS A CG   4  
ATOM   3464  C CD   . LYS A 1 50 ? 10.575  -4.090  -4.366  1.00 0.00 ? 50 LYS A CD   4  
ATOM   3465  C CE   . LYS A 1 50 ? 10.327  -3.094  -5.501  1.00 0.00 ? 50 LYS A CE   4  
ATOM   3466  N NZ   . LYS A 1 50 ? 11.585  -2.813  -6.228  1.00 0.00 ? 50 LYS A NZ   4  
ATOM   3467  H H    . LYS A 1 50 ? 8.467   -5.397  0.065   1.00 0.00 ? 50 LYS A H    4  
ATOM   3468  H HA   . LYS A 1 50 ? 9.551   -2.802  -0.770  1.00 0.00 ? 50 LYS A HA   4  
ATOM   3469  H HB2  . LYS A 1 50 ? 9.117   -5.176  -2.391  1.00 0.00 ? 50 LYS A HB2  4  
ATOM   3470  H HB3  . LYS A 1 50 ? 8.146   -3.837  -2.967  1.00 0.00 ? 50 LYS A HB3  4  
ATOM   3471  H HG2  . LYS A 1 50 ? 10.117  -2.387  -3.125  1.00 0.00 ? 50 LYS A HG2  4  
ATOM   3472  H HG3  . LYS A 1 50 ? 11.124  -3.589  -2.342  1.00 0.00 ? 50 LYS A HG3  4  
ATOM   3473  H HD2  . LYS A 1 50 ? 11.612  -4.425  -4.392  1.00 0.00 ? 50 LYS A HD2  4  
ATOM   3474  H HD3  . LYS A 1 50 ? 9.952   -4.973  -4.510  1.00 0.00 ? 50 LYS A HD3  4  
ATOM   3475  H HE2  . LYS A 1 50 ? 9.584   -3.495  -6.190  1.00 0.00 ? 50 LYS A HE2  4  
ATOM   3476  H HE3  . LYS A 1 50 ? 9.919   -2.167  -5.096  1.00 0.00 ? 50 LYS A HE3  4  
ATOM   3477  H HZ1  . LYS A 1 50 ? 11.544  -1.894  -6.622  1.00 0.00 ? 50 LYS A HZ1  4  
ATOM   3478  H HZ2  . LYS A 1 50 ? 12.356  -2.869  -5.594  1.00 0.00 ? 50 LYS A HZ2  4  
ATOM   3479  N N    . TYR A 1 51 ? 7.197   -1.847  -1.076  1.00 0.00 ? 51 TYR A N    4  
ATOM   3480  C CA   . TYR A 1 51 ? 5.905   -1.215  -0.869  1.00 0.00 ? 51 TYR A CA   4  
ATOM   3481  C C    . TYR A 1 51 ? 5.414   -0.538  -2.151  1.00 0.00 ? 51 TYR A C    4  
ATOM   3482  O O    . TYR A 1 51 ? 6.186   0.127   -2.841  1.00 0.00 ? 51 TYR A O    4  
ATOM   3483  C CB   . TYR A 1 51 ? 6.125   -0.148  0.205   1.00 0.00 ? 51 TYR A CB   4  
ATOM   3484  C CG   . TYR A 1 51 ? 6.855   -0.658  1.449   1.00 0.00 ? 51 TYR A CG   4  
ATOM   3485  C CD1  . TYR A 1 51 ? 6.531   -1.888  1.983   1.00 0.00 ? 51 TYR A CD1  4  
ATOM   3486  C CD2  . TYR A 1 51 ? 7.838   0.112   2.036   1.00 0.00 ? 51 TYR A CD2  4  
ATOM   3487  C CE1  . TYR A 1 51 ? 7.219   -2.368  3.154   1.00 0.00 ? 51 TYR A CE1  4  
ATOM   3488  C CE2  . TYR A 1 51 ? 8.526   -0.368  3.207   1.00 0.00 ? 51 TYR A CE2  4  
ATOM   3489  C CZ   . TYR A 1 51 ? 8.182   -1.585  3.708   1.00 0.00 ? 51 TYR A CZ   4  
ATOM   3490  O OH   . TYR A 1 51 ? 8.832   -2.038  4.813   1.00 0.00 ? 51 TYR A OH   4  
ATOM   3491  H H    . TYR A 1 51 ? 7.870   -1.285  -1.557  1.00 0.00 ? 51 TYR A H    4  
ATOM   3492  H HA   . TYR A 1 51 ? 5.194   -1.989  -0.581  1.00 0.00 ? 51 TYR A HA   4  
ATOM   3493  H HB2  . TYR A 1 51 ? 6.694   0.675   -0.226  1.00 0.00 ? 51 TYR A HB2  4  
ATOM   3494  H HB3  . TYR A 1 51 ? 5.158   0.256   0.504   1.00 0.00 ? 51 TYR A HB3  4  
ATOM   3495  H HD1  . TYR A 1 51 ? 5.755   -2.497  1.519   1.00 0.00 ? 51 TYR A HD1  4  
ATOM   3496  H HD2  . TYR A 1 51 ? 8.094   1.084   1.614   1.00 0.00 ? 51 TYR A HD2  4  
ATOM   3497  H HE1  . TYR A 1 51 ? 6.972   -3.338  3.586   1.00 0.00 ? 51 TYR A HE1  4  
ATOM   3498  H HE2  . TYR A 1 51 ? 9.304   0.230   3.680   1.00 0.00 ? 51 TYR A HE2  4  
ATOM   3499  H HH   . TYR A 1 51 ? 8.462   -2.926  5.087   1.00 0.00 ? 51 TYR A HH   4  
ATOM   3500  N N    . VAL A 1 52 ? 4.134   -0.731  -2.430  1.00 0.00 ? 52 VAL A N    4  
ATOM   3501  C CA   . VAL A 1 52 ? 3.531   -0.147  -3.617  1.00 0.00 ? 52 VAL A CA   4  
ATOM   3502  C C    . VAL A 1 52 ? 2.390   0.783   -3.199  1.00 0.00 ? 52 VAL A C    4  
ATOM   3503  O O    . VAL A 1 52 ? 1.566   0.423   -2.360  1.00 0.00 ? 52 VAL A O    4  
ATOM   3504  C CB   . VAL A 1 52 ? 3.080   -1.254  -4.573  1.00 0.00 ? 52 VAL A CB   4  
ATOM   3505  C CG1  . VAL A 1 52 ? 2.242   -0.681  -5.717  1.00 0.00 ? 52 VAL A CG1  4  
ATOM   3506  C CG2  . VAL A 1 52 ? 4.280   -2.036  -5.110  1.00 0.00 ? 52 VAL A CG2  4  
ATOM   3507  H H    . VAL A 1 52 ? 3.513   -1.273  -1.864  1.00 0.00 ? 52 VAL A H    4  
ATOM   3508  H HA   . VAL A 1 52 ? 4.298   0.442   -4.120  1.00 0.00 ? 52 VAL A HA   4  
ATOM   3509  H HB   . VAL A 1 52 ? 2.452   -1.946  -4.012  1.00 0.00 ? 52 VAL A HB   4  
ATOM   3510  H HG11 . VAL A 1 52 ? 1.419   -0.095  -5.307  1.00 0.00 ? 52 VAL A HG11 4  
ATOM   3511  H HG12 . VAL A 1 52 ? 2.867   -0.042  -6.341  1.00 0.00 ? 52 VAL A HG12 4  
ATOM   3512  H HG21 . VAL A 1 52 ? 4.005   -2.526  -6.044  1.00 0.00 ? 52 VAL A HG21 4  
ATOM   3513  H HG22 . VAL A 1 52 ? 5.109   -1.352  -5.288  1.00 0.00 ? 52 VAL A HG22 4  
ATOM   3514  N N    . CYS A 1 53 ? 2.379   1.962   -3.804  1.00 0.00 ? 53 CYS A N    4  
ATOM   3515  C CA   . CYS A 1 53 ? 1.353   2.947   -3.505  1.00 0.00 ? 53 CYS A CA   4  
ATOM   3516  C C    . CYS A 1 53 ? 0.584   3.244   -4.793  1.00 0.00 ? 53 CYS A C    4  
ATOM   3517  O O    . CYS A 1 53 ? 1.142   3.168   -5.886  1.00 0.00 ? 53 CYS A O    4  
ATOM   3518  C CB   . CYS A 1 53 ? 1.949   4.215   -2.890  1.00 0.00 ? 53 CYS A CB   4  
ATOM   3519  S SG   . CYS A 1 53 ? 2.488   4.043   -1.149  1.00 0.00 ? 53 CYS A SG   4  
ATOM   3520  H H    . CYS A 1 53 ? 3.053   2.247   -4.485  1.00 0.00 ? 53 CYS A H    4  
ATOM   3521  H HA   . CYS A 1 53 ? 0.698   2.500   -2.757  1.00 0.00 ? 53 CYS A HA   4  
ATOM   3522  H HB2  . CYS A 1 53 ? 2.803   4.527   -3.491  1.00 0.00 ? 53 CYS A HB2  4  
ATOM   3523  H HB3  . CYS A 1 53 ? 1.208   5.013   -2.949  1.00 0.00 ? 53 CYS A HB3  4  
ATOM   3524  N N    . CYS A 1 54 ? -0.687  3.578   -4.622  1.00 0.00 ? 54 CYS A N    4  
ATOM   3525  C CA   . CYS A 1 54 ? -1.540  3.887   -5.757  1.00 0.00 ? 54 CYS A CA   4  
ATOM   3526  C C    . CYS A 1 54 ? -2.740  4.691   -5.252  1.00 0.00 ? 54 CYS A C    4  
ATOM   3527  O O    . CYS A 1 54 ? -3.156  4.537   -4.105  1.00 0.00 ? 54 CYS A O    4  
ATOM   3528  C CB   . CYS A 1 54 ? -1.972  2.622   -6.501  1.00 0.00 ? 54 CYS A CB   4  
ATOM   3529  S SG   . CYS A 1 54 ? -1.994  1.102   -5.483  1.00 0.00 ? 54 CYS A SG   4  
ATOM   3530  H H    . CYS A 1 54 ? -1.134  3.637   -3.729  1.00 0.00 ? 54 CYS A H    4  
ATOM   3531  H HA   . CYS A 1 54 ? -0.939  4.481   -6.446  1.00 0.00 ? 54 CYS A HA   4  
ATOM   3532  H HB2  . CYS A 1 54 ? -2.969  2.782   -6.912  1.00 0.00 ? 54 CYS A HB2  4  
ATOM   3533  H HB3  . CYS A 1 54 ? -1.301  2.467   -7.346  1.00 0.00 ? 54 CYS A HB3  4  
ATOM   3534  N N    . ASN A 1 55 ? -3.262  5.530   -6.133  1.00 0.00 ? 55 ASN A N    4  
ATOM   3535  C CA   . ASN A 1 55 ? -4.406  6.358   -5.791  1.00 0.00 ? 55 ASN A CA   4  
ATOM   3536  C C    . ASN A 1 55 ? -5.611  5.928   -6.631  1.00 0.00 ? 55 ASN A C    4  
ATOM   3537  O O    . ASN A 1 55 ? -6.037  6.654   -7.528  1.00 0.00 ? 55 ASN A O    4  
ATOM   3538  C CB   . ASN A 1 55 ? -4.127  7.833   -6.086  1.00 0.00 ? 55 ASN A CB   4  
ATOM   3539  C CG   . ASN A 1 55 ? -3.715  8.032   -7.546  1.00 0.00 ? 55 ASN A CG   4  
ATOM   3540  O OD1  . ASN A 1 55 ? -3.725  7.116   -8.351  1.00 0.00 ? 55 ASN A OD1  4  
ATOM   3541  N ND2  . ASN A 1 55 ? -3.354  9.278   -7.841  1.00 0.00 ? 55 ASN A ND2  4  
ATOM   3542  H H    . ASN A 1 55 ? -2.918  5.649   -7.065  1.00 0.00 ? 55 ASN A H    4  
ATOM   3543  H HA   . ASN A 1 55 ? -4.565  6.201   -4.724  1.00 0.00 ? 55 ASN A HA   4  
ATOM   3544  H HB2  . ASN A 1 55 ? -5.016  8.426   -5.871  1.00 0.00 ? 55 ASN A HB2  4  
ATOM   3545  H HB3  . ASN A 1 55 ? -3.336  8.195   -5.429  1.00 0.00 ? 55 ASN A HB3  4  
ATOM   3546  H HD21 . ASN A 1 55 ? -3.369  9.984   -7.133  1.00 0.00 ? 55 ASN A HD21 4  
ATOM   3547  H HD22 . ASN A 1 55 ? -3.068  9.508   -8.771  1.00 0.00 ? 55 ASN A HD22 4  
ATOM   3548  N N    . THR A 1 56 ? -6.125  4.750   -6.311  1.00 0.00 ? 56 THR A N    4  
ATOM   3549  C CA   . THR A 1 56 ? -7.272  4.215   -7.025  1.00 0.00 ? 56 THR A CA   4  
ATOM   3550  C C    . THR A 1 56 ? -8.124  3.350   -6.094  1.00 0.00 ? 56 THR A C    4  
ATOM   3551  O O    . THR A 1 56 ? -7.625  2.827   -5.098  1.00 0.00 ? 56 THR A O    4  
ATOM   3552  C CB   . THR A 1 56 ? -6.756  3.461   -8.252  1.00 0.00 ? 56 THR A CB   4  
ATOM   3553  O OG1  . THR A 1 56 ? -5.785  2.562   -7.723  1.00 0.00 ? 56 THR A OG1  4  
ATOM   3554  C CG2  . THR A 1 56 ? -5.956  4.360   -9.197  1.00 0.00 ? 56 THR A CG2  4  
ATOM   3555  H H    . THR A 1 56 ? -5.773  4.166   -5.580  1.00 0.00 ? 56 THR A H    4  
ATOM   3556  H HA   . THR A 1 56 ? -7.897  5.049   -7.346  1.00 0.00 ? 56 THR A HA   4  
ATOM   3557  H HB   . THR A 1 56 ? -7.573  2.971   -8.780  1.00 0.00 ? 56 THR A HB   4  
ATOM   3558  H HG1  . THR A 1 56 ? -5.124  3.062   -7.163  1.00 0.00 ? 56 THR A HG1  4  
ATOM   3559  H HG21 . THR A 1 56 ? -6.544  5.244   -9.443  1.00 0.00 ? 56 THR A HG21 4  
ATOM   3560  H HG22 . THR A 1 56 ? -5.029  4.664   -8.711  1.00 0.00 ? 56 THR A HG22 4  
ATOM   3561  N N    . ASP A 1 57 ? -9.408  3.202   -6.423  1.00 0.00 ? 57 ASP A N    4  
ATOM   3562  C CA   . ASP A 1 57 ? -10.317 2.408   -5.621  1.00 0.00 ? 57 ASP A CA   4  
ATOM   3563  C C    . ASP A 1 57 ? -9.889  0.948   -5.652  1.00 0.00 ? 57 ASP A C    4  
ATOM   3564  O O    . ASP A 1 57 ? -9.768  0.357   -6.723  1.00 0.00 ? 57 ASP A O    4  
ATOM   3565  C CB   . ASP A 1 57 ? -11.737 2.566   -6.157  1.00 0.00 ? 57 ASP A CB   4  
ATOM   3566  C CG   . ASP A 1 57 ? -12.498 3.628   -5.375  1.00 0.00 ? 57 ASP A CG   4  
ATOM   3567  O OD1  . ASP A 1 57 ? -12.123 3.847   -4.203  1.00 0.00 ? 57 ASP A OD1  4  
ATOM   3568  O OD2  . ASP A 1 57 ? -13.440 4.201   -5.964  1.00 0.00 ? 57 ASP A OD2  4  
ATOM   3569  H H    . ASP A 1 57 ? -9.768  3.653   -7.252  1.00 0.00 ? 57 ASP A H    4  
ATOM   3570  H HA   . ASP A 1 57 ? -10.286 2.764   -4.592  1.00 0.00 ? 57 ASP A HA   4  
ATOM   3571  H HB2  . ASP A 1 57 ? -11.694 2.857   -7.206  1.00 0.00 ? 57 ASP A HB2  4  
ATOM   3572  H HB3  . ASP A 1 57 ? -12.261 1.614   -6.070  1.00 0.00 ? 57 ASP A HB3  4  
ATOM   3573  H HD2  . ASP A 1 57 ? -13.879 4.858   -5.419  1.00 0.00 ? 57 ASP A HD2  4  
ATOM   3574  N N    . LYS A 1 58 ? -9.669  0.402   -4.464  1.00 0.00 ? 58 LYS A N    4  
ATOM   3575  C CA   . LYS A 1 58 ? -9.255  -0.985  -4.343  1.00 0.00 ? 58 LYS A CA   4  
ATOM   3576  C C    . LYS A 1 58 ? -7.969  -1.200  -5.144  1.00 0.00 ? 58 LYS A C    4  
ATOM   3577  O O    . LYS A 1 58 ? -7.903  -2.090  -5.991  1.00 0.00 ? 58 LYS A O    4  
ATOM   3578  C CB   . LYS A 1 58 ? -10.395 -1.922  -4.747  1.00 0.00 ? 58 LYS A CB   4  
ATOM   3579  C CG   . LYS A 1 58 ? -10.600 -3.019  -3.700  1.00 0.00 ? 58 LYS A CG   4  
ATOM   3580  C CD   . LYS A 1 58 ? -11.208 -4.273  -4.331  1.00 0.00 ? 58 LYS A CD   4  
ATOM   3581  C CE   . LYS A 1 58 ? -10.254 -5.463  -4.214  1.00 0.00 ? 58 LYS A CE   4  
ATOM   3582  N NZ   . LYS A 1 58 ? -9.564  -5.704  -5.501  1.00 0.00 ? 58 LYS A NZ   4  
ATOM   3583  H H    . LYS A 1 58 ? -9.770  0.890   -3.597  1.00 0.00 ? 58 LYS A H    4  
ATOM   3584  H HA   . LYS A 1 58 ? -9.041  -1.172  -3.291  1.00 0.00 ? 58 LYS A HA   4  
ATOM   3585  H HB2  . LYS A 1 58 ? -11.316 -1.351  -4.865  1.00 0.00 ? 58 LYS A HB2  4  
ATOM   3586  H HB3  . LYS A 1 58 ? -10.174 -2.374  -5.714  1.00 0.00 ? 58 LYS A HB3  4  
ATOM   3587  H HG2  . LYS A 1 58 ? -9.645  -3.267  -3.236  1.00 0.00 ? 58 LYS A HG2  4  
ATOM   3588  H HG3  . LYS A 1 58 ? -11.253 -2.653  -2.908  1.00 0.00 ? 58 LYS A HG3  4  
ATOM   3589  H HD2  . LYS A 1 58 ? -12.153 -4.509  -3.842  1.00 0.00 ? 58 LYS A HD2  4  
ATOM   3590  H HD3  . LYS A 1 58 ? -11.432 -4.084  -5.381  1.00 0.00 ? 58 LYS A HD3  4  
ATOM   3591  H HE2  . LYS A 1 58 ? -9.521  -5.273  -3.430  1.00 0.00 ? 58 LYS A HE2  4  
ATOM   3592  H HE3  . LYS A 1 58 ? -10.810 -6.354  -3.920  1.00 0.00 ? 58 LYS A HE3  4  
ATOM   3593  H HZ1  . LYS A 1 58 ? -10.237 -5.946  -6.200  1.00 0.00 ? 58 LYS A HZ1  4  
ATOM   3594  H HZ2  . LYS A 1 58 ? -9.079  -4.875  -5.778  1.00 0.00 ? 58 LYS A HZ2  4  
ATOM   3595  N N    . CYS A 1 59 ? -6.980  -0.370  -4.849  1.00 0.00 ? 59 CYS A N    4  
ATOM   3596  C CA   . CYS A 1 59 ? -5.700  -0.458  -5.531  1.00 0.00 ? 59 CYS A CA   4  
ATOM   3597  C C    . CYS A 1 59 ? -4.789  -1.387  -4.725  1.00 0.00 ? 59 CYS A C    4  
ATOM   3598  O O    . CYS A 1 59 ? -4.160  -2.284  -5.285  1.00 0.00 ? 59 CYS A O    4  
ATOM   3599  C CB   . CYS A 1 59 ? -5.071  0.921   -5.735  1.00 0.00 ? 59 CYS A CB   4  
ATOM   3600  S SG   . CYS A 1 59 ? -3.793  1.372   -4.506  1.00 0.00 ? 59 CYS A SG   4  
ATOM   3601  H H    . CYS A 1 59 ? -7.042  0.351   -4.159  1.00 0.00 ? 59 CYS A H    4  
ATOM   3602  H HA   . CYS A 1 59 ? -5.900  -0.874  -6.519  1.00 0.00 ? 59 CYS A HA   4  
ATOM   3603  H HB2  . CYS A 1 59 ? -4.628  0.960   -6.730  1.00 0.00 ? 59 CYS A HB2  4  
ATOM   3604  H HB3  . CYS A 1 59 ? -5.861  1.672   -5.709  1.00 0.00 ? 59 CYS A HB3  4  
ATOM   3605  N N    . ASN A 1 60 ? -4.747  -1.140  -3.424  1.00 0.00 ? 60 ASN A N    4  
ATOM   3606  C CA   . ASN A 1 60 ? -3.924  -1.943  -2.536  1.00 0.00 ? 60 ASN A CA   4  
ATOM   3607  C C    . ASN A 1 60 ? -4.671  -3.229  -2.179  1.00 0.00 ? 60 ASN A C    4  
ATOM   3608  O O    . ASN A 1 60 ? -4.268  -4.318  -2.585  1.00 0.00 ? 60 ASN A O    4  
ATOM   3609  C CB   . ASN A 1 60 ? -3.624  -1.194  -1.236  1.00 0.00 ? 60 ASN A CB   4  
ATOM   3610  C CG   . ASN A 1 60 ? -4.841  -1.197  -0.308  1.00 0.00 ? 60 ASN A CG   4  
ATOM   3611  O OD1  . ASN A 1 60 ? -5.974  -1.364  -0.728  1.00 0.00 ? 60 ASN A OD1  4  
ATOM   3612  N ND2  . ASN A 1 60 ? -4.544  -1.005  0.974   1.00 0.00 ? 60 ASN A ND2  4  
ATOM   3613  H H    . ASN A 1 60 ? -5.262  -0.408  -2.977  1.00 0.00 ? 60 ASN A H    4  
ATOM   3614  H HA   . ASN A 1 60 ? -3.006  -2.134  -3.091  1.00 0.00 ? 60 ASN A HA   4  
ATOM   3615  H HB2  . ASN A 1 60 ? -2.777  -1.658  -0.732  1.00 0.00 ? 60 ASN A HB2  4  
ATOM   3616  H HB3  . ASN A 1 60 ? -3.338  -0.166  -1.462  1.00 0.00 ? 60 ASN A HB3  4  
ATOM   3617  H HD21 . ASN A 1 60 ? -3.593  -0.875  1.253   1.00 0.00 ? 60 ASN A HD21 4  
ATOM   3618  H HD22 . ASN A 1 60 ? -5.272  -0.991  1.659   1.00 0.00 ? 60 ASN A HD22 4  
HETATM 3619  O O    . HOH B 2 .  ? 4.961   -11.045 1.323   1.00 0.00 ? 61 HOH A O    4  
HETATM 3620  H H1   . HOH B 2 .  ? 5.183   -11.434 2.169   1.00 0.00 ? 61 HOH A H1   4  
HETATM 3621  H H2   . HOH B 2 .  ? 5.661   -11.334 0.736   1.00 0.00 ? 61 HOH A H2   4  
HETATM 3622  O O    . HOH B 2 .  ? 9.897   -12.347 -6.406  1.00 0.00 ? 62 HOH A O    4  
HETATM 3623  H H1   . HOH B 2 .  ? 9.210   -11.681 -6.396  1.00 0.00 ? 62 HOH A H1   4  
HETATM 3624  H H2   . HOH B 2 .  ? 10.329  -12.231 -7.253  1.00 0.00 ? 62 HOH A H2   4  
ATOM   3625  N N    . LEU A 1 1  ? -9.270  7.178   -0.578  1.00 0.00 ? 1  LEU A N    5  
ATOM   3626  C CA   . LEU A 1 1  ? -10.321 6.593   -1.394  1.00 0.00 ? 1  LEU A CA   5  
ATOM   3627  C C    . LEU A 1 1  ? -10.814 5.303   -0.735  1.00 0.00 ? 1  LEU A C    5  
ATOM   3628  O O    . LEU A 1 1  ? -10.312 4.908   0.316   1.00 0.00 ? 1  LEU A O    5  
ATOM   3629  C CB   . LEU A 1 1  ? -9.839  6.403   -2.833  1.00 0.00 ? 1  LEU A CB   5  
ATOM   3630  C CG   . LEU A 1 1  ? -9.810  7.662   -3.703  1.00 0.00 ? 1  LEU A CG   5  
ATOM   3631  C CD1  . LEU A 1 1  ? -9.043  7.413   -5.002  1.00 0.00 ? 1  LEU A CD1  5  
ATOM   3632  C CD2  . LEU A 1 1  ? -11.226 8.181   -3.964  1.00 0.00 ? 1  LEU A CD2  5  
ATOM   3633  H H    . LEU A 1 1  ? -9.278  8.177   -0.531  1.00 0.00 ? 1  LEU A H    5  
ATOM   3634  H HA   . LEU A 1 1  ? -11.147 7.304   -1.422  1.00 0.00 ? 1  LEU A HA   5  
ATOM   3635  H HB2  . LEU A 1 1  ? -8.835  5.981   -2.807  1.00 0.00 ? 1  LEU A HB2  5  
ATOM   3636  H HB3  . LEU A 1 1  ? -10.482 5.667   -3.316  1.00 0.00 ? 1  LEU A HB3  5  
ATOM   3637  H HG   . LEU A 1 1  ? -9.277  8.441   -3.158  1.00 0.00 ? 1  LEU A HG   5  
ATOM   3638  H HD11 . LEU A 1 1  ? -8.654  6.395   -5.006  1.00 0.00 ? 1  LEU A HD11 5  
ATOM   3639  H HD12 . LEU A 1 1  ? -9.712  7.550   -5.852  1.00 0.00 ? 1  LEU A HD12 5  
ATOM   3640  H HD21 . LEU A 1 1  ? -11.459 8.083   -5.024  1.00 0.00 ? 1  LEU A HD21 5  
ATOM   3641  H HD22 . LEU A 1 1  ? -11.939 7.599   -3.379  1.00 0.00 ? 1  LEU A HD22 5  
ATOM   3642  N N    . LYS A 1 2  ? -11.791 4.683   -1.380  1.00 0.00 ? 2  LYS A N    5  
ATOM   3643  C CA   . LYS A 1 2  ? -12.357 3.445   -0.870  1.00 0.00 ? 2  LYS A CA   5  
ATOM   3644  C C    . LYS A 1 2  ? -11.521 2.264   -1.366  1.00 0.00 ? 2  LYS A C    5  
ATOM   3645  O O    . LYS A 1 2  ? -11.540 1.940   -2.553  1.00 0.00 ? 2  LYS A O    5  
ATOM   3646  C CB   . LYS A 1 2  ? -13.840 3.345   -1.233  1.00 0.00 ? 2  LYS A CB   5  
ATOM   3647  C CG   . LYS A 1 2  ? -14.447 2.045   -0.702  1.00 0.00 ? 2  LYS A CG   5  
ATOM   3648  C CD   . LYS A 1 2  ? -15.976 2.100   -0.737  1.00 0.00 ? 2  LYS A CD   5  
ATOM   3649  C CE   . LYS A 1 2  ? -16.519 1.442   -2.007  1.00 0.00 ? 2  LYS A CE   5  
ATOM   3650  N NZ   . LYS A 1 2  ? -17.984 1.253   -1.907  1.00 0.00 ? 2  LYS A NZ   5  
ATOM   3651  H H    . LYS A 1 2  ? -12.194 5.011   -2.234  1.00 0.00 ? 2  LYS A H    5  
ATOM   3652  H HA   . LYS A 1 2  ? -12.293 3.481   0.218   1.00 0.00 ? 2  LYS A HA   5  
ATOM   3653  H HB2  . LYS A 1 2  ? -14.378 4.198   -0.820  1.00 0.00 ? 2  LYS A HB2  5  
ATOM   3654  H HB3  . LYS A 1 2  ? -13.956 3.389   -2.316  1.00 0.00 ? 2  LYS A HB3  5  
ATOM   3655  H HG2  . LYS A 1 2  ? -14.096 1.204   -1.300  1.00 0.00 ? 2  LYS A HG2  5  
ATOM   3656  H HG3  . LYS A 1 2  ? -14.110 1.873   0.320   1.00 0.00 ? 2  LYS A HG3  5  
ATOM   3657  H HD2  . LYS A 1 2  ? -16.382 1.596   0.140   1.00 0.00 ? 2  LYS A HD2  5  
ATOM   3658  H HD3  . LYS A 1 2  ? -16.307 3.138   -0.690  1.00 0.00 ? 2  LYS A HD3  5  
ATOM   3659  H HE2  . LYS A 1 2  ? -16.285 2.061   -2.873  1.00 0.00 ? 2  LYS A HE2  5  
ATOM   3660  H HE3  . LYS A 1 2  ? -16.032 0.479   -2.162  1.00 0.00 ? 2  LYS A HE3  5  
ATOM   3661  H HZ1  . LYS A 1 2  ? -18.439 1.795   -2.614  1.00 0.00 ? 2  LYS A HZ1  5  
ATOM   3662  H HZ2  . LYS A 1 2  ? -18.205 0.286   -2.035  1.00 0.00 ? 2  LYS A HZ2  5  
ATOM   3663  N N    . CYS A 1 3  ? -10.806 1.653   -0.433  1.00 0.00 ? 3  CYS A N    5  
ATOM   3664  C CA   . CYS A 1 3  ? -9.964  0.515   -0.761  1.00 0.00 ? 3  CYS A CA   5  
ATOM   3665  C C    . CYS A 1 3  ? -10.295 -0.622  0.208   1.00 0.00 ? 3  CYS A C    5  
ATOM   3666  O O    . CYS A 1 3  ? -11.228 -0.514  1.002   1.00 0.00 ? 3  CYS A O    5  
ATOM   3667  C CB   . CYS A 1 3  ? -8.479  0.881   -0.726  1.00 0.00 ? 3  CYS A CB   5  
ATOM   3668  S SG   . CYS A 1 3  ? -7.926  1.978   -2.082  1.00 0.00 ? 3  CYS A SG   5  
ATOM   3669  H H    . CYS A 1 3  ? -10.795 1.923   0.530   1.00 0.00 ? 3  CYS A H    5  
ATOM   3670  H HA   . CYS A 1 3  ? -10.205 0.232   -1.786  1.00 0.00 ? 3  CYS A HA   5  
ATOM   3671  H HB2  . CYS A 1 3  ? -8.261  1.365   0.226   1.00 0.00 ? 3  CYS A HB2  5  
ATOM   3672  H HB3  . CYS A 1 3  ? -7.892  -0.037  -0.758  1.00 0.00 ? 3  CYS A HB3  5  
ATOM   3673  N N    . LYS A 1 4  ? -9.511  -1.686  0.111   1.00 0.00 ? 4  LYS A N    5  
ATOM   3674  C CA   . LYS A 1 4  ? -9.710  -2.842  0.969   1.00 0.00 ? 4  LYS A CA   5  
ATOM   3675  C C    . LYS A 1 4  ? -8.826  -2.707  2.211   1.00 0.00 ? 4  LYS A C    5  
ATOM   3676  O O    . LYS A 1 4  ? -7.796  -2.036  2.174   1.00 0.00 ? 4  LYS A O    5  
ATOM   3677  C CB   . LYS A 1 4  ? -9.478  -4.136  0.187   1.00 0.00 ? 4  LYS A CB   5  
ATOM   3678  C CG   . LYS A 1 4  ? -10.562 -4.337  -0.874  1.00 0.00 ? 4  LYS A CG   5  
ATOM   3679  C CD   . LYS A 1 4  ? -11.691 -5.222  -0.343  1.00 0.00 ? 4  LYS A CD   5  
ATOM   3680  C CE   . LYS A 1 4  ? -12.697 -5.548  -1.449  1.00 0.00 ? 4  LYS A CE   5  
ATOM   3681  N NZ   . LYS A 1 4  ? -12.149 -6.576  -2.362  1.00 0.00 ? 4  LYS A NZ   5  
ATOM   3682  H H    . LYS A 1 4  ? -8.754  -1.766  -0.537  1.00 0.00 ? 4  LYS A H    5  
ATOM   3683  H HA   . LYS A 1 4  ? -10.753 -2.839  1.286   1.00 0.00 ? 4  LYS A HA   5  
ATOM   3684  H HB2  . LYS A 1 4  ? -8.498  -4.107  -0.290  1.00 0.00 ? 4  LYS A HB2  5  
ATOM   3685  H HB3  . LYS A 1 4  ? -9.473  -4.984  0.872   1.00 0.00 ? 4  LYS A HB3  5  
ATOM   3686  H HG2  . LYS A 1 4  ? -10.964 -3.370  -1.176  1.00 0.00 ? 4  LYS A HG2  5  
ATOM   3687  H HG3  . LYS A 1 4  ? -10.125 -4.792  -1.763  1.00 0.00 ? 4  LYS A HG3  5  
ATOM   3688  H HD2  . LYS A 1 4  ? -11.275 -6.146  0.059   1.00 0.00 ? 4  LYS A HD2  5  
ATOM   3689  H HD3  . LYS A 1 4  ? -12.199 -4.717  0.478   1.00 0.00 ? 4  LYS A HD3  5  
ATOM   3690  H HE2  . LYS A 1 4  ? -13.628 -5.905  -1.008  1.00 0.00 ? 4  LYS A HE2  5  
ATOM   3691  H HE3  . LYS A 1 4  ? -12.936 -4.645  -2.010  1.00 0.00 ? 4  LYS A HE3  5  
ATOM   3692  H HZ1  . LYS A 1 4  ? -11.179 -6.717  -2.161  1.00 0.00 ? 4  LYS A HZ1  5  
ATOM   3693  H HZ2  . LYS A 1 4  ? -12.645 -7.435  -2.234  1.00 0.00 ? 4  LYS A HZ2  5  
ATOM   3694  N N    . LYS A 1 5  ? -9.261  -3.356  3.281   1.00 0.00 ? 5  LYS A N    5  
ATOM   3695  C CA   . LYS A 1 5  ? -8.522  -3.317  4.532   1.00 0.00 ? 5  LYS A CA   5  
ATOM   3696  C C    . LYS A 1 5  ? -7.497  -4.453  4.549   1.00 0.00 ? 5  LYS A C    5  
ATOM   3697  O O    . LYS A 1 5  ? -7.281  -5.115  3.535   1.00 0.00 ? 5  LYS A O    5  
ATOM   3698  C CB   . LYS A 1 5  ? -9.483  -3.339  5.722   1.00 0.00 ? 5  LYS A CB   5  
ATOM   3699  C CG   . LYS A 1 5  ? -9.979  -1.929  6.052   1.00 0.00 ? 5  LYS A CG   5  
ATOM   3700  C CD   . LYS A 1 5  ? -10.740 -1.912  7.379   1.00 0.00 ? 5  LYS A CD   5  
ATOM   3701  C CE   . LYS A 1 5  ? -10.093 -0.941  8.369   1.00 0.00 ? 5  LYS A CE   5  
ATOM   3702  N NZ   . LYS A 1 5  ? -9.949  -1.576  9.699   1.00 0.00 ? 5  LYS A NZ   5  
ATOM   3703  H H    . LYS A 1 5  ? -10.100 -3.900  3.302   1.00 0.00 ? 5  LYS A H    5  
ATOM   3704  H HA   . LYS A 1 5  ? -7.987  -2.368  4.566   1.00 0.00 ? 5  LYS A HA   5  
ATOM   3705  H HB2  . LYS A 1 5  ? -10.332 -3.984  5.498   1.00 0.00 ? 5  LYS A HB2  5  
ATOM   3706  H HB3  . LYS A 1 5  ? -8.981  -3.764  6.591   1.00 0.00 ? 5  LYS A HB3  5  
ATOM   3707  H HG2  . LYS A 1 5  ? -9.132  -1.245  6.105   1.00 0.00 ? 5  LYS A HG2  5  
ATOM   3708  H HG3  . LYS A 1 5  ? -10.628 -1.572  5.252   1.00 0.00 ? 5  LYS A HG3  5  
ATOM   3709  H HD2  . LYS A 1 5  ? -11.776 -1.623  7.205   1.00 0.00 ? 5  LYS A HD2  5  
ATOM   3710  H HD3  . LYS A 1 5  ? -10.756 -2.915  7.806   1.00 0.00 ? 5  LYS A HD3  5  
ATOM   3711  H HE2  . LYS A 1 5  ? -9.116  -0.632  7.999   1.00 0.00 ? 5  LYS A HE2  5  
ATOM   3712  H HE3  . LYS A 1 5  ? -10.701 -0.040  8.454   1.00 0.00 ? 5  LYS A HE3  5  
ATOM   3713  H HZ1  . LYS A 1 5  ? -9.401  -2.408  9.613   1.00 0.00 ? 5  LYS A HZ1  5  
ATOM   3714  H HZ2  . LYS A 1 5  ? -9.495  -0.940  10.323  1.00 0.00 ? 5  LYS A HZ2  5  
ATOM   3715  N N    . LEU A 1 6  ? -6.891  -4.643  5.711   1.00 0.00 ? 6  LEU A N    5  
ATOM   3716  C CA   . LEU A 1 6  ? -5.893  -5.686  5.874   1.00 0.00 ? 6  LEU A CA   5  
ATOM   3717  C C    . LEU A 1 6  ? -6.375  -6.960  5.176   1.00 0.00 ? 6  LEU A C    5  
ATOM   3718  O O    . LEU A 1 6  ? -5.796  -7.380  4.175   1.00 0.00 ? 6  LEU A O    5  
ATOM   3719  C CB   . LEU A 1 6  ? -5.561  -5.885  7.354   1.00 0.00 ? 6  LEU A CB   5  
ATOM   3720  C CG   . LEU A 1 6  ? -4.498  -4.950  7.934   1.00 0.00 ? 6  LEU A CG   5  
ATOM   3721  C CD1  . LEU A 1 6  ? -5.133  -3.668  8.479   1.00 0.00 ? 6  LEU A CD1  5  
ATOM   3722  C CD2  . LEU A 1 6  ? -3.656  -5.666  8.992   1.00 0.00 ? 6  LEU A CD2  5  
ATOM   3723  H H    . LEU A 1 6  ? -7.071  -4.100  6.531   1.00 0.00 ? 6  LEU A H    5  
ATOM   3724  H HA   . LEU A 1 6  ? -4.982  -5.346  5.382   1.00 0.00 ? 6  LEU A HA   5  
ATOM   3725  H HB2  . LEU A 1 6  ? -6.478  -5.763  7.931   1.00 0.00 ? 6  LEU A HB2  5  
ATOM   3726  H HB3  . LEU A 1 6  ? -5.229  -6.913  7.497   1.00 0.00 ? 6  LEU A HB3  5  
ATOM   3727  H HG   . LEU A 1 6  ? -3.823  -4.658  7.129   1.00 0.00 ? 6  LEU A HG   5  
ATOM   3728  H HD11 . LEU A 1 6  ? -4.913  -3.578  9.542   1.00 0.00 ? 6  LEU A HD11 5  
ATOM   3729  H HD12 . LEU A 1 6  ? -4.725  -2.807  7.948   1.00 0.00 ? 6  LEU A HD12 5  
ATOM   3730  H HD21 . LEU A 1 6  ? -3.339  -4.950  9.750   1.00 0.00 ? 6  LEU A HD21 5  
ATOM   3731  H HD22 . LEU A 1 6  ? -4.250  -6.451  9.459   1.00 0.00 ? 6  LEU A HD22 5  
ATOM   3732  N N    . VAL A 1 7  ? -7.430  -7.537  5.731   1.00 0.00 ? 7  VAL A N    5  
ATOM   3733  C CA   . VAL A 1 7  ? -7.996  -8.754  5.174   1.00 0.00 ? 7  VAL A CA   5  
ATOM   3734  C C    . VAL A 1 7  ? -9.043  -8.388  4.119   1.00 0.00 ? 7  VAL A C    5  
ATOM   3735  O O    . VAL A 1 7  ? -9.825  -7.459  4.312   1.00 0.00 ? 7  VAL A O    5  
ATOM   3736  C CB   . VAL A 1 7  ? -8.558  -9.631  6.295   1.00 0.00 ? 7  VAL A CB   5  
ATOM   3737  C CG1  . VAL A 1 7  ? -9.400  -10.775 5.727   1.00 0.00 ? 7  VAL A CG1  5  
ATOM   3738  C CG2  . VAL A 1 7  ? -7.436  -10.166 7.187   1.00 0.00 ? 7  VAL A CG2  5  
ATOM   3739  H H    . VAL A 1 7  ? -7.895  -7.189  6.544   1.00 0.00 ? 7  VAL A H    5  
ATOM   3740  H HA   . VAL A 1 7  ? -7.187  -9.302  4.690   1.00 0.00 ? 7  VAL A HA   5  
ATOM   3741  H HB   . VAL A 1 7  ? -9.209  -9.010  6.911   1.00 0.00 ? 7  VAL A HB   5  
ATOM   3742  H HG11 . VAL A 1 7  ? -9.992  -11.222 6.525   1.00 0.00 ? 7  VAL A HG11 5  
ATOM   3743  H HG12 . VAL A 1 7  ? -10.065 -10.388 4.954   1.00 0.00 ? 7  VAL A HG12 5  
ATOM   3744  H HG21 . VAL A 1 7  ? -7.705  -11.157 7.554   1.00 0.00 ? 7  VAL A HG21 5  
ATOM   3745  H HG22 . VAL A 1 7  ? -6.513  -10.229 6.611   1.00 0.00 ? 7  VAL A HG22 5  
ATOM   3746  N N    . PRO A 1 8  ? -9.023  -9.159  2.999   1.00 0.00 ? 8  PRO A N    5  
ATOM   3747  C CA   . PRO A 1 8  ? -9.960  -8.925  1.913   1.00 0.00 ? 8  PRO A CA   5  
ATOM   3748  C C    . PRO A 1 8  ? -11.358 -9.430  2.278   1.00 0.00 ? 8  PRO A C    5  
ATOM   3749  O O    . PRO A 1 8  ? -11.952 -10.212 1.537   1.00 0.00 ? 8  PRO A O    5  
ATOM   3750  C CB   . PRO A 1 8  ? -9.362  -9.645  0.715   1.00 0.00 ? 8  PRO A CB   5  
ATOM   3751  C CG   . PRO A 1 8  ? -8.360  -10.637 1.283   1.00 0.00 ? 8  PRO A CG   5  
ATOM   3752  C CD   . PRO A 1 8  ? -8.111  -10.268 2.736   1.00 0.00 ? 8  PRO A CD   5  
ATOM   3753  H HA   . PRO A 1 8  ? -10.059 -7.944  1.745   1.00 0.00 ? 8  PRO A HA   5  
ATOM   3754  H HB2  . PRO A 1 8  ? -10.135 -10.155 0.141   1.00 0.00 ? 8  PRO A HB2  5  
ATOM   3755  H HB3  . PRO A 1 8  ? -8.876  -8.941  0.040   1.00 0.00 ? 8  PRO A HB3  5  
ATOM   3756  H HG2  . PRO A 1 8  ? -8.745  -11.654 1.207   1.00 0.00 ? 8  PRO A HG2  5  
ATOM   3757  H HG3  . PRO A 1 8  ? -7.430  -10.605 0.716   1.00 0.00 ? 8  PRO A HG3  5  
ATOM   3758  H HD2  . PRO A 1 8  ? -8.312  -11.111 3.398   1.00 0.00 ? 8  PRO A HD2  5  
ATOM   3759  H HD3  . PRO A 1 8  ? -7.074  -9.975  2.898   1.00 0.00 ? 8  PRO A HD3  5  
ATOM   3760  N N    . LEU A 1 9  ? -11.842 -8.963  3.419   1.00 0.00 ? 9  LEU A N    5  
ATOM   3761  C CA   . LEU A 1 9  ? -13.158 -9.358  3.891   1.00 0.00 ? 9  LEU A CA   5  
ATOM   3762  C C    . LEU A 1 9  ? -14.060 -8.124  3.963   1.00 0.00 ? 9  LEU A C    5  
ATOM   3763  O O    . LEU A 1 9  ? -15.258 -8.210  3.697   1.00 0.00 ? 9  LEU A O    5  
ATOM   3764  C CB   . LEU A 1 9  ? -13.048 -10.117 5.215   1.00 0.00 ? 9  LEU A CB   5  
ATOM   3765  C CG   . LEU A 1 9  ? -12.891 -11.635 5.106   1.00 0.00 ? 9  LEU A CG   5  
ATOM   3766  C CD1  . LEU A 1 9  ? -12.573 -12.252 6.469   1.00 0.00 ? 9  LEU A CD1  5  
ATOM   3767  C CD2  . LEU A 1 9  ? -14.126 -12.270 4.464   1.00 0.00 ? 9  LEU A CD2  5  
ATOM   3768  H H    . LEU A 1 9  ? -11.352 -8.328  4.016   1.00 0.00 ? 9  LEU A H    5  
ATOM   3769  H HA   . LEU A 1 9  ? -13.575 -10.048 3.157   1.00 0.00 ? 9  LEU A HA   5  
ATOM   3770  H HB2  . LEU A 1 9  ? -12.195 -9.722  5.767   1.00 0.00 ? 9  LEU A HB2  5  
ATOM   3771  H HB3  . LEU A 1 9  ? -13.938 -9.905  5.808   1.00 0.00 ? 9  LEU A HB3  5  
ATOM   3772  H HG   . LEU A 1 9  ? -12.044 -11.845 4.452   1.00 0.00 ? 9  LEU A HG   5  
ATOM   3773  H HD11 . LEU A 1 9  ? -13.211 -13.121 6.633   1.00 0.00 ? 9  LEU A HD11 5  
ATOM   3774  H HD12 . LEU A 1 9  ? -11.528 -12.560 6.494   1.00 0.00 ? 9  LEU A HD12 5  
ATOM   3775  H HD21 . LEU A 1 9  ? -14.711 -12.781 5.228   1.00 0.00 ? 9  LEU A HD21 5  
ATOM   3776  H HD22 . LEU A 1 9  ? -14.734 -11.493 4.000   1.00 0.00 ? 9  LEU A HD22 5  
ATOM   3777  N N    . PHE A 1 10 ? -13.451 -7.005  4.325   1.00 0.00 ? 10 PHE A N    5  
ATOM   3778  C CA   . PHE A 1 10 ? -14.184 -5.755  4.435   1.00 0.00 ? 10 PHE A CA   5  
ATOM   3779  C C    . PHE A 1 10 ? -13.426 -4.613  3.754   1.00 0.00 ? 10 PHE A C    5  
ATOM   3780  O O    . PHE A 1 10 ? -12.236 -4.736  3.470   1.00 0.00 ? 10 PHE A O    5  
ATOM   3781  C CB   . PHE A 1 10 ? -14.316 -5.445  5.928   1.00 0.00 ? 10 PHE A CB   5  
ATOM   3782  C CG   . PHE A 1 10 ? -14.756 -6.640  6.775   1.00 0.00 ? 10 PHE A CG   5  
ATOM   3783  C CD1  . PHE A 1 10 ? -13.827 -7.503  7.268   1.00 0.00 ? 10 PHE A CD1  5  
ATOM   3784  C CD2  . PHE A 1 10 ? -16.076 -6.840  7.036   1.00 0.00 ? 10 PHE A CD2  5  
ATOM   3785  C CE1  . PHE A 1 10 ? -14.236 -8.613  8.054   1.00 0.00 ? 10 PHE A CE1  5  
ATOM   3786  C CE2  . PHE A 1 10 ? -16.484 -7.949  7.823   1.00 0.00 ? 10 PHE A CE2  5  
ATOM   3787  C CZ   . PHE A 1 10 ? -15.555 -8.812  8.315   1.00 0.00 ? 10 PHE A CZ   5  
ATOM   3788  H H    . PHE A 1 10 ? -12.476 -6.943  4.540   1.00 0.00 ? 10 PHE A H    5  
ATOM   3789  H HA   . PHE A 1 10 ? -15.144 -5.898  3.940   1.00 0.00 ? 10 PHE A HA   5  
ATOM   3790  H HB2  . PHE A 1 10 ? -13.358 -5.082  6.299   1.00 0.00 ? 10 PHE A HB2  5  
ATOM   3791  H HB3  . PHE A 1 10 ? -15.035 -4.636  6.058   1.00 0.00 ? 10 PHE A HB3  5  
ATOM   3792  H HD1  . PHE A 1 10 ? -12.770 -7.343  7.059   1.00 0.00 ? 10 PHE A HD1  5  
ATOM   3793  H HD2  . PHE A 1 10 ? -16.820 -6.148  6.642   1.00 0.00 ? 10 PHE A HD2  5  
ATOM   3794  H HE1  . PHE A 1 10 ? -13.491 -9.304  8.449   1.00 0.00 ? 10 PHE A HE1  5  
ATOM   3795  H HE2  . PHE A 1 10 ? -17.542 -8.109  8.032   1.00 0.00 ? 10 PHE A HE2  5  
ATOM   3796  H HZ   . PHE A 1 10 ? -15.869 -9.664  8.919   1.00 0.00 ? 10 PHE A HZ   5  
ATOM   3797  N N    . SER A 1 11 ? -14.148 -3.529  3.512   1.00 0.00 ? 11 SER A N    5  
ATOM   3798  C CA   . SER A 1 11 ? -13.560 -2.366  2.870   1.00 0.00 ? 11 SER A CA   5  
ATOM   3799  C C    . SER A 1 11 ? -13.723 -1.136  3.764   1.00 0.00 ? 11 SER A C    5  
ATOM   3800  O O    . SER A 1 11 ? -14.603 -1.100  4.623   1.00 0.00 ? 11 SER A O    5  
ATOM   3801  C CB   . SER A 1 11 ? -14.193 -2.114  1.500   1.00 0.00 ? 11 SER A CB   5  
ATOM   3802  O OG   . SER A 1 11 ? -15.616 -2.147  1.556   1.00 0.00 ? 11 SER A OG   5  
ATOM   3803  H H    . SER A 1 11 ? -15.116 -3.438  3.746   1.00 0.00 ? 11 SER A H    5  
ATOM   3804  H HA   . SER A 1 11 ? -12.505 -2.610  2.743   1.00 0.00 ? 11 SER A HA   5  
ATOM   3805  H HB2  . SER A 1 11 ? -13.867 -1.145  1.123   1.00 0.00 ? 11 SER A HB2  5  
ATOM   3806  H HB3  . SER A 1 11 ? -13.840 -2.866  0.794   1.00 0.00 ? 11 SER A HB3  5  
ATOM   3807  H HG   . SER A 1 11 ? -16.000 -1.810  0.696   1.00 0.00 ? 11 SER A HG   5  
ATOM   3808  N N    . LYS A 1 12 ? -12.860 -0.157  3.533   1.00 0.00 ? 12 LYS A N    5  
ATOM   3809  C CA   . LYS A 1 12 ? -12.898 1.072   4.307   1.00 0.00 ? 12 LYS A CA   5  
ATOM   3810  C C    . LYS A 1 12 ? -12.399 2.231   3.441   1.00 0.00 ? 12 LYS A C    5  
ATOM   3811  O O    . LYS A 1 12 ? -11.955 2.021   2.313   1.00 0.00 ? 12 LYS A O    5  
ATOM   3812  C CB   . LYS A 1 12 ? -12.123 0.905   5.615   1.00 0.00 ? 12 LYS A CB   5  
ATOM   3813  C CG   . LYS A 1 12 ? -12.807 1.659   6.758   1.00 0.00 ? 12 LYS A CG   5  
ATOM   3814  C CD   . LYS A 1 12 ? -11.783 2.415   7.606   1.00 0.00 ? 12 LYS A CD   5  
ATOM   3815  C CE   . LYS A 1 12 ? -12.341 3.764   8.065   1.00 0.00 ? 12 LYS A CE   5  
ATOM   3816  N NZ   . LYS A 1 12 ? -11.796 4.125   9.393   1.00 0.00 ? 12 LYS A NZ   5  
ATOM   3817  H H    . LYS A 1 12 ? -12.147 -0.194  2.832   1.00 0.00 ? 12 LYS A H    5  
ATOM   3818  H HA   . LYS A 1 12 ? -13.938 1.261   4.570   1.00 0.00 ? 12 LYS A HA   5  
ATOM   3819  H HB2  . LYS A 1 12 ? -12.049 -0.153  5.866   1.00 0.00 ? 12 LYS A HB2  5  
ATOM   3820  H HB3  . LYS A 1 12 ? -11.105 1.274   5.489   1.00 0.00 ? 12 LYS A HB3  5  
ATOM   3821  H HG2  . LYS A 1 12 ? -13.536 2.359   6.351   1.00 0.00 ? 12 LYS A HG2  5  
ATOM   3822  H HG3  . LYS A 1 12 ? -13.356 0.956   7.385   1.00 0.00 ? 12 LYS A HG3  5  
ATOM   3823  H HD2  . LYS A 1 12 ? -11.510 1.816   8.475   1.00 0.00 ? 12 LYS A HD2  5  
ATOM   3824  H HD3  . LYS A 1 12 ? -10.872 2.572   7.029   1.00 0.00 ? 12 LYS A HD3  5  
ATOM   3825  H HE2  . LYS A 1 12 ? -12.086 4.536   7.339   1.00 0.00 ? 12 LYS A HE2  5  
ATOM   3826  H HE3  . LYS A 1 12 ? -13.429 3.717   8.112   1.00 0.00 ? 12 LYS A HE3  5  
ATOM   3827  H HZ1  . LYS A 1 12 ? -12.404 4.785   9.835   1.00 0.00 ? 12 LYS A HZ1  5  
ATOM   3828  H HZ2  . LYS A 1 12 ? -11.727 3.304   9.960   1.00 0.00 ? 12 LYS A HZ2  5  
ATOM   3829  N N    . THR A 1 13 ? -12.488 3.428   4.001   1.00 0.00 ? 13 THR A N    5  
ATOM   3830  C CA   . THR A 1 13 ? -12.052 4.620   3.294   1.00 0.00 ? 13 THR A CA   5  
ATOM   3831  C C    . THR A 1 13 ? -10.966 5.345   4.092   1.00 0.00 ? 13 THR A C    5  
ATOM   3832  O O    . THR A 1 13 ? -11.175 5.702   5.250   1.00 0.00 ? 13 THR A O    5  
ATOM   3833  C CB   . THR A 1 13 ? -13.284 5.485   3.019   1.00 0.00 ? 13 THR A CB   5  
ATOM   3834  O OG1  . THR A 1 13 ? -14.036 4.727   2.076   1.00 0.00 ? 13 THR A OG1  5  
ATOM   3835  C CG2  . THR A 1 13 ? -12.939 6.774   2.272   1.00 0.00 ? 13 THR A CG2  5  
ATOM   3836  H H    . THR A 1 13 ? -12.850 3.590   4.919   1.00 0.00 ? 13 THR A H    5  
ATOM   3837  H HA   . THR A 1 13 ? -11.604 4.314   2.349   1.00 0.00 ? 13 THR A HA   5  
ATOM   3838  H HB   . THR A 1 13 ? -13.821 5.701   3.943   1.00 0.00 ? 13 THR A HB   5  
ATOM   3839  H HG1  . THR A 1 13 ? -14.585 4.038   2.550   1.00 0.00 ? 13 THR A HG1  5  
ATOM   3840  H HG21 . THR A 1 13 ? -13.619 6.898   1.429   1.00 0.00 ? 13 THR A HG21 5  
ATOM   3841  H HG22 . THR A 1 13 ? -13.039 7.624   2.947   1.00 0.00 ? 13 THR A HG22 5  
ATOM   3842  N N    . CYS A 1 14 ? -9.830  5.542   3.440   1.00 0.00 ? 14 CYS A N    5  
ATOM   3843  C CA   . CYS A 1 14 ? -8.710  6.218   4.073   1.00 0.00 ? 14 CYS A CA   5  
ATOM   3844  C C    . CYS A 1 14 ? -9.179  7.603   4.524   1.00 0.00 ? 14 CYS A C    5  
ATOM   3845  O O    . CYS A 1 14 ? -9.633  8.405   3.709   1.00 0.00 ? 14 CYS A O    5  
ATOM   3846  C CB   . CYS A 1 14 ? -7.499  6.301   3.142   1.00 0.00 ? 14 CYS A CB   5  
ATOM   3847  S SG   . CYS A 1 14 ? -7.187  4.794   2.152   1.00 0.00 ? 14 CYS A SG   5  
ATOM   3848  H H    . CYS A 1 14 ? -9.668  5.249   2.497   1.00 0.00 ? 14 CYS A H    5  
ATOM   3849  H HA   . CYS A 1 14 ? -8.421  5.609   4.930   1.00 0.00 ? 14 CYS A HA   5  
ATOM   3850  H HB2  . CYS A 1 14 ? -7.637  7.142   2.464   1.00 0.00 ? 14 CYS A HB2  5  
ATOM   3851  H HB3  . CYS A 1 14 ? -6.613  6.515   3.740   1.00 0.00 ? 14 CYS A HB3  5  
ATOM   3852  N N    . PRO A 1 15 ? -9.050  7.848   5.856   1.00 0.00 ? 15 PRO A N    5  
ATOM   3853  C CA   . PRO A 1 15 ? -9.455  9.122   6.425   1.00 0.00 ? 15 PRO A CA   5  
ATOM   3854  C C    . PRO A 1 15 ? -8.442  10.219  6.089   1.00 0.00 ? 15 PRO A C    5  
ATOM   3855  O O    . PRO A 1 15 ? -7.389  9.943   5.518   1.00 0.00 ? 15 PRO A O    5  
ATOM   3856  C CB   . PRO A 1 15 ? -9.578  8.864   7.918   1.00 0.00 ? 15 PRO A CB   5  
ATOM   3857  C CG   . PRO A 1 15 ? -8.794  7.591   8.187   1.00 0.00 ? 15 PRO A CG   5  
ATOM   3858  C CD   . PRO A 1 15 ? -8.517  6.922   6.851   1.00 0.00 ? 15 PRO A CD   5  
ATOM   3859  H HA   . PRO A 1 15 ? -10.322 9.420   6.027   1.00 0.00 ? 15 PRO A HA   5  
ATOM   3860  H HB2  . PRO A 1 15 ? -9.178  9.699   8.493   1.00 0.00 ? 15 PRO A HB2  5  
ATOM   3861  H HB3  . PRO A 1 15 ? -10.622 8.749   8.209   1.00 0.00 ? 15 PRO A HB3  5  
ATOM   3862  H HG2  . PRO A 1 15 ? -7.860  7.819   8.701   1.00 0.00 ? 15 PRO A HG2  5  
ATOM   3863  H HG3  . PRO A 1 15 ? -9.360  6.924   8.838   1.00 0.00 ? 15 PRO A HG3  5  
ATOM   3864  H HD2  . PRO A 1 15 ? -7.449  6.756   6.705   1.00 0.00 ? 15 PRO A HD2  5  
ATOM   3865  H HD3  . PRO A 1 15 ? -9.003  5.949   6.787   1.00 0.00 ? 15 PRO A HD3  5  
ATOM   3866  N N    . ALA A 1 16 ? -8.798  11.441  6.459   1.00 0.00 ? 16 ALA A N    5  
ATOM   3867  C CA   . ALA A 1 16 ? -7.933  12.581  6.204   1.00 0.00 ? 16 ALA A CA   5  
ATOM   3868  C C    . ALA A 1 16 ? -6.479  12.181  6.465   1.00 0.00 ? 16 ALA A C    5  
ATOM   3869  O O    . ALA A 1 16 ? -6.214  11.260  7.235   1.00 0.00 ? 16 ALA A O    5  
ATOM   3870  C CB   . ALA A 1 16 ? -8.377  13.762  7.069   1.00 0.00 ? 16 ALA A CB   5  
ATOM   3871  H H    . ALA A 1 16 ? -9.656  11.657  6.923   1.00 0.00 ? 16 ALA A H    5  
ATOM   3872  H HA   . ALA A 1 16 ? -8.044  12.853  5.155   1.00 0.00 ? 16 ALA A HA   5  
ATOM   3873  H HB1  . ALA A 1 16 ? -9.465  13.828  7.063   1.00 0.00 ? 16 ALA A HB1  5  
ATOM   3874  H HB2  . ALA A 1 16 ? -8.028  13.615  8.091   1.00 0.00 ? 16 ALA A HB2  5  
ATOM   3875  N N    . GLY A 1 17 ? -5.576  12.895  5.809   1.00 0.00 ? 17 GLY A N    5  
ATOM   3876  C CA   . GLY A 1 17 ? -4.156  12.626  5.960   1.00 0.00 ? 17 GLY A CA   5  
ATOM   3877  C C    . GLY A 1 17 ? -3.694  11.550  4.975   1.00 0.00 ? 17 GLY A C    5  
ATOM   3878  O O    . GLY A 1 17 ? -2.767  11.772  4.198   1.00 0.00 ? 17 GLY A O    5  
ATOM   3879  H H    . GLY A 1 17 ? -5.801  13.643  5.184   1.00 0.00 ? 17 GLY A H    5  
ATOM   3880  H HA2  . GLY A 1 17 ? -3.590  13.542  5.795   1.00 0.00 ? 17 GLY A HA2  5  
ATOM   3881  H HA3  . GLY A 1 17 ? -3.950  12.303  6.980   1.00 0.00 ? 17 GLY A HA3  5  
ATOM   3882  N N    . LYS A 1 18 ? -4.361  10.407  5.040   1.00 0.00 ? 18 LYS A N    5  
ATOM   3883  C CA   . LYS A 1 18 ? -4.031  9.297   4.164   1.00 0.00 ? 18 LYS A CA   5  
ATOM   3884  C C    . LYS A 1 18 ? -5.117  9.154   3.096   1.00 0.00 ? 18 LYS A C    5  
ATOM   3885  O O    . LYS A 1 18 ? -6.199  8.638   3.371   1.00 0.00 ? 18 LYS A O    5  
ATOM   3886  C CB   . LYS A 1 18 ? -3.798  8.023   4.978   1.00 0.00 ? 18 LYS A CB   5  
ATOM   3887  C CG   . LYS A 1 18 ? -4.748  7.956   6.176   1.00 0.00 ? 18 LYS A CG   5  
ATOM   3888  C CD   . LYS A 1 18 ? -4.591  6.633   6.928   1.00 0.00 ? 18 LYS A CD   5  
ATOM   3889  C CE   . LYS A 1 18 ? -3.866  6.841   8.259   1.00 0.00 ? 18 LYS A CE   5  
ATOM   3890  N NZ   . LYS A 1 18 ? -2.421  6.559   8.111   1.00 0.00 ? 18 LYS A NZ   5  
ATOM   3891  H H    . LYS A 1 18 ? -5.114  10.235  5.675   1.00 0.00 ? 18 LYS A H    5  
ATOM   3892  H HA   . LYS A 1 18 ? -3.090  9.539   3.669   1.00 0.00 ? 18 LYS A HA   5  
ATOM   3893  H HB2  . LYS A 1 18 ? -3.945  7.149   4.344   1.00 0.00 ? 18 LYS A HB2  5  
ATOM   3894  H HB3  . LYS A 1 18 ? -2.765  7.993   5.326   1.00 0.00 ? 18 LYS A HB3  5  
ATOM   3895  H HG2  . LYS A 1 18 ? -4.546  8.788   6.851   1.00 0.00 ? 18 LYS A HG2  5  
ATOM   3896  H HG3  . LYS A 1 18 ? -5.777  8.065   5.835   1.00 0.00 ? 18 LYS A HG3  5  
ATOM   3897  H HD2  . LYS A 1 18 ? -5.572  6.195   7.109   1.00 0.00 ? 18 LYS A HD2  5  
ATOM   3898  H HD3  . LYS A 1 18 ? -4.034  5.925   6.313   1.00 0.00 ? 18 LYS A HD3  5  
ATOM   3899  H HE2  . LYS A 1 18 ? -4.009  7.866   8.601   1.00 0.00 ? 18 LYS A HE2  5  
ATOM   3900  H HE3  . LYS A 1 18 ? -4.294  6.188   9.019   1.00 0.00 ? 18 LYS A HE3  5  
ATOM   3901  H HZ1  . LYS A 1 18 ? -1.916  7.421   8.062   1.00 0.00 ? 18 LYS A HZ1  5  
ATOM   3902  H HZ2  . LYS A 1 18 ? -2.102  6.031   8.899   1.00 0.00 ? 18 LYS A HZ2  5  
ATOM   3903  N N    . ASN A 1 19 ? -4.790  9.620   1.899   1.00 0.00 ? 19 ASN A N    5  
ATOM   3904  C CA   . ASN A 1 19 ? -5.725  9.551   0.789   1.00 0.00 ? 19 ASN A CA   5  
ATOM   3905  C C    . ASN A 1 19 ? -5.183  8.586   -0.268  1.00 0.00 ? 19 ASN A C    5  
ATOM   3906  O O    . ASN A 1 19 ? -5.715  8.511   -1.375  1.00 0.00 ? 19 ASN A O    5  
ATOM   3907  C CB   . ASN A 1 19 ? -5.902  10.921  0.132   1.00 0.00 ? 19 ASN A CB   5  
ATOM   3908  C CG   . ASN A 1 19 ? -7.042  11.701  0.790   1.00 0.00 ? 19 ASN A CG   5  
ATOM   3909  O OD1  . ASN A 1 19 ? -8.179  11.679  0.350   1.00 0.00 ? 19 ASN A OD1  5  
ATOM   3910  N ND2  . ASN A 1 19 ? -6.674  12.390  1.867   1.00 0.00 ? 19 ASN A ND2  5  
ATOM   3911  H H    . ASN A 1 19 ? -3.908  10.038  1.683   1.00 0.00 ? 19 ASN A H    5  
ATOM   3912  H HA   . ASN A 1 19 ? -6.663  9.207   1.225   1.00 0.00 ? 19 ASN A HA   5  
ATOM   3913  H HB2  . ASN A 1 19 ? -4.975  11.489  0.210   1.00 0.00 ? 19 ASN A HB2  5  
ATOM   3914  H HB3  . ASN A 1 19 ? -6.110  10.795  -0.931  1.00 0.00 ? 19 ASN A HB3  5  
ATOM   3915  H HD21 . ASN A 1 19 ? -5.724  12.365  2.176   1.00 0.00 ? 19 ASN A HD21 5  
ATOM   3916  H HD22 . ASN A 1 19 ? -7.349  12.932  2.368   1.00 0.00 ? 19 ASN A HD22 5  
ATOM   3917  N N    . LEU A 1 20 ? -4.133  7.873   0.110   1.00 0.00 ? 20 LEU A N    5  
ATOM   3918  C CA   . LEU A 1 20 ? -3.513  6.917   -0.792  1.00 0.00 ? 20 LEU A CA   5  
ATOM   3919  C C    . LEU A 1 20 ? -3.488  5.539   -0.128  1.00 0.00 ? 20 LEU A C    5  
ATOM   3920  O O    . LEU A 1 20 ? -3.060  5.406   1.018   1.00 0.00 ? 20 LEU A O    5  
ATOM   3921  C CB   . LEU A 1 20 ? -2.135  7.412   -1.234  1.00 0.00 ? 20 LEU A CB   5  
ATOM   3922  C CG   . LEU A 1 20 ? -2.116  8.711   -2.042  1.00 0.00 ? 20 LEU A CG   5  
ATOM   3923  C CD1  . LEU A 1 20 ? -1.147  9.724   -1.429  1.00 0.00 ? 20 LEU A CD1  5  
ATOM   3924  C CD2  . LEU A 1 20 ? -1.804  8.437   -3.514  1.00 0.00 ? 20 LEU A CD2  5  
ATOM   3925  H H    . LEU A 1 20 ? -3.706  7.941   1.012   1.00 0.00 ? 20 LEU A H    5  
ATOM   3926  H HA   . LEU A 1 20 ? -4.136  6.859   -1.685  1.00 0.00 ? 20 LEU A HA   5  
ATOM   3927  H HB2  . LEU A 1 20 ? -1.519  7.551   -0.346  1.00 0.00 ? 20 LEU A HB2  5  
ATOM   3928  H HB3  . LEU A 1 20 ? -1.664  6.630   -1.830  1.00 0.00 ? 20 LEU A HB3  5  
ATOM   3929  H HG   . LEU A 1 20 ? -3.112  9.153   -2.001  1.00 0.00 ? 20 LEU A HG   5  
ATOM   3930  H HD11 . LEU A 1 20 ? -1.487  9.994   -0.430  1.00 0.00 ? 20 LEU A HD11 5  
ATOM   3931  H HD12 . LEU A 1 20 ? -0.152  9.283   -1.367  1.00 0.00 ? 20 LEU A HD12 5  
ATOM   3932  H HD21 . LEU A 1 20 ? -2.363  7.562   -3.847  1.00 0.00 ? 20 LEU A HD21 5  
ATOM   3933  H HD22 . LEU A 1 20 ? -2.090  9.301   -4.114  1.00 0.00 ? 20 LEU A HD22 5  
ATOM   3934  N N    . CYS A 1 21 ? -3.951  4.548   -0.875  1.00 0.00 ? 21 CYS A N    5  
ATOM   3935  C CA   . CYS A 1 21 ? -3.987  3.185   -0.373  1.00 0.00 ? 21 CYS A CA   5  
ATOM   3936  C C    . CYS A 1 21 ? -2.617  2.548   -0.615  1.00 0.00 ? 21 CYS A C    5  
ATOM   3937  O O    . CYS A 1 21 ? -2.014  2.745   -1.669  1.00 0.00 ? 21 CYS A O    5  
ATOM   3938  C CB   . CYS A 1 21 ? -5.114  2.374   -1.017  1.00 0.00 ? 21 CYS A CB   5  
ATOM   3939  S SG   . CYS A 1 21 ? -6.673  3.297   -1.272  1.00 0.00 ? 21 CYS A SG   5  
ATOM   3940  H H    . CYS A 1 21 ? -4.297  4.665   -1.806  1.00 0.00 ? 21 CYS A H    5  
ATOM   3941  H HA   . CYS A 1 21 ? -4.201  3.250   0.693   1.00 0.00 ? 21 CYS A HA   5  
ATOM   3942  H HB2  . CYS A 1 21 ? -4.769  1.999   -1.980  1.00 0.00 ? 21 CYS A HB2  5  
ATOM   3943  H HB3  . CYS A 1 21 ? -5.320  1.506   -0.391  1.00 0.00 ? 21 CYS A HB3  5  
ATOM   3944  N N    . TYR A 1 22 ? -2.165  1.798   0.380   1.00 0.00 ? 22 TYR A N    5  
ATOM   3945  C CA   . TYR A 1 22 ? -0.877  1.131   0.289   1.00 0.00 ? 22 TYR A CA   5  
ATOM   3946  C C    . TYR A 1 22 ? -0.985  -0.331  0.727   1.00 0.00 ? 22 TYR A C    5  
ATOM   3947  O O    . TYR A 1 22 ? -1.965  -0.723  1.357   1.00 0.00 ? 22 TYR A O    5  
ATOM   3948  C CB   . TYR A 1 22 ? 0.051   1.873   1.252   1.00 0.00 ? 22 TYR A CB   5  
ATOM   3949  C CG   . TYR A 1 22 ? -0.044  1.392   2.702   1.00 0.00 ? 22 TYR A CG   5  
ATOM   3950  C CD1  . TYR A 1 22 ? 0.566   0.212   3.078   1.00 0.00 ? 22 TYR A CD1  5  
ATOM   3951  C CD2  . TYR A 1 22 ? -0.739  2.137   3.632   1.00 0.00 ? 22 TYR A CD2  5  
ATOM   3952  C CE1  . TYR A 1 22 ? 0.477   -0.241  4.443   1.00 0.00 ? 22 TYR A CE1  5  
ATOM   3953  C CE2  . TYR A 1 22 ? -0.828  1.684   4.996   1.00 0.00 ? 22 TYR A CE2  5  
ATOM   3954  C CZ   . TYR A 1 22 ? -0.216  0.518   5.334   1.00 0.00 ? 22 TYR A CZ   5  
ATOM   3955  O OH   . TYR A 1 22 ? -0.300  0.090   6.622   1.00 0.00 ? 22 TYR A OH   5  
ATOM   3956  H H    . TYR A 1 22 ? -2.662  1.643   1.233   1.00 0.00 ? 22 TYR A H    5  
ATOM   3957  H HA   . TYR A 1 22 ? -0.552  1.168   -0.751  1.00 0.00 ? 22 TYR A HA   5  
ATOM   3958  H HB2  . TYR A 1 22 ? 1.079   1.760   0.909   1.00 0.00 ? 22 TYR A HB2  5  
ATOM   3959  H HB3  . TYR A 1 22 ? -0.182  2.937   1.218   1.00 0.00 ? 22 TYR A HB3  5  
ATOM   3960  H HD1  . TYR A 1 22 ? 1.115   -0.377  2.343   1.00 0.00 ? 22 TYR A HD1  5  
ATOM   3961  H HD2  . TYR A 1 22 ? -1.220  3.069   3.335   1.00 0.00 ? 22 TYR A HD2  5  
ATOM   3962  H HE1  . TYR A 1 22 ? 0.954   -1.170  4.753   1.00 0.00 ? 22 TYR A HE1  5  
ATOM   3963  H HE2  . TYR A 1 22 ? -1.373  2.264   5.741   1.00 0.00 ? 22 TYR A HE2  5  
ATOM   3964  H HH   . TYR A 1 22 ? -1.026  -0.591  6.710   1.00 0.00 ? 22 TYR A HH   5  
ATOM   3965  N N    . LYS A 1 23 ? 0.037   -1.097  0.376   1.00 0.00 ? 23 LYS A N    5  
ATOM   3966  C CA   . LYS A 1 23 ? 0.070   -2.507  0.725   1.00 0.00 ? 23 LYS A CA   5  
ATOM   3967  C C    . LYS A 1 23 ? 1.523   -2.949  0.911   1.00 0.00 ? 23 LYS A C    5  
ATOM   3968  O O    . LYS A 1 23 ? 2.362   -2.718  0.041   1.00 0.00 ? 23 LYS A O    5  
ATOM   3969  C CB   . LYS A 1 23 ? -0.695  -3.334  -0.311  1.00 0.00 ? 23 LYS A CB   5  
ATOM   3970  C CG   . LYS A 1 23 ? 0.065   -3.392  -1.637  1.00 0.00 ? 23 LYS A CG   5  
ATOM   3971  C CD   . LYS A 1 23 ? -0.802  -4.001  -2.740  1.00 0.00 ? 23 LYS A CD   5  
ATOM   3972  C CE   . LYS A 1 23 ? -0.008  -5.016  -3.565  1.00 0.00 ? 23 LYS A CE   5  
ATOM   3973  N NZ   . LYS A 1 23 ? -0.894  -5.713  -4.524  1.00 0.00 ? 23 LYS A NZ   5  
ATOM   3974  H H    . LYS A 1 23 ? 0.831   -0.770  -0.137  1.00 0.00 ? 23 LYS A H    5  
ATOM   3975  H HA   . LYS A 1 23 ? -0.450  -2.621  1.676   1.00 0.00 ? 23 LYS A HA   5  
ATOM   3976  H HB2  . LYS A 1 23 ? -0.852  -4.344  0.068   1.00 0.00 ? 23 LYS A HB2  5  
ATOM   3977  H HB3  . LYS A 1 23 ? -1.682  -2.898  -0.472  1.00 0.00 ? 23 LYS A HB3  5  
ATOM   3978  H HG2  . LYS A 1 23 ? 0.376   -2.388  -1.926  1.00 0.00 ? 23 LYS A HG2  5  
ATOM   3979  H HG3  . LYS A 1 23 ? 0.972   -3.984  -1.514  1.00 0.00 ? 23 LYS A HG3  5  
ATOM   3980  H HD2  . LYS A 1 23 ? -1.671  -4.488  -2.297  1.00 0.00 ? 23 LYS A HD2  5  
ATOM   3981  H HD3  . LYS A 1 23 ? -1.177  -3.211  -3.391  1.00 0.00 ? 23 LYS A HD3  5  
ATOM   3982  H HE2  . LYS A 1 23 ? 0.792   -4.508  -4.104  1.00 0.00 ? 23 LYS A HE2  5  
ATOM   3983  H HE3  . LYS A 1 23 ? 0.464   -5.742  -2.903  1.00 0.00 ? 23 LYS A HE3  5  
ATOM   3984  H HZ1  . LYS A 1 23 ? -0.913  -5.209  -5.388  1.00 0.00 ? 23 LYS A HZ1  5  
ATOM   3985  H HZ2  . LYS A 1 23 ? -0.550  -6.638  -4.684  1.00 0.00 ? 23 LYS A HZ2  5  
ATOM   3986  N N    . MET A 1 24 ? 1.776   -3.576  2.050   1.00 0.00 ? 24 MET A N    5  
ATOM   3987  C CA   . MET A 1 24 ? 3.114   -4.051  2.362   1.00 0.00 ? 24 MET A CA   5  
ATOM   3988  C C    . MET A 1 24 ? 3.227   -5.559  2.131   1.00 0.00 ? 24 MET A C    5  
ATOM   3989  O O    . MET A 1 24 ? 2.385   -6.327  2.594   1.00 0.00 ? 24 MET A O    5  
ATOM   3990  C CB   . MET A 1 24 ? 3.442   -3.732  3.822   1.00 0.00 ? 24 MET A CB   5  
ATOM   3991  C CG   . MET A 1 24 ? 3.758   -2.246  4.000   1.00 0.00 ? 24 MET A CG   5  
ATOM   3992  S SD   . MET A 1 24 ? 4.875   -2.020  5.374   1.00 0.00 ? 24 MET A SD   5  
ATOM   3993  C CE   . MET A 1 24 ? 3.856   -1.013  6.440   1.00 0.00 ? 24 MET A CE   5  
ATOM   3994  H H    . MET A 1 24 ? 1.088   -3.759  2.753   1.00 0.00 ? 24 MET A H    5  
ATOM   3995  H HA   . MET A 1 24 ? 3.779   -3.521  1.680   1.00 0.00 ? 24 MET A HA   5  
ATOM   3996  H HB2  . MET A 1 24 ? 2.600   -4.008  4.456   1.00 0.00 ? 24 MET A HB2  5  
ATOM   3997  H HB3  . MET A 1 24 ? 4.294   -4.330  4.146   1.00 0.00 ? 24 MET A HB3  5  
ATOM   3998  H HG2  . MET A 1 24 ? 4.204   -1.848  3.089   1.00 0.00 ? 24 MET A HG2  5  
ATOM   3999  H HG3  . MET A 1 24 ? 2.837   -1.688  4.174   1.00 0.00 ? 24 MET A HG3  5  
ATOM   4000  H HE1  . MET A 1 24 ? 4.212   -1.095  7.467   1.00 0.00 ? 24 MET A HE1  5  
ATOM   4001  H HE2  . MET A 1 24 ? 3.909   0.027   6.118   1.00 0.00 ? 24 MET A HE2  5  
ATOM   4002  N N    . PHE A 1 25 ? 4.275   -5.939  1.414   1.00 0.00 ? 25 PHE A N    5  
ATOM   4003  C CA   . PHE A 1 25 ? 4.509   -7.341  1.116   1.00 0.00 ? 25 PHE A CA   5  
ATOM   4004  C C    . PHE A 1 25 ? 6.007   -7.639  1.019   1.00 0.00 ? 25 PHE A C    5  
ATOM   4005  O O    . PHE A 1 25 ? 6.788   -6.783  0.606   1.00 0.00 ? 25 PHE A O    5  
ATOM   4006  C CB   . PHE A 1 25 ? 3.857   -7.626  -0.239  1.00 0.00 ? 25 PHE A CB   5  
ATOM   4007  C CG   . PHE A 1 25 ? 4.408   -6.776  -1.386  1.00 0.00 ? 25 PHE A CG   5  
ATOM   4008  C CD1  . PHE A 1 25 ? 5.596   -7.102  -1.963  1.00 0.00 ? 25 PHE A CD1  5  
ATOM   4009  C CD2  . PHE A 1 25 ? 3.711   -5.696  -1.828  1.00 0.00 ? 25 PHE A CD2  5  
ATOM   4010  C CE1  . PHE A 1 25 ? 6.108   -6.313  -3.027  1.00 0.00 ? 25 PHE A CE1  5  
ATOM   4011  C CE2  . PHE A 1 25 ? 4.223   -4.907  -2.892  1.00 0.00 ? 25 PHE A CE2  5  
ATOM   4012  C CZ   . PHE A 1 25 ? 5.411   -5.233  -3.469  1.00 0.00 ? 25 PHE A CZ   5  
ATOM   4013  H H    . PHE A 1 25 ? 4.955   -5.308  1.040   1.00 0.00 ? 25 PHE A H    5  
ATOM   4014  H HA   . PHE A 1 25 ? 4.077   -7.922  1.930   1.00 0.00 ? 25 PHE A HA   5  
ATOM   4015  H HB2  . PHE A 1 25 ? 3.993   -8.679  -0.483  1.00 0.00 ? 25 PHE A HB2  5  
ATOM   4016  H HB3  . PHE A 1 25 ? 2.783   -7.454  -0.157  1.00 0.00 ? 25 PHE A HB3  5  
ATOM   4017  H HD1  . PHE A 1 25 ? 6.155   -7.968  -1.608  1.00 0.00 ? 25 PHE A HD1  5  
ATOM   4018  H HD2  . PHE A 1 25 ? 2.759   -5.435  -1.366  1.00 0.00 ? 25 PHE A HD2  5  
ATOM   4019  H HE1  . PHE A 1 25 ? 7.060   -6.574  -3.489  1.00 0.00 ? 25 PHE A HE1  5  
ATOM   4020  H HE2  . PHE A 1 25 ? 3.664   -4.041  -3.247  1.00 0.00 ? 25 PHE A HE2  5  
ATOM   4021  H HZ   . PHE A 1 25 ? 5.804   -4.627  -4.286  1.00 0.00 ? 25 PHE A HZ   5  
ATOM   4022  N N    . MET A 1 26 ? 6.362   -8.855  1.408   1.00 0.00 ? 26 MET A N    5  
ATOM   4023  C CA   . MET A 1 26 ? 7.752   -9.275  1.371   1.00 0.00 ? 26 MET A CA   5  
ATOM   4024  C C    . MET A 1 26 ? 8.143   -9.755  -0.028  1.00 0.00 ? 26 MET A C    5  
ATOM   4025  O O    . MET A 1 26 ? 7.334   -10.363 -0.728  1.00 0.00 ? 26 MET A O    5  
ATOM   4026  C CB   . MET A 1 26 ? 7.971   -10.406 2.379   1.00 0.00 ? 26 MET A CB   5  
ATOM   4027  C CG   . MET A 1 26 ? 7.784   -9.907  3.813   1.00 0.00 ? 26 MET A CG   5  
ATOM   4028  S SD   . MET A 1 26 ? 9.311   -10.074 4.721   1.00 0.00 ? 26 MET A SD   5  
ATOM   4029  C CE   . MET A 1 26 ? 8.794   -11.221 5.988   1.00 0.00 ? 26 MET A CE   5  
ATOM   4030  H H    . MET A 1 26 ? 5.720   -9.544  1.743   1.00 0.00 ? 26 MET A H    5  
ATOM   4031  H HA   . MET A 1 26 ? 8.333   -8.391  1.635   1.00 0.00 ? 26 MET A HA   5  
ATOM   4032  H HB2  . MET A 1 26 ? 7.270   -11.217 2.178   1.00 0.00 ? 26 MET A HB2  5  
ATOM   4033  H HB3  . MET A 1 26 ? 8.974   -10.815 2.260   1.00 0.00 ? 26 MET A HB3  5  
ATOM   4034  H HG2  . MET A 1 26 ? 7.468   -8.864  3.805   1.00 0.00 ? 26 MET A HG2  5  
ATOM   4035  H HG3  . MET A 1 26 ? 6.994   -10.475 4.304   1.00 0.00 ? 26 MET A HG3  5  
ATOM   4036  H HE1  . MET A 1 26 ? 8.129   -10.714 6.687   1.00 0.00 ? 26 MET A HE1  5  
ATOM   4037  H HE2  . MET A 1 26 ? 8.268   -12.057 5.528   1.00 0.00 ? 26 MET A HE2  5  
ATOM   4038  N N    . VAL A 1 27 ? 9.383   -9.465  -0.394  1.00 0.00 ? 27 VAL A N    5  
ATOM   4039  C CA   . VAL A 1 27 ? 9.890   -9.859  -1.697  1.00 0.00 ? 27 VAL A CA   5  
ATOM   4040  C C    . VAL A 1 27 ? 9.829   -11.383 -1.824  1.00 0.00 ? 27 VAL A C    5  
ATOM   4041  O O    . VAL A 1 27 ? 9.962   -11.924 -2.920  1.00 0.00 ? 27 VAL A O    5  
ATOM   4042  C CB   . VAL A 1 27 ? 11.299  -9.299  -1.902  1.00 0.00 ? 27 VAL A CB   5  
ATOM   4043  C CG1  . VAL A 1 27 ? 12.315  -10.037 -1.028  1.00 0.00 ? 27 VAL A CG1  5  
ATOM   4044  C CG2  . VAL A 1 27 ? 11.702  -9.353  -3.377  1.00 0.00 ? 27 VAL A CG2  5  
ATOM   4045  H H    . VAL A 1 27 ? 10.034  -8.971  0.181   1.00 0.00 ? 27 VAL A H    5  
ATOM   4046  H HA   . VAL A 1 27 ? 9.238   -9.418  -2.451  1.00 0.00 ? 27 VAL A HA   5  
ATOM   4047  H HB   . VAL A 1 27 ? 11.291  -8.253  -1.595  1.00 0.00 ? 27 VAL A HB   5  
ATOM   4048  H HG11 . VAL A 1 27 ? 12.006  -9.980  0.016   1.00 0.00 ? 27 VAL A HG11 5  
ATOM   4049  H HG12 . VAL A 1 27 ? 12.366  -11.082 -1.334  1.00 0.00 ? 27 VAL A HG12 5  
ATOM   4050  H HG21 . VAL A 1 27 ? 12.565  -8.708  -3.542  1.00 0.00 ? 27 VAL A HG21 5  
ATOM   4051  H HG22 . VAL A 1 27 ? 11.958  -10.378 -3.646  1.00 0.00 ? 27 VAL A HG22 5  
ATOM   4052  N N    . ALA A 1 28 ? 9.626   -12.032 -0.686  1.00 0.00 ? 28 ALA A N    5  
ATOM   4053  C CA   . ALA A 1 28 ? 9.546   -13.482 -0.656  1.00 0.00 ? 28 ALA A CA   5  
ATOM   4054  C C    . ALA A 1 28 ? 8.824   -13.975 -1.913  1.00 0.00 ? 28 ALA A C    5  
ATOM   4055  O O    . ALA A 1 28 ? 9.204   -14.991 -2.492  1.00 0.00 ? 28 ALA A O    5  
ATOM   4056  C CB   . ALA A 1 28 ? 8.847   -13.928 0.630   1.00 0.00 ? 28 ALA A CB   5  
ATOM   4057  H H    . ALA A 1 28 ? 9.519   -11.584 0.201   1.00 0.00 ? 28 ALA A H    5  
ATOM   4058  H HA   . ALA A 1 28 ? 10.564  -13.871 -0.656  1.00 0.00 ? 28 ALA A HA   5  
ATOM   4059  H HB1  . ALA A 1 28 ? 9.260   -14.883 0.955   1.00 0.00 ? 28 ALA A HB1  5  
ATOM   4060  H HB2  . ALA A 1 28 ? 9.005   -13.180 1.407   1.00 0.00 ? 28 ALA A HB2  5  
ATOM   4061  N N    . ALA A 1 29 ? 7.797   -13.231 -2.296  1.00 0.00 ? 29 ALA A N    5  
ATOM   4062  C CA   . ALA A 1 29 ? 7.019   -13.580 -3.473  1.00 0.00 ? 29 ALA A CA   5  
ATOM   4063  C C    . ALA A 1 29 ? 6.496   -12.301 -4.130  1.00 0.00 ? 29 ALA A C    5  
ATOM   4064  O O    . ALA A 1 29 ? 6.248   -11.306 -3.450  1.00 0.00 ? 29 ALA A O    5  
ATOM   4065  C CB   . ALA A 1 29 ? 5.892   -14.534 -3.076  1.00 0.00 ? 29 ALA A CB   5  
ATOM   4066  H H    . ALA A 1 29 ? 7.495   -12.406 -1.819  1.00 0.00 ? 29 ALA A H    5  
ATOM   4067  H HA   . ALA A 1 29 ? 7.683   -14.091 -4.170  1.00 0.00 ? 29 ALA A HA   5  
ATOM   4068  H HB1  . ALA A 1 29 ? 5.785   -14.539 -1.991  1.00 0.00 ? 29 ALA A HB1  5  
ATOM   4069  H HB2  . ALA A 1 29 ? 4.958   -14.203 -3.531  1.00 0.00 ? 29 ALA A HB2  5  
ATOM   4070  N N    . PRO A 1 30 ? 6.340   -12.370 -5.479  1.00 0.00 ? 30 PRO A N    5  
ATOM   4071  C CA   . PRO A 1 30 ? 5.851   -11.230 -6.236  1.00 0.00 ? 30 PRO A CA   5  
ATOM   4072  C C    . PRO A 1 30 ? 4.345   -11.045 -6.036  1.00 0.00 ? 30 PRO A C    5  
ATOM   4073  O O    . PRO A 1 30 ? 3.791   -10.005 -6.390  1.00 0.00 ? 30 PRO A O    5  
ATOM   4074  C CB   . PRO A 1 30 ? 6.227   -11.525 -7.679  1.00 0.00 ? 30 PRO A CB   5  
ATOM   4075  C CG   . PRO A 1 30 ? 6.494   -13.020 -7.743  1.00 0.00 ? 30 PRO A CG   5  
ATOM   4076  C CD   . PRO A 1 30 ? 6.624   -13.532 -6.317  1.00 0.00 ? 30 PRO A CD   5  
ATOM   4077  H HA   . PRO A 1 30 ? 6.276   -10.387 -5.907  1.00 0.00 ? 30 PRO A HA   5  
ATOM   4078  H HB2  . PRO A 1 30 ? 5.422   -11.243 -8.357  1.00 0.00 ? 30 PRO A HB2  5  
ATOM   4079  H HB3  . PRO A 1 30 ? 7.108   -10.957 -7.976  1.00 0.00 ? 30 PRO A HB3  5  
ATOM   4080  H HG2  . PRO A 1 30 ? 5.683   -13.532 -8.260  1.00 0.00 ? 30 PRO A HG2  5  
ATOM   4081  H HG3  . PRO A 1 30 ? 7.407   -13.221 -8.304  1.00 0.00 ? 30 PRO A HG3  5  
ATOM   4082  H HD2  . PRO A 1 30 ? 5.921   -14.342 -6.122  1.00 0.00 ? 30 PRO A HD2  5  
ATOM   4083  H HD3  . PRO A 1 30 ? 7.623   -13.923 -6.126  1.00 0.00 ? 30 PRO A HD3  5  
ATOM   4084  N N    . HIS A 1 31 ? 3.725   -12.070 -5.470  1.00 0.00 ? 31 HIS A N    5  
ATOM   4085  C CA   . HIS A 1 31 ? 2.294   -12.033 -5.219  1.00 0.00 ? 31 HIS A CA   5  
ATOM   4086  C C    . HIS A 1 31 ? 1.990   -12.715 -3.883  1.00 0.00 ? 31 HIS A C    5  
ATOM   4087  O O    . HIS A 1 31 ? 1.394   -13.790 -3.852  1.00 0.00 ? 31 HIS A O    5  
ATOM   4088  C CB   . HIS A 1 31 ? 1.522   -12.648 -6.388  1.00 0.00 ? 31 HIS A CB   5  
ATOM   4089  C CG   . HIS A 1 31 ? 0.214   -11.957 -6.690  1.00 0.00 ? 31 HIS A CG   5  
ATOM   4090  N ND1  . HIS A 1 31 ? -0.945  -12.197 -5.972  1.00 0.00 ? 31 HIS A ND1  5  
ATOM   4091  C CD2  . HIS A 1 31 ? -0.106  -11.031 -7.639  1.00 0.00 ? 31 HIS A CD2  5  
ATOM   4092  C CE1  . HIS A 1 31 ? -1.912  -11.445 -6.476  1.00 0.00 ? 31 HIS A CE1  5  
ATOM   4093  N NE2  . HIS A 1 31 ? -1.391  -10.723 -7.509  1.00 0.00 ? 31 HIS A NE2  5  
ATOM   4094  H H    . HIS A 1 31 ? 4.183   -12.912 -5.185  1.00 0.00 ? 31 HIS A H    5  
ATOM   4095  H HA   . HIS A 1 31 ? 2.015   -10.982 -5.152  1.00 0.00 ? 31 HIS A HA   5  
ATOM   4096  H HB2  . HIS A 1 31 ? 2.149   -12.622 -7.278  1.00 0.00 ? 31 HIS A HB2  5  
ATOM   4097  H HB3  . HIS A 1 31 ? 1.324   -13.697 -6.167  1.00 0.00 ? 31 HIS A HB3  5  
ATOM   4098  H HD1  . HIS A 1 31 ? -1.036  -12.831 -5.204  1.00 0.00 ? 31 HIS A HD1  5  
ATOM   4099  H HD2  . HIS A 1 31 ? 0.577   -10.614 -8.379  1.00 0.00 ? 31 HIS A HD2  5  
ATOM   4100  H HE1  . HIS A 1 31 ? -2.944  -11.409 -6.125  1.00 0.00 ? 31 HIS A HE1  5  
ATOM   4101  N N    . VAL A 1 32 ? 2.413   -12.060 -2.812  1.00 0.00 ? 32 VAL A N    5  
ATOM   4102  C CA   . VAL A 1 32 ? 2.193   -12.589 -1.476  1.00 0.00 ? 32 VAL A CA   5  
ATOM   4103  C C    . VAL A 1 32 ? 2.283   -11.449 -0.460  1.00 0.00 ? 32 VAL A C    5  
ATOM   4104  O O    . VAL A 1 32 ? 3.339   -11.218 0.127   1.00 0.00 ? 32 VAL A O    5  
ATOM   4105  C CB   . VAL A 1 32 ? 3.181   -13.722 -1.193  1.00 0.00 ? 32 VAL A CB   5  
ATOM   4106  C CG1  . VAL A 1 32 ? 3.429   -13.871 0.309   1.00 0.00 ? 32 VAL A CG1  5  
ATOM   4107  C CG2  . VAL A 1 32 ? 2.694   -15.039 -1.802  1.00 0.00 ? 32 VAL A CG2  5  
ATOM   4108  H H    . VAL A 1 32 ? 2.897   -11.186 -2.845  1.00 0.00 ? 32 VAL A H    5  
ATOM   4109  H HA   . VAL A 1 32 ? 1.186   -13.005 -1.449  1.00 0.00 ? 32 VAL A HA   5  
ATOM   4110  H HB   . VAL A 1 32 ? 4.129   -13.466 -1.665  1.00 0.00 ? 32 VAL A HB   5  
ATOM   4111  H HG11 . VAL A 1 32 ? 4.304   -13.286 0.593   1.00 0.00 ? 32 VAL A HG11 5  
ATOM   4112  H HG12 . VAL A 1 32 ? 2.558   -13.512 0.858   1.00 0.00 ? 32 VAL A HG12 5  
ATOM   4113  H HG21 . VAL A 1 32 ? 3.203   -15.873 -1.317  1.00 0.00 ? 32 VAL A HG21 5  
ATOM   4114  H HG22 . VAL A 1 32 ? 1.619   -15.133 -1.652  1.00 0.00 ? 32 VAL A HG22 5  
ATOM   4115  N N    . PRO A 1 33 ? 1.132   -10.749 -0.277  1.00 0.00 ? 33 PRO A N    5  
ATOM   4116  C CA   . PRO A 1 33 ? 1.071   -9.639  0.658   1.00 0.00 ? 33 PRO A CA   5  
ATOM   4117  C C    . PRO A 1 33 ? 1.035   -10.141 2.103   1.00 0.00 ? 33 PRO A C    5  
ATOM   4118  O O    . PRO A 1 33 ? 0.552   -11.241 2.370   1.00 0.00 ? 33 PRO A O    5  
ATOM   4119  C CB   . PRO A 1 33 ? -0.177  -8.863  0.268   1.00 0.00 ? 33 PRO A CB   5  
ATOM   4120  C CG   . PRO A 1 33 ? -1.018  -9.818  -0.565  1.00 0.00 ? 33 PRO A CG   5  
ATOM   4121  C CD   . PRO A 1 33 ? -0.138  -10.994 -0.955  1.00 0.00 ? 33 PRO A CD   5  
ATOM   4122  H HA   . PRO A 1 33 ? 1.895   -9.077  0.585   1.00 0.00 ? 33 PRO A HA   5  
ATOM   4123  H HB2  . PRO A 1 33 ? -0.722  -8.531  1.151   1.00 0.00 ? 33 PRO A HB2  5  
ATOM   4124  H HB3  . PRO A 1 33 ? 0.081   -7.971  -0.303  1.00 0.00 ? 33 PRO A HB3  5  
ATOM   4125  H HG2  . PRO A 1 33 ? -1.883  -10.159 0.004   1.00 0.00 ? 33 PRO A HG2  5  
ATOM   4126  H HG3  . PRO A 1 33 ? -1.399  -9.315  -1.453  1.00 0.00 ? 33 PRO A HG3  5  
ATOM   4127  H HD2  . PRO A 1 33 ? -0.579  -11.940 -0.639  1.00 0.00 ? 33 PRO A HD2  5  
ATOM   4128  H HD3  . PRO A 1 33 ? -0.006  -11.049 -2.035  1.00 0.00 ? 33 PRO A HD3  5  
ATOM   4129  N N    . VAL A 1 34 ? 1.552   -9.311  2.997   1.00 0.00 ? 34 VAL A N    5  
ATOM   4130  C CA   . VAL A 1 34 ? 1.585   -9.657  4.408   1.00 0.00 ? 34 VAL A CA   5  
ATOM   4131  C C    . VAL A 1 34 ? 0.477   -8.897  5.141   1.00 0.00 ? 34 VAL A C    5  
ATOM   4132  O O    . VAL A 1 34 ? -0.136  -9.426  6.067   1.00 0.00 ? 34 VAL A O    5  
ATOM   4133  C CB   . VAL A 1 34 ? 2.977   -9.385  4.981   1.00 0.00 ? 34 VAL A CB   5  
ATOM   4134  C CG1  . VAL A 1 34 ? 3.330   -7.900  4.881   1.00 0.00 ? 34 VAL A CG1  5  
ATOM   4135  C CG2  . VAL A 1 34 ? 3.081   -9.878  6.426   1.00 0.00 ? 34 VAL A CG2  5  
ATOM   4136  H H    . VAL A 1 34 ? 1.942   -8.419  2.772   1.00 0.00 ? 34 VAL A H    5  
ATOM   4137  H HA   . VAL A 1 34 ? 1.389   -10.727 4.489   1.00 0.00 ? 34 VAL A HA   5  
ATOM   4138  H HB   . VAL A 1 34 ? 3.699   -9.942  4.385   1.00 0.00 ? 34 VAL A HB   5  
ATOM   4139  H HG11 . VAL A 1 34 ? 3.609   -7.661  3.855   1.00 0.00 ? 34 VAL A HG11 5  
ATOM   4140  H HG12 . VAL A 1 34 ? 2.468   -7.301  5.172   1.00 0.00 ? 34 VAL A HG12 5  
ATOM   4141  H HG21 . VAL A 1 34 ? 2.895   -9.048  7.107   1.00 0.00 ? 34 VAL A HG21 5  
ATOM   4142  H HG22 . VAL A 1 34 ? 2.342   -10.661 6.597   1.00 0.00 ? 34 VAL A HG22 5  
ATOM   4143  N N    . LYS A 1 35 ? 0.255   -7.668  4.700   1.00 0.00 ? 35 LYS A N    5  
ATOM   4144  C CA   . LYS A 1 35 ? -0.767  -6.830  5.302   1.00 0.00 ? 35 LYS A CA   5  
ATOM   4145  C C    . LYS A 1 35 ? -1.033  -5.626  4.396   1.00 0.00 ? 35 LYS A C    5  
ATOM   4146  O O    . LYS A 1 35 ? -0.349  -5.438  3.391   1.00 0.00 ? 35 LYS A O    5  
ATOM   4147  C CB   . LYS A 1 35 ? -0.375  -6.450  6.731   1.00 0.00 ? 35 LYS A CB   5  
ATOM   4148  C CG   . LYS A 1 35 ? 0.773   -5.438  6.734   1.00 0.00 ? 35 LYS A CG   5  
ATOM   4149  C CD   . LYS A 1 35 ? 0.566   -4.377  7.817   1.00 0.00 ? 35 LYS A CD   5  
ATOM   4150  C CE   . LYS A 1 35 ? 1.600   -4.526  8.935   1.00 0.00 ? 35 LYS A CE   5  
ATOM   4151  N NZ   . LYS A 1 35 ? 0.940   -4.483  10.259  1.00 0.00 ? 35 LYS A NZ   5  
ATOM   4152  H H    . LYS A 1 35 ? 0.758   -7.245  3.946   1.00 0.00 ? 35 LYS A H    5  
ATOM   4153  H HA   . LYS A 1 35 ? -1.680  -7.422  5.365   1.00 0.00 ? 35 LYS A HA   5  
ATOM   4154  H HB2  . LYS A 1 35 ? -1.236  -6.029  7.250   1.00 0.00 ? 35 LYS A HB2  5  
ATOM   4155  H HB3  . LYS A 1 35 ? -0.078  -7.343  7.281   1.00 0.00 ? 35 LYS A HB3  5  
ATOM   4156  H HG2  . LYS A 1 35 ? 1.718   -5.955  6.902   1.00 0.00 ? 35 LYS A HG2  5  
ATOM   4157  H HG3  . LYS A 1 35 ? 0.842   -4.958  5.758   1.00 0.00 ? 35 LYS A HG3  5  
ATOM   4158  H HD2  . LYS A 1 35 ? 0.643   -3.383  7.376   1.00 0.00 ? 35 LYS A HD2  5  
ATOM   4159  H HD3  . LYS A 1 35 ? -0.438  -4.466  8.231   1.00 0.00 ? 35 LYS A HD3  5  
ATOM   4160  H HE2  . LYS A 1 35 ? 2.136   -5.468  8.820   1.00 0.00 ? 35 LYS A HE2  5  
ATOM   4161  H HE3  . LYS A 1 35 ? 2.339   -3.728  8.864   1.00 0.00 ? 35 LYS A HE3  5  
ATOM   4162  H HZ1  . LYS A 1 35 ? -0.043  -4.349  10.138  1.00 0.00 ? 35 LYS A HZ1  5  
ATOM   4163  H HZ2  . LYS A 1 35 ? 1.103   -5.344  10.741  1.00 0.00 ? 35 LYS A HZ2  5  
ATOM   4164  N N    . ARG A 1 36 ? -2.027  -4.813  4.758   1.00 0.00 ? 36 ARG A N    5  
ATOM   4165  C CA   . ARG A 1 36 ? -2.378  -3.640  3.983   1.00 0.00 ? 36 ARG A CA   5  
ATOM   4166  C C    . ARG A 1 36 ? -2.875  -2.540  4.910   1.00 0.00 ? 36 ARG A C    5  
ATOM   4167  O O    . ARG A 1 36 ? -3.096  -2.777  6.096   1.00 0.00 ? 36 ARG A O    5  
ATOM   4168  C CB   . ARG A 1 36 ? -3.448  -4.009  2.960   1.00 0.00 ? 36 ARG A CB   5  
ATOM   4169  C CG   . ARG A 1 36 ? -2.843  -4.923  1.899   1.00 0.00 ? 36 ARG A CG   5  
ATOM   4170  C CD   . ARG A 1 36 ? -3.385  -4.537  0.525   1.00 0.00 ? 36 ARG A CD   5  
ATOM   4171  N NE   . ARG A 1 36 ? -4.714  -5.108  0.305   1.00 0.00 ? 36 ARG A NE   5  
ATOM   4172  C CZ   . ARG A 1 36 ? -4.902  -6.340  -0.187  1.00 0.00 ? 36 ARG A CZ   5  
ATOM   4173  N NH1  . ARG A 1 36 ? -3.847  -7.105  -0.500  1.00 0.00 ? 36 ARG A NH1  5  
ATOM   4174  N NH2  . ARG A 1 36 ? -6.145  -6.807  -0.368  1.00 0.00 ? 36 ARG A NH2  5  
ATOM   4175  H H    . ARG A 1 36 ? -2.558  -5.012  5.594   1.00 0.00 ? 36 ARG A H    5  
ATOM   4176  H HA   . ARG A 1 36 ? -1.492  -3.285  3.457   1.00 0.00 ? 36 ARG A HA   5  
ATOM   4177  H HB2  . ARG A 1 36 ? -4.267  -4.525  3.461   1.00 0.00 ? 36 ARG A HB2  5  
ATOM   4178  H HB3  . ARG A 1 36 ? -3.825  -3.102  2.486   1.00 0.00 ? 36 ARG A HB3  5  
ATOM   4179  H HG2  . ARG A 1 36 ? -1.758  -4.818  1.904   1.00 0.00 ? 36 ARG A HG2  5  
ATOM   4180  H HG3  . ARG A 1 36 ? -3.108  -5.958  2.116   1.00 0.00 ? 36 ARG A HG3  5  
ATOM   4181  H HD2  . ARG A 1 36 ? -3.447  -3.451  0.458   1.00 0.00 ? 36 ARG A HD2  5  
ATOM   4182  H HD3  . ARG A 1 36 ? -2.706  -4.906  -0.244  1.00 0.00 ? 36 ARG A HD3  5  
ATOM   4183  H HE   . ARG A 1 36 ? -5.515  -4.539  0.539   1.00 0.00 ? 36 ARG A HE   5  
ATOM   4184  H HH11 . ARG A 1 36 ? -2.910  -6.753  -0.364  1.00 0.00 ? 36 ARG A HH11 5  
ATOM   4185  H HH12 . ARG A 1 36 ? -3.989  -8.033  -0.872  1.00 0.00 ? 36 ARG A HH12 5  
ATOM   4186  H HH21 . ARG A 1 36 ? -6.940  -6.230  -0.132  1.00 0.00 ? 36 ARG A HH21 5  
ATOM   4187  H HH22 . ARG A 1 36 ? -6.287  -7.735  -0.739  1.00 0.00 ? 36 ARG A HH22 5  
ATOM   4188  N N    . GLY A 1 37 ? -3.039  -1.355  4.337   1.00 0.00 ? 37 GLY A N    5  
ATOM   4189  C CA   . GLY A 1 37 ? -3.510  -0.214  5.103   1.00 0.00 ? 37 GLY A CA   5  
ATOM   4190  C C    . GLY A 1 37 ? -3.569  1.043   4.232   1.00 0.00 ? 37 GLY A C    5  
ATOM   4191  O O    . GLY A 1 37 ? -3.508  0.957   3.007   1.00 0.00 ? 37 GLY A O    5  
ATOM   4192  H H    . GLY A 1 37 ? -2.857  -1.171  3.372   1.00 0.00 ? 37 GLY A H    5  
ATOM   4193  H HA2  . GLY A 1 37 ? -4.498  -0.426  5.509   1.00 0.00 ? 37 GLY A HA2  5  
ATOM   4194  H HA3  . GLY A 1 37 ? -2.847  -0.042  5.951   1.00 0.00 ? 37 GLY A HA3  5  
ATOM   4195  N N    . CYS A 1 38 ? -3.688  2.182   4.900   1.00 0.00 ? 38 CYS A N    5  
ATOM   4196  C CA   . CYS A 1 38 ? -3.756  3.454   4.202   1.00 0.00 ? 38 CYS A CA   5  
ATOM   4197  C C    . CYS A 1 38 ? -2.630  4.349   4.723   1.00 0.00 ? 38 CYS A C    5  
ATOM   4198  O O    . CYS A 1 38 ? -2.302  4.314   5.909   1.00 0.00 ? 38 CYS A O    5  
ATOM   4199  C CB   . CYS A 1 38 ? -5.128  4.113   4.360   1.00 0.00 ? 38 CYS A CB   5  
ATOM   4200  S SG   . CYS A 1 38 ? -6.444  3.410   3.300   1.00 0.00 ? 38 CYS A SG   5  
ATOM   4201  H H    . CYS A 1 38 ? -3.737  2.243   5.896   1.00 0.00 ? 38 CYS A H    5  
ATOM   4202  H HA   . CYS A 1 38 ? -3.620  3.238   3.142   1.00 0.00 ? 38 CYS A HA   5  
ATOM   4203  H HB2  . CYS A 1 38 ? -5.437  4.031   5.402   1.00 0.00 ? 38 CYS A HB2  5  
ATOM   4204  H HB3  . CYS A 1 38 ? -5.032  5.176   4.140   1.00 0.00 ? 38 CYS A HB3  5  
ATOM   4205  N N    . ILE A 1 39 ? -2.068  5.130   3.812   1.00 0.00 ? 39 ILE A N    5  
ATOM   4206  C CA   . ILE A 1 39 ? -0.985  6.032   4.166   1.00 0.00 ? 39 ILE A CA   5  
ATOM   4207  C C    . ILE A 1 39 ? -1.139  7.338   3.382   1.00 0.00 ? 39 ILE A C    5  
ATOM   4208  O O    . ILE A 1 39 ? -2.110  7.515   2.649   1.00 0.00 ? 39 ILE A O    5  
ATOM   4209  C CB   . ILE A 1 39 ? 0.369   5.350   3.963   1.00 0.00 ? 39 ILE A CB   5  
ATOM   4210  C CG1  . ILE A 1 39 ? 1.385   5.828   5.003   1.00 0.00 ? 39 ILE A CG1  5  
ATOM   4211  C CG2  . ILE A 1 39 ? 0.875   5.548   2.533   1.00 0.00 ? 39 ILE A CG2  5  
ATOM   4212  C CD1  . ILE A 1 39 ? 2.364   4.711   5.367   1.00 0.00 ? 39 ILE A CD1  5  
ATOM   4213  H H    . ILE A 1 39 ? -2.340  5.153   2.850   1.00 0.00 ? 39 ILE A H    5  
ATOM   4214  H HA   . ILE A 1 39 ? -1.078  6.255   5.229   1.00 0.00 ? 39 ILE A HA   5  
ATOM   4215  H HB   . ILE A 1 39 ? 0.237   4.278   4.112   1.00 0.00 ? 39 ILE A HB   5  
ATOM   4216  H HG12 . ILE A 1 39 ? 1.934   6.685   4.611   1.00 0.00 ? 39 ILE A HG12 5  
ATOM   4217  H HG13 . ILE A 1 39 ? 0.863   6.166   5.898   1.00 0.00 ? 39 ILE A HG13 5  
ATOM   4218  H HG21 . ILE A 1 39 ? 1.809   5.001   2.399   1.00 0.00 ? 39 ILE A HG21 5  
ATOM   4219  H HG22 . ILE A 1 39 ? 0.131   5.174   1.830   1.00 0.00 ? 39 ILE A HG22 5  
ATOM   4220  H HD11 . ILE A 1 39 ? 3.014   5.047   6.175   1.00 0.00 ? 39 ILE A HD11 5  
ATOM   4221  H HD12 . ILE A 1 39 ? 1.807   3.831   5.691   1.00 0.00 ? 39 ILE A HD12 5  
ATOM   4222  N N    . ASP A 1 40 ? -0.176  8.247   3.541   1.00 0.00 ? 40 ASP A N    5  
ATOM   4223  C CA   . ASP A 1 40 ? -0.207  9.523   2.854   1.00 0.00 ? 40 ASP A CA   5  
ATOM   4224  C C    . ASP A 1 40 ? 0.873   9.558   1.783   1.00 0.00 ? 40 ASP A C    5  
ATOM   4225  O O    . ASP A 1 40 ? 0.611   9.949   0.648   1.00 0.00 ? 40 ASP A O    5  
ATOM   4226  C CB   . ASP A 1 40 ? -0.005  10.649  3.865   1.00 0.00 ? 40 ASP A CB   5  
ATOM   4227  C CG   . ASP A 1 40 ? 1.239   10.405  4.708   1.00 0.00 ? 40 ASP A CG   5  
ATOM   4228  O OD1  . ASP A 1 40 ? 1.164   9.519   5.586   1.00 0.00 ? 40 ASP A OD1  5  
ATOM   4229  O OD2  . ASP A 1 40 ? 2.241   11.109  4.459   1.00 0.00 ? 40 ASP A OD2  5  
ATOM   4230  H H    . ASP A 1 40 ? 0.602   8.052   4.155   1.00 0.00 ? 40 ASP A H    5  
ATOM   4231  H HA   . ASP A 1 40 ? -1.181  9.646   2.379   1.00 0.00 ? 40 ASP A HA   5  
ATOM   4232  H HB2  . ASP A 1 40 ? 0.104   11.593  3.332   1.00 0.00 ? 40 ASP A HB2  5  
ATOM   4233  H HB3  . ASP A 1 40 ? -0.875  10.704  4.518   1.00 0.00 ? 40 ASP A HB3  5  
ATOM   4234  H HD2  . ASP A 1 40 ? 2.990   10.908  5.024   1.00 0.00 ? 40 ASP A HD2  5  
ATOM   4235  N N    . VAL A 1 41 ? 2.069   9.146   2.179   1.00 0.00 ? 41 VAL A N    5  
ATOM   4236  C CA   . VAL A 1 41 ? 3.195   9.126   1.261   1.00 0.00 ? 41 VAL A CA   5  
ATOM   4237  C C    . VAL A 1 41 ? 3.835   7.736   1.275   1.00 0.00 ? 41 VAL A C    5  
ATOM   4238  O O    . VAL A 1 41 ? 4.004   7.138   2.336   1.00 0.00 ? 41 VAL A O    5  
ATOM   4239  C CB   . VAL A 1 41 ? 4.180   10.242  1.616   1.00 0.00 ? 41 VAL A CB   5  
ATOM   4240  C CG1  . VAL A 1 41 ? 5.441   10.154  0.755   1.00 0.00 ? 41 VAL A CG1  5  
ATOM   4241  C CG2  . VAL A 1 41 ? 3.521   11.616  1.486   1.00 0.00 ? 41 VAL A CG2  5  
ATOM   4242  H H    . VAL A 1 41 ? 2.274   8.830   3.106   1.00 0.00 ? 41 VAL A H    5  
ATOM   4243  H HA   . VAL A 1 41 ? 2.808   9.324   0.261   1.00 0.00 ? 41 VAL A HA   5  
ATOM   4244  H HB   . VAL A 1 41 ? 4.475   10.109  2.657   1.00 0.00 ? 41 VAL A HB   5  
ATOM   4245  H HG11 . VAL A 1 41 ? 6.298   10.507  1.329   1.00 0.00 ? 41 VAL A HG11 5  
ATOM   4246  H HG12 . VAL A 1 41 ? 5.606   9.119   0.456   1.00 0.00 ? 41 VAL A HG12 5  
ATOM   4247  H HG21 . VAL A 1 41 ? 2.809   11.757  2.300   1.00 0.00 ? 41 VAL A HG21 5  
ATOM   4248  H HG22 . VAL A 1 41 ? 4.286   12.392  1.535   1.00 0.00 ? 41 VAL A HG22 5  
ATOM   4249  N N    . CYS A 1 42 ? 4.174   7.264   0.085   1.00 0.00 ? 42 CYS A N    5  
ATOM   4250  C CA   . CYS A 1 42 ? 4.792   5.956   -0.053  1.00 0.00 ? 42 CYS A CA   5  
ATOM   4251  C C    . CYS A 1 42 ? 6.190   6.017   0.567   1.00 0.00 ? 42 CYS A C    5  
ATOM   4252  O O    . CYS A 1 42 ? 6.988   6.886   0.221   1.00 0.00 ? 42 CYS A O    5  
ATOM   4253  C CB   . CYS A 1 42 ? 4.835   5.501   -1.514  1.00 0.00 ? 42 CYS A CB   5  
ATOM   4254  S SG   . CYS A 1 42 ? 4.383   3.749   -1.786  1.00 0.00 ? 42 CYS A SG   5  
ATOM   4255  H H    . CYS A 1 42 ? 4.034   7.757   -0.774  1.00 0.00 ? 42 CYS A H    5  
ATOM   4256  H HA   . CYS A 1 42 ? 4.159   5.252   0.488   1.00 0.00 ? 42 CYS A HA   5  
ATOM   4257  H HB2  . CYS A 1 42 ? 4.160   6.130   -2.095  1.00 0.00 ? 42 CYS A HB2  5  
ATOM   4258  H HB3  . CYS A 1 42 ? 5.840   5.668   -1.902  1.00 0.00 ? 42 CYS A HB3  5  
ATOM   4259  N N    . PRO A 1 43 ? 6.449   5.058   1.496   1.00 0.00 ? 43 PRO A N    5  
ATOM   4260  C CA   . PRO A 1 43 ? 7.736   4.995   2.167   1.00 0.00 ? 43 PRO A CA   5  
ATOM   4261  C C    . PRO A 1 43 ? 8.813   4.433   1.236   1.00 0.00 ? 43 PRO A C    5  
ATOM   4262  O O    . PRO A 1 43 ? 8.499   3.838   0.207   1.00 0.00 ? 43 PRO A O    5  
ATOM   4263  C CB   . PRO A 1 43 ? 7.499   4.128   3.392   1.00 0.00 ? 43 PRO A CB   5  
ATOM   4264  C CG   . PRO A 1 43 ? 6.216   3.359   3.117   1.00 0.00 ? 43 PRO A CG   5  
ATOM   4265  C CD   . PRO A 1 43 ? 5.527   4.013   1.930   1.00 0.00 ? 43 PRO A CD   5  
ATOM   4266  H HA   . PRO A 1 43 ? 8.043   5.914   2.416   1.00 0.00 ? 43 PRO A HA   5  
ATOM   4267  H HB2  . PRO A 1 43 ? 8.334   3.447   3.556   1.00 0.00 ? 43 PRO A HB2  5  
ATOM   4268  H HB3  . PRO A 1 43 ? 7.403   4.738   4.290   1.00 0.00 ? 43 PRO A HB3  5  
ATOM   4269  H HG2  . PRO A 1 43 ? 6.436   2.314   2.902   1.00 0.00 ? 43 PRO A HG2  5  
ATOM   4270  H HG3  . PRO A 1 43 ? 5.566   3.375   3.992   1.00 0.00 ? 43 PRO A HG3  5  
ATOM   4271  H HD2  . PRO A 1 43 ? 5.342   3.292   1.133   1.00 0.00 ? 43 PRO A HD2  5  
ATOM   4272  H HD3  . PRO A 1 43 ? 4.560   4.430   2.214   1.00 0.00 ? 43 PRO A HD3  5  
ATOM   4273  N N    . LYS A 1 44 ? 10.060  4.643   1.631   1.00 0.00 ? 44 LYS A N    5  
ATOM   4274  C CA   . LYS A 1 44 ? 11.184  4.165   0.846   1.00 0.00 ? 44 LYS A CA   5  
ATOM   4275  C C    . LYS A 1 44 ? 11.067  2.650   0.664   1.00 0.00 ? 44 LYS A C    5  
ATOM   4276  O O    . LYS A 1 44 ? 10.720  1.934   1.602   1.00 0.00 ? 44 LYS A O    5  
ATOM   4277  C CB   . LYS A 1 44 ? 12.506  4.608   1.477   1.00 0.00 ? 44 LYS A CB   5  
ATOM   4278  C CG   . LYS A 1 44 ? 13.699  4.017   0.723   1.00 0.00 ? 44 LYS A CG   5  
ATOM   4279  C CD   . LYS A 1 44 ? 14.452  5.103   -0.048  1.00 0.00 ? 44 LYS A CD   5  
ATOM   4280  C CE   . LYS A 1 44 ? 15.319  5.942   0.892   1.00 0.00 ? 44 LYS A CE   5  
ATOM   4281  N NZ   . LYS A 1 44 ? 14.586  7.149   1.335   1.00 0.00 ? 44 LYS A NZ   5  
ATOM   4282  H H    . LYS A 1 44 ? 10.306  5.129   2.470   1.00 0.00 ? 44 LYS A H    5  
ATOM   4283  H HA   . LYS A 1 44 ? 11.122  4.637   -0.135  1.00 0.00 ? 44 LYS A HA   5  
ATOM   4284  H HB2  . LYS A 1 44 ? 12.570  5.696   1.471   1.00 0.00 ? 44 LYS A HB2  5  
ATOM   4285  H HB3  . LYS A 1 44 ? 12.538  4.293   2.520   1.00 0.00 ? 44 LYS A HB3  5  
ATOM   4286  H HG2  . LYS A 1 44 ? 14.374  3.531   1.427   1.00 0.00 ? 44 LYS A HG2  5  
ATOM   4287  H HG3  . LYS A 1 44 ? 13.352  3.249   0.031   1.00 0.00 ? 44 LYS A HG3  5  
ATOM   4288  H HD2  . LYS A 1 44 ? 15.078  4.643   -0.813  1.00 0.00 ? 44 LYS A HD2  5  
ATOM   4289  H HD3  . LYS A 1 44 ? 13.741  5.748   -0.564  1.00 0.00 ? 44 LYS A HD3  5  
ATOM   4290  H HE2  . LYS A 1 44 ? 15.608  5.346   1.759   1.00 0.00 ? 44 LYS A HE2  5  
ATOM   4291  H HE3  . LYS A 1 44 ? 16.239  6.233   0.386   1.00 0.00 ? 44 LYS A HE3  5  
ATOM   4292  H HZ1  . LYS A 1 44 ? 15.234  7.897   1.483   1.00 0.00 ? 44 LYS A HZ1  5  
ATOM   4293  H HZ2  . LYS A 1 44 ? 13.926  7.414   0.632   1.00 0.00 ? 44 LYS A HZ2  5  
ATOM   4294  N N    . SER A 1 45 ? 11.362  2.207   -0.550  1.00 0.00 ? 45 SER A N    5  
ATOM   4295  C CA   . SER A 1 45 ? 11.294  0.791   -0.866  1.00 0.00 ? 45 SER A CA   5  
ATOM   4296  C C    . SER A 1 45 ? 12.696  0.179   -0.831  1.00 0.00 ? 45 SER A C    5  
ATOM   4297  O O    . SER A 1 45 ? 13.634  0.735   -1.398  1.00 0.00 ? 45 SER A O    5  
ATOM   4298  C CB   . SER A 1 45 ? 10.650  0.563   -2.235  1.00 0.00 ? 45 SER A CB   5  
ATOM   4299  O OG   . SER A 1 45 ? 9.252   0.305   -2.131  1.00 0.00 ? 45 SER A OG   5  
ATOM   4300  H H    . SER A 1 45 ? 11.643  2.797   -1.307  1.00 0.00 ? 45 SER A H    5  
ATOM   4301  H HA   . SER A 1 45 ? 10.665  0.352   -0.092  1.00 0.00 ? 45 SER A HA   5  
ATOM   4302  H HB2  . SER A 1 45 ? 10.811  1.440   -2.862  1.00 0.00 ? 45 SER A HB2  5  
ATOM   4303  H HB3  . SER A 1 45 ? 11.137  -0.276  -2.730  1.00 0.00 ? 45 SER A HB3  5  
ATOM   4304  H HG   . SER A 1 45 ? 8.997   0.184   -1.172  1.00 0.00 ? 45 SER A HG   5  
ATOM   4305  N N    . SER A 1 46 ? 12.793  -0.959  -0.159  1.00 0.00 ? 46 SER A N    5  
ATOM   4306  C CA   . SER A 1 46 ? 14.064  -1.653  -0.042  1.00 0.00 ? 46 SER A CA   5  
ATOM   4307  C C    . SER A 1 46 ? 14.022  -2.959  -0.837  1.00 0.00 ? 46 SER A C    5  
ATOM   4308  O O    . SER A 1 46 ? 12.971  -3.348  -1.343  1.00 0.00 ? 46 SER A O    5  
ATOM   4309  C CB   . SER A 1 46 ? 14.407  -1.933  1.422   1.00 0.00 ? 46 SER A CB   5  
ATOM   4310  O OG   . SER A 1 46 ? 13.629  -3.000  1.957   1.00 0.00 ? 46 SER A OG   5  
ATOM   4311  H H    . SER A 1 46 ? 12.025  -1.405  0.300   1.00 0.00 ? 46 SER A H    5  
ATOM   4312  H HA   . SER A 1 46 ? 14.804  -0.972  -0.464  1.00 0.00 ? 46 SER A HA   5  
ATOM   4313  H HB2  . SER A 1 46 ? 15.466  -2.178  1.507   1.00 0.00 ? 46 SER A HB2  5  
ATOM   4314  H HB3  . SER A 1 46 ? 14.240  -1.032  2.012   1.00 0.00 ? 46 SER A HB3  5  
ATOM   4315  H HG   . SER A 1 46 ? 13.590  -2.929  2.954   1.00 0.00 ? 46 SER A HG   5  
ATOM   4316  N N    . LEU A 1 47 ? 15.179  -3.601  -0.922  1.00 0.00 ? 47 LEU A N    5  
ATOM   4317  C CA   . LEU A 1 47 ? 15.287  -4.856  -1.646  1.00 0.00 ? 47 LEU A CA   5  
ATOM   4318  C C    . LEU A 1 47 ? 14.570  -5.956  -0.861  1.00 0.00 ? 47 LEU A C    5  
ATOM   4319  O O    . LEU A 1 47 ? 13.850  -6.768  -1.440  1.00 0.00 ? 47 LEU A O    5  
ATOM   4320  C CB   . LEU A 1 47 ? 16.752  -5.173  -1.952  1.00 0.00 ? 47 LEU A CB   5  
ATOM   4321  C CG   . LEU A 1 47 ? 17.525  -4.099  -2.721  1.00 0.00 ? 47 LEU A CG   5  
ATOM   4322  C CD1  . LEU A 1 47 ? 18.986  -4.047  -2.271  1.00 0.00 ? 47 LEU A CD1  5  
ATOM   4323  C CD2  . LEU A 1 47 ? 17.397  -4.308  -4.231  1.00 0.00 ? 47 LEU A CD2  5  
ATOM   4324  H H    . LEU A 1 47 ? 16.029  -3.277  -0.507  1.00 0.00 ? 47 LEU A H    5  
ATOM   4325  H HA   . LEU A 1 47 ? 14.779  -4.726  -2.602  1.00 0.00 ? 47 LEU A HA   5  
ATOM   4326  H HB2  . LEU A 1 47 ? 17.268  -5.358  -1.009  1.00 0.00 ? 47 LEU A HB2  5  
ATOM   4327  H HB3  . LEU A 1 47 ? 16.791  -6.100  -2.524  1.00 0.00 ? 47 LEU A HB3  5  
ATOM   4328  H HG   . LEU A 1 47 ? 17.082  -3.130  -2.492  1.00 0.00 ? 47 LEU A HG   5  
ATOM   4329  H HD11 . LEU A 1 47 ? 19.395  -5.057  -2.246  1.00 0.00 ? 47 LEU A HD11 5  
ATOM   4330  H HD12 . LEU A 1 47 ? 19.560  -3.440  -2.972  1.00 0.00 ? 47 LEU A HD12 5  
ATOM   4331  H HD21 . LEU A 1 47 ? 18.344  -4.065  -4.713  1.00 0.00 ? 47 LEU A HD21 5  
ATOM   4332  H HD22 . LEU A 1 47 ? 17.142  -5.348  -4.434  1.00 0.00 ? 47 LEU A HD22 5  
ATOM   4333  N N    . LEU A 1 48 ? 14.793  -5.948  0.445   1.00 0.00 ? 48 LEU A N    5  
ATOM   4334  C CA   . LEU A 1 48 ? 14.178  -6.936  1.315   1.00 0.00 ? 48 LEU A CA   5  
ATOM   4335  C C    . LEU A 1 48 ? 12.656  -6.852  1.178   1.00 0.00 ? 48 LEU A C    5  
ATOM   4336  O O    . LEU A 1 48 ? 12.019  -7.794  0.709   1.00 0.00 ? 48 LEU A O    5  
ATOM   4337  C CB   . LEU A 1 48 ? 14.676  -6.769  2.752   1.00 0.00 ? 48 LEU A CB   5  
ATOM   4338  C CG   . LEU A 1 48 ? 14.829  -8.057  3.563   1.00 0.00 ? 48 LEU A CG   5  
ATOM   4339  C CD1  . LEU A 1 48 ? 13.476  -8.744  3.760   1.00 0.00 ? 48 LEU A CD1  5  
ATOM   4340  C CD2  . LEU A 1 48 ? 15.858  -8.990  2.922   1.00 0.00 ? 48 LEU A CD2  5  
ATOM   4341  H H    . LEU A 1 48 ? 15.381  -5.285  0.908   1.00 0.00 ? 48 LEU A H    5  
ATOM   4342  H HA   . LEU A 1 48 ? 14.502  -7.919  0.974   1.00 0.00 ? 48 LEU A HA   5  
ATOM   4343  H HB2  . LEU A 1 48 ? 15.642  -6.264  2.724   1.00 0.00 ? 48 LEU A HB2  5  
ATOM   4344  H HB3  . LEU A 1 48 ? 13.987  -6.110  3.280   1.00 0.00 ? 48 LEU A HB3  5  
ATOM   4345  H HG   . LEU A 1 48 ? 15.204  -7.795  4.553   1.00 0.00 ? 48 LEU A HG   5  
ATOM   4346  H HD11 . LEU A 1 48 ? 13.548  -9.785  3.444   1.00 0.00 ? 48 LEU A HD11 5  
ATOM   4347  H HD12 . LEU A 1 48 ? 13.197  -8.702  4.813   1.00 0.00 ? 48 LEU A HD12 5  
ATOM   4348  H HD21 . LEU A 1 48 ? 16.324  -8.489  2.074   1.00 0.00 ? 48 LEU A HD21 5  
ATOM   4349  H HD22 . LEU A 1 48 ? 16.621  -9.248  3.656   1.00 0.00 ? 48 LEU A HD22 5  
ATOM   4350  N N    . VAL A 1 49 ? 12.118  -5.716  1.596   1.00 0.00 ? 49 VAL A N    5  
ATOM   4351  C CA   . VAL A 1 49 ? 10.683  -5.497  1.526   1.00 0.00 ? 49 VAL A CA   5  
ATOM   4352  C C    . VAL A 1 49 ? 10.393  -4.352  0.554   1.00 0.00 ? 49 VAL A C    5  
ATOM   4353  O O    . VAL A 1 49 ? 11.245  -3.493  0.329   1.00 0.00 ? 49 VAL A O    5  
ATOM   4354  C CB   . VAL A 1 49 ? 10.123  -5.248  2.928   1.00 0.00 ? 49 VAL A CB   5  
ATOM   4355  C CG1  . VAL A 1 49 ? 10.433  -6.422  3.859   1.00 0.00 ? 49 VAL A CG1  5  
ATOM   4356  C CG2  . VAL A 1 49 ? 10.654  -3.935  3.505   1.00 0.00 ? 49 VAL A CG2  5  
ATOM   4357  H H    . VAL A 1 49 ? 12.644  -4.955  1.976   1.00 0.00 ? 49 VAL A H    5  
ATOM   4358  H HA   . VAL A 1 49 ? 10.230  -6.410  1.138   1.00 0.00 ? 49 VAL A HA   5  
ATOM   4359  H HB   . VAL A 1 49 ? 9.039   -5.164  2.845   1.00 0.00 ? 49 VAL A HB   5  
ATOM   4360  H HG11 . VAL A 1 49 ? 11.513  -6.560  3.922   1.00 0.00 ? 49 VAL A HG11 5  
ATOM   4361  H HG12 . VAL A 1 49 ? 10.035  -6.214  4.851   1.00 0.00 ? 49 VAL A HG12 5  
ATOM   4362  H HG21 . VAL A 1 49 ? 9.912   -3.149  3.362   1.00 0.00 ? 49 VAL A HG21 5  
ATOM   4363  H HG22 . VAL A 1 49 ? 10.850  -4.060  4.570   1.00 0.00 ? 49 VAL A HG22 5  
ATOM   4364  N N    . LYS A 1 50 ? 9.189   -4.376  0.003   1.00 0.00 ? 50 LYS A N    5  
ATOM   4365  C CA   . LYS A 1 50 ? 8.776   -3.350  -0.939  1.00 0.00 ? 50 LYS A CA   5  
ATOM   4366  C C    . LYS A 1 50 ? 7.325   -2.956  -0.654  1.00 0.00 ? 50 LYS A C    5  
ATOM   4367  O O    . LYS A 1 50 ? 6.570   -3.733  -0.072  1.00 0.00 ? 50 LYS A O    5  
ATOM   4368  C CB   . LYS A 1 50 ? 9.015   -3.815  -2.377  1.00 0.00 ? 50 LYS A CB   5  
ATOM   4369  C CG   . LYS A 1 50 ? 10.115  -2.987  -3.045  1.00 0.00 ? 50 LYS A CG   5  
ATOM   4370  C CD   . LYS A 1 50 ? 10.243  -3.341  -4.528  1.00 0.00 ? 50 LYS A CD   5  
ATOM   4371  C CE   . LYS A 1 50 ? 10.750  -2.145  -5.336  1.00 0.00 ? 50 LYS A CE   5  
ATOM   4372  N NZ   . LYS A 1 50 ? 9.616   -1.320  -5.808  1.00 0.00 ? 50 LYS A NZ   5  
ATOM   4373  H H    . LYS A 1 50 ? 8.502   -5.078  0.192   1.00 0.00 ? 50 LYS A H    5  
ATOM   4374  H HA   . LYS A 1 50 ? 9.410   -2.479  -0.773  1.00 0.00 ? 50 LYS A HA   5  
ATOM   4375  H HB2  . LYS A 1 50 ? 9.296   -4.869  -2.380  1.00 0.00 ? 50 LYS A HB2  5  
ATOM   4376  H HB3  . LYS A 1 50 ? 8.092   -3.730  -2.949  1.00 0.00 ? 50 LYS A HB3  5  
ATOM   4377  H HG2  . LYS A 1 50 ? 9.891   -1.926  -2.939  1.00 0.00 ? 50 LYS A HG2  5  
ATOM   4378  H HG3  . LYS A 1 50 ? 11.065  -3.164  -2.542  1.00 0.00 ? 50 LYS A HG3  5  
ATOM   4379  H HD2  . LYS A 1 50 ? 10.927  -4.182  -4.647  1.00 0.00 ? 50 LYS A HD2  5  
ATOM   4380  H HD3  . LYS A 1 50 ? 9.275   -3.661  -4.914  1.00 0.00 ? 50 LYS A HD3  5  
ATOM   4381  H HE2  . LYS A 1 50 ? 11.417  -1.540  -4.721  1.00 0.00 ? 50 LYS A HE2  5  
ATOM   4382  H HE3  . LYS A 1 50 ? 11.333  -2.495  -6.188  1.00 0.00 ? 50 LYS A HE3  5  
ATOM   4383  H HZ1  . LYS A 1 50 ? 8.760   -1.816  -5.662  1.00 0.00 ? 50 LYS A HZ1  5  
ATOM   4384  H HZ2  . LYS A 1 50 ? 9.594   -0.460  -5.297  1.00 0.00 ? 50 LYS A HZ2  5  
ATOM   4385  N N    . TYR A 1 51 ? 6.980   -1.749  -1.077  1.00 0.00 ? 51 TYR A N    5  
ATOM   4386  C CA   . TYR A 1 51 ? 5.633   -1.242  -0.875  1.00 0.00 ? 51 TYR A CA   5  
ATOM   4387  C C    . TYR A 1 51 ? 5.082   -0.621  -2.160  1.00 0.00 ? 51 TYR A C    5  
ATOM   4388  O O    . TYR A 1 51 ? 5.838   -0.084  -2.968  1.00 0.00 ? 51 TYR A O    5  
ATOM   4389  C CB   . TYR A 1 51 ? 5.748   -0.153  0.194   1.00 0.00 ? 51 TYR A CB   5  
ATOM   4390  C CG   . TYR A 1 51 ? 6.619   -0.545  1.390   1.00 0.00 ? 51 TYR A CG   5  
ATOM   4391  C CD1  . TYR A 1 51 ? 6.485   -1.795  1.960   1.00 0.00 ? 51 TYR A CD1  5  
ATOM   4392  C CD2  . TYR A 1 51 ? 7.537   0.351   1.898   1.00 0.00 ? 51 TYR A CD2  5  
ATOM   4393  C CE1  . TYR A 1 51 ? 7.304   -2.164  3.086   1.00 0.00 ? 51 TYR A CE1  5  
ATOM   4394  C CE2  . TYR A 1 51 ? 8.356   -0.018  3.024   1.00 0.00 ? 51 TYR A CE2  5  
ATOM   4395  C CZ   . TYR A 1 51 ? 8.199   -1.257  3.562   1.00 0.00 ? 51 TYR A CZ   5  
ATOM   4396  O OH   . TYR A 1 51 ? 8.973   -1.606  4.625   1.00 0.00 ? 51 TYR A OH   5  
ATOM   4397  H H    . TYR A 1 51 ? 7.600   -1.123  -1.550  1.00 0.00 ? 51 TYR A H    5  
ATOM   4398  H HA   . TYR A 1 51 ? 4.999   -2.079  -0.583  1.00 0.00 ? 51 TYR A HA   5  
ATOM   4399  H HB2  . TYR A 1 51 ? 6.160   0.747   -0.262  1.00 0.00 ? 51 TYR A HB2  5  
ATOM   4400  H HB3  . TYR A 1 51 ? 4.750   0.098   0.551   1.00 0.00 ? 51 TYR A HB3  5  
ATOM   4401  H HD1  . TYR A 1 51 ? 5.760   -2.503  1.559   1.00 0.00 ? 51 TYR A HD1  5  
ATOM   4402  H HD2  . TYR A 1 51 ? 7.642   1.338   1.448   1.00 0.00 ? 51 TYR A HD2  5  
ATOM   4403  H HE1  . TYR A 1 51 ? 7.209   -3.148  3.545   1.00 0.00 ? 51 TYR A HE1  5  
ATOM   4404  H HE2  . TYR A 1 51 ? 9.085   0.680   3.435   1.00 0.00 ? 51 TYR A HE2  5  
ATOM   4405  H HH   . TYR A 1 51 ? 8.964   -0.876  5.308   1.00 0.00 ? 51 TYR A HH   5  
ATOM   4406  N N    . VAL A 1 52 ? 3.769   -0.716  -2.309  1.00 0.00 ? 52 VAL A N    5  
ATOM   4407  C CA   . VAL A 1 52 ? 3.107   -0.170  -3.482  1.00 0.00 ? 52 VAL A CA   5  
ATOM   4408  C C    . VAL A 1 52 ? 1.953   0.730   -3.039  1.00 0.00 ? 52 VAL A C    5  
ATOM   4409  O O    . VAL A 1 52 ? 1.149   0.344   -2.192  1.00 0.00 ? 52 VAL A O    5  
ATOM   4410  C CB   . VAL A 1 52 ? 2.660   -1.305  -4.406  1.00 0.00 ? 52 VAL A CB   5  
ATOM   4411  C CG1  . VAL A 1 52 ? 1.627   -0.811  -5.421  1.00 0.00 ? 52 VAL A CG1  5  
ATOM   4412  C CG2  . VAL A 1 52 ? 3.859   -1.943  -5.111  1.00 0.00 ? 52 VAL A CG2  5  
ATOM   4413  H H    . VAL A 1 52 ? 3.161   -1.154  -1.647  1.00 0.00 ? 52 VAL A H    5  
ATOM   4414  H HA   . VAL A 1 52 ? 3.838   0.435   -4.020  1.00 0.00 ? 52 VAL A HA   5  
ATOM   4415  H HB   . VAL A 1 52 ? 2.187   -2.070  -3.791  1.00 0.00 ? 52 VAL A HB   5  
ATOM   4416  H HG11 . VAL A 1 52 ? 1.212   -1.662  -5.960  1.00 0.00 ? 52 VAL A HG11 5  
ATOM   4417  H HG12 . VAL A 1 52 ? 0.827   -0.287  -4.898  1.00 0.00 ? 52 VAL A HG12 5  
ATOM   4418  H HG21 . VAL A 1 52 ? 4.775   -1.677  -4.583  1.00 0.00 ? 52 VAL A HG21 5  
ATOM   4419  H HG22 . VAL A 1 52 ? 3.744   -3.027  -5.114  1.00 0.00 ? 52 VAL A HG22 5  
ATOM   4420  N N    . CYS A 1 53 ? 1.906   1.914   -3.632  1.00 0.00 ? 53 CYS A N    5  
ATOM   4421  C CA   . CYS A 1 53 ? 0.863   2.873   -3.309  1.00 0.00 ? 53 CYS A CA   5  
ATOM   4422  C C    . CYS A 1 53 ? 0.104   3.208   -4.594  1.00 0.00 ? 53 CYS A C    5  
ATOM   4423  O O    . CYS A 1 53 ? 0.568   2.901   -5.692  1.00 0.00 ? 53 CYS A O    5  
ATOM   4424  C CB   . CYS A 1 53 ? 1.433   4.125   -2.640  1.00 0.00 ? 53 CYS A CB   5  
ATOM   4425  S SG   . CYS A 1 53 ? 2.395   3.810   -1.115  1.00 0.00 ? 53 CYS A SG   5  
ATOM   4426  H H    . CYS A 1 53 ? 2.564   2.221   -4.320  1.00 0.00 ? 53 CYS A H    5  
ATOM   4427  H HA   . CYS A 1 53 ? 0.206   2.389   -2.587  1.00 0.00 ? 53 CYS A HA   5  
ATOM   4428  H HB2  . CYS A 1 53 ? 2.072   4.644   -3.355  1.00 0.00 ? 53 CYS A HB2  5  
ATOM   4429  H HB3  . CYS A 1 53 ? 0.610   4.799   -2.400  1.00 0.00 ? 53 CYS A HB3  5  
ATOM   4430  N N    . CYS A 1 54 ? -1.050  3.834   -4.416  1.00 0.00 ? 54 CYS A N    5  
ATOM   4431  C CA   . CYS A 1 54 ? -1.878  4.215   -5.548  1.00 0.00 ? 54 CYS A CA   5  
ATOM   4432  C C    . CYS A 1 54 ? -3.076  5.008   -5.022  1.00 0.00 ? 54 CYS A C    5  
ATOM   4433  O O    . CYS A 1 54 ? -3.454  4.870   -3.860  1.00 0.00 ? 54 CYS A O    5  
ATOM   4434  C CB   . CYS A 1 54 ? -2.314  2.996   -6.364  1.00 0.00 ? 54 CYS A CB   5  
ATOM   4435  S SG   . CYS A 1 54 ? -2.347  1.421   -5.434  1.00 0.00 ? 54 CYS A SG   5  
ATOM   4436  H H    . CYS A 1 54 ? -1.420  4.081   -3.520  1.00 0.00 ? 54 CYS A H    5  
ATOM   4437  H HA   . CYS A 1 54 ? -1.257  4.834   -6.195  1.00 0.00 ? 54 CYS A HA   5  
ATOM   4438  H HB2  . CYS A 1 54 ? -3.309  3.184   -6.768  1.00 0.00 ? 54 CYS A HB2  5  
ATOM   4439  H HB3  . CYS A 1 54 ? -1.641  2.886   -7.215  1.00 0.00 ? 54 CYS A HB3  5  
ATOM   4440  N N    . ASN A 1 55 ? -3.638  5.822   -5.903  1.00 0.00 ? 55 ASN A N    5  
ATOM   4441  C CA   . ASN A 1 55 ? -4.785  6.638   -5.542  1.00 0.00 ? 55 ASN A CA   5  
ATOM   4442  C C    . ASN A 1 55 ? -5.975  6.256   -6.424  1.00 0.00 ? 55 ASN A C    5  
ATOM   4443  O O    . ASN A 1 55 ? -6.466  7.074   -7.200  1.00 0.00 ? 55 ASN A O    5  
ATOM   4444  C CB   . ASN A 1 55 ? -4.494  8.124   -5.759  1.00 0.00 ? 55 ASN A CB   5  
ATOM   4445  C CG   . ASN A 1 55 ? -4.146  8.407   -7.221  1.00 0.00 ? 55 ASN A CG   5  
ATOM   4446  O OD1  . ASN A 1 55 ? -3.200  7.872   -7.776  1.00 0.00 ? 55 ASN A OD1  5  
ATOM   4447  N ND2  . ASN A 1 55 ? -4.960  9.276   -7.813  1.00 0.00 ? 55 ASN A ND2  5  
ATOM   4448  H H    . ASN A 1 55 ? -3.324  5.929   -6.846  1.00 0.00 ? 55 ASN A H    5  
ATOM   4449  H HA   . ASN A 1 55 ? -4.964  6.430   -4.487  1.00 0.00 ? 55 ASN A HA   5  
ATOM   4450  H HB2  . ASN A 1 55 ? -5.363  8.715   -5.467  1.00 0.00 ? 55 ASN A HB2  5  
ATOM   4451  H HB3  . ASN A 1 55 ? -3.669  8.434   -5.118  1.00 0.00 ? 55 ASN A HB3  5  
ATOM   4452  H HD21 . ASN A 1 55 ? -5.719  9.679   -7.301  1.00 0.00 ? 55 ASN A HD21 5  
ATOM   4453  H HD22 . ASN A 1 55 ? -4.815  9.526   -8.770  1.00 0.00 ? 55 ASN A HD22 5  
ATOM   4454  N N    . THR A 1 56 ? -6.405  5.011   -6.276  1.00 0.00 ? 56 THR A N    5  
ATOM   4455  C CA   . THR A 1 56 ? -7.529  4.510   -7.050  1.00 0.00 ? 56 THR A CA   5  
ATOM   4456  C C    . THR A 1 56 ? -8.389  3.576   -6.197  1.00 0.00 ? 56 THR A C    5  
ATOM   4457  O O    . THR A 1 56 ? -7.884  2.917   -5.289  1.00 0.00 ? 56 THR A O    5  
ATOM   4458  C CB   . THR A 1 56 ? -6.975  3.845   -8.311  1.00 0.00 ? 56 THR A CB   5  
ATOM   4459  O OG1  . THR A 1 56 ? -6.078  2.854   -7.816  1.00 0.00 ? 56 THR A OG1  5  
ATOM   4460  C CG2  . THR A 1 56 ? -6.081  4.783   -9.124  1.00 0.00 ? 56 THR A CG2  5  
ATOM   4461  H H    . THR A 1 56 ? -6.001  4.351   -5.643  1.00 0.00 ? 56 THR A H    5  
ATOM   4462  H HA   . THR A 1 56 ? -8.157  5.356   -7.331  1.00 0.00 ? 56 THR A HA   5  
ATOM   4463  H HB   . THR A 1 56 ? -7.781  3.445   -8.926  1.00 0.00 ? 56 THR A HB   5  
ATOM   4464  H HG1  . THR A 1 56 ? -5.299  3.292   -7.366  1.00 0.00 ? 56 THR A HG1  5  
ATOM   4465  H HG21 . THR A 1 56 ? -5.741  4.272   -10.025 1.00 0.00 ? 56 THR A HG21 5  
ATOM   4466  H HG22 . THR A 1 56 ? -6.646  5.672   -9.403  1.00 0.00 ? 56 THR A HG22 5  
ATOM   4467  N N    . ASP A 1 57 ? -9.689  3.522   -6.495  1.00 0.00 ? 57 ASP A N    5  
ATOM   4468  C CA   . ASP A 1 57 ? -10.608 2.676   -5.760  1.00 0.00 ? 57 ASP A CA   5  
ATOM   4469  C C    . ASP A 1 57 ? -10.250 1.213   -5.982  1.00 0.00 ? 57 ASP A C    5  
ATOM   4470  O O    . ASP A 1 57 ? -10.264 0.735   -7.114  1.00 0.00 ? 57 ASP A O    5  
ATOM   4471  C CB   . ASP A 1 57 ? -12.035 2.960   -6.217  1.00 0.00 ? 57 ASP A CB   5  
ATOM   4472  C CG   . ASP A 1 57 ? -12.742 3.894   -5.245  1.00 0.00 ? 57 ASP A CG   5  
ATOM   4473  O OD1  . ASP A 1 57 ? -12.160 4.136   -4.166  1.00 0.00 ? 57 ASP A OD1  5  
ATOM   4474  O OD2  . ASP A 1 57 ? -13.852 4.348   -5.599  1.00 0.00 ? 57 ASP A OD2  5  
ATOM   4475  H H    . ASP A 1 57 ? -10.054 4.084   -7.251  1.00 0.00 ? 57 ASP A H    5  
ATOM   4476  H HA   . ASP A 1 57 ? -10.525 2.903   -4.697  1.00 0.00 ? 57 ASP A HA   5  
ATOM   4477  H HB2  . ASP A 1 57 ? -12.010 3.422   -7.204  1.00 0.00 ? 57 ASP A HB2  5  
ATOM   4478  H HB3  . ASP A 1 57 ? -12.586 2.021   -6.276  1.00 0.00 ? 57 ASP A HB3  5  
ATOM   4479  H HD2  . ASP A 1 57 ? -14.246 4.929   -4.945  1.00 0.00 ? 57 ASP A HD2  5  
ATOM   4480  N N    . LYS A 1 58 ? -9.938  0.539   -4.884  1.00 0.00 ? 58 LYS A N    5  
ATOM   4481  C CA   . LYS A 1 58 ? -9.576  -0.867  -4.948  1.00 0.00 ? 58 LYS A CA   5  
ATOM   4482  C C    . LYS A 1 58 ? -8.257  -1.015  -5.709  1.00 0.00 ? 58 LYS A C    5  
ATOM   4483  O O    . LYS A 1 58 ? -8.170  -1.789  -6.661  1.00 0.00 ? 58 LYS A O    5  
ATOM   4484  C CB   . LYS A 1 58 ? -10.723 -1.689  -5.539  1.00 0.00 ? 58 LYS A CB   5  
ATOM   4485  C CG   . LYS A 1 58 ? -11.640 -2.222  -4.436  1.00 0.00 ? 58 LYS A CG   5  
ATOM   4486  C CD   . LYS A 1 58 ? -13.105 -1.897  -4.736  1.00 0.00 ? 58 LYS A CD   5  
ATOM   4487  C CE   . LYS A 1 58 ? -13.629 -2.748  -5.894  1.00 0.00 ? 58 LYS A CE   5  
ATOM   4488  N NZ   . LYS A 1 58 ? -14.031 -4.088  -5.413  1.00 0.00 ? 58 LYS A NZ   5  
ATOM   4489  H H    . LYS A 1 58 ? -9.930  0.937   -3.967  1.00 0.00 ? 58 LYS A H    5  
ATOM   4490  H HA   . LYS A 1 58 ? -9.425  -1.212  -3.925  1.00 0.00 ? 58 LYS A HA   5  
ATOM   4491  H HB2  . LYS A 1 58 ? -11.299 -1.073  -6.229  1.00 0.00 ? 58 LYS A HB2  5  
ATOM   4492  H HB3  . LYS A 1 58 ? -10.320 -2.521  -6.115  1.00 0.00 ? 58 LYS A HB3  5  
ATOM   4493  H HG2  . LYS A 1 58 ? -11.515 -3.301  -4.344  1.00 0.00 ? 58 LYS A HG2  5  
ATOM   4494  H HG3  . LYS A 1 58 ? -11.355 -1.786  -3.479  1.00 0.00 ? 58 LYS A HG3  5  
ATOM   4495  H HD2  . LYS A 1 58 ? -13.710 -2.075  -3.847  1.00 0.00 ? 58 LYS A HD2  5  
ATOM   4496  H HD3  . LYS A 1 58 ? -13.203 -0.840  -4.982  1.00 0.00 ? 58 LYS A HD3  5  
ATOM   4497  H HE2  . LYS A 1 58 ? -14.480 -2.252  -6.361  1.00 0.00 ? 58 LYS A HE2  5  
ATOM   4498  H HE3  . LYS A 1 58 ? -12.859 -2.846  -6.659  1.00 0.00 ? 58 LYS A HE3  5  
ATOM   4499  H HZ1  . LYS A 1 58 ? -13.231 -4.566  -5.050  1.00 0.00 ? 58 LYS A HZ1  5  
ATOM   4500  H HZ2  . LYS A 1 58 ? -14.717 -3.992  -4.691  1.00 0.00 ? 58 LYS A HZ2  5  
ATOM   4501  N N    . CYS A 1 59 ? -7.264  -0.262  -5.261  1.00 0.00 ? 59 CYS A N    5  
ATOM   4502  C CA   . CYS A 1 59 ? -5.954  -0.300  -5.888  1.00 0.00 ? 59 CYS A CA   5  
ATOM   4503  C C    . CYS A 1 59 ? -5.106  -1.348  -5.165  1.00 0.00 ? 59 CYS A C    5  
ATOM   4504  O O    . CYS A 1 59 ? -4.473  -2.188  -5.804  1.00 0.00 ? 59 CYS A O    5  
ATOM   4505  C CB   . CYS A 1 59 ? -5.285  1.076   -5.885  1.00 0.00 ? 59 CYS A CB   5  
ATOM   4506  S SG   . CYS A 1 59 ? -4.138  1.369   -4.489  1.00 0.00 ? 59 CYS A SG   5  
ATOM   4507  H H    . CYS A 1 59 ? -7.343  0.365   -4.486  1.00 0.00 ? 59 CYS A H    5  
ATOM   4508  H HA   . CYS A 1 59 ? -6.113  -0.581  -6.929  1.00 0.00 ? 59 CYS A HA   5  
ATOM   4509  H HB2  . CYS A 1 59 ? -4.737  1.200   -6.819  1.00 0.00 ? 59 CYS A HB2  5  
ATOM   4510  H HB3  . CYS A 1 59 ? -6.061  1.842   -5.867  1.00 0.00 ? 59 CYS A HB3  5  
ATOM   4511  N N    . ASN A 1 60 ? -5.120  -1.266  -3.843  1.00 0.00 ? 60 ASN A N    5  
ATOM   4512  C CA   . ASN A 1 60 ? -4.360  -2.197  -3.027  1.00 0.00 ? 60 ASN A CA   5  
ATOM   4513  C C    . ASN A 1 60 ? -5.209  -3.440  -2.754  1.00 0.00 ? 60 ASN A C    5  
ATOM   4514  O O    . ASN A 1 60 ? -5.345  -4.305  -3.618  1.00 0.00 ? 60 ASN A O    5  
ATOM   4515  C CB   . ASN A 1 60 ? -3.990  -1.573  -1.680  1.00 0.00 ? 60 ASN A CB   5  
ATOM   4516  C CG   . ASN A 1 60 ? -5.191  -1.562  -0.732  1.00 0.00 ? 60 ASN A CG   5  
ATOM   4517  O OD1  . ASN A 1 60 ? -6.330  -1.742  -1.129  1.00 0.00 ? 60 ASN A OD1  5  
ATOM   4518  N ND2  . ASN A 1 60 ? -4.873  -1.341  0.541   1.00 0.00 ? 60 ASN A ND2  5  
ATOM   4519  H H    . ASN A 1 60 ? -5.638  -0.580  -3.331  1.00 0.00 ? 60 ASN A H    5  
ATOM   4520  H HA   . ASN A 1 60 ? -3.465  -2.422  -3.607  1.00 0.00 ? 60 ASN A HA   5  
ATOM   4521  H HB2  . ASN A 1 60 ? -3.171  -2.133  -1.228  1.00 0.00 ? 60 ASN A HB2  5  
ATOM   4522  H HB3  . ASN A 1 60 ? -3.633  -0.554  -1.832  1.00 0.00 ? 60 ASN A HB3  5  
ATOM   4523  H HD21 . ASN A 1 60 ? -3.918  -1.201  0.801   1.00 0.00 ? 60 ASN A HD21 5  
ATOM   4524  H HD22 . ASN A 1 60 ? -5.590  -1.315  1.238   1.00 0.00 ? 60 ASN A HD22 5  
HETATM 4525  O O    . HOH B 2 .  ? 5.474   -10.844 2.343   1.00 0.00 ? 61 HOH A O    5  
HETATM 4526  H H1   . HOH B 2 .  ? 4.637   -10.774 1.885   1.00 0.00 ? 61 HOH A H1   5  
HETATM 4527  H H2   . HOH B 2 .  ? 5.235   -10.923 3.267   1.00 0.00 ? 61 HOH A H2   5  
HETATM 4528  O O    . HOH B 2 .  ? 7.851   -16.056 -6.204  1.00 0.00 ? 62 HOH A O    5  
HETATM 4529  H H1   . HOH B 2 .  ? 8.228   -16.054 -7.084  1.00 0.00 ? 62 HOH A H1   5  
HETATM 4530  H H2   . HOH B 2 .  ? 8.126   -16.893 -5.830  1.00 0.00 ? 62 HOH A H2   5  
ATOM   4531  N N    . LEU A 1 1  ? -12.165 7.563   -1.625  1.00 0.00 ? 1  LEU A N    6  
ATOM   4532  C CA   . LEU A 1 1  ? -11.079 6.857   -0.966  1.00 0.00 ? 1  LEU A CA   6  
ATOM   4533  C C    . LEU A 1 1  ? -11.607 5.542   -0.390  1.00 0.00 ? 1  LEU A C    6  
ATOM   4534  O O    . LEU A 1 1  ? -11.717 5.393   0.826   1.00 0.00 ? 1  LEU A O    6  
ATOM   4535  C CB   . LEU A 1 1  ? -10.407 7.758   0.073   1.00 0.00 ? 1  LEU A CB   6  
ATOM   4536  C CG   . LEU A 1 1  ? -9.073  8.381   -0.343  1.00 0.00 ? 1  LEU A CG   6  
ATOM   4537  C CD1  . LEU A 1 1  ? -8.024  7.301   -0.613  1.00 0.00 ? 1  LEU A CD1  6  
ATOM   4538  C CD2  . LEU A 1 1  ? -9.254  9.316   -1.540  1.00 0.00 ? 1  LEU A CD2  6  
ATOM   4539  H H    . LEU A 1 1  ? -12.125 8.560   -1.554  1.00 0.00 ? 1  LEU A H    6  
ATOM   4540  H HA   . LEU A 1 1  ? -10.331 6.627   -1.725  1.00 0.00 ? 1  LEU A HA   6  
ATOM   4541  H HB2  . LEU A 1 1  ? -11.097 8.562   0.328   1.00 0.00 ? 1  LEU A HB2  6  
ATOM   4542  H HB3  . LEU A 1 1  ? -10.247 7.175   0.980   1.00 0.00 ? 1  LEU A HB3  6  
ATOM   4543  H HG   . LEU A 1 1  ? -8.706  8.986   0.486   1.00 0.00 ? 1  LEU A HG   6  
ATOM   4544  H HD11 . LEU A 1 1  ? -7.064  7.771   -0.825  1.00 0.00 ? 1  LEU A HD11 6  
ATOM   4545  H HD12 . LEU A 1 1  ? -7.928  6.660   0.264   1.00 0.00 ? 1  LEU A HD12 6  
ATOM   4546  H HD21 . LEU A 1 1  ? -10.209 9.834   -1.456  1.00 0.00 ? 1  LEU A HD21 6  
ATOM   4547  H HD22 . LEU A 1 1  ? -8.445  10.046  -1.557  1.00 0.00 ? 1  LEU A HD22 6  
ATOM   4548  N N    . LYS A 1 2  ? -11.921 4.622   -1.290  1.00 0.00 ? 2  LYS A N    6  
ATOM   4549  C CA   . LYS A 1 2  ? -12.435 3.325   -0.887  1.00 0.00 ? 2  LYS A CA   6  
ATOM   4550  C C    . LYS A 1 2  ? -11.428 2.239   -1.273  1.00 0.00 ? 2  LYS A C    6  
ATOM   4551  O O    . LYS A 1 2  ? -11.263 1.931   -2.452  1.00 0.00 ? 2  LYS A O    6  
ATOM   4552  C CB   . LYS A 1 2  ? -13.834 3.099   -1.465  1.00 0.00 ? 2  LYS A CB   6  
ATOM   4553  C CG   . LYS A 1 2  ? -14.837 4.092   -0.874  1.00 0.00 ? 2  LYS A CG   6  
ATOM   4554  C CD   . LYS A 1 2  ? -16.140 4.097   -1.677  1.00 0.00 ? 2  LYS A CD   6  
ATOM   4555  C CE   . LYS A 1 2  ? -16.866 5.436   -1.535  1.00 0.00 ? 2  LYS A CE   6  
ATOM   4556  N NZ   . LYS A 1 2  ? -17.944 5.550   -2.542  1.00 0.00 ? 2  LYS A NZ   6  
ATOM   4557  H H    . LYS A 1 2  ? -11.829 4.752   -2.278  1.00 0.00 ? 2  LYS A H    6  
ATOM   4558  H HA   . LYS A 1 2  ? -12.533 3.335   0.199   1.00 0.00 ? 2  LYS A HA   6  
ATOM   4559  H HB2  . LYS A 1 2  ? -13.805 3.207   -2.549  1.00 0.00 ? 2  LYS A HB2  6  
ATOM   4560  H HB3  . LYS A 1 2  ? -14.158 2.080   -1.254  1.00 0.00 ? 2  LYS A HB3  6  
ATOM   4561  H HG2  . LYS A 1 2  ? -15.046 3.830   0.163   1.00 0.00 ? 2  LYS A HG2  6  
ATOM   4562  H HG3  . LYS A 1 2  ? -14.405 5.092   -0.870  1.00 0.00 ? 2  LYS A HG3  6  
ATOM   4563  H HD2  . LYS A 1 2  ? -15.925 3.905   -2.728  1.00 0.00 ? 2  LYS A HD2  6  
ATOM   4564  H HD3  . LYS A 1 2  ? -16.787 3.290   -1.332  1.00 0.00 ? 2  LYS A HD3  6  
ATOM   4565  H HE2  . LYS A 1 2  ? -17.286 5.524   -0.532  1.00 0.00 ? 2  LYS A HE2  6  
ATOM   4566  H HE3  . LYS A 1 2  ? -16.158 6.255   -1.656  1.00 0.00 ? 2  LYS A HE3  6  
ATOM   4567  H HZ1  . LYS A 1 2  ? -17.745 6.312   -3.158  1.00 0.00 ? 2  LYS A HZ1  6  
ATOM   4568  H HZ2  . LYS A 1 2  ? -18.000 4.702   -3.069  1.00 0.00 ? 2  LYS A HZ2  6  
ATOM   4569  N N    . CYS A 1 3  ? -10.780 1.689   -0.256  1.00 0.00 ? 3  CYS A N    6  
ATOM   4570  C CA   . CYS A 1 3  ? -9.794  0.645   -0.474  1.00 0.00 ? 3  CYS A CA   6  
ATOM   4571  C C    . CYS A 1 3  ? -10.080 -0.498  0.502   1.00 0.00 ? 3  CYS A C    6  
ATOM   4572  O O    . CYS A 1 3  ? -11.071 -0.463  1.231   1.00 0.00 ? 3  CYS A O    6  
ATOM   4573  C CB   . CYS A 1 3  ? -8.366  1.176   -0.328  1.00 0.00 ? 3  CYS A CB   6  
ATOM   4574  S SG   . CYS A 1 3  ? -7.682  1.961   -1.832  1.00 0.00 ? 3  CYS A SG   6  
ATOM   4575  H H    . CYS A 1 3  ? -10.920 1.946   0.700   1.00 0.00 ? 3  CYS A H    6  
ATOM   4576  H HA   . CYS A 1 3  ? -9.913  0.312   -1.505  1.00 0.00 ? 3  CYS A HA   6  
ATOM   4577  H HB2  . CYS A 1 3  ? -8.345  1.901   0.485   1.00 0.00 ? 3  CYS A HB2  6  
ATOM   4578  H HB3  . CYS A 1 3  ? -7.715  0.352   -0.037  1.00 0.00 ? 3  CYS A HB3  6  
ATOM   4579  N N    . LYS A 1 4  ? -9.196  -1.484  0.484   1.00 0.00 ? 4  LYS A N    6  
ATOM   4580  C CA   . LYS A 1 4  ? -9.342  -2.636  1.358   1.00 0.00 ? 4  LYS A CA   6  
ATOM   4581  C C    . LYS A 1 4  ? -8.546  -2.398  2.644   1.00 0.00 ? 4  LYS A C    6  
ATOM   4582  O O    . LYS A 1 4  ? -7.526  -1.712  2.629   1.00 0.00 ? 4  LYS A O    6  
ATOM   4583  C CB   . LYS A 1 4  ? -8.953  -3.920  0.623   1.00 0.00 ? 4  LYS A CB   6  
ATOM   4584  C CG   . LYS A 1 4  ? -10.103 -4.419  -0.254  1.00 0.00 ? 4  LYS A CG   6  
ATOM   4585  C CD   . LYS A 1 4  ? -9.719  -5.710  -0.979  1.00 0.00 ? 4  LYS A CD   6  
ATOM   4586  C CE   . LYS A 1 4  ? -10.885 -6.700  -0.993  1.00 0.00 ? 4  LYS A CE   6  
ATOM   4587  N NZ   . LYS A 1 4  ? -10.705 -7.699  -2.070  1.00 0.00 ? 4  LYS A NZ   6  
ATOM   4588  H H    . LYS A 1 4  ? -8.393  -1.505  -0.112  1.00 0.00 ? 4  LYS A H    6  
ATOM   4589  H HA   . LYS A 1 4  ? -10.398 -2.719  1.616   1.00 0.00 ? 4  LYS A HA   6  
ATOM   4590  H HB2  . LYS A 1 4  ? -8.073  -3.738  0.006   1.00 0.00 ? 4  LYS A HB2  6  
ATOM   4591  H HB3  . LYS A 1 4  ? -8.681  -4.689  1.346   1.00 0.00 ? 4  LYS A HB3  6  
ATOM   4592  H HG2  . LYS A 1 4  ? -10.985 -4.593  0.362   1.00 0.00 ? 4  LYS A HG2  6  
ATOM   4593  H HG3  . LYS A 1 4  ? -10.369 -3.653  -0.982  1.00 0.00 ? 4  LYS A HG3  6  
ATOM   4594  H HD2  . LYS A 1 4  ? -9.420  -5.481  -2.002  1.00 0.00 ? 4  LYS A HD2  6  
ATOM   4595  H HD3  . LYS A 1 4  ? -8.857  -6.164  -0.490  1.00 0.00 ? 4  LYS A HD3  6  
ATOM   4596  H HE2  . LYS A 1 4  ? -10.953 -7.204  -0.029  1.00 0.00 ? 4  LYS A HE2  6  
ATOM   4597  H HE3  . LYS A 1 4  ? -11.823 -6.164  -1.138  1.00 0.00 ? 4  LYS A HE3  6  
ATOM   4598  H HZ1  . LYS A 1 4  ? -10.857 -8.616  -1.702  1.00 0.00 ? 4  LYS A HZ1  6  
ATOM   4599  H HZ2  . LYS A 1 4  ? -11.362 -7.521  -2.803  1.00 0.00 ? 4  LYS A HZ2  6  
ATOM   4600  N N    . LYS A 1 5  ? -9.044  -2.979  3.726   1.00 0.00 ? 5  LYS A N    6  
ATOM   4601  C CA   . LYS A 1 5  ? -8.392  -2.840  5.017   1.00 0.00 ? 5  LYS A CA   6  
ATOM   4602  C C    . LYS A 1 5  ? -7.275  -3.878  5.134   1.00 0.00 ? 5  LYS A C    6  
ATOM   4603  O O    . LYS A 1 5  ? -6.947  -4.556  4.161   1.00 0.00 ? 5  LYS A O    6  
ATOM   4604  C CB   . LYS A 1 5  ? -9.421  -2.913  6.147   1.00 0.00 ? 5  LYS A CB   6  
ATOM   4605  C CG   . LYS A 1 5  ? -10.199 -1.600  6.266   1.00 0.00 ? 5  LYS A CG   6  
ATOM   4606  C CD   . LYS A 1 5  ? -9.462  -0.607  7.167   1.00 0.00 ? 5  LYS A CD   6  
ATOM   4607  C CE   . LYS A 1 5  ? -9.607  -0.992  8.641   1.00 0.00 ? 5  LYS A CE   6  
ATOM   4608  N NZ   . LYS A 1 5  ? -8.277  -1.128  9.274   1.00 0.00 ? 5  LYS A NZ   6  
ATOM   4609  H H    . LYS A 1 5  ? -9.874  -3.536  3.729   1.00 0.00 ? 5  LYS A H    6  
ATOM   4610  H HA   . LYS A 1 5  ? -7.946  -1.846  5.051   1.00 0.00 ? 5  LYS A HA   6  
ATOM   4611  H HB2  . LYS A 1 5  ? -10.114 -3.734  5.961   1.00 0.00 ? 5  LYS A HB2  6  
ATOM   4612  H HB3  . LYS A 1 5  ? -8.917  -3.128  7.089   1.00 0.00 ? 5  LYS A HB3  6  
ATOM   4613  H HG2  . LYS A 1 5  ? -10.338 -1.165  5.276   1.00 0.00 ? 5  LYS A HG2  6  
ATOM   4614  H HG3  . LYS A 1 5  ? -11.192 -1.797  6.670   1.00 0.00 ? 5  LYS A HG3  6  
ATOM   4615  H HD2  . LYS A 1 5  ? -8.407  -0.579  6.897   1.00 0.00 ? 5  LYS A HD2  6  
ATOM   4616  H HD3  . LYS A 1 5  ? -9.859  0.396   7.009   1.00 0.00 ? 5  LYS A HD3  6  
ATOM   4617  H HE2  . LYS A 1 5  ? -10.190 -0.235  9.165   1.00 0.00 ? 5  LYS A HE2  6  
ATOM   4618  H HE3  . LYS A 1 5  ? -10.155 -1.931  8.725   1.00 0.00 ? 5  LYS A HE3  6  
ATOM   4619  H HZ1  . LYS A 1 5  ? -8.283  -1.909  9.899   1.00 0.00 ? 5  LYS A HZ1  6  
ATOM   4620  H HZ2  . LYS A 1 5  ? -7.584  -1.272  8.567   1.00 0.00 ? 5  LYS A HZ2  6  
ATOM   4621  N N    . LEU A 1 6  ? -6.721  -3.971  6.334   1.00 0.00 ? 6  LEU A N    6  
ATOM   4622  C CA   . LEU A 1 6  ? -5.647  -4.916  6.592   1.00 0.00 ? 6  LEU A CA   6  
ATOM   4623  C C    . LEU A 1 6  ? -5.980  -6.253  5.927   1.00 0.00 ? 6  LEU A C    6  
ATOM   4624  O O    . LEU A 1 6  ? -5.346  -6.638  4.946   1.00 0.00 ? 6  LEU A O    6  
ATOM   4625  C CB   . LEU A 1 6  ? -5.379  -5.025  8.094   1.00 0.00 ? 6  LEU A CB   6  
ATOM   4626  C CG   . LEU A 1 6  ? -4.341  -4.056  8.663   1.00 0.00 ? 6  LEU A CG   6  
ATOM   4627  C CD1  . LEU A 1 6  ? -5.008  -2.780  9.180   1.00 0.00 ? 6  LEU A CD1  6  
ATOM   4628  C CD2  . LEU A 1 6  ? -3.489  -4.734  9.738   1.00 0.00 ? 6  LEU A CD2  6  
ATOM   4629  H H    . LEU A 1 6  ? -6.994  -3.416  7.121   1.00 0.00 ? 6  LEU A H    6  
ATOM   4630  H HA   . LEU A 1 6  ? -4.744  -4.517  6.132   1.00 0.00 ? 6  LEU A HA   6  
ATOM   4631  H HB2  . LEU A 1 6  ? -6.320  -4.871  8.623   1.00 0.00 ? 6  LEU A HB2  6  
ATOM   4632  H HB3  . LEU A 1 6  ? -5.054  -6.043  8.312   1.00 0.00 ? 6  LEU A HB3  6  
ATOM   4633  H HG   . LEU A 1 6  ? -3.669  -3.764  7.856   1.00 0.00 ? 6  LEU A HG   6  
ATOM   4634  H HD11 . LEU A 1 6  ? -6.001  -2.685  8.740   1.00 0.00 ? 6  LEU A HD11 6  
ATOM   4635  H HD12 . LEU A 1 6  ? -5.094  -2.829  10.265  1.00 0.00 ? 6  LEU A HD12 6  
ATOM   4636  H HD21 . LEU A 1 6  ? -2.805  -5.440  9.268   1.00 0.00 ? 6  LEU A HD21 6  
ATOM   4637  H HD22 . LEU A 1 6  ? -2.917  -3.979  10.277  1.00 0.00 ? 6  LEU A HD22 6  
ATOM   4638  N N    . VAL A 1 7  ? -6.975  -6.925  6.488   1.00 0.00 ? 7  VAL A N    6  
ATOM   4639  C CA   . VAL A 1 7  ? -7.400  -8.211  5.962   1.00 0.00 ? 7  VAL A CA   6  
ATOM   4640  C C    . VAL A 1 7  ? -8.318  -7.987  4.759   1.00 0.00 ? 7  VAL A C    6  
ATOM   4641  O O    . VAL A 1 7  ? -9.237  -7.172  4.818   1.00 0.00 ? 7  VAL A O    6  
ATOM   4642  C CB   . VAL A 1 7  ? -8.056  -9.038  7.070   1.00 0.00 ? 7  VAL A CB   6  
ATOM   4643  C CG1  . VAL A 1 7  ? -8.585  -10.365 6.522   1.00 0.00 ? 7  VAL A CG1  6  
ATOM   4644  C CG2  . VAL A 1 7  ? -7.086  -9.271  8.229   1.00 0.00 ? 7  VAL A CG2  6  
ATOM   4645  H H    . VAL A 1 7  ? -7.486  -6.605  7.286   1.00 0.00 ? 7  VAL A H    6  
ATOM   4646  H HA   . VAL A 1 7  ? -6.508  -8.741  5.629   1.00 0.00 ? 7  VAL A HA   6  
ATOM   4647  H HB   . VAL A 1 7  ? -8.905  -8.472  7.452   1.00 0.00 ? 7  VAL A HB   6  
ATOM   4648  H HG11 . VAL A 1 7  ? -7.816  -11.131 6.619   1.00 0.00 ? 7  VAL A HG11 6  
ATOM   4649  H HG12 . VAL A 1 7  ? -9.469  -10.665 7.086   1.00 0.00 ? 7  VAL A HG12 6  
ATOM   4650  H HG21 . VAL A 1 7  ? -6.420  -10.098 7.984   1.00 0.00 ? 7  VAL A HG21 6  
ATOM   4651  H HG22 . VAL A 1 7  ? -6.498  -8.369  8.397   1.00 0.00 ? 7  VAL A HG22 6  
ATOM   4652  N N    . PRO A 1 8  ? -8.029  -8.745  3.667   1.00 0.00 ? 8  PRO A N    6  
ATOM   4653  C CA   . PRO A 1 8  ? -8.818  -8.637  2.452   1.00 0.00 ? 8  PRO A CA   6  
ATOM   4654  C C    . PRO A 1 8  ? -10.174 -9.327  2.615   1.00 0.00 ? 8  PRO A C    6  
ATOM   4655  O O    . PRO A 1 8  ? -10.537 -10.188 1.815   1.00 0.00 ? 8  PRO A O    6  
ATOM   4656  C CB   . PRO A 1 8  ? -7.959  -9.266  1.368   1.00 0.00 ? 8  PRO A CB   6  
ATOM   4657  C CG   . PRO A 1 8  ? -6.928  -10.115 2.093   1.00 0.00 ? 8  PRO A CG   6  
ATOM   4658  C CD   . PRO A 1 8  ? -6.949  -9.720  3.561   1.00 0.00 ? 8  PRO A CD   6  
ATOM   4659  H HA   . PRO A 1 8  ? -9.022  -7.678  2.254   1.00 0.00 ? 8  PRO A HA   6  
ATOM   4660  H HB2  . PRO A 1 8  ? -8.563  -9.875  0.695   1.00 0.00 ? 8  PRO A HB2  6  
ATOM   4661  H HB3  . PRO A 1 8  ? -7.476  -8.501  0.759   1.00 0.00 ? 8  PRO A HB3  6  
ATOM   4662  H HG2  . PRO A 1 8  ? -7.158  -11.175 1.980   1.00 0.00 ? 8  PRO A HG2  6  
ATOM   4663  H HG3  . PRO A 1 8  ? -5.936  -9.957  1.669   1.00 0.00 ? 8  PRO A HG3  6  
ATOM   4664  H HD2  . PRO A 1 8  ? -7.130  -10.584 4.201   1.00 0.00 ? 8  PRO A HD2  6  
ATOM   4665  H HD3  . PRO A 1 8  ? -5.995  -9.291  3.869   1.00 0.00 ? 8  PRO A HD3  6  
ATOM   4666  N N    . LEU A 1 9  ? -10.886 -8.923  3.657   1.00 0.00 ? 9  LEU A N    6  
ATOM   4667  C CA   . LEU A 1 9  ? -12.194 -9.491  3.936   1.00 0.00 ? 9  LEU A CA   6  
ATOM   4668  C C    . LEU A 1 9  ? -13.256 -8.396  3.823   1.00 0.00 ? 9  LEU A C    6  
ATOM   4669  O O    . LEU A 1 9  ? -14.373 -8.653  3.376   1.00 0.00 ? 9  LEU A O    6  
ATOM   4670  C CB   . LEU A 1 9  ? -12.190 -10.207 5.288   1.00 0.00 ? 9  LEU A CB   6  
ATOM   4671  C CG   . LEU A 1 9  ? -11.577 -11.609 5.304   1.00 0.00 ? 9  LEU A CG   6  
ATOM   4672  C CD1  . LEU A 1 9  ? -11.458 -12.140 6.734   1.00 0.00 ? 9  LEU A CD1  6  
ATOM   4673  C CD2  . LEU A 1 9  ? -12.364 -12.561 4.402   1.00 0.00 ? 9  LEU A CD2  6  
ATOM   4674  H H    . LEU A 1 9  ? -10.584 -8.222  4.303   1.00 0.00 ? 9  LEU A H    6  
ATOM   4675  H HA   . LEU A 1 9  ? -12.392 -10.245 3.173   1.00 0.00 ? 9  LEU A HA   6  
ATOM   4676  H HB2  . LEU A 1 9  ? -11.649 -9.587  6.003   1.00 0.00 ? 9  LEU A HB2  6  
ATOM   4677  H HB3  . LEU A 1 9  ? -13.218 -10.278 5.642   1.00 0.00 ? 9  LEU A HB3  6  
ATOM   4678  H HG   . LEU A 1 9  ? -10.566 -11.544 4.900   1.00 0.00 ? 9  LEU A HG   6  
ATOM   4679  H HD11 . LEU A 1 9  ? -12.095 -13.017 6.849   1.00 0.00 ? 9  LEU A HD11 6  
ATOM   4680  H HD12 . LEU A 1 9  ? -10.423 -12.413 6.935   1.00 0.00 ? 9  LEU A HD12 6  
ATOM   4681  H HD21 . LEU A 1 9  ? -12.254 -12.252 3.362   1.00 0.00 ? 9  LEU A HD21 6  
ATOM   4682  H HD22 . LEU A 1 9  ? -11.980 -13.575 4.521   1.00 0.00 ? 9  LEU A HD22 6  
ATOM   4683  N N    . PHE A 1 10 ? -12.871 -7.198  4.236   1.00 0.00 ? 10 PHE A N    6  
ATOM   4684  C CA   . PHE A 1 10 ? -13.776 -6.062  4.187   1.00 0.00 ? 10 PHE A CA   6  
ATOM   4685  C C    . PHE A 1 10 ? -13.056 -4.808  3.686   1.00 0.00 ? 10 PHE A C    6  
ATOM   4686  O O    . PHE A 1 10 ? -11.831 -4.720  3.759   1.00 0.00 ? 10 PHE A O    6  
ATOM   4687  C CB   . PHE A 1 10 ? -14.265 -5.818  5.616   1.00 0.00 ? 10 PHE A CB   6  
ATOM   4688  C CG   . PHE A 1 10 ? -14.664 -7.092  6.363   1.00 0.00 ? 10 PHE A CG   6  
ATOM   4689  C CD1  . PHE A 1 10 ? -15.834 -7.718  6.064   1.00 0.00 ? 10 PHE A CD1  6  
ATOM   4690  C CD2  . PHE A 1 10 ? -13.849 -7.599  7.327   1.00 0.00 ? 10 PHE A CD2  6  
ATOM   4691  C CE1  . PHE A 1 10 ? -16.204 -8.900  6.758   1.00 0.00 ? 10 PHE A CE1  6  
ATOM   4692  C CE2  . PHE A 1 10 ? -14.219 -8.781  8.020   1.00 0.00 ? 10 PHE A CE2  6  
ATOM   4693  C CZ   . PHE A 1 10 ? -15.389 -9.407  7.721   1.00 0.00 ? 10 PHE A CZ   6  
ATOM   4694  H H    . PHE A 1 10 ? -11.960 -6.997  4.599   1.00 0.00 ? 10 PHE A H    6  
ATOM   4695  H HA   . PHE A 1 10 ? -14.579 -6.318  3.496   1.00 0.00 ? 10 PHE A HA   6  
ATOM   4696  H HB2  . PHE A 1 10 ? -13.480 -5.311  6.176   1.00 0.00 ? 10 PHE A HB2  6  
ATOM   4697  H HB3  . PHE A 1 10 ? -15.121 -5.144  5.586   1.00 0.00 ? 10 PHE A HB3  6  
ATOM   4698  H HD1  . PHE A 1 10 ? -16.487 -7.312  5.292   1.00 0.00 ? 10 PHE A HD1  6  
ATOM   4699  H HD2  . PHE A 1 10 ? -12.911 -7.097  7.566   1.00 0.00 ? 10 PHE A HD2  6  
ATOM   4700  H HE1  . PHE A 1 10 ? -17.142 -9.402  6.518   1.00 0.00 ? 10 PHE A HE1  6  
ATOM   4701  H HE2  . PHE A 1 10 ? -13.565 -9.187  8.792   1.00 0.00 ? 10 PHE A HE2  6  
ATOM   4702  H HZ   . PHE A 1 10 ? -15.673 -10.315 8.254   1.00 0.00 ? 10 PHE A HZ   6  
ATOM   4703  N N    . SER A 1 11 ? -13.848 -3.870  3.188   1.00 0.00 ? 11 SER A N    6  
ATOM   4704  C CA   . SER A 1 11 ? -13.301 -2.625  2.674   1.00 0.00 ? 11 SER A CA   6  
ATOM   4705  C C    . SER A 1 11 ? -13.801 -1.448  3.515   1.00 0.00 ? 11 SER A C    6  
ATOM   4706  O O    . SER A 1 11 ? -14.895 -1.501  4.075   1.00 0.00 ? 11 SER A O    6  
ATOM   4707  C CB   . SER A 1 11 ? -13.675 -2.424  1.205   1.00 0.00 ? 11 SER A CB   6  
ATOM   4708  O OG   . SER A 1 11 ? -15.056 -2.681  0.965   1.00 0.00 ? 11 SER A OG   6  
ATOM   4709  H H    . SER A 1 11 ? -14.843 -3.949  3.131   1.00 0.00 ? 11 SER A H    6  
ATOM   4710  H HA   . SER A 1 11 ? -12.220 -2.726  2.763   1.00 0.00 ? 11 SER A HA   6  
ATOM   4711  H HB2  . SER A 1 11 ? -13.440 -1.402  0.907   1.00 0.00 ? 11 SER A HB2  6  
ATOM   4712  H HB3  . SER A 1 11 ? -13.070 -3.084  0.583   1.00 0.00 ? 11 SER A HB3  6  
ATOM   4713  H HG   . SER A 1 11 ? -15.379 -2.128  0.197   1.00 0.00 ? 11 SER A HG   6  
ATOM   4714  N N    . LYS A 1 12 ? -12.976 -0.414  3.577   1.00 0.00 ? 12 LYS A N    6  
ATOM   4715  C CA   . LYS A 1 12 ? -13.320 0.774   4.340   1.00 0.00 ? 12 LYS A CA   6  
ATOM   4716  C C    . LYS A 1 12 ? -12.823 2.015   3.595   1.00 0.00 ? 12 LYS A C    6  
ATOM   4717  O O    . LYS A 1 12 ? -12.225 1.904   2.526   1.00 0.00 ? 12 LYS A O    6  
ATOM   4718  C CB   . LYS A 1 12 ? -12.792 0.663   5.771   1.00 0.00 ? 12 LYS A CB   6  
ATOM   4719  C CG   . LYS A 1 12 ? -13.928 0.368   6.753   1.00 0.00 ? 12 LYS A CG   6  
ATOM   4720  C CD   . LYS A 1 12 ? -13.461 -0.573  7.866   1.00 0.00 ? 12 LYS A CD   6  
ATOM   4721  C CE   . LYS A 1 12 ? -14.261 -0.343  9.150   1.00 0.00 ? 12 LYS A CE   6  
ATOM   4722  N NZ   . LYS A 1 12 ? -14.738 -1.631  9.701   1.00 0.00 ? 12 LYS A NZ   6  
ATOM   4723  H H    . LYS A 1 12 ? -12.087 -0.379  3.118   1.00 0.00 ? 12 LYS A H    6  
ATOM   4724  H HA   . LYS A 1 12 ? -14.407 0.820   4.400   1.00 0.00 ? 12 LYS A HA   6  
ATOM   4725  H HB2  . LYS A 1 12 ? -12.044 -0.128  5.827   1.00 0.00 ? 12 LYS A HB2  6  
ATOM   4726  H HB3  . LYS A 1 12 ? -12.295 1.591   6.053   1.00 0.00 ? 12 LYS A HB3  6  
ATOM   4727  H HG2  . LYS A 1 12 ? -14.289 1.301   7.188   1.00 0.00 ? 12 LYS A HG2  6  
ATOM   4728  H HG3  . LYS A 1 12 ? -14.767 -0.080  6.221   1.00 0.00 ? 12 LYS A HG3  6  
ATOM   4729  H HD2  . LYS A 1 12 ? -13.575 -1.608  7.543   1.00 0.00 ? 12 LYS A HD2  6  
ATOM   4730  H HD3  . LYS A 1 12 ? -12.401 -0.414  8.060   1.00 0.00 ? 12 LYS A HD3  6  
ATOM   4731  H HE2  . LYS A 1 12 ? -13.640 0.167   9.886   1.00 0.00 ? 12 LYS A HE2  6  
ATOM   4732  H HE3  . LYS A 1 12 ? -15.111 0.308   8.944   1.00 0.00 ? 12 LYS A HE3  6  
ATOM   4733  H HZ1  . LYS A 1 12 ? -13.955 -2.176  10.001  1.00 0.00 ? 12 LYS A HZ1  6  
ATOM   4734  H HZ2  . LYS A 1 12 ? -15.342 -1.458  10.479  1.00 0.00 ? 12 LYS A HZ2  6  
ATOM   4735  N N    . THR A 1 13 ? -13.088 3.168   4.190   1.00 0.00 ? 13 THR A N    6  
ATOM   4736  C CA   . THR A 1 13 ? -12.675 4.429   3.597   1.00 0.00 ? 13 THR A CA   6  
ATOM   4737  C C    . THR A 1 13 ? -11.540 5.055   4.411   1.00 0.00 ? 13 THR A C    6  
ATOM   4738  O O    . THR A 1 13 ? -11.645 5.186   5.629   1.00 0.00 ? 13 THR A O    6  
ATOM   4739  C CB   . THR A 1 13 ? -13.909 5.326   3.486   1.00 0.00 ? 13 THR A CB   6  
ATOM   4740  O OG1  . THR A 1 13 ? -14.617 4.806   2.364   1.00 0.00 ? 13 THR A OG1  6  
ATOM   4741  C CG2  . THR A 1 13 ? -13.558 6.757   3.074   1.00 0.00 ? 13 THR A CG2  6  
ATOM   4742  H H    . THR A 1 13 ? -13.575 3.250   5.060   1.00 0.00 ? 13 THR A H    6  
ATOM   4743  H HA   . THR A 1 13 ? -12.281 4.227   2.601   1.00 0.00 ? 13 THR A HA   6  
ATOM   4744  H HB   . THR A 1 13 ? -14.481 5.318   4.414   1.00 0.00 ? 13 THR A HB   6  
ATOM   4745  H HG1  . THR A 1 13 ? -14.688 3.811   2.436   1.00 0.00 ? 13 THR A HG1  6  
ATOM   4746  H HG21 . THR A 1 13 ? -12.812 6.733   2.279   1.00 0.00 ? 13 THR A HG21 6  
ATOM   4747  H HG22 . THR A 1 13 ? -14.455 7.263   2.716   1.00 0.00 ? 13 THR A HG22 6  
ATOM   4748  N N    . CYS A 1 14 ? -10.482 5.424   3.704   1.00 0.00 ? 14 CYS A N    6  
ATOM   4749  C CA   . CYS A 1 14 ? -9.329  6.032   4.345   1.00 0.00 ? 14 CYS A CA   6  
ATOM   4750  C C    . CYS A 1 14 ? -9.734  7.422   4.842   1.00 0.00 ? 14 CYS A C    6  
ATOM   4751  O O    . CYS A 1 14 ? -10.462 8.141   4.161   1.00 0.00 ? 14 CYS A O    6  
ATOM   4752  C CB   . CYS A 1 14 ? -8.124  6.091   3.404   1.00 0.00 ? 14 CYS A CB   6  
ATOM   4753  S SG   . CYS A 1 14 ? -7.833  4.568   2.433   1.00 0.00 ? 14 CYS A SG   6  
ATOM   4754  H H    . CYS A 1 14 ? -10.405 5.313   2.713   1.00 0.00 ? 14 CYS A H    6  
ATOM   4755  H HA   . CYS A 1 14 ? -9.058  5.386   5.180   1.00 0.00 ? 14 CYS A HA   6  
ATOM   4756  H HB2  . CYS A 1 14 ? -8.260  6.925   2.715   1.00 0.00 ? 14 CYS A HB2  6  
ATOM   4757  H HB3  . CYS A 1 14 ? -7.232  6.306   3.992   1.00 0.00 ? 14 CYS A HB3  6  
ATOM   4758  N N    . PRO A 1 15 ? -9.230  7.766   6.058   1.00 0.00 ? 15 PRO A N    6  
ATOM   4759  C CA   . PRO A 1 15 ? -9.531  9.056   6.654   1.00 0.00 ? 15 PRO A CA   6  
ATOM   4760  C C    . PRO A 1 15 ? -8.741  10.174  5.972   1.00 0.00 ? 15 PRO A C    6  
ATOM   4761  O O    . PRO A 1 15 ? -7.786  9.908   5.243   1.00 0.00 ? 15 PRO A O    6  
ATOM   4762  C CB   . PRO A 1 15 ? -9.187  8.899   8.127   1.00 0.00 ? 15 PRO A CB   6  
ATOM   4763  C CG   . PRO A 1 15 ? -8.275  7.687   8.214   1.00 0.00 ? 15 PRO A CG   6  
ATOM   4764  C CD   . PRO A 1 15 ? -8.364  6.940   6.894   1.00 0.00 ? 15 PRO A CD   6  
ATOM   4765  H HA   . PRO A 1 15 ? -10.496 9.284   6.521   1.00 0.00 ? 15 PRO A HA   6  
ATOM   4766  H HB2  . PRO A 1 15 ? -8.690  9.791   8.509   1.00 0.00 ? 15 PRO A HB2  6  
ATOM   4767  H HB3  . PRO A 1 15 ? -10.087 8.755   8.725   1.00 0.00 ? 15 PRO A HB3  6  
ATOM   4768  H HG2  . PRO A 1 15 ? -7.248  7.996   8.409   1.00 0.00 ? 15 PRO A HG2  6  
ATOM   4769  H HG3  . PRO A 1 15 ? -8.575  7.042   9.039   1.00 0.00 ? 15 PRO A HG3  6  
ATOM   4770  H HD2  . PRO A 1 15 ? -7.380  6.814   6.442   1.00 0.00 ? 15 PRO A HD2  6  
ATOM   4771  H HD3  . PRO A 1 15 ? -8.781  5.942   7.031   1.00 0.00 ? 15 PRO A HD3  6  
ATOM   4772  N N    . ALA A 1 16 ? -9.167  11.401  6.231   1.00 0.00 ? 16 ALA A N    6  
ATOM   4773  C CA   . ALA A 1 16 ? -8.511  12.560  5.651   1.00 0.00 ? 16 ALA A CA   6  
ATOM   4774  C C    . ALA A 1 16 ? -6.999  12.438  5.849   1.00 0.00 ? 16 ALA A C    6  
ATOM   4775  O O    . ALA A 1 16 ? -6.543  11.748  6.760   1.00 0.00 ? 16 ALA A O    6  
ATOM   4776  C CB   . ALA A 1 16 ? -9.080  13.836  6.276   1.00 0.00 ? 16 ALA A CB   6  
ATOM   4777  H H    . ALA A 1 16 ? -9.945  11.609  6.825   1.00 0.00 ? 16 ALA A H    6  
ATOM   4778  H HA   . ALA A 1 16 ? -8.730  12.565  4.583   1.00 0.00 ? 16 ALA A HA   6  
ATOM   4779  H HB1  . ALA A 1 16 ? -8.663  13.967  7.275   1.00 0.00 ? 16 ALA A HB1  6  
ATOM   4780  H HB2  . ALA A 1 16 ? -8.816  14.693  5.657   1.00 0.00 ? 16 ALA A HB2  6  
ATOM   4781  N N    . GLY A 1 17 ? -6.263  13.118  4.982   1.00 0.00 ? 17 GLY A N    6  
ATOM   4782  C CA   . GLY A 1 17 ? -4.812  13.093  5.051   1.00 0.00 ? 17 GLY A CA   6  
ATOM   4783  C C    . GLY A 1 17 ? -4.245  11.918  4.253   1.00 0.00 ? 17 GLY A C    6  
ATOM   4784  O O    . GLY A 1 17 ? -3.293  12.081  3.491   1.00 0.00 ? 17 GLY A O    6  
ATOM   4785  H H    . GLY A 1 17 ? -6.642  13.676  4.245   1.00 0.00 ? 17 GLY A H    6  
ATOM   4786  H HA2  . GLY A 1 17 ? -4.410  14.029  4.662   1.00 0.00 ? 17 GLY A HA2  6  
ATOM   4787  H HA3  . GLY A 1 17 ? -4.495  13.018  6.091   1.00 0.00 ? 17 GLY A HA3  6  
ATOM   4788  N N    . LYS A 1 18 ? -4.853  10.758  4.455   1.00 0.00 ? 18 LYS A N    6  
ATOM   4789  C CA   . LYS A 1 18 ? -4.421  9.555   3.764   1.00 0.00 ? 18 LYS A CA   6  
ATOM   4790  C C    . LYS A 1 18 ? -5.275  9.358   2.510   1.00 0.00 ? 18 LYS A C    6  
ATOM   4791  O O    . LYS A 1 18 ? -6.321  8.715   2.562   1.00 0.00 ? 18 LYS A O    6  
ATOM   4792  C CB   . LYS A 1 18 ? -4.438  8.356   4.714   1.00 0.00 ? 18 LYS A CB   6  
ATOM   4793  C CG   . LYS A 1 18 ? -4.070  8.779   6.138   1.00 0.00 ? 18 LYS A CG   6  
ATOM   4794  C CD   . LYS A 1 18 ? -2.603  9.205   6.222   1.00 0.00 ? 18 LYS A CD   6  
ATOM   4795  C CE   . LYS A 1 18 ? -1.920  8.582   7.441   1.00 0.00 ? 18 LYS A CE   6  
ATOM   4796  N NZ   . LYS A 1 18 ? -1.580  9.625   8.434   1.00 0.00 ? 18 LYS A NZ   6  
ATOM   4797  H H    . LYS A 1 18 ? -5.627  10.634  5.077   1.00 0.00 ? 18 LYS A H    6  
ATOM   4798  H HA   . LYS A 1 18 ? -3.386  9.709   3.457   1.00 0.00 ? 18 LYS A HA   6  
ATOM   4799  H HB2  . LYS A 1 18 ? -5.427  7.898   4.711   1.00 0.00 ? 18 LYS A HB2  6  
ATOM   4800  H HB3  . LYS A 1 18 ? -3.736  7.600   4.363   1.00 0.00 ? 18 LYS A HB3  6  
ATOM   4801  H HG2  . LYS A 1 18 ? -4.710  9.603   6.453   1.00 0.00 ? 18 LYS A HG2  6  
ATOM   4802  H HG3  . LYS A 1 18 ? -4.253  7.953   6.825   1.00 0.00 ? 18 LYS A HG3  6  
ATOM   4803  H HD2  . LYS A 1 18 ? -2.081  8.903   5.314   1.00 0.00 ? 18 LYS A HD2  6  
ATOM   4804  H HD3  . LYS A 1 18 ? -2.539  10.292  6.280   1.00 0.00 ? 18 LYS A HD3  6  
ATOM   4805  H HE2  . LYS A 1 18 ? -2.578  7.841   7.894   1.00 0.00 ? 18 LYS A HE2  6  
ATOM   4806  H HE3  . LYS A 1 18 ? -1.016  8.058   7.130   1.00 0.00 ? 18 LYS A HE3  6  
ATOM   4807  H HZ1  . LYS A 1 18 ? -0.592  9.783   8.425   1.00 0.00 ? 18 LYS A HZ1  6  
ATOM   4808  H HZ2  . LYS A 1 18 ? -2.055  10.474  8.202   1.00 0.00 ? 18 LYS A HZ2  6  
ATOM   4809  N N    . ASN A 1 19 ? -4.796  9.925   1.412   1.00 0.00 ? 19 ASN A N    6  
ATOM   4810  C CA   . ASN A 1 19 ? -5.502  9.819   0.146   1.00 0.00 ? 19 ASN A CA   6  
ATOM   4811  C C    . ASN A 1 19 ? -4.745  8.863   -0.777  1.00 0.00 ? 19 ASN A C    6  
ATOM   4812  O O    . ASN A 1 19 ? -4.905  8.915   -1.996  1.00 0.00 ? 19 ASN A O    6  
ATOM   4813  C CB   . ASN A 1 19 ? -5.590  11.179  -0.550  1.00 0.00 ? 19 ASN A CB   6  
ATOM   4814  C CG   . ASN A 1 19 ? -6.854  11.931  -0.127  1.00 0.00 ? 19 ASN A CG   6  
ATOM   4815  O OD1  . ASN A 1 19 ? -7.490  11.619  0.866   1.00 0.00 ? 19 ASN A OD1  6  
ATOM   4816  N ND2  . ASN A 1 19 ? -7.181  12.935  -0.935  1.00 0.00 ? 19 ASN A ND2  6  
ATOM   4817  H H    . ASN A 1 19 ? -3.943  10.447  1.378   1.00 0.00 ? 19 ASN A H    6  
ATOM   4818  H HA   . ASN A 1 19 ? -6.496  9.452   0.403   1.00 0.00 ? 19 ASN A HA   6  
ATOM   4819  H HB2  . ASN A 1 19 ? -4.710  11.774  -0.306  1.00 0.00 ? 19 ASN A HB2  6  
ATOM   4820  H HB3  . ASN A 1 19 ? -5.590  11.038  -1.631  1.00 0.00 ? 19 ASN A HB3  6  
ATOM   4821  H HD21 . ASN A 1 19 ? -6.616  13.139  -1.734  1.00 0.00 ? 19 ASN A HD21 6  
ATOM   4822  H HD22 . ASN A 1 19 ? -7.992  13.488  -0.743  1.00 0.00 ? 19 ASN A HD22 6  
ATOM   4823  N N    . LEU A 1 20 ? -3.936  8.013   -0.162  1.00 0.00 ? 20 LEU A N    6  
ATOM   4824  C CA   . LEU A 1 20 ? -3.154  7.046   -0.913  1.00 0.00 ? 20 LEU A CA   6  
ATOM   4825  C C    . LEU A 1 20 ? -3.227  5.686   -0.218  1.00 0.00 ? 20 LEU A C    6  
ATOM   4826  O O    . LEU A 1 20 ? -3.034  5.593   0.993   1.00 0.00 ? 20 LEU A O    6  
ATOM   4827  C CB   . LEU A 1 20 ? -1.726  7.556   -1.118  1.00 0.00 ? 20 LEU A CB   6  
ATOM   4828  C CG   . LEU A 1 20 ? -1.556  8.680   -2.142  1.00 0.00 ? 20 LEU A CG   6  
ATOM   4829  C CD1  . LEU A 1 20 ? -0.081  9.053   -2.307  1.00 0.00 ? 20 LEU A CD1  6  
ATOM   4830  C CD2  . LEU A 1 20 ? -2.206  8.309   -3.477  1.00 0.00 ? 20 LEU A CD2  6  
ATOM   4831  H H    . LEU A 1 20 ? -3.812  7.977   0.830   1.00 0.00 ? 20 LEU A H    6  
ATOM   4832  H HA   . LEU A 1 20 ? -3.608  6.955   -1.900  1.00 0.00 ? 20 LEU A HA   6  
ATOM   4833  H HB2  . LEU A 1 20 ? -1.345  7.905   -0.159  1.00 0.00 ? 20 LEU A HB2  6  
ATOM   4834  H HB3  . LEU A 1 20 ? -1.102  6.716   -1.423  1.00 0.00 ? 20 LEU A HB3  6  
ATOM   4835  H HG   . LEU A 1 20 ? -2.071  9.565   -1.768  1.00 0.00 ? 20 LEU A HG   6  
ATOM   4836  H HD11 . LEU A 1 20 ? 0.506   8.566   -1.528  1.00 0.00 ? 20 LEU A HD11 6  
ATOM   4837  H HD12 . LEU A 1 20 ? 0.270   8.724   -3.285  1.00 0.00 ? 20 LEU A HD12 6  
ATOM   4838  H HD21 . LEU A 1 20 ? -1.803  8.945   -4.266  1.00 0.00 ? 20 LEU A HD21 6  
ATOM   4839  H HD22 . LEU A 1 20 ? -1.992  7.265   -3.707  1.00 0.00 ? 20 LEU A HD22 6  
ATOM   4840  N N    . CYS A 1 21 ? -3.506  4.664   -1.014  1.00 0.00 ? 21 CYS A N    6  
ATOM   4841  C CA   . CYS A 1 21 ? -3.608  3.313   -0.490  1.00 0.00 ? 21 CYS A CA   6  
ATOM   4842  C C    . CYS A 1 21 ? -2.272  2.605   -0.726  1.00 0.00 ? 21 CYS A C    6  
ATOM   4843  O O    . CYS A 1 21 ? -1.736  2.636   -1.833  1.00 0.00 ? 21 CYS A O    6  
ATOM   4844  C CB   . CYS A 1 21 ? -4.777  2.549   -1.115  1.00 0.00 ? 21 CYS A CB   6  
ATOM   4845  S SG   . CYS A 1 21 ? -6.407  3.362   -0.937  1.00 0.00 ? 21 CYS A SG   6  
ATOM   4846  H H    . CYS A 1 21 ? -3.662  4.749   -1.998  1.00 0.00 ? 21 CYS A H    6  
ATOM   4847  H HA   . CYS A 1 21 ? -3.813  3.405   0.576   1.00 0.00 ? 21 CYS A HA   6  
ATOM   4848  H HB2  . CYS A 1 21 ? -4.572  2.405   -2.176  1.00 0.00 ? 21 CYS A HB2  6  
ATOM   4849  H HB3  . CYS A 1 21 ? -4.829  1.559   -0.664  1.00 0.00 ? 21 CYS A HB3  6  
ATOM   4850  N N    . TYR A 1 22 ? -1.773  1.983   0.332   1.00 0.00 ? 22 TYR A N    6  
ATOM   4851  C CA   . TYR A 1 22 ? -0.510  1.268   0.254   1.00 0.00 ? 22 TYR A CA   6  
ATOM   4852  C C    . TYR A 1 22 ? -0.679  -0.192  0.678   1.00 0.00 ? 22 TYR A C    6  
ATOM   4853  O O    . TYR A 1 22 ? -1.619  -0.529  1.397   1.00 0.00 ? 22 TYR A O    6  
ATOM   4854  C CB   . TYR A 1 22 ? 0.431   1.966   1.237   1.00 0.00 ? 22 TYR A CB   6  
ATOM   4855  C CG   . TYR A 1 22 ? 0.265   1.511   2.688   1.00 0.00 ? 22 TYR A CG   6  
ATOM   4856  C CD1  . TYR A 1 22 ? 0.975   0.424   3.155   1.00 0.00 ? 22 TYR A CD1  6  
ATOM   4857  C CD2  . TYR A 1 22 ? -0.595  2.187   3.529   1.00 0.00 ? 22 TYR A CD2  6  
ATOM   4858  C CE1  . TYR A 1 22 ? 0.819   -0.005  4.521   1.00 0.00 ? 22 TYR A CE1  6  
ATOM   4859  C CE2  . TYR A 1 22 ? -0.751  1.758   4.895   1.00 0.00 ? 22 TYR A CE2  6  
ATOM   4860  C CZ   . TYR A 1 22 ? -0.037  0.683   5.323   1.00 0.00 ? 22 TYR A CZ   6  
ATOM   4861  O OH   . TYR A 1 22 ? -0.184  0.278   6.613   1.00 0.00 ? 22 TYR A OH   6  
ATOM   4862  H H    . TYR A 1 22 ? -2.215  1.962   1.229   1.00 0.00 ? 22 TYR A H    6  
ATOM   4863  H HA   . TYR A 1 22 ? -0.169  1.301   -0.781  1.00 0.00 ? 22 TYR A HA   6  
ATOM   4864  H HB2  . TYR A 1 22 ? 1.461   1.789   0.927   1.00 0.00 ? 22 TYR A HB2  6  
ATOM   4865  H HB3  . TYR A 1 22 ? 0.264   3.042   1.183   1.00 0.00 ? 22 TYR A HB3  6  
ATOM   4866  H HD1  . TYR A 1 22 ? 1.655   -0.110  2.491   1.00 0.00 ? 22 TYR A HD1  6  
ATOM   4867  H HD2  . TYR A 1 22 ? -1.156  3.045   3.160   1.00 0.00 ? 22 TYR A HD2  6  
ATOM   4868  H HE1  . TYR A 1 22 ? 1.374   -0.862  4.903   1.00 0.00 ? 22 TYR A HE1  6  
ATOM   4869  H HE2  . TYR A 1 22 ? -1.427  2.283   5.570   1.00 0.00 ? 22 TYR A HE2  6  
ATOM   4870  H HH   . TYR A 1 22 ? -0.418  -0.694  6.642   1.00 0.00 ? 22 TYR A HH   6  
ATOM   4871  N N    . LYS A 1 23 ? 0.245   -1.020  0.214   1.00 0.00 ? 23 LYS A N    6  
ATOM   4872  C CA   . LYS A 1 23 ? 0.210   -2.437  0.536   1.00 0.00 ? 23 LYS A CA   6  
ATOM   4873  C C    . LYS A 1 23 ? 1.640   -2.952  0.706   1.00 0.00 ? 23 LYS A C    6  
ATOM   4874  O O    . LYS A 1 23 ? 2.462   -2.822  -0.199  1.00 0.00 ? 23 LYS A O    6  
ATOM   4875  C CB   . LYS A 1 23 ? -0.600  -3.205  -0.510  1.00 0.00 ? 23 LYS A CB   6  
ATOM   4876  C CG   . LYS A 1 23 ? 0.054   -3.107  -1.890  1.00 0.00 ? 23 LYS A CG   6  
ATOM   4877  C CD   . LYS A 1 23 ? -0.704  -3.950  -2.917  1.00 0.00 ? 23 LYS A CD   6  
ATOM   4878  C CE   . LYS A 1 23 ? -0.466  -3.430  -4.336  1.00 0.00 ? 23 LYS A CE   6  
ATOM   4879  N NZ   . LYS A 1 23 ? -0.226  -4.556  -5.267  1.00 0.00 ? 23 LYS A NZ   6  
ATOM   4880  H H    . LYS A 1 23 ? 1.006   -0.739  -0.370  1.00 0.00 ? 23 LYS A H    6  
ATOM   4881  H HA   . LYS A 1 23 ? -0.311  -2.543  1.488   1.00 0.00 ? 23 LYS A HA   6  
ATOM   4882  H HB2  . LYS A 1 23 ? -0.683  -4.251  -0.216  1.00 0.00 ? 23 LYS A HB2  6  
ATOM   4883  H HB3  . LYS A 1 23 ? -1.614  -2.806  -0.556  1.00 0.00 ? 23 LYS A HB3  6  
ATOM   4884  H HG2  . LYS A 1 23 ? 0.077   -2.067  -2.213  1.00 0.00 ? 23 LYS A HG2  6  
ATOM   4885  H HG3  . LYS A 1 23 ? 1.089   -3.445  -1.830  1.00 0.00 ? 23 LYS A HG3  6  
ATOM   4886  H HD2  . LYS A 1 23 ? -0.384  -4.990  -2.848  1.00 0.00 ? 23 LYS A HD2  6  
ATOM   4887  H HD3  . LYS A 1 23 ? -1.771  -3.930  -2.693  1.00 0.00 ? 23 LYS A HD3  6  
ATOM   4888  H HE2  . LYS A 1 23 ? -1.329  -2.854  -4.668  1.00 0.00 ? 23 LYS A HE2  6  
ATOM   4889  H HE3  . LYS A 1 23 ? 0.391   -2.756  -4.344  1.00 0.00 ? 23 LYS A HE3  6  
ATOM   4890  H HZ1  . LYS A 1 23 ? 0.717   -4.875  -5.168  1.00 0.00 ? 23 LYS A HZ1  6  
ATOM   4891  H HZ2  . LYS A 1 23 ? -0.855  -5.304  -5.055  1.00 0.00 ? 23 LYS A HZ2  6  
ATOM   4892  N N    . MET A 1 24 ? 1.894   -3.527  1.873   1.00 0.00 ? 24 MET A N    6  
ATOM   4893  C CA   . MET A 1 24 ? 3.211   -4.063  2.173   1.00 0.00 ? 24 MET A CA   6  
ATOM   4894  C C    . MET A 1 24 ? 3.252   -5.575  1.947   1.00 0.00 ? 24 MET A C    6  
ATOM   4895  O O    . MET A 1 24 ? 2.376   -6.301  2.417   1.00 0.00 ? 24 MET A O    6  
ATOM   4896  C CB   . MET A 1 24 ? 3.568   -3.753  3.628   1.00 0.00 ? 24 MET A CB   6  
ATOM   4897  C CG   . MET A 1 24 ? 3.691   -2.245  3.854   1.00 0.00 ? 24 MET A CG   6  
ATOM   4898  S SD   . MET A 1 24 ? 4.307   -1.922  5.498   1.00 0.00 ? 24 MET A SD   6  
ATOM   4899  C CE   . MET A 1 24 ? 5.122   -0.359  5.222   1.00 0.00 ? 24 MET A CE   6  
ATOM   4900  H H    . MET A 1 24 ? 1.219   -3.629  2.604   1.00 0.00 ? 24 MET A H    6  
ATOM   4901  H HA   . MET A 1 24 ? 3.893   -3.567  1.482   1.00 0.00 ? 24 MET A HA   6  
ATOM   4902  H HB2  . MET A 1 24 ? 2.804   -4.162  4.289   1.00 0.00 ? 24 MET A HB2  6  
ATOM   4903  H HB3  . MET A 1 24 ? 4.508   -4.241  3.887   1.00 0.00 ? 24 MET A HB3  6  
ATOM   4904  H HG2  . MET A 1 24 ? 4.364   -1.812  3.113   1.00 0.00 ? 24 MET A HG2  6  
ATOM   4905  H HG3  . MET A 1 24 ? 2.720   -1.768  3.720   1.00 0.00 ? 24 MET A HG3  6  
ATOM   4906  H HE1  . MET A 1 24 ? 6.201   -0.491  5.308   1.00 0.00 ? 24 MET A HE1  6  
ATOM   4907  H HE2  . MET A 1 24 ? 4.880   0.007   4.224   1.00 0.00 ? 24 MET A HE2  6  
ATOM   4908  N N    . PHE A 1 25 ? 4.277   -6.007  1.228   1.00 0.00 ? 25 PHE A N    6  
ATOM   4909  C CA   . PHE A 1 25 ? 4.444   -7.420  0.934   1.00 0.00 ? 25 PHE A CA   6  
ATOM   4910  C C    . PHE A 1 25 ? 5.922   -7.812  0.950   1.00 0.00 ? 25 PHE A C    6  
ATOM   4911  O O    . PHE A 1 25 ? 6.797   -6.959  0.805   1.00 0.00 ? 25 PHE A O    6  
ATOM   4912  C CB   . PHE A 1 25 ? 3.881   -7.654  -0.469  1.00 0.00 ? 25 PHE A CB   6  
ATOM   4913  C CG   . PHE A 1 25 ? 4.709   -7.017  -1.586  1.00 0.00 ? 25 PHE A CG   6  
ATOM   4914  C CD1  . PHE A 1 25 ? 5.837   -7.632  -2.032  1.00 0.00 ? 25 PHE A CD1  6  
ATOM   4915  C CD2  . PHE A 1 25 ? 4.318   -5.835  -2.134  1.00 0.00 ? 25 PHE A CD2  6  
ATOM   4916  C CE1  . PHE A 1 25 ? 6.606   -7.041  -3.069  1.00 0.00 ? 25 PHE A CE1  6  
ATOM   4917  C CE2  . PHE A 1 25 ? 5.086   -5.244  -3.171  1.00 0.00 ? 25 PHE A CE2  6  
ATOM   4918  C CZ   . PHE A 1 25 ? 6.214   -5.859  -3.617  1.00 0.00 ? 25 PHE A CZ   6  
ATOM   4919  H H    . PHE A 1 25 ? 4.985   -5.410  0.849   1.00 0.00 ? 25 PHE A H    6  
ATOM   4920  H HA   . PHE A 1 25 ? 3.914   -7.976  1.708   1.00 0.00 ? 25 PHE A HA   6  
ATOM   4921  H HB2  . PHE A 1 25 ? 3.814   -8.728  -0.648  1.00 0.00 ? 25 PHE A HB2  6  
ATOM   4922  H HB3  . PHE A 1 25 ? 2.866   -7.260  -0.513  1.00 0.00 ? 25 PHE A HB3  6  
ATOM   4923  H HD1  . PHE A 1 25 ? 6.151   -8.579  -1.594  1.00 0.00 ? 25 PHE A HD1  6  
ATOM   4924  H HD2  . PHE A 1 25 ? 3.413   -5.342  -1.776  1.00 0.00 ? 25 PHE A HD2  6  
ATOM   4925  H HE1  . PHE A 1 25 ? 7.510   -7.534  -3.427  1.00 0.00 ? 25 PHE A HE1  6  
ATOM   4926  H HE2  . PHE A 1 25 ? 4.772   -4.296  -3.609  1.00 0.00 ? 25 PHE A HE2  6  
ATOM   4927  H HZ   . PHE A 1 25 ? 6.804   -5.405  -4.413  1.00 0.00 ? 25 PHE A HZ   6  
ATOM   4928  N N    . MET A 1 26 ? 6.157   -9.104  1.128   1.00 0.00 ? 26 MET A N    6  
ATOM   4929  C CA   . MET A 1 26 ? 7.515   -9.620  1.164   1.00 0.00 ? 26 MET A CA   6  
ATOM   4930  C C    . MET A 1 26 ? 7.971   -10.062 -0.228  1.00 0.00 ? 26 MET A C    6  
ATOM   4931  O O    . MET A 1 26 ? 7.160   -10.501 -1.041  1.00 0.00 ? 26 MET A O    6  
ATOM   4932  C CB   . MET A 1 26 ? 7.583   -10.809 2.125   1.00 0.00 ? 26 MET A CB   6  
ATOM   4933  C CG   . MET A 1 26 ? 7.412   -10.353 3.575   1.00 0.00 ? 26 MET A CG   6  
ATOM   4934  S SD   . MET A 1 26 ? 8.098   -11.572 4.684   1.00 0.00 ? 26 MET A SD   6  
ATOM   4935  C CE   . MET A 1 26 ? 7.357   -11.046 6.220   1.00 0.00 ? 26 MET A CE   6  
ATOM   4936  H H    . MET A 1 26 ? 5.440   -9.792  1.245   1.00 0.00 ? 26 MET A H    6  
ATOM   4937  H HA   . MET A 1 26 ? 8.133   -8.793  1.512   1.00 0.00 ? 26 MET A HA   6  
ATOM   4938  H HB2  . MET A 1 26 ? 6.806   -11.531 1.873   1.00 0.00 ? 26 MET A HB2  6  
ATOM   4939  H HB3  . MET A 1 26 ? 8.540   -11.319 2.011   1.00 0.00 ? 26 MET A HB3  6  
ATOM   4940  H HG2  . MET A 1 26 ? 7.908   -9.394  3.724   1.00 0.00 ? 26 MET A HG2  6  
ATOM   4941  H HG3  . MET A 1 26 ? 6.355   -10.203 3.795   1.00 0.00 ? 26 MET A HG3  6  
ATOM   4942  H HE1  . MET A 1 26 ? 7.788   -11.614 7.045   1.00 0.00 ? 26 MET A HE1  6  
ATOM   4943  H HE2  . MET A 1 26 ? 7.549   -9.984  6.371   1.00 0.00 ? 26 MET A HE2  6  
ATOM   4944  N N    . VAL A 1 27 ? 9.269   -9.929  -0.459  1.00 0.00 ? 27 VAL A N    6  
ATOM   4945  C CA   . VAL A 1 27 ? 9.843   -10.309 -1.739  1.00 0.00 ? 27 VAL A CA   6  
ATOM   4946  C C    . VAL A 1 27 ? 9.554   -11.787 -2.005  1.00 0.00 ? 27 VAL A C    6  
ATOM   4947  O O    . VAL A 1 27 ? 9.692   -12.257 -3.133  1.00 0.00 ? 27 VAL A O    6  
ATOM   4948  C CB   . VAL A 1 27 ? 11.337  -9.979  -1.760  1.00 0.00 ? 27 VAL A CB   6  
ATOM   4949  C CG1  . VAL A 1 27 ? 12.111  -10.880 -0.796  1.00 0.00 ? 27 VAL A CG1  6  
ATOM   4950  C CG2  . VAL A 1 27 ? 11.901  -10.082 -3.179  1.00 0.00 ? 27 VAL A CG2  6  
ATOM   4951  H H    . VAL A 1 27 ? 9.922   -9.571  0.207   1.00 0.00 ? 27 VAL A H    6  
ATOM   4952  H HA   . VAL A 1 27 ? 9.355   -9.711  -2.509  1.00 0.00 ? 27 VAL A HA   6  
ATOM   4953  H HB   . VAL A 1 27 ? 11.458  -8.949  -1.426  1.00 0.00 ? 27 VAL A HB   6  
ATOM   4954  H HG11 . VAL A 1 27 ? 11.430  -11.276 -0.043  1.00 0.00 ? 27 VAL A HG11 6  
ATOM   4955  H HG12 . VAL A 1 27 ? 12.560  -11.705 -1.350  1.00 0.00 ? 27 VAL A HG12 6  
ATOM   4956  H HG21 . VAL A 1 27 ? 12.748  -10.768 -3.184  1.00 0.00 ? 27 VAL A HG21 6  
ATOM   4957  H HG22 . VAL A 1 27 ? 11.128  -10.454 -3.851  1.00 0.00 ? 27 VAL A HG22 6  
ATOM   4958  N N    . ALA A 1 28 ? 9.157   -12.479 -0.947  1.00 0.00 ? 28 ALA A N    6  
ATOM   4959  C CA   . ALA A 1 28 ? 8.846   -13.895 -1.052  1.00 0.00 ? 28 ALA A CA   6  
ATOM   4960  C C    . ALA A 1 28 ? 8.174   -14.166 -2.399  1.00 0.00 ? 28 ALA A C    6  
ATOM   4961  O O    . ALA A 1 28 ? 8.512   -15.132 -3.082  1.00 0.00 ? 28 ALA A O    6  
ATOM   4962  C CB   . ALA A 1 28 ? 7.972   -14.315 0.131   1.00 0.00 ? 28 ALA A CB   6  
ATOM   4963  H H    . ALA A 1 28 ? 9.047   -12.089 -0.033  1.00 0.00 ? 28 ALA A H    6  
ATOM   4964  H HA   . ALA A 1 28 ? 9.786   -14.445 -1.007  1.00 0.00 ? 28 ALA A HA   6  
ATOM   4965  H HB1  . ALA A 1 28 ? 8.373   -13.887 1.050   1.00 0.00 ? 28 ALA A HB1  6  
ATOM   4966  H HB2  . ALA A 1 28 ? 6.955   -13.955 -0.023  1.00 0.00 ? 28 ALA A HB2  6  
ATOM   4967  N N    . ALA A 1 29 ? 7.233   -13.297 -2.741  1.00 0.00 ? 29 ALA A N    6  
ATOM   4968  C CA   . ALA A 1 29 ? 6.510   -13.431 -3.994  1.00 0.00 ? 29 ALA A CA   6  
ATOM   4969  C C    . ALA A 1 29 ? 6.184   -12.040 -4.541  1.00 0.00 ? 29 ALA A C    6  
ATOM   4970  O O    . ALA A 1 29 ? 6.044   -11.086 -3.778  1.00 0.00 ? 29 ALA A O    6  
ATOM   4971  C CB   . ALA A 1 29 ? 5.256   -14.279 -3.772  1.00 0.00 ? 29 ALA A CB   6  
ATOM   4972  H H    . ALA A 1 29 ? 6.964   -12.515 -2.179  1.00 0.00 ? 29 ALA A H    6  
ATOM   4973  H HA   . ALA A 1 29 ? 7.162   -13.947 -4.700  1.00 0.00 ? 29 ALA A HA   6  
ATOM   4974  H HB1  . ALA A 1 29 ? 5.185   -14.554 -2.720  1.00 0.00 ? 29 ALA A HB1  6  
ATOM   4975  H HB2  . ALA A 1 29 ? 4.374   -13.705 -4.057  1.00 0.00 ? 29 ALA A HB2  6  
ATOM   4976  N N    . PRO A 1 30 ? 6.071   -11.967 -5.894  1.00 0.00 ? 30 PRO A N    6  
ATOM   4977  C CA   . PRO A 1 30 ? 5.764   -10.708 -6.553  1.00 0.00 ? 30 PRO A CA   6  
ATOM   4978  C C    . PRO A 1 30 ? 4.290   -10.342 -6.374  1.00 0.00 ? 30 PRO A C    6  
ATOM   4979  O O    . PRO A 1 30 ? 3.917   -9.176  -6.497  1.00 0.00 ? 30 PRO A O    6  
ATOM   4980  C CB   . PRO A 1 30 ? 6.152   -10.920 -8.007  1.00 0.00 ? 30 PRO A CB   6  
ATOM   4981  C CG   . PRO A 1 30 ? 6.224   -12.426 -8.204  1.00 0.00 ? 30 PRO A CG   6  
ATOM   4982  C CD   . PRO A 1 30 ? 6.231   -13.076 -6.830  1.00 0.00 ? 30 PRO A CD   6  
ATOM   4983  H HA   . PRO A 1 30 ? 6.284   -9.963  -6.135  1.00 0.00 ? 30 PRO A HA   6  
ATOM   4984  H HB2  . PRO A 1 30 ? 5.417   -10.473 -8.676  1.00 0.00 ? 30 PRO A HB2  6  
ATOM   4985  H HB3  . PRO A 1 30 ? 7.111   -10.451 -8.228  1.00 0.00 ? 30 PRO A HB3  6  
ATOM   4986  H HG2  . PRO A 1 30 ? 5.372   -12.775 -8.788  1.00 0.00 ? 30 PRO A HG2  6  
ATOM   4987  H HG3  . PRO A 1 30 ? 7.123   -12.695 -8.759  1.00 0.00 ? 30 PRO A HG3  6  
ATOM   4988  H HD2  . PRO A 1 30 ? 5.422   -13.799 -6.730  1.00 0.00 ? 30 PRO A HD2  6  
ATOM   4989  H HD3  . PRO A 1 30 ? 7.162   -13.613 -6.652  1.00 0.00 ? 30 PRO A HD3  6  
ATOM   4990  N N    . HIS A 1 31 ? 3.490   -11.359 -6.088  1.00 0.00 ? 31 HIS A N    6  
ATOM   4991  C CA   . HIS A 1 31 ? 2.065   -11.158 -5.892  1.00 0.00 ? 31 HIS A CA   6  
ATOM   4992  C C    . HIS A 1 31 ? 1.605   -11.923 -4.650  1.00 0.00 ? 31 HIS A C    6  
ATOM   4993  O O    . HIS A 1 31 ? 0.764   -12.816 -4.742  1.00 0.00 ? 31 HIS A O    6  
ATOM   4994  C CB   . HIS A 1 31 ? 1.283   -11.545 -7.149  1.00 0.00 ? 31 HIS A CB   6  
ATOM   4995  C CG   . HIS A 1 31 ? -0.051  -10.852 -7.281  1.00 0.00 ? 31 HIS A CG   6  
ATOM   4996  N ND1  . HIS A 1 31 ? -0.299  -9.875  -8.230  1.00 0.00 ? 31 HIS A ND1  6  
ATOM   4997  C CD2  . HIS A 1 31 ? -1.209  -11.005 -6.575  1.00 0.00 ? 31 HIS A CD2  6  
ATOM   4998  C CE1  . HIS A 1 31 ? -1.551  -9.465  -8.091  1.00 0.00 ? 31 HIS A CE1  6  
ATOM   4999  N NE2  . HIS A 1 31 ? -2.113  -10.166 -7.065  1.00 0.00 ? 31 HIS A NE2  6  
ATOM   5000  H H    . HIS A 1 31 ? 3.801   -12.304 -5.991  1.00 0.00 ? 31 HIS A H    6  
ATOM   5001  H HA   . HIS A 1 31 ? 1.919   -10.091 -5.726  1.00 0.00 ? 31 HIS A HA   6  
ATOM   5002  H HB2  . HIS A 1 31 ? 1.889   -11.315 -8.026  1.00 0.00 ? 31 HIS A HB2  6  
ATOM   5003  H HB3  . HIS A 1 31 ? 1.123   -12.623 -7.147  1.00 0.00 ? 31 HIS A HB3  6  
ATOM   5004  H HD1  . HIS A 1 31 ? 0.357   -9.536  -8.905  1.00 0.00 ? 31 HIS A HD1  6  
ATOM   5005  H HD2  . HIS A 1 31 ? -1.364  -11.698 -5.749  1.00 0.00 ? 31 HIS A HD2  6  
ATOM   5006  H HE1  . HIS A 1 31 ? -2.045  -8.701  -8.692  1.00 0.00 ? 31 HIS A HE1  6  
ATOM   5007  N N    . VAL A 1 32 ? 2.177   -11.545 -3.516  1.00 0.00 ? 32 VAL A N    6  
ATOM   5008  C CA   . VAL A 1 32 ? 1.836   -12.184 -2.256  1.00 0.00 ? 32 VAL A CA   6  
ATOM   5009  C C    . VAL A 1 32 ? 2.051   -11.192 -1.111  1.00 0.00 ? 32 VAL A C    6  
ATOM   5010  O O    . VAL A 1 32 ? 3.112   -11.178 -0.489  1.00 0.00 ? 32 VAL A O    6  
ATOM   5011  C CB   . VAL A 1 32 ? 2.643   -13.474 -2.089  1.00 0.00 ? 32 VAL A CB   6  
ATOM   5012  C CG1  . VAL A 1 32 ? 2.489   -14.037 -0.675  1.00 0.00 ? 32 VAL A CG1  6  
ATOM   5013  C CG2  . VAL A 1 32 ? 2.241   -14.511 -3.139  1.00 0.00 ? 32 VAL A CG2  6  
ATOM   5014  H H    . VAL A 1 32 ? 2.860   -10.818 -3.450  1.00 0.00 ? 32 VAL A H    6  
ATOM   5015  H HA   . VAL A 1 32 ? 0.780   -12.449 -2.297  1.00 0.00 ? 32 VAL A HA   6  
ATOM   5016  H HB   . VAL A 1 32 ? 3.695   -13.233 -2.241  1.00 0.00 ? 32 VAL A HB   6  
ATOM   5017  H HG11 . VAL A 1 32 ? 1.549   -14.585 -0.603  1.00 0.00 ? 32 VAL A HG11 6  
ATOM   5018  H HG12 . VAL A 1 32 ? 3.319   -14.709 -0.459  1.00 0.00 ? 32 VAL A HG12 6  
ATOM   5019  H HG21 . VAL A 1 32 ? 1.181   -14.743 -3.035  1.00 0.00 ? 32 VAL A HG21 6  
ATOM   5020  H HG22 . VAL A 1 32 ? 2.430   -14.111 -4.136  1.00 0.00 ? 32 VAL A HG22 6  
ATOM   5021  N N    . PRO A 1 33 ? 1.001   -10.365 -0.863  1.00 0.00 ? 33 PRO A N    6  
ATOM   5022  C CA   . PRO A 1 33 ? 1.064   -9.372  0.196   1.00 0.00 ? 33 PRO A CA   6  
ATOM   5023  C C    . PRO A 1 33 ? 0.919   -10.027 1.572   1.00 0.00 ? 33 PRO A C    6  
ATOM   5024  O O    . PRO A 1 33 ? 0.504   -11.180 1.673   1.00 0.00 ? 33 PRO A O    6  
ATOM   5025  C CB   . PRO A 1 33 ? -0.055  -8.392  -0.116  1.00 0.00 ? 33 PRO A CB   6  
ATOM   5026  C CG   . PRO A 1 33 ? -0.993  -9.119  -1.065  1.00 0.00 ? 33 PRO A CG   6  
ATOM   5027  C CD   . PRO A 1 33 ? -0.271  -10.354 -1.580  1.00 0.00 ? 33 PRO A CD   6  
ATOM   5028  H HA   . PRO A 1 33 ? 1.959   -8.925  0.200   1.00 0.00 ? 33 PRO A HA   6  
ATOM   5029  H HB2  . PRO A 1 33 ? -0.575  -8.091  0.793   1.00 0.00 ? 33 PRO A HB2  6  
ATOM   5030  H HB3  . PRO A 1 33 ? 0.338   -7.484  -0.574  1.00 0.00 ? 33 PRO A HB3  6  
ATOM   5031  H HG2  . PRO A 1 33 ? -1.913  -9.401  -0.552  1.00 0.00 ? 33 PRO A HG2  6  
ATOM   5032  H HG3  . PRO A 1 33 ? -1.277  -8.470  -1.893  1.00 0.00 ? 33 PRO A HG3  6  
ATOM   5033  H HD2  . PRO A 1 33 ? -0.845  -11.259 -1.383  1.00 0.00 ? 33 PRO A HD2  6  
ATOM   5034  H HD3  . PRO A 1 33 ? -0.117  -10.302 -2.658  1.00 0.00 ? 33 PRO A HD3  6  
ATOM   5035  N N    . VAL A 1 34 ? 1.269   -9.263  2.595   1.00 0.00 ? 34 VAL A N    6  
ATOM   5036  C CA   . VAL A 1 34 ? 1.183   -9.754  3.960   1.00 0.00 ? 34 VAL A CA   6  
ATOM   5037  C C    . VAL A 1 34 ? 0.152   -8.928  4.731   1.00 0.00 ? 34 VAL A C    6  
ATOM   5038  O O    . VAL A 1 34 ? -0.616  -9.471  5.525   1.00 0.00 ? 34 VAL A O    6  
ATOM   5039  C CB   . VAL A 1 34 ? 2.568   -9.738  4.610   1.00 0.00 ? 34 VAL A CB   6  
ATOM   5040  C CG1  . VAL A 1 34 ? 2.990   -8.311  4.967   1.00 0.00 ? 34 VAL A CG1  6  
ATOM   5041  C CG2  . VAL A 1 34 ? 2.606   -10.646 5.841   1.00 0.00 ? 34 VAL A CG2  6  
ATOM   5042  H H    . VAL A 1 34 ? 1.606   -8.325  2.504   1.00 0.00 ? 34 VAL A H    6  
ATOM   5043  H HA   . VAL A 1 34 ? 0.843   -10.789 3.916   1.00 0.00 ? 34 VAL A HA   6  
ATOM   5044  H HB   . VAL A 1 34 ? 3.283   -10.127 3.885   1.00 0.00 ? 34 VAL A HB   6  
ATOM   5045  H HG11 . VAL A 1 34 ? 4.069   -8.278  5.118   1.00 0.00 ? 34 VAL A HG11 6  
ATOM   5046  H HG12 . VAL A 1 34 ? 2.715   -7.637  4.156   1.00 0.00 ? 34 VAL A HG12 6  
ATOM   5047  H HG21 . VAL A 1 34 ? 3.428   -11.356 5.744   1.00 0.00 ? 34 VAL A HG21 6  
ATOM   5048  H HG22 . VAL A 1 34 ? 2.754   -10.040 6.735   1.00 0.00 ? 34 VAL A HG22 6  
ATOM   5049  N N    . LYS A 1 35 ? 0.166   -7.629  4.470   1.00 0.00 ? 35 LYS A N    6  
ATOM   5050  C CA   . LYS A 1 35 ? -0.759  -6.723  5.130   1.00 0.00 ? 35 LYS A CA   6  
ATOM   5051  C C    . LYS A 1 35 ? -0.959  -5.482  4.258   1.00 0.00 ? 35 LYS A C    6  
ATOM   5052  O O    . LYS A 1 35 ? -0.228  -5.274  3.290   1.00 0.00 ? 35 LYS A O    6  
ATOM   5053  C CB   . LYS A 1 35 ? -0.280  -6.407  6.548   1.00 0.00 ? 35 LYS A CB   6  
ATOM   5054  C CG   . LYS A 1 35 ? -0.991  -7.289  7.576   1.00 0.00 ? 35 LYS A CG   6  
ATOM   5055  C CD   . LYS A 1 35 ? 0.009   -7.906  8.555   1.00 0.00 ? 35 LYS A CD   6  
ATOM   5056  C CE   . LYS A 1 35 ? -0.030  -7.188  9.906   1.00 0.00 ? 35 LYS A CE   6  
ATOM   5057  N NZ   . LYS A 1 35 ? 0.722   -5.915  9.838   1.00 0.00 ? 35 LYS A NZ   6  
ATOM   5058  H H    . LYS A 1 35 ? 0.794   -7.196  3.823   1.00 0.00 ? 35 LYS A H    6  
ATOM   5059  H HA   . LYS A 1 35 ? -1.714  -7.240  5.220   1.00 0.00 ? 35 LYS A HA   6  
ATOM   5060  H HB2  . LYS A 1 35 ? 0.797   -6.561  6.615   1.00 0.00 ? 35 LYS A HB2  6  
ATOM   5061  H HB3  . LYS A 1 35 ? -0.466  -5.357  6.774   1.00 0.00 ? 35 LYS A HB3  6  
ATOM   5062  H HG2  . LYS A 1 35 ? -1.724  -6.696  8.124   1.00 0.00 ? 35 LYS A HG2  6  
ATOM   5063  H HG3  . LYS A 1 35 ? -1.540  -8.080  7.065   1.00 0.00 ? 35 LYS A HG3  6  
ATOM   5064  H HD2  . LYS A 1 35 ? -0.218  -8.963  8.695   1.00 0.00 ? 35 LYS A HD2  6  
ATOM   5065  H HD3  . LYS A 1 35 ? 1.015   -7.849  8.138   1.00 0.00 ? 35 LYS A HD3  6  
ATOM   5066  H HE2  . LYS A 1 35 ? -1.064  -6.991  10.189  1.00 0.00 ? 35 LYS A HE2  6  
ATOM   5067  H HE3  . LYS A 1 35 ? 0.396   -7.828  10.678  1.00 0.00 ? 35 LYS A HE3  6  
ATOM   5068  H HZ1  . LYS A 1 35 ? 0.639   -5.527  8.920   1.00 0.00 ? 35 LYS A HZ1  6  
ATOM   5069  H HZ2  . LYS A 1 35 ? 0.350   -5.272  10.507  1.00 0.00 ? 35 LYS A HZ2  6  
ATOM   5070  N N    . ARG A 1 36 ? -1.951  -4.661  4.606   1.00 0.00 ? 36 ARG A N    6  
ATOM   5071  C CA   . ARG A 1 36 ? -2.243  -3.453  3.860   1.00 0.00 ? 36 ARG A CA   6  
ATOM   5072  C C    . ARG A 1 36 ? -2.873  -2.418  4.781   1.00 0.00 ? 36 ARG A C    6  
ATOM   5073  O O    . ARG A 1 36 ? -3.310  -2.747  5.881   1.00 0.00 ? 36 ARG A O    6  
ATOM   5074  C CB   . ARG A 1 36 ? -3.178  -3.786  2.701   1.00 0.00 ? 36 ARG A CB   6  
ATOM   5075  C CG   . ARG A 1 36 ? -2.521  -4.826  1.799   1.00 0.00 ? 36 ARG A CG   6  
ATOM   5076  C CD   . ARG A 1 36 ? -3.198  -4.816  0.432   1.00 0.00 ? 36 ARG A CD   6  
ATOM   5077  N NE   . ARG A 1 36 ? -4.540  -5.394  0.507   1.00 0.00 ? 36 ARG A NE   6  
ATOM   5078  C CZ   . ARG A 1 36 ? -5.143  -5.969  -0.543  1.00 0.00 ? 36 ARG A CZ   6  
ATOM   5079  N NH1  . ARG A 1 36 ? -4.514  -6.032  -1.725  1.00 0.00 ? 36 ARG A NH1  6  
ATOM   5080  N NH2  . ARG A 1 36 ? -6.375  -6.479  -0.412  1.00 0.00 ? 36 ARG A NH2  6  
ATOM   5081  H H    . ARG A 1 36 ? -2.522  -4.878  5.410   1.00 0.00 ? 36 ARG A H    6  
ATOM   5082  H HA   . ARG A 1 36 ? -1.313  -3.050  3.459   1.00 0.00 ? 36 ARG A HA   6  
ATOM   5083  H HB2  . ARG A 1 36 ? -4.115  -4.183  3.092   1.00 0.00 ? 36 ARG A HB2  6  
ATOM   5084  H HB3  . ARG A 1 36 ? -3.379  -2.882  2.126   1.00 0.00 ? 36 ARG A HB3  6  
ATOM   5085  H HG2  . ARG A 1 36 ? -1.463  -4.589  1.682   1.00 0.00 ? 36 ARG A HG2  6  
ATOM   5086  H HG3  . ARG A 1 36 ? -2.624  -5.814  2.249   1.00 0.00 ? 36 ARG A HG3  6  
ATOM   5087  H HD2  . ARG A 1 36 ? -3.271  -3.789  0.076   1.00 0.00 ? 36 ARG A HD2  6  
ATOM   5088  H HD3  . ARG A 1 36 ? -2.598  -5.396  -0.269  1.00 0.00 ? 36 ARG A HD3  6  
ATOM   5089  H HE   . ARG A 1 36 ? -5.023  -5.352  1.393   1.00 0.00 ? 36 ARG A HE   6  
ATOM   5090  H HH11 . ARG A 1 36 ? -3.585  -5.647  -1.823  1.00 0.00 ? 36 ARG A HH11 6  
ATOM   5091  H HH12 . ARG A 1 36 ? -4.968  -6.465  -2.516  1.00 0.00 ? 36 ARG A HH12 6  
ATOM   5092  H HH21 . ARG A 1 36 ? -6.849  -6.432  0.478   1.00 0.00 ? 36 ARG A HH21 6  
ATOM   5093  H HH22 . ARG A 1 36 ? -6.829  -6.912  -1.204  1.00 0.00 ? 36 ARG A HH22 6  
ATOM   5094  N N    . GLY A 1 37 ? -2.903  -1.183  4.299   1.00 0.00 ? 37 GLY A N    6  
ATOM   5095  C CA   . GLY A 1 37 ? -3.476  -0.094  5.071   1.00 0.00 ? 37 GLY A CA   6  
ATOM   5096  C C    . GLY A 1 37 ? -3.520  1.196   4.249   1.00 0.00 ? 37 GLY A C    6  
ATOM   5097  O O    . GLY A 1 37 ? -3.130  1.207   3.082   1.00 0.00 ? 37 GLY A O    6  
ATOM   5098  H H    . GLY A 1 37 ? -2.545  -0.923  3.402   1.00 0.00 ? 37 GLY A H    6  
ATOM   5099  H HA2  . GLY A 1 37 ? -4.484  -0.360  5.390   1.00 0.00 ? 37 GLY A HA2  6  
ATOM   5100  H HA3  . GLY A 1 37 ? -2.887  0.066   5.974   1.00 0.00 ? 37 GLY A HA3  6  
ATOM   5101  N N    . CYS A 1 38 ? -3.998  2.253   4.890   1.00 0.00 ? 38 CYS A N    6  
ATOM   5102  C CA   . CYS A 1 38 ? -4.098  3.545   4.233   1.00 0.00 ? 38 CYS A CA   6  
ATOM   5103  C C    . CYS A 1 38 ? -2.988  4.447   4.775   1.00 0.00 ? 38 CYS A C    6  
ATOM   5104  O O    . CYS A 1 38 ? -2.679  4.410   5.965   1.00 0.00 ? 38 CYS A O    6  
ATOM   5105  C CB   . CYS A 1 38 ? -5.483  4.169   4.420   1.00 0.00 ? 38 CYS A CB   6  
ATOM   5106  S SG   . CYS A 1 38 ? -6.842  3.293   3.563   1.00 0.00 ? 38 CYS A SG   6  
ATOM   5107  H H    . CYS A 1 38 ? -4.313  2.236   5.839   1.00 0.00 ? 38 CYS A H    6  
ATOM   5108  H HA   . CYS A 1 38 ? -3.965  3.365   3.166   1.00 0.00 ? 38 CYS A HA   6  
ATOM   5109  H HB2  . CYS A 1 38 ? -5.708  4.206   5.486   1.00 0.00 ? 38 CYS A HB2  6  
ATOM   5110  H HB3  . CYS A 1 38 ? -5.452  5.199   4.065   1.00 0.00 ? 38 CYS A HB3  6  
ATOM   5111  N N    . ILE A 1 39 ? -2.418  5.235   3.876   1.00 0.00 ? 39 ILE A N    6  
ATOM   5112  C CA   . ILE A 1 39 ? -1.348  6.145   4.249   1.00 0.00 ? 39 ILE A CA   6  
ATOM   5113  C C    . ILE A 1 39 ? -1.427  7.402   3.380   1.00 0.00 ? 39 ILE A C    6  
ATOM   5114  O O    . ILE A 1 39 ? -2.296  7.510   2.517   1.00 0.00 ? 39 ILE A O    6  
ATOM   5115  C CB   . ILE A 1 39 ? 0.006   5.436   4.183   1.00 0.00 ? 39 ILE A CB   6  
ATOM   5116  C CG1  . ILE A 1 39 ? 0.917   5.886   5.327   1.00 0.00 ? 39 ILE A CG1  6  
ATOM   5117  C CG2  . ILE A 1 39 ? 0.663   5.635   2.815   1.00 0.00 ? 39 ILE A CG2  6  
ATOM   5118  C CD1  . ILE A 1 39 ? 0.879   4.886   6.484   1.00 0.00 ? 39 ILE A CD1  6  
ATOM   5119  H H    . ILE A 1 39 ? -2.675  5.259   2.910   1.00 0.00 ? 39 ILE A H    6  
ATOM   5120  H HA   . ILE A 1 39 ? -1.511  6.432   5.288   1.00 0.00 ? 39 ILE A HA   6  
ATOM   5121  H HB   . ILE A 1 39 ? -0.162  4.366   4.307   1.00 0.00 ? 39 ILE A HB   6  
ATOM   5122  H HG12 . ILE A 1 39 ? 1.939   5.988   4.964   1.00 0.00 ? 39 ILE A HG12 6  
ATOM   5123  H HG13 . ILE A 1 39 ? 0.604   6.869   5.681   1.00 0.00 ? 39 ILE A HG13 6  
ATOM   5124  H HG21 . ILE A 1 39 ? 1.652   5.177   2.818   1.00 0.00 ? 39 ILE A HG21 6  
ATOM   5125  H HG22 . ILE A 1 39 ? 0.048   5.167   2.046   1.00 0.00 ? 39 ILE A HG22 6  
ATOM   5126  H HD11 . ILE A 1 39 ? 0.843   3.871   6.087   1.00 0.00 ? 39 ILE A HD11 6  
ATOM   5127  H HD12 . ILE A 1 39 ? 1.772   5.005   7.097   1.00 0.00 ? 39 ILE A HD12 6  
ATOM   5128  N N    . ASP A 1 40 ? -0.516  8.349   3.614   1.00 0.00 ? 40 ASP A N    6  
ATOM   5129  C CA   . ASP A 1 40 ? -0.487  9.585   2.859   1.00 0.00 ? 40 ASP A CA   6  
ATOM   5130  C C    . ASP A 1 40 ? 0.745   9.614   1.965   1.00 0.00 ? 40 ASP A C    6  
ATOM   5131  O O    . ASP A 1 40 ? 0.670   10.041  0.815   1.00 0.00 ? 40 ASP A O    6  
ATOM   5132  C CB   . ASP A 1 40 ? -0.484  10.769  3.822   1.00 0.00 ? 40 ASP A CB   6  
ATOM   5133  C CG   . ASP A 1 40 ? 0.628   10.629  4.852   1.00 0.00 ? 40 ASP A CG   6  
ATOM   5134  O OD1  . ASP A 1 40 ? 1.299   11.653  5.105   1.00 0.00 ? 40 ASP A OD1  6  
ATOM   5135  O OD2  . ASP A 1 40 ? 0.787   9.501   5.366   1.00 0.00 ? 40 ASP A OD2  6  
ATOM   5136  H H    . ASP A 1 40 ? 0.177   8.211   4.335   1.00 0.00 ? 40 ASP A H    6  
ATOM   5137  H HA   . ASP A 1 40 ? -1.378  9.640   2.233   1.00 0.00 ? 40 ASP A HA   6  
ATOM   5138  H HB2  . ASP A 1 40 ? -0.336  11.690  3.258   1.00 0.00 ? 40 ASP A HB2  6  
ATOM   5139  H HB3  . ASP A 1 40 ? -1.444  10.814  4.336   1.00 0.00 ? 40 ASP A HB3  6  
ATOM   5140  H HD2  . ASP A 1 40 ? 1.502   9.478   6.006   1.00 0.00 ? 40 ASP A HD2  6  
ATOM   5141  N N    . VAL A 1 41 ? 1.855   9.154   2.525   1.00 0.00 ? 41 VAL A N    6  
ATOM   5142  C CA   . VAL A 1 41 ? 3.107   9.123   1.788   1.00 0.00 ? 41 VAL A CA   6  
ATOM   5143  C C    . VAL A 1 41 ? 3.592   7.676   1.677   1.00 0.00 ? 41 VAL A C    6  
ATOM   5144  O O    . VAL A 1 41 ? 3.270   6.843   2.522   1.00 0.00 ? 41 VAL A O    6  
ATOM   5145  C CB   . VAL A 1 41 ? 4.129   10.047  2.453   1.00 0.00 ? 41 VAL A CB   6  
ATOM   5146  C CG1  . VAL A 1 41 ? 3.668   11.505  2.398   1.00 0.00 ? 41 VAL A CG1  6  
ATOM   5147  C CG2  . VAL A 1 41 ? 4.404   9.613   3.894   1.00 0.00 ? 41 VAL A CG2  6  
ATOM   5148  H H    . VAL A 1 41 ? 1.908   8.808   3.462   1.00 0.00 ? 41 VAL A H    6  
ATOM   5149  H HA   . VAL A 1 41 ? 2.908   9.505   0.787   1.00 0.00 ? 41 VAL A HA   6  
ATOM   5150  H HB   . VAL A 1 41 ? 5.063   9.969   1.896   1.00 0.00 ? 41 VAL A HB   6  
ATOM   5151  H HG11 . VAL A 1 41 ? 4.539   12.159  2.354   1.00 0.00 ? 41 VAL A HG11 6  
ATOM   5152  H HG12 . VAL A 1 41 ? 3.054   11.658  1.511   1.00 0.00 ? 41 VAL A HG12 6  
ATOM   5153  H HG21 . VAL A 1 41 ? 3.623   10.004  4.547   1.00 0.00 ? 41 VAL A HG21 6  
ATOM   5154  H HG22 . VAL A 1 41 ? 4.413   8.524   3.951   1.00 0.00 ? 41 VAL A HG22 6  
ATOM   5155  N N    . CYS A 1 42 ? 4.360   7.422   0.627   1.00 0.00 ? 42 CYS A N    6  
ATOM   5156  C CA   . CYS A 1 42 ? 4.893   6.091   0.394   1.00 0.00 ? 42 CYS A CA   6  
ATOM   5157  C C    . CYS A 1 42 ? 6.257   5.993   1.079   1.00 0.00 ? 42 CYS A C    6  
ATOM   5158  O O    . CYS A 1 42 ? 7.120   6.846   0.878   1.00 0.00 ? 42 CYS A O    6  
ATOM   5159  C CB   . CYS A 1 42 ? 4.980   5.769   -1.099  1.00 0.00 ? 42 CYS A CB   6  
ATOM   5160  S SG   . CYS A 1 42 ? 4.520   4.055   -1.544  1.00 0.00 ? 42 CYS A SG   6  
ATOM   5161  H H    . CYS A 1 42 ? 4.617   8.106   -0.056  1.00 0.00 ? 42 CYS A H    6  
ATOM   5162  H HA   . CYS A 1 42 ? 4.186   5.389   0.837   1.00 0.00 ? 42 CYS A HA   6  
ATOM   5163  H HB2  . CYS A 1 42 ? 4.332   6.457   -1.643  1.00 0.00 ? 42 CYS A HB2  6  
ATOM   5164  H HB3  . CYS A 1 42 ? 5.999   5.957   -1.438  1.00 0.00 ? 42 CYS A HB3  6  
ATOM   5165  N N    . PRO A 1 43 ? 6.414   4.917   1.896   1.00 0.00 ? 43 PRO A N    6  
ATOM   5166  C CA   . PRO A 1 43 ? 7.659   4.696   2.612   1.00 0.00 ? 43 PRO A CA   6  
ATOM   5167  C C    . PRO A 1 43 ? 8.750   4.184   1.670   1.00 0.00 ? 43 PRO A C    6  
ATOM   5168  O O    . PRO A 1 43 ? 8.456   3.706   0.575   1.00 0.00 ? 43 PRO A O    6  
ATOM   5169  C CB   . PRO A 1 43 ? 7.310   3.706   3.712   1.00 0.00 ? 43 PRO A CB   6  
ATOM   5170  C CG   . PRO A 1 43 ? 6.003   3.056   3.288   1.00 0.00 ? 43 PRO A CG   6  
ATOM   5171  C CD   . PRO A 1 43 ? 5.414   3.886   2.159   1.00 0.00 ? 43 PRO A CD   6  
ATOM   5172  H HA   . PRO A 1 43 ? 8.002   5.558   2.985   1.00 0.00 ? 43 PRO A HA   6  
ATOM   5173  H HB2  . PRO A 1 43 ? 8.097   2.961   3.830   1.00 0.00 ? 43 PRO A HB2  6  
ATOM   5174  H HB3  . PRO A 1 43 ? 7.202   4.211   4.672   1.00 0.00 ? 43 PRO A HB3  6  
ATOM   5175  H HG2  . PRO A 1 43 ? 6.176   2.031   2.958   1.00 0.00 ? 43 PRO A HG2  6  
ATOM   5176  H HG3  . PRO A 1 43 ? 5.311   3.008   4.128   1.00 0.00 ? 43 PRO A HG3  6  
ATOM   5177  H HD2  . PRO A 1 43 ? 5.231   3.277   1.273   1.00 0.00 ? 43 PRO A HD2  6  
ATOM   5178  H HD3  . PRO A 1 43 ? 4.459   4.325   2.447   1.00 0.00 ? 43 PRO A HD3  6  
ATOM   5179  N N    . LYS A 1 44 ? 9.987   4.300   2.130   1.00 0.00 ? 44 LYS A N    6  
ATOM   5180  C CA   . LYS A 1 44 ? 11.124  3.854   1.342   1.00 0.00 ? 44 LYS A CA   6  
ATOM   5181  C C    . LYS A 1 44 ? 10.995  2.353   1.073   1.00 0.00 ? 44 LYS A C    6  
ATOM   5182  O O    . LYS A 1 44 ? 10.568  1.597   1.944   1.00 0.00 ? 44 LYS A O    6  
ATOM   5183  C CB   . LYS A 1 44 ? 12.436  4.245   2.025   1.00 0.00 ? 44 LYS A CB   6  
ATOM   5184  C CG   . LYS A 1 44 ? 13.639  3.693   1.259   1.00 0.00 ? 44 LYS A CG   6  
ATOM   5185  C CD   . LYS A 1 44 ? 14.853  4.612   1.406   1.00 0.00 ? 44 LYS A CD   6  
ATOM   5186  C CE   . LYS A 1 44 ? 15.889  4.331   0.317   1.00 0.00 ? 44 LYS A CE   6  
ATOM   5187  N NZ   . LYS A 1 44 ? 15.433  4.868   -0.984  1.00 0.00 ? 44 LYS A NZ   6  
ATOM   5188  H H    . LYS A 1 44 ? 10.218  4.689   3.022   1.00 0.00 ? 44 LYS A H    6  
ATOM   5189  H HA   . LYS A 1 44 ? 11.087  4.381   0.389   1.00 0.00 ? 44 LYS A HA   6  
ATOM   5190  H HB2  . LYS A 1 44 ? 12.508  5.331   2.088   1.00 0.00 ? 44 LYS A HB2  6  
ATOM   5191  H HB3  . LYS A 1 44 ? 12.445  3.866   3.047   1.00 0.00 ? 44 LYS A HB3  6  
ATOM   5192  H HG2  . LYS A 1 44 ? 13.885  2.697   1.630   1.00 0.00 ? 44 LYS A HG2  6  
ATOM   5193  H HG3  . LYS A 1 44 ? 13.385  3.586   0.204   1.00 0.00 ? 44 LYS A HG3  6  
ATOM   5194  H HD2  . LYS A 1 44 ? 14.534  5.653   1.350   1.00 0.00 ? 44 LYS A HD2  6  
ATOM   5195  H HD3  . LYS A 1 44 ? 15.304  4.470   2.388   1.00 0.00 ? 44 LYS A HD3  6  
ATOM   5196  H HE2  . LYS A 1 44 ? 16.843  4.783   0.589   1.00 0.00 ? 44 LYS A HE2  6  
ATOM   5197  H HE3  . LYS A 1 44 ? 16.057  3.257   0.235   1.00 0.00 ? 44 LYS A HE3  6  
ATOM   5198  H HZ1  . LYS A 1 44 ? 15.173  4.111   -1.585  1.00 0.00 ? 44 LYS A HZ1  6  
ATOM   5199  H HZ2  . LYS A 1 44 ? 14.643  5.465   -0.840  1.00 0.00 ? 44 LYS A HZ2  6  
ATOM   5200  N N    . SER A 1 45 ? 11.371  1.967   -0.137  1.00 0.00 ? 45 SER A N    6  
ATOM   5201  C CA   . SER A 1 45 ? 11.303  0.571   -0.533  1.00 0.00 ? 45 SER A CA   6  
ATOM   5202  C C    . SER A 1 45 ? 12.693  -0.064  -0.453  1.00 0.00 ? 45 SER A C    6  
ATOM   5203  O O    . SER A 1 45 ? 13.676  0.529   -0.894  1.00 0.00 ? 45 SER A O    6  
ATOM   5204  C CB   . SER A 1 45 ? 10.733  0.425   -1.945  1.00 0.00 ? 45 SER A CB   6  
ATOM   5205  O OG   . SER A 1 45 ? 9.317   0.265   -1.935  1.00 0.00 ? 45 SER A OG   6  
ATOM   5206  H H    . SER A 1 45 ? 11.717  2.589   -0.840  1.00 0.00 ? 45 SER A H    6  
ATOM   5207  H HA   . SER A 1 45 ? 10.627  0.101   0.182   1.00 0.00 ? 45 SER A HA   6  
ATOM   5208  H HB2  . SER A 1 45 ? 10.994  1.305   -2.534  1.00 0.00 ? 45 SER A HB2  6  
ATOM   5209  H HB3  . SER A 1 45 ? 11.192  -0.434  -2.434  1.00 0.00 ? 45 SER A HB3  6  
ATOM   5210  H HG   . SER A 1 45 ? 8.985   0.218   -0.994  1.00 0.00 ? 45 SER A HG   6  
ATOM   5211  N N    . SER A 1 46 ? 12.730  -1.262  0.112   1.00 0.00 ? 46 SER A N    6  
ATOM   5212  C CA   . SER A 1 46 ? 13.983  -1.984  0.254   1.00 0.00 ? 46 SER A CA   6  
ATOM   5213  C C    . SER A 1 46 ? 13.956  -3.253  -0.599  1.00 0.00 ? 46 SER A C    6  
ATOM   5214  O O    . SER A 1 46 ? 12.969  -3.526  -1.280  1.00 0.00 ? 46 SER A O    6  
ATOM   5215  C CB   . SER A 1 46 ? 14.252  -2.335  1.719   1.00 0.00 ? 46 SER A CB   6  
ATOM   5216  O OG   . SER A 1 46 ? 13.575  -3.524  2.116   1.00 0.00 ? 46 SER A OG   6  
ATOM   5217  H H    . SER A 1 46 ? 11.925  -1.738  0.467   1.00 0.00 ? 46 SER A H    6  
ATOM   5218  H HA   . SER A 1 46 ? 14.752  -1.299  -0.102  1.00 0.00 ? 46 SER A HA   6  
ATOM   5219  H HB2  . SER A 1 46 ? 15.325  -2.460  1.870   1.00 0.00 ? 46 SER A HB2  6  
ATOM   5220  H HB3  . SER A 1 46 ? 13.936  -1.507  2.354   1.00 0.00 ? 46 SER A HB3  6  
ATOM   5221  H HG   . SER A 1 46 ? 14.234  -4.263  2.255   1.00 0.00 ? 46 SER A HG   6  
ATOM   5222  N N    . LEU A 1 47 ? 15.052  -3.994  -0.535  1.00 0.00 ? 47 LEU A N    6  
ATOM   5223  C CA   . LEU A 1 47 ? 15.167  -5.228  -1.294  1.00 0.00 ? 47 LEU A CA   6  
ATOM   5224  C C    . LEU A 1 47 ? 14.381  -6.333  -0.585  1.00 0.00 ? 47 LEU A C    6  
ATOM   5225  O O    . LEU A 1 47 ? 13.603  -7.049  -1.214  1.00 0.00 ? 47 LEU A O    6  
ATOM   5226  C CB   . LEU A 1 47 ? 16.637  -5.576  -1.532  1.00 0.00 ? 47 LEU A CB   6  
ATOM   5227  C CG   . LEU A 1 47 ? 17.505  -4.459  -2.116  1.00 0.00 ? 47 LEU A CG   6  
ATOM   5228  C CD1  . LEU A 1 47 ? 18.946  -4.566  -1.615  1.00 0.00 ? 47 LEU A CD1  6  
ATOM   5229  C CD2  . LEU A 1 47 ? 17.428  -4.447  -3.644  1.00 0.00 ? 47 LEU A CD2  6  
ATOM   5230  H H    . LEU A 1 47 ? 15.851  -3.765  0.021   1.00 0.00 ? 47 LEU A H    6  
ATOM   5231  H HA   . LEU A 1 47 ? 14.714  -5.055  -2.270  1.00 0.00 ? 47 LEU A HA   6  
ATOM   5232  H HB2  . LEU A 1 47 ? 17.074  -5.890  -0.584  1.00 0.00 ? 47 LEU A HB2  6  
ATOM   5233  H HB3  . LEU A 1 47 ? 16.683  -6.433  -2.204  1.00 0.00 ? 47 LEU A HB3  6  
ATOM   5234  H HG   . LEU A 1 47 ? 17.112  -3.504  -1.767  1.00 0.00 ? 47 LEU A HG   6  
ATOM   5235  H HD11 . LEU A 1 47 ? 19.107  -5.551  -1.178  1.00 0.00 ? 47 LEU A HD11 6  
ATOM   5236  H HD12 . LEU A 1 47 ? 19.633  -4.422  -2.450  1.00 0.00 ? 47 LEU A HD12 6  
ATOM   5237  H HD21 . LEU A 1 47 ? 17.986  -5.295  -4.042  1.00 0.00 ? 47 LEU A HD21 6  
ATOM   5238  H HD22 . LEU A 1 47 ? 16.387  -4.519  -3.956  1.00 0.00 ? 47 LEU A HD22 6  
ATOM   5239  N N    . LEU A 1 48 ? 14.610  -6.436  0.716   1.00 0.00 ? 48 LEU A N    6  
ATOM   5240  C CA   . LEU A 1 48 ? 13.933  -7.442  1.518   1.00 0.00 ? 48 LEU A CA   6  
ATOM   5241  C C    . LEU A 1 48 ? 12.422  -7.324  1.306   1.00 0.00 ? 48 LEU A C    6  
ATOM   5242  O O    . LEU A 1 48 ? 11.779  -8.272  0.858   1.00 0.00 ? 48 LEU A O    6  
ATOM   5243  C CB   . LEU A 1 48 ? 14.359  -7.334  2.984   1.00 0.00 ? 48 LEU A CB   6  
ATOM   5244  C CG   . LEU A 1 48 ? 13.855  -8.442  3.911   1.00 0.00 ? 48 LEU A CG   6  
ATOM   5245  C CD1  . LEU A 1 48 ? 14.976  -9.427  4.248   1.00 0.00 ? 48 LEU A CD1  6  
ATOM   5246  C CD2  . LEU A 1 48 ? 13.212  -7.853  5.169   1.00 0.00 ? 48 LEU A CD2  6  
ATOM   5247  H H    . LEU A 1 48 ? 15.244  -5.850  1.221   1.00 0.00 ? 48 LEU A H    6  
ATOM   5248  H HA   . LEU A 1 48 ? 14.258  -8.418  1.159   1.00 0.00 ? 48 LEU A HA   6  
ATOM   5249  H HB2  . LEU A 1 48 ? 15.448  -7.320  3.025   1.00 0.00 ? 48 LEU A HB2  6  
ATOM   5250  H HB3  . LEU A 1 48 ? 14.012  -6.376  3.372   1.00 0.00 ? 48 LEU A HB3  6  
ATOM   5251  H HG   . LEU A 1 48 ? 13.081  -9.002  3.386   1.00 0.00 ? 48 LEU A HG   6  
ATOM   5252  H HD11 . LEU A 1 48 ? 15.308  -9.263  5.273   1.00 0.00 ? 48 LEU A HD11 6  
ATOM   5253  H HD12 . LEU A 1 48 ? 14.607  -10.447 4.143   1.00 0.00 ? 48 LEU A HD12 6  
ATOM   5254  H HD21 . LEU A 1 48 ? 12.936  -6.815  4.984   1.00 0.00 ? 48 LEU A HD21 6  
ATOM   5255  H HD22 . LEU A 1 48 ? 12.321  -8.427  5.424   1.00 0.00 ? 48 LEU A HD22 6  
ATOM   5256  N N    . VAL A 1 49 ? 11.900  -6.153  1.638   1.00 0.00 ? 49 VAL A N    6  
ATOM   5257  C CA   . VAL A 1 49 ? 10.477  -5.899  1.489   1.00 0.00 ? 49 VAL A CA   6  
ATOM   5258  C C    . VAL A 1 49 ? 10.272  -4.663  0.612   1.00 0.00 ? 49 VAL A C    6  
ATOM   5259  O O    . VAL A 1 49 ? 11.105  -3.758  0.605   1.00 0.00 ? 49 VAL A O    6  
ATOM   5260  C CB   . VAL A 1 49 ? 9.822   -5.770  2.866   1.00 0.00 ? 49 VAL A CB   6  
ATOM   5261  C CG1  . VAL A 1 49 ? 9.968   -7.066  3.667   1.00 0.00 ? 49 VAL A CG1  6  
ATOM   5262  C CG2  . VAL A 1 49 ? 10.397  -4.581  3.638   1.00 0.00 ? 49 VAL A CG2  6  
ATOM   5263  H H    . VAL A 1 49 ? 12.430  -5.387  2.002   1.00 0.00 ? 49 VAL A H    6  
ATOM   5264  H HA   . VAL A 1 49 ? 10.040  -6.762  0.987   1.00 0.00 ? 49 VAL A HA   6  
ATOM   5265  H HB   . VAL A 1 49 ? 8.758   -5.589  2.715   1.00 0.00 ? 49 VAL A HB   6  
ATOM   5266  H HG11 . VAL A 1 49 ? 8.981   -7.442  3.934   1.00 0.00 ? 49 VAL A HG11 6  
ATOM   5267  H HG12 . VAL A 1 49 ? 10.489  -7.809  3.062   1.00 0.00 ? 49 VAL A HG12 6  
ATOM   5268  H HG21 . VAL A 1 49 ? 11.362  -4.305  3.213   1.00 0.00 ? 49 VAL A HG21 6  
ATOM   5269  H HG22 . VAL A 1 49 ? 9.713   -3.736  3.565   1.00 0.00 ? 49 VAL A HG22 6  
ATOM   5270  N N    . LYS A 1 50 ? 9.159   -4.664  -0.106  1.00 0.00 ? 50 LYS A N    6  
ATOM   5271  C CA   . LYS A 1 50 ? 8.834   -3.553  -0.985  1.00 0.00 ? 50 LYS A CA   6  
ATOM   5272  C C    . LYS A 1 50 ? 7.397   -3.102  -0.721  1.00 0.00 ? 50 LYS A C    6  
ATOM   5273  O O    . LYS A 1 50 ? 6.597   -3.857  -0.169  1.00 0.00 ? 50 LYS A O    6  
ATOM   5274  C CB   . LYS A 1 50 ? 9.103   -3.929  -2.444  1.00 0.00 ? 50 LYS A CB   6  
ATOM   5275  C CG   . LYS A 1 50 ? 9.840   -2.804  -3.173  1.00 0.00 ? 50 LYS A CG   6  
ATOM   5276  C CD   . LYS A 1 50 ? 9.491   -2.794  -4.663  1.00 0.00 ? 50 LYS A CD   6  
ATOM   5277  C CE   . LYS A 1 50 ? 9.633   -1.388  -5.250  1.00 0.00 ? 50 LYS A CE   6  
ATOM   5278  N NZ   . LYS A 1 50 ? 9.905   -1.458  -6.703  1.00 0.00 ? 50 LYS A NZ   6  
ATOM   5279  H H    . LYS A 1 50 ? 8.487   -5.404  -0.095  1.00 0.00 ? 50 LYS A H    6  
ATOM   5280  H HA   . LYS A 1 50 ? 9.506   -2.732  -0.735  1.00 0.00 ? 50 LYS A HA   6  
ATOM   5281  H HB2  . LYS A 1 50 ? 9.694   -4.843  -2.486  1.00 0.00 ? 50 LYS A HB2  6  
ATOM   5282  H HB3  . LYS A 1 50 ? 8.159   -4.137  -2.949  1.00 0.00 ? 50 LYS A HB3  6  
ATOM   5283  H HG2  . LYS A 1 50 ? 9.578   -1.844  -2.728  1.00 0.00 ? 50 LYS A HG2  6  
ATOM   5284  H HG3  . LYS A 1 50 ? 10.916  -2.929  -3.049  1.00 0.00 ? 50 LYS A HG3  6  
ATOM   5285  H HD2  . LYS A 1 50 ? 10.144  -3.483  -5.198  1.00 0.00 ? 50 LYS A HD2  6  
ATOM   5286  H HD3  . LYS A 1 50 ? 8.470   -3.149  -4.802  1.00 0.00 ? 50 LYS A HD3  6  
ATOM   5287  H HE2  . LYS A 1 50 ? 8.720   -0.819  -5.072  1.00 0.00 ? 50 LYS A HE2  6  
ATOM   5288  H HE3  . LYS A 1 50 ? 10.441  -0.857  -4.747  1.00 0.00 ? 50 LYS A HE3  6  
ATOM   5289  H HZ1  . LYS A 1 50 ? 9.701   -2.379  -7.036  1.00 0.00 ? 50 LYS A HZ1  6  
ATOM   5290  H HZ2  . LYS A 1 50 ? 9.330   -0.795  -7.182  1.00 0.00 ? 50 LYS A HZ2  6  
ATOM   5291  N N    . TYR A 1 51 ? 7.111   -1.874  -1.127  1.00 0.00 ? 51 TYR A N    6  
ATOM   5292  C CA   . TYR A 1 51 ? 5.784   -1.313  -0.940  1.00 0.00 ? 51 TYR A CA   6  
ATOM   5293  C C    . TYR A 1 51 ? 5.279   -0.659  -2.228  1.00 0.00 ? 51 TYR A C    6  
ATOM   5294  O O    . TYR A 1 51 ? 6.060   -0.082  -2.983  1.00 0.00 ? 51 TYR A O    6  
ATOM   5295  C CB   . TYR A 1 51 ? 5.927   -0.240  0.140   1.00 0.00 ? 51 TYR A CB   6  
ATOM   5296  C CG   . TYR A 1 51 ? 6.783   -0.669  1.334   1.00 0.00 ? 51 TYR A CG   6  
ATOM   5297  C CD1  . TYR A 1 51 ? 6.612   -1.919  1.892   1.00 0.00 ? 51 TYR A CD1  6  
ATOM   5298  C CD2  . TYR A 1 51 ? 7.727   0.195   1.851   1.00 0.00 ? 51 TYR A CD2  6  
ATOM   5299  C CE1  . TYR A 1 51 ? 7.418   -2.323  3.015   1.00 0.00 ? 51 TYR A CE1  6  
ATOM   5300  C CE2  . TYR A 1 51 ? 8.533   -0.209  2.975   1.00 0.00 ? 51 TYR A CE2  6  
ATOM   5301  C CZ   . TYR A 1 51 ? 8.338   -1.448  3.501   1.00 0.00 ? 51 TYR A CZ   6  
ATOM   5302  O OH   . TYR A 1 51 ? 9.099   -1.829  4.562   1.00 0.00 ? 51 TYR A OH   6  
ATOM   5303  H H    . TYR A 1 51 ? 7.767   -1.267  -1.575  1.00 0.00 ? 51 TYR A H    6  
ATOM   5304  H HA   . TYR A 1 51 ? 5.111   -2.126  -0.667  1.00 0.00 ? 51 TYR A HA   6  
ATOM   5305  H HB2  . TYR A 1 51 ? 6.365   0.654   -0.305  1.00 0.00 ? 51 TYR A HB2  6  
ATOM   5306  H HB3  . TYR A 1 51 ? 4.935   0.035   0.498   1.00 0.00 ? 51 TYR A HB3  6  
ATOM   5307  H HD1  . TYR A 1 51 ? 5.866   -2.601  1.483   1.00 0.00 ? 51 TYR A HD1  6  
ATOM   5308  H HD2  . TYR A 1 51 ? 7.863   1.182   1.410   1.00 0.00 ? 51 TYR A HD2  6  
ATOM   5309  H HE1  . TYR A 1 51 ? 7.292   -3.307  3.466   1.00 0.00 ? 51 TYR A HE1  6  
ATOM   5310  H HE2  . TYR A 1 51 ? 9.282   0.463   3.393   1.00 0.00 ? 51 TYR A HE2  6  
ATOM   5311  H HH   . TYR A 1 51 ? 10.024  -1.460  4.469   1.00 0.00 ? 51 TYR A HH   6  
ATOM   5312  N N    . VAL A 1 52 ? 3.976   -0.771  -2.440  1.00 0.00 ? 52 VAL A N    6  
ATOM   5313  C CA   . VAL A 1 52 ? 3.358   -0.198  -3.623  1.00 0.00 ? 52 VAL A CA   6  
ATOM   5314  C C    . VAL A 1 52 ? 2.213   0.725   -3.199  1.00 0.00 ? 52 VAL A C    6  
ATOM   5315  O O    . VAL A 1 52 ? 1.408   0.367   -2.340  1.00 0.00 ? 52 VAL A O    6  
ATOM   5316  C CB   . VAL A 1 52 ? 2.908   -1.312  -4.570  1.00 0.00 ? 52 VAL A CB   6  
ATOM   5317  C CG1  . VAL A 1 52 ? 1.965   -0.770  -5.646  1.00 0.00 ? 52 VAL A CG1  6  
ATOM   5318  C CG2  . VAL A 1 52 ? 4.112   -2.016  -5.200  1.00 0.00 ? 52 VAL A CG2  6  
ATOM   5319  H H    . VAL A 1 52 ? 3.348   -1.242  -1.821  1.00 0.00 ? 52 VAL A H    6  
ATOM   5320  H HA   . VAL A 1 52 ? 4.115   0.395   -4.135  1.00 0.00 ? 52 VAL A HA   6  
ATOM   5321  H HB   . VAL A 1 52 ? 2.359   -2.049  -3.984  1.00 0.00 ? 52 VAL A HB   6  
ATOM   5322  H HG11 . VAL A 1 52 ? 2.263   -1.158  -6.620  1.00 0.00 ? 52 VAL A HG11 6  
ATOM   5323  H HG12 . VAL A 1 52 ? 0.944   -1.083  -5.427  1.00 0.00 ? 52 VAL A HG12 6  
ATOM   5324  H HG21 . VAL A 1 52 ? 3.815   -3.008  -5.540  1.00 0.00 ? 52 VAL A HG21 6  
ATOM   5325  H HG22 . VAL A 1 52 ? 4.470   -1.433  -6.049  1.00 0.00 ? 52 VAL A HG22 6  
ATOM   5326  N N    . CYS A 1 53 ? 2.177   1.894   -3.821  1.00 0.00 ? 53 CYS A N    6  
ATOM   5327  C CA   . CYS A 1 53 ? 1.145   2.871   -3.519  1.00 0.00 ? 53 CYS A CA   6  
ATOM   5328  C C    . CYS A 1 53 ? 0.375   3.170   -4.807  1.00 0.00 ? 53 CYS A C    6  
ATOM   5329  O O    . CYS A 1 53 ? 0.872   2.920   -5.904  1.00 0.00 ? 53 CYS A O    6  
ATOM   5330  C CB   . CYS A 1 53 ? 1.731   4.139   -2.896  1.00 0.00 ? 53 CYS A CB   6  
ATOM   5331  S SG   . CYS A 1 53 ? 2.547   3.893   -1.277  1.00 0.00 ? 53 CYS A SG   6  
ATOM   5332  H H    . CYS A 1 53 ? 2.836   2.177   -4.518  1.00 0.00 ? 53 CYS A H    6  
ATOM   5333  H HA   . CYS A 1 53 ? 0.491   2.416   -2.775  1.00 0.00 ? 53 CYS A HA   6  
ATOM   5334  H HB2  . CYS A 1 53 ? 2.455   4.567   -3.590  1.00 0.00 ? 53 CYS A HB2  6  
ATOM   5335  H HB3  . CYS A 1 53 ? 0.932   4.871   -2.777  1.00 0.00 ? 53 CYS A HB3  6  
ATOM   5336  N N    . CYS A 1 54 ? -0.825  3.703   -4.631  1.00 0.00 ? 54 CYS A N    6  
ATOM   5337  C CA   . CYS A 1 54 ? -1.668  4.039   -5.765  1.00 0.00 ? 54 CYS A CA   6  
ATOM   5338  C C    . CYS A 1 54 ? -2.864  4.845   -5.253  1.00 0.00 ? 54 CYS A C    6  
ATOM   5339  O O    . CYS A 1 54 ? -3.178  4.809   -4.065  1.00 0.00 ? 54 CYS A O    6  
ATOM   5340  C CB   . CYS A 1 54 ? -2.108  2.791   -6.534  1.00 0.00 ? 54 CYS A CB   6  
ATOM   5341  S SG   . CYS A 1 54 ? -2.121  1.249   -5.549  1.00 0.00 ? 54 CYS A SG   6  
ATOM   5342  H H    . CYS A 1 54 ? -1.222  3.904   -3.735  1.00 0.00 ? 54 CYS A H    6  
ATOM   5343  H HA   . CYS A 1 54 ? -1.059  4.639   -6.442  1.00 0.00 ? 54 CYS A HA   6  
ATOM   5344  H HB2  . CYS A 1 54 ? -3.108  2.960   -6.932  1.00 0.00 ? 54 CYS A HB2  6  
ATOM   5345  H HB3  . CYS A 1 54 ? -1.444  2.655   -7.387  1.00 0.00 ? 54 CYS A HB3  6  
ATOM   5346  N N    . ASN A 1 55 ? -3.499  5.553   -6.176  1.00 0.00 ? 55 ASN A N    6  
ATOM   5347  C CA   . ASN A 1 55 ? -4.653  6.366   -5.833  1.00 0.00 ? 55 ASN A CA   6  
ATOM   5348  C C    . ASN A 1 55 ? -5.862  5.896   -6.645  1.00 0.00 ? 55 ASN A C    6  
ATOM   5349  O O    . ASN A 1 55 ? -6.401  6.649   -7.454  1.00 0.00 ? 55 ASN A O    6  
ATOM   5350  C CB   . ASN A 1 55 ? -4.406  7.839   -6.162  1.00 0.00 ? 55 ASN A CB   6  
ATOM   5351  C CG   . ASN A 1 55 ? -4.119  8.028   -7.653  1.00 0.00 ? 55 ASN A CG   6  
ATOM   5352  O OD1  . ASN A 1 55 ? -4.997  8.321   -8.448  1.00 0.00 ? 55 ASN A OD1  6  
ATOM   5353  N ND2  . ASN A 1 55 ? -2.845  7.844   -7.986  1.00 0.00 ? 55 ASN A ND2  6  
ATOM   5354  H H    . ASN A 1 55 ? -3.237  5.576   -7.141  1.00 0.00 ? 55 ASN A H    6  
ATOM   5355  H HA   . ASN A 1 55 ? -4.792  6.228   -4.761  1.00 0.00 ? 55 ASN A HA   6  
ATOM   5356  H HB2  . ASN A 1 55 ? -5.277  8.430   -5.878  1.00 0.00 ? 55 ASN A HB2  6  
ATOM   5357  H HB3  . ASN A 1 55 ? -3.565  8.211   -5.576  1.00 0.00 ? 55 ASN A HB3  6  
ATOM   5358  H HD21 . ASN A 1 55 ? -2.174  7.605   -7.284  1.00 0.00 ? 55 ASN A HD21 6  
ATOM   5359  H HD22 . ASN A 1 55 ? -2.557  7.945   -8.938  1.00 0.00 ? 55 ASN A HD22 6  
ATOM   5360  N N    . THR A 1 56 ? -6.252  4.654   -6.400  1.00 0.00 ? 56 THR A N    6  
ATOM   5361  C CA   . THR A 1 56 ? -7.387  4.075   -7.099  1.00 0.00 ? 56 THR A CA   6  
ATOM   5362  C C    . THR A 1 56 ? -8.200  3.189   -6.152  1.00 0.00 ? 56 THR A C    6  
ATOM   5363  O O    . THR A 1 56 ? -7.662  2.646   -5.189  1.00 0.00 ? 56 THR A O    6  
ATOM   5364  C CB   . THR A 1 56 ? -6.857  3.328   -8.324  1.00 0.00 ? 56 THR A CB   6  
ATOM   5365  O OG1  . THR A 1 56 ? -5.797  2.526   -7.811  1.00 0.00 ? 56 THR A OG1  6  
ATOM   5366  C CG2  . THR A 1 56 ? -6.169  4.258   -9.325  1.00 0.00 ? 56 THR A CG2  6  
ATOM   5367  H H    . THR A 1 56 ? -5.808  4.047   -5.741  1.00 0.00 ? 56 THR A H    6  
ATOM   5368  H HA   . THR A 1 56 ? -8.042  4.884   -7.421  1.00 0.00 ? 56 THR A HA   6  
ATOM   5369  H HB   . THR A 1 56 ? -7.651  2.757   -8.806  1.00 0.00 ? 56 THR A HB   6  
ATOM   5370  H HG1  . THR A 1 56 ? -5.058  3.110   -7.476  1.00 0.00 ? 56 THR A HG1  6  
ATOM   5371  H HG21 . THR A 1 56 ? -6.915  4.894   -9.803  1.00 0.00 ? 56 THR A HG21 6  
ATOM   5372  H HG22 . THR A 1 56 ? -5.443  4.881   -8.802  1.00 0.00 ? 56 THR A HG22 6  
ATOM   5373  N N    . ASP A 1 57 ? -9.497  3.048   -6.433  1.00 0.00 ? 57 ASP A N    6  
ATOM   5374  C CA   . ASP A 1 57 ? -10.373 2.237   -5.612  1.00 0.00 ? 57 ASP A CA   6  
ATOM   5375  C C    . ASP A 1 57 ? -9.957  0.775   -5.703  1.00 0.00 ? 57 ASP A C    6  
ATOM   5376  O O    . ASP A 1 57 ? -9.942  0.200   -6.789  1.00 0.00 ? 57 ASP A O    6  
ATOM   5377  C CB   . ASP A 1 57 ? -11.816 2.419   -6.075  1.00 0.00 ? 57 ASP A CB   6  
ATOM   5378  C CG   . ASP A 1 57 ? -12.549 3.416   -5.190  1.00 0.00 ? 57 ASP A CG   6  
ATOM   5379  O OD1  . ASP A 1 57 ? -12.011 3.712   -4.101  1.00 0.00 ? 57 ASP A OD1  6  
ATOM   5380  O OD2  . ASP A 1 57 ? -13.635 3.864   -5.619  1.00 0.00 ? 57 ASP A OD2  6  
ATOM   5381  H H    . ASP A 1 57 ? -9.890  3.516   -7.237  1.00 0.00 ? 57 ASP A H    6  
ATOM   5382  H HA   . ASP A 1 57 ? -10.291 2.564   -4.575  1.00 0.00 ? 57 ASP A HA   6  
ATOM   5383  H HB2  . ASP A 1 57 ? -11.819 2.782   -7.103  1.00 0.00 ? 57 ASP A HB2  6  
ATOM   5384  H HB3  . ASP A 1 57 ? -12.329 1.458   -6.033  1.00 0.00 ? 57 ASP A HB3  6  
ATOM   5385  H HD2  . ASP A 1 57 ? -14.048 4.487   -5.016  1.00 0.00 ? 57 ASP A HD2  6  
ATOM   5386  N N    . LYS A 1 58 ? -9.629  0.212   -4.549  1.00 0.00 ? 58 LYS A N    6  
ATOM   5387  C CA   . LYS A 1 58 ? -9.212  -1.178  -4.487  1.00 0.00 ? 58 LYS A CA   6  
ATOM   5388  C C    . LYS A 1 58 ? -7.900  -1.347  -5.256  1.00 0.00 ? 58 LYS A C    6  
ATOM   5389  O O    . LYS A 1 58 ? -7.802  -2.191  -6.146  1.00 0.00 ? 58 LYS A O    6  
ATOM   5390  C CB   . LYS A 1 58 ? -10.334 -2.096  -4.977  1.00 0.00 ? 58 LYS A CB   6  
ATOM   5391  C CG   . LYS A 1 58 ? -11.009 -2.811  -3.804  1.00 0.00 ? 58 LYS A CG   6  
ATOM   5392  C CD   . LYS A 1 58 ? -12.260 -2.056  -3.349  1.00 0.00 ? 58 LYS A CD   6  
ATOM   5393  C CE   . LYS A 1 58 ? -13.036 -2.861  -2.304  1.00 0.00 ? 58 LYS A CE   6  
ATOM   5394  N NZ   . LYS A 1 58 ? -13.680 -4.037  -2.930  1.00 0.00 ? 58 LYS A NZ   6  
ATOM   5395  H H    . LYS A 1 58 ? -9.644  0.688   -3.669  1.00 0.00 ? 58 LYS A H    6  
ATOM   5396  H HA   . LYS A 1 58 ? -9.032  -1.419  -3.440  1.00 0.00 ? 58 LYS A HA   6  
ATOM   5397  H HB2  . LYS A 1 58 ? -11.073 -1.513  -5.526  1.00 0.00 ? 58 LYS A HB2  6  
ATOM   5398  H HB3  . LYS A 1 58 ? -9.930  -2.832  -5.672  1.00 0.00 ? 58 LYS A HB3  6  
ATOM   5399  H HG2  . LYS A 1 58 ? -11.279 -3.825  -4.098  1.00 0.00 ? 58 LYS A HG2  6  
ATOM   5400  H HG3  . LYS A 1 58 ? -10.308 -2.895  -2.973  1.00 0.00 ? 58 LYS A HG3  6  
ATOM   5401  H HD2  . LYS A 1 58 ? -11.974 -1.091  -2.931  1.00 0.00 ? 58 LYS A HD2  6  
ATOM   5402  H HD3  . LYS A 1 58 ? -12.900 -1.855  -4.207  1.00 0.00 ? 58 LYS A HD3  6  
ATOM   5403  H HE2  . LYS A 1 58 ? -12.361 -3.187  -1.513  1.00 0.00 ? 58 LYS A HE2  6  
ATOM   5404  H HE3  . LYS A 1 58 ? -13.792 -2.229  -1.838  1.00 0.00 ? 58 LYS A HE3  6  
ATOM   5405  H HZ1  . LYS A 1 58 ? -13.163 -4.862  -2.702  1.00 0.00 ? 58 LYS A HZ1  6  
ATOM   5406  H HZ2  . LYS A 1 58 ? -14.616 -4.125  -2.588  1.00 0.00 ? 58 LYS A HZ2  6  
ATOM   5407  N N    . CYS A 1 59 ? -6.924  -0.532  -4.884  1.00 0.00 ? 59 CYS A N    6  
ATOM   5408  C CA   . CYS A 1 59 ? -5.622  -0.580  -5.527  1.00 0.00 ? 59 CYS A CA   6  
ATOM   5409  C C    . CYS A 1 59 ? -4.681  -1.404  -4.646  1.00 0.00 ? 59 CYS A C    6  
ATOM   5410  O O    . CYS A 1 59 ? -3.962  -2.270  -5.140  1.00 0.00 ? 59 CYS A O    6  
ATOM   5411  C CB   . CYS A 1 59 ? -5.072  0.821   -5.797  1.00 0.00 ? 59 CYS A CB   6  
ATOM   5412  S SG   . CYS A 1 59 ? -3.880  1.431   -4.548  1.00 0.00 ? 59 CYS A SG   6  
ATOM   5413  H H    . CYS A 1 59 ? -7.012  0.151   -4.159  1.00 0.00 ? 59 CYS A H    6  
ATOM   5414  H HA   . CYS A 1 59 ? -5.768  -1.063  -6.494  1.00 0.00 ? 59 CYS A HA   6  
ATOM   5415  H HB2  . CYS A 1 59 ? -4.587  0.825   -6.773  1.00 0.00 ? 59 CYS A HB2  6  
ATOM   5416  H HB3  . CYS A 1 59 ? -5.906  1.520   -5.853  1.00 0.00 ? 59 CYS A HB3  6  
ATOM   5417  N N    . ASN A 1 60 ? -4.717  -1.104  -3.356  1.00 0.00 ? 60 ASN A N    6  
ATOM   5418  C CA   . ASN A 1 60 ? -3.876  -1.805  -2.401  1.00 0.00 ? 60 ASN A CA   6  
ATOM   5419  C C    . ASN A 1 60 ? -4.561  -3.109  -1.987  1.00 0.00 ? 60 ASN A C    6  
ATOM   5420  O O    . ASN A 1 60 ? -5.318  -3.691  -2.762  1.00 0.00 ? 60 ASN A O    6  
ATOM   5421  C CB   . ASN A 1 60 ? -3.656  -0.966  -1.140  1.00 0.00 ? 60 ASN A CB   6  
ATOM   5422  C CG   . ASN A 1 60 ? -4.894  -0.990  -0.242  1.00 0.00 ? 60 ASN A CG   6  
ATOM   5423  O OD1  . ASN A 1 60 ? -6.018  -1.134  -0.695  1.00 0.00 ? 60 ASN A OD1  6  
ATOM   5424  N ND2  . ASN A 1 60 ? -4.627  -0.839  1.052   1.00 0.00 ? 60 ASN A ND2  6  
ATOM   5425  H H    . ASN A 1 60 ? -5.305  -0.397  -2.962  1.00 0.00 ? 60 ASN A H    6  
ATOM   5426  H HA   . ASN A 1 60 ? -2.934  -1.976  -2.920  1.00 0.00 ? 60 ASN A HA   6  
ATOM   5427  H HB2  . ASN A 1 60 ? -2.796  -1.348  -0.590  1.00 0.00 ? 60 ASN A HB2  6  
ATOM   5428  H HB3  . ASN A 1 60 ? -3.424  0.062   -1.419  1.00 0.00 ? 60 ASN A HB3  6  
ATOM   5429  H HD21 . ASN A 1 60 ? -3.682  -0.725  1.357   1.00 0.00 ? 60 ASN A HD21 6  
ATOM   5430  H HD22 . ASN A 1 60 ? -5.372  -0.841  1.720   1.00 0.00 ? 60 ASN A HD22 6  
HETATM 5431  O O    . HOH B 2 .  ? 4.999   -11.125 1.389   1.00 0.00 ? 61 HOH A O    6  
HETATM 5432  H H1   . HOH B 2 .  ? 5.379   -11.384 2.229   1.00 0.00 ? 61 HOH A H1   6  
HETATM 5433  H H2   . HOH B 2 .  ? 5.596   -11.489 0.735   1.00 0.00 ? 61 HOH A H2   6  
HETATM 5434  O O    . HOH B 2 .  ? 6.888   -16.183 -7.436  1.00 0.00 ? 62 HOH A O    6  
HETATM 5435  H H1   . HOH B 2 .  ? 7.527   -15.471 -7.456  1.00 0.00 ? 62 HOH A H1   6  
HETATM 5436  H H2   . HOH B 2 .  ? 6.664   -16.276 -6.509  1.00 0.00 ? 62 HOH A H2   6  
ATOM   5437  N N    . LEU A 1 1  ? -12.410 7.335   -2.016  1.00 0.00 ? 1  LEU A N    7  
ATOM   5438  C CA   . LEU A 1 1  ? -11.410 7.059   -0.998  1.00 0.00 ? 1  LEU A CA   7  
ATOM   5439  C C    . LEU A 1 1  ? -11.821 5.812   -0.212  1.00 0.00 ? 1  LEU A C    7  
ATOM   5440  O O    . LEU A 1 1  ? -12.197 5.906   0.955   1.00 0.00 ? 1  LEU A O    7  
ATOM   5441  C CB   . LEU A 1 1  ? -11.184 8.292   -0.121  1.00 0.00 ? 1  LEU A CB   7  
ATOM   5442  C CG   . LEU A 1 1  ? -9.874  9.048   -0.352  1.00 0.00 ? 1  LEU A CG   7  
ATOM   5443  C CD1  . LEU A 1 1  ? -10.064 10.176  -1.368  1.00 0.00 ? 1  LEU A CD1  7  
ATOM   5444  C CD2  . LEU A 1 1  ? -9.295  9.559   0.969   1.00 0.00 ? 1  LEU A CD2  7  
ATOM   5445  H H    . LEU A 1 1  ? -12.272 6.858   -2.884  1.00 0.00 ? 1  LEU A H    7  
ATOM   5446  H HA   . LEU A 1 1  ? -10.471 6.851   -1.510  1.00 0.00 ? 1  LEU A HA   7  
ATOM   5447  H HB2  . LEU A 1 1  ? -12.012 8.983   -0.278  1.00 0.00 ? 1  LEU A HB2  7  
ATOM   5448  H HB3  . LEU A 1 1  ? -11.222 7.982   0.924   1.00 0.00 ? 1  LEU A HB3  7  
ATOM   5449  H HG   . LEU A 1 1  ? -9.148  8.353   -0.774  1.00 0.00 ? 1  LEU A HG   7  
ATOM   5450  H HD11 . LEU A 1 1  ? -9.578  9.906   -2.306  1.00 0.00 ? 1  LEU A HD11 7  
ATOM   5451  H HD12 . LEU A 1 1  ? -11.129 10.331  -1.543  1.00 0.00 ? 1  LEU A HD12 7  
ATOM   5452  H HD21 . LEU A 1 1  ? -8.849  8.728   1.515   1.00 0.00 ? 1  LEU A HD21 7  
ATOM   5453  H HD22 . LEU A 1 1  ? -8.533  10.311  0.765   1.00 0.00 ? 1  LEU A HD22 7  
ATOM   5454  N N    . LYS A 1 2  ? -11.734 4.673   -0.883  1.00 0.00 ? 2  LYS A N    7  
ATOM   5455  C CA   . LYS A 1 2  ? -12.091 3.409   -0.262  1.00 0.00 ? 2  LYS A CA   7  
ATOM   5456  C C    . LYS A 1 2  ? -11.069 2.343   -0.661  1.00 0.00 ? 2  LYS A C    7  
ATOM   5457  O O    . LYS A 1 2  ? -10.921 2.030   -1.841  1.00 0.00 ? 2  LYS A O    7  
ATOM   5458  C CB   . LYS A 1 2  ? -13.535 3.034   -0.603  1.00 0.00 ? 2  LYS A CB   7  
ATOM   5459  C CG   . LYS A 1 2  ? -14.504 3.567   0.455   1.00 0.00 ? 2  LYS A CG   7  
ATOM   5460  C CD   . LYS A 1 2  ? -15.740 2.671   0.567   1.00 0.00 ? 2  LYS A CD   7  
ATOM   5461  C CE   . LYS A 1 2  ? -16.732 2.963   -0.560  1.00 0.00 ? 2  LYS A CE   7  
ATOM   5462  N NZ   . LYS A 1 2  ? -18.081 3.221   -0.009  1.00 0.00 ? 2  LYS A NZ   7  
ATOM   5463  H H    . LYS A 1 2  ? -11.427 4.606   -1.833  1.00 0.00 ? 2  LYS A H    7  
ATOM   5464  H HA   . LYS A 1 2  ? -12.041 3.550   0.817   1.00 0.00 ? 2  LYS A HA   7  
ATOM   5465  H HB2  . LYS A 1 2  ? -13.800 3.439   -1.579  1.00 0.00 ? 2  LYS A HB2  7  
ATOM   5466  H HB3  . LYS A 1 2  ? -13.627 1.951   -0.672  1.00 0.00 ? 2  LYS A HB3  7  
ATOM   5467  H HG2  . LYS A 1 2  ? -14.000 3.619   1.421   1.00 0.00 ? 2  LYS A HG2  7  
ATOM   5468  H HG3  . LYS A 1 2  ? -14.807 4.581   0.198   1.00 0.00 ? 2  LYS A HG3  7  
ATOM   5469  H HD2  . LYS A 1 2  ? -15.439 1.624   0.530   1.00 0.00 ? 2  LYS A HD2  7  
ATOM   5470  H HD3  . LYS A 1 2  ? -16.222 2.830   1.531   1.00 0.00 ? 2  LYS A HD3  7  
ATOM   5471  H HE2  . LYS A 1 2  ? -16.396 3.827   -1.134  1.00 0.00 ? 2  LYS A HE2  7  
ATOM   5472  H HE3  . LYS A 1 2  ? -16.768 2.119   -1.248  1.00 0.00 ? 2  LYS A HE3  7  
ATOM   5473  H HZ1  . LYS A 1 2  ? -18.562 3.874   -0.595  1.00 0.00 ? 2  LYS A HZ1  7  
ATOM   5474  H HZ2  . LYS A 1 2  ? -18.596 2.364   0.026   1.00 0.00 ? 2  LYS A HZ2  7  
ATOM   5475  N N    . CYS A 1 3  ? -10.390 1.814   0.347   1.00 0.00 ? 3  CYS A N    7  
ATOM   5476  C CA   . CYS A 1 3  ? -9.386  0.789   0.116   1.00 0.00 ? 3  CYS A CA   7  
ATOM   5477  C C    . CYS A 1 3  ? -9.748  -0.436  0.957   1.00 0.00 ? 3  CYS A C    7  
ATOM   5478  O O    . CYS A 1 3  ? -10.647 -0.375  1.795   1.00 0.00 ? 3  CYS A O    7  
ATOM   5479  C CB   . CYS A 1 3  ? -7.977  1.298   0.426   1.00 0.00 ? 3  CYS A CB   7  
ATOM   5480  S SG   . CYS A 1 3  ? -7.637  3.007   -0.133  1.00 0.00 ? 3  CYS A SG   7  
ATOM   5481  H H    . CYS A 1 3  ? -10.517 2.074   1.304   1.00 0.00 ? 3  CYS A H    7  
ATOM   5482  H HA   . CYS A 1 3  ? -9.419  0.552   -0.947  1.00 0.00 ? 3  CYS A HA   7  
ATOM   5483  H HB2  . CYS A 1 3  ? -7.815  1.245   1.503   1.00 0.00 ? 3  CYS A HB2  7  
ATOM   5484  H HB3  . CYS A 1 3  ? -7.253  0.628   -0.038  1.00 0.00 ? 3  CYS A HB3  7  
ATOM   5485  N N    . LYS A 1 4  ? -9.031  -1.521  0.704   1.00 0.00 ? 4  LYS A N    7  
ATOM   5486  C CA   . LYS A 1 4  ? -9.265  -2.759  1.428   1.00 0.00 ? 4  LYS A CA   7  
ATOM   5487  C C    . LYS A 1 4  ? -8.392  -2.784  2.684   1.00 0.00 ? 4  LYS A C    7  
ATOM   5488  O O    . LYS A 1 4  ? -7.261  -2.302  2.667   1.00 0.00 ? 4  LYS A O    7  
ATOM   5489  C CB   . LYS A 1 4  ? -9.056  -3.964  0.509   1.00 0.00 ? 4  LYS A CB   7  
ATOM   5490  C CG   . LYS A 1 4  ? -10.355 -4.340  -0.207  1.00 0.00 ? 4  LYS A CG   7  
ATOM   5491  C CD   . LYS A 1 4  ? -10.343 -5.810  -0.630  1.00 0.00 ? 4  LYS A CD   7  
ATOM   5492  C CE   . LYS A 1 4  ? -10.417 -5.944  -2.153  1.00 0.00 ? 4  LYS A CE   7  
ATOM   5493  N NZ   . LYS A 1 4  ? -9.058  -6.011  -2.734  1.00 0.00 ? 4  LYS A NZ   7  
ATOM   5494  H H    . LYS A 1 4  ? -8.302  -1.562  0.021   1.00 0.00 ? 4  LYS A H    7  
ATOM   5495  H HA   . LYS A 1 4  ? -10.311 -2.765  1.734   1.00 0.00 ? 4  LYS A HA   7  
ATOM   5496  H HB2  . LYS A 1 4  ? -8.284  -3.737  -0.226  1.00 0.00 ? 4  LYS A HB2  7  
ATOM   5497  H HB3  . LYS A 1 4  ? -8.700  -4.813  1.092   1.00 0.00 ? 4  LYS A HB3  7  
ATOM   5498  H HG2  . LYS A 1 4  ? -11.204 -4.154  0.450   1.00 0.00 ? 4  LYS A HG2  7  
ATOM   5499  H HG3  . LYS A 1 4  ? -10.486 -3.706  -1.085  1.00 0.00 ? 4  LYS A HG3  7  
ATOM   5500  H HD2  . LYS A 1 4  ? -9.435  -6.290  -0.263  1.00 0.00 ? 4  LYS A HD2  7  
ATOM   5501  H HD3  . LYS A 1 4  ? -11.185 -6.330  -0.174  1.00 0.00 ? 4  LYS A HD3  7  
ATOM   5502  H HE2  . LYS A 1 4  ? -10.978 -6.840  -2.418  1.00 0.00 ? 4  LYS A HE2  7  
ATOM   5503  H HE3  . LYS A 1 4  ? -10.957 -5.095  -2.572  1.00 0.00 ? 4  LYS A HE3  7  
ATOM   5504  H HZ1  . LYS A 1 4  ? -8.879  -6.940  -3.057  1.00 0.00 ? 4  LYS A HZ1  7  
ATOM   5505  H HZ2  . LYS A 1 4  ? -8.992  -5.373  -3.502  1.00 0.00 ? 4  LYS A HZ2  7  
ATOM   5506  N N    . LYS A 1 5  ? -8.950  -3.351  3.743   1.00 0.00 ? 5  LYS A N    7  
ATOM   5507  C CA   . LYS A 1 5  ? -8.237  -3.446  5.005   1.00 0.00 ? 5  LYS A CA   7  
ATOM   5508  C C    . LYS A 1 5  ? -7.196  -4.564  4.915   1.00 0.00 ? 5  LYS A C    7  
ATOM   5509  O O    . LYS A 1 5  ? -6.968  -5.119  3.842   1.00 0.00 ? 5  LYS A O    7  
ATOM   5510  C CB   . LYS A 1 5  ? -9.220  -3.613  6.165   1.00 0.00 ? 5  LYS A CB   7  
ATOM   5511  C CG   . LYS A 1 5  ? -10.015 -2.326  6.400   1.00 0.00 ? 5  LYS A CG   7  
ATOM   5512  C CD   . LYS A 1 5  ? -9.644  -1.690  7.741   1.00 0.00 ? 5  LYS A CD   7  
ATOM   5513  C CE   . LYS A 1 5  ? -10.844 -1.676  8.691   1.00 0.00 ? 5  LYS A CE   7  
ATOM   5514  N NZ   . LYS A 1 5  ? -10.590 -0.768  9.832   1.00 0.00 ? 5  LYS A NZ   7  
ATOM   5515  H H    . LYS A 1 5  ? -9.871  -3.742  3.748   1.00 0.00 ? 5  LYS A H    7  
ATOM   5516  H HA   . LYS A 1 5  ? -7.716  -2.501  5.157   1.00 0.00 ? 5  LYS A HA   7  
ATOM   5517  H HB2  . LYS A 1 5  ? -9.905  -4.433  5.952   1.00 0.00 ? 5  LYS A HB2  7  
ATOM   5518  H HB3  . LYS A 1 5  ? -8.676  -3.879  7.072   1.00 0.00 ? 5  LYS A HB3  7  
ATOM   5519  H HG2  . LYS A 1 5  ? -9.818  -1.621  5.592   1.00 0.00 ? 5  LYS A HG2  7  
ATOM   5520  H HG3  . LYS A 1 5  ? -11.082 -2.545  6.379   1.00 0.00 ? 5  LYS A HG3  7  
ATOM   5521  H HD2  . LYS A 1 5  ? -8.822  -2.243  8.195   1.00 0.00 ? 5  LYS A HD2  7  
ATOM   5522  H HD3  . LYS A 1 5  ? -9.292  -0.671  7.579   1.00 0.00 ? 5  LYS A HD3  7  
ATOM   5523  H HE2  . LYS A 1 5  ? -11.736 -1.355  8.154   1.00 0.00 ? 5  LYS A HE2  7  
ATOM   5524  H HE3  . LYS A 1 5  ? -11.037 -2.684  9.057   1.00 0.00 ? 5  LYS A HE3  7  
ATOM   5525  H HZ1  . LYS A 1 5  ? -10.733 0.178   9.543   1.00 0.00 ? 5  LYS A HZ1  7  
ATOM   5526  H HZ2  . LYS A 1 5  ? -11.219 -0.987  10.578  1.00 0.00 ? 5  LYS A HZ2  7  
ATOM   5527  N N    . LEU A 1 6  ? -6.593  -4.861  6.057   1.00 0.00 ? 6  LEU A N    7  
ATOM   5528  C CA   . LEU A 1 6  ? -5.582  -5.902  6.121   1.00 0.00 ? 6  LEU A CA   7  
ATOM   5529  C C    . LEU A 1 6  ? -6.035  -7.099  5.281   1.00 0.00 ? 6  LEU A C    7  
ATOM   5530  O O    . LEU A 1 6  ? -5.449  -7.388  4.240   1.00 0.00 ? 6  LEU A O    7  
ATOM   5531  C CB   . LEU A 1 6  ? -5.268  -6.256  7.576   1.00 0.00 ? 6  LEU A CB   7  
ATOM   5532  C CG   . LEU A 1 6  ? -4.154  -5.442  8.238   1.00 0.00 ? 6  LEU A CG   7  
ATOM   5533  C CD1  . LEU A 1 6  ? -4.457  -5.200  9.718   1.00 0.00 ? 6  LEU A CD1  7  
ATOM   5534  C CD2  . LEU A 1 6  ? -2.792  -6.110  8.033   1.00 0.00 ? 6  LEU A CD2  7  
ATOM   5535  H H    . LEU A 1 6  ? -6.785  -4.404  6.926   1.00 0.00 ? 6  LEU A H    7  
ATOM   5536  H HA   . LEU A 1 6  ? -4.669  -5.499  5.682   1.00 0.00 ? 6  LEU A HA   7  
ATOM   5537  H HB2  . LEU A 1 6  ? -6.178  -6.133  8.163   1.00 0.00 ? 6  LEU A HB2  7  
ATOM   5538  H HB3  . LEU A 1 6  ? -4.998  -7.310  7.622   1.00 0.00 ? 6  LEU A HB3  7  
ATOM   5539  H HG   . LEU A 1 6  ? -4.109  -4.466  7.754   1.00 0.00 ? 6  LEU A HG   7  
ATOM   5540  H HD11 . LEU A 1 6  ? -3.701  -5.694  10.329  1.00 0.00 ? 6  LEU A HD11 7  
ATOM   5541  H HD12 . LEU A 1 6  ? -4.445  -4.129  9.920   1.00 0.00 ? 6  LEU A HD12 7  
ATOM   5542  H HD21 . LEU A 1 6  ? -2.187  -5.503  7.359   1.00 0.00 ? 6  LEU A HD21 7  
ATOM   5543  H HD22 . LEU A 1 6  ? -2.285  -6.202  8.993   1.00 0.00 ? 6  LEU A HD22 7  
ATOM   5544  N N    . VAL A 1 7  ? -7.075  -7.761  5.767   1.00 0.00 ? 7  VAL A N    7  
ATOM   5545  C CA   . VAL A 1 7  ? -7.614  -8.920  5.074   1.00 0.00 ? 7  VAL A CA   7  
ATOM   5546  C C    . VAL A 1 7  ? -8.541  -8.452  3.951   1.00 0.00 ? 7  VAL A C    7  
ATOM   5547  O O    . VAL A 1 7  ? -9.387  -7.584  4.161   1.00 0.00 ? 7  VAL A O    7  
ATOM   5548  C CB   . VAL A 1 7  ? -8.305  -9.851  6.072   1.00 0.00 ? 7  VAL A CB   7  
ATOM   5549  C CG1  . VAL A 1 7  ? -8.803  -11.122 5.381   1.00 0.00 ? 7  VAL A CG1  7  
ATOM   5550  C CG2  . VAL A 1 7  ? -7.377  -10.189 7.240   1.00 0.00 ? 7  VAL A CG2  7  
ATOM   5551  H H    . VAL A 1 7  ? -7.546  -7.519  6.615   1.00 0.00 ? 7  VAL A H    7  
ATOM   5552  H HA   . VAL A 1 7  ? -6.775  -9.459  4.634   1.00 0.00 ? 7  VAL A HA   7  
ATOM   5553  H HB   . VAL A 1 7  ? -9.172  -9.327  6.474   1.00 0.00 ? 7  VAL A HB   7  
ATOM   5554  H HG11 . VAL A 1 7  ? -9.234  -11.794 6.123   1.00 0.00 ? 7  VAL A HG11 7  
ATOM   5555  H HG12 . VAL A 1 7  ? -9.561  -10.861 4.643   1.00 0.00 ? 7  VAL A HG12 7  
ATOM   5556  H HG21 . VAL A 1 7  ? -7.455  -9.413  8.002   1.00 0.00 ? 7  VAL A HG21 7  
ATOM   5557  H HG22 . VAL A 1 7  ? -7.667  -11.149 7.669   1.00 0.00 ? 7  VAL A HG22 7  
ATOM   5558  N N    . PRO A 1 8  ? -8.346  -9.063  2.752   1.00 0.00 ? 8  PRO A N    7  
ATOM   5559  C CA   . PRO A 1 8  ? -9.155  -8.718  1.596   1.00 0.00 ? 8  PRO A CA   7  
ATOM   5560  C C    . PRO A 1 8  ? -10.559 -9.315  1.711   1.00 0.00 ? 8  PRO A C    7  
ATOM   5561  O O    . PRO A 1 8  ? -11.011 -10.026 0.814   1.00 0.00 ? 8  PRO A O    7  
ATOM   5562  C CB   . PRO A 1 8  ? -8.380  -9.249  0.401   1.00 0.00 ? 8  PRO A CB   7  
ATOM   5563  C CG   . PRO A 1 8  ? -7.405  -10.273 0.958   1.00 0.00 ? 8  PRO A CG   7  
ATOM   5564  C CD   . PRO A 1 8  ? -7.354  -10.095 2.467   1.00 0.00 ? 8  PRO A CD   7  
ATOM   5565  H HA   . PRO A 1 8  ? -9.283  -7.727  1.544   1.00 0.00 ? 8  PRO A HA   7  
ATOM   5566  H HB2  . PRO A 1 8  ? -9.050  -9.704  -0.329  1.00 0.00 ? 8  PRO A HB2  7  
ATOM   5567  H HB3  . PRO A 1 8  ? -7.852  -8.444  -0.111  1.00 0.00 ? 8  PRO A HB3  7  
ATOM   5568  H HG2  . PRO A 1 8  ? -7.726  -11.283 0.703   1.00 0.00 ? 8  PRO A HG2  7  
ATOM   5569  H HG3  . PRO A 1 8  ? -6.415  -10.134 0.523   1.00 0.00 ? 8  PRO A HG3  7  
ATOM   5570  H HD2  . PRO A 1 8  ? -7.590  -11.025 2.983   1.00 0.00 ? 8  PRO A HD2  7  
ATOM   5571  H HD3  . PRO A 1 8  ? -6.360  -9.791  2.796   1.00 0.00 ? 8  PRO A HD3  7  
ATOM   5572  N N    . LEU A 1 9  ? -11.210 -9.004  2.822   1.00 0.00 ? 9  LEU A N    7  
ATOM   5573  C CA   . LEU A 1 9  ? -12.554 -9.501  3.066   1.00 0.00 ? 9  LEU A CA   7  
ATOM   5574  C C    . LEU A 1 9  ? -13.526 -8.321  3.127   1.00 0.00 ? 9  LEU A C    7  
ATOM   5575  O O    . LEU A 1 9  ? -14.667 -8.429  2.680   1.00 0.00 ? 9  LEU A O    7  
ATOM   5576  C CB   . LEU A 1 9  ? -12.580 -10.384 4.315   1.00 0.00 ? 9  LEU A CB   7  
ATOM   5577  C CG   . LEU A 1 9  ? -12.180 -11.847 4.111   1.00 0.00 ? 9  LEU A CG   7  
ATOM   5578  C CD1  . LEU A 1 9  ? -11.914 -12.534 5.452   1.00 0.00 ? 9  LEU A CD1  7  
ATOM   5579  C CD2  . LEU A 1 9  ? -13.228 -12.592 3.283   1.00 0.00 ? 9  LEU A CD2  7  
ATOM   5580  H H    . LEU A 1 9  ? -10.836 -8.425  3.546   1.00 0.00 ? 9  LEU A H    7  
ATOM   5581  H HA   . LEU A 1 9  ? -12.828 -10.132 2.220   1.00 0.00 ? 9  LEU A HA   7  
ATOM   5582  H HB2  . LEU A 1 9  ? -11.914 -9.946  5.059   1.00 0.00 ? 9  LEU A HB2  7  
ATOM   5583  H HB3  . LEU A 1 9  ? -13.586 -10.358 4.734   1.00 0.00 ? 9  LEU A HB3  7  
ATOM   5584  H HG   . LEU A 1 9  ? -11.248 -11.870 3.547   1.00 0.00 ? 9  LEU A HG   7  
ATOM   5585  H HD11 . LEU A 1 9  ? -12.178 -11.859 6.266   1.00 0.00 ? 9  LEU A HD11 7  
ATOM   5586  H HD12 . LEU A 1 9  ? -12.516 -13.440 5.521   1.00 0.00 ? 9  LEU A HD12 7  
ATOM   5587  H HD21 . LEU A 1 9  ? -12.734 -13.327 2.648   1.00 0.00 ? 9  LEU A HD21 7  
ATOM   5588  H HD22 . LEU A 1 9  ? -13.926 -13.098 3.950   1.00 0.00 ? 9  LEU A HD22 7  
ATOM   5589  N N    . PHE A 1 10 ? -13.039 -7.222  3.683   1.00 0.00 ? 10 PHE A N    7  
ATOM   5590  C CA   . PHE A 1 10 ? -13.851 -6.023  3.807   1.00 0.00 ? 10 PHE A CA   7  
ATOM   5591  C C    . PHE A 1 10 ? -13.030 -4.771  3.494   1.00 0.00 ? 10 PHE A C    7  
ATOM   5592  O O    . PHE A 1 10 ? -11.804 -4.788  3.585   1.00 0.00 ? 10 PHE A O    7  
ATOM   5593  C CB   . PHE A 1 10 ? -14.328 -5.956  5.259   1.00 0.00 ? 10 PHE A CB   7  
ATOM   5594  C CG   . PHE A 1 10 ? -14.806 -7.296  5.820   1.00 0.00 ? 10 PHE A CG   7  
ATOM   5595  C CD1  . PHE A 1 10 ? -16.098 -7.685  5.645   1.00 0.00 ? 10 PHE A CD1  7  
ATOM   5596  C CD2  . PHE A 1 10 ? -13.940 -8.099  6.494   1.00 0.00 ? 10 PHE A CD2  7  
ATOM   5597  C CE1  . PHE A 1 10 ? -16.541 -8.930  6.166   1.00 0.00 ? 10 PHE A CE1  7  
ATOM   5598  C CE2  . PHE A 1 10 ? -14.383 -9.343  7.015   1.00 0.00 ? 10 PHE A CE2  7  
ATOM   5599  C CZ   . PHE A 1 10 ? -15.675 -9.733  6.840   1.00 0.00 ? 10 PHE A CZ   7  
ATOM   5600  H H    . PHE A 1 10 ? -12.110 -7.142  4.043   1.00 0.00 ? 10 PHE A H    7  
ATOM   5601  H HA   . PHE A 1 10 ? -14.667 -6.110  3.090   1.00 0.00 ? 10 PHE A HA   7  
ATOM   5602  H HB2  . PHE A 1 10 ? -13.515 -5.582  5.881   1.00 0.00 ? 10 PHE A HB2  7  
ATOM   5603  H HB3  . PHE A 1 10 ? -15.142 -5.233  5.330   1.00 0.00 ? 10 PHE A HB3  7  
ATOM   5604  H HD1  . PHE A 1 10 ? -16.792 -7.042  5.105   1.00 0.00 ? 10 PHE A HD1  7  
ATOM   5605  H HD2  . PHE A 1 10 ? -12.905 -7.787  6.635   1.00 0.00 ? 10 PHE A HD2  7  
ATOM   5606  H HE1  . PHE A 1 10 ? -17.576 -9.242  6.025   1.00 0.00 ? 10 PHE A HE1  7  
ATOM   5607  H HE2  . PHE A 1 10 ? -13.689 -9.987  7.555   1.00 0.00 ? 10 PHE A HE2  7  
ATOM   5608  H HZ   . PHE A 1 10 ? -16.015 -10.688 7.239   1.00 0.00 ? 10 PHE A HZ   7  
ATOM   5609  N N    . SER A 1 11 ? -13.741 -3.713  3.130   1.00 0.00 ? 11 SER A N    7  
ATOM   5610  C CA   . SER A 1 11 ? -13.094 -2.454  2.803   1.00 0.00 ? 11 SER A CA   7  
ATOM   5611  C C    . SER A 1 11 ? -13.665 -1.330  3.670   1.00 0.00 ? 11 SER A C    7  
ATOM   5612  O O    . SER A 1 11 ? -14.778 -1.442  4.182   1.00 0.00 ? 11 SER A O    7  
ATOM   5613  C CB   . SER A 1 11 ? -13.262 -2.117  1.320   1.00 0.00 ? 11 SER A CB   7  
ATOM   5614  O OG   . SER A 1 11 ? -14.607 -2.292  0.882   1.00 0.00 ? 11 SER A OG   7  
ATOM   5615  H H    . SER A 1 11 ? -14.738 -3.707  3.058   1.00 0.00 ? 11 SER A H    7  
ATOM   5616  H HA   . SER A 1 11 ? -12.037 -2.606  3.022   1.00 0.00 ? 11 SER A HA   7  
ATOM   5617  H HB2  . SER A 1 11 ? -12.955 -1.086  1.145   1.00 0.00 ? 11 SER A HB2  7  
ATOM   5618  H HB3  . SER A 1 11 ? -12.603 -2.751  0.727   1.00 0.00 ? 11 SER A HB3  7  
ATOM   5619  H HG   . SER A 1 11 ? -14.736 -1.857  -0.009  1.00 0.00 ? 11 SER A HG   7  
ATOM   5620  N N    . LYS A 1 12 ? -12.878 -0.274  3.808   1.00 0.00 ? 12 LYS A N    7  
ATOM   5621  C CA   . LYS A 1 12 ? -13.292 0.869   4.605   1.00 0.00 ? 12 LYS A CA   7  
ATOM   5622  C C    . LYS A 1 12 ? -12.796 2.155   3.940   1.00 0.00 ? 12 LYS A C    7  
ATOM   5623  O O    . LYS A 1 12 ? -11.966 2.109   3.034   1.00 0.00 ? 12 LYS A O    7  
ATOM   5624  C CB   . LYS A 1 12 ? -12.828 0.707   6.054   1.00 0.00 ? 12 LYS A CB   7  
ATOM   5625  C CG   . LYS A 1 12 ? -13.980 0.244   6.949   1.00 0.00 ? 12 LYS A CG   7  
ATOM   5626  C CD   . LYS A 1 12 ? -14.595 1.423   7.705   1.00 0.00 ? 12 LYS A CD   7  
ATOM   5627  C CE   . LYS A 1 12 ? -15.489 0.936   8.847   1.00 0.00 ? 12 LYS A CE   7  
ATOM   5628  N NZ   . LYS A 1 12 ? -16.576 1.907   9.106   1.00 0.00 ? 12 LYS A NZ   7  
ATOM   5629  H H    . LYS A 1 12 ? -11.974 -0.191  3.388   1.00 0.00 ? 12 LYS A H    7  
ATOM   5630  H HA   . LYS A 1 12 ? -14.381 0.883   4.615   1.00 0.00 ? 12 LYS A HA   7  
ATOM   5631  H HB2  . LYS A 1 12 ? -12.013 -0.014  6.102   1.00 0.00 ? 12 LYS A HB2  7  
ATOM   5632  H HB3  . LYS A 1 12 ? -12.436 1.655   6.422   1.00 0.00 ? 12 LYS A HB3  7  
ATOM   5633  H HG2  . LYS A 1 12 ? -14.744 -0.242  6.343   1.00 0.00 ? 12 LYS A HG2  7  
ATOM   5634  H HG3  . LYS A 1 12 ? -13.616 -0.498  7.660   1.00 0.00 ? 12 LYS A HG3  7  
ATOM   5635  H HD2  . LYS A 1 12 ? -13.803 2.058   8.104   1.00 0.00 ? 12 LYS A HD2  7  
ATOM   5636  H HD3  . LYS A 1 12 ? -15.179 2.036   7.018   1.00 0.00 ? 12 LYS A HD3  7  
ATOM   5637  H HE2  . LYS A 1 12 ? -15.914 -0.036  8.595   1.00 0.00 ? 12 LYS A HE2  7  
ATOM   5638  H HE3  . LYS A 1 12 ? -14.894 0.799   9.750   1.00 0.00 ? 12 LYS A HE3  7  
ATOM   5639  H HZ1  . LYS A 1 12 ? -16.203 2.835   9.096   1.00 0.00 ? 12 LYS A HZ1  7  
ATOM   5640  H HZ2  . LYS A 1 12 ? -17.275 1.822   8.396   1.00 0.00 ? 12 LYS A HZ2  7  
ATOM   5641  N N    . THR A 1 13 ? -13.326 3.272   4.417   1.00 0.00 ? 13 THR A N    7  
ATOM   5642  C CA   . THR A 1 13 ? -12.947 4.568   3.881   1.00 0.00 ? 13 THR A CA   7  
ATOM   5643  C C    . THR A 1 13 ? -11.736 5.123   4.633   1.00 0.00 ? 13 THR A C    7  
ATOM   5644  O O    . THR A 1 13 ? -11.625 4.957   5.846   1.00 0.00 ? 13 THR A O    7  
ATOM   5645  C CB   . THR A 1 13 ? -14.173 5.481   3.943   1.00 0.00 ? 13 THR A CB   7  
ATOM   5646  O OG1  . THR A 1 13 ? -14.983 5.051   2.853   1.00 0.00 ? 13 THR A OG1  7  
ATOM   5647  C CG2  . THR A 1 13 ? -13.837 6.936   3.607   1.00 0.00 ? 13 THR A CG2  7  
ATOM   5648  H H    . THR A 1 13 ? -14.000 3.300   5.155   1.00 0.00 ? 13 THR A H    7  
ATOM   5649  H HA   . THR A 1 13 ? -12.645 4.435   2.842   1.00 0.00 ? 13 THR A HA   7  
ATOM   5650  H HB   . THR A 1 13 ? -14.663 5.409   4.914   1.00 0.00 ? 13 THR A HB   7  
ATOM   5651  H HG1  . THR A 1 13 ? -14.629 5.425   1.995   1.00 0.00 ? 13 THR A HG1  7  
ATOM   5652  H HG21 . THR A 1 13 ? -13.258 7.372   4.421   1.00 0.00 ? 13 THR A HG21 7  
ATOM   5653  H HG22 . THR A 1 13 ? -13.254 6.971   2.687   1.00 0.00 ? 13 THR A HG22 7  
ATOM   5654  N N    . CYS A 1 14 ? -10.860 5.773   3.881   1.00 0.00 ? 14 CYS A N    7  
ATOM   5655  C CA   . CYS A 1 14 ? -9.661  6.354   4.461   1.00 0.00 ? 14 CYS A CA   7  
ATOM   5656  C C    . CYS A 1 14 ? -9.970  7.799   4.855   1.00 0.00 ? 14 CYS A C    7  
ATOM   5657  O O    . CYS A 1 14 ? -10.633 8.521   4.112   1.00 0.00 ? 14 CYS A O    7  
ATOM   5658  C CB   . CYS A 1 14 ? -8.470  6.266   3.505   1.00 0.00 ? 14 CYS A CB   7  
ATOM   5659  S SG   . CYS A 1 14 ? -8.352  4.699   2.567   1.00 0.00 ? 14 CYS A SG   7  
ATOM   5660  H H    . CYS A 1 14 ? -10.958 5.904   2.894   1.00 0.00 ? 14 CYS A H    7  
ATOM   5661  H HA   . CYS A 1 14 ? -9.417  5.757   5.340   1.00 0.00 ? 14 CYS A HA   7  
ATOM   5662  H HB2  . CYS A 1 14 ? -8.528  7.093   2.797   1.00 0.00 ? 14 CYS A HB2  7  
ATOM   5663  H HB3  . CYS A 1 14 ? -7.552  6.400   4.077   1.00 0.00 ? 14 CYS A HB3  7  
ATOM   5664  N N    . PRO A 1 15 ? -9.463  8.189   6.055   1.00 0.00 ? 15 PRO A N    7  
ATOM   5665  C CA   . PRO A 1 15 ? -9.678  9.535   6.558   1.00 0.00 ? 15 PRO A CA   7  
ATOM   5666  C C    . PRO A 1 15 ? -8.797  10.544  5.818   1.00 0.00 ? 15 PRO A C    7  
ATOM   5667  O O    . PRO A 1 15 ? -7.960  10.161  5.001   1.00 0.00 ? 15 PRO A O    7  
ATOM   5668  C CB   . PRO A 1 15 ? -9.370  9.455   8.044   1.00 0.00 ? 15 PRO A CB   7  
ATOM   5669  C CG   . PRO A 1 15 ? -8.550  8.189   8.231   1.00 0.00 ? 15 PRO A CG   7  
ATOM   5670  C CD   . PRO A 1 15 ? -8.673  7.361   6.962   1.00 0.00 ? 15 PRO A CD   7  
ATOM   5671  H HA   . PRO A 1 15 ? -10.621 9.822   6.390   1.00 0.00 ? 15 PRO A HA   7  
ATOM   5672  H HB2  . PRO A 1 15 ? -8.815  10.332  8.376   1.00 0.00 ? 15 PRO A HB2  7  
ATOM   5673  H HB3  . PRO A 1 15 ? -10.287 9.417   8.631   1.00 0.00 ? 15 PRO A HB3  7  
ATOM   5674  H HG2  . PRO A 1 15 ? -7.506  8.435   8.427   1.00 0.00 ? 15 PRO A HG2  7  
ATOM   5675  H HG3  . PRO A 1 15 ? -8.910  7.624   9.092   1.00 0.00 ? 15 PRO A HG3  7  
ATOM   5676  H HD2  . PRO A 1 15 ? -7.694  7.135   6.541   1.00 0.00 ? 15 PRO A HD2  7  
ATOM   5677  H HD3  . PRO A 1 15 ? -9.164  6.408   7.157   1.00 0.00 ? 15 PRO A HD3  7  
ATOM   5678  N N    . ALA A 1 16 ? -9.014  11.813  6.131   1.00 0.00 ? 16 ALA A N    7  
ATOM   5679  C CA   . ALA A 1 16 ? -8.250  12.879  5.506   1.00 0.00 ? 16 ALA A CA   7  
ATOM   5680  C C    . ALA A 1 16 ? -6.756  12.583  5.651   1.00 0.00 ? 16 ALA A C    7  
ATOM   5681  O O    . ALA A 1 16 ? -6.333  11.975  6.633   1.00 0.00 ? 16 ALA A O    7  
ATOM   5682  C CB   . ALA A 1 16 ? -8.641  14.220  6.130   1.00 0.00 ? 16 ALA A CB   7  
ATOM   5683  H H    . ALA A 1 16 ? -9.696  12.115  6.797   1.00 0.00 ? 16 ALA A H    7  
ATOM   5684  H HA   . ALA A 1 16 ? -8.508  12.896  4.447   1.00 0.00 ? 16 ALA A HA   7  
ATOM   5685  H HB1  . ALA A 1 16 ? -9.569  14.104  6.691   1.00 0.00 ? 16 ALA A HB1  7  
ATOM   5686  H HB2  . ALA A 1 16 ? -7.850  14.554  6.801   1.00 0.00 ? 16 ALA A HB2  7  
ATOM   5687  N N    . GLY A 1 17 ? -5.999  13.025  4.658   1.00 0.00 ? 17 GLY A N    7  
ATOM   5688  C CA   . GLY A 1 17 ? -4.561  12.815  4.663   1.00 0.00 ? 17 GLY A CA   7  
ATOM   5689  C C    . GLY A 1 17 ? -4.187  11.564  3.864   1.00 0.00 ? 17 GLY A C    7  
ATOM   5690  O O    . GLY A 1 17 ? -3.217  11.573  3.109   1.00 0.00 ? 17 GLY A O    7  
ATOM   5691  H H    . GLY A 1 17 ? -6.351  13.519  3.863   1.00 0.00 ? 17 GLY A H    7  
ATOM   5692  H HA2  . GLY A 1 17 ? -4.061  13.685  4.237   1.00 0.00 ? 17 GLY A HA2  7  
ATOM   5693  H HA3  . GLY A 1 17 ? -4.208  12.715  5.689   1.00 0.00 ? 17 GLY A HA3  7  
ATOM   5694  N N    . LYS A 1 18 ? -4.978  10.519  4.059   1.00 0.00 ? 18 LYS A N    7  
ATOM   5695  C CA   . LYS A 1 18 ? -4.742  9.264   3.366   1.00 0.00 ? 18 LYS A CA   7  
ATOM   5696  C C    . LYS A 1 18 ? -5.551  9.243   2.068   1.00 0.00 ? 18 LYS A C    7  
ATOM   5697  O O    . LYS A 1 18 ? -6.725  8.874   2.069   1.00 0.00 ? 18 LYS A O    7  
ATOM   5698  C CB   . LYS A 1 18 ? -5.033  8.079   4.290   1.00 0.00 ? 18 LYS A CB   7  
ATOM   5699  C CG   . LYS A 1 18 ? -4.570  8.372   5.719   1.00 0.00 ? 18 LYS A CG   7  
ATOM   5700  C CD   . LYS A 1 18 ? -4.349  7.076   6.500   1.00 0.00 ? 18 LYS A CD   7  
ATOM   5701  C CE   . LYS A 1 18 ? -4.731  7.251   7.972   1.00 0.00 ? 18 LYS A CE   7  
ATOM   5702  N NZ   . LYS A 1 18 ? -4.960  5.934   8.608   1.00 0.00 ? 18 LYS A NZ   7  
ATOM   5703  H H    . LYS A 1 18 ? -5.766  10.521  4.675   1.00 0.00 ? 18 LYS A H    7  
ATOM   5704  H HA   . LYS A 1 18 ? -3.683  9.224   3.114   1.00 0.00 ? 18 LYS A HA   7  
ATOM   5705  H HB2  . LYS A 1 18 ? -6.101  7.864   4.287   1.00 0.00 ? 18 LYS A HB2  7  
ATOM   5706  H HB3  . LYS A 1 18 ? -4.528  7.189   3.916   1.00 0.00 ? 18 LYS A HB3  7  
ATOM   5707  H HG2  . LYS A 1 18 ? -3.644  8.948   5.694   1.00 0.00 ? 18 LYS A HG2  7  
ATOM   5708  H HG3  . LYS A 1 18 ? -5.313  8.986   6.227   1.00 0.00 ? 18 LYS A HG3  7  
ATOM   5709  H HD2  . LYS A 1 18 ? -4.943  6.275   6.059   1.00 0.00 ? 18 LYS A HD2  7  
ATOM   5710  H HD3  . LYS A 1 18 ? -3.304  6.775   6.426   1.00 0.00 ? 18 LYS A HD3  7  
ATOM   5711  H HE2  . LYS A 1 18 ? -3.939  7.782   8.498   1.00 0.00 ? 18 LYS A HE2  7  
ATOM   5712  H HE3  . LYS A 1 18 ? -5.631  7.860   8.050   1.00 0.00 ? 18 LYS A HE3  7  
ATOM   5713  H HZ1  . LYS A 1 18 ? -4.766  5.207   7.949   1.00 0.00 ? 18 LYS A HZ1  7  
ATOM   5714  H HZ2  . LYS A 1 18 ? -4.356  5.836   9.399   1.00 0.00 ? 18 LYS A HZ2  7  
ATOM   5715  N N    . ASN A 1 19 ? -4.892  9.644   0.991   1.00 0.00 ? 19 ASN A N    7  
ATOM   5716  C CA   . ASN A 1 19 ? -5.535  9.676   -0.312  1.00 0.00 ? 19 ASN A CA   7  
ATOM   5717  C C    . ASN A 1 19 ? -4.903  8.613   -1.214  1.00 0.00 ? 19 ASN A C    7  
ATOM   5718  O O    . ASN A 1 19 ? -5.209  8.543   -2.403  1.00 0.00 ? 19 ASN A O    7  
ATOM   5719  C CB   . ASN A 1 19 ? -5.349  11.037  -0.984  1.00 0.00 ? 19 ASN A CB   7  
ATOM   5720  C CG   . ASN A 1 19 ? -6.392  12.041  -0.488  1.00 0.00 ? 19 ASN A CG   7  
ATOM   5721  O OD1  . ASN A 1 19 ? -7.589  11.811  -0.545  1.00 0.00 ? 19 ASN A OD1  7  
ATOM   5722  N ND2  . ASN A 1 19 ? -5.873  13.163  0.001   1.00 0.00 ? 19 ASN A ND2  7  
ATOM   5723  H H    . ASN A 1 19 ? -3.937  9.942   0.998   1.00 0.00 ? 19 ASN A H    7  
ATOM   5724  H HA   . ASN A 1 19 ? -6.589  9.483   -0.116  1.00 0.00 ? 19 ASN A HA   7  
ATOM   5725  H HB2  . ASN A 1 19 ? -4.348  11.416  -0.778  1.00 0.00 ? 19 ASN A HB2  7  
ATOM   5726  H HB3  . ASN A 1 19 ? -5.431  10.927  -2.066  1.00 0.00 ? 19 ASN A HB3  7  
ATOM   5727  H HD21 . ASN A 1 19 ? -4.881  13.289  0.019   1.00 0.00 ? 19 ASN A HD21 7  
ATOM   5728  H HD22 . ASN A 1 19 ? -6.474  13.882  0.351   1.00 0.00 ? 19 ASN A HD22 7  
ATOM   5729  N N    . LEU A 1 20 ? -4.035  7.813   -0.613  1.00 0.00 ? 20 LEU A N    7  
ATOM   5730  C CA   . LEU A 1 20 ? -3.358  6.758   -1.347  1.00 0.00 ? 20 LEU A CA   7  
ATOM   5731  C C    . LEU A 1 20 ? -3.273  5.507   -0.471  1.00 0.00 ? 20 LEU A C    7  
ATOM   5732  O O    . LEU A 1 20 ? -2.856  5.580   0.684   1.00 0.00 ? 20 LEU A O    7  
ATOM   5733  C CB   . LEU A 1 20 ? -2.000  7.245   -1.857  1.00 0.00 ? 20 LEU A CB   7  
ATOM   5734  C CG   . LEU A 1 20 ? -2.033  8.419   -2.837  1.00 0.00 ? 20 LEU A CG   7  
ATOM   5735  C CD1  . LEU A 1 20 ? -1.487  9.692   -2.187  1.00 0.00 ? 20 LEU A CD1  7  
ATOM   5736  C CD2  . LEU A 1 20 ? -1.293  8.074   -4.131  1.00 0.00 ? 20 LEU A CD2  7  
ATOM   5737  H H    . LEU A 1 20 ? -3.792  7.878   0.355   1.00 0.00 ? 20 LEU A H    7  
ATOM   5738  H HA   . LEU A 1 20 ? -3.966  6.527   -2.222  1.00 0.00 ? 20 LEU A HA   7  
ATOM   5739  H HB2  . LEU A 1 20 ? -1.394  7.532   -0.997  1.00 0.00 ? 20 LEU A HB2  7  
ATOM   5740  H HB3  . LEU A 1 20 ? -1.493  6.409   -2.339  1.00 0.00 ? 20 LEU A HB3  7  
ATOM   5741  H HG   . LEU A 1 20 ? -3.072  8.613   -3.103  1.00 0.00 ? 20 LEU A HG   7  
ATOM   5742  H HD11 . LEU A 1 20 ? -0.462  9.859   -2.520  1.00 0.00 ? 20 LEU A HD11 7  
ATOM   5743  H HD12 . LEU A 1 20 ? -2.106  10.542  -2.477  1.00 0.00 ? 20 LEU A HD12 7  
ATOM   5744  H HD21 . LEU A 1 20 ? -1.504  8.833   -4.884  1.00 0.00 ? 20 LEU A HD21 7  
ATOM   5745  H HD22 . LEU A 1 20 ? -0.221  8.040   -3.939  1.00 0.00 ? 20 LEU A HD22 7  
ATOM   5746  N N    . CYS A 1 21 ? -3.675  4.387   -1.054  1.00 0.00 ? 21 CYS A N    7  
ATOM   5747  C CA   . CYS A 1 21 ? -3.650  3.121   -0.340  1.00 0.00 ? 21 CYS A CA   7  
ATOM   5748  C C    . CYS A 1 21 ? -2.250  2.519   -0.480  1.00 0.00 ? 21 CYS A C    7  
ATOM   5749  O O    . CYS A 1 21 ? -1.646  2.585   -1.549  1.00 0.00 ? 21 CYS A O    7  
ATOM   5750  C CB   . CYS A 1 21 ? -4.735  2.166   -0.843  1.00 0.00 ? 21 CYS A CB   7  
ATOM   5751  S SG   . CYS A 1 21 ? -6.231  2.986   -1.504  1.00 0.00 ? 21 CYS A SG   7  
ATOM   5752  H H    . CYS A 1 21 ? -4.012  4.335   -1.994  1.00 0.00 ? 21 CYS A H    7  
ATOM   5753  H HA   . CYS A 1 21 ? -3.872  3.345   0.703   1.00 0.00 ? 21 CYS A HA   7  
ATOM   5754  H HB2  . CYS A 1 21 ? -4.310  1.534   -1.622  1.00 0.00 ? 21 CYS A HB2  7  
ATOM   5755  H HB3  . CYS A 1 21 ? -5.029  1.510   -0.024  1.00 0.00 ? 21 CYS A HB3  7  
ATOM   5756  N N    . TYR A 1 22 ? -1.775  1.945   0.616   1.00 0.00 ? 22 TYR A N    7  
ATOM   5757  C CA   . TYR A 1 22 ? -0.458  1.331   0.629   1.00 0.00 ? 22 TYR A CA   7  
ATOM   5758  C C    . TYR A 1 22 ? -0.561  -0.182  0.828   1.00 0.00 ? 22 TYR A C    7  
ATOM   5759  O O    . TYR A 1 22 ? -1.427  -0.658  1.560   1.00 0.00 ? 22 TYR A O    7  
ATOM   5760  C CB   . TYR A 1 22 ? 0.279   1.942   1.822   1.00 0.00 ? 22 TYR A CB   7  
ATOM   5761  C CG   . TYR A 1 22 ? -0.042  1.274   3.161   1.00 0.00 ? 22 TYR A CG   7  
ATOM   5762  C CD1  . TYR A 1 22 ? -1.090  1.738   3.929   1.00 0.00 ? 22 TYR A CD1  7  
ATOM   5763  C CD2  . TYR A 1 22 ? 0.718   0.209   3.600   1.00 0.00 ? 22 TYR A CD2  7  
ATOM   5764  C CE1  . TYR A 1 22 ? -1.393  1.109   5.189   1.00 0.00 ? 22 TYR A CE1  7  
ATOM   5765  C CE2  . TYR A 1 22 ? 0.415   -0.420  4.860   1.00 0.00 ? 22 TYR A CE2  7  
ATOM   5766  C CZ   . TYR A 1 22 ? -0.625  0.062   5.592   1.00 0.00 ? 22 TYR A CZ   7  
ATOM   5767  O OH   . TYR A 1 22 ? -0.910  -0.532  6.782   1.00 0.00 ? 22 TYR A OH   7  
ATOM   5768  H H    . TYR A 1 22 ? -2.273  1.895   1.482   1.00 0.00 ? 22 TYR A H    7  
ATOM   5769  H HA   . TYR A 1 22 ? 0.016   1.532   -0.331  1.00 0.00 ? 22 TYR A HA   7  
ATOM   5770  H HB2  . TYR A 1 22 ? 1.353   1.878   1.644   1.00 0.00 ? 22 TYR A HB2  7  
ATOM   5771  H HB3  . TYR A 1 22 ? 0.030   3.001   1.887   1.00 0.00 ? 22 TYR A HB3  7  
ATOM   5772  H HD1  . TYR A 1 22 ? -1.690  2.579   3.582   1.00 0.00 ? 22 TYR A HD1  7  
ATOM   5773  H HD2  . TYR A 1 22 ? 1.546   -0.157  2.993   1.00 0.00 ? 22 TYR A HD2  7  
ATOM   5774  H HE1  . TYR A 1 22 ? -2.218  1.465   5.805   1.00 0.00 ? 22 TYR A HE1  7  
ATOM   5775  H HE2  . TYR A 1 22 ? 1.007   -1.262  5.219   1.00 0.00 ? 22 TYR A HE2  7  
ATOM   5776  H HH   . TYR A 1 22 ? -0.601  0.048   7.536   1.00 0.00 ? 22 TYR A HH   7  
ATOM   5777  N N    . LYS A 1 23 ? 0.336   -0.896  0.164   1.00 0.00 ? 23 LYS A N    7  
ATOM   5778  C CA   . LYS A 1 23 ? 0.358   -2.346  0.259   1.00 0.00 ? 23 LYS A CA   7  
ATOM   5779  C C    . LYS A 1 23 ? 1.767   -2.807  0.639   1.00 0.00 ? 23 LYS A C    7  
ATOM   5780  O O    . LYS A 1 23 ? 2.714   -2.608  -0.120  1.00 0.00 ? 23 LYS A O    7  
ATOM   5781  C CB   . LYS A 1 23 ? -0.168  -2.976  -1.032  1.00 0.00 ? 23 LYS A CB   7  
ATOM   5782  C CG   . LYS A 1 23 ? -0.156  -4.503  -0.942  1.00 0.00 ? 23 LYS A CG   7  
ATOM   5783  C CD   . LYS A 1 23 ? -1.426  -5.098  -1.554  1.00 0.00 ? 23 LYS A CD   7  
ATOM   5784  C CE   . LYS A 1 23 ? -1.238  -5.371  -3.048  1.00 0.00 ? 23 LYS A CE   7  
ATOM   5785  N NZ   . LYS A 1 23 ? -1.543  -6.786  -3.358  1.00 0.00 ? 23 LYS A NZ   7  
ATOM   5786  H H    . LYS A 1 23 ? 1.038   -0.501  -0.429  1.00 0.00 ? 23 LYS A H    7  
ATOM   5787  H HA   . LYS A 1 23 ? -0.326  -2.631  1.059   1.00 0.00 ? 23 LYS A HA   7  
ATOM   5788  H HB2  . LYS A 1 23 ? -1.183  -2.627  -1.225  1.00 0.00 ? 23 LYS A HB2  7  
ATOM   5789  H HB3  . LYS A 1 23 ? 0.445   -2.653  -1.874  1.00 0.00 ? 23 LYS A HB3  7  
ATOM   5790  H HG2  . LYS A 1 23 ? 0.719   -4.895  -1.459  1.00 0.00 ? 23 LYS A HG2  7  
ATOM   5791  H HG3  . LYS A 1 23 ? -0.073  -4.809  0.101   1.00 0.00 ? 23 LYS A HG3  7  
ATOM   5792  H HD2  . LYS A 1 23 ? -1.682  -6.025  -1.041  1.00 0.00 ? 23 LYS A HD2  7  
ATOM   5793  H HD3  . LYS A 1 23 ? -2.260  -4.412  -1.408  1.00 0.00 ? 23 LYS A HD3  7  
ATOM   5794  H HE2  . LYS A 1 23 ? -1.889  -4.717  -3.628  1.00 0.00 ? 23 LYS A HE2  7  
ATOM   5795  H HE3  . LYS A 1 23 ? -0.214  -5.141  -3.340  1.00 0.00 ? 23 LYS A HE3  7  
ATOM   5796  H HZ1  . LYS A 1 23 ? -1.137  -7.375  -2.660  1.00 0.00 ? 23 LYS A HZ1  7  
ATOM   5797  H HZ2  . LYS A 1 23 ? -2.534  -6.918  -3.371  1.00 0.00 ? 23 LYS A HZ2  7  
ATOM   5798  N N    . MET A 1 24 ? 1.860   -3.414  1.813   1.00 0.00 ? 24 MET A N    7  
ATOM   5799  C CA   . MET A 1 24 ? 3.137   -3.905  2.302   1.00 0.00 ? 24 MET A CA   7  
ATOM   5800  C C    . MET A 1 24 ? 3.243   -5.422  2.132   1.00 0.00 ? 24 MET A C    7  
ATOM   5801  O O    . MET A 1 24 ? 2.423   -6.169  2.664   1.00 0.00 ? 24 MET A O    7  
ATOM   5802  C CB   . MET A 1 24 ? 3.289   -3.545  3.781   1.00 0.00 ? 24 MET A CB   7  
ATOM   5803  C CG   . MET A 1 24 ? 3.578   -2.053  3.956   1.00 0.00 ? 24 MET A CG   7  
ATOM   5804  S SD   . MET A 1 24 ? 4.506   -1.782  5.457   1.00 0.00 ? 24 MET A SD   7  
ATOM   5805  C CE   . MET A 1 24 ? 3.188   -1.881  6.657   1.00 0.00 ? 24 MET A CE   7  
ATOM   5806  H H    . MET A 1 24 ? 1.084   -3.572  2.424   1.00 0.00 ? 24 MET A H    7  
ATOM   5807  H HA   . MET A 1 24 ? 3.893   -3.410  1.693   1.00 0.00 ? 24 MET A HA   7  
ATOM   5808  H HB2  . MET A 1 24 ? 2.378   -3.808  4.319   1.00 0.00 ? 24 MET A HB2  7  
ATOM   5809  H HB3  . MET A 1 24 ? 4.098   -4.130  4.220   1.00 0.00 ? 24 MET A HB3  7  
ATOM   5810  H HG2  . MET A 1 24 ? 4.140   -1.680  3.099   1.00 0.00 ? 24 MET A HG2  7  
ATOM   5811  H HG3  . MET A 1 24 ? 2.643   -1.495  3.991   1.00 0.00 ? 24 MET A HG3  7  
ATOM   5812  H HE1  . MET A 1 24 ? 3.579   -2.277  7.594   1.00 0.00 ? 24 MET A HE1  7  
ATOM   5813  H HE2  . MET A 1 24 ? 2.776   -0.886  6.827   1.00 0.00 ? 24 MET A HE2  7  
ATOM   5814  N N    . PHE A 1 25 ? 4.260   -5.832  1.388   1.00 0.00 ? 25 PHE A N    7  
ATOM   5815  C CA   . PHE A 1 25 ? 4.484   -7.246  1.141   1.00 0.00 ? 25 PHE A CA   7  
ATOM   5816  C C    . PHE A 1 25 ? 5.979   -7.554  1.030   1.00 0.00 ? 25 PHE A C    7  
ATOM   5817  O O    . PHE A 1 25 ? 6.803   -6.641  1.005   1.00 0.00 ? 25 PHE A O    7  
ATOM   5818  C CB   . PHE A 1 25 ? 3.807   -7.581  -0.189  1.00 0.00 ? 25 PHE A CB   7  
ATOM   5819  C CG   . PHE A 1 25 ? 4.392   -6.834  -1.390  1.00 0.00 ? 25 PHE A CG   7  
ATOM   5820  C CD1  . PHE A 1 25 ? 3.949   -5.585  -1.696  1.00 0.00 ? 25 PHE A CD1  7  
ATOM   5821  C CD2  . PHE A 1 25 ? 5.354   -7.420  -2.152  1.00 0.00 ? 25 PHE A CD2  7  
ATOM   5822  C CE1  . PHE A 1 25 ? 4.492   -4.892  -2.810  1.00 0.00 ? 25 PHE A CE1  7  
ATOM   5823  C CE2  . PHE A 1 25 ? 5.897   -6.728  -3.266  1.00 0.00 ? 25 PHE A CE2  7  
ATOM   5824  C CZ   . PHE A 1 25 ? 5.455   -5.478  -3.572  1.00 0.00 ? 25 PHE A CZ   7  
ATOM   5825  H H    . PHE A 1 25 ? 4.922   -5.218  0.959   1.00 0.00 ? 25 PHE A H    7  
ATOM   5826  H HA   . PHE A 1 25 ? 4.064   -7.793  1.986   1.00 0.00 ? 25 PHE A HA   7  
ATOM   5827  H HB2  . PHE A 1 25 ? 3.887   -8.653  -0.367  1.00 0.00 ? 25 PHE A HB2  7  
ATOM   5828  H HB3  . PHE A 1 25 ? 2.744   -7.349  -0.113  1.00 0.00 ? 25 PHE A HB3  7  
ATOM   5829  H HD1  . PHE A 1 25 ? 3.178   -5.116  -1.085  1.00 0.00 ? 25 PHE A HD1  7  
ATOM   5830  H HD2  . PHE A 1 25 ? 5.709   -8.422  -1.907  1.00 0.00 ? 25 PHE A HD2  7  
ATOM   5831  H HE1  . PHE A 1 25 ? 4.138   -3.891  -3.055  1.00 0.00 ? 25 PHE A HE1  7  
ATOM   5832  H HE2  . PHE A 1 25 ? 6.668   -7.197  -3.877  1.00 0.00 ? 25 PHE A HE2  7  
ATOM   5833  H HZ   . PHE A 1 25 ? 5.871   -4.947  -4.427  1.00 0.00 ? 25 PHE A HZ   7  
ATOM   5834  N N    . MET A 1 26 ? 6.282   -8.842  0.968   1.00 0.00 ? 26 MET A N    7  
ATOM   5835  C CA   . MET A 1 26 ? 7.663   -9.281  0.861   1.00 0.00 ? 26 MET A CA   7  
ATOM   5836  C C    . MET A 1 26 ? 8.023   -9.608  -0.590  1.00 0.00 ? 26 MET A C    7  
ATOM   5837  O O    . MET A 1 26 ? 7.164   -10.015 -1.370  1.00 0.00 ? 26 MET A O    7  
ATOM   5838  C CB   . MET A 1 26 ? 7.874   -10.521 1.732   1.00 0.00 ? 26 MET A CB   7  
ATOM   5839  C CG   . MET A 1 26 ? 7.888   -10.152 3.216   1.00 0.00 ? 26 MET A CG   7  
ATOM   5840  S SD   . MET A 1 26 ? 6.677   -11.122 4.098   1.00 0.00 ? 26 MET A SD   7  
ATOM   5841  C CE   . MET A 1 26 ? 6.662   -10.256 5.659   1.00 0.00 ? 26 MET A CE   7  
ATOM   5842  H H    . MET A 1 26 ? 5.606   -9.577  0.989   1.00 0.00 ? 26 MET A H    7  
ATOM   5843  H HA   . MET A 1 26 ? 8.265   -8.442  1.211   1.00 0.00 ? 26 MET A HA   7  
ATOM   5844  H HB2  . MET A 1 26 ? 7.081   -11.243 1.540   1.00 0.00 ? 26 MET A HB2  7  
ATOM   5845  H HB3  . MET A 1 26 ? 8.815   -11.002 1.464   1.00 0.00 ? 26 MET A HB3  7  
ATOM   5846  H HG2  . MET A 1 26 ? 8.880   -10.327 3.634   1.00 0.00 ? 26 MET A HG2  7  
ATOM   5847  H HG3  . MET A 1 26 ? 7.674   -9.090  3.338   1.00 0.00 ? 26 MET A HG3  7  
ATOM   5848  H HE1  . MET A 1 26 ? 7.368   -9.426  5.620   1.00 0.00 ? 26 MET A HE1  7  
ATOM   5849  H HE2  . MET A 1 26 ? 5.661   -9.872  5.852   1.00 0.00 ? 26 MET A HE2  7  
ATOM   5850  N N    . VAL A 1 27 ? 9.296   -9.418  -0.908  1.00 0.00 ? 27 VAL A N    7  
ATOM   5851  C CA   . VAL A 1 27 ? 9.780   -9.688  -2.251  1.00 0.00 ? 27 VAL A CA   7  
ATOM   5852  C C    . VAL A 1 27 ? 9.542   -11.161 -2.587  1.00 0.00 ? 27 VAL A C    7  
ATOM   5853  O O    . VAL A 1 27 ? 9.628   -11.558 -3.748  1.00 0.00 ? 27 VAL A O    7  
ATOM   5854  C CB   . VAL A 1 27 ? 11.249  -9.277  -2.370  1.00 0.00 ? 27 VAL A CB   7  
ATOM   5855  C CG1  . VAL A 1 27 ? 12.155  -10.256 -1.620  1.00 0.00 ? 27 VAL A CG1  7  
ATOM   5856  C CG2  . VAL A 1 27 ? 11.667  -9.156  -3.836  1.00 0.00 ? 27 VAL A CG2  7  
ATOM   5857  H H    . VAL A 1 27 ? 9.988   -9.087  -0.267  1.00 0.00 ? 27 VAL A H    7  
ATOM   5858  H HA   . VAL A 1 27 ? 9.201   -9.073  -2.939  1.00 0.00 ? 27 VAL A HA   7  
ATOM   5859  H HB   . VAL A 1 27 ? 11.361  -8.296  -1.908  1.00 0.00 ? 27 VAL A HB   7  
ATOM   5860  H HG11 . VAL A 1 27 ? 11.790  -10.381 -0.600  1.00 0.00 ? 27 VAL A HG11 7  
ATOM   5861  H HG12 . VAL A 1 27 ? 12.148  -11.220 -2.128  1.00 0.00 ? 27 VAL A HG12 7  
ATOM   5862  H HG21 . VAL A 1 27 ? 12.735  -8.942  -3.893  1.00 0.00 ? 27 VAL A HG21 7  
ATOM   5863  H HG22 . VAL A 1 27 ? 11.457  -10.093 -4.352  1.00 0.00 ? 27 VAL A HG22 7  
ATOM   5864  N N    . ALA A 1 28 ? 9.248   -11.932 -1.551  1.00 0.00 ? 28 ALA A N    7  
ATOM   5865  C CA   . ALA A 1 28 ? 8.997   -13.353 -1.722  1.00 0.00 ? 28 ALA A CA   7  
ATOM   5866  C C    . ALA A 1 28 ? 8.228   -13.578 -3.025  1.00 0.00 ? 28 ALA A C    7  
ATOM   5867  O O    . ALA A 1 28 ? 8.523   -14.510 -3.771  1.00 0.00 ? 28 ALA A O    7  
ATOM   5868  C CB   . ALA A 1 28 ? 8.246   -13.890 -0.502  1.00 0.00 ? 28 ALA A CB   7  
ATOM   5869  H H    . ALA A 1 28 ? 9.180   -11.602 -0.609  1.00 0.00 ? 28 ALA A H    7  
ATOM   5870  H HA   . ALA A 1 28 ? 9.963   -13.855 -1.788  1.00 0.00 ? 28 ALA A HA   7  
ATOM   5871  H HB1  . ALA A 1 28 ? 8.753   -13.567 0.408   1.00 0.00 ? 28 ALA A HB1  7  
ATOM   5872  H HB2  . ALA A 1 28 ? 7.226   -13.506 -0.505  1.00 0.00 ? 28 ALA A HB2  7  
ATOM   5873  N N    . ALA A 1 29 ? 7.258   -12.707 -3.260  1.00 0.00 ? 29 ALA A N    7  
ATOM   5874  C CA   . ALA A 1 29 ? 6.444   -12.798 -4.460  1.00 0.00 ? 29 ALA A CA   7  
ATOM   5875  C C    . ALA A 1 29 ? 5.711   -11.473 -4.676  1.00 0.00 ? 29 ALA A C    7  
ATOM   5876  O O    . ALA A 1 29 ? 5.457   -10.738 -3.723  1.00 0.00 ? 29 ALA A O    7  
ATOM   5877  C CB   . ALA A 1 29 ? 5.484   -13.983 -4.337  1.00 0.00 ? 29 ALA A CB   7  
ATOM   5878  H H    . ALA A 1 29 ? 7.024   -11.951 -2.648  1.00 0.00 ? 29 ALA A H    7  
ATOM   5879  H HA   . ALA A 1 29 ? 7.114   -12.975 -5.302  1.00 0.00 ? 29 ALA A HA   7  
ATOM   5880  H HB1  . ALA A 1 29 ? 4.719   -13.755 -3.595  1.00 0.00 ? 29 ALA A HB1  7  
ATOM   5881  H HB2  . ALA A 1 29 ? 5.010   -14.168 -5.301  1.00 0.00 ? 29 ALA A HB2  7  
ATOM   5882  N N    . PRO A 1 30 ? 5.382   -11.202 -5.967  1.00 0.00 ? 30 PRO A N    7  
ATOM   5883  C CA   . PRO A 1 30 ? 4.683   -9.978  -6.321  1.00 0.00 ? 30 PRO A CA   7  
ATOM   5884  C C    . PRO A 1 30 ? 3.207   -10.057 -5.925  1.00 0.00 ? 30 PRO A C    7  
ATOM   5885  O O    . PRO A 1 30 ? 2.490   -9.058  -5.985  1.00 0.00 ? 30 PRO A O    7  
ATOM   5886  C CB   . PRO A 1 30 ? 4.889   -9.825  -7.819  1.00 0.00 ? 30 PRO A CB   7  
ATOM   5887  C CG   . PRO A 1 30 ? 5.296   -11.199 -8.326  1.00 0.00 ? 30 PRO A CG   7  
ATOM   5888  C CD   . PRO A 1 30 ? 5.667   -12.049 -7.121  1.00 0.00 ? 30 PRO A CD   7  
ATOM   5889  H HA   . PRO A 1 30 ? 5.061   -9.204  -5.813  1.00 0.00 ? 30 PRO A HA   7  
ATOM   5890  H HB2  . PRO A 1 30 ? 3.976   -9.484  -8.306  1.00 0.00 ? 30 PRO A HB2  7  
ATOM   5891  H HB3  . PRO A 1 30 ? 5.660   -9.085  -8.033  1.00 0.00 ? 30 PRO A HB3  7  
ATOM   5892  H HG2  . PRO A 1 30 ? 4.478   -11.659 -8.880  1.00 0.00 ? 30 PRO A HG2  7  
ATOM   5893  H HG3  . PRO A 1 30 ? 6.140   -11.119 -9.011  1.00 0.00 ? 30 PRO A HG3  7  
ATOM   5894  H HD2  . PRO A 1 30 ? 5.082   -12.969 -7.091  1.00 0.00 ? 30 PRO A HD2  7  
ATOM   5895  H HD3  . PRO A 1 30 ? 6.717   -12.340 -7.150  1.00 0.00 ? 30 PRO A HD3  7  
ATOM   5896  N N    . HIS A 1 31 ? 2.796   -11.253 -5.530  1.00 0.00 ? 31 HIS A N    7  
ATOM   5897  C CA   . HIS A 1 31 ? 1.418   -11.474 -5.125  1.00 0.00 ? 31 HIS A CA   7  
ATOM   5898  C C    . HIS A 1 31 ? 1.389   -12.245 -3.804  1.00 0.00 ? 31 HIS A C    7  
ATOM   5899  O O    . HIS A 1 31 ? 0.902   -13.373 -3.749  1.00 0.00 ? 31 HIS A O    7  
ATOM   5900  C CB   . HIS A 1 31 ? 0.631   -12.173 -6.236  1.00 0.00 ? 31 HIS A CB   7  
ATOM   5901  C CG   . HIS A 1 31 ? -0.857  -11.923 -6.185  1.00 0.00 ? 31 HIS A CG   7  
ATOM   5902  N ND1  . HIS A 1 31 ? -1.552  -11.320 -7.219  1.00 0.00 ? 31 HIS A ND1  7  
ATOM   5903  C CD2  . HIS A 1 31 ? -1.775  -12.201 -5.215  1.00 0.00 ? 31 HIS A CD2  7  
ATOM   5904  C CE1  . HIS A 1 31 ? -2.829  -11.243 -6.876  1.00 0.00 ? 31 HIS A CE1  7  
ATOM   5905  N NE2  . HIS A 1 31 ? -2.965  -11.789 -5.634  1.00 0.00 ? 31 HIS A NE2  7  
ATOM   5906  H H    . HIS A 1 31 ? 3.385   -12.059 -5.485  1.00 0.00 ? 31 HIS A H    7  
ATOM   5907  H HA   . HIS A 1 31 ? 0.975   -10.491 -4.972  1.00 0.00 ? 31 HIS A HA   7  
ATOM   5908  H HB2  . HIS A 1 31 ? 1.012   -11.841 -7.202  1.00 0.00 ? 31 HIS A HB2  7  
ATOM   5909  H HB3  . HIS A 1 31 ? 0.811   -13.247 -6.174  1.00 0.00 ? 31 HIS A HB3  7  
ATOM   5910  H HD1  . HIS A 1 31 ? -1.157  -10.997 -8.079  1.00 0.00 ? 31 HIS A HD1  7  
ATOM   5911  H HD2  . HIS A 1 31 ? -1.566  -12.680 -4.259  1.00 0.00 ? 31 HIS A HD2  7  
ATOM   5912  H HE1  . HIS A 1 31 ? -3.630  -10.818 -7.480  1.00 0.00 ? 31 HIS A HE1  7  
ATOM   5913  N N    . VAL A 1 32 ? 1.918   -11.604 -2.771  1.00 0.00 ? 32 VAL A N    7  
ATOM   5914  C CA   . VAL A 1 32 ? 1.959   -12.215 -1.453  1.00 0.00 ? 32 VAL A CA   7  
ATOM   5915  C C    . VAL A 1 32 ? 2.055   -11.118 -0.391  1.00 0.00 ? 32 VAL A C    7  
ATOM   5916  O O    . VAL A 1 32 ? 3.114   -10.910 0.198   1.00 0.00 ? 32 VAL A O    7  
ATOM   5917  C CB   . VAL A 1 32 ? 3.108   -13.221 -1.378  1.00 0.00 ? 32 VAL A CB   7  
ATOM   5918  C CG1  . VAL A 1 32 ? 3.496   -13.505 0.074   1.00 0.00 ? 32 VAL A CG1  7  
ATOM   5919  C CG2  . VAL A 1 32 ? 2.752   -14.515 -2.113  1.00 0.00 ? 32 VAL A CG2  7  
ATOM   5920  H H    . VAL A 1 32 ? 2.312   -10.687 -2.824  1.00 0.00 ? 32 VAL A H    7  
ATOM   5921  H HA   . VAL A 1 32 ? 1.024   -12.758 -1.313  1.00 0.00 ? 32 VAL A HA   7  
ATOM   5922  H HB   . VAL A 1 32 ? 3.972   -12.781 -1.876  1.00 0.00 ? 32 VAL A HB   7  
ATOM   5923  H HG11 . VAL A 1 32 ? 4.271   -12.805 0.386   1.00 0.00 ? 32 VAL A HG11 7  
ATOM   5924  H HG12 . VAL A 1 32 ? 2.621   -13.385 0.713   1.00 0.00 ? 32 VAL A HG12 7  
ATOM   5925  H HG21 . VAL A 1 32 ? 1.733   -14.809 -1.859  1.00 0.00 ? 32 VAL A HG21 7  
ATOM   5926  H HG22 . VAL A 1 32 ? 2.827   -14.355 -3.189  1.00 0.00 ? 32 VAL A HG22 7  
ATOM   5927  N N    . PRO A 1 33 ? 0.903   -10.428 -0.171  1.00 0.00 ? 33 PRO A N    7  
ATOM   5928  C CA   . PRO A 1 33 ? 0.848   -9.358  0.810   1.00 0.00 ? 33 PRO A CA   7  
ATOM   5929  C C    . PRO A 1 33 ? 0.822   -9.919  2.233   1.00 0.00 ? 33 PRO A C    7  
ATOM   5930  O O    . PRO A 1 33 ? 0.473   -11.081 2.439   1.00 0.00 ? 33 PRO A O    7  
ATOM   5931  C CB   . PRO A 1 33 ? -0.403  -8.568  0.461   1.00 0.00 ? 33 PRO A CB   7  
ATOM   5932  C CG   . PRO A 1 33 ? -1.249  -9.489  -0.405  1.00 0.00 ? 33 PRO A CG   7  
ATOM   5933  C CD   . PRO A 1 33 ? -0.371  -10.647 -0.850  1.00 0.00 ? 33 PRO A CD   7  
ATOM   5934  H HA   . PRO A 1 33 ? 1.670   -8.792  0.754   1.00 0.00 ? 33 PRO A HA   7  
ATOM   5935  H HB2  . PRO A 1 33 ? -0.943  -8.274  1.361   1.00 0.00 ? 33 PRO A HB2  7  
ATOM   5936  H HB3  . PRO A 1 33 ? -0.151  -7.652  -0.074  1.00 0.00 ? 33 PRO A HB3  7  
ATOM   5937  H HG2  . PRO A 1 33 ? -2.110  -9.855  0.155   1.00 0.00 ? 33 PRO A HG2  7  
ATOM   5938  H HG3  . PRO A 1 33 ? -1.637  -8.950  -1.269  1.00 0.00 ? 33 PRO A HG3  7  
ATOM   5939  H HD2  . PRO A 1 33 ? -0.808  -11.605 -0.570  1.00 0.00 ? 33 PRO A HD2  7  
ATOM   5940  H HD3  . PRO A 1 33 ? -0.247  -10.656 -1.932  1.00 0.00 ? 33 PRO A HD3  7  
ATOM   5941  N N    . VAL A 1 34 ? 1.197   -9.069  3.177   1.00 0.00 ? 34 VAL A N    7  
ATOM   5942  C CA   . VAL A 1 34 ? 1.222   -9.466  4.575   1.00 0.00 ? 34 VAL A CA   7  
ATOM   5943  C C    . VAL A 1 34 ? 0.328   -8.524  5.384   1.00 0.00 ? 34 VAL A C    7  
ATOM   5944  O O    . VAL A 1 34 ? -0.432  -8.969  6.243   1.00 0.00 ? 34 VAL A O    7  
ATOM   5945  C CB   . VAL A 1 34 ? 2.664   -9.504  5.083   1.00 0.00 ? 34 VAL A CB   7  
ATOM   5946  C CG1  . VAL A 1 34 ? 3.273   -8.101  5.112   1.00 0.00 ? 34 VAL A CG1  7  
ATOM   5947  C CG2  . VAL A 1 34 ? 2.743   -10.165 6.460   1.00 0.00 ? 34 VAL A CG2  7  
ATOM   5948  H H    . VAL A 1 34 ? 1.479   -8.126  3.001   1.00 0.00 ? 34 VAL A H    7  
ATOM   5949  H HA   . VAL A 1 34 ? 0.815   -10.475 4.637   1.00 0.00 ? 34 VAL A HA   7  
ATOM   5950  H HB   . VAL A 1 34 ? 3.248   -10.108 4.388   1.00 0.00 ? 34 VAL A HB   7  
ATOM   5951  H HG11 . VAL A 1 34 ? 3.133   -7.624  4.142   1.00 0.00 ? 34 VAL A HG11 7  
ATOM   5952  H HG12 . VAL A 1 34 ? 2.781   -7.508  5.882   1.00 0.00 ? 34 VAL A HG12 7  
ATOM   5953  H HG21 . VAL A 1 34 ? 2.107   -9.624  7.160   1.00 0.00 ? 34 VAL A HG21 7  
ATOM   5954  H HG22 . VAL A 1 34 ? 2.406   -11.199 6.387   1.00 0.00 ? 34 VAL A HG22 7  
ATOM   5955  N N    . LYS A 1 35 ? 0.449   -7.240  5.081   1.00 0.00 ? 35 LYS A N    7  
ATOM   5956  C CA   . LYS A 1 35 ? -0.339  -6.231  5.769   1.00 0.00 ? 35 LYS A CA   7  
ATOM   5957  C C    . LYS A 1 35 ? -0.554  -5.036  4.839   1.00 0.00 ? 35 LYS A C    7  
ATOM   5958  O O    . LYS A 1 35 ? 0.350   -4.650  4.099   1.00 0.00 ? 35 LYS A O    7  
ATOM   5959  C CB   . LYS A 1 35 ? 0.312   -5.863  7.104   1.00 0.00 ? 35 LYS A CB   7  
ATOM   5960  C CG   . LYS A 1 35 ? 0.352   -7.068  8.046   1.00 0.00 ? 35 LYS A CG   7  
ATOM   5961  C CD   . LYS A 1 35 ? 0.933   -6.680  9.407   1.00 0.00 ? 35 LYS A CD   7  
ATOM   5962  C CE   . LYS A 1 35 ? 0.018   -7.139  10.545  1.00 0.00 ? 35 LYS A CE   7  
ATOM   5963  N NZ   . LYS A 1 35 ? 0.008   -6.140  11.637  1.00 0.00 ? 35 LYS A NZ   7  
ATOM   5964  H H    . LYS A 1 35 ? 1.069   -6.886  4.381   1.00 0.00 ? 35 LYS A H    7  
ATOM   5965  H HA   . LYS A 1 35 ? -1.309  -6.673  5.995   1.00 0.00 ? 35 LYS A HA   7  
ATOM   5966  H HB2  . LYS A 1 35 ? 1.325   -5.498  6.931   1.00 0.00 ? 35 LYS A HB2  7  
ATOM   5967  H HB3  . LYS A 1 35 ? -0.243  -5.049  7.571   1.00 0.00 ? 35 LYS A HB3  7  
ATOM   5968  H HG2  . LYS A 1 35 ? -0.655  -7.465  8.176   1.00 0.00 ? 35 LYS A HG2  7  
ATOM   5969  H HG3  . LYS A 1 35 ? 0.953   -7.861  7.602   1.00 0.00 ? 35 LYS A HG3  7  
ATOM   5970  H HD2  . LYS A 1 35 ? 1.920   -7.129  9.526   1.00 0.00 ? 35 LYS A HD2  7  
ATOM   5971  H HD3  . LYS A 1 35 ? 1.066   -5.600  9.456   1.00 0.00 ? 35 LYS A HD3  7  
ATOM   5972  H HE2  . LYS A 1 35 ? -0.994  -7.285  10.169  1.00 0.00 ? 35 LYS A HE2  7  
ATOM   5973  H HE3  . LYS A 1 35 ? 0.358   -8.101  10.928  1.00 0.00 ? 35 LYS A HE3  7  
ATOM   5974  H HZ1  . LYS A 1 35 ? -0.433  -6.532  12.444  1.00 0.00 ? 35 LYS A HZ1  7  
ATOM   5975  H HZ2  . LYS A 1 35 ? 0.948   -5.884  11.863  1.00 0.00 ? 35 LYS A HZ2  7  
ATOM   5976  N N    . ARG A 1 36 ? -1.754  -4.454  4.882   1.00 0.00 ? 36 ARG A N    7  
ATOM   5977  C CA   . ARG A 1 36 ? -2.082  -3.314  4.049   1.00 0.00 ? 36 ARG A CA   7  
ATOM   5978  C C    . ARG A 1 36 ? -2.953  -2.339  4.829   1.00 0.00 ? 36 ARG A C    7  
ATOM   5979  O O    . ARG A 1 36 ? -3.412  -2.654  5.925   1.00 0.00 ? 36 ARG A O    7  
ATOM   5980  C CB   . ARG A 1 36 ? -2.801  -3.794  2.792   1.00 0.00 ? 36 ARG A CB   7  
ATOM   5981  C CG   . ARG A 1 36 ? -1.818  -4.547  1.900   1.00 0.00 ? 36 ARG A CG   7  
ATOM   5982  C CD   . ARG A 1 36 ? -2.328  -5.966  1.665   1.00 0.00 ? 36 ARG A CD   7  
ATOM   5983  N NE   . ARG A 1 36 ? -3.600  -5.955  0.943   1.00 0.00 ? 36 ARG A NE   7  
ATOM   5984  C CZ   . ARG A 1 36 ? -4.240  -7.076  0.583   1.00 0.00 ? 36 ARG A CZ   7  
ATOM   5985  N NH1  . ARG A 1 36 ? -3.717  -8.272  0.884   1.00 0.00 ? 36 ARG A NH1  7  
ATOM   5986  N NH2  . ARG A 1 36 ? -5.403  -7.000  -0.079  1.00 0.00 ? 36 ARG A NH2  7  
ATOM   5987  H H    . ARG A 1 36 ? -2.461  -4.810  5.508   1.00 0.00 ? 36 ARG A H    7  
ATOM   5988  H HA   . ARG A 1 36 ? -1.160  -2.810  3.759   1.00 0.00 ? 36 ARG A HA   7  
ATOM   5989  H HB2  . ARG A 1 36 ? -3.619  -4.458  3.073   1.00 0.00 ? 36 ARG A HB2  7  
ATOM   5990  H HB3  . ARG A 1 36 ? -3.199  -2.936  2.251   1.00 0.00 ? 36 ARG A HB3  7  
ATOM   5991  H HG2  . ARG A 1 36 ? -1.728  -4.031  0.944   1.00 0.00 ? 36 ARG A HG2  7  
ATOM   5992  H HG3  . ARG A 1 36 ? -0.843  -4.586  2.385   1.00 0.00 ? 36 ARG A HG3  7  
ATOM   5993  H HD2  . ARG A 1 36 ? -1.591  -6.519  1.082   1.00 0.00 ? 36 ARG A HD2  7  
ATOM   5994  H HD3  . ARG A 1 36 ? -2.467  -6.460  2.627   1.00 0.00 ? 36 ARG A HD3  7  
ATOM   5995  H HE   . ARG A 1 36 ? -4.003  -5.058  0.713   1.00 0.00 ? 36 ARG A HE   7  
ATOM   5996  H HH11 . ARG A 1 36 ? -2.841  -8.329  1.382   1.00 0.00 ? 36 ARG A HH11 7  
ATOM   5997  H HH12 . ARG A 1 36 ? -4.199  -9.117  0.612   1.00 0.00 ? 36 ARG A HH12 7  
ATOM   5998  H HH21 . ARG A 1 36 ? -5.798  -6.099  -0.305  1.00 0.00 ? 36 ARG A HH21 7  
ATOM   5999  H HH22 . ARG A 1 36 ? -5.885  -7.845  -0.350  1.00 0.00 ? 36 ARG A HH22 7  
ATOM   6000  N N    . GLY A 1 37 ? -3.156  -1.171  4.237   1.00 0.00 ? 37 GLY A N    7  
ATOM   6001  C CA   . GLY A 1 37 ? -3.969  -0.145  4.867   1.00 0.00 ? 37 GLY A CA   7  
ATOM   6002  C C    . GLY A 1 37 ? -3.931  1.156   4.061   1.00 0.00 ? 37 GLY A C    7  
ATOM   6003  O O    . GLY A 1 37 ? -3.463  1.172   2.924   1.00 0.00 ? 37 GLY A O    7  
ATOM   6004  H H    . GLY A 1 37 ? -2.778  -0.923  3.345   1.00 0.00 ? 37 GLY A H    7  
ATOM   6005  H HA2  . GLY A 1 37 ? -4.998  -0.493  4.954   1.00 0.00 ? 37 GLY A HA2  7  
ATOM   6006  H HA3  . GLY A 1 37 ? -3.607  0.040   5.879   1.00 0.00 ? 37 GLY A HA3  7  
ATOM   6007  N N    . CYS A 1 38 ? -4.431  2.214   4.683   1.00 0.00 ? 38 CYS A N    7  
ATOM   6008  C CA   . CYS A 1 38 ? -4.460  3.516   4.038   1.00 0.00 ? 38 CYS A CA   7  
ATOM   6009  C C    . CYS A 1 38 ? -3.254  4.321   4.526   1.00 0.00 ? 38 CYS A C    7  
ATOM   6010  O O    . CYS A 1 38 ? -2.745  4.081   5.620   1.00 0.00 ? 38 CYS A O    7  
ATOM   6011  C CB   . CYS A 1 38 ? -5.778  4.247   4.300   1.00 0.00 ? 38 CYS A CB   7  
ATOM   6012  S SG   . CYS A 1 38 ? -7.259  3.436   3.593   1.00 0.00 ? 38 CYS A SG   7  
ATOM   6013  H H    . CYS A 1 38 ? -4.810  2.192   5.608   1.00 0.00 ? 38 CYS A H    7  
ATOM   6014  H HA   . CYS A 1 38 ? -4.396  3.335   2.965   1.00 0.00 ? 38 CYS A HA   7  
ATOM   6015  H HB2  . CYS A 1 38 ? -5.915  4.347   5.376   1.00 0.00 ? 38 CYS A HB2  7  
ATOM   6016  H HB3  . CYS A 1 38 ? -5.705  5.256   3.893   1.00 0.00 ? 38 CYS A HB3  7  
ATOM   6017  N N    . ILE A 1 39 ? -2.833  5.260   3.691   1.00 0.00 ? 39 ILE A N    7  
ATOM   6018  C CA   . ILE A 1 39 ? -1.696  6.102   4.024   1.00 0.00 ? 39 ILE A CA   7  
ATOM   6019  C C    . ILE A 1 39 ? -1.712  7.347   3.135   1.00 0.00 ? 39 ILE A C    7  
ATOM   6020  O O    . ILE A 1 39 ? -2.584  7.493   2.280   1.00 0.00 ? 39 ILE A O    7  
ATOM   6021  C CB   . ILE A 1 39 ? -0.394  5.302   3.940   1.00 0.00 ? 39 ILE A CB   7  
ATOM   6022  C CG1  . ILE A 1 39 ? 0.573   5.711   5.053   1.00 0.00 ? 39 ILE A CG1  7  
ATOM   6023  C CG2  . ILE A 1 39 ? 0.240   5.431   2.554   1.00 0.00 ? 39 ILE A CG2  7  
ATOM   6024  C CD1  . ILE A 1 39 ? 0.528   4.714   6.213   1.00 0.00 ? 39 ILE A CD1  7  
ATOM   6025  H H    . ILE A 1 39 ? -3.253  5.448   2.804   1.00 0.00 ? 39 ILE A H    7  
ATOM   6026  H HA   . ILE A 1 39 ? -1.815  6.416   5.061   1.00 0.00 ? 39 ILE A HA   7  
ATOM   6027  H HB   . ILE A 1 39 ? -0.630  4.249   4.090   1.00 0.00 ? 39 ILE A HB   7  
ATOM   6028  H HG12 . ILE A 1 39 ? 1.587   5.767   4.656   1.00 0.00 ? 39 ILE A HG12 7  
ATOM   6029  H HG13 . ILE A 1 39 ? 0.317   6.707   5.415   1.00 0.00 ? 39 ILE A HG13 7  
ATOM   6030  H HG21 . ILE A 1 39 ? 1.221   4.955   2.557   1.00 0.00 ? 39 ILE A HG21 7  
ATOM   6031  H HG22 . ILE A 1 39 ? -0.398  4.944   1.816   1.00 0.00 ? 39 ILE A HG22 7  
ATOM   6032  H HD11 . ILE A 1 39 ? 1.329   4.939   6.917   1.00 0.00 ? 39 ILE A HD11 7  
ATOM   6033  H HD12 . ILE A 1 39 ? -0.434  4.789   6.720   1.00 0.00 ? 39 ILE A HD12 7  
ATOM   6034  N N    . ASP A 1 40 ? -0.743  8.241   3.341   1.00 0.00 ? 40 ASP A N    7  
ATOM   6035  C CA   . ASP A 1 40 ? -0.650  9.461   2.564   1.00 0.00 ? 40 ASP A CA   7  
ATOM   6036  C C    . ASP A 1 40 ? 0.587   9.414   1.678   1.00 0.00 ? 40 ASP A C    7  
ATOM   6037  O O    . ASP A 1 40 ? 0.516   9.734   0.494   1.00 0.00 ? 40 ASP A O    7  
ATOM   6038  C CB   . ASP A 1 40 ? -0.595  10.659  3.507   1.00 0.00 ? 40 ASP A CB   7  
ATOM   6039  C CG   . ASP A 1 40 ? -0.450  11.958  2.727   1.00 0.00 ? 40 ASP A CG   7  
ATOM   6040  O OD1  . ASP A 1 40 ? -0.010  12.948  3.350   1.00 0.00 ? 40 ASP A OD1  7  
ATOM   6041  O OD2  . ASP A 1 40 ? -0.783  11.937  1.522   1.00 0.00 ? 40 ASP A OD2  7  
ATOM   6042  H H    . ASP A 1 40 ? -0.049  8.073   4.056   1.00 0.00 ? 40 ASP A H    7  
ATOM   6043  H HA   . ASP A 1 40 ? -1.534  9.547   1.933   1.00 0.00 ? 40 ASP A HA   7  
ATOM   6044  H HB2  . ASP A 1 40 ? -1.512  10.695  4.095   1.00 0.00 ? 40 ASP A HB2  7  
ATOM   6045  H HB3  . ASP A 1 40 ? 0.257   10.549  4.178   1.00 0.00 ? 40 ASP A HB3  7  
ATOM   6046  H HD2  . ASP A 1 40 ? -0.669  12.785  1.086   1.00 0.00 ? 40 ASP A HD2  7  
ATOM   6047  N N    . VAL A 1 41 ? 1.696   9.012   2.283   1.00 0.00 ? 41 VAL A N    7  
ATOM   6048  C CA   . VAL A 1 41 ? 2.951   8.920   1.558   1.00 0.00 ? 41 VAL A CA   7  
ATOM   6049  C C    . VAL A 1 41 ? 3.484   7.488   1.649   1.00 0.00 ? 41 VAL A C    7  
ATOM   6050  O O    . VAL A 1 41 ? 3.175   6.766   2.596   1.00 0.00 ? 41 VAL A O    7  
ATOM   6051  C CB   . VAL A 1 41 ? 3.940   9.961   2.088   1.00 0.00 ? 41 VAL A CB   7  
ATOM   6052  C CG1  . VAL A 1 41 ? 4.436   9.584   3.485   1.00 0.00 ? 41 VAL A CG1  7  
ATOM   6053  C CG2  . VAL A 1 41 ? 5.111   10.146  1.122   1.00 0.00 ? 41 VAL A CG2  7  
ATOM   6054  H H    . VAL A 1 41 ? 1.745   8.753   3.248   1.00 0.00 ? 41 VAL A H    7  
ATOM   6055  H HA   . VAL A 1 41 ? 2.745   9.151   0.513   1.00 0.00 ? 41 VAL A HA   7  
ATOM   6056  H HB   . VAL A 1 41 ? 3.415   10.913  2.164   1.00 0.00 ? 41 VAL A HB   7  
ATOM   6057  H HG11 . VAL A 1 41 ? 4.383   10.456  4.137   1.00 0.00 ? 41 VAL A HG11 7  
ATOM   6058  H HG12 . VAL A 1 41 ? 3.810   8.789   3.891   1.00 0.00 ? 41 VAL A HG12 7  
ATOM   6059  H HG21 . VAL A 1 41 ? 5.884   10.749  1.599   1.00 0.00 ? 41 VAL A HG21 7  
ATOM   6060  H HG22 . VAL A 1 41 ? 5.522   9.172   0.857   1.00 0.00 ? 41 VAL A HG22 7  
ATOM   6061  N N    . CYS A 1 42 ? 4.276   7.121   0.652   1.00 0.00 ? 42 CYS A N    7  
ATOM   6062  C CA   . CYS A 1 42 ? 4.855   5.789   0.609   1.00 0.00 ? 42 CYS A CA   7  
ATOM   6063  C C    . CYS A 1 42 ? 6.299   5.876   1.106   1.00 0.00 ? 42 CYS A C    7  
ATOM   6064  O O    . CYS A 1 42 ? 7.045   6.767   0.703   1.00 0.00 ? 42 CYS A O    7  
ATOM   6065  C CB   . CYS A 1 42 ? 4.770   5.181   -0.793  1.00 0.00 ? 42 CYS A CB   7  
ATOM   6066  S SG   . CYS A 1 42 ? 4.072   3.491   -0.855  1.00 0.00 ? 42 CYS A SG   7  
ATOM   6067  H H    . CYS A 1 42 ? 4.523   7.714   -0.114  1.00 0.00 ? 42 CYS A H    7  
ATOM   6068  H HA   . CYS A 1 42 ? 4.255   5.165   1.270   1.00 0.00 ? 42 CYS A HA   7  
ATOM   6069  H HB2  . CYS A 1 42 ? 4.162   5.833   -1.420  1.00 0.00 ? 42 CYS A HB2  7  
ATOM   6070  H HB3  . CYS A 1 42 ? 5.770   5.162   -1.227  1.00 0.00 ? 42 CYS A HB3  7  
ATOM   6071  N N    . PRO A 1 43 ? 6.659   4.914   1.997   1.00 0.00 ? 43 PRO A N    7  
ATOM   6072  C CA   . PRO A 1 43 ? 8.001   4.873   2.554   1.00 0.00 ? 43 PRO A CA   7  
ATOM   6073  C C    . PRO A 1 43 ? 9.005   4.347   1.526   1.00 0.00 ? 43 PRO A C    7  
ATOM   6074  O O    . PRO A 1 43 ? 8.628   3.988   0.412   1.00 0.00 ? 43 PRO A O    7  
ATOM   6075  C CB   . PRO A 1 43 ? 7.890   3.988   3.784   1.00 0.00 ? 43 PRO A CB   7  
ATOM   6076  C CG   . PRO A 1 43 ? 6.606   3.193   3.611   1.00 0.00 ? 43 PRO A CG   7  
ATOM   6077  C CD   . PRO A 1 43 ? 5.802   3.843   2.496   1.00 0.00 ? 43 PRO A CD   7  
ATOM   6078  H HA   . PRO A 1 43 ? 8.308   5.796   2.787   1.00 0.00 ? 43 PRO A HA   7  
ATOM   6079  H HB2  . PRO A 1 43 ? 8.751   3.325   3.867   1.00 0.00 ? 43 PRO A HB2  7  
ATOM   6080  H HB3  . PRO A 1 43 ? 7.859   4.586   4.694   1.00 0.00 ? 43 PRO A HB3  7  
ATOM   6081  H HG2  . PRO A 1 43 ? 6.830   2.155   3.365   1.00 0.00 ? 43 PRO A HG2  7  
ATOM   6082  H HG3  . PRO A 1 43 ? 6.034   3.184   4.539   1.00 0.00 ? 43 PRO A HG3  7  
ATOM   6083  H HD2  . PRO A 1 43 ? 5.565   3.126   1.710   1.00 0.00 ? 43 PRO A HD2  7  
ATOM   6084  H HD3  . PRO A 1 43 ? 4.855   4.234   2.867   1.00 0.00 ? 43 PRO A HD3  7  
ATOM   6085  N N    . LYS A 1 44 ? 10.264  4.317   1.938   1.00 0.00 ? 44 LYS A N    7  
ATOM   6086  C CA   . LYS A 1 44 ? 11.325  3.841   1.068   1.00 0.00 ? 44 LYS A CA   7  
ATOM   6087  C C    . LYS A 1 44 ? 11.141  2.342   0.820   1.00 0.00 ? 44 LYS A C    7  
ATOM   6088  O O    . LYS A 1 44 ? 10.525  1.647   1.626   1.00 0.00 ? 44 LYS A O    7  
ATOM   6089  C CB   . LYS A 1 44 ? 12.695  4.205   1.644   1.00 0.00 ? 44 LYS A CB   7  
ATOM   6090  C CG   . LYS A 1 44 ? 13.764  4.220   0.549   1.00 0.00 ? 44 LYS A CG   7  
ATOM   6091  C CD   . LYS A 1 44 ? 15.165  4.345   1.152   1.00 0.00 ? 44 LYS A CD   7  
ATOM   6092  C CE   . LYS A 1 44 ? 16.241  4.106   0.091   1.00 0.00 ? 44 LYS A CE   7  
ATOM   6093  N NZ   . LYS A 1 44 ? 17.287  5.150   0.171   1.00 0.00 ? 44 LYS A NZ   7  
ATOM   6094  H H    . LYS A 1 44 ? 10.562  4.611   2.846   1.00 0.00 ? 44 LYS A H    7  
ATOM   6095  H HA   . LYS A 1 44 ? 11.227  4.363   0.116   1.00 0.00 ? 44 LYS A HA   7  
ATOM   6096  H HB2  . LYS A 1 44 ? 12.645  5.183   2.121   1.00 0.00 ? 44 LYS A HB2  7  
ATOM   6097  H HB3  . LYS A 1 44 ? 12.971  3.488   2.417   1.00 0.00 ? 44 LYS A HB3  7  
ATOM   6098  H HG2  . LYS A 1 44 ? 13.698  3.305   -0.041  1.00 0.00 ? 44 LYS A HG2  7  
ATOM   6099  H HG3  . LYS A 1 44 ? 13.581  5.052   -0.131  1.00 0.00 ? 44 LYS A HG3  7  
ATOM   6100  H HD2  . LYS A 1 44 ? 15.290  5.336   1.586   1.00 0.00 ? 44 LYS A HD2  7  
ATOM   6101  H HD3  . LYS A 1 44 ? 15.281  3.625   1.962   1.00 0.00 ? 44 LYS A HD3  7  
ATOM   6102  H HE2  . LYS A 1 44 ? 16.689  3.122   0.234   1.00 0.00 ? 44 LYS A HE2  7  
ATOM   6103  H HE3  . LYS A 1 44 ? 15.790  4.110   -0.901  1.00 0.00 ? 44 LYS A HE3  7  
ATOM   6104  H HZ1  . LYS A 1 44 ? 18.188  4.717   0.201   1.00 0.00 ? 44 LYS A HZ1  7  
ATOM   6105  H HZ2  . LYS A 1 44 ? 17.229  5.742   -0.633  1.00 0.00 ? 44 LYS A HZ2  7  
ATOM   6106  N N    . SER A 1 45 ? 11.686  1.888   -0.299  1.00 0.00 ? 45 SER A N    7  
ATOM   6107  C CA   . SER A 1 45 ? 11.590  0.485   -0.663  1.00 0.00 ? 45 SER A CA   7  
ATOM   6108  C C    . SER A 1 45 ? 12.944  -0.200  -0.469  1.00 0.00 ? 45 SER A C    7  
ATOM   6109  O O    . SER A 1 45 ? 13.976  0.329   -0.879  1.00 0.00 ? 45 SER A O    7  
ATOM   6110  C CB   . SER A 1 45 ? 11.115  0.322   -2.109  1.00 0.00 ? 45 SER A CB   7  
ATOM   6111  O OG   . SER A 1 45 ? 9.721   0.036   -2.184  1.00 0.00 ? 45 SER A OG   7  
ATOM   6112  H H    . SER A 1 45 ? 12.186  2.460   -0.950  1.00 0.00 ? 45 SER A H    7  
ATOM   6113  H HA   . SER A 1 45 ? 10.847  0.062   0.012   1.00 0.00 ? 45 SER A HA   7  
ATOM   6114  H HB2  . SER A 1 45 ? 11.328  1.235   -2.665  1.00 0.00 ? 45 SER A HB2  7  
ATOM   6115  H HB3  . SER A 1 45 ? 11.676  -0.480  -2.587  1.00 0.00 ? 45 SER A HB3  7  
ATOM   6116  H HG   . SER A 1 45 ? 9.374   0.265   -3.093  1.00 0.00 ? 45 SER A HG   7  
ATOM   6117  N N    . SER A 1 46 ? 12.897  -1.367  0.156   1.00 0.00 ? 46 SER A N    7  
ATOM   6118  C CA   . SER A 1 46 ? 14.107  -2.130  0.409   1.00 0.00 ? 46 SER A CA   7  
ATOM   6119  C C    . SER A 1 46 ? 14.135  -3.377  -0.478  1.00 0.00 ? 46 SER A C    7  
ATOM   6120  O O    . SER A 1 46 ? 13.170  -3.662  -1.185  1.00 0.00 ? 46 SER A O    7  
ATOM   6121  C CB   . SER A 1 46 ? 14.210  -2.526  1.884   1.00 0.00 ? 46 SER A CB   7  
ATOM   6122  O OG   . SER A 1 46 ? 13.420  -3.673  2.185   1.00 0.00 ? 46 SER A OG   7  
ATOM   6123  H H    . SER A 1 46 ? 12.053  -1.791  0.486   1.00 0.00 ? 46 SER A H    7  
ATOM   6124  H HA   . SER A 1 46 ? 14.929  -1.461  0.155   1.00 0.00 ? 46 SER A HA   7  
ATOM   6125  H HB2  . SER A 1 46 ? 15.252  -2.728  2.133   1.00 0.00 ? 46 SER A HB2  7  
ATOM   6126  H HB3  . SER A 1 46 ? 13.890  -1.691  2.506   1.00 0.00 ? 46 SER A HB3  7  
ATOM   6127  H HG   . SER A 1 46 ? 12.708  -3.789  1.493   1.00 0.00 ? 46 SER A HG   7  
ATOM   6128  N N    . LEU A 1 47 ? 15.252  -4.086  -0.412  1.00 0.00 ? 47 LEU A N    7  
ATOM   6129  C CA   . LEU A 1 47 ? 15.419  -5.295  -1.200  1.00 0.00 ? 47 LEU A CA   7  
ATOM   6130  C C    . LEU A 1 47 ? 14.584  -6.419  -0.585  1.00 0.00 ? 47 LEU A C    7  
ATOM   6131  O O    . LEU A 1 47 ? 13.764  -7.033  -1.266  1.00 0.00 ? 47 LEU A O    7  
ATOM   6132  C CB   . LEU A 1 47 ? 16.903  -5.639  -1.346  1.00 0.00 ? 47 LEU A CB   7  
ATOM   6133  C CG   . LEU A 1 47 ? 17.668  -4.868  -2.423  1.00 0.00 ? 47 LEU A CG   7  
ATOM   6134  C CD1  . LEU A 1 47 ? 19.177  -4.943  -2.183  1.00 0.00 ? 47 LEU A CD1  7  
ATOM   6135  C CD2  . LEU A 1 47 ? 17.285  -5.355  -3.822  1.00 0.00 ? 47 LEU A CD2  7  
ATOM   6136  H H    . LEU A 1 47 ? 16.033  -3.847  0.166   1.00 0.00 ? 47 LEU A H    7  
ATOM   6137  H HA   . LEU A 1 47 ? 15.037  -5.088  -2.200  1.00 0.00 ? 47 LEU A HA   7  
ATOM   6138  H HB2  . LEU A 1 47 ? 17.391  -5.467  -0.387  1.00 0.00 ? 47 LEU A HB2  7  
ATOM   6139  H HB3  . LEU A 1 47 ? 16.988  -6.705  -1.560  1.00 0.00 ? 47 LEU A HB3  7  
ATOM   6140  H HG   . LEU A 1 47 ? 17.383  -3.818  -2.358  1.00 0.00 ? 47 LEU A HG   7  
ATOM   6141  H HD11 . LEU A 1 47 ? 19.684  -4.231  -2.834  1.00 0.00 ? 47 LEU A HD11 7  
ATOM   6142  H HD12 . LEU A 1 47 ? 19.392  -4.700  -1.142  1.00 0.00 ? 47 LEU A HD12 7  
ATOM   6143  H HD21 . LEU A 1 47 ? 17.694  -4.673  -4.568  1.00 0.00 ? 47 LEU A HD21 7  
ATOM   6144  H HD22 . LEU A 1 47 ? 17.690  -6.354  -3.982  1.00 0.00 ? 47 LEU A HD22 7  
ATOM   6145  N N    . LEU A 1 48 ? 14.821  -6.655  0.697   1.00 0.00 ? 48 LEU A N    7  
ATOM   6146  C CA   . LEU A 1 48 ? 14.101  -7.695  1.413   1.00 0.00 ? 48 LEU A CA   7  
ATOM   6147  C C    . LEU A 1 48 ? 12.597  -7.497  1.213   1.00 0.00 ? 48 LEU A C    7  
ATOM   6148  O O    . LEU A 1 48 ? 11.921  -8.365  0.661   1.00 0.00 ? 48 LEU A O    7  
ATOM   6149  C CB   . LEU A 1 48 ? 14.527  -7.728  2.882   1.00 0.00 ? 48 LEU A CB   7  
ATOM   6150  C CG   . LEU A 1 48 ? 14.534  -9.106  3.547   1.00 0.00 ? 48 LEU A CG   7  
ATOM   6151  C CD1  . LEU A 1 48 ? 15.847  -9.347  4.294   1.00 0.00 ? 48 LEU A CD1  7  
ATOM   6152  C CD2  . LEU A 1 48 ? 13.317  -9.282  4.456   1.00 0.00 ? 48 LEU A CD2  7  
ATOM   6153  H H    . LEU A 1 48 ? 15.489  -6.151  1.245   1.00 0.00 ? 48 LEU A H    7  
ATOM   6154  H HA   . LEU A 1 48 ? 14.385  -8.651  0.973   1.00 0.00 ? 48 LEU A HA   7  
ATOM   6155  H HB2  . LEU A 1 48 ? 15.528  -7.304  2.959   1.00 0.00 ? 48 LEU A HB2  7  
ATOM   6156  H HB3  . LEU A 1 48 ? 13.860  -7.077  3.448   1.00 0.00 ? 48 LEU A HB3  7  
ATOM   6157  H HG   . LEU A 1 48 ? 14.465  -9.863  2.766   1.00 0.00 ? 48 LEU A HG   7  
ATOM   6158  H HD11 . LEU A 1 48 ? 16.021  -10.419 4.387   1.00 0.00 ? 48 LEU A HD11 7  
ATOM   6159  H HD12 . LEU A 1 48 ? 16.669  -8.892  3.741   1.00 0.00 ? 48 LEU A HD12 7  
ATOM   6160  H HD21 . LEU A 1 48 ? 13.008  -10.328 4.452   1.00 0.00 ? 48 LEU A HD21 7  
ATOM   6161  H HD22 . LEU A 1 48 ? 13.576  -8.985  5.472   1.00 0.00 ? 48 LEU A HD22 7  
ATOM   6162  N N    . VAL A 1 49 ? 12.117  -6.351  1.673   1.00 0.00 ? 49 VAL A N    7  
ATOM   6163  C CA   . VAL A 1 49 ? 10.705  -6.029  1.551   1.00 0.00 ? 49 VAL A CA   7  
ATOM   6164  C C    . VAL A 1 49 ? 10.540  -4.821  0.627   1.00 0.00 ? 49 VAL A C    7  
ATOM   6165  O O    . VAL A 1 49 ? 11.452  -4.007  0.494   1.00 0.00 ? 49 VAL A O    7  
ATOM   6166  C CB   . VAL A 1 49 ? 10.098  -5.808  2.938   1.00 0.00 ? 49 VAL A CB   7  
ATOM   6167  C CG1  . VAL A 1 49 ? 10.085  -7.108  3.745   1.00 0.00 ? 49 VAL A CG1  7  
ATOM   6168  C CG2  . VAL A 1 49 ? 10.840  -4.702  3.691   1.00 0.00 ? 49 VAL A CG2  7  
ATOM   6169  H H    . VAL A 1 49 ? 12.673  -5.651  2.120   1.00 0.00 ? 49 VAL A H    7  
ATOM   6170  H HA   . VAL A 1 49 ? 10.209  -6.888  1.099   1.00 0.00 ? 49 VAL A HA   7  
ATOM   6171  H HB   . VAL A 1 49 ? 9.065   -5.486  2.804   1.00 0.00 ? 49 VAL A HB   7  
ATOM   6172  H HG11 . VAL A 1 49 ? 10.275  -7.950  3.080   1.00 0.00 ? 49 VAL A HG11 7  
ATOM   6173  H HG12 . VAL A 1 49 ? 10.860  -7.067  4.511   1.00 0.00 ? 49 VAL A HG12 7  
ATOM   6174  H HG21 . VAL A 1 49 ? 10.409  -4.588  4.686   1.00 0.00 ? 49 VAL A HG21 7  
ATOM   6175  H HG22 . VAL A 1 49 ? 11.894  -4.966  3.780   1.00 0.00 ? 49 VAL A HG22 7  
ATOM   6176  N N    . LYS A 1 50 ? 9.369   -4.744  0.011   1.00 0.00 ? 50 LYS A N    7  
ATOM   6177  C CA   . LYS A 1 50 ? 9.073   -3.649  -0.898  1.00 0.00 ? 50 LYS A CA   7  
ATOM   6178  C C    . LYS A 1 50 ? 7.621   -3.209  -0.702  1.00 0.00 ? 50 LYS A C    7  
ATOM   6179  O O    . LYS A 1 50 ? 6.794   -3.981  -0.220  1.00 0.00 ? 50 LYS A O    7  
ATOM   6180  C CB   . LYS A 1 50 ? 9.407   -4.043  -2.338  1.00 0.00 ? 50 LYS A CB   7  
ATOM   6181  C CG   . LYS A 1 50 ? 10.432  -3.083  -2.945  1.00 0.00 ? 50 LYS A CG   7  
ATOM   6182  C CD   . LYS A 1 50 ? 10.648  -3.379  -4.431  1.00 0.00 ? 50 LYS A CD   7  
ATOM   6183  C CE   . LYS A 1 50 ? 11.800  -4.366  -4.630  1.00 0.00 ? 50 LYS A CE   7  
ATOM   6184  N NZ   . LYS A 1 50 ? 11.405  -5.441  -5.568  1.00 0.00 ? 50 LYS A NZ   7  
ATOM   6185  H H    . LYS A 1 50 ? 8.633   -5.411  0.124   1.00 0.00 ? 50 LYS A H    7  
ATOM   6186  H HA   . LYS A 1 50 ? 9.725   -2.818  -0.631  1.00 0.00 ? 50 LYS A HA   7  
ATOM   6187  H HB2  . LYS A 1 50 ? 9.799   -5.060  -2.360  1.00 0.00 ? 50 LYS A HB2  7  
ATOM   6188  H HB3  . LYS A 1 50 ? 8.498   -4.039  -2.940  1.00 0.00 ? 50 LYS A HB3  7  
ATOM   6189  H HG2  . LYS A 1 50 ? 10.090  -2.055  -2.822  1.00 0.00 ? 50 LYS A HG2  7  
ATOM   6190  H HG3  . LYS A 1 50 ? 11.378  -3.170  -2.411  1.00 0.00 ? 50 LYS A HG3  7  
ATOM   6191  H HD2  . LYS A 1 50 ? 9.734   -3.789  -4.860  1.00 0.00 ? 50 LYS A HD2  7  
ATOM   6192  H HD3  . LYS A 1 50 ? 10.863  -2.452  -4.963  1.00 0.00 ? 50 LYS A HD3  7  
ATOM   6193  H HE2  . LYS A 1 50 ? 12.674  -3.841  -5.017  1.00 0.00 ? 50 LYS A HE2  7  
ATOM   6194  H HE3  . LYS A 1 50 ? 12.087  -4.799  -3.672  1.00 0.00 ? 50 LYS A HE3  7  
ATOM   6195  H HZ1  . LYS A 1 50 ? 10.590  -5.158  -6.075  1.00 0.00 ? 50 LYS A HZ1  7  
ATOM   6196  H HZ2  . LYS A 1 50 ? 12.152  -5.616  -6.209  1.00 0.00 ? 50 LYS A HZ2  7  
ATOM   6197  N N    . TYR A 1 51 ? 7.355   -1.969  -1.086  1.00 0.00 ? 51 TYR A N    7  
ATOM   6198  C CA   . TYR A 1 51 ? 6.017   -1.417  -0.959  1.00 0.00 ? 51 TYR A CA   7  
ATOM   6199  C C    . TYR A 1 51 ? 5.572   -0.752  -2.263  1.00 0.00 ? 51 TYR A C    7  
ATOM   6200  O O    . TYR A 1 51 ? 6.404   -0.315  -3.057  1.00 0.00 ? 51 TYR A O    7  
ATOM   6201  C CB   . TYR A 1 51 ? 6.102   -0.354  0.138   1.00 0.00 ? 51 TYR A CB   7  
ATOM   6202  C CG   . TYR A 1 51 ? 6.898   -0.792  1.369   1.00 0.00 ? 51 TYR A CG   7  
ATOM   6203  C CD1  . TYR A 1 51 ? 6.704   -2.049  1.904   1.00 0.00 ? 51 TYR A CD1  7  
ATOM   6204  C CD2  . TYR A 1 51 ? 7.811   0.069   1.943   1.00 0.00 ? 51 TYR A CD2  7  
ATOM   6205  C CE1  . TYR A 1 51 ? 7.454   -2.462  3.063   1.00 0.00 ? 51 TYR A CE1  7  
ATOM   6206  C CE2  . TYR A 1 51 ? 8.560   -0.343  3.102   1.00 0.00 ? 51 TYR A CE2  7  
ATOM   6207  C CZ   . TYR A 1 51 ? 8.344   -1.588  3.604   1.00 0.00 ? 51 TYR A CZ   7  
ATOM   6208  O OH   . TYR A 1 51 ? 9.052   -1.978  4.698   1.00 0.00 ? 51 TYR A OH   7  
ATOM   6209  H H    . TYR A 1 51 ? 8.033   -1.347  -1.478  1.00 0.00 ? 51 TYR A H    7  
ATOM   6210  H HA   . TYR A 1 51 ? 5.336   -2.235  -0.726  1.00 0.00 ? 51 TYR A HA   7  
ATOM   6211  H HB2  . TYR A 1 51 ? 6.559   0.545   -0.276  1.00 0.00 ? 51 TYR A HB2  7  
ATOM   6212  H HB3  . TYR A 1 51 ? 5.093   -0.084  0.448   1.00 0.00 ? 51 TYR A HB3  7  
ATOM   6213  H HD1  . TYR A 1 51 ? 5.984   -2.730  1.450   1.00 0.00 ? 51 TYR A HD1  7  
ATOM   6214  H HD2  . TYR A 1 51 ? 7.964   1.062   1.520   1.00 0.00 ? 51 TYR A HD2  7  
ATOM   6215  H HE1  . TYR A 1 51 ? 7.310   -3.452  3.496   1.00 0.00 ? 51 TYR A HE1  7  
ATOM   6216  H HE2  . TYR A 1 51 ? 9.283   0.327   3.565   1.00 0.00 ? 51 TYR A HE2  7  
ATOM   6217  H HH   . TYR A 1 51 ? 9.634   -2.758  4.469   1.00 0.00 ? 51 TYR A HH   7  
ATOM   6218  N N    . VAL A 1 52 ? 4.261   -0.697  -2.444  1.00 0.00 ? 52 VAL A N    7  
ATOM   6219  C CA   . VAL A 1 52 ? 3.695   -0.092  -3.639  1.00 0.00 ? 52 VAL A CA   7  
ATOM   6220  C C    . VAL A 1 52 ? 2.435   0.689   -3.262  1.00 0.00 ? 52 VAL A C    7  
ATOM   6221  O O    . VAL A 1 52 ? 1.509   0.135   -2.672  1.00 0.00 ? 52 VAL A O    7  
ATOM   6222  C CB   . VAL A 1 52 ? 3.437   -1.167  -4.697  1.00 0.00 ? 52 VAL A CB   7  
ATOM   6223  C CG1  . VAL A 1 52 ? 2.675   -0.589  -5.891  1.00 0.00 ? 52 VAL A CG1  7  
ATOM   6224  C CG2  . VAL A 1 52 ? 4.746   -1.820  -5.146  1.00 0.00 ? 52 VAL A CG2  7  
ATOM   6225  H H    . VAL A 1 52 ? 3.591   -1.054  -1.794  1.00 0.00 ? 52 VAL A H    7  
ATOM   6226  H HA   . VAL A 1 52 ? 4.434   0.603   -4.037  1.00 0.00 ? 52 VAL A HA   7  
ATOM   6227  H HB   . VAL A 1 52 ? 2.816   -1.940  -4.245  1.00 0.00 ? 52 VAL A HB   7  
ATOM   6228  H HG11 . VAL A 1 52 ? 3.339   -0.533  -6.753  1.00 0.00 ? 52 VAL A HG11 7  
ATOM   6229  H HG12 . VAL A 1 52 ? 1.827   -1.232  -6.127  1.00 0.00 ? 52 VAL A HG12 7  
ATOM   6230  H HG21 . VAL A 1 52 ? 4.563   -2.430  -6.030  1.00 0.00 ? 52 VAL A HG21 7  
ATOM   6231  H HG22 . VAL A 1 52 ? 5.476   -1.045  -5.383  1.00 0.00 ? 52 VAL A HG22 7  
ATOM   6232  N N    . CYS A 1 53 ? 2.441   1.966   -3.617  1.00 0.00 ? 53 CYS A N    7  
ATOM   6233  C CA   . CYS A 1 53 ? 1.310   2.830   -3.324  1.00 0.00 ? 53 CYS A CA   7  
ATOM   6234  C C    . CYS A 1 53 ? 0.561   3.101   -4.630  1.00 0.00 ? 53 CYS A C    7  
ATOM   6235  O O    . CYS A 1 53 ? 1.121   2.947   -5.714  1.00 0.00 ? 53 CYS A O    7  
ATOM   6236  C CB   . CYS A 1 53 ? 1.750   4.125   -2.639  1.00 0.00 ? 53 CYS A CB   7  
ATOM   6237  S SG   . CYS A 1 53 ? 2.028   3.983   -0.835  1.00 0.00 ? 53 CYS A SG   7  
ATOM   6238  H H    . CYS A 1 53 ? 3.198   2.409   -4.097  1.00 0.00 ? 53 CYS A H    7  
ATOM   6239  H HA   . CYS A 1 53 ? 0.677   2.289   -2.620  1.00 0.00 ? 53 CYS A HA   7  
ATOM   6240  H HB2  . CYS A 1 53 ? 2.671   4.473   -3.108  1.00 0.00 ? 53 CYS A HB2  7  
ATOM   6241  H HB3  . CYS A 1 53 ? 0.994   4.889   -2.816  1.00 0.00 ? 53 CYS A HB3  7  
ATOM   6242  N N    . CYS A 1 54 ? -0.694  3.501   -4.483  1.00 0.00 ? 54 CYS A N    7  
ATOM   6243  C CA   . CYS A 1 54 ? -1.525  3.795   -5.638  1.00 0.00 ? 54 CYS A CA   7  
ATOM   6244  C C    . CYS A 1 54 ? -2.748  4.581   -5.161  1.00 0.00 ? 54 CYS A C    7  
ATOM   6245  O O    . CYS A 1 54 ? -3.269  4.327   -4.077  1.00 0.00 ? 54 CYS A O    7  
ATOM   6246  C CB   . CYS A 1 54 ? -1.921  2.523   -6.389  1.00 0.00 ? 54 CYS A CB   7  
ATOM   6247  S SG   . CYS A 1 54 ? -1.909  0.999   -5.376  1.00 0.00 ? 54 CYS A SG   7  
ATOM   6248  H H    . CYS A 1 54 ? -1.141  3.624   -3.598  1.00 0.00 ? 54 CYS A H    7  
ATOM   6249  H HA   . CYS A 1 54 ? -0.919  4.397   -6.315  1.00 0.00 ? 54 CYS A HA   7  
ATOM   6250  H HB2  . CYS A 1 54 ? -2.920  2.659   -6.804  1.00 0.00 ? 54 CYS A HB2  7  
ATOM   6251  H HB3  . CYS A 1 54 ? -1.242  2.388   -7.231  1.00 0.00 ? 54 CYS A HB3  7  
ATOM   6252  N N    . ASN A 1 55 ? -3.171  5.520   -5.996  1.00 0.00 ? 55 ASN A N    7  
ATOM   6253  C CA   . ASN A 1 55 ? -4.323  6.344   -5.673  1.00 0.00 ? 55 ASN A CA   7  
ATOM   6254  C C    . ASN A 1 55 ? -5.533  5.857   -6.472  1.00 0.00 ? 55 ASN A C    7  
ATOM   6255  O O    . ASN A 1 55 ? -6.004  6.547   -7.376  1.00 0.00 ? 55 ASN A O    7  
ATOM   6256  C CB   . ASN A 1 55 ? -4.072  7.808   -6.040  1.00 0.00 ? 55 ASN A CB   7  
ATOM   6257  C CG   . ASN A 1 55 ? -3.502  7.930   -7.454  1.00 0.00 ? 55 ASN A CG   7  
ATOM   6258  O OD1  . ASN A 1 55 ? -2.457  7.391   -7.778  1.00 0.00 ? 55 ASN A OD1  7  
ATOM   6259  N ND2  . ASN A 1 55 ? -4.245  8.666   -8.276  1.00 0.00 ? 55 ASN A ND2  7  
ATOM   6260  H H    . ASN A 1 55 ? -2.741  5.720   -6.876  1.00 0.00 ? 55 ASN A H    7  
ATOM   6261  H HA   . ASN A 1 55 ? -4.462  6.234   -4.598  1.00 0.00 ? 55 ASN A HA   7  
ATOM   6262  H HB2  . ASN A 1 55 ? -5.005  8.369   -5.970  1.00 0.00 ? 55 ASN A HB2  7  
ATOM   6263  H HB3  . ASN A 1 55 ? -3.379  8.253   -5.325  1.00 0.00 ? 55 ASN A HB3  7  
ATOM   6264  H HD21 . ASN A 1 55 ? -5.093  9.081   -7.946  1.00 0.00 ? 55 ASN A HD21 7  
ATOM   6265  H HD22 . ASN A 1 55 ? -3.955  8.804   -9.223  1.00 0.00 ? 55 ASN A HD22 7  
ATOM   6266  N N    . THR A 1 56 ? -6.002  4.672   -6.112  1.00 0.00 ? 56 THR A N    7  
ATOM   6267  C CA   . THR A 1 56 ? -7.149  4.085   -6.784  1.00 0.00 ? 56 THR A CA   7  
ATOM   6268  C C    . THR A 1 56 ? -7.984  3.266   -5.797  1.00 0.00 ? 56 THR A C    7  
ATOM   6269  O O    . THR A 1 56 ? -7.454  2.731   -4.824  1.00 0.00 ? 56 THR A O    7  
ATOM   6270  C CB   . THR A 1 56 ? -6.633  3.266   -7.969  1.00 0.00 ? 56 THR A CB   7  
ATOM   6271  O OG1  . THR A 1 56 ? -5.722  2.340   -7.382  1.00 0.00 ? 56 THR A OG1  7  
ATOM   6272  C CG2  . THR A 1 56 ? -5.764  4.093   -8.918  1.00 0.00 ? 56 THR A CG2  7  
ATOM   6273  H H    . THR A 1 56 ? -5.614  4.117   -5.376  1.00 0.00 ? 56 THR A H    7  
ATOM   6274  H HA   . THR A 1 56 ? -7.784  4.892   -7.148  1.00 0.00 ? 56 THR A HA   7  
ATOM   6275  H HB   . THR A 1 56 ? -7.458  2.796   -8.506  1.00 0.00 ? 56 THR A HB   7  
ATOM   6276  H HG1  . THR A 1 56 ? -5.044  2.829   -6.834  1.00 0.00 ? 56 THR A HG1  7  
ATOM   6277  H HG21 . THR A 1 56 ? -5.601  3.535   -9.841  1.00 0.00 ? 56 THR A HG21 7  
ATOM   6278  H HG22 . THR A 1 56 ? -6.267  5.033   -9.146  1.00 0.00 ? 56 THR A HG22 7  
ATOM   6279  N N    . ASP A 1 57 ? -9.290  3.172   -6.054  1.00 0.00 ? 57 ASP A N    7  
ATOM   6280  C CA   . ASP A 1 57 ? -10.187 2.426   -5.194  1.00 0.00 ? 57 ASP A CA   7  
ATOM   6281  C C    . ASP A 1 57 ? -9.819  0.949   -5.225  1.00 0.00 ? 57 ASP A C    7  
ATOM   6282  O O    . ASP A 1 57 ? -9.849  0.322   -6.281  1.00 0.00 ? 57 ASP A O    7  
ATOM   6283  C CB   . ASP A 1 57 ? -11.626 2.635   -5.658  1.00 0.00 ? 57 ASP A CB   7  
ATOM   6284  C CG   . ASP A 1 57 ? -12.314 3.709   -4.827  1.00 0.00 ? 57 ASP A CG   7  
ATOM   6285  O OD1  . ASP A 1 57 ? -11.731 4.081   -3.786  1.00 0.00 ? 57 ASP A OD1  7  
ATOM   6286  O OD2  . ASP A 1 57 ? -13.409 4.138   -5.249  1.00 0.00 ? 57 ASP A OD2  7  
ATOM   6287  H H    . ASP A 1 57 ? -9.676  3.630   -6.867  1.00 0.00 ? 57 ASP A H    7  
ATOM   6288  H HA   . ASP A 1 57 ? -10.087 2.794   -4.173  1.00 0.00 ? 57 ASP A HA   7  
ATOM   6289  H HB2  . ASP A 1 57 ? -11.624 2.938   -6.704  1.00 0.00 ? 57 ASP A HB2  7  
ATOM   6290  H HB3  . ASP A 1 57 ? -12.174 1.699   -5.556  1.00 0.00 ? 57 ASP A HB3  7  
ATOM   6291  H HD2  . ASP A 1 57 ? -13.792 4.812   -4.682  1.00 0.00 ? 57 ASP A HD2  7  
ATOM   6292  N N    . LYS A 1 58 ? -9.479  0.431   -4.053  1.00 0.00 ? 58 LYS A N    7  
ATOM   6293  C CA   . LYS A 1 58 ? -9.105  -0.967  -3.934  1.00 0.00 ? 58 LYS A CA   7  
ATOM   6294  C C    . LYS A 1 58 ? -7.833  -1.221  -4.746  1.00 0.00 ? 58 LYS A C    7  
ATOM   6295  O O    . LYS A 1 58 ? -7.794  -2.124  -5.580  1.00 0.00 ? 58 LYS A O    7  
ATOM   6296  C CB   . LYS A 1 58 ? -10.275 -1.871  -4.327  1.00 0.00 ? 58 LYS A CB   7  
ATOM   6297  C CG   . LYS A 1 58 ? -11.124 -2.231  -3.106  1.00 0.00 ? 58 LYS A CG   7  
ATOM   6298  C CD   . LYS A 1 58 ? -12.294 -1.258  -2.946  1.00 0.00 ? 58 LYS A CD   7  
ATOM   6299  C CE   . LYS A 1 58 ? -13.492 -1.945  -2.287  1.00 0.00 ? 58 LYS A CE   7  
ATOM   6300  N NZ   . LYS A 1 58 ? -14.278 -2.693  -3.294  1.00 0.00 ? 58 LYS A NZ   7  
ATOM   6301  H H    . LYS A 1 58 ? -9.457  0.949   -3.197  1.00 0.00 ? 58 LYS A H    7  
ATOM   6302  H HA   . LYS A 1 58 ? -8.888  -1.160  -2.883  1.00 0.00 ? 58 LYS A HA   7  
ATOM   6303  H HB2  . LYS A 1 58 ? -10.895 -1.368  -5.070  1.00 0.00 ? 58 LYS A HB2  7  
ATOM   6304  H HB3  . LYS A 1 58 ? -9.896  -2.781  -4.793  1.00 0.00 ? 58 LYS A HB3  7  
ATOM   6305  H HG2  . LYS A 1 58 ? -11.504 -3.248  -3.210  1.00 0.00 ? 58 LYS A HG2  7  
ATOM   6306  H HG3  . LYS A 1 58 ? -10.505 -2.212  -2.210  1.00 0.00 ? 58 LYS A HG3  7  
ATOM   6307  H HD2  . LYS A 1 58 ? -11.982 -0.405  -2.342  1.00 0.00 ? 58 LYS A HD2  7  
ATOM   6308  H HD3  . LYS A 1 58 ? -12.585 -0.869  -3.921  1.00 0.00 ? 58 LYS A HD3  7  
ATOM   6309  H HE2  . LYS A 1 58 ? -13.146 -2.625  -1.509  1.00 0.00 ? 58 LYS A HE2  7  
ATOM   6310  H HE3  . LYS A 1 58 ? -14.124 -1.201  -1.803  1.00 0.00 ? 58 LYS A HE3  7  
ATOM   6311  H HZ1  . LYS A 1 58 ? -13.672 -3.302  -3.805  1.00 0.00 ? 58 LYS A HZ1  7  
ATOM   6312  H HZ2  . LYS A 1 58 ? -14.982 -3.233  -2.832  1.00 0.00 ? 58 LYS A HZ2  7  
ATOM   6313  N N    . CYS A 1 59 ? -6.823  -0.408  -4.473  1.00 0.00 ? 59 CYS A N    7  
ATOM   6314  C CA   . CYS A 1 59 ? -5.553  -0.532  -5.167  1.00 0.00 ? 59 CYS A CA   7  
ATOM   6315  C C    . CYS A 1 59 ? -4.670  -1.505  -4.382  1.00 0.00 ? 59 CYS A C    7  
ATOM   6316  O O    . CYS A 1 59 ? -4.077  -2.415  -4.960  1.00 0.00 ? 59 CYS A O    7  
ATOM   6317  C CB   . CYS A 1 59 ? -4.876  0.827   -5.357  1.00 0.00 ? 59 CYS A CB   7  
ATOM   6318  S SG   . CYS A 1 59 ? -3.569  1.211   -4.136  1.00 0.00 ? 59 CYS A SG   7  
ATOM   6319  H H    . CYS A 1 59 ? -6.863  0.324   -3.793  1.00 0.00 ? 59 CYS A H    7  
ATOM   6320  H HA   . CYS A 1 59 ? -5.775  -0.926  -6.159  1.00 0.00 ? 59 CYS A HA   7  
ATOM   6321  H HB2  . CYS A 1 59 ? -4.443  0.864   -6.357  1.00 0.00 ? 59 CYS A HB2  7  
ATOM   6322  H HB3  . CYS A 1 59 ? -5.637  1.606   -5.310  1.00 0.00 ? 59 CYS A HB3  7  
ATOM   6323  N N    . ASN A 1 60 ? -4.610  -1.279  -3.078  1.00 0.00 ? 60 ASN A N    7  
ATOM   6324  C CA   . ASN A 1 60 ? -3.809  -2.123  -2.208  1.00 0.00 ? 60 ASN A CA   7  
ATOM   6325  C C    . ASN A 1 60 ? -4.596  -3.391  -1.870  1.00 0.00 ? 60 ASN A C    7  
ATOM   6326  O O    . ASN A 1 60 ? -4.941  -4.168  -2.760  1.00 0.00 ? 60 ASN A O    7  
ATOM   6327  C CB   . ASN A 1 60 ? -3.479  -1.408  -0.897  1.00 0.00 ? 60 ASN A CB   7  
ATOM   6328  C CG   . ASN A 1 60 ? -4.693  -1.382  0.034   1.00 0.00 ? 60 ASN A CG   7  
ATOM   6329  O OD1  . ASN A 1 60 ? -5.831  -1.516  -0.384  1.00 0.00 ? 60 ASN A OD1  7  
ATOM   6330  N ND2  . ASN A 1 60 ? -4.387  -1.202  1.316   1.00 0.00 ? 60 ASN A ND2  7  
ATOM   6331  H H    . ASN A 1 60 ? -5.095  -0.536  -2.616  1.00 0.00 ? 60 ASN A H    7  
ATOM   6332  H HA   . ASN A 1 60 ? -2.900  -2.335  -2.772  1.00 0.00 ? 60 ASN A HA   7  
ATOM   6333  H HB2  . ASN A 1 60 ? -2.648  -1.911  -0.403  1.00 0.00 ? 60 ASN A HB2  7  
ATOM   6334  H HB3  . ASN A 1 60 ? -3.155  -0.388  -1.106  1.00 0.00 ? 60 ASN A HB3  7  
ATOM   6335  H HD21 . ASN A 1 60 ? -3.432  -1.099  1.593   1.00 0.00 ? 60 ASN A HD21 7  
ATOM   6336  H HD22 . ASN A 1 60 ? -5.113  -1.171  2.003   1.00 0.00 ? 60 ASN A HD22 7  
HETATM 6337  O O    . HOH B 2 .  ? 4.573   -9.836  2.175   1.00 0.00 ? 61 HOH A O    7  
HETATM 6338  H H1   . HOH B 2 .  ? 4.380   -9.186  2.850   1.00 0.00 ? 61 HOH A H1   7  
HETATM 6339  H H2   . HOH B 2 .  ? 5.115   -10.489 2.620   1.00 0.00 ? 61 HOH A H2   7  
HETATM 6340  O O    . HOH B 2 .  ? 5.752   -14.436 -9.136  1.00 0.00 ? 62 HOH A O    7  
HETATM 6341  H H1   . HOH B 2 .  ? 5.073   -13.829 -8.840  1.00 0.00 ? 62 HOH A H1   7  
HETATM 6342  H H2   . HOH B 2 .  ? 5.987   -14.123 -10.010 1.00 0.00 ? 62 HOH A H2   7  
ATOM   6343  N N    . LEU A 1 1  ? -13.017 6.791   -2.153  1.00 0.00 ? 1  LEU A N    8  
ATOM   6344  C CA   . LEU A 1 1  ? -11.817 6.561   -1.366  1.00 0.00 ? 1  LEU A CA   8  
ATOM   6345  C C    . LEU A 1 1  ? -12.036 5.354   -0.452  1.00 0.00 ? 1  LEU A C    8  
ATOM   6346  O O    . LEU A 1 1  ? -12.146 5.503   0.764   1.00 0.00 ? 1  LEU A O    8  
ATOM   6347  C CB   . LEU A 1 1  ? -11.414 7.833   -0.619  1.00 0.00 ? 1  LEU A CB   8  
ATOM   6348  C CG   . LEU A 1 1  ? -10.326 8.683   -1.279  1.00 0.00 ? 1  LEU A CG   8  
ATOM   6349  C CD1  . LEU A 1 1  ? -10.535 10.169  -0.983  1.00 0.00 ? 1  LEU A CD1  8  
ATOM   6350  C CD2  . LEU A 1 1  ? -8.932  8.206   -0.864  1.00 0.00 ? 1  LEU A CD2  8  
ATOM   6351  H H    . LEU A 1 1  ? -13.437 5.967   -2.534  1.00 0.00 ? 1  LEU A H    8  
ATOM   6352  H HA   . LEU A 1 1  ? -11.011 6.326   -2.061  1.00 0.00 ? 1  LEU A HA   8  
ATOM   6353  H HB2  . LEU A 1 1  ? -12.302 8.452   -0.491  1.00 0.00 ? 1  LEU A HB2  8  
ATOM   6354  H HB3  . LEU A 1 1  ? -11.075 7.553   0.378   1.00 0.00 ? 1  LEU A HB3  8  
ATOM   6355  H HG   . LEU A 1 1  ? -10.401 8.556   -2.359  1.00 0.00 ? 1  LEU A HG   8  
ATOM   6356  H HD11 . LEU A 1 1  ? -10.952 10.285  0.018   1.00 0.00 ? 1  LEU A HD11 8  
ATOM   6357  H HD12 . LEU A 1 1  ? -9.579  10.689  -1.042  1.00 0.00 ? 1  LEU A HD12 8  
ATOM   6358  H HD21 . LEU A 1 1  ? -8.980  7.770   0.134   1.00 0.00 ? 1  LEU A HD21 8  
ATOM   6359  H HD22 . LEU A 1 1  ? -8.579  7.457   -1.572  1.00 0.00 ? 1  LEU A HD22 8  
ATOM   6360  N N    . LYS A 1 2  ? -12.091 4.184   -1.072  1.00 0.00 ? 2  LYS A N    8  
ATOM   6361  C CA   . LYS A 1 2  ? -12.294 2.952   -0.329  1.00 0.00 ? 2  LYS A CA   8  
ATOM   6362  C C    . LYS A 1 2  ? -11.334 1.882   -0.853  1.00 0.00 ? 2  LYS A C    8  
ATOM   6363  O O    . LYS A 1 2  ? -11.303 1.603   -2.051  1.00 0.00 ? 2  LYS A O    8  
ATOM   6364  C CB   . LYS A 1 2  ? -13.765 2.535   -0.376  1.00 0.00 ? 2  LYS A CB   8  
ATOM   6365  C CG   . LYS A 1 2  ? -14.003 1.271   0.453   1.00 0.00 ? 2  LYS A CG   8  
ATOM   6366  C CD   . LYS A 1 2  ? -15.490 1.094   0.769   1.00 0.00 ? 2  LYS A CD   8  
ATOM   6367  C CE   . LYS A 1 2  ? -16.264 0.644   -0.471  1.00 0.00 ? 2  LYS A CE   8  
ATOM   6368  N NZ   . LYS A 1 2  ? -17.693 0.440   -0.144  1.00 0.00 ? 2  LYS A NZ   8  
ATOM   6369  H H    . LYS A 1 2  ? -12.000 4.071   -2.062  1.00 0.00 ? 2  LYS A H    8  
ATOM   6370  H HA   . LYS A 1 2  ? -12.050 3.155   0.713   1.00 0.00 ? 2  LYS A HA   8  
ATOM   6371  H HB2  . LYS A 1 2  ? -14.390 3.344   0.002   1.00 0.00 ? 2  LYS A HB2  8  
ATOM   6372  H HB3  . LYS A 1 2  ? -14.065 2.358   -1.409  1.00 0.00 ? 2  LYS A HB3  8  
ATOM   6373  H HG2  . LYS A 1 2  ? -13.638 0.400   -0.092  1.00 0.00 ? 2  LYS A HG2  8  
ATOM   6374  H HG3  . LYS A 1 2  ? -13.435 1.328   1.381   1.00 0.00 ? 2  LYS A HG3  8  
ATOM   6375  H HD2  . LYS A 1 2  ? -15.611 0.359   1.565   1.00 0.00 ? 2  LYS A HD2  8  
ATOM   6376  H HD3  . LYS A 1 2  ? -15.901 2.033   1.138   1.00 0.00 ? 2  LYS A HD3  8  
ATOM   6377  H HE2  . LYS A 1 2  ? -16.168 1.392   -1.259  1.00 0.00 ? 2  LYS A HE2  8  
ATOM   6378  H HE3  . LYS A 1 2  ? -15.838 -0.282  -0.857  1.00 0.00 ? 2  LYS A HE3  8  
ATOM   6379  H HZ1  . LYS A 1 2  ? -18.258 0.987   -0.763  1.00 0.00 ? 2  LYS A HZ1  8  
ATOM   6380  H HZ2  . LYS A 1 2  ? -17.925 -0.527  -0.249  1.00 0.00 ? 2  LYS A HZ2  8  
ATOM   6381  N N    . CYS A 1 3  ? -10.575 1.311   0.070   1.00 0.00 ? 3  CYS A N    8  
ATOM   6382  C CA   . CYS A 1 3  ? -9.617  0.277   -0.283  1.00 0.00 ? 3  CYS A CA   8  
ATOM   6383  C C    . CYS A 1 3  ? -9.878  -0.943  0.602   1.00 0.00 ? 3  CYS A C    8  
ATOM   6384  O O    . CYS A 1 3  ? -10.841 -0.965  1.366   1.00 0.00 ? 3  CYS A O    8  
ATOM   6385  C CB   . CYS A 1 3  ? -8.175  0.775   -0.158  1.00 0.00 ? 3  CYS A CB   8  
ATOM   6386  S SG   . CYS A 1 3  ? -7.545  1.674   -1.622  1.00 0.00 ? 3  CYS A SG   8  
ATOM   6387  H H    . CYS A 1 3  ? -10.606 1.543   1.042   1.00 0.00 ? 3  CYS A H    8  
ATOM   6388  H HA   . CYS A 1 3  ? -9.788  0.037   -1.333  1.00 0.00 ? 3  CYS A HA   8  
ATOM   6389  H HB2  . CYS A 1 3  ? -8.106  1.430   0.710   1.00 0.00 ? 3  CYS A HB2  8  
ATOM   6390  H HB3  . CYS A 1 3  ? -7.526  -0.079  0.034   1.00 0.00 ? 3  CYS A HB3  8  
ATOM   6391  N N    . LYS A 1 4  ? -9.002  -1.928  0.470   1.00 0.00 ? 4  LYS A N    8  
ATOM   6392  C CA   . LYS A 1 4  ? -9.125  -3.149  1.249   1.00 0.00 ? 4  LYS A CA   8  
ATOM   6393  C C    . LYS A 1 4  ? -8.200  -3.068  2.465   1.00 0.00 ? 4  LYS A C    8  
ATOM   6394  O O    . LYS A 1 4  ? -7.167  -2.402  2.421   1.00 0.00 ? 4  LYS A O    8  
ATOM   6395  C CB   . LYS A 1 4  ? -8.876  -4.374  0.367   1.00 0.00 ? 4  LYS A CB   8  
ATOM   6396  C CG   . LYS A 1 4  ? -10.079 -4.652  -0.537  1.00 0.00 ? 4  LYS A CG   8  
ATOM   6397  C CD   . LYS A 1 4  ? -10.154 -6.134  -0.909  1.00 0.00 ? 4  LYS A CD   8  
ATOM   6398  C CE   . LYS A 1 4  ? -10.443 -6.311  -2.401  1.00 0.00 ? 4  LYS A CE   8  
ATOM   6399  N NZ   . LYS A 1 4  ? -11.113 -7.607  -2.650  1.00 0.00 ? 4  LYS A NZ   8  
ATOM   6400  H H    . LYS A 1 4  ? -8.220  -1.902  -0.153  1.00 0.00 ? 4  LYS A H    8  
ATOM   6401  H HA   . LYS A 1 4  ? -10.155 -3.209  1.601   1.00 0.00 ? 4  LYS A HA   8  
ATOM   6402  H HB2  . LYS A 1 4  ? -7.988  -4.214  -0.243  1.00 0.00 ? 4  LYS A HB2  8  
ATOM   6403  H HB3  . LYS A 1 4  ? -8.679  -5.244  0.994   1.00 0.00 ? 4  LYS A HB3  8  
ATOM   6404  H HG2  . LYS A 1 4  ? -10.997 -4.355  -0.029  1.00 0.00 ? 4  LYS A HG2  8  
ATOM   6405  H HG3  . LYS A 1 4  ? -10.005 -4.049  -1.442  1.00 0.00 ? 4  LYS A HG3  8  
ATOM   6406  H HD2  . LYS A 1 4  ? -9.213  -6.624  -0.657  1.00 0.00 ? 4  LYS A HD2  8  
ATOM   6407  H HD3  . LYS A 1 4  ? -10.933 -6.622  -0.324  1.00 0.00 ? 4  LYS A HD3  8  
ATOM   6408  H HE2  . LYS A 1 4  ? -11.073 -5.495  -2.754  1.00 0.00 ? 4  LYS A HE2  8  
ATOM   6409  H HE3  . LYS A 1 4  ? -9.512  -6.262  -2.967  1.00 0.00 ? 4  LYS A HE3  8  
ATOM   6410  H HZ1  . LYS A 1 4  ? -10.437 -8.279  -2.951  1.00 0.00 ? 4  LYS A HZ1  8  
ATOM   6411  H HZ2  . LYS A 1 4  ? -11.547 -7.924  -1.807  1.00 0.00 ? 4  LYS A HZ2  8  
ATOM   6412  N N    . LYS A 1 5  ? -8.605  -3.756  3.523   1.00 0.00 ? 5  LYS A N    8  
ATOM   6413  C CA   . LYS A 1 5  ? -7.826  -3.771  4.749   1.00 0.00 ? 5  LYS A CA   8  
ATOM   6414  C C    . LYS A 1 5  ? -6.809  -4.913  4.688   1.00 0.00 ? 5  LYS A C    8  
ATOM   6415  O O    . LYS A 1 5  ? -6.631  -5.535  3.642   1.00 0.00 ? 5  LYS A O    8  
ATOM   6416  C CB   . LYS A 1 5  ? -8.747  -3.833  5.969   1.00 0.00 ? 5  LYS A CB   8  
ATOM   6417  C CG   . LYS A 1 5  ? -9.290  -2.445  6.316   1.00 0.00 ? 5  LYS A CG   8  
ATOM   6418  C CD   . LYS A 1 5  ? -9.914  -2.435  7.714   1.00 0.00 ? 5  LYS A CD   8  
ATOM   6419  C CE   . LYS A 1 5  ? -9.063  -1.617  8.687   1.00 0.00 ? 5  LYS A CE   8  
ATOM   6420  N NZ   . LYS A 1 5  ? -9.915  -0.694  9.471   1.00 0.00 ? 5  LYS A NZ   8  
ATOM   6421  H H    . LYS A 1 5  ? -9.447  -4.296  3.551   1.00 0.00 ? 5  LYS A H    8  
ATOM   6422  H HA   . LYS A 1 5  ? -7.283  -2.827  4.803   1.00 0.00 ? 5  LYS A HA   8  
ATOM   6423  H HB2  . LYS A 1 5  ? -9.576  -4.512  5.770   1.00 0.00 ? 5  LYS A HB2  8  
ATOM   6424  H HB3  . LYS A 1 5  ? -8.202  -4.238  6.821   1.00 0.00 ? 5  LYS A HB3  8  
ATOM   6425  H HG2  . LYS A 1 5  ? -8.484  -1.713  6.268   1.00 0.00 ? 5  LYS A HG2  8  
ATOM   6426  H HG3  . LYS A 1 5  ? -10.036 -2.147  5.579   1.00 0.00 ? 5  LYS A HG3  8  
ATOM   6427  H HD2  . LYS A 1 5  ? -10.919 -2.016  7.664   1.00 0.00 ? 5  LYS A HD2  8  
ATOM   6428  H HD3  . LYS A 1 5  ? -10.011 -3.456  8.080   1.00 0.00 ? 5  LYS A HD3  8  
ATOM   6429  H HE2  . LYS A 1 5  ? -8.526  -2.285  9.360   1.00 0.00 ? 5  LYS A HE2  8  
ATOM   6430  H HE3  . LYS A 1 5  ? -8.313  -1.049  8.136   1.00 0.00 ? 5  LYS A HE3  8  
ATOM   6431  H HZ1  . LYS A 1 5  ? -9.337  -0.041  9.960   1.00 0.00 ? 5  LYS A HZ1  8  
ATOM   6432  H HZ2  . LYS A 1 5  ? -10.528 -0.201  8.854   1.00 0.00 ? 5  LYS A HZ2  8  
ATOM   6433  N N    . LEU A 1 6  ? -6.169  -5.153  5.823   1.00 0.00 ? 6  LEU A N    8  
ATOM   6434  C CA   . LEU A 1 6  ? -5.174  -6.209  5.912   1.00 0.00 ? 6  LEU A CA   8  
ATOM   6435  C C    . LEU A 1 6  ? -5.656  -7.426  5.119   1.00 0.00 ? 6  LEU A C    8  
ATOM   6436  O O    . LEU A 1 6  ? -5.142  -7.711  4.039   1.00 0.00 ? 6  LEU A O    8  
ATOM   6437  C CB   . LEU A 1 6  ? -4.849  -6.517  7.375   1.00 0.00 ? 6  LEU A CB   8  
ATOM   6438  C CG   . LEU A 1 6  ? -3.702  -5.714  7.991   1.00 0.00 ? 6  LEU A CG   8  
ATOM   6439  C CD1  . LEU A 1 6  ? -4.173  -4.320  8.411   1.00 0.00 ? 6  LEU A CD1  8  
ATOM   6440  C CD2  . LEU A 1 6  ? -3.060  -6.477  9.151   1.00 0.00 ? 6  LEU A CD2  8  
ATOM   6441  H H    . LEU A 1 6  ? -6.319  -4.642  6.669   1.00 0.00 ? 6  LEU A H    8  
ATOM   6442  H HA   . LEU A 1 6  ? -4.260  -5.836  5.450   1.00 0.00 ? 6  LEU A HA   8  
ATOM   6443  H HB2  . LEU A 1 6  ? -5.747  -6.346  7.969   1.00 0.00 ? 6  LEU A HB2  8  
ATOM   6444  H HB3  . LEU A 1 6  ? -4.610  -7.577  7.457   1.00 0.00 ? 6  LEU A HB3  8  
ATOM   6445  H HG   . LEU A 1 6  ? -2.933  -5.578  7.230   1.00 0.00 ? 6  LEU A HG   8  
ATOM   6446  H HD11 . LEU A 1 6  ? -4.949  -4.413  9.171   1.00 0.00 ? 6  LEU A HD11 8  
ATOM   6447  H HD12 . LEU A 1 6  ? -3.331  -3.760  8.818   1.00 0.00 ? 6  LEU A HD12 8  
ATOM   6448  H HD21 . LEU A 1 6  ? -3.731  -7.271  9.480   1.00 0.00 ? 6  LEU A HD21 8  
ATOM   6449  H HD22 . LEU A 1 6  ? -2.116  -6.911  8.823   1.00 0.00 ? 6  LEU A HD22 8  
ATOM   6450  N N    . VAL A 1 7  ? -6.639  -8.110  5.687   1.00 0.00 ? 7  VAL A N    8  
ATOM   6451  C CA   . VAL A 1 7  ? -7.196  -9.290  5.047   1.00 0.00 ? 7  VAL A CA   8  
ATOM   6452  C C    . VAL A 1 7  ? -8.290  -8.863  4.066   1.00 0.00 ? 7  VAL A C    8  
ATOM   6453  O O    . VAL A 1 7  ? -9.056  -7.943  4.347   1.00 0.00 ? 7  VAL A O    8  
ATOM   6454  C CB   . VAL A 1 7  ? -7.694  -10.274 6.107   1.00 0.00 ? 7  VAL A CB   8  
ATOM   6455  C CG1  . VAL A 1 7  ? -8.364  -11.487 5.457   1.00 0.00 ? 7  VAL A CG1  8  
ATOM   6456  C CG2  . VAL A 1 7  ? -6.554  -10.707 7.031   1.00 0.00 ? 7  VAL A CG2  8  
ATOM   6457  H H    . VAL A 1 7  ? -7.052  -7.871  6.565   1.00 0.00 ? 7  VAL A H    8  
ATOM   6458  H HA   . VAL A 1 7  ? -6.393  -9.771  4.489   1.00 0.00 ? 7  VAL A HA   8  
ATOM   6459  H HB   . VAL A 1 7  ? -8.441  -9.764  6.714   1.00 0.00 ? 7  VAL A HB   8  
ATOM   6460  H HG11 . VAL A 1 7  ? -8.977  -11.157 4.619   1.00 0.00 ? 7  VAL A HG11 8  
ATOM   6461  H HG12 . VAL A 1 7  ? -7.599  -12.176 5.098   1.00 0.00 ? 7  VAL A HG12 8  
ATOM   6462  H HG21 . VAL A 1 7  ? -5.668  -10.929 6.436   1.00 0.00 ? 7  VAL A HG21 8  
ATOM   6463  H HG22 . VAL A 1 7  ? -6.329  -9.903  7.732   1.00 0.00 ? 7  VAL A HG22 8  
ATOM   6464  N N    . PRO A 1 8  ? -8.330  -9.571  2.905   1.00 0.00 ? 8  PRO A N    8  
ATOM   6465  C CA   . PRO A 1 8  ? -9.317  -9.276  1.882   1.00 0.00 ? 8  PRO A CA   8  
ATOM   6466  C C    . PRO A 1 8  ? -10.698 -9.795  2.286   1.00 0.00 ? 8  PRO A C    8  
ATOM   6467  O O    . PRO A 1 8  ? -11.329 -10.540 1.537   1.00 0.00 ? 8  PRO A O    8  
ATOM   6468  C CB   . PRO A 1 8  ? -8.783  -9.931  0.618   1.00 0.00 ? 8  PRO A CB   8  
ATOM   6469  C CG   . PRO A 1 8  ? -7.760  -10.956 1.081   1.00 0.00 ? 8  PRO A CG   8  
ATOM   6470  C CD   . PRO A 1 8  ? -7.438  -10.668 2.539   1.00 0.00 ? 8  PRO A CD   8  
ATOM   6471  H HA   . PRO A 1 8  ? -9.419  -8.287  1.772   1.00 0.00 ? 8  PRO A HA   8  
ATOM   6472  H HB2  . PRO A 1 8  ? -9.586  -10.407 0.055   1.00 0.00 ? 8  PRO A HB2  8  
ATOM   6473  H HB3  . PRO A 1 8  ? -8.326  -9.193  -0.041  1.00 0.00 ? 8  PRO A HB3  8  
ATOM   6474  H HG2  . PRO A 1 8  ? -8.154  -11.966 0.969   1.00 0.00 ? 8  PRO A HG2  8  
ATOM   6475  H HG3  . PRO A 1 8  ? -6.858  -10.897 0.472   1.00 0.00 ? 8  PRO A HG3  8  
ATOM   6476  H HD2  . PRO A 1 8  ? -7.611  -11.545 3.163   1.00 0.00 ? 8  PRO A HD2  8  
ATOM   6477  H HD3  . PRO A 1 8  ? -6.393  -10.388 2.666   1.00 0.00 ? 8  PRO A HD3  8  
ATOM   6478  N N    . LEU A 1 9  ? -11.128 -9.382  3.469   1.00 0.00 ? 9  LEU A N    8  
ATOM   6479  C CA   . LEU A 1 9  ? -12.423 -9.796  3.982   1.00 0.00 ? 9  LEU A CA   8  
ATOM   6480  C C    . LEU A 1 9  ? -13.322 -8.568  4.136   1.00 0.00 ? 9  LEU A C    8  
ATOM   6481  O O    . LEU A 1 9  ? -14.529 -8.646  3.912   1.00 0.00 ? 9  LEU A O    8  
ATOM   6482  C CB   . LEU A 1 9  ? -12.255 -10.601 5.272   1.00 0.00 ? 9  LEU A CB   8  
ATOM   6483  C CG   . LEU A 1 9  ? -11.898 -12.079 5.098   1.00 0.00 ? 9  LEU A CG   8  
ATOM   6484  C CD1  . LEU A 1 9  ? -11.423 -12.687 6.420   1.00 0.00 ? 9  LEU A CD1  8  
ATOM   6485  C CD2  . LEU A 1 9  ? -13.067 -12.859 4.495   1.00 0.00 ? 9  LEU A CD2  8  
ATOM   6486  H H    . LEU A 1 9  ? -10.609 -8.776  4.072   1.00 0.00 ? 9  LEU A H    8  
ATOM   6487  H HA   . LEU A 1 9  ? -12.870 -10.461 3.243   1.00 0.00 ? 9  LEU A HA   8  
ATOM   6488  H HB2  . LEU A 1 9  ? -11.480 -10.128 5.874   1.00 0.00 ? 9  LEU A HB2  8  
ATOM   6489  H HB3  . LEU A 1 9  ? -13.183 -10.537 5.840   1.00 0.00 ? 9  LEU A HB3  8  
ATOM   6490  H HG   . LEU A 1 9  ? -11.067 -12.149 4.396   1.00 0.00 ? 9  LEU A HG   8  
ATOM   6491  H HD11 . LEU A 1 9  ? -11.074 -11.893 7.080   1.00 0.00 ? 9  LEU A HD11 8  
ATOM   6492  H HD12 . LEU A 1 9  ? -12.251 -13.216 6.894   1.00 0.00 ? 9  LEU A HD12 8  
ATOM   6493  H HD21 . LEU A 1 9  ? -13.735 -12.170 3.978   1.00 0.00 ? 9  LEU A HD21 8  
ATOM   6494  H HD22 . LEU A 1 9  ? -12.686 -13.596 3.788   1.00 0.00 ? 9  LEU A HD22 8  
ATOM   6495  N N    . PHE A 1 10 ? -12.699 -7.462  4.518   1.00 0.00 ? 10 PHE A N    8  
ATOM   6496  C CA   . PHE A 1 10 ? -13.429 -6.219  4.704   1.00 0.00 ? 10 PHE A CA   8  
ATOM   6497  C C    . PHE A 1 10 ? -12.664 -5.039  4.102   1.00 0.00 ? 10 PHE A C    8  
ATOM   6498  O O    . PHE A 1 10 ? -11.456 -5.123  3.885   1.00 0.00 ? 10 PHE A O    8  
ATOM   6499  C CB   . PHE A 1 10 ? -13.568 -6.005  6.213   1.00 0.00 ? 10 PHE A CB   8  
ATOM   6500  C CG   . PHE A 1 10 ? -13.925 -7.272  6.991   1.00 0.00 ? 10 PHE A CG   8  
ATOM   6501  C CD1  . PHE A 1 10 ? -12.950 -8.156  7.337   1.00 0.00 ? 10 PHE A CD1  8  
ATOM   6502  C CD2  . PHE A 1 10 ? -15.217 -7.516  7.338   1.00 0.00 ? 10 PHE A CD2  8  
ATOM   6503  C CE1  . PHE A 1 10 ? -13.282 -9.332  8.059   1.00 0.00 ? 10 PHE A CE1  8  
ATOM   6504  C CE2  . PHE A 1 10 ? -15.549 -8.692  8.061   1.00 0.00 ? 10 PHE A CE2  8  
ATOM   6505  C CZ   . PHE A 1 10 ? -14.574 -9.576  8.406   1.00 0.00 ? 10 PHE A CZ   8  
ATOM   6506  H H    . PHE A 1 10 ? -11.717 -7.407  4.698   1.00 0.00 ? 10 PHE A H    8  
ATOM   6507  H HA   . PHE A 1 10 ? -14.387 -6.327  4.196   1.00 0.00 ? 10 PHE A HA   8  
ATOM   6508  H HB2  . PHE A 1 10 ? -12.631 -5.604  6.601   1.00 0.00 ? 10 PHE A HB2  8  
ATOM   6509  H HB3  . PHE A 1 10 ? -14.335 -5.252  6.393   1.00 0.00 ? 10 PHE A HB3  8  
ATOM   6510  H HD1  . PHE A 1 10 ? -11.915 -7.961  7.059   1.00 0.00 ? 10 PHE A HD1  8  
ATOM   6511  H HD2  . PHE A 1 10 ? -15.999 -6.808  7.062   1.00 0.00 ? 10 PHE A HD2  8  
ATOM   6512  H HE1  . PHE A 1 10 ? -12.501 -10.040 8.336   1.00 0.00 ? 10 PHE A HE1  8  
ATOM   6513  H HE2  . PHE A 1 10 ? -16.585 -8.887  8.339   1.00 0.00 ? 10 PHE A HE2  8  
ATOM   6514  H HZ   . PHE A 1 10 ? -14.829 -10.479 8.961   1.00 0.00 ? 10 PHE A HZ   8  
ATOM   6515  N N    . SER A 1 11 ? -13.399 -3.966  3.848   1.00 0.00 ? 11 SER A N    8  
ATOM   6516  C CA   . SER A 1 11 ? -12.805 -2.771  3.275   1.00 0.00 ? 11 SER A CA   8  
ATOM   6517  C C    . SER A 1 11 ? -13.079 -1.566  4.177   1.00 0.00 ? 11 SER A C    8  
ATOM   6518  O O    . SER A 1 11 ? -14.060 -1.553  4.920   1.00 0.00 ? 11 SER A O    8  
ATOM   6519  C CB   . SER A 1 11 ? -13.340 -2.511  1.866   1.00 0.00 ? 11 SER A CB   8  
ATOM   6520  O OG   . SER A 1 11 ? -14.759 -2.625  1.804   1.00 0.00 ? 11 SER A OG   8  
ATOM   6521  H H    . SER A 1 11 ? -14.381 -3.906  4.028   1.00 0.00 ? 11 SER A H    8  
ATOM   6522  H HA   . SER A 1 11 ? -11.735 -2.975  3.225   1.00 0.00 ? 11 SER A HA   8  
ATOM   6523  H HB2  . SER A 1 11 ? -13.042 -1.514  1.542   1.00 0.00 ? 11 SER A HB2  8  
ATOM   6524  H HB3  . SER A 1 11 ? -12.889 -3.219  1.171   1.00 0.00 ? 11 SER A HB3  8  
ATOM   6525  H HG   . SER A 1 11 ? -15.015 -3.456  1.311   1.00 0.00 ? 11 SER A HG   8  
ATOM   6526  N N    . LYS A 1 12 ? -12.197 -0.582  4.082   1.00 0.00 ? 12 LYS A N    8  
ATOM   6527  C CA   . LYS A 1 12 ? -12.332 0.624   4.880   1.00 0.00 ? 12 LYS A CA   8  
ATOM   6528  C C    . LYS A 1 12 ? -11.979 1.841   4.022   1.00 0.00 ? 12 LYS A C    8  
ATOM   6529  O O    . LYS A 1 12 ? -11.176 1.739   3.096   1.00 0.00 ? 12 LYS A O    8  
ATOM   6530  C CB   . LYS A 1 12 ? -11.503 0.515   6.162   1.00 0.00 ? 12 LYS A CB   8  
ATOM   6531  C CG   . LYS A 1 12 ? -12.228 1.167   7.341   1.00 0.00 ? 12 LYS A CG   8  
ATOM   6532  C CD   . LYS A 1 12 ? -13.351 0.267   7.859   1.00 0.00 ? 12 LYS A CD   8  
ATOM   6533  C CE   . LYS A 1 12 ? -14.010 0.872   9.101   1.00 0.00 ? 12 LYS A CE   8  
ATOM   6534  N NZ   . LYS A 1 12 ? -14.961 1.938   8.715   1.00 0.00 ? 12 LYS A NZ   8  
ATOM   6535  H H    . LYS A 1 12 ? -11.402 -0.601  3.475   1.00 0.00 ? 12 LYS A H    8  
ATOM   6536  H HA   . LYS A 1 12 ? -13.377 0.703   5.179   1.00 0.00 ? 12 LYS A HA   8  
ATOM   6537  H HB2  . LYS A 1 12 ? -11.308 -0.534  6.385   1.00 0.00 ? 12 LYS A HB2  8  
ATOM   6538  H HB3  . LYS A 1 12 ? -10.535 0.994   6.015   1.00 0.00 ? 12 LYS A HB3  8  
ATOM   6539  H HG2  . LYS A 1 12 ? -11.517 1.367   8.143   1.00 0.00 ? 12 LYS A HG2  8  
ATOM   6540  H HG3  . LYS A 1 12 ? -12.640 2.128   7.033   1.00 0.00 ? 12 LYS A HG3  8  
ATOM   6541  H HD2  . LYS A 1 12 ? -14.099 0.126   7.079   1.00 0.00 ? 12 LYS A HD2  8  
ATOM   6542  H HD3  . LYS A 1 12 ? -12.952 -0.719  8.099   1.00 0.00 ? 12 LYS A HD3  8  
ATOM   6543  H HE2  . LYS A 1 12 ? -14.532 0.094   9.658   1.00 0.00 ? 12 LYS A HE2  8  
ATOM   6544  H HE3  . LYS A 1 12 ? -13.246 1.280   9.763   1.00 0.00 ? 12 LYS A HE3  8  
ATOM   6545  H HZ1  . LYS A 1 12 ? -15.739 1.935   9.344   1.00 0.00 ? 12 LYS A HZ1  8  
ATOM   6546  H HZ2  . LYS A 1 12 ? -14.502 2.825   8.756   1.00 0.00 ? 12 LYS A HZ2  8  
ATOM   6547  N N    . THR A 1 13 ? -12.597 2.963   4.360   1.00 0.00 ? 13 THR A N    8  
ATOM   6548  C CA   . THR A 1 13 ? -12.358 4.197   3.632   1.00 0.00 ? 13 THR A CA   8  
ATOM   6549  C C    . THR A 1 13 ? -11.212 4.982   4.274   1.00 0.00 ? 13 THR A C    8  
ATOM   6550  O O    . THR A 1 13 ? -11.060 4.979   5.494   1.00 0.00 ? 13 THR A O    8  
ATOM   6551  C CB   . THR A 1 13 ? -13.673 4.977   3.579   1.00 0.00 ? 13 THR A CB   8  
ATOM   6552  O OG1  . THR A 1 13 ? -14.422 4.326   2.556   1.00 0.00 ? 13 THR A OG1  8  
ATOM   6553  C CG2  . THR A 1 13 ? -13.488 6.403   3.056   1.00 0.00 ? 13 THR A CG2  8  
ATOM   6554  H H    . THR A 1 13 ? -13.249 3.037   5.115   1.00 0.00 ? 13 THR A H    8  
ATOM   6555  H HA   . THR A 1 13 ? -12.044 3.944   2.619   1.00 0.00 ? 13 THR A HA   8  
ATOM   6556  H HB   . THR A 1 13 ? -14.163 4.980   4.552   1.00 0.00 ? 13 THR A HB   8  
ATOM   6557  H HG1  . THR A 1 13 ? -14.029 4.534   1.660   1.00 0.00 ? 13 THR A HG1  8  
ATOM   6558  H HG21 . THR A 1 13 ? -12.470 6.525   2.686   1.00 0.00 ? 13 THR A HG21 8  
ATOM   6559  H HG22 . THR A 1 13 ? -14.193 6.587   2.245   1.00 0.00 ? 13 THR A HG22 8  
ATOM   6560  N N    . CYS A 1 14 ? -10.435 5.635   3.422   1.00 0.00 ? 14 CYS A N    8  
ATOM   6561  C CA   . CYS A 1 14 ? -9.307  6.422   3.891   1.00 0.00 ? 14 CYS A CA   8  
ATOM   6562  C C    . CYS A 1 14 ? -9.783  7.860   4.111   1.00 0.00 ? 14 CYS A C    8  
ATOM   6563  O O    . CYS A 1 14 ? -10.225 8.521   3.174   1.00 0.00 ? 14 CYS A O    8  
ATOM   6564  C CB   . CYS A 1 14 ? -8.127  6.355   2.919   1.00 0.00 ? 14 CYS A CB   8  
ATOM   6565  S SG   . CYS A 1 14 ? -7.851  4.712   2.161   1.00 0.00 ? 14 CYS A SG   8  
ATOM   6566  H H    . CYS A 1 14 ? -10.565 5.632   2.431   1.00 0.00 ? 14 CYS A H    8  
ATOM   6567  H HA   . CYS A 1 14 ? -8.981  5.974   4.829   1.00 0.00 ? 14 CYS A HA   8  
ATOM   6568  H HB2  . CYS A 1 14 ? -8.286  7.084   2.125   1.00 0.00 ? 14 CYS A HB2  8  
ATOM   6569  H HB3  . CYS A 1 14 ? -7.222  6.652   3.448   1.00 0.00 ? 14 CYS A HB3  8  
ATOM   6570  N N    . PRO A 1 15 ? -9.674  8.312   5.389   1.00 0.00 ? 15 PRO A N    8  
ATOM   6571  C CA   . PRO A 1 15 ? -10.088 9.658   5.745   1.00 0.00 ? 15 PRO A CA   8  
ATOM   6572  C C    . PRO A 1 15 ? -9.071  10.692  5.255   1.00 0.00 ? 15 PRO A C    8  
ATOM   6573  O O    . PRO A 1 15 ? -7.974  10.335  4.828   1.00 0.00 ? 15 PRO A O    8  
ATOM   6574  C CB   . PRO A 1 15 ? -10.233 9.638   7.258   1.00 0.00 ? 15 PRO A CB   8  
ATOM   6575  C CG   . PRO A 1 15 ? -9.452  8.426   7.736   1.00 0.00 ? 15 PRO A CG   8  
ATOM   6576  C CD   . PRO A 1 15 ? -9.155  7.556   6.525   1.00 0.00 ? 15 PRO A CD   8  
ATOM   6577  H HA   . PRO A 1 15 ? -10.950 9.887   5.292   1.00 0.00 ? 15 PRO A HA   8  
ATOM   6578  H HB2  . PRO A 1 15 ? -9.842  10.555  7.700   1.00 0.00 ? 15 PRO A HB2  8  
ATOM   6579  H HB3  . PRO A 1 15 ? -11.281 9.567   7.548   1.00 0.00 ? 15 PRO A HB3  8  
ATOM   6580  H HG2  . PRO A 1 15 ? -8.526  8.735   8.220   1.00 0.00 ? 15 PRO A HG2  8  
ATOM   6581  H HG3  . PRO A 1 15 ? -10.027 7.868   8.475   1.00 0.00 ? 15 PRO A HG3  8  
ATOM   6582  H HD2  . PRO A 1 15 ? -8.085  7.371   6.423   1.00 0.00 ? 15 PRO A HD2  8  
ATOM   6583  H HD3  . PRO A 1 15 ? -9.639  6.583   6.608   1.00 0.00 ? 15 PRO A HD3  8  
ATOM   6584  N N    . ALA A 1 16 ? -9.472  11.952  5.334   1.00 0.00 ? 16 ALA A N    8  
ATOM   6585  C CA   . ALA A 1 16 ? -8.610  13.040  4.905   1.00 0.00 ? 16 ALA A CA   8  
ATOM   6586  C C    . ALA A 1 16 ? -7.183  12.775  5.389   1.00 0.00 ? 16 ALA A C    8  
ATOM   6587  O O    . ALA A 1 16 ? -6.976  12.026  6.342   1.00 0.00 ? 16 ALA A O    8  
ATOM   6588  C CB   . ALA A 1 16 ? -9.165  14.367  5.424   1.00 0.00 ? 16 ALA A CB   8  
ATOM   6589  H H    . ALA A 1 16 ? -10.366 12.234  5.683   1.00 0.00 ? 16 ALA A H    8  
ATOM   6590  H HA   . ALA A 1 16 ? -8.617  13.059  3.815   1.00 0.00 ? 16 ALA A HA   8  
ATOM   6591  H HB1  . ALA A 1 16 ? -8.898  14.487  6.475   1.00 0.00 ? 16 ALA A HB1  8  
ATOM   6592  H HB2  . ALA A 1 16 ? -8.742  15.189  4.847   1.00 0.00 ? 16 ALA A HB2  8  
ATOM   6593  N N    . GLY A 1 17 ? -6.235  13.405  4.709   1.00 0.00 ? 17 GLY A N    8  
ATOM   6594  C CA   . GLY A 1 17 ? -4.833  13.247  5.058   1.00 0.00 ? 17 GLY A CA   8  
ATOM   6595  C C    . GLY A 1 17 ? -4.228  12.028  4.358   1.00 0.00 ? 17 GLY A C    8  
ATOM   6596  O O    . GLY A 1 17 ? -3.146  12.115  3.779   1.00 0.00 ? 17 GLY A O    8  
ATOM   6597  H H    . GLY A 1 17 ? -6.412  14.012  3.935   1.00 0.00 ? 17 GLY A H    8  
ATOM   6598  H HA2  . GLY A 1 17 ? -4.282  14.144  4.777   1.00 0.00 ? 17 GLY A HA2  8  
ATOM   6599  H HA3  . GLY A 1 17 ? -4.734  13.137  6.138   1.00 0.00 ? 17 GLY A HA3  8  
ATOM   6600  N N    . LYS A 1 18 ? -4.953  10.922  4.434   1.00 0.00 ? 18 LYS A N    8  
ATOM   6601  C CA   . LYS A 1 18 ? -4.501  9.687   3.815   1.00 0.00 ? 18 LYS A CA   8  
ATOM   6602  C C    . LYS A 1 18 ? -5.414  9.350   2.635   1.00 0.00 ? 18 LYS A C    8  
ATOM   6603  O O    . LYS A 1 18 ? -6.413  8.650   2.799   1.00 0.00 ? 18 LYS A O    8  
ATOM   6604  C CB   . LYS A 1 18 ? -4.402  8.570   4.856   1.00 0.00 ? 18 LYS A CB   8  
ATOM   6605  C CG   . LYS A 1 18 ? -5.463  8.741   5.945   1.00 0.00 ? 18 LYS A CG   8  
ATOM   6606  C CD   . LYS A 1 18 ? -5.364  7.625   6.987   1.00 0.00 ? 18 LYS A CD   8  
ATOM   6607  C CE   . LYS A 1 18 ? -5.401  8.194   8.406   1.00 0.00 ? 18 LYS A CE   8  
ATOM   6608  N NZ   . LYS A 1 18 ? -4.035  8.539   8.862   1.00 0.00 ? 18 LYS A NZ   8  
ATOM   6609  H H    . LYS A 1 18 ? -5.832  10.860  4.907   1.00 0.00 ? 18 LYS A H    8  
ATOM   6610  H HA   . LYS A 1 18 ? -3.495  9.862   3.434   1.00 0.00 ? 18 LYS A HA   8  
ATOM   6611  H HB2  . LYS A 1 18 ? -4.528  7.603   4.370   1.00 0.00 ? 18 LYS A HB2  8  
ATOM   6612  H HB3  . LYS A 1 18 ? -3.410  8.574   5.306   1.00 0.00 ? 18 LYS A HB3  8  
ATOM   6613  H HG2  . LYS A 1 18 ? -5.337  9.709   6.431   1.00 0.00 ? 18 LYS A HG2  8  
ATOM   6614  H HG3  . LYS A 1 18 ? -6.456  8.737   5.495   1.00 0.00 ? 18 LYS A HG3  8  
ATOM   6615  H HD2  . LYS A 1 18 ? -6.187  6.922   6.851   1.00 0.00 ? 18 LYS A HD2  8  
ATOM   6616  H HD3  . LYS A 1 18 ? -4.440  7.066   6.839   1.00 0.00 ? 18 LYS A HD3  8  
ATOM   6617  H HE2  . LYS A 1 18 ? -6.034  9.081   8.433   1.00 0.00 ? 18 LYS A HE2  8  
ATOM   6618  H HE3  . LYS A 1 18 ? -5.844  7.466   9.085   1.00 0.00 ? 18 LYS A HE3  8  
ATOM   6619  H HZ1  . LYS A 1 18 ? -3.741  7.886   9.559   1.00 0.00 ? 18 LYS A HZ1  8  
ATOM   6620  H HZ2  . LYS A 1 18 ? -3.406  8.504   8.085   1.00 0.00 ? 18 LYS A HZ2  8  
ATOM   6621  N N    . ASN A 1 19 ? -5.040  9.862   1.472   1.00 0.00 ? 19 ASN A N    8  
ATOM   6622  C CA   . ASN A 1 19 ? -5.813  9.624   0.265   1.00 0.00 ? 19 ASN A CA   8  
ATOM   6623  C C    . ASN A 1 19 ? -5.042  8.669   -0.649  1.00 0.00 ? 19 ASN A C    8  
ATOM   6624  O O    . ASN A 1 19 ? -5.403  8.489   -1.811  1.00 0.00 ? 19 ASN A O    8  
ATOM   6625  C CB   . ASN A 1 19 ? -6.050  10.925  -0.503  1.00 0.00 ? 19 ASN A CB   8  
ATOM   6626  C CG   . ASN A 1 19 ? -7.286  11.656  0.024   1.00 0.00 ? 19 ASN A CG   8  
ATOM   6627  O OD1  . ASN A 1 19 ? -8.031  11.154  0.849   1.00 0.00 ? 19 ASN A OD1  8  
ATOM   6628  N ND2  . ASN A 1 19 ? -7.462  12.867  -0.498  1.00 0.00 ? 19 ASN A ND2  8  
ATOM   6629  H H    . ASN A 1 19 ? -4.226  10.431  1.347   1.00 0.00 ? 19 ASN A H    8  
ATOM   6630  H HA   . ASN A 1 19 ? -6.757  9.201   0.609   1.00 0.00 ? 19 ASN A HA   8  
ATOM   6631  H HB2  . ASN A 1 19 ? -5.176  11.570  -0.412  1.00 0.00 ? 19 ASN A HB2  8  
ATOM   6632  H HB3  . ASN A 1 19 ? -6.176  10.708  -1.564  1.00 0.00 ? 19 ASN A HB3  8  
ATOM   6633  H HD21 . ASN A 1 19 ? -6.813  13.221  -1.171  1.00 0.00 ? 19 ASN A HD21 8  
ATOM   6634  H HD22 . ASN A 1 19 ? -8.243  13.424  -0.216  1.00 0.00 ? 19 ASN A HD22 8  
ATOM   6635  N N    . LEU A 1 20 ? -3.995  8.082   -0.089  1.00 0.00 ? 20 LEU A N    8  
ATOM   6636  C CA   . LEU A 1 20 ? -3.170  7.149   -0.839  1.00 0.00 ? 20 LEU A CA   8  
ATOM   6637  C C    . LEU A 1 20 ? -3.249  5.767   -0.187  1.00 0.00 ? 20 LEU A C    8  
ATOM   6638  O O    . LEU A 1 20 ? -3.071  5.637   1.023   1.00 0.00 ? 20 LEU A O    8  
ATOM   6639  C CB   . LEU A 1 20 ? -1.743  7.685   -0.974  1.00 0.00 ? 20 LEU A CB   8  
ATOM   6640  C CG   . LEU A 1 20 ? -1.591  9.002   -1.739  1.00 0.00 ? 20 LEU A CG   8  
ATOM   6641  C CD1  . LEU A 1 20 ? -0.204  9.607   -1.517  1.00 0.00 ? 20 LEU A CD1  8  
ATOM   6642  C CD2  . LEU A 1 20 ? -1.902  8.812   -3.225  1.00 0.00 ? 20 LEU A CD2  8  
ATOM   6643  H H    . LEU A 1 20 ? -3.708  8.233   0.857   1.00 0.00 ? 20 LEU A H    8  
ATOM   6644  H HA   . LEU A 1 20 ? -3.585  7.081   -1.844  1.00 0.00 ? 20 LEU A HA   8  
ATOM   6645  H HB2  . LEU A 1 20 ? -1.330  7.819   0.026   1.00 0.00 ? 20 LEU A HB2  8  
ATOM   6646  H HB3  . LEU A 1 20 ? -1.137  6.927   -1.470  1.00 0.00 ? 20 LEU A HB3  8  
ATOM   6647  H HG   . LEU A 1 20 ? -2.319  9.711   -1.346  1.00 0.00 ? 20 LEU A HG   8  
ATOM   6648  H HD11 . LEU A 1 20 ? -0.288  10.481  -0.870  1.00 0.00 ? 20 LEU A HD11 8  
ATOM   6649  H HD12 . LEU A 1 20 ? 0.444   8.868   -1.046  1.00 0.00 ? 20 LEU A HD12 8  
ATOM   6650  H HD21 . LEU A 1 20 ? -2.806  8.212   -3.333  1.00 0.00 ? 20 LEU A HD21 8  
ATOM   6651  H HD22 . LEU A 1 20 ? -2.054  9.785   -3.691  1.00 0.00 ? 20 LEU A HD22 8  
ATOM   6652  N N    . CYS A 1 21 ? -3.515  4.771   -1.019  1.00 0.00 ? 21 CYS A N    8  
ATOM   6653  C CA   . CYS A 1 21 ? -3.619  3.403   -0.538  1.00 0.00 ? 21 CYS A CA   8  
ATOM   6654  C C    . CYS A 1 21 ? -2.270  2.714   -0.754  1.00 0.00 ? 21 CYS A C    8  
ATOM   6655  O O    . CYS A 1 21 ? -1.719  2.750   -1.853  1.00 0.00 ? 21 CYS A O    8  
ATOM   6656  C CB   . CYS A 1 21 ? -4.761  2.649   -1.223  1.00 0.00 ? 21 CYS A CB   8  
ATOM   6657  S SG   . CYS A 1 21 ? -6.437  3.258   -0.814  1.00 0.00 ? 21 CYS A SG   8  
ATOM   6658  H H    . CYS A 1 21 ? -3.658  4.885   -2.002  1.00 0.00 ? 21 CYS A H    8  
ATOM   6659  H HA   . CYS A 1 21 ? -3.859  3.461   0.523   1.00 0.00 ? 21 CYS A HA   8  
ATOM   6660  H HB2  . CYS A 1 21 ? -4.621  2.708   -2.302  1.00 0.00 ? 21 CYS A HB2  8  
ATOM   6661  H HB3  . CYS A 1 21 ? -4.696  1.595   -0.951  1.00 0.00 ? 21 CYS A HB3  8  
ATOM   6662  N N    . TYR A 1 22 ? -1.776  2.104   0.314   1.00 0.00 ? 22 TYR A N    8  
ATOM   6663  C CA   . TYR A 1 22 ? -0.502  1.408   0.255   1.00 0.00 ? 22 TYR A CA   8  
ATOM   6664  C C    . TYR A 1 22 ? -0.636  -0.025  0.775   1.00 0.00 ? 22 TYR A C    8  
ATOM   6665  O O    . TYR A 1 22 ? -1.565  -0.336  1.519   1.00 0.00 ? 22 TYR A O    8  
ATOM   6666  C CB   . TYR A 1 22 ? 0.445   2.184   1.173   1.00 0.00 ? 22 TYR A CB   8  
ATOM   6667  C CG   . TYR A 1 22 ? 0.327   1.806   2.651   1.00 0.00 ? 22 TYR A CG   8  
ATOM   6668  C CD1  . TYR A 1 22 ? 0.874   0.624   3.107   1.00 0.00 ? 22 TYR A CD1  8  
ATOM   6669  C CD2  . TYR A 1 22 ? -0.327  2.648   3.528   1.00 0.00 ? 22 TYR A CD2  8  
ATOM   6670  C CE1  . TYR A 1 22 ? 0.763   0.269   4.498   1.00 0.00 ? 22 TYR A CE1  8  
ATOM   6671  C CE2  . TYR A 1 22 ? -0.438  2.293   4.919   1.00 0.00 ? 22 TYR A CE2  8  
ATOM   6672  C CZ   . TYR A 1 22 ? 0.112   1.121   5.336   1.00 0.00 ? 22 TYR A CZ   8  
ATOM   6673  O OH   . TYR A 1 22 ? 0.008   0.786   6.650   1.00 0.00 ? 22 TYR A OH   8  
ATOM   6674  H H    . TYR A 1 22 ? -2.231  2.080   1.204   1.00 0.00 ? 22 TYR A H    8  
ATOM   6675  H HA   . TYR A 1 22 ? -0.181  1.381   -0.786  1.00 0.00 ? 22 TYR A HA   8  
ATOM   6676  H HB2  . TYR A 1 22 ? 1.471   2.015   0.846   1.00 0.00 ? 22 TYR A HB2  8  
ATOM   6677  H HB3  . TYR A 1 22 ? 0.247   3.250   1.064   1.00 0.00 ? 22 TYR A HB3  8  
ATOM   6678  H HD1  . TYR A 1 22 ? 1.390   -0.040  2.415   1.00 0.00 ? 22 TYR A HD1  8  
ATOM   6679  H HD2  . TYR A 1 22 ? -0.759  3.582   3.168   1.00 0.00 ? 22 TYR A HD2  8  
ATOM   6680  H HE1  . TYR A 1 22 ? 1.190   -0.661  4.872   1.00 0.00 ? 22 TYR A HE1  8  
ATOM   6681  H HE2  . TYR A 1 22 ? -0.951  2.949   5.623   1.00 0.00 ? 22 TYR A HE2  8  
ATOM   6682  H HH   . TYR A 1 22 ? 0.918   0.677   7.048   1.00 0.00 ? 22 TYR A HH   8  
ATOM   6683  N N    . LYS A 1 23 ? 0.306   -0.861  0.361   1.00 0.00 ? 23 LYS A N    8  
ATOM   6684  C CA   . LYS A 1 23 ? 0.305   -2.254  0.775   1.00 0.00 ? 23 LYS A CA   8  
ATOM   6685  C C    . LYS A 1 23 ? 1.748   -2.730  0.951   1.00 0.00 ? 23 LYS A C    8  
ATOM   6686  O O    . LYS A 1 23 ? 2.608   -2.433  0.124   1.00 0.00 ? 23 LYS A O    8  
ATOM   6687  C CB   . LYS A 1 23 ? -0.508  -3.103  -0.204  1.00 0.00 ? 23 LYS A CB   8  
ATOM   6688  C CG   . LYS A 1 23 ? 0.140   -3.114  -1.590  1.00 0.00 ? 23 LYS A CG   8  
ATOM   6689  C CD   . LYS A 1 23 ? -0.120  -4.440  -2.306  1.00 0.00 ? 23 LYS A CD   8  
ATOM   6690  C CE   . LYS A 1 23 ? 0.682   -4.528  -3.606  1.00 0.00 ? 23 LYS A CE   8  
ATOM   6691  N NZ   . LYS A 1 23 ? -0.208  -4.847  -4.745  1.00 0.00 ? 23 LYS A NZ   8  
ATOM   6692  H H    . LYS A 1 23 ? 1.058   -0.600  -0.245  1.00 0.00 ? 23 LYS A H    8  
ATOM   6693  H HA   . LYS A 1 23 ? -0.197  -2.307  1.741   1.00 0.00 ? 23 LYS A HA   8  
ATOM   6694  H HB2  . LYS A 1 23 ? -0.588  -4.123  0.172   1.00 0.00 ? 23 LYS A HB2  8  
ATOM   6695  H HB3  . LYS A 1 23 ? -1.523  -2.711  -0.276  1.00 0.00 ? 23 LYS A HB3  8  
ATOM   6696  H HG2  . LYS A 1 23 ? -0.255  -2.291  -2.186  1.00 0.00 ? 23 LYS A HG2  8  
ATOM   6697  H HG3  . LYS A 1 23 ? 1.213   -2.952  -1.494  1.00 0.00 ? 23 LYS A HG3  8  
ATOM   6698  H HD2  . LYS A 1 23 ? 0.148   -5.270  -1.652  1.00 0.00 ? 23 LYS A HD2  8  
ATOM   6699  H HD3  . LYS A 1 23 ? -1.184  -4.538  -2.525  1.00 0.00 ? 23 LYS A HD3  8  
ATOM   6700  H HE2  . LYS A 1 23 ? 1.193   -3.583  -3.789  1.00 0.00 ? 23 LYS A HE2  8  
ATOM   6701  H HE3  . LYS A 1 23 ? 1.453   -5.294  -3.513  1.00 0.00 ? 23 LYS A HE3  8  
ATOM   6702  H HZ1  . LYS A 1 23 ? -1.058  -4.327  -4.659  1.00 0.00 ? 23 LYS A HZ1  8  
ATOM   6703  H HZ2  . LYS A 1 23 ? 0.247   -4.604  -5.601  1.00 0.00 ? 23 LYS A HZ2  8  
ATOM   6704  N N    . MET A 1 24 ? 1.968   -3.461  2.033   1.00 0.00 ? 24 MET A N    8  
ATOM   6705  C CA   . MET A 1 24 ? 3.293   -3.982  2.328   1.00 0.00 ? 24 MET A CA   8  
ATOM   6706  C C    . MET A 1 24 ? 3.318   -5.508  2.222   1.00 0.00 ? 24 MET A C    8  
ATOM   6707  O O    . MET A 1 24 ? 2.494   -6.190  2.830   1.00 0.00 ? 24 MET A O    8  
ATOM   6708  C CB   . MET A 1 24 ? 3.704   -3.561  3.740   1.00 0.00 ? 24 MET A CB   8  
ATOM   6709  C CG   . MET A 1 24 ? 3.832   -2.039  3.843   1.00 0.00 ? 24 MET A CG   8  
ATOM   6710  S SD   . MET A 1 24 ? 4.320   -1.579  5.497   1.00 0.00 ? 24 MET A SD   8  
ATOM   6711  C CE   . MET A 1 24 ? 3.883   0.152   5.478   1.00 0.00 ? 24 MET A CE   8  
ATOM   6712  H H    . MET A 1 24 ? 1.263   -3.699  2.701   1.00 0.00 ? 24 MET A H    8  
ATOM   6713  H HA   . MET A 1 24 ? 3.952   -3.547  1.576   1.00 0.00 ? 24 MET A HA   8  
ATOM   6714  H HB2  . MET A 1 24 ? 2.966   -3.917  4.459   1.00 0.00 ? 24 MET A HB2  8  
ATOM   6715  H HB3  . MET A 1 24 ? 4.654   -4.028  4.000   1.00 0.00 ? 24 MET A HB3  8  
ATOM   6716  H HG2  . MET A 1 24 ? 4.568   -1.679  3.124   1.00 0.00 ? 24 MET A HG2  8  
ATOM   6717  H HG3  . MET A 1 24 ? 2.882   -1.568  3.591   1.00 0.00 ? 24 MET A HG3  8  
ATOM   6718  H HE1  . MET A 1 24 ? 4.766   0.747   5.246   1.00 0.00 ? 24 MET A HE1  8  
ATOM   6719  H HE2  . MET A 1 24 ? 3.118   0.325   4.721   1.00 0.00 ? 24 MET A HE2  8  
ATOM   6720  N N    . PHE A 1 25 ? 4.272   -6.000  1.445   1.00 0.00 ? 25 PHE A N    8  
ATOM   6721  C CA   . PHE A 1 25 ? 4.416   -7.432  1.252   1.00 0.00 ? 25 PHE A CA   8  
ATOM   6722  C C    . PHE A 1 25 ? 5.891   -7.837  1.223   1.00 0.00 ? 25 PHE A C    8  
ATOM   6723  O O    . PHE A 1 25 ? 6.773   -6.980  1.190   1.00 0.00 ? 25 PHE A O    8  
ATOM   6724  C CB   . PHE A 1 25 ? 3.781   -7.767  -0.099  1.00 0.00 ? 25 PHE A CB   8  
ATOM   6725  C CG   . PHE A 1 25 ? 4.630   -7.359  -1.304  1.00 0.00 ? 25 PHE A CG   8  
ATOM   6726  C CD1  . PHE A 1 25 ? 4.735   -6.048  -1.650  1.00 0.00 ? 25 PHE A CD1  8  
ATOM   6727  C CD2  . PHE A 1 25 ? 5.280   -8.308  -2.030  1.00 0.00 ? 25 PHE A CD2  8  
ATOM   6728  C CE1  . PHE A 1 25 ? 5.524   -5.670  -2.768  1.00 0.00 ? 25 PHE A CE1  8  
ATOM   6729  C CE2  . PHE A 1 25 ? 6.069   -7.929  -3.149  1.00 0.00 ? 25 PHE A CE2  8  
ATOM   6730  C CZ   . PHE A 1 25 ? 6.174   -6.618  -3.494  1.00 0.00 ? 25 PHE A CZ   8  
ATOM   6731  H H    . PHE A 1 25 ? 4.938   -5.438  0.954   1.00 0.00 ? 25 PHE A H    8  
ATOM   6732  H HA   . PHE A 1 25 ? 3.923   -7.923  2.091   1.00 0.00 ? 25 PHE A HA   8  
ATOM   6733  H HB2  . PHE A 1 25 ? 3.594   -8.840  -0.145  1.00 0.00 ? 25 PHE A HB2  8  
ATOM   6734  H HB3  . PHE A 1 25 ? 2.812   -7.272  -0.166  1.00 0.00 ? 25 PHE A HB3  8  
ATOM   6735  H HD1  . PHE A 1 25 ? 4.214   -5.288  -1.068  1.00 0.00 ? 25 PHE A HD1  8  
ATOM   6736  H HD2  . PHE A 1 25 ? 5.196   -9.359  -1.753  1.00 0.00 ? 25 PHE A HD2  8  
ATOM   6737  H HE1  . PHE A 1 25 ? 5.608   -4.619  -3.045  1.00 0.00 ? 25 PHE A HE1  8  
ATOM   6738  H HE2  . PHE A 1 25 ? 6.590   -8.690  -3.731  1.00 0.00 ? 25 PHE A HE2  8  
ATOM   6739  H HZ   . PHE A 1 25 ? 6.779   -6.328  -4.353  1.00 0.00 ? 25 PHE A HZ   8  
ATOM   6740  N N    . MET A 1 26 ? 6.114   -9.143  1.236   1.00 0.00 ? 26 MET A N    8  
ATOM   6741  C CA   . MET A 1 26 ? 7.467   -9.671  1.212   1.00 0.00 ? 26 MET A CA   8  
ATOM   6742  C C    . MET A 1 26 ? 7.880   -10.055 -0.210  1.00 0.00 ? 26 MET A C    8  
ATOM   6743  O O    . MET A 1 26 ? 7.039   -10.432 -1.025  1.00 0.00 ? 26 MET A O    8  
ATOM   6744  C CB   . MET A 1 26 ? 7.552   -10.901 2.118   1.00 0.00 ? 26 MET A CB   8  
ATOM   6745  C CG   . MET A 1 26 ? 7.335   -10.518 3.583   1.00 0.00 ? 26 MET A CG   8  
ATOM   6746  S SD   . MET A 1 26 ? 8.221   -11.646 4.646   1.00 0.00 ? 26 MET A SD   8  
ATOM   6747  C CE   . MET A 1 26 ? 7.332   -11.396 6.174   1.00 0.00 ? 26 MET A CE   8  
ATOM   6748  H H    . MET A 1 26 ? 5.391   -9.833  1.263   1.00 0.00 ? 26 MET A H    8  
ATOM   6749  H HA   . MET A 1 26 ? 8.103   -8.864  1.577   1.00 0.00 ? 26 MET A HA   8  
ATOM   6750  H HB2  . MET A 1 26 ? 6.803   -11.632 1.815   1.00 0.00 ? 26 MET A HB2  8  
ATOM   6751  H HB3  . MET A 1 26 ? 8.526   -11.376 2.003   1.00 0.00 ? 26 MET A HB3  8  
ATOM   6752  H HG2  . MET A 1 26 ? 7.678   -9.498  3.756   1.00 0.00 ? 26 MET A HG2  8  
ATOM   6753  H HG3  . MET A 1 26 ? 6.272   -10.541 3.821   1.00 0.00 ? 26 MET A HG3  8  
ATOM   6754  H HE1  . MET A 1 26 ? 6.297   -11.135 5.953   1.00 0.00 ? 26 MET A HE1  8  
ATOM   6755  H HE2  . MET A 1 26 ? 7.358   -12.312 6.764   1.00 0.00 ? 26 MET A HE2  8  
ATOM   6756  N N    . VAL A 1 27 ? 9.176   -9.946  -0.466  1.00 0.00 ? 27 VAL A N    8  
ATOM   6757  C CA   . VAL A 1 27 ? 9.711   -10.277 -1.776  1.00 0.00 ? 27 VAL A CA   8  
ATOM   6758  C C    . VAL A 1 27 ? 9.383   -11.736 -2.102  1.00 0.00 ? 27 VAL A C    8  
ATOM   6759  O O    . VAL A 1 27 ? 9.492   -12.158 -3.252  1.00 0.00 ? 27 VAL A O    8  
ATOM   6760  C CB   . VAL A 1 27 ? 11.211  -9.977  -1.820  1.00 0.00 ? 27 VAL A CB   8  
ATOM   6761  C CG1  . VAL A 1 27 ? 11.986  -10.922 -0.899  1.00 0.00 ? 27 VAL A CG1  8  
ATOM   6762  C CG2  . VAL A 1 27 ? 11.742  -10.049 -3.252  1.00 0.00 ? 27 VAL A CG2  8  
ATOM   6763  H H    . VAL A 1 27 ? 9.854   -9.639  0.202   1.00 0.00 ? 27 VAL A H    8  
ATOM   6764  H HA   . VAL A 1 27 ? 9.217   -9.635  -2.505  1.00 0.00 ? 27 VAL A HA   8  
ATOM   6765  H HB   . VAL A 1 27 ? 11.360  -8.960  -1.458  1.00 0.00 ? 27 VAL A HB   8  
ATOM   6766  H HG11 . VAL A 1 27 ? 11.319  -11.303 -0.125  1.00 0.00 ? 27 VAL A HG11 8  
ATOM   6767  H HG12 . VAL A 1 27 ? 12.379  -11.755 -1.482  1.00 0.00 ? 27 VAL A HG12 8  
ATOM   6768  H HG21 . VAL A 1 27 ? 11.230  -9.309  -3.867  1.00 0.00 ? 27 VAL A HG21 8  
ATOM   6769  H HG22 . VAL A 1 27 ? 12.813  -9.844  -3.253  1.00 0.00 ? 27 VAL A HG22 8  
ATOM   6770  N N    . ALA A 1 28 ? 8.987   -12.465 -1.069  1.00 0.00 ? 28 ALA A N    8  
ATOM   6771  C CA   . ALA A 1 28 ? 8.643   -13.867 -1.231  1.00 0.00 ? 28 ALA A CA   8  
ATOM   6772  C C    . ALA A 1 28 ? 7.945   -14.064 -2.579  1.00 0.00 ? 28 ALA A C    8  
ATOM   6773  O O    . ALA A 1 28 ? 8.227   -15.025 -3.293  1.00 0.00 ? 28 ALA A O    8  
ATOM   6774  C CB   . ALA A 1 28 ? 7.776   -14.320 -0.054  1.00 0.00 ? 28 ALA A CB   8  
ATOM   6775  H H    . ALA A 1 28 ? 8.901   -12.114 -0.137  1.00 0.00 ? 28 ALA A H    8  
ATOM   6776  H HA   . ALA A 1 28 ? 9.570   -14.440 -1.225  1.00 0.00 ? 28 ALA A HA   8  
ATOM   6777  H HB1  . ALA A 1 28 ? 7.433   -15.340 -0.227  1.00 0.00 ? 28 ALA A HB1  8  
ATOM   6778  H HB2  . ALA A 1 28 ? 8.362   -14.283 0.864   1.00 0.00 ? 28 ALA A HB2  8  
ATOM   6779  N N    . ALA A 1 29 ? 7.048   -13.138 -2.885  1.00 0.00 ? 29 ALA A N    8  
ATOM   6780  C CA   . ALA A 1 29 ? 6.308   -13.198 -4.134  1.00 0.00 ? 29 ALA A CA   8  
ATOM   6781  C C    . ALA A 1 29 ? 5.796   -11.800 -4.486  1.00 0.00 ? 29 ALA A C    8  
ATOM   6782  O O    . ALA A 1 29 ? 5.507   -10.999 -3.598  1.00 0.00 ? 29 ALA A O    8  
ATOM   6783  C CB   . ALA A 1 29 ? 5.175   -14.219 -4.008  1.00 0.00 ? 29 ALA A CB   8  
ATOM   6784  H H    . ALA A 1 29 ? 6.824   -12.360 -2.298  1.00 0.00 ? 29 ALA A H    8  
ATOM   6785  H HA   . ALA A 1 29 ? 6.995   -13.530 -4.912  1.00 0.00 ? 29 ALA A HA   8  
ATOM   6786  H HB1  . ALA A 1 29 ? 4.644   -14.291 -4.957  1.00 0.00 ? 29 ALA A HB1  8  
ATOM   6787  H HB2  . ALA A 1 29 ? 5.591   -15.193 -3.750  1.00 0.00 ? 29 ALA A HB2  8  
ATOM   6788  N N    . PRO A 1 30 ? 5.697   -11.542 -5.817  1.00 0.00 ? 30 PRO A N    8  
ATOM   6789  C CA   . PRO A 1 30 ? 5.225   -10.254 -6.297  1.00 0.00 ? 30 PRO A CA   8  
ATOM   6790  C C    . PRO A 1 30 ? 3.710   -10.126 -6.125  1.00 0.00 ? 30 PRO A C    8  
ATOM   6791  O O    . PRO A 1 30 ? 3.124   -9.106  -6.484  1.00 0.00 ? 30 PRO A O    8  
ATOM   6792  C CB   . PRO A 1 30 ? 5.664   -10.191 -7.751  1.00 0.00 ? 30 PRO A CB   8  
ATOM   6793  C CG   . PRO A 1 30 ? 5.954   -11.626 -8.162  1.00 0.00 ? 30 PRO A CG   8  
ATOM   6794  C CD   . PRO A 1 30 ? 6.030   -12.466 -6.897  1.00 0.00 ? 30 PRO A CD   8  
ATOM   6795  H HA   . PRO A 1 30 ? 5.625   -9.514  -5.757  1.00 0.00 ? 30 PRO A HA   8  
ATOM   6796  H HB2  . PRO A 1 30 ? 4.885   -9.756  -8.376  1.00 0.00 ? 30 PRO A HB2  8  
ATOM   6797  H HB3  . PRO A 1 30 ? 6.550   -9.566  -7.865  1.00 0.00 ? 30 PRO A HB3  8  
ATOM   6798  H HG2  . PRO A 1 30 ? 5.171   -11.999 -8.822  1.00 0.00 ? 30 PRO A HG2  8  
ATOM   6799  H HG3  . PRO A 1 30 ? 6.891   -11.682 -8.715  1.00 0.00 ? 30 PRO A HG3  8  
ATOM   6800  H HD2  . PRO A 1 30 ? 5.330   -13.301 -6.934  1.00 0.00 ? 30 PRO A HD2  8  
ATOM   6801  H HD3  . PRO A 1 30 ? 7.025   -12.890 -6.763  1.00 0.00 ? 30 PRO A HD3  8  
ATOM   6802  N N    . HIS A 1 31 ? 3.118   -11.177 -5.575  1.00 0.00 ? 31 HIS A N    8  
ATOM   6803  C CA   . HIS A 1 31 ? 1.683   -11.195 -5.351  1.00 0.00 ? 31 HIS A CA   8  
ATOM   6804  C C    . HIS A 1 31 ? 1.375   -11.963 -4.064  1.00 0.00 ? 31 HIS A C    8  
ATOM   6805  O O    . HIS A 1 31 ? 0.715   -13.000 -4.098  1.00 0.00 ? 31 HIS A O    8  
ATOM   6806  C CB   . HIS A 1 31 ? 0.949   -11.760 -6.568  1.00 0.00 ? 31 HIS A CB   8  
ATOM   6807  C CG   . HIS A 1 31 ? -0.462  -11.248 -6.728  1.00 0.00 ? 31 HIS A CG   8  
ATOM   6808  N ND1  . HIS A 1 31 ? -0.749  -9.953  -7.123  1.00 0.00 ? 31 HIS A ND1  8  
ATOM   6809  C CD2  . HIS A 1 31 ? -1.662  -11.869 -6.542  1.00 0.00 ? 31 HIS A CD2  8  
ATOM   6810  C CE1  . HIS A 1 31 ? -2.066  -9.812  -7.169  1.00 0.00 ? 31 HIS A CE1  8  
ATOM   6811  N NE2  . HIS A 1 31 ? -2.630  -11.001 -6.808  1.00 0.00 ? 31 HIS A NE2  8  
ATOM   6812  H H    . HIS A 1 31 ? 3.602   -12.003 -5.286  1.00 0.00 ? 31 HIS A H    8  
ATOM   6813  H HA   . HIS A 1 31 ? 1.372   -10.157 -5.228  1.00 0.00 ? 31 HIS A HA   8  
ATOM   6814  H HB2  . HIS A 1 31 ? 1.517   -11.517 -7.467  1.00 0.00 ? 31 HIS A HB2  8  
ATOM   6815  H HB3  . HIS A 1 31 ? 0.924   -12.847 -6.492  1.00 0.00 ? 31 HIS A HB3  8  
ATOM   6816  H HD1  . HIS A 1 31 ? -0.077  -9.244  -7.338  1.00 0.00 ? 31 HIS A HD1  8  
ATOM   6817  H HD2  . HIS A 1 31 ? -1.802  -12.904 -6.229  1.00 0.00 ? 31 HIS A HD2  8  
ATOM   6818  H HE1  . HIS A 1 31 ? -2.604  -8.906  -7.447  1.00 0.00 ? 31 HIS A HE1  8  
ATOM   6819  N N    . VAL A 1 32 ? 1.866   -11.423 -2.958  1.00 0.00 ? 32 VAL A N    8  
ATOM   6820  C CA   . VAL A 1 32 ? 1.652   -12.044 -1.662  1.00 0.00 ? 32 VAL A CA   8  
ATOM   6821  C C    . VAL A 1 32 ? 1.829   -10.995 -0.563  1.00 0.00 ? 32 VAL A C    8  
ATOM   6822  O O    . VAL A 1 32 ? 2.889   -10.911 0.055   1.00 0.00 ? 32 VAL A O    8  
ATOM   6823  C CB   . VAL A 1 32 ? 2.584   -13.246 -1.497  1.00 0.00 ? 32 VAL A CB   8  
ATOM   6824  C CG1  . VAL A 1 32 ? 2.579   -13.749 -0.052  1.00 0.00 ? 32 VAL A CG1  8  
ATOM   6825  C CG2  . VAL A 1 32 ? 2.209   -14.367 -2.469  1.00 0.00 ? 32 VAL A CG2  8  
ATOM   6826  H H    . VAL A 1 32 ? 2.402   -10.579 -2.938  1.00 0.00 ? 32 VAL A H    8  
ATOM   6827  H HA   . VAL A 1 32 ? 0.624   -12.407 -1.638  1.00 0.00 ? 32 VAL A HA   8  
ATOM   6828  H HB   . VAL A 1 32 ? 3.596   -12.921 -1.736  1.00 0.00 ? 32 VAL A HB   8  
ATOM   6829  H HG11 . VAL A 1 32 ? 3.082   -14.715 -0.002  1.00 0.00 ? 32 VAL A HG11 8  
ATOM   6830  H HG12 . VAL A 1 32 ? 3.102   -13.034 0.583   1.00 0.00 ? 32 VAL A HG12 8  
ATOM   6831  H HG21 . VAL A 1 32 ? 2.515   -14.091 -3.478  1.00 0.00 ? 32 VAL A HG21 8  
ATOM   6832  H HG22 . VAL A 1 32 ? 2.716   -15.287 -2.175  1.00 0.00 ? 32 VAL A HG22 8  
ATOM   6833  N N    . PRO A 1 33 ? 0.747   -10.201 -0.346  1.00 0.00 ? 33 PRO A N    8  
ATOM   6834  C CA   . PRO A 1 33 ? 0.773   -9.160  0.668   1.00 0.00 ? 33 PRO A CA   8  
ATOM   6835  C C    . PRO A 1 33 ? 0.657   -9.759  2.071   1.00 0.00 ? 33 PRO A C    8  
ATOM   6836  O O    . PRO A 1 33 ? 0.129   -10.858 2.239   1.00 0.00 ? 33 PRO A O    8  
ATOM   6837  C CB   . PRO A 1 33 ? -0.385  -8.240  0.318   1.00 0.00 ? 33 PRO A CB   8  
ATOM   6838  C CG   . PRO A 1 33 ? -1.296  -9.045  -0.595  1.00 0.00 ? 33 PRO A CG   8  
ATOM   6839  C CD   . PRO A 1 33 ? -0.526  -10.271 -1.058  1.00 0.00 ? 33 PRO A CD   8  
ATOM   6840  H HA   . PRO A 1 33 ? 1.648   -8.678  0.648   1.00 0.00 ? 33 PRO A HA   8  
ATOM   6841  H HB2  . PRO A 1 33 ? -0.915  -7.921  1.215   1.00 0.00 ? 33 PRO A HB2  8  
ATOM   6842  H HB3  . PRO A 1 33 ? -0.031  -7.338  -0.181  1.00 0.00 ? 33 PRO A HB3  8  
ATOM   6843  H HG2  . PRO A 1 33 ? -2.202  -9.341  -0.066  1.00 0.00 ? 33 PRO A HG2  8  
ATOM   6844  H HG3  . PRO A 1 33 ? -1.607  -8.445  -1.450  1.00 0.00 ? 33 PRO A HG3  8  
ATOM   6845  H HD2  . PRO A 1 33 ? -1.062  -11.190 -0.820  1.00 0.00 ? 33 PRO A HD2  8  
ATOM   6846  H HD3  . PRO A 1 33 ? -0.377  -10.261 -2.138  1.00 0.00 ? 33 PRO A HD3  8  
ATOM   6847  N N    . VAL A 1 34 ? 1.159   -9.011  3.042   1.00 0.00 ? 34 VAL A N    8  
ATOM   6848  C CA   . VAL A 1 34 ? 1.119   -9.455  4.425   1.00 0.00 ? 34 VAL A CA   8  
ATOM   6849  C C    . VAL A 1 34 ? 0.178   -8.548  5.220   1.00 0.00 ? 34 VAL A C    8  
ATOM   6850  O O    . VAL A 1 34 ? -0.478  -8.997  6.159   1.00 0.00 ? 34 VAL A O    8  
ATOM   6851  C CB   . VAL A 1 34 ? 2.535   -9.499  5.002   1.00 0.00 ? 34 VAL A CB   8  
ATOM   6852  C CG1  . VAL A 1 34 ? 3.096   -8.087  5.186   1.00 0.00 ? 34 VAL A CG1  8  
ATOM   6853  C CG2  . VAL A 1 34 ? 2.567   -10.278 6.319   1.00 0.00 ? 34 VAL A CG2  8  
ATOM   6854  H H    . VAL A 1 34 ? 1.587   -8.119  2.897   1.00 0.00 ? 34 VAL A H    8  
ATOM   6855  H HA   . VAL A 1 34 ? 0.719   -10.469 4.434   1.00 0.00 ? 34 VAL A HA   8  
ATOM   6856  H HB   . VAL A 1 34 ? 3.172   -10.022 4.289   1.00 0.00 ? 34 VAL A HB   8  
ATOM   6857  H HG11 . VAL A 1 34 ? 2.449   -7.370  4.682   1.00 0.00 ? 34 VAL A HG11 8  
ATOM   6858  H HG12 . VAL A 1 34 ? 3.143   -7.850  6.249   1.00 0.00 ? 34 VAL A HG12 8  
ATOM   6859  H HG21 . VAL A 1 34 ? 1.978   -9.748  7.068   1.00 0.00 ? 34 VAL A HG21 8  
ATOM   6860  H HG22 . VAL A 1 34 ? 2.148   -11.272 6.163   1.00 0.00 ? 34 VAL A HG22 8  
ATOM   6861  N N    . LYS A 1 35 ? 0.140   -7.287  4.815   1.00 0.00 ? 35 LYS A N    8  
ATOM   6862  C CA   . LYS A 1 35 ? -0.710  -6.312  5.477   1.00 0.00 ? 35 LYS A CA   8  
ATOM   6863  C C    . LYS A 1 35 ? -0.951  -5.130  4.537   1.00 0.00 ? 35 LYS A C    8  
ATOM   6864  O O    . LYS A 1 35 ? -0.194  -4.919  3.591   1.00 0.00 ? 35 LYS A O    8  
ATOM   6865  C CB   . LYS A 1 35 ? -0.114  -5.912  6.828   1.00 0.00 ? 35 LYS A CB   8  
ATOM   6866  C CG   . LYS A 1 35 ? 1.155   -5.077  6.642   1.00 0.00 ? 35 LYS A CG   8  
ATOM   6867  C CD   . LYS A 1 35 ? 1.778   -4.718  7.993   1.00 0.00 ? 35 LYS A CD   8  
ATOM   6868  C CE   . LYS A 1 35 ? 2.959   -5.637  8.313   1.00 0.00 ? 35 LYS A CE   8  
ATOM   6869  N NZ   . LYS A 1 35 ? 2.628   -6.531  9.445   1.00 0.00 ? 35 LYS A NZ   8  
ATOM   6870  H H    . LYS A 1 35 ? 0.676   -6.929  4.050   1.00 0.00 ? 35 LYS A H    8  
ATOM   6871  H HA   . LYS A 1 35 ? -1.666  -6.795  5.677   1.00 0.00 ? 35 LYS A HA   8  
ATOM   6872  H HB2  . LYS A 1 35 ? -0.847  -5.343  7.400   1.00 0.00 ? 35 LYS A HB2  8  
ATOM   6873  H HB3  . LYS A 1 35 ? 0.117   -6.806  7.407   1.00 0.00 ? 35 LYS A HB3  8  
ATOM   6874  H HG2  . LYS A 1 35 ? 1.875   -5.632  6.041   1.00 0.00 ? 35 LYS A HG2  8  
ATOM   6875  H HG3  . LYS A 1 35 ? 0.917   -4.165  6.094   1.00 0.00 ? 35 LYS A HG3  8  
ATOM   6876  H HD2  . LYS A 1 35 ? 2.113   -3.681  7.979   1.00 0.00 ? 35 LYS A HD2  8  
ATOM   6877  H HD3  . LYS A 1 35 ? 1.026   -4.800  8.778   1.00 0.00 ? 35 LYS A HD3  8  
ATOM   6878  H HE2  . LYS A 1 35 ? 3.213   -6.231  7.435   1.00 0.00 ? 35 LYS A HE2  8  
ATOM   6879  H HE3  . LYS A 1 35 ? 3.836   -5.039  8.559   1.00 0.00 ? 35 LYS A HE3  8  
ATOM   6880  H HZ1  . LYS A 1 35 ? 3.383   -7.168  9.598   1.00 0.00 ? 35 LYS A HZ1  8  
ATOM   6881  H HZ2  . LYS A 1 35 ? 2.481   -5.984  10.269  1.00 0.00 ? 35 LYS A HZ2  8  
ATOM   6882  N N    . ARG A 1 36 ? -2.009  -4.361  4.803   1.00 0.00 ? 36 ARG A N    8  
ATOM   6883  C CA   . ARG A 1 36 ? -2.346  -3.212  3.986   1.00 0.00 ? 36 ARG A CA   8  
ATOM   6884  C C    . ARG A 1 36 ? -2.976  -2.131  4.852   1.00 0.00 ? 36 ARG A C    8  
ATOM   6885  O O    . ARG A 1 36 ? -3.318  -2.378  6.006   1.00 0.00 ? 36 ARG A O    8  
ATOM   6886  C CB   . ARG A 1 36 ? -3.301  -3.641  2.876   1.00 0.00 ? 36 ARG A CB   8  
ATOM   6887  C CG   . ARG A 1 36 ? -2.600  -4.637  1.957   1.00 0.00 ? 36 ARG A CG   8  
ATOM   6888  C CD   . ARG A 1 36 ? -2.977  -6.058  2.365   1.00 0.00 ? 36 ARG A CD   8  
ATOM   6889  N NE   . ARG A 1 36 ? -4.060  -6.574  1.527   1.00 0.00 ? 36 ARG A NE   8  
ATOM   6890  C CZ   . ARG A 1 36 ? -4.328  -7.882  1.412   1.00 0.00 ? 36 ARG A CZ   8  
ATOM   6891  N NH1  . ARG A 1 36 ? -3.590  -8.779  2.081   1.00 0.00 ? 36 ARG A NH1  8  
ATOM   6892  N NH2  . ARG A 1 36 ? -5.334  -8.294  0.628   1.00 0.00 ? 36 ARG A NH2  8  
ATOM   6893  H H    . ARG A 1 36 ? -2.600  -4.578  5.593   1.00 0.00 ? 36 ARG A H    8  
ATOM   6894  H HA   . ARG A 1 36 ? -1.434  -2.819  3.536   1.00 0.00 ? 36 ARG A HA   8  
ATOM   6895  H HB2  . ARG A 1 36 ? -4.182  -4.109  3.316   1.00 0.00 ? 36 ARG A HB2  8  
ATOM   6896  H HB3  . ARG A 1 36 ? -3.604  -2.766  2.300   1.00 0.00 ? 36 ARG A HB3  8  
ATOM   6897  H HG2  . ARG A 1 36 ? -2.909  -4.460  0.927   1.00 0.00 ? 36 ARG A HG2  8  
ATOM   6898  H HG3  . ARG A 1 36 ? -1.520  -4.509  2.040   1.00 0.00 ? 36 ARG A HG3  8  
ATOM   6899  H HD2  . ARG A 1 36 ? -2.105  -6.704  2.259   1.00 0.00 ? 36 ARG A HD2  8  
ATOM   6900  H HD3  . ARG A 1 36 ? -3.299  -6.058  3.406   1.00 0.00 ? 36 ARG A HD3  8  
ATOM   6901  H HE   . ARG A 1 36 ? -4.622  -5.906  1.020   1.00 0.00 ? 36 ARG A HE   8  
ATOM   6902  H HH11 . ARG A 1 36 ? -2.833  -8.469  2.673   1.00 0.00 ? 36 ARG A HH11 8  
ATOM   6903  H HH12 . ARG A 1 36 ? -3.792  -9.765  1.994   1.00 0.00 ? 36 ARG A HH12 8  
ATOM   6904  H HH21 . ARG A 1 36 ? -5.890  -7.618  0.124   1.00 0.00 ? 36 ARG A HH21 8  
ATOM   6905  H HH22 . ARG A 1 36 ? -5.535  -9.280  0.541   1.00 0.00 ? 36 ARG A HH22 8  
ATOM   6906  N N    . GLY A 1 37 ? -3.113  -0.951  4.264   1.00 0.00 ? 37 GLY A N    8  
ATOM   6907  C CA   . GLY A 1 37 ? -3.699  0.174   4.973   1.00 0.00 ? 37 GLY A CA   8  
ATOM   6908  C C    . GLY A 1 37 ? -3.590  1.459   4.149   1.00 0.00 ? 37 GLY A C    8  
ATOM   6909  O O    . GLY A 1 37 ? -3.056  1.446   3.041   1.00 0.00 ? 37 GLY A O    8  
ATOM   6910  H H    . GLY A 1 37 ? -2.831  -0.758  3.324   1.00 0.00 ? 37 GLY A H    8  
ATOM   6911  H HA2  . GLY A 1 37 ? -4.747  -0.035  5.190   1.00 0.00 ? 37 GLY A HA2  8  
ATOM   6912  H HA3  . GLY A 1 37 ? -3.196  0.308   5.931   1.00 0.00 ? 37 GLY A HA3  8  
ATOM   6913  N N    . CYS A 1 38 ? -4.103  2.537   4.723   1.00 0.00 ? 38 CYS A N    8  
ATOM   6914  C CA   . CYS A 1 38 ? -4.070  3.827   4.055   1.00 0.00 ? 38 CYS A CA   8  
ATOM   6915  C C    . CYS A 1 38 ? -2.963  4.669   4.693   1.00 0.00 ? 38 CYS A C    8  
ATOM   6916  O O    . CYS A 1 38 ? -2.551  4.407   5.822   1.00 0.00 ? 38 CYS A O    8  
ATOM   6917  C CB   . CYS A 1 38 ? -5.427  4.530   4.115   1.00 0.00 ? 38 CYS A CB   8  
ATOM   6918  S SG   . CYS A 1 38 ? -6.807  3.601   3.353   1.00 0.00 ? 38 CYS A SG   8  
ATOM   6919  H H    . CYS A 1 38 ? -4.536  2.539   5.624   1.00 0.00 ? 38 CYS A H    8  
ATOM   6920  H HA   . CYS A 1 38 ? -3.851  3.631   3.006   1.00 0.00 ? 38 CYS A HA   8  
ATOM   6921  H HB2  . CYS A 1 38 ? -5.673  4.728   5.158   1.00 0.00 ? 38 CYS A HB2  8  
ATOM   6922  H HB3  . CYS A 1 38 ? -5.342  5.497   3.619   1.00 0.00 ? 38 CYS A HB3  8  
ATOM   6923  N N    . ILE A 1 39 ? -2.512  5.663   3.942   1.00 0.00 ? 39 ILE A N    8  
ATOM   6924  C CA   . ILE A 1 39 ? -1.461  6.545   4.419   1.00 0.00 ? 39 ILE A CA   8  
ATOM   6925  C C    . ILE A 1 39 ? -1.398  7.786   3.527   1.00 0.00 ? 39 ILE A C    8  
ATOM   6926  O O    . ILE A 1 39 ? -2.207  7.940   2.614   1.00 0.00 ? 39 ILE A O    8  
ATOM   6927  C CB   . ILE A 1 39 ? -0.133  5.791   4.518   1.00 0.00 ? 39 ILE A CB   8  
ATOM   6928  C CG1  . ILE A 1 39 ? 0.713   6.320   5.678   1.00 0.00 ? 39 ILE A CG1  8  
ATOM   6929  C CG2  . ILE A 1 39 ? 0.624   5.837   3.189   1.00 0.00 ? 39 ILE A CG2  8  
ATOM   6930  C CD1  . ILE A 1 39 ? 1.342   5.170   6.467   1.00 0.00 ? 39 ILE A CD1  8  
ATOM   6931  H H    . ILE A 1 39 ? -2.852  5.869   3.024   1.00 0.00 ? 39 ILE A H    8  
ATOM   6932  H HA   . ILE A 1 39 ? -1.730  6.857   5.428   1.00 0.00 ? 39 ILE A HA   8  
ATOM   6933  H HB   . ILE A 1 39 ? -0.349  4.744   4.729   1.00 0.00 ? 39 ILE A HB   8  
ATOM   6934  H HG12 . ILE A 1 39 ? 1.496   6.973   5.294   1.00 0.00 ? 39 ILE A HG12 8  
ATOM   6935  H HG13 . ILE A 1 39 ? 0.092   6.923   6.341   1.00 0.00 ? 39 ILE A HG13 8  
ATOM   6936  H HG21 . ILE A 1 39 ? 1.604   5.375   3.313   1.00 0.00 ? 39 ILE A HG21 8  
ATOM   6937  H HG22 . ILE A 1 39 ? 0.060   5.295   2.430   1.00 0.00 ? 39 ILE A HG22 8  
ATOM   6938  H HD11 . ILE A 1 39 ? 2.015   5.573   7.223   1.00 0.00 ? 39 ILE A HD11 8  
ATOM   6939  H HD12 . ILE A 1 39 ? 0.557   4.589   6.952   1.00 0.00 ? 39 ILE A HD12 8  
ATOM   6940  N N    . ASP A 1 40 ? -0.434  8.668   3.797   1.00 0.00 ? 40 ASP A N    8  
ATOM   6941  C CA   . ASP A 1 40 ? -0.271  9.884   3.025   1.00 0.00 ? 40 ASP A CA   8  
ATOM   6942  C C    . ASP A 1 40 ? 0.969   9.776   2.149   1.00 0.00 ? 40 ASP A C    8  
ATOM   6943  O O    . ASP A 1 40 ? 0.918   10.076  0.959   1.00 0.00 ? 40 ASP A O    8  
ATOM   6944  C CB   . ASP A 1 40 ? -0.162  11.076  3.971   1.00 0.00 ? 40 ASP A CB   8  
ATOM   6945  C CG   . ASP A 1 40 ? 0.645   10.715  5.210   1.00 0.00 ? 40 ASP A CG   8  
ATOM   6946  O OD1  . ASP A 1 40 ? 1.424   9.742   5.116   1.00 0.00 ? 40 ASP A OD1  8  
ATOM   6947  O OD2  . ASP A 1 40 ? 0.468   11.418  6.228   1.00 0.00 ? 40 ASP A OD2  8  
ATOM   6948  H H    . ASP A 1 40 ? 0.206   8.494   4.559   1.00 0.00 ? 40 ASP A H    8  
ATOM   6949  H HA   . ASP A 1 40 ? -1.144  10.018  2.386   1.00 0.00 ? 40 ASP A HA   8  
ATOM   6950  H HB2  . ASP A 1 40 ? 0.326   11.901  3.454   1.00 0.00 ? 40 ASP A HB2  8  
ATOM   6951  H HB3  . ASP A 1 40 ? -1.163  11.385  4.274   1.00 0.00 ? 40 ASP A HB3  8  
ATOM   6952  H HD2  . ASP A 1 40 ? 1.005   11.141  6.974   1.00 0.00 ? 40 ASP A HD2  8  
ATOM   6953  N N    . VAL A 1 41 ? 2.058   9.344   2.770   1.00 0.00 ? 41 VAL A N    8  
ATOM   6954  C CA   . VAL A 1 41 ? 3.315   9.193   2.056   1.00 0.00 ? 41 VAL A CA   8  
ATOM   6955  C C    . VAL A 1 41 ? 3.666   7.707   1.960   1.00 0.00 ? 41 VAL A C    8  
ATOM   6956  O O    . VAL A 1 41 ? 3.274   6.916   2.817   1.00 0.00 ? 41 VAL A O    8  
ATOM   6957  C CB   . VAL A 1 41 ? 4.406   10.022  2.736   1.00 0.00 ? 41 VAL A CB   8  
ATOM   6958  C CG1  . VAL A 1 41 ? 4.777   9.429   4.097   1.00 0.00 ? 41 VAL A CG1  8  
ATOM   6959  C CG2  . VAL A 1 41 ? 5.639   10.147  1.838   1.00 0.00 ? 41 VAL A CG2  8  
ATOM   6960  H H    . VAL A 1 41 ? 2.091   9.102   3.739   1.00 0.00 ? 41 VAL A H    8  
ATOM   6961  H HA   . VAL A 1 41 ? 3.171   9.585   1.049   1.00 0.00 ? 41 VAL A HA   8  
ATOM   6962  H HB   . VAL A 1 41 ? 4.011   11.024  2.903   1.00 0.00 ? 41 VAL A HB   8  
ATOM   6963  H HG11 . VAL A 1 41 ? 5.825   9.128   4.088   1.00 0.00 ? 41 VAL A HG11 8  
ATOM   6964  H HG12 . VAL A 1 41 ? 4.621   10.178  4.873   1.00 0.00 ? 41 VAL A HG12 8  
ATOM   6965  H HG21 . VAL A 1 41 ? 5.323   10.278  0.803   1.00 0.00 ? 41 VAL A HG21 8  
ATOM   6966  H HG22 . VAL A 1 41 ? 6.229   11.009  2.149   1.00 0.00 ? 41 VAL A HG22 8  
ATOM   6967  N N    . CYS A 1 42 ? 4.400   7.372   0.909   1.00 0.00 ? 42 CYS A N    8  
ATOM   6968  C CA   . CYS A 1 42 ? 4.808   5.994   0.690   1.00 0.00 ? 42 CYS A CA   8  
ATOM   6969  C C    . CYS A 1 42 ? 6.198   5.803   1.298   1.00 0.00 ? 42 CYS A C    8  
ATOM   6970  O O    . CYS A 1 42 ? 7.067   6.662   1.154   1.00 0.00 ? 42 CYS A O    8  
ATOM   6971  C CB   . CYS A 1 42 ? 4.779   5.625   -0.795  1.00 0.00 ? 42 CYS A CB   8  
ATOM   6972  S SG   . CYS A 1 42 ? 4.404   3.868   -1.142  1.00 0.00 ? 42 CYS A SG   8  
ATOM   6973  H H    . CYS A 1 42 ? 4.714   8.021   0.216   1.00 0.00 ? 42 CYS A H    8  
ATOM   6974  H HA   . CYS A 1 42 ? 4.074   5.366   1.195   1.00 0.00 ? 42 CYS A HA   8  
ATOM   6975  H HB2  . CYS A 1 42 ? 4.035   6.246   -1.295  1.00 0.00 ? 42 CYS A HB2  8  
ATOM   6976  H HB3  . CYS A 1 42 ? 5.746   5.870   -1.235  1.00 0.00 ? 42 CYS A HB3  8  
ATOM   6977  N N    . PRO A 1 43 ? 6.371   4.640   1.983   1.00 0.00 ? 43 PRO A N    8  
ATOM   6978  C CA   . PRO A 1 43 ? 7.641   4.325   2.614   1.00 0.00 ? 43 PRO A CA   8  
ATOM   6979  C C    . PRO A 1 43 ? 8.681   3.906   1.573   1.00 0.00 ? 43 PRO A C    8  
ATOM   6980  O O    . PRO A 1 43 ? 8.333   3.564   0.444   1.00 0.00 ? 43 PRO A O    8  
ATOM   6981  C CB   . PRO A 1 43 ? 7.322   3.223   3.611   1.00 0.00 ? 43 PRO A CB   8  
ATOM   6982  C CG   . PRO A 1 43 ? 5.987   2.641   3.176   1.00 0.00 ? 43 PRO A CG   8  
ATOM   6983  C CD   . PRO A 1 43 ? 5.365   3.599   2.174   1.00 0.00 ? 43 PRO A CD   8  
ATOM   6984  H HA   . PRO A 1 43 ? 8.016   5.135   3.064   1.00 0.00 ? 43 PRO A HA   8  
ATOM   6985  H HB2  . PRO A 1 43 ? 8.100   2.459   3.611   1.00 0.00 ? 43 PRO A HB2  8  
ATOM   6986  H HB3  . PRO A 1 43 ? 7.264   3.618   4.625   1.00 0.00 ? 43 PRO A HB3  8  
ATOM   6987  H HG2  . PRO A 1 43 ? 6.127   1.657   2.728   1.00 0.00 ? 43 PRO A HG2  8  
ATOM   6988  H HG3  . PRO A 1 43 ? 5.330   2.509   4.036   1.00 0.00 ? 43 PRO A HG3  8  
ATOM   6989  H HD2  . PRO A 1 43 ? 5.134   3.096   1.235   1.00 0.00 ? 43 PRO A HD2  8  
ATOM   6990  H HD3  . PRO A 1 43 ? 4.431   4.016   2.551   1.00 0.00 ? 43 PRO A HD3  8  
ATOM   6991  N N    . LYS A 1 44 ? 9.939   3.947   1.989   1.00 0.00 ? 44 LYS A N    8  
ATOM   6992  C CA   . LYS A 1 44 ? 11.032  3.577   1.107   1.00 0.00 ? 44 LYS A CA   8  
ATOM   6993  C C    . LYS A 1 44 ? 10.930  2.087   0.774   1.00 0.00 ? 44 LYS A C    8  
ATOM   6994  O O    . LYS A 1 44 ? 10.561  1.280   1.626   1.00 0.00 ? 44 LYS A O    8  
ATOM   6995  C CB   . LYS A 1 44 ? 12.375  3.979   1.720   1.00 0.00 ? 44 LYS A CB   8  
ATOM   6996  C CG   . LYS A 1 44 ? 13.539  3.526   0.836   1.00 0.00 ? 44 LYS A CG   8  
ATOM   6997  C CD   . LYS A 1 44 ? 14.514  4.677   0.580   1.00 0.00 ? 44 LYS A CD   8  
ATOM   6998  C CE   . LYS A 1 44 ? 14.221  5.357   -0.759  1.00 0.00 ? 44 LYS A CE   8  
ATOM   6999  N NZ   . LYS A 1 44 ? 15.478  5.813   -1.394  1.00 0.00 ? 44 LYS A NZ   8  
ATOM   7000  H H    . LYS A 1 44 ? 10.214  4.227   2.909   1.00 0.00 ? 44 LYS A H    8  
ATOM   7001  H HA   . LYS A 1 44 ? 10.915  4.146   0.185   1.00 0.00 ? 44 LYS A HA   8  
ATOM   7002  H HB2  . LYS A 1 44 ? 12.411  5.061   1.848   1.00 0.00 ? 44 LYS A HB2  8  
ATOM   7003  H HB3  . LYS A 1 44 ? 12.473  3.538   2.711   1.00 0.00 ? 44 LYS A HB3  8  
ATOM   7004  H HG2  . LYS A 1 44 ? 14.064  2.700   1.315   1.00 0.00 ? 44 LYS A HG2  8  
ATOM   7005  H HG3  . LYS A 1 44 ? 13.155  3.152   -0.113  1.00 0.00 ? 44 LYS A HG3  8  
ATOM   7006  H HD2  . LYS A 1 44 ? 14.439  5.408   1.386   1.00 0.00 ? 44 LYS A HD2  8  
ATOM   7007  H HD3  . LYS A 1 44 ? 15.536  4.301   0.586   1.00 0.00 ? 44 LYS A HD3  8  
ATOM   7008  H HE2  . LYS A 1 44 ? 13.704  4.662   -1.421  1.00 0.00 ? 44 LYS A HE2  8  
ATOM   7009  H HE3  . LYS A 1 44 ? 13.555  6.206   -0.605  1.00 0.00 ? 44 LYS A HE3  8  
ATOM   7010  H HZ1  . LYS A 1 44 ? 15.359  5.840   -2.387  1.00 0.00 ? 44 LYS A HZ1  8  
ATOM   7011  H HZ2  . LYS A 1 44 ? 15.707  6.727   -1.061  1.00 0.00 ? 44 LYS A HZ2  8  
ATOM   7012  N N    . SER A 1 45 ? 11.264  1.767   -0.468  1.00 0.00 ? 45 SER A N    8  
ATOM   7013  C CA   . SER A 1 45 ? 11.215  0.388   -0.924  1.00 0.00 ? 45 SER A CA   8  
ATOM   7014  C C    . SER A 1 45 ? 12.595  -0.259  -0.784  1.00 0.00 ? 45 SER A C    8  
ATOM   7015  O O    . SER A 1 45 ? 13.588  0.278   -1.272  1.00 0.00 ? 45 SER A O    8  
ATOM   7016  C CB   . SER A 1 45 ? 10.734  0.304   -2.374  1.00 0.00 ? 45 SER A CB   8  
ATOM   7017  O OG   . SER A 1 45 ? 9.323   0.120   -2.458  1.00 0.00 ? 45 SER A OG   8  
ATOM   7018  H H    . SER A 1 45 ? 11.564  2.429   -1.155  1.00 0.00 ? 45 SER A H    8  
ATOM   7019  H HA   . SER A 1 45 ? 10.493  -0.106  -0.273  1.00 0.00 ? 45 SER A HA   8  
ATOM   7020  H HB2  . SER A 1 45 ? 11.012  1.217   -2.901  1.00 0.00 ? 45 SER A HB2  8  
ATOM   7021  H HB3  . SER A 1 45 ? 11.238  -0.521  -2.876  1.00 0.00 ? 45 SER A HB3  8  
ATOM   7022  H HG   . SER A 1 45 ? 9.042   0.069   -3.416  1.00 0.00 ? 45 SER A HG   8  
ATOM   7023  N N    . SER A 1 46 ? 12.612  -1.403  -0.117  1.00 0.00 ? 46 SER A N    8  
ATOM   7024  C CA   . SER A 1 46 ? 13.853  -2.129  0.093   1.00 0.00 ? 46 SER A CA   8  
ATOM   7025  C C    . SER A 1 46 ? 13.832  -3.440  -0.696  1.00 0.00 ? 46 SER A C    8  
ATOM   7026  O O    . SER A 1 46 ? 12.817  -3.793  -1.294  1.00 0.00 ? 46 SER A O    8  
ATOM   7027  C CB   . SER A 1 46 ? 14.084  -2.408  1.579   1.00 0.00 ? 46 SER A CB   8  
ATOM   7028  O OG   . SER A 1 46 ? 13.323  -3.522  2.038   1.00 0.00 ? 46 SER A OG   8  
ATOM   7029  H H    . SER A 1 46 ? 11.799  -1.834  0.276   1.00 0.00 ? 46 SER A H    8  
ATOM   7030  H HA   . SER A 1 46 ? 14.638  -1.471  -0.279  1.00 0.00 ? 46 SER A HA   8  
ATOM   7031  H HB2  . SER A 1 46 ? 15.143  -2.596  1.752   1.00 0.00 ? 46 SER A HB2  8  
ATOM   7032  H HB3  . SER A 1 46 ? 13.818  -1.524  2.159   1.00 0.00 ? 46 SER A HB3  8  
ATOM   7033  H HG   . SER A 1 46 ? 12.584  -3.720  1.394   1.00 0.00 ? 46 SER A HG   8  
ATOM   7034  N N    . LEU A 1 47 ? 14.966  -4.126  -0.673  1.00 0.00 ? 47 LEU A N    8  
ATOM   7035  C CA   . LEU A 1 47 ? 15.090  -5.390  -1.378  1.00 0.00 ? 47 LEU A CA   8  
ATOM   7036  C C    . LEU A 1 47 ? 14.271  -6.458  -0.651  1.00 0.00 ? 47 LEU A C    8  
ATOM   7037  O O    . LEU A 1 47 ? 13.370  -7.059  -1.235  1.00 0.00 ? 47 LEU A O    8  
ATOM   7038  C CB   . LEU A 1 47 ? 16.564  -5.761  -1.556  1.00 0.00 ? 47 LEU A CB   8  
ATOM   7039  C CG   . LEU A 1 47 ? 17.275  -5.127  -2.754  1.00 0.00 ? 47 LEU A CG   8  
ATOM   7040  C CD1  . LEU A 1 47 ? 18.778  -5.413  -2.713  1.00 0.00 ? 47 LEU A CD1  8  
ATOM   7041  C CD2  . LEU A 1 47 ? 16.641  -5.580  -4.071  1.00 0.00 ? 47 LEU A CD2  8  
ATOM   7042  H H    . LEU A 1 47 ? 15.787  -3.831  -0.184  1.00 0.00 ? 47 LEU A H    8  
ATOM   7043  H HA   . LEU A 1 47 ? 14.670  -5.251  -2.374  1.00 0.00 ? 47 LEU A HA   8  
ATOM   7044  H HB2  . LEU A 1 47 ? 17.101  -5.480  -0.650  1.00 0.00 ? 47 LEU A HB2  8  
ATOM   7045  H HB3  . LEU A 1 47 ? 16.637  -6.844  -1.647  1.00 0.00 ? 47 LEU A HB3  8  
ATOM   7046  H HG   . LEU A 1 47 ? 17.151  -4.046  -2.692  1.00 0.00 ? 47 LEU A HG   8  
ATOM   7047  H HD11 . LEU A 1 47 ? 18.964  -6.431  -3.055  1.00 0.00 ? 47 LEU A HD11 8  
ATOM   7048  H HD12 . LEU A 1 47 ? 19.299  -4.710  -3.363  1.00 0.00 ? 47 LEU A HD12 8  
ATOM   7049  H HD21 . LEU A 1 47 ? 15.635  -5.169  -4.150  1.00 0.00 ? 47 LEU A HD21 8  
ATOM   7050  H HD22 . LEU A 1 47 ? 17.245  -5.226  -4.906  1.00 0.00 ? 47 LEU A HD22 8  
ATOM   7051  N N    . LEU A 1 48 ? 14.612  -6.661  0.613   1.00 0.00 ? 48 LEU A N    8  
ATOM   7052  C CA   . LEU A 1 48 ? 13.919  -7.646  1.426   1.00 0.00 ? 48 LEU A CA   8  
ATOM   7053  C C    . LEU A 1 48 ? 12.410  -7.502  1.219   1.00 0.00 ? 48 LEU A C    8  
ATOM   7054  O O    . LEU A 1 48 ? 11.754  -8.425  0.740   1.00 0.00 ? 48 LEU A O    8  
ATOM   7055  C CB   . LEU A 1 48 ? 14.353  -7.535  2.889   1.00 0.00 ? 48 LEU A CB   8  
ATOM   7056  C CG   . LEU A 1 48 ? 14.014  -8.730  3.782   1.00 0.00 ? 48 LEU A CG   8  
ATOM   7057  C CD1  . LEU A 1 48 ? 14.731  -9.993  3.303   1.00 0.00 ? 48 LEU A CD1  8  
ATOM   7058  C CD2  . LEU A 1 48 ? 14.317  -8.421  5.249   1.00 0.00 ? 48 LEU A CD2  8  
ATOM   7059  H H    . LEU A 1 48 ? 15.346  -6.168  1.080   1.00 0.00 ? 48 LEU A H    8  
ATOM   7060  H HA   . LEU A 1 48 ? 14.223  -8.632  1.074   1.00 0.00 ? 48 LEU A HA   8  
ATOM   7061  H HB2  . LEU A 1 48 ? 15.432  -7.380  2.916   1.00 0.00 ? 48 LEU A HB2  8  
ATOM   7062  H HB3  . LEU A 1 48 ? 13.893  -6.644  3.316   1.00 0.00 ? 48 LEU A HB3  8  
ATOM   7063  H HG   . LEU A 1 48 ? 12.944  -8.919  3.707   1.00 0.00 ? 48 LEU A HG   8  
ATOM   7064  H HD11 . LEU A 1 48 ? 13.998  -10.704 2.922   1.00 0.00 ? 48 LEU A HD11 8  
ATOM   7065  H HD12 . LEU A 1 48 ? 15.433  -9.734  2.509   1.00 0.00 ? 48 LEU A HD12 8  
ATOM   7066  H HD21 . LEU A 1 48 ? 13.470  -8.719  5.866   1.00 0.00 ? 48 LEU A HD21 8  
ATOM   7067  H HD22 . LEU A 1 48 ? 15.205  -8.971  5.561   1.00 0.00 ? 48 LEU A HD22 8  
ATOM   7068  N N    . VAL A 1 49 ? 11.904  -6.335  1.590   1.00 0.00 ? 49 VAL A N    8  
ATOM   7069  C CA   . VAL A 1 49 ? 10.484  -6.057  1.451   1.00 0.00 ? 49 VAL A CA   8  
ATOM   7070  C C    . VAL A 1 49 ? 10.293  -4.854  0.525   1.00 0.00 ? 49 VAL A C    8  
ATOM   7071  O O    . VAL A 1 49 ? 11.164  -3.991  0.435   1.00 0.00 ? 49 VAL A O    8  
ATOM   7072  C CB   . VAL A 1 49 ? 9.853   -5.856  2.831   1.00 0.00 ? 49 VAL A CB   8  
ATOM   7073  C CG1  . VAL A 1 49 ? 10.053  -7.092  3.710   1.00 0.00 ? 49 VAL A CG1  8  
ATOM   7074  C CG2  . VAL A 1 49 ? 10.409  -4.604  3.511   1.00 0.00 ? 49 VAL A CG2  8  
ATOM   7075  H H    . VAL A 1 49 ? 12.444  -5.589  1.979   1.00 0.00 ? 49 VAL A H    8  
ATOM   7076  H HA   . VAL A 1 49 ? 10.022  -6.931  0.992   1.00 0.00 ? 49 VAL A HA   8  
ATOM   7077  H HB   . VAL A 1 49 ? 8.781   -5.714  2.691   1.00 0.00 ? 49 VAL A HB   8  
ATOM   7078  H HG11 . VAL A 1 49 ? 9.737   -6.868  4.729   1.00 0.00 ? 49 VAL A HG11 8  
ATOM   7079  H HG12 . VAL A 1 49 ? 9.458   -7.917  3.318   1.00 0.00 ? 49 VAL A HG12 8  
ATOM   7080  H HG21 . VAL A 1 49 ? 10.432  -4.756  4.590   1.00 0.00 ? 49 VAL A HG21 8  
ATOM   7081  H HG22 . VAL A 1 49 ? 11.419  -4.412  3.149   1.00 0.00 ? 49 VAL A HG22 8  
ATOM   7082  N N    . LYS A 1 50 ? 9.146   -4.836  -0.139  1.00 0.00 ? 50 LYS A N    8  
ATOM   7083  C CA   . LYS A 1 50 ? 8.829   -3.754  -1.054  1.00 0.00 ? 50 LYS A CA   8  
ATOM   7084  C C    . LYS A 1 50 ? 7.409   -3.257  -0.778  1.00 0.00 ? 50 LYS A C    8  
ATOM   7085  O O    . LYS A 1 50 ? 6.564   -4.014  -0.302  1.00 0.00 ? 50 LYS A O    8  
ATOM   7086  C CB   . LYS A 1 50 ? 9.056   -4.193  -2.502  1.00 0.00 ? 50 LYS A CB   8  
ATOM   7087  C CG   . LYS A 1 50 ? 9.267   -2.984  -3.415  1.00 0.00 ? 50 LYS A CG   8  
ATOM   7088  C CD   . LYS A 1 50 ? 10.494  -3.179  -4.309  1.00 0.00 ? 50 LYS A CD   8  
ATOM   7089  C CE   . LYS A 1 50 ? 10.099  -3.786  -5.657  1.00 0.00 ? 50 LYS A CE   8  
ATOM   7090  N NZ   . LYS A 1 50 ? 11.246  -3.761  -6.592  1.00 0.00 ? 50 LYS A NZ   8  
ATOM   7091  H H    . LYS A 1 50 ? 8.443   -5.542  -0.059  1.00 0.00 ? 50 LYS A H    8  
ATOM   7092  H HA   . LYS A 1 50 ? 9.525   -2.940  -0.852  1.00 0.00 ? 50 LYS A HA   8  
ATOM   7093  H HB2  . LYS A 1 50 ? 9.924   -4.850  -2.556  1.00 0.00 ? 50 LYS A HB2  8  
ATOM   7094  H HB3  . LYS A 1 50 ? 8.198   -4.770  -2.850  1.00 0.00 ? 50 LYS A HB3  8  
ATOM   7095  H HG2  . LYS A 1 50 ? 8.383   -2.832  -4.034  1.00 0.00 ? 50 LYS A HG2  8  
ATOM   7096  H HG3  . LYS A 1 50 ? 9.392   -2.085  -2.812  1.00 0.00 ? 50 LYS A HG3  8  
ATOM   7097  H HD2  . LYS A 1 50 ? 10.989  -2.221  -4.468  1.00 0.00 ? 50 LYS A HD2  8  
ATOM   7098  H HD3  . LYS A 1 50 ? 11.212  -3.829  -3.809  1.00 0.00 ? 50 LYS A HD3  8  
ATOM   7099  H HE2  . LYS A 1 50 ? 9.760   -4.812  -5.515  1.00 0.00 ? 50 LYS A HE2  8  
ATOM   7100  H HE3  . LYS A 1 50 ? 9.264   -3.230  -6.082  1.00 0.00 ? 50 LYS A HE3  8  
ATOM   7101  H HZ1  . LYS A 1 50 ? 11.477  -2.813  -6.811  1.00 0.00 ? 50 LYS A HZ1  8  
ATOM   7102  H HZ2  . LYS A 1 50 ? 12.034  -4.206  -6.166  1.00 0.00 ? 50 LYS A HZ2  8  
ATOM   7103  N N    . TYR A 1 51 ? 7.189   -1.988  -1.088  1.00 0.00 ? 51 TYR A N    8  
ATOM   7104  C CA   . TYR A 1 51 ? 5.885   -1.381  -0.878  1.00 0.00 ? 51 TYR A CA   8  
ATOM   7105  C C    . TYR A 1 51 ? 5.381   -0.710  -2.157  1.00 0.00 ? 51 TYR A C    8  
ATOM   7106  O O    . TYR A 1 51 ? 6.175   -0.261  -2.982  1.00 0.00 ? 51 TYR A O    8  
ATOM   7107  C CB   . TYR A 1 51 ? 6.085   -0.313  0.199   1.00 0.00 ? 51 TYR A CB   8  
ATOM   7108  C CG   . TYR A 1 51 ? 6.967   -0.764  1.366   1.00 0.00 ? 51 TYR A CG   8  
ATOM   7109  C CD1  . TYR A 1 51 ? 6.774   -2.005  1.937   1.00 0.00 ? 51 TYR A CD1  8  
ATOM   7110  C CD2  . TYR A 1 51 ? 7.955   0.071   1.846   1.00 0.00 ? 51 TYR A CD2  8  
ATOM   7111  C CE1  . TYR A 1 51 ? 7.604   -2.428  3.035   1.00 0.00 ? 51 TYR A CE1  8  
ATOM   7112  C CE2  . TYR A 1 51 ? 8.785   -0.352  2.944   1.00 0.00 ? 51 TYR A CE2  8  
ATOM   7113  C CZ   . TYR A 1 51 ? 8.568   -1.581  3.484   1.00 0.00 ? 51 TYR A CZ   8  
ATOM   7114  O OH   . TYR A 1 51 ? 9.352   -1.982  4.521   1.00 0.00 ? 51 TYR A OH   8  
ATOM   7115  H H    . TYR A 1 51 ? 7.881   -1.379  -1.474  1.00 0.00 ? 51 TYR A H    8  
ATOM   7116  H HA   . TYR A 1 51 ? 5.189   -2.170  -0.592  1.00 0.00 ? 51 TYR A HA   8  
ATOM   7117  H HB2  . TYR A 1 51 ? 6.529   0.571   -0.258  1.00 0.00 ? 51 TYR A HB2  8  
ATOM   7118  H HB3  . TYR A 1 51 ? 5.111   -0.016  0.587   1.00 0.00 ? 51 TYR A HB3  8  
ATOM   7119  H HD1  . TYR A 1 51 ? 5.993   -2.664  1.558   1.00 0.00 ? 51 TYR A HD1  8  
ATOM   7120  H HD2  . TYR A 1 51 ? 8.108   1.052   1.394   1.00 0.00 ? 51 TYR A HD2  8  
ATOM   7121  H HE1  . TYR A 1 51 ? 7.462   -3.406  3.496   1.00 0.00 ? 51 TYR A HE1  8  
ATOM   7122  H HE2  . TYR A 1 51 ? 9.569   0.297   3.333   1.00 0.00 ? 51 TYR A HE2  8  
ATOM   7123  H HH   . TYR A 1 51 ? 9.186   -1.402  5.319   1.00 0.00 ? 51 TYR A HH   8  
ATOM   7124  N N    . VAL A 1 52 ? 4.063   -0.663  -2.283  1.00 0.00 ? 52 VAL A N    8  
ATOM   7125  C CA   . VAL A 1 52 ? 3.443   -0.054  -3.447  1.00 0.00 ? 52 VAL A CA   8  
ATOM   7126  C C    . VAL A 1 52 ? 2.354   0.918   -2.990  1.00 0.00 ? 52 VAL A C    8  
ATOM   7127  O O    . VAL A 1 52 ? 1.661   0.663   -2.006  1.00 0.00 ? 52 VAL A O    8  
ATOM   7128  C CB   . VAL A 1 52 ? 2.918   -1.140  -4.388  1.00 0.00 ? 52 VAL A CB   8  
ATOM   7129  C CG1  . VAL A 1 52 ? 2.162   -0.525  -5.568  1.00 0.00 ? 52 VAL A CG1  8  
ATOM   7130  C CG2  . VAL A 1 52 ? 4.055   -2.040  -4.876  1.00 0.00 ? 52 VAL A CG2  8  
ATOM   7131  H H    . VAL A 1 52 ? 3.423   -1.031  -1.607  1.00 0.00 ? 52 VAL A H    8  
ATOM   7132  H HA   . VAL A 1 52 ? 4.214   0.506   -3.975  1.00 0.00 ? 52 VAL A HA   8  
ATOM   7133  H HB   . VAL A 1 52 ? 2.218   -1.760  -3.828  1.00 0.00 ? 52 VAL A HB   8  
ATOM   7134  H HG11 . VAL A 1 52 ? 2.554   -0.929  -6.501  1.00 0.00 ? 52 VAL A HG11 8  
ATOM   7135  H HG12 . VAL A 1 52 ? 1.102   -0.766  -5.485  1.00 0.00 ? 52 VAL A HG12 8  
ATOM   7136  H HG21 . VAL A 1 52 ? 3.785   -3.085  -4.719  1.00 0.00 ? 52 VAL A HG21 8  
ATOM   7137  H HG22 . VAL A 1 52 ? 4.227   -1.865  -5.938  1.00 0.00 ? 52 VAL A HG22 8  
ATOM   7138  N N    . CYS A 1 53 ? 2.236   2.013   -3.727  1.00 0.00 ? 53 CYS A N    8  
ATOM   7139  C CA   . CYS A 1 53 ? 1.243   3.025   -3.409  1.00 0.00 ? 53 CYS A CA   8  
ATOM   7140  C C    . CYS A 1 53 ? 0.541   3.433   -4.706  1.00 0.00 ? 53 CYS A C    8  
ATOM   7141  O O    . CYS A 1 53 ? 1.092   3.267   -5.793  1.00 0.00 ? 53 CYS A O    8  
ATOM   7142  C CB   . CYS A 1 53 ? 1.867   4.227   -2.697  1.00 0.00 ? 53 CYS A CB   8  
ATOM   7143  S SG   . CYS A 1 53 ? 2.313   3.934   -0.946  1.00 0.00 ? 53 CYS A SG   8  
ATOM   7144  H H    . CYS A 1 53 ? 2.803   2.214   -4.526  1.00 0.00 ? 53 CYS A H    8  
ATOM   7145  H HA   . CYS A 1 53 ? 0.539   2.566   -2.716  1.00 0.00 ? 53 CYS A HA   8  
ATOM   7146  H HB2  . CYS A 1 53 ? 2.763   4.528   -3.240  1.00 0.00 ? 53 CYS A HB2  8  
ATOM   7147  H HB3  . CYS A 1 53 ? 1.169   5.063   -2.744  1.00 0.00 ? 53 CYS A HB3  8  
ATOM   7148  N N    . CYS A 1 54 ? -0.665  3.959   -4.549  1.00 0.00 ? 54 CYS A N    8  
ATOM   7149  C CA   . CYS A 1 54 ? -1.448  4.391   -5.694  1.00 0.00 ? 54 CYS A CA   8  
ATOM   7150  C C    . CYS A 1 54 ? -2.612  5.244   -5.185  1.00 0.00 ? 54 CYS A C    8  
ATOM   7151  O O    . CYS A 1 54 ? -2.869  5.296   -3.984  1.00 0.00 ? 54 CYS A O    8  
ATOM   7152  C CB   . CYS A 1 54 ? -1.932  3.204   -6.529  1.00 0.00 ? 54 CYS A CB   8  
ATOM   7153  S SG   . CYS A 1 54 ? -2.068  1.626   -5.613  1.00 0.00 ? 54 CYS A SG   8  
ATOM   7154  H H    . CYS A 1 54 ? -1.106  4.091   -3.661  1.00 0.00 ? 54 CYS A H    8  
ATOM   7155  H HA   . CYS A 1 54 ? -0.782  4.981   -6.324  1.00 0.00 ? 54 CYS A HA   8  
ATOM   7156  H HB2  . CYS A 1 54 ? -2.908  3.448   -6.950  1.00 0.00 ? 54 CYS A HB2  8  
ATOM   7157  H HB3  . CYS A 1 54 ? -1.249  3.064   -7.366  1.00 0.00 ? 54 CYS A HB3  8  
ATOM   7158  N N    . ASN A 1 55 ? -3.284  5.892   -6.126  1.00 0.00 ? 55 ASN A N    8  
ATOM   7159  C CA   . ASN A 1 55 ? -4.415  6.740   -5.788  1.00 0.00 ? 55 ASN A CA   8  
ATOM   7160  C C    . ASN A 1 55 ? -5.627  6.323   -6.623  1.00 0.00 ? 55 ASN A C    8  
ATOM   7161  O O    . ASN A 1 55 ? -6.063  7.062   -7.504  1.00 0.00 ? 55 ASN A O    8  
ATOM   7162  C CB   . ASN A 1 55 ? -4.113  8.208   -6.093  1.00 0.00 ? 55 ASN A CB   8  
ATOM   7163  C CG   . ASN A 1 55 ? -3.793  8.405   -7.576  1.00 0.00 ? 55 ASN A CG   8  
ATOM   7164  O OD1  . ASN A 1 55 ? -2.972  7.714   -8.158  1.00 0.00 ? 55 ASN A OD1  8  
ATOM   7165  N ND2  . ASN A 1 55 ? -4.484  9.383   -8.153  1.00 0.00 ? 55 ASN A ND2  8  
ATOM   7166  H H    . ASN A 1 55 ? -3.069  5.844   -7.101  1.00 0.00 ? 55 ASN A H    8  
ATOM   7167  H HA   . ASN A 1 55 ? -4.574  6.593   -4.719  1.00 0.00 ? 55 ASN A HA   8  
ATOM   7168  H HB2  . ASN A 1 55 ? -4.969  8.824   -5.817  1.00 0.00 ? 55 ASN A HB2  8  
ATOM   7169  H HB3  . ASN A 1 55 ? -3.270  8.543   -5.488  1.00 0.00 ? 55 ASN A HB3  8  
ATOM   7170  H HD21 . ASN A 1 55 ? -5.143  9.913   -7.619  1.00 0.00 ? 55 ASN A HD21 8  
ATOM   7171  H HD22 . ASN A 1 55 ? -4.345  9.590   -9.122  1.00 0.00 ? 55 ASN A HD22 8  
ATOM   7172  N N    . THR A 1 56 ? -6.138  5.139   -6.316  1.00 0.00 ? 56 THR A N    8  
ATOM   7173  C CA   . THR A 1 56 ? -7.292  4.615   -7.028  1.00 0.00 ? 56 THR A CA   8  
ATOM   7174  C C    . THR A 1 56 ? -8.113  3.704   -6.113  1.00 0.00 ? 56 THR A C    8  
ATOM   7175  O O    . THR A 1 56 ? -7.598  3.181   -5.126  1.00 0.00 ? 56 THR A O    8  
ATOM   7176  C CB   . THR A 1 56 ? -6.789  3.914   -8.291  1.00 0.00 ? 56 THR A CB   8  
ATOM   7177  O OG1  . THR A 1 56 ? -6.025  2.817   -7.800  1.00 0.00 ? 56 THR A OG1  8  
ATOM   7178  C CG2  . THR A 1 56 ? -5.775  4.759   -9.065  1.00 0.00 ? 56 THR A CG2  8  
ATOM   7179  H H    . THR A 1 56 ? -5.778  4.544   -5.598  1.00 0.00 ? 56 THR A H    8  
ATOM   7180  H HA   . THR A 1 56 ? -7.933  5.451   -7.305  1.00 0.00 ? 56 THR A HA   8  
ATOM   7181  H HB   . THR A 1 56 ? -7.622  3.623   -8.932  1.00 0.00 ? 56 THR A HB   8  
ATOM   7182  H HG1  . THR A 1 56 ? -6.625  2.043   -7.602  1.00 0.00 ? 56 THR A HG1  8  
ATOM   7183  H HG21 . THR A 1 56 ? -6.194  5.747   -9.255  1.00 0.00 ? 56 THR A HG21 8  
ATOM   7184  H HG22 . THR A 1 56 ? -4.862  4.858   -8.478  1.00 0.00 ? 56 THR A HG22 8  
ATOM   7185  N N    . ASP A 1 57 ? -9.392  3.518   -6.447  1.00 0.00 ? 57 ASP A N    8  
ATOM   7186  C CA   . ASP A 1 57 ? -10.273 2.678   -5.661  1.00 0.00 ? 57 ASP A CA   8  
ATOM   7187  C C    . ASP A 1 57 ? -9.817  1.229   -5.749  1.00 0.00 ? 57 ASP A C    8  
ATOM   7188  O O    . ASP A 1 57 ? -9.650  0.694   -6.843  1.00 0.00 ? 57 ASP A O    8  
ATOM   7189  C CB   . ASP A 1 57 ? -11.704 2.827   -6.170  1.00 0.00 ? 57 ASP A CB   8  
ATOM   7190  C CG   . ASP A 1 57 ? -12.487 3.810   -5.312  1.00 0.00 ? 57 ASP A CG   8  
ATOM   7191  O OD1  . ASP A 1 57 ? -12.181 3.876   -4.102  1.00 0.00 ? 57 ASP A OD1  8  
ATOM   7192  O OD2  . ASP A 1 57 ? -13.377 4.478   -5.881  1.00 0.00 ? 57 ASP A OD2  8  
ATOM   7193  H H    . ASP A 1 57 ? -9.766  3.971   -7.268  1.00 0.00 ? 57 ASP A H    8  
ATOM   7194  H HA   . ASP A 1 57 ? -10.233 2.999   -4.620  1.00 0.00 ? 57 ASP A HA   8  
ATOM   7195  H HB2  . ASP A 1 57 ? -11.683 3.188   -7.198  1.00 0.00 ? 57 ASP A HB2  8  
ATOM   7196  H HB3  . ASP A 1 57 ? -12.197 1.856   -6.141  1.00 0.00 ? 57 ASP A HB3  8  
ATOM   7197  H HD2  . ASP A 1 57 ? -13.834 5.078   -5.288  1.00 0.00 ? 57 ASP A HD2  8  
ATOM   7198  N N    . LYS A 1 58 ? -9.627  0.629   -4.582  1.00 0.00 ? 58 LYS A N    8  
ATOM   7199  C CA   . LYS A 1 58 ? -9.191  -0.756  -4.516  1.00 0.00 ? 58 LYS A CA   8  
ATOM   7200  C C    . LYS A 1 58 ? -7.900  -0.918  -5.320  1.00 0.00 ? 58 LYS A C    8  
ATOM   7201  O O    . LYS A 1 58 ? -7.808  -1.788  -6.185  1.00 0.00 ? 58 LYS A O    8  
ATOM   7202  C CB   . LYS A 1 58 ? -10.315 -1.693  -4.962  1.00 0.00 ? 58 LYS A CB   8  
ATOM   7203  C CG   . LYS A 1 58 ? -10.063 -3.122  -4.476  1.00 0.00 ? 58 LYS A CG   8  
ATOM   7204  C CD   . LYS A 1 58 ? -10.362 -4.138  -5.581  1.00 0.00 ? 58 LYS A CD   8  
ATOM   7205  C CE   . LYS A 1 58 ? -11.851 -4.491  -5.612  1.00 0.00 ? 58 LYS A CE   8  
ATOM   7206  N NZ   . LYS A 1 58 ? -12.548 -3.706  -6.654  1.00 0.00 ? 58 LYS A NZ   8  
ATOM   7207  H H    . LYS A 1 58 ? -9.766  1.071   -3.696  1.00 0.00 ? 58 LYS A H    8  
ATOM   7208  H HA   . LYS A 1 58 ? -8.979  -0.982  -3.471  1.00 0.00 ? 58 LYS A HA   8  
ATOM   7209  H HB2  . LYS A 1 58 ? -11.269 -1.336  -4.572  1.00 0.00 ? 58 LYS A HB2  8  
ATOM   7210  H HB3  . LYS A 1 58 ? -10.393 -1.683  -6.049  1.00 0.00 ? 58 LYS A HB3  8  
ATOM   7211  H HG2  . LYS A 1 58 ? -9.026  -3.223  -4.156  1.00 0.00 ? 58 LYS A HG2  8  
ATOM   7212  H HG3  . LYS A 1 58 ? -10.687 -3.330  -3.607  1.00 0.00 ? 58 LYS A HG3  8  
ATOM   7213  H HD2  . LYS A 1 58 ? -10.062 -3.730  -6.546  1.00 0.00 ? 58 LYS A HD2  8  
ATOM   7214  H HD3  . LYS A 1 58 ? -9.774  -5.041  -5.419  1.00 0.00 ? 58 LYS A HD3  8  
ATOM   7215  H HE2  . LYS A 1 58 ? -11.973 -5.556  -5.807  1.00 0.00 ? 58 LYS A HE2  8  
ATOM   7216  H HE3  . LYS A 1 58 ? -12.298 -4.292  -4.638  1.00 0.00 ? 58 LYS A HE3  8  
ATOM   7217  H HZ1  . LYS A 1 58 ? -13.188 -4.298  -7.145  1.00 0.00 ? 58 LYS A HZ1  8  
ATOM   7218  H HZ2  . LYS A 1 58 ? -13.051 -2.955  -6.226  1.00 0.00 ? 58 LYS A HZ2  8  
ATOM   7219  N N    . CYS A 1 59 ? -6.934  -0.067  -5.007  1.00 0.00 ? 59 CYS A N    8  
ATOM   7220  C CA   . CYS A 1 59 ? -5.652  -0.106  -5.689  1.00 0.00 ? 59 CYS A CA   8  
ATOM   7221  C C    . CYS A 1 59 ? -4.728  -1.056  -4.924  1.00 0.00 ? 59 CYS A C    8  
ATOM   7222  O O    . CYS A 1 59 ? -4.089  -1.920  -5.520  1.00 0.00 ? 59 CYS A O    8  
ATOM   7223  C CB   . CYS A 1 59 ? -5.044  1.291   -5.830  1.00 0.00 ? 59 CYS A CB   8  
ATOM   7224  S SG   . CYS A 1 59 ? -3.757  1.696   -4.594  1.00 0.00 ? 59 CYS A SG   8  
ATOM   7225  H H    . CYS A 1 59 ? -7.017  0.637   -4.302  1.00 0.00 ? 59 CYS A H    8  
ATOM   7226  H HA   . CYS A 1 59 ? -5.844  -0.479  -6.695  1.00 0.00 ? 59 CYS A HA   8  
ATOM   7227  H HB2  . CYS A 1 59 ? -4.613  1.386   -6.827  1.00 0.00 ? 59 CYS A HB2  8  
ATOM   7228  H HB3  . CYS A 1 59 ? -5.843  2.029   -5.756  1.00 0.00 ? 59 CYS A HB3  8  
ATOM   7229  N N    . ASN A 1 60 ? -4.688  -0.863  -3.613  1.00 0.00 ? 60 ASN A N    8  
ATOM   7230  C CA   . ASN A 1 60 ? -3.854  -1.691  -2.760  1.00 0.00 ? 60 ASN A CA   8  
ATOM   7231  C C    . ASN A 1 60 ? -4.564  -3.020  -2.495  1.00 0.00 ? 60 ASN A C    8  
ATOM   7232  O O    . ASN A 1 60 ? -5.353  -3.481  -3.318  1.00 0.00 ? 60 ASN A O    8  
ATOM   7233  C CB   . ASN A 1 60 ? -3.600  -1.014  -1.412  1.00 0.00 ? 60 ASN A CB   8  
ATOM   7234  C CG   . ASN A 1 60 ? -4.783  -1.220  -0.463  1.00 0.00 ? 60 ASN A CG   8  
ATOM   7235  O OD1  . ASN A 1 60 ? -5.906  -1.462  -0.874  1.00 0.00 ? 60 ASN A OD1  8  
ATOM   7236  N ND2  . ASN A 1 60 ? -4.468  -1.112  0.824   1.00 0.00 ? 60 ASN A ND2  8  
ATOM   7237  H H    . ASN A 1 60 ? -5.212  -0.157  -3.136  1.00 0.00 ? 60 ASN A H    8  
ATOM   7238  H HA   . ASN A 1 60 ? -2.921  -1.819  -3.309  1.00 0.00 ? 60 ASN A HA   8  
ATOM   7239  H HB2  . ASN A 1 60 ? -2.694  -1.418  -0.962  1.00 0.00 ? 60 ASN A HB2  8  
ATOM   7240  H HB3  . ASN A 1 60 ? -3.432  0.053   -1.563  1.00 0.00 ? 60 ASN A HB3  8  
ATOM   7241  H HD21 . ASN A 1 60 ? -3.526  -0.912  1.094   1.00 0.00 ? 60 ASN A HD21 8  
ATOM   7242  H HD22 . ASN A 1 60 ? -5.174  -1.231  1.523   1.00 0.00 ? 60 ASN A HD22 8  
HETATM 7243  O O    . HOH B 2 .  ? 4.919   -11.124 1.867   1.00 0.00 ? 61 HOH A O    8  
HETATM 7244  H H1   . HOH B 2 .  ? 3.994   -11.045 2.100   1.00 0.00 ? 61 HOH A H1   8  
HETATM 7245  H H2   . HOH B 2 .  ? 5.294   -11.668 2.561   1.00 0.00 ? 61 HOH A H2   8  
HETATM 7246  O O    . HOH B 2 .  ? 9.155   -14.227 -8.186  1.00 0.00 ? 62 HOH A O    8  
HETATM 7247  H H1   . HOH B 2 .  ? 8.286   -14.624 -8.119  1.00 0.00 ? 62 HOH A H1   8  
HETATM 7248  H H2   . HOH B 2 .  ? 9.065   -13.571 -8.877  1.00 0.00 ? 62 HOH A H2   8  
ATOM   7249  N N    . LEU A 1 1  ? -12.495 7.300   -1.198  1.00 0.00 ? 1  LEU A N    9  
ATOM   7250  C CA   . LEU A 1 1  ? -11.406 6.365   -1.429  1.00 0.00 ? 1  LEU A CA   9  
ATOM   7251  C C    . LEU A 1 1  ? -11.704 5.053   -0.701  1.00 0.00 ? 1  LEU A C    9  
ATOM   7252  O O    . LEU A 1 1  ? -11.438 4.928   0.493   1.00 0.00 ? 1  LEU A O    9  
ATOM   7253  C CB   . LEU A 1 1  ? -10.068 6.995   -1.040  1.00 0.00 ? 1  LEU A CB   9  
ATOM   7254  C CG   . LEU A 1 1  ? -9.234  7.563   -2.190  1.00 0.00 ? 1  LEU A CG   9  
ATOM   7255  C CD1  . LEU A 1 1  ? -8.819  6.458   -3.165  1.00 0.00 ? 1  LEU A CD1  9  
ATOM   7256  C CD2  . LEU A 1 1  ? -9.975  8.701   -2.895  1.00 0.00 ? 1  LEU A CD2  9  
ATOM   7257  H H    . LEU A 1 1  ? -12.212 8.243   -1.024  1.00 0.00 ? 1  LEU A H    9  
ATOM   7258  H HA   . LEU A 1 1  ? -11.369 6.166   -2.500  1.00 0.00 ? 1  LEU A HA   9  
ATOM   7259  H HB2  . LEU A 1 1  ? -10.259 7.796   -0.327  1.00 0.00 ? 1  LEU A HB2  9  
ATOM   7260  H HB3  . LEU A 1 1  ? -9.472  6.243   -0.522  1.00 0.00 ? 1  LEU A HB3  9  
ATOM   7261  H HG   . LEU A 1 1  ? -8.319  7.984   -1.774  1.00 0.00 ? 1  LEU A HG   9  
ATOM   7262  H HD11 . LEU A 1 1  ? -7.740  6.493   -3.316  1.00 0.00 ? 1  LEU A HD11 9  
ATOM   7263  H HD12 . LEU A 1 1  ? -9.098  5.488   -2.753  1.00 0.00 ? 1  LEU A HD12 9  
ATOM   7264  H HD21 . LEU A 1 1  ? -9.386  9.615   -2.828  1.00 0.00 ? 1  LEU A HD21 9  
ATOM   7265  H HD22 . LEU A 1 1  ? -10.125 8.442   -3.944  1.00 0.00 ? 1  LEU A HD22 9  
ATOM   7266  N N    . LYS A 1 2  ? -12.250 4.108   -1.451  1.00 0.00 ? 2  LYS A N    9  
ATOM   7267  C CA   . LYS A 1 2  ? -12.587 2.809   -0.892  1.00 0.00 ? 2  LYS A CA   9  
ATOM   7268  C C    . LYS A 1 2  ? -11.529 1.788   -1.314  1.00 0.00 ? 2  LYS A C    9  
ATOM   7269  O O    . LYS A 1 2  ? -11.470 1.395   -2.478  1.00 0.00 ? 2  LYS A O    9  
ATOM   7270  C CB   . LYS A 1 2  ? -14.013 2.413   -1.278  1.00 0.00 ? 2  LYS A CB   9  
ATOM   7271  C CG   . LYS A 1 2  ? -15.023 3.450   -0.784  1.00 0.00 ? 2  LYS A CG   9  
ATOM   7272  C CD   . LYS A 1 2  ? -15.729 4.131   -1.958  1.00 0.00 ? 2  LYS A CD   9  
ATOM   7273  C CE   . LYS A 1 2  ? -16.773 3.203   -2.582  1.00 0.00 ? 2  LYS A CE   9  
ATOM   7274  N NZ   . LYS A 1 2  ? -17.921 3.984   -3.095  1.00 0.00 ? 2  LYS A NZ   9  
ATOM   7275  H H    . LYS A 1 2  ? -12.463 4.217   -2.422  1.00 0.00 ? 2  LYS A H    9  
ATOM   7276  H HA   . LYS A 1 2  ? -12.561 2.905   0.193   1.00 0.00 ? 2  LYS A HA   9  
ATOM   7277  H HB2  . LYS A 1 2  ? -14.087 2.315   -2.361  1.00 0.00 ? 2  LYS A HB2  9  
ATOM   7278  H HB3  . LYS A 1 2  ? -14.250 1.437   -0.854  1.00 0.00 ? 2  LYS A HB3  9  
ATOM   7279  H HG2  . LYS A 1 2  ? -15.760 2.968   -0.142  1.00 0.00 ? 2  LYS A HG2  9  
ATOM   7280  H HG3  . LYS A 1 2  ? -14.514 4.199   -0.177  1.00 0.00 ? 2  LYS A HG3  9  
ATOM   7281  H HD2  . LYS A 1 2  ? -16.211 5.047   -1.616  1.00 0.00 ? 2  LYS A HD2  9  
ATOM   7282  H HD3  . LYS A 1 2  ? -14.996 4.418   -2.711  1.00 0.00 ? 2  LYS A HD3  9  
ATOM   7283  H HE2  . LYS A 1 2  ? -16.322 2.632   -3.394  1.00 0.00 ? 2  LYS A HE2  9  
ATOM   7284  H HE3  . LYS A 1 2  ? -17.119 2.483   -1.841  1.00 0.00 ? 2  LYS A HE3  9  
ATOM   7285  H HZ1  . LYS A 1 2  ? -18.768 3.634   -2.695  1.00 0.00 ? 2  LYS A HZ1  9  
ATOM   7286  H HZ2  . LYS A 1 2  ? -17.807 4.946   -2.846  1.00 0.00 ? 2  LYS A HZ2  9  
ATOM   7287  N N    . CYS A 1 3  ? -10.719 1.387   -0.345  1.00 0.00 ? 3  CYS A N    9  
ATOM   7288  C CA   . CYS A 1 3  ? -9.667  0.419   -0.601  1.00 0.00 ? 3  CYS A CA   9  
ATOM   7289  C C    . CYS A 1 3  ? -9.930  -0.817  0.262   1.00 0.00 ? 3  CYS A C    9  
ATOM   7290  O O    . CYS A 1 3  ? -10.900 -0.856  1.017   1.00 0.00 ? 3  CYS A O    9  
ATOM   7291  C CB   . CYS A 1 3  ? -8.279  1.010   -0.344  1.00 0.00 ? 3  CYS A CB   9  
ATOM   7292  S SG   . CYS A 1 3  ? -7.514  1.831   -1.790  1.00 0.00 ? 3  CYS A SG   9  
ATOM   7293  H H    . CYS A 1 3  ? -10.774 1.712   0.599   1.00 0.00 ? 3  CYS A H    9  
ATOM   7294  H HA   . CYS A 1 3  ? -9.722  0.169   -1.661  1.00 0.00 ? 3  CYS A HA   9  
ATOM   7295  H HB2  . CYS A 1 3  ? -8.352  1.732   0.469   1.00 0.00 ? 3  CYS A HB2  9  
ATOM   7296  H HB3  . CYS A 1 3  ? -7.617  0.213   -0.005  1.00 0.00 ? 3  CYS A HB3  9  
ATOM   7297  N N    . LYS A 1 4  ? -9.048  -1.795  0.122   1.00 0.00 ? 4  LYS A N    9  
ATOM   7298  C CA   . LYS A 1 4  ? -9.172  -3.029  0.880   1.00 0.00 ? 4  LYS A CA   9  
ATOM   7299  C C    . LYS A 1 4  ? -8.353  -2.917  2.167   1.00 0.00 ? 4  LYS A C    9  
ATOM   7300  O O    . LYS A 1 4  ? -7.310  -2.265  2.189   1.00 0.00 ? 4  LYS A O    9  
ATOM   7301  C CB   . LYS A 1 4  ? -8.793  -4.231  0.013   1.00 0.00 ? 4  LYS A CB   9  
ATOM   7302  C CG   . LYS A 1 4  ? -9.913  -4.572  -0.973  1.00 0.00 ? 4  LYS A CG   9  
ATOM   7303  C CD   . LYS A 1 4  ? -10.487 -5.962  -0.692  1.00 0.00 ? 4  LYS A CD   9  
ATOM   7304  C CE   . LYS A 1 4  ? -11.166 -6.536  -1.937  1.00 0.00 ? 4  LYS A CE   9  
ATOM   7305  N NZ   . LYS A 1 4  ? -12.527 -5.975  -2.091  1.00 0.00 ? 4  LYS A NZ   9  
ATOM   7306  H H    . LYS A 1 4  ? -8.261  -1.756  -0.494  1.00 0.00 ? 4  LYS A H    9  
ATOM   7307  H HA   . LYS A 1 4  ? -10.223 -3.143  1.147   1.00 0.00 ? 4  LYS A HA   9  
ATOM   7308  H HB2  . LYS A 1 4  ? -7.876  -4.015  -0.535  1.00 0.00 ? 4  LYS A HB2  9  
ATOM   7309  H HB3  . LYS A 1 4  ? -8.589  -5.093  0.648   1.00 0.00 ? 4  LYS A HB3  9  
ATOM   7310  H HG2  . LYS A 1 4  ? -10.705 -3.826  -0.901  1.00 0.00 ? 4  LYS A HG2  9  
ATOM   7311  H HG3  . LYS A 1 4  ? -9.530  -4.531  -1.992  1.00 0.00 ? 4  LYS A HG3  9  
ATOM   7312  H HD2  . LYS A 1 4  ? -9.689  -6.630  -0.368  1.00 0.00 ? 4  LYS A HD2  9  
ATOM   7313  H HD3  . LYS A 1 4  ? -11.206 -5.904  0.125   1.00 0.00 ? 4  LYS A HD3  9  
ATOM   7314  H HE2  . LYS A 1 4  ? -10.570 -6.309  -2.821  1.00 0.00 ? 4  LYS A HE2  9  
ATOM   7315  H HE3  . LYS A 1 4  ? -11.221 -7.622  -1.860  1.00 0.00 ? 4  LYS A HE3  9  
ATOM   7316  H HZ1  . LYS A 1 4  ? -12.866 -6.171  -3.011  1.00 0.00 ? 4  LYS A HZ1  9  
ATOM   7317  H HZ2  . LYS A 1 4  ? -13.136 -6.388  -1.415  1.00 0.00 ? 4  LYS A HZ2  9  
ATOM   7318  N N    . LYS A 1 5  ? -8.857  -3.562  3.209   1.00 0.00 ? 5  LYS A N    9  
ATOM   7319  C CA   . LYS A 1 5  ? -8.185  -3.543  4.497   1.00 0.00 ? 5  LYS A CA   9  
ATOM   7320  C C    . LYS A 1 5  ? -7.158  -4.675  4.549   1.00 0.00 ? 5  LYS A C    9  
ATOM   7321  O O    . LYS A 1 5  ? -6.873  -5.307  3.532   1.00 0.00 ? 5  LYS A O    9  
ATOM   7322  C CB   . LYS A 1 5  ? -9.207  -3.586  5.635   1.00 0.00 ? 5  LYS A CB   9  
ATOM   7323  C CG   . LYS A 1 5  ? -9.625  -2.175  6.051   1.00 0.00 ? 5  LYS A CG   9  
ATOM   7324  C CD   . LYS A 1 5  ? -8.492  -1.463  6.793   1.00 0.00 ? 5  LYS A CD   9  
ATOM   7325  C CE   . LYS A 1 5  ? -8.700  -1.531  8.307   1.00 0.00 ? 5  LYS A CE   9  
ATOM   7326  N NZ   . LYS A 1 5  ? -9.865  -0.711  8.707   1.00 0.00 ? 5  LYS A NZ   9  
ATOM   7327  H H    . LYS A 1 5  ? -9.706  -4.090  3.183   1.00 0.00 ? 5  LYS A H    9  
ATOM   7328  H HA   . LYS A 1 5  ? -7.656  -2.593  4.576   1.00 0.00 ? 5  LYS A HA   9  
ATOM   7329  H HB2  . LYS A 1 5  ? -10.084 -4.152  5.320   1.00 0.00 ? 5  LYS A HB2  9  
ATOM   7330  H HB3  . LYS A 1 5  ? -8.781  -4.110  6.491   1.00 0.00 ? 5  LYS A HB3  9  
ATOM   7331  H HG2  . LYS A 1 5  ? -9.904  -1.600  5.168   1.00 0.00 ? 5  LYS A HG2  9  
ATOM   7332  H HG3  . LYS A 1 5  ? -10.506 -2.226  6.690   1.00 0.00 ? 5  LYS A HG3  9  
ATOM   7333  H HD2  . LYS A 1 5  ? -7.538  -1.921  6.532   1.00 0.00 ? 5  LYS A HD2  9  
ATOM   7334  H HD3  . LYS A 1 5  ? -8.442  -0.422  6.475   1.00 0.00 ? 5  LYS A HD3  9  
ATOM   7335  H HE2  . LYS A 1 5  ? -8.853  -2.566  8.613   1.00 0.00 ? 5  LYS A HE2  9  
ATOM   7336  H HE3  . LYS A 1 5  ? -7.805  -1.176  8.819   1.00 0.00 ? 5  LYS A HE3  9  
ATOM   7337  H HZ1  . LYS A 1 5  ? -10.570 -1.303  9.099   1.00 0.00 ? 5  LYS A HZ1  9  
ATOM   7338  H HZ2  . LYS A 1 5  ? -9.580  -0.036  9.388   1.00 0.00 ? 5  LYS A HZ2  9  
ATOM   7339  N N    . LEU A 1 6  ? -6.629  -4.898  5.743   1.00 0.00 ? 6  LEU A N    9  
ATOM   7340  C CA   . LEU A 1 6  ? -5.640  -5.944  5.941   1.00 0.00 ? 6  LEU A CA   9  
ATOM   7341  C C    . LEU A 1 6  ? -6.091  -7.211  5.211   1.00 0.00 ? 6  LEU A C    9  
ATOM   7342  O O    . LEU A 1 6  ? -5.483  -7.608  4.218   1.00 0.00 ? 6  LEU A O    9  
ATOM   7343  C CB   . LEU A 1 6  ? -5.374  -6.155  7.433   1.00 0.00 ? 6  LEU A CB   9  
ATOM   7344  C CG   . LEU A 1 6  ? -4.251  -5.312  8.040   1.00 0.00 ? 6  LEU A CG   9  
ATOM   7345  C CD1  . LEU A 1 6  ? -4.759  -3.924  8.433   1.00 0.00 ? 6  LEU A CD1  9  
ATOM   7346  C CD2  . LEU A 1 6  ? -3.597  -6.038  9.217   1.00 0.00 ? 6  LEU A CD2  9  
ATOM   7347  H H    . LEU A 1 6  ? -6.866  -4.380  6.565   1.00 0.00 ? 6  LEU A H    9  
ATOM   7348  H HA   . LEU A 1 6  ? -4.707  -5.600  5.493   1.00 0.00 ? 6  LEU A HA   9  
ATOM   7349  H HB2  . LEU A 1 6  ? -6.294  -5.946  7.978   1.00 0.00 ? 6  LEU A HB2  9  
ATOM   7350  H HB3  . LEU A 1 6  ? -5.140  -7.207  7.594   1.00 0.00 ? 6  LEU A HB3  9  
ATOM   7351  H HG   . LEU A 1 6  ? -3.482  -5.171  7.281   1.00 0.00 ? 6  LEU A HG   9  
ATOM   7352  H HD11 . LEU A 1 6  ? -4.746  -3.826  9.519   1.00 0.00 ? 6  LEU A HD11 9  
ATOM   7353  H HD12 . LEU A 1 6  ? -4.115  -3.163  7.992   1.00 0.00 ? 6  LEU A HD12 9  
ATOM   7354  H HD21 . LEU A 1 6  ? -3.286  -5.309  9.966   1.00 0.00 ? 6  LEU A HD21 9  
ATOM   7355  H HD22 . LEU A 1 6  ? -4.312  -6.731  9.660   1.00 0.00 ? 6  LEU A HD22 9  
ATOM   7356  N N    . VAL A 1 7  ? -7.152  -7.809  5.731   1.00 0.00 ? 7  VAL A N    9  
ATOM   7357  C CA   . VAL A 1 7  ? -7.691  -9.023  5.141   1.00 0.00 ? 7  VAL A CA   9  
ATOM   7358  C C    . VAL A 1 7  ? -8.713  -8.651  4.065   1.00 0.00 ? 7  VAL A C    9  
ATOM   7359  O O    . VAL A 1 7  ? -9.495  -7.718  4.243   1.00 0.00 ? 7  VAL A O    9  
ATOM   7360  C CB   . VAL A 1 7  ? -8.273  -9.922  6.234   1.00 0.00 ? 7  VAL A CB   9  
ATOM   7361  C CG1  . VAL A 1 7  ? -8.926  -11.167 5.629   1.00 0.00 ? 7  VAL A CG1  9  
ATOM   7362  C CG2  . VAL A 1 7  ? -7.201  -10.307 7.255   1.00 0.00 ? 7  VAL A CG2  9  
ATOM   7363  H H    . VAL A 1 7  ? -7.640  -7.479  6.539   1.00 0.00 ? 7  VAL A H    9  
ATOM   7364  H HA   . VAL A 1 7  ? -6.864  -9.555  4.670   1.00 0.00 ? 7  VAL A HA   9  
ATOM   7365  H HB   . VAL A 1 7  ? -9.046  -9.358  6.756   1.00 0.00 ? 7  VAL A HB   9  
ATOM   7366  H HG11 . VAL A 1 7  ? -9.540  -11.657 6.384   1.00 0.00 ? 7  VAL A HG11 9  
ATOM   7367  H HG12 . VAL A 1 7  ? -9.550  -10.875 4.785   1.00 0.00 ? 7  VAL A HG12 9  
ATOM   7368  H HG21 . VAL A 1 7  ? -6.869  -9.415  7.787   1.00 0.00 ? 7  VAL A HG21 9  
ATOM   7369  H HG22 . VAL A 1 7  ? -7.616  -11.020 7.967   1.00 0.00 ? 7  VAL A HG22 9  
ATOM   7370  N N    . PRO A 1 8  ? -8.674  -9.421  2.945   1.00 0.00 ? 8  PRO A N    9  
ATOM   7371  C CA   . PRO A 1 8  ? -9.588  -9.182  1.840   1.00 0.00 ? 8  PRO A CA   9  
ATOM   7372  C C    . PRO A 1 8  ? -10.995 -9.680  2.175   1.00 0.00 ? 8  PRO A C    9  
ATOM   7373  O O    . PRO A 1 8  ? -11.584 -10.446 1.413   1.00 0.00 ? 8  PRO A O    9  
ATOM   7374  C CB   . PRO A 1 8  ? -8.968  -9.903  0.654   1.00 0.00 ? 8  PRO A CB   9  
ATOM   7375  C CG   . PRO A 1 8  ? -7.983  -10.900 1.241   1.00 0.00 ? 8  PRO A CG   9  
ATOM   7376  C CD   . PRO A 1 8  ? -7.762  -10.534 2.700   1.00 0.00 ? 8  PRO A CD   9  
ATOM   7377  H HA   . PRO A 1 8  ? -9.679  -8.200  1.671   1.00 0.00 ? 8  PRO A HA   9  
ATOM   7378  H HB2  . PRO A 1 8  ? -9.732  -10.409 0.063   1.00 0.00 ? 8  PRO A HB2  9  
ATOM   7379  H HB3  . PRO A 1 8  ? -8.465  -9.201  -0.010  1.00 0.00 ? 8  PRO A HB3  9  
ATOM   7380  H HG2  . PRO A 1 8  ? -8.371  -11.915 1.157   1.00 0.00 ? 8  PRO A HG2  9  
ATOM   7381  H HG3  . PRO A 1 8  ? -7.041  -10.873 0.694   1.00 0.00 ? 8  PRO A HG3  9  
ATOM   7382  H HD2  . PRO A 1 8  ? -7.980  -11.376 3.357   1.00 0.00 ? 8  PRO A HD2  9  
ATOM   7383  H HD3  . PRO A 1 8  ? -6.727  -10.246 2.884   1.00 0.00 ? 8  PRO A HD3  9  
ATOM   7384  N N    . LEU A 1 9  ? -11.493 -9.226  3.316   1.00 0.00 ? 9  LEU A N    9  
ATOM   7385  C CA   . LEU A 1 9  ? -12.820 -9.617  3.760   1.00 0.00 ? 9  LEU A CA   9  
ATOM   7386  C C    . LEU A 1 9  ? -13.722 -8.381  3.808   1.00 0.00 ? 9  LEU A C    9  
ATOM   7387  O O    . LEU A 1 9  ? -14.922 -8.474  3.553   1.00 0.00 ? 9  LEU A O    9  
ATOM   7388  C CB   . LEU A 1 9  ? -12.739 -10.370 5.090   1.00 0.00 ? 9  LEU A CB   9  
ATOM   7389  C CG   . LEU A 1 9  ? -12.527 -11.882 4.992   1.00 0.00 ? 9  LEU A CG   9  
ATOM   7390  C CD1  . LEU A 1 9  ? -12.117 -12.467 6.345   1.00 0.00 ? 9  LEU A CD1  9  
ATOM   7391  C CD2  . LEU A 1 9  ? -13.766 -12.574 4.420   1.00 0.00 ? 9  LEU A CD2  9  
ATOM   7392  H H    . LEU A 1 9  ? -11.008 -8.604  3.929   1.00 0.00 ? 9  LEU A H    9  
ATOM   7393  H HA   . LEU A 1 9  ? -13.222 -10.310 3.021   1.00 0.00 ? 9  LEU A HA   9  
ATOM   7394  H HB2  . LEU A 1 9  ? -11.924 -9.946  5.676   1.00 0.00 ? 9  LEU A HB2  9  
ATOM   7395  H HB3  . LEU A 1 9  ? -13.660 -10.188 5.644   1.00 0.00 ? 9  LEU A HB3  9  
ATOM   7396  H HG   . LEU A 1 9  ? -11.706 -12.068 4.299   1.00 0.00 ? 9  LEU A HG   9  
ATOM   7397  H HD11 . LEU A 1 9  ? -11.695 -11.679 6.968   1.00 0.00 ? 9  LEU A HD11 9  
ATOM   7398  H HD12 . LEU A 1 9  ? -12.992 -12.890 6.838   1.00 0.00 ? 9  LEU A HD12 9  
ATOM   7399  H HD21 . LEU A 1 9  ? -13.601 -13.651 4.393   1.00 0.00 ? 9  LEU A HD21 9  
ATOM   7400  H HD22 . LEU A 1 9  ? -14.628 -12.354 5.050   1.00 0.00 ? 9  LEU A HD22 9  
ATOM   7401  N N    . PHE A 1 10 ? -13.109 -7.253  4.135   1.00 0.00 ? 10 PHE A N    9  
ATOM   7402  C CA   . PHE A 1 10 ? -13.841 -6.001  4.219   1.00 0.00 ? 10 PHE A CA   9  
ATOM   7403  C C    . PHE A 1 10 ? -13.019 -4.846  3.644   1.00 0.00 ? 10 PHE A C    9  
ATOM   7404  O O    . PHE A 1 10 ? -11.808 -4.968  3.469   1.00 0.00 ? 10 PHE A O    9  
ATOM   7405  C CB   . PHE A 1 10 ? -14.104 -5.735  5.702   1.00 0.00 ? 10 PHE A CB   9  
ATOM   7406  C CG   . PHE A 1 10 ? -14.578 -6.964  6.480   1.00 0.00 ? 10 PHE A CG   9  
ATOM   7407  C CD1  . PHE A 1 10 ? -15.681 -7.646  6.069   1.00 0.00 ? 10 PHE A CD1  9  
ATOM   7408  C CD2  . PHE A 1 10 ? -13.897 -7.375  7.584   1.00 0.00 ? 10 PHE A CD2  9  
ATOM   7409  C CE1  . PHE A 1 10 ? -16.121 -8.787  6.791   1.00 0.00 ? 10 PHE A CE1  9  
ATOM   7410  C CE2  . PHE A 1 10 ? -14.337 -8.516  8.306   1.00 0.00 ? 10 PHE A CE2  9  
ATOM   7411  C CZ   . PHE A 1 10 ? -15.440 -9.198  7.894   1.00 0.00 ? 10 PHE A CZ   9  
ATOM   7412  H H    . PHE A 1 10 ? -12.133 -7.186  4.340   1.00 0.00 ? 10 PHE A H    9  
ATOM   7413  H HA   . PHE A 1 10 ? -14.754 -6.120  3.635   1.00 0.00 ? 10 PHE A HA   9  
ATOM   7414  H HB2  . PHE A 1 10 ? -13.191 -5.357  6.161   1.00 0.00 ? 10 PHE A HB2  9  
ATOM   7415  H HB3  . PHE A 1 10 ? -14.854 -4.949  5.793   1.00 0.00 ? 10 PHE A HB3  9  
ATOM   7416  H HD1  . PHE A 1 10 ? -16.227 -7.317  5.184   1.00 0.00 ? 10 PHE A HD1  9  
ATOM   7417  H HD2  . PHE A 1 10 ? -13.014 -6.828  7.914   1.00 0.00 ? 10 PHE A HD2  9  
ATOM   7418  H HE1  . PHE A 1 10 ? -17.004 -9.334  6.461   1.00 0.00 ? 10 PHE A HE1  9  
ATOM   7419  H HE2  . PHE A 1 10 ? -13.792 -8.845  9.190   1.00 0.00 ? 10 PHE A HE2  9  
ATOM   7420  H HZ   . PHE A 1 10 ? -15.777 -10.073 8.448   1.00 0.00 ? 10 PHE A HZ   9  
ATOM   7421  N N    . SER A 1 11 ? -13.711 -3.750  3.365   1.00 0.00 ? 11 SER A N    9  
ATOM   7422  C CA   . SER A 1 11 ? -13.061 -2.574  2.813   1.00 0.00 ? 11 SER A CA   9  
ATOM   7423  C C    . SER A 1 11 ? -13.240 -1.385  3.759   1.00 0.00 ? 11 SER A C    9  
ATOM   7424  O O    . SER A 1 11 ? -14.249 -1.289  4.456   1.00 0.00 ? 11 SER A O    9  
ATOM   7425  C CB   . SER A 1 11 ? -13.613 -2.239  1.427   1.00 0.00 ? 11 SER A CB   9  
ATOM   7426  O OG   . SER A 1 11 ? -15.035 -2.318  1.385   1.00 0.00 ? 11 SER A OG   9  
ATOM   7427  H H    . SER A 1 11 ? -14.696 -3.659  3.510   1.00 0.00 ? 11 SER A H    9  
ATOM   7428  H HA   . SER A 1 11 ? -12.007 -2.840  2.729   1.00 0.00 ? 11 SER A HA   9  
ATOM   7429  H HB2  . SER A 1 11 ? -13.298 -1.234  1.144   1.00 0.00 ? 11 SER A HB2  9  
ATOM   7430  H HB3  . SER A 1 11 ? -13.190 -2.924  0.692   1.00 0.00 ? 11 SER A HB3  9  
ATOM   7431  H HG   . SER A 1 11 ? -15.327 -2.816  0.569   1.00 0.00 ? 11 SER A HG   9  
ATOM   7432  N N    . LYS A 1 12 ? -12.247 -0.509  3.752   1.00 0.00 ? 12 LYS A N    9  
ATOM   7433  C CA   . LYS A 1 12 ? -12.283 0.671   4.600   1.00 0.00 ? 12 LYS A CA   9  
ATOM   7434  C C    . LYS A 1 12 ? -11.975 1.910   3.757   1.00 0.00 ? 12 LYS A C    9  
ATOM   7435  O O    . LYS A 1 12 ? -11.226 1.832   2.784   1.00 0.00 ? 12 LYS A O    9  
ATOM   7436  C CB   . LYS A 1 12 ? -11.350 0.496   5.800   1.00 0.00 ? 12 LYS A CB   9  
ATOM   7437  C CG   . LYS A 1 12 ? -11.703 1.481   6.917   1.00 0.00 ? 12 LYS A CG   9  
ATOM   7438  C CD   . LYS A 1 12 ? -12.891 0.975   7.738   1.00 0.00 ? 12 LYS A CD   9  
ATOM   7439  C CE   . LYS A 1 12 ? -12.795 1.448   9.190   1.00 0.00 ? 12 LYS A CE   9  
ATOM   7440  N NZ   . LYS A 1 12 ? -12.762 0.290   10.111  1.00 0.00 ? 12 LYS A NZ   9  
ATOM   7441  H H    . LYS A 1 12 ? -11.430 -0.594  3.181   1.00 0.00 ? 12 LYS A H    9  
ATOM   7442  H HA   . LYS A 1 12 ? -13.296 0.762   4.990   1.00 0.00 ? 12 LYS A HA   9  
ATOM   7443  H HB2  . LYS A 1 12 ? -11.420 -0.525  6.175   1.00 0.00 ? 12 LYS A HB2  9  
ATOM   7444  H HB3  . LYS A 1 12 ? -10.317 0.650   5.488   1.00 0.00 ? 12 LYS A HB3  9  
ATOM   7445  H HG2  . LYS A 1 12 ? -10.840 1.622   7.568   1.00 0.00 ? 12 LYS A HG2  9  
ATOM   7446  H HG3  . LYS A 1 12 ? -11.941 2.453   6.487   1.00 0.00 ? 12 LYS A HG3  9  
ATOM   7447  H HD2  . LYS A 1 12 ? -13.821 1.332   7.296   1.00 0.00 ? 12 LYS A HD2  9  
ATOM   7448  H HD3  . LYS A 1 12 ? -12.921 -0.114  7.708   1.00 0.00 ? 12 LYS A HD3  9  
ATOM   7449  H HE2  . LYS A 1 12 ? -11.897 2.052   9.323   1.00 0.00 ? 12 LYS A HE2  9  
ATOM   7450  H HE3  . LYS A 1 12 ? -13.646 2.086   9.428   1.00 0.00 ? 12 LYS A HE3  9  
ATOM   7451  H HZ1  . LYS A 1 12 ? -11.990 -0.300  9.877   1.00 0.00 ? 12 LYS A HZ1  9  
ATOM   7452  H HZ2  . LYS A 1 12 ? -12.660 0.615   11.051  1.00 0.00 ? 12 LYS A HZ2  9  
ATOM   7453  N N    . THR A 1 13 ? -12.568 3.023   4.160   1.00 0.00 ? 13 THR A N    9  
ATOM   7454  C CA   . THR A 1 13 ? -12.366 4.277   3.454   1.00 0.00 ? 13 THR A CA   9  
ATOM   7455  C C    . THR A 1 13 ? -11.268 5.100   4.131   1.00 0.00 ? 13 THR A C    9  
ATOM   7456  O O    . THR A 1 13 ? -11.368 5.421   5.314   1.00 0.00 ? 13 THR A O    9  
ATOM   7457  C CB   . THR A 1 13 ? -13.712 5.002   3.384   1.00 0.00 ? 13 THR A CB   9  
ATOM   7458  O OG1  . THR A 1 13 ? -14.491 4.202   2.498   1.00 0.00 ? 13 THR A OG1  9  
ATOM   7459  C CG2  . THR A 1 13 ? -13.612 6.354   2.675   1.00 0.00 ? 13 THR A CG2  9  
ATOM   7460  H H    . THR A 1 13 ? -13.175 3.078   4.953   1.00 0.00 ? 13 THR A H    9  
ATOM   7461  H HA   . THR A 1 13 ? -12.021 4.052   2.445   1.00 0.00 ? 13 THR A HA   9  
ATOM   7462  H HB   . THR A 1 13 ? -14.146 5.114   4.377   1.00 0.00 ? 13 THR A HB   9  
ATOM   7463  H HG1  . THR A 1 13 ? -13.937 3.920   1.715   1.00 0.00 ? 13 THR A HG1  9  
ATOM   7464  H HG21 . THR A 1 13 ? -14.417 7.004   3.018   1.00 0.00 ? 13 THR A HG21 9  
ATOM   7465  H HG22 . THR A 1 13 ? -12.651 6.814   2.903   1.00 0.00 ? 13 THR A HG22 9  
ATOM   7466  N N    . CYS A 1 14 ? -10.245 5.417   3.351   1.00 0.00 ? 14 CYS A N    9  
ATOM   7467  C CA   . CYS A 1 14 ? -9.129  6.196   3.860   1.00 0.00 ? 14 CYS A CA   9  
ATOM   7468  C C    . CYS A 1 14 ? -9.628  7.609   4.164   1.00 0.00 ? 14 CYS A C    9  
ATOM   7469  O O    . CYS A 1 14 ? -10.021 8.341   3.257   1.00 0.00 ? 14 CYS A O    9  
ATOM   7470  C CB   . CYS A 1 14 ? -7.952  6.204   2.882   1.00 0.00 ? 14 CYS A CB   9  
ATOM   7471  S SG   . CYS A 1 14 ? -7.588  4.588   2.105   1.00 0.00 ? 14 CYS A SG   9  
ATOM   7472  H H    . CYS A 1 14 ? -10.171 5.151   2.389   1.00 0.00 ? 14 CYS A H    9  
ATOM   7473  H HA   . CYS A 1 14 ? -8.791  5.700   4.770   1.00 0.00 ? 14 CYS A HA   9  
ATOM   7474  H HB2  . CYS A 1 14 ? -8.156  6.931   2.096   1.00 0.00 ? 14 CYS A HB2  9  
ATOM   7475  H HB3  . CYS A 1 14 ? -7.062  6.546   3.409   1.00 0.00 ? 14 CYS A HB3  9  
ATOM   7476  N N    . PRO A 1 15 ? -9.596  7.960   5.477   1.00 0.00 ? 15 PRO A N    9  
ATOM   7477  C CA   . PRO A 1 15 ? -10.041 9.273   5.912   1.00 0.00 ? 15 PRO A CA   9  
ATOM   7478  C C    . PRO A 1 15 ? -9.007  10.346  5.565   1.00 0.00 ? 15 PRO A C    9  
ATOM   7479  O O    . PRO A 1 15 ? -7.882  10.027  5.183   1.00 0.00 ? 15 PRO A O    9  
ATOM   7480  C CB   . PRO A 1 15 ? -10.274 9.135   7.408   1.00 0.00 ? 15 PRO A CB   9  
ATOM   7481  C CG   . PRO A 1 15 ? -9.511  7.891   7.835   1.00 0.00 ? 15 PRO A CG   9  
ATOM   7482  C CD   . PRO A 1 15 ? -9.137  7.120   6.579   1.00 0.00 ? 15 PRO A CD   9  
ATOM   7483  H HA   . PRO A 1 15 ? -10.878 9.534   5.430   1.00 0.00 ? 15 PRO A HA   9  
ATOM   7484  H HB2  . PRO A 1 15 ? -9.916  10.015  7.942   1.00 0.00 ? 15 PRO A HB2  9  
ATOM   7485  H HB3  . PRO A 1 15 ? -11.336 9.037   7.631   1.00 0.00 ? 15 PRO A HB3  9  
ATOM   7486  H HG2  . PRO A 1 15 ? -8.617  8.165   8.394   1.00 0.00 ? 15 PRO A HG2  9  
ATOM   7487  H HG3  . PRO A 1 15 ? -10.123 7.275   8.493   1.00 0.00 ? 15 PRO A HG3  9  
ATOM   7488  H HD2  . PRO A 1 15 ? -8.062  6.948   6.525   1.00 0.00 ? 15 PRO A HD2  9  
ATOM   7489  H HD3  . PRO A 1 15 ? -9.618  6.141   6.558   1.00 0.00 ? 15 PRO A HD3  9  
ATOM   7490  N N    . ALA A 1 16 ? -9.425  11.595  5.709   1.00 0.00 ? 16 ALA A N    9  
ATOM   7491  C CA   . ALA A 1 16 ? -8.549  12.716  5.416   1.00 0.00 ? 16 ALA A CA   9  
ATOM   7492  C C    . ALA A 1 16 ? -7.140  12.404  5.926   1.00 0.00 ? 16 ALA A C    9  
ATOM   7493  O O    . ALA A 1 16 ? -6.969  11.575  6.819   1.00 0.00 ? 16 ALA A O    9  
ATOM   7494  C CB   . ALA A 1 16 ? -9.125  13.990  6.035   1.00 0.00 ? 16 ALA A CB   9  
ATOM   7495  H H    . ALA A 1 16 ? -10.342 11.845  6.020   1.00 0.00 ? 16 ALA A H    9  
ATOM   7496  H HA   . ALA A 1 16 ? -8.515  12.836  4.333   1.00 0.00 ? 16 ALA A HA   9  
ATOM   7497  H HB1  . ALA A 1 16 ? -8.759  14.096  7.056   1.00 0.00 ? 16 ALA A HB1  9  
ATOM   7498  H HB2  . ALA A 1 16 ? -8.813  14.853  5.447   1.00 0.00 ? 16 ALA A HB2  9  
ATOM   7499  N N    . GLY A 1 17 ? -6.168  13.086  5.338   1.00 0.00 ? 17 GLY A N    9  
ATOM   7500  C CA   . GLY A 1 17 ? -4.780  12.892  5.723   1.00 0.00 ? 17 GLY A CA   9  
ATOM   7501  C C    . GLY A 1 17 ? -4.139  11.765  4.911   1.00 0.00 ? 17 GLY A C    9  
ATOM   7502  O O    . GLY A 1 17 ? -2.994  11.881  4.477   1.00 0.00 ? 17 GLY A O    9  
ATOM   7503  H H    . GLY A 1 17 ? -6.316  13.758  4.613   1.00 0.00 ? 17 GLY A H    9  
ATOM   7504  H HA2  . GLY A 1 17 ? -4.224  13.817  5.569   1.00 0.00 ? 17 GLY A HA2  9  
ATOM   7505  H HA3  . GLY A 1 17 ? -4.723  12.658  6.786   1.00 0.00 ? 17 GLY A HA3  9  
ATOM   7506  N N    . LYS A 1 18 ? -4.904  10.699  4.732   1.00 0.00 ? 18 LYS A N    9  
ATOM   7507  C CA   . LYS A 1 18 ? -4.425  9.551   3.980   1.00 0.00 ? 18 LYS A CA   9  
ATOM   7508  C C    . LYS A 1 18 ? -5.334  9.323   2.771   1.00 0.00 ? 18 LYS A C    9  
ATOM   7509  O O    . LYS A 1 18 ? -6.391  8.706   2.891   1.00 0.00 ? 18 LYS A O    9  
ATOM   7510  C CB   . LYS A 1 18 ? -4.297  8.329   4.892   1.00 0.00 ? 18 LYS A CB   9  
ATOM   7511  C CG   . LYS A 1 18 ? -5.422  8.298   5.929   1.00 0.00 ? 18 LYS A CG   9  
ATOM   7512  C CD   . LYS A 1 18 ? -5.197  7.179   6.948   1.00 0.00 ? 18 LYS A CD   9  
ATOM   7513  C CE   . LYS A 1 18 ? -5.305  7.711   8.379   1.00 0.00 ? 18 LYS A CE   9  
ATOM   7514  N NZ   . LYS A 1 18 ? -4.185  8.633   8.674   1.00 0.00 ? 18 LYS A NZ   9  
ATOM   7515  H H    . LYS A 1 18 ? -5.835  10.612  5.088   1.00 0.00 ? 18 LYS A H    9  
ATOM   7516  H HA   . LYS A 1 18 ? -3.425  9.791   3.620   1.00 0.00 ? 18 LYS A HA   9  
ATOM   7517  H HB2  . LYS A 1 18 ? -4.325  7.419   4.293   1.00 0.00 ? 18 LYS A HB2  9  
ATOM   7518  H HB3  . LYS A 1 18 ? -3.331  8.348   5.398   1.00 0.00 ? 18 LYS A HB3  9  
ATOM   7519  H HG2  . LYS A 1 18 ? -5.473  9.258   6.443   1.00 0.00 ? 18 LYS A HG2  9  
ATOM   7520  H HG3  . LYS A 1 18 ? -6.379  8.153   5.428   1.00 0.00 ? 18 LYS A HG3  9  
ATOM   7521  H HD2  . LYS A 1 18 ? -5.932  6.389   6.794   1.00 0.00 ? 18 LYS A HD2  9  
ATOM   7522  H HD3  . LYS A 1 18 ? -4.214  6.734   6.794   1.00 0.00 ? 18 LYS A HD3  9  
ATOM   7523  H HE2  . LYS A 1 18 ? -6.255  8.229   8.510   1.00 0.00 ? 18 LYS A HE2  9  
ATOM   7524  H HE3  . LYS A 1 18 ? -5.295  6.880   9.084   1.00 0.00 ? 18 LYS A HE3  9  
ATOM   7525  H HZ1  . LYS A 1 18 ? -3.318  8.143   8.585   1.00 0.00 ? 18 LYS A HZ1  9  
ATOM   7526  H HZ2  . LYS A 1 18 ? -4.204  9.398   8.031   1.00 0.00 ? 18 LYS A HZ2  9  
ATOM   7527  N N    . ASN A 1 19 ? -4.889  9.834   1.632   1.00 0.00 ? 19 ASN A N    9  
ATOM   7528  C CA   . ASN A 1 19 ? -5.649  9.694   0.401   1.00 0.00 ? 19 ASN A CA   9  
ATOM   7529  C C    . ASN A 1 19 ? -4.912  8.741   -0.542  1.00 0.00 ? 19 ASN A C    9  
ATOM   7530  O O    . ASN A 1 19 ? -5.211  8.689   -1.734  1.00 0.00 ? 19 ASN A O    9  
ATOM   7531  C CB   . ASN A 1 19 ? -5.800  11.041  -0.309  1.00 0.00 ? 19 ASN A CB   9  
ATOM   7532  C CG   . ASN A 1 19 ? -7.063  11.768  0.157   1.00 0.00 ? 19 ASN A CG   9  
ATOM   7533  O OD1  . ASN A 1 19 ? -8.181  11.362  -0.115  1.00 0.00 ? 19 ASN A OD1  9  
ATOM   7534  N ND2  . ASN A 1 19 ? -6.823  12.863  0.872   1.00 0.00 ? 19 ASN A ND2  9  
ATOM   7535  H H    . ASN A 1 19 ? -4.028  10.335  1.542   1.00 0.00 ? 19 ASN A H    9  
ATOM   7536  H HA   . ASN A 1 19 ? -6.621  9.308   0.708   1.00 0.00 ? 19 ASN A HA   9  
ATOM   7537  H HB2  . ASN A 1 19 ? -4.925  11.660  -0.112  1.00 0.00 ? 19 ASN A HB2  9  
ATOM   7538  H HB3  . ASN A 1 19 ? -5.843  10.884  -1.387  1.00 0.00 ? 19 ASN A HB3  9  
ATOM   7539  H HD21 . ASN A 1 19 ? -5.881  13.142  1.060   1.00 0.00 ? 19 ASN A HD21 9  
ATOM   7540  H HD22 . ASN A 1 19 ? -7.585  13.408  1.223   1.00 0.00 ? 19 ASN A HD22 9  
ATOM   7541  N N    . LEU A 1 20 ? -3.964  8.012   0.027   1.00 0.00 ? 20 LEU A N    9  
ATOM   7542  C CA   . LEU A 1 20 ? -3.182  7.064   -0.749  1.00 0.00 ? 20 LEU A CA   9  
ATOM   7543  C C    . LEU A 1 20 ? -3.217  5.698   -0.062  1.00 0.00 ? 20 LEU A C    9  
ATOM   7544  O O    . LEU A 1 20 ? -2.976  5.597   1.140   1.00 0.00 ? 20 LEU A O    9  
ATOM   7545  C CB   . LEU A 1 20 ? -1.768  7.600   -0.982  1.00 0.00 ? 20 LEU A CB   9  
ATOM   7546  C CG   . LEU A 1 20 ? -1.660  8.848   -1.859  1.00 0.00 ? 20 LEU A CG   9  
ATOM   7547  C CD1  . LEU A 1 20 ? -0.649  9.840   -1.280  1.00 0.00 ? 20 LEU A CD1  9  
ATOM   7548  C CD2  . LEU A 1 20 ? -1.333  8.475   -3.307  1.00 0.00 ? 20 LEU A CD2  9  
ATOM   7549  H H    . LEU A 1 20 ? -3.728  8.060   0.997   1.00 0.00 ? 20 LEU A H    9  
ATOM   7550  H HA   . LEU A 1 20 ? -3.657  6.971   -1.726  1.00 0.00 ? 20 LEU A HA   9  
ATOM   7551  H HB2  . LEU A 1 20 ? -1.320  7.821   -0.013  1.00 0.00 ? 20 LEU A HB2  9  
ATOM   7552  H HB3  . LEU A 1 20 ? -1.172  6.808   -1.436  1.00 0.00 ? 20 LEU A HB3  9  
ATOM   7553  H HG   . LEU A 1 20 ? -2.630  9.346   -1.867  1.00 0.00 ? 20 LEU A HG   9  
ATOM   7554  H HD11 . LEU A 1 20 ? 0.358   9.436   -1.389  1.00 0.00 ? 20 LEU A HD11 9  
ATOM   7555  H HD12 . LEU A 1 20 ? -0.721  10.787  -1.815  1.00 0.00 ? 20 LEU A HD12 9  
ATOM   7556  H HD21 . LEU A 1 20 ? -0.480  7.796   -3.323  1.00 0.00 ? 20 LEU A HD21 9  
ATOM   7557  H HD22 . LEU A 1 20 ? -2.195  7.987   -3.760  1.00 0.00 ? 20 LEU A HD22 9  
ATOM   7558  N N    . CYS A 1 21 ? -3.519  4.679   -0.854  1.00 0.00 ? 21 CYS A N    9  
ATOM   7559  C CA   . CYS A 1 21 ? -3.588  3.323   -0.337  1.00 0.00 ? 21 CYS A CA   9  
ATOM   7560  C C    . CYS A 1 21 ? -2.220  2.665   -0.530  1.00 0.00 ? 21 CYS A C    9  
ATOM   7561  O O    . CYS A 1 21 ? -1.669  2.682   -1.629  1.00 0.00 ? 21 CYS A O    9  
ATOM   7562  C CB   . CYS A 1 21 ? -4.707  2.520   -1.003  1.00 0.00 ? 21 CYS A CB   9  
ATOM   7563  S SG   . CYS A 1 21 ? -6.368  3.281   -0.892  1.00 0.00 ? 21 CYS A SG   9  
ATOM   7564  H H    . CYS A 1 21 ? -3.713  4.770   -1.831  1.00 0.00 ? 21 CYS A H    9  
ATOM   7565  H HA   . CYS A 1 21 ? -3.832  3.404   0.722   1.00 0.00 ? 21 CYS A HA   9  
ATOM   7566  H HB2  . CYS A 1 21 ? -4.457  2.379   -2.054  1.00 0.00 ? 21 CYS A HB2  9  
ATOM   7567  H HB3  . CYS A 1 21 ? -4.745  1.530   -0.548  1.00 0.00 ? 21 CYS A HB3  9  
ATOM   7568  N N    . TYR A 1 22 ? -1.712  2.101   0.556   1.00 0.00 ? 22 TYR A N    9  
ATOM   7569  C CA   . TYR A 1 22 ? -0.419  1.438   0.520   1.00 0.00 ? 22 TYR A CA   9  
ATOM   7570  C C    . TYR A 1 22 ? -0.563  -0.059  0.801   1.00 0.00 ? 22 TYR A C    9  
ATOM   7571  O O    . TYR A 1 22 ? -1.475  -0.476  1.512   1.00 0.00 ? 22 TYR A O    9  
ATOM   7572  C CB   . TYR A 1 22 ? 0.413   2.076   1.633   1.00 0.00 ? 22 TYR A CB   9  
ATOM   7573  C CG   . TYR A 1 22 ? 0.158   1.482   3.020   1.00 0.00 ? 22 TYR A CG   9  
ATOM   7574  C CD1  . TYR A 1 22 ? 0.686   0.250   3.350   1.00 0.00 ? 22 TYR A CD1  9  
ATOM   7575  C CD2  . TYR A 1 22 ? -0.600  2.177   3.940   1.00 0.00 ? 22 TYR A CD2  9  
ATOM   7576  C CE1  . TYR A 1 22 ? 0.445   -0.309  4.655   1.00 0.00 ? 22 TYR A CE1  9  
ATOM   7577  C CE2  . TYR A 1 22 ? -0.841  1.617   5.245   1.00 0.00 ? 22 TYR A CE2  9  
ATOM   7578  C CZ   . TYR A 1 22 ? -0.306  0.402   5.538   1.00 0.00 ? 22 TYR A CZ   9  
ATOM   7579  O OH   . TYR A 1 22 ? -0.533  -0.127  6.770   1.00 0.00 ? 22 TYR A OH   9  
ATOM   7580  H H    . TYR A 1 22 ? -2.167  2.091   1.446   1.00 0.00 ? 22 TYR A H    9  
ATOM   7581  H HA   . TYR A 1 22 ? 0.001   1.575   -0.477  1.00 0.00 ? 22 TYR A HA   9  
ATOM   7582  H HB2  . TYR A 1 22 ? 1.470   1.967   1.391   1.00 0.00 ? 22 TYR A HB2  9  
ATOM   7583  H HB3  . TYR A 1 22 ? 0.202   3.145   1.663   1.00 0.00 ? 22 TYR A HB3  9  
ATOM   7584  H HD1  . TYR A 1 22 ? 1.284   -0.299  2.623   1.00 0.00 ? 22 TYR A HD1  9  
ATOM   7585  H HD2  . TYR A 1 22 ? -1.017  3.150   3.679   1.00 0.00 ? 22 TYR A HD2  9  
ATOM   7586  H HE1  . TYR A 1 22 ? 0.856   -1.281  4.929   1.00 0.00 ? 22 TYR A HE1  9  
ATOM   7587  H HE2  . TYR A 1 22 ? -1.438  2.156   5.981   1.00 0.00 ? 22 TYR A HE2  9  
ATOM   7588  H HH   . TYR A 1 22 ? -1.082  -0.958  6.690   1.00 0.00 ? 22 TYR A HH   9  
ATOM   7589  N N    . LYS A 1 23 ? 0.353   -0.826  0.227   1.00 0.00 ? 23 LYS A N    9  
ATOM   7590  C CA   . LYS A 1 23 ? 0.340   -2.268  0.407   1.00 0.00 ? 23 LYS A CA   9  
ATOM   7591  C C    . LYS A 1 23 ? 1.768   -2.760  0.653   1.00 0.00 ? 23 LYS A C    9  
ATOM   7592  O O    . LYS A 1 23 ? 2.662   -2.508  -0.153  1.00 0.00 ? 23 LYS A O    9  
ATOM   7593  C CB   . LYS A 1 23 ? -0.350  -2.950  -0.776  1.00 0.00 ? 23 LYS A CB   9  
ATOM   7594  C CG   . LYS A 1 23 ? 0.456   -2.761  -2.063  1.00 0.00 ? 23 LYS A CG   9  
ATOM   7595  C CD   . LYS A 1 23 ? -0.228  -3.453  -3.244  1.00 0.00 ? 23 LYS A CD   9  
ATOM   7596  C CE   . LYS A 1 23 ? 0.790   -3.834  -4.321  1.00 0.00 ? 23 LYS A CE   9  
ATOM   7597  N NZ   . LYS A 1 23 ? 0.283   -4.957  -5.140  1.00 0.00 ? 23 LYS A NZ   9  
ATOM   7598  H H    . LYS A 1 23 ? 1.092   -0.479  -0.350  1.00 0.00 ? 23 LYS A H    9  
ATOM   7599  H HA   . LYS A 1 23 ? -0.256  -2.481  1.294   1.00 0.00 ? 23 LYS A HA   9  
ATOM   7600  H HB2  . LYS A 1 23 ? -0.469  -4.013  -0.570  1.00 0.00 ? 23 LYS A HB2  9  
ATOM   7601  H HB3  . LYS A 1 23 ? -1.350  -2.537  -0.905  1.00 0.00 ? 23 LYS A HB3  9  
ATOM   7602  H HG2  . LYS A 1 23 ? 0.566   -1.698  -2.275  1.00 0.00 ? 23 LYS A HG2  9  
ATOM   7603  H HG3  . LYS A 1 23 ? 1.459   -3.166  -1.931  1.00 0.00 ? 23 LYS A HG3  9  
ATOM   7604  H HD2  . LYS A 1 23 ? -0.747  -4.347  -2.897  1.00 0.00 ? 23 LYS A HD2  9  
ATOM   7605  H HD3  . LYS A 1 23 ? -0.983  -2.792  -3.671  1.00 0.00 ? 23 LYS A HD3  9  
ATOM   7606  H HE2  . LYS A 1 23 ? 0.994   -2.974  -4.958  1.00 0.00 ? 23 LYS A HE2  9  
ATOM   7607  H HE3  . LYS A 1 23 ? 1.734   -4.115  -3.853  1.00 0.00 ? 23 LYS A HE3  9  
ATOM   7608  H HZ1  . LYS A 1 23 ? -0.468  -5.410  -4.658  1.00 0.00 ? 23 LYS A HZ1  9  
ATOM   7609  H HZ2  . LYS A 1 23 ? -0.048  -4.608  -6.017  1.00 0.00 ? 23 LYS A HZ2  9  
ATOM   7610  N N    . MET A 1 24 ? 1.937   -3.453  1.769   1.00 0.00 ? 24 MET A N    9  
ATOM   7611  C CA   . MET A 1 24 ? 3.241   -3.982  2.131   1.00 0.00 ? 24 MET A CA   9  
ATOM   7612  C C    . MET A 1 24 ? 3.257   -5.510  2.042   1.00 0.00 ? 24 MET A C    9  
ATOM   7613  O O    . MET A 1 24 ? 2.419   -6.179  2.644   1.00 0.00 ? 24 MET A O    9  
ATOM   7614  C CB   . MET A 1 24 ? 3.589   -3.551  3.557   1.00 0.00 ? 24 MET A CB   9  
ATOM   7615  C CG   . MET A 1 24 ? 3.745   -2.031  3.648   1.00 0.00 ? 24 MET A CG   9  
ATOM   7616  S SD   . MET A 1 24 ? 3.571   -1.500  5.343   1.00 0.00 ? 24 MET A SD   9  
ATOM   7617  C CE   . MET A 1 24 ? 5.240   -1.758  5.921   1.00 0.00 ? 24 MET A CE   9  
ATOM   7618  H H    . MET A 1 24 ? 1.204   -3.654  2.419   1.00 0.00 ? 24 MET A H    9  
ATOM   7619  H HA   . MET A 1 24 ? 3.939   -3.561  1.407   1.00 0.00 ? 24 MET A HA   9  
ATOM   7620  H HB2  . MET A 1 24 ? 2.809   -3.881  4.242   1.00 0.00 ? 24 MET A HB2  9  
ATOM   7621  H HB3  . MET A 1 24 ? 4.515   -4.034  3.871   1.00 0.00 ? 24 MET A HB3  9  
ATOM   7622  H HG2  . MET A 1 24 ? 4.720   -1.733  3.263   1.00 0.00 ? 24 MET A HG2  9  
ATOM   7623  H HG3  . MET A 1 24 ? 2.994   -1.543  3.026   1.00 0.00 ? 24 MET A HG3  9  
ATOM   7624  H HE1  . MET A 1 24 ? 5.369   -2.802  6.205   1.00 0.00 ? 24 MET A HE1  9  
ATOM   7625  H HE2  . MET A 1 24 ? 5.943   -1.508  5.126   1.00 0.00 ? 24 MET A HE2  9  
ATOM   7626  N N    . PHE A 1 25 ? 4.220   -6.016  1.285   1.00 0.00 ? 25 PHE A N    9  
ATOM   7627  C CA   . PHE A 1 25 ? 4.356   -7.452  1.109   1.00 0.00 ? 25 PHE A CA   9  
ATOM   7628  C C    . PHE A 1 25 ? 5.827   -7.870  1.134   1.00 0.00 ? 25 PHE A C    9  
ATOM   7629  O O    . PHE A 1 25 ? 6.718   -7.025  1.066   1.00 0.00 ? 25 PHE A O    9  
ATOM   7630  C CB   . PHE A 1 25 ? 3.764   -7.793  -0.260  1.00 0.00 ? 25 PHE A CB   9  
ATOM   7631  C CG   . PHE A 1 25 ? 4.450   -7.082  -1.429  1.00 0.00 ? 25 PHE A CG   9  
ATOM   7632  C CD1  . PHE A 1 25 ? 4.069   -5.824  -1.778  1.00 0.00 ? 25 PHE A CD1  9  
ATOM   7633  C CD2  . PHE A 1 25 ? 5.441   -7.709  -2.118  1.00 0.00 ? 25 PHE A CD2  9  
ATOM   7634  C CE1  . PHE A 1 25 ? 4.706   -5.165  -2.863  1.00 0.00 ? 25 PHE A CE1  9  
ATOM   7635  C CE2  . PHE A 1 25 ? 6.078   -7.050  -3.203  1.00 0.00 ? 25 PHE A CE2  9  
ATOM   7636  C CZ   . PHE A 1 25 ? 5.697   -5.792  -3.552  1.00 0.00 ? 25 PHE A CZ   9  
ATOM   7637  H H    . PHE A 1 25 ? 4.897   -5.464  0.799   1.00 0.00 ? 25 PHE A H    9  
ATOM   7638  H HA   . PHE A 1 25 ? 3.830   -7.931  1.935   1.00 0.00 ? 25 PHE A HA   9  
ATOM   7639  H HB2  . PHE A 1 25 ? 3.828   -8.870  -0.415  1.00 0.00 ? 25 PHE A HB2  9  
ATOM   7640  H HB3  . PHE A 1 25 ? 2.705   -7.533  -0.262  1.00 0.00 ? 25 PHE A HB3  9  
ATOM   7641  H HD1  . PHE A 1 25 ? 3.275   -5.322  -1.226  1.00 0.00 ? 25 PHE A HD1  9  
ATOM   7642  H HD2  . PHE A 1 25 ? 5.746   -8.717  -1.838  1.00 0.00 ? 25 PHE A HD2  9  
ATOM   7643  H HE1  . PHE A 1 25 ? 4.401   -4.157  -3.143  1.00 0.00 ? 25 PHE A HE1  9  
ATOM   7644  H HE2  . PHE A 1 25 ? 6.872   -7.552  -3.755  1.00 0.00 ? 25 PHE A HE2  9  
ATOM   7645  H HZ   . PHE A 1 25 ? 6.186   -5.286  -4.385  1.00 0.00 ? 25 PHE A HZ   9  
ATOM   7646  N N    . MET A 1 26 ? 6.037   -9.175  1.232   1.00 0.00 ? 26 MET A N    9  
ATOM   7647  C CA   . MET A 1 26 ? 7.385   -9.716  1.267   1.00 0.00 ? 26 MET A CA   9  
ATOM   7648  C C    . MET A 1 26 ? 7.877   -10.053 -0.142  1.00 0.00 ? 26 MET A C    9  
ATOM   7649  O O    . MET A 1 26 ? 7.086   -10.427 -1.007  1.00 0.00 ? 26 MET A O    9  
ATOM   7650  C CB   . MET A 1 26 ? 7.406   -10.978 2.131   1.00 0.00 ? 26 MET A CB   9  
ATOM   7651  C CG   . MET A 1 26 ? 7.096   -10.647 3.592   1.00 0.00 ? 26 MET A CG   9  
ATOM   7652  S SD   . MET A 1 26 ? 6.670   -12.137 4.479   1.00 0.00 ? 26 MET A SD   9  
ATOM   7653  C CE   . MET A 1 26 ? 6.631   -11.504 6.147   1.00 0.00 ? 26 MET A CE   9  
ATOM   7654  H H    . MET A 1 26 ? 5.307   -9.856  1.287   1.00 0.00 ? 26 MET A H    9  
ATOM   7655  H HA   . MET A 1 26 ? 8.005   -8.929  1.697   1.00 0.00 ? 26 MET A HA   9  
ATOM   7656  H HB2  . MET A 1 26 ? 6.677   -11.694 1.754   1.00 0.00 ? 26 MET A HB2  9  
ATOM   7657  H HB3  . MET A 1 26 ? 8.385   -11.453 2.062   1.00 0.00 ? 26 MET A HB3  9  
ATOM   7658  H HG2  . MET A 1 26 ? 7.959   -10.171 4.058   1.00 0.00 ? 26 MET A HG2  9  
ATOM   7659  H HG3  . MET A 1 26 ? 6.273   -9.935  3.646   1.00 0.00 ? 26 MET A HG3  9  
ATOM   7660  H HE1  . MET A 1 26 ? 5.970   -10.639 6.193   1.00 0.00 ? 26 MET A HE1  9  
ATOM   7661  H HE2  . MET A 1 26 ? 6.264   -12.278 6.821   1.00 0.00 ? 26 MET A HE2  9  
ATOM   7662  N N    . VAL A 1 27 ? 9.180   -9.909  -0.330  1.00 0.00 ? 27 VAL A N    9  
ATOM   7663  C CA   . VAL A 1 27 ? 9.787   -10.194 -1.619  1.00 0.00 ? 27 VAL A CA   9  
ATOM   7664  C C    . VAL A 1 27 ? 9.488   -11.643 -2.009  1.00 0.00 ? 27 VAL A C    9  
ATOM   7665  O O    . VAL A 1 27 ? 9.650   -12.023 -3.168  1.00 0.00 ? 27 VAL A O    9  
ATOM   7666  C CB   . VAL A 1 27 ? 11.285  -9.884  -1.572  1.00 0.00 ? 27 VAL A CB   9  
ATOM   7667  C CG1  . VAL A 1 27 ? 12.023  -10.878 -0.673  1.00 0.00 ? 27 VAL A CG1  9  
ATOM   7668  C CG2  . VAL A 1 27 ? 11.885  -9.867  -2.979  1.00 0.00 ? 27 VAL A CG2  9  
ATOM   7669  H H    . VAL A 1 27 ? 9.817   -9.604  0.379   1.00 0.00 ? 27 VAL A H    9  
ATOM   7670  H HA   . VAL A 1 27 ? 9.328   -9.531  -2.352  1.00 0.00 ? 27 VAL A HA   9  
ATOM   7671  H HB   . VAL A 1 27 ? 11.408  -8.890  -1.144  1.00 0.00 ? 27 VAL A HB   9  
ATOM   7672  H HG11 . VAL A 1 27 ? 11.693  -10.750 0.358   1.00 0.00 ? 27 VAL A HG11 9  
ATOM   7673  H HG12 . VAL A 1 27 ? 11.805  -11.895 -1.001  1.00 0.00 ? 27 VAL A HG12 9  
ATOM   7674  H HG21 . VAL A 1 27 ? 12.126  -8.841  -3.259  1.00 0.00 ? 27 VAL A HG21 9  
ATOM   7675  H HG22 . VAL A 1 27 ? 12.793  -10.470 -2.995  1.00 0.00 ? 27 VAL A HG22 9  
ATOM   7676  N N    . ALA A 1 28 ? 9.058   -12.412 -1.020  1.00 0.00 ? 28 ALA A N    9  
ATOM   7677  C CA   . ALA A 1 28 ? 8.735   -13.811 -1.246  1.00 0.00 ? 28 ALA A CA   9  
ATOM   7678  C C    . ALA A 1 28 ? 8.098   -13.966 -2.628  1.00 0.00 ? 28 ALA A C    9  
ATOM   7679  O O    . ALA A 1 28 ? 8.459   -14.867 -3.384  1.00 0.00 ? 28 ALA A O    9  
ATOM   7680  C CB   . ALA A 1 28 ? 7.823   -14.312 -0.124  1.00 0.00 ? 28 ALA A CB   9  
ATOM   7681  H H    . ALA A 1 28 ? 8.929   -12.095 -0.080  1.00 0.00 ? 28 ALA A H    9  
ATOM   7682  H HA   . ALA A 1 28 ? 9.667   -14.375 -1.218  1.00 0.00 ? 28 ALA A HA   9  
ATOM   7683  H HB1  . ALA A 1 28 ? 7.478   -15.319 -0.358  1.00 0.00 ? 28 ALA A HB1  9  
ATOM   7684  H HB2  . ALA A 1 28 ? 8.376   -14.326 0.815   1.00 0.00 ? 28 ALA A HB2  9  
ATOM   7685  N N    . ALA A 1 29 ? 7.161   -13.074 -2.916  1.00 0.00 ? 29 ALA A N    9  
ATOM   7686  C CA   . ALA A 1 29 ? 6.471   -13.101 -4.195  1.00 0.00 ? 29 ALA A CA   9  
ATOM   7687  C C    . ALA A 1 29 ? 5.822   -11.739 -4.447  1.00 0.00 ? 29 ALA A C    9  
ATOM   7688  O O    . ALA A 1 29 ? 5.512   -11.011 -3.506  1.00 0.00 ? 29 ALA A O    9  
ATOM   7689  C CB   . ALA A 1 29 ? 5.452   -14.243 -4.201  1.00 0.00 ? 29 ALA A CB   9  
ATOM   7690  H H    . ALA A 1 29 ? 6.874   -12.345 -2.296  1.00 0.00 ? 29 ALA A H    9  
ATOM   7691  H HA   . ALA A 1 29 ? 7.214   -13.290 -4.969  1.00 0.00 ? 29 ALA A HA   9  
ATOM   7692  H HB1  . ALA A 1 29 ? 5.744   -14.987 -4.942  1.00 0.00 ? 29 ALA A HB1  9  
ATOM   7693  H HB2  . ALA A 1 29 ? 5.419   -14.706 -3.214  1.00 0.00 ? 29 ALA A HB2  9  
ATOM   7694  N N    . PRO A 1 30 ? 5.631   -11.428 -5.757  1.00 0.00 ? 30 PRO A N    9  
ATOM   7695  C CA   . PRO A 1 30 ? 5.024   -10.166 -6.146  1.00 0.00 ? 30 PRO A CA   9  
ATOM   7696  C C    . PRO A 1 30 ? 3.515   -10.182 -5.894  1.00 0.00 ? 30 PRO A C    9  
ATOM   7697  O O    . PRO A 1 30 ? 2.819   -9.219  -6.211  1.00 0.00 ? 30 PRO A O    9  
ATOM   7698  C CB   . PRO A 1 30 ? 5.380   -9.994  -7.614  1.00 0.00 ? 30 PRO A CB   9  
ATOM   7699  C CG   . PRO A 1 30 ? 5.771   -11.376 -8.113  1.00 0.00 ? 30 PRO A CG   9  
ATOM   7700  C CD   . PRO A 1 30 ? 5.986   -12.265 -6.899  1.00 0.00 ? 30 PRO A CD   9  
ATOM   7701  H HA   . PRO A 1 30 ? 5.387   -9.420  -5.587  1.00 0.00 ? 30 PRO A HA   9  
ATOM   7702  H HB2  . PRO A 1 30 ? 4.534   -9.600  -8.177  1.00 0.00 ? 30 PRO A HB2  9  
ATOM   7703  H HB3  . PRO A 1 30 ? 6.201   -9.287  -7.737  1.00 0.00 ? 30 PRO A HB3  9  
ATOM   7704  H HG2  . PRO A 1 30 ? 4.990   -11.785 -8.753  1.00 0.00 ? 30 PRO A HG2  9  
ATOM   7705  H HG3  . PRO A 1 30 ? 6.679   -11.322 -8.712  1.00 0.00 ? 30 PRO A HG3  9  
ATOM   7706  H HD2  . PRO A 1 30 ? 5.361   -13.157 -6.946  1.00 0.00 ? 30 PRO A HD2  9  
ATOM   7707  H HD3  . PRO A 1 30 ? 7.020   -12.604 -6.835  1.00 0.00 ? 30 PRO A HD3  9  
ATOM   7708  N N    . HIS A 1 31 ? 3.054   -11.287 -5.327  1.00 0.00 ? 31 HIS A N    9  
ATOM   7709  C CA   . HIS A 1 31 ? 1.641   -11.442 -5.029  1.00 0.00 ? 31 HIS A CA   9  
ATOM   7710  C C    . HIS A 1 31 ? 1.474   -12.177 -3.697  1.00 0.00 ? 31 HIS A C    9  
ATOM   7711  O O    . HIS A 1 31 ? 0.836   -13.226 -3.639  1.00 0.00 ? 31 HIS A O    9  
ATOM   7712  C CB   . HIS A 1 31 ? 0.915   -12.135 -6.184  1.00 0.00 ? 31 HIS A CB   9  
ATOM   7713  C CG   . HIS A 1 31 ? -0.591  -12.048 -6.104  1.00 0.00 ? 31 HIS A CG   9  
ATOM   7714  N ND1  . HIS A 1 31 ? -1.313  -11.013 -6.672  1.00 0.00 ? 31 HIS A ND1  9  
ATOM   7715  C CD2  . HIS A 1 31 ? -1.502  -12.876 -5.517  1.00 0.00 ? 31 HIS A CD2  9  
ATOM   7716  C CE1  . HIS A 1 31 ? -2.599  -11.219 -6.432  1.00 0.00 ? 31 HIS A CE1  9  
ATOM   7717  N NE2  . HIS A 1 31 ? -2.714  -12.374 -5.716  1.00 0.00 ? 31 HIS A NE2  9  
ATOM   7718  H H    . HIS A 1 31 ? 3.627   -12.066 -5.072  1.00 0.00 ? 31 HIS A H    9  
ATOM   7719  H HA   . HIS A 1 31 ? 1.229   -10.437 -4.934  1.00 0.00 ? 31 HIS A HA   9  
ATOM   7720  H HB2  . HIS A 1 31 ? 1.245   -11.694 -7.124  1.00 0.00 ? 31 HIS A HB2  9  
ATOM   7721  H HB3  . HIS A 1 31 ? 1.207   -13.185 -6.204  1.00 0.00 ? 31 HIS A HB3  9  
ATOM   7722  H HD1  . HIS A 1 31 ? -0.928  -10.241 -7.178  1.00 0.00 ? 31 HIS A HD1  9  
ATOM   7723  H HD2  . HIS A 1 31 ? -1.272  -13.795 -4.977  1.00 0.00 ? 31 HIS A HD2  9  
ATOM   7724  H HE1  . HIS A 1 31 ? -3.421  -10.578 -6.751  1.00 0.00 ? 31 HIS A HE1  9  
ATOM   7725  N N    . VAL A 1 32 ? 2.060   -11.596 -2.660  1.00 0.00 ? 32 VAL A N    9  
ATOM   7726  C CA   . VAL A 1 32 ? 1.984   -12.182 -1.333  1.00 0.00 ? 32 VAL A CA   9  
ATOM   7727  C C    . VAL A 1 32 ? 1.974   -11.066 -0.287  1.00 0.00 ? 32 VAL A C    9  
ATOM   7728  O O    . VAL A 1 32 ? 2.997   -10.782 0.334   1.00 0.00 ? 32 VAL A O    9  
ATOM   7729  C CB   . VAL A 1 32 ? 3.130   -13.177 -1.135  1.00 0.00 ? 32 VAL A CB   9  
ATOM   7730  C CG1  . VAL A 1 32 ? 3.346   -13.474 0.351   1.00 0.00 ? 32 VAL A CG1  9  
ATOM   7731  C CG2  . VAL A 1 32 ? 2.880   -14.465 -1.921  1.00 0.00 ? 32 VAL A CG2  9  
ATOM   7732  H H    . VAL A 1 32 ? 2.577   -10.742 -2.716  1.00 0.00 ? 32 VAL A H    9  
ATOM   7733  H HA   . VAL A 1 32 ? 1.045   -12.732 -1.269  1.00 0.00 ? 32 VAL A HA   9  
ATOM   7734  H HB   . VAL A 1 32 ? 4.041   -12.720 -1.521  1.00 0.00 ? 32 VAL A HB   9  
ATOM   7735  H HG11 . VAL A 1 32 ? 3.342   -14.552 0.510   1.00 0.00 ? 32 VAL A HG11 9  
ATOM   7736  H HG12 . VAL A 1 32 ? 4.306   -13.064 0.667   1.00 0.00 ? 32 VAL A HG12 9  
ATOM   7737  H HG21 . VAL A 1 32 ? 3.163   -15.323 -1.312  1.00 0.00 ? 32 VAL A HG21 9  
ATOM   7738  H HG22 . VAL A 1 32 ? 1.822   -14.535 -2.177  1.00 0.00 ? 32 VAL A HG22 9  
ATOM   7739  N N    . PRO A 1 33 ? 0.775   -10.446 -0.120  1.00 0.00 ? 33 PRO A N    9  
ATOM   7740  C CA   . PRO A 1 33 ? 0.618   -9.367  0.841   1.00 0.00 ? 33 PRO A CA   9  
ATOM   7741  C C    . PRO A 1 33 ? 0.576   -9.908  2.271   1.00 0.00 ? 33 PRO A C    9  
ATOM   7742  O O    . PRO A 1 33 ? 0.109   -11.021 2.504   1.00 0.00 ? 33 PRO A O    9  
ATOM   7743  C CB   . PRO A 1 33 ? -0.667  -8.663  0.434   1.00 0.00 ? 33 PRO A CB   9  
ATOM   7744  C CG   . PRO A 1 33 ? -1.422  -9.647  -0.444  1.00 0.00 ? 33 PRO A CG   9  
ATOM   7745  C CD   . PRO A 1 33 ? -0.458  -10.754 -0.838  1.00 0.00 ? 33 PRO A CD   9  
ATOM   7746  H HA   . PRO A 1 33 ? 1.405   -8.752  0.803   1.00 0.00 ? 33 PRO A HA   9  
ATOM   7747  H HB2  . PRO A 1 33 ? -1.256  -8.389  1.310   1.00 0.00 ? 33 PRO A HB2  9  
ATOM   7748  H HB3  . PRO A 1 33 ? -0.453  -7.741  -0.107  1.00 0.00 ? 33 PRO A HB3  9  
ATOM   7749  H HG2  . PRO A 1 33 ? -2.278  -10.058 0.092   1.00 0.00 ? 33 PRO A HG2  9  
ATOM   7750  H HG3  . PRO A 1 33 ? -1.812  -9.147  -1.330  1.00 0.00 ? 33 PRO A HG3  9  
ATOM   7751  H HD2  . PRO A 1 33 ? -0.845  -11.734 -0.558  1.00 0.00 ? 33 PRO A HD2  9  
ATOM   7752  H HD3  . PRO A 1 33 ? -0.295  -10.773 -1.915  1.00 0.00 ? 33 PRO A HD3  9  
ATOM   7753  N N    . VAL A 1 34 ? 1.072   -9.094  3.192   1.00 0.00 ? 34 VAL A N    9  
ATOM   7754  C CA   . VAL A 1 34 ? 1.098   -9.477  4.593   1.00 0.00 ? 34 VAL A CA   9  
ATOM   7755  C C    . VAL A 1 34 ? 0.272   -8.478  5.406   1.00 0.00 ? 34 VAL A C    9  
ATOM   7756  O O    . VAL A 1 34 ? -0.474  -8.868  6.302   1.00 0.00 ? 34 VAL A O    9  
ATOM   7757  C CB   . VAL A 1 34 ? 2.545   -9.590  5.078   1.00 0.00 ? 34 VAL A CB   9  
ATOM   7758  C CG1  . VAL A 1 34 ? 3.221   -8.218  5.111   1.00 0.00 ? 34 VAL A CG1  9  
ATOM   7759  C CG2  . VAL A 1 34 ? 2.612   -10.268 6.448   1.00 0.00 ? 34 VAL A CG2  9  
ATOM   7760  H H    . VAL A 1 34 ? 1.451   -8.190  2.994   1.00 0.00 ? 34 VAL A H    9  
ATOM   7761  H HA   . VAL A 1 34 ? 0.637   -10.461 4.674   1.00 0.00 ? 34 VAL A HA   9  
ATOM   7762  H HB   . VAL A 1 34 ? 3.088   -10.214 4.369   1.00 0.00 ? 34 VAL A HB   9  
ATOM   7763  H HG11 . VAL A 1 34 ? 2.926   -7.689  6.017   1.00 0.00 ? 34 VAL A HG11 9  
ATOM   7764  H HG12 . VAL A 1 34 ? 4.304   -8.346  5.102   1.00 0.00 ? 34 VAL A HG12 9  
ATOM   7765  H HG21 . VAL A 1 34 ? 3.649   -10.312 6.781   1.00 0.00 ? 34 VAL A HG21 9  
ATOM   7766  H HG22 . VAL A 1 34 ? 2.025   -9.695  7.166   1.00 0.00 ? 34 VAL A HG22 9  
ATOM   7767  N N    . LYS A 1 35 ? 0.433   -7.208  5.063   1.00 0.00 ? 35 LYS A N    9  
ATOM   7768  C CA   . LYS A 1 35 ? -0.289  -6.150  5.749   1.00 0.00 ? 35 LYS A CA   9  
ATOM   7769  C C    . LYS A 1 35 ? -0.556  -5.004  4.771   1.00 0.00 ? 35 LYS A C    9  
ATOM   7770  O O    . LYS A 1 35 ? 0.169   -4.836  3.793   1.00 0.00 ? 35 LYS A O    9  
ATOM   7771  C CB   . LYS A 1 35 ? 0.463   -5.720  7.010   1.00 0.00 ? 35 LYS A CB   9  
ATOM   7772  C CG   . LYS A 1 35 ? -0.409  -4.819  7.887   1.00 0.00 ? 35 LYS A CG   9  
ATOM   7773  C CD   . LYS A 1 35 ? 0.353   -4.363  9.133   1.00 0.00 ? 35 LYS A CD   9  
ATOM   7774  C CE   . LYS A 1 35 ? 0.157   -5.349  10.286  1.00 0.00 ? 35 LYS A CE   9  
ATOM   7775  N NZ   . LYS A 1 35 ? 0.516   -4.717  11.576  1.00 0.00 ? 35 LYS A NZ   9  
ATOM   7776  H H    . LYS A 1 35 ? 1.042   -6.899  4.332   1.00 0.00 ? 35 LYS A H    9  
ATOM   7777  H HA   . LYS A 1 35 ? -1.246  -6.562  6.069   1.00 0.00 ? 35 LYS A HA   9  
ATOM   7778  H HB2  . LYS A 1 35 ? 0.765   -6.601  7.576   1.00 0.00 ? 35 LYS A HB2  9  
ATOM   7779  H HB3  . LYS A 1 35 ? 1.374   -5.191  6.733   1.00 0.00 ? 35 LYS A HB3  9  
ATOM   7780  H HG2  . LYS A 1 35 ? -0.730  -3.948  7.314   1.00 0.00 ? 35 LYS A HG2  9  
ATOM   7781  H HG3  . LYS A 1 35 ? -1.310  -5.355  8.183   1.00 0.00 ? 35 LYS A HG3  9  
ATOM   7782  H HD2  . LYS A 1 35 ? 1.415   -4.274  8.902   1.00 0.00 ? 35 LYS A HD2  9  
ATOM   7783  H HD3  . LYS A 1 35 ? 0.008   -3.374  9.434   1.00 0.00 ? 35 LYS A HD3  9  
ATOM   7784  H HE2  . LYS A 1 35 ? -0.880  -5.684  10.315  1.00 0.00 ? 35 LYS A HE2  9  
ATOM   7785  H HE3  . LYS A 1 35 ? 0.773   -6.234  10.125  1.00 0.00 ? 35 LYS A HE3  9  
ATOM   7786  H HZ1  . LYS A 1 35 ? -0.299  -4.646  12.150  1.00 0.00 ? 35 LYS A HZ1  9  
ATOM   7787  H HZ2  . LYS A 1 35 ? 1.204   -5.275  12.041  1.00 0.00 ? 35 LYS A HZ2  9  
ATOM   7788  N N    . ARG A 1 36 ? -1.600  -4.218  5.043   1.00 0.00 ? 36 ARG A N    9  
ATOM   7789  C CA   . ARG A 1 36 ? -1.958  -3.100  4.193   1.00 0.00 ? 36 ARG A CA   9  
ATOM   7790  C C    . ARG A 1 36 ? -2.721  -2.061  5.003   1.00 0.00 ? 36 ARG A C    9  
ATOM   7791  O O    . ARG A 1 36 ? -3.182  -2.347  6.105   1.00 0.00 ? 36 ARG A O    9  
ATOM   7792  C CB   . ARG A 1 36 ? -2.802  -3.601  3.025   1.00 0.00 ? 36 ARG A CB   9  
ATOM   7793  C CG   . ARG A 1 36 ? -2.010  -4.637  2.232   1.00 0.00 ? 36 ARG A CG   9  
ATOM   7794  C CD   . ARG A 1 36 ? -2.667  -4.847  0.871   1.00 0.00 ? 36 ARG A CD   9  
ATOM   7795  N NE   . ARG A 1 36 ? -3.826  -5.734  0.978   1.00 0.00 ? 36 ARG A NE   9  
ATOM   7796  C CZ   . ARG A 1 36 ? -4.295  -6.443  -0.057  1.00 0.00 ? 36 ARG A CZ   9  
ATOM   7797  N NH1  . ARG A 1 36 ? -3.699  -6.357  -1.254  1.00 0.00 ? 36 ARG A NH1  9  
ATOM   7798  N NH2  . ARG A 1 36 ? -5.362  -7.238  0.104   1.00 0.00 ? 36 ARG A NH2  9  
ATOM   7799  H H    . ARG A 1 36 ? -2.164  -4.400  5.860   1.00 0.00 ? 36 ARG A H    9  
ATOM   7800  H HA   . ARG A 1 36 ? -1.047  -2.646  3.803   1.00 0.00 ? 36 ARG A HA   9  
ATOM   7801  H HB2  . ARG A 1 36 ? -3.717  -4.055  3.405   1.00 0.00 ? 36 ARG A HB2  9  
ATOM   7802  H HB3  . ARG A 1 36 ? -3.056  -2.763  2.375   1.00 0.00 ? 36 ARG A HB3  9  
ATOM   7803  H HG2  . ARG A 1 36 ? -0.989  -4.283  2.091   1.00 0.00 ? 36 ARG A HG2  9  
ATOM   7804  H HG3  . ARG A 1 36 ? -1.997  -5.580  2.778   1.00 0.00 ? 36 ARG A HG3  9  
ATOM   7805  H HD2  . ARG A 1 36 ? -2.991  -3.883  0.477   1.00 0.00 ? 36 ARG A HD2  9  
ATOM   7806  H HD3  . ARG A 1 36 ? -1.942  -5.288  0.187   1.00 0.00 ? 36 ARG A HD3  9  
ATOM   7807  H HE   . ARG A 1 36 ? -4.282  -5.806  1.876   1.00 0.00 ? 36 ARG A HE   9  
ATOM   7808  H HH11 . ARG A 1 36 ? -2.894  -5.758  -1.375  1.00 0.00 ? 36 ARG A HH11 9  
ATOM   7809  H HH12 . ARG A 1 36 ? -4.053  -6.892  -2.034  1.00 0.00 ? 36 ARG A HH12 9  
ATOM   7810  H HH21 . ARG A 1 36 ? -5.812  -7.303  1.005   1.00 0.00 ? 36 ARG A HH21 9  
ATOM   7811  H HH22 . ARG A 1 36 ? -5.716  -7.773  -0.677  1.00 0.00 ? 36 ARG A HH22 9  
ATOM   7812  N N    . GLY A 1 37 ? -2.832  -0.872  4.426   1.00 0.00 ? 37 GLY A N    9  
ATOM   7813  C CA   . GLY A 1 37 ? -3.535  0.215   5.085   1.00 0.00 ? 37 GLY A CA   9  
ATOM   7814  C C    . GLY A 1 37 ? -3.507  1.484   4.231   1.00 0.00 ? 37 GLY A C    9  
ATOM   7815  O O    . GLY A 1 37 ? -3.167  1.433   3.050   1.00 0.00 ? 37 GLY A O    9  
ATOM   7816  H H    . GLY A 1 37 ? -2.453  -0.648  3.529   1.00 0.00 ? 37 GLY A H    9  
ATOM   7817  H HA2  . GLY A 1 37 ? -4.568  -0.077  5.275   1.00 0.00 ? 37 GLY A HA2  9  
ATOM   7818  H HA3  . GLY A 1 37 ? -3.077  0.415   6.054   1.00 0.00 ? 37 GLY A HA3  9  
ATOM   7819  N N    . CYS A 1 38 ? -3.869  2.591   4.861   1.00 0.00 ? 38 CYS A N    9  
ATOM   7820  C CA   . CYS A 1 38 ? -3.890  3.871   4.173   1.00 0.00 ? 38 CYS A CA   9  
ATOM   7821  C C    . CYS A 1 38 ? -2.852  4.785   4.827   1.00 0.00 ? 38 CYS A C    9  
ATOM   7822  O O    . CYS A 1 38 ? -2.515  4.610   5.997   1.00 0.00 ? 38 CYS A O    9  
ATOM   7823  C CB   . CYS A 1 38 ? -5.287  4.495   4.181   1.00 0.00 ? 38 CYS A CB   9  
ATOM   7824  S SG   . CYS A 1 38 ? -6.583  3.487   3.375   1.00 0.00 ? 38 CYS A SG   9  
ATOM   7825  H H    . CYS A 1 38 ? -4.144  2.624   5.822   1.00 0.00 ? 38 CYS A H    9  
ATOM   7826  H HA   . CYS A 1 38 ? -3.630  3.672   3.133   1.00 0.00 ? 38 CYS A HA   9  
ATOM   7827  H HB2  . CYS A 1 38 ? -5.580  4.680   5.215   1.00 0.00 ? 38 CYS A HB2  9  
ATOM   7828  H HB3  . CYS A 1 38 ? -5.239  5.465   3.685   1.00 0.00 ? 38 CYS A HB3  9  
ATOM   7829  N N    . ILE A 1 39 ? -2.375  5.742   4.044   1.00 0.00 ? 39 ILE A N    9  
ATOM   7830  C CA   . ILE A 1 39 ? -1.383  6.684   4.533   1.00 0.00 ? 39 ILE A CA   9  
ATOM   7831  C C    . ILE A 1 39 ? -1.323  7.888   3.591   1.00 0.00 ? 39 ILE A C    9  
ATOM   7832  O O    . ILE A 1 39 ? -2.148  8.017   2.689   1.00 0.00 ? 39 ILE A O    9  
ATOM   7833  C CB   . ILE A 1 39 ? -0.034  5.988   4.728   1.00 0.00 ? 39 ILE A CB   9  
ATOM   7834  C CG1  . ILE A 1 39 ? 0.774   6.661   5.839   1.00 0.00 ? 39 ILE A CG1  9  
ATOM   7835  C CG2  . ILE A 1 39 ? 0.744   5.921   3.412   1.00 0.00 ? 39 ILE A CG2  9  
ATOM   7836  C CD1  . ILE A 1 39 ? 1.065   5.681   6.977   1.00 0.00 ? 39 ILE A CD1  9  
ATOM   7837  H H    . ILE A 1 39 ? -2.655  5.878   3.093   1.00 0.00 ? 39 ILE A H    9  
ATOM   7838  H HA   . ILE A 1 39 ? -1.713  7.027   5.513   1.00 0.00 ? 39 ILE A HA   9  
ATOM   7839  H HB   . ILE A 1 39 ? -0.222  4.962   5.043   1.00 0.00 ? 39 ILE A HB   9  
ATOM   7840  H HG12 . ILE A 1 39 ? 1.712   7.040   5.432   1.00 0.00 ? 39 ILE A HG12 9  
ATOM   7841  H HG13 . ILE A 1 39 ? 0.224   7.519   6.225   1.00 0.00 ? 39 ILE A HG13 9  
ATOM   7842  H HG21 . ILE A 1 39 ? 1.705   5.436   3.583   1.00 0.00 ? 39 ILE A HG21 9  
ATOM   7843  H HG22 . ILE A 1 39 ? 0.173   5.350   2.681   1.00 0.00 ? 39 ILE A HG22 9  
ATOM   7844  H HD11 . ILE A 1 39 ? 1.170   6.230   7.912   1.00 0.00 ? 39 ILE A HD11 9  
ATOM   7845  H HD12 . ILE A 1 39 ? 0.242   4.971   7.063   1.00 0.00 ? 39 ILE A HD12 9  
ATOM   7846  N N    . ASP A 1 40 ? -0.342  8.767   3.807   1.00 0.00 ? 40 ASP A N    9  
ATOM   7847  C CA   . ASP A 1 40 ? -0.180  9.950   2.985   1.00 0.00 ? 40 ASP A CA   9  
ATOM   7848  C C    . ASP A 1 40 ? 1.130   9.865   2.215   1.00 0.00 ? 40 ASP A C    9  
ATOM   7849  O O    . ASP A 1 40 ? 1.168   10.146  1.019   1.00 0.00 ? 40 ASP A O    9  
ATOM   7850  C CB   . ASP A 1 40 ? -0.208  11.192  3.871   1.00 0.00 ? 40 ASP A CB   9  
ATOM   7851  C CG   . ASP A 1 40 ? -0.430  12.448  3.040   1.00 0.00 ? 40 ASP A CG   9  
ATOM   7852  O OD1  . ASP A 1 40 ? 0.258   12.571  2.003   1.00 0.00 ? 40 ASP A OD1  9  
ATOM   7853  O OD2  . ASP A 1 40 ? -1.282  13.261  3.457   1.00 0.00 ? 40 ASP A OD2  9  
ATOM   7854  H H    . ASP A 1 40 ? 0.311   8.615   4.563   1.00 0.00 ? 40 ASP A H    9  
ATOM   7855  H HA   . ASP A 1 40 ? -1.005  10.003  2.275   1.00 0.00 ? 40 ASP A HA   9  
ATOM   7856  H HB2  . ASP A 1 40 ? -1.015  11.096  4.597   1.00 0.00 ? 40 ASP A HB2  9  
ATOM   7857  H HB3  . ASP A 1 40 ? 0.742   11.276  4.399   1.00 0.00 ? 40 ASP A HB3  9  
ATOM   7858  H HD2  . ASP A 1 40 ? -1.376  14.030  2.890   1.00 0.00 ? 40 ASP A HD2  9  
ATOM   7859  N N    . VAL A 1 41 ? 2.177   9.477   2.929   1.00 0.00 ? 41 VAL A N    9  
ATOM   7860  C CA   . VAL A 1 41 ? 3.491   9.353   2.323   1.00 0.00 ? 41 VAL A CA   9  
ATOM   7861  C C    . VAL A 1 41 ? 3.897   7.878   2.294   1.00 0.00 ? 41 VAL A C    9  
ATOM   7862  O O    . VAL A 1 41 ? 3.766   7.174   3.294   1.00 0.00 ? 41 VAL A O    9  
ATOM   7863  C CB   . VAL A 1 41 ? 4.496   10.235  3.066   1.00 0.00 ? 41 VAL A CB   9  
ATOM   7864  C CG1  . VAL A 1 41 ? 5.925   9.955   2.595   1.00 0.00 ? 41 VAL A CG1  9  
ATOM   7865  C CG2  . VAL A 1 41 ? 4.147   11.716  2.908   1.00 0.00 ? 41 VAL A CG2  9  
ATOM   7866  H H    . VAL A 1 41 ? 2.137   9.250   3.902   1.00 0.00 ? 41 VAL A H    9  
ATOM   7867  H HA   . VAL A 1 41 ? 3.416   9.716   1.298   1.00 0.00 ? 41 VAL A HA   9  
ATOM   7868  H HB   . VAL A 1 41 ? 4.439   9.989   4.126   1.00 0.00 ? 41 VAL A HB   9  
ATOM   7869  H HG11 . VAL A 1 41 ? 6.464   9.414   3.372   1.00 0.00 ? 41 VAL A HG11 9  
ATOM   7870  H HG12 . VAL A 1 41 ? 5.897   9.353   1.686   1.00 0.00 ? 41 VAL A HG12 9  
ATOM   7871  H HG21 . VAL A 1 41 ? 4.056   12.175  3.893   1.00 0.00 ? 41 VAL A HG21 9  
ATOM   7872  H HG22 . VAL A 1 41 ? 4.935   12.217  2.346   1.00 0.00 ? 41 VAL A HG22 9  
ATOM   7873  N N    . CYS A 1 42 ? 4.383   7.453   1.136   1.00 0.00 ? 42 CYS A N    9  
ATOM   7874  C CA   . CYS A 1 42 ? 4.809   6.075   0.964   1.00 0.00 ? 42 CYS A CA   9  
ATOM   7875  C C    . CYS A 1 42 ? 6.317   6.003   1.214   1.00 0.00 ? 42 CYS A C    9  
ATOM   7876  O O    . CYS A 1 42 ? 7.068   6.860   0.750   1.00 0.00 ? 42 CYS A O    9  
ATOM   7877  C CB   . CYS A 1 42 ? 4.433   5.535   -0.418  1.00 0.00 ? 42 CYS A CB   9  
ATOM   7878  S SG   . CYS A 1 42 ? 3.664   3.875   -0.410  1.00 0.00 ? 42 CYS A SG   9  
ATOM   7879  H H    . CYS A 1 42 ? 4.486   8.032   0.327   1.00 0.00 ? 42 CYS A H    9  
ATOM   7880  H HA   . CYS A 1 42 ? 4.266   5.485   1.702   1.00 0.00 ? 42 CYS A HA   9  
ATOM   7881  H HB2  . CYS A 1 42 ? 3.746   6.236   -0.892  1.00 0.00 ? 42 CYS A HB2  9  
ATOM   7882  H HB3  . CYS A 1 42 ? 5.330   5.501   -1.035  1.00 0.00 ? 42 CYS A HB3  9  
ATOM   7883  N N    . PRO A 1 43 ? 6.725   4.946   1.965   1.00 0.00 ? 43 PRO A N    9  
ATOM   7884  C CA   . PRO A 1 43 ? 8.130   4.751   2.282   1.00 0.00 ? 43 PRO A CA   9  
ATOM   7885  C C    . PRO A 1 43 ? 8.899   4.230   1.067   1.00 0.00 ? 43 PRO A C    9  
ATOM   7886  O O    . PRO A 1 43 ? 8.299   3.741   0.111   1.00 0.00 ? 43 PRO A O    9  
ATOM   7887  C CB   . PRO A 1 43 ? 8.138   3.781   3.452   1.00 0.00 ? 43 PRO A CB   9  
ATOM   7888  C CG   . PRO A 1 43 ? 6.774   3.110   3.447   1.00 0.00 ? 43 PRO A CG   9  
ATOM   7889  C CD   . PRO A 1 43 ? 5.864   3.911   2.530   1.00 0.00 ? 43 PRO A CD   9  
ATOM   7890  H HA   . PRO A 1 43 ? 8.556   5.624   2.521   1.00 0.00 ? 43 PRO A HA   9  
ATOM   7891  H HB2  . PRO A 1 43 ? 8.936   3.046   3.344   1.00 0.00 ? 43 PRO A HB2  9  
ATOM   7892  H HB3  . PRO A 1 43 ? 8.313   4.304   4.392   1.00 0.00 ? 43 PRO A HB3  9  
ATOM   7893  H HG2  . PRO A 1 43 ? 6.857   2.081   3.098   1.00 0.00 ? 43 PRO A HG2  9  
ATOM   7894  H HG3  . PRO A 1 43 ? 6.363   3.073   4.456   1.00 0.00 ? 43 PRO A HG3  9  
ATOM   7895  H HD2  . PRO A 1 43 ? 5.435   3.283   1.750   1.00 0.00 ? 43 PRO A HD2  9  
ATOM   7896  H HD3  . PRO A 1 43 ? 5.031   4.347   3.082   1.00 0.00 ? 43 PRO A HD3  9  
ATOM   7897  N N    . LYS A 1 44 ? 10.216  4.351   1.143   1.00 0.00 ? 44 LYS A N    9  
ATOM   7898  C CA   . LYS A 1 44 ? 11.074  3.898   0.061   1.00 0.00 ? 44 LYS A CA   9  
ATOM   7899  C C    . LYS A 1 44 ? 11.065  2.369   0.016   1.00 0.00 ? 44 LYS A C    9  
ATOM   7900  O O    . LYS A 1 44 ? 11.057  1.713   1.057   1.00 0.00 ? 44 LYS A O    9  
ATOM   7901  C CB   . LYS A 1 44 ? 12.473  4.501   0.199   1.00 0.00 ? 44 LYS A CB   9  
ATOM   7902  C CG   . LYS A 1 44 ? 13.407  3.973   -0.893  1.00 0.00 ? 44 LYS A CG   9  
ATOM   7903  C CD   . LYS A 1 44 ? 14.062  5.125   -1.658  1.00 0.00 ? 44 LYS A CD   9  
ATOM   7904  C CE   . LYS A 1 44 ? 15.446  4.725   -2.172  1.00 0.00 ? 44 LYS A CE   9  
ATOM   7905  N NZ   . LYS A 1 44 ? 16.293  5.923   -2.366  1.00 0.00 ? 44 LYS A NZ   9  
ATOM   7906  H H    . LYS A 1 44 ? 10.696  4.750   1.924   1.00 0.00 ? 44 LYS A H    9  
ATOM   7907  H HA   . LYS A 1 44 ? 10.651  4.274   -0.870  1.00 0.00 ? 44 LYS A HA   9  
ATOM   7908  H HB2  . LYS A 1 44 ? 12.413  5.587   0.137   1.00 0.00 ? 44 LYS A HB2  9  
ATOM   7909  H HB3  . LYS A 1 44 ? 12.882  4.260   1.180   1.00 0.00 ? 44 LYS A HB3  9  
ATOM   7910  H HG2  . LYS A 1 44 ? 14.177  3.345   -0.445  1.00 0.00 ? 44 LYS A HG2  9  
ATOM   7911  H HG3  . LYS A 1 44 ? 12.845  3.345   -1.584  1.00 0.00 ? 44 LYS A HG3  9  
ATOM   7912  H HD2  . LYS A 1 44 ? 13.428  5.416   -2.496  1.00 0.00 ? 44 LYS A HD2  9  
ATOM   7913  H HD3  . LYS A 1 44 ? 14.149  5.995   -1.008  1.00 0.00 ? 44 LYS A HD3  9  
ATOM   7914  H HE2  . LYS A 1 44 ? 15.921  4.046   -1.464  1.00 0.00 ? 44 LYS A HE2  9  
ATOM   7915  H HE3  . LYS A 1 44 ? 15.348  4.185   -3.114  1.00 0.00 ? 44 LYS A HE3  9  
ATOM   7916  H HZ1  . LYS A 1 44 ? 17.115  5.671   -2.877  1.00 0.00 ? 44 LYS A HZ1  9  
ATOM   7917  H HZ2  . LYS A 1 44 ? 15.782  6.614   -2.876  1.00 0.00 ? 44 LYS A HZ2  9  
ATOM   7918  N N    . SER A 1 45 ? 11.066  1.845   -1.201  1.00 0.00 ? 45 SER A N    9  
ATOM   7919  C CA   . SER A 1 45 ? 11.058  0.405   -1.396  1.00 0.00 ? 45 SER A CA   9  
ATOM   7920  C C    . SER A 1 45 ? 12.446  -0.170  -1.107  1.00 0.00 ? 45 SER A C    9  
ATOM   7921  O O    . SER A 1 45 ? 13.458  0.456   -1.416  1.00 0.00 ? 45 SER A O    9  
ATOM   7922  C CB   . SER A 1 45 ? 10.620  0.044   -2.817  1.00 0.00 ? 45 SER A CB   9  
ATOM   7923  O OG   . SER A 1 45 ? 9.210   -0.145  -2.909  1.00 0.00 ? 45 SER A OG   9  
ATOM   7924  H H    . SER A 1 45 ? 11.072  2.385   -2.043  1.00 0.00 ? 45 SER A H    9  
ATOM   7925  H HA   . SER A 1 45 ? 10.329  0.021   -0.683  1.00 0.00 ? 45 SER A HA   9  
ATOM   7926  H HB2  . SER A 1 45 ? 10.925  0.834   -3.502  1.00 0.00 ? 45 SER A HB2  9  
ATOM   7927  H HB3  . SER A 1 45 ? 11.129  -0.866  -3.133  1.00 0.00 ? 45 SER A HB3  9  
ATOM   7928  H HG   . SER A 1 45 ? 8.954   -0.351  -3.853  1.00 0.00 ? 45 SER A HG   9  
ATOM   7929  N N    . SER A 1 46 ? 12.449  -1.356  -0.516  1.00 0.00 ? 46 SER A N    9  
ATOM   7930  C CA   . SER A 1 46 ? 13.696  -2.023  -0.181  1.00 0.00 ? 46 SER A CA   9  
ATOM   7931  C C    . SER A 1 46 ? 13.781  -3.368  -0.905  1.00 0.00 ? 46 SER A C    9  
ATOM   7932  O O    . SER A 1 46 ? 12.855  -3.753  -1.617  1.00 0.00 ? 46 SER A O    9  
ATOM   7933  C CB   . SER A 1 46 ? 13.824  -2.224  1.330   1.00 0.00 ? 46 SER A CB   9  
ATOM   7934  O OG   . SER A 1 46 ? 12.905  -3.197  1.819   1.00 0.00 ? 46 SER A OG   9  
ATOM   7935  H H    . SER A 1 46 ? 11.621  -1.859  -0.268  1.00 0.00 ? 46 SER A H    9  
ATOM   7936  H HA   . SER A 1 46 ? 14.483  -1.352  -0.526  1.00 0.00 ? 46 SER A HA   9  
ATOM   7937  H HB2  . SER A 1 46 ? 14.842  -2.534  1.569   1.00 0.00 ? 46 SER A HB2  9  
ATOM   7938  H HB3  . SER A 1 46 ? 13.653  -1.275  1.838   1.00 0.00 ? 46 SER A HB3  9  
ATOM   7939  H HG   . SER A 1 46 ? 12.334  -3.534  1.071   1.00 0.00 ? 46 SER A HG   9  
ATOM   7940  N N    . LEU A 1 47 ? 14.900  -4.045  -0.698  1.00 0.00 ? 47 LEU A N    9  
ATOM   7941  C CA   . LEU A 1 47 ? 15.118  -5.340  -1.322  1.00 0.00 ? 47 LEU A CA   9  
ATOM   7942  C C    . LEU A 1 47 ? 14.317  -6.405  -0.570  1.00 0.00 ? 47 LEU A C    9  
ATOM   7943  O O    . LEU A 1 47 ? 13.495  -7.101  -1.164  1.00 0.00 ? 47 LEU A O    9  
ATOM   7944  C CB   . LEU A 1 47 ? 16.614  -5.646  -1.412  1.00 0.00 ? 47 LEU A CB   9  
ATOM   7945  C CG   . LEU A 1 47 ? 17.377  -4.940  -2.535  1.00 0.00 ? 47 LEU A CG   9  
ATOM   7946  C CD1  . LEU A 1 47 ? 18.856  -4.781  -2.178  1.00 0.00 ? 47 LEU A CD1  9  
ATOM   7947  C CD2  . LEU A 1 47 ? 17.184  -5.666  -3.868  1.00 0.00 ? 47 LEU A CD2  9  
ATOM   7948  H H    . LEU A 1 47 ? 15.648  -3.725  -0.117  1.00 0.00 ? 47 LEU A H    9  
ATOM   7949  H HA   . LEU A 1 47 ? 14.740  -5.278  -2.342  1.00 0.00 ? 47 LEU A HA   9  
ATOM   7950  H HB2  . LEU A 1 47 ? 17.078  -5.379  -0.462  1.00 0.00 ? 47 LEU A HB2  9  
ATOM   7951  H HB3  . LEU A 1 47 ? 16.738  -6.722  -1.535  1.00 0.00 ? 47 LEU A HB3  9  
ATOM   7952  H HG   . LEU A 1 47 ? 16.964  -3.938  -2.651  1.00 0.00 ? 47 LEU A HG   9  
ATOM   7953  H HD11 . LEU A 1 47 ? 19.373  -4.270  -2.990  1.00 0.00 ? 47 LEU A HD11 9  
ATOM   7954  H HD12 . LEU A 1 47 ? 18.948  -4.195  -1.263  1.00 0.00 ? 47 LEU A HD12 9  
ATOM   7955  H HD21 . LEU A 1 47 ? 17.049  -6.732  -3.686  1.00 0.00 ? 47 LEU A HD21 9  
ATOM   7956  H HD22 . LEU A 1 47 ? 16.303  -5.269  -4.374  1.00 0.00 ? 47 LEU A HD22 9  
ATOM   7957  N N    . LEU A 1 48 ? 14.584  -6.497  0.724   1.00 0.00 ? 48 LEU A N    9  
ATOM   7958  C CA   . LEU A 1 48 ? 13.898  -7.465  1.563   1.00 0.00 ? 48 LEU A CA   9  
ATOM   7959  C C    . LEU A 1 48 ? 12.391  -7.372  1.313   1.00 0.00 ? 48 LEU A C    9  
ATOM   7960  O O    . LEU A 1 48 ? 11.767  -8.345  0.893   1.00 0.00 ? 48 LEU A O    9  
ATOM   7961  C CB   . LEU A 1 48 ? 14.292  -7.278  3.029   1.00 0.00 ? 48 LEU A CB   9  
ATOM   7962  C CG   . LEU A 1 48 ? 13.655  -8.251  4.024   1.00 0.00 ? 48 LEU A CG   9  
ATOM   7963  C CD1  . LEU A 1 48 ? 14.248  -9.654  3.875   1.00 0.00 ? 48 LEU A CD1  9  
ATOM   7964  C CD2  . LEU A 1 48 ? 13.775  -7.727  5.456   1.00 0.00 ? 48 LEU A CD2  9  
ATOM   7965  H H    . LEU A 1 48 ? 15.254  -5.927  1.199   1.00 0.00 ? 48 LEU A H    9  
ATOM   7966  H HA   . LEU A 1 48 ? 14.237  -8.457  1.262   1.00 0.00 ? 48 LEU A HA   9  
ATOM   7967  H HB2  . LEU A 1 48 ? 15.375  -7.366  3.108   1.00 0.00 ? 48 LEU A HB2  9  
ATOM   7968  H HB3  . LEU A 1 48 ? 14.032  -6.263  3.328   1.00 0.00 ? 48 LEU A HB3  9  
ATOM   7969  H HG   . LEU A 1 48 ? 12.592  -8.325  3.796   1.00 0.00 ? 48 LEU A HG   9  
ATOM   7970  H HD11 . LEU A 1 48 ? 13.816  -10.313 4.628   1.00 0.00 ? 48 LEU A HD11 9  
ATOM   7971  H HD12 . LEU A 1 48 ? 14.022  -10.040 2.881   1.00 0.00 ? 48 LEU A HD12 9  
ATOM   7972  H HD21 . LEU A 1 48 ? 14.650  -7.082  5.535   1.00 0.00 ? 48 LEU A HD21 9  
ATOM   7973  H HD22 . LEU A 1 48 ? 12.880  -7.159  5.711   1.00 0.00 ? 48 LEU A HD22 9  
ATOM   7974  N N    . VAL A 1 49 ? 11.851  -6.193  1.584   1.00 0.00 ? 49 VAL A N    9  
ATOM   7975  C CA   . VAL A 1 49 ? 10.429  -5.961  1.394   1.00 0.00 ? 49 VAL A CA   9  
ATOM   7976  C C    . VAL A 1 49 ? 10.232  -4.809  0.406   1.00 0.00 ? 49 VAL A C    9  
ATOM   7977  O O    . VAL A 1 49 ? 11.119  -3.973  0.238   1.00 0.00 ? 49 VAL A O    9  
ATOM   7978  C CB   . VAL A 1 49 ? 9.755   -5.711  2.745   1.00 0.00 ? 49 VAL A CB   9  
ATOM   7979  C CG1  . VAL A 1 49 ? 9.744   -6.984  3.595   1.00 0.00 ? 49 VAL A CG1  9  
ATOM   7980  C CG2  . VAL A 1 49 ? 10.431  -4.559  3.491   1.00 0.00 ? 49 VAL A CG2  9  
ATOM   7981  H H    . VAL A 1 49 ? 12.366  -5.407  1.926   1.00 0.00 ? 49 VAL A H    9  
ATOM   7982  H HA   . VAL A 1 49 ? 10.002  -6.867  0.966   1.00 0.00 ? 49 VAL A HA   9  
ATOM   7983  H HB   . VAL A 1 49 ? 8.720   -5.426  2.556   1.00 0.00 ? 49 VAL A HB   9  
ATOM   7984  H HG11 . VAL A 1 49 ? 8.889   -7.600  3.316   1.00 0.00 ? 49 VAL A HG11 9  
ATOM   7985  H HG12 . VAL A 1 49 ? 10.665  -7.542  3.427   1.00 0.00 ? 49 VAL A HG12 9  
ATOM   7986  H HG21 . VAL A 1 49 ? 11.502  -4.750  3.561   1.00 0.00 ? 49 VAL A HG21 9  
ATOM   7987  H HG22 . VAL A 1 49 ? 10.263  -3.628  2.950   1.00 0.00 ? 49 VAL A HG22 9  
ATOM   7988  N N    . LYS A 1 50 ? 9.065   -4.803  -0.220  1.00 0.00 ? 50 LYS A N    9  
ATOM   7989  C CA   . LYS A 1 50 ? 8.741   -3.767  -1.187  1.00 0.00 ? 50 LYS A CA   9  
ATOM   7990  C C    . LYS A 1 50 ? 7.344   -3.219  -0.891  1.00 0.00 ? 50 LYS A C    9  
ATOM   7991  O O    . LYS A 1 50 ? 6.502   -3.921  -0.333  1.00 0.00 ? 50 LYS A O    9  
ATOM   7992  C CB   . LYS A 1 50 ? 8.904   -4.296  -2.614  1.00 0.00 ? 50 LYS A CB   9  
ATOM   7993  C CG   . LYS A 1 50 ? 10.288  -3.955  -3.170  1.00 0.00 ? 50 LYS A CG   9  
ATOM   7994  C CD   . LYS A 1 50 ? 10.175  -3.182  -4.485  1.00 0.00 ? 50 LYS A CD   9  
ATOM   7995  C CE   . LYS A 1 50 ? 11.559  -2.833  -5.036  1.00 0.00 ? 50 LYS A CE   9  
ATOM   7996  N NZ   . LYS A 1 50 ? 11.606  -3.056  -6.499  1.00 0.00 ? 50 LYS A NZ   9  
ATOM   7997  H H    . LYS A 1 50 ? 8.349   -5.486  -0.077  1.00 0.00 ? 50 LYS A H    9  
ATOM   7998  H HA   . LYS A 1 50 ? 9.463   -2.962  -1.058  1.00 0.00 ? 50 LYS A HA   9  
ATOM   7999  H HB2  . LYS A 1 50 ? 8.760   -5.377  -2.624  1.00 0.00 ? 50 LYS A HB2  9  
ATOM   8000  H HB3  . LYS A 1 50 ? 8.134   -3.867  -3.255  1.00 0.00 ? 50 LYS A HB3  9  
ATOM   8001  H HG2  . LYS A 1 50 ? 10.840  -3.362  -2.441  1.00 0.00 ? 50 LYS A HG2  9  
ATOM   8002  H HG3  . LYS A 1 50 ? 10.855  -4.872  -3.330  1.00 0.00 ? 50 LYS A HG3  9  
ATOM   8003  H HD2  . LYS A 1 50 ? 9.629   -3.779  -5.216  1.00 0.00 ? 50 LYS A HD2  9  
ATOM   8004  H HD3  . LYS A 1 50 ? 9.601   -2.269  -4.327  1.00 0.00 ? 50 LYS A HD3  9  
ATOM   8005  H HE2  . LYS A 1 50 ? 11.793  -1.792  -4.814  1.00 0.00 ? 50 LYS A HE2  9  
ATOM   8006  H HE3  . LYS A 1 50 ? 12.317  -3.442  -4.545  1.00 0.00 ? 50 LYS A HE3  9  
ATOM   8007  H HZ1  . LYS A 1 50 ? 12.528  -2.865  -6.835  1.00 0.00 ? 50 LYS A HZ1  9  
ATOM   8008  H HZ2  . LYS A 1 50 ? 11.368  -4.007  -6.698  1.00 0.00 ? 50 LYS A HZ2  9  
ATOM   8009  N N    . TYR A 1 51 ? 7.140   -1.968  -1.277  1.00 0.00 ? 51 TYR A N    9  
ATOM   8010  C CA   . TYR A 1 51 ? 5.859   -1.317  -1.060  1.00 0.00 ? 51 TYR A CA   9  
ATOM   8011  C C    . TYR A 1 51 ? 5.380   -0.611  -2.330  1.00 0.00 ? 51 TYR A C    9  
ATOM   8012  O O    . TYR A 1 51 ? 6.191   -0.160  -3.138  1.00 0.00 ? 51 TYR A O    9  
ATOM   8013  C CB   . TYR A 1 51 ? 6.098   -0.271  0.031   1.00 0.00 ? 51 TYR A CB   9  
ATOM   8014  C CG   . TYR A 1 51 ? 6.961   -0.768  1.192   1.00 0.00 ? 51 TYR A CG   9  
ATOM   8015  C CD1  . TYR A 1 51 ? 6.725   -2.010  1.745   1.00 0.00 ? 51 TYR A CD1  9  
ATOM   8016  C CD2  . TYR A 1 51 ? 7.976   0.026   1.686   1.00 0.00 ? 51 TYR A CD2  9  
ATOM   8017  C CE1  . TYR A 1 51 ? 7.538   -2.478  2.838   1.00 0.00 ? 51 TYR A CE1  9  
ATOM   8018  C CE2  . TYR A 1 51 ? 8.789   -0.442  2.779   1.00 0.00 ? 51 TYR A CE2  9  
ATOM   8019  C CZ   . TYR A 1 51 ? 8.530   -1.671  3.301   1.00 0.00 ? 51 TYR A CZ   9  
ATOM   8020  O OH   . TYR A 1 51 ? 9.297   -2.113  4.333   1.00 0.00 ? 51 TYR A OH   9  
ATOM   8021  H H    . TYR A 1 51 ? 7.830   -1.403  -1.730  1.00 0.00 ? 51 TYR A H    9  
ATOM   8022  H HA   . TYR A 1 51 ? 5.135   -2.083  -0.784  1.00 0.00 ? 51 TYR A HA   9  
ATOM   8023  H HB2  . TYR A 1 51 ? 6.574   0.602   -0.415  1.00 0.00 ? 51 TYR A HB2  9  
ATOM   8024  H HB3  . TYR A 1 51 ? 5.135   0.057   0.422   1.00 0.00 ? 51 TYR A HB3  9  
ATOM   8025  H HD1  . TYR A 1 51 ? 5.923   -2.637  1.354   1.00 0.00 ? 51 TYR A HD1  9  
ATOM   8026  H HD2  . TYR A 1 51 ? 8.163   1.007   1.249   1.00 0.00 ? 51 TYR A HD2  9  
ATOM   8027  H HE1  . TYR A 1 51 ? 7.362   -3.457  3.283   1.00 0.00 ? 51 TYR A HE1  9  
ATOM   8028  H HE2  . TYR A 1 51 ? 9.594   0.174   3.179   1.00 0.00 ? 51 TYR A HE2  9  
ATOM   8029  H HH   . TYR A 1 51 ? 8.880   -1.855  5.204   1.00 0.00 ? 51 TYR A HH   9  
ATOM   8030  N N    . VAL A 1 52 ? 4.064   -0.538  -2.468  1.00 0.00 ? 52 VAL A N    9  
ATOM   8031  C CA   . VAL A 1 52 ? 3.468   0.104   -3.627  1.00 0.00 ? 52 VAL A CA   9  
ATOM   8032  C C    . VAL A 1 52 ? 2.290   0.969   -3.174  1.00 0.00 ? 52 VAL A C    9  
ATOM   8033  O O    . VAL A 1 52 ? 1.475   0.538   -2.360  1.00 0.00 ? 52 VAL A O    9  
ATOM   8034  C CB   . VAL A 1 52 ? 3.073   -0.949  -4.664  1.00 0.00 ? 52 VAL A CB   9  
ATOM   8035  C CG1  . VAL A 1 52 ? 2.220   -0.332  -5.774  1.00 0.00 ? 52 VAL A CG1  9  
ATOM   8036  C CG2  . VAL A 1 52 ? 4.309   -1.640  -5.241  1.00 0.00 ? 52 VAL A CG2  9  
ATOM   8037  H H    . VAL A 1 52 ? 3.412   -0.908  -1.807  1.00 0.00 ? 52 VAL A H    9  
ATOM   8038  H HA   . VAL A 1 52 ? 4.226   0.749   -4.072  1.00 0.00 ? 52 VAL A HA   9  
ATOM   8039  H HB   . VAL A 1 52 ? 2.470   -1.705  -4.160  1.00 0.00 ? 52 VAL A HB   9  
ATOM   8040  H HG11 . VAL A 1 52 ? 2.750   -0.408  -6.724  1.00 0.00 ? 52 VAL A HG11 9  
ATOM   8041  H HG12 . VAL A 1 52 ? 1.272   -0.864  -5.843  1.00 0.00 ? 52 VAL A HG12 9  
ATOM   8042  H HG21 . VAL A 1 52 ? 5.195   -1.044  -5.021  1.00 0.00 ? 52 VAL A HG21 9  
ATOM   8043  H HG22 . VAL A 1 52 ? 4.415   -2.628  -4.794  1.00 0.00 ? 52 VAL A HG22 9  
ATOM   8044  N N    . CYS A 1 53 ? 2.237   2.175   -3.721  1.00 0.00 ? 53 CYS A N    9  
ATOM   8045  C CA   . CYS A 1 53 ? 1.172   3.104   -3.384  1.00 0.00 ? 53 CYS A CA   9  
ATOM   8046  C C    . CYS A 1 53 ? 0.395   3.428   -4.661  1.00 0.00 ? 53 CYS A C    9  
ATOM   8047  O O    . CYS A 1 53 ? 0.927   3.308   -5.764  1.00 0.00 ? 53 CYS A O    9  
ATOM   8048  C CB   . CYS A 1 53 ? 1.715   4.367   -2.712  1.00 0.00 ? 53 CYS A CB   9  
ATOM   8049  S SG   . CYS A 1 53 ? 1.698   4.330   -0.882  1.00 0.00 ? 53 CYS A SG   9  
ATOM   8050  H H    . CYS A 1 53 ? 2.904   2.518   -4.383  1.00 0.00 ? 53 CYS A H    9  
ATOM   8051  H HA   . CYS A 1 53 ? 0.534   2.599   -2.659  1.00 0.00 ? 53 CYS A HA   9  
ATOM   8052  H HB2  . CYS A 1 53 ? 2.740   4.529   -3.048  1.00 0.00 ? 53 CYS A HB2  9  
ATOM   8053  H HB3  . CYS A 1 53 ? 1.130   5.222   -3.049  1.00 0.00 ? 53 CYS A HB3  9  
ATOM   8054  N N    . CYS A 1 54 ? -0.853  3.831   -4.470  1.00 0.00 ? 54 CYS A N    9  
ATOM   8055  C CA   . CYS A 1 54 ? -1.709  4.173   -5.593  1.00 0.00 ? 54 CYS A CA   9  
ATOM   8056  C C    . CYS A 1 54 ? -2.965  4.857   -5.049  1.00 0.00 ? 54 CYS A C    9  
ATOM   8057  O O    . CYS A 1 54 ? -3.423  4.540   -3.952  1.00 0.00 ? 54 CYS A O    9  
ATOM   8058  C CB   . CYS A 1 54 ? -2.049  2.944   -6.439  1.00 0.00 ? 54 CYS A CB   9  
ATOM   8059  S SG   . CYS A 1 54 ? -2.063  1.361   -5.522  1.00 0.00 ? 54 CYS A SG   9  
ATOM   8060  H H    . CYS A 1 54 ? -1.278  3.926   -3.570  1.00 0.00 ? 54 CYS A H    9  
ATOM   8061  H HA   . CYS A 1 54 ? -1.140  4.855   -6.225  1.00 0.00 ? 54 CYS A HA   9  
ATOM   8062  H HB2  . CYS A 1 54 ? -3.029  3.093   -6.894  1.00 0.00 ? 54 CYS A HB2  9  
ATOM   8063  H HB3  . CYS A 1 54 ? -1.328  2.870   -7.253  1.00 0.00 ? 54 CYS A HB3  9  
ATOM   8064  N N    . ASN A 1 55 ? -3.486  5.782   -5.842  1.00 0.00 ? 55 ASN A N    9  
ATOM   8065  C CA   . ASN A 1 55 ? -4.680  6.513   -5.453  1.00 0.00 ? 55 ASN A CA   9  
ATOM   8066  C C    . ASN A 1 55 ? -5.852  6.072   -6.332  1.00 0.00 ? 55 ASN A C    9  
ATOM   8067  O O    . ASN A 1 55 ? -6.374  6.860   -7.119  1.00 0.00 ? 55 ASN A O    9  
ATOM   8068  C CB   . ASN A 1 55 ? -4.489  8.020   -5.642  1.00 0.00 ? 55 ASN A CB   9  
ATOM   8069  C CG   . ASN A 1 55 ? -3.907  8.330   -7.022  1.00 0.00 ? 55 ASN A CG   9  
ATOM   8070  O OD1  . ASN A 1 55 ? -3.937  7.519   -7.934  1.00 0.00 ? 55 ASN A OD1  9  
ATOM   8071  N ND2  . ASN A 1 55 ? -3.377  9.545   -7.125  1.00 0.00 ? 55 ASN A ND2  9  
ATOM   8072  H H    . ASN A 1 55 ? -3.108  6.034   -6.732  1.00 0.00 ? 55 ASN A H    9  
ATOM   8073  H HA   . ASN A 1 55 ? -4.834  6.273   -4.401  1.00 0.00 ? 55 ASN A HA   9  
ATOM   8074  H HB2  . ASN A 1 55 ? -5.446  8.529   -5.524  1.00 0.00 ? 55 ASN A HB2  9  
ATOM   8075  H HB3  . ASN A 1 55 ? -3.825  8.405   -4.868  1.00 0.00 ? 55 ASN A HB3  9  
ATOM   8076  H HD21 . ASN A 1 55 ? -3.385  10.162  -6.339  1.00 0.00 ? 55 ASN A HD21 9  
ATOM   8077  H HD22 . ASN A 1 55 ? -2.971  9.842   -7.990  1.00 0.00 ? 55 ASN A HD22 9  
ATOM   8078  N N    . THR A 1 56 ? -6.231  4.813   -6.168  1.00 0.00 ? 56 THR A N    9  
ATOM   8079  C CA   . THR A 1 56 ? -7.332  4.257   -6.937  1.00 0.00 ? 56 THR A CA   9  
ATOM   8080  C C    . THR A 1 56 ? -8.140  3.280   -6.081  1.00 0.00 ? 56 THR A C    9  
ATOM   8081  O O    . THR A 1 56 ? -7.637  2.754   -5.089  1.00 0.00 ? 56 THR A O    9  
ATOM   8082  C CB   . THR A 1 56 ? -6.752  3.620   -8.201  1.00 0.00 ? 56 THR A CB   9  
ATOM   8083  O OG1  . THR A 1 56 ? -5.745  2.737   -7.714  1.00 0.00 ? 56 THR A OG1  9  
ATOM   8084  C CG2  . THR A 1 56 ? -5.982  4.624   -9.062  1.00 0.00 ? 56 THR A CG2  9  
ATOM   8085  H H    . THR A 1 56 ? -5.801  4.178   -5.526  1.00 0.00 ? 56 THR A H    9  
ATOM   8086  H HA   . THR A 1 56 ? -8.003  5.070   -7.214  1.00 0.00 ? 56 THR A HA   9  
ATOM   8087  H HB   . THR A 1 56 ? -7.531  3.126   -8.781  1.00 0.00 ? 56 THR A HB   9  
ATOM   8088  H HG1  . THR A 1 56 ? -4.972  3.262   -7.358  1.00 0.00 ? 56 THR A HG1  9  
ATOM   8089  H HG21 . THR A 1 56 ? -5.956  4.273   -10.094 1.00 0.00 ? 56 THR A HG21 9  
ATOM   8090  H HG22 . THR A 1 56 ? -6.479  5.594   -9.020  1.00 0.00 ? 56 THR A HG22 9  
ATOM   8091  N N    . ASP A 1 57 ? -9.395  3.041   -6.469  1.00 0.00 ? 57 ASP A N    9  
ATOM   8092  C CA   . ASP A 1 57 ? -10.262 2.136   -5.741  1.00 0.00 ? 57 ASP A CA   9  
ATOM   8093  C C    . ASP A 1 57 ? -9.711  0.720   -5.820  1.00 0.00 ? 57 ASP A C    9  
ATOM   8094  O O    . ASP A 1 57 ? -9.413  0.228   -6.906  1.00 0.00 ? 57 ASP A O    9  
ATOM   8095  C CB   . ASP A 1 57 ? -11.670 2.203   -6.325  1.00 0.00 ? 57 ASP A CB   9  
ATOM   8096  C CG   . ASP A 1 57 ? -12.514 3.237   -5.594  1.00 0.00 ? 57 ASP A CG   9  
ATOM   8097  O OD1  . ASP A 1 57 ? -12.255 3.430   -4.386  1.00 0.00 ? 57 ASP A OD1  9  
ATOM   8098  O OD2  . ASP A 1 57 ? -13.401 3.817   -6.257  1.00 0.00 ? 57 ASP A OD2  9  
ATOM   8099  H H    . ASP A 1 57 ? -9.761  3.499   -7.291  1.00 0.00 ? 57 ASP A H    9  
ATOM   8100  H HA   . ASP A 1 57 ? -10.297 2.444   -4.696  1.00 0.00 ? 57 ASP A HA   9  
ATOM   8101  H HB2  . ASP A 1 57 ? -11.608 2.472   -7.379  1.00 0.00 ? 57 ASP A HB2  9  
ATOM   8102  H HB3  . ASP A 1 57 ? -12.143 1.225   -6.231  1.00 0.00 ? 57 ASP A HB3  9  
ATOM   8103  H HD2  . ASP A 1 57 ? -13.897 4.456   -5.740  1.00 0.00 ? 57 ASP A HD2  9  
ATOM   8104  N N    . LYS A 1 58 ? -9.589  0.099   -4.655  1.00 0.00 ? 58 LYS A N    9  
ATOM   8105  C CA   . LYS A 1 58 ? -9.076  -1.258  -4.582  1.00 0.00 ? 58 LYS A CA   9  
ATOM   8106  C C    . LYS A 1 58 ? -7.749  -1.339  -5.339  1.00 0.00 ? 58 LYS A C    9  
ATOM   8107  O O    . LYS A 1 58 ? -7.601  -2.148  -6.254  1.00 0.00 ? 58 LYS A O    9  
ATOM   8108  C CB   . LYS A 1 58 ? -10.127 -2.256  -5.073  1.00 0.00 ? 58 LYS A CB   9  
ATOM   8109  C CG   . LYS A 1 58 ? -9.864  -3.653  -4.507  1.00 0.00 ? 58 LYS A CG   9  
ATOM   8110  C CD   . LYS A 1 58 ? -10.698 -4.707  -5.239  1.00 0.00 ? 58 LYS A CD   9  
ATOM   8111  C CE   . LYS A 1 58 ? -9.888  -5.368  -6.355  1.00 0.00 ? 58 LYS A CE   9  
ATOM   8112  N NZ   . LYS A 1 58 ? -10.665 -6.462  -6.980  1.00 0.00 ? 58 LYS A NZ   9  
ATOM   8113  H H    . LYS A 1 58 ? -9.833  0.507   -3.775  1.00 0.00 ? 58 LYS A H    9  
ATOM   8114  H HA   . LYS A 1 58 ? -8.888  -1.480  -3.531  1.00 0.00 ? 58 LYS A HA   9  
ATOM   8115  H HB2  . LYS A 1 58 ? -11.120 -1.920  -4.776  1.00 0.00 ? 58 LYS A HB2  9  
ATOM   8116  H HB3  . LYS A 1 58 ? -10.117 -2.293  -6.162  1.00 0.00 ? 58 LYS A HB3  9  
ATOM   8117  H HG2  . LYS A 1 58 ? -8.805  -3.893  -4.600  1.00 0.00 ? 58 LYS A HG2  9  
ATOM   8118  H HG3  . LYS A 1 58 ? -10.102 -3.669  -3.444  1.00 0.00 ? 58 LYS A HG3  9  
ATOM   8119  H HD2  . LYS A 1 58 ? -11.035 -5.464  -4.531  1.00 0.00 ? 58 LYS A HD2  9  
ATOM   8120  H HD3  . LYS A 1 58 ? -11.590 -4.242  -5.658  1.00 0.00 ? 58 LYS A HD3  9  
ATOM   8121  H HE2  . LYS A 1 58 ? -9.621  -4.627  -7.108  1.00 0.00 ? 58 LYS A HE2  9  
ATOM   8122  H HE3  . LYS A 1 58 ? -8.955  -5.762  -5.951  1.00 0.00 ? 58 LYS A HE3  9  
ATOM   8123  H HZ1  . LYS A 1 58 ? -10.548 -7.301  -6.448  1.00 0.00 ? 58 LYS A HZ1  9  
ATOM   8124  H HZ2  . LYS A 1 58 ? -11.633 -6.213  -7.002  1.00 0.00 ? 58 LYS A HZ2  9  
ATOM   8125  N N    . CYS A 1 59 ? -6.818  -0.489  -4.931  1.00 0.00 ? 59 CYS A N    9  
ATOM   8126  C CA   . CYS A 1 59 ? -5.509  -0.454  -5.560  1.00 0.00 ? 59 CYS A CA   9  
ATOM   8127  C C    . CYS A 1 59 ? -4.540  -1.264  -4.697  1.00 0.00 ? 59 CYS A C    9  
ATOM   8128  O O    . CYS A 1 59 ? -3.797  -2.101  -5.209  1.00 0.00 ? 59 CYS A O    9  
ATOM   8129  C CB   . CYS A 1 59 ? -5.022  0.980   -5.773  1.00 0.00 ? 59 CYS A CB   9  
ATOM   8130  S SG   . CYS A 1 59 ? -3.859  1.593   -4.499  1.00 0.00 ? 59 CYS A SG   9  
ATOM   8131  H H    . CYS A 1 59 ? -6.947  0.166   -4.187  1.00 0.00 ? 59 CYS A H    9  
ATOM   8132  H HA   . CYS A 1 59 ? -5.623  -0.908  -6.545  1.00 0.00 ? 59 CYS A HA   9  
ATOM   8133  H HB2  . CYS A 1 59 ? -4.537  1.044   -6.747  1.00 0.00 ? 59 CYS A HB2  9  
ATOM   8134  H HB3  . CYS A 1 59 ? -5.887  1.642   -5.803  1.00 0.00 ? 59 CYS A HB3  9  
ATOM   8135  N N    . ASN A 1 60 ? -4.578  -0.988  -3.402  1.00 0.00 ? 60 ASN A N    9  
ATOM   8136  C CA   . ASN A 1 60 ? -3.712  -1.680  -2.463  1.00 0.00 ? 60 ASN A CA   9  
ATOM   8137  C C    . ASN A 1 60 ? -4.342  -3.024  -2.091  1.00 0.00 ? 60 ASN A C    9  
ATOM   8138  O O    . ASN A 1 60 ? -5.213  -3.523  -2.802  1.00 0.00 ? 60 ASN A O    9  
ATOM   8139  C CB   . ASN A 1 60 ? -3.534  -0.870  -1.177  1.00 0.00 ? 60 ASN A CB   9  
ATOM   8140  C CG   . ASN A 1 60 ? -4.755  -1.012  -0.266  1.00 0.00 ? 60 ASN A CG   9  
ATOM   8141  O OD1  . ASN A 1 60 ? -5.880  -1.164  -0.712  1.00 0.00 ? 60 ASN A OD1  9  
ATOM   8142  N ND2  . ASN A 1 60 ? -4.471  -0.953  1.032   1.00 0.00 ? 60 ASN A ND2  9  
ATOM   8143  H H    . ASN A 1 60 ? -5.185  -0.306  -2.993  1.00 0.00 ? 60 ASN A H    9  
ATOM   8144  H HA   . ASN A 1 60 ? -2.760  -1.795  -2.982  1.00 0.00 ? 60 ASN A HA   9  
ATOM   8145  H HB2  . ASN A 1 60 ? -2.642  -1.209  -0.651  1.00 0.00 ? 60 ASN A HB2  9  
ATOM   8146  H HB3  . ASN A 1 60 ? -3.379  0.180   -1.424  1.00 0.00 ? 60 ASN A HB3  9  
ATOM   8147  H HD21 . ASN A 1 60 ? -3.526  -0.826  1.331   1.00 0.00 ? 60 ASN A HD21 9  
ATOM   8148  H HD22 . ASN A 1 60 ? -5.203  -1.036  1.708   1.00 0.00 ? 60 ASN A HD22 9  
HETATM 8149  O O    . HOH B 2 .  ? 4.683   -11.275 2.232   1.00 0.00 ? 61 HOH A O    9  
HETATM 8150  H H1   . HOH B 2 .  ? 4.109   -11.085 2.973   1.00 0.00 ? 61 HOH A H1   9  
HETATM 8151  H H2   . HOH B 2 .  ? 5.494   -11.589 2.632   1.00 0.00 ? 61 HOH A H2   9  
HETATM 8152  O O    . HOH B 2 .  ? 8.562   -14.719 -9.571  1.00 0.00 ? 62 HOH A O    9  
HETATM 8153  H H1   . HOH B 2 .  ? 7.885   -14.509 -8.928  1.00 0.00 ? 62 HOH A H1   9  
HETATM 8154  H H2   . HOH B 2 .  ? 8.954   -13.874 -9.791  1.00 0.00 ? 62 HOH A H2   9  
ATOM   8155  N N    . LEU A 1 1  ? -12.761 7.338   -1.596  1.00 0.00 ? 1  LEU A N    10 
ATOM   8156  C CA   . LEU A 1 1  ? -11.448 6.859   -1.201  1.00 0.00 ? 1  LEU A CA   10 
ATOM   8157  C C    . LEU A 1 1  ? -11.606 5.620   -0.317  1.00 0.00 ? 1  LEU A C    10 
ATOM   8158  O O    . LEU A 1 1  ? -11.349 5.673   0.885   1.00 0.00 ? 1  LEU A O    10 
ATOM   8159  C CB   . LEU A 1 1  ? -10.642 7.983   -0.545  1.00 0.00 ? 1  LEU A CB   10 
ATOM   8160  C CG   . LEU A 1 1  ? -11.257 8.604   0.711   1.00 0.00 ? 1  LEU A CG   10 
ATOM   8161  C CD1  . LEU A 1 1  ? -10.271 9.557   1.390   1.00 0.00 ? 1  LEU A CD1  10 
ATOM   8162  C CD2  . LEU A 1 1  ? -12.587 9.289   0.389   1.00 0.00 ? 1  LEU A CD2  10 
ATOM   8163  H H    . LEU A 1 1  ? -12.821 7.685   -2.532  1.00 0.00 ? 1  LEU A H    10 
ATOM   8164  H HA   . LEU A 1 1  ? -10.918 6.571   -2.109  1.00 0.00 ? 1  LEU A HA   10 
ATOM   8165  H HB2  . LEU A 1 1  ? -9.656  7.595   -0.289  1.00 0.00 ? 1  LEU A HB2  10 
ATOM   8166  H HB3  . LEU A 1 1  ? -10.493 8.773   -1.281  1.00 0.00 ? 1  LEU A HB3  10 
ATOM   8167  H HG   . LEU A 1 1  ? -11.471 7.804   1.418   1.00 0.00 ? 1  LEU A HG   10 
ATOM   8168  H HD11 . LEU A 1 1  ? -10.582 9.727   2.421   1.00 0.00 ? 1  LEU A HD11 10 
ATOM   8169  H HD12 . LEU A 1 1  ? -9.274  9.116   1.379   1.00 0.00 ? 1  LEU A HD12 10 
ATOM   8170  H HD21 . LEU A 1 1  ? -12.855 9.964   1.202   1.00 0.00 ? 1  LEU A HD21 10 
ATOM   8171  H HD22 . LEU A 1 1  ? -12.488 9.858   -0.536  1.00 0.00 ? 1  LEU A HD22 10 
ATOM   8172  N N    . LYS A 1 2  ? -12.028 4.534   -0.947  1.00 0.00 ? 2  LYS A N    10 
ATOM   8173  C CA   . LYS A 1 2  ? -12.224 3.283   -0.233  1.00 0.00 ? 2  LYS A CA   10 
ATOM   8174  C C    . LYS A 1 2  ? -11.285 2.221   -0.807  1.00 0.00 ? 2  LYS A C    10 
ATOM   8175  O O    . LYS A 1 2  ? -11.239 2.017   -2.020  1.00 0.00 ? 2  LYS A O    10 
ATOM   8176  C CB   . LYS A 1 2  ? -13.699 2.878   -0.257  1.00 0.00 ? 2  LYS A CB   10 
ATOM   8177  C CG   . LYS A 1 2  ? -14.118 2.415   -1.654  1.00 0.00 ? 2  LYS A CG   10 
ATOM   8178  C CD   . LYS A 1 2  ? -15.640 2.454   -1.810  1.00 0.00 ? 2  LYS A CD   10 
ATOM   8179  C CE   . LYS A 1 2  ? -16.067 3.592   -2.738  1.00 0.00 ? 2  LYS A CE   10 
ATOM   8180  N NZ   . LYS A 1 2  ? -16.813 3.061   -3.901  1.00 0.00 ? 2  LYS A NZ   10 
ATOM   8181  H H    . LYS A 1 2  ? -12.235 4.499   -1.925  1.00 0.00 ? 2  LYS A H    10 
ATOM   8182  H HA   . LYS A 1 2  ? -11.954 3.456   0.809   1.00 0.00 ? 2  LYS A HA   10 
ATOM   8183  H HB2  . LYS A 1 2  ? -13.872 2.077   0.462   1.00 0.00 ? 2  LYS A HB2  10 
ATOM   8184  H HB3  . LYS A 1 2  ? -14.317 3.721   0.052   1.00 0.00 ? 2  LYS A HB3  10 
ATOM   8185  H HG2  . LYS A 1 2  ? -13.655 3.054   -2.406  1.00 0.00 ? 2  LYS A HG2  10 
ATOM   8186  H HG3  . LYS A 1 2  ? -13.756 1.403   -1.829  1.00 0.00 ? 2  LYS A HG3  10 
ATOM   8187  H HD2  . LYS A 1 2  ? -15.991 1.502   -2.210  1.00 0.00 ? 2  LYS A HD2  10 
ATOM   8188  H HD3  . LYS A 1 2  ? -16.106 2.581   -0.833  1.00 0.00 ? 2  LYS A HD3  10 
ATOM   8189  H HE2  . LYS A 1 2  ? -16.689 4.301   -2.192  1.00 0.00 ? 2  LYS A HE2  10 
ATOM   8190  H HE3  . LYS A 1 2  ? -15.188 4.139   -3.082  1.00 0.00 ? 2  LYS A HE3  10 
ATOM   8191  H HZ1  . LYS A 1 2  ? -16.168 2.791   -4.616  1.00 0.00 ? 2  LYS A HZ1  10 
ATOM   8192  H HZ2  . LYS A 1 2  ? -17.349 2.266   -3.618  1.00 0.00 ? 2  LYS A HZ2  10 
ATOM   8193  N N    . CYS A 1 3  ? -10.558 1.571   0.090   1.00 0.00 ? 3  CYS A N    10 
ATOM   8194  C CA   . CYS A 1 3  ? -9.623  0.535   -0.312  1.00 0.00 ? 3  CYS A CA   10 
ATOM   8195  C C    . CYS A 1 3  ? -9.900  -0.715  0.526   1.00 0.00 ? 3  CYS A C    10 
ATOM   8196  O O    . CYS A 1 3  ? -10.807 -0.720  1.357   1.00 0.00 ? 3  CYS A O    10 
ATOM   8197  C CB   . CYS A 1 3  ? -8.171  1.000   -0.179  1.00 0.00 ? 3  CYS A CB   10 
ATOM   8198  S SG   . CYS A 1 3  ? -7.494  1.835   -1.660  1.00 0.00 ? 3  CYS A SG   10 
ATOM   8199  H H    . CYS A 1 3  ? -10.601 1.743   1.075   1.00 0.00 ? 3  CYS A H    10 
ATOM   8200  H HA   . CYS A 1 3  ? -9.806  0.341   -1.369  1.00 0.00 ? 3  CYS A HA   10 
ATOM   8201  H HB2  . CYS A 1 3  ? -8.099  1.681   0.669   1.00 0.00 ? 3  CYS A HB2  10 
ATOM   8202  H HB3  . CYS A 1 3  ? -7.547  0.137   0.051   1.00 0.00 ? 3  CYS A HB3  10 
ATOM   8203  N N    . LYS A 1 4  ? -9.104  -1.744  0.278   1.00 0.00 ? 4  LYS A N    10 
ATOM   8204  C CA   . LYS A 1 4  ? -9.252  -2.996  0.999   1.00 0.00 ? 4  LYS A CA   10 
ATOM   8205  C C    . LYS A 1 4  ? -8.394  -2.956  2.265   1.00 0.00 ? 4  LYS A C    10 
ATOM   8206  O O    . LYS A 1 4  ? -7.322  -2.353  2.273   1.00 0.00 ? 4  LYS A O    10 
ATOM   8207  C CB   . LYS A 1 4  ? -8.943  -4.182  0.084   1.00 0.00 ? 4  LYS A CB   10 
ATOM   8208  C CG   . LYS A 1 4  ? -10.083 -4.422  -0.908  1.00 0.00 ? 4  LYS A CG   10 
ATOM   8209  C CD   . LYS A 1 4  ? -10.778 -5.757  -0.632  1.00 0.00 ? 4  LYS A CD   10 
ATOM   8210  C CE   . LYS A 1 4  ? -12.012 -5.561  0.250   1.00 0.00 ? 4  LYS A CE   10 
ATOM   8211  N NZ   . LYS A 1 4  ? -13.145 -5.046  -0.551  1.00 0.00 ? 4  LYS A NZ   10 
ATOM   8212  H H    . LYS A 1 4  ? -8.369  -1.731  -0.400  1.00 0.00 ? 4  LYS A H    10 
ATOM   8213  H HA   . LYS A 1 4  ? -10.298 -3.081  1.294   1.00 0.00 ? 4  LYS A HA   10 
ATOM   8214  H HB2  . LYS A 1 4  ? -8.017  -3.995  -0.460  1.00 0.00 ? 4  LYS A HB2  10 
ATOM   8215  H HB3  . LYS A 1 4  ? -8.783  -5.078  0.684   1.00 0.00 ? 4  LYS A HB3  10 
ATOM   8216  H HG2  . LYS A 1 4  ? -10.807 -3.610  -0.838  1.00 0.00 ? 4  LYS A HG2  10 
ATOM   8217  H HG3  . LYS A 1 4  ? -9.693  -4.414  -1.926  1.00 0.00 ? 4  LYS A HG3  10 
ATOM   8218  H HD2  . LYS A 1 4  ? -11.069 -6.220  -1.575  1.00 0.00 ? 4  LYS A HD2  10 
ATOM   8219  H HD3  . LYS A 1 4  ? -10.082 -6.439  -0.144  1.00 0.00 ? 4  LYS A HD3  10 
ATOM   8220  H HE2  . LYS A 1 4  ? -12.288 -6.507  0.715   1.00 0.00 ? 4  LYS A HE2  10 
ATOM   8221  H HE3  . LYS A 1 4  ? -11.783 -4.864  1.056   1.00 0.00 ? 4  LYS A HE3  10 
ATOM   8222  H HZ1  . LYS A 1 4  ? -12.808 -4.376  -1.213  1.00 0.00 ? 4  LYS A HZ1  10 
ATOM   8223  H HZ2  . LYS A 1 4  ? -13.582 -5.804  -1.037  1.00 0.00 ? 4  LYS A HZ2  10 
ATOM   8224  N N    . LYS A 1 5  ? -8.897  -3.606  3.304   1.00 0.00 ? 5  LYS A N    10 
ATOM   8225  C CA   . LYS A 1 5  ? -8.189  -3.652  4.572   1.00 0.00 ? 5  LYS A CA   10 
ATOM   8226  C C    . LYS A 1 5  ? -7.243  -4.854  4.580   1.00 0.00 ? 5  LYS A C    10 
ATOM   8227  O O    . LYS A 1 5  ? -7.048  -5.502  3.553   1.00 0.00 ? 5  LYS A O    10 
ATOM   8228  C CB   . LYS A 1 5  ? -9.179  -3.641  5.739   1.00 0.00 ? 5  LYS A CB   10 
ATOM   8229  C CG   . LYS A 1 5  ? -9.570  -2.210  6.113   1.00 0.00 ? 5  LYS A CG   10 
ATOM   8230  C CD   . LYS A 1 5  ? -9.571  -2.021  7.631   1.00 0.00 ? 5  LYS A CD   10 
ATOM   8231  C CE   . LYS A 1 5  ? -8.941  -0.681  8.017   1.00 0.00 ? 5  LYS A CE   10 
ATOM   8232  N NZ   . LYS A 1 5  ? -8.212  -0.802  9.300   1.00 0.00 ? 5  LYS A NZ   10 
ATOM   8233  H H    . LYS A 1 5  ? -9.770  -4.094  3.289   1.00 0.00 ? 5  LYS A H    10 
ATOM   8234  H HA   . LYS A 1 5  ? -7.593  -2.742  4.647   1.00 0.00 ? 5  LYS A HA   10 
ATOM   8235  H HB2  . LYS A 1 5  ? -10.071 -4.207  5.470   1.00 0.00 ? 5  LYS A HB2  10 
ATOM   8236  H HB3  . LYS A 1 5  ? -8.736  -4.138  6.602   1.00 0.00 ? 5  LYS A HB3  10 
ATOM   8237  H HG2  . LYS A 1 5  ? -8.874  -1.507  5.656   1.00 0.00 ? 5  LYS A HG2  10 
ATOM   8238  H HG3  . LYS A 1 5  ? -10.559 -1.983  5.714   1.00 0.00 ? 5  LYS A HG3  10 
ATOM   8239  H HD2  . LYS A 1 5  ? -10.593 -2.068  8.007   1.00 0.00 ? 5  LYS A HD2  10 
ATOM   8240  H HD3  . LYS A 1 5  ? -9.021  -2.835  8.103   1.00 0.00 ? 5  LYS A HD3  10 
ATOM   8241  H HE2  . LYS A 1 5  ? -8.258  -0.354  7.233   1.00 0.00 ? 5  LYS A HE2  10 
ATOM   8242  H HE3  . LYS A 1 5  ? -9.716  0.081   8.103   1.00 0.00 ? 5  LYS A HE3  10 
ATOM   8243  H HZ1  . LYS A 1 5  ? -7.557  -0.051  9.383   1.00 0.00 ? 5  LYS A HZ1  10 
ATOM   8244  H HZ2  . LYS A 1 5  ? -8.863  -0.761  10.058  1.00 0.00 ? 5  LYS A HZ2  10 
ATOM   8245  N N    . LEU A 1 6  ? -6.680  -5.116  5.750   1.00 0.00 ? 6  LEU A N    10 
ATOM   8246  C CA   . LEU A 1 6  ? -5.758  -6.228  5.905   1.00 0.00 ? 6  LEU A CA   10 
ATOM   8247  C C    . LEU A 1 6  ? -6.283  -7.433  5.121   1.00 0.00 ? 6  LEU A C    10 
ATOM   8248  O O    . LEU A 1 6  ? -5.732  -7.790  4.081   1.00 0.00 ? 6  LEU A O    10 
ATOM   8249  C CB   . LEU A 1 6  ? -5.513  -6.519  7.387   1.00 0.00 ? 6  LEU A CB   10 
ATOM   8250  C CG   . LEU A 1 6  ? -4.352  -5.762  8.036   1.00 0.00 ? 6  LEU A CG   10 
ATOM   8251  C CD1  . LEU A 1 6  ? -4.774  -4.347  8.435   1.00 0.00 ? 6  LEU A CD1  10 
ATOM   8252  C CD2  . LEU A 1 6  ? -3.780  -6.546  9.219   1.00 0.00 ? 6  LEU A CD2  10 
ATOM   8253  H H    . LEU A 1 6  ? -6.843  -4.584  6.581   1.00 0.00 ? 6  LEU A H    10 
ATOM   8254  H HA   . LEU A 1 6  ? -4.804  -5.925  5.474   1.00 0.00 ? 6  LEU A HA   10 
ATOM   8255  H HB2  . LEU A 1 6  ? -6.424  -6.287  7.938   1.00 0.00 ? 6  LEU A HB2  10 
ATOM   8256  H HB3  . LEU A 1 6  ? -5.334  -7.588  7.503   1.00 0.00 ? 6  LEU A HB3  10 
ATOM   8257  H HG   . LEU A 1 6  ? -3.554  -5.664  7.299   1.00 0.00 ? 6  LEU A HG   10 
ATOM   8258  H HD11 . LEU A 1 6  ? -5.862  -4.281  8.441   1.00 0.00 ? 6  LEU A HD11 10 
ATOM   8259  H HD12 . LEU A 1 6  ? -4.391  -4.121  9.431   1.00 0.00 ? 6  LEU A HD12 10 
ATOM   8260  H HD21 . LEU A 1 6  ? -3.967  -5.997  10.142  1.00 0.00 ? 6  LEU A HD21 10 
ATOM   8261  H HD22 . LEU A 1 6  ? -4.260  -7.523  9.273   1.00 0.00 ? 6  LEU A HD22 10 
ATOM   8262  N N    . VAL A 1 7  ? -7.344  -8.026  5.650   1.00 0.00 ? 7  VAL A N    10 
ATOM   8263  C CA   . VAL A 1 7  ? -7.950  -9.182  5.013   1.00 0.00 ? 7  VAL A CA   10 
ATOM   8264  C C    . VAL A 1 7  ? -8.901  -8.712  3.911   1.00 0.00 ? 7  VAL A C    10 
ATOM   8265  O O    . VAL A 1 7  ? -9.675  -7.777  4.111   1.00 0.00 ? 7  VAL A O    10 
ATOM   8266  C CB   . VAL A 1 7  ? -8.637  -10.058 6.062   1.00 0.00 ? 7  VAL A CB   10 
ATOM   8267  C CG1  . VAL A 1 7  ? -9.265  -11.295 5.418   1.00 0.00 ? 7  VAL A CG1  10 
ATOM   8268  C CG2  . VAL A 1 7  ? -7.660  -10.453 7.172   1.00 0.00 ? 7  VAL A CG2  10 
ATOM   8269  H H    . VAL A 1 7  ? -7.786  -7.729  6.496   1.00 0.00 ? 7  VAL A H    10 
ATOM   8270  H HA   . VAL A 1 7  ? -7.148  -9.766  4.559   1.00 0.00 ? 7  VAL A HA   10 
ATOM   8271  H HB   . VAL A 1 7  ? -9.438  -9.473  6.515   1.00 0.00 ? 7  VAL A HB   10 
ATOM   8272  H HG11 . VAL A 1 7  ? -8.478  -11.946 5.038   1.00 0.00 ? 7  VAL A HG11 10 
ATOM   8273  H HG12 . VAL A 1 7  ? -9.854  -11.833 6.161   1.00 0.00 ? 7  VAL A HG12 10 
ATOM   8274  H HG21 . VAL A 1 7  ? -8.080  -11.278 7.748   1.00 0.00 ? 7  VAL A HG21 10 
ATOM   8275  H HG22 . VAL A 1 7  ? -6.714  -10.764 6.729   1.00 0.00 ? 7  VAL A HG22 10 
ATOM   8276  N N    . PRO A 1 8  ? -8.810  -9.400  2.741   1.00 0.00 ? 8  PRO A N    10 
ATOM   8277  C CA   . PRO A 1 8  ? -9.653  -9.062  1.607   1.00 0.00 ? 8  PRO A CA   10 
ATOM   8278  C C    . PRO A 1 8  ? -11.086 -9.553  1.824   1.00 0.00 ? 8  PRO A C    10 
ATOM   8279  O O    . PRO A 1 8  ? -11.638 -10.261 0.983   1.00 0.00 ? 8  PRO A O    10 
ATOM   8280  C CB   . PRO A 1 8  ? -8.979  -9.710  0.408   1.00 0.00 ? 8  PRO A CB   10 
ATOM   8281  C CG   . PRO A 1 8  ? -8.047  -10.768 0.976   1.00 0.00 ? 8  PRO A CG   10 
ATOM   8282  C CD   . PRO A 1 8  ? -7.905  -10.513 2.468   1.00 0.00 ? 8  PRO A CD   10 
ATOM   8283  H HA   . PRO A 1 8  ? -9.717  -8.070  1.505   1.00 0.00 ? 8  PRO A HA   10 
ATOM   8284  H HB2  . PRO A 1 8  ? -9.715  -10.156 -0.260  1.00 0.00 ? 8  PRO A HB2  10 
ATOM   8285  H HB3  . PRO A 1 8  ? -8.425  -8.973  -0.173  1.00 0.00 ? 8  PRO A HB3  10 
ATOM   8286  H HG2  . PRO A 1 8  ? -8.447  -11.766 0.796   1.00 0.00 ? 8  PRO A HG2  10 
ATOM   8287  H HG3  . PRO A 1 8  ? -7.074  -10.722 0.487   1.00 0.00 ? 8  PRO A HG3  10 
ATOM   8288  H HD2  . PRO A 1 8  ? -8.176  -11.395 3.048   1.00 0.00 ? 8  PRO A HD2  10 
ATOM   8289  H HD3  . PRO A 1 8  ? -6.878  -10.262 2.731   1.00 0.00 ? 8  PRO A HD3  10 
ATOM   8290  N N    . LEU A 1 9  ? -11.648 -9.157  2.957   1.00 0.00 ? 9  LEU A N    10 
ATOM   8291  C CA   . LEU A 1 9  ? -13.006 -9.548  3.295   1.00 0.00 ? 9  LEU A CA   10 
ATOM   8292  C C    . LEU A 1 9  ? -13.894 -8.303  3.338   1.00 0.00 ? 9  LEU A C    10 
ATOM   8293  O O    . LEU A 1 9  ? -15.076 -8.367  3.002   1.00 0.00 ? 9  LEU A O    10 
ATOM   8294  C CB   . LEU A 1 9  ? -13.023 -10.360 4.591   1.00 0.00 ? 9  LEU A CB   10 
ATOM   8295  C CG   . LEU A 1 9  ? -12.853 -11.873 4.437   1.00 0.00 ? 9  LEU A CG   10 
ATOM   8296  C CD1  . LEU A 1 9  ? -12.407 -12.511 5.754   1.00 0.00 ? 9  LEU A CD1  10 
ATOM   8297  C CD2  . LEU A 1 9  ? -14.130 -12.515 3.891   1.00 0.00 ? 9  LEU A CD2  10 
ATOM   8298  H H    . LEU A 1 9  ? -11.192 -8.581  3.635   1.00 0.00 ? 9  LEU A H    10 
ATOM   8299  H HA   . LEU A 1 9  ? -13.365 -10.201 2.500   1.00 0.00 ? 9  LEU A HA   10 
ATOM   8300  H HB2  . LEU A 1 9  ? -12.229 -9.989  5.239   1.00 0.00 ? 9  LEU A HB2  10 
ATOM   8301  H HB3  . LEU A 1 9  ? -13.966 -10.171 5.103   1.00 0.00 ? 9  LEU A HB3  10 
ATOM   8302  H HG   . LEU A 1 9  ? -12.064 -12.055 3.707   1.00 0.00 ? 9  LEU A HG   10 
ATOM   8303  H HD11 . LEU A 1 9  ? -12.103 -11.731 6.451   1.00 0.00 ? 9  LEU A HD11 10 
ATOM   8304  H HD12 . LEU A 1 9  ? -13.234 -13.079 6.181   1.00 0.00 ? 9  LEU A HD12 10 
ATOM   8305  H HD21 . LEU A 1 9  ? -13.874 -13.206 3.088   1.00 0.00 ? 9  LEU A HD21 10 
ATOM   8306  H HD22 . LEU A 1 9  ? -14.633 -13.058 4.691   1.00 0.00 ? 9  LEU A HD22 10 
ATOM   8307  N N    . PHE A 1 10 ? -13.291 -7.199  3.754   1.00 0.00 ? 10 PHE A N    10 
ATOM   8308  C CA   . PHE A 1 10 ? -14.013 -5.941  3.845   1.00 0.00 ? 10 PHE A CA   10 
ATOM   8309  C C    . PHE A 1 10 ? -13.132 -4.770  3.403   1.00 0.00 ? 10 PHE A C    10 
ATOM   8310  O O    . PHE A 1 10 ? -11.918 -4.917  3.272   1.00 0.00 ? 10 PHE A O    10 
ATOM   8311  C CB   . PHE A 1 10 ? -14.395 -5.750  5.314   1.00 0.00 ? 10 PHE A CB   10 
ATOM   8312  C CG   . PHE A 1 10 ? -14.921 -7.018  5.990   1.00 0.00 ? 10 PHE A CG   10 
ATOM   8313  C CD1  . PHE A 1 10 ? -16.150 -7.502  5.665   1.00 0.00 ? 10 PHE A CD1  10 
ATOM   8314  C CD2  . PHE A 1 10 ? -14.160 -7.661  6.916   1.00 0.00 ? 10 PHE A CD2  10 
ATOM   8315  C CE1  . PHE A 1 10 ? -16.638 -8.679  6.292   1.00 0.00 ? 10 PHE A CE1  10 
ATOM   8316  C CE2  . PHE A 1 10 ? -14.648 -8.837  7.543   1.00 0.00 ? 10 PHE A CE2  10 
ATOM   8317  C CZ   . PHE A 1 10 ? -15.877 -9.322  7.218   1.00 0.00 ? 10 PHE A CZ   10 
ATOM   8318  H H    . PHE A 1 10 ? -12.330 -7.155  4.025   1.00 0.00 ? 10 PHE A H    10 
ATOM   8319  H HA   . PHE A 1 10 ? -14.876 -6.014  3.183   1.00 0.00 ? 10 PHE A HA   10 
ATOM   8320  H HB2  . PHE A 1 10 ? -13.524 -5.393  5.863   1.00 0.00 ? 10 PHE A HB2  10 
ATOM   8321  H HB3  . PHE A 1 10 ? -15.156 -4.972  5.383   1.00 0.00 ? 10 PHE A HB3  10 
ATOM   8322  H HD1  . PHE A 1 10 ? -16.760 -6.987  4.923   1.00 0.00 ? 10 PHE A HD1  10 
ATOM   8323  H HD2  . PHE A 1 10 ? -13.176 -7.272  7.177   1.00 0.00 ? 10 PHE A HD2  10 
ATOM   8324  H HE1  . PHE A 1 10 ? -17.623 -9.067  6.031   1.00 0.00 ? 10 PHE A HE1  10 
ATOM   8325  H HE2  . PHE A 1 10 ? -14.039 -9.352  8.285   1.00 0.00 ? 10 PHE A HE2  10 
ATOM   8326  H HZ   . PHE A 1 10 ? -16.252 -10.225 7.699   1.00 0.00 ? 10 PHE A HZ   10 
ATOM   8327  N N    . SER A 1 11 ? -13.779 -3.634  3.186   1.00 0.00 ? 11 SER A N    10 
ATOM   8328  C CA   . SER A 1 11 ? -13.069 -2.439  2.762   1.00 0.00 ? 11 SER A CA   10 
ATOM   8329  C C    . SER A 1 11 ? -13.423 -1.267  3.680   1.00 0.00 ? 11 SER A C    10 
ATOM   8330  O O    . SER A 1 11 ? -14.530 -1.203  4.213   1.00 0.00 ? 11 SER A O    10 
ATOM   8331  C CB   . SER A 1 11 ? -13.396 -2.091  1.308   1.00 0.00 ? 11 SER A CB   10 
ATOM   8332  O OG   . SER A 1 11 ? -14.789 -2.207  1.032   1.00 0.00 ? 11 SER A OG   10 
ATOM   8333  H H    . SER A 1 11 ? -14.766 -3.523  3.295   1.00 0.00 ? 11 SER A H    10 
ATOM   8334  H HA   . SER A 1 11 ? -12.011 -2.686  2.847   1.00 0.00 ? 11 SER A HA   10 
ATOM   8335  H HB2  . SER A 1 11 ? -13.068 -1.074  1.096   1.00 0.00 ? 11 SER A HB2  10 
ATOM   8336  H HB3  . SER A 1 11 ? -12.839 -2.751  0.644   1.00 0.00 ? 11 SER A HB3  10 
ATOM   8337  H HG   . SER A 1 11 ? -15.302 -2.286  1.887   1.00 0.00 ? 11 SER A HG   10 
ATOM   8338  N N    . LYS A 1 12 ? -12.461 -0.370  3.838   1.00 0.00 ? 12 LYS A N    10 
ATOM   8339  C CA   . LYS A 1 12 ? -12.657 0.796   4.683   1.00 0.00 ? 12 LYS A CA   10 
ATOM   8340  C C    . LYS A 1 12 ? -12.176 2.045   3.940   1.00 0.00 ? 12 LYS A C    10 
ATOM   8341  O O    . LYS A 1 12 ? -11.282 1.966   3.100   1.00 0.00 ? 12 LYS A O    10 
ATOM   8342  C CB   . LYS A 1 12 ? -11.984 0.592   6.042   1.00 0.00 ? 12 LYS A CB   10 
ATOM   8343  C CG   . LYS A 1 12 ? -12.565 1.544   7.089   1.00 0.00 ? 12 LYS A CG   10 
ATOM   8344  C CD   . LYS A 1 12 ? -12.524 0.916   8.484   1.00 0.00 ? 12 LYS A CD   10 
ATOM   8345  C CE   . LYS A 1 12 ? -12.456 1.993   9.569   1.00 0.00 ? 12 LYS A CE   10 
ATOM   8346  N NZ   . LYS A 1 12 ? -13.613 1.879   10.485  1.00 0.00 ? 12 LYS A NZ   10 
ATOM   8347  H H    . LYS A 1 12 ? -11.563 -0.429  3.401   1.00 0.00 ? 12 LYS A H    10 
ATOM   8348  H HA   . LYS A 1 12 ? -13.727 0.893   4.864   1.00 0.00 ? 12 LYS A HA   10 
ATOM   8349  H HB2  . LYS A 1 12 ? -12.119 -0.439  6.368   1.00 0.00 ? 12 LYS A HB2  10 
ATOM   8350  H HB3  . LYS A 1 12 ? -10.911 0.759   5.949   1.00 0.00 ? 12 LYS A HB3  10 
ATOM   8351  H HG2  . LYS A 1 12 ? -12.002 2.477   7.090   1.00 0.00 ? 12 LYS A HG2  10 
ATOM   8352  H HG3  . LYS A 1 12 ? -13.594 1.793   6.829   1.00 0.00 ? 12 LYS A HG3  10 
ATOM   8353  H HD2  . LYS A 1 12 ? -13.410 0.298   8.634   1.00 0.00 ? 12 LYS A HD2  10 
ATOM   8354  H HD3  . LYS A 1 12 ? -11.659 0.258   8.565   1.00 0.00 ? 12 LYS A HD3  10 
ATOM   8355  H HE2  . LYS A 1 12 ? -11.528 1.893   10.131  1.00 0.00 ? 12 LYS A HE2  10 
ATOM   8356  H HE3  . LYS A 1 12 ? -12.446 2.981   9.108   1.00 0.00 ? 12 LYS A HE3  10 
ATOM   8357  H HZ1  . LYS A 1 12 ? -13.865 2.787   10.818  1.00 0.00 ? 12 LYS A HZ1  10 
ATOM   8358  H HZ2  . LYS A 1 12 ? -14.387 1.476   9.997   1.00 0.00 ? 12 LYS A HZ2  10 
ATOM   8359  N N    . THR A 1 13 ? -12.792 3.169   4.278   1.00 0.00 ? 13 THR A N    10 
ATOM   8360  C CA   . THR A 1 13 ? -12.439 4.432   3.654   1.00 0.00 ? 13 THR A CA   10 
ATOM   8361  C C    . THR A 1 13 ? -11.380 5.160   4.485   1.00 0.00 ? 13 THR A C    10 
ATOM   8362  O O    . THR A 1 13 ? -11.556 5.357   5.686   1.00 0.00 ? 13 THR A O    10 
ATOM   8363  C CB   . THR A 1 13 ? -13.723 5.241   3.463   1.00 0.00 ? 13 THR A CB   10 
ATOM   8364  O OG1  . THR A 1 13 ? -14.402 4.570   2.405   1.00 0.00 ? 13 THR A OG1  10 
ATOM   8365  C CG2  . THR A 1 13 ? -13.456 6.641   2.906   1.00 0.00 ? 13 THR A CG2  10 
ATOM   8366  H H    . THR A 1 13 ? -13.519 3.224   4.962   1.00 0.00 ? 13 THR A H    10 
ATOM   8367  H HA   . THR A 1 13 ? -11.993 4.223   2.681   1.00 0.00 ? 13 THR A HA   10 
ATOM   8368  H HB   . THR A 1 13 ? -14.291 5.293   4.392   1.00 0.00 ? 13 THR A HB   10 
ATOM   8369  H HG1  . THR A 1 13 ? -15.130 5.152   2.043   1.00 0.00 ? 13 THR A HG1  10 
ATOM   8370  H HG21 . THR A 1 13 ? -12.704 7.139   3.518   1.00 0.00 ? 13 THR A HG21 10 
ATOM   8371  H HG22 . THR A 1 13 ? -13.095 6.561   1.881   1.00 0.00 ? 13 THR A HG22 10 
ATOM   8372  N N    . CYS A 1 14 ? -10.303 5.539   3.812   1.00 0.00 ? 14 CYS A N    10 
ATOM   8373  C CA   . CYS A 1 14 ? -9.216  6.241   4.473   1.00 0.00 ? 14 CYS A CA   10 
ATOM   8374  C C    . CYS A 1 14 ? -9.726  7.617   4.906   1.00 0.00 ? 14 CYS A C    10 
ATOM   8375  O O    . CYS A 1 14 ? -10.469 8.267   4.173   1.00 0.00 ? 14 CYS A O    10 
ATOM   8376  C CB   . CYS A 1 14 ? -7.982  6.346   3.575   1.00 0.00 ? 14 CYS A CB   10 
ATOM   8377  S SG   . CYS A 1 14 ? -7.666  4.877   2.530   1.00 0.00 ? 14 CYS A SG   10 
ATOM   8378  H H    . CYS A 1 14 ? -10.168 5.375   2.835   1.00 0.00 ? 14 CYS A H    10 
ATOM   8379  H HA   . CYS A 1 14 ? -8.938  5.641   5.340   1.00 0.00 ? 14 CYS A HA   10 
ATOM   8380  H HB2  . CYS A 1 14 ? -8.092  7.217   2.930   1.00 0.00 ? 14 CYS A HB2  10 
ATOM   8381  H HB3  . CYS A 1 14 ? -7.108  6.523   4.202   1.00 0.00 ? 14 CYS A HB3  10 
ATOM   8382  N N    . PRO A 1 15 ? -9.294  8.031   6.128   1.00 0.00 ? 15 PRO A N    10 
ATOM   8383  C CA   . PRO A 1 15 ? -9.698  9.318   6.667   1.00 0.00 ? 15 PRO A CA   10 
ATOM   8384  C C    . PRO A 1 15 ? -8.951  10.461  5.977   1.00 0.00 ? 15 PRO A C    10 
ATOM   8385  O O    . PRO A 1 15 ? -7.940  10.236  5.314   1.00 0.00 ? 15 PRO A O    10 
ATOM   8386  C CB   . PRO A 1 15 ? -9.405  9.230   8.156   1.00 0.00 ? 15 PRO A CB   10 
ATOM   8387  C CG   . PRO A 1 15 ? -8.423  8.082   8.320   1.00 0.00 ? 15 PRO A CG   10 
ATOM   8388  C CD   . PRO A 1 15 ? -8.413  7.288   7.024   1.00 0.00 ? 15 PRO A CD   10 
ATOM   8389  H HA   . PRO A 1 15 ? -10.669 9.480   6.490   1.00 0.00 ? 15 PRO A HA   10 
ATOM   8390  H HB2  . PRO A 1 15 ? -8.980  10.163  8.526   1.00 0.00 ? 15 PRO A HB2  10 
ATOM   8391  H HB3  . PRO A 1 15 ? -10.318 9.049   8.724   1.00 0.00 ? 15 PRO A HB3  10 
ATOM   8392  H HG2  . PRO A 1 15 ? -7.426  8.461   8.544   1.00 0.00 ? 15 PRO A HG2  10 
ATOM   8393  H HG3  . PRO A 1 15 ? -8.717  7.445   9.155   1.00 0.00 ? 15 PRO A HG3  10 
ATOM   8394  H HD2  . PRO A 1 15 ? -7.406  7.211   6.615   1.00 0.00 ? 15 PRO A HD2  10 
ATOM   8395  H HD3  . PRO A 1 15 ? -8.773  6.271   7.179   1.00 0.00 ? 15 PRO A HD3  10 
ATOM   8396  N N    . ALA A 1 16 ? -9.479  11.664  6.156   1.00 0.00 ? 16 ALA A N    10 
ATOM   8397  C CA   . ALA A 1 16 ? -8.874  12.842  5.559   1.00 0.00 ? 16 ALA A CA   10 
ATOM   8398  C C    . ALA A 1 16 ? -7.360  12.797  5.772   1.00 0.00 ? 16 ALA A C    10 
ATOM   8399  O O    . ALA A 1 16 ? -6.888  12.334  6.809   1.00 0.00 ? 16 ALA A O    10 
ATOM   8400  C CB   . ALA A 1 16 ? -9.509  14.100  6.156   1.00 0.00 ? 16 ALA A CB   10 
ATOM   8401  H H    . ALA A 1 16 ? -10.301 11.838  6.697   1.00 0.00 ? 16 ALA A H    10 
ATOM   8402  H HA   . ALA A 1 16 ? -9.084  12.817  4.490   1.00 0.00 ? 16 ALA A HA   10 
ATOM   8403  H HB1  . ALA A 1 16 ? -9.105  14.272  7.154   1.00 0.00 ? 16 ALA A HB1  10 
ATOM   8404  H HB2  . ALA A 1 16 ? -9.285  14.957  5.521   1.00 0.00 ? 16 ALA A HB2  10 
ATOM   8405  N N    . GLY A 1 17 ? -6.639  13.283  4.772   1.00 0.00 ? 17 GLY A N    10 
ATOM   8406  C CA   . GLY A 1 17 ? -5.188  13.304  4.836   1.00 0.00 ? 17 GLY A CA   10 
ATOM   8407  C C    . GLY A 1 17 ? -4.588  12.129  4.060   1.00 0.00 ? 17 GLY A C    10 
ATOM   8408  O O    . GLY A 1 17 ? -3.687  12.315  3.244   1.00 0.00 ? 17 GLY A O    10 
ATOM   8409  H H    . GLY A 1 17 ? -7.030  13.658  3.931   1.00 0.00 ? 17 GLY A H    10 
ATOM   8410  H HA2  . GLY A 1 17 ? -4.815  14.243  4.427   1.00 0.00 ? 17 GLY A HA2  10 
ATOM   8411  H HA3  . GLY A 1 17 ? -4.866  13.260  5.876   1.00 0.00 ? 17 GLY A HA3  10 
ATOM   8412  N N    . LYS A 1 18 ? -5.112  10.946  4.342   1.00 0.00 ? 18 LYS A N    10 
ATOM   8413  C CA   . LYS A 1 18 ? -4.640  9.741   3.681   1.00 0.00 ? 18 LYS A CA   10 
ATOM   8414  C C    . LYS A 1 18 ? -5.513  9.461   2.457   1.00 0.00 ? 18 LYS A C    10 
ATOM   8415  O O    . LYS A 1 18 ? -6.572  8.847   2.572   1.00 0.00 ? 18 LYS A O    10 
ATOM   8416  C CB   . LYS A 1 18 ? -4.577  8.576   4.671   1.00 0.00 ? 18 LYS A CB   10 
ATOM   8417  C CG   . LYS A 1 18 ? -4.046  9.039   6.030   1.00 0.00 ? 18 LYS A CG   10 
ATOM   8418  C CD   . LYS A 1 18 ? -2.624  9.590   5.904   1.00 0.00 ? 18 LYS A CD   10 
ATOM   8419  C CE   . LYS A 1 18 ? -2.069  9.992   7.272   1.00 0.00 ? 18 LYS A CE   10 
ATOM   8420  N NZ   . LYS A 1 18 ? -1.163  8.943   7.792   1.00 0.00 ? 18 LYS A NZ   10 
ATOM   8421  H H    . LYS A 1 18 ? -5.845  10.803  5.007   1.00 0.00 ? 18 LYS A H    10 
ATOM   8422  H HA   . LYS A 1 18 ? -3.621  9.932   3.343   1.00 0.00 ? 18 LYS A HA   10 
ATOM   8423  H HB2  . LYS A 1 18 ? -5.570  8.143   4.793   1.00 0.00 ? 18 LYS A HB2  10 
ATOM   8424  H HB3  . LYS A 1 18 ? -3.934  7.791   4.274   1.00 0.00 ? 18 LYS A HB3  10 
ATOM   8425  H HG2  . LYS A 1 18 ? -4.703  9.807   6.438   1.00 0.00 ? 18 LYS A HG2  10 
ATOM   8426  H HG3  . LYS A 1 18 ? -4.056  8.205   6.731   1.00 0.00 ? 18 LYS A HG3  10 
ATOM   8427  H HD2  . LYS A 1 18 ? -1.978  8.838   5.452   1.00 0.00 ? 18 LYS A HD2  10 
ATOM   8428  H HD3  . LYS A 1 18 ? -2.623  10.453  5.239   1.00 0.00 ? 18 LYS A HD3  10 
ATOM   8429  H HE2  . LYS A 1 18 ? -1.532  10.937  7.190   1.00 0.00 ? 18 LYS A HE2  10 
ATOM   8430  H HE3  . LYS A 1 18 ? -2.890  10.151  7.971   1.00 0.00 ? 18 LYS A HE3  10 
ATOM   8431  H HZ1  . LYS A 1 18 ? -0.507  9.354   8.425   1.00 0.00 ? 18 LYS A HZ1  10 
ATOM   8432  H HZ2  . LYS A 1 18 ? -1.699  8.248   8.272   1.00 0.00 ? 18 LYS A HZ2  10 
ATOM   8433  N N    . ASN A 1 19 ? -5.036  9.924   1.311   1.00 0.00 ? 19 ASN A N    10 
ATOM   8434  C CA   . ASN A 1 19 ? -5.759  9.731   0.066   1.00 0.00 ? 19 ASN A CA   10 
ATOM   8435  C C    . ASN A 1 19 ? -4.981  8.762   -0.826  1.00 0.00 ? 19 ASN A C    10 
ATOM   8436  O O    . ASN A 1 19 ? -5.239  8.673   -2.026  1.00 0.00 ? 19 ASN A O    10 
ATOM   8437  C CB   . ASN A 1 19 ? -5.913  11.051  -0.692  1.00 0.00 ? 19 ASN A CB   10 
ATOM   8438  C CG   . ASN A 1 19 ? -7.200  11.771  -0.284  1.00 0.00 ? 19 ASN A CG   10 
ATOM   8439  O OD1  . ASN A 1 19 ? -8.299  11.261  -0.426  1.00 0.00 ? 19 ASN A OD1  10 
ATOM   8440  N ND2  . ASN A 1 19 ? -7.003  12.982  0.230   1.00 0.00 ? 19 ASN A ND2  10 
ATOM   8441  H H    . ASN A 1 19 ? -4.173  10.423  1.225   1.00 0.00 ? 19 ASN A H    10 
ATOM   8442  H HA   . ASN A 1 19 ? -6.733  9.339   0.358   1.00 0.00 ? 19 ASN A HA   10 
ATOM   8443  H HB2  . ASN A 1 19 ? -5.055  11.692  -0.492  1.00 0.00 ? 19 ASN A HB2  10 
ATOM   8444  H HB3  . ASN A 1 19 ? -5.924  10.860  -1.765  1.00 0.00 ? 19 ASN A HB3  10 
ATOM   8445  H HD21 . ASN A 1 19 ? -6.074  13.342  0.319   1.00 0.00 ? 19 ASN A HD21 10 
ATOM   8446  H HD22 . ASN A 1 19 ? -7.783  13.532  0.527   1.00 0.00 ? 19 ASN A HD22 10 
ATOM   8447  N N    . LEU A 1 20 ? -4.045  8.059   -0.206  1.00 0.00 ? 20 LEU A N    10 
ATOM   8448  C CA   . LEU A 1 20 ? -3.228  7.100   -0.929  1.00 0.00 ? 20 LEU A CA   10 
ATOM   8449  C C    . LEU A 1 20 ? -3.233  5.765   -0.180  1.00 0.00 ? 20 LEU A C    10 
ATOM   8450  O O    . LEU A 1 20 ? -3.013  5.727   1.029   1.00 0.00 ? 20 LEU A O    10 
ATOM   8451  C CB   . LEU A 1 20 ? -1.826  7.664   -1.170  1.00 0.00 ? 20 LEU A CB   10 
ATOM   8452  C CG   . LEU A 1 20 ? -1.723  8.783   -2.208  1.00 0.00 ? 20 LEU A CG   10 
ATOM   8453  C CD1  . LEU A 1 20 ? -0.426  9.575   -2.033  1.00 0.00 ? 20 LEU A CD1  10 
ATOM   8454  C CD2  . LEU A 1 20 ? -1.870  8.231   -3.627  1.00 0.00 ? 20 LEU A CD2  10 
ATOM   8455  H H    . LEU A 1 20 ? -3.841  8.137   0.770   1.00 0.00 ? 20 LEU A H    10 
ATOM   8456  H HA   . LEU A 1 20 ? -3.687  6.949   -1.906  1.00 0.00 ? 20 LEU A HA   10 
ATOM   8457  H HB2  . LEU A 1 20 ? -1.438  8.037   -0.222  1.00 0.00 ? 20 LEU A HB2  10 
ATOM   8458  H HB3  . LEU A 1 20 ? -1.176  6.846   -1.481  1.00 0.00 ? 20 LEU A HB3  10 
ATOM   8459  H HG   . LEU A 1 20 ? -2.548  9.477   -2.045  1.00 0.00 ? 20 LEU A HG   10 
ATOM   8460  H HD11 . LEU A 1 20 ? 0.356   8.914   -1.659  1.00 0.00 ? 20 LEU A HD11 10 
ATOM   8461  H HD12 . LEU A 1 20 ? -0.122  9.992   -2.993  1.00 0.00 ? 20 LEU A HD12 10 
ATOM   8462  H HD21 . LEU A 1 20 ? -0.963  7.692   -3.903  1.00 0.00 ? 20 LEU A HD21 10 
ATOM   8463  H HD22 . LEU A 1 20 ? -2.722  7.552   -3.666  1.00 0.00 ? 20 LEU A HD22 10 
ATOM   8464  N N    . CYS A 1 21 ? -3.487  4.703   -0.931  1.00 0.00 ? 21 CYS A N    10 
ATOM   8465  C CA   . CYS A 1 21 ? -3.524  3.370   -0.353  1.00 0.00 ? 21 CYS A CA   10 
ATOM   8466  C C    . CYS A 1 21 ? -2.147  2.729   -0.537  1.00 0.00 ? 21 CYS A C    10 
ATOM   8467  O O    . CYS A 1 21 ? -1.522  2.881   -1.585  1.00 0.00 ? 21 CYS A O    10 
ATOM   8468  C CB   . CYS A 1 21 ? -4.637  2.519   -0.967  1.00 0.00 ? 21 CYS A CB   10 
ATOM   8469  S SG   . CYS A 1 21 ? -6.310  3.252   -0.863  1.00 0.00 ? 21 CYS A SG   10 
ATOM   8470  H H    . CYS A 1 21 ? -3.665  4.743   -1.914  1.00 0.00 ? 21 CYS A H    10 
ATOM   8471  H HA   . CYS A 1 21 ? -3.755  3.494   0.705   1.00 0.00 ? 21 CYS A HA   10 
ATOM   8472  H HB2  . CYS A 1 21 ? -4.400  2.337   -2.015  1.00 0.00 ? 21 CYS A HB2  10 
ATOM   8473  H HB3  . CYS A 1 21 ? -4.649  1.549   -0.470  1.00 0.00 ? 21 CYS A HB3  10 
ATOM   8474  N N    . TYR A 1 22 ? -1.715  2.025   0.499   1.00 0.00 ? 22 TYR A N    10 
ATOM   8475  C CA   . TYR A 1 22 ? -0.423  1.360   0.465   1.00 0.00 ? 22 TYR A CA   10 
ATOM   8476  C C    . TYR A 1 22 ? -0.553  -0.110  0.871   1.00 0.00 ? 22 TYR A C    10 
ATOM   8477  O O    . TYR A 1 22 ? -1.466  -0.475  1.610   1.00 0.00 ? 22 TYR A O    10 
ATOM   8478  C CB   . TYR A 1 22 ? 0.452   2.085   1.490   1.00 0.00 ? 22 TYR A CB   10 
ATOM   8479  C CG   . TYR A 1 22 ? 0.285   1.574   2.923   1.00 0.00 ? 22 TYR A CG   10 
ATOM   8480  C CD1  . TYR A 1 22 ? 0.934   0.424   3.325   1.00 0.00 ? 22 TYR A CD1  10 
ATOM   8481  C CD2  . TYR A 1 22 ? -0.514  2.262   3.812   1.00 0.00 ? 22 TYR A CD2  10 
ATOM   8482  C CE1  . TYR A 1 22 ? 0.777   -0.057  4.674   1.00 0.00 ? 22 TYR A CE1  10 
ATOM   8483  C CE2  . TYR A 1 22 ? -0.671  1.782   5.161   1.00 0.00 ? 22 TYR A CE2  10 
ATOM   8484  C CZ   . TYR A 1 22 ? -0.018  0.646   5.525   1.00 0.00 ? 22 TYR A CZ   10 
ATOM   8485  O OH   . TYR A 1 22 ? -0.166  0.192   6.798   1.00 0.00 ? 22 TYR A OH   10 
ATOM   8486  H H    . TYR A 1 22 ? -2.229  1.906   1.349   1.00 0.00 ? 22 TYR A H    10 
ATOM   8487  H HA   . TYR A 1 22 ? -0.043  1.415   -0.554  1.00 0.00 ? 22 TYR A HA   10 
ATOM   8488  H HB2  . TYR A 1 22 ? 1.497   1.982   1.198   1.00 0.00 ? 22 TYR A HB2  10 
ATOM   8489  H HB3  . TYR A 1 22 ? 0.217   3.149   1.465   1.00 0.00 ? 22 TYR A HB3  10 
ATOM   8490  H HD1  . TYR A 1 22 ? 1.565   -0.120  2.623   1.00 0.00 ? 22 TYR A HD1  10 
ATOM   8491  H HD2  . TYR A 1 22 ? -1.027  3.170   3.495   1.00 0.00 ? 22 TYR A HD2  10 
ATOM   8492  H HE1  . TYR A 1 22 ? 1.284   -0.963  5.004   1.00 0.00 ? 22 TYR A HE1  10 
ATOM   8493  H HE2  . TYR A 1 22 ? -1.299  2.316   5.874   1.00 0.00 ? 22 TYR A HE2  10 
ATOM   8494  H HH   . TYR A 1 22 ? -0.988  0.586   7.208   1.00 0.00 ? 22 TYR A HH   10 
ATOM   8495  N N    . LYS A 1 23 ? 0.375   -0.912  0.371   1.00 0.00 ? 23 LYS A N    10 
ATOM   8496  C CA   . LYS A 1 23 ? 0.376   -2.334  0.673   1.00 0.00 ? 23 LYS A CA   10 
ATOM   8497  C C    . LYS A 1 23 ? 1.816   -2.803  0.895   1.00 0.00 ? 23 LYS A C    10 
ATOM   8498  O O    . LYS A 1 23 ? 2.677   -2.600  0.041   1.00 0.00 ? 23 LYS A O    10 
ATOM   8499  C CB   . LYS A 1 23 ? -0.363  -3.113  -0.417  1.00 0.00 ? 23 LYS A CB   10 
ATOM   8500  C CG   . LYS A 1 23 ? 0.440   -3.131  -1.719  1.00 0.00 ? 23 LYS A CG   10 
ATOM   8501  C CD   . LYS A 1 23 ? -0.326  -3.858  -2.826  1.00 0.00 ? 23 LYS A CD   10 
ATOM   8502  C CE   . LYS A 1 23 ? 0.477   -5.047  -3.358  1.00 0.00 ? 23 LYS A CE   10 
ATOM   8503  N NZ   . LYS A 1 23 ? -0.127  -6.322  -2.912  1.00 0.00 ? 23 LYS A NZ   10 
ATOM   8504  H H    . LYS A 1 23 ? 1.115   -0.607  -0.228  1.00 0.00 ? 23 LYS A H    10 
ATOM   8505  H HA   . LYS A 1 23 ? -0.179  -2.471  1.601   1.00 0.00 ? 23 LYS A HA   10 
ATOM   8506  H HB2  . LYS A 1 23 ? -0.542  -4.135  -0.081  1.00 0.00 ? 23 LYS A HB2  10 
ATOM   8507  H HB3  . LYS A 1 23 ? -1.339  -2.661  -0.594  1.00 0.00 ? 23 LYS A HB3  10 
ATOM   8508  H HG2  . LYS A 1 23 ? 0.656   -2.109  -2.032  1.00 0.00 ? 23 LYS A HG2  10 
ATOM   8509  H HG3  . LYS A 1 23 ? 1.399   -3.622  -1.552  1.00 0.00 ? 23 LYS A HG3  10 
ATOM   8510  H HD2  . LYS A 1 23 ? -1.285  -4.206  -2.441  1.00 0.00 ? 23 LYS A HD2  10 
ATOM   8511  H HD3  . LYS A 1 23 ? -0.541  -3.166  -3.640  1.00 0.00 ? 23 LYS A HD3  10 
ATOM   8512  H HE2  . LYS A 1 23 ? 0.507   -5.014  -4.447  1.00 0.00 ? 23 LYS A HE2  10 
ATOM   8513  H HE3  . LYS A 1 23 ? 1.507   -4.983  -3.009  1.00 0.00 ? 23 LYS A HE3  10 
ATOM   8514  H HZ1  . LYS A 1 23 ? -1.115  -6.205  -2.808  1.00 0.00 ? 23 LYS A HZ1  10 
ATOM   8515  H HZ2  . LYS A 1 23 ? 0.055   -7.033  -3.591  1.00 0.00 ? 23 LYS A HZ2  10 
ATOM   8516  N N    . MET A 1 24 ? 2.032   -3.420  2.047   1.00 0.00 ? 24 MET A N    10 
ATOM   8517  C CA   . MET A 1 24 ? 3.352   -3.919  2.392   1.00 0.00 ? 24 MET A CA   10 
ATOM   8518  C C    . MET A 1 24 ? 3.416   -5.442  2.256   1.00 0.00 ? 24 MET A C    10 
ATOM   8519  O O    . MET A 1 24 ? 2.627   -6.157  2.872   1.00 0.00 ? 24 MET A O    10 
ATOM   8520  C CB   . MET A 1 24 ? 3.689   -3.521  3.831   1.00 0.00 ? 24 MET A CB   10 
ATOM   8521  C CG   . MET A 1 24 ? 3.885   -2.008  3.949   1.00 0.00 ? 24 MET A CG   10 
ATOM   8522  S SD   . MET A 1 24 ? 3.838   -1.518  5.665   1.00 0.00 ? 24 MET A SD   10 
ATOM   8523  C CE   . MET A 1 24 ? 5.385   -2.209  6.227   1.00 0.00 ? 24 MET A CE   10 
ATOM   8524  H H    . MET A 1 24 ? 1.326   -3.581  2.737   1.00 0.00 ? 24 MET A H    10 
ATOM   8525  H HA   . MET A 1 24 ? 4.036   -3.455  1.682   1.00 0.00 ? 24 MET A HA   10 
ATOM   8526  H HB2  . MET A 1 24 ? 2.887   -3.840  4.497   1.00 0.00 ? 24 MET A HB2  10 
ATOM   8527  H HB3  . MET A 1 24 ? 4.594   -4.035  4.152   1.00 0.00 ? 24 MET A HB3  10 
ATOM   8528  H HG2  . MET A 1 24 ? 4.839   -1.721  3.507   1.00 0.00 ? 24 MET A HG2  10 
ATOM   8529  H HG3  . MET A 1 24 ? 3.107   -1.487  3.392   1.00 0.00 ? 24 MET A HG3  10 
ATOM   8530  H HE1  . MET A 1 24 ? 5.187   -3.057  6.883   1.00 0.00 ? 24 MET A HE1  10 
ATOM   8531  H HE2  . MET A 1 24 ? 5.968   -2.542  5.368   1.00 0.00 ? 24 MET A HE2  10 
ATOM   8532  N N    . PHE A 1 25 ? 4.362   -5.892  1.446   1.00 0.00 ? 25 PHE A N    10 
ATOM   8533  C CA   . PHE A 1 25 ? 4.539   -7.317  1.221   1.00 0.00 ? 25 PHE A CA   10 
ATOM   8534  C C    . PHE A 1 25 ? 6.023   -7.689  1.205   1.00 0.00 ? 25 PHE A C    10 
ATOM   8535  O O    . PHE A 1 25 ? 6.883   -6.822  1.059   1.00 0.00 ? 25 PHE A O    10 
ATOM   8536  C CB   . PHE A 1 25 ? 3.931   -7.632  -0.148  1.00 0.00 ? 25 PHE A CB   10 
ATOM   8537  C CG   . PHE A 1 25 ? 4.755   -7.114  -1.328  1.00 0.00 ? 25 PHE A CG   10 
ATOM   8538  C CD1  . PHE A 1 25 ? 4.834   -5.778  -1.568  1.00 0.00 ? 25 PHE A CD1  10 
ATOM   8539  C CD2  . PHE A 1 25 ? 5.407   -7.990  -2.139  1.00 0.00 ? 25 PHE A CD2  10 
ATOM   8540  C CE1  . PHE A 1 25 ? 5.599   -5.297  -2.664  1.00 0.00 ? 25 PHE A CE1  10 
ATOM   8541  C CE2  . PHE A 1 25 ? 6.172   -7.509  -3.235  1.00 0.00 ? 25 PHE A CE2  10 
ATOM   8542  C CZ   . PHE A 1 25 ? 6.251   -6.173  -3.474  1.00 0.00 ? 25 PHE A CZ   10 
ATOM   8543  H H    . PHE A 1 25 ? 4.999   -5.304  0.949   1.00 0.00 ? 25 PHE A H    10 
ATOM   8544  H HA   . PHE A 1 25 ? 4.044   -7.838  2.040   1.00 0.00 ? 25 PHE A HA   10 
ATOM   8545  H HB2  . PHE A 1 25 ? 3.818   -8.712  -0.243  1.00 0.00 ? 25 PHE A HB2  10 
ATOM   8546  H HB3  . PHE A 1 25 ? 2.932   -7.201  -0.198  1.00 0.00 ? 25 PHE A HB3  10 
ATOM   8547  H HD1  . PHE A 1 25 ? 4.312   -5.076  -0.918  1.00 0.00 ? 25 PHE A HD1  10 
ATOM   8548  H HD2  . PHE A 1 25 ? 5.344   -9.061  -1.947  1.00 0.00 ? 25 PHE A HD2  10 
ATOM   8549  H HE1  . PHE A 1 25 ? 5.663   -4.226  -2.855  1.00 0.00 ? 25 PHE A HE1  10 
ATOM   8550  H HE2  . PHE A 1 25 ? 6.695   -8.211  -3.884  1.00 0.00 ? 25 PHE A HE2  10 
ATOM   8551  H HZ   . PHE A 1 25 ? 6.838   -5.804  -4.315  1.00 0.00 ? 25 PHE A HZ   10 
ATOM   8552  N N    . MET A 1 26 ? 6.277   -8.981  1.357   1.00 0.00 ? 26 MET A N    10 
ATOM   8553  C CA   . MET A 1 26 ? 7.642   -9.479  1.363   1.00 0.00 ? 26 MET A CA   10 
ATOM   8554  C C    . MET A 1 26 ? 8.048   -9.982  -0.024  1.00 0.00 ? 26 MET A C    10 
ATOM   8555  O O    . MET A 1 26 ? 7.197   -10.390 -0.814  1.00 0.00 ? 26 MET A O    10 
ATOM   8556  C CB   . MET A 1 26 ? 7.766   -10.619 2.376   1.00 0.00 ? 26 MET A CB   10 
ATOM   8557  C CG   . MET A 1 26 ? 7.517   -10.116 3.799   1.00 0.00 ? 26 MET A CG   10 
ATOM   8558  S SD   . MET A 1 26 ? 7.465   -11.495 4.932   1.00 0.00 ? 26 MET A SD   10 
ATOM   8559  C CE   . MET A 1 26 ? 6.242   -10.899 6.089   1.00 0.00 ? 26 MET A CE   10 
ATOM   8560  H H    . MET A 1 26 ? 5.572   -9.680  1.476   1.00 0.00 ? 26 MET A H    10 
ATOM   8561  H HA   . MET A 1 26 ? 8.263   -8.628  1.644   1.00 0.00 ? 26 MET A HA   10 
ATOM   8562  H HB2  . MET A 1 26 ? 7.051   -11.405 2.133   1.00 0.00 ? 26 MET A HB2  10 
ATOM   8563  H HB3  . MET A 1 26 ? 8.760   -11.061 2.311   1.00 0.00 ? 26 MET A HB3  10 
ATOM   8564  H HG2  . MET A 1 26 ? 8.305   -9.423  4.093   1.00 0.00 ? 26 MET A HG2  10 
ATOM   8565  H HG3  . MET A 1 26 ? 6.577   -9.566  3.840   1.00 0.00 ? 26 MET A HG3  10 
ATOM   8566  H HE1  . MET A 1 26 ? 5.651   -10.112 5.620   1.00 0.00 ? 26 MET A HE1  10 
ATOM   8567  H HE2  . MET A 1 26 ? 5.587   -11.720 6.380   1.00 0.00 ? 26 MET A HE2  10 
ATOM   8568  N N    . VAL A 1 27 ? 9.347   -9.936  -0.279  1.00 0.00 ? 27 VAL A N    10 
ATOM   8569  C CA   . VAL A 1 27 ? 9.876   -10.382 -1.557  1.00 0.00 ? 27 VAL A CA   10 
ATOM   8570  C C    . VAL A 1 27 ? 9.491   -11.846 -1.780  1.00 0.00 ? 27 VAL A C    10 
ATOM   8571  O O    . VAL A 1 27 ? 9.582   -12.352 -2.897  1.00 0.00 ? 27 VAL A O    10 
ATOM   8572  C CB   . VAL A 1 27 ? 11.387  -10.146 -1.609  1.00 0.00 ? 27 VAL A CB   10 
ATOM   8573  C CG1  . VAL A 1 27 ? 12.123  -11.104 -0.670  1.00 0.00 ? 27 VAL A CG1  10 
ATOM   8574  C CG2  . VAL A 1 27 ? 11.911  -10.269 -3.041  1.00 0.00 ? 27 VAL A CG2  10 
ATOM   8575  H H    . VAL A 1 27 ? 10.032  -9.602  0.369   1.00 0.00 ? 27 VAL A H    10 
ATOM   8576  H HA   . VAL A 1 27 ? 9.412   -9.775  -2.334  1.00 0.00 ? 27 VAL A HA   10 
ATOM   8577  H HB   . VAL A 1 27 ? 11.579  -9.129  -1.268  1.00 0.00 ? 27 VAL A HB   10 
ATOM   8578  H HG11 . VAL A 1 27 ? 12.910  -11.620 -1.222  1.00 0.00 ? 27 VAL A HG11 10 
ATOM   8579  H HG12 . VAL A 1 27 ? 12.566  -10.540 0.151   1.00 0.00 ? 27 VAL A HG12 10 
ATOM   8580  H HG21 . VAL A 1 27 ? 12.359  -9.324  -3.346  1.00 0.00 ? 27 VAL A HG21 10 
ATOM   8581  H HG22 . VAL A 1 27 ? 12.663  -11.058 -3.086  1.00 0.00 ? 27 VAL A HG22 10 
ATOM   8582  N N    . ALA A 1 28 ? 9.068   -12.485 -0.699  1.00 0.00 ? 28 ALA A N    10 
ATOM   8583  C CA   . ALA A 1 28 ? 8.668   -13.880 -0.763  1.00 0.00 ? 28 ALA A CA   10 
ATOM   8584  C C    . ALA A 1 28 ? 7.953   -14.141 -2.090  1.00 0.00 ? 28 ALA A C    10 
ATOM   8585  O O    . ALA A 1 28 ? 8.222   -15.138 -2.759  1.00 0.00 ? 28 ALA A O    10 
ATOM   8586  C CB   . ALA A 1 28 ? 7.794   -14.217 0.447   1.00 0.00 ? 28 ALA A CB   10 
ATOM   8587  H H    . ALA A 1 28 ? 8.996   -12.066 0.206   1.00 0.00 ? 28 ALA A H    10 
ATOM   8588  H HA   . ALA A 1 28 ? 9.573   -14.487 -0.722  1.00 0.00 ? 28 ALA A HA   10 
ATOM   8589  H HB1  . ALA A 1 28 ? 6.884   -13.618 0.415   1.00 0.00 ? 28 ALA A HB1  10 
ATOM   8590  H HB2  . ALA A 1 28 ? 7.533   -15.275 0.423   1.00 0.00 ? 28 ALA A HB2  10 
ATOM   8591  N N    . ALA A 1 29 ? 7.056   -13.228 -2.432  1.00 0.00 ? 29 ALA A N    10 
ATOM   8592  C CA   . ALA A 1 29 ? 6.300   -13.347 -3.667  1.00 0.00 ? 29 ALA A CA   10 
ATOM   8593  C C    . ALA A 1 29 ? 6.025   -11.951 -4.228  1.00 0.00 ? 29 ALA A C    10 
ATOM   8594  O O    . ALA A 1 29 ? 5.949   -10.980 -3.477  1.00 0.00 ? 29 ALA A O    10 
ATOM   8595  C CB   . ALA A 1 29 ? 5.015   -14.135 -3.405  1.00 0.00 ? 29 ALA A CB   10 
ATOM   8596  H H    . ALA A 1 29 ? 6.843   -12.420 -1.882  1.00 0.00 ? 29 ALA A H    10 
ATOM   8597  H HA   . ALA A 1 29 ? 6.913   -13.901 -4.379  1.00 0.00 ? 29 ALA A HA   10 
ATOM   8598  H HB1  . ALA A 1 29 ? 4.925   -14.340 -2.339  1.00 0.00 ? 29 ALA A HB1  10 
ATOM   8599  H HB2  . ALA A 1 29 ? 4.157   -13.550 -3.736  1.00 0.00 ? 29 ALA A HB2  10 
ATOM   8600  N N    . PRO A 1 30 ? 5.878   -11.892 -5.579  1.00 0.00 ? 30 PRO A N    10 
ATOM   8601  C CA   . PRO A 1 30 ? 5.613   -10.631 -6.249  1.00 0.00 ? 30 PRO A CA   10 
ATOM   8602  C C    . PRO A 1 30 ? 4.162   -10.193 -6.038  1.00 0.00 ? 30 PRO A C    10 
ATOM   8603  O O    . PRO A 1 30 ? 3.840   -9.013  -6.173  1.00 0.00 ? 30 PRO A O    10 
ATOM   8604  C CB   . PRO A 1 30 ? 5.951   -10.882 -7.709  1.00 0.00 ? 30 PRO A CB   10 
ATOM   8605  C CG   . PRO A 1 30 ? 5.947   -12.392 -7.884  1.00 0.00 ? 30 PRO A CG   10 
ATOM   8606  C CD   . PRO A 1 30 ? 5.961   -13.022 -6.500  1.00 0.00 ? 30 PRO A CD   10 
ATOM   8607  H HA   . PRO A 1 30 ? 6.177   -9.904  -5.858  1.00 0.00 ? 30 PRO A HA   10 
ATOM   8608  H HB2  . PRO A 1 30 ? 5.220   -10.411 -8.366  1.00 0.00 ? 30 PRO A HB2  10 
ATOM   8609  H HB3  . PRO A 1 30 ? 6.924   -10.462 -7.963  1.00 0.00 ? 30 PRO A HB3  10 
ATOM   8610  H HG2  . PRO A 1 30 ? 5.065   -12.710 -8.439  1.00 0.00 ? 30 PRO A HG2  10 
ATOM   8611  H HG3  . PRO A 1 30 ? 6.817   -12.712 -8.458  1.00 0.00 ? 30 PRO A HG3  10 
ATOM   8612  H HD2  . PRO A 1 30 ? 5.122   -13.704 -6.367  1.00 0.00 ? 30 PRO A HD2  10 
ATOM   8613  H HD3  . PRO A 1 30 ? 6.871   -13.600 -6.338  1.00 0.00 ? 30 PRO A HD3  10 
ATOM   8614  N N    . HIS A 1 31 ? 3.325   -11.166 -5.711  1.00 0.00 ? 31 HIS A N    10 
ATOM   8615  C CA   . HIS A 1 31 ? 1.916   -10.896 -5.480  1.00 0.00 ? 31 HIS A CA   10 
ATOM   8616  C C    . HIS A 1 31 ? 1.446   -11.650 -4.234  1.00 0.00 ? 31 HIS A C    10 
ATOM   8617  O O    . HIS A 1 31 ? 0.583   -12.522 -4.321  1.00 0.00 ? 31 HIS A O    10 
ATOM   8618  C CB   . HIS A 1 31 ? 1.088   -11.230 -6.723  1.00 0.00 ? 31 HIS A CB   10 
ATOM   8619  C CG   . HIS A 1 31 ? -0.331  -10.717 -6.671  1.00 0.00 ? 31 HIS A CG   10 
ATOM   8620  N ND1  . HIS A 1 31 ? -1.403  -11.423 -7.188  1.00 0.00 ? 31 HIS A ND1  10 
ATOM   8621  C CD2  . HIS A 1 31 ? -0.843  -9.561  -6.159  1.00 0.00 ? 31 HIS A CD2  10 
ATOM   8622  C CE1  . HIS A 1 31 ? -2.505  -10.715 -6.991  1.00 0.00 ? 31 HIS A CE1  10 
ATOM   8623  N NE2  . HIS A 1 31 ? -2.156  -9.561  -6.353  1.00 0.00 ? 31 HIS A NE2  10 
ATOM   8624  H H    . HIS A 1 31 ? 3.595   -12.123 -5.603  1.00 0.00 ? 31 HIS A H    10 
ATOM   8625  H HA   . HIS A 1 31 ? 1.829   -9.825  -5.300  1.00 0.00 ? 31 HIS A HA   10 
ATOM   8626  H HB2  . HIS A 1 31 ? 1.583   -10.813 -7.599  1.00 0.00 ? 31 HIS A HB2  10 
ATOM   8627  H HB3  . HIS A 1 31 ? 1.068   -12.312 -6.853  1.00 0.00 ? 31 HIS A HB3  10 
ATOM   8628  H HD1  . HIS A 1 31 ? -1.354  -12.317 -7.634  1.00 0.00 ? 31 HIS A HD1  10 
ATOM   8629  H HD2  . HIS A 1 31 ? -0.270  -8.771  -5.672  1.00 0.00 ? 31 HIS A HD2  10 
ATOM   8630  H HE1  . HIS A 1 31 ? -3.514  -11.003 -7.286  1.00 0.00 ? 31 HIS A HE1  10 
ATOM   8631  N N    . VAL A 1 32 ? 2.036   -11.286 -3.105  1.00 0.00 ? 32 VAL A N    10 
ATOM   8632  C CA   . VAL A 1 32 ? 1.688   -11.917 -1.843  1.00 0.00 ? 32 VAL A CA   10 
ATOM   8633  C C    . VAL A 1 32 ? 1.923   -10.927 -0.700  1.00 0.00 ? 32 VAL A C    10 
ATOM   8634  O O    . VAL A 1 32 ? 2.997   -10.906 -0.102  1.00 0.00 ? 32 VAL A O    10 
ATOM   8635  C CB   . VAL A 1 32 ? 2.473   -13.220 -1.675  1.00 0.00 ? 32 VAL A CB   10 
ATOM   8636  C CG1  . VAL A 1 32 ? 2.339   -13.762 -0.251  1.00 0.00 ? 32 VAL A CG1  10 
ATOM   8637  C CG2  . VAL A 1 32 ? 2.031   -14.263 -2.703  1.00 0.00 ? 32 VAL A CG2  10 
ATOM   8638  H H    . VAL A 1 32 ? 2.737   -10.576 -3.043  1.00 0.00 ? 32 VAL A H    10 
ATOM   8639  H HA   . VAL A 1 32 ? 0.627   -12.165 -1.880  1.00 0.00 ? 32 VAL A HA   10 
ATOM   8640  H HB   . VAL A 1 32 ? 3.527   -13.001 -1.852  1.00 0.00 ? 32 VAL A HB   10 
ATOM   8641  H HG11 . VAL A 1 32 ? 3.330   -13.885 0.186   1.00 0.00 ? 32 VAL A HG11 10 
ATOM   8642  H HG12 . VAL A 1 32 ? 1.760   -13.061 0.351   1.00 0.00 ? 32 VAL A HG12 10 
ATOM   8643  H HG21 . VAL A 1 32 ? 2.611   -15.176 -2.567  1.00 0.00 ? 32 VAL A HG21 10 
ATOM   8644  H HG22 . VAL A 1 32 ? 0.972   -14.482 -2.566  1.00 0.00 ? 32 VAL A HG22 10 
ATOM   8645  N N    . PRO A 1 33 ? 0.872   -10.108 -0.425  1.00 0.00 ? 33 PRO A N    10 
ATOM   8646  C CA   . PRO A 1 33 ? 0.953   -9.117  0.635   1.00 0.00 ? 33 PRO A CA   10 
ATOM   8647  C C    . PRO A 1 33 ? 0.845   -9.777  2.011   1.00 0.00 ? 33 PRO A C    10 
ATOM   8648  O O    . PRO A 1 33 ? 0.397   -10.917 2.124   1.00 0.00 ? 33 PRO A O    10 
ATOM   8649  C CB   . PRO A 1 33 ? -0.180  -8.144  0.351   1.00 0.00 ? 33 PRO A CB   10 
ATOM   8650  C CG   . PRO A 1 33 ? -1.135  -8.876  -0.578  1.00 0.00 ? 33 PRO A CG   10 
ATOM   8651  C CD   . PRO A 1 33 ? -0.416  -10.104 -1.113  1.00 0.00 ? 33 PRO A CD   10 
ATOM   8652  H HA   . PRO A 1 33 ? 1.844   -8.664  0.618   1.00 0.00 ? 33 PRO A HA   10 
ATOM   8653  H HB2  . PRO A 1 33 ? -0.681  -7.849  1.273   1.00 0.00 ? 33 PRO A HB2  10 
ATOM   8654  H HB3  . PRO A 1 33 ? 0.196   -7.233  -0.113  1.00 0.00 ? 33 PRO A HB3  10 
ATOM   8655  H HG2  . PRO A 1 33 ? -2.040  -9.166  -0.044  1.00 0.00 ? 33 PRO A HG2  10 
ATOM   8656  H HG3  . PRO A 1 33 ? -1.442  -8.226  -1.397  1.00 0.00 ? 33 PRO A HG3  10 
ATOM   8657  H HD2  . PRO A 1 33 ? -0.978  -11.014 -0.905  1.00 0.00 ? 33 PRO A HD2  10 
ATOM   8658  H HD3  . PRO A 1 33 ? -0.287  -10.048 -2.194  1.00 0.00 ? 33 PRO A HD3  10 
ATOM   8659  N N    . VAL A 1 34 ? 1.263   -9.031  3.024   1.00 0.00 ? 34 VAL A N    10 
ATOM   8660  C CA   . VAL A 1 34 ? 1.218   -9.529  4.388   1.00 0.00 ? 34 VAL A CA   10 
ATOM   8661  C C    . VAL A 1 34 ? 0.282   -8.648  5.218   1.00 0.00 ? 34 VAL A C    10 
ATOM   8662  O O    . VAL A 1 34 ? -0.510  -9.153  6.011   1.00 0.00 ? 34 VAL A O    10 
ATOM   8663  C CB   . VAL A 1 34 ? 2.634   -9.606  4.963   1.00 0.00 ? 34 VAL A CB   10 
ATOM   8664  C CG1  . VAL A 1 34 ? 3.288   -8.223  4.996   1.00 0.00 ? 34 VAL A CG1  10 
ATOM   8665  C CG2  . VAL A 1 34 ? 2.626   -10.241 6.355   1.00 0.00 ? 34 VAL A CG2  10 
ATOM   8666  H H    . VAL A 1 34 ? 1.626   -8.105  2.924   1.00 0.00 ? 34 VAL A H    10 
ATOM   8667  H HA   . VAL A 1 34 ? 0.812   -10.540 4.356   1.00 0.00 ? 34 VAL A HA   10 
ATOM   8668  H HB   . VAL A 1 34 ? 3.228   -10.242 4.308   1.00 0.00 ? 34 VAL A HB   10 
ATOM   8669  H HG11 . VAL A 1 34 ? 3.445   -7.872  3.976   1.00 0.00 ? 34 VAL A HG11 10 
ATOM   8670  H HG12 . VAL A 1 34 ? 2.638   -7.526  5.524   1.00 0.00 ? 34 VAL A HG12 10 
ATOM   8671  H HG21 . VAL A 1 34 ? 2.270   -9.514  7.085   1.00 0.00 ? 34 VAL A HG21 10 
ATOM   8672  H HG22 . VAL A 1 34 ? 1.966   -11.109 6.355   1.00 0.00 ? 34 VAL A HG22 10 
ATOM   8673  N N    . LYS A 1 35 ? 0.406   -7.346  5.006   1.00 0.00 ? 35 LYS A N    10 
ATOM   8674  C CA   . LYS A 1 35 ? -0.419  -6.389  5.724   1.00 0.00 ? 35 LYS A CA   10 
ATOM   8675  C C    . LYS A 1 35 ? -0.547  -5.109  4.896   1.00 0.00 ? 35 LYS A C    10 
ATOM   8676  O O    . LYS A 1 35 ? 0.416   -4.674  4.267   1.00 0.00 ? 35 LYS A O    10 
ATOM   8677  C CB   . LYS A 1 35 ? 0.132   -6.158  7.133   1.00 0.00 ? 35 LYS A CB   10 
ATOM   8678  C CG   . LYS A 1 35 ? -0.657  -5.066  7.858   1.00 0.00 ? 35 LYS A CG   10 
ATOM   8679  C CD   . LYS A 1 35 ? 0.256   -3.908  8.266   1.00 0.00 ? 35 LYS A CD   10 
ATOM   8680  C CE   . LYS A 1 35 ? -0.548  -2.626  8.486   1.00 0.00 ? 35 LYS A CE   10 
ATOM   8681  N NZ   . LYS A 1 35 ? -0.938  -2.496  9.908   1.00 0.00 ? 35 LYS A NZ   10 
ATOM   8682  H H    . LYS A 1 35 ? 1.053   -6.943  4.359   1.00 0.00 ? 35 LYS A H    10 
ATOM   8683  H HA   . LYS A 1 35 ? -1.410  -6.830  5.834   1.00 0.00 ? 35 LYS A HA   10 
ATOM   8684  H HB2  . LYS A 1 35 ? 0.084   -7.086  7.703   1.00 0.00 ? 35 LYS A HB2  10 
ATOM   8685  H HB3  . LYS A 1 35 ? 1.182   -5.874  7.074   1.00 0.00 ? 35 LYS A HB3  10 
ATOM   8686  H HG2  . LYS A 1 35 ? -1.452  -4.696  7.210   1.00 0.00 ? 35 LYS A HG2  10 
ATOM   8687  H HG3  . LYS A 1 35 ? -1.137  -5.485  8.743   1.00 0.00 ? 35 LYS A HG3  10 
ATOM   8688  H HD2  . LYS A 1 35 ? 0.791   -4.167  9.180   1.00 0.00 ? 35 LYS A HD2  10 
ATOM   8689  H HD3  . LYS A 1 35 ? 1.007   -3.743  7.493   1.00 0.00 ? 35 LYS A HD3  10 
ATOM   8690  H HE2  . LYS A 1 35 ? 0.044   -1.762  8.184   1.00 0.00 ? 35 LYS A HE2  10 
ATOM   8691  H HE3  . LYS A 1 35 ? -1.439  -2.637  7.858   1.00 0.00 ? 35 LYS A HE3  10 
ATOM   8692  H HZ1  . LYS A 1 35 ? -1.140  -3.401  10.282  1.00 0.00 ? 35 LYS A HZ1  10 
ATOM   8693  H HZ2  . LYS A 1 35 ? -0.187  -2.082  10.422  1.00 0.00 ? 35 LYS A HZ2  10 
ATOM   8694  N N    . ARG A 1 36 ? -1.740  -4.511  4.900   1.00 0.00 ? 36 ARG A N    10 
ATOM   8695  C CA   . ARG A 1 36 ? -1.989  -3.294  4.155   1.00 0.00 ? 36 ARG A CA   10 
ATOM   8696  C C    . ARG A 1 36 ? -2.623  -2.252  5.066   1.00 0.00 ? 36 ARG A C    10 
ATOM   8697  O O    . ARG A 1 36 ? -2.977  -2.553  6.204   1.00 0.00 ? 36 ARG A O    10 
ATOM   8698  C CB   . ARG A 1 36 ? -2.901  -3.601  2.970   1.00 0.00 ? 36 ARG A CB   10 
ATOM   8699  C CG   . ARG A 1 36 ? -2.243  -4.654  2.082   1.00 0.00 ? 36 ARG A CG   10 
ATOM   8700  C CD   . ARG A 1 36 ? -2.842  -4.584  0.681   1.00 0.00 ? 36 ARG A CD   10 
ATOM   8701  N NE   . ARG A 1 36 ? -4.215  -5.090  0.671   1.00 0.00 ? 36 ARG A NE   10 
ATOM   8702  C CZ   . ARG A 1 36 ? -4.508  -6.390  0.532   1.00 0.00 ? 36 ARG A CZ   10 
ATOM   8703  N NH1  . ARG A 1 36 ? -3.523  -7.288  0.395   1.00 0.00 ? 36 ARG A NH1  10 
ATOM   8704  N NH2  . ARG A 1 36 ? -5.786  -6.793  0.529   1.00 0.00 ? 36 ARG A NH2  10 
ATOM   8705  H H    . ARG A 1 36 ? -2.499  -4.911  5.434   1.00 0.00 ? 36 ARG A H    10 
ATOM   8706  H HA   . ARG A 1 36 ? -1.041  -2.907  3.781   1.00 0.00 ? 36 ARG A HA   10 
ATOM   8707  H HB2  . ARG A 1 36 ? -3.856  -3.979  3.335   1.00 0.00 ? 36 ARG A HB2  10 
ATOM   8708  H HB3  . ARG A 1 36 ? -3.066  -2.691  2.394   1.00 0.00 ? 36 ARG A HB3  10 
ATOM   8709  H HG2  . ARG A 1 36 ? -1.171  -4.465  2.029   1.00 0.00 ? 36 ARG A HG2  10 
ATOM   8710  H HG3  . ARG A 1 36 ? -2.416  -5.644  2.503   1.00 0.00 ? 36 ARG A HG3  10 
ATOM   8711  H HD2  . ARG A 1 36 ? -2.841  -3.548  0.343   1.00 0.00 ? 36 ARG A HD2  10 
ATOM   8712  H HD3  . ARG A 1 36 ? -2.235  -5.183  0.002   1.00 0.00 ? 36 ARG A HD3  10 
ATOM   8713  H HE   . ARG A 1 36 ? -4.964  -4.421  0.774   1.00 0.00 ? 36 ARG A HE   10 
ATOM   8714  H HH11 . ARG A 1 36 ? -2.559  -6.985  0.397   1.00 0.00 ? 36 ARG A HH11 10 
ATOM   8715  H HH12 . ARG A 1 36 ? -3.743  -8.268  0.290   1.00 0.00 ? 36 ARG A HH12 10 
ATOM   8716  H HH21 . ARG A 1 36 ? -6.529  -6.116  0.632   1.00 0.00 ? 36 ARG A HH21 10 
ATOM   8717  H HH22 . ARG A 1 36 ? -6.007  -7.773  0.424   1.00 0.00 ? 36 ARG A HH22 10 
ATOM   8718  N N    . GLY A 1 37 ? -2.749  -1.045  4.534   1.00 0.00 ? 37 GLY A N    10 
ATOM   8719  C CA   . GLY A 1 37 ? -3.338  0.048   5.291   1.00 0.00 ? 37 GLY A CA   10 
ATOM   8720  C C    . GLY A 1 37 ? -3.427  1.317   4.441   1.00 0.00 ? 37 GLY A C    10 
ATOM   8721  O O    . GLY A 1 37 ? -3.100  1.299   3.255   1.00 0.00 ? 37 GLY A O    10 
ATOM   8722  H H    . GLY A 1 37 ? -2.459  -0.808  3.607   1.00 0.00 ? 37 GLY A H    10 
ATOM   8723  H HA2  . GLY A 1 37 ? -4.333  -0.237  5.632   1.00 0.00 ? 37 GLY A HA2  10 
ATOM   8724  H HA3  . GLY A 1 37 ? -2.739  0.242   6.180   1.00 0.00 ? 37 GLY A HA3  10 
ATOM   8725  N N    . CYS A 1 38 ? -3.872  2.389   5.081   1.00 0.00 ? 38 CYS A N    10 
ATOM   8726  C CA   . CYS A 1 38 ? -4.008  3.664   4.399   1.00 0.00 ? 38 CYS A CA   10 
ATOM   8727  C C    . CYS A 1 38 ? -2.892  4.591   4.886   1.00 0.00 ? 38 CYS A C    10 
ATOM   8728  O O    . CYS A 1 38 ? -2.504  4.542   6.052   1.00 0.00 ? 38 CYS A O    10 
ATOM   8729  C CB   . CYS A 1 38 ? -5.393  4.277   4.616   1.00 0.00 ? 38 CYS A CB   10 
ATOM   8730  S SG   . CYS A 1 38 ? -6.727  3.536   3.605   1.00 0.00 ? 38 CYS A SG   10 
ATOM   8731  H H    . CYS A 1 38 ? -4.136  2.395   6.046   1.00 0.00 ? 38 CYS A H    10 
ATOM   8732  H HA   . CYS A 1 38 ? -3.906  3.462   3.333   1.00 0.00 ? 38 CYS A HA   10 
ATOM   8733  H HB2  . CYS A 1 38 ? -5.658  4.178   5.669   1.00 0.00 ? 38 CYS A HB2  10 
ATOM   8734  H HB3  . CYS A 1 38 ? -5.342  5.344   4.399   1.00 0.00 ? 38 CYS A HB3  10 
ATOM   8735  N N    . ILE A 1 39 ? -2.408  5.414   3.968   1.00 0.00 ? 39 ILE A N    10 
ATOM   8736  C CA   . ILE A 1 39 ? -1.344  6.351   4.289   1.00 0.00 ? 39 ILE A CA   10 
ATOM   8737  C C    . ILE A 1 39 ? -1.369  7.507   3.287   1.00 0.00 ? 39 ILE A C    10 
ATOM   8738  O O    . ILE A 1 39 ? -2.272  7.594   2.457   1.00 0.00 ? 39 ILE A O    10 
ATOM   8739  C CB   . ILE A 1 39 ? 0.003   5.628   4.360   1.00 0.00 ? 39 ILE A CB   10 
ATOM   8740  C CG1  . ILE A 1 39 ? 0.918   6.275   5.402   1.00 0.00 ? 39 ILE A CG1  10 
ATOM   8741  C CG2  . ILE A 1 39 ? 0.662   5.560   2.981   1.00 0.00 ? 39 ILE A CG2  10 
ATOM   8742  C CD1  . ILE A 1 39 ? 1.081   5.371   6.625   1.00 0.00 ? 39 ILE A CD1  10 
ATOM   8743  H H    . ILE A 1 39 ? -2.729  5.448   3.021   1.00 0.00 ? 39 ILE A H    10 
ATOM   8744  H HA   . ILE A 1 39 ? -1.549  6.750   5.282   1.00 0.00 ? 39 ILE A HA   10 
ATOM   8745  H HB   . ILE A 1 39 ? -0.177  4.602   4.682   1.00 0.00 ? 39 ILE A HB   10 
ATOM   8746  H HG12 . ILE A 1 39 ? 1.894   6.475   4.959   1.00 0.00 ? 39 ILE A HG12 10 
ATOM   8747  H HG13 . ILE A 1 39 ? 0.504   7.236   5.707   1.00 0.00 ? 39 ILE A HG13 10 
ATOM   8748  H HG21 . ILE A 1 39 ? 1.626   5.057   3.064   1.00 0.00 ? 39 ILE A HG21 10 
ATOM   8749  H HG22 . ILE A 1 39 ? 0.020   5.004   2.298   1.00 0.00 ? 39 ILE A HG22 10 
ATOM   8750  H HD11 . ILE A 1 39 ? 2.049   5.560   7.090   1.00 0.00 ? 39 ILE A HD11 10 
ATOM   8751  H HD12 . ILE A 1 39 ? 0.287   5.583   7.342   1.00 0.00 ? 39 ILE A HD12 10 
ATOM   8752  N N    . ASP A 1 40 ? -0.374  8.392   3.371   1.00 0.00 ? 40 ASP A N    10 
ATOM   8753  C CA   . ASP A 1 40 ? -0.286  9.531   2.479   1.00 0.00 ? 40 ASP A CA   10 
ATOM   8754  C C    . ASP A 1 40 ? 1.014   9.470   1.691   1.00 0.00 ? 40 ASP A C    10 
ATOM   8755  O O    . ASP A 1 40 ? 1.029   9.743   0.493   1.00 0.00 ? 40 ASP A O    10 
ATOM   8756  C CB   . ASP A 1 40 ? -0.365  10.820  3.293   1.00 0.00 ? 40 ASP A CB   10 
ATOM   8757  C CG   . ASP A 1 40 ? 0.716   10.853  4.364   1.00 0.00 ? 40 ASP A CG   10 
ATOM   8758  O OD1  . ASP A 1 40 ? 1.848   11.253  4.016   1.00 0.00 ? 40 ASP A OD1  10 
ATOM   8759  O OD2  . ASP A 1 40 ? 0.390   10.479  5.511   1.00 0.00 ? 40 ASP A OD2  10 
ATOM   8760  H H    . ASP A 1 40 ? 0.344   8.275   4.071   1.00 0.00 ? 40 ASP A H    10 
ATOM   8761  H HA   . ASP A 1 40 ? -1.124  9.501   1.782   1.00 0.00 ? 40 ASP A HA   10 
ATOM   8762  H HB2  . ASP A 1 40 ? -0.236  11.673  2.627   1.00 0.00 ? 40 ASP A HB2  10 
ATOM   8763  H HB3  . ASP A 1 40 ? -1.343  10.883  3.770   1.00 0.00 ? 40 ASP A HB3  10 
ATOM   8764  H HD2  . ASP A 1 40 ? 1.114   10.523  6.140   1.00 0.00 ? 40 ASP A HD2  10 
ATOM   8765  N N    . VAL A 1 41 ? 2.079   9.108   2.393   1.00 0.00 ? 41 VAL A N    10 
ATOM   8766  C CA   . VAL A 1 41 ? 3.387   9.008   1.768   1.00 0.00 ? 41 VAL A CA   10 
ATOM   8767  C C    . VAL A 1 41 ? 3.845   7.548   1.786   1.00 0.00 ? 41 VAL A C    10 
ATOM   8768  O O    . VAL A 1 41 ? 3.586   6.824   2.746   1.00 0.00 ? 41 VAL A O    10 
ATOM   8769  C CB   . VAL A 1 41 ? 4.372   9.952   2.461   1.00 0.00 ? 41 VAL A CB   10 
ATOM   8770  C CG1  . VAL A 1 41 ? 4.735   9.439   3.856   1.00 0.00 ? 41 VAL A CG1  10 
ATOM   8771  C CG2  . VAL A 1 41 ? 5.626   10.158  1.609   1.00 0.00 ? 41 VAL A CG2  10 
ATOM   8772  H H    . VAL A 1 41 ? 2.059   8.887   3.368   1.00 0.00 ? 41 VAL A H    10 
ATOM   8773  H HA   . VAL A 1 41 ? 3.283   9.330   0.732   1.00 0.00 ? 41 VAL A HA   10 
ATOM   8774  H HB   . VAL A 1 41 ? 3.884   10.920  2.576   1.00 0.00 ? 41 VAL A HB   10 
ATOM   8775  H HG11 . VAL A 1 41 ? 5.320   10.195  4.380   1.00 0.00 ? 41 VAL A HG11 10 
ATOM   8776  H HG12 . VAL A 1 41 ? 3.822   9.233   4.416   1.00 0.00 ? 41 VAL A HG12 10 
ATOM   8777  H HG21 . VAL A 1 41 ? 5.596   9.486   0.751   1.00 0.00 ? 41 VAL A HG21 10 
ATOM   8778  H HG22 . VAL A 1 41 ? 5.664   11.190  1.261   1.00 0.00 ? 41 VAL A HG22 10 
ATOM   8779  N N    . CYS A 1 42 ? 4.519   7.159   0.714   1.00 0.00 ? 42 CYS A N    10 
ATOM   8780  C CA   . CYS A 1 42 ? 5.016   5.799   0.594   1.00 0.00 ? 42 CYS A CA   10 
ATOM   8781  C C    . CYS A 1 42 ? 6.463   5.771   1.090   1.00 0.00 ? 42 CYS A C    10 
ATOM   8782  O O    . CYS A 1 42 ? 7.257   6.645   0.747   1.00 0.00 ? 42 CYS A O    10 
ATOM   8783  C CB   . CYS A 1 42 ? 4.893   5.276   -0.838  1.00 0.00 ? 42 CYS A CB   10 
ATOM   8784  S SG   . CYS A 1 42 ? 4.096   3.635   -0.990  1.00 0.00 ? 42 CYS A SG   10 
ATOM   8785  H H    . CYS A 1 42 ? 4.726   7.754   -0.063  1.00 0.00 ? 42 CYS A H    10 
ATOM   8786  H HA   . CYS A 1 42 ? 4.379   5.177   1.223   1.00 0.00 ? 42 CYS A HA   10 
ATOM   8787  H HB2  . CYS A 1 42 ? 4.323   5.996   -1.426  1.00 0.00 ? 42 CYS A HB2  10 
ATOM   8788  H HB3  . CYS A 1 42 ? 5.889   5.222   -1.278  1.00 0.00 ? 42 CYS A HB3  10 
ATOM   8789  N N    . PRO A 1 43 ? 6.769   4.730   1.910   1.00 0.00 ? 43 PRO A N    10 
ATOM   8790  C CA   . PRO A 1 43 ? 8.107   4.576   2.456   1.00 0.00 ? 43 PRO A CA   10 
ATOM   8791  C C    . PRO A 1 43 ? 9.079   4.068   1.390   1.00 0.00 ? 43 PRO A C    10 
ATOM   8792  O O    . PRO A 1 43 ? 8.660   3.513   0.375   1.00 0.00 ? 43 PRO A O    10 
ATOM   8793  C CB   . PRO A 1 43 ? 7.948   3.614   3.622   1.00 0.00 ? 43 PRO A CB   10 
ATOM   8794  C CG   . PRO A 1 43 ? 6.621   2.906   3.399   1.00 0.00 ? 43 PRO A CG   10 
ATOM   8795  C CD   . PRO A 1 43 ? 5.854   3.676   2.337   1.00 0.00 ? 43 PRO A CD   10 
ATOM   8796  H HA   . PRO A 1 43 ? 8.465   5.462   2.752   1.00 0.00 ? 43 PRO A HA   10 
ATOM   8797  H HB2  . PRO A 1 43 ? 8.771   2.900   3.654   1.00 0.00 ? 43 PRO A HB2  10 
ATOM   8798  H HB3  . PRO A 1 43 ? 7.951   4.148   4.572   1.00 0.00 ? 43 PRO A HB3  10 
ATOM   8799  H HG2  . PRO A 1 43 ? 6.787   1.877   3.080   1.00 0.00 ? 43 PRO A HG2  10 
ATOM   8800  H HG3  . PRO A 1 43 ? 6.050   2.864   4.327   1.00 0.00 ? 43 PRO A HG3  10 
ATOM   8801  H HD2  . PRO A 1 43 ? 5.576   3.031   1.503   1.00 0.00 ? 43 PRO A HD2  10 
ATOM   8802  H HD3  . PRO A 1 43 ? 4.930   4.092   2.739   1.00 0.00 ? 43 PRO A HD3  10 
ATOM   8803  N N    . LYS A 1 44 ? 10.361  4.275   1.656   1.00 0.00 ? 44 LYS A N    10 
ATOM   8804  C CA   . LYS A 1 44 ? 11.396  3.845   0.732   1.00 0.00 ? 44 LYS A CA   10 
ATOM   8805  C C    . LYS A 1 44 ? 11.285  2.334   0.516   1.00 0.00 ? 44 LYS A C    10 
ATOM   8806  O O    . LYS A 1 44 ? 11.075  1.581   1.466   1.00 0.00 ? 44 LYS A O    10 
ATOM   8807  C CB   . LYS A 1 44 ? 12.773  4.296   1.223   1.00 0.00 ? 44 LYS A CB   10 
ATOM   8808  C CG   . LYS A 1 44 ? 13.886  3.700   0.358   1.00 0.00 ? 44 LYS A CG   10 
ATOM   8809  C CD   . LYS A 1 44 ? 15.250  4.276   0.746   1.00 0.00 ? 44 LYS A CD   10 
ATOM   8810  C CE   . LYS A 1 44 ? 16.321  3.883   -0.274  1.00 0.00 ? 44 LYS A CE   10 
ATOM   8811  N NZ   . LYS A 1 44 ? 16.996  5.088   -0.806  1.00 0.00 ? 44 LYS A NZ   10 
ATOM   8812  H H    . LYS A 1 44 ? 10.694  4.727   2.484   1.00 0.00 ? 44 LYS A H    10 
ATOM   8813  H HA   . LYS A 1 44 ? 11.213  4.344   -0.219  1.00 0.00 ? 44 LYS A HA   10 
ATOM   8814  H HB2  . LYS A 1 44 ? 12.833  5.384   1.200   1.00 0.00 ? 44 LYS A HB2  10 
ATOM   8815  H HB3  . LYS A 1 44 ? 12.911  3.992   2.260   1.00 0.00 ? 44 LYS A HB3  10 
ATOM   8816  H HG2  . LYS A 1 44 ? 13.899  2.616   0.472   1.00 0.00 ? 44 LYS A HG2  10 
ATOM   8817  H HG3  . LYS A 1 44 ? 13.685  3.908   -0.693  1.00 0.00 ? 44 LYS A HG3  10 
ATOM   8818  H HD2  . LYS A 1 44 ? 15.185  5.362   0.811   1.00 0.00 ? 44 LYS A HD2  10 
ATOM   8819  H HD3  . LYS A 1 44 ? 15.533  3.914   1.734   1.00 0.00 ? 44 LYS A HD3  10 
ATOM   8820  H HE2  . LYS A 1 44 ? 17.053  3.225   0.194   1.00 0.00 ? 44 LYS A HE2  10 
ATOM   8821  H HE3  . LYS A 1 44 ? 15.865  3.324   -1.091  1.00 0.00 ? 44 LYS A HE3  10 
ATOM   8822  H HZ1  . LYS A 1 44 ? 17.036  5.034   -1.803  1.00 0.00 ? 44 LYS A HZ1  10 
ATOM   8823  H HZ2  . LYS A 1 44 ? 16.485  5.903   -0.535  1.00 0.00 ? 44 LYS A HZ2  10 
ATOM   8824  N N    . SER A 1 45 ? 11.432  1.936   -0.739  1.00 0.00 ? 45 SER A N    10 
ATOM   8825  C CA   . SER A 1 45 ? 11.352  0.528   -1.092  1.00 0.00 ? 45 SER A CA   10 
ATOM   8826  C C    . SER A 1 45 ? 12.729  -0.124  -0.958  1.00 0.00 ? 45 SER A C    10 
ATOM   8827  O O    . SER A 1 45 ? 13.722  0.408   -1.451  1.00 0.00 ? 45 SER A O    10 
ATOM   8828  C CB   . SER A 1 45 ? 10.813  0.347   -2.512  1.00 0.00 ? 45 SER A CB   10 
ATOM   8829  O OG   . SER A 1 45 ? 9.420   0.049   -2.521  1.00 0.00 ? 45 SER A OG   10 
ATOM   8830  H H    . SER A 1 45 ? 11.604  2.554   -1.506  1.00 0.00 ? 45 SER A H    10 
ATOM   8831  H HA   . SER A 1 45 ? 10.651  0.092   -0.380  1.00 0.00 ? 45 SER A HA   10 
ATOM   8832  H HB2  . SER A 1 45 ? 10.993  1.255   -3.087  1.00 0.00 ? 45 SER A HB2  10 
ATOM   8833  H HB3  . SER A 1 45 ? 11.359  -0.457  -3.007  1.00 0.00 ? 45 SER A HB3  10 
ATOM   8834  H HG   . SER A 1 45 ? 8.904   0.814   -2.136  1.00 0.00 ? 45 SER A HG   10 
ATOM   8835  N N    . SER A 1 46 ? 12.744  -1.269  -0.290  1.00 0.00 ? 46 SER A N    10 
ATOM   8836  C CA   . SER A 1 46 ? 13.983  -2.000  -0.086  1.00 0.00 ? 46 SER A CA   10 
ATOM   8837  C C    . SER A 1 46 ? 13.967  -3.294  -0.902  1.00 0.00 ? 46 SER A C    10 
ATOM   8838  O O    . SER A 1 46 ? 12.963  -3.623  -1.532  1.00 0.00 ? 46 SER A O    10 
ATOM   8839  C CB   . SER A 1 46 ? 14.202  -2.309  1.396   1.00 0.00 ? 46 SER A CB   10 
ATOM   8840  O OG   . SER A 1 46 ? 13.464  -3.452  1.818   1.00 0.00 ? 46 SER A OG   10 
ATOM   8841  H H    . SER A 1 46 ? 11.931  -1.695  0.107   1.00 0.00 ? 46 SER A H    10 
ATOM   8842  H HA   . SER A 1 46 ? 14.771  -1.335  -0.439  1.00 0.00 ? 46 SER A HA   10 
ATOM   8843  H HB2  . SER A 1 46 ? 15.264  -2.475  1.578   1.00 0.00 ? 46 SER A HB2  10 
ATOM   8844  H HB3  . SER A 1 46 ? 13.907  -1.446  1.994   1.00 0.00 ? 46 SER A HB3  10 
ATOM   8845  H HG   . SER A 1 46 ? 14.015  -4.003  2.445   1.00 0.00 ? 46 SER A HG   10 
ATOM   8846  N N    . LEU A 1 47 ? 15.091  -3.995  -0.862  1.00 0.00 ? 47 LEU A N    10 
ATOM   8847  C CA   . LEU A 1 47 ? 15.218  -5.246  -1.590  1.00 0.00 ? 47 LEU A CA   10 
ATOM   8848  C C    . LEU A 1 47 ? 14.458  -6.344  -0.844  1.00 0.00 ? 47 LEU A C    10 
ATOM   8849  O O    . LEU A 1 47 ? 13.612  -7.022  -1.425  1.00 0.00 ? 47 LEU A O    10 
ATOM   8850  C CB   . LEU A 1 47 ? 16.692  -5.576  -1.834  1.00 0.00 ? 47 LEU A CB   10 
ATOM   8851  C CG   . LEU A 1 47 ? 17.352  -4.864  -3.016  1.00 0.00 ? 47 LEU A CG   10 
ATOM   8852  C CD1  . LEU A 1 47 ? 18.863  -5.106  -3.029  1.00 0.00 ? 47 LEU A CD1  10 
ATOM   8853  C CD2  . LEU A 1 47 ? 16.695  -5.271  -4.337  1.00 0.00 ? 47 LEU A CD2  10 
ATOM   8854  H H    . LEU A 1 47 ? 15.903  -3.721  -0.347  1.00 0.00 ? 47 LEU A H    10 
ATOM   8855  H HA   . LEU A 1 47 ? 14.754  -5.106  -2.566  1.00 0.00 ? 47 LEU A HA   10 
ATOM   8856  H HB2  . LEU A 1 47 ? 17.253  -5.334  -0.931  1.00 0.00 ? 47 LEU A HB2  10 
ATOM   8857  H HB3  . LEU A 1 47 ? 16.783  -6.651  -1.986  1.00 0.00 ? 47 LEU A HB3  10 
ATOM   8858  H HG   . LEU A 1 47 ? 17.199  -3.791  -2.898  1.00 0.00 ? 47 LEU A HG   10 
ATOM   8859  H HD11 . LEU A 1 47 ? 19.162  -5.584  -2.096  1.00 0.00 ? 47 LEU A HD11 10 
ATOM   8860  H HD12 . LEU A 1 47 ? 19.120  -5.753  -3.868  1.00 0.00 ? 47 LEU A HD12 10 
ATOM   8861  H HD21 . LEU A 1 47 ? 17.377  -5.908  -4.901  1.00 0.00 ? 47 LEU A HD21 10 
ATOM   8862  H HD22 . LEU A 1 47 ? 15.774  -5.816  -4.132  1.00 0.00 ? 47 LEU A HD22 10 
ATOM   8863  N N    . LEU A 1 48 ? 14.787  -6.486  0.432   1.00 0.00 ? 48 LEU A N    10 
ATOM   8864  C CA   . LEU A 1 48 ? 14.145  -7.490  1.263   1.00 0.00 ? 48 LEU A CA   10 
ATOM   8865  C C    . LEU A 1 48 ? 12.627  -7.372  1.118   1.00 0.00 ? 48 LEU A C    10 
ATOM   8866  O O    . LEU A 1 48 ? 11.955  -8.342  0.768   1.00 0.00 ? 48 LEU A O    10 
ATOM   8867  C CB   . LEU A 1 48 ? 14.635  -7.382  2.708   1.00 0.00 ? 48 LEU A CB   10 
ATOM   8868  C CG   . LEU A 1 48 ? 14.762  -8.701  3.474   1.00 0.00 ? 48 LEU A CG   10 
ATOM   8869  C CD1  . LEU A 1 48 ? 16.166  -8.862  4.060   1.00 0.00 ? 48 LEU A CD1  10 
ATOM   8870  C CD2  . LEU A 1 48 ? 13.676  -8.819  4.546   1.00 0.00 ? 48 LEU A CD2  10 
ATOM   8871  H H    . LEU A 1 48 ? 15.476  -5.930  0.897   1.00 0.00 ? 48 LEU A H    10 
ATOM   8872  H HA   . LEU A 1 48 ? 14.453  -8.468  0.891   1.00 0.00 ? 48 LEU A HA   10 
ATOM   8873  H HB2  . LEU A 1 48 ? 15.608  -6.892  2.706   1.00 0.00 ? 48 LEU A HB2  10 
ATOM   8874  H HB3  . LEU A 1 48 ? 13.952  -6.732  3.255   1.00 0.00 ? 48 LEU A HB3  10 
ATOM   8875  H HG   . LEU A 1 48 ? 14.611  -9.520  2.771   1.00 0.00 ? 48 LEU A HG   10 
ATOM   8876  H HD11 . LEU A 1 48 ? 16.859  -9.149  3.269   1.00 0.00 ? 48 LEU A HD11 10 
ATOM   8877  H HD12 . LEU A 1 48 ? 16.487  -7.917  4.499   1.00 0.00 ? 48 LEU A HD12 10 
ATOM   8878  H HD21 . LEU A 1 48 ? 13.154  -9.769  4.430   1.00 0.00 ? 48 LEU A HD21 10 
ATOM   8879  H HD22 . LEU A 1 48 ? 14.135  -8.774  5.534   1.00 0.00 ? 48 LEU A HD22 10 
ATOM   8880  N N    . VAL A 1 49 ? 12.129  -6.176  1.393   1.00 0.00 ? 49 VAL A N    10 
ATOM   8881  C CA   . VAL A 1 49 ? 10.702  -5.918  1.298   1.00 0.00 ? 49 VAL A CA   10 
ATOM   8882  C C    . VAL A 1 49 ? 10.464  -4.737  0.355   1.00 0.00 ? 49 VAL A C    10 
ATOM   8883  O O    . VAL A 1 49 ? 11.328  -3.874  0.204   1.00 0.00 ? 49 VAL A O    10 
ATOM   8884  C CB   . VAL A 1 49 ? 10.116  -5.697  2.694   1.00 0.00 ? 49 VAL A CB   10 
ATOM   8885  C CG1  . VAL A 1 49 ? 10.164  -6.985  3.519   1.00 0.00 ? 49 VAL A CG1  10 
ATOM   8886  C CG2  . VAL A 1 49 ? 10.834  -4.556  3.416   1.00 0.00 ? 49 VAL A CG2  10 
ATOM   8887  H H    . VAL A 1 49 ? 12.682  -5.392  1.677   1.00 0.00 ? 49 VAL A H    10 
ATOM   8888  H HA   . VAL A 1 49 ? 10.236  -6.806  0.872   1.00 0.00 ? 49 VAL A HA   10 
ATOM   8889  H HB   . VAL A 1 49 ? 9.070   -5.414  2.577   1.00 0.00 ? 49 VAL A HB   10 
ATOM   8890  H HG11 . VAL A 1 49 ? 10.048  -6.744  4.575   1.00 0.00 ? 49 VAL A HG11 10 
ATOM   8891  H HG12 . VAL A 1 49 ? 9.357   -7.647  3.206   1.00 0.00 ? 49 VAL A HG12 10 
ATOM   8892  H HG21 . VAL A 1 49 ? 11.912  -4.694  3.331   1.00 0.00 ? 49 VAL A HG21 10 
ATOM   8893  H HG22 . VAL A 1 49 ? 10.553  -3.605  2.962   1.00 0.00 ? 49 VAL A HG22 10 
ATOM   8894  N N    . LYS A 1 50 ? 9.287   -4.735  -0.254  1.00 0.00 ? 50 LYS A N    10 
ATOM   8895  C CA   . LYS A 1 50 ? 8.924   -3.674  -1.178  1.00 0.00 ? 50 LYS A CA   10 
ATOM   8896  C C    . LYS A 1 50 ? 7.502   -3.200  -0.870  1.00 0.00 ? 50 LYS A C    10 
ATOM   8897  O O    . LYS A 1 50 ? 6.695   -3.956  -0.332  1.00 0.00 ? 50 LYS A O    10 
ATOM   8898  C CB   . LYS A 1 50 ? 9.120   -4.133  -2.624  1.00 0.00 ? 50 LYS A CB   10 
ATOM   8899  C CG   . LYS A 1 50 ? 10.443  -3.613  -3.190  1.00 0.00 ? 50 LYS A CG   10 
ATOM   8900  C CD   . LYS A 1 50 ? 10.209  -2.756  -4.435  1.00 0.00 ? 50 LYS A CD   10 
ATOM   8901  C CE   . LYS A 1 50 ? 11.339  -2.943  -5.450  1.00 0.00 ? 50 LYS A CE   10 
ATOM   8902  N NZ   . LYS A 1 50 ? 11.277  -4.294  -6.051  1.00 0.00 ? 50 LYS A NZ   10 
ATOM   8903  H H    . LYS A 1 50 ? 8.590   -5.441  -0.126  1.00 0.00 ? 50 LYS A H    10 
ATOM   8904  H HA   . LYS A 1 50 ? 9.610   -2.844  -1.007  1.00 0.00 ? 50 LYS A HA   10 
ATOM   8905  H HB2  . LYS A 1 50 ? 9.103   -5.221  -2.671  1.00 0.00 ? 50 LYS A HB2  10 
ATOM   8906  H HB3  . LYS A 1 50 ? 8.293   -3.775  -3.238  1.00 0.00 ? 50 LYS A HB3  10 
ATOM   8907  H HG2  . LYS A 1 50 ? 10.961  -3.025  -2.432  1.00 0.00 ? 50 LYS A HG2  10 
ATOM   8908  H HG3  . LYS A 1 50 ? 11.091  -4.453  -3.439  1.00 0.00 ? 50 LYS A HG3  10 
ATOM   8909  H HD2  . LYS A 1 50 ? 9.257   -3.025  -4.892  1.00 0.00 ? 50 LYS A HD2  10 
ATOM   8910  H HD3  . LYS A 1 50 ? 10.140  -1.706  -4.151  1.00 0.00 ? 50 LYS A HD3  10 
ATOM   8911  H HE2  . LYS A 1 50 ? 11.262  -2.187  -6.231  1.00 0.00 ? 50 LYS A HE2  10 
ATOM   8912  H HE3  . LYS A 1 50 ? 12.302  -2.800  -4.961  1.00 0.00 ? 50 LYS A HE3  10 
ATOM   8913  H HZ1  . LYS A 1 50 ? 10.559  -4.317  -6.747  1.00 0.00 ? 50 LYS A HZ1  10 
ATOM   8914  H HZ2  . LYS A 1 50 ? 12.157  -4.511  -6.474  1.00 0.00 ? 50 LYS A HZ2  10 
ATOM   8915  N N    . TYR A 1 51 ? 7.239   -1.951  -1.225  1.00 0.00 ? 51 TYR A N    10 
ATOM   8916  C CA   . TYR A 1 51 ? 5.929   -1.368  -0.993  1.00 0.00 ? 51 TYR A CA   10 
ATOM   8917  C C    . TYR A 1 51 ? 5.374   -0.740  -2.273  1.00 0.00 ? 51 TYR A C    10 
ATOM   8918  O O    . TYR A 1 51 ? 6.135   -0.343  -3.155  1.00 0.00 ? 51 TYR A O    10 
ATOM   8919  C CB   . TYR A 1 51 ? 6.135   -0.269  0.051   1.00 0.00 ? 51 TYR A CB   10 
ATOM   8920  C CG   . TYR A 1 51 ? 6.943   -0.715  1.272   1.00 0.00 ? 51 TYR A CG   10 
ATOM   8921  C CD1  . TYR A 1 51 ? 6.770   -1.983  1.788   1.00 0.00 ? 51 TYR A CD1  10 
ATOM   8922  C CD2  . TYR A 1 51 ? 7.845   0.151   1.856   1.00 0.00 ? 51 TYR A CD2  10 
ATOM   8923  C CE1  . TYR A 1 51 ? 7.530   -2.402  2.937   1.00 0.00 ? 51 TYR A CE1  10 
ATOM   8924  C CE2  . TYR A 1 51 ? 8.605   -0.268  3.005   1.00 0.00 ? 51 TYR A CE2  10 
ATOM   8925  C CZ   . TYR A 1 51 ? 8.410   -1.524  3.489   1.00 0.00 ? 51 TYR A CZ   10 
ATOM   8926  O OH   . TYR A 1 51 ? 9.129   -1.921  4.574   1.00 0.00 ? 51 TYR A OH   10 
ATOM   8927  H H    . TYR A 1 51 ? 7.901   -1.343  -1.662  1.00 0.00 ? 51 TYR A H    10 
ATOM   8928  H HA   . TYR A 1 51 ? 5.259   -2.163  -0.668  1.00 0.00 ? 51 TYR A HA   10 
ATOM   8929  H HB2  . TYR A 1 51 ? 6.641   0.574   -0.418  1.00 0.00 ? 51 TYR A HB2  10 
ATOM   8930  H HB3  . TYR A 1 51 ? 5.161   0.089   0.384   1.00 0.00 ? 51 TYR A HB3  10 
ATOM   8931  H HD1  . TYR A 1 51 ? 6.058   -2.667  1.327   1.00 0.00 ? 51 TYR A HD1  10 
ATOM   8932  H HD2  . TYR A 1 51 ? 7.981   1.153   1.448   1.00 0.00 ? 51 TYR A HD2  10 
ATOM   8933  H HE1  . TYR A 1 51 ? 7.404   -3.401  3.355   1.00 0.00 ? 51 TYR A HE1  10 
ATOM   8934  H HE2  . TYR A 1 51 ? 9.321   0.406   3.476   1.00 0.00 ? 51 TYR A HE2  10 
ATOM   8935  H HH   . TYR A 1 51 ? 9.445   -2.861  4.449   1.00 0.00 ? 51 TYR A HH   10 
ATOM   8936  N N    . VAL A 1 52 ? 4.053   -0.669  -2.335  1.00 0.00 ? 52 VAL A N    10 
ATOM   8937  C CA   . VAL A 1 52 ? 3.387   -0.097  -3.493  1.00 0.00 ? 52 VAL A CA   10 
ATOM   8938  C C    . VAL A 1 52 ? 2.311   0.884   -3.024  1.00 0.00 ? 52 VAL A C    10 
ATOM   8939  O O    . VAL A 1 52 ? 1.693   0.681   -1.980  1.00 0.00 ? 52 VAL A O    10 
ATOM   8940  C CB   . VAL A 1 52 ? 2.833   -1.211  -4.383  1.00 0.00 ? 52 VAL A CB   10 
ATOM   8941  C CG1  . VAL A 1 52 ? 1.930   -0.640  -5.478  1.00 0.00 ? 52 VAL A CG1  10 
ATOM   8942  C CG2  . VAL A 1 52 ? 3.965   -2.045  -4.985  1.00 0.00 ? 52 VAL A CG2  10 
ATOM   8943  H H    . VAL A 1 52 ? 3.441   -0.995  -1.614  1.00 0.00 ? 52 VAL A H    10 
ATOM   8944  H HA   . VAL A 1 52 ? 4.136   0.451   -4.065  1.00 0.00 ? 52 VAL A HA   10 
ATOM   8945  H HB   . VAL A 1 52 ? 2.228   -1.869  -3.759  1.00 0.00 ? 52 VAL A HB   10 
ATOM   8946  H HG11 . VAL A 1 52 ? 2.545   -0.196  -6.261  1.00 0.00 ? 52 VAL A HG11 10 
ATOM   8947  H HG12 . VAL A 1 52 ? 1.324   -1.440  -5.903  1.00 0.00 ? 52 VAL A HG12 10 
ATOM   8948  H HG21 . VAL A 1 52 ? 3.582   -2.626  -5.824  1.00 0.00 ? 52 VAL A HG21 10 
ATOM   8949  H HG22 . VAL A 1 52 ? 4.759   -1.384  -5.334  1.00 0.00 ? 52 VAL A HG22 10 
ATOM   8950  N N    . CYS A 1 53 ? 2.120   1.928   -3.818  1.00 0.00 ? 53 CYS A N    10 
ATOM   8951  C CA   . CYS A 1 53 ? 1.129   2.941   -3.497  1.00 0.00 ? 53 CYS A CA   10 
ATOM   8952  C C    . CYS A 1 53 ? 0.336   3.257   -4.767  1.00 0.00 ? 53 CYS A C    10 
ATOM   8953  O O    . CYS A 1 53 ? 0.827   3.052   -5.876  1.00 0.00 ? 53 CYS A O    10 
ATOM   8954  C CB   . CYS A 1 53 ? 1.773   4.193   -2.899  1.00 0.00 ? 53 CYS A CB   10 
ATOM   8955  S SG   . CYS A 1 53 ? 2.115   4.099   -1.104  1.00 0.00 ? 53 CYS A SG   10 
ATOM   8956  H H    . CYS A 1 53 ? 2.627   2.086   -4.665  1.00 0.00 ? 53 CYS A H    10 
ATOM   8957  H HA   . CYS A 1 53 ? 0.480   2.513   -2.732  1.00 0.00 ? 53 CYS A HA   10 
ATOM   8958  H HB2  . CYS A 1 53 ? 2.709   4.388   -3.423  1.00 0.00 ? 53 CYS A HB2  10 
ATOM   8959  H HB3  . CYS A 1 53 ? 1.120   5.046   -3.086  1.00 0.00 ? 53 CYS A HB3  10 
ATOM   8960  N N    . CYS A 1 54 ? -0.876  3.751   -4.562  1.00 0.00 ? 54 CYS A N    10 
ATOM   8961  C CA   . CYS A 1 54 ? -1.741  4.098   -5.676  1.00 0.00 ? 54 CYS A CA   10 
ATOM   8962  C C    . CYS A 1 54 ? -2.946  4.866   -5.129  1.00 0.00 ? 54 CYS A C    10 
ATOM   8963  O O    . CYS A 1 54 ? -3.357  4.652   -3.989  1.00 0.00 ? 54 CYS A O    10 
ATOM   8964  C CB   . CYS A 1 54 ? -2.166  2.860   -6.469  1.00 0.00 ? 54 CYS A CB   10 
ATOM   8965  S SG   . CYS A 1 54 ? -2.152  1.297   -5.517  1.00 0.00 ? 54 CYS A SG   10 
ATOM   8966  H H    . CYS A 1 54 ? -1.267  3.915   -3.656  1.00 0.00 ? 54 CYS A H    10 
ATOM   8967  H HA   . CYS A 1 54 ? -1.153  4.726   -6.346  1.00 0.00 ? 54 CYS A HA   10 
ATOM   8968  H HB2  . CYS A 1 54 ? -3.171  3.022   -6.858  1.00 0.00 ? 54 CYS A HB2  10 
ATOM   8969  H HB3  . CYS A 1 54 ? -1.505  2.751   -7.328  1.00 0.00 ? 54 CYS A HB3  10 
ATOM   8970  N N    . ASN A 1 55 ? -3.477  5.745   -5.966  1.00 0.00 ? 55 ASN A N    10 
ATOM   8971  C CA   . ASN A 1 55 ? -4.626  6.547   -5.580  1.00 0.00 ? 55 ASN A CA   10 
ATOM   8972  C C    . ASN A 1 55 ? -5.848  6.098   -6.384  1.00 0.00 ? 55 ASN A C    10 
ATOM   8973  O O    . ASN A 1 55 ? -6.368  6.855   -7.203  1.00 0.00 ? 55 ASN A O    10 
ATOM   8974  C CB   . ASN A 1 55 ? -4.386  8.029   -5.871  1.00 0.00 ? 55 ASN A CB   10 
ATOM   8975  C CG   . ASN A 1 55 ? -3.819  8.227   -7.278  1.00 0.00 ? 55 ASN A CG   10 
ATOM   8976  O OD1  . ASN A 1 55 ? -3.907  7.366   -8.138  1.00 0.00 ? 55 ASN A OD1  10 
ATOM   8977  N ND2  . ASN A 1 55 ? -3.234  9.407   -7.465  1.00 0.00 ? 55 ASN A ND2  10 
ATOM   8978  H H    . ASN A 1 55 ? -3.136  5.913   -6.891  1.00 0.00 ? 55 ASN A H    10 
ATOM   8979  H HA   . ASN A 1 55 ? -4.746  6.378   -4.510  1.00 0.00 ? 55 ASN A HA   10 
ATOM   8980  H HB2  . ASN A 1 55 ? -5.322  8.579   -5.771  1.00 0.00 ? 55 ASN A HB2  10 
ATOM   8981  H HB3  . ASN A 1 55 ? -3.694  8.441   -5.136  1.00 0.00 ? 55 ASN A HB3  10 
ATOM   8982  H HD21 . ASN A 1 55 ? -3.195  10.069  -6.717  1.00 0.00 ? 55 ASN A HD21 10 
ATOM   8983  H HD22 . ASN A 1 55 ? -2.832  9.631   -8.353  1.00 0.00 ? 55 ASN A HD22 10 
ATOM   8984  N N    . THR A 1 56 ? -6.271  4.870   -6.123  1.00 0.00 ? 56 THR A N    10 
ATOM   8985  C CA   . THR A 1 56 ? -7.422  4.313   -6.812  1.00 0.00 ? 56 THR A CA   10 
ATOM   8986  C C    . THR A 1 56 ? -8.224  3.414   -5.869  1.00 0.00 ? 56 THR A C    10 
ATOM   8987  O O    . THR A 1 56 ? -7.680  2.878   -4.904  1.00 0.00 ? 56 THR A O    10 
ATOM   8988  C CB   . THR A 1 56 ? -6.919  3.587   -8.061  1.00 0.00 ? 56 THR A CB   10 
ATOM   8989  O OG1  . THR A 1 56 ? -5.921  2.698   -7.569  1.00 0.00 ? 56 THR A OG1  10 
ATOM   8990  C CG2  . THR A 1 56 ? -6.156  4.515   -9.010  1.00 0.00 ? 56 THR A CG2  10 
ATOM   8991  H H    . THR A 1 56 ? -5.842  4.262   -5.455  1.00 0.00 ? 56 THR A H    10 
ATOM   8992  H HA   . THR A 1 56 ? -8.077  5.133   -7.106  1.00 0.00 ? 56 THR A HA   10 
ATOM   8993  H HB   . THR A 1 56 ? -7.739  3.090   -8.579  1.00 0.00 ? 56 THR A HB   10 
ATOM   8994  H HG1  . THR A 1 56 ? -5.247  3.204   -7.030  1.00 0.00 ? 56 THR A HG1  10 
ATOM   8995  H HG21 . THR A 1 56 ? -6.569  5.521   -8.944  1.00 0.00 ? 56 THR A HG21 10 
ATOM   8996  H HG22 . THR A 1 56 ? -5.103  4.535   -8.729  1.00 0.00 ? 56 THR A HG22 10 
ATOM   8997  N N    . ASP A 1 57 ? -9.518  3.252   -6.153  1.00 0.00 ? 57 ASP A N    10 
ATOM   8998  C CA   . ASP A 1 57 ? -10.383 2.426   -5.335  1.00 0.00 ? 57 ASP A CA   10 
ATOM   8999  C C    . ASP A 1 57 ? -9.937  0.974   -5.418  1.00 0.00 ? 57 ASP A C    10 
ATOM   9000  O O    . ASP A 1 57 ? -9.835  0.415   -6.507  1.00 0.00 ? 57 ASP A O    10 
ATOM   9001  C CB   . ASP A 1 57 ? -11.826 2.577   -5.811  1.00 0.00 ? 57 ASP A CB   10 
ATOM   9002  C CG   . ASP A 1 57 ? -12.532 3.696   -5.059  1.00 0.00 ? 57 ASP A CG   10 
ATOM   9003  O OD1  . ASP A 1 57 ? -12.249 3.833   -3.849  1.00 0.00 ? 57 ASP A OD1  10 
ATOM   9004  O OD2  . ASP A 1 57 ? -13.342 4.392   -5.708  1.00 0.00 ? 57 ASP A OD2  10 
ATOM   9005  H H    . ASP A 1 57 ? -9.916  3.715   -6.958  1.00 0.00 ? 57 ASP A H    10 
ATOM   9006  H HA   . ASP A 1 57 ? -10.316 2.759   -4.300  1.00 0.00 ? 57 ASP A HA   10 
ATOM   9007  H HB2  . ASP A 1 57 ? -11.830 2.804   -6.877  1.00 0.00 ? 57 ASP A HB2  10 
ATOM   9008  H HB3  . ASP A 1 57 ? -12.358 1.641   -5.642  1.00 0.00 ? 57 ASP A HB3  10 
ATOM   9009  H HD2  . ASP A 1 57 ? -13.754 5.080   -5.179  1.00 0.00 ? 57 ASP A HD2  10 
ATOM   9010  N N    . LYS A 1 58 ? -9.681  0.399   -4.251  1.00 0.00 ? 58 LYS A N    10 
ATOM   9011  C CA   . LYS A 1 58 ? -9.245  -0.986  -4.180  1.00 0.00 ? 58 LYS A CA   10 
ATOM   9012  C C    . LYS A 1 58 ? -7.968  -1.157  -5.004  1.00 0.00 ? 58 LYS A C    10 
ATOM   9013  O O    . LYS A 1 58 ? -7.910  -2.002  -5.897  1.00 0.00 ? 58 LYS A O    10 
ATOM   9014  C CB   . LYS A 1 58 ? -10.378 -1.926  -4.597  1.00 0.00 ? 58 LYS A CB   10 
ATOM   9015  C CG   . LYS A 1 58 ? -11.145 -2.436  -3.375  1.00 0.00 ? 58 LYS A CG   10 
ATOM   9016  C CD   . LYS A 1 58 ? -12.188 -3.480  -3.780  1.00 0.00 ? 58 LYS A CD   10 
ATOM   9017  C CE   . LYS A 1 58 ? -13.452 -2.811  -4.322  1.00 0.00 ? 58 LYS A CE   10 
ATOM   9018  N NZ   . LYS A 1 58 ? -14.429 -2.590  -3.232  1.00 0.00 ? 58 LYS A NZ   10 
ATOM   9019  H H    . LYS A 1 58 ? -9.767  0.861   -3.368  1.00 0.00 ? 58 LYS A H    10 
ATOM   9020  H HA   . LYS A 1 58 ? -9.014  -1.202  -3.137  1.00 0.00 ? 58 LYS A HA   10 
ATOM   9021  H HB2  . LYS A 1 58 ? -11.060 -1.404  -5.268  1.00 0.00 ? 58 LYS A HB2  10 
ATOM   9022  H HB3  . LYS A 1 58 ? -9.968  -2.770  -5.153  1.00 0.00 ? 58 LYS A HB3  10 
ATOM   9023  H HG2  . LYS A 1 58 ? -10.448 -2.872  -2.660  1.00 0.00 ? 58 LYS A HG2  10 
ATOM   9024  H HG3  . LYS A 1 58 ? -11.636 -1.602  -2.875  1.00 0.00 ? 58 LYS A HG3  10 
ATOM   9025  H HD2  . LYS A 1 58 ? -11.769 -4.143  -4.538  1.00 0.00 ? 58 LYS A HD2  10 
ATOM   9026  H HD3  . LYS A 1 58 ? -12.440 -4.100  -2.919  1.00 0.00 ? 58 LYS A HD3  10 
ATOM   9027  H HE2  . LYS A 1 58 ? -13.196 -1.859  -4.787  1.00 0.00 ? 58 LYS A HE2  10 
ATOM   9028  H HE3  . LYS A 1 58 ? -13.898 -3.435  -5.097  1.00 0.00 ? 58 LYS A HE3  10 
ATOM   9029  H HZ1  . LYS A 1 58 ? -14.030 -2.879  -2.362  1.00 0.00 ? 58 LYS A HZ1  10 
ATOM   9030  H HZ2  . LYS A 1 58 ? -14.662 -1.618  -3.186  1.00 0.00 ? 58 LYS A HZ2  10 
ATOM   9031  N N    . CYS A 1 59 ? -6.976  -0.342  -4.677  1.00 0.00 ? 59 CYS A N    10 
ATOM   9032  C CA   . CYS A 1 59 ? -5.704  -0.393  -5.376  1.00 0.00 ? 59 CYS A CA   10 
ATOM   9033  C C    . CYS A 1 59 ? -4.745  -1.267  -4.566  1.00 0.00 ? 59 CYS A C    10 
ATOM   9034  O O    . CYS A 1 59 ? -4.085  -2.147  -5.117  1.00 0.00 ? 59 CYS A O    10 
ATOM   9035  C CB   . CYS A 1 59 ? -5.134  1.007   -5.617  1.00 0.00 ? 59 CYS A CB   10 
ATOM   9036  S SG   . CYS A 1 59 ? -3.855  1.532   -4.418  1.00 0.00 ? 59 CYS A SG   10 
ATOM   9037  H H    . CYS A 1 59 ? -7.032  0.342   -3.950  1.00 0.00 ? 59 CYS A H    10 
ATOM   9038  H HA   . CYS A 1 59 ? -5.900  -0.836  -6.353  1.00 0.00 ? 59 CYS A HA   10 
ATOM   9039  H HB2  . CYS A 1 59 ? -4.709  1.043   -6.620  1.00 0.00 ? 59 CYS A HB2  10 
ATOM   9040  H HB3  . CYS A 1 59 ? -5.953  1.726   -5.592  1.00 0.00 ? 59 CYS A HB3  10 
ATOM   9041  N N    . ASN A 1 60 ? -4.697  -0.995  -3.270  1.00 0.00 ? 60 ASN A N    10 
ATOM   9042  C CA   . ASN A 1 60 ? -3.830  -1.746  -2.379  1.00 0.00 ? 60 ASN A CA   10 
ATOM   9043  C C    . ASN A 1 60 ? -4.495  -3.080  -2.032  1.00 0.00 ? 60 ASN A C    10 
ATOM   9044  O O    . ASN A 1 60 ? -5.403  -3.525  -2.731  1.00 0.00 ? 60 ASN A O    10 
ATOM   9045  C CB   . ASN A 1 60 ? -3.589  -0.984  -1.074  1.00 0.00 ? 60 ASN A CB   10 
ATOM   9046  C CG   . ASN A 1 60 ? -4.764  -1.162  -0.110  1.00 0.00 ? 60 ASN A CG   10 
ATOM   9047  O OD1  . ASN A 1 60 ? -5.899  -1.367  -0.506  1.00 0.00 ? 60 ASN A OD1  10 
ATOM   9048  N ND2  . ASN A 1 60 ? -4.428  -1.072  1.174   1.00 0.00 ? 60 ASN A ND2  10 
ATOM   9049  H H    . ASN A 1 60 ? -5.237  -0.277  -2.830  1.00 0.00 ? 60 ASN A H    10 
ATOM   9050  H HA   . ASN A 1 60 ? -2.898  -1.875  -2.928  1.00 0.00 ? 60 ASN A HA   10 
ATOM   9051  H HB2  . ASN A 1 60 ? -2.672  -1.340  -0.605  1.00 0.00 ? 60 ASN A HB2  10 
ATOM   9052  H HB3  . ASN A 1 60 ? -3.447  0.075   -1.288  1.00 0.00 ? 60 ASN A HB3  10 
ATOM   9053  H HD21 . ASN A 1 60 ? -3.477  -0.903  1.431   1.00 0.00 ? 60 ASN A HD21 10 
ATOM   9054  H HD22 . ASN A 1 60 ? -5.127  -1.175  1.881   1.00 0.00 ? 60 ASN A HD22 10 
HETATM 9055  O O    . HOH B 2 .  ? 5.324   -10.585 2.712   1.00 0.00 ? 61 HOH A O    10 
HETATM 9056  H H1   . HOH B 2 .  ? 5.936   -11.098 3.240   1.00 0.00 ? 61 HOH A H1   10 
HETATM 9057  H H2   . HOH B 2 .  ? 4.890   -11.232 2.155   1.00 0.00 ? 61 HOH A H2   10 
HETATM 9058  O O    . HOH B 2 .  ? 4.837   -16.179 -6.896  1.00 0.00 ? 62 HOH A O    10 
HETATM 9059  H H1   . HOH B 2 .  ? 4.670   -15.304 -6.546  1.00 0.00 ? 62 HOH A H1   10 
HETATM 9060  H H2   . HOH B 2 .  ? 4.089   -16.353 -7.470  1.00 0.00 ? 62 HOH A H2   10 
ATOM   9061  N N    . LEU A 1 1  ? -13.114 7.025   -2.160  1.00 0.00 ? 1  LEU A N    11 
ATOM   9062  C CA   . LEU A 1 1  ? -11.866 6.837   -1.439  1.00 0.00 ? 1  LEU A CA   11 
ATOM   9063  C C    . LEU A 1 1  ? -12.014 5.662   -0.471  1.00 0.00 ? 1  LEU A C    11 
ATOM   9064  O O    . LEU A 1 1  ? -12.067 5.855   0.743   1.00 0.00 ? 1  LEU A O    11 
ATOM   9065  C CB   . LEU A 1 1  ? -11.437 8.141   -0.763  1.00 0.00 ? 1  LEU A CB   11 
ATOM   9066  C CG   . LEU A 1 1  ? -9.981  8.560   -0.979  1.00 0.00 ? 1  LEU A CG   11 
ATOM   9067  C CD1  . LEU A 1 1  ? -9.847  9.459   -2.210  1.00 0.00 ? 1  LEU A CD1  11 
ATOM   9068  C CD2  . LEU A 1 1  ? -9.408  9.219   0.277   1.00 0.00 ? 1  LEU A CD2  11 
ATOM   9069  H H    . LEU A 1 1  ? -13.057 7.633   -2.952  1.00 0.00 ? 1  LEU A H    11 
ATOM   9070  H HA   . LEU A 1 1  ? -11.100 6.586   -2.173  1.00 0.00 ? 1  LEU A HA   11 
ATOM   9071  H HB2  . LEU A 1 1  ? -12.082 8.942   -1.121  1.00 0.00 ? 1  LEU A HB2  11 
ATOM   9072  H HB3  . LEU A 1 1  ? -11.611 8.045   0.308   1.00 0.00 ? 1  LEU A HB3  11 
ATOM   9073  H HG   . LEU A 1 1  ? -9.392  7.664   -1.170  1.00 0.00 ? 1  LEU A HG   11 
ATOM   9074  H HD11 . LEU A 1 1  ? -10.591 10.254  -2.162  1.00 0.00 ? 1  LEU A HD11 11 
ATOM   9075  H HD12 . LEU A 1 1  ? -8.849  9.896   -2.234  1.00 0.00 ? 1  LEU A HD12 11 
ATOM   9076  H HD21 . LEU A 1 1  ? -8.394  8.858   0.447   1.00 0.00 ? 1  LEU A HD21 11 
ATOM   9077  H HD22 . LEU A 1 1  ? -9.391  10.301  0.144   1.00 0.00 ? 1  LEU A HD22 11 
ATOM   9078  N N    . LYS A 1 2  ? -12.076 4.469   -1.044  1.00 0.00 ? 2  LYS A N    11 
ATOM   9079  C CA   . LYS A 1 2  ? -12.216 3.262   -0.246  1.00 0.00 ? 2  LYS A CA   11 
ATOM   9080  C C    . LYS A 1 2  ? -11.249 2.197   -0.767  1.00 0.00 ? 2  LYS A C    11 
ATOM   9081  O O    . LYS A 1 2  ? -11.155 1.974   -1.973  1.00 0.00 ? 2  LYS A O    11 
ATOM   9082  C CB   . LYS A 1 2  ? -13.676 2.806   -0.218  1.00 0.00 ? 2  LYS A CB   11 
ATOM   9083  C CG   . LYS A 1 2  ? -14.093 2.215   -1.567  1.00 0.00 ? 2  LYS A CG   11 
ATOM   9084  C CD   . LYS A 1 2  ? -15.576 2.472   -1.843  1.00 0.00 ? 2  LYS A CD   11 
ATOM   9085  C CE   . LYS A 1 2  ? -16.084 1.579   -2.977  1.00 0.00 ? 2  LYS A CE   11 
ATOM   9086  N NZ   . LYS A 1 2  ? -17.220 0.751   -2.514  1.00 0.00 ? 2  LYS A NZ   11 
ATOM   9087  H H    . LYS A 1 2  ? -12.032 4.320   -2.032  1.00 0.00 ? 2  LYS A H    11 
ATOM   9088  H HA   . LYS A 1 2  ? -11.937 3.512   0.777   1.00 0.00 ? 2  LYS A HA   11 
ATOM   9089  H HB2  . LYS A 1 2  ? -13.814 2.061   0.567   1.00 0.00 ? 2  LYS A HB2  11 
ATOM   9090  H HB3  . LYS A 1 2  ? -14.320 3.650   0.028   1.00 0.00 ? 2  LYS A HB3  11 
ATOM   9091  H HG2  . LYS A 1 2  ? -13.490 2.655   -2.362  1.00 0.00 ? 2  LYS A HG2  11 
ATOM   9092  H HG3  . LYS A 1 2  ? -13.898 1.143   -1.574  1.00 0.00 ? 2  LYS A HG3  11 
ATOM   9093  H HD2  . LYS A 1 2  ? -16.155 2.284   -0.939  1.00 0.00 ? 2  LYS A HD2  11 
ATOM   9094  H HD3  . LYS A 1 2  ? -15.725 3.519   -2.106  1.00 0.00 ? 2  LYS A HD3  11 
ATOM   9095  H HE2  . LYS A 1 2  ? -16.395 2.194   -3.821  1.00 0.00 ? 2  LYS A HE2  11 
ATOM   9096  H HE3  . LYS A 1 2  ? -15.279 0.936   -3.331  1.00 0.00 ? 2  LYS A HE3  11 
ATOM   9097  H HZ1  . LYS A 1 2  ? -18.060 1.293   -2.540  1.00 0.00 ? 2  LYS A HZ1  11 
ATOM   9098  H HZ2  . LYS A 1 2  ? -17.318 -0.045  -3.112  1.00 0.00 ? 2  LYS A HZ2  11 
ATOM   9099  N N    . CYS A 1 3  ? -10.554 1.567   0.169   1.00 0.00 ? 3  CYS A N    11 
ATOM   9100  C CA   . CYS A 1 3  ? -9.598  0.530   -0.180  1.00 0.00 ? 3  CYS A CA   11 
ATOM   9101  C C    . CYS A 1 3  ? -9.850  -0.680  0.723   1.00 0.00 ? 3  CYS A C    11 
ATOM   9102  O O    . CYS A 1 3  ? -10.752 -0.658  1.558   1.00 0.00 ? 3  CYS A O    11 
ATOM   9103  C CB   . CYS A 1 3  ? -8.156  1.032   -0.073  1.00 0.00 ? 3  CYS A CB   11 
ATOM   9104  S SG   . CYS A 1 3  ? -7.484  1.769   -1.607  1.00 0.00 ? 3  CYS A SG   11 
ATOM   9105  H H    . CYS A 1 3  ? -10.637 1.753   1.148   1.00 0.00 ? 3  CYS A H    11 
ATOM   9106  H HA   . CYS A 1 3  ? -9.777  0.277   -1.225  1.00 0.00 ? 3  CYS A HA   11 
ATOM   9107  H HB2  . CYS A 1 3  ? -8.103  1.773   0.724   1.00 0.00 ? 3  CYS A HB2  11 
ATOM   9108  H HB3  . CYS A 1 3  ? -7.518  0.199   0.224   1.00 0.00 ? 3  CYS A HB3  11 
ATOM   9109  N N    . LYS A 1 4  ? -9.036  -1.706  0.524   1.00 0.00 ? 4  LYS A N    11 
ATOM   9110  C CA   . LYS A 1 4  ? -9.159  -2.922  1.309   1.00 0.00 ? 4  LYS A CA   11 
ATOM   9111  C C    . LYS A 1 4  ? -8.330  -2.784  2.588   1.00 0.00 ? 4  LYS A C    11 
ATOM   9112  O O    . LYS A 1 4  ? -7.224  -2.247  2.560   1.00 0.00 ? 4  LYS A O    11 
ATOM   9113  C CB   . LYS A 1 4  ? -8.790  -4.144  0.466   1.00 0.00 ? 4  LYS A CB   11 
ATOM   9114  C CG   . LYS A 1 4  ? -10.011 -4.683  -0.282  1.00 0.00 ? 4  LYS A CG   11 
ATOM   9115  C CD   . LYS A 1 4  ? -10.854 -5.584  0.623   1.00 0.00 ? 4  LYS A CD   11 
ATOM   9116  C CE   . LYS A 1 4  ? -12.036 -6.179  -0.144  1.00 0.00 ? 4  LYS A CE   11 
ATOM   9117  N NZ   . LYS A 1 4  ? -12.785 -7.127  0.712   1.00 0.00 ? 4  LYS A NZ   11 
ATOM   9118  H H    . LYS A 1 4  ? -8.304  -1.715  -0.158  1.00 0.00 ? 4  LYS A H    11 
ATOM   9119  H HA   . LYS A 1 4  ? -10.208 -3.027  1.587   1.00 0.00 ? 4  LYS A HA   11 
ATOM   9120  H HB2  . LYS A 1 4  ? -8.011  -3.877  -0.248  1.00 0.00 ? 4  LYS A HB2  11 
ATOM   9121  H HB3  . LYS A 1 4  ? -8.379  -4.923  1.108   1.00 0.00 ? 4  LYS A HB3  11 
ATOM   9122  H HG2  . LYS A 1 4  ? -10.618 -3.852  -0.641  1.00 0.00 ? 4  LYS A HG2  11 
ATOM   9123  H HG3  . LYS A 1 4  ? -9.687  -5.244  -1.158  1.00 0.00 ? 4  LYS A HG3  11 
ATOM   9124  H HD2  . LYS A 1 4  ? -10.235 -6.386  1.023   1.00 0.00 ? 4  LYS A HD2  11 
ATOM   9125  H HD3  . LYS A 1 4  ? -11.221 -5.010  1.474   1.00 0.00 ? 4  LYS A HD3  11 
ATOM   9126  H HE2  . LYS A 1 4  ? -12.699 -5.382  -0.480  1.00 0.00 ? 4  LYS A HE2  11 
ATOM   9127  H HE3  . LYS A 1 4  ? -11.677 -6.692  -1.036  1.00 0.00 ? 4  LYS A HE3  11 
ATOM   9128  H HZ1  . LYS A 1 4  ? -12.385 -7.137  1.628   1.00 0.00 ? 4  LYS A HZ1  11 
ATOM   9129  H HZ2  . LYS A 1 4  ? -13.741 -6.839  0.769   1.00 0.00 ? 4  LYS A HZ2  11 
ATOM   9130  N N    . LYS A 1 5  ? -8.897  -3.279  3.679   1.00 0.00 ? 5  LYS A N    11 
ATOM   9131  C CA   . LYS A 1 5  ? -8.224  -3.218  4.965   1.00 0.00 ? 5  LYS A CA   11 
ATOM   9132  C C    . LYS A 1 5  ? -7.158  -4.313  5.031   1.00 0.00 ? 5  LYS A C    11 
ATOM   9133  O O    . LYS A 1 5  ? -6.863  -4.958  4.026   1.00 0.00 ? 5  LYS A O    11 
ATOM   9134  C CB   . LYS A 1 5  ? -9.242  -3.282  6.106   1.00 0.00 ? 5  LYS A CB   11 
ATOM   9135  C CG   . LYS A 1 5  ? -9.716  -1.881  6.497   1.00 0.00 ? 5  LYS A CG   11 
ATOM   9136  C CD   . LYS A 1 5  ? -10.559 -1.923  7.773   1.00 0.00 ? 5  LYS A CD   11 
ATOM   9137  C CE   . LYS A 1 5  ? -9.861  -1.184  8.916   1.00 0.00 ? 5  LYS A CE   11 
ATOM   9138  N NZ   . LYS A 1 5  ? -9.979  0.280   8.735   1.00 0.00 ? 5  LYS A NZ   11 
ATOM   9139  H H    . LYS A 1 5  ? -9.797  -3.714  3.693   1.00 0.00 ? 5  LYS A H    11 
ATOM   9140  H HA   . LYS A 1 5  ? -7.729  -2.249  5.029   1.00 0.00 ? 5  LYS A HA   11 
ATOM   9141  H HB2  . LYS A 1 5  ? -10.097 -3.887  5.802   1.00 0.00 ? 5  LYS A HB2  11 
ATOM   9142  H HB3  . LYS A 1 5  ? -8.795  -3.773  6.970   1.00 0.00 ? 5  LYS A HB3  11 
ATOM   9143  H HG2  . LYS A 1 5  ? -8.854  -1.231  6.648   1.00 0.00 ? 5  LYS A HG2  11 
ATOM   9144  H HG3  . LYS A 1 5  ? -10.301 -1.450  5.684   1.00 0.00 ? 5  LYS A HG3  11 
ATOM   9145  H HD2  . LYS A 1 5  ? -11.533 -1.472  7.585   1.00 0.00 ? 5  LYS A HD2  11 
ATOM   9146  H HD3  . LYS A 1 5  ? -10.737 -2.959  8.061   1.00 0.00 ? 5  LYS A HD3  11 
ATOM   9147  H HE2  . LYS A 1 5  ? -10.303 -1.475  9.869   1.00 0.00 ? 5  LYS A HE2  11 
ATOM   9148  H HE3  . LYS A 1 5  ? -8.809  -1.468  8.953   1.00 0.00 ? 5  LYS A HE3  11 
ATOM   9149  H HZ1  . LYS A 1 5  ? -10.942 0.526   8.626   1.00 0.00 ? 5  LYS A HZ1  11 
ATOM   9150  H HZ2  . LYS A 1 5  ? -9.604  0.747   9.536   1.00 0.00 ? 5  LYS A HZ2  11 
ATOM   9151  N N    . LEU A 1 6  ? -6.609  -4.490  6.224   1.00 0.00 ? 6  LEU A N    11 
ATOM   9152  C CA   . LEU A 1 6  ? -5.582  -5.496  6.433   1.00 0.00 ? 6  LEU A CA   11 
ATOM   9153  C C    . LEU A 1 6  ? -6.029  -6.815  5.800   1.00 0.00 ? 6  LEU A C    11 
ATOM   9154  O O    . LEU A 1 6  ? -5.395  -7.306  4.868   1.00 0.00 ? 6  LEU A O    11 
ATOM   9155  C CB   . LEU A 1 6  ? -5.241  -5.612  7.920   1.00 0.00 ? 6  LEU A CB   11 
ATOM   9156  C CG   . LEU A 1 6  ? -4.116  -4.705  8.424   1.00 0.00 ? 6  LEU A CG   11 
ATOM   9157  C CD1  . LEU A 1 6  ? -4.652  -3.320  8.792   1.00 0.00 ? 6  LEU A CD1  11 
ATOM   9158  C CD2  . LEU A 1 6  ? -3.365  -5.356  9.586   1.00 0.00 ? 6  LEU A CD2  11 
ATOM   9159  H H    . LEU A 1 6  ? -6.855  -3.961  7.036   1.00 0.00 ? 6  LEU A H    11 
ATOM   9160  H HA   . LEU A 1 6  ? -4.681  -5.155  5.922   1.00 0.00 ? 6  LEU A HA   11 
ATOM   9161  H HB2  . LEU A 1 6  ? -6.141  -5.396  8.497   1.00 0.00 ? 6  LEU A HB2  11 
ATOM   9162  H HB3  . LEU A 1 6  ? -4.969  -6.646  8.131   1.00 0.00 ? 6  LEU A HB3  11 
ATOM   9163  H HG   . LEU A 1 6  ? -3.400  -4.568  7.614   1.00 0.00 ? 6  LEU A HG   11 
ATOM   9164  H HD11 . LEU A 1 6  ? -3.947  -2.557  8.460   1.00 0.00 ? 6  LEU A HD11 11 
ATOM   9165  H HD12 . LEU A 1 6  ? -5.614  -3.161  8.305   1.00 0.00 ? 6  LEU A HD12 11 
ATOM   9166  H HD21 . LEU A 1 6  ? -4.042  -5.479  10.433  1.00 0.00 ? 6  LEU A HD21 11 
ATOM   9167  H HD22 . LEU A 1 6  ? -2.991  -6.332  9.276   1.00 0.00 ? 6  LEU A HD22 11 
ATOM   9168  N N    . VAL A 1 7  ? -7.118  -7.350  6.331   1.00 0.00 ? 7  VAL A N    11 
ATOM   9169  C CA   . VAL A 1 7  ? -7.658  -8.602  5.830   1.00 0.00 ? 7  VAL A CA   11 
ATOM   9170  C C    . VAL A 1 7  ? -8.571  -8.318  4.635   1.00 0.00 ? 7  VAL A C    11 
ATOM   9171  O O    . VAL A 1 7  ? -9.418  -7.428  4.695   1.00 0.00 ? 7  VAL A O    11 
ATOM   9172  C CB   . VAL A 1 7  ? -8.366  -9.356  6.957   1.00 0.00 ? 7  VAL A CB   11 
ATOM   9173  C CG1  . VAL A 1 7  ? -9.003  -10.647 6.439   1.00 0.00 ? 7  VAL A CG1  11 
ATOM   9174  C CG2  . VAL A 1 7  ? -7.405  -9.644  8.112   1.00 0.00 ? 7  VAL A CG2  11 
ATOM   9175  H H    . VAL A 1 7  ? -7.629  -6.943  7.089   1.00 0.00 ? 7  VAL A H    11 
ATOM   9176  H HA   . VAL A 1 7  ? -6.818  -9.211  5.493   1.00 0.00 ? 7  VAL A HA   11 
ATOM   9177  H HB   . VAL A 1 7  ? -9.164  -8.718  7.337   1.00 0.00 ? 7  VAL A HB   11 
ATOM   9178  H HG11 . VAL A 1 7  ? -9.988  -10.772 6.889   1.00 0.00 ? 7  VAL A HG11 11 
ATOM   9179  H HG12 . VAL A 1 7  ? -9.103  -10.592 5.355   1.00 0.00 ? 7  VAL A HG12 11 
ATOM   9180  H HG21 . VAL A 1 7  ? -6.868  -8.733  8.375   1.00 0.00 ? 7  VAL A HG21 11 
ATOM   9181  H HG22 . VAL A 1 7  ? -7.970  -9.995  8.976   1.00 0.00 ? 7  VAL A HG22 11 
ATOM   9182  N N    . PRO A 1 8  ? -8.361  -9.110  3.550   1.00 0.00 ? 8  PRO A N    11 
ATOM   9183  C CA   . PRO A 1 8  ? -9.155  -8.952  2.344   1.00 0.00 ? 8  PRO A CA   11 
ATOM   9184  C C    . PRO A 1 8  ? -10.561 -9.525  2.534   1.00 0.00 ? 8  PRO A C    11 
ATOM   9185  O O    . PRO A 1 8  ? -11.006 -10.361 1.749   1.00 0.00 ? 8  PRO A O    11 
ATOM   9186  C CB   . PRO A 1 8  ? -8.366  -9.664  1.257   1.00 0.00 ? 8  PRO A CB   11 
ATOM   9187  C CG   . PRO A 1 8  ? -7.399  -10.587 1.981   1.00 0.00 ? 8  PRO A CG   11 
ATOM   9188  C CD   . PRO A 1 8  ? -7.367  -10.173 3.443   1.00 0.00 ? 8  PRO A CD   11 
ATOM   9189  H HA   . PRO A 1 8  ? -9.281  -7.982  2.136   1.00 0.00 ? 8  PRO A HA   11 
ATOM   9190  H HB2  . PRO A 1 8  ? -9.027  -10.228 0.600   1.00 0.00 ? 8  PRO A HB2  11 
ATOM   9191  H HB3  . PRO A 1 8  ? -7.830  -8.949  0.632   1.00 0.00 ? 8  PRO A HB3  11 
ATOM   9192  H HG2  . PRO A 1 8  ? -7.718  -11.625 1.884   1.00 0.00 ? 8  PRO A HG2  11 
ATOM   9193  H HG3  . PRO A 1 8  ? -6.404  -10.517 1.542   1.00 0.00 ? 8  PRO A HG3  11 
ATOM   9194  H HD2  . PRO A 1 8  ? -7.610  -11.011 4.097   1.00 0.00 ? 8  PRO A HD2  11 
ATOM   9195  H HD3  . PRO A 1 8  ? -6.377  -9.821  3.733   1.00 0.00 ? 8  PRO A HD3  11 
ATOM   9196  N N    . LEU A 1 9  ? -11.222 -9.051  3.580   1.00 0.00 ? 9  LEU A N    11 
ATOM   9197  C CA   . LEU A 1 9  ? -12.568 -9.506  3.883   1.00 0.00 ? 9  LEU A CA   11 
ATOM   9198  C C    . LEU A 1 9  ? -13.538 -8.328  3.767   1.00 0.00 ? 9  LEU A C    11 
ATOM   9199  O O    . LEU A 1 9  ? -14.678 -8.498  3.338   1.00 0.00 ? 9  LEU A O    11 
ATOM   9200  C CB   . LEU A 1 9  ? -12.605 -10.200 5.246   1.00 0.00 ? 9  LEU A CB   11 
ATOM   9201  C CG   . LEU A 1 9  ? -12.228 -11.683 5.254   1.00 0.00 ? 9  LEU A CG   11 
ATOM   9202  C CD1  . LEU A 1 9  ? -11.959 -12.173 6.678   1.00 0.00 ? 9  LEU A CD1  11 
ATOM   9203  C CD2  . LEU A 1 9  ? -13.296 -12.524 4.551   1.00 0.00 ? 9  LEU A CD2  11 
ATOM   9204  H H    . LEU A 1 9  ? -10.853 -8.371  4.214   1.00 0.00 ? 9  LEU A H    11 
ATOM   9205  H HA   . LEU A 1 9  ? -12.838 -10.251 3.135   1.00 0.00 ? 9  LEU A HA   11 
ATOM   9206  H HB2  . LEU A 1 9  ? -11.932 -9.671  5.920   1.00 0.00 ? 9  LEU A HB2  11 
ATOM   9207  H HB3  . LEU A 1 9  ? -13.610 -10.099 5.656   1.00 0.00 ? 9  LEU A HB3  11 
ATOM   9208  H HG   . LEU A 1 9  ? -11.302 -11.803 4.692   1.00 0.00 ? 9  LEU A HG   11 
ATOM   9209  H HD11 . LEU A 1 9  ? -12.726 -12.890 6.967   1.00 0.00 ? 9  LEU A HD11 11 
ATOM   9210  H HD12 . LEU A 1 9  ? -10.980 -12.652 6.719   1.00 0.00 ? 9  LEU A HD12 11 
ATOM   9211  H HD21 . LEU A 1 9  ? -14.258 -12.017 4.616   1.00 0.00 ? 9  LEU A HD21 11 
ATOM   9212  H HD22 . LEU A 1 9  ? -13.024 -12.654 3.503   1.00 0.00 ? 9  LEU A HD22 11 
ATOM   9213  N N    . PHE A 1 10 ? -13.049 -7.160  4.156   1.00 0.00 ? 10 PHE A N    11 
ATOM   9214  C CA   . PHE A 1 10 ? -13.858 -5.954  4.101   1.00 0.00 ? 10 PHE A CA   11 
ATOM   9215  C C    . PHE A 1 10 ? -13.011 -4.743  3.706   1.00 0.00 ? 10 PHE A C    11 
ATOM   9216  O O    . PHE A 1 10 ? -11.783 -4.795  3.761   1.00 0.00 ? 10 PHE A O    11 
ATOM   9217  C CB   . PHE A 1 10 ? -14.424 -5.730  5.504   1.00 0.00 ? 10 PHE A CB   11 
ATOM   9218  C CG   . PHE A 1 10 ? -14.839 -7.017  6.221   1.00 0.00 ? 10 PHE A CG   11 
ATOM   9219  C CD1  . PHE A 1 10 ? -13.929 -7.710  6.955   1.00 0.00 ? 10 PHE A CD1  11 
ATOM   9220  C CD2  . PHE A 1 10 ? -16.119 -7.467  6.122   1.00 0.00 ? 10 PHE A CD2  11 
ATOM   9221  C CE1  . PHE A 1 10 ? -14.314 -8.905  7.620   1.00 0.00 ? 10 PHE A CE1  11 
ATOM   9222  C CE2  . PHE A 1 10 ? -16.504 -8.661  6.787   1.00 0.00 ? 10 PHE A CE2  11 
ATOM   9223  C CZ   . PHE A 1 10 ? -15.594 -9.355  7.522   1.00 0.00 ? 10 PHE A CZ   11 
ATOM   9224  H H    . PHE A 1 10 ? -12.121 -7.030  4.504   1.00 0.00 ? 10 PHE A H    11 
ATOM   9225  H HA   . PHE A 1 10 ? -14.630 -6.117  3.348   1.00 0.00 ? 10 PHE A HA   11 
ATOM   9226  H HB2  . PHE A 1 10 ? -13.677 -5.215  6.108   1.00 0.00 ? 10 PHE A HB2  11 
ATOM   9227  H HB3  . PHE A 1 10 ? -15.288 -5.070  5.435   1.00 0.00 ? 10 PHE A HB3  11 
ATOM   9228  H HD1  . PHE A 1 10 ? -12.904 -7.350  7.034   1.00 0.00 ? 10 PHE A HD1  11 
ATOM   9229  H HD2  . PHE A 1 10 ? -16.849 -6.911  5.533   1.00 0.00 ? 10 PHE A HD2  11 
ATOM   9230  H HE1  . PHE A 1 10 ? -13.585 -9.460  8.209   1.00 0.00 ? 10 PHE A HE1  11 
ATOM   9231  H HE2  . PHE A 1 10 ? -17.530 -9.022  6.708   1.00 0.00 ? 10 PHE A HE2  11 
ATOM   9232  H HZ   . PHE A 1 10 ? -15.890 -10.271 8.032   1.00 0.00 ? 10 PHE A HZ   11 
ATOM   9233  N N    . SER A 1 11 ? -13.700 -3.681  3.316   1.00 0.00 ? 11 SER A N    11 
ATOM   9234  C CA   . SER A 1 11 ? -13.026 -2.458  2.912   1.00 0.00 ? 11 SER A CA   11 
ATOM   9235  C C    . SER A 1 11 ? -13.586 -1.269  3.695   1.00 0.00 ? 11 SER A C    11 
ATOM   9236  O O    . SER A 1 11 ? -14.733 -1.297  4.138   1.00 0.00 ? 11 SER A O    11 
ATOM   9237  C CB   . SER A 1 11 ? -13.173 -2.220  1.408   1.00 0.00 ? 11 SER A CB   11 
ATOM   9238  O OG   . SER A 1 11 ? -14.503 -2.458  0.957   1.00 0.00 ? 11 SER A OG   11 
ATOM   9239  H H    . SER A 1 11 ? -14.699 -3.647  3.274   1.00 0.00 ? 11 SER A H    11 
ATOM   9240  H HA   . SER A 1 11 ? -11.975 -2.615  3.154   1.00 0.00 ? 11 SER A HA   11 
ATOM   9241  H HB2  . SER A 1 11 ? -12.889 -1.193  1.175   1.00 0.00 ? 11 SER A HB2  11 
ATOM   9242  H HB3  . SER A 1 11 ? -12.485 -2.871  0.869   1.00 0.00 ? 11 SER A HB3  11 
ATOM   9243  H HG   . SER A 1 11 ? -14.853 -3.306  1.356   1.00 0.00 ? 11 SER A HG   11 
ATOM   9244  N N    . LYS A 1 12 ? -12.750 -0.252  3.842   1.00 0.00 ? 12 LYS A N    11 
ATOM   9245  C CA   . LYS A 1 12 ? -13.146 0.945   4.564   1.00 0.00 ? 12 LYS A CA   11 
ATOM   9246  C C    . LYS A 1 12 ? -12.602 2.177   3.839   1.00 0.00 ? 12 LYS A C    11 
ATOM   9247  O O    . LYS A 1 12 ? -11.665 2.073   3.049   1.00 0.00 ? 12 LYS A O    11 
ATOM   9248  C CB   . LYS A 1 12 ? -12.716 0.854   6.030   1.00 0.00 ? 12 LYS A CB   11 
ATOM   9249  C CG   . LYS A 1 12 ? -13.882 1.182   6.965   1.00 0.00 ? 12 LYS A CG   11 
ATOM   9250  C CD   . LYS A 1 12 ? -14.270 -0.036  7.806   1.00 0.00 ? 12 LYS A CD   11 
ATOM   9251  C CE   . LYS A 1 12 ? -15.597 0.199   8.531   1.00 0.00 ? 12 LYS A CE   11 
ATOM   9252  N NZ   . LYS A 1 12 ? -15.459 1.284   9.528   1.00 0.00 ? 12 LYS A NZ   11 
ATOM   9253  H H    . LYS A 1 12 ? -11.818 -0.237  3.479   1.00 0.00 ? 12 LYS A H    11 
ATOM   9254  H HA   . LYS A 1 12 ? -14.235 0.989   4.550   1.00 0.00 ? 12 LYS A HA   11 
ATOM   9255  H HB2  . LYS A 1 12 ? -12.346 -0.149  6.243   1.00 0.00 ? 12 LYS A HB2  11 
ATOM   9256  H HB3  . LYS A 1 12 ? -11.892 1.543   6.214   1.00 0.00 ? 12 LYS A HB3  11 
ATOM   9257  H HG2  . LYS A 1 12 ? -13.605 2.008   7.620   1.00 0.00 ? 12 LYS A HG2  11 
ATOM   9258  H HG3  . LYS A 1 12 ? -14.740 1.513   6.380   1.00 0.00 ? 12 LYS A HG3  11 
ATOM   9259  H HD2  . LYS A 1 12 ? -14.351 -0.914  7.166   1.00 0.00 ? 12 LYS A HD2  11 
ATOM   9260  H HD3  . LYS A 1 12 ? -13.485 -0.244  8.534   1.00 0.00 ? 12 LYS A HD3  11 
ATOM   9261  H HE2  . LYS A 1 12 ? -16.371 0.457   7.808   1.00 0.00 ? 12 LYS A HE2  11 
ATOM   9262  H HE3  . LYS A 1 12 ? -15.915 -0.719  9.025   1.00 0.00 ? 12 LYS A HE3  11 
ATOM   9263  H HZ1  . LYS A 1 12 ? -14.737 1.913   9.238   1.00 0.00 ? 12 LYS A HZ1  11 
ATOM   9264  H HZ2  . LYS A 1 12 ? -16.323 1.780   9.602   1.00 0.00 ? 12 LYS A HZ2  11 
ATOM   9265  N N    . THR A 1 13 ? -13.213 3.315   4.133   1.00 0.00 ? 13 THR A N    11 
ATOM   9266  C CA   . THR A 1 13 ? -12.802 4.566   3.518   1.00 0.00 ? 13 THR A CA   11 
ATOM   9267  C C    . THR A 1 13 ? -11.648 5.192   4.305   1.00 0.00 ? 13 THR A C    11 
ATOM   9268  O O    . THR A 1 13 ? -11.665 5.204   5.534   1.00 0.00 ? 13 THR A O    11 
ATOM   9269  C CB   . THR A 1 13 ? -14.031 5.471   3.418   1.00 0.00 ? 13 THR A CB   11 
ATOM   9270  O OG1  . THR A 1 13 ? -14.746 4.962   2.295   1.00 0.00 ? 13 THR A OG1  11 
ATOM   9271  C CG2  . THR A 1 13 ? -13.673 6.903   3.014   1.00 0.00 ? 13 THR A CG2  11 
ATOM   9272  H H    . THR A 1 13 ? -13.975 3.391   4.776   1.00 0.00 ? 13 THR A H    11 
ATOM   9273  H HA   . THR A 1 13 ? -12.426 4.350   2.518   1.00 0.00 ? 13 THR A HA   11 
ATOM   9274  H HB   . THR A 1 13 ? -14.600 5.459   4.348   1.00 0.00 ? 13 THR A HB   11 
ATOM   9275  H HG1  . THR A 1 13 ? -15.653 4.652   2.580   1.00 0.00 ? 13 THR A HG1  11 
ATOM   9276  H HG21 . THR A 1 13 ? -12.599 7.053   3.123   1.00 0.00 ? 13 THR A HG21 11 
ATOM   9277  H HG22 . THR A 1 13 ? -13.961 7.070   1.976   1.00 0.00 ? 13 THR A HG22 11 
ATOM   9278  N N    . CYS A 1 14 ? -10.674 5.698   3.563   1.00 0.00 ? 14 CYS A N    11 
ATOM   9279  C CA   . CYS A 1 14 ? -9.515  6.325   4.175   1.00 0.00 ? 14 CYS A CA   11 
ATOM   9280  C C    . CYS A 1 14 ? -9.884  7.764   4.539   1.00 0.00 ? 14 CYS A C    11 
ATOM   9281  O O    . CYS A 1 14 ? -10.511 8.467   3.749   1.00 0.00 ? 14 CYS A O    11 
ATOM   9282  C CB   . CYS A 1 14 ? -8.290  6.264   3.261   1.00 0.00 ? 14 CYS A CB   11 
ATOM   9283  S SG   . CYS A 1 14 ? -8.034  4.655   2.428   1.00 0.00 ? 14 CYS A SG   11 
ATOM   9284  H H    . CYS A 1 14 ? -10.668 5.685   2.563   1.00 0.00 ? 14 CYS A H    11 
ATOM   9285  H HA   . CYS A 1 14 ? -9.283  5.747   5.069   1.00 0.00 ? 14 CYS A HA   11 
ATOM   9286  H HB2  . CYS A 1 14 ? -8.381  7.040   2.501   1.00 0.00 ? 14 CYS A HB2  11 
ATOM   9287  H HB3  . CYS A 1 14 ? -7.403  6.497   3.850   1.00 0.00 ? 14 CYS A HB3  11 
ATOM   9288  N N    . PRO A 1 15 ? -9.468  8.171   5.769   1.00 0.00 ? 15 PRO A N    11 
ATOM   9289  C CA   . PRO A 1 15 ? -9.748  9.514   6.248   1.00 0.00 ? 15 PRO A CA   11 
ATOM   9290  C C    . PRO A 1 15 ? -8.842  10.539  5.564   1.00 0.00 ? 15 PRO A C    11 
ATOM   9291  O O    . PRO A 1 15 ? -7.835  10.177  4.957   1.00 0.00 ? 15 PRO A O    11 
ATOM   9292  C CB   . PRO A 1 15 ? -9.540  9.446   7.752   1.00 0.00 ? 15 PRO A CB   11 
ATOM   9293  C CG   . PRO A 1 15 ? -8.706  8.200   8.002   1.00 0.00 ? 15 PRO A CG   11 
ATOM   9294  C CD   . PRO A 1 15 ? -8.723  7.365   6.732   1.00 0.00 ? 15 PRO A CD   11 
ATOM   9295  H HA   . PRO A 1 15 ? -10.684 9.777   6.014   1.00 0.00 ? 15 PRO A HA   11 
ATOM   9296  H HB2  . PRO A 1 15 ? -9.029  10.338  8.116   1.00 0.00 ? 15 PRO A HB2  11 
ATOM   9297  H HB3  . PRO A 1 15 ? -10.494 9.389   8.276   1.00 0.00 ? 15 PRO A HB3  11 
ATOM   9298  H HG2  . PRO A 1 15 ? -7.684  8.472   8.267   1.00 0.00 ? 15 PRO A HG2  11 
ATOM   9299  H HG3  . PRO A 1 15 ? -9.111  7.631   8.839   1.00 0.00 ? 15 PRO A HG3  11 
ATOM   9300  H HD2  . PRO A 1 15 ? -7.713  7.160   6.379   1.00 0.00 ? 15 PRO A HD2  11 
ATOM   9301  H HD3  . PRO A 1 15 ? -9.205  6.401   6.899   1.00 0.00 ? 15 PRO A HD3  11 
ATOM   9302  N N    . ALA A 1 16 ? -9.232  11.800  5.686   1.00 0.00 ? 16 ALA A N    11 
ATOM   9303  C CA   . ALA A 1 16 ? -8.467  12.881  5.087   1.00 0.00 ? 16 ALA A CA   11 
ATOM   9304  C C    . ALA A 1 16 ? -6.979  12.662  5.367   1.00 0.00 ? 16 ALA A C    11 
ATOM   9305  O O    . ALA A 1 16 ? -6.617  11.948  6.300   1.00 0.00 ? 16 ALA A O    11 
ATOM   9306  C CB   . ALA A 1 16 ? -8.971  14.221  5.625   1.00 0.00 ? 16 ALA A CB   11 
ATOM   9307  H H    . ALA A 1 16 ? -10.052 12.086  6.181   1.00 0.00 ? 16 ALA A H    11 
ATOM   9308  H HA   . ALA A 1 16 ? -8.634  12.849  4.010   1.00 0.00 ? 16 ALA A HA   11 
ATOM   9309  H HB1  . ALA A 1 16 ? -8.721  14.306  6.683   1.00 0.00 ? 16 ALA A HB1  11 
ATOM   9310  H HB2  . ALA A 1 16 ? -8.498  15.035  5.074   1.00 0.00 ? 16 ALA A HB2  11 
ATOM   9311  N N    . GLY A 1 17 ? -6.156  13.291  4.540   1.00 0.00 ? 17 GLY A N    11 
ATOM   9312  C CA   . GLY A 1 17 ? -4.715  13.174  4.686   1.00 0.00 ? 17 GLY A CA   11 
ATOM   9313  C C    . GLY A 1 17 ? -4.189  11.931  3.965   1.00 0.00 ? 17 GLY A C    11 
ATOM   9314  O O    . GLY A 1 17 ? -3.196  12.002  3.243   1.00 0.00 ? 17 GLY A O    11 
ATOM   9315  H H    . GLY A 1 17 ? -6.458  13.870  3.783   1.00 0.00 ? 17 GLY A H    11 
ATOM   9316  H HA2  . GLY A 1 17 ? -4.231  14.064  4.284   1.00 0.00 ? 17 GLY A HA2  11 
ATOM   9317  H HA3  . GLY A 1 17 ? -4.456  13.121  5.744   1.00 0.00 ? 17 GLY A HA3  11 
ATOM   9318  N N    . LYS A 1 18 ? -4.879  10.822  4.185   1.00 0.00 ? 18 LYS A N    11 
ATOM   9319  C CA   . LYS A 1 18 ? -4.495  9.565   3.565   1.00 0.00 ? 18 LYS A CA   11 
ATOM   9320  C C    . LYS A 1 18 ? -5.311  9.361   2.288   1.00 0.00 ? 18 LYS A C    11 
ATOM   9321  O O    . LYS A 1 18 ? -6.397  8.785   2.327   1.00 0.00 ? 18 LYS A O    11 
ATOM   9322  C CB   . LYS A 1 18 ? -4.619  8.414   4.565   1.00 0.00 ? 18 LYS A CB   11 
ATOM   9323  C CG   . LYS A 1 18 ? -4.314  8.888   5.988   1.00 0.00 ? 18 LYS A CG   11 
ATOM   9324  C CD   . LYS A 1 18 ? -2.841  9.273   6.134   1.00 0.00 ? 18 LYS A CD   11 
ATOM   9325  C CE   . LYS A 1 18 ? -2.234  8.649   7.392   1.00 0.00 ? 18 LYS A CE   11 
ATOM   9326  N NZ   . LYS A 1 18 ? -1.876  9.700   8.371   1.00 0.00 ? 18 LYS A NZ   11 
ATOM   9327  H H    . LYS A 1 18 ? -5.686  10.773  4.774   1.00 0.00 ? 18 LYS A H    11 
ATOM   9328  H HA   . LYS A 1 18 ? -3.442  9.644   3.294   1.00 0.00 ? 18 LYS A HA   11 
ATOM   9329  H HB2  . LYS A 1 18 ? -5.626  7.999   4.524   1.00 0.00 ? 18 LYS A HB2  11 
ATOM   9330  H HB3  . LYS A 1 18 ? -3.933  7.613   4.290   1.00 0.00 ? 18 LYS A HB3  11 
ATOM   9331  H HG2  . LYS A 1 18 ? -4.943  9.745   6.232   1.00 0.00 ? 18 LYS A HG2  11 
ATOM   9332  H HG3  . LYS A 1 18 ? -4.561  8.100   6.699   1.00 0.00 ? 18 LYS A HG3  11 
ATOM   9333  H HD2  . LYS A 1 18 ? -2.286  8.942   5.256   1.00 0.00 ? 18 LYS A HD2  11 
ATOM   9334  H HD3  . LYS A 1 18 ? -2.747  10.358  6.180   1.00 0.00 ? 18 LYS A HD3  11 
ATOM   9335  H HE2  . LYS A 1 18 ? -2.944  7.954   7.840   1.00 0.00 ? 18 LYS A HE2  11 
ATOM   9336  H HE3  . LYS A 1 18 ? -1.347  8.072   7.128   1.00 0.00 ? 18 LYS A HE3  11 
ATOM   9337  H HZ1  . LYS A 1 18 ? -1.676  10.552  7.887   1.00 0.00 ? 18 LYS A HZ1  11 
ATOM   9338  H HZ2  . LYS A 1 18 ? -2.640  9.844   9.000   1.00 0.00 ? 18 LYS A HZ2  11 
ATOM   9339  N N    . ASN A 1 19 ? -4.757  9.845   1.186   1.00 0.00 ? 19 ASN A N    11 
ATOM   9340  C CA   . ASN A 1 19 ? -5.421  9.722   -0.101  1.00 0.00 ? 19 ASN A CA   11 
ATOM   9341  C C    . ASN A 1 19 ? -4.660  8.718   -0.969  1.00 0.00 ? 19 ASN A C    11 
ATOM   9342  O O    . ASN A 1 19 ? -4.847  8.675   -2.184  1.00 0.00 ? 19 ASN A O    11 
ATOM   9343  C CB   . ASN A 1 19 ? -5.443  11.062  -0.839  1.00 0.00 ? 19 ASN A CB   11 
ATOM   9344  C CG   . ASN A 1 19 ? -6.697  11.864  -0.482  1.00 0.00 ? 19 ASN A CG   11 
ATOM   9345  O OD1  . ASN A 1 19 ? -7.783  11.622  -0.982  1.00 0.00 ? 19 ASN A OD1  11 
ATOM   9346  N ND2  . ASN A 1 19 ? -6.486  12.829  0.408   1.00 0.00 ? 19 ASN A ND2  11 
ATOM   9347  H H    . ASN A 1 19 ? -3.874  10.312  1.163   1.00 0.00 ? 19 ASN A H    11 
ATOM   9348  H HA   . ASN A 1 19 ? -6.434  9.392   0.129   1.00 0.00 ? 19 ASN A HA   11 
ATOM   9349  H HB2  . ASN A 1 19 ? -4.554  11.638  -0.582  1.00 0.00 ? 19 ASN A HB2  11 
ATOM   9350  H HB3  . ASN A 1 19 ? -5.412  10.890  -1.915  1.00 0.00 ? 19 ASN A HB3  11 
ATOM   9351  H HD21 . ASN A 1 19 ? -5.570  12.975  0.780   1.00 0.00 ? 19 ASN A HD21 11 
ATOM   9352  H HD22 . ASN A 1 19 ? -7.245  13.409  0.706   1.00 0.00 ? 19 ASN A HD22 11 
ATOM   9353  N N    . LEU A 1 20 ? -3.818  7.934   -0.311  1.00 0.00 ? 20 LEU A N    11 
ATOM   9354  C CA   . LEU A 1 20 ? -3.028  6.933   -1.007  1.00 0.00 ? 20 LEU A CA   11 
ATOM   9355  C C    . LEU A 1 20 ? -3.082  5.616   -0.230  1.00 0.00 ? 20 LEU A C    11 
ATOM   9356  O O    . LEU A 1 20 ? -2.886  5.600   0.985   1.00 0.00 ? 20 LEU A O    11 
ATOM   9357  C CB   . LEU A 1 20 ? -1.607  7.445   -1.251  1.00 0.00 ? 20 LEU A CB   11 
ATOM   9358  C CG   . LEU A 1 20 ? -1.461  8.539   -2.311  1.00 0.00 ? 20 LEU A CG   11 
ATOM   9359  C CD1  . LEU A 1 20 ? 0.010   8.896   -2.531  1.00 0.00 ? 20 LEU A CD1  11 
ATOM   9360  C CD2  . LEU A 1 20 ? -2.154  8.135   -3.614  1.00 0.00 ? 20 LEU A CD2  11 
ATOM   9361  H H    . LEU A 1 20 ? -3.672  7.976   0.677   1.00 0.00 ? 20 LEU A H    11 
ATOM   9362  H HA   . LEU A 1 20 ? -3.486  6.776   -1.984  1.00 0.00 ? 20 LEU A HA   11 
ATOM   9363  H HB2  . LEU A 1 20 ? -1.213  7.826   -0.309  1.00 0.00 ? 20 LEU A HB2  11 
ATOM   9364  H HB3  . LEU A 1 20 ? -0.982  6.601   -1.540  1.00 0.00 ? 20 LEU A HB3  11 
ATOM   9365  H HG   . LEU A 1 20 ? -1.960  9.437   -1.947  1.00 0.00 ? 20 LEU A HG   11 
ATOM   9366  H HD11 . LEU A 1 20 ? 0.103   9.970   -2.693  1.00 0.00 ? 20 LEU A HD11 11 
ATOM   9367  H HD12 . LEU A 1 20 ? 0.589   8.610   -1.653  1.00 0.00 ? 20 LEU A HD12 11 
ATOM   9368  H HD21 . LEU A 1 20 ? -3.103  8.664   -3.700  1.00 0.00 ? 20 LEU A HD21 11 
ATOM   9369  H HD22 . LEU A 1 20 ? -1.516  8.392   -4.460  1.00 0.00 ? 20 LEU A HD22 11 
ATOM   9370  N N    . CYS A 1 21 ? -3.348  4.544   -0.962  1.00 0.00 ? 21 CYS A N    11 
ATOM   9371  C CA   . CYS A 1 21 ? -3.430  3.226   -0.356  1.00 0.00 ? 21 CYS A CA   11 
ATOM   9372  C C    . CYS A 1 21 ? -2.063  2.552   -0.485  1.00 0.00 ? 21 CYS A C    11 
ATOM   9373  O O    . CYS A 1 21 ? -1.484  2.516   -1.570  1.00 0.00 ? 21 CYS A O    11 
ATOM   9374  C CB   . CYS A 1 21 ? -4.543  2.384   -0.983  1.00 0.00 ? 21 CYS A CB   11 
ATOM   9375  S SG   . CYS A 1 21 ? -6.185  3.189   -1.024  1.00 0.00 ? 21 CYS A SG   11 
ATOM   9376  H H    . CYS A 1 21 ? -3.506  4.566   -1.949  1.00 0.00 ? 21 CYS A H    11 
ATOM   9377  H HA   . CYS A 1 21 ? -3.690  3.379   0.692   1.00 0.00 ? 21 CYS A HA   11 
ATOM   9378  H HB2  . CYS A 1 21 ? -4.254  2.127   -2.002  1.00 0.00 ? 21 CYS A HB2  11 
ATOM   9379  H HB3  . CYS A 1 21 ? -4.627  1.448   -0.430  1.00 0.00 ? 21 CYS A HB3  11 
ATOM   9380  N N    . TYR A 1 22 ? -1.585  2.036   0.638   1.00 0.00 ? 22 TYR A N    11 
ATOM   9381  C CA   . TYR A 1 22 ? -0.296  1.365   0.665   1.00 0.00 ? 22 TYR A CA   11 
ATOM   9382  C C    . TYR A 1 22 ? -0.462  -0.130  0.943   1.00 0.00 ? 22 TYR A C    11 
ATOM   9383  O O    . TYR A 1 22 ? -1.396  -0.537  1.633   1.00 0.00 ? 22 TYR A O    11 
ATOM   9384  C CB   . TYR A 1 22 ? 0.487   2.002   1.814   1.00 0.00 ? 22 TYR A CB   11 
ATOM   9385  C CG   . TYR A 1 22 ? 0.200   1.381   3.182   1.00 0.00 ? 22 TYR A CG   11 
ATOM   9386  C CD1  . TYR A 1 22 ? 0.929   0.291   3.612   1.00 0.00 ? 22 TYR A CD1  11 
ATOM   9387  C CD2  . TYR A 1 22 ? -0.788  1.911   3.987   1.00 0.00 ? 22 TYR A CD2  11 
ATOM   9388  C CE1  . TYR A 1 22 ? 0.659   -0.294  4.900   1.00 0.00 ? 22 TYR A CE1  11 
ATOM   9389  C CE2  . TYR A 1 22 ? -1.058  1.326   5.275   1.00 0.00 ? 22 TYR A CE2  11 
ATOM   9390  C CZ   . TYR A 1 22 ? -0.321  0.253   5.668   1.00 0.00 ? 22 TYR A CZ   11 
ATOM   9391  O OH   . TYR A 1 22 ? -0.576  -0.299  6.884   1.00 0.00 ? 22 TYR A OH   11 
ATOM   9392  H H    . TYR A 1 22 ? -2.062  2.070   1.517   1.00 0.00 ? 22 TYR A H    11 
ATOM   9393  H HA   . TYR A 1 22 ? 0.171   1.496   -0.312  1.00 0.00 ? 22 TYR A HA   11 
ATOM   9394  H HB2  . TYR A 1 22 ? 1.553   1.918   1.604   1.00 0.00 ? 22 TYR A HB2  11 
ATOM   9395  H HB3  . TYR A 1 22 ? 0.254   3.066   1.853   1.00 0.00 ? 22 TYR A HB3  11 
ATOM   9396  H HD1  . TYR A 1 22 ? 1.710   -0.127  2.976   1.00 0.00 ? 22 TYR A HD1  11 
ATOM   9397  H HD2  . TYR A 1 22 ? -1.364  2.772   3.648   1.00 0.00 ? 22 TYR A HD2  11 
ATOM   9398  H HE1  . TYR A 1 22 ? 1.228   -1.155  5.251   1.00 0.00 ? 22 TYR A HE1  11 
ATOM   9399  H HE2  . TYR A 1 22 ? -1.835  1.735   5.921   1.00 0.00 ? 22 TYR A HE2  11 
ATOM   9400  H HH   . TYR A 1 22 ? -1.356  0.158   7.311   1.00 0.00 ? 22 TYR A HH   11 
ATOM   9401  N N    . LYS A 1 23 ? 0.459   -0.908  0.393   1.00 0.00 ? 23 LYS A N    11 
ATOM   9402  C CA   . LYS A 1 23 ? 0.427   -2.349  0.574   1.00 0.00 ? 23 LYS A CA   11 
ATOM   9403  C C    . LYS A 1 23 ? 1.848   -2.859  0.825   1.00 0.00 ? 23 LYS A C    11 
ATOM   9404  O O    . LYS A 1 23 ? 2.746   -2.629  0.016   1.00 0.00 ? 23 LYS A O    11 
ATOM   9405  C CB   . LYS A 1 23 ? -0.268  -3.022  -0.611  1.00 0.00 ? 23 LYS A CB   11 
ATOM   9406  C CG   . LYS A 1 23 ? 0.595   -2.939  -1.872  1.00 0.00 ? 23 LYS A CG   11 
ATOM   9407  C CD   . LYS A 1 23 ? -0.241  -3.201  -3.126  1.00 0.00 ? 23 LYS A CD   11 
ATOM   9408  C CE   . LYS A 1 23 ? 0.504   -4.116  -4.100  1.00 0.00 ? 23 LYS A CE   11 
ATOM   9409  N NZ   . LYS A 1 23 ? -0.401  -4.569  -5.180  1.00 0.00 ? 23 LYS A NZ   11 
ATOM   9410  H H    . LYS A 1 23 ? 1.216   -0.569  -0.166  1.00 0.00 ? 23 LYS A H    11 
ATOM   9411  H HA   . LYS A 1 23 ? -0.175  -2.554  1.460   1.00 0.00 ? 23 LYS A HA   11 
ATOM   9412  H HB2  . LYS A 1 23 ? -0.471  -4.067  -0.373  1.00 0.00 ? 23 LYS A HB2  11 
ATOM   9413  H HB3  . LYS A 1 23 ? -1.230  -2.544  -0.792  1.00 0.00 ? 23 LYS A HB3  11 
ATOM   9414  H HG2  . LYS A 1 23 ? 1.056   -1.953  -1.937  1.00 0.00 ? 23 LYS A HG2  11 
ATOM   9415  H HG3  . LYS A 1 23 ? 1.405   -3.666  -1.812  1.00 0.00 ? 23 LYS A HG3  11 
ATOM   9416  H HD2  . LYS A 1 23 ? -1.191  -3.657  -2.846  1.00 0.00 ? 23 LYS A HD2  11 
ATOM   9417  H HD3  . LYS A 1 23 ? -0.474  -2.255  -3.616  1.00 0.00 ? 23 LYS A HD3  11 
ATOM   9418  H HE2  . LYS A 1 23 ? 1.354   -3.586  -4.528  1.00 0.00 ? 23 LYS A HE2  11 
ATOM   9419  H HE3  . LYS A 1 23 ? 0.902   -4.978  -3.566  1.00 0.00 ? 23 LYS A HE3  11 
ATOM   9420  H HZ1  . LYS A 1 23 ? -1.077  -3.856  -5.370  1.00 0.00 ? 23 LYS A HZ1  11 
ATOM   9421  H HZ2  . LYS A 1 23 ? 0.132   -4.751  -6.007  1.00 0.00 ? 23 LYS A HZ2  11 
ATOM   9422  N N    . MET A 1 24 ? 2.007   -3.542  1.949   1.00 0.00 ? 24 MET A N    11 
ATOM   9423  C CA   . MET A 1 24 ? 3.303   -4.087  2.316   1.00 0.00 ? 24 MET A CA   11 
ATOM   9424  C C    . MET A 1 24 ? 3.362   -5.592  2.046   1.00 0.00 ? 24 MET A C    11 
ATOM   9425  O O    . MET A 1 24 ? 2.542   -6.351  2.559   1.00 0.00 ? 24 MET A O    11 
ATOM   9426  C CB   . MET A 1 24 ? 3.565   -3.824  3.801   1.00 0.00 ? 24 MET A CB   11 
ATOM   9427  C CG   . MET A 1 24 ? 3.681   -2.324  4.080   1.00 0.00 ? 24 MET A CG   11 
ATOM   9428  S SD   . MET A 1 24 ? 3.841   -2.040  5.835   1.00 0.00 ? 24 MET A SD   11 
ATOM   9429  C CE   . MET A 1 24 ? 4.506   -0.384  5.821   1.00 0.00 ? 24 MET A CE   11 
ATOM   9430  H H    . MET A 1 24 ? 1.272   -3.725  2.601   1.00 0.00 ? 24 MET A H    11 
ATOM   9431  H HA   . MET A 1 24 ? 4.027   -3.569  1.687   1.00 0.00 ? 24 MET A HA   11 
ATOM   9432  H HB2  . MET A 1 24 ? 2.757   -4.247  4.397   1.00 0.00 ? 24 MET A HB2  11 
ATOM   9433  H HB3  . MET A 1 24 ? 4.483   -4.326  4.106   1.00 0.00 ? 24 MET A HB3  11 
ATOM   9434  H HG2  . MET A 1 24 ? 4.545   -1.914  3.557   1.00 0.00 ? 24 MET A HG2  11 
ATOM   9435  H HG3  . MET A 1 24 ? 2.802   -1.806  3.697   1.00 0.00 ? 24 MET A HG3  11 
ATOM   9436  H HE1  . MET A 1 24 ? 3.817   0.289   6.332   1.00 0.00 ? 24 MET A HE1  11 
ATOM   9437  H HE2  . MET A 1 24 ? 5.469   -0.375  6.333   1.00 0.00 ? 24 MET A HE2  11 
ATOM   9438  N N    . PHE A 1 25 ? 4.341   -5.978  1.240   1.00 0.00 ? 25 PHE A N    11 
ATOM   9439  C CA   . PHE A 1 25 ? 4.518   -7.378  0.895   1.00 0.00 ? 25 PHE A CA   11 
ATOM   9440  C C    . PHE A 1 25 ? 5.998   -7.766  0.921   1.00 0.00 ? 25 PHE A C    11 
ATOM   9441  O O    . PHE A 1 25 ? 6.870   -6.899  0.926   1.00 0.00 ? 25 PHE A O    11 
ATOM   9442  C CB   . PHE A 1 25 ? 3.980   -7.560  -0.525  1.00 0.00 ? 25 PHE A CB   11 
ATOM   9443  C CG   . PHE A 1 25 ? 4.646   -6.657  -1.564  1.00 0.00 ? 25 PHE A CG   11 
ATOM   9444  C CD1  . PHE A 1 25 ? 5.931   -6.891  -1.945  1.00 0.00 ? 25 PHE A CD1  11 
ATOM   9445  C CD2  . PHE A 1 25 ? 3.955   -5.619  -2.107  1.00 0.00 ? 25 PHE A CD2  11 
ATOM   9446  C CE1  . PHE A 1 25 ? 6.549   -6.052  -2.909  1.00 0.00 ? 25 PHE A CE1  11 
ATOM   9447  C CE2  . PHE A 1 25 ? 4.573   -4.780  -3.071  1.00 0.00 ? 25 PHE A CE2  11 
ATOM   9448  C CZ   . PHE A 1 25 ? 5.858   -5.014  -3.452  1.00 0.00 ? 25 PHE A CZ   11 
ATOM   9449  H H    . PHE A 1 25 ? 5.004   -5.353  0.827   1.00 0.00 ? 25 PHE A H    11 
ATOM   9450  H HA   . PHE A 1 25 ? 3.977   -7.965  1.638   1.00 0.00 ? 25 PHE A HA   11 
ATOM   9451  H HB2  . PHE A 1 25 ? 4.114   -8.600  -0.823  1.00 0.00 ? 25 PHE A HB2  11 
ATOM   9452  H HB3  . PHE A 1 25 ? 2.907   -7.365  -0.524  1.00 0.00 ? 25 PHE A HB3  11 
ATOM   9453  H HD1  . PHE A 1 25 ? 6.485   -7.722  -1.510  1.00 0.00 ? 25 PHE A HD1  11 
ATOM   9454  H HD2  . PHE A 1 25 ? 2.925   -5.431  -1.802  1.00 0.00 ? 25 PHE A HD2  11 
ATOM   9455  H HE1  . PHE A 1 25 ? 7.579   -6.240  -3.215  1.00 0.00 ? 25 PHE A HE1  11 
ATOM   9456  H HE2  . PHE A 1 25 ? 4.019   -3.948  -3.506  1.00 0.00 ? 25 PHE A HE2  11 
ATOM   9457  H HZ   . PHE A 1 25 ? 6.333   -4.371  -4.192  1.00 0.00 ? 25 PHE A HZ   11 
ATOM   9458  N N    . MET A 1 26 ? 6.234   -9.070  0.937   1.00 0.00 ? 26 MET A N    11 
ATOM   9459  C CA   . MET A 1 26 ? 7.593   -9.583  0.962   1.00 0.00 ? 26 MET A CA   11 
ATOM   9460  C C    . MET A 1 26 ? 8.048   -9.999  -0.439  1.00 0.00 ? 26 MET A C    11 
ATOM   9461  O O    . MET A 1 26 ? 7.226   -10.345 -1.285  1.00 0.00 ? 26 MET A O    11 
ATOM   9462  C CB   . MET A 1 26 ? 7.666   -10.789 1.901   1.00 0.00 ? 26 MET A CB   11 
ATOM   9463  C CG   . MET A 1 26 ? 7.544   -10.353 3.363   1.00 0.00 ? 26 MET A CG   11 
ATOM   9464  S SD   . MET A 1 26 ? 6.221   -11.249 4.158   1.00 0.00 ? 26 MET A SD   11 
ATOM   9465  C CE   . MET A 1 26 ? 6.946   -11.507 5.769   1.00 0.00 ? 26 MET A CE   11 
ATOM   9466  H H    . MET A 1 26 ? 5.519   -9.768  0.933   1.00 0.00 ? 26 MET A H    11 
ATOM   9467  H HA   . MET A 1 26 ? 8.210   -8.761  1.323   1.00 0.00 ? 26 MET A HA   11 
ATOM   9468  H HB2  . MET A 1 26 ? 6.869   -11.492 1.659   1.00 0.00 ? 26 MET A HB2  11 
ATOM   9469  H HB3  . MET A 1 26 ? 8.610   -11.314 1.752   1.00 0.00 ? 26 MET A HB3  11 
ATOM   9470  H HG2  . MET A 1 26 ? 8.483   -10.536 3.885   1.00 0.00 ? 26 MET A HG2  11 
ATOM   9471  H HG3  . MET A 1 26 ? 7.353   -9.281  3.417   1.00 0.00 ? 26 MET A HG3  11 
ATOM   9472  H HE1  . MET A 1 26 ? 7.686   -10.731 5.963   1.00 0.00 ? 26 MET A HE1  11 
ATOM   9473  H HE2  . MET A 1 26 ? 6.166   -11.464 6.529   1.00 0.00 ? 26 MET A HE2  11 
ATOM   9474  N N    . VAL A 1 27 ? 9.357   -9.950  -0.640  1.00 0.00 ? 27 VAL A N    11 
ATOM   9475  C CA   . VAL A 1 27 ? 9.931   -10.317 -1.923  1.00 0.00 ? 27 VAL A CA   11 
ATOM   9476  C C    . VAL A 1 27 ? 9.566   -11.768 -2.244  1.00 0.00 ? 27 VAL A C    11 
ATOM   9477  O O    . VAL A 1 27 ? 9.714   -12.211 -3.382  1.00 0.00 ? 27 VAL A O    11 
ATOM   9478  C CB   . VAL A 1 27 ? 11.441  -10.069 -1.911  1.00 0.00 ? 27 VAL A CB   11 
ATOM   9479  C CG1  . VAL A 1 27 ? 12.150  -11.052 -0.978  1.00 0.00 ? 27 VAL A CG1  11 
ATOM   9480  C CG2  . VAL A 1 27 ? 12.020  -10.140 -3.325  1.00 0.00 ? 27 VAL A CG2  11 
ATOM   9481  H H    . VAL A 1 27 ? 10.019  -9.667  0.054   1.00 0.00 ? 27 VAL A H    11 
ATOM   9482  H HA   . VAL A 1 27 ? 9.489   -9.668  -2.679  1.00 0.00 ? 27 VAL A HA   11 
ATOM   9483  H HB   . VAL A 1 27 ? 11.612  -9.062  -1.530  1.00 0.00 ? 27 VAL A HB   11 
ATOM   9484  H HG11 . VAL A 1 27 ? 13.225  -11.012 -1.157  1.00 0.00 ? 27 VAL A HG11 11 
ATOM   9485  H HG12 . VAL A 1 27 ? 11.945  -10.782 0.058   1.00 0.00 ? 27 VAL A HG12 11 
ATOM   9486  H HG21 . VAL A 1 27 ? 12.525  -11.097 -3.463  1.00 0.00 ? 27 VAL A HG21 11 
ATOM   9487  H HG22 . VAL A 1 27 ? 11.213  -10.047 -4.053  1.00 0.00 ? 27 VAL A HG22 11 
ATOM   9488  N N    . ALA A 1 28 ? 9.097   -12.466 -1.221  1.00 0.00 ? 28 ALA A N    11 
ATOM   9489  C CA   . ALA A 1 28 ? 8.709   -13.858 -1.380  1.00 0.00 ? 28 ALA A CA   11 
ATOM   9490  C C    . ALA A 1 28 ? 8.046   -14.045 -2.746  1.00 0.00 ? 28 ALA A C    11 
ATOM   9491  O O    . ALA A 1 28 ? 8.312   -15.026 -3.440  1.00 0.00 ? 28 ALA A O    11 
ATOM   9492  C CB   . ALA A 1 28 ? 7.793   -14.268 -0.226  1.00 0.00 ? 28 ALA A CB   11 
ATOM   9493  H H    . ALA A 1 28 ? 8.979   -12.098 -0.299  1.00 0.00 ? 28 ALA A H    11 
ATOM   9494  H HA   . ALA A 1 28 ? 9.616   -14.461 -1.340  1.00 0.00 ? 28 ALA A HA   11 
ATOM   9495  H HB1  . ALA A 1 28 ? 8.179   -15.174 0.241   1.00 0.00 ? 28 ALA A HB1  11 
ATOM   9496  H HB2  . ALA A 1 28 ? 7.756   -13.466 0.512   1.00 0.00 ? 28 ALA A HB2  11 
ATOM   9497  N N    . ALA A 1 29 ? 7.195   -13.090 -3.091  1.00 0.00 ? 29 ALA A N    11 
ATOM   9498  C CA   . ALA A 1 29 ? 6.492   -13.138 -4.362  1.00 0.00 ? 29 ALA A CA   11 
ATOM   9499  C C    . ALA A 1 29 ? 6.081   -11.720 -4.766  1.00 0.00 ? 29 ALA A C    11 
ATOM   9500  O O    . ALA A 1 29 ? 5.857   -10.867 -3.908  1.00 0.00 ? 29 ALA A O    11 
ATOM   9501  C CB   . ALA A 1 29 ? 5.294   -14.082 -4.247  1.00 0.00 ? 29 ALA A CB   11 
ATOM   9502  H H    . ALA A 1 29 ? 6.985   -12.296 -2.521  1.00 0.00 ? 29 ALA A H    11 
ATOM   9503  H HA   . ALA A 1 29 ? 7.181   -13.534 -5.108  1.00 0.00 ? 29 ALA A HA   11 
ATOM   9504  H HB1  . ALA A 1 29 ? 5.610   -15.100 -4.475  1.00 0.00 ? 29 ALA A HB1  11 
ATOM   9505  H HB2  . ALA A 1 29 ? 4.897   -14.044 -3.233  1.00 0.00 ? 29 ALA A HB2  11 
ATOM   9506  N N    . PRO A 1 30 ? 5.992   -11.508 -6.106  1.00 0.00 ? 30 PRO A N    11 
ATOM   9507  C CA   . PRO A 1 30 ? 5.611   -10.209 -6.634  1.00 0.00 ? 30 PRO A CA   11 
ATOM   9508  C C    . PRO A 1 30 ? 4.111   -9.964  -6.460  1.00 0.00 ? 30 PRO A C    11 
ATOM   9509  O O    . PRO A 1 30 ? 3.622   -8.868  -6.728  1.00 0.00 ? 30 PRO A O    11 
ATOM   9510  C CB   . PRO A 1 30 ? 6.044   -10.234 -8.091  1.00 0.00 ? 30 PRO A CB   11 
ATOM   9511  C CG   . PRO A 1 30 ? 6.226   -11.700 -8.446  1.00 0.00 ? 30 PRO A CG   11 
ATOM   9512  C CD   . PRO A 1 30 ? 6.250   -12.495 -7.150  1.00 0.00 ? 30 PRO A CD   11 
ATOM   9513  H HA   . PRO A 1 30 ? 6.068   -9.480  -6.124  1.00 0.00 ? 30 PRO A HA   11 
ATOM   9514  H HB2  . PRO A 1 30 ? 5.294   -9.767  -8.729  1.00 0.00 ? 30 PRO A HB2  11 
ATOM   9515  H HB3  . PRO A 1 30 ? 6.972   -9.680  -8.232  1.00 0.00 ? 30 PRO A HB3  11 
ATOM   9516  H HG2  . PRO A 1 30 ? 5.414   -12.041 -9.088  1.00 0.00 ? 30 PRO A HG2  11 
ATOM   9517  H HG3  . PRO A 1 30 ? 7.153   -11.847 -9.001  1.00 0.00 ? 30 PRO A HG3  11 
ATOM   9518  H HD2  . PRO A 1 30 ? 5.491   -13.277 -7.152  1.00 0.00 ? 30 PRO A HD2  11 
ATOM   9519  H HD3  . PRO A 1 30 ? 7.212   -12.984 -7.004  1.00 0.00 ? 30 PRO A HD3  11 
ATOM   9520  N N    . HIS A 1 31 ? 3.422   -11.004 -6.013  1.00 0.00 ? 31 HIS A N    11 
ATOM   9521  C CA   . HIS A 1 31 ? 1.987   -10.916 -5.801  1.00 0.00 ? 31 HIS A CA   11 
ATOM   9522  C C    . HIS A 1 31 ? 1.602   -11.721 -4.558  1.00 0.00 ? 31 HIS A C    11 
ATOM   9523  O O    . HIS A 1 31 ? 0.902   -12.727 -4.658  1.00 0.00 ? 31 HIS A O    11 
ATOM   9524  C CB   . HIS A 1 31 ? 1.225   -11.356 -7.052  1.00 0.00 ? 31 HIS A CB   11 
ATOM   9525  C CG   . HIS A 1 31 ? -0.079  -10.625 -7.266  1.00 0.00 ? 31 HIS A CG   11 
ATOM   9526  N ND1  . HIS A 1 31 ? -1.240  -11.263 -7.663  1.00 0.00 ? 31 HIS A ND1  11 
ATOM   9527  C CD2  . HIS A 1 31 ? -0.391  -9.304  -7.133  1.00 0.00 ? 31 HIS A CD2  11 
ATOM   9528  C CE1  . HIS A 1 31 ? -2.202  -10.358 -7.763  1.00 0.00 ? 31 HIS A CE1  11 
ATOM   9529  N NE2  . HIS A 1 31 ? -1.674  -9.144  -7.435  1.00 0.00 ? 31 HIS A NE2  11 
ATOM   9530  H H    . HIS A 1 31 ? 3.828   -11.893 -5.798  1.00 0.00 ? 31 HIS A H    11 
ATOM   9531  H HA   . HIS A 1 31 ? 1.761   -9.864  -5.627  1.00 0.00 ? 31 HIS A HA   11 
ATOM   9532  H HB2  . HIS A 1 31 ? 1.861   -11.207 -7.924  1.00 0.00 ? 31 HIS A HB2  11 
ATOM   9533  H HB3  . HIS A 1 31 ? 1.023   -12.425 -6.984  1.00 0.00 ? 31 HIS A HB3  11 
ATOM   9534  H HD1  . HIS A 1 31 ? -1.337  -12.242 -7.844  1.00 0.00 ? 31 HIS A HD1  11 
ATOM   9535  H HD2  . HIS A 1 31 ? 0.296   -8.514  -6.831  1.00 0.00 ? 31 HIS A HD2  11 
ATOM   9536  H HE1  . HIS A 1 31 ? -3.235  -10.549 -8.055  1.00 0.00 ? 31 HIS A HE1  11 
ATOM   9537  N N    . VAL A 1 32 ? 2.077   -11.247 -3.415  1.00 0.00 ? 32 VAL A N    11 
ATOM   9538  C CA   . VAL A 1 32 ? 1.792   -11.910 -2.154  1.00 0.00 ? 32 VAL A CA   11 
ATOM   9539  C C    . VAL A 1 32 ? 1.896   -10.895 -1.014  1.00 0.00 ? 32 VAL A C    11 
ATOM   9540  O O    . VAL A 1 32 ? 2.936   -10.790 -0.365  1.00 0.00 ? 32 VAL A O    11 
ATOM   9541  C CB   . VAL A 1 32 ? 2.722   -13.111 -1.972  1.00 0.00 ? 32 VAL A CB   11 
ATOM   9542  C CG1  . VAL A 1 32 ? 2.630   -13.665 -0.548  1.00 0.00 ? 32 VAL A CG1  11 
ATOM   9543  C CG2  . VAL A 1 32 ? 2.420   -14.200 -3.004  1.00 0.00 ? 32 VAL A CG2  11 
ATOM   9544  H H    . VAL A 1 32 ? 2.646   -10.428 -3.343  1.00 0.00 ? 32 VAL A H    11 
ATOM   9545  H HA   . VAL A 1 32 ? 0.768   -12.280 -2.202  1.00 0.00 ? 32 VAL A HA   11 
ATOM   9546  H HB   . VAL A 1 32 ? 3.744   -12.771 -2.134  1.00 0.00 ? 32 VAL A HB   11 
ATOM   9547  H HG11 . VAL A 1 32 ? 2.770   -14.746 -0.569  1.00 0.00 ? 32 VAL A HG11 11 
ATOM   9548  H HG12 . VAL A 1 32 ? 3.404   -13.210 0.069   1.00 0.00 ? 32 VAL A HG12 11 
ATOM   9549  H HG21 . VAL A 1 32 ? 1.347   -14.388 -3.030  1.00 0.00 ? 32 VAL A HG21 11 
ATOM   9550  H HG22 . VAL A 1 32 ? 2.755   -13.871 -3.988  1.00 0.00 ? 32 VAL A HG22 11 
ATOM   9551  N N    . PRO A 1 33 ? 0.776   -10.154 -0.800  1.00 0.00 ? 33 PRO A N    11 
ATOM   9552  C CA   . PRO A 1 33 ? 0.732   -9.151  0.251   1.00 0.00 ? 33 PRO A CA   11 
ATOM   9553  C C    . PRO A 1 33 ? 0.605   -9.805  1.628   1.00 0.00 ? 33 PRO A C    11 
ATOM   9554  O O    . PRO A 1 33 ? 0.008   -10.873 1.760   1.00 0.00 ? 33 PRO A O    11 
ATOM   9555  C CB   . PRO A 1 33 ? -0.455  -8.268  -0.099  1.00 0.00 ? 33 PRO A CB   11 
ATOM   9556  C CG   . PRO A 1 33 ? -1.307  -9.076  -1.064  1.00 0.00 ? 33 PRO A CG   11 
ATOM   9557  C CD   . PRO A 1 33 ? -0.474  -10.252 -1.549  1.00 0.00 ? 33 PRO A CD   11 
ATOM   9558  H HA   . PRO A 1 33 ? 1.586   -8.633  0.272   1.00 0.00 ? 33 PRO A HA   11 
ATOM   9559  H HB2  . PRO A 1 33 ? -1.021  -8.003  0.794   1.00 0.00 ? 33 PRO A HB2  11 
ATOM   9560  H HB3  . PRO A 1 33 ? -0.126  -7.334  -0.556  1.00 0.00 ? 33 PRO A HB3  11 
ATOM   9561  H HG2  . PRO A 1 33 ? -2.213  -9.428  -0.571  1.00 0.00 ? 33 PRO A HG2  11 
ATOM   9562  H HG3  . PRO A 1 33 ? -1.621  -8.458  -1.905  1.00 0.00 ? 33 PRO A HG3  11 
ATOM   9563  H HD2  . PRO A 1 33 ? -0.977  -11.199 -1.357  1.00 0.00 ? 33 PRO A HD2  11 
ATOM   9564  H HD3  . PRO A 1 33 ? -0.297  -10.196 -2.623  1.00 0.00 ? 33 PRO A HD3  11 
ATOM   9565  N N    . VAL A 1 34 ? 1.175   -9.137  2.620   1.00 0.00 ? 34 VAL A N    11 
ATOM   9566  C CA   . VAL A 1 34 ? 1.134   -9.639  3.982   1.00 0.00 ? 34 VAL A CA   11 
ATOM   9567  C C    . VAL A 1 34 ? 0.184   -8.773  4.812   1.00 0.00 ? 34 VAL A C    11 
ATOM   9568  O O    . VAL A 1 34 ? -0.490  -9.272  5.713   1.00 0.00 ? 34 VAL A O    11 
ATOM   9569  C CB   . VAL A 1 34 ? 2.549   -9.699  4.562   1.00 0.00 ? 34 VAL A CB   11 
ATOM   9570  C CG1  . VAL A 1 34 ? 3.197   -8.313  4.567   1.00 0.00 ? 34 VAL A CG1  11 
ATOM   9571  C CG2  . VAL A 1 34 ? 2.541   -10.306 5.966   1.00 0.00 ? 34 VAL A CG2  11 
ATOM   9572  H H    . VAL A 1 34 ? 1.659   -8.269  2.504   1.00 0.00 ? 34 VAL A H    11 
ATOM   9573  H HA   . VAL A 1 34 ? 0.741   -10.655 3.946   1.00 0.00 ? 34 VAL A HA   11 
ATOM   9574  H HB   . VAL A 1 34 ? 3.147   -10.346 3.920   1.00 0.00 ? 34 VAL A HB   11 
ATOM   9575  H HG11 . VAL A 1 34 ? 3.674   -8.131  3.604   1.00 0.00 ? 34 VAL A HG11 11 
ATOM   9576  H HG12 . VAL A 1 34 ? 2.434   -7.555  4.744   1.00 0.00 ? 34 VAL A HG12 11 
ATOM   9577  H HG21 . VAL A 1 34 ? 2.346   -9.524  6.699   1.00 0.00 ? 34 VAL A HG21 11 
ATOM   9578  H HG22 . VAL A 1 34 ? 1.761   -11.066 6.029   1.00 0.00 ? 34 VAL A HG22 11 
ATOM   9579  N N    . LYS A 1 35 ? 0.160   -7.491  4.479   1.00 0.00 ? 35 LYS A N    11 
ATOM   9580  C CA   . LYS A 1 35 ? -0.696  -6.551  5.182   1.00 0.00 ? 35 LYS A CA   11 
ATOM   9581  C C    . LYS A 1 35 ? -0.977  -5.349  4.278   1.00 0.00 ? 35 LYS A C    11 
ATOM   9582  O O    . LYS A 1 35 ? -0.368  -5.209  3.219   1.00 0.00 ? 35 LYS A O    11 
ATOM   9583  C CB   . LYS A 1 35 ? -0.084  -6.175  6.532   1.00 0.00 ? 35 LYS A CB   11 
ATOM   9584  C CG   . LYS A 1 35 ? -0.788  -6.906  7.677   1.00 0.00 ? 35 LYS A CG   11 
ATOM   9585  C CD   . LYS A 1 35 ? -0.229  -6.470  9.033   1.00 0.00 ? 35 LYS A CD   11 
ATOM   9586  C CE   . LYS A 1 35 ? -0.269  -7.622  10.039  1.00 0.00 ? 35 LYS A CE   11 
ATOM   9587  N NZ   . LYS A 1 35 ? 0.971   -7.649  10.845  1.00 0.00 ? 35 LYS A NZ   11 
ATOM   9588  H H    . LYS A 1 35 ? 0.711   -7.094  3.745   1.00 0.00 ? 35 LYS A H    11 
ATOM   9589  H HA   . LYS A 1 35 ? -1.640  -7.057  5.386   1.00 0.00 ? 35 LYS A HA   11 
ATOM   9590  H HB2  . LYS A 1 35 ? 0.978   -6.423  6.537   1.00 0.00 ? 35 LYS A HB2  11 
ATOM   9591  H HB3  . LYS A 1 35 ? -0.159  -5.098  6.683   1.00 0.00 ? 35 LYS A HB3  11 
ATOM   9592  H HG2  . LYS A 1 35 ? -1.858  -6.703  7.638   1.00 0.00 ? 35 LYS A HG2  11 
ATOM   9593  H HG3  . LYS A 1 35 ? -0.663  -7.982  7.557   1.00 0.00 ? 35 LYS A HG3  11 
ATOM   9594  H HD2  . LYS A 1 35 ? 0.797   -6.123  8.912   1.00 0.00 ? 35 LYS A HD2  11 
ATOM   9595  H HD3  . LYS A 1 35 ? -0.807  -5.628  9.415   1.00 0.00 ? 35 LYS A HD3  11 
ATOM   9596  H HE2  . LYS A 1 35 ? -1.133  -7.510  10.694  1.00 0.00 ? 35 LYS A HE2  11 
ATOM   9597  H HE3  . LYS A 1 35 ? -0.389  -8.568  9.512   1.00 0.00 ? 35 LYS A HE3  11 
ATOM   9598  H HZ1  . LYS A 1 35 ? 0.742   -7.553  11.813  1.00 0.00 ? 35 LYS A HZ1  11 
ATOM   9599  H HZ2  . LYS A 1 35 ? 1.444   -8.518  10.699  1.00 0.00 ? 35 LYS A HZ2  11 
ATOM   9600  N N    . ARG A 1 36 ? -1.901  -4.485  4.702   1.00 0.00 ? 36 ARG A N    11 
ATOM   9601  C CA   . ARG A 1 36 ? -2.258  -3.308  3.936   1.00 0.00 ? 36 ARG A CA   11 
ATOM   9602  C C    . ARG A 1 36 ? -2.959  -2.300  4.835   1.00 0.00 ? 36 ARG A C    11 
ATOM   9603  O O    . ARG A 1 36 ? -3.383  -2.639  5.938   1.00 0.00 ? 36 ARG A O    11 
ATOM   9604  C CB   . ARG A 1 36 ? -3.159  -3.713  2.773   1.00 0.00 ? 36 ARG A CB   11 
ATOM   9605  C CG   . ARG A 1 36 ? -2.421  -4.705  1.878   1.00 0.00 ? 36 ARG A CG   11 
ATOM   9606  C CD   . ARG A 1 36 ? -3.231  -4.946  0.608   1.00 0.00 ? 36 ARG A CD   11 
ATOM   9607  N NE   . ARG A 1 36 ? -4.501  -5.606  0.912   1.00 0.00 ? 36 ARG A NE   11 
ATOM   9608  C CZ   . ARG A 1 36 ? -4.611  -6.932  1.065   1.00 0.00 ? 36 ARG A CZ   11 
ATOM   9609  N NH1  . ARG A 1 36 ? -3.529  -7.713  0.941   1.00 0.00 ? 36 ARG A NH1  11 
ATOM   9610  N NH2  . ARG A 1 36 ? -5.803  -7.479  1.342   1.00 0.00 ? 36 ARG A NH2  11 
ATOM   9611  H H    . ARG A 1 36 ? -2.373  -4.647  5.580   1.00 0.00 ? 36 ARG A H    11 
ATOM   9612  H HA   . ARG A 1 36 ? -1.350  -2.855  3.538   1.00 0.00 ? 36 ARG A HA   11 
ATOM   9613  H HB2  . ARG A 1 36 ? -4.066  -4.178  3.160   1.00 0.00 ? 36 ARG A HB2  11 
ATOM   9614  H HB3  . ARG A 1 36 ? -3.424  -2.829  2.193   1.00 0.00 ? 36 ARG A HB3  11 
ATOM   9615  H HG2  . ARG A 1 36 ? -1.444  -4.298  1.615   1.00 0.00 ? 36 ARG A HG2  11 
ATOM   9616  H HG3  . ARG A 1 36 ? -2.290  -5.647  2.410   1.00 0.00 ? 36 ARG A HG3  11 
ATOM   9617  H HD2  . ARG A 1 36 ? -3.432  -3.989  0.125   1.00 0.00 ? 36 ARG A HD2  11 
ATOM   9618  H HD3  . ARG A 1 36 ? -2.654  -5.575  -0.070  1.00 0.00 ? 36 ARG A HD3  11 
ATOM   9619  H HE   . ARG A 1 36 ? -5.322  -5.026  1.008   1.00 0.00 ? 36 ARG A HE   11 
ATOM   9620  H HH11 . ARG A 1 36 ? -2.630  -7.302  0.732   1.00 0.00 ? 36 ARG A HH11 11 
ATOM   9621  H HH12 . ARG A 1 36 ? -3.612  -8.713  1.056   1.00 0.00 ? 36 ARG A HH12 11 
ATOM   9622  H HH21 . ARG A 1 36 ? -6.618  -6.891  1.436   1.00 0.00 ? 36 ARG A HH21 11 
ATOM   9623  H HH22 . ARG A 1 36 ? -5.885  -8.479  1.457   1.00 0.00 ? 36 ARG A HH22 11 
ATOM   9624  N N    . GLY A 1 37 ? -3.063  -1.078  4.334   1.00 0.00 ? 37 GLY A N    11 
ATOM   9625  C CA   . GLY A 1 37 ? -3.710  -0.014  5.083   1.00 0.00 ? 37 GLY A CA   11 
ATOM   9626  C C    . GLY A 1 37 ? -3.723  1.290   4.284   1.00 0.00 ? 37 GLY A C    11 
ATOM   9627  O O    . GLY A 1 37 ? -3.228  1.338   3.159   1.00 0.00 ? 37 GLY A O    11 
ATOM   9628  H H    . GLY A 1 37 ? -2.715  -0.810  3.435   1.00 0.00 ? 37 GLY A H    11 
ATOM   9629  H HA2  . GLY A 1 37 ? -4.731  -0.306  5.328   1.00 0.00 ? 37 GLY A HA2  11 
ATOM   9630  H HA3  . GLY A 1 37 ? -3.187  0.139   6.028   1.00 0.00 ? 37 GLY A HA3  11 
ATOM   9631  N N    . CYS A 1 38 ? -4.296  2.316   4.896   1.00 0.00 ? 38 CYS A N    11 
ATOM   9632  C CA   . CYS A 1 38 ? -4.381  3.618   4.256   1.00 0.00 ? 38 CYS A CA   11 
ATOM   9633  C C    . CYS A 1 38 ? -3.247  4.492   4.793   1.00 0.00 ? 38 CYS A C    11 
ATOM   9634  O O    . CYS A 1 38 ? -2.883  4.393   5.964   1.00 0.00 ? 38 CYS A O    11 
ATOM   9635  C CB   . CYS A 1 38 ? -5.751  4.265   4.469   1.00 0.00 ? 38 CYS A CB   11 
ATOM   9636  S SG   . CYS A 1 38 ? -7.136  3.428   3.614   1.00 0.00 ? 38 CYS A SG   11 
ATOM   9637  H H    . CYS A 1 38 ? -4.697  2.269   5.811   1.00 0.00 ? 38 CYS A H    11 
ATOM   9638  H HA   . CYS A 1 38 ? -4.265  3.448   3.185   1.00 0.00 ? 38 CYS A HA   11 
ATOM   9639  H HB2  . CYS A 1 38 ? -5.963  4.289   5.538   1.00 0.00 ? 38 CYS A HB2  11 
ATOM   9640  H HB3  . CYS A 1 38 ? -5.705  5.300   4.129   1.00 0.00 ? 38 CYS A HB3  11 
ATOM   9641  N N    . ILE A 1 39 ? -2.719  5.329   3.912   1.00 0.00 ? 39 ILE A N    11 
ATOM   9642  C CA   . ILE A 1 39 ? -1.634  6.221   4.283   1.00 0.00 ? 39 ILE A CA   11 
ATOM   9643  C C    . ILE A 1 39 ? -1.652  7.448   3.369   1.00 0.00 ? 39 ILE A C    11 
ATOM   9644  O O    . ILE A 1 39 ? -2.504  7.558   2.489   1.00 0.00 ? 39 ILE A O    11 
ATOM   9645  C CB   . ILE A 1 39 ? -0.300  5.471   4.280   1.00 0.00 ? 39 ILE A CB   11 
ATOM   9646  C CG1  . ILE A 1 39 ? 0.606   5.960   5.412   1.00 0.00 ? 39 ILE A CG1  11 
ATOM   9647  C CG2  . ILE A 1 39 ? 0.383   5.574   2.915   1.00 0.00 ? 39 ILE A CG2  11 
ATOM   9648  C CD1  . ILE A 1 39 ? 0.595   4.977   6.585   1.00 0.00 ? 39 ILE A CD1  11 
ATOM   9649  H H    . ILE A 1 39 ? -3.021  5.404   2.961   1.00 0.00 ? 39 ILE A H    11 
ATOM   9650  H HA   . ILE A 1 39 ? -1.816  6.550   5.306   1.00 0.00 ? 39 ILE A HA   11 
ATOM   9651  H HB   . ILE A 1 39 ? -0.501  4.416   4.461   1.00 0.00 ? 39 ILE A HB   11 
ATOM   9652  H HG12 . ILE A 1 39 ? 1.624   6.079   5.042   1.00 0.00 ? 39 ILE A HG12 11 
ATOM   9653  H HG13 . ILE A 1 39 ? 0.273   6.941   5.751   1.00 0.00 ? 39 ILE A HG13 11 
ATOM   9654  H HG21 . ILE A 1 39 ? 1.368   5.108   2.965   1.00 0.00 ? 39 ILE A HG21 11 
ATOM   9655  H HG22 . ILE A 1 39 ? -0.222  5.062   2.166   1.00 0.00 ? 39 ILE A HG22 11 
ATOM   9656  H HD11 . ILE A 1 39 ? 0.310   3.988   6.228   1.00 0.00 ? 39 ILE A HD11 11 
ATOM   9657  H HD12 . ILE A 1 39 ? 1.589   4.931   7.030   1.00 0.00 ? 39 ILE A HD12 11 
ATOM   9658  N N    . ASP A 1 40 ? -0.708  8.366   3.581   1.00 0.00 ? 40 ASP A N    11 
ATOM   9659  C CA   . ASP A 1 40 ? -0.620  9.572   2.783   1.00 0.00 ? 40 ASP A CA   11 
ATOM   9660  C C    . ASP A 1 40 ? 0.629   9.525   1.914   1.00 0.00 ? 40 ASP A C    11 
ATOM   9661  O O    . ASP A 1 40 ? 0.600   9.943   0.759   1.00 0.00 ? 40 ASP A O    11 
ATOM   9662  C CB   . ASP A 1 40 ? -0.593  10.789  3.703   1.00 0.00 ? 40 ASP A CB   11 
ATOM   9663  C CG   . ASP A 1 40 ? 0.580   10.713  4.671   1.00 0.00 ? 40 ASP A CG   11 
ATOM   9664  O OD1  . ASP A 1 40 ? 1.577   11.421  4.412   1.00 0.00 ? 40 ASP A OD1  11 
ATOM   9665  O OD2  . ASP A 1 40 ? 0.457   9.949   5.653   1.00 0.00 ? 40 ASP A OD2  11 
ATOM   9666  H H    . ASP A 1 40 ? -0.030  8.227   4.318   1.00 0.00 ? 40 ASP A H    11 
ATOM   9667  H HA   . ASP A 1 40 ? -1.497  9.636   2.139   1.00 0.00 ? 40 ASP A HA   11 
ATOM   9668  H HB2  . ASP A 1 40 ? -0.501  11.693  3.100   1.00 0.00 ? 40 ASP A HB2  11 
ATOM   9669  H HB3  . ASP A 1 40 ? -1.523  10.830  4.270   1.00 0.00 ? 40 ASP A HB3  11 
ATOM   9670  H HD2  . ASP A 1 40 ? 1.228   9.945   6.224   1.00 0.00 ? 40 ASP A HD2  11 
ATOM   9671  N N    . VAL A 1 41 ? 1.701   9.012   2.501   1.00 0.00 ? 41 VAL A N    11 
ATOM   9672  C CA   . VAL A 1 41 ? 2.964   8.905   1.789   1.00 0.00 ? 41 VAL A CA   11 
ATOM   9673  C C    . VAL A 1 41 ? 3.458   7.458   1.851   1.00 0.00 ? 41 VAL A C    11 
ATOM   9674  O O    . VAL A 1 41 ? 3.101   6.715   2.764   1.00 0.00 ? 41 VAL A O    11 
ATOM   9675  C CB   . VAL A 1 41 ? 3.971   9.906   2.357   1.00 0.00 ? 41 VAL A CB   11 
ATOM   9676  C CG1  . VAL A 1 41 ? 4.455   9.471   3.742   1.00 0.00 ? 41 VAL A CG1  11 
ATOM   9677  C CG2  . VAL A 1 41 ? 5.149   10.101  1.401   1.00 0.00 ? 41 VAL A CG2  11 
ATOM   9678  H H    . VAL A 1 41 ? 1.717   8.674   3.442   1.00 0.00 ? 41 VAL A H    11 
ATOM   9679  H HA   . VAL A 1 41 ? 2.777   9.167   0.748   1.00 0.00 ? 41 VAL A HA   11 
ATOM   9680  H HB   . VAL A 1 41 ? 3.465   10.866  2.465   1.00 0.00 ? 41 VAL A HB   11 
ATOM   9681  H HG11 . VAL A 1 41 ? 3.793   8.699   4.132   1.00 0.00 ? 41 VAL A HG11 11 
ATOM   9682  H HG12 . VAL A 1 41 ? 5.468   9.077   3.665   1.00 0.00 ? 41 VAL A HG12 11 
ATOM   9683  H HG21 . VAL A 1 41 ? 5.769   10.927  1.751   1.00 0.00 ? 41 VAL A HG21 11 
ATOM   9684  H HG22 . VAL A 1 41 ? 5.745   9.189   1.367   1.00 0.00 ? 41 VAL A HG22 11 
ATOM   9685  N N    . CYS A 1 42 ? 4.273   7.103   0.869   1.00 0.00 ? 42 CYS A N    11 
ATOM   9686  C CA   . CYS A 1 42 ? 4.821   5.758   0.801   1.00 0.00 ? 42 CYS A CA   11 
ATOM   9687  C C    . CYS A 1 42 ? 6.249   5.793   1.349   1.00 0.00 ? 42 CYS A C    11 
ATOM   9688  O O    . CYS A 1 42 ? 7.020   6.695   1.026   1.00 0.00 ? 42 CYS A O    11 
ATOM   9689  C CB   . CYS A 1 42 ? 4.769   5.198   -0.622  1.00 0.00 ? 42 CYS A CB   11 
ATOM   9690  S SG   . CYS A 1 42 ? 4.088   3.505   -0.756  1.00 0.00 ? 42 CYS A SG   11 
ATOM   9691  H H    . CYS A 1 42 ? 4.559   7.713   0.130   1.00 0.00 ? 42 CYS A H    11 
ATOM   9692  H HA   . CYS A 1 42 ? 4.183   5.129   1.421   1.00 0.00 ? 42 CYS A HA   11 
ATOM   9693  H HB2  . CYS A 1 42 ? 4.167   5.866   -1.239  1.00 0.00 ? 42 CYS A HB2  11 
ATOM   9694  H HB3  . CYS A 1 42 ? 5.777   5.203   -1.037  1.00 0.00 ? 42 CYS A HB3  11 
ATOM   9695  N N    . PRO A 1 43 ? 6.566   4.773   2.190   1.00 0.00 ? 43 PRO A N    11 
ATOM   9696  C CA   . PRO A 1 43 ? 7.888   4.678   2.786   1.00 0.00 ? 43 PRO A CA   11 
ATOM   9697  C C    . PRO A 1 43 ? 8.918   4.199   1.762   1.00 0.00 ? 43 PRO A C    11 
ATOM   9698  O O    . PRO A 1 43 ? 8.567   3.874   0.628   1.00 0.00 ? 43 PRO A O    11 
ATOM   9699  C CB   . PRO A 1 43 ? 7.724   3.721   3.956   1.00 0.00 ? 43 PRO A CB   11 
ATOM   9700  C CG   . PRO A 1 43 ? 6.436   2.958   3.694   1.00 0.00 ? 43 PRO A CG   11 
ATOM   9701  C CD   . PRO A 1 43 ? 5.678   3.687   2.596   1.00 0.00 ? 43 PRO A CD   11 
ATOM   9702  H HA   . PRO A 1 43 ? 8.199   5.580   3.086   1.00 0.00 ? 43 PRO A HA   11 
ATOM   9703  H HB2  . PRO A 1 43 ? 8.573   3.042   4.026   1.00 0.00 ? 43 PRO A HB2  11 
ATOM   9704  H HB3  . PRO A 1 43 ? 7.672   4.264   4.900   1.00 0.00 ? 43 PRO A HB3  11 
ATOM   9705  H HG2  . PRO A 1 43 ? 6.654   1.934   3.392   1.00 0.00 ? 43 PRO A HG2  11 
ATOM   9706  H HG3  . PRO A 1 43 ? 5.834   2.903   4.601   1.00 0.00 ? 43 PRO A HG3  11 
ATOM   9707  H HD2  . PRO A 1 43 ? 5.457   3.023   1.760   1.00 0.00 ? 43 PRO A HD2  11 
ATOM   9708  H HD3  . PRO A 1 43 ? 4.725   4.070   2.959   1.00 0.00 ? 43 PRO A HD3  11 
ATOM   9709  N N    . LYS A 1 44 ? 10.169  4.170   2.197   1.00 0.00 ? 44 LYS A N    11 
ATOM   9710  C CA   . LYS A 1 44 ? 11.253  3.736   1.332   1.00 0.00 ? 44 LYS A CA   11 
ATOM   9711  C C    . LYS A 1 44 ? 11.116  2.236   1.064   1.00 0.00 ? 44 LYS A C    11 
ATOM   9712  O O    . LYS A 1 44 ? 10.657  1.488   1.924   1.00 0.00 ? 44 LYS A O    11 
ATOM   9713  C CB   . LYS A 1 44 ? 12.605  4.134   1.927   1.00 0.00 ? 44 LYS A CB   11 
ATOM   9714  C CG   . LYS A 1 44 ? 13.746  3.808   0.961   1.00 0.00 ? 44 LYS A CG   11 
ATOM   9715  C CD   . LYS A 1 44 ? 13.934  4.929   -0.064  1.00 0.00 ? 44 LYS A CD   11 
ATOM   9716  C CE   . LYS A 1 44 ? 13.627  4.434   -1.479  1.00 0.00 ? 44 LYS A CE   11 
ATOM   9717  N NZ   . LYS A 1 44 ? 14.465  5.146   -2.470  1.00 0.00 ? 44 LYS A NZ   11 
ATOM   9718  H H    . LYS A 1 44 ? 10.446  4.436   3.120   1.00 0.00 ? 44 LYS A H    11 
ATOM   9719  H HA   . LYS A 1 44 ? 11.148  4.268   0.386   1.00 0.00 ? 44 LYS A HA   11 
ATOM   9720  H HB2  . LYS A 1 44 ? 12.609  5.200   2.153   1.00 0.00 ? 44 LYS A HB2  11 
ATOM   9721  H HB3  . LYS A 1 44 ? 12.761  3.609   2.869   1.00 0.00 ? 44 LYS A HB3  11 
ATOM   9722  H HG2  . LYS A 1 44 ? 14.671  3.664   1.520   1.00 0.00 ? 44 LYS A HG2  11 
ATOM   9723  H HG3  . LYS A 1 44 ? 13.535  2.871   0.446   1.00 0.00 ? 44 LYS A HG3  11 
ATOM   9724  H HD2  . LYS A 1 44 ? 13.280  5.765   0.182   1.00 0.00 ? 44 LYS A HD2  11 
ATOM   9725  H HD3  . LYS A 1 44 ? 14.957  5.300   -0.019  1.00 0.00 ? 44 LYS A HD3  11 
ATOM   9726  H HE2  . LYS A 1 44 ? 13.809  3.362   -1.544  1.00 0.00 ? 44 LYS A HE2  11 
ATOM   9727  H HE3  . LYS A 1 44 ? 12.572  4.593   -1.706  1.00 0.00 ? 44 LYS A HE3  11 
ATOM   9728  H HZ1  . LYS A 1 44 ? 15.430  5.019   -2.243  1.00 0.00 ? 44 LYS A HZ1  11 
ATOM   9729  H HZ2  . LYS A 1 44 ? 14.286  4.779   -3.383  1.00 0.00 ? 44 LYS A HZ2  11 
ATOM   9730  N N    . SER A 1 45 ? 11.524  1.842   -0.134  1.00 0.00 ? 45 SER A N    11 
ATOM   9731  C CA   . SER A 1 45 ? 11.452  0.445   -0.526  1.00 0.00 ? 45 SER A CA   11 
ATOM   9732  C C    . SER A 1 45 ? 12.838  -0.197  -0.431  1.00 0.00 ? 45 SER A C    11 
ATOM   9733  O O    . SER A 1 45 ? 13.819  0.360   -0.923  1.00 0.00 ? 45 SER A O    11 
ATOM   9734  C CB   . SER A 1 45 ? 10.896  0.299   -1.944  1.00 0.00 ? 45 SER A CB   11 
ATOM   9735  O OG   . SER A 1 45 ? 9.479   0.148   -1.948  1.00 0.00 ? 45 SER A OG   11 
ATOM   9736  H H    . SER A 1 45 ? 11.896  2.458   -0.828  1.00 0.00 ? 45 SER A H    11 
ATOM   9737  H HA   . SER A 1 45 ? 10.767  -0.019  0.182   1.00 0.00 ? 45 SER A HA   11 
ATOM   9738  H HB2  . SER A 1 45 ? 11.169  1.175   -2.533  1.00 0.00 ? 45 SER A HB2  11 
ATOM   9739  H HB3  . SER A 1 45 ? 11.354  -0.565  -2.426  1.00 0.00 ? 45 SER A HB3  11 
ATOM   9740  H HG   . SER A 1 45 ? 9.076   0.676   -1.201  1.00 0.00 ? 45 SER A HG   11 
ATOM   9741  N N    . SER A 1 46 ? 12.875  -1.358  0.205   1.00 0.00 ? 46 SER A N    11 
ATOM   9742  C CA   . SER A 1 46 ? 14.124  -2.081  0.371   1.00 0.00 ? 46 SER A CA   11 
ATOM   9743  C C    . SER A 1 46 ? 14.128  -3.329  -0.514  1.00 0.00 ? 46 SER A C    11 
ATOM   9744  O O    . SER A 1 46 ? 13.113  -3.667  -1.121  1.00 0.00 ? 46 SER A O    11 
ATOM   9745  C CB   . SER A 1 46 ? 14.347  -2.468  1.834   1.00 0.00 ? 46 SER A CB   11 
ATOM   9746  O OG   . SER A 1 46 ? 13.582  -3.611  2.207   1.00 0.00 ? 46 SER A OG   11 
ATOM   9747  H H    . SER A 1 46 ? 12.073  -1.804  0.602   1.00 0.00 ? 46 SER A H    11 
ATOM   9748  H HA   . SER A 1 46 ? 14.904  -1.387  0.056   1.00 0.00 ? 46 SER A HA   11 
ATOM   9749  H HB2  . SER A 1 46 ? 15.405  -2.670  1.999   1.00 0.00 ? 46 SER A HB2  11 
ATOM   9750  H HB3  . SER A 1 46 ? 14.080  -1.628  2.476   1.00 0.00 ? 46 SER A HB3  11 
ATOM   9751  H HG   . SER A 1 46 ? 14.145  -4.435  2.140   1.00 0.00 ? 46 SER A HG   11 
ATOM   9752  N N    . LEU A 1 47 ? 15.281  -3.980  -0.560  1.00 0.00 ? 47 LEU A N    11 
ATOM   9753  C CA   . LEU A 1 47 ? 15.430  -5.183  -1.361  1.00 0.00 ? 47 LEU A CA   11 
ATOM   9754  C C    . LEU A 1 47 ? 14.617  -6.315  -0.729  1.00 0.00 ? 47 LEU A C    11 
ATOM   9755  O O    . LEU A 1 47 ? 13.899  -7.031  -1.426  1.00 0.00 ? 47 LEU A O    11 
ATOM   9756  C CB   . LEU A 1 47 ? 16.911  -5.521  -1.549  1.00 0.00 ? 47 LEU A CB   11 
ATOM   9757  C CG   . LEU A 1 47 ? 17.625  -4.793  -2.689  1.00 0.00 ? 47 LEU A CG   11 
ATOM   9758  C CD1  . LEU A 1 47 ? 19.143  -4.950  -2.574  1.00 0.00 ? 47 LEU A CD1  11 
ATOM   9759  C CD2  . LEU A 1 47 ? 17.102  -5.258  -4.050  1.00 0.00 ? 47 LEU A CD2  11 
ATOM   9760  H H    . LEU A 1 47 ? 16.102  -3.699  -0.063  1.00 0.00 ? 47 LEU A H    11 
ATOM   9761  H HA   . LEU A 1 47 ? 15.020  -4.972  -2.348  1.00 0.00 ? 47 LEU A HA   11 
ATOM   9762  H HB2  . LEU A 1 47 ? 17.435  -5.301  -0.619  1.00 0.00 ? 47 LEU A HB2  11 
ATOM   9763  H HB3  . LEU A 1 47 ? 16.999  -6.595  -1.718  1.00 0.00 ? 47 LEU A HB3  11 
ATOM   9764  H HG   . LEU A 1 47 ? 17.404  -3.729  -2.606  1.00 0.00 ? 47 LEU A HG   11 
ATOM   9765  H HD11 . LEU A 1 47 ? 19.413  -5.106  -1.530  1.00 0.00 ? 47 LEU A HD11 11 
ATOM   9766  H HD12 . LEU A 1 47 ? 19.465  -5.807  -3.165  1.00 0.00 ? 47 LEU A HD12 11 
ATOM   9767  H HD21 . LEU A 1 47 ? 17.824  -5.938  -4.503  1.00 0.00 ? 47 LEU A HD21 11 
ATOM   9768  H HD22 . LEU A 1 47 ? 16.151  -5.774  -3.917  1.00 0.00 ? 47 LEU A HD22 11 
ATOM   9769  N N    . LEU A 1 48 ? 14.756  -6.441  0.582   1.00 0.00 ? 48 LEU A N    11 
ATOM   9770  C CA   . LEU A 1 48 ? 14.043  -7.473  1.315   1.00 0.00 ? 48 LEU A CA   11 
ATOM   9771  C C    . LEU A 1 48 ? 12.542  -7.336  1.050   1.00 0.00 ? 48 LEU A C    11 
ATOM   9772  O O    . LEU A 1 48 ? 11.938  -8.203  0.421   1.00 0.00 ? 48 LEU A O    11 
ATOM   9773  C CB   . LEU A 1 48 ? 14.412  -7.428  2.799   1.00 0.00 ? 48 LEU A CB   11 
ATOM   9774  C CG   . LEU A 1 48 ? 14.415  -8.773  3.530   1.00 0.00 ? 48 LEU A CG   11 
ATOM   9775  C CD1  . LEU A 1 48 ? 15.753  -9.492  3.349   1.00 0.00 ? 48 LEU A CD1  11 
ATOM   9776  C CD2  . LEU A 1 48 ? 14.055  -8.595  5.006   1.00 0.00 ? 48 LEU A CD2  11 
ATOM   9777  H H    . LEU A 1 48 ? 15.342  -5.854  1.141   1.00 0.00 ? 48 LEU A H    11 
ATOM   9778  H HA   . LEU A 1 48 ? 14.375  -8.437  0.929   1.00 0.00 ? 48 LEU A HA   11 
ATOM   9779  H HB2  . LEU A 1 48 ? 15.402  -6.984  2.894   1.00 0.00 ? 48 LEU A HB2  11 
ATOM   9780  H HB3  . LEU A 1 48 ? 13.714  -6.763  3.307   1.00 0.00 ? 48 LEU A HB3  11 
ATOM   9781  H HG   . LEU A 1 48 ? 13.647  -9.405  3.085   1.00 0.00 ? 48 LEU A HG   11 
ATOM   9782  H HD11 . LEU A 1 48 ? 16.025  -9.993  4.278   1.00 0.00 ? 48 LEU A HD11 11 
ATOM   9783  H HD12 . LEU A 1 48 ? 15.664  -10.230 2.552   1.00 0.00 ? 48 LEU A HD12 11 
ATOM   9784  H HD21 . LEU A 1 48 ? 13.147  -7.998  5.090   1.00 0.00 ? 48 LEU A HD21 11 
ATOM   9785  H HD22 . LEU A 1 48 ? 13.890  -9.572  5.461   1.00 0.00 ? 48 LEU A HD22 11 
ATOM   9786  N N    . VAL A 1 49 ? 11.984  -6.240  1.544   1.00 0.00 ? 49 VAL A N    11 
ATOM   9787  C CA   . VAL A 1 49 ? 10.566  -5.979  1.368   1.00 0.00 ? 49 VAL A CA   11 
ATOM   9788  C C    . VAL A 1 49 ? 10.385  -4.738  0.491   1.00 0.00 ? 49 VAL A C    11 
ATOM   9789  O O    . VAL A 1 49 ? 11.259  -3.874  0.445   1.00 0.00 ? 49 VAL A O    11 
ATOM   9790  C CB   . VAL A 1 49 ? 9.884   -5.851  2.732   1.00 0.00 ? 49 VAL A CB   11 
ATOM   9791  C CG1  . VAL A 1 49 ? 10.068  -7.126  3.558   1.00 0.00 ? 49 VAL A CG1  11 
ATOM   9792  C CG2  . VAL A 1 49 ? 10.401  -4.627  3.491   1.00 0.00 ? 49 VAL A CG2  11 
ATOM   9793  H H    . VAL A 1 49 ? 12.483  -5.540  2.055   1.00 0.00 ? 49 VAL A H    11 
ATOM   9794  H HA   . VAL A 1 49 ? 10.134  -6.838  0.854   1.00 0.00 ? 49 VAL A HA   11 
ATOM   9795  H HB   . VAL A 1 49 ? 8.817   -5.713  2.562   1.00 0.00 ? 49 VAL A HB   11 
ATOM   9796  H HG11 . VAL A 1 49 ? 9.152   -7.716  3.524   1.00 0.00 ? 49 VAL A HG11 11 
ATOM   9797  H HG12 . VAL A 1 49 ? 10.892  -7.710  3.147   1.00 0.00 ? 49 VAL A HG12 11 
ATOM   9798  H HG21 . VAL A 1 49 ? 11.335  -4.289  3.042   1.00 0.00 ? 49 VAL A HG21 11 
ATOM   9799  H HG22 . VAL A 1 49 ? 9.662   -3.828  3.438   1.00 0.00 ? 49 VAL A HG22 11 
ATOM   9800  N N    . LYS A 1 50 ? 9.245   -4.690  -0.182  1.00 0.00 ? 50 LYS A N    11 
ATOM   9801  C CA   . LYS A 1 50 ? 8.938   -3.569  -1.055  1.00 0.00 ? 50 LYS A CA   11 
ATOM   9802  C C    . LYS A 1 50 ? 7.514   -3.085  -0.775  1.00 0.00 ? 50 LYS A C    11 
ATOM   9803  O O    . LYS A 1 50 ? 6.683   -3.844  -0.278  1.00 0.00 ? 50 LYS A O    11 
ATOM   9804  C CB   . LYS A 1 50 ? 9.184   -3.946  -2.517  1.00 0.00 ? 50 LYS A CB   11 
ATOM   9805  C CG   . LYS A 1 50 ? 10.438  -3.257  -3.059  1.00 0.00 ? 50 LYS A CG   11 
ATOM   9806  C CD   . LYS A 1 50 ? 11.192  -4.172  -4.026  1.00 0.00 ? 50 LYS A CD   11 
ATOM   9807  C CE   . LYS A 1 50 ? 12.606  -3.649  -4.285  1.00 0.00 ? 50 LYS A CE   11 
ATOM   9808  N NZ   . LYS A 1 50 ? 13.225  -4.370  -5.420  1.00 0.00 ? 50 LYS A NZ   11 
ATOM   9809  H H    . LYS A 1 50 ? 8.539   -5.397  -0.139  1.00 0.00 ? 50 LYS A H    11 
ATOM   9810  H HA   . LYS A 1 50 ? 9.631   -2.765  -0.809  1.00 0.00 ? 50 LYS A HA   11 
ATOM   9811  H HB2  . LYS A 1 50 ? 9.292   -5.028  -2.605  1.00 0.00 ? 50 LYS A HB2  11 
ATOM   9812  H HB3  . LYS A 1 50 ? 8.320   -3.663  -3.119  1.00 0.00 ? 50 LYS A HB3  11 
ATOM   9813  H HG2  . LYS A 1 50 ? 10.159  -2.335  -3.567  1.00 0.00 ? 50 LYS A HG2  11 
ATOM   9814  H HG3  . LYS A 1 50 ? 11.091  -2.980  -2.231  1.00 0.00 ? 50 LYS A HG3  11 
ATOM   9815  H HD2  . LYS A 1 50 ? 11.243  -5.180  -3.614  1.00 0.00 ? 50 LYS A HD2  11 
ATOM   9816  H HD3  . LYS A 1 50 ? 10.647  -4.240  -4.967  1.00 0.00 ? 50 LYS A HD3  11 
ATOM   9817  H HE2  . LYS A 1 50 ? 12.572  -2.581  -4.500  1.00 0.00 ? 50 LYS A HE2  11 
ATOM   9818  H HE3  . LYS A 1 50 ? 13.216  -3.775  -3.391  1.00 0.00 ? 50 LYS A HE3  11 
ATOM   9819  H HZ1  . LYS A 1 50 ? 14.164  -4.048  -5.547  1.00 0.00 ? 50 LYS A HZ1  11 
ATOM   9820  H HZ2  . LYS A 1 50 ? 13.232  -5.351  -5.228  1.00 0.00 ? 50 LYS A HZ2  11 
ATOM   9821  N N    . TYR A 1 51 ? 7.276   -1.825  -1.107  1.00 0.00 ? 51 TYR A N    11 
ATOM   9822  C CA   . TYR A 1 51 ? 5.967   -1.230  -0.897  1.00 0.00 ? 51 TYR A CA   11 
ATOM   9823  C C    . TYR A 1 51 ? 5.443   -0.590  -2.184  1.00 0.00 ? 51 TYR A C    11 
ATOM   9824  O O    . TYR A 1 51 ? 6.213   -0.019  -2.956  1.00 0.00 ? 51 TYR A O    11 
ATOM   9825  C CB   . TYR A 1 51 ? 6.163   -0.140  0.158   1.00 0.00 ? 51 TYR A CB   11 
ATOM   9826  C CG   . TYR A 1 51 ? 6.929   -0.604  1.398   1.00 0.00 ? 51 TYR A CG   11 
ATOM   9827  C CD1  . TYR A 1 51 ? 6.694   -1.858  1.925   1.00 0.00 ? 51 TYR A CD1  11 
ATOM   9828  C CD2  . TYR A 1 51 ? 7.855   0.231   1.990   1.00 0.00 ? 51 TYR A CD2  11 
ATOM   9829  C CE1  . TYR A 1 51 ? 7.416   -2.295  3.092   1.00 0.00 ? 51 TYR A CE1  11 
ATOM   9830  C CE2  . TYR A 1 51 ? 8.576   -0.206  3.157   1.00 0.00 ? 51 TYR A CE2  11 
ATOM   9831  C CZ   . TYR A 1 51 ? 8.321   -1.447  3.651   1.00 0.00 ? 51 TYR A CZ   11 
ATOM   9832  O OH   . TYR A 1 51 ? 9.002   -1.860  4.753   1.00 0.00 ? 51 TYR A OH   11 
ATOM   9833  H H    . TYR A 1 51 ? 7.958   -1.214  -1.510  1.00 0.00 ? 51 TYR A H    11 
ATOM   9834  H HA   . TYR A 1 51 ? 5.283   -2.022  -0.590  1.00 0.00 ? 51 TYR A HA   11 
ATOM   9835  H HB2  . TYR A 1 51 ? 6.696   0.697   -0.294  1.00 0.00 ? 51 TYR A HB2  11 
ATOM   9836  H HB3  . TYR A 1 51 ? 5.186   0.233   0.466   1.00 0.00 ? 51 TYR A HB3  11 
ATOM   9837  H HD1  . TYR A 1 51 ? 5.963   -2.517  1.458   1.00 0.00 ? 51 TYR A HD1  11 
ATOM   9838  H HD2  . TYR A 1 51 ? 8.040   1.221   1.574   1.00 0.00 ? 51 TYR A HD2  11 
ATOM   9839  H HE1  . TYR A 1 51 ? 7.240   -3.282  3.518   1.00 0.00 ? 51 TYR A HE1  11 
ATOM   9840  H HE2  . TYR A 1 51 ? 9.310   0.443   3.634   1.00 0.00 ? 51 TYR A HE2  11 
ATOM   9841  H HH   . TYR A 1 51 ? 8.787   -2.816  4.950   1.00 0.00 ? 51 TYR A HH   11 
ATOM   9842  N N    . VAL A 1 52 ? 4.137   -0.706  -2.376  1.00 0.00 ? 52 VAL A N    11 
ATOM   9843  C CA   . VAL A 1 52 ? 3.502   -0.145  -3.557  1.00 0.00 ? 52 VAL A CA   11 
ATOM   9844  C C    . VAL A 1 52 ? 2.326   0.735   -3.128  1.00 0.00 ? 52 VAL A C    11 
ATOM   9845  O O    . VAL A 1 52 ? 1.514   0.331   -2.298  1.00 0.00 ? 52 VAL A O    11 
ATOM   9846  C CB   . VAL A 1 52 ? 3.091   -1.267  -4.512  1.00 0.00 ? 52 VAL A CB   11 
ATOM   9847  C CG1  . VAL A 1 52 ? 2.088   -0.762  -5.552  1.00 0.00 ? 52 VAL A CG1  11 
ATOM   9848  C CG2  . VAL A 1 52 ? 4.315   -1.888  -5.188  1.00 0.00 ? 52 VAL A CG2  11 
ATOM   9849  H H    . VAL A 1 52 ? 3.518   -1.171  -1.744  1.00 0.00 ? 52 VAL A H    11 
ATOM   9850  H HA   . VAL A 1 52 ? 4.240   0.477   -4.063  1.00 0.00 ? 52 VAL A HA   11 
ATOM   9851  H HB   . VAL A 1 52 ? 2.603   -2.045  -3.926  1.00 0.00 ? 52 VAL A HB   11 
ATOM   9852  H HG11 . VAL A 1 52 ? 2.426   -1.043  -6.549  1.00 0.00 ? 52 VAL A HG11 11 
ATOM   9853  H HG12 . VAL A 1 52 ? 1.112   -1.207  -5.360  1.00 0.00 ? 52 VAL A HG12 11 
ATOM   9854  H HG21 . VAL A 1 52 ? 4.766   -1.160  -5.863  1.00 0.00 ? 52 VAL A HG21 11 
ATOM   9855  H HG22 . VAL A 1 52 ? 5.042   -2.177  -4.429  1.00 0.00 ? 52 VAL A HG22 11 
ATOM   9856  N N    . CYS A 1 53 ? 2.274   1.923   -3.713  1.00 0.00 ? 53 CYS A N    11 
ATOM   9857  C CA   . CYS A 1 53 ? 1.212   2.864   -3.402  1.00 0.00 ? 53 CYS A CA   11 
ATOM   9858  C C    . CYS A 1 53 ? 0.485   3.215   -4.702  1.00 0.00 ? 53 CYS A C    11 
ATOM   9859  O O    . CYS A 1 53 ? 1.086   3.205   -5.775  1.00 0.00 ? 53 CYS A O    11 
ATOM   9860  C CB   . CYS A 1 53 ? 1.748   4.110   -2.695  1.00 0.00 ? 53 CYS A CB   11 
ATOM   9861  S SG   . CYS A 1 53 ? 2.037   3.908   -0.899  1.00 0.00 ? 53 CYS A SG   11 
ATOM   9862  H H    . CYS A 1 53 ? 2.939   2.244   -4.387  1.00 0.00 ? 53 CYS A H    11 
ATOM   9863  H HA   . CYS A 1 53 ? 0.540   2.360   -2.707  1.00 0.00 ? 53 CYS A HA   11 
ATOM   9864  H HB2  . CYS A 1 53 ? 2.685   4.404   -3.168  1.00 0.00 ? 53 CYS A HB2  11 
ATOM   9865  H HB3  . CYS A 1 53 ? 1.044   4.928   -2.845  1.00 0.00 ? 53 CYS A HB3  11 
ATOM   9866  N N    . CYS A 1 54 ? -0.798  3.516   -4.563  1.00 0.00 ? 54 CYS A N    11 
ATOM   9867  C CA   . CYS A 1 54 ? -1.613  3.869   -5.713  1.00 0.00 ? 54 CYS A CA   11 
ATOM   9868  C C    . CYS A 1 54 ? -2.780  4.732   -5.228  1.00 0.00 ? 54 CYS A C    11 
ATOM   9869  O O    . CYS A 1 54 ? -3.059  4.788   -4.031  1.00 0.00 ? 54 CYS A O    11 
ATOM   9870  C CB   . CYS A 1 54 ? -2.095  2.629   -6.467  1.00 0.00 ? 54 CYS A CB   11 
ATOM   9871  S SG   . CYS A 1 54 ? -2.184  1.104   -5.459  1.00 0.00 ? 54 CYS A SG   11 
ATOM   9872  H H    . CYS A 1 54 ? -1.279  3.522   -3.686  1.00 0.00 ? 54 CYS A H    11 
ATOM   9873  H HA   . CYS A 1 54 ? -0.971  4.432   -6.390  1.00 0.00 ? 54 CYS A HA   11 
ATOM   9874  H HB2  . CYS A 1 54 ? -3.083  2.833   -6.879  1.00 0.00 ? 54 CYS A HB2  11 
ATOM   9875  H HB3  . CYS A 1 54 ? -1.428  2.451   -7.310  1.00 0.00 ? 54 CYS A HB3  11 
ATOM   9876  N N    . ASN A 1 55 ? -3.429  5.383   -6.182  1.00 0.00 ? 55 ASN A N    11 
ATOM   9877  C CA   . ASN A 1 55 ? -4.559  6.240   -5.867  1.00 0.00 ? 55 ASN A CA   11 
ATOM   9878  C C    . ASN A 1 55 ? -5.792  5.753   -6.632  1.00 0.00 ? 55 ASN A C    11 
ATOM   9879  O O    . ASN A 1 55 ? -6.315  6.463   -7.490  1.00 0.00 ? 55 ASN A O    11 
ATOM   9880  C CB   . ASN A 1 55 ? -4.286  7.687   -6.282  1.00 0.00 ? 55 ASN A CB   11 
ATOM   9881  C CG   . ASN A 1 55 ? -3.929  7.773   -7.768  1.00 0.00 ? 55 ASN A CG   11 
ATOM   9882  O OD1  . ASN A 1 55 ? -2.910  7.274   -8.217  1.00 0.00 ? 55 ASN A OD1  11 
ATOM   9883  N ND2  . ASN A 1 55 ? -4.822  8.431   -8.501  1.00 0.00 ? 55 ASN A ND2  11 
ATOM   9884  H H    . ASN A 1 55 ? -3.195  5.332   -7.153  1.00 0.00 ? 55 ASN A H    11 
ATOM   9885  H HA   . ASN A 1 55 ? -4.683  6.166   -4.787  1.00 0.00 ? 55 ASN A HA   11 
ATOM   9886  H HB2  . ASN A 1 55 ? -5.165  8.299   -6.080  1.00 0.00 ? 55 ASN A HB2  11 
ATOM   9887  H HB3  . ASN A 1 55 ? -3.470  8.093   -5.684  1.00 0.00 ? 55 ASN A HB3  11 
ATOM   9888  H HD21 . ASN A 1 55 ? -5.637  8.816   -8.070  1.00 0.00 ? 55 ASN A HD21 11 
ATOM   9889  H HD22 . ASN A 1 55 ? -4.677  8.541   -9.485  1.00 0.00 ? 55 ASN A HD22 11 
ATOM   9890  N N    . THR A 1 56 ? -6.220  4.546   -6.294  1.00 0.00 ? 56 THR A N    11 
ATOM   9891  C CA   . THR A 1 56 ? -7.381  3.956   -6.938  1.00 0.00 ? 56 THR A CA   11 
ATOM   9892  C C    . THR A 1 56 ? -8.170  3.106   -5.941  1.00 0.00 ? 56 THR A C    11 
ATOM   9893  O O    . THR A 1 56 ? -7.634  2.688   -4.915  1.00 0.00 ? 56 THR A O    11 
ATOM   9894  C CB   . THR A 1 56 ? -6.896  3.169   -8.157  1.00 0.00 ? 56 THR A CB   11 
ATOM   9895  O OG1  . THR A 1 56 ? -5.848  2.350   -7.647  1.00 0.00 ? 56 THR A OG1  11 
ATOM   9896  C CG2  . THR A 1 56 ? -6.204  4.059   -9.191  1.00 0.00 ? 56 THR A CG2  11 
ATOM   9897  H H    . THR A 1 56 ? -5.789  3.975   -5.595  1.00 0.00 ? 56 THR A H    11 
ATOM   9898  H HA   . THR A 1 56 ? -8.040  4.761   -7.263  1.00 0.00 ? 56 THR A HA   11 
ATOM   9899  H HB   . THR A 1 56 ? -7.715  2.611   -8.611  1.00 0.00 ? 56 THR A HB   11 
ATOM   9900  H HG1  . THR A 1 56 ? -5.019  2.894   -7.522  1.00 0.00 ? 56 THR A HG1  11 
ATOM   9901  H HG21 . THR A 1 56 ? -6.922  4.771   -9.598  1.00 0.00 ? 56 THR A HG21 11 
ATOM   9902  H HG22 . THR A 1 56 ? -5.386  4.600   -8.715  1.00 0.00 ? 56 THR A HG22 11 
ATOM   9903  N N    . ASP A 1 57 ? -9.444  2.852   -6.247  1.00 0.00 ? 57 ASP A N    11 
ATOM   9904  C CA   . ASP A 1 57 ? -10.296 2.060   -5.383  1.00 0.00 ? 57 ASP A CA   11 
ATOM   9905  C C    . ASP A 1 57 ? -9.801  0.621   -5.351  1.00 0.00 ? 57 ASP A C    11 
ATOM   9906  O O    . ASP A 1 57 ? -9.542  0.029   -6.397  1.00 0.00 ? 57 ASP A O    11 
ATOM   9907  C CB   . ASP A 1 57 ? -11.734 2.127   -5.888  1.00 0.00 ? 57 ASP A CB   11 
ATOM   9908  C CG   . ASP A 1 57 ? -12.531 3.173   -5.122  1.00 0.00 ? 57 ASP A CG   11 
ATOM   9909  O OD1  . ASP A 1 57 ? -12.220 3.361   -3.926  1.00 0.00 ? 57 ASP A OD1  11 
ATOM   9910  O OD2  . ASP A 1 57 ? -13.437 3.766   -5.747  1.00 0.00 ? 57 ASP A OD2  11 
ATOM   9911  H H    . ASP A 1 57 ? -9.836  3.219   -7.102  1.00 0.00 ? 57 ASP A H    11 
ATOM   9912  H HA   . ASP A 1 57 ? -10.256 2.470   -4.373  1.00 0.00 ? 57 ASP A HA   11 
ATOM   9913  H HB2  . ASP A 1 57 ? -11.730 2.384   -6.947  1.00 0.00 ? 57 ASP A HB2  11 
ATOM   9914  H HB3  . ASP A 1 57 ? -12.205 1.153   -5.757  1.00 0.00 ? 57 ASP A HB3  11 
ATOM   9915  H HD2  . ASP A 1 57 ? -13.902 4.413   -5.211  1.00 0.00 ? 57 ASP A HD2  11 
ATOM   9916  N N    . LYS A 1 58 ? -9.683  0.095   -4.141  1.00 0.00 ? 58 LYS A N    11 
ATOM   9917  C CA   . LYS A 1 58 ? -9.221  -1.271  -3.961  1.00 0.00 ? 58 LYS A CA   11 
ATOM   9918  C C    . LYS A 1 58 ? -7.955  -1.490  -4.791  1.00 0.00 ? 58 LYS A C    11 
ATOM   9919  O O    . LYS A 1 58 ? -7.875  -2.439  -5.570  1.00 0.00 ? 58 LYS A O    11 
ATOM   9920  C CB   . LYS A 1 58 ? -10.343 -2.262  -4.278  1.00 0.00 ? 58 LYS A CB   11 
ATOM   9921  C CG   . LYS A 1 58 ? -10.401 -3.378  -3.233  1.00 0.00 ? 58 LYS A CG   11 
ATOM   9922  C CD   . LYS A 1 58 ? -10.247 -4.752  -3.888  1.00 0.00 ? 58 LYS A CD   11 
ATOM   9923  C CE   . LYS A 1 58 ? -8.771  -5.124  -4.041  1.00 0.00 ? 58 LYS A CE   11 
ATOM   9924  N NZ   . LYS A 1 58 ? -8.594  -6.097  -5.142  1.00 0.00 ? 58 LYS A NZ   11 
ATOM   9925  H H    . LYS A 1 58 ? -9.896  0.583   -3.295  1.00 0.00 ? 58 LYS A H    11 
ATOM   9926  H HA   . LYS A 1 58 ? -8.969  -1.395  -2.908  1.00 0.00 ? 58 LYS A HA   11 
ATOM   9927  H HB2  . LYS A 1 58 ? -11.298 -1.738  -4.309  1.00 0.00 ? 58 LYS A HB2  11 
ATOM   9928  H HB3  . LYS A 1 58 ? -10.184 -2.693  -5.267  1.00 0.00 ? 58 LYS A HB3  11 
ATOM   9929  H HG2  . LYS A 1 58 ? -9.610  -3.232  -2.496  1.00 0.00 ? 58 LYS A HG2  11 
ATOM   9930  H HG3  . LYS A 1 58 ? -11.349 -3.330  -2.697  1.00 0.00 ? 58 LYS A HG3  11 
ATOM   9931  H HD2  . LYS A 1 58 ? -10.755 -5.505  -3.285  1.00 0.00 ? 58 LYS A HD2  11 
ATOM   9932  H HD3  . LYS A 1 58 ? -10.728 -4.748  -4.866  1.00 0.00 ? 58 LYS A HD3  11 
ATOM   9933  H HE2  . LYS A 1 58 ? -8.183  -4.229  -4.241  1.00 0.00 ? 58 LYS A HE2  11 
ATOM   9934  H HE3  . LYS A 1 58 ? -8.398  -5.549  -3.109  1.00 0.00 ? 58 LYS A HE3  11 
ATOM   9935  H HZ1  . LYS A 1 58 ? -8.319  -6.981  -4.765  1.00 0.00 ? 58 LYS A HZ1  11 
ATOM   9936  H HZ2  . LYS A 1 58 ? -9.456  -6.200  -5.638  1.00 0.00 ? 58 LYS A HZ2  11 
ATOM   9937  N N    . CYS A 1 59 ? -6.996  -0.596  -4.597  1.00 0.00 ? 59 CYS A N    11 
ATOM   9938  C CA   . CYS A 1 59 ? -5.737  -0.680  -5.318  1.00 0.00 ? 59 CYS A CA   11 
ATOM   9939  C C    . CYS A 1 59 ? -4.758  -1.505  -4.481  1.00 0.00 ? 59 CYS A C    11 
ATOM   9940  O O    . CYS A 1 59 ? -4.096  -2.403  -4.999  1.00 0.00 ? 59 CYS A O    11 
ATOM   9941  C CB   . CYS A 1 59 ? -5.180  0.707   -5.646  1.00 0.00 ? 59 CYS A CB   11 
ATOM   9942  S SG   . CYS A 1 59 ? -3.898  1.312   -4.489  1.00 0.00 ? 59 CYS A SG   11 
ATOM   9943  H H    . CYS A 1 59 ? -7.069  0.173   -3.962  1.00 0.00 ? 59 CYS A H    11 
ATOM   9944  H HA   . CYS A 1 59 ? -5.951  -1.176  -6.264  1.00 0.00 ? 59 CYS A HA   11 
ATOM   9945  H HB2  . CYS A 1 59 ? -4.761  0.686   -6.652  1.00 0.00 ? 59 CYS A HB2  11 
ATOM   9946  H HB3  . CYS A 1 59 ? -6.004  1.421   -5.658  1.00 0.00 ? 59 CYS A HB3  11 
ATOM   9947  N N    . ASN A 1 60 ? -4.696  -1.170  -3.200  1.00 0.00 ? 60 ASN A N    11 
ATOM   9948  C CA   . ASN A 1 60 ? -3.808  -1.869  -2.286  1.00 0.00 ? 60 ASN A CA   11 
ATOM   9949  C C    . ASN A 1 60 ? -4.453  -3.192  -1.868  1.00 0.00 ? 60 ASN A C    11 
ATOM   9950  O O    . ASN A 1 60 ? -3.910  -4.263  -2.135  1.00 0.00 ? 60 ASN A O    11 
ATOM   9951  C CB   . ASN A 1 60 ? -3.559  -1.044  -1.022  1.00 0.00 ? 60 ASN A CB   11 
ATOM   9952  C CG   . ASN A 1 60 ? -4.743  -1.147  -0.058  1.00 0.00 ? 60 ASN A CG   11 
ATOM   9953  O OD1  . ASN A 1 60 ? -5.886  -1.306  -0.453  1.00 0.00 ? 60 ASN A OD1  11 
ATOM   9954  N ND2  . ASN A 1 60 ? -4.406  -1.046  1.224   1.00 0.00 ? 60 ASN A ND2  11 
ATOM   9955  H H    . ASN A 1 60 ? -5.237  -0.438  -2.787  1.00 0.00 ? 60 ASN A H    11 
ATOM   9956  H HA   . ASN A 1 60 ? -2.882  -2.014  -2.842  1.00 0.00 ? 60 ASN A HA   11 
ATOM   9957  H HB2  . ASN A 1 60 ? -2.652  -1.394  -0.529  1.00 0.00 ? 60 ASN A HB2  11 
ATOM   9958  H HB3  . ASN A 1 60 ? -3.393  -0.001  -1.291  1.00 0.00 ? 60 ASN A HB3  11 
ATOM   9959  H HD21 . ASN A 1 60 ? -3.449  -0.916  1.481   1.00 0.00 ? 60 ASN A HD21 11 
ATOM   9960  H HD22 . ASN A 1 60 ? -5.111  -1.101  1.932   1.00 0.00 ? 60 ASN A HD22 11 
HETATM 9961  O O    . HOH B 2 .  ? 4.905   -10.967 1.301   1.00 0.00 ? 61 HOH A O    11 
HETATM 9962  H H1   . HOH B 2 .  ? 4.261   -10.441 1.774   1.00 0.00 ? 61 HOH A H1   11 
HETATM 9963  H H2   . HOH B 2 .  ? 5.455   -11.347 1.988   1.00 0.00 ? 61 HOH A H2   11 
HETATM 9964  O O    . HOH B 2 .  ? 4.662   -15.473 -7.588  1.00 0.00 ? 62 HOH A O    11 
HETATM 9965  H H1   . HOH B 2 .  ? 4.224   -14.655 -7.822  1.00 0.00 ? 62 HOH A H1   11 
HETATM 9966  H H2   . HOH B 2 .  ? 4.492   -15.576 -6.651  1.00 0.00 ? 62 HOH A H2   11 
ATOM   9967  N N    . LEU A 1 1  ? -12.735 7.135   -2.198  1.00 0.00 ? 1  LEU A N    12 
ATOM   9968  C CA   . LEU A 1 1  ? -11.568 7.113   -1.333  1.00 0.00 ? 1  LEU A CA   12 
ATOM   9969  C C    . LEU A 1 1  ? -11.714 5.981   -0.315  1.00 0.00 ? 1  LEU A C    12 
ATOM   9970  O O    . LEU A 1 1  ? -11.918 6.232   0.872   1.00 0.00 ? 1  LEU A O    12 
ATOM   9971  C CB   . LEU A 1 1  ? -11.346 8.487   -0.698  1.00 0.00 ? 1  LEU A CB   12 
ATOM   9972  C CG   . LEU A 1 1  ? -10.580 9.504   -1.547  1.00 0.00 ? 1  LEU A CG   12 
ATOM   9973  C CD1  . LEU A 1 1  ? -9.281  8.901   -2.084  1.00 0.00 ? 1  LEU A CD1  12 
ATOM   9974  C CD2  . LEU A 1 1  ? -11.462 10.057  -2.668  1.00 0.00 ? 1  LEU A CD2  12 
ATOM   9975  H H    . LEU A 1 1  ? -12.613 6.688   -3.084  1.00 0.00 ? 1  LEU A H    12 
ATOM   9976  H HA   . LEU A 1 1  ? -10.701 6.905   -1.960  1.00 0.00 ? 1  LEU A HA   12 
ATOM   9977  H HB2  . LEU A 1 1  ? -12.319 8.912   -0.449  1.00 0.00 ? 1  LEU A HB2  12 
ATOM   9978  H HB3  . LEU A 1 1  ? -10.809 8.349   0.240   1.00 0.00 ? 1  LEU A HB3  12 
ATOM   9979  H HG   . LEU A 1 1  ? -10.305 10.344  -0.909  1.00 0.00 ? 1  LEU A HG   12 
ATOM   9980  H HD11 . LEU A 1 1  ? -9.014  8.026   -1.491  1.00 0.00 ? 1  LEU A HD11 12 
ATOM   9981  H HD12 . LEU A 1 1  ? -9.420  8.606   -3.124  1.00 0.00 ? 1  LEU A HD12 12 
ATOM   9982  H HD21 . LEU A 1 1  ? -10.996 9.851   -3.632  1.00 0.00 ? 1  LEU A HD21 12 
ATOM   9983  H HD22 . LEU A 1 1  ? -12.442 9.581   -2.629  1.00 0.00 ? 1  LEU A HD22 12 
ATOM   9984  N N    . LYS A 1 2  ? -11.605 4.760   -0.816  1.00 0.00 ? 2  LYS A N    12 
ATOM   9985  C CA   . LYS A 1 2  ? -11.723 3.588   0.035   1.00 0.00 ? 2  LYS A CA   12 
ATOM   9986  C C    . LYS A 1 2  ? -10.815 2.479   -0.502  1.00 0.00 ? 2  LYS A C    12 
ATOM   9987  O O    . LYS A 1 2  ? -10.725 2.278   -1.712  1.00 0.00 ? 2  LYS A O    12 
ATOM   9988  C CB   . LYS A 1 2  ? -13.188 3.171   0.173   1.00 0.00 ? 2  LYS A CB   12 
ATOM   9989  C CG   . LYS A 1 2  ? -13.736 2.646   -1.156  1.00 0.00 ? 2  LYS A CG   12 
ATOM   9990  C CD   . LYS A 1 2  ? -14.727 3.637   -1.770  1.00 0.00 ? 2  LYS A CD   12 
ATOM   9991  C CE   . LYS A 1 2  ? -16.130 3.437   -1.194  1.00 0.00 ? 2  LYS A CE   12 
ATOM   9992  N NZ   . LYS A 1 2  ? -17.154 3.632   -2.245  1.00 0.00 ? 2  LYS A NZ   12 
ATOM   9993  H H    . LYS A 1 2  ? -11.439 4.564   -1.783  1.00 0.00 ? 2  LYS A H    12 
ATOM   9994  H HA   . LYS A 1 2  ? -11.373 3.870   1.028   1.00 0.00 ? 2  LYS A HA   12 
ATOM   9995  H HB2  . LYS A 1 2  ? -13.281 2.400   0.938   1.00 0.00 ? 2  LYS A HB2  12 
ATOM   9996  H HB3  . LYS A 1 2  ? -13.783 4.022   0.505   1.00 0.00 ? 2  LYS A HB3  12 
ATOM   9997  H HG2  . LYS A 1 2  ? -12.913 2.472   -1.849  1.00 0.00 ? 2  LYS A HG2  12 
ATOM   9998  H HG3  . LYS A 1 2  ? -14.227 1.686   -0.997  1.00 0.00 ? 2  LYS A HG3  12 
ATOM   9999  H HD2  . LYS A 1 2  ? -14.393 4.657   -1.578  1.00 0.00 ? 2  LYS A HD2  12 
ATOM   10000 H HD3  . LYS A 1 2  ? -14.752 3.508   -2.852  1.00 0.00 ? 2  LYS A HD3  12 
ATOM   10001 H HE2  . LYS A 1 2  ? -16.218 2.435   -0.774  1.00 0.00 ? 2  LYS A HE2  12 
ATOM   10002 H HE3  . LYS A 1 2  ? -16.299 4.141   -0.379  1.00 0.00 ? 2  LYS A HE3  12 
ATOM   10003 H HZ1  . LYS A 1 2  ? -17.995 3.159   -1.983  1.00 0.00 ? 2  LYS A HZ1  12 
ATOM   10004 H HZ2  . LYS A 1 2  ? -17.340 4.609   -2.352  1.00 0.00 ? 2  LYS A HZ2  12 
ATOM   10005 N N    . CYS A 1 3  ? -10.166 1.789   0.424   1.00 0.00 ? 3  CYS A N    12 
ATOM   10006 C CA   . CYS A 1 3  ? -9.269  0.706   0.059   1.00 0.00 ? 3  CYS A CA   12 
ATOM   10007 C C    . CYS A 1 3  ? -9.689  -0.546  0.831   1.00 0.00 ? 3  CYS A C    12 
ATOM   10008 O O    . CYS A 1 3  ? -10.578 -0.488  1.679   1.00 0.00 ? 3  CYS A O    12 
ATOM   10009 C CB   . CYS A 1 3  ? -7.806  1.072   0.316   1.00 0.00 ? 3  CYS A CB   12 
ATOM   10010 S SG   . CYS A 1 3  ? -7.422  2.854   0.160   1.00 0.00 ? 3  CYS A SG   12 
ATOM   10011 H H    . CYS A 1 3  ? -10.245 1.959   1.406   1.00 0.00 ? 3  CYS A H    12 
ATOM   10012 H HA   . CYS A 1 3  ? -9.382  0.555   -1.015  1.00 0.00 ? 3  CYS A HA   12 
ATOM   10013 H HB2  . CYS A 1 3  ? -7.535  0.742   1.319   1.00 0.00 ? 3  CYS A HB2  12 
ATOM   10014 H HB3  . CYS A 1 3  ? -7.179  0.517   -0.382  1.00 0.00 ? 3  CYS A HB3  12 
ATOM   10015 N N    . LYS A 1 4  ? -9.029  -1.650  0.509   1.00 0.00 ? 4  LYS A N    12 
ATOM   10016 C CA   . LYS A 1 4  ? -9.323  -2.914  1.162   1.00 0.00 ? 4  LYS A CA   12 
ATOM   10017 C C    . LYS A 1 4  ? -8.282  -3.174  2.253   1.00 0.00 ? 4  LYS A C    12 
ATOM   10018 O O    . LYS A 1 4  ? -7.112  -2.829  2.094   1.00 0.00 ? 4  LYS A O    12 
ATOM   10019 C CB   . LYS A 1 4  ? -9.425  -4.039  0.130   1.00 0.00 ? 4  LYS A CB   12 
ATOM   10020 C CG   . LYS A 1 4  ? -10.807 -4.056  -0.528  1.00 0.00 ? 4  LYS A CG   12 
ATOM   10021 C CD   . LYS A 1 4  ? -11.599 -5.296  -0.108  1.00 0.00 ? 4  LYS A CD   12 
ATOM   10022 C CE   . LYS A 1 4  ? -12.921 -5.386  -0.871  1.00 0.00 ? 4  LYS A CE   12 
ATOM   10023 N NZ   . LYS A 1 4  ? -12.681 -5.774  -2.279  1.00 0.00 ? 4  LYS A NZ   12 
ATOM   10024 H H    . LYS A 1 4  ? -8.308  -1.688  -0.182  1.00 0.00 ? 4  LYS A H    12 
ATOM   10025 H HA   . LYS A 1 4  ? -10.301 -2.819  1.633   1.00 0.00 ? 4  LYS A HA   12 
ATOM   10026 H HB2  . LYS A 1 4  ? -8.657  -3.909  -0.633  1.00 0.00 ? 4  LYS A HB2  12 
ATOM   10027 H HB3  . LYS A 1 4  ? -9.236  -4.998  0.612   1.00 0.00 ? 4  LYS A HB3  12 
ATOM   10028 H HG2  . LYS A 1 4  ? -11.357 -3.157  -0.249  1.00 0.00 ? 4  LYS A HG2  12 
ATOM   10029 H HG3  . LYS A 1 4  ? -10.698 -4.040  -1.612  1.00 0.00 ? 4  LYS A HG3  12 
ATOM   10030 H HD2  . LYS A 1 4  ? -11.005 -6.191  -0.293  1.00 0.00 ? 4  LYS A HD2  12 
ATOM   10031 H HD3  . LYS A 1 4  ? -11.795 -5.261  0.964   1.00 0.00 ? 4  LYS A HD3  12 
ATOM   10032 H HE2  . LYS A 1 4  ? -13.575 -6.116  -0.393  1.00 0.00 ? 4  LYS A HE2  12 
ATOM   10033 H HE3  . LYS A 1 4  ? -13.435 -4.426  -0.835  1.00 0.00 ? 4  LYS A HE3  12 
ATOM   10034 H HZ1  . LYS A 1 4  ? -12.096 -6.585  -2.307  1.00 0.00 ? 4  LYS A HZ1  12 
ATOM   10035 H HZ2  . LYS A 1 4  ? -13.554 -5.978  -2.722  1.00 0.00 ? 4  LYS A HZ2  12 
ATOM   10036 N N    . LYS A 1 5  ? -8.746  -3.779  3.337   1.00 0.00 ? 5  LYS A N    12 
ATOM   10037 C CA   . LYS A 1 5  ? -7.869  -4.089  4.453   1.00 0.00 ? 5  LYS A CA   12 
ATOM   10038 C C    . LYS A 1 5  ? -6.999  -5.295  4.095   1.00 0.00 ? 5  LYS A C    12 
ATOM   10039 O O    . LYS A 1 5  ? -6.934  -5.694  2.933   1.00 0.00 ? 5  LYS A O    12 
ATOM   10040 C CB   . LYS A 1 5  ? -8.682  -4.277  5.736   1.00 0.00 ? 5  LYS A CB   12 
ATOM   10041 C CG   . LYS A 1 5  ? -9.452  -3.003  6.089   1.00 0.00 ? 5  LYS A CG   12 
ATOM   10042 C CD   . LYS A 1 5  ? -8.564  -2.021  6.858   1.00 0.00 ? 5  LYS A CD   12 
ATOM   10043 C CE   . LYS A 1 5  ? -8.941  -1.987  8.340   1.00 0.00 ? 5  LYS A CE   12 
ATOM   10044 N NZ   . LYS A 1 5  ? -8.118  -2.949  9.107   1.00 0.00 ? 5  LYS A NZ   12 
ATOM   10045 H H    . LYS A 1 5  ? -9.699  -4.057  3.458   1.00 0.00 ? 5  LYS A H    12 
ATOM   10046 H HA   . LYS A 1 5  ? -7.220  -3.227  4.607   1.00 0.00 ? 5  LYS A HA   12 
ATOM   10047 H HB2  . LYS A 1 5  ? -9.380  -5.105  5.611   1.00 0.00 ? 5  LYS A HB2  12 
ATOM   10048 H HB3  . LYS A 1 5  ? -8.017  -4.544  6.557   1.00 0.00 ? 5  LYS A HB3  12 
ATOM   10049 H HG2  . LYS A 1 5  ? -9.818  -2.530  5.178   1.00 0.00 ? 5  LYS A HG2  12 
ATOM   10050 H HG3  . LYS A 1 5  ? -10.325 -3.256  6.690   1.00 0.00 ? 5  LYS A HG3  12 
ATOM   10051 H HD2  . LYS A 1 5  ? -7.519  -2.311  6.751   1.00 0.00 ? 5  LYS A HD2  12 
ATOM   10052 H HD3  . LYS A 1 5  ? -8.664  -1.024  6.430   1.00 0.00 ? 5  LYS A HD3  12 
ATOM   10053 H HE2  . LYS A 1 5  ? -8.797  -0.981  8.735   1.00 0.00 ? 5  LYS A HE2  12 
ATOM   10054 H HE3  . LYS A 1 5  ? -9.997  -2.228  8.459   1.00 0.00 ? 5  LYS A HE3  12 
ATOM   10055 H HZ1  . LYS A 1 5  ? -8.537  -3.856  9.063   1.00 0.00 ? 5  LYS A HZ1  12 
ATOM   10056 H HZ2  . LYS A 1 5  ? -7.198  -2.987  8.715   1.00 0.00 ? 5  LYS A HZ2  12 
ATOM   10057 N N    . LEU A 1 6  ? -6.353  -5.842  5.113   1.00 0.00 ? 6  LEU A N    12 
ATOM   10058 C CA   . LEU A 1 6  ? -5.490  -6.995  4.920   1.00 0.00 ? 6  LEU A CA   12 
ATOM   10059 C C    . LEU A 1 6  ? -6.201  -8.016  4.030   1.00 0.00 ? 6  LEU A C    12 
ATOM   10060 O O    . LEU A 1 6  ? -5.755  -8.293  2.918   1.00 0.00 ? 6  LEU A O    12 
ATOM   10061 C CB   . LEU A 1 6  ? -5.041  -7.561  6.269   1.00 0.00 ? 6  LEU A CB   12 
ATOM   10062 C CG   . LEU A 1 6  ? -3.745  -6.985  6.841   1.00 0.00 ? 6  LEU A CG   12 
ATOM   10063 C CD1  . LEU A 1 6  ? -3.980  -5.597  7.441   1.00 0.00 ? 6  LEU A CD1  12 
ATOM   10064 C CD2  . LEU A 1 6  ? -3.115  -7.947  7.850   1.00 0.00 ? 6  LEU A CD2  12 
ATOM   10065 H H    . LEU A 1 6  ? -6.412  -5.512  6.055   1.00 0.00 ? 6  LEU A H    12 
ATOM   10066 H HA   . LEU A 1 6  ? -4.595  -6.649  4.402   1.00 0.00 ? 6  LEU A HA   12 
ATOM   10067 H HB2  . LEU A 1 6  ? -5.839  -7.397  6.993   1.00 0.00 ? 6  LEU A HB2  12 
ATOM   10068 H HB3  . LEU A 1 6  ? -4.922  -8.640  6.166   1.00 0.00 ? 6  LEU A HB3  12 
ATOM   10069 H HG   . LEU A 1 6  ? -3.034  -6.865  6.023   1.00 0.00 ? 6  LEU A HG   12 
ATOM   10070 H HD11 . LEU A 1 6  ? -3.033  -5.060  7.496   1.00 0.00 ? 6  LEU A HD11 12 
ATOM   10071 H HD12 . LEU A 1 6  ? -4.676  -5.042  6.812   1.00 0.00 ? 6  LEU A HD12 12 
ATOM   10072 H HD21 . LEU A 1 6  ? -3.831  -8.730  8.100   1.00 0.00 ? 6  LEU A HD21 12 
ATOM   10073 H HD22 . LEU A 1 6  ? -2.222  -8.396  7.415   1.00 0.00 ? 6  LEU A HD22 12 
ATOM   10074 N N    . VAL A 1 7  ? -7.296  -8.548  4.553   1.00 0.00 ? 7  VAL A N    12 
ATOM   10075 C CA   . VAL A 1 7  ? -8.074  -9.532  3.820   1.00 0.00 ? 7  VAL A CA   12 
ATOM   10076 C C    . VAL A 1 7  ? -9.148  -8.817  2.997   1.00 0.00 ? 7  VAL A C    12 
ATOM   10077 O O    . VAL A 1 7  ? -9.788  -7.885  3.481   1.00 0.00 ? 7  VAL A O    12 
ATOM   10078 C CB   . VAL A 1 7  ? -8.653  -10.567 4.787   1.00 0.00 ? 7  VAL A CB   12 
ATOM   10079 C CG1  . VAL A 1 7  ? -9.531  -11.578 4.047   1.00 0.00 ? 7  VAL A CG1  12 
ATOM   10080 C CG2  . VAL A 1 7  ? -7.540  -11.273 5.565   1.00 0.00 ? 7  VAL A CG2  12 
ATOM   10081 H H    . VAL A 1 7  ? -7.653  -8.317  5.459   1.00 0.00 ? 7  VAL A H    12 
ATOM   10082 H HA   . VAL A 1 7  ? -7.396  -10.047 3.140   1.00 0.00 ? 7  VAL A HA   12 
ATOM   10083 H HB   . VAL A 1 7  ? -9.281  -10.040 5.505   1.00 0.00 ? 7  VAL A HB   12 
ATOM   10084 H HG11 . VAL A 1 7  ? -8.916  -12.410 3.703   1.00 0.00 ? 7  VAL A HG11 12 
ATOM   10085 H HG12 . VAL A 1 7  ? -10.302 -11.951 4.720   1.00 0.00 ? 7  VAL A HG12 12 
ATOM   10086 H HG21 . VAL A 1 7  ? -7.358  -12.255 5.128   1.00 0.00 ? 7  VAL A HG21 12 
ATOM   10087 H HG22 . VAL A 1 7  ? -6.628  -10.678 5.514   1.00 0.00 ? 7  VAL A HG22 12 
ATOM   10088 N N    . PRO A 1 8  ? -9.316  -9.294  1.734   1.00 0.00 ? 8  PRO A N    12 
ATOM   10089 C CA   . PRO A 1 8  ? -10.301 -8.711  0.839   1.00 0.00 ? 8  PRO A CA   12 
ATOM   10090 C C    . PRO A 1 8  ? -11.717 -9.141  1.227   1.00 0.00 ? 8  PRO A C    12 
ATOM   10091 O O    . PRO A 1 8  ? -12.457 -9.670  0.400   1.00 0.00 ? 8  PRO A O    12 
ATOM   10092 C CB   . PRO A 1 8  ? -9.897  -9.180  -0.549  1.00 0.00 ? 8  PRO A CB   12 
ATOM   10093 C CG   . PRO A 1 8  ? -8.985  -10.377 -0.336  1.00 0.00 ? 8  PRO A CG   12 
ATOM   10094 C CD   . PRO A 1 8  ? -8.576  -10.396 1.128   1.00 0.00 ? 8  PRO A CD   12 
ATOM   10095 H HA   . PRO A 1 8  ? -10.288 -7.713  0.912   1.00 0.00 ? 8  PRO A HA   12 
ATOM   10096 H HB2  . PRO A 1 8  ? -10.772 -9.455  -1.138  1.00 0.00 ? 8  PRO A HB2  12 
ATOM   10097 H HB3  . PRO A 1 8  ? -9.382  -8.389  -1.094  1.00 0.00 ? 8  PRO A HB3  12 
ATOM   10098 H HG2  . PRO A 1 8  ? -9.501  -11.301 -0.600  1.00 0.00 ? 8  PRO A HG2  12 
ATOM   10099 H HG3  . PRO A 1 8  ? -8.107  -10.308 -0.978  1.00 0.00 ? 8  PRO A HG3  12 
ATOM   10100 H HD2  . PRO A 1 8  ? -8.827  -11.348 1.597   1.00 0.00 ? 8  PRO A HD2  12 
ATOM   10101 H HD3  . PRO A 1 8  ? -7.500  -10.260 1.239   1.00 0.00 ? 8  PRO A HD3  12 
ATOM   10102 N N    . LEU A 1 9  ? -12.051 -8.897  2.486   1.00 0.00 ? 9  LEU A N    12 
ATOM   10103 C CA   . LEU A 1 9  ? -13.365 -9.252  2.994   1.00 0.00 ? 9  LEU A CA   12 
ATOM   10104 C C    . LEU A 1 9  ? -14.108 -7.980  3.408   1.00 0.00 ? 9  LEU A C    12 
ATOM   10105 O O    . LEU A 1 9  ? -15.323 -7.884  3.240   1.00 0.00 ? 9  LEU A O    12 
ATOM   10106 C CB   . LEU A 1 9  ? -13.245 -10.286 4.115   1.00 0.00 ? 9  LEU A CB   12 
ATOM   10107 C CG   . LEU A 1 9  ? -13.276 -11.753 3.680   1.00 0.00 ? 9  LEU A CG   12 
ATOM   10108 C CD1  . LEU A 1 9  ? -12.964 -12.680 4.857   1.00 0.00 ? 9  LEU A CD1  12 
ATOM   10109 C CD2  . LEU A 1 9  ? -14.609 -12.100 3.015   1.00 0.00 ? 9  LEU A CD2  12 
ATOM   10110 H H    . LEU A 1 9  ? -11.443 -8.466  3.152   1.00 0.00 ? 9  LEU A H    12 
ATOM   10111 H HA   . LEU A 1 9  ? -13.914 -9.723  2.178   1.00 0.00 ? 9  LEU A HA   12 
ATOM   10112 H HB2  . LEU A 1 9  ? -12.312 -10.106 4.650   1.00 0.00 ? 9  LEU A HB2  12 
ATOM   10113 H HB3  . LEU A 1 9  ? -14.056 -10.121 4.824   1.00 0.00 ? 9  LEU A HB3  12 
ATOM   10114 H HG   . LEU A 1 9  ? -12.495 -11.905 2.935   1.00 0.00 ? 9  LEU A HG   12 
ATOM   10115 H HD11 . LEU A 1 9  ? -13.019 -12.117 5.788   1.00 0.00 ? 9  LEU A HD11 12 
ATOM   10116 H HD12 . LEU A 1 9  ? -13.689 -13.494 4.881   1.00 0.00 ? 9  LEU A HD12 12 
ATOM   10117 H HD21 . LEU A 1 9  ? -15.313 -11.281 3.164   1.00 0.00 ? 9  LEU A HD21 12 
ATOM   10118 H HD22 . LEU A 1 9  ? -14.454 -12.256 1.948   1.00 0.00 ? 9  LEU A HD22 12 
ATOM   10119 N N    . PHE A 1 10 ? -13.347 -7.036  3.941   1.00 0.00 ? 10 PHE A N    12 
ATOM   10120 C CA   . PHE A 1 10 ? -13.918 -5.774  4.380   1.00 0.00 ? 10 PHE A CA   12 
ATOM   10121 C C    . PHE A 1 10 ? -13.111 -4.590  3.843   1.00 0.00 ? 10 PHE A C    12 
ATOM   10122 O O    . PHE A 1 10 ? -11.898 -4.692  3.663   1.00 0.00 ? 10 PHE A O    12 
ATOM   10123 C CB   . PHE A 1 10 ? -13.860 -5.765  5.909   1.00 0.00 ? 10 PHE A CB   12 
ATOM   10124 C CG   . PHE A 1 10 ? -14.398 -7.041  6.560   1.00 0.00 ? 10 PHE A CG   12 
ATOM   10125 C CD1  . PHE A 1 10 ? -15.723 -7.338  6.481   1.00 0.00 ? 10 PHE A CD1  12 
ATOM   10126 C CD2  . PHE A 1 10 ? -13.551 -7.877  7.217   1.00 0.00 ? 10 PHE A CD2  12 
ATOM   10127 C CE1  . PHE A 1 10 ? -16.222 -8.522  7.085   1.00 0.00 ? 10 PHE A CE1  12 
ATOM   10128 C CE2  . PHE A 1 10 ? -14.050 -9.062  7.821   1.00 0.00 ? 10 PHE A CE2  12 
ATOM   10129 C CZ   . PHE A 1 10 ? -15.375 -9.359  7.742   1.00 0.00 ? 10 PHE A CZ   12 
ATOM   10130 H H    . PHE A 1 10 ? -12.360 -7.122  4.074   1.00 0.00 ? 10 PHE A H    12 
ATOM   10131 H HA   . PHE A 1 10 ? -14.935 -5.725  3.989   1.00 0.00 ? 10 PHE A HA   12 
ATOM   10132 H HB2  . PHE A 1 10 ? -12.827 -5.617  6.222   1.00 0.00 ? 10 PHE A HB2  12 
ATOM   10133 H HB3  . PHE A 1 10 ? -14.430 -4.912  6.279   1.00 0.00 ? 10 PHE A HB3  12 
ATOM   10134 H HD1  . PHE A 1 10 ? -16.401 -6.667  5.954   1.00 0.00 ? 10 PHE A HD1  12 
ATOM   10135 H HD2  . PHE A 1 10 ? -12.489 -7.639  7.280   1.00 0.00 ? 10 PHE A HD2  12 
ATOM   10136 H HE1  . PHE A 1 10 ? -17.284 -8.760  7.022   1.00 0.00 ? 10 PHE A HE1  12 
ATOM   10137 H HE2  . PHE A 1 10 ? -13.372 -9.732  8.348   1.00 0.00 ? 10 PHE A HE2  12 
ATOM   10138 H HZ   . PHE A 1 10 ? -15.758 -10.268 8.206   1.00 0.00 ? 10 PHE A HZ   12 
ATOM   10139 N N    . SER A 1 11 ? -13.816 -3.494  3.604   1.00 0.00 ? 11 SER A N    12 
ATOM   10140 C CA   . SER A 1 11 ? -13.180 -2.292  3.091   1.00 0.00 ? 11 SER A CA   12 
ATOM   10141 C C    . SER A 1 11 ? -13.452 -1.116  4.030   1.00 0.00 ? 11 SER A C    12 
ATOM   10142 O O    . SER A 1 11 ? -14.466 -1.094  4.727   1.00 0.00 ? 11 SER A O    12 
ATOM   10143 C CB   . SER A 1 11 ? -13.670 -1.969  1.679   1.00 0.00 ? 11 SER A CB   12 
ATOM   10144 O OG   . SER A 1 11 ? -15.091 -2.024  1.581   1.00 0.00 ? 11 SER A OG   12 
ATOM   10145 H H    . SER A 1 11 ? -14.802 -3.420  3.753   1.00 0.00 ? 11 SER A H    12 
ATOM   10146 H HA   . SER A 1 11 ? -12.114 -2.520  3.062   1.00 0.00 ? 11 SER A HA   12 
ATOM   10147 H HB2  . SER A 1 11 ? -13.325 -0.975  1.394   1.00 0.00 ? 11 SER A HB2  12 
ATOM   10148 H HB3  . SER A 1 11 ? -13.231 -2.673  0.972   1.00 0.00 ? 11 SER A HB3  12 
ATOM   10149 H HG   . SER A 1 11 ? -15.498 -1.969  2.493   1.00 0.00 ? 11 SER A HG   12 
ATOM   10150 N N    . LYS A 1 12 ? -12.528 -0.165  4.020   1.00 0.00 ? 12 LYS A N    12 
ATOM   10151 C CA   . LYS A 1 12 ? -12.656 1.012   4.862   1.00 0.00 ? 12 LYS A CA   12 
ATOM   10152 C C    . LYS A 1 12 ? -12.279 2.255   4.053   1.00 0.00 ? 12 LYS A C    12 
ATOM   10153 O O    . LYS A 1 12 ? -11.575 2.157   3.049   1.00 0.00 ? 12 LYS A O    12 
ATOM   10154 C CB   . LYS A 1 12 ? -11.842 0.843   6.146   1.00 0.00 ? 12 LYS A CB   12 
ATOM   10155 C CG   . LYS A 1 12 ? -12.708 1.093   7.382   1.00 0.00 ? 12 LYS A CG   12 
ATOM   10156 C CD   . LYS A 1 12 ? -12.495 2.508   7.923   1.00 0.00 ? 12 LYS A CD   12 
ATOM   10157 C CE   . LYS A 1 12 ? -13.116 2.662   9.313   1.00 0.00 ? 12 LYS A CE   12 
ATOM   10158 N NZ   . LYS A 1 12 ? -12.100 2.429   10.363  1.00 0.00 ? 12 LYS A NZ   12 
ATOM   10159 H H    . LYS A 1 12 ? -11.707 -0.191  3.450   1.00 0.00 ? 12 LYS A H    12 
ATOM   10160 H HA   . LYS A 1 12 ? -13.703 1.093   5.153   1.00 0.00 ? 12 LYS A HA   12 
ATOM   10161 H HB2  . LYS A 1 12 ? -11.425 -0.163  6.187   1.00 0.00 ? 12 LYS A HB2  12 
ATOM   10162 H HB3  . LYS A 1 12 ? -11.000 1.536   6.141   1.00 0.00 ? 12 LYS A HB3  12 
ATOM   10163 H HG2  . LYS A 1 12 ? -13.759 0.951   7.128   1.00 0.00 ? 12 LYS A HG2  12 
ATOM   10164 H HG3  . LYS A 1 12 ? -12.465 0.364   8.154   1.00 0.00 ? 12 LYS A HG3  12 
ATOM   10165 H HD2  . LYS A 1 12 ? -11.428 2.726   7.971   1.00 0.00 ? 12 LYS A HD2  12 
ATOM   10166 H HD3  . LYS A 1 12 ? -12.938 3.233   7.241   1.00 0.00 ? 12 LYS A HD3  12 
ATOM   10167 H HE2  . LYS A 1 12 ? -13.537 3.662   9.421   1.00 0.00 ? 12 LYS A HE2  12 
ATOM   10168 H HE3  . LYS A 1 12 ? -13.938 1.956   9.431   1.00 0.00 ? 12 LYS A HE3  12 
ATOM   10169 H HZ1  . LYS A 1 12 ? -12.537 2.459   11.263  1.00 0.00 ? 12 LYS A HZ1  12 
ATOM   10170 H HZ2  . LYS A 1 12 ? -11.680 1.532   10.227  1.00 0.00 ? 12 LYS A HZ2  12 
ATOM   10171 N N    . THR A 1 13 ? -12.765 3.396   4.521   1.00 0.00 ? 13 THR A N    12 
ATOM   10172 C CA   . THR A 1 13 ? -12.488 4.656   3.854   1.00 0.00 ? 13 THR A CA   12 
ATOM   10173 C C    . THR A 1 13 ? -11.330 5.381   4.543   1.00 0.00 ? 13 THR A C    12 
ATOM   10174 O O    . THR A 1 13 ? -11.226 5.368   5.769   1.00 0.00 ? 13 THR A O    12 
ATOM   10175 C CB   . THR A 1 13 ? -13.783 5.470   3.825   1.00 0.00 ? 13 THR A CB   12 
ATOM   10176 O OG1  . THR A 1 13 ? -14.531 4.894   2.758   1.00 0.00 ? 13 THR A OG1  12 
ATOM   10177 C CG2  . THR A 1 13 ? -13.556 6.917   3.382   1.00 0.00 ? 13 THR A CG2  12 
ATOM   10178 H H    . THR A 1 13 ? -13.337 3.466   5.338   1.00 0.00 ? 13 THR A H    12 
ATOM   10179 H HA   . THR A 1 13 ? -12.169 4.443   2.834   1.00 0.00 ? 13 THR A HA   12 
ATOM   10180 H HB   . THR A 1 13 ? -14.288 5.434   4.790   1.00 0.00 ? 13 THR A HB   12 
ATOM   10181 H HG1  . THR A 1 13 ? -14.924 4.022   3.048   1.00 0.00 ? 13 THR A HG1  12 
ATOM   10182 H HG21 . THR A 1 13 ? -13.494 7.561   4.259   1.00 0.00 ? 13 THR A HG21 12 
ATOM   10183 H HG22 . THR A 1 13 ? -12.625 6.982   2.817   1.00 0.00 ? 13 THR A HG22 12 
ATOM   10184 N N    . CYS A 1 14 ? -10.489 5.997   3.726   1.00 0.00 ? 14 CYS A N    12 
ATOM   10185 C CA   . CYS A 1 14 ? -9.343  6.726   4.241   1.00 0.00 ? 14 CYS A CA   12 
ATOM   10186 C C    . CYS A 1 14 ? -9.730  8.200   4.373   1.00 0.00 ? 14 CYS A C    12 
ATOM   10187 O O    . CYS A 1 14 ? -9.987  8.870   3.373   1.00 0.00 ? 14 CYS A O    12 
ATOM   10188 C CB   . CYS A 1 14 ? -8.108  6.537   3.357   1.00 0.00 ? 14 CYS A CB   12 
ATOM   10189 S SG   . CYS A 1 14 ? -7.954  4.879   2.598   1.00 0.00 ? 14 CYS A SG   12 
ATOM   10190 H H    . CYS A 1 14 ? -10.581 6.003   2.730   1.00 0.00 ? 14 CYS A H    12 
ATOM   10191 H HA   . CYS A 1 14 ? -9.112  6.298   5.217   1.00 0.00 ? 14 CYS A HA   12 
ATOM   10192 H HB2  . CYS A 1 14 ? -8.129  7.284   2.564   1.00 0.00 ? 14 CYS A HB2  12 
ATOM   10193 H HB3  . CYS A 1 14 ? -7.217  6.731   3.955   1.00 0.00 ? 14 CYS A HB3  12 
ATOM   10194 N N    . PRO A 1 15 ? -9.762  8.674   5.647   1.00 0.00 ? 15 PRO A N    12 
ATOM   10195 C CA   . PRO A 1 15 ? -10.114 10.057  5.922   1.00 0.00 ? 15 PRO A CA   12 
ATOM   10196 C C    . PRO A 1 15 ? -8.962  10.998  5.564   1.00 0.00 ? 15 PRO A C    12 
ATOM   10197 O O    . PRO A 1 15 ? -7.894  10.549  5.150   1.00 0.00 ? 15 PRO A O    12 
ATOM   10198 C CB   . PRO A 1 15 ? -10.467 10.086  7.400   1.00 0.00 ? 15 PRO A CB   12 
ATOM   10199 C CG   . PRO A 1 15 ? -9.855  8.830   8.000   1.00 0.00 ? 15 PRO A CG   12 
ATOM   10200 C CD   . PRO A 1 15 ? -9.464  7.910   6.855   1.00 0.00 ? 15 PRO A CD   12 
ATOM   10201 H HA   . PRO A 1 15 ? -10.885 10.339  5.351   1.00 0.00 ? 15 PRO A HA   12 
ATOM   10202 H HB2  . PRO A 1 15 ? -10.069 10.981  7.879   1.00 0.00 ? 15 PRO A HB2  12 
ATOM   10203 H HB3  . PRO A 1 15 ? -11.547 10.102  7.544   1.00 0.00 ? 15 PRO A HB3  12 
ATOM   10204 H HG2  . PRO A 1 15 ? -8.983  9.081   8.603   1.00 0.00 ? 15 PRO A HG2  12 
ATOM   10205 H HG3  . PRO A 1 15 ? -10.569 8.336   8.660   1.00 0.00 ? 15 PRO A HG3  12 
ATOM   10206 H HD2  . PRO A 1 15 ? -8.409  7.643   6.904   1.00 0.00 ? 15 PRO A HD2  12 
ATOM   10207 H HD3  . PRO A 1 15 ? -10.030 6.979   6.884   1.00 0.00 ? 15 PRO A HD3  12 
ATOM   10208 N N    . ALA A 1 16 ? -9.218  12.287  5.735   1.00 0.00 ? 16 ALA A N    12 
ATOM   10209 C CA   . ALA A 1 16 ? -8.215  13.295  5.435   1.00 0.00 ? 16 ALA A CA   12 
ATOM   10210 C C    . ALA A 1 16 ? -6.861  12.840  5.982   1.00 0.00 ? 16 ALA A C    12 
ATOM   10211 O O    . ALA A 1 16 ? -6.796  12.180  7.018   1.00 0.00 ? 16 ALA A O    12 
ATOM   10212 C CB   . ALA A 1 16 ? -8.656  14.641  6.013   1.00 0.00 ? 16 ALA A CB   12 
ATOM   10213 H H    . ALA A 1 16 ? -10.089 12.644  6.072   1.00 0.00 ? 16 ALA A H    12 
ATOM   10214 H HA   . ALA A 1 16 ? -8.149  13.384  4.350   1.00 0.00 ? 16 ALA A HA   12 
ATOM   10215 H HB1  . ALA A 1 16 ? -8.167  15.448  5.468   1.00 0.00 ? 16 ALA A HB1  12 
ATOM   10216 H HB2  . ALA A 1 16 ? -9.737  14.741  5.919   1.00 0.00 ? 16 ALA A HB2  12 
ATOM   10217 N N    . GLY A 1 17 ? -5.813  13.211  5.261   1.00 0.00 ? 17 GLY A N    12 
ATOM   10218 C CA   . GLY A 1 17 ? -4.464  12.849  5.661   1.00 0.00 ? 17 GLY A CA   12 
ATOM   10219 C C    . GLY A 1 17 ? -3.956  11.650  4.857   1.00 0.00 ? 17 GLY A C    12 
ATOM   10220 O O    . GLY A 1 17 ? -2.792  11.610  4.463   1.00 0.00 ? 17 GLY A O    12 
ATOM   10221 H H    . GLY A 1 17 ? -5.874  13.747  4.419   1.00 0.00 ? 17 GLY A H    12 
ATOM   10222 H HA2  . GLY A 1 17 ? -3.797  13.699  5.513   1.00 0.00 ? 17 GLY A HA2  12 
ATOM   10223 H HA3  . GLY A 1 17 ? -4.447  12.612  6.724   1.00 0.00 ? 17 GLY A HA3  12 
ATOM   10224 N N    . LYS A 1 18 ? -4.856  10.701  4.639   1.00 0.00 ? 18 LYS A N    12 
ATOM   10225 C CA   . LYS A 1 18 ? -4.514  9.504   3.890   1.00 0.00 ? 18 LYS A CA   12 
ATOM   10226 C C    . LYS A 1 18 ? -5.536  9.299   2.771   1.00 0.00 ? 18 LYS A C    12 
ATOM   10227 O O    . LYS A 1 18 ? -6.689  8.960   3.033   1.00 0.00 ? 18 LYS A O    12 
ATOM   10228 C CB   . LYS A 1 18 ? -4.381  8.304   4.830   1.00 0.00 ? 18 LYS A CB   12 
ATOM   10229 C CG   . LYS A 1 18 ? -5.469  8.326   5.905   1.00 0.00 ? 18 LYS A CG   12 
ATOM   10230 C CD   . LYS A 1 18 ? -5.148  7.342   7.031   1.00 0.00 ? 18 LYS A CD   12 
ATOM   10231 C CE   . LYS A 1 18 ? -4.636  8.076   8.272   1.00 0.00 ? 18 LYS A CE   12 
ATOM   10232 N NZ   . LYS A 1 18 ? -3.157  8.045   8.320   1.00 0.00 ? 18 LYS A NZ   12 
ATOM   10233 H H    . LYS A 1 18 ? -5.801  10.741  4.964   1.00 0.00 ? 18 LYS A H    12 
ATOM   10234 H HA   . LYS A 1 18 ? -3.536  9.669   3.439   1.00 0.00 ? 18 LYS A HA   12 
ATOM   10235 H HB2  . LYS A 1 18 ? -4.450  7.379   4.257   1.00 0.00 ? 18 LYS A HB2  12 
ATOM   10236 H HB3  . LYS A 1 18 ? -3.398  8.314   5.301   1.00 0.00 ? 18 LYS A HB3  12 
ATOM   10237 H HG2  . LYS A 1 18 ? -5.562  9.333   6.313   1.00 0.00 ? 18 LYS A HG2  12 
ATOM   10238 H HG3  . LYS A 1 18 ? -6.431  8.073   5.459   1.00 0.00 ? 18 LYS A HG3  12 
ATOM   10239 H HD2  . LYS A 1 18 ? -6.041  6.770   7.285   1.00 0.00 ? 18 LYS A HD2  12 
ATOM   10240 H HD3  . LYS A 1 18 ? -4.398  6.628   6.692   1.00 0.00 ? 18 LYS A HD3  12 
ATOM   10241 H HE2  . LYS A 1 18 ? -4.984  9.109   8.260   1.00 0.00 ? 18 LYS A HE2  12 
ATOM   10242 H HE3  . LYS A 1 18 ? -5.045  7.613   9.170   1.00 0.00 ? 18 LYS A HE3  12 
ATOM   10243 H HZ1  . LYS A 1 18 ? -2.860  7.690   9.206   1.00 0.00 ? 18 LYS A HZ1  12 
ATOM   10244 H HZ2  . LYS A 1 18 ? -2.813  7.454   7.591   1.00 0.00 ? 18 LYS A HZ2  12 
ATOM   10245 N N    . ASN A 1 19 ? -5.077  9.513   1.547   1.00 0.00 ? 19 ASN A N    12 
ATOM   10246 C CA   . ASN A 1 19 ? -5.938  9.356   0.386   1.00 0.00 ? 19 ASN A CA   12 
ATOM   10247 C C    . ASN A 1 19 ? -5.304  8.354   -0.581  1.00 0.00 ? 19 ASN A C    12 
ATOM   10248 O O    . ASN A 1 19 ? -5.845  8.096   -1.655  1.00 0.00 ? 19 ASN A O    12 
ATOM   10249 C CB   . ASN A 1 19 ? -6.112  10.683  -0.354  1.00 0.00 ? 19 ASN A CB   12 
ATOM   10250 C CG   . ASN A 1 19 ? -7.308  11.464  0.193   1.00 0.00 ? 19 ASN A CG   12 
ATOM   10251 O OD1  . ASN A 1 19 ? -7.616  11.430  1.373   1.00 0.00 ? 19 ASN A OD1  12 
ATOM   10252 N ND2  . ASN A 1 19 ? -7.962  12.167  -0.727  1.00 0.00 ? 19 ASN A ND2  12 
ATOM   10253 H H    . ASN A 1 19 ? -4.138  9.789   1.342   1.00 0.00 ? 19 ASN A H    12 
ATOM   10254 H HA   . ASN A 1 19 ? -6.891  9.007   0.782   1.00 0.00 ? 19 ASN A HA   12 
ATOM   10255 H HB2  . ASN A 1 19 ? -5.206  11.281  -0.254  1.00 0.00 ? 19 ASN A HB2  12 
ATOM   10256 H HB3  . ASN A 1 19 ? -6.253  10.494  -1.418  1.00 0.00 ? 19 ASN A HB3  12 
ATOM   10257 H HD21 . ASN A 1 19 ? -7.656  12.151  -1.679  1.00 0.00 ? 19 ASN A HD21 12 
ATOM   10258 H HD22 . ASN A 1 19 ? -8.760  12.711  -0.466  1.00 0.00 ? 19 ASN A HD22 12 
ATOM   10259 N N    . LEU A 1 20 ? -4.166  7.817   -0.165  1.00 0.00 ? 20 LEU A N    12 
ATOM   10260 C CA   . LEU A 1 20 ? -3.453  6.849   -0.981  1.00 0.00 ? 20 LEU A CA   12 
ATOM   10261 C C    . LEU A 1 20 ? -3.374  5.517   -0.233  1.00 0.00 ? 20 LEU A C    12 
ATOM   10262 O O    . LEU A 1 20 ? -2.979  5.478   0.932   1.00 0.00 ? 20 LEU A O    12 
ATOM   10263 C CB   . LEU A 1 20 ? -2.089  7.402   -1.399  1.00 0.00 ? 20 LEU A CB   12 
ATOM   10264 C CG   . LEU A 1 20 ? -2.107  8.740   -2.141  1.00 0.00 ? 20 LEU A CG   12 
ATOM   10265 C CD1  . LEU A 1 20 ? -1.680  9.884   -1.218  1.00 0.00 ? 20 LEU A CD1  12 
ATOM   10266 C CD2  . LEU A 1 20 ? -1.251  8.677   -3.407  1.00 0.00 ? 20 LEU A CD2  12 
ATOM   10267 H H    . LEU A 1 20 ? -3.733  8.032   0.710   1.00 0.00 ? 20 LEU A H    12 
ATOM   10268 H HA   . LEU A 1 20 ? -4.033  6.699   -1.892  1.00 0.00 ? 20 LEU A HA   12 
ATOM   10269 H HB2  . LEU A 1 20 ? -1.475  7.512   -0.506  1.00 0.00 ? 20 LEU A HB2  12 
ATOM   10270 H HB3  . LEU A 1 20 ? -1.599  6.664   -2.034  1.00 0.00 ? 20 LEU A HB3  12 
ATOM   10271 H HG   . LEU A 1 20 ? -3.131  8.944   -2.454  1.00 0.00 ? 20 LEU A HG   12 
ATOM   10272 H HD11 . LEU A 1 20 ? -0.694  10.241  -1.514  1.00 0.00 ? 20 LEU A HD11 12 
ATOM   10273 H HD12 . LEU A 1 20 ? -2.400  10.699  -1.293  1.00 0.00 ? 20 LEU A HD12 12 
ATOM   10274 H HD21 . LEU A 1 20 ? -0.620  7.789   -3.375  1.00 0.00 ? 20 LEU A HD21 12 
ATOM   10275 H HD22 . LEU A 1 20 ? -1.900  8.629   -4.282  1.00 0.00 ? 20 LEU A HD22 12 
ATOM   10276 N N    . CYS A 1 21 ? -3.754  4.458   -0.932  1.00 0.00 ? 21 CYS A N    12 
ATOM   10277 C CA   . CYS A 1 21 ? -3.731  3.128   -0.349  1.00 0.00 ? 21 CYS A CA   12 
ATOM   10278 C C    . CYS A 1 21 ? -2.304  2.585   -0.447  1.00 0.00 ? 21 CYS A C    12 
ATOM   10279 O O    . CYS A 1 21 ? -1.622  2.799   -1.449  1.00 0.00 ? 21 CYS A O    12 
ATOM   10280 C CB   . CYS A 1 21 ? -4.743  2.197   -1.020  1.00 0.00 ? 21 CYS A CB   12 
ATOM   10281 S SG   . CYS A 1 21 ? -6.320  2.995   -1.496  1.00 0.00 ? 21 CYS A SG   12 
ATOM   10282 H H    . CYS A 1 21 ? -4.074  4.499   -1.879  1.00 0.00 ? 21 CYS A H    12 
ATOM   10283 H HA   . CYS A 1 21 ? -4.032  3.238   0.693   1.00 0.00 ? 21 CYS A HA   12 
ATOM   10284 H HB2  . CYS A 1 21 ? -4.286  1.768   -1.911  1.00 0.00 ? 21 CYS A HB2  12 
ATOM   10285 H HB3  . CYS A 1 21 ? -4.960  1.371   -0.344  1.00 0.00 ? 21 CYS A HB3  12 
ATOM   10286 N N    . TYR A 1 22 ? -1.894  1.892   0.606   1.00 0.00 ? 22 TYR A N    12 
ATOM   10287 C CA   . TYR A 1 22 ? -0.561  1.317   0.650   1.00 0.00 ? 22 TYR A CA   12 
ATOM   10288 C C    . TYR A 1 22 ? -0.623  -0.193  0.885   1.00 0.00 ? 22 TYR A C    12 
ATOM   10289 O O    . TYR A 1 22 ? -1.528  -0.684  1.558   1.00 0.00 ? 22 TYR A O    12 
ATOM   10290 C CB   . TYR A 1 22 ? 0.144   1.977   1.837   1.00 0.00 ? 22 TYR A CB   12 
ATOM   10291 C CG   . TYR A 1 22 ? -0.115  1.287   3.177   1.00 0.00 ? 22 TYR A CG   12 
ATOM   10292 C CD1  . TYR A 1 22 ? 0.552   0.120   3.492   1.00 0.00 ? 22 TYR A CD1  12 
ATOM   10293 C CD2  . TYR A 1 22 ? -1.015  1.830   4.071   1.00 0.00 ? 22 TYR A CD2  12 
ATOM   10294 C CE1  . TYR A 1 22 ? 0.308   -0.530  4.754   1.00 0.00 ? 22 TYR A CE1  12 
ATOM   10295 C CE2  . TYR A 1 22 ? -1.259  1.179   5.332   1.00 0.00 ? 22 TYR A CE2  12 
ATOM   10296 C CZ   . TYR A 1 22 ? -0.585  0.032   5.612   1.00 0.00 ? 22 TYR A CZ   12 
ATOM   10297 O OH   . TYR A 1 22 ? -0.815  -0.583  6.803   1.00 0.00 ? 22 TYR A OH   12 
ATOM   10298 H H    . TYR A 1 22 ? -2.455  1.723   1.416   1.00 0.00 ? 22 TYR A H    12 
ATOM   10299 H HA   . TYR A 1 22 ? -0.080  1.509   -0.309  1.00 0.00 ? 22 TYR A HA   12 
ATOM   10300 H HB2  . TYR A 1 22 ? 1.217   1.990   1.648   1.00 0.00 ? 22 TYR A HB2  12 
ATOM   10301 H HB3  . TYR A 1 22 ? -0.180  3.016   1.907   1.00 0.00 ? 22 TYR A HB3  12 
ATOM   10302 H HD1  . TYR A 1 22 ? 1.263   -0.309  2.786   1.00 0.00 ? 22 TYR A HD1  12 
ATOM   10303 H HD2  . TYR A 1 22 ? -1.542  2.751   3.822   1.00 0.00 ? 22 TYR A HD2  12 
ATOM   10304 H HE1  . TYR A 1 22 ? 0.828   -1.452  5.015   1.00 0.00 ? 22 TYR A HE1  12 
ATOM   10305 H HE2  . TYR A 1 22 ? -1.968  1.598   6.047   1.00 0.00 ? 22 TYR A HE2  12 
ATOM   10306 H HH   . TYR A 1 22 ? 0.051   -0.865  7.215   1.00 0.00 ? 22 TYR A HH   12 
ATOM   10307 N N    . LYS A 1 23 ? 0.352   -0.889  0.318   1.00 0.00 ? 23 LYS A N    12 
ATOM   10308 C CA   . LYS A 1 23 ? 0.420   -2.334  0.457   1.00 0.00 ? 23 LYS A CA   12 
ATOM   10309 C C    . LYS A 1 23 ? 1.865   -2.747  0.742   1.00 0.00 ? 23 LYS A C    12 
ATOM   10310 O O    . LYS A 1 23 ? 2.765   -2.447  -0.041  1.00 0.00 ? 23 LYS A O    12 
ATOM   10311 C CB   . LYS A 1 23 ? -0.186  -3.019  -0.769  1.00 0.00 ? 23 LYS A CB   12 
ATOM   10312 C CG   . LYS A 1 23 ? 0.845   -3.145  -1.892  1.00 0.00 ? 23 LYS A CG   12 
ATOM   10313 C CD   . LYS A 1 23 ? 0.254   -3.874  -3.101  1.00 0.00 ? 23 LYS A CD   12 
ATOM   10314 C CE   . LYS A 1 23 ? 0.419   -3.045  -4.376  1.00 0.00 ? 23 LYS A CE   12 
ATOM   10315 N NZ   . LYS A 1 23 ? 1.324   -3.729  -5.326  1.00 0.00 ? 23 LYS A NZ   12 
ATOM   10316 H H    . LYS A 1 23 ? 1.085   -0.482  -0.228  1.00 0.00 ? 23 LYS A H    12 
ATOM   10317 H HA   . LYS A 1 23 ? -0.194  -2.608  1.316   1.00 0.00 ? 23 LYS A HA   12 
ATOM   10318 H HB2  . LYS A 1 23 ? -0.552  -4.008  -0.494  1.00 0.00 ? 23 LYS A HB2  12 
ATOM   10319 H HB3  . LYS A 1 23 ? -1.045  -2.449  -1.122  1.00 0.00 ? 23 LYS A HB3  12 
ATOM   10320 H HG2  . LYS A 1 23 ? 1.186   -2.154  -2.191  1.00 0.00 ? 23 LYS A HG2  12 
ATOM   10321 H HG3  . LYS A 1 23 ? 1.719   -3.686  -1.529  1.00 0.00 ? 23 LYS A HG3  12 
ATOM   10322 H HD2  . LYS A 1 23 ? 0.746   -4.839  -3.224  1.00 0.00 ? 23 LYS A HD2  12 
ATOM   10323 H HD3  . LYS A 1 23 ? -0.803  -4.075  -2.927  1.00 0.00 ? 23 LYS A HD3  12 
ATOM   10324 H HE2  . LYS A 1 23 ? -0.553  -2.885  -4.841  1.00 0.00 ? 23 LYS A HE2  12 
ATOM   10325 H HE3  . LYS A 1 23 ? 0.819   -2.061  -4.128  1.00 0.00 ? 23 LYS A HE3  12 
ATOM   10326 H HZ1  . LYS A 1 23 ? 2.198   -3.918  -4.877  1.00 0.00 ? 23 LYS A HZ1  12 
ATOM   10327 H HZ2  . LYS A 1 23 ? 0.908   -4.590  -5.621  1.00 0.00 ? 23 LYS A HZ2  12 
ATOM   10328 N N    . MET A 1 24 ? 2.042   -3.429  1.864   1.00 0.00 ? 24 MET A N    12 
ATOM   10329 C CA   . MET A 1 24 ? 3.362   -3.887  2.262   1.00 0.00 ? 24 MET A CA   12 
ATOM   10330 C C    . MET A 1 24 ? 3.463   -5.411  2.175   1.00 0.00 ? 24 MET A C    12 
ATOM   10331 O O    . MET A 1 24 ? 2.688   -6.125  2.810   1.00 0.00 ? 24 MET A O    12 
ATOM   10332 C CB   . MET A 1 24 ? 3.649   -3.436  3.695   1.00 0.00 ? 24 MET A CB   12 
ATOM   10333 C CG   . MET A 1 24 ? 3.797   -1.915  3.773   1.00 0.00 ? 24 MET A CG   12 
ATOM   10334 S SD   . MET A 1 24 ? 4.783   -1.470  5.192   1.00 0.00 ? 24 MET A SD   12 
ATOM   10335 C CE   . MET A 1 24 ? 3.492   -1.007  6.334   1.00 0.00 ? 24 MET A CE   12 
ATOM   10336 H H    . MET A 1 24 ? 1.304   -3.668  2.495   1.00 0.00 ? 24 MET A H    12 
ATOM   10337 H HA   . MET A 1 24 ? 4.055   -3.429  1.556   1.00 0.00 ? 24 MET A HA   12 
ATOM   10338 H HB2  . MET A 1 24 ? 2.840   -3.760  4.350   1.00 0.00 ? 24 MET A HB2  12 
ATOM   10339 H HB3  . MET A 1 24 ? 4.561   -3.913  4.055   1.00 0.00 ? 24 MET A HB3  12 
ATOM   10340 H HG2  . MET A 1 24 ? 4.265   -1.540  2.863   1.00 0.00 ? 24 MET A HG2  12 
ATOM   10341 H HG3  . MET A 1 24 ? 2.814   -1.449  3.842   1.00 0.00 ? 24 MET A HG3  12 
ATOM   10342 H HE1  . MET A 1 24 ? 3.891   -0.310  7.071   1.00 0.00 ? 24 MET A HE1  12 
ATOM   10343 H HE2  . MET A 1 24 ? 2.677   -0.532  5.788   1.00 0.00 ? 24 MET A HE2  12 
ATOM   10344 N N    . PHE A 1 25 ? 4.425   -5.865  1.385   1.00 0.00 ? 25 PHE A N    12 
ATOM   10345 C CA   . PHE A 1 25 ? 4.637   -7.291  1.208   1.00 0.00 ? 25 PHE A CA   12 
ATOM   10346 C C    . PHE A 1 25 ? 6.126   -7.609  1.056   1.00 0.00 ? 25 PHE A C    12 
ATOM   10347 O O    . PHE A 1 25 ? 6.933   -6.714  0.808   1.00 0.00 ? 25 PHE A O    12 
ATOM   10348 C CB   . PHE A 1 25 ? 3.908   -7.696  -0.075  1.00 0.00 ? 25 PHE A CB   12 
ATOM   10349 C CG   . PHE A 1 25 ? 4.499   -7.084  -1.347  1.00 0.00 ? 25 PHE A CG   12 
ATOM   10350 C CD1  . PHE A 1 25 ? 5.639   -7.597  -1.882  1.00 0.00 ? 25 PHE A CD1  12 
ATOM   10351 C CD2  . PHE A 1 25 ? 3.885   -6.026  -1.942  1.00 0.00 ? 25 PHE A CD2  12 
ATOM   10352 C CE1  . PHE A 1 25 ? 6.188   -7.029  -3.062  1.00 0.00 ? 25 PHE A CE1  12 
ATOM   10353 C CE2  . PHE A 1 25 ? 4.434   -5.458  -3.122  1.00 0.00 ? 25 PHE A CE2  12 
ATOM   10354 C CZ   . PHE A 1 25 ? 5.573   -5.972  -3.657  1.00 0.00 ? 25 PHE A CZ   12 
ATOM   10355 H H    . PHE A 1 25 ? 5.051   -5.277  0.872   1.00 0.00 ? 25 PHE A H    12 
ATOM   10356 H HA   . PHE A 1 25 ? 4.250   -7.789  2.097   1.00 0.00 ? 25 PHE A HA   12 
ATOM   10357 H HB2  . PHE A 1 25 ? 3.927   -8.782  -0.164  1.00 0.00 ? 25 PHE A HB2  12 
ATOM   10358 H HB3  . PHE A 1 25 ? 2.862   -7.400  0.005   1.00 0.00 ? 25 PHE A HB3  12 
ATOM   10359 H HD1  . PHE A 1 25 ? 6.132   -8.445  -1.405  1.00 0.00 ? 25 PHE A HD1  12 
ATOM   10360 H HD2  . PHE A 1 25 ? 2.971   -5.615  -1.513  1.00 0.00 ? 25 PHE A HD2  12 
ATOM   10361 H HE1  . PHE A 1 25 ? 7.101   -7.441  -3.491  1.00 0.00 ? 25 PHE A HE1  12 
ATOM   10362 H HE2  . PHE A 1 25 ? 3.941   -4.611  -3.599  1.00 0.00 ? 25 PHE A HE2  12 
ATOM   10363 H HZ   . PHE A 1 25 ? 5.995   -5.536  -4.563  1.00 0.00 ? 25 PHE A HZ   12 
ATOM   10364 N N    . MET A 1 26 ? 6.445   -8.885  1.211   1.00 0.00 ? 26 MET A N    12 
ATOM   10365 C CA   . MET A 1 26 ? 7.822   -9.333  1.094   1.00 0.00 ? 26 MET A CA   12 
ATOM   10366 C C    . MET A 1 26 ? 8.141   -9.757  -0.341  1.00 0.00 ? 26 MET A C    12 
ATOM   10367 O O    . MET A 1 26 ? 7.279   -10.284 -1.042  1.00 0.00 ? 26 MET A O    12 
ATOM   10368 C CB   . MET A 1 26 ? 8.059   -10.512 2.039   1.00 0.00 ? 26 MET A CB   12 
ATOM   10369 C CG   . MET A 1 26 ? 8.039   -10.056 3.500   1.00 0.00 ? 26 MET A CG   12 
ATOM   10370 S SD   . MET A 1 26 ? 7.681   -11.442 4.567   1.00 0.00 ? 26 MET A SD   12 
ATOM   10371 C CE   . MET A 1 26 ? 5.905   -11.295 4.680   1.00 0.00 ? 26 MET A CE   12 
ATOM   10372 H H    . MET A 1 26 ? 5.782   -9.607  1.412   1.00 0.00 ? 26 MET A H    12 
ATOM   10373 H HA   . MET A 1 26 ? 8.433   -8.473  1.371   1.00 0.00 ? 26 MET A HA   12 
ATOM   10374 H HB2  . MET A 1 26 ? 7.291   -11.269 1.881   1.00 0.00 ? 26 MET A HB2  12 
ATOM   10375 H HB3  . MET A 1 26 ? 9.018   -10.978 1.813   1.00 0.00 ? 26 MET A HB3  12 
ATOM   10376 H HG2  . MET A 1 26 ? 9.002   -9.621  3.767   1.00 0.00 ? 26 MET A HG2  12 
ATOM   10377 H HG3  . MET A 1 26 ? 7.288   -9.278  3.636   1.00 0.00 ? 26 MET A HG3  12 
ATOM   10378 H HE1  . MET A 1 26 ? 5.512   -12.107 5.291   1.00 0.00 ? 26 MET A HE1  12 
ATOM   10379 H HE2  . MET A 1 26 ? 5.648   -10.339 5.136   1.00 0.00 ? 26 MET A HE2  12 
ATOM   10380 N N    . VAL A 1 27 ? 9.382   -9.510  -0.735  1.00 0.00 ? 27 VAL A N    12 
ATOM   10381 C CA   . VAL A 1 27 ? 9.825   -9.860  -2.074  1.00 0.00 ? 27 VAL A CA   12 
ATOM   10382 C C    . VAL A 1 27 ? 9.652   -11.365 -2.287  1.00 0.00 ? 27 VAL A C    12 
ATOM   10383 O O    . VAL A 1 27 ? 9.700   -11.845 -3.419  1.00 0.00 ? 27 VAL A O    12 
ATOM   10384 C CB   . VAL A 1 27 ? 11.265  -9.388  -2.289  1.00 0.00 ? 27 VAL A CB   12 
ATOM   10385 C CG1  . VAL A 1 27 ? 12.239  -10.185 -1.419  1.00 0.00 ? 27 VAL A CG1  12 
ATOM   10386 C CG2  . VAL A 1 27 ? 11.655  -9.471  -3.766  1.00 0.00 ? 27 VAL A CG2  12 
ATOM   10387 H H    . VAL A 1 27 ? 10.077  -9.080  -0.159  1.00 0.00 ? 27 VAL A H    12 
ATOM   10388 H HA   . VAL A 1 27 ? 9.187   -9.329  -2.781  1.00 0.00 ? 27 VAL A HA   12 
ATOM   10389 H HB   . VAL A 1 27 ? 11.324  -8.342  -1.985  1.00 0.00 ? 27 VAL A HB   12 
ATOM   10390 H HG11 . VAL A 1 27 ? 12.565  -11.074 -1.959  1.00 0.00 ? 27 VAL A HG11 12 
ATOM   10391 H HG12 . VAL A 1 27 ? 13.104  -9.566  -1.181  1.00 0.00 ? 27 VAL A HG12 12 
ATOM   10392 H HG21 . VAL A 1 27 ? 11.738  -8.464  -4.176  1.00 0.00 ? 27 VAL A HG21 12 
ATOM   10393 H HG22 . VAL A 1 27 ? 12.613  -9.982  -3.860  1.00 0.00 ? 27 VAL A HG22 12 
ATOM   10394 N N    . ALA A 1 28 ? 9.454   -12.068 -1.182  1.00 0.00 ? 28 ALA A N    12 
ATOM   10395 C CA   . ALA A 1 28 ? 9.273   -13.509 -1.233  1.00 0.00 ? 28 ALA A CA   12 
ATOM   10396 C C    . ALA A 1 28 ? 8.471   -13.873 -2.485  1.00 0.00 ? 28 ALA A C    12 
ATOM   10397 O O    . ALA A 1 28 ? 8.805   -14.828 -3.184  1.00 0.00 ? 28 ALA A O    12 
ATOM   10398 C CB   . ALA A 1 28 ? 8.594   -13.985 0.053   1.00 0.00 ? 28 ALA A CB   12 
ATOM   10399 H H    . ALA A 1 28 ? 9.416   -11.670 -0.265  1.00 0.00 ? 28 ALA A H    12 
ATOM   10400 H HA   . ALA A 1 28 ? 10.260  -13.965 -1.299  1.00 0.00 ? 28 ALA A HA   12 
ATOM   10401 H HB1  . ALA A 1 28 ? 8.327   -13.122 0.663   1.00 0.00 ? 28 ALA A HB1  12 
ATOM   10402 H HB2  . ALA A 1 28 ? 7.694   -14.546 -0.198  1.00 0.00 ? 28 ALA A HB2  12 
ATOM   10403 N N    . ALA A 1 29 ? 7.428   -13.093 -2.728  1.00 0.00 ? 29 ALA A N    12 
ATOM   10404 C CA   . ALA A 1 29 ? 6.576   -13.322 -3.883  1.00 0.00 ? 29 ALA A CA   12 
ATOM   10405 C C    . ALA A 1 29 ? 5.958   -11.994 -4.326  1.00 0.00 ? 29 ALA A C    12 
ATOM   10406 O O    . ALA A 1 29 ? 5.772   -11.090 -3.514  1.00 0.00 ? 29 ALA A O    12 
ATOM   10407 C CB   . ALA A 1 29 ? 5.518   -14.371 -3.537  1.00 0.00 ? 29 ALA A CB   12 
ATOM   10408 H H    . ALA A 1 29 ? 7.163   -12.318 -2.155  1.00 0.00 ? 29 ALA A H    12 
ATOM   10409 H HA   . ALA A 1 29 ? 7.203   -13.707 -4.687  1.00 0.00 ? 29 ALA A HA   12 
ATOM   10410 H HB1  . ALA A 1 29 ? 5.923   -15.367 -3.714  1.00 0.00 ? 29 ALA A HB1  12 
ATOM   10411 H HB2  . ALA A 1 29 ? 5.238   -14.273 -2.488  1.00 0.00 ? 29 ALA A HB2  12 
ATOM   10412 N N    . PRO A 1 30 ? 5.650   -11.917 -5.649  1.00 0.00 ? 30 PRO A N    12 
ATOM   10413 C CA   . PRO A 1 30 ? 5.056   -10.715 -6.210  1.00 0.00 ? 30 PRO A CA   12 
ATOM   10414 C C    . PRO A 1 30 ? 3.580   -10.600 -5.823  1.00 0.00 ? 30 PRO A C    12 
ATOM   10415 O O    . PRO A 1 30 ? 2.932   -9.599  -6.125  1.00 0.00 ? 30 PRO A O    12 
ATOM   10416 C CB   . PRO A 1 30 ? 5.270   -10.834 -7.710  1.00 0.00 ? 30 PRO A CB   12 
ATOM   10417 C CG   . PRO A 1 30 ? 5.556   -12.304 -7.975  1.00 0.00 ? 30 PRO A CG   12 
ATOM   10418 C CD   . PRO A 1 30 ? 5.857   -12.968 -6.641  1.00 0.00 ? 30 PRO A CD   12 
ATOM   10419 H HA   . PRO A 1 30 ? 5.501   -9.901  -5.836  1.00 0.00 ? 30 PRO A HA   12 
ATOM   10420 H HB2  . PRO A 1 30 ? 4.387   -10.503 -8.258  1.00 0.00 ? 30 PRO A HB2  12 
ATOM   10421 H HB3  . PRO A 1 30 ? 6.101   -10.210 -8.037  1.00 0.00 ? 30 PRO A HB3  12 
ATOM   10422 H HG2  . PRO A 1 30 ? 4.699   -12.779 -8.453  1.00 0.00 ? 30 PRO A HG2  12 
ATOM   10423 H HG3  . PRO A 1 30 ? 6.401   -12.412 -8.654  1.00 0.00 ? 30 PRO A HG3  12 
ATOM   10424 H HD2  . PRO A 1 30 ? 5.196   -13.816 -6.463  1.00 0.00 ? 30 PRO A HD2  12 
ATOM   10425 H HD3  . PRO A 1 30 ? 6.878   -13.347 -6.609  1.00 0.00 ? 30 PRO A HD3  12 
ATOM   10426 N N    . HIS A 1 31 ? 3.093   -11.639 -5.161  1.00 0.00 ? 31 HIS A N    12 
ATOM   10427 C CA   . HIS A 1 31 ? 1.705   -11.667 -4.730  1.00 0.00 ? 31 HIS A CA   12 
ATOM   10428 C C    . HIS A 1 31 ? 1.605   -12.356 -3.367  1.00 0.00 ? 31 HIS A C    12 
ATOM   10429 O O    . HIS A 1 31 ? 1.084   -13.465 -3.265  1.00 0.00 ? 31 HIS A O    12 
ATOM   10430 C CB   . HIS A 1 31 ? 0.820   -12.323 -5.792  1.00 0.00 ? 31 HIS A CB   12 
ATOM   10431 C CG   . HIS A 1 31 ? -0.544  -11.688 -5.931  1.00 0.00 ? 31 HIS A CG   12 
ATOM   10432 N ND1  . HIS A 1 31 ? -0.756  -10.329 -5.784  1.00 0.00 ? 31 HIS A ND1  12 
ATOM   10433 C CD2  . HIS A 1 31 ? -1.760  -12.241 -6.206  1.00 0.00 ? 31 HIS A CD2  12 
ATOM   10434 C CE1  . HIS A 1 31 ? -2.046  -10.086 -5.964  1.00 0.00 ? 31 HIS A CE1  12 
ATOM   10435 N NE2  . HIS A 1 31 ? -2.667  -11.272 -6.225  1.00 0.00 ? 31 HIS A NE2  12 
ATOM   10436 H H    . HIS A 1 31 ? 3.627   -12.449 -4.920  1.00 0.00 ? 31 HIS A H    12 
ATOM   10437 H HA   . HIS A 1 31 ? 1.388   -10.629 -4.627  1.00 0.00 ? 31 HIS A HA   12 
ATOM   10438 H HB2  . HIS A 1 31 ? 1.330   -12.278 -6.754  1.00 0.00 ? 31 HIS A HB2  12 
ATOM   10439 H HB3  . HIS A 1 31 ? 0.695   -13.377 -5.546  1.00 0.00 ? 31 HIS A HB3  12 
ATOM   10440 H HD1  . HIS A 1 31 ? -0.056  -9.646  -5.577  1.00 0.00 ? 31 HIS A HD1  12 
ATOM   10441 H HD2  . HIS A 1 31 ? -1.954  -13.299 -6.381  1.00 0.00 ? 31 HIS A HD2  12 
ATOM   10442 H HE1  . HIS A 1 31 ? -2.528  -9.109  -5.912  1.00 0.00 ? 31 HIS A HE1  12 
ATOM   10443 N N    . VAL A 1 32 ? 2.113   -11.669 -2.355  1.00 0.00 ? 32 VAL A N    12 
ATOM   10444 C CA   . VAL A 1 32 ? 2.088   -12.200 -1.002  1.00 0.00 ? 32 VAL A CA   12 
ATOM   10445 C C    . VAL A 1 32 ? 2.176   -11.045 -0.003  1.00 0.00 ? 32 VAL A C    12 
ATOM   10446 O O    . VAL A 1 32 ? 3.249   -10.756 0.524   1.00 0.00 ? 32 VAL A O    12 
ATOM   10447 C CB   . VAL A 1 32 ? 3.204   -13.231 -0.824  1.00 0.00 ? 32 VAL A CB   12 
ATOM   10448 C CG1  . VAL A 1 32 ? 3.353   -13.629 0.646   1.00 0.00 ? 32 VAL A CG1  12 
ATOM   10449 C CG2  . VAL A 1 32 ? 2.960   -14.460 -1.702  1.00 0.00 ? 32 VAL A CG2  12 
ATOM   10450 H H    . VAL A 1 32 ? 2.535   -10.767 -2.446  1.00 0.00 ? 32 VAL A H    12 
ATOM   10451 H HA   . VAL A 1 32 ? 1.133   -12.709 -0.867  1.00 0.00 ? 32 VAL A HA   12 
ATOM   10452 H HB   . VAL A 1 32 ? 4.139   -12.772 -1.144  1.00 0.00 ? 32 VAL A HB   12 
ATOM   10453 H HG11 . VAL A 1 32 ? 4.371   -13.420 0.977   1.00 0.00 ? 32 VAL A HG11 12 
ATOM   10454 H HG12 . VAL A 1 32 ? 2.650   -13.056 1.250   1.00 0.00 ? 32 VAL A HG12 12 
ATOM   10455 H HG21 . VAL A 1 32 ? 1.916   -14.762 -1.624  1.00 0.00 ? 32 VAL A HG21 12 
ATOM   10456 H HG22 . VAL A 1 32 ? 3.191   -14.217 -2.740  1.00 0.00 ? 32 VAL A HG22 12 
ATOM   10457 N N    . PRO A 1 33 ? 1.003   -10.398 0.233   1.00 0.00 ? 33 PRO A N    12 
ATOM   10458 C CA   . PRO A 1 33 ? 0.938   -9.280  1.159   1.00 0.00 ? 33 PRO A CA   12 
ATOM   10459 C C    . PRO A 1 33 ? 1.002   -9.766  2.609   1.00 0.00 ? 33 PRO A C    12 
ATOM   10460 O O    . PRO A 1 33 ? 0.604   -10.890 2.909   1.00 0.00 ? 33 PRO A O    12 
ATOM   10461 C CB   . PRO A 1 33 ? -0.364  -8.570  0.828   1.00 0.00 ? 33 PRO A CB   12 
ATOM   10462 C CG   . PRO A 1 33 ? -1.200  -9.574  0.050   1.00 0.00 ? 33 PRO A CG   12 
ATOM   10463 C CD   . PRO A 1 33 ? -0.287  -10.712 -0.374  1.00 0.00 ? 33 PRO A CD   12 
ATOM   10464 H HA   . PRO A 1 33 ? 1.729   -8.681  1.036   1.00 0.00 ? 33 PRO A HA   12 
ATOM   10465 H HB2  . PRO A 1 33 ? -0.878  -8.253  1.735   1.00 0.00 ? 33 PRO A HB2  12 
ATOM   10466 H HB3  . PRO A 1 33 ? -0.180  -7.673  0.236   1.00 0.00 ? 33 PRO A HB3  12 
ATOM   10467 H HG2  . PRO A 1 33 ? -2.017  -9.949  0.667   1.00 0.00 ? 33 PRO A HG2  12 
ATOM   10468 H HG3  . PRO A 1 33 ? -1.652  -9.100  -0.822  1.00 0.00 ? 33 PRO A HG3  12 
ATOM   10469 H HD2  . PRO A 1 33 ? -0.665  -11.673 -0.026  1.00 0.00 ? 33 PRO A HD2  12 
ATOM   10470 H HD3  . PRO A 1 33 ? -0.210  -10.774 -1.459  1.00 0.00 ? 33 PRO A HD3  12 
ATOM   10471 N N    . VAL A 1 34 ? 1.505   -8.893  3.470   1.00 0.00 ? 34 VAL A N    12 
ATOM   10472 C CA   . VAL A 1 34 ? 1.626   -9.219  4.880   1.00 0.00 ? 34 VAL A CA   12 
ATOM   10473 C C    . VAL A 1 34 ? 0.729   -8.284  5.694   1.00 0.00 ? 34 VAL A C    12 
ATOM   10474 O O    . VAL A 1 34 ? 0.107   -8.706  6.667   1.00 0.00 ? 34 VAL A O    12 
ATOM   10475 C CB   . VAL A 1 34 ? 3.094   -9.159  5.307   1.00 0.00 ? 34 VAL A CB   12 
ATOM   10476 C CG1  . VAL A 1 34 ? 3.669   -7.756  5.102   1.00 0.00 ? 34 VAL A CG1  12 
ATOM   10477 C CG2  . VAL A 1 34 ? 3.263   -9.614  6.758   1.00 0.00 ? 34 VAL A CG2  12 
ATOM   10478 H H    . VAL A 1 34 ? 1.826   -7.980  3.217   1.00 0.00 ? 34 VAL A H    12 
ATOM   10479 H HA   . VAL A 1 34 ? 1.277   -10.243 5.013   1.00 0.00 ? 34 VAL A HA   12 
ATOM   10480 H HB   . VAL A 1 34 ? 3.655   -9.846  4.674   1.00 0.00 ? 34 VAL A HB   12 
ATOM   10481 H HG11 . VAL A 1 34 ? 2.984   -7.019  5.521   1.00 0.00 ? 34 VAL A HG11 12 
ATOM   10482 H HG12 . VAL A 1 34 ? 4.634   -7.681  5.604   1.00 0.00 ? 34 VAL A HG12 12 
ATOM   10483 H HG21 . VAL A 1 34 ? 3.410   -10.694 6.785   1.00 0.00 ? 34 VAL A HG21 12 
ATOM   10484 H HG22 . VAL A 1 34 ? 4.129   -9.118  7.196   1.00 0.00 ? 34 VAL A HG22 12 
ATOM   10485 N N    . LYS A 1 35 ? 0.691   -7.030  5.265   1.00 0.00 ? 35 LYS A N    12 
ATOM   10486 C CA   . LYS A 1 35 ? -0.119  -6.032  5.941   1.00 0.00 ? 35 LYS A CA   12 
ATOM   10487 C C    . LYS A 1 35 ? -0.366  -4.856  4.995   1.00 0.00 ? 35 LYS A C    12 
ATOM   10488 O O    . LYS A 1 35 ? 0.504   -4.497  4.203   1.00 0.00 ? 35 LYS A O    12 
ATOM   10489 C CB   . LYS A 1 35 ? 0.525   -5.629  7.269   1.00 0.00 ? 35 LYS A CB   12 
ATOM   10490 C CG   . LYS A 1 35 ? -0.427  -4.768  8.101   1.00 0.00 ? 35 LYS A CG   12 
ATOM   10491 C CD   . LYS A 1 35 ? 0.335   -3.671  8.848   1.00 0.00 ? 35 LYS A CD   12 
ATOM   10492 C CE   . LYS A 1 35 ? 1.027   -4.233  10.091  1.00 0.00 ? 35 LYS A CE   12 
ATOM   10493 N NZ   . LYS A 1 35 ? 0.775   -3.364  11.262  1.00 0.00 ? 35 LYS A NZ   12 
ATOM   10494 H H    . LYS A 1 35 ? 1.200   -6.695  4.472   1.00 0.00 ? 35 LYS A H    12 
ATOM   10495 H HA   . LYS A 1 35 ? -1.078  -6.494  6.176   1.00 0.00 ? 35 LYS A HA   12 
ATOM   10496 H HB2  . LYS A 1 35 ? 0.800   -6.521  7.831   1.00 0.00 ? 35 LYS A HB2  12 
ATOM   10497 H HB3  . LYS A 1 35 ? 1.446   -5.078  7.078   1.00 0.00 ? 35 LYS A HB3  12 
ATOM   10498 H HG2  . LYS A 1 35 ? -1.177  -4.317  7.452   1.00 0.00 ? 35 LYS A HG2  12 
ATOM   10499 H HG3  . LYS A 1 35 ? -0.960  -5.396  8.816   1.00 0.00 ? 35 LYS A HG3  12 
ATOM   10500 H HD2  . LYS A 1 35 ? 1.077   -3.224  8.186   1.00 0.00 ? 35 LYS A HD2  12 
ATOM   10501 H HD3  . LYS A 1 35 ? -0.353  -2.877  9.138   1.00 0.00 ? 35 LYS A HD3  12 
ATOM   10502 H HE2  . LYS A 1 35 ? 0.663   -5.241  10.293  1.00 0.00 ? 35 LYS A HE2  12 
ATOM   10503 H HE3  . LYS A 1 35 ? 2.100   -4.312  9.914   1.00 0.00 ? 35 LYS A HE3  12 
ATOM   10504 H HZ1  . LYS A 1 35 ? 1.524   -2.709  11.358  1.00 0.00 ? 35 LYS A HZ1  12 
ATOM   10505 H HZ2  . LYS A 1 35 ? -0.085  -2.871  11.132  1.00 0.00 ? 35 LYS A HZ2  12 
ATOM   10506 N N    . ARG A 1 36 ? -1.557  -4.259  5.081   1.00 0.00 ? 36 ARG A N    12 
ATOM   10507 C CA   . ARG A 1 36 ? -1.912  -3.135  4.239   1.00 0.00 ? 36 ARG A CA   12 
ATOM   10508 C C    . ARG A 1 36 ? -2.783  -2.160  5.020   1.00 0.00 ? 36 ARG A C    12 
ATOM   10509 O O    . ARG A 1 36 ? -3.202  -2.457  6.137   1.00 0.00 ? 36 ARG A O    12 
ATOM   10510 C CB   . ARG A 1 36 ? -2.646  -3.640  3.000   1.00 0.00 ? 36 ARG A CB   12 
ATOM   10511 C CG   . ARG A 1 36 ? -1.653  -4.328  2.067   1.00 0.00 ? 36 ARG A CG   12 
ATOM   10512 C CD   . ARG A 1 36 ? -2.014  -5.806  1.941   1.00 0.00 ? 36 ARG A CD   12 
ATOM   10513 N NE   . ARG A 1 36 ? -3.222  -5.985  1.135   1.00 0.00 ? 36 ARG A NE   12 
ATOM   10514 C CZ   . ARG A 1 36 ? -3.895  -7.142  1.083   1.00 0.00 ? 36 ARG A CZ   12 
ATOM   10515 N NH1  . ARG A 1 36 ? -3.468  -8.197  1.790   1.00 0.00 ? 36 ARG A NH1  12 
ATOM   10516 N NH2  . ARG A 1 36 ? -4.995  -7.244  0.325   1.00 0.00 ? 36 ARG A NH2  12 
ATOM   10517 H H    . ARG A 1 36 ? -2.237  -4.592  5.749   1.00 0.00 ? 36 ARG A H    12 
ATOM   10518 H HA   . ARG A 1 36 ? -1.002  -2.623  3.927   1.00 0.00 ? 36 ARG A HA   12 
ATOM   10519 H HB2  . ARG A 1 36 ? -3.416  -4.351  3.299   1.00 0.00 ? 36 ARG A HB2  12 
ATOM   10520 H HB3  . ARG A 1 36 ? -3.108  -2.799  2.483   1.00 0.00 ? 36 ARG A HB3  12 
ATOM   10521 H HG2  . ARG A 1 36 ? -1.694  -3.859  1.084   1.00 0.00 ? 36 ARG A HG2  12 
ATOM   10522 H HG3  . ARG A 1 36 ? -0.646  -4.233  2.474   1.00 0.00 ? 36 ARG A HG3  12 
ATOM   10523 H HD2  . ARG A 1 36 ? -1.187  -6.336  1.468   1.00 0.00 ? 36 ARG A HD2  12 
ATOM   10524 H HD3  . ARG A 1 36 ? -2.182  -6.219  2.935   1.00 0.00 ? 36 ARG A HD3  12 
ATOM   10525 H HE   . ARG A 1 36 ? -3.552  -5.195  0.599   1.00 0.00 ? 36 ARG A HE   12 
ATOM   10526 H HH11 . ARG A 1 36 ? -2.639  -8.120  2.362   1.00 0.00 ? 36 ARG A HH11 12 
ATOM   10527 H HH12 . ARG A 1 36 ? -3.975  -9.070  1.751   1.00 0.00 ? 36 ARG A HH12 12 
ATOM   10528 H HH21 . ARG A 1 36 ? -5.317  -6.449  -0.208  1.00 0.00 ? 36 ARG A HH21 12 
ATOM   10529 H HH22 . ARG A 1 36 ? -5.502  -8.117  0.286   1.00 0.00 ? 36 ARG A HH22 12 
ATOM   10530 N N    . GLY A 1 37 ? -3.032  -1.013  4.405   1.00 0.00 ? 37 GLY A N    12 
ATOM   10531 C CA   . GLY A 1 37 ? -3.849  0.010   5.033   1.00 0.00 ? 37 GLY A CA   12 
ATOM   10532 C C    . GLY A 1 37 ? -3.792  1.319   4.243   1.00 0.00 ? 37 GLY A C    12 
ATOM   10533 O O    . GLY A 1 37 ? -3.344  1.338   3.098   1.00 0.00 ? 37 GLY A O    12 
ATOM   10534 H H    . GLY A 1 37 ? -2.686  -0.779  3.496   1.00 0.00 ? 37 GLY A H    12 
ATOM   10535 H HA2  . GLY A 1 37 ? -4.881  -0.334  5.100   1.00 0.00 ? 37 GLY A HA2  12 
ATOM   10536 H HA3  . GLY A 1 37 ? -3.504  0.182   6.053   1.00 0.00 ? 37 GLY A HA3  12 
ATOM   10537 N N    . CYS A 1 38 ? -4.252  2.382   4.887   1.00 0.00 ? 38 CYS A N    12 
ATOM   10538 C CA   . CYS A 1 38 ? -4.259  3.693   4.258   1.00 0.00 ? 38 CYS A CA   12 
ATOM   10539 C C    . CYS A 1 38 ? -3.024  4.460   4.735   1.00 0.00 ? 38 CYS A C    12 
ATOM   10540 O O    . CYS A 1 38 ? -2.473  4.161   5.793   1.00 0.00 ? 38 CYS A O    12 
ATOM   10541 C CB   . CYS A 1 38 ? -5.553  4.454   4.552   1.00 0.00 ? 38 CYS A CB   12 
ATOM   10542 S SG   . CYS A 1 38 ? -7.066  3.690   3.862   1.00 0.00 ? 38 CYS A SG   12 
ATOM   10543 H H    . CYS A 1 38 ? -4.615  2.359   5.818   1.00 0.00 ? 38 CYS A H    12 
ATOM   10544 H HA   . CYS A 1 38 ? -4.218  3.524   3.182   1.00 0.00 ? 38 CYS A HA   12 
ATOM   10545 H HB2  . CYS A 1 38 ? -5.669  4.543   5.632   1.00 0.00 ? 38 CYS A HB2  12 
ATOM   10546 H HB3  . CYS A 1 38 ? -5.461  5.466   4.157   1.00 0.00 ? 38 CYS A HB3  12 
ATOM   10547 N N    . ILE A 1 39 ? -2.627  5.436   3.931   1.00 0.00 ? 39 ILE A N    12 
ATOM   10548 C CA   . ILE A 1 39 ? -1.467  6.249   4.258   1.00 0.00 ? 39 ILE A CA   12 
ATOM   10549 C C    . ILE A 1 39 ? -1.474  7.510   3.391   1.00 0.00 ? 39 ILE A C    12 
ATOM   10550 O O    . ILE A 1 39 ? -2.389  7.715   2.595   1.00 0.00 ? 39 ILE A O    12 
ATOM   10551 C CB   . ILE A 1 39 ? -0.184  5.425   4.136   1.00 0.00 ? 39 ILE A CB   12 
ATOM   10552 C CG1  . ILE A 1 39 ? 0.839   5.843   5.195   1.00 0.00 ? 39 ILE A CG1  12 
ATOM   10553 C CG2  . ILE A 1 39 ? 0.390   5.511   2.720   1.00 0.00 ? 39 ILE A CG2  12 
ATOM   10554 C CD1  . ILE A 1 39 ? 1.304   4.637   6.013   1.00 0.00 ? 39 ILE A CD1  12 
ATOM   10555 H H    . ILE A 1 39 ? -3.081  5.673   3.073   1.00 0.00 ? 39 ILE A H    12 
ATOM   10556 H HA   . ILE A 1 39 ? -1.561  6.546   5.302   1.00 0.00 ? 39 ILE A HA   12 
ATOM   10557 H HB   . ILE A 1 39 ? -0.430  4.379   4.320   1.00 0.00 ? 39 ILE A HB   12 
ATOM   10558 H HG12 . ILE A 1 39 ? 1.696   6.312   4.712   1.00 0.00 ? 39 ILE A HG12 12 
ATOM   10559 H HG13 . ILE A 1 39 ? 0.398   6.588   5.857   1.00 0.00 ? 39 ILE A HG13 12 
ATOM   10560 H HG21 . ILE A 1 39 ? 1.362   5.019   2.692   1.00 0.00 ? 39 ILE A HG21 12 
ATOM   10561 H HG22 . ILE A 1 39 ? -0.287  5.016   2.023   1.00 0.00 ? 39 ILE A HG22 12 
ATOM   10562 H HD11 . ILE A 1 39 ? 0.457   3.979   6.205   1.00 0.00 ? 39 ILE A HD11 12 
ATOM   10563 H HD12 . ILE A 1 39 ? 2.067   4.093   5.456   1.00 0.00 ? 39 ILE A HD12 12 
ATOM   10564 N N    . ASP A 1 40 ? -0.450  8.350   3.551   1.00 0.00 ? 40 ASP A N    12 
ATOM   10565 C CA   . ASP A 1 40 ? -0.343  9.579   2.790   1.00 0.00 ? 40 ASP A CA   12 
ATOM   10566 C C    . ASP A 1 40 ? 0.787   9.460   1.778   1.00 0.00 ? 40 ASP A C    12 
ATOM   10567 O O    . ASP A 1 40 ? 0.608   9.783   0.605   1.00 0.00 ? 40 ASP A O    12 
ATOM   10568 C CB   . ASP A 1 40 ? -0.096  10.746  3.742   1.00 0.00 ? 40 ASP A CB   12 
ATOM   10569 C CG   . ASP A 1 40 ? -0.201  12.076  3.010   1.00 0.00 ? 40 ASP A CG   12 
ATOM   10570 O OD1  . ASP A 1 40 ? 0.307   13.073  3.568   1.00 0.00 ? 40 ASP A OD1  12 
ATOM   10571 O OD2  . ASP A 1 40 ? -0.788  12.072  1.907   1.00 0.00 ? 40 ASP A OD2  12 
ATOM   10572 H H    . ASP A 1 40 ? 0.276   8.135   4.219   1.00 0.00 ? 40 ASP A H    12 
ATOM   10573 H HA   . ASP A 1 40 ? -1.279  9.749   2.258   1.00 0.00 ? 40 ASP A HA   12 
ATOM   10574 H HB2  . ASP A 1 40 ? -0.836  10.718  4.542   1.00 0.00 ? 40 ASP A HB2  12 
ATOM   10575 H HB3  . ASP A 1 40 ? 0.901   10.652  4.172   1.00 0.00 ? 40 ASP A HB3  12 
ATOM   10576 H HD2  . ASP A 1 40 ? -0.821  12.939  1.496   1.00 0.00 ? 40 ASP A HD2  12 
ATOM   10577 N N    . VAL A 1 41 ? 1.930   8.997   2.264   1.00 0.00 ? 41 VAL A N    12 
ATOM   10578 C CA   . VAL A 1 41 ? 3.093   8.832   1.410   1.00 0.00 ? 41 VAL A CA   12 
ATOM   10579 C C    . VAL A 1 41 ? 3.571   7.380   1.480   1.00 0.00 ? 41 VAL A C    12 
ATOM   10580 O O    . VAL A 1 41 ? 3.294   6.678   2.452   1.00 0.00 ? 41 VAL A O    12 
ATOM   10581 C CB   . VAL A 1 41 ? 4.178   9.837   1.802   1.00 0.00 ? 41 VAL A CB   12 
ATOM   10582 C CG1  . VAL A 1 41 ? 5.500   9.520   1.101   1.00 0.00 ? 41 VAL A CG1  12 
ATOM   10583 C CG2  . VAL A 1 41 ? 3.730   11.270  1.505   1.00 0.00 ? 41 VAL A CG2  12 
ATOM   10584 H H    . VAL A 1 41 ? 2.067   8.737   3.220   1.00 0.00 ? 41 VAL A H    12 
ATOM   10585 H HA   . VAL A 1 41 ? 2.785   9.050   0.387   1.00 0.00 ? 41 VAL A HA   12 
ATOM   10586 H HB   . VAL A 1 41 ? 4.340   9.753   2.877   1.00 0.00 ? 41 VAL A HB   12 
ATOM   10587 H HG11 . VAL A 1 41 ? 6.204   10.335  1.267   1.00 0.00 ? 41 VAL A HG11 12 
ATOM   10588 H HG12 . VAL A 1 41 ? 5.913   8.595   1.505   1.00 0.00 ? 41 VAL A HG12 12 
ATOM   10589 H HG21 . VAL A 1 41 ? 4.120   11.939  2.272   1.00 0.00 ? 41 VAL A HG21 12 
ATOM   10590 H HG22 . VAL A 1 41 ? 4.110   11.575  0.530   1.00 0.00 ? 41 VAL A HG22 12 
ATOM   10591 N N    . CYS A 1 42 ? 4.281   6.972   0.438   1.00 0.00 ? 42 CYS A N    12 
ATOM   10592 C CA   . CYS A 1 42 ? 4.800   5.617   0.370   1.00 0.00 ? 42 CYS A CA   12 
ATOM   10593 C C    . CYS A 1 42 ? 6.215   5.614   0.950   1.00 0.00 ? 42 CYS A C    12 
ATOM   10594 O O    . CYS A 1 42 ? 7.001   6.523   0.684   1.00 0.00 ? 42 CYS A O    12 
ATOM   10595 C CB   . CYS A 1 42 ? 4.767   5.070   -1.059  1.00 0.00 ? 42 CYS A CB   12 
ATOM   10596 S SG   . CYS A 1 42 ? 3.999   3.418   -1.231  1.00 0.00 ? 42 CYS A SG   12 
ATOM   10597 H H    . CYS A 1 42 ? 4.502   7.550   -0.348  1.00 0.00 ? 42 CYS A H    12 
ATOM   10598 H HA   . CYS A 1 42 ? 4.134   4.996   0.970   1.00 0.00 ? 42 CYS A HA   12 
ATOM   10599 H HB2  . CYS A 1 42 ? 4.227   5.775   -1.690  1.00 0.00 ? 42 CYS A HB2  12 
ATOM   10600 H HB3  . CYS A 1 42 ? 5.788   5.022   -1.437  1.00 0.00 ? 42 CYS A HB3  12 
ATOM   10601 N N    . PRO A 1 43 ? 6.505   4.556   1.754   1.00 0.00 ? 43 PRO A N    12 
ATOM   10602 C CA   . PRO A 1 43 ? 7.812   4.423   2.374   1.00 0.00 ? 43 PRO A CA   12 
ATOM   10603 C C    . PRO A 1 43 ? 8.861   3.980   1.353   1.00 0.00 ? 43 PRO A C    12 
ATOM   10604 O O    . PRO A 1 43 ? 8.519   3.452   0.296   1.00 0.00 ? 43 PRO A O    12 
ATOM   10605 C CB   . PRO A 1 43 ? 7.615   3.419   3.497   1.00 0.00 ? 43 PRO A CB   12 
ATOM   10606 C CG   . PRO A 1 43 ? 6.326   2.680   3.174   1.00 0.00 ? 43 PRO A CG   12 
ATOM   10607 C CD   . PRO A 1 43 ? 5.600   3.462   2.092   1.00 0.00 ? 43 PRO A CD   12 
ATOM   10608 H HA   . PRO A 1 43 ? 8.124   5.309   2.719   1.00 0.00 ? 43 PRO A HA   12 
ATOM   10609 H HB2  . PRO A 1 43 ? 8.456   2.729   3.557   1.00 0.00 ? 43 PRO A HB2  12 
ATOM   10610 H HB3  . PRO A 1 43 ? 7.545   3.920   4.463   1.00 0.00 ? 43 PRO A HB3  12 
ATOM   10611 H HG2  . PRO A 1 43 ? 6.542   1.667   2.833   1.00 0.00 ? 43 PRO A HG2  12 
ATOM   10612 H HG3  . PRO A 1 43 ? 5.704   2.590   4.064   1.00 0.00 ? 43 PRO A HG3  12 
ATOM   10613 H HD2  . PRO A 1 43 ? 5.392   2.837   1.223   1.00 0.00 ? 43 PRO A HD2  12 
ATOM   10614 H HD3  . PRO A 1 43 ? 4.641   3.837   2.451   1.00 0.00 ? 43 PRO A HD3  12 
ATOM   10615 N N    . LYS A 1 44 ? 10.118  4.210   1.704   1.00 0.00 ? 44 LYS A N    12 
ATOM   10616 C CA   . LYS A 1 44 ? 11.219  3.841   0.831   1.00 0.00 ? 44 LYS A CA   12 
ATOM   10617 C C    . LYS A 1 44 ? 11.171  2.335   0.567   1.00 0.00 ? 44 LYS A C    12 
ATOM   10618 O O    . LYS A 1 44 ? 10.922  1.548   1.479   1.00 0.00 ? 44 LYS A O    12 
ATOM   10619 C CB   . LYS A 1 44 ? 12.550  4.321   1.415   1.00 0.00 ? 44 LYS A CB   12 
ATOM   10620 C CG   . LYS A 1 44 ? 13.727  3.844   0.561   1.00 0.00 ? 44 LYS A CG   12 
ATOM   10621 C CD   . LYS A 1 44 ? 14.481  5.029   -0.043  1.00 0.00 ? 44 LYS A CD   12 
ATOM   10622 C CE   . LYS A 1 44 ? 15.438  4.566   -1.144  1.00 0.00 ? 44 LYS A CE   12 
ATOM   10623 N NZ   . LYS A 1 44 ? 16.839  4.864   -0.772  1.00 0.00 ? 44 LYS A NZ   12 
ATOM   10624 H H    . LYS A 1 44 ? 10.388  4.640   2.566   1.00 0.00 ? 44 LYS A H    12 
ATOM   10625 H HA   . LYS A 1 44 ? 11.075  4.363   -0.115  1.00 0.00 ? 44 LYS A HA   12 
ATOM   10626 H HB2  . LYS A 1 44 ? 12.555  5.410   1.472   1.00 0.00 ? 44 LYS A HB2  12 
ATOM   10627 H HB3  . LYS A 1 44 ? 12.660  3.949   2.433   1.00 0.00 ? 44 LYS A HB3  12 
ATOM   10628 H HG2  . LYS A 1 44 ? 14.406  3.249   1.172   1.00 0.00 ? 44 LYS A HG2  12 
ATOM   10629 H HG3  . LYS A 1 44 ? 13.363  3.195   -0.235  1.00 0.00 ? 44 LYS A HG3  12 
ATOM   10630 H HD2  . LYS A 1 44 ? 13.770  5.747   -0.453  1.00 0.00 ? 44 LYS A HD2  12 
ATOM   10631 H HD3  . LYS A 1 44 ? 15.041  5.545   0.737   1.00 0.00 ? 44 LYS A HD3  12 
ATOM   10632 H HE2  . LYS A 1 44 ? 15.319  3.496   -1.311  1.00 0.00 ? 44 LYS A HE2  12 
ATOM   10633 H HE3  . LYS A 1 44 ? 15.191  5.064   -2.082  1.00 0.00 ? 44 LYS A HE3  12 
ATOM   10634 H HZ1  . LYS A 1 44 ? 17.445  4.184   -1.185  1.00 0.00 ? 44 LYS A HZ1  12 
ATOM   10635 H HZ2  . LYS A 1 44 ? 17.085  5.775   -1.102  1.00 0.00 ? 44 LYS A HZ2  12 
ATOM   10636 N N    . SER A 1 45 ? 11.415  1.978   -0.686  1.00 0.00 ? 45 SER A N    12 
ATOM   10637 C CA   . SER A 1 45 ? 11.403  0.580   -1.082  1.00 0.00 ? 45 SER A CA   12 
ATOM   10638 C C    . SER A 1 45 ? 12.802  -0.019  -0.928  1.00 0.00 ? 45 SER A C    12 
ATOM   10639 O O    . SER A 1 45 ? 13.778  0.537   -1.429  1.00 0.00 ? 45 SER A O    12 
ATOM   10640 C CB   . SER A 1 45 ? 10.912  0.420   -2.522  1.00 0.00 ? 45 SER A CB   12 
ATOM   10641 O OG   . SER A 1 45 ? 9.528   0.088   -2.580  1.00 0.00 ? 45 SER A OG   12 
ATOM   10642 H H    . SER A 1 45 ? 11.618  2.624   -1.422  1.00 0.00 ? 45 SER A H    12 
ATOM   10643 H HA   . SER A 1 45 ? 10.702  0.094   -0.404  1.00 0.00 ? 45 SER A HA   12 
ATOM   10644 H HB2  . SER A 1 45 ? 11.087  1.346   -3.070  1.00 0.00 ? 45 SER A HB2  12 
ATOM   10645 H HB3  . SER A 1 45 ? 11.493  -0.358  -3.018  1.00 0.00 ? 45 SER A HB3  12 
ATOM   10646 H HG   . SER A 1 45 ? 9.006   0.861   -2.941  1.00 0.00 ? 45 SER A HG   12 
ATOM   10647 N N    . SER A 1 46 ? 12.856  -1.146  -0.233  1.00 0.00 ? 46 SER A N    12 
ATOM   10648 C CA   . SER A 1 46 ? 14.119  -1.827  -0.007  1.00 0.00 ? 46 SER A CA   12 
ATOM   10649 C C    . SER A 1 46 ? 14.164  -3.127  -0.812  1.00 0.00 ? 46 SER A C    12 
ATOM   10650 O O    . SER A 1 46 ? 13.180  -3.503  -1.445  1.00 0.00 ? 46 SER A O    12 
ATOM   10651 C CB   . SER A 1 46 ? 14.330  -2.116  1.481   1.00 0.00 ? 46 SER A CB   12 
ATOM   10652 O OG   . SER A 1 46 ? 13.417  -3.096  1.969   1.00 0.00 ? 46 SER A OG   12 
ATOM   10653 H H    . SER A 1 46 ? 12.057  -1.592  0.172   1.00 0.00 ? 46 SER A H    12 
ATOM   10654 H HA   . SER A 1 46 ? 14.886  -1.135  -0.354  1.00 0.00 ? 46 SER A HA   12 
ATOM   10655 H HB2  . SER A 1 46 ? 15.352  -2.461  1.641   1.00 0.00 ? 46 SER A HB2  12 
ATOM   10656 H HB3  . SER A 1 46 ? 14.212  -1.195  2.050   1.00 0.00 ? 46 SER A HB3  12 
ATOM   10657 H HG   . SER A 1 46 ? 12.829  -3.415  1.226   1.00 0.00 ? 46 SER A HG   12 
ATOM   10658 N N    . LEU A 1 47 ? 15.318  -3.776  -0.763  1.00 0.00 ? 47 LEU A N    12 
ATOM   10659 C CA   . LEU A 1 47 ? 15.505  -5.026  -1.480  1.00 0.00 ? 47 LEU A CA   12 
ATOM   10660 C C    . LEU A 1 47 ? 14.736  -6.139  -0.765  1.00 0.00 ? 47 LEU A C    12 
ATOM   10661 O O    . LEU A 1 47 ? 13.998  -6.893  -1.397  1.00 0.00 ? 47 LEU A O    12 
ATOM   10662 C CB   . LEU A 1 47 ? 16.995  -5.324  -1.658  1.00 0.00 ? 47 LEU A CB   12 
ATOM   10663 C CG   . LEU A 1 47 ? 17.688  -4.607  -2.818  1.00 0.00 ? 47 LEU A CG   12 
ATOM   10664 C CD1  . LEU A 1 47 ? 19.207  -4.774  -2.736  1.00 0.00 ? 47 LEU A CD1  12 
ATOM   10665 C CD2  . LEU A 1 47 ? 17.132  -5.077  -4.164  1.00 0.00 ? 47 LEU A CD2  12 
ATOM   10666 H H    . LEU A 1 47 ? 16.115  -3.463  -0.245  1.00 0.00 ? 47 LEU A H    12 
ATOM   10667 H HA   . LEU A 1 47 ? 15.081  -4.898  -2.476  1.00 0.00 ? 47 LEU A HA   12 
ATOM   10668 H HB2  . LEU A 1 47 ? 17.511  -5.062  -0.734  1.00 0.00 ? 47 LEU A HB2  12 
ATOM   10669 H HB3  . LEU A 1 47 ? 17.116  -6.399  -1.796  1.00 0.00 ? 47 LEU A HB3  12 
ATOM   10670 H HG   . LEU A 1 47 ? 17.477  -3.541  -2.737  1.00 0.00 ? 47 LEU A HG   12 
ATOM   10671 H HD11 . LEU A 1 47 ? 19.690  -3.996  -3.327  1.00 0.00 ? 47 LEU A HD11 12 
ATOM   10672 H HD12 . LEU A 1 47 ? 19.526  -4.692  -1.697  1.00 0.00 ? 47 LEU A HD12 12 
ATOM   10673 H HD21 . LEU A 1 47 ? 17.109  -6.166  -4.187  1.00 0.00 ? 47 LEU A HD21 12 
ATOM   10674 H HD22 . LEU A 1 47 ? 16.122  -4.690  -4.294  1.00 0.00 ? 47 LEU A HD22 12 
ATOM   10675 N N    . LEU A 1 48 ? 14.936  -6.207  0.543   1.00 0.00 ? 48 LEU A N    12 
ATOM   10676 C CA   . LEU A 1 48 ? 14.271  -7.215  1.350   1.00 0.00 ? 48 LEU A CA   12 
ATOM   10677 C C    . LEU A 1 48 ? 12.758  -7.109  1.147   1.00 0.00 ? 48 LEU A C    12 
ATOM   10678 O O    . LEU A 1 48 ? 12.139  -8.008  0.580   1.00 0.00 ? 48 LEU A O    12 
ATOM   10679 C CB   . LEU A 1 48 ? 14.704  -7.101  2.813   1.00 0.00 ? 48 LEU A CB   12 
ATOM   10680 C CG   . LEU A 1 48 ? 14.206  -8.206  3.748   1.00 0.00 ? 48 LEU A CG   12 
ATOM   10681 C CD1  . LEU A 1 48 ? 15.297  -9.250  3.993   1.00 0.00 ? 48 LEU A CD1  12 
ATOM   10682 C CD2  . LEU A 1 48 ? 13.672  -7.618  5.056   1.00 0.00 ? 48 LEU A CD2  12 
ATOM   10683 H H    . LEU A 1 48 ? 15.538  -5.590  1.049   1.00 0.00 ? 48 LEU A H    12 
ATOM   10684 H HA   . LEU A 1 48 ? 14.600  -8.190  0.992   1.00 0.00 ? 48 LEU A HA   12 
ATOM   10685 H HB2  . LEU A 1 48 ? 15.793  -7.086  2.849   1.00 0.00 ? 48 LEU A HB2  12 
ATOM   10686 H HB3  . LEU A 1 48 ? 14.359  -6.143  3.200   1.00 0.00 ? 48 LEU A HB3  12 
ATOM   10687 H HG   . LEU A 1 48 ? 13.375  -8.717  3.261   1.00 0.00 ? 48 LEU A HG   12 
ATOM   10688 H HD11 . LEU A 1 48 ? 16.147  -9.047  3.341   1.00 0.00 ? 48 LEU A HD11 12 
ATOM   10689 H HD12 . LEU A 1 48 ? 15.618  -9.203  5.033   1.00 0.00 ? 48 LEU A HD12 12 
ATOM   10690 H HD21 . LEU A 1 48 ? 13.522  -6.545  4.937   1.00 0.00 ? 48 LEU A HD21 12 
ATOM   10691 H HD22 . LEU A 1 48 ? 12.722  -8.092  5.306   1.00 0.00 ? 48 LEU A HD22 12 
ATOM   10692 N N    . VAL A 1 49 ? 12.206  -6.001  1.620   1.00 0.00 ? 49 VAL A N    12 
ATOM   10693 C CA   . VAL A 1 49 ? 10.777  -5.766  1.497   1.00 0.00 ? 49 VAL A CA   12 
ATOM   10694 C C    . VAL A 1 49 ? 10.537  -4.617  0.516   1.00 0.00 ? 49 VAL A C    12 
ATOM   10695 O O    . VAL A 1 49 ? 11.343  -3.692  0.428   1.00 0.00 ? 49 VAL A O    12 
ATOM   10696 C CB   . VAL A 1 49 ? 10.168  -5.510  2.878   1.00 0.00 ? 49 VAL A CB   12 
ATOM   10697 C CG1  . VAL A 1 49 ? 10.226  -6.769  3.744   1.00 0.00 ? 49 VAL A CG1  12 
ATOM   10698 C CG2  . VAL A 1 49 ? 10.859  -4.334  3.572   1.00 0.00 ? 49 VAL A CG2  12 
ATOM   10699 H H    . VAL A 1 49 ? 12.716  -5.274  2.080   1.00 0.00 ? 49 VAL A H    12 
ATOM   10700 H HA   . VAL A 1 49 ? 10.328  -6.673  1.093   1.00 0.00 ? 49 VAL A HA   12 
ATOM   10701 H HB   . VAL A 1 49 ? 9.120   -5.247  2.738   1.00 0.00 ? 49 VAL A HB   12 
ATOM   10702 H HG11 . VAL A 1 49 ? 9.216   -7.148  3.902   1.00 0.00 ? 49 VAL A HG11 12 
ATOM   10703 H HG12 . VAL A 1 49 ? 10.825  -7.529  3.242   1.00 0.00 ? 49 VAL A HG12 12 
ATOM   10704 H HG21 . VAL A 1 49 ? 11.898  -4.593  3.776   1.00 0.00 ? 49 VAL A HG21 12 
ATOM   10705 H HG22 . VAL A 1 49 ? 10.823  -3.458  2.925   1.00 0.00 ? 49 VAL A HG22 12 
ATOM   10706 N N    . LYS A 1 50 ? 9.425   -4.714  -0.198  1.00 0.00 ? 50 LYS A N    12 
ATOM   10707 C CA   . LYS A 1 50 ? 9.068   -3.695  -1.170  1.00 0.00 ? 50 LYS A CA   12 
ATOM   10708 C C    . LYS A 1 50 ? 7.622   -3.255  -0.934  1.00 0.00 ? 50 LYS A C    12 
ATOM   10709 O O    . LYS A 1 50 ? 6.782   -4.060  -0.535  1.00 0.00 ? 50 LYS A O    12 
ATOM   10710 C CB   . LYS A 1 50 ? 9.335   -4.194  -2.592  1.00 0.00 ? 50 LYS A CB   12 
ATOM   10711 C CG   . LYS A 1 50 ? 10.350  -3.298  -3.305  1.00 0.00 ? 50 LYS A CG   12 
ATOM   10712 C CD   . LYS A 1 50 ? 10.720  -3.872  -4.674  1.00 0.00 ? 50 LYS A CD   12 
ATOM   10713 C CE   . LYS A 1 50 ? 10.646  -2.796  -5.759  1.00 0.00 ? 50 LYS A CE   12 
ATOM   10714 N NZ   . LYS A 1 50 ? 9.237   -2.435  -6.036  1.00 0.00 ? 50 LYS A NZ   12 
ATOM   10715 H H    . LYS A 1 50 ? 8.775   -5.470  -0.120  1.00 0.00 ? 50 LYS A H    12 
ATOM   10716 H HA   . LYS A 1 50 ? 9.721   -2.839  -1.001  1.00 0.00 ? 50 LYS A HA   12 
ATOM   10717 H HB2  . LYS A 1 50 ? 9.708   -5.217  -2.558  1.00 0.00 ? 50 LYS A HB2  12 
ATOM   10718 H HB3  . LYS A 1 50 ? 8.402   -4.213  -3.155  1.00 0.00 ? 50 LYS A HB3  12 
ATOM   10719 H HG2  . LYS A 1 50 ? 9.935   -2.298  -3.427  1.00 0.00 ? 50 LYS A HG2  12 
ATOM   10720 H HG3  . LYS A 1 50 ? 11.247  -3.200  -2.694  1.00 0.00 ? 50 LYS A HG3  12 
ATOM   10721 H HD2  . LYS A 1 50 ? 11.727  -4.288  -4.638  1.00 0.00 ? 50 LYS A HD2  12 
ATOM   10722 H HD3  . LYS A 1 50 ? 10.046  -4.692  -4.924  1.00 0.00 ? 50 LYS A HD3  12 
ATOM   10723 H HE2  . LYS A 1 50 ? 11.198  -1.911  -5.440  1.00 0.00 ? 50 LYS A HE2  12 
ATOM   10724 H HE3  . LYS A 1 50 ? 11.121  -3.156  -6.671  1.00 0.00 ? 50 LYS A HE3  12 
ATOM   10725 H HZ1  . LYS A 1 50 ? 8.738   -2.355  -5.173  1.00 0.00 ? 50 LYS A HZ1  12 
ATOM   10726 H HZ2  . LYS A 1 50 ? 9.206   -1.562  -6.521  1.00 0.00 ? 50 LYS A HZ2  12 
ATOM   10727 N N    . TYR A 1 51 ? 7.376   -1.979  -1.191  1.00 0.00 ? 51 TYR A N    12 
ATOM   10728 C CA   . TYR A 1 51 ? 6.045   -1.422  -1.011  1.00 0.00 ? 51 TYR A CA   12 
ATOM   10729 C C    . TYR A 1 51 ? 5.578   -0.700  -2.277  1.00 0.00 ? 51 TYR A C    12 
ATOM   10730 O O    . TYR A 1 51 ? 6.393   -0.319  -3.115  1.00 0.00 ? 51 TYR A O    12 
ATOM   10731 C CB   . TYR A 1 51 ? 6.163   -0.407  0.127   1.00 0.00 ? 51 TYR A CB   12 
ATOM   10732 C CG   . TYR A 1 51 ? 7.126   -0.827  1.239   1.00 0.00 ? 51 TYR A CG   12 
ATOM   10733 C CD1  . TYR A 1 51 ? 7.018   -2.080  1.808   1.00 0.00 ? 51 TYR A CD1  12 
ATOM   10734 C CD2  . TYR A 1 51 ? 8.103   0.046   1.673   1.00 0.00 ? 51 TYR A CD2  12 
ATOM   10735 C CE1  . TYR A 1 51 ? 7.925   -2.475  2.855   1.00 0.00 ? 51 TYR A CE1  12 
ATOM   10736 C CE2  . TYR A 1 51 ? 9.009   -0.350  2.719   1.00 0.00 ? 51 TYR A CE2  12 
ATOM   10737 C CZ   . TYR A 1 51 ? 8.876   -1.591  3.259   1.00 0.00 ? 51 TYR A CZ   12 
ATOM   10738 O OH   . TYR A 1 51 ? 9.732   -1.965  4.247   1.00 0.00 ? 51 TYR A OH   12 
ATOM   10739 H H    . TYR A 1 51 ? 8.065   -1.331  -1.515  1.00 0.00 ? 51 TYR A H    12 
ATOM   10740 H HA   . TYR A 1 51 ? 5.363   -2.245  -0.798  1.00 0.00 ? 51 TYR A HA   12 
ATOM   10741 H HB2  . TYR A 1 51 ? 6.493   0.547   -0.284  1.00 0.00 ? 51 TYR A HB2  12 
ATOM   10742 H HB3  . TYR A 1 51 ? 5.176   -0.243  0.558   1.00 0.00 ? 51 TYR A HB3  12 
ATOM   10743 H HD1  . TYR A 1 51 ? 6.247   -2.770  1.465   1.00 0.00 ? 51 TYR A HD1  12 
ATOM   10744 H HD2  . TYR A 1 51 ? 8.188   1.035   1.223   1.00 0.00 ? 51 TYR A HD2  12 
ATOM   10745 H HE1  . TYR A 1 51 ? 7.851   -3.462  3.313   1.00 0.00 ? 51 TYR A HE1  12 
ATOM   10746 H HE2  . TYR A 1 51 ? 9.785   0.330   3.071   1.00 0.00 ? 51 TYR A HE2  12 
ATOM   10747 H HH   . TYR A 1 51 ? 10.211  -1.163  4.606   1.00 0.00 ? 51 TYR A HH   12 
ATOM   10748 N N    . VAL A 1 52 ? 4.267   -0.535  -2.374  1.00 0.00 ? 52 VAL A N    12 
ATOM   10749 C CA   . VAL A 1 52 ? 3.681   0.135   -3.523  1.00 0.00 ? 52 VAL A CA   12 
ATOM   10750 C C    . VAL A 1 52 ? 2.401   0.854   -3.091  1.00 0.00 ? 52 VAL A C    12 
ATOM   10751 O O    . VAL A 1 52 ? 1.622   0.321   -2.303  1.00 0.00 ? 52 VAL A O    12 
ATOM   10752 C CB   . VAL A 1 52 ? 3.450   -0.871  -4.653  1.00 0.00 ? 52 VAL A CB   12 
ATOM   10753 C CG1  . VAL A 1 52 ? 2.567   -0.270  -5.749  1.00 0.00 ? 52 VAL A CG1  12 
ATOM   10754 C CG2  . VAL A 1 52 ? 4.778   -1.364  -5.228  1.00 0.00 ? 52 VAL A CG2  12 
ATOM   10755 H H    . VAL A 1 52 ? 3.611   -0.848  -1.688  1.00 0.00 ? 52 VAL A H    12 
ATOM   10756 H HA   . VAL A 1 52 ? 4.399   0.876   -3.873  1.00 0.00 ? 52 VAL A HA   12 
ATOM   10757 H HB   . VAL A 1 52 ? 2.926   -1.730  -4.234  1.00 0.00 ? 52 VAL A HB   12 
ATOM   10758 H HG11 . VAL A 1 52 ? 2.602   0.817   -5.689  1.00 0.00 ? 52 VAL A HG11 12 
ATOM   10759 H HG12 . VAL A 1 52 ? 2.930   -0.592  -6.725  1.00 0.00 ? 52 VAL A HG12 12 
ATOM   10760 H HG21 . VAL A 1 52 ? 5.298   -1.963  -4.480  1.00 0.00 ? 52 VAL A HG21 12 
ATOM   10761 H HG22 . VAL A 1 52 ? 4.588   -1.973  -6.113  1.00 0.00 ? 52 VAL A HG22 12 
ATOM   10762 N N    . CYS A 1 53 ? 2.225   2.053   -3.627  1.00 0.00 ? 53 CYS A N    12 
ATOM   10763 C CA   . CYS A 1 53 ? 1.053   2.850   -3.307  1.00 0.00 ? 53 CYS A CA   12 
ATOM   10764 C C    . CYS A 1 53 ? 0.280   3.110   -4.601  1.00 0.00 ? 53 CYS A C    12 
ATOM   10765 O O    . CYS A 1 53 ? 0.784   2.849   -5.692  1.00 0.00 ? 53 CYS A O    12 
ATOM   10766 C CB   . CYS A 1 53 ? 1.431   4.152   -2.597  1.00 0.00 ? 53 CYS A CB   12 
ATOM   10767 S SG   . CYS A 1 53 ? 1.997   3.948   -0.869  1.00 0.00 ? 53 CYS A SG   12 
ATOM   10768 H H    . CYS A 1 53 ? 2.864   2.479   -4.267  1.00 0.00 ? 53 CYS A H    12 
ATOM   10769 H HA   . CYS A 1 53 ? 0.455   2.262   -2.610  1.00 0.00 ? 53 CYS A HA   12 
ATOM   10770 H HB2  . CYS A 1 53 ? 2.220   4.644   -3.167  1.00 0.00 ? 53 CYS A HB2  12 
ATOM   10771 H HB3  . CYS A 1 53 ? 0.568   4.818   -2.606  1.00 0.00 ? 53 CYS A HB3  12 
ATOM   10772 N N    . CYS A 1 54 ? -0.932  3.620   -4.437  1.00 0.00 ? 54 CYS A N    12 
ATOM   10773 C CA   . CYS A 1 54 ? -1.779  3.917   -5.579  1.00 0.00 ? 54 CYS A CA   12 
ATOM   10774 C C    . CYS A 1 54 ? -3.006  4.684   -5.081  1.00 0.00 ? 54 CYS A C    12 
ATOM   10775 O O    . CYS A 1 54 ? -3.517  4.407   -3.997  1.00 0.00 ? 54 CYS A O    12 
ATOM   10776 C CB   . CYS A 1 54 ? -2.170  2.648   -6.340  1.00 0.00 ? 54 CYS A CB   12 
ATOM   10777 S SG   . CYS A 1 54 ? -2.105  1.110   -5.351  1.00 0.00 ? 54 CYS A SG   12 
ATOM   10778 H H    . CYS A 1 54 ? -1.335  3.829   -3.546  1.00 0.00 ? 54 CYS A H    12 
ATOM   10779 H HA   . CYS A 1 54 ? -1.187  4.533   -6.257  1.00 0.00 ? 54 CYS A HA   12 
ATOM   10780 H HB2  . CYS A 1 54 ? -3.181  2.771   -6.729  1.00 0.00 ? 54 CYS A HB2  12 
ATOM   10781 H HB3  . CYS A 1 54 ? -1.509  2.539   -7.200  1.00 0.00 ? 54 CYS A HB3  12 
ATOM   10782 N N    . ASN A 1 55 ? -3.443  5.633   -5.896  1.00 0.00 ? 55 ASN A N    12 
ATOM   10783 C CA   . ASN A 1 55 ? -4.599  6.441   -5.551  1.00 0.00 ? 55 ASN A CA   12 
ATOM   10784 C C    . ASN A 1 55 ? -5.809  5.963   -6.356  1.00 0.00 ? 55 ASN A C    12 
ATOM   10785 O O    . ASN A 1 55 ? -6.366  6.717   -7.153  1.00 0.00 ? 55 ASN A O    12 
ATOM   10786 C CB   . ASN A 1 55 ? -4.361  7.915   -5.886  1.00 0.00 ? 55 ASN A CB   12 
ATOM   10787 C CG   . ASN A 1 55 ? -3.801  8.072   -7.301  1.00 0.00 ? 55 ASN A CG   12 
ATOM   10788 O OD1  . ASN A 1 55 ? -4.269  7.468   -8.252  1.00 0.00 ? 55 ASN A OD1  12 
ATOM   10789 N ND2  . ASN A 1 55 ? -2.776  8.915   -7.386  1.00 0.00 ? 55 ASN A ND2  12 
ATOM   10790 H H    . ASN A 1 55 ? -3.021  5.852   -6.776  1.00 0.00 ? 55 ASN A H    12 
ATOM   10791 H HA   . ASN A 1 55 ? -4.733  6.307   -4.477  1.00 0.00 ? 55 ASN A HA   12 
ATOM   10792 H HB2  . ASN A 1 55 ? -5.296  8.468   -5.797  1.00 0.00 ? 55 ASN A HB2  12 
ATOM   10793 H HB3  . ASN A 1 55 ? -3.666  8.348   -5.166  1.00 0.00 ? 55 ASN A HB3  12 
ATOM   10794 H HD21 . ASN A 1 55 ? -2.441  9.379   -6.567  1.00 0.00 ? 55 ASN A HD21 12 
ATOM   10795 H HD22 . ASN A 1 55 ? -2.341  9.085   -8.271  1.00 0.00 ? 55 ASN A HD22 12 
ATOM   10796 N N    . THR A 1 56 ? -6.180  4.713   -6.121  1.00 0.00 ? 56 THR A N    12 
ATOM   10797 C CA   . THR A 1 56 ? -7.313  4.126   -6.815  1.00 0.00 ? 56 THR A CA   12 
ATOM   10798 C C    . THR A 1 56 ? -8.146  3.277   -5.852  1.00 0.00 ? 56 THR A C    12 
ATOM   10799 O O    . THR A 1 56 ? -7.601  2.625   -4.963  1.00 0.00 ? 56 THR A O    12 
ATOM   10800 C CB   . THR A 1 56 ? -6.778  3.338   -8.012  1.00 0.00 ? 56 THR A CB   12 
ATOM   10801 O OG1  . THR A 1 56 ? -6.015  2.288   -7.423  1.00 0.00 ? 56 THR A OG1  12 
ATOM   10802 C CG2  . THR A 1 56 ? -5.754  4.132   -8.825  1.00 0.00 ? 56 THR A CG2  12 
ATOM   10803 H H    . THR A 1 56 ? -5.722  4.107   -5.471  1.00 0.00 ? 56 THR A H    12 
ATOM   10804 H HA   . THR A 1 56 ? -7.956  4.932   -7.168  1.00 0.00 ? 56 THR A HA   12 
ATOM   10805 H HB   . THR A 1 56 ? -7.594  2.990   -8.646  1.00 0.00 ? 56 THR A HB   12 
ATOM   10806 H HG1  . THR A 1 56 ? -6.524  1.429   -7.468  1.00 0.00 ? 56 THR A HG1  12 
ATOM   10807 H HG21 . THR A 1 56 ? -4.946  4.460   -8.171  1.00 0.00 ? 56 THR A HG21 12 
ATOM   10808 H HG22 . THR A 1 56 ? -5.348  3.500   -9.615  1.00 0.00 ? 56 THR A HG22 12 
ATOM   10809 N N    . ASP A 1 57 ? -9.468  3.290   -6.034  1.00 0.00 ? 57 ASP A N    12 
ATOM   10810 C CA   . ASP A 1 57 ? -10.365 2.528   -5.188  1.00 0.00 ? 57 ASP A CA   12 
ATOM   10811 C C    . ASP A 1 57 ? -10.040 1.045   -5.296  1.00 0.00 ? 57 ASP A C    12 
ATOM   10812 O O    . ASP A 1 57 ? -10.111 0.470   -6.379  1.00 0.00 ? 57 ASP A O    12 
ATOM   10813 C CB   . ASP A 1 57 ? -11.808 2.798   -5.604  1.00 0.00 ? 57 ASP A CB   12 
ATOM   10814 C CG   . ASP A 1 57 ? -12.428 3.888   -4.742  1.00 0.00 ? 57 ASP A CG   12 
ATOM   10815 O OD1  . ASP A 1 57 ? -11.840 4.172   -3.676  1.00 0.00 ? 57 ASP A OD1  12 
ATOM   10816 O OD2  . ASP A 1 57 ? -13.478 4.418   -5.165  1.00 0.00 ? 57 ASP A OD2  12 
ATOM   10817 H H    . ASP A 1 57 ? -9.866  3.843   -6.780  1.00 0.00 ? 57 ASP A H    12 
ATOM   10818 H HA   . ASP A 1 57 ? -10.230 2.845   -4.153  1.00 0.00 ? 57 ASP A HA   12 
ATOM   10819 H HB2  . ASP A 1 57 ? -11.827 3.112   -6.648  1.00 0.00 ? 57 ASP A HB2  12 
ATOM   10820 H HB3  . ASP A 1 57 ? -12.389 1.882   -5.495  1.00 0.00 ? 57 ASP A HB3  12 
ATOM   10821 H HD2  . ASP A 1 57 ? -13.819 5.096   -4.578  1.00 0.00 ? 57 ASP A HD2  12 
ATOM   10822 N N    . LYS A 1 58 ? -9.688  0.464   -4.158  1.00 0.00 ? 58 LYS A N    12 
ATOM   10823 C CA   . LYS A 1 58 ? -9.350  -0.949  -4.114  1.00 0.00 ? 58 LYS A CA   12 
ATOM   10824 C C    . LYS A 1 58 ? -8.124  -1.203  -4.993  1.00 0.00 ? 58 LYS A C    12 
ATOM   10825 O O    . LYS A 1 58 ? -8.164  -2.041  -5.893  1.00 0.00 ? 58 LYS A O    12 
ATOM   10826 C CB   . LYS A 1 58 ? -10.563 -1.802  -4.490  1.00 0.00 ? 58 LYS A CB   12 
ATOM   10827 C CG   . LYS A 1 58 ? -11.413 -2.120  -3.258  1.00 0.00 ? 58 LYS A CG   12 
ATOM   10828 C CD   . LYS A 1 58 ? -12.373 -0.970  -2.942  1.00 0.00 ? 58 LYS A CD   12 
ATOM   10829 C CE   . LYS A 1 58 ? -13.799 -1.486  -2.743  1.00 0.00 ? 58 LYS A CE   12 
ATOM   10830 N NZ   . LYS A 1 58 ? -14.781 -0.504  -3.255  1.00 0.00 ? 58 LYS A NZ   12 
ATOM   10831 H H    . LYS A 1 58 ? -9.632  0.939   -3.280  1.00 0.00 ? 58 LYS A H    12 
ATOM   10832 H HA   . LYS A 1 58 ? -9.093  -1.191  -3.083  1.00 0.00 ? 58 LYS A HA   12 
ATOM   10833 H HB2  . LYS A 1 58 ? -11.169 -1.275  -5.228  1.00 0.00 ? 58 LYS A HB2  12 
ATOM   10834 H HB3  . LYS A 1 58 ? -10.230 -2.730  -4.955  1.00 0.00 ? 58 LYS A HB3  12 
ATOM   10835 H HG2  . LYS A 1 58 ? -11.980 -3.035  -3.429  1.00 0.00 ? 58 LYS A HG2  12 
ATOM   10836 H HG3  . LYS A 1 58 ? -10.764 -2.302  -2.401  1.00 0.00 ? 58 LYS A HG3  12 
ATOM   10837 H HD2  . LYS A 1 58 ? -12.041 -0.451  -2.043  1.00 0.00 ? 58 LYS A HD2  12 
ATOM   10838 H HD3  . LYS A 1 58 ? -12.355 -0.243  -3.754  1.00 0.00 ? 58 LYS A HD3  12 
ATOM   10839 H HE2  . LYS A 1 58 ? -13.924 -2.437  -3.260  1.00 0.00 ? 58 LYS A HE2  12 
ATOM   10840 H HE3  . LYS A 1 58 ? -13.981 -1.672  -1.684  1.00 0.00 ? 58 LYS A HE3  12 
ATOM   10841 H HZ1  . LYS A 1 58 ? -14.823 0.280   -2.636  1.00 0.00 ? 58 LYS A HZ1  12 
ATOM   10842 H HZ2  . LYS A 1 58 ? -14.501 -0.196  -4.165  1.00 0.00 ? 58 LYS A HZ2  12 
ATOM   10843 N N    . CYS A 1 59 ? -7.063  -0.466  -4.700  1.00 0.00 ? 59 CYS A N    12 
ATOM   10844 C CA   . CYS A 1 59 ? -5.827  -0.601  -5.453  1.00 0.00 ? 59 CYS A CA   12 
ATOM   10845 C C    . CYS A 1 59 ? -4.992  -1.709  -4.809  1.00 0.00 ? 59 CYS A C    12 
ATOM   10846 O O    . CYS A 1 59 ? -4.501  -2.602  -5.499  1.00 0.00 ? 59 CYS A O    12 
ATOM   10847 C CB   . CYS A 1 59 ? -5.061  0.722   -5.525  1.00 0.00 ? 59 CYS A CB   12 
ATOM   10848 S SG   . CYS A 1 59 ? -3.701  0.889   -4.313  1.00 0.00 ? 59 CYS A SG   12 
ATOM   10849 H H    . CYS A 1 59 ? -7.039  0.213   -3.967  1.00 0.00 ? 59 CYS A H    12 
ATOM   10850 H HA   . CYS A 1 59 ? -6.108  -0.869  -6.471  1.00 0.00 ? 59 CYS A HA   12 
ATOM   10851 H HB2  . CYS A 1 59 ? -4.651  0.833   -6.529  1.00 0.00 ? 59 CYS A HB2  12 
ATOM   10852 H HB3  . CYS A 1 59 ? -5.765  1.541   -5.376  1.00 0.00 ? 59 CYS A HB3  12 
ATOM   10853 N N    . ASN A 1 60 ? -4.855  -1.616  -3.495  1.00 0.00 ? 60 ASN A N    12 
ATOM   10854 C CA   . ASN A 1 60 ? -4.088  -2.600  -2.750  1.00 0.00 ? 60 ASN A CA   12 
ATOM   10855 C C    . ASN A 1 60 ? -4.978  -3.804  -2.436  1.00 0.00 ? 60 ASN A C    12 
ATOM   10856 O O    . ASN A 1 60 ? -4.680  -4.924  -2.847  1.00 0.00 ? 60 ASN A O    12 
ATOM   10857 C CB   . ASN A 1 60 ? -3.590  -2.022  -1.424  1.00 0.00 ? 60 ASN A CB   12 
ATOM   10858 C CG   . ASN A 1 60 ? -4.731  -1.912  -0.411  1.00 0.00 ? 60 ASN A CG   12 
ATOM   10859 O OD1  . ASN A 1 60 ? -5.899  -2.054  -0.734  1.00 0.00 ? 60 ASN A OD1  12 
ATOM   10860 N ND2  . ASN A 1 60 ? -4.329  -1.652  0.830   1.00 0.00 ? 60 ASN A ND2  12 
ATOM   10861 H H    . ASN A 1 60 ? -5.258  -0.887  -2.941  1.00 0.00 ? 60 ASN A H    12 
ATOM   10862 H HA   . ASN A 1 60 ? -3.250  -2.858  -3.397  1.00 0.00 ? 60 ASN A HA   12 
ATOM   10863 H HB2  . ASN A 1 60 ? -2.800  -2.655  -1.021  1.00 0.00 ? 60 ASN A HB2  12 
ATOM   10864 H HB3  . ASN A 1 60 ? -3.154  -1.037  -1.594  1.00 0.00 ? 60 ASN A HB3  12 
ATOM   10865 H HD21 . ASN A 1 60 ? -3.354  -1.547  1.029   1.00 0.00 ? 60 ASN A HD21 12 
ATOM   10866 H HD22 . ASN A 1 60 ? -5.001  -1.562  1.565   1.00 0.00 ? 60 ASN A HD22 12 
HETATM 10867 O O    . HOH B 2 .  ? 5.951   -11.076 0.256   1.00 0.00 ? 61 HOH A O    12 
HETATM 10868 H H1   . HOH B 2 .  ? 5.941   -10.915 -0.687  1.00 0.00 ? 61 HOH A H1   12 
HETATM 10869 H H2   . HOH B 2 .  ? 5.129   -11.536 0.428   1.00 0.00 ? 61 HOH A H2   12 
HETATM 10870 O O    . HOH B 2 .  ? 7.416   -15.477 -7.801  1.00 0.00 ? 62 HOH A O    12 
HETATM 10871 H H1   . HOH B 2 .  ? 6.984   -15.196 -6.994  1.00 0.00 ? 62 HOH A H1   12 
HETATM 10872 H H2   . HOH B 2 .  ? 8.308   -15.137 -7.726  1.00 0.00 ? 62 HOH A H2   12 
ATOM   10873 N N    . LEU A 1 1  ? -12.871 7.343   -1.808  1.00 0.00 ? 1  LEU A N    13 
ATOM   10874 C CA   . LEU A 1 1  ? -11.734 7.074   -0.945  1.00 0.00 ? 1  LEU A CA   13 
ATOM   10875 C C    . LEU A 1 1  ? -12.013 5.816   -0.120  1.00 0.00 ? 1  LEU A C    13 
ATOM   10876 O O    . LEU A 1 1  ? -12.231 5.897   1.088   1.00 0.00 ? 1  LEU A O    13 
ATOM   10877 C CB   . LEU A 1 1  ? -11.401 8.303   -0.098  1.00 0.00 ? 1  LEU A CB   13 
ATOM   10878 C CG   . LEU A 1 1  ? -10.449 9.318   -0.734  1.00 0.00 ? 1  LEU A CG   13 
ATOM   10879 C CD1  . LEU A 1 1  ? -9.094  8.679   -1.044  1.00 0.00 ? 1  LEU A CD1  13 
ATOM   10880 C CD2  . LEU A 1 1  ? -11.078 9.958   -1.973  1.00 0.00 ? 1  LEU A CD2  13 
ATOM   10881 H H    . LEU A 1 1  ? -12.819 8.201   -2.320  1.00 0.00 ? 1  LEU A H    13 
ATOM   10882 H HA   . LEU A 1 1  ? -10.875 6.882   -1.587  1.00 0.00 ? 1  LEU A HA   13 
ATOM   10883 H HB2  . LEU A 1 1  ? -12.332 8.814   0.149   1.00 0.00 ? 1  LEU A HB2  13 
ATOM   10884 H HB3  . LEU A 1 1  ? -10.965 7.965   0.842   1.00 0.00 ? 1  LEU A HB3  13 
ATOM   10885 H HG   . LEU A 1 1  ? -10.270 10.117  -0.014  1.00 0.00 ? 1  LEU A HG   13 
ATOM   10886 H HD11 . LEU A 1 1  ? -8.961  8.615   -2.124  1.00 0.00 ? 1  LEU A HD11 13 
ATOM   10887 H HD12 . LEU A 1 1  ? -8.298  9.288   -0.616  1.00 0.00 ? 1  LEU A HD12 13 
ATOM   10888 H HD21 . LEU A 1 1  ? -11.046 9.252   -2.802  1.00 0.00 ? 1  LEU A HD21 13 
ATOM   10889 H HD22 . LEU A 1 1  ? -12.114 10.222  -1.759  1.00 0.00 ? 1  LEU A HD22 13 
ATOM   10890 N N    . LYS A 1 2  ? -11.996 4.682   -0.804  1.00 0.00 ? 2  LYS A N    13 
ATOM   10891 C CA   . LYS A 1 2  ? -12.245 3.408   -0.150  1.00 0.00 ? 2  LYS A CA   13 
ATOM   10892 C C    . LYS A 1 2  ? -11.303 2.350   -0.729  1.00 0.00 ? 2  LYS A C    13 
ATOM   10893 O O    . LYS A 1 2  ? -11.219 2.189   -1.945  1.00 0.00 ? 2  LYS A O    13 
ATOM   10894 C CB   . LYS A 1 2  ? -13.725 3.035   -0.249  1.00 0.00 ? 2  LYS A CB   13 
ATOM   10895 C CG   . LYS A 1 2  ? -14.044 1.822   0.628   1.00 0.00 ? 2  LYS A CG   13 
ATOM   10896 C CD   . LYS A 1 2  ? -15.552 1.684   0.845   1.00 0.00 ? 2  LYS A CD   13 
ATOM   10897 C CE   . LYS A 1 2  ? -15.942 0.223   1.075   1.00 0.00 ? 2  LYS A CE   13 
ATOM   10898 N NZ   . LYS A 1 2  ? -16.739 -0.287  -0.062  1.00 0.00 ? 2  LYS A NZ   13 
ATOM   10899 H H    . LYS A 1 2  ? -11.818 4.624   -1.787  1.00 0.00 ? 2  LYS A H    13 
ATOM   10900 H HA   . LYS A 1 2  ? -12.014 3.534   0.908   1.00 0.00 ? 2  LYS A HA   13 
ATOM   10901 H HB2  . LYS A 1 2  ? -14.339 3.881   0.058   1.00 0.00 ? 2  LYS A HB2  13 
ATOM   10902 H HB3  . LYS A 1 2  ? -13.980 2.816   -1.286  1.00 0.00 ? 2  LYS A HB3  13 
ATOM   10903 H HG2  . LYS A 1 2  ? -13.657 0.918   0.159   1.00 0.00 ? 2  LYS A HG2  13 
ATOM   10904 H HG3  . LYS A 1 2  ? -13.542 1.922   1.590   1.00 0.00 ? 2  LYS A HG3  13 
ATOM   10905 H HD2  . LYS A 1 2  ? -15.856 2.285   1.702   1.00 0.00 ? 2  LYS A HD2  13 
ATOM   10906 H HD3  . LYS A 1 2  ? -16.085 2.074   -0.022  1.00 0.00 ? 2  LYS A HD3  13 
ATOM   10907 H HE2  . LYS A 1 2  ? -15.045 -0.384  1.199   1.00 0.00 ? 2  LYS A HE2  13 
ATOM   10908 H HE3  . LYS A 1 2  ? -16.516 0.134   1.998   1.00 0.00 ? 2  LYS A HE3  13 
ATOM   10909 H HZ1  . LYS A 1 2  ? -16.476 -1.232  -0.258  1.00 0.00 ? 2  LYS A HZ1  13 
ATOM   10910 H HZ2  . LYS A 1 2  ? -17.711 -0.254  0.170   1.00 0.00 ? 2  LYS A HZ2  13 
ATOM   10911 N N    . CYS A 1 3  ? -10.620 1.657   0.170   1.00 0.00 ? 3  CYS A N    13 
ATOM   10912 C CA   . CYS A 1 3  ? -9.688  0.619   -0.237  1.00 0.00 ? 3  CYS A CA   13 
ATOM   10913 C C    . CYS A 1 3  ? -9.962  -0.629  0.605   1.00 0.00 ? 3  CYS A C    13 
ATOM   10914 O O    . CYS A 1 3  ? -10.912 -0.659  1.386   1.00 0.00 ? 3  CYS A O    13 
ATOM   10915 C CB   . CYS A 1 3  ? -8.235  1.082   -0.113  1.00 0.00 ? 3  CYS A CB   13 
ATOM   10916 S SG   . CYS A 1 3  ? -7.575  1.941   -1.588  1.00 0.00 ? 3  CYS A SG   13 
ATOM   10917 H H    . CYS A 1 3  ? -10.695 1.795   1.157   1.00 0.00 ? 3  CYS A H    13 
ATOM   10918 H HA   . CYS A 1 3  ? -9.878  0.423   -1.292  1.00 0.00 ? 3  CYS A HA   13 
ATOM   10919 H HB2  . CYS A 1 3  ? -8.153  1.749   0.746   1.00 0.00 ? 3  CYS A HB2  13 
ATOM   10920 H HB3  . CYS A 1 3  ? -7.608  0.216   0.097   1.00 0.00 ? 3  CYS A HB3  13 
ATOM   10921 N N    . LYS A 1 4  ? -9.114  -1.629  0.416   1.00 0.00 ? 4  LYS A N    13 
ATOM   10922 C CA   . LYS A 1 4  ? -9.253  -2.877  1.148   1.00 0.00 ? 4  LYS A CA   13 
ATOM   10923 C C    . LYS A 1 4  ? -8.410  -2.812  2.423   1.00 0.00 ? 4  LYS A C    13 
ATOM   10924 O O    . LYS A 1 4  ? -7.330  -2.223  2.428   1.00 0.00 ? 4  LYS A O    13 
ATOM   10925 C CB   . LYS A 1 4  ? -8.916  -4.067  0.248   1.00 0.00 ? 4  LYS A CB   13 
ATOM   10926 C CG   . LYS A 1 4  ? -10.129 -4.483  -0.587  1.00 0.00 ? 4  LYS A CG   13 
ATOM   10927 C CD   . LYS A 1 4  ? -10.900 -5.616  0.093   1.00 0.00 ? 4  LYS A CD   13 
ATOM   10928 C CE   . LYS A 1 4  ? -11.000 -6.838  -0.822  1.00 0.00 ? 4  LYS A CE   13 
ATOM   10929 N NZ   . LYS A 1 4  ? -12.236 -6.777  -1.635  1.00 0.00 ? 4  LYS A NZ   13 
ATOM   10930 H H    . LYS A 1 4  ? -8.344  -1.597  -0.221  1.00 0.00 ? 4  LYS A H    13 
ATOM   10931 H HA   . LYS A 1 4  ? -10.301 -2.974  1.432   1.00 0.00 ? 4  LYS A HA   13 
ATOM   10932 H HB2  . LYS A 1 4  ? -8.088  -3.806  -0.411  1.00 0.00 ? 4  LYS A HB2  13 
ATOM   10933 H HB3  . LYS A 1 4  ? -8.584  -4.907  0.858   1.00 0.00 ? 4  LYS A HB3  13 
ATOM   10934 H HG2  . LYS A 1 4  ? -10.786 -3.626  -0.732  1.00 0.00 ? 4  LYS A HG2  13 
ATOM   10935 H HG3  . LYS A 1 4  ? -9.801  -4.804  -1.576  1.00 0.00 ? 4  LYS A HG3  13 
ATOM   10936 H HD2  . LYS A 1 4  ? -10.402 -5.893  1.022   1.00 0.00 ? 4  LYS A HD2  13 
ATOM   10937 H HD3  . LYS A 1 4  ? -11.900 -5.272  0.357   1.00 0.00 ? 4  LYS A HD3  13 
ATOM   10938 H HE2  . LYS A 1 4  ? -10.130 -6.882  -1.476  1.00 0.00 ? 4  LYS A HE2  13 
ATOM   10939 H HE3  . LYS A 1 4  ? -10.996 -7.749  -0.224  1.00 0.00 ? 4  LYS A HE3  13 
ATOM   10940 H HZ1  . LYS A 1 4  ? -12.150 -6.052  -2.318  1.00 0.00 ? 4  LYS A HZ1  13 
ATOM   10941 H HZ2  . LYS A 1 4  ? -12.376 -7.654  -2.095  1.00 0.00 ? 4  LYS A HZ2  13 
ATOM   10942 N N    . LYS A 1 5  ? -8.935  -3.425  3.474   1.00 0.00 ? 5  LYS A N    13 
ATOM   10943 C CA   . LYS A 1 5  ? -8.243  -3.445  4.752   1.00 0.00 ? 5  LYS A CA   13 
ATOM   10944 C C    . LYS A 1 5  ? -7.107  -4.468  4.696   1.00 0.00 ? 5  LYS A C    13 
ATOM   10945 O O    . LYS A 1 5  ? -6.791  -4.993  3.630   1.00 0.00 ? 5  LYS A O    13 
ATOM   10946 C CB   . LYS A 1 5  ? -9.234  -3.687  5.893   1.00 0.00 ? 5  LYS A CB   13 
ATOM   10947 C CG   . LYS A 1 5  ? -10.122 -2.461  6.116   1.00 0.00 ? 5  LYS A CG   13 
ATOM   10948 C CD   . LYS A 1 5  ? -9.400  -1.406  6.956   1.00 0.00 ? 5  LYS A CD   13 
ATOM   10949 C CE   . LYS A 1 5  ? -8.622  -0.435  6.066   1.00 0.00 ? 5  LYS A CE   13 
ATOM   10950 N NZ   . LYS A 1 5  ? -7.166  -0.585  6.285   1.00 0.00 ? 5  LYS A NZ   13 
ATOM   10951 H H    . LYS A 1 5  ? -9.814  -3.902  3.462   1.00 0.00 ? 5  LYS A H    13 
ATOM   10952 H HA   . LYS A 1 5  ? -7.811  -2.456  4.904   1.00 0.00 ? 5  LYS A HA   13 
ATOM   10953 H HB2  . LYS A 1 5  ? -9.854  -4.553  5.664   1.00 0.00 ? 5  LYS A HB2  13 
ATOM   10954 H HB3  . LYS A 1 5  ? -8.689  -3.918  6.808   1.00 0.00 ? 5  LYS A HB3  13 
ATOM   10955 H HG2  . LYS A 1 5  ? -10.407 -2.034  5.155   1.00 0.00 ? 5  LYS A HG2  13 
ATOM   10956 H HG3  . LYS A 1 5  ? -11.043 -2.762  6.617   1.00 0.00 ? 5  LYS A HG3  13 
ATOM   10957 H HD2  . LYS A 1 5  ? -10.125 -0.855  7.555   1.00 0.00 ? 5  LYS A HD2  13 
ATOM   10958 H HD3  . LYS A 1 5  ? -8.718  -1.894  7.652   1.00 0.00 ? 5  LYS A HD3  13 
ATOM   10959 H HE2  . LYS A 1 5  ? -8.860  -0.623  5.019   1.00 0.00 ? 5  LYS A HE2  13 
ATOM   10960 H HE3  . LYS A 1 5  ? -8.925  0.589   6.283   1.00 0.00 ? 5  LYS A HE3  13 
ATOM   10961 H HZ1  . LYS A 1 5  ? -6.971  -1.511  6.609   1.00 0.00 ? 5  LYS A HZ1  13 
ATOM   10962 H HZ2  . LYS A 1 5  ? -6.681  -0.424  5.425   1.00 0.00 ? 5  LYS A HZ2  13 
ATOM   10963 N N    . LEU A 1 6  ? -6.524  -4.720  5.859   1.00 0.00 ? 6  LEU A N    13 
ATOM   10964 C CA   . LEU A 1 6  ? -5.429  -5.670  5.956   1.00 0.00 ? 6  LEU A CA   13 
ATOM   10965 C C    . LEU A 1 6  ? -5.799  -6.947  5.198   1.00 0.00 ? 6  LEU A C    13 
ATOM   10966 O O    . LEU A 1 6  ? -5.220  -7.242  4.153   1.00 0.00 ? 6  LEU A O    13 
ATOM   10967 C CB   . LEU A 1 6  ? -5.057  -5.911  7.421   1.00 0.00 ? 6  LEU A CB   13 
ATOM   10968 C CG   . LEU A 1 6  ? -4.018  -4.957  8.015   1.00 0.00 ? 6  LEU A CG   13 
ATOM   10969 C CD1  . LEU A 1 6  ? -4.680  -3.680  8.535   1.00 0.00 ? 6  LEU A CD1  13 
ATOM   10970 C CD2  . LEU A 1 6  ? -3.188  -5.654  9.094   1.00 0.00 ? 6  LEU A CD2  13 
ATOM   10971 H H    . LEU A 1 6  ? -6.787  -4.288  6.722   1.00 0.00 ? 6  LEU A H    13 
ATOM   10972 H HA   . LEU A 1 6  ? -4.562  -5.220  5.473   1.00 0.00 ? 6  LEU A HA   13 
ATOM   10973 H HB2  . LEU A 1 6  ? -5.965  -5.847  8.021   1.00 0.00 ? 6  LEU A HB2  13 
ATOM   10974 H HB3  . LEU A 1 6  ? -4.683  -6.930  7.517   1.00 0.00 ? 6  LEU A HB3  13 
ATOM   10975 H HG   . LEU A 1 6  ? -3.332  -4.663  7.221   1.00 0.00 ? 6  LEU A HG   13 
ATOM   10976 H HD11 . LEU A 1 6  ? -5.452  -3.941  9.260   1.00 0.00 ? 6  LEU A HD11 13 
ATOM   10977 H HD12 . LEU A 1 6  ? -3.930  -3.051  9.014   1.00 0.00 ? 6  LEU A HD12 13 
ATOM   10978 H HD21 . LEU A 1 6  ? -2.921  -6.656  8.758   1.00 0.00 ? 6  LEU A HD21 13 
ATOM   10979 H HD22 . LEU A 1 6  ? -2.281  -5.080  9.282   1.00 0.00 ? 6  LEU A HD22 13 
ATOM   10980 N N    . VAL A 1 7  ? -6.760  -7.669  5.754   1.00 0.00 ? 7  VAL A N    13 
ATOM   10981 C CA   . VAL A 1 7  ? -7.214  -8.907  5.143   1.00 0.00 ? 7  VAL A CA   13 
ATOM   10982 C C    . VAL A 1 7  ? -8.249  -8.588  4.062   1.00 0.00 ? 7  VAL A C    13 
ATOM   10983 O O    . VAL A 1 7  ? -9.114  -7.735  4.258   1.00 0.00 ? 7  VAL A O    13 
ATOM   10984 C CB   . VAL A 1 7  ? -7.745  -9.857  6.218   1.00 0.00 ? 7  VAL A CB   13 
ATOM   10985 C CG1  . VAL A 1 7  ? -8.316  -11.131 5.591   1.00 0.00 ? 7  VAL A CG1  13 
ATOM   10986 C CG2  . VAL A 1 7  ? -6.658  -10.190 7.242   1.00 0.00 ? 7  VAL A CG2  13 
ATOM   10987 H H    . VAL A 1 7  ? -7.226  -7.422  6.603   1.00 0.00 ? 7  VAL A H    13 
ATOM   10988 H HA   . VAL A 1 7  ? -6.350  -9.378  4.673   1.00 0.00 ? 7  VAL A HA   13 
ATOM   10989 H HB   . VAL A 1 7  ? -8.555  -9.351  6.743   1.00 0.00 ? 7  VAL A HB   13 
ATOM   10990 H HG11 . VAL A 1 7  ? -9.110  -11.524 6.225   1.00 0.00 ? 7  VAL A HG11 13 
ATOM   10991 H HG12 . VAL A 1 7  ? -8.719  -10.901 4.604   1.00 0.00 ? 7  VAL A HG12 13 
ATOM   10992 H HG21 . VAL A 1 7  ? -5.828  -10.689 6.741   1.00 0.00 ? 7  VAL A HG21 13 
ATOM   10993 H HG22 . VAL A 1 7  ? -6.302  -9.270  7.705   1.00 0.00 ? 7  VAL A HG22 13 
ATOM   10994 N N    . PRO A 1 8  ? -8.124  -9.309  2.916   1.00 0.00 ? 8  PRO A N    13 
ATOM   10995 C CA   . PRO A 1 8  ? -9.039  -9.111  1.804   1.00 0.00 ? 8  PRO A CA   13 
ATOM   10996 C C    . PRO A 1 8  ? -10.401 -9.745  2.095   1.00 0.00 ? 8  PRO A C    13 
ATOM   10997 O O    . PRO A 1 8  ? -10.899 -10.545 1.305   1.00 0.00 ? 8  PRO A O    13 
ATOM   10998 C CB   . PRO A 1 8  ? -8.340  -9.730  0.605   1.00 0.00 ? 8  PRO A CB   13 
ATOM   10999 C CG   . PRO A 1 8  ? -7.278  -10.657 1.174   1.00 0.00 ? 8  PRO A CG   13 
ATOM   11000 C CD   . PRO A 1 8  ? -7.113  -10.327 2.648   1.00 0.00 ? 8  PRO A CD   13 
ATOM   11001 H HA   . PRO A 1 8  ? -9.215  -8.136  1.669   1.00 0.00 ? 8  PRO A HA   13 
ATOM   11002 H HB2  . PRO A 1 8  ? -9.045  -10.280 -0.018  1.00 0.00 ? 8  PRO A HB2  13 
ATOM   11003 H HB3  . PRO A 1 8  ? -7.891  -8.962  -0.025  1.00 0.00 ? 8  PRO A HB3  13 
ATOM   11004 H HG2  . PRO A 1 8  ? -7.572  -11.699 1.046   1.00 0.00 ? 8  PRO A HG2  13 
ATOM   11005 H HG3  . PRO A 1 8  ? -6.334  -10.526 0.645   1.00 0.00 ? 8  PRO A HG3  13 
ATOM   11006 H HD2  . PRO A 1 8  ? -7.265  -11.209 3.271   1.00 0.00 ? 8  PRO A HD2  13 
ATOM   11007 H HD3  . PRO A 1 8  ? -6.111  -9.956  2.861   1.00 0.00 ? 8  PRO A HD3  13 
ATOM   11008 N N    . LEU A 1 9  ? -10.964 -9.364  3.232   1.00 0.00 ? 9  LEU A N    13 
ATOM   11009 C CA   . LEU A 1 9  ? -12.259 -9.885  3.637   1.00 0.00 ? 9  LEU A CA   13 
ATOM   11010 C C    . LEU A 1 9  ? -13.266 -8.736  3.709   1.00 0.00 ? 9  LEU A C    13 
ATOM   11011 O O    . LEU A 1 9  ? -14.441 -8.915  3.391   1.00 0.00 ? 9  LEU A O    13 
ATOM   11012 C CB   . LEU A 1 9  ? -12.134 -10.676 4.941   1.00 0.00 ? 9  LEU A CB   13 
ATOM   11013 C CG   . LEU A 1 9  ? -11.842 -12.171 4.793   1.00 0.00 ? 9  LEU A CG   13 
ATOM   11014 C CD1  . LEU A 1 9  ? -11.654 -12.831 6.160   1.00 0.00 ? 9  LEU A CD1  13 
ATOM   11015 C CD2  . LEU A 1 9  ? -12.928 -12.863 3.966   1.00 0.00 ? 9  LEU A CD2  13 
ATOM   11016 H H    . LEU A 1 9  ? -10.553 -8.713  3.869   1.00 0.00 ? 9  LEU A H    13 
ATOM   11017 H HA   . LEU A 1 9  ? -12.586 -10.583 2.866   1.00 0.00 ? 9  LEU A HA   13 
ATOM   11018 H HB2  . LEU A 1 9  ? -11.340 -10.229 5.539   1.00 0.00 ? 9  LEU A HB2  13 
ATOM   11019 H HB3  . LEU A 1 9  ? -13.061 -10.561 5.502   1.00 0.00 ? 9  LEU A HB3  13 
ATOM   11020 H HG   . LEU A 1 9  ? -10.903 -12.283 4.249   1.00 0.00 ? 9  LEU A HG   13 
ATOM   11021 H HD11 . LEU A 1 9  ? -12.057 -13.843 6.133   1.00 0.00 ? 9  LEU A HD11 13 
ATOM   11022 H HD12 . LEU A 1 9  ? -10.592 -12.869 6.402   1.00 0.00 ? 9  LEU A HD12 13 
ATOM   11023 H HD21 . LEU A 1 9  ? -13.881 -12.358 4.124   1.00 0.00 ? 9  LEU A HD21 13 
ATOM   11024 H HD22 . LEU A 1 9  ? -12.664 -12.819 2.910   1.00 0.00 ? 9  LEU A HD22 13 
ATOM   11025 N N    . PHE A 1 10 ? -12.770 -7.582  4.131   1.00 0.00 ? 10 PHE A N    13 
ATOM   11026 C CA   . PHE A 1 10 ? -13.613 -6.404  4.249   1.00 0.00 ? 10 PHE A CA   13 
ATOM   11027 C C    . PHE A 1 10 ? -12.887 -5.157  3.737   1.00 0.00 ? 10 PHE A C    13 
ATOM   11028 O O    . PHE A 1 10 ? -11.666 -5.163  3.587   1.00 0.00 ? 10 PHE A O    13 
ATOM   11029 C CB   . PHE A 1 10 ? -13.924 -6.224  5.736   1.00 0.00 ? 10 PHE A CB   13 
ATOM   11030 C CG   . PHE A 1 10 ? -14.294 -7.522  6.456   1.00 0.00 ? 10 PHE A CG   13 
ATOM   11031 C CD1  . PHE A 1 10 ? -15.525 -8.071  6.277   1.00 0.00 ? 10 PHE A CD1  13 
ATOM   11032 C CD2  . PHE A 1 10 ? -13.391 -8.127  7.274   1.00 0.00 ? 10 PHE A CD2  13 
ATOM   11033 C CE1  . PHE A 1 10 ? -15.868 -9.276  6.945   1.00 0.00 ? 10 PHE A CE1  13 
ATOM   11034 C CE2  . PHE A 1 10 ? -13.735 -9.332  7.942   1.00 0.00 ? 10 PHE A CE2  13 
ATOM   11035 C CZ   . PHE A 1 10 ? -14.966 -9.881  7.764   1.00 0.00 ? 10 PHE A CZ   13 
ATOM   11036 H H    . PHE A 1 10 ? -11.814 -7.445  4.388   1.00 0.00 ? 10 PHE A H    13 
ATOM   11037 H HA   . PHE A 1 10 ? -14.501 -6.579  3.642   1.00 0.00 ? 10 PHE A HA   13 
ATOM   11038 H HB2  . PHE A 1 10 ? -13.057 -5.782  6.227   1.00 0.00 ? 10 PHE A HB2  13 
ATOM   11039 H HB3  . PHE A 1 10 ? -14.745 -5.515  5.842   1.00 0.00 ? 10 PHE A HB3  13 
ATOM   11040 H HD1  . PHE A 1 10 ? -16.248 -7.587  5.621   1.00 0.00 ? 10 PHE A HD1  13 
ATOM   11041 H HD2  . PHE A 1 10 ? -12.405 -7.686  7.417   1.00 0.00 ? 10 PHE A HD2  13 
ATOM   11042 H HE1  . PHE A 1 10 ? -16.855 -9.717  6.802   1.00 0.00 ? 10 PHE A HE1  13 
ATOM   11043 H HE2  . PHE A 1 10 ? -13.012 -9.816  8.598   1.00 0.00 ? 10 PHE A HE2  13 
ATOM   11044 H HZ   . PHE A 1 10 ? -15.230 -10.806 8.277   1.00 0.00 ? 10 PHE A HZ   13 
ATOM   11045 N N    . SER A 1 11 ? -13.670 -4.119  3.483   1.00 0.00 ? 11 SER A N    13 
ATOM   11046 C CA   . SER A 1 11 ? -13.117 -2.868  2.991   1.00 0.00 ? 11 SER A CA   13 
ATOM   11047 C C    . SER A 1 11 ? -13.470 -1.728  3.949   1.00 0.00 ? 11 SER A C    13 
ATOM   11048 O O    . SER A 1 11 ? -14.420 -1.834  4.722   1.00 0.00 ? 11 SER A O    13 
ATOM   11049 C CB   . SER A 1 11 ? -13.629 -2.556  1.583   1.00 0.00 ? 11 SER A CB   13 
ATOM   11050 O OG   . SER A 1 11 ? -15.037 -2.740  1.474   1.00 0.00 ? 11 SER A OG   13 
ATOM   11051 H H    . SER A 1 11 ? -14.662 -4.123  3.607   1.00 0.00 ? 11 SER A H    13 
ATOM   11052 H HA   . SER A 1 11 ? -12.039 -3.022  2.960   1.00 0.00 ? 11 SER A HA   13 
ATOM   11053 H HB2  . SER A 1 11 ? -13.376 -1.527  1.326   1.00 0.00 ? 11 SER A HB2  13 
ATOM   11054 H HB3  . SER A 1 11 ? -13.122 -3.198  0.863   1.00 0.00 ? 11 SER A HB3  13 
ATOM   11055 H HG   . SER A 1 11 ? -15.235 -3.538  0.905   1.00 0.00 ? 11 SER A HG   13 
ATOM   11056 N N    . LYS A 1 12 ? -12.684 -0.664  3.866   1.00 0.00 ? 12 LYS A N    13 
ATOM   11057 C CA   . LYS A 1 12 ? -12.902 0.494   4.715   1.00 0.00 ? 12 LYS A CA   13 
ATOM   11058 C C    . LYS A 1 12 ? -12.481 1.759   3.963   1.00 0.00 ? 12 LYS A C    13 
ATOM   11059 O O    . LYS A 1 12 ? -11.762 1.683   2.969   1.00 0.00 ? 12 LYS A O    13 
ATOM   11060 C CB   . LYS A 1 12 ? -12.192 0.314   6.059   1.00 0.00 ? 12 LYS A CB   13 
ATOM   11061 C CG   . LYS A 1 12 ? -13.133 -0.300  7.098   1.00 0.00 ? 12 LYS A CG   13 
ATOM   11062 C CD   . LYS A 1 12 ? -12.525 -0.226  8.500   1.00 0.00 ? 12 LYS A CD   13 
ATOM   11063 C CE   . LYS A 1 12 ? -13.424 0.572   9.446   1.00 0.00 ? 12 LYS A CE   13 
ATOM   11064 N NZ   . LYS A 1 12 ? -13.142 2.020   9.331   1.00 0.00 ? 12 LYS A NZ   13 
ATOM   11065 H H    . LYS A 1 12 ? -11.913 -0.586  3.234   1.00 0.00 ? 12 LYS A H    13 
ATOM   11066 H HA   . LYS A 1 12 ? -13.970 0.553   4.920   1.00 0.00 ? 12 LYS A HA   13 
ATOM   11067 H HB2  . LYS A 1 12 ? -11.319 -0.326  5.931   1.00 0.00 ? 12 LYS A HB2  13 
ATOM   11068 H HB3  . LYS A 1 12 ? -11.830 1.278   6.416   1.00 0.00 ? 12 LYS A HB3  13 
ATOM   11069 H HG2  . LYS A 1 12 ? -14.088 0.225   7.083   1.00 0.00 ? 12 LYS A HG2  13 
ATOM   11070 H HG3  . LYS A 1 12 ? -13.337 -1.339  6.840   1.00 0.00 ? 12 LYS A HG3  13 
ATOM   11071 H HD2  . LYS A 1 12 ? -12.383 -1.234  8.891   1.00 0.00 ? 12 LYS A HD2  13 
ATOM   11072 H HD3  . LYS A 1 12 ? -11.541 0.238   8.449   1.00 0.00 ? 12 LYS A HD3  13 
ATOM   11073 H HE2  . LYS A 1 12 ? -14.471 0.380   9.211   1.00 0.00 ? 12 LYS A HE2  13 
ATOM   11074 H HE3  . LYS A 1 12 ? -13.263 0.244   10.473  1.00 0.00 ? 12 LYS A HE3  13 
ATOM   11075 H HZ1  . LYS A 1 12 ? -13.089 2.423   10.245  1.00 0.00 ? 12 LYS A HZ1  13 
ATOM   11076 H HZ2  . LYS A 1 12 ? -12.271 2.153   8.857   1.00 0.00 ? 12 LYS A HZ2  13 
ATOM   11077 N N    . THR A 1 13 ? -12.949 2.891   4.467   1.00 0.00 ? 13 THR A N    13 
ATOM   11078 C CA   . THR A 1 13 ? -12.631 4.170   3.856   1.00 0.00 ? 13 THR A CA   13 
ATOM   11079 C C    . THR A 1 13 ? -11.486 4.851   4.608   1.00 0.00 ? 13 THR A C    13 
ATOM   11080 O O    . THR A 1 13 ? -11.360 4.700   5.822   1.00 0.00 ? 13 THR A O    13 
ATOM   11081 C CB   . THR A 1 13 ? -13.912 5.006   3.813   1.00 0.00 ? 13 THR A CB   13 
ATOM   11082 O OG1  . THR A 1 13 ? -14.730 4.338   2.856   1.00 0.00 ? 13 THR A OG1  13 
ATOM   11083 C CG2  . THR A 1 13 ? -13.687 6.393   3.207   1.00 0.00 ? 13 THR A CG2  13 
ATOM   11084 H H    . THR A 1 13 ? -13.534 2.944   5.277   1.00 0.00 ? 13 THR A H    13 
ATOM   11085 H HA   . THR A 1 13 ? -12.281 3.988   2.839   1.00 0.00 ? 13 THR A HA   13 
ATOM   11086 H HB   . THR A 1 13 ? -14.360 5.081   4.803   1.00 0.00 ? 13 THR A HB   13 
ATOM   11087 H HG1  . THR A 1 13 ? -15.592 4.057   3.279   1.00 0.00 ? 13 THR A HG1  13 
ATOM   11088 H HG21 . THR A 1 13 ? -14.125 6.429   2.210   1.00 0.00 ? 13 THR A HG21 13 
ATOM   11089 H HG22 . THR A 1 13 ? -14.158 7.146   3.839   1.00 0.00 ? 13 THR A HG22 13 
ATOM   11090 N N    . CYS A 1 14 ? -10.681 5.587   3.856   1.00 0.00 ? 14 CYS A N    13 
ATOM   11091 C CA   . CYS A 1 14 ? -9.551  6.292   4.437   1.00 0.00 ? 14 CYS A CA   13 
ATOM   11092 C C    . CYS A 1 14 ? -9.973  7.739   4.703   1.00 0.00 ? 14 CYS A C    13 
ATOM   11093 O O    . CYS A 1 14 ? -10.541 8.394   3.831   1.00 0.00 ? 14 CYS A O    13 
ATOM   11094 C CB   . CYS A 1 14 ? -8.314  6.214   3.540   1.00 0.00 ? 14 CYS A CB   13 
ATOM   11095 S SG   . CYS A 1 14 ? -8.123  4.637   2.631   1.00 0.00 ? 14 CYS A SG   13 
ATOM   11096 H H    . CYS A 1 14 ? -10.791 5.706   2.869   1.00 0.00 ? 14 CYS A H    13 
ATOM   11097 H HA   . CYS A 1 14 ? -9.309  5.782   5.369   1.00 0.00 ? 14 CYS A HA   13 
ATOM   11098 H HB2  . CYS A 1 14 ? -8.354  7.031   2.819   1.00 0.00 ? 14 CYS A HB2  13 
ATOM   11099 H HB3  . CYS A 1 14 ? -7.427  6.374   4.153   1.00 0.00 ? 14 CYS A HB3  13 
ATOM   11100 N N    . PRO A 1 15 ? -9.671  8.206   5.944   1.00 0.00 ? 15 PRO A N    13 
ATOM   11101 C CA   . PRO A 1 15 ? -10.012 9.563   6.337   1.00 0.00 ? 15 PRO A CA   13 
ATOM   11102 C C    . PRO A 1 15 ? -9.067  10.576  5.687   1.00 0.00 ? 15 PRO A C    13 
ATOM   11103 O O    . PRO A 1 15 ? -8.055  10.197  5.099   1.00 0.00 ? 15 PRO A O    13 
ATOM   11104 C CB   . PRO A 1 15 ? -9.934  9.565   7.854   1.00 0.00 ? 15 PRO A CB   13 
ATOM   11105 C CG   . PRO A 1 15 ? -9.104  8.348   8.231   1.00 0.00 ? 15 PRO A CG   13 
ATOM   11106 C CD   . PRO A 1 15 ? -8.999  7.458   7.003   1.00 0.00 ? 15 PRO A CD   13 
ATOM   11107 H HA   . PRO A 1 15 ? -10.929 9.798   6.012   1.00 0.00 ? 15 PRO A HA   13 
ATOM   11108 H HB2  . PRO A 1 15 ? -9.470  10.482  8.220   1.00 0.00 ? 15 PRO A HB2  13 
ATOM   11109 H HB3  . PRO A 1 15 ? -10.928 9.512   8.297   1.00 0.00 ? 15 PRO A HB3  13 
ATOM   11110 H HG2  . PRO A 1 15 ? -8.113  8.651   8.569   1.00 0.00 ? 15 PRO A HG2  13 
ATOM   11111 H HG3  . PRO A 1 15 ? -9.571  7.808   9.055   1.00 0.00 ? 15 PRO A HG3  13 
ATOM   11112 H HD2  . PRO A 1 15 ? -7.959  7.258   6.747   1.00 0.00 ? 15 PRO A HD2  13 
ATOM   11113 H HD3  . PRO A 1 15 ? -9.478  6.493   7.171   1.00 0.00 ? 15 PRO A HD3  13 
ATOM   11114 N N    . ALA A 1 16 ? -9.430  11.843  5.816   1.00 0.00 ? 16 ALA A N    13 
ATOM   11115 C CA   . ALA A 1 16 ? -8.627  12.913  5.249   1.00 0.00 ? 16 ALA A CA   13 
ATOM   11116 C C    . ALA A 1 16 ? -7.149  12.641  5.534   1.00 0.00 ? 16 ALA A C    13 
ATOM   11117 O O    . ALA A 1 16 ? -6.818  11.828  6.395   1.00 0.00 ? 16 ALA A O    13 
ATOM   11118 C CB   . ALA A 1 16 ? -9.092  14.256  5.816   1.00 0.00 ? 16 ALA A CB   13 
ATOM   11119 H H    . ALA A 1 16 ? -10.255 12.143  6.296   1.00 0.00 ? 16 ALA A H    13 
ATOM   11120 H HA   . ALA A 1 16 ? -8.787  12.913  4.171   1.00 0.00 ? 16 ALA A HA   13 
ATOM   11121 H HB1  . ALA A 1 16 ? -9.041  15.017  5.037   1.00 0.00 ? 16 ALA A HB1  13 
ATOM   11122 H HB2  . ALA A 1 16 ? -10.120 14.166  6.168   1.00 0.00 ? 16 ALA A HB2  13 
ATOM   11123 N N    . GLY A 1 17 ? -6.298  13.337  4.793   1.00 0.00 ? 17 GLY A N    13 
ATOM   11124 C CA   . GLY A 1 17 ? -4.863  13.181  4.956   1.00 0.00 ? 17 GLY A CA   13 
ATOM   11125 C C    . GLY A 1 17 ? -4.351  11.973  4.168   1.00 0.00 ? 17 GLY A C    13 
ATOM   11126 O O    . GLY A 1 17 ? -3.359  12.073  3.447   1.00 0.00 ? 17 GLY A O    13 
ATOM   11127 H H    . GLY A 1 17 ? -6.575  13.997  4.095   1.00 0.00 ? 17 GLY A H    13 
ATOM   11128 H HA2  . GLY A 1 17 ? -4.355  14.083  4.616   1.00 0.00 ? 17 GLY A HA2  13 
ATOM   11129 H HA3  . GLY A 1 17 ? -4.624  13.058  6.012   1.00 0.00 ? 17 GLY A HA3  13 
ATOM   11130 N N    . LYS A 1 18 ? -5.050  10.860  4.333   1.00 0.00 ? 18 LYS A N    13 
ATOM   11131 C CA   . LYS A 1 18 ? -4.678  9.634   3.647   1.00 0.00 ? 18 LYS A CA   13 
ATOM   11132 C C    . LYS A 1 18 ? -5.449  9.539   2.329   1.00 0.00 ? 18 LYS A C    13 
ATOM   11133 O O    . LYS A 1 18 ? -6.537  8.967   2.282   1.00 0.00 ? 18 LYS A O    13 
ATOM   11134 C CB   . LYS A 1 18 ? -4.876  8.425   4.563   1.00 0.00 ? 18 LYS A CB   13 
ATOM   11135 C CG   . LYS A 1 18 ? -4.538  8.776   6.014   1.00 0.00 ? 18 LYS A CG   13 
ATOM   11136 C CD   . LYS A 1 18 ? -3.032  8.986   6.190   1.00 0.00 ? 18 LYS A CD   13 
ATOM   11137 C CE   . LYS A 1 18 ? -2.510  8.218   7.406   1.00 0.00 ? 18 LYS A CE   13 
ATOM   11138 N NZ   . LYS A 1 18 ? -1.105  8.587   7.688   1.00 0.00 ? 18 LYS A NZ   13 
ATOM   11139 H H    . LYS A 1 18 ? -5.855  10.787  4.922   1.00 0.00 ? 18 LYS A H    13 
ATOM   11140 H HA   . LYS A 1 18 ? -3.613  9.696   3.421   1.00 0.00 ? 18 LYS A HA   13 
ATOM   11141 H HB2  . LYS A 1 18 ? -5.908  8.081   4.500   1.00 0.00 ? 18 LYS A HB2  13 
ATOM   11142 H HB3  . LYS A 1 18 ? -4.245  7.602   4.228   1.00 0.00 ? 18 LYS A HB3  13 
ATOM   11143 H HG2  . LYS A 1 18 ? -5.072  9.680   6.307   1.00 0.00 ? 18 LYS A HG2  13 
ATOM   11144 H HG3  . LYS A 1 18 ? -4.876  7.977   6.673   1.00 0.00 ? 18 LYS A HG3  13 
ATOM   11145 H HD2  . LYS A 1 18 ? -2.508  8.656   5.294   1.00 0.00 ? 18 LYS A HD2  13 
ATOM   11146 H HD3  . LYS A 1 18 ? -2.822  10.049  6.309   1.00 0.00 ? 18 LYS A HD3  13 
ATOM   11147 H HE2  . LYS A 1 18 ? -3.131  8.436   8.275   1.00 0.00 ? 18 LYS A HE2  13 
ATOM   11148 H HE3  . LYS A 1 18 ? -2.581  7.146   7.224   1.00 0.00 ? 18 LYS A HE3  13 
ATOM   11149 H HZ1  . LYS A 1 18 ? -0.503  7.832   7.426   1.00 0.00 ? 18 LYS A HZ1  13 
ATOM   11150 H HZ2  . LYS A 1 18 ? -0.863  9.403   7.163   1.00 0.00 ? 18 LYS A HZ2  13 
ATOM   11151 N N    . ASN A 1 19 ? -4.855  10.108  1.290   1.00 0.00 ? 19 ASN A N    13 
ATOM   11152 C CA   . ASN A 1 19 ? -5.472  10.095  -0.025  1.00 0.00 ? 19 ASN A CA   13 
ATOM   11153 C C    . ASN A 1 19 ? -4.725  9.107   -0.924  1.00 0.00 ? 19 ASN A C    13 
ATOM   11154 O O    . ASN A 1 19 ? -4.899  9.117   -2.142  1.00 0.00 ? 19 ASN A O    13 
ATOM   11155 C CB   . ASN A 1 19 ? -5.403  11.475  -0.680  1.00 0.00 ? 19 ASN A CB   13 
ATOM   11156 C CG   . ASN A 1 19 ? -6.634  12.312  -0.326  1.00 0.00 ? 19 ASN A CG   13 
ATOM   11157 O OD1  . ASN A 1 19 ? -7.666  12.251  -0.973  1.00 0.00 ? 19 ASN A OD1  13 
ATOM   11158 N ND2  . ASN A 1 19 ? -6.468  13.096  0.736   1.00 0.00 ? 19 ASN A ND2  13 
ATOM   11159 H H    . ASN A 1 19 ? -3.970  10.571  1.337   1.00 0.00 ? 19 ASN A H    13 
ATOM   11160 H HA   . ASN A 1 19 ? -6.507  9.801   0.147   1.00 0.00 ? 19 ASN A HA   13 
ATOM   11161 H HB2  . ASN A 1 19 ? -4.501  11.992  -0.353  1.00 0.00 ? 19 ASN A HB2  13 
ATOM   11162 H HB3  . ASN A 1 19 ? -5.333  11.366  -1.762  1.00 0.00 ? 19 ASN A HB3  13 
ATOM   11163 H HD21 . ASN A 1 19 ? -5.594  13.100  1.223   1.00 0.00 ? 19 ASN A HD21 13 
ATOM   11164 H HD22 . ASN A 1 19 ? -7.216  13.682  1.047   1.00 0.00 ? 19 ASN A HD22 13 
ATOM   11165 N N    . LEU A 1 20 ? -3.909  8.278   -0.289  1.00 0.00 ? 20 LEU A N    13 
ATOM   11166 C CA   . LEU A 1 20 ? -3.135  7.287   -1.017  1.00 0.00 ? 20 LEU A CA   13 
ATOM   11167 C C    . LEU A 1 20 ? -3.168  5.961   -0.254  1.00 0.00 ? 20 LEU A C    13 
ATOM   11168 O O    . LEU A 1 20 ? -2.934  5.930   0.954   1.00 0.00 ? 20 LEU A O    13 
ATOM   11169 C CB   . LEU A 1 20 ? -1.722  7.805   -1.289  1.00 0.00 ? 20 LEU A CB   13 
ATOM   11170 C CG   . LEU A 1 20 ? -1.584  8.804   -2.440  1.00 0.00 ? 20 LEU A CG   13 
ATOM   11171 C CD1  . LEU A 1 20 ? -0.216  9.489   -2.410  1.00 0.00 ? 20 LEU A CD1  13 
ATOM   11172 C CD2  . LEU A 1 20 ? -1.860  8.132   -3.786  1.00 0.00 ? 20 LEU A CD2  13 
ATOM   11173 H H    . LEU A 1 20 ? -3.774  8.277   0.701   1.00 0.00 ? 20 LEU A H    13 
ATOM   11174 H HA   . LEU A 1 20 ? -3.617  7.141   -1.983  1.00 0.00 ? 20 LEU A HA   13 
ATOM   11175 H HB2  . LEU A 1 20 ? -1.346  8.274   -0.380  1.00 0.00 ? 20 LEU A HB2  13 
ATOM   11176 H HB3  . LEU A 1 20 ? -1.077  6.951   -1.497  1.00 0.00 ? 20 LEU A HB3  13 
ATOM   11177 H HG   . LEU A 1 20 ? -2.336  9.582   -2.308  1.00 0.00 ? 20 LEU A HG   13 
ATOM   11178 H HD11 . LEU A 1 20 ? -0.281  10.405  -1.824  1.00 0.00 ? 20 LEU A HD11 13 
ATOM   11179 H HD12 . LEU A 1 20 ? 0.516   8.819   -1.959  1.00 0.00 ? 20 LEU A HD12 13 
ATOM   11180 H HD21 . LEU A 1 20 ? -2.897  7.797   -3.819  1.00 0.00 ? 20 LEU A HD21 13 
ATOM   11181 H HD22 . LEU A 1 20 ? -1.683  8.845   -4.591  1.00 0.00 ? 20 LEU A HD22 13 
ATOM   11182 N N    . CYS A 1 21 ? -3.460  4.898   -0.989  1.00 0.00 ? 21 CYS A N    13 
ATOM   11183 C CA   . CYS A 1 21 ? -3.526  3.573   -0.397  1.00 0.00 ? 21 CYS A CA   13 
ATOM   11184 C C    . CYS A 1 21 ? -2.160  2.904   -0.563  1.00 0.00 ? 21 CYS A C    13 
ATOM   11185 O O    . CYS A 1 21 ? -1.554  2.979   -1.630  1.00 0.00 ? 21 CYS A O    13 
ATOM   11186 C CB   . CYS A 1 21 ? -4.649  2.735   -1.010  1.00 0.00 ? 21 CYS A CB   13 
ATOM   11187 S SG   . CYS A 1 21 ? -6.340  3.336   -0.648  1.00 0.00 ? 21 CYS A SG   13 
ATOM   11188 H H    . CYS A 1 21 ? -3.649  4.933   -1.971  1.00 0.00 ? 21 CYS A H    13 
ATOM   11189 H HA   . CYS A 1 21 ? -3.763  3.713   0.658   1.00 0.00 ? 21 CYS A HA   13 
ATOM   11190 H HB2  . CYS A 1 21 ? -4.513  2.705   -2.091  1.00 0.00 ? 21 CYS A HB2  13 
ATOM   11191 H HB3  . CYS A 1 21 ? -4.558  1.711   -0.648  1.00 0.00 ? 21 CYS A HB3  13 
ATOM   11192 N N    . TYR A 1 22 ? -1.715  2.267   0.510   1.00 0.00 ? 22 TYR A N    13 
ATOM   11193 C CA   . TYR A 1 22 ? -0.431  1.585   0.497   1.00 0.00 ? 22 TYR A CA   13 
ATOM   11194 C C    . TYR A 1 22 ? -0.612  0.073   0.640   1.00 0.00 ? 22 TYR A C    13 
ATOM   11195 O O    . TYR A 1 22 ? -1.566  -0.385  1.268   1.00 0.00 ? 22 TYR A O    13 
ATOM   11196 C CB   . TYR A 1 22 ? 0.338   2.112   1.710   1.00 0.00 ? 22 TYR A CB   13 
ATOM   11197 C CG   . TYR A 1 22 ? 0.002   1.395   3.019   1.00 0.00 ? 22 TYR A CG   13 
ATOM   11198 C CD1  . TYR A 1 22 ? 0.553   0.159   3.290   1.00 0.00 ? 22 TYR A CD1  13 
ATOM   11199 C CD2  . TYR A 1 22 ? -0.852  1.984   3.930   1.00 0.00 ? 22 TYR A CD2  13 
ATOM   11200 C CE1  . TYR A 1 22 ? 0.237   -0.516  4.522   1.00 0.00 ? 22 TYR A CE1  13 
ATOM   11201 C CE2  . TYR A 1 22 ? -1.168  1.309   5.162   1.00 0.00 ? 22 TYR A CE2  13 
ATOM   11202 C CZ   . TYR A 1 22 ? -0.608  0.092   5.397   1.00 0.00 ? 22 TYR A CZ   13 
ATOM   11203 O OH   . TYR A 1 22 ? -0.907  -0.545  6.561   1.00 0.00 ? 22 TYR A OH   13 
ATOM   11204 H H    . TYR A 1 22 ? -2.214  2.211   1.375   1.00 0.00 ? 22 TYR A H    13 
ATOM   11205 H HA   . TYR A 1 22 ? 0.052   1.797   -0.456  1.00 0.00 ? 22 TYR A HA   13 
ATOM   11206 H HB2  . TYR A 1 22 ? 1.407   2.016   1.520   1.00 0.00 ? 22 TYR A HB2  13 
ATOM   11207 H HB3  . TYR A 1 22 ? 0.129   3.175   1.827   1.00 0.00 ? 22 TYR A HB3  13 
ATOM   11208 H HD1  . TYR A 1 22 ? 1.227   -0.307  2.571   1.00 0.00 ? 22 TYR A HD1  13 
ATOM   11209 H HD2  . TYR A 1 22 ? -1.287  2.961   3.716   1.00 0.00 ? 22 TYR A HD2  13 
ATOM   11210 H HE1  . TYR A 1 22 ? 0.665   -1.493  4.748   1.00 0.00 ? 22 TYR A HE1  13 
ATOM   11211 H HE2  . TYR A 1 22 ? -1.841  1.763   5.889   1.00 0.00 ? 22 TYR A HE2  13 
ATOM   11212 H HH   . TYR A 1 22 ? -0.090  -0.991  6.926   1.00 0.00 ? 22 TYR A HH   13 
ATOM   11213 N N    . LYS A 1 23 ? 0.318   -0.661  0.048   1.00 0.00 ? 23 LYS A N    13 
ATOM   11214 C CA   . LYS A 1 23 ? 0.274   -2.112  0.101   1.00 0.00 ? 23 LYS A CA   13 
ATOM   11215 C C    . LYS A 1 23 ? 1.675   -2.651  0.396   1.00 0.00 ? 23 LYS A C    13 
ATOM   11216 O O    . LYS A 1 23 ? 2.607   -2.419  -0.372  1.00 0.00 ? 23 LYS A O    13 
ATOM   11217 C CB   . LYS A 1 23 ? -0.345  -2.677  -1.179  1.00 0.00 ? 23 LYS A CB   13 
ATOM   11218 C CG   . LYS A 1 23 ? -0.249  -4.204  -1.208  1.00 0.00 ? 23 LYS A CG   13 
ATOM   11219 C CD   . LYS A 1 23 ? 0.187   -4.700  -2.588  1.00 0.00 ? 23 LYS A CD   13 
ATOM   11220 C CE   . LYS A 1 23 ? -0.955  -4.578  -3.600  1.00 0.00 ? 23 LYS A CE   13 
ATOM   11221 N NZ   . LYS A 1 23 ? -0.844  -3.310  -4.356  1.00 0.00 ? 23 LYS A NZ   13 
ATOM   11222 H H    . LYS A 1 23 ? 1.091   -0.280  -0.461  1.00 0.00 ? 23 LYS A H    13 
ATOM   11223 H HA   . LYS A 1 23 ? -0.384  -2.389  0.925   1.00 0.00 ? 23 LYS A HA   13 
ATOM   11224 H HB2  . LYS A 1 23 ? -1.390  -2.373  -1.248  1.00 0.00 ? 23 LYS A HB2  13 
ATOM   11225 H HB3  . LYS A 1 23 ? 0.165   -2.260  -2.048  1.00 0.00 ? 23 LYS A HB3  13 
ATOM   11226 H HG2  . LYS A 1 23 ? 0.464   -4.540  -0.455  1.00 0.00 ? 23 LYS A HG2  13 
ATOM   11227 H HG3  . LYS A 1 23 ? -1.214  -4.637  -0.950  1.00 0.00 ? 23 LYS A HG3  13 
ATOM   11228 H HD2  . LYS A 1 23 ? 1.045   -4.123  -2.932  1.00 0.00 ? 23 LYS A HD2  13 
ATOM   11229 H HD3  . LYS A 1 23 ? 0.508   -5.739  -2.520  1.00 0.00 ? 23 LYS A HD3  13 
ATOM   11230 H HE2  . LYS A 1 23 ? -0.930  -5.422  -4.288  1.00 0.00 ? 23 LYS A HE2  13 
ATOM   11231 H HE3  . LYS A 1 23 ? -1.913  -4.617  -3.082  1.00 0.00 ? 23 LYS A HE3  13 
ATOM   11232 H HZ1  . LYS A 1 23 ? -1.244  -3.428  -5.265  1.00 0.00 ? 23 LYS A HZ1  13 
ATOM   11233 H HZ2  . LYS A 1 23 ? -1.332  -2.587  -3.868  1.00 0.00 ? 23 LYS A HZ2  13 
ATOM   11234 N N    . MET A 1 24 ? 1.779   -3.359  1.511   1.00 0.00 ? 24 MET A N    13 
ATOM   11235 C CA   . MET A 1 24 ? 3.051   -3.932  1.917   1.00 0.00 ? 24 MET A CA   13 
ATOM   11236 C C    . MET A 1 24 ? 3.092   -5.434  1.629   1.00 0.00 ? 24 MET A C    13 
ATOM   11237 O O    . MET A 1 24 ? 2.227   -6.181  2.083   1.00 0.00 ? 24 MET A O    13 
ATOM   11238 C CB   . MET A 1 24 ? 3.264   -3.694  3.414   1.00 0.00 ? 24 MET A CB   13 
ATOM   11239 C CG   . MET A 1 24 ? 3.305   -2.197  3.730   1.00 0.00 ? 24 MET A CG   13 
ATOM   11240 S SD   . MET A 1 24 ? 3.914   -1.940  5.388   1.00 0.00 ? 24 MET A SD   13 
ATOM   11241 C CE   . MET A 1 24 ? 3.573   -0.198  5.576   1.00 0.00 ? 24 MET A CE   13 
ATOM   11242 H H    . MET A 1 24 ? 1.016   -3.543  2.130   1.00 0.00 ? 24 MET A H    13 
ATOM   11243 H HA   . MET A 1 24 ? 3.807   -3.420  1.322   1.00 0.00 ? 24 MET A HA   13 
ATOM   11244 H HB2  . MET A 1 24 ? 2.461   -4.167  3.979   1.00 0.00 ? 24 MET A HB2  13 
ATOM   11245 H HB3  . MET A 1 24 ? 4.196   -4.161  3.731   1.00 0.00 ? 24 MET A HB3  13 
ATOM   11246 H HG2  . MET A 1 24 ? 3.946   -1.683  3.014   1.00 0.00 ? 24 MET A HG2  13 
ATOM   11247 H HG3  . MET A 1 24 ? 2.307   -1.769  3.629   1.00 0.00 ? 24 MET A HG3  13 
ATOM   11248 H HE1  . MET A 1 24 ? 3.287   0.007   6.608   1.00 0.00 ? 24 MET A HE1  13 
ATOM   11249 H HE2  . MET A 1 24 ? 4.464   0.376   5.325   1.00 0.00 ? 24 MET A HE2  13 
ATOM   11250 N N    . PHE A 1 25 ? 4.107   -5.832  0.876   1.00 0.00 ? 25 PHE A N    13 
ATOM   11251 C CA   . PHE A 1 25 ? 4.273   -7.231  0.521   1.00 0.00 ? 25 PHE A CA   13 
ATOM   11252 C C    . PHE A 1 25 ? 5.743   -7.647  0.600   1.00 0.00 ? 25 PHE A C    13 
ATOM   11253 O O    . PHE A 1 25 ? 6.635   -6.836  0.355   1.00 0.00 ? 25 PHE A O    13 
ATOM   11254 C CB   . PHE A 1 25 ? 3.788   -7.388  -0.922  1.00 0.00 ? 25 PHE A CB   13 
ATOM   11255 C CG   . PHE A 1 25 ? 4.763   -6.843  -1.968  1.00 0.00 ? 25 PHE A CG   13 
ATOM   11256 C CD1  . PHE A 1 25 ? 5.932   -7.493  -2.212  1.00 0.00 ? 25 PHE A CD1  13 
ATOM   11257 C CD2  . PHE A 1 25 ? 4.459   -5.709  -2.654  1.00 0.00 ? 25 PHE A CD2  13 
ATOM   11258 C CE1  . PHE A 1 25 ? 6.836   -6.987  -3.183  1.00 0.00 ? 25 PHE A CE1  13 
ATOM   11259 C CE2  . PHE A 1 25 ? 5.363   -5.203  -3.626  1.00 0.00 ? 25 PHE A CE2  13 
ATOM   11260 C CZ   . PHE A 1 25 ? 6.533   -5.853  -3.869  1.00 0.00 ? 25 PHE A CZ   13 
ATOM   11261 H H    . PHE A 1 25 ? 4.807   -5.218  0.510   1.00 0.00 ? 25 PHE A H    13 
ATOM   11262 H HA   . PHE A 1 25 ? 3.693   -7.817  1.235   1.00 0.00 ? 25 PHE A HA   13 
ATOM   11263 H HB2  . PHE A 1 25 ? 3.610   -8.444  -1.122  1.00 0.00 ? 25 PHE A HB2  13 
ATOM   11264 H HB3  . PHE A 1 25 ? 2.832   -6.877  -1.030  1.00 0.00 ? 25 PHE A HB3  13 
ATOM   11265 H HD1  . PHE A 1 25 ? 6.175   -8.402  -1.661  1.00 0.00 ? 25 PHE A HD1  13 
ATOM   11266 H HD2  . PHE A 1 25 ? 3.522   -5.188  -2.459  1.00 0.00 ? 25 PHE A HD2  13 
ATOM   11267 H HE1  . PHE A 1 25 ? 7.774   -7.508  -3.378  1.00 0.00 ? 25 PHE A HE1  13 
ATOM   11268 H HE2  . PHE A 1 25 ? 5.120   -4.294  -4.176  1.00 0.00 ? 25 PHE A HE2  13 
ATOM   11269 H HZ   . PHE A 1 25 ? 7.227   -5.465  -4.615  1.00 0.00 ? 25 PHE A HZ   13 
ATOM   11270 N N    . MET A 1 26 ? 5.951   -8.909  0.944   1.00 0.00 ? 26 MET A N    13 
ATOM   11271 C CA   . MET A 1 26 ? 7.298   -9.442  1.058   1.00 0.00 ? 26 MET A CA   13 
ATOM   11272 C C    . MET A 1 26 ? 7.748   -10.082 -0.257  1.00 0.00 ? 26 MET A C    13 
ATOM   11273 O O    . MET A 1 26 ? 6.932   -10.628 -0.997  1.00 0.00 ? 26 MET A O    13 
ATOM   11274 C CB   . MET A 1 26 ? 7.340   -10.487 2.176   1.00 0.00 ? 26 MET A CB   13 
ATOM   11275 C CG   . MET A 1 26 ? 7.229   -9.824  3.550   1.00 0.00 ? 26 MET A CG   13 
ATOM   11276 S SD   . MET A 1 26 ? 6.586   -10.989 4.739   1.00 0.00 ? 26 MET A SD   13 
ATOM   11277 C CE   . MET A 1 26 ? 6.804   -10.052 6.242   1.00 0.00 ? 26 MET A CE   13 
ATOM   11278 H H    . MET A 1 26 ? 5.220   -9.562  1.141   1.00 0.00 ? 26 MET A H    13 
ATOM   11279 H HA   . MET A 1 26 ? 7.932   -8.587  1.290   1.00 0.00 ? 26 MET A HA   13 
ATOM   11280 H HB2  . MET A 1 26 ? 6.526   -11.199 2.044   1.00 0.00 ? 26 MET A HB2  13 
ATOM   11281 H HB3  . MET A 1 26 ? 8.271   -11.052 2.115   1.00 0.00 ? 26 MET A HB3  13 
ATOM   11282 H HG2  . MET A 1 26 ? 8.207   -9.467  3.871   1.00 0.00 ? 26 MET A HG2  13 
ATOM   11283 H HG3  . MET A 1 26 ? 6.576   -8.954  3.492   1.00 0.00 ? 26 MET A HG3  13 
ATOM   11284 H HE1  . MET A 1 26 ? 5.856   -9.596  6.527   1.00 0.00 ? 26 MET A HE1  13 
ATOM   11285 H HE2  . MET A 1 26 ? 7.143   -10.715 7.038   1.00 0.00 ? 26 MET A HE2  13 
ATOM   11286 N N    . VAL A 1 27 ? 9.046   -9.993  -0.507  1.00 0.00 ? 27 VAL A N    13 
ATOM   11287 C CA   . VAL A 1 27 ? 9.615   -10.556 -1.719  1.00 0.00 ? 27 VAL A CA   13 
ATOM   11288 C C    . VAL A 1 27 ? 9.346   -12.062 -1.752  1.00 0.00 ? 27 VAL A C    13 
ATOM   11289 O O    . VAL A 1 27 ? 9.505   -12.702 -2.790  1.00 0.00 ? 27 VAL A O    13 
ATOM   11290 C CB   . VAL A 1 27 ? 11.103  -10.212 -1.808  1.00 0.00 ? 27 VAL A CB   13 
ATOM   11291 C CG1  . VAL A 1 27 ? 11.919  -11.049 -0.821  1.00 0.00 ? 27 VAL A CG1  13 
ATOM   11292 C CG2  . VAL A 1 27 ? 11.622  -10.389 -3.237  1.00 0.00 ? 27 VAL A CG2  13 
ATOM   11293 H H    . VAL A 1 27 ? 9.703   -9.547  0.101   1.00 0.00 ? 27 VAL A H    13 
ATOM   11294 H HA   . VAL A 1 27 ? 9.110   -10.091 -2.566  1.00 0.00 ? 27 VAL A HA   13 
ATOM   11295 H HB   . VAL A 1 27 ? 11.221  -9.163  -1.536  1.00 0.00 ? 27 VAL A HB   13 
ATOM   11296 H HG11 . VAL A 1 27 ? 11.260  -11.747 -0.305  1.00 0.00 ? 27 VAL A HG11 13 
ATOM   11297 H HG12 . VAL A 1 27 ? 12.685  -11.604 -1.362  1.00 0.00 ? 27 VAL A HG12 13 
ATOM   11298 H HG21 . VAL A 1 27 ? 11.681  -9.416  -3.725  1.00 0.00 ? 27 VAL A HG21 13 
ATOM   11299 H HG22 . VAL A 1 27 ? 12.613  -10.842 -3.209  1.00 0.00 ? 27 VAL A HG22 13 
ATOM   11300 N N    . ALA A 1 28 ? 8.945   -12.584 -0.602  1.00 0.00 ? 28 ALA A N    13 
ATOM   11301 C CA   . ALA A 1 28 ? 8.653   -14.002 -0.486  1.00 0.00 ? 28 ALA A CA   13 
ATOM   11302 C C    . ALA A 1 28 ? 7.983   -14.488 -1.773  1.00 0.00 ? 28 ALA A C    13 
ATOM   11303 O O    . ALA A 1 28 ? 8.286   -15.576 -2.261  1.00 0.00 ? 28 ALA A O    13 
ATOM   11304 C CB   . ALA A 1 28 ? 7.784   -14.245 0.750   1.00 0.00 ? 28 ALA A CB   13 
ATOM   11305 H H    . ALA A 1 28 ? 8.818   -12.056 0.238   1.00 0.00 ? 28 ALA A H    13 
ATOM   11306 H HA   . ALA A 1 28 ? 9.600   -14.527 -0.358  1.00 0.00 ? 28 ALA A HA   13 
ATOM   11307 H HB1  . ALA A 1 28 ? 7.430   -15.276 0.749   1.00 0.00 ? 28 ALA A HB1  13 
ATOM   11308 H HB2  . ALA A 1 28 ? 8.373   -14.065 1.649   1.00 0.00 ? 28 ALA A HB2  13 
ATOM   11309 N N    . ALA A 1 29 ? 7.087   -13.658 -2.286  1.00 0.00 ? 29 ALA A N    13 
ATOM   11310 C CA   . ALA A 1 29 ? 6.373   -13.990 -3.507  1.00 0.00 ? 29 ALA A CA   13 
ATOM   11311 C C    . ALA A 1 29 ? 5.972   -12.699 -4.225  1.00 0.00 ? 29 ALA A C    13 
ATOM   11312 O O    . ALA A 1 29 ? 5.802   -11.659 -3.590  1.00 0.00 ? 29 ALA A O    13 
ATOM   11313 C CB   . ALA A 1 29 ? 5.167   -14.869 -3.171  1.00 0.00 ? 29 ALA A CB   13 
ATOM   11314 H H    . ALA A 1 29 ? 6.847   -12.775 -1.883  1.00 0.00 ? 29 ALA A H    13 
ATOM   11315 H HA   . ALA A 1 29 ? 7.052   -14.555 -4.146  1.00 0.00 ? 29 ALA A HA   13 
ATOM   11316 H HB1  . ALA A 1 29 ? 4.267   -14.433 -3.606  1.00 0.00 ? 29 ALA A HB1  13 
ATOM   11317 H HB2  . ALA A 1 29 ? 5.320   -15.868 -3.578  1.00 0.00 ? 29 ALA A HB2  13 
ATOM   11318 N N    . PRO A 1 30 ? 5.829   -12.812 -5.572  1.00 0.00 ? 30 PRO A N    13 
ATOM   11319 C CA   . PRO A 1 30 ? 5.451   -11.667 -6.383  1.00 0.00 ? 30 PRO A CA   13 
ATOM   11320 C C    . PRO A 1 30 ? 3.965   -11.344 -6.217  1.00 0.00 ? 30 PRO A C    13 
ATOM   11321 O O    . PRO A 1 30 ? 3.530   -10.233 -6.516  1.00 0.00 ? 30 PRO A O    13 
ATOM   11322 C CB   . PRO A 1 30 ? 5.819   -12.053 -7.806  1.00 0.00 ? 30 PRO A CB   13 
ATOM   11323 C CG   . PRO A 1 30 ? 5.957   -13.567 -7.804  1.00 0.00 ? 30 PRO A CG   13 
ATOM   11324 C CD   . PRO A 1 30 ? 6.022   -14.028 -6.357  1.00 0.00 ? 30 PRO A CD   13 
ATOM   11325 H HA   . PRO A 1 30 ? 5.943   -10.850 -6.081  1.00 0.00 ? 30 PRO A HA   13 
ATOM   11326 H HB2  . PRO A 1 30 ? 5.051   -11.732 -8.509  1.00 0.00 ? 30 PRO A HB2  13 
ATOM   11327 H HB3  . PRO A 1 30 ? 6.751   -11.577 -8.111  1.00 0.00 ? 30 PRO A HB3  13 
ATOM   11328 H HG2  . PRO A 1 30 ? 5.111   -14.028 -8.314  1.00 0.00 ? 30 PRO A HG2  13 
ATOM   11329 H HG3  . PRO A 1 30 ? 6.856   -13.869 -8.342  1.00 0.00 ? 30 PRO A HG3  13 
ATOM   11330 H HD2  . PRO A 1 30 ? 5.248   -14.765 -6.142  1.00 0.00 ? 30 PRO A HD2  13 
ATOM   11331 H HD3  . PRO A 1 30 ? 6.980   -14.496 -6.133  1.00 0.00 ? 30 PRO A HD3  13 
ATOM   11332 N N    . HIS A 1 31 ? 3.226   -12.335 -5.740  1.00 0.00 ? 31 HIS A N    13 
ATOM   11333 C CA   . HIS A 1 31 ? 1.798   -12.170 -5.531  1.00 0.00 ? 31 HIS A CA   13 
ATOM   11334 C C    . HIS A 1 31 ? 1.409   -12.749 -4.169  1.00 0.00 ? 31 HIS A C    13 
ATOM   11335 O O    . HIS A 1 31 ? 0.597   -13.670 -4.091  1.00 0.00 ? 31 HIS A O    13 
ATOM   11336 C CB   . HIS A 1 31 ? 1.005   -12.787 -6.685  1.00 0.00 ? 31 HIS A CB   13 
ATOM   11337 C CG   . HIS A 1 31 ? -0.250  -12.026 -7.044  1.00 0.00 ? 31 HIS A CG   13 
ATOM   11338 N ND1  . HIS A 1 31 ? -1.466  -12.648 -7.264  1.00 0.00 ? 31 HIS A ND1  13 
ATOM   11339 C CD2  . HIS A 1 31 ? -0.463  -10.690 -7.217  1.00 0.00 ? 31 HIS A CD2  13 
ATOM   11340 C CE1  . HIS A 1 31 ? -2.364  -11.718 -7.557  1.00 0.00 ? 31 HIS A CE1  13 
ATOM   11341 N NE2  . HIS A 1 31 ? -1.740  -10.506 -7.527  1.00 0.00 ? 31 HIS A NE2  13 
ATOM   11342 H H    . HIS A 1 31 ? 3.587   -13.236 -5.499  1.00 0.00 ? 31 HIS A H    13 
ATOM   11343 H HA   . HIS A 1 31 ? 1.603   -11.098 -5.529  1.00 0.00 ? 31 HIS A HA   13 
ATOM   11344 H HB2  . HIS A 1 31 ? 1.647   -12.843 -7.564  1.00 0.00 ? 31 HIS A HB2  13 
ATOM   11345 H HB3  . HIS A 1 31 ? 0.735   -13.809 -6.422  1.00 0.00 ? 31 HIS A HB3  13 
ATOM   11346 H HD1  . HIS A 1 31 ? -1.638  -13.632 -7.211  1.00 0.00 ? 31 HIS A HD1  13 
ATOM   11347 H HD2  . HIS A 1 31 ? 0.288   -9.907  -7.117  1.00 0.00 ? 31 HIS A HD2  13 
ATOM   11348 H HE1  . HIS A 1 31 ? -3.416  -11.892 -7.781  1.00 0.00 ? 31 HIS A HE1  13 
ATOM   11349 N N    . VAL A 1 32 ? 2.006   -12.185 -3.130  1.00 0.00 ? 32 VAL A N    13 
ATOM   11350 C CA   . VAL A 1 32 ? 1.732   -12.633 -1.775  1.00 0.00 ? 32 VAL A CA   13 
ATOM   11351 C C    . VAL A 1 32 ? 1.941   -11.468 -0.805  1.00 0.00 ? 32 VAL A C    13 
ATOM   11352 O O    . VAL A 1 32 ? 3.045   -11.263 -0.304  1.00 0.00 ? 32 VAL A O    13 
ATOM   11353 C CB   . VAL A 1 32 ? 2.597   -13.850 -1.442  1.00 0.00 ? 32 VAL A CB   13 
ATOM   11354 C CG1  . VAL A 1 32 ? 2.504   -14.198 0.045   1.00 0.00 ? 32 VAL A CG1  13 
ATOM   11355 C CG2  . VAL A 1 32 ? 2.214   -15.050 -2.311  1.00 0.00 ? 32 VAL A CG2  13 
ATOM   11356 H H    . VAL A 1 32 ? 2.665   -11.436 -3.202  1.00 0.00 ? 32 VAL A H    13 
ATOM   11357 H HA   . VAL A 1 32 ? 0.687   -12.940 -1.735  1.00 0.00 ? 32 VAL A HA   13 
ATOM   11358 H HB   . VAL A 1 32 ? 3.634   -13.595 -1.661  1.00 0.00 ? 32 VAL A HB   13 
ATOM   11359 H HG11 . VAL A 1 32 ? 1.722   -14.943 0.196   1.00 0.00 ? 32 VAL A HG11 13 
ATOM   11360 H HG12 . VAL A 1 32 ? 3.459   -14.601 0.385   1.00 0.00 ? 32 VAL A HG12 13 
ATOM   11361 H HG21 . VAL A 1 32 ? 2.859   -15.895 -2.068  1.00 0.00 ? 32 VAL A HG21 13 
ATOM   11362 H HG22 . VAL A 1 32 ? 1.175   -15.319 -2.120  1.00 0.00 ? 32 VAL A HG22 13 
ATOM   11363 N N    . PRO A 1 33 ? 0.834   -10.716 -0.564  1.00 0.00 ? 33 PRO A N    13 
ATOM   11364 C CA   . PRO A 1 33 ? 0.884   -9.577  0.337   1.00 0.00 ? 33 PRO A CA   13 
ATOM   11365 C C    . PRO A 1 33 ? 0.934   -10.034 1.796   1.00 0.00 ? 33 PRO A C    13 
ATOM   11366 O O    . PRO A 1 33 ? 0.594   -11.175 2.105   1.00 0.00 ? 33 PRO A O    13 
ATOM   11367 C CB   . PRO A 1 33 ? -0.357  -8.763  0.012   1.00 0.00 ? 33 PRO A CB   13 
ATOM   11368 C CG   . PRO A 1 33 ? -1.293  -9.706  -0.726  1.00 0.00 ? 33 PRO A CG   13 
ATOM   11369 C CD   . PRO A 1 33 ? -0.491  -10.929 -1.140  1.00 0.00 ? 33 PRO A CD   13 
ATOM   11370 H HA   . PRO A 1 33 ? 1.722   -9.052  0.186   1.00 0.00 ? 33 PRO A HA   13 
ATOM   11371 H HB2  . PRO A 1 33 ? -0.824  -8.382  0.920   1.00 0.00 ? 33 PRO A HB2  13 
ATOM   11372 H HB3  . PRO A 1 33 ? -0.108  -7.899  -0.604  1.00 0.00 ? 33 PRO A HB3  13 
ATOM   11373 H HG2  . PRO A 1 33 ? -2.127  -9.995  -0.086  1.00 0.00 ? 33 PRO A HG2  13 
ATOM   11374 H HG3  . PRO A 1 33 ? -1.718  -9.215  -1.602  1.00 0.00 ? 33 PRO A HG3  13 
ATOM   11375 H HD2  . PRO A 1 33 ? -0.944  -11.846 -0.763  1.00 0.00 ? 33 PRO A HD2  13 
ATOM   11376 H HD3  . PRO A 1 33 ? -0.441  -11.022 -2.225  1.00 0.00 ? 33 PRO A HD3  13 
ATOM   11377 N N    . VAL A 1 34 ? 1.362   -9.120  2.655   1.00 0.00 ? 34 VAL A N    13 
ATOM   11378 C CA   . VAL A 1 34 ? 1.460   -9.415  4.074   1.00 0.00 ? 34 VAL A CA   13 
ATOM   11379 C C    . VAL A 1 34 ? 0.400   -8.614  4.832   1.00 0.00 ? 34 VAL A C    13 
ATOM   11380 O O    . VAL A 1 34 ? -0.217  -9.123  5.767   1.00 0.00 ? 34 VAL A O    13 
ATOM   11381 C CB   . VAL A 1 34 ? 2.883   -9.140  4.568   1.00 0.00 ? 34 VAL A CB   13 
ATOM   11382 C CG1  . VAL A 1 34 ? 3.295   -7.696  4.277   1.00 0.00 ? 34 VAL A CG1  13 
ATOM   11383 C CG2  . VAL A 1 34 ? 3.017   -9.459  6.058   1.00 0.00 ? 34 VAL A CG2  13 
ATOM   11384 H H    . VAL A 1 34 ? 1.637   -8.194  2.395   1.00 0.00 ? 34 VAL A H    13 
ATOM   11385 H HA   . VAL A 1 34 ? 1.257   -10.478 4.204   1.00 0.00 ? 34 VAL A HA   13 
ATOM   11386 H HB   . VAL A 1 34 ? 3.559   -9.798  4.023   1.00 0.00 ? 34 VAL A HB   13 
ATOM   11387 H HG11 . VAL A 1 34 ? 4.194   -7.454  4.843   1.00 0.00 ? 34 VAL A HG11 13 
ATOM   11388 H HG12 . VAL A 1 34 ? 3.495   -7.583  3.211   1.00 0.00 ? 34 VAL A HG12 13 
ATOM   11389 H HG21 . VAL A 1 34 ? 2.032   -9.433  6.525   1.00 0.00 ? 34 VAL A HG21 13 
ATOM   11390 H HG22 . VAL A 1 34 ? 3.450   -10.452 6.180   1.00 0.00 ? 34 VAL A HG22 13 
ATOM   11391 N N    . LYS A 1 35 ? 0.220   -7.374  4.401   1.00 0.00 ? 35 LYS A N    13 
ATOM   11392 C CA   . LYS A 1 35 ? -0.755  -6.498  5.028   1.00 0.00 ? 35 LYS A CA   13 
ATOM   11393 C C    . LYS A 1 35 ? -0.835  -5.187  4.243   1.00 0.00 ? 35 LYS A C    13 
ATOM   11394 O O    . LYS A 1 35 ? 0.104   -4.824  3.536   1.00 0.00 ? 35 LYS A O    13 
ATOM   11395 C CB   . LYS A 1 35 ? -0.430  -6.308  6.511   1.00 0.00 ? 35 LYS A CB   13 
ATOM   11396 C CG   . LYS A 1 35 ? 0.727   -5.324  6.696   1.00 0.00 ? 35 LYS A CG   13 
ATOM   11397 C CD   . LYS A 1 35 ? 1.905   -5.991  7.408   1.00 0.00 ? 35 LYS A CD   13 
ATOM   11398 C CE   . LYS A 1 35 ? 2.483   -5.075  8.489   1.00 0.00 ? 35 LYS A CE   13 
ATOM   11399 N NZ   . LYS A 1 35 ? 1.754   -5.254  9.764   1.00 0.00 ? 35 LYS A NZ   13 
ATOM   11400 H H    . LYS A 1 35 ? 0.726   -6.968  3.641   1.00 0.00 ? 35 LYS A H    13 
ATOM   11401 H HA   . LYS A 1 35 ? -1.724  -6.994  4.971   1.00 0.00 ? 35 LYS A HA   13 
ATOM   11402 H HB2  . LYS A 1 35 ? -1.312  -5.941  7.036   1.00 0.00 ? 35 LYS A HB2  13 
ATOM   11403 H HB3  . LYS A 1 35 ? -0.171  -7.268  6.956   1.00 0.00 ? 35 LYS A HB3  13 
ATOM   11404 H HG2  . LYS A 1 35 ? 1.049   -4.948  5.725   1.00 0.00 ? 35 LYS A HG2  13 
ATOM   11405 H HG3  . LYS A 1 35 ? 0.388   -4.464  7.274   1.00 0.00 ? 35 LYS A HG3  13 
ATOM   11406 H HD2  . LYS A 1 35 ? 1.579   -6.929  7.857   1.00 0.00 ? 35 LYS A HD2  13 
ATOM   11407 H HD3  . LYS A 1 35 ? 2.681   -6.238  6.683   1.00 0.00 ? 35 LYS A HD3  13 
ATOM   11408 H HE2  . LYS A 1 35 ? 3.541   -5.296  8.633   1.00 0.00 ? 35 LYS A HE2  13 
ATOM   11409 H HE3  . LYS A 1 35 ? 2.416   -4.036  8.167   1.00 0.00 ? 35 LYS A HE3  13 
ATOM   11410 H HZ1  . LYS A 1 35 ? 0.849   -5.638  9.580   1.00 0.00 ? 35 LYS A HZ1  13 
ATOM   11411 H HZ2  . LYS A 1 35 ? 2.266   -5.877  10.356  1.00 0.00 ? 35 LYS A HZ2  13 
ATOM   11412 N N    . ARG A 1 36 ? -1.961  -4.482  4.371   1.00 0.00 ? 36 ARG A N    13 
ATOM   11413 C CA   . ARG A 1 36 ? -2.159  -3.225  3.678   1.00 0.00 ? 36 ARG A CA   13 
ATOM   11414 C C    . ARG A 1 36 ? -2.859  -2.234  4.598   1.00 0.00 ? 36 ARG A C    13 
ATOM   11415 O O    . ARG A 1 36 ? -3.261  -2.588  5.704   1.00 0.00 ? 36 ARG A O    13 
ATOM   11416 C CB   . ARG A 1 36 ? -2.983  -3.465  2.416   1.00 0.00 ? 36 ARG A CB   13 
ATOM   11417 C CG   . ARG A 1 36 ? -2.292  -4.513  1.549   1.00 0.00 ? 36 ARG A CG   13 
ATOM   11418 C CD   . ARG A 1 36 ? -3.317  -5.169  0.628   1.00 0.00 ? 36 ARG A CD   13 
ATOM   11419 N NE   . ARG A 1 36 ? -4.278  -5.963  1.393   1.00 0.00 ? 36 ARG A NE   13 
ATOM   11420 C CZ   . ARG A 1 36 ? -4.996  -6.955  0.849   1.00 0.00 ? 36 ARG A CZ   13 
ATOM   11421 N NH1  . ARG A 1 36 ? -4.848  -7.256  -0.448  1.00 0.00 ? 36 ARG A NH1  13 
ATOM   11422 N NH2  . ARG A 1 36 ? -5.863  -7.647  1.602   1.00 0.00 ? 36 ARG A NH2  13 
ATOM   11423 H H    . ARG A 1 36 ? -2.702  -4.825  4.964   1.00 0.00 ? 36 ARG A H    13 
ATOM   11424 H HA   . ARG A 1 36 ? -1.188  -2.819  3.394   1.00 0.00 ? 36 ARG A HA   13 
ATOM   11425 H HB2  . ARG A 1 36 ? -3.976  -3.819  2.693   1.00 0.00 ? 36 ARG A HB2  13 
ATOM   11426 H HB3  . ARG A 1 36 ? -3.072  -2.533  1.858   1.00 0.00 ? 36 ARG A HB3  13 
ATOM   11427 H HG2  . ARG A 1 36 ? -1.518  -4.035  0.949   1.00 0.00 ? 36 ARG A HG2  13 
ATOM   11428 H HG3  . ARG A 1 36 ? -1.840  -5.272  2.188   1.00 0.00 ? 36 ARG A HG3  13 
ATOM   11429 H HD2  . ARG A 1 36 ? -3.852  -4.393  0.079   1.00 0.00 ? 36 ARG A HD2  13 
ATOM   11430 H HD3  . ARG A 1 36 ? -2.800  -5.817  -0.079  1.00 0.00 ? 36 ARG A HD3  13 
ATOM   11431 H HE   . ARG A 1 36 ? -4.397  -5.744  2.372   1.00 0.00 ? 36 ARG A HE   13 
ATOM   11432 H HH11 . ARG A 1 36 ? -4.195  -6.735  -1.016  1.00 0.00 ? 36 ARG A HH11 13 
ATOM   11433 H HH12 . ARG A 1 36 ? -5.389  -8.004  -0.858  1.00 0.00 ? 36 ARG A HH12 13 
ATOM   11434 H HH21 . ARG A 1 36 ? -5.975  -7.420  2.580   1.00 0.00 ? 36 ARG A HH21 13 
ATOM   11435 H HH22 . ARG A 1 36 ? -6.404  -8.394  1.192   1.00 0.00 ? 36 ARG A HH22 13 
ATOM   11436 N N    . GLY A 1 37 ? -2.985  -1.008  4.109   1.00 0.00 ? 37 GLY A N    13 
ATOM   11437 C CA   . GLY A 1 37 ? -3.633  0.040   4.879   1.00 0.00 ? 37 GLY A CA   13 
ATOM   11438 C C    . GLY A 1 37 ? -3.661  1.356   4.098   1.00 0.00 ? 37 GLY A C    13 
ATOM   11439 O O    . GLY A 1 37 ? -3.300  1.392   2.923   1.00 0.00 ? 37 GLY A O    13 
ATOM   11440 H H    . GLY A 1 37 ? -2.656  -0.728  3.208   1.00 0.00 ? 37 GLY A H    13 
ATOM   11441 H HA2  . GLY A 1 37 ? -4.651  -0.262  5.126   1.00 0.00 ? 37 GLY A HA2  13 
ATOM   11442 H HA3  . GLY A 1 37 ? -3.106  0.183   5.821   1.00 0.00 ? 37 GLY A HA3  13 
ATOM   11443 N N    . CYS A 1 38 ? -4.092  2.404   4.784   1.00 0.00 ? 38 CYS A N    13 
ATOM   11444 C CA   . CYS A 1 38 ? -4.172  3.719   4.170   1.00 0.00 ? 38 CYS A CA   13 
ATOM   11445 C C    . CYS A 1 38 ? -3.032  4.577   4.722   1.00 0.00 ? 38 CYS A C    13 
ATOM   11446 O O    . CYS A 1 38 ? -2.598  4.383   5.857   1.00 0.00 ? 38 CYS A O    13 
ATOM   11447 C CB   . CYS A 1 38 ? -5.538  4.369   4.399   1.00 0.00 ? 38 CYS A CB   13 
ATOM   11448 S SG   . CYS A 1 38 ? -6.952  3.454   3.685   1.00 0.00 ? 38 CYS A SG   13 
ATOM   11449 H H    . CYS A 1 38 ? -4.384  2.366   5.740   1.00 0.00 ? 38 CYS A H    13 
ATOM   11450 H HA   . CYS A 1 38 ? -4.059  3.570   3.096   1.00 0.00 ? 38 CYS A HA   13 
ATOM   11451 H HB2  . CYS A 1 38 ? -5.698  4.477   5.472   1.00 0.00 ? 38 CYS A HB2  13 
ATOM   11452 H HB3  . CYS A 1 38 ? -5.522  5.373   3.976   1.00 0.00 ? 38 CYS A HB3  13 
ATOM   11453 N N    . ILE A 1 39 ? -2.579  5.507   3.894   1.00 0.00 ? 39 ILE A N    13 
ATOM   11454 C CA   . ILE A 1 39 ? -1.498  6.395   4.286   1.00 0.00 ? 39 ILE A CA   13 
ATOM   11455 C C    . ILE A 1 39 ? -1.482  7.612   3.359   1.00 0.00 ? 39 ILE A C    13 
ATOM   11456 O O    . ILE A 1 39 ? -2.324  7.730   2.470   1.00 0.00 ? 39 ILE A O    13 
ATOM   11457 C CB   . ILE A 1 39 ? -0.170  5.637   4.327   1.00 0.00 ? 39 ILE A CB   13 
ATOM   11458 C CG1  . ILE A 1 39 ? 0.720   6.150   5.461   1.00 0.00 ? 39 ILE A CG1  13 
ATOM   11459 C CG2  . ILE A 1 39 ? 0.538   5.695   2.972   1.00 0.00 ? 39 ILE A CG2  13 
ATOM   11460 C CD1  . ILE A 1 39 ? 0.723   5.176   6.641   1.00 0.00 ? 39 ILE A CD1  13 
ATOM   11461 H H    . ILE A 1 39 ? -2.937  5.658   2.973   1.00 0.00 ? 39 ILE A H    13 
ATOM   11462 H HA   . ILE A 1 39 ? -1.706  6.736   5.300   1.00 0.00 ? 39 ILE A HA   13 
ATOM   11463 H HB   . ILE A 1 39 ? -0.382  4.588   4.535   1.00 0.00 ? 39 ILE A HB   13 
ATOM   11464 H HG12 . ILE A 1 39 ? 1.738   6.287   5.096   1.00 0.00 ? 39 ILE A HG12 13 
ATOM   11465 H HG13 . ILE A 1 39 ? 0.366   7.127   5.792   1.00 0.00 ? 39 ILE A HG13 13 
ATOM   11466 H HG21 . ILE A 1 39 ? 1.530   5.252   3.061   1.00 0.00 ? 39 ILE A HG21 13 
ATOM   11467 H HG22 . ILE A 1 39 ? -0.043  5.141   2.235   1.00 0.00 ? 39 ILE A HG22 13 
ATOM   11468 H HD11 . ILE A 1 39 ? -0.303  4.994   6.964   1.00 0.00 ? 39 ILE A HD11 13 
ATOM   11469 H HD12 . ILE A 1 39 ? 1.179   4.235   6.334   1.00 0.00 ? 39 ILE A HD12 13 
ATOM   11470 N N    . ASP A 1 40 ? -0.521  8.513   3.571   1.00 0.00 ? 40 ASP A N    13 
ATOM   11471 C CA   . ASP A 1 40 ? -0.401  9.709   2.761   1.00 0.00 ? 40 ASP A CA   13 
ATOM   11472 C C    . ASP A 1 40 ? 0.866   9.637   1.921   1.00 0.00 ? 40 ASP A C    13 
ATOM   11473 O O    . ASP A 1 40 ? 0.835   9.907   0.723   1.00 0.00 ? 40 ASP A O    13 
ATOM   11474 C CB   . ASP A 1 40 ? -0.381  10.936  3.667   1.00 0.00 ? 40 ASP A CB   13 
ATOM   11475 C CG   . ASP A 1 40 ? 0.785   10.872  4.643   1.00 0.00 ? 40 ASP A CG   13 
ATOM   11476 O OD1  . ASP A 1 40 ? 1.894   11.277  4.231   1.00 0.00 ? 40 ASP A OD1  13 
ATOM   11477 O OD2  . ASP A 1 40 ? 0.547   10.420  5.784   1.00 0.00 ? 40 ASP A OD2  13 
ATOM   11478 H H    . ASP A 1 40 ? 0.146   8.369   4.315   1.00 0.00 ? 40 ASP A H    13 
ATOM   11479 H HA   . ASP A 1 40 ? -1.263  9.774   2.096   1.00 0.00 ? 40 ASP A HA   13 
ATOM   11480 H HB2  . ASP A 1 40 ? -0.286  11.833  3.054   1.00 0.00 ? 40 ASP A HB2  13 
ATOM   11481 H HB3  . ASP A 1 40 ? -1.314  10.983  4.228   1.00 0.00 ? 40 ASP A HB3  13 
ATOM   11482 H HD2  . ASP A 1 40 ? 1.321   10.405  6.351   1.00 0.00 ? 40 ASP A HD2  13 
ATOM   11483 N N    . VAL A 1 41 ? 1.956   9.270   2.581   1.00 0.00 ? 41 VAL A N    13 
ATOM   11484 C CA   . VAL A 1 41 ? 3.237   9.160   1.905   1.00 0.00 ? 41 VAL A CA   13 
ATOM   11485 C C    . VAL A 1 41 ? 3.658   7.690   1.857   1.00 0.00 ? 41 VAL A C    13 
ATOM   11486 O O    . VAL A 1 41 ? 3.218   6.887   2.678   1.00 0.00 ? 41 VAL A O    13 
ATOM   11487 C CB   . VAL A 1 41 ? 4.271   10.055  2.592   1.00 0.00 ? 41 VAL A CB   13 
ATOM   11488 C CG1  . VAL A 1 41 ? 4.644   9.505   3.970   1.00 0.00 ? 41 VAL A CG1  13 
ATOM   11489 C CG2  . VAL A 1 41 ? 5.513   10.230  1.716   1.00 0.00 ? 41 VAL A CG2  13 
ATOM   11490 H H    . VAL A 1 41 ? 1.973   9.052   3.557   1.00 0.00 ? 41 VAL A H    13 
ATOM   11491 H HA   . VAL A 1 41 ? 3.103   9.520   0.885   1.00 0.00 ? 41 VAL A HA   13 
ATOM   11492 H HB   . VAL A 1 41 ? 3.820   11.038  2.734   1.00 0.00 ? 41 VAL A HB   13 
ATOM   11493 H HG11 . VAL A 1 41 ? 4.047   10.003  4.734   1.00 0.00 ? 41 VAL A HG11 13 
ATOM   11494 H HG12 . VAL A 1 41 ? 4.448   8.433   3.998   1.00 0.00 ? 41 VAL A HG12 13 
ATOM   11495 H HG21 . VAL A 1 41 ? 6.150   11.006  2.140   1.00 0.00 ? 41 VAL A HG21 13 
ATOM   11496 H HG22 . VAL A 1 41 ? 6.064   9.290   1.676   1.00 0.00 ? 41 VAL A HG22 13 
ATOM   11497 N N    . CYS A 1 42 ? 4.506   7.381   0.886   1.00 0.00 ? 42 CYS A N    13 
ATOM   11498 C CA   . CYS A 1 42 ? 4.991   6.022   0.720   1.00 0.00 ? 42 CYS A CA   13 
ATOM   11499 C C    . CYS A 1 42 ? 6.384   5.929   1.346   1.00 0.00 ? 42 CYS A C    13 
ATOM   11500 O O    . CYS A 1 42 ? 7.216   6.814   1.150   1.00 0.00 ? 42 CYS A O    13 
ATOM   11501 C CB   . CYS A 1 42 ? 4.997   5.599   -0.751  1.00 0.00 ? 42 CYS A CB   13 
ATOM   11502 S SG   . CYS A 1 42 ? 4.191   3.991   -1.090  1.00 0.00 ? 42 CYS A SG   13 
ATOM   11503 H H    . CYS A 1 42 ? 4.859   8.040   0.221   1.00 0.00 ? 42 CYS A H    13 
ATOM   11504 H HA   . CYS A 1 42 ? 4.288   5.373   1.242   1.00 0.00 ? 42 CYS A HA   13 
ATOM   11505 H HB2  . CYS A 1 42 ? 4.498   6.370   -1.338  1.00 0.00 ? 42 CYS A HB2  13 
ATOM   11506 H HB3  . CYS A 1 42 ? 6.029   5.552   -1.097  1.00 0.00 ? 42 CYS A HB3  13 
ATOM   11507 N N    . PRO A 1 43 ? 6.600   4.822   2.105   1.00 0.00 ? 43 PRO A N    13 
ATOM   11508 C CA   . PRO A 1 43 ? 7.878   4.602   2.761   1.00 0.00 ? 43 PRO A CA   13 
ATOM   11509 C C    . PRO A 1 43 ? 8.943   4.162   1.754   1.00 0.00 ? 43 PRO A C    13 
ATOM   11510 O O    . PRO A 1 43 ? 8.617   3.741   0.645   1.00 0.00 ? 43 PRO A O    13 
ATOM   11511 C CB   . PRO A 1 43 ? 7.599   3.555   3.826   1.00 0.00 ? 43 PRO A CB   13 
ATOM   11512 C CG   . PRO A 1 43 ? 6.292   2.889   3.424   1.00 0.00 ? 43 PRO A CG   13 
ATOM   11513 C CD   . PRO A 1 43 ? 5.638   3.754   2.358   1.00 0.00 ? 43 PRO A CD   13 
ATOM   11514 H HA   . PRO A 1 43 ? 8.215   5.455   3.159   1.00 0.00 ? 43 PRO A HA   13 
ATOM   11515 H HB2  . PRO A 1 43 ? 8.408   2.826   3.879   1.00 0.00 ? 43 PRO A HB2  13 
ATOM   11516 H HB3  . PRO A 1 43 ? 7.517   4.012   4.812   1.00 0.00 ? 43 PRO A HB3  13 
ATOM   11517 H HG2  . PRO A 1 43 ? 6.477   1.886   3.041   1.00 0.00 ? 43 PRO A HG2  13 
ATOM   11518 H HG3  . PRO A 1 43 ? 5.636   2.785   4.287   1.00 0.00 ? 43 PRO A HG3  13 
ATOM   11519 H HD2  . PRO A 1 43 ? 5.435   3.181   1.453   1.00 0.00 ? 43 PRO A HD2  13 
ATOM   11520 H HD3  . PRO A 1 43 ? 4.684   4.154   2.703   1.00 0.00 ? 43 PRO A HD3  13 
ATOM   11521 N N    . LYS A 1 44 ? 10.194  4.275   2.176   1.00 0.00 ? 44 LYS A N    13 
ATOM   11522 C CA   . LYS A 1 44 ? 11.308  3.894   1.325   1.00 0.00 ? 44 LYS A CA   13 
ATOM   11523 C C    . LYS A 1 44 ? 11.224  2.396   1.023   1.00 0.00 ? 44 LYS A C    13 
ATOM   11524 O O    . LYS A 1 44 ? 10.923  1.596   1.908   1.00 0.00 ? 44 LYS A O    13 
ATOM   11525 C CB   . LYS A 1 44 ? 12.635  4.320   1.957   1.00 0.00 ? 44 LYS A CB   13 
ATOM   11526 C CG   . LYS A 1 44 ? 13.821  3.754   1.174   1.00 0.00 ? 44 LYS A CG   13 
ATOM   11527 C CD   . LYS A 1 44 ? 15.135  3.992   1.922   1.00 0.00 ? 44 LYS A CD   13 
ATOM   11528 C CE   . LYS A 1 44 ? 15.787  5.304   1.483   1.00 0.00 ? 44 LYS A CE   13 
ATOM   11529 N NZ   . LYS A 1 44 ? 17.152  5.058   0.968   1.00 0.00 ? 44 LYS A NZ   13 
ATOM   11530 H H    . LYS A 1 44 ? 10.450  4.618   3.080   1.00 0.00 ? 44 LYS A H    13 
ATOM   11531 H HA   . LYS A 1 44 ? 11.206  4.441   0.388   1.00 0.00 ? 44 LYS A HA   13 
ATOM   11532 H HB2  . LYS A 1 44 ? 12.697  5.408   1.982   1.00 0.00 ? 44 LYS A HB2  13 
ATOM   11533 H HB3  . LYS A 1 44 ? 12.677  3.975   2.990   1.00 0.00 ? 44 LYS A HB3  13 
ATOM   11534 H HG2  . LYS A 1 44 ? 13.679  2.686   1.013   1.00 0.00 ? 44 LYS A HG2  13 
ATOM   11535 H HG3  . LYS A 1 44 ? 13.869  4.222   0.191   1.00 0.00 ? 44 LYS A HG3  13 
ATOM   11536 H HD2  . LYS A 1 44 ? 14.946  4.016   2.996   1.00 0.00 ? 44 LYS A HD2  13 
ATOM   11537 H HD3  . LYS A 1 44 ? 15.818  3.162   1.738   1.00 0.00 ? 44 LYS A HD3  13 
ATOM   11538 H HE2  . LYS A 1 44 ? 15.180  5.777   0.711   1.00 0.00 ? 44 LYS A HE2  13 
ATOM   11539 H HE3  . LYS A 1 44 ? 15.828  5.996   2.324   1.00 0.00 ? 44 LYS A HE3  13 
ATOM   11540 H HZ1  . LYS A 1 44 ? 17.822  5.322   1.662   1.00 0.00 ? 44 LYS A HZ1  13 
ATOM   11541 H HZ2  . LYS A 1 44 ? 17.258  4.086   0.756   1.00 0.00 ? 44 LYS A HZ2  13 
ATOM   11542 N N    . SER A 1 45 ? 11.496  2.062   -0.230  1.00 0.00 ? 45 SER A N    13 
ATOM   11543 C CA   . SER A 1 45 ? 11.455  0.674   -0.660  1.00 0.00 ? 45 SER A CA   13 
ATOM   11544 C C    . SER A 1 45 ? 12.824  0.023   -0.455  1.00 0.00 ? 45 SER A C    13 
ATOM   11545 O O    . SER A 1 45 ? 13.856  0.664   -0.648  1.00 0.00 ? 45 SER A O    13 
ATOM   11546 C CB   . SER A 1 45 ? 11.029  0.564   -2.125  1.00 0.00 ? 45 SER A CB   13 
ATOM   11547 O OG   . SER A 1 45 ? 9.650   0.232   -2.256  1.00 0.00 ? 45 SER A OG   13 
ATOM   11548 H H    . SER A 1 45 ? 11.740  2.718   -0.944  1.00 0.00 ? 45 SER A H    13 
ATOM   11549 H HA   . SER A 1 45 ? 10.706  0.198   -0.027  1.00 0.00 ? 45 SER A HA   13 
ATOM   11550 H HB2  . SER A 1 45 ? 11.224  1.510   -2.631  1.00 0.00 ? 45 SER A HB2  13 
ATOM   11551 H HB3  . SER A 1 45 ? 11.634  -0.194  -2.623  1.00 0.00 ? 45 SER A HB3  13 
ATOM   11552 H HG   . SER A 1 45 ? 9.083   1.014   -1.997  1.00 0.00 ? 45 SER A HG   13 
ATOM   11553 N N    . SER A 1 46 ? 12.789  -1.244  -0.066  1.00 0.00 ? 46 SER A N    13 
ATOM   11554 C CA   . SER A 1 46 ? 14.014  -1.989  0.167   1.00 0.00 ? 46 SER A CA   13 
ATOM   11555 C C    . SER A 1 46 ? 14.088  -3.185  -0.784  1.00 0.00 ? 46 SER A C    13 
ATOM   11556 O O    . SER A 1 46 ? 13.271  -3.310  -1.695  1.00 0.00 ? 46 SER A O    13 
ATOM   11557 C CB   . SER A 1 46 ? 14.104  -2.460  1.620   1.00 0.00 ? 46 SER A CB   13 
ATOM   11558 O OG   . SER A 1 46 ? 13.121  -3.446  1.923   1.00 0.00 ? 46 SER A OG   13 
ATOM   11559 H H    . SER A 1 46 ? 11.945  -1.758  0.088   1.00 0.00 ? 46 SER A H    13 
ATOM   11560 H HA   . SER A 1 46 ? 14.823  -1.287  -0.038  1.00 0.00 ? 46 SER A HA   13 
ATOM   11561 H HB2  . SER A 1 46 ? 15.097  -2.869  1.808   1.00 0.00 ? 46 SER A HB2  13 
ATOM   11562 H HB3  . SER A 1 46 ? 13.979  -1.607  2.286   1.00 0.00 ? 46 SER A HB3  13 
ATOM   11563 H HG   . SER A 1 46 ? 13.008  -4.067  1.147   1.00 0.00 ? 46 SER A HG   13 
ATOM   11564 N N    . LEU A 1 47 ? 15.075  -4.035  -0.540  1.00 0.00 ? 47 LEU A N    13 
ATOM   11565 C CA   . LEU A 1 47 ? 15.267  -5.216  -1.364  1.00 0.00 ? 47 LEU A CA   13 
ATOM   11566 C C    . LEU A 1 47 ? 14.410  -6.359  -0.816  1.00 0.00 ? 47 LEU A C    13 
ATOM   11567 O O    . LEU A 1 47 ? 13.711  -7.033  -1.571  1.00 0.00 ? 47 LEU A O    13 
ATOM   11568 C CB   . LEU A 1 47 ? 16.754  -5.560  -1.471  1.00 0.00 ? 47 LEU A CB   13 
ATOM   11569 C CG   . LEU A 1 47 ? 17.608  -4.593  -2.295  1.00 0.00 ? 47 LEU A CG   13 
ATOM   11570 C CD1  . LEU A 1 47 ? 19.090  -4.960  -2.207  1.00 0.00 ? 47 LEU A CD1  13 
ATOM   11571 C CD2  . LEU A 1 47 ? 17.118  -4.526  -3.743  1.00 0.00 ? 47 LEU A CD2  13 
ATOM   11572 H H    . LEU A 1 47 ? 15.736  -3.926  0.202   1.00 0.00 ? 47 LEU A H    13 
ATOM   11573 H HA   . LEU A 1 47 ? 14.918  -4.974  -2.368  1.00 0.00 ? 47