data_1G88
# 
_entry.id   1G88 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1G88         
RCSB  RCSB012356   
WWPDB D_1000012356 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1DD1 
_pdbx_database_related.details        '1DD1 is native form of S4AF' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1G88 
_pdbx_database_status.recvd_initial_deposition_date   2000-11-16 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Chako, B.M.'   1 
'Qin, B.'       2 
'Lam, S.S.'     3 
'Correia, J.J.' 4 
'Lin, K.'       5 
# 
_citation.id                        primary 
_citation.title                     'The L3 loop and C-terminal phosphorylation jointly define Smad protein trimerization.' 
_citation.journal_abbrev            Nat.Struct.Biol. 
_citation.journal_volume            8 
_citation.page_first                248 
_citation.page_last                 253 
_citation.year                      2001 
_citation.journal_id_ASTM           NSBIEW 
_citation.country                   US 
_citation.journal_id_ISSN           1072-8368 
_citation.journal_id_CSD            2024 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   11224571 
_citation.pdbx_database_id_DOI      10.1038/84995 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Chacko, B.M.'        1 
primary 'Qin, B.'             2 
primary 'Correia, J.J.'       3 
primary 'Lam, S.S.'           4 
primary 'de Caestecker, M.P.' 5 
primary 'Lin, K.'             6 
# 
_cell.entry_id           1G88 
_cell.length_a           140.855 
_cell.length_b           140.855 
_cell.length_c           194.613 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              48 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1G88 
_symmetry.space_group_name_H-M             'I 41 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                98 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 nat 
_entity.pdbx_description           SMAD4 
_entity.formula_weight             29348.332 
_entity.pdbx_number_of_molecules   3 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              R515S 
_entity.pdbx_fragment              'SMAD4 ACTIVE FRAGMENT' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        DPC4 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;NGHLQHHPPMPPHPGHYWPVHNELAFQPPISNHPAPEYWCSIAYFEMDVQVGETFKVPSSCPIVTVDGYVDPSGGDRFCL
GQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGRAPGDAVHKIYPSAYIKVFDLRQCH
RQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAPAISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPSQSIKETPCW
IEIHLHRALQLLDEVLHTMPIADPQPLD
;
_entity_poly.pdbx_seq_one_letter_code_can   
;NGHLQHHPPMPPHPGHYWPVHNELAFQPPISNHPAPEYWCSIAYFEMDVQVGETFKVPSSCPIVTVDGYVDPSGGDRFCL
GQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGRAPGDAVHKIYPSAYIKVFDLRQCH
RQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAPAISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPSQSIKETPCW
IEIHLHRALQLLDEVLHTMPIADPQPLD
;
_entity_poly.pdbx_strand_id                 A,B,C 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASN n 
1 2   GLY n 
1 3   HIS n 
1 4   LEU n 
1 5   GLN n 
1 6   HIS n 
1 7   HIS n 
1 8   PRO n 
1 9   PRO n 
1 10  MET n 
1 11  PRO n 
1 12  PRO n 
1 13  HIS n 
1 14  PRO n 
1 15  GLY n 
1 16  HIS n 
1 17  TYR n 
1 18  TRP n 
1 19  PRO n 
1 20  VAL n 
1 21  HIS n 
1 22  ASN n 
1 23  GLU n 
1 24  LEU n 
1 25  ALA n 
1 26  PHE n 
1 27  GLN n 
1 28  PRO n 
1 29  PRO n 
1 30  ILE n 
1 31  SER n 
1 32  ASN n 
1 33  HIS n 
1 34  PRO n 
1 35  ALA n 
1 36  PRO n 
1 37  GLU n 
1 38  TYR n 
1 39  TRP n 
1 40  CYS n 
1 41  SER n 
1 42  ILE n 
1 43  ALA n 
1 44  TYR n 
1 45  PHE n 
1 46  GLU n 
1 47  MET n 
1 48  ASP n 
1 49  VAL n 
1 50  GLN n 
1 51  VAL n 
1 52  GLY n 
1 53  GLU n 
1 54  THR n 
1 55  PHE n 
1 56  LYS n 
1 57  VAL n 
1 58  PRO n 
1 59  SER n 
1 60  SER n 
1 61  CYS n 
1 62  PRO n 
1 63  ILE n 
1 64  VAL n 
1 65  THR n 
1 66  VAL n 
1 67  ASP n 
1 68  GLY n 
1 69  TYR n 
1 70  VAL n 
1 71  ASP n 
1 72  PRO n 
1 73  SER n 
1 74  GLY n 
1 75  GLY n 
1 76  ASP n 
1 77  ARG n 
1 78  PHE n 
1 79  CYS n 
1 80  LEU n 
1 81  GLY n 
1 82  GLN n 
1 83  LEU n 
1 84  SER n 
1 85  ASN n 
1 86  VAL n 
1 87  HIS n 
1 88  ARG n 
1 89  THR n 
1 90  GLU n 
1 91  ALA n 
1 92  ILE n 
1 93  GLU n 
1 94  ARG n 
1 95  ALA n 
1 96  ARG n 
1 97  LEU n 
1 98  HIS n 
1 99  ILE n 
1 100 GLY n 
1 101 LYS n 
1 102 GLY n 
1 103 VAL n 
1 104 GLN n 
1 105 LEU n 
1 106 GLU n 
1 107 CYS n 
1 108 LYS n 
1 109 GLY n 
1 110 GLU n 
1 111 GLY n 
1 112 ASP n 
1 113 VAL n 
1 114 TRP n 
1 115 VAL n 
1 116 ARG n 
1 117 CYS n 
1 118 LEU n 
1 119 SER n 
1 120 ASP n 
1 121 HIS n 
1 122 ALA n 
1 123 VAL n 
1 124 PHE n 
1 125 VAL n 
1 126 GLN n 
1 127 SER n 
1 128 TYR n 
1 129 TYR n 
1 130 LEU n 
1 131 ASP n 
1 132 ARG n 
1 133 GLU n 
1 134 ALA n 
1 135 GLY n 
1 136 ARG n 
1 137 ALA n 
1 138 PRO n 
1 139 GLY n 
1 140 ASP n 
1 141 ALA n 
1 142 VAL n 
1 143 HIS n 
1 144 LYS n 
1 145 ILE n 
1 146 TYR n 
1 147 PRO n 
1 148 SER n 
1 149 ALA n 
1 150 TYR n 
1 151 ILE n 
1 152 LYS n 
1 153 VAL n 
1 154 PHE n 
1 155 ASP n 
1 156 LEU n 
1 157 ARG n 
1 158 GLN n 
1 159 CYS n 
1 160 HIS n 
1 161 ARG n 
1 162 GLN n 
1 163 MET n 
1 164 GLN n 
1 165 GLN n 
1 166 GLN n 
1 167 ALA n 
1 168 ALA n 
1 169 THR n 
1 170 ALA n 
1 171 GLN n 
1 172 ALA n 
1 173 ALA n 
1 174 ALA n 
1 175 ALA n 
1 176 ALA n 
1 177 GLN n 
1 178 ALA n 
1 179 ALA n 
1 180 ALA n 
1 181 VAL n 
1 182 ALA n 
1 183 GLY n 
1 184 ASN n 
1 185 ILE n 
1 186 PRO n 
1 187 GLY n 
1 188 PRO n 
1 189 GLY n 
1 190 SER n 
1 191 VAL n 
1 192 GLY n 
1 193 GLY n 
1 194 ILE n 
1 195 ALA n 
1 196 PRO n 
1 197 ALA n 
1 198 ILE n 
1 199 SER n 
1 200 LEU n 
1 201 SER n 
1 202 ALA n 
1 203 ALA n 
1 204 ALA n 
1 205 GLY n 
1 206 ILE n 
1 207 GLY n 
1 208 VAL n 
1 209 ASP n 
1 210 ASP n 
1 211 LEU n 
1 212 ARG n 
1 213 ARG n 
1 214 LEU n 
1 215 CYS n 
1 216 ILE n 
1 217 LEU n 
1 218 ARG n 
1 219 MET n 
1 220 SER n 
1 221 PHE n 
1 222 VAL n 
1 223 LYS n 
1 224 GLY n 
1 225 TRP n 
1 226 GLY n 
1 227 PRO n 
1 228 ASP n 
1 229 TYR n 
1 230 PRO n 
1 231 SER n 
1 232 GLN n 
1 233 SER n 
1 234 ILE n 
1 235 LYS n 
1 236 GLU n 
1 237 THR n 
1 238 PRO n 
1 239 CYS n 
1 240 TRP n 
1 241 ILE n 
1 242 GLU n 
1 243 ILE n 
1 244 HIS n 
1 245 LEU n 
1 246 HIS n 
1 247 ARG n 
1 248 ALA n 
1 249 LEU n 
1 250 GLN n 
1 251 LEU n 
1 252 LEU n 
1 253 ASP n 
1 254 GLU n 
1 255 VAL n 
1 256 LEU n 
1 257 HIS n 
1 258 THR n 
1 259 MET n 
1 260 PRO n 
1 261 ILE n 
1 262 ALA n 
1 263 ASP n 
1 264 PRO n 
1 265 GLN n 
1 266 PRO n 
1 267 LEU n 
1 268 ASP n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                human 
_entity_src_nat.pdbx_organism_scientific   'Homo sapiens' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      9606 
_entity_src_nat.genus                      Homo 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    SMAD4_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;NGHLQHHPPMPPHPGHYWPVHNELAFQPPISNHPAPEYWCSIAYFEMDVQVGETFKVPSSCPIVTVDGYVDPSGGDRFCL
GQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGRAPGDAVHKIYPSAYIKVFDLRQCH
RQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAPAISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCW
IEIHLHRALQLLDEVLHTMPIADPQPLD
;
_struct_ref.pdbx_align_begin           285 
_struct_ref.pdbx_db_accession          Q13485 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1G88 A 1 ? 268 ? Q13485 285 ? 552 ? 285 552 
2 1 1G88 B 1 ? 268 ? Q13485 285 ? 552 ? 285 552 
3 1 1G88 C 1 ? 268 ? Q13485 285 ? 552 ? 285 552 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1G88 SER A 231 ? UNP Q13485 ARG 515 ENGINEERED 515 1 
2 1G88 SER B 231 ? UNP Q13485 ARG 515 ENGINEERED 515 2 
3 1G88 SER C 231 ? UNP Q13485 ARG 515 ENGINEERED 515 3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1G88 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.74 
_exptl_crystal.density_percent_sol   55.09 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7 
_exptl_crystal_grow.pdbx_details    'pH 7, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           298 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   RIGAKU 
_diffrn_detector.pdbx_collection_date   2000-03-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        RIGAKU 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1G88 
_reflns.observed_criterion_sigma_I   5.5 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            3 
_reflns.number_obs                   19552 
_reflns.number_all                   72845 
_reflns.percent_possible_obs         97.9 
_reflns.pdbx_Rmerge_I_obs            0.1260000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        9.5 
_reflns.B_iso_Wilson_estimate        26.4 
_reflns.pdbx_redundancy              3.72 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             3 
_reflns_shell.d_res_low              3.11 
_reflns_shell.percent_possible_all   88 
_reflns_shell.Rmerge_I_obs           0.4850000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    5.5 
_reflns_shell.pdbx_redundancy        3 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1G88 
_refine.ls_number_reflns_obs                     18416 
_refine.ls_number_reflns_all                     19954 
_refine.pdbx_ls_sigma_I                          0 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               191639.16 
_refine.pdbx_data_cutoff_low_absF                0.00 
_refine.ls_d_res_low                             40.50 
_refine.ls_d_res_high                            3.00 
_refine.ls_percent_reflns_obs                    92.6 
_refine.ls_R_factor_obs                          0.2030000 
_refine.ls_R_factor_all                          0.1900000 
_refine.ls_R_factor_R_work                       0.2030000 
_refine.ls_R_factor_R_free                       0.2634000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  897 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               26.4 
_refine.aniso_B[1][1]                            0.39 
_refine.aniso_B[2][2]                            0.39 
_refine.aniso_B[3][3]                            -0.78 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.323 
_refine.solvent_model_param_bsol                 12.00 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1G88 
_refine_analyze.Luzzati_coordinate_error_obs    0.32 
_refine_analyze.Luzzati_sigma_a_obs             0.43 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5431 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               5431 
_refine_hist.d_res_high                       3.00 
_refine_hist.d_res_low                        40.50 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.007 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.3   ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 24.7  ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 0.82  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       3.00 
_refine_ls_shell.d_res_low                        3.19 
_refine_ls_shell.number_reflns_R_work             2557 
_refine_ls_shell.R_factor_R_work                  0.2760000 
_refine_ls_shell.percent_reflns_obs               88 
_refine_ls_shell.R_factor_R_free                  ? 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 WATER_REP.PARAM   WATER.TOP   'X-RAY DIFFRACTION' 
3 ION.PARAM         ION.TOP     'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1G88 
_struct.title                     'S4AFL3ARG515 MUTANT' 
_struct.pdbx_descriptor           SMAD4 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1G88 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
_struct_keywords.text            'transcriptional factor, L3 loop mutant, TRANSCRIPTION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 89  ? LEU A 97  ? THR A 373 LEU A 381 1 ? 9  
HELX_P HELX_P2  2  SER A 127 ? ALA A 134 ? SER A 411 ALA A 418 1 ? 8  
HELX_P HELX_P3  3  ASP A 155 ? ALA A 173 ? ASP A 439 ALA A 457 1 ? 19 
HELX_P HELX_P4  4  GLY A 207 ? ARG A 212 ? GLY A 491 ARG A 496 1 ? 6  
HELX_P HELX_P5  5  SER A 233 ? THR A 237 ? SER A 517 THR A 521 5 ? 5  
HELX_P HELX_P6  6  HIS A 246 ? LEU A 256 ? HIS A 530 LEU A 540 1 ? 11 
HELX_P HELX_P7  7  THR B 89  ? GLY B 100 ? THR B 373 GLY B 384 1 ? 12 
HELX_P HELX_P8  8  SER B 127 ? ALA B 134 ? SER B 411 ALA B 418 1 ? 8  
HELX_P HELX_P9  9  ASP B 155 ? ALA B 182 ? ASP B 439 ALA B 466 1 ? 28 
HELX_P HELX_P10 10 GLY B 207 ? ARG B 212 ? GLY B 491 ARG B 496 1 ? 6  
HELX_P HELX_P11 11 SER B 233 ? THR B 237 ? SER B 517 THR B 521 5 ? 5  
HELX_P HELX_P12 12 HIS B 246 ? HIS B 257 ? HIS B 530 HIS B 541 1 ? 12 
HELX_P HELX_P13 13 THR C 89  ? HIS C 98  ? THR C 373 HIS C 382 1 ? 10 
HELX_P HELX_P14 14 SER C 127 ? ALA C 134 ? SER C 411 ALA C 418 1 ? 8  
HELX_P HELX_P15 15 ASP C 155 ? ALA C 179 ? ASP C 439 ALA C 463 1 ? 25 
HELX_P HELX_P16 16 GLY C 207 ? LEU C 214 ? GLY C 491 LEU C 498 1 ? 8  
HELX_P HELX_P17 17 SER C 233 ? THR C 237 ? SER C 517 THR C 521 5 ? 5  
HELX_P HELX_P18 18 HIS C 246 ? HIS C 257 ? HIS C 530 HIS C 541 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 7 ? 
B ? 7 ? 
C ? 5 ? 
D ? 7 ? 
E ? 7 ? 
F ? 5 ? 
G ? 7 ? 
H ? 7 ? 
I ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
A 6 7 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? anti-parallel 
B 6 7 ? anti-parallel 
C 1 2 ? parallel      
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
C 4 5 ? anti-parallel 
D 1 2 ? parallel      
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
D 4 5 ? anti-parallel 
D 5 6 ? anti-parallel 
D 6 7 ? anti-parallel 
E 1 2 ? parallel      
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
E 4 5 ? anti-parallel 
E 5 6 ? anti-parallel 
E 6 7 ? anti-parallel 
F 1 2 ? parallel      
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
F 4 5 ? anti-parallel 
G 1 2 ? parallel      
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
G 4 5 ? anti-parallel 
G 5 6 ? anti-parallel 
G 6 7 ? anti-parallel 
H 1 2 ? parallel      
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
H 4 5 ? anti-parallel 
H 5 6 ? anti-parallel 
H 6 7 ? anti-parallel 
I 1 2 ? parallel      
I 2 3 ? anti-parallel 
I 3 4 ? anti-parallel 
I 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 4   ? HIS A 7   ? LEU A 288 HIS A 291 
A 2 VAL A 142 ? ILE A 145 ? VAL A 426 ILE A 429 
A 3 VAL A 123 ? GLN A 126 ? VAL A 407 GLN A 410 
A 4 ILE A 216 ? PHE A 221 ? ILE A 500 PHE A 505 
A 5 TRP A 240 ? LEU A 245 ? TRP A 524 LEU A 529 
A 6 TYR A 38  ? GLU A 46  ? TYR A 322 GLU A 330 
A 7 VAL A 49  ? GLN A 50  ? VAL A 333 GLN A 334 
B 1 LEU A 4   ? HIS A 7   ? LEU A 288 HIS A 291 
B 2 VAL A 142 ? ILE A 145 ? VAL A 426 ILE A 429 
B 3 VAL A 123 ? GLN A 126 ? VAL A 407 GLN A 410 
B 4 ILE A 216 ? PHE A 221 ? ILE A 500 PHE A 505 
B 5 TRP A 240 ? LEU A 245 ? TRP A 524 LEU A 529 
B 6 TYR A 38  ? GLU A 46  ? TYR A 322 GLU A 330 
B 7 PHE A 55  ? PRO A 58  ? PHE A 339 PRO A 342 
C 1 ARG A 77  ? CYS A 79  ? ARG A 361 CYS A 363 
C 2 ILE A 63  ? ASP A 67  ? ILE A 347 ASP A 351 
C 3 VAL A 103 ? LYS A 108 ? VAL A 387 LYS A 392 
C 4 ASP A 112 ? CYS A 117 ? ASP A 396 CYS A 401 
C 5 TYR A 150 ? PHE A 154 ? TYR A 434 PHE A 438 
D 1 LEU B 4   ? HIS B 7   ? LEU B 288 HIS B 291 
D 2 VAL B 142 ? ILE B 145 ? VAL B 426 ILE B 429 
D 3 VAL B 123 ? GLN B 126 ? VAL B 407 GLN B 410 
D 4 ILE B 216 ? SER B 220 ? ILE B 500 SER B 504 
D 5 TRP B 240 ? LEU B 245 ? TRP B 524 LEU B 529 
D 6 TYR B 38  ? GLU B 46  ? TYR B 322 GLU B 330 
D 7 VAL B 49  ? GLN B 50  ? VAL B 333 GLN B 334 
E 1 LEU B 4   ? HIS B 7   ? LEU B 288 HIS B 291 
E 2 VAL B 142 ? ILE B 145 ? VAL B 426 ILE B 429 
E 3 VAL B 123 ? GLN B 126 ? VAL B 407 GLN B 410 
E 4 ILE B 216 ? SER B 220 ? ILE B 500 SER B 504 
E 5 TRP B 240 ? LEU B 245 ? TRP B 524 LEU B 529 
E 6 TYR B 38  ? GLU B 46  ? TYR B 322 GLU B 330 
E 7 PHE B 55  ? PRO B 58  ? PHE B 339 PRO B 342 
F 1 ARG B 77  ? CYS B 79  ? ARG B 361 CYS B 363 
F 2 ILE B 63  ? ASP B 67  ? ILE B 347 ASP B 351 
F 3 VAL B 103 ? LYS B 108 ? VAL B 387 LYS B 392 
F 4 ASP B 112 ? CYS B 117 ? ASP B 396 CYS B 401 
F 5 TYR B 150 ? PHE B 154 ? TYR B 434 PHE B 438 
G 1 LEU C 4   ? HIS C 7   ? LEU C 288 HIS C 291 
G 2 VAL C 142 ? ILE C 145 ? VAL C 426 ILE C 429 
G 3 VAL C 123 ? GLN C 126 ? VAL C 407 GLN C 410 
G 4 ILE C 216 ? SER C 220 ? ILE C 500 SER C 504 
G 5 TRP C 240 ? LEU C 245 ? TRP C 524 LEU C 529 
G 6 TYR C 38  ? GLU C 46  ? TYR C 322 GLU C 330 
G 7 VAL C 49  ? GLN C 50  ? VAL C 333 GLN C 334 
H 1 LEU C 4   ? HIS C 7   ? LEU C 288 HIS C 291 
H 2 VAL C 142 ? ILE C 145 ? VAL C 426 ILE C 429 
H 3 VAL C 123 ? GLN C 126 ? VAL C 407 GLN C 410 
H 4 ILE C 216 ? SER C 220 ? ILE C 500 SER C 504 
H 5 TRP C 240 ? LEU C 245 ? TRP C 524 LEU C 529 
H 6 TYR C 38  ? GLU C 46  ? TYR C 322 GLU C 330 
H 7 PHE C 55  ? PRO C 58  ? PHE C 339 PRO C 342 
I 1 ARG C 77  ? CYS C 79  ? ARG C 361 CYS C 363 
I 2 ILE C 63  ? ASP C 67  ? ILE C 347 ASP C 351 
I 3 VAL C 103 ? LYS C 108 ? VAL C 387 LYS C 392 
I 4 ASP C 112 ? CYS C 117 ? ASP C 396 CYS C 401 
I 5 TYR C 150 ? PHE C 154 ? TYR C 434 PHE C 438 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLN A 5   ? N GLN A 289 O VAL A 142 ? O VAL A 426 
A 2 3 N ILE A 145 ? N ILE A 429 O VAL A 123 ? O VAL A 407 
A 3 4 N GLN A 126 ? N GLN A 410 O ARG A 218 ? O ARG A 502 
A 4 5 O MET A 219 ? O MET A 503 N ILE A 241 ? N ILE A 525 
A 5 6 N HIS A 244 ? N HIS A 528 O SER A 41  ? O SER A 325 
A 6 7 N GLU A 46  ? N GLU A 330 O VAL A 49  ? O VAL A 333 
B 1 2 N GLN A 5   ? N GLN A 289 O VAL A 142 ? O VAL A 426 
B 2 3 N ILE A 145 ? N ILE A 429 O VAL A 123 ? O VAL A 407 
B 3 4 N GLN A 126 ? N GLN A 410 O ARG A 218 ? O ARG A 502 
B 4 5 O MET A 219 ? O MET A 503 N ILE A 241 ? N ILE A 525 
B 5 6 N HIS A 244 ? N HIS A 528 O SER A 41  ? O SER A 325 
B 6 7 N ILE A 42  ? N ILE A 326 O PHE A 55  ? O PHE A 339 
C 1 2 N PHE A 78  ? N PHE A 362 O THR A 65  ? O THR A 349 
C 2 3 N VAL A 66  ? N VAL A 350 O VAL A 103 ? O VAL A 387 
C 3 4 O LYS A 108 ? O LYS A 392 N ASP A 112 ? N ASP A 396 
C 4 5 N VAL A 115 ? N VAL A 399 O ILE A 151 ? O ILE A 435 
D 1 2 N GLN B 5   ? N GLN B 289 O VAL B 142 ? O VAL B 426 
D 2 3 N ILE B 145 ? N ILE B 429 O VAL B 123 ? O VAL B 407 
D 3 4 N GLN B 126 ? N GLN B 410 O ARG B 218 ? O ARG B 502 
D 4 5 O MET B 219 ? O MET B 503 N ILE B 241 ? N ILE B 525 
D 5 6 N HIS B 244 ? N HIS B 528 O SER B 41  ? O SER B 325 
D 6 7 N GLU B 46  ? N GLU B 330 O VAL B 49  ? O VAL B 333 
E 1 2 N GLN B 5   ? N GLN B 289 O VAL B 142 ? O VAL B 426 
E 2 3 N ILE B 145 ? N ILE B 429 O VAL B 123 ? O VAL B 407 
E 3 4 N GLN B 126 ? N GLN B 410 O ARG B 218 ? O ARG B 502 
E 4 5 O MET B 219 ? O MET B 503 N ILE B 241 ? N ILE B 525 
E 5 6 N HIS B 244 ? N HIS B 528 O SER B 41  ? O SER B 325 
E 6 7 O ILE B 42  ? O ILE B 326 N PHE B 55  ? N PHE B 339 
F 1 2 N PHE B 78  ? N PHE B 362 O THR B 65  ? O THR B 349 
F 2 3 N VAL B 66  ? N VAL B 350 O VAL B 103 ? O VAL B 387 
F 3 4 O LYS B 108 ? O LYS B 392 N ASP B 112 ? N ASP B 396 
F 4 5 N VAL B 115 ? N VAL B 399 O ILE B 151 ? O ILE B 435 
G 1 2 N GLN C 5   ? N GLN C 289 O VAL C 142 ? O VAL C 426 
G 2 3 N ILE C 145 ? N ILE C 429 O VAL C 123 ? O VAL C 407 
G 3 4 N GLN C 126 ? N GLN C 410 O ARG C 218 ? O ARG C 502 
G 4 5 O MET C 219 ? O MET C 503 N ILE C 241 ? N ILE C 525 
G 5 6 N HIS C 244 ? N HIS C 528 O SER C 41  ? O SER C 325 
G 6 7 N GLU C 46  ? N GLU C 330 O VAL C 49  ? O VAL C 333 
H 1 2 N GLN C 5   ? N GLN C 289 O VAL C 142 ? O VAL C 426 
H 2 3 N ILE C 145 ? N ILE C 429 O VAL C 123 ? O VAL C 407 
H 3 4 N GLN C 126 ? N GLN C 410 O ARG C 218 ? O ARG C 502 
H 4 5 O MET C 219 ? O MET C 503 N ILE C 241 ? N ILE C 525 
H 5 6 N HIS C 244 ? N HIS C 528 O SER C 41  ? O SER C 325 
H 6 7 N ILE C 42  ? N ILE C 326 O PHE C 55  ? O PHE C 339 
I 1 2 N PHE C 78  ? N PHE C 362 O THR C 65  ? O THR C 349 
I 2 3 N VAL C 66  ? N VAL C 350 O VAL C 103 ? O VAL C 387 
I 3 4 N LYS C 108 ? N LYS C 392 O ASP C 112 ? O ASP C 396 
I 4 5 N VAL C 115 ? N VAL C 399 O ILE C 151 ? O ILE C 435 
# 
_database_PDB_matrix.entry_id          1G88 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1G88 
_atom_sites.fract_transf_matrix[1][1]   0.007099 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007099 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005138 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    N N   . ASN A 1 1   ? 5.226   -2.100  -48.858 1.00 73.83  ? 285 ASN A N   1 
ATOM 2    C CA  . ASN A 1 1   ? 5.393   -2.233  -50.337 1.00 74.33  ? 285 ASN A CA  1 
ATOM 3    C C   . ASN A 1 1   ? 4.402   -3.241  -50.924 1.00 73.22  ? 285 ASN A C   1 
ATOM 4    O O   . ASN A 1 1   ? 4.797   -4.170  -51.636 1.00 75.08  ? 285 ASN A O   1 
ATOM 5    C CB  . ASN A 1 1   ? 6.823   -2.679  -50.666 1.00 75.22  ? 285 ASN A CB  1 
ATOM 6    C CG  . ASN A 1 1   ? 7.867   -1.669  -50.229 1.00 76.10  ? 285 ASN A CG  1 
ATOM 7    O OD1 . ASN A 1 1   ? 9.057   -1.841  -50.488 1.00 75.02  ? 285 ASN A OD1 1 
ATOM 8    N ND2 . ASN A 1 1   ? 7.425   -0.608  -49.563 1.00 77.30  ? 285 ASN A ND2 1 
ATOM 9    N N   . GLY A 1 2   ? 3.116   -3.050  -50.635 1.00 68.96  ? 286 GLY A N   1 
ATOM 10   C CA  . GLY A 1 2   ? 2.111   -3.971  -51.132 1.00 61.00  ? 286 GLY A CA  1 
ATOM 11   C C   . GLY A 1 2   ? 2.395   -5.342  -50.555 1.00 56.12  ? 286 GLY A C   1 
ATOM 12   O O   . GLY A 1 2   ? 2.458   -6.334  -51.283 1.00 56.26  ? 286 GLY A O   1 
ATOM 13   N N   . HIS A 1 3   ? 2.581   -5.393  -49.238 1.00 50.01  ? 287 HIS A N   1 
ATOM 14   C CA  . HIS A 1 3   ? 2.877   -6.643  -48.553 1.00 43.81  ? 287 HIS A CA  1 
ATOM 15   C C   . HIS A 1 3   ? 1.723   -7.618  -48.692 1.00 41.81  ? 287 HIS A C   1 
ATOM 16   O O   . HIS A 1 3   ? 1.909   -8.830  -48.652 1.00 42.15  ? 287 HIS A O   1 
ATOM 17   C CB  . HIS A 1 3   ? 3.153   -6.386  -47.075 1.00 39.76  ? 287 HIS A CB  1 
ATOM 18   C CG  . HIS A 1 3   ? 3.605   -7.603  -46.330 1.00 37.80  ? 287 HIS A CG  1 
ATOM 19   N ND1 . HIS A 1 3   ? 2.796   -8.701  -46.138 1.00 36.37  ? 287 HIS A ND1 1 
ATOM 20   C CD2 . HIS A 1 3   ? 4.789   -7.902  -45.747 1.00 37.68  ? 287 HIS A CD2 1 
ATOM 21   C CE1 . HIS A 1 3   ? 3.463   -9.625  -45.469 1.00 36.00  ? 287 HIS A CE1 1 
ATOM 22   N NE2 . HIS A 1 3   ? 4.675   -9.166  -45.220 1.00 36.40  ? 287 HIS A NE2 1 
ATOM 23   N N   . LEU A 1 4   ? 0.525   -7.077  -48.859 1.00 40.36  ? 288 LEU A N   1 
ATOM 24   C CA  . LEU A 1 4   ? -0.662  -7.900  -49.011 1.00 36.30  ? 288 LEU A CA  1 
ATOM 25   C C   . LEU A 1 4   ? -1.080  -8.008  -50.477 1.00 34.39  ? 288 LEU A C   1 
ATOM 26   O O   . LEU A 1 4   ? -1.476  -7.021  -51.102 1.00 36.39  ? 288 LEU A O   1 
ATOM 27   C CB  . LEU A 1 4   ? -1.821  -7.317  -48.198 1.00 34.56  ? 288 LEU A CB  1 
ATOM 28   C CG  . LEU A 1 4   ? -3.081  -8.184  -48.200 1.00 33.99  ? 288 LEU A CG  1 
ATOM 29   C CD1 . LEU A 1 4   ? -2.848  -9.396  -47.318 1.00 37.38  ? 288 LEU A CD1 1 
ATOM 30   C CD2 . LEU A 1 4   ? -4.256  -7.402  -47.688 1.00 34.56  ? 288 LEU A CD2 1 
ATOM 31   N N   . GLN A 1 5   ? -0.979  -9.213  -51.022 1.00 31.44  ? 289 GLN A N   1 
ATOM 32   C CA  . GLN A 1 5   ? -1.375  -9.460  -52.398 1.00 28.58  ? 289 GLN A CA  1 
ATOM 33   C C   . GLN A 1 5   ? -2.861  -9.813  -52.423 1.00 26.41  ? 289 GLN A C   1 
ATOM 34   O O   . GLN A 1 5   ? -3.362  -10.537 -51.564 1.00 28.20  ? 289 GLN A O   1 
ATOM 35   C CB  . GLN A 1 5   ? -0.547  -10.600 -52.988 1.00 29.90  ? 289 GLN A CB  1 
ATOM 36   C CG  . GLN A 1 5   ? 0.942   -10.319 -53.021 1.00 33.02  ? 289 GLN A CG  1 
ATOM 37   C CD  . GLN A 1 5   ? 1.275   -9.038  -53.766 1.00 33.87  ? 289 GLN A CD  1 
ATOM 38   O OE1 . GLN A 1 5   ? 0.892   -8.862  -54.927 1.00 32.72  ? 289 GLN A OE1 1 
ATOM 39   N NE2 . GLN A 1 5   ? 1.996   -8.135  -53.100 1.00 31.70  ? 289 GLN A NE2 1 
ATOM 40   N N   . HIS A 1 6   ? -3.567  -9.299  -53.415 1.00 22.21  ? 290 HIS A N   1 
ATOM 41   C CA  . HIS A 1 6   ? -4.988  -9.549  -53.519 1.00 20.60  ? 290 HIS A CA  1 
ATOM 42   C C   . HIS A 1 6   ? -5.362  -10.537 -54.615 1.00 22.37  ? 290 HIS A C   1 
ATOM 43   O O   . HIS A 1 6   ? -5.049  -10.329 -55.790 1.00 23.60  ? 290 HIS A O   1 
ATOM 44   C CB  . HIS A 1 6   ? -5.702  -8.224  -53.759 1.00 18.32  ? 290 HIS A CB  1 
ATOM 45   C CG  . HIS A 1 6   ? -5.523  -7.240  -52.650 1.00 17.36  ? 290 HIS A CG  1 
ATOM 46   N ND1 . HIS A 1 6   ? -6.373  -7.177  -51.567 1.00 15.89  ? 290 HIS A ND1 1 
ATOM 47   C CD2 . HIS A 1 6   ? -4.579  -6.292  -52.445 1.00 17.08  ? 290 HIS A CD2 1 
ATOM 48   C CE1 . HIS A 1 6   ? -5.962  -6.229  -50.744 1.00 16.73  ? 290 HIS A CE1 1 
ATOM 49   N NE2 . HIS A 1 6   ? -4.876  -5.676  -51.253 1.00 18.00  ? 290 HIS A NE2 1 
ATOM 50   N N   . HIS A 1 7   ? -6.041  -11.615 -54.238 1.00 22.36  ? 291 HIS A N   1 
ATOM 51   C CA  . HIS A 1 7   ? -6.460  -12.588 -55.231 1.00 22.31  ? 291 HIS A CA  1 
ATOM 52   C C   . HIS A 1 7   ? -7.967  -12.707 -55.317 1.00 25.48  ? 291 HIS A C   1 
ATOM 53   O O   . HIS A 1 7   ? -8.578  -13.498 -54.605 1.00 27.93  ? 291 HIS A O   1 
ATOM 54   C CB  . HIS A 1 7   ? -5.858  -13.956 -54.937 1.00 19.69  ? 291 HIS A CB  1 
ATOM 55   C CG  . HIS A 1 7   ? -4.367  -13.973 -55.000 1.00 20.99  ? 291 HIS A CG  1 
ATOM 56   N ND1 . HIS A 1 7   ? -3.577  -13.383 -54.038 1.00 21.49  ? 291 HIS A ND1 1 
ATOM 57   C CD2 . HIS A 1 7   ? -3.520  -14.459 -55.937 1.00 20.22  ? 291 HIS A CD2 1 
ATOM 58   C CE1 . HIS A 1 7   ? -2.307  -13.503 -54.380 1.00 20.01  ? 291 HIS A CE1 1 
ATOM 59   N NE2 . HIS A 1 7   ? -2.245  -14.151 -55.528 1.00 21.21  ? 291 HIS A NE2 1 
ATOM 60   N N   . PRO A 1 8   ? -8.597  -11.891 -56.171 1.00 27.47  ? 292 PRO A N   1 
ATOM 61   C CA  . PRO A 1 8   ? -10.049 -11.975 -56.302 1.00 28.85  ? 292 PRO A CA  1 
ATOM 62   C C   . PRO A 1 8   ? -10.349 -13.123 -57.267 1.00 30.89  ? 292 PRO A C   1 
ATOM 63   O O   . PRO A 1 8   ? -9.462  -13.592 -57.984 1.00 28.45  ? 292 PRO A O   1 
ATOM 64   C CB  . PRO A 1 8   ? -10.415 -10.611 -56.873 1.00 28.08  ? 292 PRO A CB  1 
ATOM 65   C CG  . PRO A 1 8   ? -9.259  -10.322 -57.753 1.00 26.14  ? 292 PRO A CG  1 
ATOM 66   C CD  . PRO A 1 8   ? -8.077  -10.717 -56.891 1.00 26.75  ? 292 PRO A CD  1 
ATOM 67   N N   . PRO A 1 9   ? -11.596 -13.601 -57.290 1.00 34.67  ? 293 PRO A N   1 
ATOM 68   C CA  . PRO A 1 9   ? -11.928 -14.699 -58.197 1.00 39.01  ? 293 PRO A CA  1 
ATOM 69   C C   . PRO A 1 9   ? -11.989 -14.237 -59.637 1.00 44.77  ? 293 PRO A C   1 
ATOM 70   O O   . PRO A 1 9   ? -12.632 -13.235 -59.952 1.00 47.67  ? 293 PRO A O   1 
ATOM 71   C CB  . PRO A 1 9   ? -13.270 -15.182 -57.672 1.00 37.43  ? 293 PRO A CB  1 
ATOM 72   C CG  . PRO A 1 9   ? -13.881 -13.929 -57.142 1.00 36.79  ? 293 PRO A CG  1 
ATOM 73   C CD  . PRO A 1 9   ? -12.742 -13.252 -56.435 1.00 35.44  ? 293 PRO A CD  1 
ATOM 74   N N   . MET A 1 10  ? -11.303 -14.973 -60.503 1.00 50.45  ? 294 MET A N   1 
ATOM 75   C CA  . MET A 1 10  ? -11.242 -14.673 -61.928 1.00 56.96  ? 294 MET A CA  1 
ATOM 76   C C   . MET A 1 10  ? -11.537 -15.954 -62.692 1.00 59.09  ? 294 MET A C   1 
ATOM 77   O O   . MET A 1 10  ? -10.660 -16.798 -62.863 1.00 60.53  ? 294 MET A O   1 
ATOM 78   C CB  . MET A 1 10  ? -9.848  -14.175 -62.286 1.00 61.55  ? 294 MET A CB  1 
ATOM 79   C CG  . MET A 1 10  ? -8.772  -14.821 -61.428 1.00 69.78  ? 294 MET A CG  1 
ATOM 80   S SD  . MET A 1 10  ? -7.124  -14.803 -62.140 1.00 77.83  ? 294 MET A SD  1 
ATOM 81   C CE  . MET A 1 10  ? -6.821  -16.565 -62.301 1.00 74.51  ? 294 MET A CE  1 
ATOM 82   N N   . PRO A 1 11  ? -12.780 -16.110 -63.170 1.00 61.14  ? 295 PRO A N   1 
ATOM 83   C CA  . PRO A 1 11  ? -13.251 -17.281 -63.924 1.00 63.44  ? 295 PRO A CA  1 
ATOM 84   C C   . PRO A 1 11  ? -12.414 -17.656 -65.155 1.00 64.39  ? 295 PRO A C   1 
ATOM 85   O O   . PRO A 1 11  ? -11.901 -16.783 -65.857 1.00 65.59  ? 295 PRO A O   1 
ATOM 86   C CB  . PRO A 1 11  ? -14.683 -16.897 -64.286 1.00 63.87  ? 295 PRO A CB  1 
ATOM 87   C CG  . PRO A 1 11  ? -14.604 -15.399 -64.395 1.00 63.47  ? 295 PRO A CG  1 
ATOM 88   C CD  . PRO A 1 11  ? -13.793 -15.041 -63.183 1.00 61.46  ? 295 PRO A CD  1 
ATOM 89   N N   . PRO A 1 12  ? -12.277 -18.969 -65.434 1.00 63.81  ? 296 PRO A N   1 
ATOM 90   C CA  . PRO A 1 12  ? -11.501 -19.455 -66.582 1.00 63.53  ? 296 PRO A CA  1 
ATOM 91   C C   . PRO A 1 12  ? -12.079 -19.037 -67.929 1.00 64.72  ? 296 PRO A C   1 
ATOM 92   O O   . PRO A 1 12  ? -11.932 -17.888 -68.346 1.00 64.08  ? 296 PRO A O   1 
ATOM 93   C CB  . PRO A 1 12  ? -11.512 -20.971 -66.389 1.00 62.67  ? 296 PRO A CB  1 
ATOM 94   C CG  . PRO A 1 12  ? -12.823 -21.212 -65.722 1.00 62.33  ? 296 PRO A CG  1 
ATOM 95   C CD  . PRO A 1 12  ? -12.889 -20.096 -64.704 1.00 62.78  ? 296 PRO A CD  1 
ATOM 96   N N   . GLN A 1 27  ? 4.474   -32.089 -67.859 1.00 87.71  ? 311 GLN A N   1 
ATOM 97   C CA  . GLN A 1 27  ? 5.508   -33.017 -68.302 1.00 88.45  ? 311 GLN A CA  1 
ATOM 98   C C   . GLN A 1 27  ? 5.601   -34.230 -67.366 1.00 87.53  ? 311 GLN A C   1 
ATOM 99   O O   . GLN A 1 27  ? 4.920   -34.283 -66.343 1.00 87.06  ? 311 GLN A O   1 
ATOM 100  C CB  . GLN A 1 27  ? 6.853   -32.288 -68.385 1.00 88.73  ? 311 GLN A CB  1 
ATOM 101  C CG  . GLN A 1 27  ? 6.829   -31.090 -69.324 1.00 89.42  ? 311 GLN A CG  1 
ATOM 102  C CD  . GLN A 1 27  ? 8.193   -30.460 -69.520 1.00 89.65  ? 311 GLN A CD  1 
ATOM 103  O OE1 . GLN A 1 27  ? 8.324   -29.429 -70.179 1.00 88.40  ? 311 GLN A OE1 1 
ATOM 104  N NE2 . GLN A 1 27  ? 9.219   -31.082 -68.955 1.00 91.93  ? 311 GLN A NE2 1 
ATOM 105  N N   . PRO A 1 28  ? 6.435   -35.227 -67.716 1.00 86.44  ? 312 PRO A N   1 
ATOM 106  C CA  . PRO A 1 28  ? 6.595   -36.433 -66.893 1.00 84.23  ? 312 PRO A CA  1 
ATOM 107  C C   . PRO A 1 28  ? 6.962   -36.138 -65.441 1.00 80.82  ? 312 PRO A C   1 
ATOM 108  O O   . PRO A 1 28  ? 7.234   -34.993 -65.080 1.00 81.13  ? 312 PRO A O   1 
ATOM 109  C CB  . PRO A 1 28  ? 7.692   -37.203 -67.624 1.00 86.45  ? 312 PRO A CB  1 
ATOM 110  C CG  . PRO A 1 28  ? 7.442   -36.844 -69.051 1.00 87.87  ? 312 PRO A CG  1 
ATOM 111  C CD  . PRO A 1 28  ? 7.216   -35.348 -68.961 1.00 87.25  ? 312 PRO A CD  1 
ATOM 112  N N   . PRO A 1 29  ? 6.978   -37.175 -64.588 1.00 76.77  ? 313 PRO A N   1 
ATOM 113  C CA  . PRO A 1 29  ? 7.317   -36.972 -63.181 1.00 73.24  ? 313 PRO A CA  1 
ATOM 114  C C   . PRO A 1 29  ? 8.741   -36.465 -63.004 1.00 70.23  ? 313 PRO A C   1 
ATOM 115  O O   . PRO A 1 29  ? 9.618   -36.760 -63.816 1.00 69.73  ? 313 PRO A O   1 
ATOM 116  C CB  . PRO A 1 29  ? 7.107   -38.357 -62.579 1.00 72.78  ? 313 PRO A CB  1 
ATOM 117  C CG  . PRO A 1 29  ? 7.485   -39.257 -63.702 1.00 73.64  ? 313 PRO A CG  1 
ATOM 118  C CD  . PRO A 1 29  ? 6.794   -38.609 -64.874 1.00 75.35  ? 313 PRO A CD  1 
ATOM 119  N N   . ILE A 1 30  ? 8.955   -35.693 -61.944 1.00 66.44  ? 314 ILE A N   1 
ATOM 120  C CA  . ILE A 1 30  ? 10.264  -35.138 -61.640 1.00 62.53  ? 314 ILE A CA  1 
ATOM 121  C C   . ILE A 1 30  ? 11.178  -36.211 -61.053 1.00 63.18  ? 314 ILE A C   1 
ATOM 122  O O   . ILE A 1 30  ? 12.382  -36.219 -61.307 1.00 62.58  ? 314 ILE A O   1 
ATOM 123  C CB  . ILE A 1 30  ? 10.150  -33.985 -60.631 1.00 60.37  ? 314 ILE A CB  1 
ATOM 124  C CG1 . ILE A 1 30  ? 9.334   -32.849 -61.232 1.00 59.42  ? 314 ILE A CG1 1 
ATOM 125  C CG2 . ILE A 1 30  ? 11.526  -33.485 -60.253 1.00 60.62  ? 314 ILE A CG2 1 
ATOM 126  C CD1 . ILE A 1 30  ? 9.257   -31.630 -60.341 1.00 60.31  ? 314 ILE A CD1 1 
ATOM 127  N N   . SER A 1 31  ? 10.602  -37.114 -60.265 1.00 63.77  ? 315 SER A N   1 
ATOM 128  C CA  . SER A 1 31  ? 11.375  -38.185 -59.645 1.00 64.01  ? 315 SER A CA  1 
ATOM 129  C C   . SER A 1 31  ? 10.708  -39.535 -59.821 1.00 64.70  ? 315 SER A C   1 
ATOM 130  O O   . SER A 1 31  ? 9.487   -39.622 -59.940 1.00 64.95  ? 315 SER A O   1 
ATOM 131  C CB  . SER A 1 31  ? 11.559  -37.918 -58.152 1.00 63.27  ? 315 SER A CB  1 
ATOM 132  O OG  . SER A 1 31  ? 12.230  -39.000 -57.530 1.00 62.83  ? 315 SER A OG  1 
ATOM 133  N N   . ASN A 1 32  ? 11.519  -40.588 -59.832 1.00 65.72  ? 316 ASN A N   1 
ATOM 134  C CA  . ASN A 1 32  ? 11.010  -41.944 -59.979 1.00 66.73  ? 316 ASN A CA  1 
ATOM 135  C C   . ASN A 1 32  ? 10.548  -42.427 -58.615 1.00 65.28  ? 316 ASN A C   1 
ATOM 136  O O   . ASN A 1 32  ? 9.717   -43.325 -58.507 1.00 64.80  ? 316 ASN A O   1 
ATOM 137  C CB  . ASN A 1 32  ? 12.102  -42.859 -60.530 1.00 69.74  ? 316 ASN A CB  1 
ATOM 138  C CG  . ASN A 1 32  ? 12.621  -42.391 -61.878 1.00 72.15  ? 316 ASN A CG  1 
ATOM 139  O OD1 . ASN A 1 32  ? 11.854  -42.212 -62.830 1.00 72.17  ? 316 ASN A OD1 1 
ATOM 140  N ND2 . ASN A 1 32  ? 13.932  -42.190 -61.967 1.00 73.22  ? 316 ASN A ND2 1 
ATOM 141  N N   . HIS A 1 33  ? 11.103  -41.806 -57.580 1.00 63.96  ? 317 HIS A N   1 
ATOM 142  C CA  . HIS A 1 33  ? 10.774  -42.093 -56.189 1.00 63.27  ? 317 HIS A CA  1 
ATOM 143  C C   . HIS A 1 33  ? 9.265   -42.382 -56.091 1.00 61.74  ? 317 HIS A C   1 
ATOM 144  O O   . HIS A 1 33  ? 8.459   -41.724 -56.747 1.00 64.05  ? 317 HIS A O   1 
ATOM 145  C CB  . HIS A 1 33  ? 11.150  -40.863 -55.360 1.00 65.97  ? 317 HIS A CB  1 
ATOM 146  C CG  . HIS A 1 33  ? 11.214  -41.103 -53.886 1.00 68.11  ? 317 HIS A CG  1 
ATOM 147  N ND1 . HIS A 1 33  ? 12.350  -40.850 -53.145 1.00 68.89  ? 317 HIS A ND1 1 
ATOM 148  C CD2 . HIS A 1 33  ? 10.273  -41.515 -53.004 1.00 67.58  ? 317 HIS A CD2 1 
ATOM 149  C CE1 . HIS A 1 33  ? 12.104  -41.094 -51.871 1.00 69.49  ? 317 HIS A CE1 1 
ATOM 150  N NE2 . HIS A 1 33  ? 10.851  -41.499 -51.758 1.00 69.59  ? 317 HIS A NE2 1 
ATOM 151  N N   . PRO A 1 34  ? 8.868   -43.379 -55.282 1.00 58.49  ? 318 PRO A N   1 
ATOM 152  C CA  . PRO A 1 34  ? 7.458   -43.760 -55.102 1.00 53.56  ? 318 PRO A CA  1 
ATOM 153  C C   . PRO A 1 34  ? 6.555   -42.631 -54.610 1.00 49.04  ? 318 PRO A C   1 
ATOM 154  O O   . PRO A 1 34  ? 7.030   -41.662 -54.017 1.00 49.71  ? 318 PRO A O   1 
ATOM 155  C CB  . PRO A 1 34  ? 7.537   -44.894 -54.091 1.00 55.45  ? 318 PRO A CB  1 
ATOM 156  C CG  . PRO A 1 34  ? 8.864   -45.515 -54.389 1.00 59.20  ? 318 PRO A CG  1 
ATOM 157  C CD  . PRO A 1 34  ? 9.753   -44.309 -54.562 1.00 58.95  ? 318 PRO A CD  1 
ATOM 158  N N   . ALA A 1 35  ? 5.252   -42.767 -54.848 1.00 42.59  ? 319 ALA A N   1 
ATOM 159  C CA  . ALA A 1 35  ? 4.282   -41.759 -54.424 1.00 36.47  ? 319 ALA A CA  1 
ATOM 160  C C   . ALA A 1 35  ? 4.014   -41.844 -52.925 1.00 33.72  ? 319 ALA A C   1 
ATOM 161  O O   . ALA A 1 35  ? 3.933   -42.932 -52.360 1.00 35.14  ? 319 ALA A O   1 
ATOM 162  C CB  . ALA A 1 35  ? 2.980   -41.925 -55.191 1.00 36.17  ? 319 ALA A CB  1 
ATOM 163  N N   . PRO A 1 36  ? 3.863   -40.688 -52.264 1.00 30.14  ? 320 PRO A N   1 
ATOM 164  C CA  . PRO A 1 36  ? 3.604   -40.579 -50.828 1.00 28.31  ? 320 PRO A CA  1 
ATOM 165  C C   . PRO A 1 36  ? 2.349   -41.322 -50.404 1.00 27.62  ? 320 PRO A C   1 
ATOM 166  O O   . PRO A 1 36  ? 1.428   -41.491 -51.198 1.00 28.76  ? 320 PRO A O   1 
ATOM 167  C CB  . PRO A 1 36  ? 3.442   -39.078 -50.624 1.00 28.13  ? 320 PRO A CB  1 
ATOM 168  C CG  . PRO A 1 36  ? 4.278   -38.500 -51.686 1.00 30.06  ? 320 PRO A CG  1 
ATOM 169  C CD  . PRO A 1 36  ? 3.934   -39.351 -52.869 1.00 29.68  ? 320 PRO A CD  1 
ATOM 170  N N   . GLU A 1 37  ? 2.315   -41.762 -49.151 1.00 25.21  ? 321 GLU A N   1 
ATOM 171  C CA  . GLU A 1 37  ? 1.143   -42.450 -48.630 1.00 24.26  ? 321 GLU A CA  1 
ATOM 172  C C   . GLU A 1 37  ? 0.073   -41.375 -48.544 1.00 23.67  ? 321 GLU A C   1 
ATOM 173  O O   . GLU A 1 37  ? -1.098  -41.614 -48.852 1.00 23.27  ? 321 GLU A O   1 
ATOM 174  C CB  . GLU A 1 37  ? 1.439   -43.005 -47.241 1.00 28.42  ? 321 GLU A CB  1 
ATOM 175  C CG  . GLU A 1 37  ? 0.316   -43.808 -46.613 1.00 31.63  ? 321 GLU A CG  1 
ATOM 176  C CD  . GLU A 1 37  ? 0.702   -44.384 -45.256 1.00 33.95  ? 321 GLU A CD  1 
ATOM 177  O OE1 . GLU A 1 37  ? -0.137  -45.084 -44.652 1.00 35.69  ? 321 GLU A OE1 1 
ATOM 178  O OE2 . GLU A 1 37  ? 1.841   -44.136 -44.795 1.00 34.00  ? 321 GLU A OE2 1 
ATOM 179  N N   . TYR A 1 38  ? 0.511   -40.186 -48.127 1.00 21.58  ? 322 TYR A N   1 
ATOM 180  C CA  . TYR A 1 38  ? -0.332  -39.000 -47.988 1.00 18.96  ? 322 TYR A CA  1 
ATOM 181  C C   . TYR A 1 38  ? 0.318   -37.882 -48.799 1.00 16.64  ? 322 TYR A C   1 
ATOM 182  O O   . TYR A 1 38  ? 1.533   -37.724 -48.750 1.00 13.99  ? 322 TYR A O   1 
ATOM 183  C CB  . TYR A 1 38  ? -0.396  -38.558 -46.526 1.00 21.21  ? 322 TYR A CB  1 
ATOM 184  C CG  . TYR A 1 38  ? -0.834  -39.630 -45.558 1.00 21.57  ? 322 TYR A CG  1 
ATOM 185  C CD1 . TYR A 1 38  ? -2.125  -40.144 -45.587 1.00 22.91  ? 322 TYR A CD1 1 
ATOM 186  C CD2 . TYR A 1 38  ? 0.047   -40.128 -44.611 1.00 23.78  ? 322 TYR A CD2 1 
ATOM 187  C CE1 . TYR A 1 38  ? -2.525  -41.132 -44.696 1.00 25.87  ? 322 TYR A CE1 1 
ATOM 188  C CE2 . TYR A 1 38  ? -0.340  -41.114 -43.716 1.00 26.77  ? 322 TYR A CE2 1 
ATOM 189  C CZ  . TYR A 1 38  ? -1.623  -41.615 -43.764 1.00 26.49  ? 322 TYR A CZ  1 
ATOM 190  O OH  . TYR A 1 38  ? -1.983  -42.620 -42.894 1.00 27.24  ? 322 TYR A OH  1 
ATOM 191  N N   . TRP A 1 39  ? -0.468  -37.100 -49.535 1.00 16.75  ? 323 TRP A N   1 
ATOM 192  C CA  . TRP A 1 39  ? 0.133   -36.029 -50.320 1.00 17.38  ? 323 TRP A CA  1 
ATOM 193  C C   . TRP A 1 39  ? 0.434   -34.802 -49.467 1.00 16.71  ? 323 TRP A C   1 
ATOM 194  O O   . TRP A 1 39  ? 1.224   -33.934 -49.867 1.00 18.32  ? 323 TRP A O   1 
ATOM 195  C CB  . TRP A 1 39  ? -0.733  -35.648 -51.548 1.00 20.45  ? 323 TRP A CB  1 
ATOM 196  C CG  . TRP A 1 39  ? -2.124  -35.040 -51.309 1.00 20.34  ? 323 TRP A CG  1 
ATOM 197  C CD1 . TRP A 1 39  ? -3.305  -35.719 -51.135 1.00 19.63  ? 323 TRP A CD1 1 
ATOM 198  C CD2 . TRP A 1 39  ? -2.460  -33.643 -51.271 1.00 16.97  ? 323 TRP A CD2 1 
ATOM 199  N NE1 . TRP A 1 39  ? -4.349  -34.831 -50.996 1.00 17.19  ? 323 TRP A NE1 1 
ATOM 200  C CE2 . TRP A 1 39  ? -3.861  -33.553 -51.072 1.00 16.74  ? 323 TRP A CE2 1 
ATOM 201  C CE3 . TRP A 1 39  ? -1.716  -32.461 -51.383 1.00 15.49  ? 323 TRP A CE3 1 
ATOM 202  C CZ2 . TRP A 1 39  ? -4.532  -32.325 -50.979 1.00 16.18  ? 323 TRP A CZ2 1 
ATOM 203  C CZ3 . TRP A 1 39  ? -2.386  -31.236 -51.290 1.00 17.03  ? 323 TRP A CZ3 1 
ATOM 204  C CH2 . TRP A 1 39  ? -3.782  -31.182 -51.089 1.00 14.73  ? 323 TRP A CH2 1 
ATOM 205  N N   . CYS A 1 40  ? -0.172  -34.751 -48.283 1.00 11.92  ? 324 CYS A N   1 
ATOM 206  C CA  . CYS A 1 40  ? 0.039   -33.642 -47.359 1.00 9.68   ? 324 CYS A CA  1 
ATOM 207  C C   . CYS A 1 40  ? -0.514  -33.975 -45.980 1.00 9.38   ? 324 CYS A C   1 
ATOM 208  O O   . CYS A 1 40  ? -1.210  -34.977 -45.797 1.00 8.16   ? 324 CYS A O   1 
ATOM 209  C CB  . CYS A 1 40  ? -0.654  -32.371 -47.870 1.00 12.05  ? 324 CYS A CB  1 
ATOM 210  S SG  . CYS A 1 40  ? -2.434  -32.226 -47.428 1.00 12.32  ? 324 CYS A SG  1 
ATOM 211  N N   . SER A 1 41  ? -0.194  -33.125 -45.014 1.00 7.76   ? 325 SER A N   1 
ATOM 212  C CA  . SER A 1 41  ? -0.685  -33.286 -43.648 1.00 10.22  ? 325 SER A CA  1 
ATOM 213  C C   . SER A 1 41  ? -0.926  -31.883 -43.091 1.00 9.03   ? 325 SER A C   1 
ATOM 214  O O   . SER A 1 41  ? -0.058  -31.010 -43.190 1.00 12.45  ? 325 SER A O   1 
ATOM 215  C CB  . SER A 1 41  ? 0.323   -34.056 -42.785 1.00 8.75   ? 325 SER A CB  1 
ATOM 216  O OG  . SER A 1 41  ? 1.566   -33.390 -42.731 1.00 12.63  ? 325 SER A OG  1 
ATOM 217  N N   . ILE A 1 42  ? -2.113  -31.662 -42.533 1.00 4.33   ? 326 ILE A N   1 
ATOM 218  C CA  . ILE A 1 42  ? -2.463  -30.357 -42.007 1.00 6.14   ? 326 ILE A CA  1 
ATOM 219  C C   . ILE A 1 42  ? -2.427  -30.358 -40.497 1.00 6.78   ? 326 ILE A C   1 
ATOM 220  O O   . ILE A 1 42  ? -2.786  -31.348 -39.864 1.00 7.14   ? 326 ILE A O   1 
ATOM 221  C CB  . ILE A 1 42  ? -3.885  -29.903 -42.464 1.00 7.64   ? 326 ILE A CB  1 
ATOM 222  C CG1 . ILE A 1 42  ? -4.011  -29.964 -43.987 1.00 7.29   ? 326 ILE A CG1 1 
ATOM 223  C CG2 . ILE A 1 42  ? -4.143  -28.461 -42.030 1.00 9.43   ? 326 ILE A CG2 1 
ATOM 224  C CD1 . ILE A 1 42  ? -4.382  -31.313 -44.523 1.00 8.36   ? 326 ILE A CD1 1 
ATOM 225  N N   . ALA A 1 43  ? -1.987  -29.239 -39.931 1.00 5.85   ? 327 ALA A N   1 
ATOM 226  C CA  . ALA A 1 43  ? -1.901  -29.072 -38.489 1.00 6.23   ? 327 ALA A CA  1 
ATOM 227  C C   . ALA A 1 43  ? -2.577  -27.763 -38.168 1.00 7.82   ? 327 ALA A C   1 
ATOM 228  O O   . ALA A 1 43  ? -2.092  -26.699 -38.554 1.00 8.06   ? 327 ALA A O   1 
ATOM 229  C CB  . ALA A 1 43  ? -0.455  -29.022 -38.049 1.00 9.98   ? 327 ALA A CB  1 
ATOM 230  N N   . TYR A 1 44  ? -3.695  -27.840 -37.456 1.00 9.03   ? 328 TYR A N   1 
ATOM 231  C CA  . TYR A 1 44  ? -4.461  -26.649 -37.100 1.00 9.32   ? 328 TYR A CA  1 
ATOM 232  C C   . TYR A 1 44  ? -3.985  -25.989 -35.804 1.00 8.66   ? 328 TYR A C   1 
ATOM 233  O O   . TYR A 1 44  ? -3.740  -26.661 -34.800 1.00 8.05   ? 328 TYR A O   1 
ATOM 234  C CB  . TYR A 1 44  ? -5.952  -27.020 -37.006 1.00 8.21   ? 328 TYR A CB  1 
ATOM 235  C CG  . TYR A 1 44  ? -6.843  -25.970 -36.373 1.00 4.97   ? 328 TYR A CG  1 
ATOM 236  C CD1 . TYR A 1 44  ? -7.160  -24.785 -37.043 1.00 4.87   ? 328 TYR A CD1 1 
ATOM 237  C CD2 . TYR A 1 44  ? -7.369  -26.166 -35.101 1.00 2.57   ? 328 TYR A CD2 1 
ATOM 238  C CE1 . TYR A 1 44  ? -7.979  -23.829 -36.454 1.00 4.24   ? 328 TYR A CE1 1 
ATOM 239  C CE2 . TYR A 1 44  ? -8.182  -25.220 -34.508 1.00 3.17   ? 328 TYR A CE2 1 
ATOM 240  C CZ  . TYR A 1 44  ? -8.485  -24.059 -35.182 1.00 2.16   ? 328 TYR A CZ  1 
ATOM 241  O OH  . TYR A 1 44  ? -9.291  -23.138 -34.569 1.00 2.16   ? 328 TYR A OH  1 
ATOM 242  N N   . PHE A 1 45  ? -3.845  -24.669 -35.845 1.00 8.12   ? 329 PHE A N   1 
ATOM 243  C CA  . PHE A 1 45  ? -3.420  -23.907 -34.678 1.00 9.85   ? 329 PHE A CA  1 
ATOM 244  C C   . PHE A 1 45  ? -4.380  -22.770 -34.339 1.00 12.48  ? 329 PHE A C   1 
ATOM 245  O O   . PHE A 1 45  ? -5.086  -22.247 -35.198 1.00 15.43  ? 329 PHE A O   1 
ATOM 246  C CB  . PHE A 1 45  ? -2.056  -23.265 -34.895 1.00 6.42   ? 329 PHE A CB  1 
ATOM 247  C CG  . PHE A 1 45  ? -0.979  -24.222 -35.222 1.00 5.87   ? 329 PHE A CG  1 
ATOM 248  C CD1 . PHE A 1 45  ? -0.902  -24.792 -36.479 1.00 10.97  ? 329 PHE A CD1 1 
ATOM 249  C CD2 . PHE A 1 45  ? -0.006  -24.520 -34.289 1.00 5.41   ? 329 PHE A CD2 1 
ATOM 250  C CE1 . PHE A 1 45  ? 0.136   -25.645 -36.801 1.00 11.14  ? 329 PHE A CE1 1 
ATOM 251  C CE2 . PHE A 1 45  ? 1.030   -25.367 -34.597 1.00 4.40   ? 329 PHE A CE2 1 
ATOM 252  C CZ  . PHE A 1 45  ? 1.104   -25.929 -35.854 1.00 9.06   ? 329 PHE A CZ  1 
ATOM 253  N N   . GLU A 1 46  ? -4.387  -22.388 -33.072 1.00 11.58  ? 330 GLU A N   1 
ATOM 254  C CA  . GLU A 1 46  ? -5.194  -21.281 -32.614 1.00 13.77  ? 330 GLU A CA  1 
ATOM 255  C C   . GLU A 1 46  ? -4.165  -20.416 -31.911 1.00 16.14  ? 330 GLU A C   1 
ATOM 256  O O   . GLU A 1 46  ? -3.659  -20.773 -30.842 1.00 14.84  ? 330 GLU A O   1 
ATOM 257  C CB  . GLU A 1 46  ? -6.272  -21.743 -31.637 1.00 16.10  ? 330 GLU A CB  1 
ATOM 258  C CG  . GLU A 1 46  ? -7.267  -22.713 -32.231 1.00 17.44  ? 330 GLU A CG  1 
ATOM 259  C CD  . GLU A 1 46  ? -8.546  -22.796 -31.424 1.00 19.35  ? 330 GLU A CD  1 
ATOM 260  O OE1 . GLU A 1 46  ? -8.483  -22.596 -30.190 1.00 18.91  ? 330 GLU A OE1 1 
ATOM 261  O OE2 . GLU A 1 46  ? -9.611  -23.073 -32.019 1.00 18.10  ? 330 GLU A OE2 1 
ATOM 262  N N   . MET A 1 47  ? -3.843  -19.283 -32.525 1.00 17.77  ? 331 MET A N   1 
ATOM 263  C CA  . MET A 1 47  ? -2.836  -18.396 -31.973 1.00 16.26  ? 331 MET A CA  1 
ATOM 264  C C   . MET A 1 47  ? -1.527  -19.184 -32.099 1.00 15.66  ? 331 MET A C   1 
ATOM 265  O O   . MET A 1 47  ? -1.106  -19.467 -33.219 1.00 17.54  ? 331 MET A O   1 
ATOM 266  C CB  . MET A 1 47  ? -3.175  -18.055 -30.520 1.00 15.59  ? 331 MET A CB  1 
ATOM 267  C CG  . MET A 1 47  ? -3.097  -16.569 -30.187 1.00 18.02  ? 331 MET A CG  1 
ATOM 268  S SD  . MET A 1 47  ? -3.597  -15.475 -31.535 1.00 21.84  ? 331 MET A SD  1 
ATOM 269  C CE  . MET A 1 47  ? -5.343  -15.302 -31.264 1.00 20.53  ? 331 MET A CE  1 
ATOM 270  N N   . ASP A 1 48  ? -0.896  -19.575 -30.995 1.00 14.30  ? 332 ASP A N   1 
ATOM 271  C CA  . ASP A 1 48  ? 0.369   -20.316 -31.103 1.00 16.63  ? 332 ASP A CA  1 
ATOM 272  C C   . ASP A 1 48  ? 0.316   -21.710 -30.504 1.00 16.40  ? 332 ASP A C   1 
ATOM 273  O O   . ASP A 1 48  ? 1.345   -22.283 -30.144 1.00 17.90  ? 332 ASP A O   1 
ATOM 274  C CB  . ASP A 1 48  ? 1.505   -19.534 -30.442 1.00 18.63  ? 332 ASP A CB  1 
ATOM 275  C CG  . ASP A 1 48  ? 1.392   -19.503 -28.930 1.00 23.27  ? 332 ASP A CG  1 
ATOM 276  O OD1 . ASP A 1 48  ? 0.253   -19.509 -28.417 1.00 24.13  ? 332 ASP A OD1 1 
ATOM 277  O OD2 . ASP A 1 48  ? 2.443   -19.457 -28.253 1.00 23.60  ? 332 ASP A OD2 1 
ATOM 278  N N   . VAL A 1 49  ? -0.892  -22.249 -30.417 1.00 14.60  ? 333 VAL A N   1 
ATOM 279  C CA  . VAL A 1 49  ? -1.133  -23.566 -29.849 1.00 9.64   ? 333 VAL A CA  1 
ATOM 280  C C   . VAL A 1 49  ? -1.689  -24.500 -30.910 1.00 9.75   ? 333 VAL A C   1 
ATOM 281  O O   . VAL A 1 49  ? -2.590  -24.124 -31.649 1.00 11.05  ? 333 VAL A O   1 
ATOM 282  C CB  . VAL A 1 49  ? -2.191  -23.480 -28.733 1.00 5.92   ? 333 VAL A CB  1 
ATOM 283  C CG1 . VAL A 1 49  ? -2.429  -24.843 -28.138 1.00 7.28   ? 333 VAL A CG1 1 
ATOM 284  C CG2 . VAL A 1 49  ? -1.768  -22.493 -27.689 1.00 2.16   ? 333 VAL A CG2 1 
ATOM 285  N N   . GLN A 1 50  ? -1.172  -25.716 -31.007 1.00 10.98  ? 334 GLN A N   1 
ATOM 286  C CA  . GLN A 1 50  ? -1.749  -26.612 -31.995 1.00 12.06  ? 334 GLN A CA  1 
ATOM 287  C C   . GLN A 1 50  ? -2.950  -27.270 -31.342 1.00 12.71  ? 334 GLN A C   1 
ATOM 288  O O   . GLN A 1 50  ? -2.869  -27.757 -30.216 1.00 15.53  ? 334 GLN A O   1 
ATOM 289  C CB  . GLN A 1 50  ? -0.777  -27.691 -32.468 1.00 8.29   ? 334 GLN A CB  1 
ATOM 290  C CG  . GLN A 1 50  ? -1.476  -28.619 -33.449 1.00 9.12   ? 334 GLN A CG  1 
ATOM 291  C CD  . GLN A 1 50  ? -0.669  -29.829 -33.846 1.00 11.60  ? 334 GLN A CD  1 
ATOM 292  O OE1 . GLN A 1 50  ? -1.178  -30.719 -34.518 1.00 12.79  ? 334 GLN A OE1 1 
ATOM 293  N NE2 . GLN A 1 50  ? 0.593   -29.872 -33.438 1.00 16.05  ? 334 GLN A NE2 1 
ATOM 294  N N   . VAL A 1 51  ? -4.071  -27.263 -32.048 1.00 11.50  ? 335 VAL A N   1 
ATOM 295  C CA  . VAL A 1 51  ? -5.294  -27.851 -31.540 1.00 8.53   ? 335 VAL A CA  1 
ATOM 296  C C   . VAL A 1 51  ? -5.594  -29.066 -32.388 1.00 9.99   ? 335 VAL A C   1 
ATOM 297  O O   . VAL A 1 51  ? -5.359  -29.052 -33.598 1.00 12.74  ? 335 VAL A O   1 
ATOM 298  C CB  . VAL A 1 51  ? -6.455  -26.857 -31.636 1.00 6.31   ? 335 VAL A CB  1 
ATOM 299  C CG1 . VAL A 1 51  ? -7.727  -27.505 -31.183 1.00 9.67   ? 335 VAL A CG1 1 
ATOM 300  C CG2 . VAL A 1 51  ? -6.164  -25.643 -30.778 1.00 6.00   ? 335 VAL A CG2 1 
ATOM 301  N N   . GLY A 1 52  ? -6.089  -30.123 -31.751 1.00 9.09   ? 336 GLY A N   1 
ATOM 302  C CA  . GLY A 1 52  ? -6.405  -31.342 -32.475 1.00 10.69  ? 336 GLY A CA  1 
ATOM 303  C C   . GLY A 1 52  ? -5.191  -32.171 -32.865 1.00 11.49  ? 336 GLY A C   1 
ATOM 304  O O   . GLY A 1 52  ? -4.056  -31.814 -32.546 1.00 14.01  ? 336 GLY A O   1 
ATOM 305  N N   . GLU A 1 53  ? -5.430  -33.297 -33.531 1.00 11.30  ? 337 GLU A N   1 
ATOM 306  C CA  . GLU A 1 53  ? -4.349  -34.167 -33.978 1.00 11.50  ? 337 GLU A CA  1 
ATOM 307  C C   . GLU A 1 53  ? -4.008  -33.628 -35.356 1.00 13.71  ? 337 GLU A C   1 
ATOM 308  O O   . GLU A 1 53  ? -4.787  -32.860 -35.931 1.00 11.84  ? 337 GLU A O   1 
ATOM 309  C CB  . GLU A 1 53  ? -4.815  -35.629 -34.115 1.00 10.42  ? 337 GLU A CB  1 
ATOM 310  C CG  . GLU A 1 53  ? -5.207  -36.342 -32.829 0.50 14.84  ? 337 GLU A CG  1 
ATOM 311  C CD  . GLU A 1 53  ? -4.011  -36.817 -32.018 0.50 17.49  ? 337 GLU A CD  1 
ATOM 312  O OE1 . GLU A 1 53  ? -3.238  -35.967 -31.527 0.50 18.84  ? 337 GLU A OE1 1 
ATOM 313  O OE2 . GLU A 1 53  ? -3.847  -38.046 -31.869 0.50 18.90  ? 337 GLU A OE2 1 
ATOM 314  N N   . THR A 1 54  ? -2.843  -34.016 -35.869 1.00 13.52  ? 338 THR A N   1 
ATOM 315  C CA  . THR A 1 54  ? -2.406  -33.601 -37.194 1.00 9.67   ? 338 THR A CA  1 
ATOM 316  C C   . THR A 1 54  ? -3.187  -34.449 -38.182 1.00 8.55   ? 338 THR A C   1 
ATOM 317  O O   . THR A 1 54  ? -3.178  -35.680 -38.088 1.00 8.67   ? 338 THR A O   1 
ATOM 318  C CB  . THR A 1 54  ? -0.905  -33.866 -37.393 1.00 10.30  ? 338 THR A CB  1 
ATOM 319  O OG1 . THR A 1 54  ? -0.157  -33.075 -36.463 1.00 13.19  ? 338 THR A OG1 1 
ATOM 320  C CG2 . THR A 1 54  ? -0.478  -33.532 -38.812 1.00 4.86   ? 338 THR A CG2 1 
ATOM 321  N N   . PHE A 1 55  ? -3.865  -33.789 -39.118 1.00 6.25   ? 339 PHE A N   1 
ATOM 322  C CA  . PHE A 1 55  ? -4.663  -34.475 -40.130 1.00 6.30   ? 339 PHE A CA  1 
ATOM 323  C C   . PHE A 1 55  ? -3.792  -34.875 -41.324 1.00 6.19   ? 339 PHE A C   1 
ATOM 324  O O   . PHE A 1 55  ? -3.072  -34.049 -41.875 1.00 9.66   ? 339 PHE A O   1 
ATOM 325  C CB  . PHE A 1 55  ? -5.788  -33.551 -40.594 1.00 8.55   ? 339 PHE A CB  1 
ATOM 326  C CG  . PHE A 1 55  ? -6.832  -34.234 -41.424 1.00 9.96   ? 339 PHE A CG  1 
ATOM 327  C CD1 . PHE A 1 55  ? -7.900  -34.893 -40.815 1.00 6.72   ? 339 PHE A CD1 1 
ATOM 328  C CD2 . PHE A 1 55  ? -6.727  -34.255 -42.815 1.00 8.53   ? 339 PHE A CD2 1 
ATOM 329  C CE1 . PHE A 1 55  ? -8.848  -35.565 -41.573 1.00 8.57   ? 339 PHE A CE1 1 
ATOM 330  C CE2 . PHE A 1 55  ? -7.672  -34.927 -43.587 1.00 9.70   ? 339 PHE A CE2 1 
ATOM 331  C CZ  . PHE A 1 55  ? -8.736  -35.585 -42.966 1.00 8.96   ? 339 PHE A CZ  1 
ATOM 332  N N   . LYS A 1 56  ? -3.853  -36.139 -41.723 1.00 5.75   ? 340 LYS A N   1 
ATOM 333  C CA  . LYS A 1 56  ? -3.056  -36.614 -42.847 1.00 8.95   ? 340 LYS A CA  1 
ATOM 334  C C   . LYS A 1 56  ? -3.950  -37.025 -44.012 1.00 10.94  ? 340 LYS A C   1 
ATOM 335  O O   . LYS A 1 56  ? -4.802  -37.896 -43.864 1.00 9.43   ? 340 LYS A O   1 
ATOM 336  C CB  . LYS A 1 56  ? -2.211  -37.804 -42.420 1.00 10.75  ? 340 LYS A CB  1 
ATOM 337  C CG  . LYS A 1 56  ? -1.370  -37.549 -41.208 1.00 14.27  ? 340 LYS A CG  1 
ATOM 338  C CD  . LYS A 1 56  ? -0.668  -38.817 -40.796 1.00 23.94  ? 340 LYS A CD  1 
ATOM 339  C CE  . LYS A 1 56  ? 0.110   -38.622 -39.507 1.00 32.07  ? 340 LYS A CE  1 
ATOM 340  N NZ  . LYS A 1 56  ? 0.873   -39.849 -39.147 1.00 37.51  ? 340 LYS A NZ  1 
ATOM 341  N N   . VAL A 1 57  ? -3.732  -36.409 -45.173 1.00 13.07  ? 341 VAL A N   1 
ATOM 342  C CA  . VAL A 1 57  ? -4.541  -36.682 -46.359 1.00 13.11  ? 341 VAL A CA  1 
ATOM 343  C C   . VAL A 1 57  ? -3.951  -37.734 -47.291 1.00 13.78  ? 341 VAL A C   1 
ATOM 344  O O   . VAL A 1 57  ? -2.854  -37.547 -47.819 1.00 17.29  ? 341 VAL A O   1 
ATOM 345  C CB  . VAL A 1 57  ? -4.742  -35.403 -47.194 1.00 10.73  ? 341 VAL A CB  1 
ATOM 346  C CG1 . VAL A 1 57  ? -5.756  -35.670 -48.302 1.00 11.92  ? 341 VAL A CG1 1 
ATOM 347  C CG2 . VAL A 1 57  ? -5.185  -34.263 -46.310 1.00 8.15   ? 341 VAL A CG2 1 
ATOM 348  N N   . PRO A 1 58  ? -4.680  -38.844 -47.521 1.00 12.81  ? 342 PRO A N   1 
ATOM 349  C CA  . PRO A 1 58  ? -4.227  -39.929 -48.402 1.00 12.24  ? 342 PRO A CA  1 
ATOM 350  C C   . PRO A 1 58  ? -4.033  -39.432 -49.816 1.00 13.23  ? 342 PRO A C   1 
ATOM 351  O O   . PRO A 1 58  ? -4.702  -38.496 -50.233 1.00 13.97  ? 342 PRO A O   1 
ATOM 352  C CB  . PRO A 1 58  ? -5.361  -40.939 -48.324 1.00 8.58   ? 342 PRO A CB  1 
ATOM 353  C CG  . PRO A 1 58  ? -5.856  -40.758 -46.943 1.00 11.71  ? 342 PRO A CG  1 
ATOM 354  C CD  . PRO A 1 58  ? -5.898  -39.245 -46.801 1.00 11.91  ? 342 PRO A CD  1 
ATOM 355  N N   . SER A 1 59  ? -3.118  -40.062 -50.547 1.00 16.89  ? 343 SER A N   1 
ATOM 356  C CA  . SER A 1 59  ? -2.838  -39.690 -51.934 1.00 20.64  ? 343 SER A CA  1 
ATOM 357  C C   . SER A 1 59  ? -4.038  -39.991 -52.818 1.00 23.70  ? 343 SER A C   1 
ATOM 358  O O   . SER A 1 59  ? -4.151  -39.479 -53.929 1.00 25.82  ? 343 SER A O   1 
ATOM 359  C CB  . SER A 1 59  ? -1.634  -40.465 -52.461 1.00 19.33  ? 343 SER A CB  1 
ATOM 360  O OG  . SER A 1 59  ? -0.473  -40.153 -51.726 1.00 20.81  ? 343 SER A OG  1 
ATOM 361  N N   . SER A 1 60  ? -4.929  -40.834 -52.315 1.00 26.25  ? 344 SER A N   1 
ATOM 362  C CA  . SER A 1 60  ? -6.120  -41.212 -53.045 1.00 27.35  ? 344 SER A CA  1 
ATOM 363  C C   . SER A 1 60  ? -7.219  -40.202 -52.772 1.00 26.04  ? 344 SER A C   1 
ATOM 364  O O   . SER A 1 60  ? -8.366  -40.409 -53.154 1.00 28.57  ? 344 SER A O   1 
ATOM 365  C CB  . SER A 1 60  ? -6.569  -42.603 -52.613 1.00 32.30  ? 344 SER A CB  1 
ATOM 366  O OG  . SER A 1 60  ? -6.789  -42.643 -51.213 1.00 39.11  ? 344 SER A OG  1 
ATOM 367  N N   . CYS A 1 61  ? -6.868  -39.119 -52.090 1.00 23.73  ? 345 CYS A N   1 
ATOM 368  C CA  . CYS A 1 61  ? -7.823  -38.056 -51.790 1.00 23.74  ? 345 CYS A CA  1 
ATOM 369  C C   . CYS A 1 61  ? -7.215  -36.762 -52.281 1.00 20.07  ? 345 CYS A C   1 
ATOM 370  O O   . CYS A 1 61  ? -6.864  -35.892 -51.496 1.00 22.44  ? 345 CYS A O   1 
ATOM 371  C CB  . CYS A 1 61  ? -8.095  -37.949 -50.284 1.00 27.35  ? 345 CYS A CB  1 
ATOM 372  S SG  . CYS A 1 61  ? -8.916  -39.378 -49.548 1.00 30.47  ? 345 CYS A SG  1 
ATOM 373  N N   . PRO A 1 62  ? -7.076  -36.624 -53.600 1.00 18.99  ? 346 PRO A N   1 
ATOM 374  C CA  . PRO A 1 62  ? -6.503  -35.436 -54.240 1.00 18.50  ? 346 PRO A CA  1 
ATOM 375  C C   . PRO A 1 62  ? -7.132  -34.114 -53.807 1.00 17.37  ? 346 PRO A C   1 
ATOM 376  O O   . PRO A 1 62  ? -6.612  -33.040 -54.110 1.00 17.87  ? 346 PRO A O   1 
ATOM 377  C CB  . PRO A 1 62  ? -6.700  -35.719 -55.727 1.00 18.03  ? 346 PRO A CB  1 
ATOM 378  C CG  . PRO A 1 62  ? -7.912  -36.606 -55.744 1.00 20.10  ? 346 PRO A CG  1 
ATOM 379  C CD  . PRO A 1 62  ? -7.629  -37.540 -54.608 1.00 20.04  ? 346 PRO A CD  1 
ATOM 380  N N   . ILE A 1 63  ? -8.251  -34.195 -53.100 1.00 15.22  ? 347 ILE A N   1 
ATOM 381  C CA  . ILE A 1 63  ? -8.920  -32.998 -52.627 1.00 12.39  ? 347 ILE A CA  1 
ATOM 382  C C   . ILE A 1 63  ? -9.306  -33.158 -51.178 1.00 13.99  ? 347 ILE A C   1 
ATOM 383  O O   . ILE A 1 63  ? -9.924  -34.153 -50.803 1.00 17.78  ? 347 ILE A O   1 
ATOM 384  C CB  . ILE A 1 63  ? -10.184 -32.711 -53.440 1.00 10.57  ? 347 ILE A CB  1 
ATOM 385  C CG1 . ILE A 1 63  ? -9.796  -32.520 -54.904 1.00 11.69  ? 347 ILE A CG1 1 
ATOM 386  C CG2 . ILE A 1 63  ? -10.899 -31.469 -52.902 1.00 6.09   ? 347 ILE A CG2 1 
ATOM 387  C CD1 . ILE A 1 63  ? -10.943 -32.146 -55.793 1.00 14.17  ? 347 ILE A CD1 1 
ATOM 388  N N   . VAL A 1 64  ? -8.924  -32.182 -50.365 1.00 14.24  ? 348 VAL A N   1 
ATOM 389  C CA  . VAL A 1 64  ? -9.251  -32.198 -48.948 1.00 15.90  ? 348 VAL A CA  1 
ATOM 390  C C   . VAL A 1 64  ? -9.988  -30.906 -48.621 1.00 14.72  ? 348 VAL A C   1 
ATOM 391  O O   . VAL A 1 64  ? -9.677  -29.848 -49.168 1.00 10.90  ? 348 VAL A O   1 
ATOM 392  C CB  . VAL A 1 64  ? -7.981  -32.294 -48.058 1.00 17.59  ? 348 VAL A CB  1 
ATOM 393  C CG1 . VAL A 1 64  ? -7.210  -30.984 -48.103 1.00 23.39  ? 348 VAL A CG1 1 
ATOM 394  C CG2 . VAL A 1 64  ? -8.367  -32.621 -46.625 1.00 16.23  ? 348 VAL A CG2 1 
ATOM 395  N N   . THR A 1 65  ? -10.969 -31.008 -47.730 1.00 17.16  ? 349 THR A N   1 
ATOM 396  C CA  . THR A 1 65  ? -11.764 -29.858 -47.317 1.00 17.17  ? 349 THR A CA  1 
ATOM 397  C C   . THR A 1 65  ? -11.530 -29.568 -45.840 1.00 18.19  ? 349 THR A C   1 
ATOM 398  O O   . THR A 1 65  ? -11.654 -30.462 -44.995 1.00 21.94  ? 349 THR A O   1 
ATOM 399  C CB  . THR A 1 65  ? -13.260 -30.128 -47.492 1.00 15.63  ? 349 THR A CB  1 
ATOM 400  O OG1 . THR A 1 65  ? -13.473 -30.888 -48.686 1.00 16.36  ? 349 THR A OG1 1 
ATOM 401  C CG2 . THR A 1 65  ? -14.017 -28.827 -47.580 1.00 14.17  ? 349 THR A CG2 1 
ATOM 402  N N   . VAL A 1 66  ? -11.183 -28.324 -45.537 1.00 15.05  ? 350 VAL A N   1 
ATOM 403  C CA  . VAL A 1 66  ? -10.967 -27.907 -44.162 1.00 12.97  ? 350 VAL A CA  1 
ATOM 404  C C   . VAL A 1 66  ? -12.054 -26.876 -43.880 1.00 15.00  ? 350 VAL A C   1 
ATOM 405  O O   . VAL A 1 66  ? -11.989 -25.742 -44.359 1.00 16.51  ? 350 VAL A O   1 
ATOM 406  C CB  . VAL A 1 66  ? -9.566  -27.275 -43.977 1.00 10.92  ? 350 VAL A CB  1 
ATOM 407  C CG1 . VAL A 1 66  ? -9.427  -26.686 -42.582 1.00 7.76   ? 350 VAL A CG1 1 
ATOM 408  C CG2 . VAL A 1 66  ? -8.497  -28.333 -44.199 1.00 10.57  ? 350 VAL A CG2 1 
ATOM 409  N N   . ASP A 1 67  ? -13.072 -27.283 -43.130 1.00 13.13  ? 351 ASP A N   1 
ATOM 410  C CA  . ASP A 1 67  ? -14.166 -26.383 -42.813 1.00 11.21  ? 351 ASP A CA  1 
ATOM 411  C C   . ASP A 1 67  ? -14.280 -26.168 -41.326 1.00 9.88   ? 351 ASP A C   1 
ATOM 412  O O   . ASP A 1 67  ? -13.413 -26.592 -40.556 1.00 11.79  ? 351 ASP A O   1 
ATOM 413  C CB  . ASP A 1 67  ? -15.492 -26.925 -43.351 1.00 12.31  ? 351 ASP A CB  1 
ATOM 414  C CG  . ASP A 1 67  ? -15.804 -28.310 -42.836 1.00 15.61  ? 351 ASP A CG  1 
ATOM 415  O OD1 . ASP A 1 67  ? -15.740 -28.501 -41.604 1.00 17.56  ? 351 ASP A OD1 1 
ATOM 416  O OD2 . ASP A 1 67  ? -16.118 -29.205 -43.655 1.00 15.38  ? 351 ASP A OD2 1 
ATOM 417  N N   . GLY A 1 68  ? -15.364 -25.506 -40.932 1.00 7.05   ? 352 GLY A N   1 
ATOM 418  C CA  . GLY A 1 68  ? -15.599 -25.216 -39.534 1.00 4.41   ? 352 GLY A CA  1 
ATOM 419  C C   . GLY A 1 68  ? -16.681 -26.093 -38.952 1.00 5.06   ? 352 GLY A C   1 
ATOM 420  O O   . GLY A 1 68  ? -17.169 -25.820 -37.862 1.00 5.72   ? 352 GLY A O   1 
ATOM 421  N N   . TYR A 1 69  ? -17.045 -27.159 -39.658 1.00 7.58   ? 353 TYR A N   1 
ATOM 422  C CA  . TYR A 1 69  ? -18.089 -28.046 -39.170 1.00 12.15  ? 353 TYR A CA  1 
ATOM 423  C C   . TYR A 1 69  ? -17.660 -29.019 -38.074 1.00 13.29  ? 353 TYR A C   1 
ATOM 424  O O   . TYR A 1 69  ? -16.641 -28.800 -37.419 1.00 12.15  ? 353 TYR A O   1 
ATOM 425  C CB  . TYR A 1 69  ? -18.766 -28.755 -40.340 1.00 16.43  ? 353 TYR A CB  1 
ATOM 426  C CG  . TYR A 1 69  ? -19.564 -27.771 -41.169 1.00 24.77  ? 353 TYR A CG  1 
ATOM 427  C CD1 . TYR A 1 69  ? -18.987 -27.106 -42.253 1.00 29.84  ? 353 TYR A CD1 1 
ATOM 428  C CD2 . TYR A 1 69  ? -20.857 -27.409 -40.796 1.00 28.28  ? 353 TYR A CD2 1 
ATOM 429  C CE1 . TYR A 1 69  ? -19.676 -26.096 -42.938 1.00 30.23  ? 353 TYR A CE1 1 
ATOM 430  C CE2 . TYR A 1 69  ? -21.552 -26.401 -41.476 1.00 30.82  ? 353 TYR A CE2 1 
ATOM 431  C CZ  . TYR A 1 69  ? -20.953 -25.748 -42.541 1.00 29.58  ? 353 TYR A CZ  1 
ATOM 432  O OH  . TYR A 1 69  ? -21.620 -24.733 -43.186 1.00 30.67  ? 353 TYR A OH  1 
ATOM 433  N N   . VAL A 1 70  ? -18.427 -30.083 -37.854 1.00 13.63  ? 354 VAL A N   1 
ATOM 434  C CA  . VAL A 1 70  ? -18.101 -30.977 -36.754 1.00 13.46  ? 354 VAL A CA  1 
ATOM 435  C C   . VAL A 1 70  ? -18.008 -32.486 -36.939 1.00 16.19  ? 354 VAL A C   1 
ATOM 436  O O   . VAL A 1 70  ? -17.955 -33.205 -35.941 1.00 16.70  ? 354 VAL A O   1 
ATOM 437  C CB  . VAL A 1 70  ? -19.054 -30.706 -35.567 1.00 14.20  ? 354 VAL A CB  1 
ATOM 438  C CG1 . VAL A 1 70  ? -18.878 -29.279 -35.083 1.00 14.26  ? 354 VAL A CG1 1 
ATOM 439  C CG2 . VAL A 1 70  ? -20.503 -30.926 -35.982 1.00 12.72  ? 354 VAL A CG2 1 
ATOM 440  N N   . ASP A 1 71  ? -17.987 -32.982 -38.178 1.00 19.17  ? 355 ASP A N   1 
ATOM 441  C CA  . ASP A 1 71  ? -17.861 -34.428 -38.392 1.00 20.97  ? 355 ASP A CA  1 
ATOM 442  C C   . ASP A 1 71  ? -16.392 -34.780 -38.179 1.00 21.66  ? 355 ASP A C   1 
ATOM 443  O O   . ASP A 1 71  ? -15.521 -34.274 -38.881 1.00 24.27  ? 355 ASP A O   1 
ATOM 444  C CB  . ASP A 1 71  ? -18.284 -34.819 -39.809 1.00 24.49  ? 355 ASP A CB  1 
ATOM 445  C CG  . ASP A 1 71  ? -18.115 -36.314 -40.079 1.00 29.86  ? 355 ASP A CG  1 
ATOM 446  O OD1 . ASP A 1 71  ? -16.993 -36.829 -39.882 1.00 30.54  ? 355 ASP A OD1 1 
ATOM 447  O OD2 . ASP A 1 71  ? -19.096 -36.975 -40.491 1.00 30.69  ? 355 ASP A OD2 1 
ATOM 448  N N   . PRO A 1 72  ? -16.097 -35.659 -37.209 1.00 23.07  ? 356 PRO A N   1 
ATOM 449  C CA  . PRO A 1 72  ? -14.726 -36.077 -36.892 1.00 22.75  ? 356 PRO A CA  1 
ATOM 450  C C   . PRO A 1 72  ? -14.065 -37.088 -37.823 1.00 22.26  ? 356 PRO A C   1 
ATOM 451  O O   . PRO A 1 72  ? -12.860 -37.315 -37.734 1.00 23.90  ? 356 PRO A O   1 
ATOM 452  C CB  . PRO A 1 72  ? -14.864 -36.626 -35.485 1.00 23.06  ? 356 PRO A CB  1 
ATOM 453  C CG  . PRO A 1 72  ? -16.202 -37.302 -35.557 1.00 24.01  ? 356 PRO A CG  1 
ATOM 454  C CD  . PRO A 1 72  ? -17.056 -36.270 -36.271 1.00 24.09  ? 356 PRO A CD  1 
ATOM 455  N N   . SER A 1 73  ? -14.835 -37.698 -38.714 1.00 21.70  ? 357 SER A N   1 
ATOM 456  C CA  . SER A 1 73  ? -14.268 -38.691 -39.621 1.00 21.36  ? 357 SER A CA  1 
ATOM 457  C C   . SER A 1 73  ? -12.968 -38.269 -40.296 1.00 20.96  ? 357 SER A C   1 
ATOM 458  O O   . SER A 1 73  ? -12.672 -37.075 -40.446 1.00 19.69  ? 357 SER A O   1 
ATOM 459  C CB  . SER A 1 73  ? -15.286 -39.069 -40.689 1.00 19.85  ? 357 SER A CB  1 
ATOM 460  O OG  . SER A 1 73  ? -16.386 -39.733 -40.106 1.00 24.78  ? 357 SER A OG  1 
ATOM 461  N N   . GLY A 1 74  ? -12.191 -39.271 -40.691 1.00 19.85  ? 358 GLY A N   1 
ATOM 462  C CA  . GLY A 1 74  ? -10.940 -39.008 -41.369 1.00 23.47  ? 358 GLY A CA  1 
ATOM 463  C C   . GLY A 1 74  ? -11.184 -38.931 -42.865 1.00 25.07  ? 358 GLY A C   1 
ATOM 464  O O   . GLY A 1 74  ? -12.309 -38.669 -43.306 1.00 28.98  ? 358 GLY A O   1 
ATOM 465  N N   . GLY A 1 75  ? -10.131 -39.129 -43.652 1.00 22.89  ? 359 GLY A N   1 
ATOM 466  C CA  . GLY A 1 75  ? -10.286 -39.101 -45.093 1.00 22.34  ? 359 GLY A CA  1 
ATOM 467  C C   . GLY A 1 75  ? -10.015 -37.807 -45.830 1.00 21.86  ? 359 GLY A C   1 
ATOM 468  O O   . GLY A 1 75  ? -8.902  -37.291 -45.823 1.00 22.25  ? 359 GLY A O   1 
ATOM 469  N N   . ASP A 1 76  ? -11.048 -37.280 -46.473 1.00 23.00  ? 360 ASP A N   1 
ATOM 470  C CA  . ASP A 1 76  ? -10.915 -36.062 -47.256 1.00 23.58  ? 360 ASP A CA  1 
ATOM 471  C C   . ASP A 1 76  ? -11.550 -34.829 -46.633 1.00 24.00  ? 360 ASP A C   1 
ATOM 472  O O   . ASP A 1 76  ? -11.708 -33.809 -47.306 1.00 25.68  ? 360 ASP A O   1 
ATOM 473  C CB  . ASP A 1 76  ? -11.527 -36.288 -48.629 1.00 24.47  ? 360 ASP A CB  1 
ATOM 474  C CG  . ASP A 1 76  ? -13.012 -36.531 -48.555 1.00 24.04  ? 360 ASP A CG  1 
ATOM 475  O OD1 . ASP A 1 76  ? -13.571 -37.102 -49.514 1.00 27.64  ? 360 ASP A OD1 1 
ATOM 476  O OD2 . ASP A 1 76  ? -13.620 -36.144 -47.535 1.00 22.72  ? 360 ASP A OD2 1 
ATOM 477  N N   . ARG A 1 77  ? -11.927 -34.910 -45.363 1.00 23.16  ? 361 ARG A N   1 
ATOM 478  C CA  . ARG A 1 77  ? -12.531 -33.754 -44.717 1.00 21.28  ? 361 ARG A CA  1 
ATOM 479  C C   . ARG A 1 77  ? -12.033 -33.575 -43.287 1.00 20.35  ? 361 ARG A C   1 
ATOM 480  O O   . ARG A 1 77  ? -12.182 -34.461 -42.441 1.00 22.98  ? 361 ARG A O   1 
ATOM 481  C CB  . ARG A 1 77  ? -14.045 -33.887 -44.743 1.00 21.02  ? 361 ARG A CB  1 
ATOM 482  C CG  . ARG A 1 77  ? -14.763 -32.592 -44.496 1.00 20.08  ? 361 ARG A CG  1 
ATOM 483  C CD  . ARG A 1 77  ? -16.255 -32.816 -44.481 1.00 18.44  ? 361 ARG A CD  1 
ATOM 484  N NE  . ARG A 1 77  ? -16.929 -31.669 -43.894 1.00 18.35  ? 361 ARG A NE  1 
ATOM 485  C CZ  . ARG A 1 77  ? -18.076 -31.746 -43.232 1.00 19.25  ? 361 ARG A CZ  1 
ATOM 486  N NH1 . ARG A 1 77  ? -18.677 -32.919 -43.078 1.00 18.50  ? 361 ARG A NH1 1 
ATOM 487  N NH2 . ARG A 1 77  ? -18.614 -30.651 -42.712 1.00 20.99  ? 361 ARG A NH2 1 
ATOM 488  N N   . PHE A 1 78  ? -11.440 -32.412 -43.039 1.00 17.22  ? 362 PHE A N   1 
ATOM 489  C CA  . PHE A 1 78  ? -10.865 -32.049 -41.741 1.00 14.70  ? 362 PHE A CA  1 
ATOM 490  C C   . PHE A 1 78  ? -11.709 -30.923 -41.138 1.00 14.44  ? 362 PHE A C   1 
ATOM 491  O O   . PHE A 1 78  ? -11.603 -29.769 -41.549 1.00 14.99  ? 362 PHE A O   1 
ATOM 492  C CB  . PHE A 1 78  ? -9.412  -31.604 -41.983 1.00 10.93  ? 362 PHE A CB  1 
ATOM 493  C CG  . PHE A 1 78  ? -8.654  -31.190 -40.748 1.00 7.98   ? 362 PHE A CG  1 
ATOM 494  C CD1 . PHE A 1 78  ? -8.789  -31.873 -39.548 1.00 9.02   ? 362 PHE A CD1 1 
ATOM 495  C CD2 . PHE A 1 78  ? -7.720  -30.161 -40.819 1.00 5.18   ? 362 PHE A CD2 1 
ATOM 496  C CE1 . PHE A 1 78  ? -7.994  -31.531 -38.436 1.00 4.11   ? 362 PHE A CE1 1 
ATOM 497  C CE2 . PHE A 1 78  ? -6.931  -29.822 -39.717 1.00 2.37   ? 362 PHE A CE2 1 
ATOM 498  C CZ  . PHE A 1 78  ? -7.069  -30.507 -38.529 1.00 2.16   ? 362 PHE A CZ  1 
ATOM 499  N N   . CYS A 1 79  ? -12.562 -31.267 -40.176 1.00 13.01  ? 363 CYS A N   1 
ATOM 500  C CA  . CYS A 1 79  ? -13.439 -30.284 -39.544 1.00 10.79  ? 363 CYS A CA  1 
ATOM 501  C C   . CYS A 1 79  ? -12.845 -29.715 -38.270 1.00 10.17  ? 363 CYS A C   1 
ATOM 502  O O   . CYS A 1 79  ? -12.534 -30.448 -37.343 1.00 11.91  ? 363 CYS A O   1 
ATOM 503  C CB  . CYS A 1 79  ? -14.795 -30.913 -39.220 1.00 10.98  ? 363 CYS A CB  1 
ATOM 504  S SG  . CYS A 1 79  ? -15.683 -31.630 -40.628 1.00 12.68  ? 363 CYS A SG  1 
ATOM 505  N N   . LEU A 1 80  ? -12.717 -28.398 -38.215 1.00 9.41   ? 364 LEU A N   1 
ATOM 506  C CA  . LEU A 1 80  ? -12.148 -27.738 -37.050 1.00 10.62  ? 364 LEU A CA  1 
ATOM 507  C C   . LEU A 1 80  ? -13.186 -27.305 -36.009 1.00 11.85  ? 364 LEU A C   1 
ATOM 508  O O   . LEU A 1 80  ? -12.829 -26.811 -34.932 1.00 11.15  ? 364 LEU A O   1 
ATOM 509  C CB  . LEU A 1 80  ? -11.350 -26.517 -37.513 1.00 10.93  ? 364 LEU A CB  1 
ATOM 510  C CG  . LEU A 1 80  ? -9.998  -26.739 -38.201 1.00 11.77  ? 364 LEU A CG  1 
ATOM 511  C CD1 . LEU A 1 80  ? -9.776  -28.204 -38.529 1.00 11.83  ? 364 LEU A CD1 1 
ATOM 512  C CD2 . LEU A 1 80  ? -9.950  -25.895 -39.446 1.00 10.41  ? 364 LEU A CD2 1 
ATOM 513  N N   . GLY A 1 81  ? -14.462 -27.508 -36.325 1.00 11.08  ? 365 GLY A N   1 
ATOM 514  C CA  . GLY A 1 81  ? -15.534 -27.090 -35.439 1.00 10.41  ? 365 GLY A CA  1 
ATOM 515  C C   . GLY A 1 81  ? -15.722 -27.793 -34.108 1.00 11.94  ? 365 GLY A C   1 
ATOM 516  O O   . GLY A 1 81  ? -16.046 -27.147 -33.101 1.00 9.34   ? 365 GLY A O   1 
ATOM 517  N N   . GLN A 1 82  ? -15.531 -29.109 -34.096 1.00 13.08  ? 366 GLN A N   1 
ATOM 518  C CA  . GLN A 1 82  ? -15.716 -29.885 -32.880 1.00 13.66  ? 366 GLN A CA  1 
ATOM 519  C C   . GLN A 1 82  ? -14.505 -29.887 -31.959 1.00 13.96  ? 366 GLN A C   1 
ATOM 520  O O   . GLN A 1 82  ? -14.636 -30.191 -30.777 1.00 17.22  ? 366 GLN A O   1 
ATOM 521  C CB  . GLN A 1 82  ? -16.097 -31.324 -33.220 1.00 12.65  ? 366 GLN A CB  1 
ATOM 522  C CG  . GLN A 1 82  ? -14.929 -32.228 -33.561 1.00 16.23  ? 366 GLN A CG  1 
ATOM 523  C CD  . GLN A 1 82  ? -14.304 -31.930 -34.907 1.00 18.35  ? 366 GLN A CD  1 
ATOM 524  O OE1 . GLN A 1 82  ? -13.391 -32.631 -35.336 1.00 18.00  ? 366 GLN A OE1 1 
ATOM 525  N NE2 . GLN A 1 82  ? -14.792 -30.896 -35.583 1.00 17.21  ? 366 GLN A NE2 1 
ATOM 526  N N   . LEU A 1 83  ? -13.335 -29.546 -32.494 1.00 12.18  ? 367 LEU A N   1 
ATOM 527  C CA  . LEU A 1 83  ? -12.099 -29.513 -31.704 1.00 11.18  ? 367 LEU A CA  1 
ATOM 528  C C   . LEU A 1 83  ? -12.193 -28.636 -30.446 1.00 8.70   ? 367 LEU A C   1 
ATOM 529  O O   . LEU A 1 83  ? -12.879 -27.610 -30.439 1.00 3.82   ? 367 LEU A O   1 
ATOM 530  C CB  . LEU A 1 83  ? -10.931 -29.018 -32.571 1.00 10.13  ? 367 LEU A CB  1 
ATOM 531  C CG  . LEU A 1 83  ? -10.608 -29.807 -33.846 1.00 10.48  ? 367 LEU A CG  1 
ATOM 532  C CD1 . LEU A 1 83  ? -9.442  -29.171 -34.559 1.00 10.78  ? 367 LEU A CD1 1 
ATOM 533  C CD2 . LEU A 1 83  ? -10.274 -31.237 -33.509 1.00 9.27   ? 367 LEU A CD2 1 
ATOM 534  N N   . SER A 1 84  ? -11.497 -29.049 -29.386 1.00 7.50   ? 368 SER A N   1 
ATOM 535  C CA  . SER A 1 84  ? -11.478 -28.295 -28.128 1.00 6.65   ? 368 SER A CA  1 
ATOM 536  C C   . SER A 1 84  ? -10.113 -27.675 -27.860 1.00 6.07   ? 368 SER A C   1 
ATOM 537  O O   . SER A 1 84  ? -9.108  -28.059 -28.461 1.00 7.39   ? 368 SER A O   1 
ATOM 538  C CB  . SER A 1 84  ? -11.826 -29.190 -26.940 1.00 5.79   ? 368 SER A CB  1 
ATOM 539  O OG  . SER A 1 84  ? -13.150 -29.654 -27.035 1.00 11.73  ? 368 SER A OG  1 
ATOM 540  N N   . ASN A 1 85  ? -10.095 -26.709 -26.949 1.00 4.06   ? 369 ASN A N   1 
ATOM 541  C CA  . ASN A 1 85  ? -8.873  -26.037 -26.552 1.00 4.44   ? 369 ASN A CA  1 
ATOM 542  C C   . ASN A 1 85  ? -9.105  -25.315 -25.237 1.00 7.78   ? 369 ASN A C   1 
ATOM 543  O O   . ASN A 1 85  ? -9.807  -24.304 -25.178 1.00 9.30   ? 369 ASN A O   1 
ATOM 544  C CB  . ASN A 1 85  ? -8.417  -25.053 -27.623 1.00 2.16   ? 369 ASN A CB  1 
ATOM 545  C CG  . ASN A 1 85  ? -7.319  -24.137 -27.128 1.00 2.82   ? 369 ASN A CG  1 
ATOM 546  O OD1 . ASN A 1 85  ? -6.609  -24.458 -26.171 1.00 2.16   ? 369 ASN A OD1 1 
ATOM 547  N ND2 . ASN A 1 85  ? -7.165  -22.993 -27.780 1.00 2.16   ? 369 ASN A ND2 1 
ATOM 548  N N   . VAL A 1 86  ? -8.514  -25.843 -24.174 1.00 12.85  ? 370 VAL A N   1 
ATOM 549  C CA  . VAL A 1 86  ? -8.678  -25.251 -22.853 1.00 17.51  ? 370 VAL A CA  1 
ATOM 550  C C   . VAL A 1 86  ? -8.200  -23.809 -22.818 1.00 18.15  ? 370 VAL A C   1 
ATOM 551  O O   . VAL A 1 86  ? -8.733  -22.998 -22.066 1.00 20.52  ? 370 VAL A O   1 
ATOM 552  C CB  . VAL A 1 86  ? -7.920  -26.060 -21.774 1.00 17.66  ? 370 VAL A CB  1 
ATOM 553  C CG1 . VAL A 1 86  ? -8.526  -27.447 -21.652 1.00 16.23  ? 370 VAL A CG1 1 
ATOM 554  C CG2 . VAL A 1 86  ? -6.443  -26.158 -22.133 1.00 17.51  ? 370 VAL A CG2 1 
ATOM 555  N N   . HIS A 1 87  ? -7.209  -23.491 -23.644 1.00 18.79  ? 371 HIS A N   1 
ATOM 556  C CA  . HIS A 1 87  ? -6.658  -22.143 -23.690 1.00 19.13  ? 371 HIS A CA  1 
ATOM 557  C C   . HIS A 1 87  ? -7.410  -21.217 -24.634 1.00 19.03  ? 371 HIS A C   1 
ATOM 558  O O   . HIS A 1 87  ? -7.014  -20.062 -24.819 1.00 18.76  ? 371 HIS A O   1 
ATOM 559  C CB  . HIS A 1 87  ? -5.195  -22.179 -24.125 1.00 21.30  ? 371 HIS A CB  1 
ATOM 560  C CG  . HIS A 1 87  ? -4.322  -23.014 -23.248 1.00 22.54  ? 371 HIS A CG  1 
ATOM 561  N ND1 . HIS A 1 87  ? -4.323  -22.902 -21.875 1.00 24.08  ? 371 HIS A ND1 1 
ATOM 562  C CD2 . HIS A 1 87  ? -3.412  -23.970 -23.551 1.00 23.67  ? 371 HIS A CD2 1 
ATOM 563  C CE1 . HIS A 1 87  ? -3.453  -23.757 -21.368 1.00 27.19  ? 371 HIS A CE1 1 
ATOM 564  N NE2 . HIS A 1 87  ? -2.886  -24.417 -22.363 1.00 27.02  ? 371 HIS A NE2 1 
ATOM 565  N N   . ARG A 1 88  ? -8.494  -21.712 -25.220 1.00 18.46  ? 372 ARG A N   1 
ATOM 566  C CA  . ARG A 1 88  ? -9.264  -20.913 -26.163 1.00 17.34  ? 372 ARG A CA  1 
ATOM 567  C C   . ARG A 1 88  ? -9.800  -19.640 -25.517 1.00 17.55  ? 372 ARG A C   1 
ATOM 568  O O   . ARG A 1 88  ? -10.102 -19.622 -24.327 1.00 17.36  ? 372 ARG A O   1 
ATOM 569  C CB  . ARG A 1 88  ? -10.400 -21.752 -26.742 1.00 14.70  ? 372 ARG A CB  1 
ATOM 570  C CG  . ARG A 1 88  ? -10.989 -21.192 -28.019 1.00 13.39  ? 372 ARG A CG  1 
ATOM 571  C CD  . ARG A 1 88  ? -11.956 -22.181 -28.649 1.00 13.23  ? 372 ARG A CD  1 
ATOM 572  N NE  . ARG A 1 88  ? -11.296 -23.246 -29.407 1.00 8.09   ? 372 ARG A NE  1 
ATOM 573  C CZ  . ARG A 1 88  ? -11.932 -24.315 -29.880 1.00 5.24   ? 372 ARG A CZ  1 
ATOM 574  N NH1 . ARG A 1 88  ? -13.230 -24.465 -29.662 1.00 7.16   ? 372 ARG A NH1 1 
ATOM 575  N NH2 . ARG A 1 88  ? -11.293 -25.216 -30.605 1.00 4.51   ? 372 ARG A NH2 1 
ATOM 576  N N   . THR A 1 89  ? -9.893  -18.575 -26.309 1.00 20.16  ? 373 THR A N   1 
ATOM 577  C CA  . THR A 1 89  ? -10.380 -17.277 -25.837 1.00 21.30  ? 373 THR A CA  1 
ATOM 578  C C   . THR A 1 89  ? -11.620 -16.864 -26.612 1.00 24.35  ? 373 THR A C   1 
ATOM 579  O O   . THR A 1 89  ? -11.950 -17.452 -27.639 1.00 27.57  ? 373 THR A O   1 
ATOM 580  C CB  . THR A 1 89  ? -9.354  -16.168 -26.062 1.00 19.55  ? 373 THR A CB  1 
ATOM 581  O OG1 . THR A 1 89  ? -9.236  -15.920 -27.468 1.00 20.75  ? 373 THR A OG1 1 
ATOM 582  C CG2 . THR A 1 89  ? -8.005  -16.568 -25.516 1.00 19.75  ? 373 THR A CG2 1 
ATOM 583  N N   . GLU A 1 90  ? -12.290 -15.829 -26.124 1.00 25.64  ? 374 GLU A N   1 
ATOM 584  C CA  . GLU A 1 90  ? -13.492 -15.324 -26.765 1.00 27.31  ? 374 GLU A CA  1 
ATOM 585  C C   . GLU A 1 90  ? -13.125 -14.840 -28.157 1.00 25.00  ? 374 GLU A C   1 
ATOM 586  O O   . GLU A 1 90  ? -13.839 -15.093 -29.131 1.00 23.62  ? 374 GLU A O   1 
ATOM 587  C CB  . GLU A 1 90  ? -14.057 -14.181 -25.932 1.00 34.90  ? 374 GLU A CB  1 
ATOM 588  C CG  . GLU A 1 90  ? -15.365 -13.596 -26.415 1.00 45.66  ? 374 GLU A CG  1 
ATOM 589  C CD  . GLU A 1 90  ? -15.919 -12.595 -25.414 1.00 54.21  ? 374 GLU A CD  1 
ATOM 590  O OE1 . GLU A 1 90  ? -16.333 -13.030 -24.316 1.00 55.54  ? 374 GLU A OE1 1 
ATOM 591  O OE2 . GLU A 1 90  ? -15.924 -11.377 -25.714 1.00 58.21  ? 374 GLU A OE2 1 
ATOM 592  N N   . ALA A 1 91  ? -11.993 -14.152 -28.239 1.00 21.75  ? 375 ALA A N   1 
ATOM 593  C CA  . ALA A 1 91  ? -11.493 -13.632 -29.502 1.00 17.99  ? 375 ALA A CA  1 
ATOM 594  C C   . ALA A 1 91  ? -11.389 -14.738 -30.542 1.00 17.97  ? 375 ALA A C   1 
ATOM 595  O O   . ALA A 1 91  ? -11.843 -14.589 -31.677 1.00 18.00  ? 375 ALA A O   1 
ATOM 596  C CB  . ALA A 1 91  ? -10.137 -13.008 -29.293 1.00 18.55  ? 375 ALA A CB  1 
ATOM 597  N N   . ILE A 1 92  ? -10.786 -15.853 -30.149 1.00 17.04  ? 376 ILE A N   1 
ATOM 598  C CA  . ILE A 1 92  ? -10.612 -16.974 -31.061 1.00 15.85  ? 376 ILE A CA  1 
ATOM 599  C C   . ILE A 1 92  ? -11.953 -17.576 -31.434 1.00 16.92  ? 376 ILE A C   1 
ATOM 600  O O   . ILE A 1 92  ? -12.184 -17.920 -32.590 1.00 16.88  ? 376 ILE A O   1 
ATOM 601  C CB  . ILE A 1 92  ? -9.720  -18.056 -30.432 1.00 14.32  ? 376 ILE A CB  1 
ATOM 602  C CG1 . ILE A 1 92  ? -8.397  -17.431 -30.009 1.00 12.83  ? 376 ILE A CG1 1 
ATOM 603  C CG2 . ILE A 1 92  ? -9.454  -19.174 -31.429 1.00 13.95  ? 376 ILE A CG2 1 
ATOM 604  C CD1 . ILE A 1 92  ? -7.528  -18.349 -29.245 1.00 11.72  ? 376 ILE A CD1 1 
ATOM 605  N N   . GLU A 1 93  ? -12.840 -17.696 -30.453 1.00 17.37  ? 377 GLU A N   1 
ATOM 606  C CA  . GLU A 1 93  ? -14.159 -18.255 -30.700 1.00 18.75  ? 377 GLU A CA  1 
ATOM 607  C C   . GLU A 1 93  ? -14.899 -17.410 -31.729 1.00 18.33  ? 377 GLU A C   1 
ATOM 608  O O   . GLU A 1 93  ? -15.396 -17.918 -32.747 1.00 11.61  ? 377 GLU A O   1 
ATOM 609  C CB  . GLU A 1 93  ? -14.957 -18.304 -29.400 1.00 21.62  ? 377 GLU A CB  1 
ATOM 610  C CG  . GLU A 1 93  ? -14.351 -19.219 -28.361 1.00 30.08  ? 377 GLU A CG  1 
ATOM 611  C CD  . GLU A 1 93  ? -15.222 -19.370 -27.132 1.00 33.45  ? 377 GLU A CD  1 
ATOM 612  O OE1 . GLU A 1 93  ? -15.500 -18.347 -26.468 1.00 32.42  ? 377 GLU A OE1 1 
ATOM 613  O OE2 . GLU A 1 93  ? -15.623 -20.519 -26.834 1.00 37.20  ? 377 GLU A OE2 1 
ATOM 614  N N   . ARG A 1 94  ? -14.957 -16.110 -31.459 1.00 18.50  ? 378 ARG A N   1 
ATOM 615  C CA  . ARG A 1 94  ? -15.636 -15.197 -32.351 1.00 19.37  ? 378 ARG A CA  1 
ATOM 616  C C   . ARG A 1 94  ? -15.152 -15.361 -33.780 1.00 18.35  ? 378 ARG A C   1 
ATOM 617  O O   . ARG A 1 94  ? -15.933 -15.215 -34.717 1.00 20.79  ? 378 ARG A O   1 
ATOM 618  C CB  . ARG A 1 94  ? -15.451 -13.754 -31.872 1.00 21.93  ? 378 ARG A CB  1 
ATOM 619  C CG  . ARG A 1 94  ? -16.197 -13.475 -30.568 1.00 30.41  ? 378 ARG A CG  1 
ATOM 620  C CD  . ARG A 1 94  ? -16.343 -11.988 -30.244 1.00 35.52  ? 378 ARG A CD  1 
ATOM 621  N NE  . ARG A 1 94  ? -15.278 -11.463 -29.386 1.00 40.40  ? 378 ARG A NE  1 
ATOM 622  C CZ  . ARG A 1 94  ? -14.101 -11.009 -29.818 1.00 44.76  ? 378 ARG A CZ  1 
ATOM 623  N NH1 . ARG A 1 94  ? -13.809 -11.006 -31.115 1.00 43.64  ? 378 ARG A NH1 1 
ATOM 624  N NH2 . ARG A 1 94  ? -13.213 -10.545 -28.944 1.00 47.84  ? 378 ARG A NH2 1 
ATOM 625  N N   . ALA A 1 95  ? -13.872 -15.692 -33.943 1.00 17.53  ? 379 ALA A N   1 
ATOM 626  C CA  . ALA A 1 95  ? -13.279 -15.869 -35.272 1.00 15.59  ? 379 ALA A CA  1 
ATOM 627  C C   . ALA A 1 95  ? -13.675 -17.186 -35.904 1.00 12.63  ? 379 ALA A C   1 
ATOM 628  O O   . ALA A 1 95  ? -14.049 -17.231 -37.074 1.00 8.36   ? 379 ALA A O   1 
ATOM 629  C CB  . ALA A 1 95  ? -11.756 -15.781 -35.188 1.00 17.32  ? 379 ALA A CB  1 
ATOM 630  N N   . ARG A 1 96  ? -13.567 -18.254 -35.117 1.00 14.17  ? 380 ARG A N   1 
ATOM 631  C CA  . ARG A 1 96  ? -13.903 -19.608 -35.556 1.00 13.91  ? 380 ARG A CA  1 
ATOM 632  C C   . ARG A 1 96  ? -15.315 -19.596 -36.116 1.00 12.45  ? 380 ARG A C   1 
ATOM 633  O O   . ARG A 1 96  ? -15.677 -20.394 -36.977 1.00 10.50  ? 380 ARG A O   1 
ATOM 634  C CB  . ARG A 1 96  ? -13.822 -20.569 -34.365 1.00 13.47  ? 380 ARG A CB  1 
ATOM 635  C CG  . ARG A 1 96  ? -12.413 -20.798 -33.822 1.00 11.43  ? 380 ARG A CG  1 
ATOM 636  C CD  . ARG A 1 96  ? -12.436 -21.494 -32.462 1.00 9.52   ? 380 ARG A CD  1 
ATOM 637  N NE  . ARG A 1 96  ? -13.219 -22.726 -32.465 1.00 7.22   ? 380 ARG A NE  1 
ATOM 638  C CZ  . ARG A 1 96  ? -12.938 -23.795 -33.206 1.00 11.62  ? 380 ARG A CZ  1 
ATOM 639  N NH1 . ARG A 1 96  ? -11.886 -23.795 -34.017 1.00 12.22  ? 380 ARG A NH1 1 
ATOM 640  N NH2 . ARG A 1 96  ? -13.709 -24.875 -33.133 1.00 12.90  ? 380 ARG A NH2 1 
ATOM 641  N N   . LEU A 1 97  ? -16.099 -18.659 -35.608 1.00 13.63  ? 381 LEU A N   1 
ATOM 642  C CA  . LEU A 1 97  ? -17.478 -18.479 -36.007 1.00 13.19  ? 381 LEU A CA  1 
ATOM 643  C C   . LEU A 1 97  ? -17.635 -18.276 -37.510 1.00 13.97  ? 381 LEU A C   1 
ATOM 644  O O   . LEU A 1 97  ? -18.647 -18.671 -38.072 1.00 15.71  ? 381 LEU A O   1 
ATOM 645  C CB  . LEU A 1 97  ? -18.046 -17.281 -35.247 1.00 13.55  ? 381 LEU A CB  1 
ATOM 646  C CG  . LEU A 1 97  ? -19.542 -17.161 -34.972 1.00 14.39  ? 381 LEU A CG  1 
ATOM 647  C CD1 . LEU A 1 97  ? -20.182 -18.520 -34.720 1.00 13.18  ? 381 LEU A CD1 1 
ATOM 648  C CD2 . LEU A 1 97  ? -19.711 -16.252 -33.768 1.00 12.24  ? 381 LEU A CD2 1 
ATOM 649  N N   . HIS A 1 98  ? -16.627 -17.694 -38.160 1.00 15.68  ? 382 HIS A N   1 
ATOM 650  C CA  . HIS A 1 98  ? -16.685 -17.413 -39.601 1.00 16.15  ? 382 HIS A CA  1 
ATOM 651  C C   . HIS A 1 98  ? -15.882 -18.284 -40.573 1.00 15.39  ? 382 HIS A C   1 
ATOM 652  O O   . HIS A 1 98  ? -15.784 -17.960 -41.754 1.00 15.65  ? 382 HIS A O   1 
ATOM 653  C CB  . HIS A 1 98  ? -16.318 -15.951 -39.831 1.00 19.51  ? 382 HIS A CB  1 
ATOM 654  C CG  . HIS A 1 98  ? -17.197 -14.999 -39.086 1.00 26.47  ? 382 HIS A CG  1 
ATOM 655  N ND1 . HIS A 1 98  ? -18.555 -14.910 -39.312 1.00 28.29  ? 382 HIS A ND1 1 
ATOM 656  C CD2 . HIS A 1 98  ? -16.924 -14.135 -38.080 1.00 27.03  ? 382 HIS A CD2 1 
ATOM 657  C CE1 . HIS A 1 98  ? -19.080 -14.034 -38.475 1.00 29.11  ? 382 HIS A CE1 1 
ATOM 658  N NE2 . HIS A 1 98  ? -18.113 -13.550 -37.716 1.00 29.22  ? 382 HIS A NE2 1 
ATOM 659  N N   . ILE A 1 99  ? -15.320 -19.388 -40.095 1.00 15.79  ? 383 ILE A N   1 
ATOM 660  C CA  . ILE A 1 99  ? -14.544 -20.276 -40.957 1.00 13.87  ? 383 ILE A CA  1 
ATOM 661  C C   . ILE A 1 99  ? -15.459 -20.884 -42.011 1.00 14.51  ? 383 ILE A C   1 
ATOM 662  O O   . ILE A 1 99  ? -15.056 -21.110 -43.149 1.00 15.52  ? 383 ILE A O   1 
ATOM 663  C CB  . ILE A 1 99  ? -13.867 -21.388 -40.131 1.00 11.67  ? 383 ILE A CB  1 
ATOM 664  C CG1 . ILE A 1 99  ? -12.888 -20.744 -39.146 1.00 10.74  ? 383 ILE A CG1 1 
ATOM 665  C CG2 . ILE A 1 99  ? -13.173 -22.378 -41.044 1.00 7.04   ? 383 ILE A CG2 1 
ATOM 666  C CD1 . ILE A 1 99  ? -12.100 -21.714 -38.336 1.00 10.71  ? 383 ILE A CD1 1 
ATOM 667  N N   . GLY A 1 100 ? -16.698 -21.144 -41.612 1.00 16.04  ? 384 GLY A N   1 
ATOM 668  C CA  . GLY A 1 100 ? -17.689 -21.694 -42.517 1.00 14.63  ? 384 GLY A CA  1 
ATOM 669  C C   . GLY A 1 100 ? -17.270 -22.831 -43.419 1.00 12.84  ? 384 GLY A C   1 
ATOM 670  O O   . GLY A 1 100 ? -16.605 -23.764 -42.990 1.00 11.04  ? 384 GLY A O   1 
ATOM 671  N N   . LYS A 1 101 ? -17.681 -22.748 -44.680 1.00 14.66  ? 385 LYS A N   1 
ATOM 672  C CA  . LYS A 1 101 ? -17.375 -23.777 -45.668 1.00 17.58  ? 385 LYS A CA  1 
ATOM 673  C C   . LYS A 1 101 ? -15.871 -24.043 -45.720 1.00 16.86  ? 385 LYS A C   1 
ATOM 674  O O   . LYS A 1 101 ? -15.413 -24.979 -46.382 1.00 17.09  ? 385 LYS A O   1 
ATOM 675  C CB  . LYS A 1 101 ? -17.876 -23.341 -47.052 1.00 21.78  ? 385 LYS A CB  1 
ATOM 676  C CG  . LYS A 1 101 ? -19.149 -22.500 -47.034 1.00 28.63  ? 385 LYS A CG  1 
ATOM 677  C CD  . LYS A 1 101 ? -20.271 -23.179 -46.265 1.00 35.75  ? 385 LYS A CD  1 
ATOM 678  C CE  . LYS A 1 101 ? -20.706 -24.485 -46.921 1.00 40.61  ? 385 LYS A CE  1 
ATOM 679  N NZ  . LYS A 1 101 ? -21.344 -24.257 -48.245 1.00 44.47  ? 385 LYS A NZ  1 
ATOM 680  N N   . GLY A 1 102 ? -15.110 -23.207 -45.022 1.00 14.23  ? 386 GLY A N   1 
ATOM 681  C CA  . GLY A 1 102 ? -13.675 -23.371 -44.998 1.00 12.30  ? 386 GLY A CA  1 
ATOM 682  C C   . GLY A 1 102 ? -13.123 -23.253 -46.393 1.00 13.85  ? 386 GLY A C   1 
ATOM 683  O O   . GLY A 1 102 ? -13.553 -22.394 -47.159 1.00 14.77  ? 386 GLY A O   1 
ATOM 684  N N   . VAL A 1 103 ? -12.178 -24.123 -46.726 1.00 14.44  ? 387 VAL A N   1 
ATOM 685  C CA  . VAL A 1 103 ? -11.558 -24.102 -48.039 1.00 15.42  ? 387 VAL A CA  1 
ATOM 686  C C   . VAL A 1 103 ? -11.246 -25.515 -48.520 1.00 18.08  ? 387 VAL A C   1 
ATOM 687  O O   . VAL A 1 103 ? -11.436 -26.498 -47.793 1.00 16.57  ? 387 VAL A O   1 
ATOM 688  C CB  . VAL A 1 103 ? -10.233 -23.307 -48.015 1.00 16.45  ? 387 VAL A CB  1 
ATOM 689  C CG1 . VAL A 1 103 ? -10.412 -22.026 -47.229 1.00 17.58  ? 387 VAL A CG1 1 
ATOM 690  C CG2 . VAL A 1 103 ? -9.121  -24.150 -47.401 1.00 17.77  ? 387 VAL A CG2 1 
ATOM 691  N N   . GLN A 1 104 ? -10.761 -25.594 -49.756 1.00 20.18  ? 388 GLN A N   1 
ATOM 692  C CA  . GLN A 1 104 ? -10.388 -26.853 -50.389 1.00 19.23  ? 388 GLN A CA  1 
ATOM 693  C C   . GLN A 1 104 ? -8.990  -26.725 -50.923 1.00 17.58  ? 388 GLN A C   1 
ATOM 694  O O   . GLN A 1 104 ? -8.704  -25.823 -51.705 1.00 18.91  ? 388 GLN A O   1 
ATOM 695  C CB  . GLN A 1 104 ? -11.299 -27.186 -51.568 1.00 22.28  ? 388 GLN A CB  1 
ATOM 696  C CG  . GLN A 1 104 ? -12.588 -27.871 -51.205 1.00 29.12  ? 388 GLN A CG  1 
ATOM 697  C CD  . GLN A 1 104 ? -13.378 -28.308 -52.427 1.00 31.24  ? 388 GLN A CD  1 
ATOM 698  O OE1 . GLN A 1 104 ? -14.500 -28.795 -52.301 1.00 35.79  ? 388 GLN A OE1 1 
ATOM 699  N NE2 . GLN A 1 104 ? -12.797 -28.140 -53.612 1.00 29.57  ? 388 GLN A NE2 1 
ATOM 700  N N   . LEU A 1 105 ? -8.125  -27.634 -50.498 1.00 15.82  ? 389 LEU A N   1 
ATOM 701  C CA  . LEU A 1 105 ? -6.745  -27.660 -50.945 1.00 12.36  ? 389 LEU A CA  1 
ATOM 702  C C   . LEU A 1 105 ? -6.734  -28.776 -51.962 1.00 13.06  ? 389 LEU A C   1 
ATOM 703  O O   . LEU A 1 105 ? -7.150  -29.888 -51.665 1.00 14.95  ? 389 LEU A O   1 
ATOM 704  C CB  . LEU A 1 105 ? -5.833  -27.991 -49.774 1.00 10.84  ? 389 LEU A CB  1 
ATOM 705  C CG  . LEU A 1 105 ? -6.022  -27.000 -48.624 1.00 11.51  ? 389 LEU A CG  1 
ATOM 706  C CD1 . LEU A 1 105 ? -5.472  -27.581 -47.344 1.00 11.09  ? 389 LEU A CD1 1 
ATOM 707  C CD2 . LEU A 1 105 ? -5.354  -25.681 -48.971 1.00 9.39   ? 389 LEU A CD2 1 
ATOM 708  N N   . GLU A 1 106 ? -6.278  -28.482 -53.167 1.00 12.85  ? 390 GLU A N   1 
ATOM 709  C CA  . GLU A 1 106 ? -6.268  -29.492 -54.203 1.00 14.69  ? 390 GLU A CA  1 
ATOM 710  C C   . GLU A 1 106 ? -4.875  -29.812 -54.700 1.00 15.63  ? 390 GLU A C   1 
ATOM 711  O O   . GLU A 1 106 ? -4.040  -28.919 -54.876 1.00 16.77  ? 390 GLU A O   1 
ATOM 712  C CB  . GLU A 1 106 ? -7.124  -29.032 -55.375 1.00 20.17  ? 390 GLU A CB  1 
ATOM 713  C CG  . GLU A 1 106 ? -7.393  -30.116 -56.393 1.00 24.30  ? 390 GLU A CG  1 
ATOM 714  C CD  . GLU A 1 106 ? -8.141  -29.597 -57.597 1.00 27.65  ? 390 GLU A CD  1 
ATOM 715  O OE1 . GLU A 1 106 ? -8.961  -28.661 -57.430 1.00 28.09  ? 390 GLU A OE1 1 
ATOM 716  O OE2 . GLU A 1 106 ? -7.912  -30.140 -58.701 1.00 27.68  ? 390 GLU A OE2 1 
ATOM 717  N N   . CYS A 1 107 ? -4.646  -31.098 -54.945 1.00 14.34  ? 391 CYS A N   1 
ATOM 718  C CA  . CYS A 1 107 ? -3.363  -31.586 -55.429 1.00 14.50  ? 391 CYS A CA  1 
ATOM 719  C C   . CYS A 1 107 ? -3.468  -32.029 -56.882 1.00 15.36  ? 391 CYS A C   1 
ATOM 720  O O   . CYS A 1 107 ? -4.185  -32.974 -57.206 1.00 19.03  ? 391 CYS A O   1 
ATOM 721  C CB  . CYS A 1 107 ? -2.898  -32.761 -54.564 1.00 14.15  ? 391 CYS A CB  1 
ATOM 722  S SG  . CYS A 1 107 ? -1.389  -33.562 -55.130 1.00 14.85  ? 391 CYS A SG  1 
ATOM 723  N N   . LYS A 1 108 ? -2.752  -31.343 -57.760 1.00 14.60  ? 392 LYS A N   1 
ATOM 724  C CA  . LYS A 1 108 ? -2.765  -31.684 -59.173 1.00 15.32  ? 392 LYS A CA  1 
ATOM 725  C C   . LYS A 1 108 ? -1.411  -32.250 -59.587 1.00 16.81  ? 392 LYS A C   1 
ATOM 726  O O   . LYS A 1 108 ? -0.384  -31.931 -58.990 1.00 19.13  ? 392 LYS A O   1 
ATOM 727  C CB  . LYS A 1 108 ? -3.075  -30.443 -60.008 1.00 17.79  ? 392 LYS A CB  1 
ATOM 728  C CG  . LYS A 1 108 ? -4.439  -29.814 -59.745 1.00 19.64  ? 392 LYS A CG  1 
ATOM 729  C CD  . LYS A 1 108 ? -4.579  -28.515 -60.522 1.00 21.90  ? 392 LYS A CD  1 
ATOM 730  C CE  . LYS A 1 108 ? -5.935  -27.875 -60.321 1.00 21.98  ? 392 LYS A CE  1 
ATOM 731  N NZ  . LYS A 1 108 ? -7.002  -28.738 -60.876 1.00 24.93  ? 392 LYS A NZ  1 
ATOM 732  N N   . GLY A 1 109 ? -1.415  -33.101 -60.606 1.00 17.55  ? 393 GLY A N   1 
ATOM 733  C CA  . GLY A 1 109 ? -0.178  -33.687 -61.091 1.00 17.67  ? 393 GLY A CA  1 
ATOM 734  C C   . GLY A 1 109 ? 0.603   -34.459 -60.048 1.00 19.04  ? 393 GLY A C   1 
ATOM 735  O O   . GLY A 1 109 ? 0.032   -35.188 -59.237 1.00 18.67  ? 393 GLY A O   1 
ATOM 736  N N   . GLU A 1 110 ? 1.919   -34.299 -60.066 1.00 21.10  ? 394 GLU A N   1 
ATOM 737  C CA  . GLU A 1 110 ? 2.764   -35.007 -59.119 1.00 24.80  ? 394 GLU A CA  1 
ATOM 738  C C   . GLU A 1 110 ? 2.643   -34.420 -57.726 1.00 26.84  ? 394 GLU A C   1 
ATOM 739  O O   . GLU A 1 110 ? 2.634   -35.160 -56.737 1.00 29.52  ? 394 GLU A O   1 
ATOM 740  C CB  . GLU A 1 110 ? 4.231   -34.963 -59.558 1.00 24.52  ? 394 GLU A CB  1 
ATOM 741  C CG  . GLU A 1 110 ? 5.106   -35.972 -58.827 1.00 23.85  ? 394 GLU A CG  1 
ATOM 742  C CD  . GLU A 1 110 ? 6.503   -36.029 -59.385 1.00 23.80  ? 394 GLU A CD  1 
ATOM 743  O OE1 . GLU A 1 110 ? 6.655   -35.785 -60.594 1.00 27.31  ? 394 GLU A OE1 1 
ATOM 744  O OE2 . GLU A 1 110 ? 7.445   -36.333 -58.629 1.00 23.27  ? 394 GLU A OE2 1 
ATOM 745  N N   . GLY A 1 111 ? 2.552   -33.095 -57.646 1.00 25.38  ? 395 GLY A N   1 
ATOM 746  C CA  . GLY A 1 111 ? 2.447   -32.468 -56.345 1.00 24.31  ? 395 GLY A CA  1 
ATOM 747  C C   . GLY A 1 111 ? 2.200   -30.978 -56.344 1.00 23.49  ? 395 GLY A C   1 
ATOM 748  O O   . GLY A 1 111 ? 2.758   -30.260 -55.519 1.00 25.54  ? 395 GLY A O   1 
ATOM 749  N N   . ASP A 1 112 ? 1.374   -30.512 -57.271 1.00 22.35  ? 396 ASP A N   1 
ATOM 750  C CA  . ASP A 1 112 ? 1.028   -29.098 -57.362 1.00 20.68  ? 396 ASP A CA  1 
ATOM 751  C C   . ASP A 1 112 ? -0.130  -28.885 -56.400 1.00 19.96  ? 396 ASP A C   1 
ATOM 752  O O   . ASP A 1 112 ? -0.854  -29.826 -56.092 1.00 21.49  ? 396 ASP A O   1 
ATOM 753  C CB  . ASP A 1 112 ? 0.588   -28.757 -58.787 1.00 23.25  ? 396 ASP A CB  1 
ATOM 754  C CG  . ASP A 1 112 ? 1.731   -28.270 -59.658 1.00 22.83  ? 396 ASP A CG  1 
ATOM 755  O OD1 . ASP A 1 112 ? 2.853   -28.813 -59.545 1.00 21.58  ? 396 ASP A OD1 1 
ATOM 756  O OD2 . ASP A 1 112 ? 1.493   -27.345 -60.468 1.00 23.31  ? 396 ASP A OD2 1 
ATOM 757  N N   . VAL A 1 113 ? -0.323  -27.666 -55.919 1.00 17.09  ? 397 VAL A N   1 
ATOM 758  C CA  . VAL A 1 113 ? -1.414  -27.448 -54.987 1.00 14.28  ? 397 VAL A CA  1 
ATOM 759  C C   . VAL A 1 113 ? -2.195  -26.184 -55.270 1.00 14.88  ? 397 VAL A C   1 
ATOM 760  O O   . VAL A 1 113 ? -1.620  -25.118 -55.499 1.00 15.71  ? 397 VAL A O   1 
ATOM 761  C CB  . VAL A 1 113 ? -0.903  -27.427 -53.525 1.00 12.72  ? 397 VAL A CB  1 
ATOM 762  C CG1 . VAL A 1 113 ? -2.047  -27.137 -52.576 1.00 10.18  ? 397 VAL A CG1 1 
ATOM 763  C CG2 . VAL A 1 113 ? -0.267  -28.763 -53.176 1.00 8.02   ? 397 VAL A CG2 1 
ATOM 764  N N   . TRP A 1 114 ? -3.517  -26.330 -55.259 1.00 14.76  ? 398 TRP A N   1 
ATOM 765  C CA  . TRP A 1 114 ? -4.445  -25.234 -55.510 1.00 14.53  ? 398 TRP A CA  1 
ATOM 766  C C   . TRP A 1 114 ? -5.377  -25.055 -54.323 1.00 14.85  ? 398 TRP A C   1 
ATOM 767  O O   . TRP A 1 114 ? -5.765  -26.024 -53.674 1.00 16.69  ? 398 TRP A O   1 
ATOM 768  C CB  . TRP A 1 114 ? -5.293  -25.528 -56.745 1.00 15.74  ? 398 TRP A CB  1 
ATOM 769  C CG  . TRP A 1 114 ? -4.531  -25.561 -58.025 1.00 20.83  ? 398 TRP A CG  1 
ATOM 770  C CD1 . TRP A 1 114 ? -3.470  -26.360 -58.328 1.00 23.41  ? 398 TRP A CD1 1 
ATOM 771  C CD2 . TRP A 1 114 ? -4.782  -24.769 -59.191 1.00 22.85  ? 398 TRP A CD2 1 
ATOM 772  N NE1 . TRP A 1 114 ? -3.043  -26.116 -59.611 1.00 24.20  ? 398 TRP A NE1 1 
ATOM 773  C CE2 . TRP A 1 114 ? -3.833  -25.143 -60.163 1.00 23.13  ? 398 TRP A CE2 1 
ATOM 774  C CE3 . TRP A 1 114 ? -5.722  -23.779 -59.509 1.00 26.14  ? 398 TRP A CE3 1 
ATOM 775  C CZ2 . TRP A 1 114 ? -3.793  -24.564 -61.433 1.00 23.98  ? 398 TRP A CZ2 1 
ATOM 776  C CZ3 . TRP A 1 114 ? -5.683  -23.203 -60.775 1.00 27.06  ? 398 TRP A CZ3 1 
ATOM 777  C CH2 . TRP A 1 114 ? -4.722  -23.600 -61.720 1.00 25.56  ? 398 TRP A CH2 1 
ATOM 778  N N   . VAL A 1 115 ? -5.737  -23.813 -54.038 1.00 13.67  ? 399 VAL A N   1 
ATOM 779  C CA  . VAL A 1 115 ? -6.645  -23.531 -52.943 1.00 12.67  ? 399 VAL A CA  1 
ATOM 780  C C   . VAL A 1 115 ? -7.942  -22.996 -53.515 1.00 14.94  ? 399 VAL A C   1 
ATOM 781  O O   . VAL A 1 115 ? -7.942  -22.221 -54.465 1.00 16.22  ? 399 VAL A O   1 
ATOM 782  C CB  . VAL A 1 115 ? -6.066  -22.482 -51.972 1.00 12.00  ? 399 VAL A CB  1 
ATOM 783  C CG1 . VAL A 1 115 ? -7.152  -21.955 -51.061 1.00 10.33  ? 399 VAL A CG1 1 
ATOM 784  C CG2 . VAL A 1 115 ? -4.969  -23.107 -51.136 1.00 14.24  ? 399 VAL A CG2 1 
ATOM 785  N N   . ARG A 1 116 ? -9.052  -23.436 -52.944 1.00 15.76  ? 400 ARG A N   1 
ATOM 786  C CA  . ARG A 1 116 ? -10.356 -22.975 -53.374 1.00 14.58  ? 400 ARG A CA  1 
ATOM 787  C C   . ARG A 1 116 ? -11.085 -22.505 -52.120 1.00 14.35  ? 400 ARG A C   1 
ATOM 788  O O   . ARG A 1 116 ? -11.434 -23.304 -51.257 1.00 15.50  ? 400 ARG A O   1 
ATOM 789  C CB  . ARG A 1 116 ? -11.113 -24.108 -54.076 1.00 13.88  ? 400 ARG A CB  1 
ATOM 790  C CG  . ARG A 1 116 ? -12.580 -23.821 -54.302 1.00 12.91  ? 400 ARG A CG  1 
ATOM 791  C CD  . ARG A 1 116 ? -13.182 -24.747 -55.326 1.00 10.97  ? 400 ARG A CD  1 
ATOM 792  N NE  . ARG A 1 116 ? -12.902 -24.258 -56.665 1.00 16.34  ? 400 ARG A NE  1 
ATOM 793  C CZ  . ARG A 1 116 ? -13.083 -24.961 -57.777 1.00 20.62  ? 400 ARG A CZ  1 
ATOM 794  N NH1 . ARG A 1 116 ? -13.552 -26.201 -57.714 1.00 22.40  ? 400 ARG A NH1 1 
ATOM 795  N NH2 . ARG A 1 116 ? -12.782 -24.427 -58.954 1.00 21.86  ? 400 ARG A NH2 1 
ATOM 796  N N   . CYS A 1 117 ? -11.269 -21.195 -52.011 1.00 14.23  ? 401 CYS A N   1 
ATOM 797  C CA  . CYS A 1 117 ? -11.948 -20.597 -50.868 1.00 14.33  ? 401 CYS A CA  1 
ATOM 798  C C   . CYS A 1 117 ? -13.445 -20.807 -51.027 1.00 15.88  ? 401 CYS A C   1 
ATOM 799  O O   . CYS A 1 117 ? -14.012 -20.460 -52.061 1.00 17.29  ? 401 CYS A O   1 
ATOM 800  C CB  . CYS A 1 117 ? -11.642 -19.099 -50.798 1.00 13.50  ? 401 CYS A CB  1 
ATOM 801  S SG  . CYS A 1 117 ? -12.358 -18.210 -49.395 1.00 13.72  ? 401 CYS A SG  1 
ATOM 802  N N   . LEU A 1 118 ? -14.069 -21.393 -50.008 1.00 15.45  ? 402 LEU A N   1 
ATOM 803  C CA  . LEU A 1 118 ? -15.502 -21.659 -50.004 1.00 13.93  ? 402 LEU A CA  1 
ATOM 804  C C   . LEU A 1 118 ? -16.116 -20.854 -48.880 1.00 16.95  ? 402 LEU A C   1 
ATOM 805  O O   . LEU A 1 118 ? -17.334 -20.703 -48.799 1.00 19.67  ? 402 LEU A O   1 
ATOM 806  C CB  . LEU A 1 118 ? -15.771 -23.145 -49.767 1.00 11.11  ? 402 LEU A CB  1 
ATOM 807  C CG  . LEU A 1 118 ? -15.732 -24.126 -50.944 1.00 10.96  ? 402 LEU A CG  1 
ATOM 808  C CD1 . LEU A 1 118 ? -15.001 -23.510 -52.094 1.00 10.07  ? 402 LEU A CD1 1 
ATOM 809  C CD2 . LEU A 1 118 ? -15.075 -25.443 -50.517 1.00 9.64   ? 402 LEU A CD2 1 
ATOM 810  N N   . SER A 1 119 ? -15.259 -20.340 -48.007 1.00 17.67  ? 403 SER A N   1 
ATOM 811  C CA  . SER A 1 119 ? -15.714 -19.548 -46.875 1.00 18.87  ? 403 SER A CA  1 
ATOM 812  C C   . SER A 1 119 ? -16.296 -18.205 -47.329 1.00 19.37  ? 403 SER A C   1 
ATOM 813  O O   . SER A 1 119 ? -15.898 -17.661 -48.350 1.00 21.00  ? 403 SER A O   1 
ATOM 814  C CB  . SER A 1 119 ? -14.555 -19.327 -45.907 1.00 17.07  ? 403 SER A CB  1 
ATOM 815  O OG  . SER A 1 119 ? -15.006 -18.705 -44.718 1.00 22.14  ? 403 SER A OG  1 
ATOM 816  N N   . ASP A 1 120 ? -17.256 -17.684 -46.575 1.00 22.11  ? 404 ASP A N   1 
ATOM 817  C CA  . ASP A 1 120 ? -17.881 -16.409 -46.906 1.00 23.03  ? 404 ASP A CA  1 
ATOM 818  C C   . ASP A 1 120 ? -16.883 -15.279 -46.713 1.00 23.72  ? 404 ASP A C   1 
ATOM 819  O O   . ASP A 1 120 ? -17.087 -14.176 -47.221 1.00 25.19  ? 404 ASP A O   1 
ATOM 820  C CB  . ASP A 1 120 ? -19.106 -16.159 -46.013 1.00 25.59  ? 404 ASP A CB  1 
ATOM 821  C CG  . ASP A 1 120 ? -20.308 -17.014 -46.400 1.00 28.85  ? 404 ASP A CG  1 
ATOM 822  O OD1 . ASP A 1 120 ? -21.280 -17.071 -45.603 1.00 29.53  ? 404 ASP A OD1 1 
ATOM 823  O OD2 . ASP A 1 120 ? -20.286 -17.618 -47.498 1.00 29.93  ? 404 ASP A OD2 1 
ATOM 824  N N   . HIS A 1 121 ? -15.809 -15.559 -45.973 1.00 24.27  ? 405 HIS A N   1 
ATOM 825  C CA  . HIS A 1 121 ? -14.762 -14.568 -45.699 1.00 23.49  ? 405 HIS A CA  1 
ATOM 826  C C   . HIS A 1 121 ? -13.412 -14.959 -46.287 1.00 22.96  ? 405 HIS A C   1 
ATOM 827  O O   . HIS A 1 121 ? -13.146 -16.134 -46.559 1.00 21.11  ? 405 HIS A O   1 
ATOM 828  C CB  . HIS A 1 121 ? -14.580 -14.370 -44.199 1.00 24.97  ? 405 HIS A CB  1 
ATOM 829  C CG  . HIS A 1 121 ? -15.791 -13.844 -43.504 1.00 27.38  ? 405 HIS A CG  1 
ATOM 830  N ND1 . HIS A 1 121 ? -17.046 -14.386 -43.685 1.00 29.67  ? 405 HIS A ND1 1 
ATOM 831  C CD2 . HIS A 1 121 ? -15.932 -12.862 -42.585 1.00 28.31  ? 405 HIS A CD2 1 
ATOM 832  C CE1 . HIS A 1 121 ? -17.908 -13.762 -42.904 1.00 31.81  ? 405 HIS A CE1 1 
ATOM 833  N NE2 . HIS A 1 121 ? -17.257 -12.834 -42.225 1.00 32.79  ? 405 HIS A NE2 1 
ATOM 834  N N   . ALA A 1 122 ? -12.558 -13.952 -46.449 1.00 23.16  ? 406 ALA A N   1 
ATOM 835  C CA  . ALA A 1 122 ? -11.224 -14.127 -47.009 1.00 22.95  ? 406 ALA A CA  1 
ATOM 836  C C   . ALA A 1 122 ? -10.345 -15.138 -46.281 1.00 22.43  ? 406 ALA A C   1 
ATOM 837  O O   . ALA A 1 122 ? -10.568 -15.474 -45.114 1.00 24.17  ? 406 ALA A O   1 
ATOM 838  C CB  . ALA A 1 122 ? -10.515 -12.784 -47.065 1.00 22.48  ? 406 ALA A CB  1 
ATOM 839  N N   . VAL A 1 123 ? -9.334  -15.610 -47.000 1.00 20.87  ? 407 VAL A N   1 
ATOM 840  C CA  . VAL A 1 123 ? -8.367  -16.570 -46.488 1.00 19.96  ? 407 VAL A CA  1 
ATOM 841  C C   . VAL A 1 123 ? -6.959  -16.041 -46.816 1.00 18.57  ? 407 VAL A C   1 
ATOM 842  O O   . VAL A 1 123 ? -6.651  -15.739 -47.971 1.00 18.25  ? 407 VAL A O   1 
ATOM 843  C CB  . VAL A 1 123 ? -8.618  -17.967 -47.125 1.00 18.37  ? 407 VAL A CB  1 
ATOM 844  C CG1 . VAL A 1 123 ? -7.319  -18.629 -47.512 1.00 20.09  ? 407 VAL A CG1 1 
ATOM 845  C CG2 . VAL A 1 123 ? -9.361  -18.840 -46.141 1.00 16.67  ? 407 VAL A CG2 1 
ATOM 846  N N   . PHE A 1 124 ? -6.109  -15.926 -45.800 1.00 15.52  ? 408 PHE A N   1 
ATOM 847  C CA  . PHE A 1 124 ? -4.759  -15.406 -46.006 1.00 16.01  ? 408 PHE A CA  1 
ATOM 848  C C   . PHE A 1 124 ? -3.682  -16.487 -46.074 1.00 15.42  ? 408 PHE A C   1 
ATOM 849  O O   . PHE A 1 124 ? -3.266  -17.026 -45.054 1.00 15.82  ? 408 PHE A O   1 
ATOM 850  C CB  . PHE A 1 124 ? -4.441  -14.387 -44.908 1.00 16.05  ? 408 PHE A CB  1 
ATOM 851  C CG  . PHE A 1 124 ? -5.452  -13.273 -44.819 1.00 17.71  ? 408 PHE A CG  1 
ATOM 852  C CD1 . PHE A 1 124 ? -6.772  -13.538 -44.443 1.00 16.28  ? 408 PHE A CD1 1 
ATOM 853  C CD2 . PHE A 1 124 ? -5.111  -11.975 -45.174 1.00 15.09  ? 408 PHE A CD2 1 
ATOM 854  C CE1 . PHE A 1 124 ? -7.726  -12.534 -44.430 1.00 12.33  ? 408 PHE A CE1 1 
ATOM 855  C CE2 . PHE A 1 124 ? -6.067  -10.965 -45.162 1.00 14.31  ? 408 PHE A CE2 1 
ATOM 856  C CZ  . PHE A 1 124 ? -7.374  -11.247 -44.792 1.00 12.85  ? 408 PHE A CZ  1 
ATOM 857  N N   . VAL A 1 125 ? -3.229  -16.781 -47.290 1.00 14.66  ? 409 VAL A N   1 
ATOM 858  C CA  . VAL A 1 125 ? -2.217  -17.804 -47.526 1.00 14.58  ? 409 VAL A CA  1 
ATOM 859  C C   . VAL A 1 125 ? -0.787  -17.313 -47.524 1.00 17.16  ? 409 VAL A C   1 
ATOM 860  O O   . VAL A 1 125 ? -0.490  -16.226 -48.007 1.00 22.13  ? 409 VAL A O   1 
ATOM 861  C CB  . VAL A 1 125 ? -2.427  -18.503 -48.882 1.00 12.67  ? 409 VAL A CB  1 
ATOM 862  C CG1 . VAL A 1 125 ? -1.210  -19.341 -49.231 1.00 7.45   ? 409 VAL A CG1 1 
ATOM 863  C CG2 . VAL A 1 125 ? -3.663  -19.376 -48.831 1.00 16.00  ? 409 VAL A CG2 1 
ATOM 864  N N   . GLN A 1 126 ? 0.097   -18.144 -46.990 1.00 16.44  ? 410 GLN A N   1 
ATOM 865  C CA  . GLN A 1 126 ? 1.516   -17.849 -46.961 1.00 17.27  ? 410 GLN A CA  1 
ATOM 866  C C   . GLN A 1 126 ? 2.186   -18.828 -47.935 1.00 17.27  ? 410 GLN A C   1 
ATOM 867  O O   . GLN A 1 126 ? 2.445   -19.976 -47.584 1.00 16.05  ? 410 GLN A O   1 
ATOM 868  C CB  . GLN A 1 126 ? 2.061   -18.061 -45.562 1.00 18.36  ? 410 GLN A CB  1 
ATOM 869  C CG  . GLN A 1 126 ? 3.550   -17.876 -45.450 1.00 25.69  ? 410 GLN A CG  1 
ATOM 870  C CD  . GLN A 1 126 ? 4.177   -18.945 -44.584 1.00 35.45  ? 410 GLN A CD  1 
ATOM 871  O OE1 . GLN A 1 126 ? 4.369   -20.087 -45.022 1.00 37.28  ? 410 GLN A OE1 1 
ATOM 872  N NE2 . GLN A 1 126 ? 4.482   -18.592 -43.337 1.00 39.19  ? 410 GLN A NE2 1 
ATOM 873  N N   . SER A 1 127 ? 2.457   -18.373 -49.157 1.00 16.68  ? 411 SER A N   1 
ATOM 874  C CA  . SER A 1 127 ? 3.065   -19.225 -50.172 1.00 16.23  ? 411 SER A CA  1 
ATOM 875  C C   . SER A 1 127 ? 4.255   -18.596 -50.880 1.00 16.27  ? 411 SER A C   1 
ATOM 876  O O   . SER A 1 127 ? 4.198   -17.447 -51.302 1.00 16.55  ? 411 SER A O   1 
ATOM 877  C CB  . SER A 1 127 ? 2.024   -19.617 -51.224 1.00 16.97  ? 411 SER A CB  1 
ATOM 878  O OG  . SER A 1 127 ? 2.622   -20.349 -52.282 1.00 15.93  ? 411 SER A OG  1 
ATOM 879  N N   . TYR A 1 128 ? 5.326   -19.373 -51.017 1.00 16.99  ? 412 TYR A N   1 
ATOM 880  C CA  . TYR A 1 128 ? 6.539   -18.927 -51.685 1.00 16.55  ? 412 TYR A CA  1 
ATOM 881  C C   . TYR A 1 128 ? 6.301   -18.786 -53.171 1.00 17.29  ? 412 TYR A C   1 
ATOM 882  O O   . TYR A 1 128 ? 6.806   -17.857 -53.800 1.00 19.46  ? 412 TYR A O   1 
ATOM 883  C CB  . TYR A 1 128 ? 7.679   -19.917 -51.442 1.00 16.03  ? 412 TYR A CB  1 
ATOM 884  C CG  . TYR A 1 128 ? 8.301   -19.756 -50.082 1.00 16.68  ? 412 TYR A CG  1 
ATOM 885  C CD1 . TYR A 1 128 ? 8.840   -18.530 -49.687 1.00 17.68  ? 412 TYR A CD1 1 
ATOM 886  C CD2 . TYR A 1 128 ? 8.326   -20.804 -49.177 1.00 16.60  ? 412 TYR A CD2 1 
ATOM 887  C CE1 . TYR A 1 128 ? 9.380   -18.355 -48.432 1.00 14.95  ? 412 TYR A CE1 1 
ATOM 888  C CE2 . TYR A 1 128 ? 8.868   -20.636 -47.912 1.00 18.10  ? 412 TYR A CE2 1 
ATOM 889  C CZ  . TYR A 1 128 ? 9.391   -19.410 -47.550 1.00 17.29  ? 412 TYR A CZ  1 
ATOM 890  O OH  . TYR A 1 128 ? 9.927   -19.242 -46.301 1.00 22.25  ? 412 TYR A OH  1 
ATOM 891  N N   . TYR A 1 129 ? 5.533   -19.718 -53.726 1.00 17.47  ? 413 TYR A N   1 
ATOM 892  C CA  . TYR A 1 129 ? 5.213   -19.708 -55.144 1.00 15.81  ? 413 TYR A CA  1 
ATOM 893  C C   . TYR A 1 129 ? 4.584   -18.376 -55.498 1.00 15.07  ? 413 TYR A C   1 
ATOM 894  O O   . TYR A 1 129 ? 5.036   -17.690 -56.412 1.00 20.09  ? 413 TYR A O   1 
ATOM 895  C CB  . TYR A 1 129 ? 4.241   -20.840 -55.476 1.00 16.06  ? 413 TYR A CB  1 
ATOM 896  C CG  . TYR A 1 129 ? 3.626   -20.739 -56.848 1.00 19.34  ? 413 TYR A CG  1 
ATOM 897  C CD1 . TYR A 1 129 ? 4.337   -21.115 -57.985 1.00 21.07  ? 413 TYR A CD1 1 
ATOM 898  C CD2 . TYR A 1 129 ? 2.331   -20.240 -57.014 1.00 21.78  ? 413 TYR A CD2 1 
ATOM 899  C CE1 . TYR A 1 129 ? 3.771   -21.000 -59.258 1.00 23.93  ? 413 TYR A CE1 1 
ATOM 900  C CE2 . TYR A 1 129 ? 1.757   -20.114 -58.280 1.00 22.56  ? 413 TYR A CE2 1 
ATOM 901  C CZ  . TYR A 1 129 ? 2.479   -20.495 -59.399 1.00 24.40  ? 413 TYR A CZ  1 
ATOM 902  O OH  . TYR A 1 129 ? 1.913   -20.367 -60.655 1.00 23.62  ? 413 TYR A OH  1 
ATOM 903  N N   . LEU A 1 130 ? 3.539   -18.003 -54.773 1.00 12.49  ? 414 LEU A N   1 
ATOM 904  C CA  . LEU A 1 130 ? 2.869   -16.740 -55.046 1.00 12.83  ? 414 LEU A CA  1 
ATOM 905  C C   . LEU A 1 130 ? 3.828   -15.564 -54.856 1.00 14.30  ? 414 LEU A C   1 
ATOM 906  O O   . LEU A 1 130 ? 3.742   -14.556 -55.561 1.00 12.72  ? 414 LEU A O   1 
ATOM 907  C CB  . LEU A 1 130 ? 1.647   -16.585 -54.140 1.00 9.13   ? 414 LEU A CB  1 
ATOM 908  C CG  . LEU A 1 130 ? 0.578   -17.673 -54.250 1.00 9.14   ? 414 LEU A CG  1 
ATOM 909  C CD1 . LEU A 1 130 ? -0.611  -17.274 -53.419 1.00 8.38   ? 414 LEU A CD1 1 
ATOM 910  C CD2 . LEU A 1 130 ? 0.154   -17.859 -55.695 1.00 9.62   ? 414 LEU A CD2 1 
ATOM 911  N N   . ASP A 1 131 ? 4.744   -15.705 -53.901 1.00 16.00  ? 415 ASP A N   1 
ATOM 912  C CA  . ASP A 1 131 ? 5.727   -14.670 -53.620 1.00 14.92  ? 415 ASP A CA  1 
ATOM 913  C C   . ASP A 1 131 ? 6.484   -14.337 -54.891 1.00 14.11  ? 415 ASP A C   1 
ATOM 914  O O   . ASP A 1 131 ? 6.659   -13.169 -55.230 1.00 11.99  ? 415 ASP A O   1 
ATOM 915  C CB  . ASP A 1 131 ? 6.715   -15.139 -52.543 1.00 16.34  ? 415 ASP A CB  1 
ATOM 916  C CG  . ASP A 1 131 ? 6.087   -15.208 -51.168 1.00 15.63  ? 415 ASP A CG  1 
ATOM 917  O OD1 . ASP A 1 131 ? 5.153   -14.416 -50.926 1.00 16.34  ? 415 ASP A OD1 1 
ATOM 918  O OD2 . ASP A 1 131 ? 6.530   -16.030 -50.333 1.00 13.71  ? 415 ASP A OD2 1 
ATOM 919  N N   . ARG A 1 132 ? 6.934   -15.371 -55.595 1.00 14.67  ? 416 ARG A N   1 
ATOM 920  C CA  . ARG A 1 132 ? 7.671   -15.168 -56.833 1.00 16.73  ? 416 ARG A CA  1 
ATOM 921  C C   . ARG A 1 132 ? 6.764   -14.495 -57.870 1.00 16.88  ? 416 ARG A C   1 
ATOM 922  O O   . ARG A 1 132 ? 7.126   -13.460 -58.445 1.00 16.88  ? 416 ARG A O   1 
ATOM 923  C CB  . ARG A 1 132 ? 8.212   -16.502 -57.381 1.00 15.32  ? 416 ARG A CB  1 
ATOM 924  C CG  . ARG A 1 132 ? 9.464   -16.305 -58.210 1.00 16.12  ? 416 ARG A CG  1 
ATOM 925  C CD  . ARG A 1 132 ? 9.989   -17.548 -58.882 1.00 19.74  ? 416 ARG A CD  1 
ATOM 926  N NE  . ARG A 1 132 ? 11.397  -17.338 -59.222 1.00 28.58  ? 416 ARG A NE  1 
ATOM 927  C CZ  . ARG A 1 132 ? 12.076  -17.978 -60.175 1.00 35.27  ? 416 ARG A CZ  1 
ATOM 928  N NH1 . ARG A 1 132 ? 11.507  -18.919 -60.954 1.00 37.94  ? 416 ARG A NH1 1 
ATOM 929  N NH2 . ARG A 1 132 ? 13.353  -17.664 -60.348 1.00 34.66  ? 416 ARG A NH2 1 
ATOM 930  N N   . GLU A 1 133 ? 5.586   -15.075 -58.093 1.00 14.11  ? 417 GLU A N   1 
ATOM 931  C CA  . GLU A 1 133 ? 4.635   -14.524 -59.052 1.00 15.41  ? 417 GLU A CA  1 
ATOM 932  C C   . GLU A 1 133 ? 4.389   -13.033 -58.822 1.00 13.97  ? 417 GLU A C   1 
ATOM 933  O O   . GLU A 1 133 ? 4.441   -12.239 -59.756 1.00 14.50  ? 417 GLU A O   1 
ATOM 934  C CB  . GLU A 1 133 ? 3.306   -15.278 -58.977 1.00 17.88  ? 417 GLU A CB  1 
ATOM 935  C CG  . GLU A 1 133 ? 3.405   -16.751 -59.349 1.00 23.60  ? 417 GLU A CG  1 
ATOM 936  C CD  . GLU A 1 133 ? 3.972   -16.970 -60.741 1.00 24.37  ? 417 GLU A CD  1 
ATOM 937  O OE1 . GLU A 1 133 ? 3.391   -16.440 -61.713 1.00 21.79  ? 417 GLU A OE1 1 
ATOM 938  O OE2 . GLU A 1 133 ? 5.001   -17.673 -60.856 1.00 24.61  ? 417 GLU A OE2 1 
ATOM 939  N N   . ALA A 1 134 ? 4.123   -12.658 -57.576 1.00 12.67  ? 418 ALA A N   1 
ATOM 940  C CA  . ALA A 1 134 ? 3.874   -11.263 -57.233 1.00 12.14  ? 418 ALA A CA  1 
ATOM 941  C C   . ALA A 1 134 ? 5.168   -10.450 -57.198 1.00 12.47  ? 418 ALA A C   1 
ATOM 942  O O   . ALA A 1 134 ? 5.150   -9.260  -56.898 1.00 13.97  ? 418 ALA A O   1 
ATOM 943  C CB  . ALA A 1 134 ? 3.164   -11.174 -55.880 1.00 9.55   ? 418 ALA A CB  1 
ATOM 944  N N   . GLY A 1 135 ? 6.291   -11.089 -57.502 1.00 11.92  ? 419 GLY A N   1 
ATOM 945  C CA  . GLY A 1 135 ? 7.554   -10.380 -57.485 1.00 13.60  ? 419 GLY A CA  1 
ATOM 946  C C   . GLY A 1 135 ? 7.945   -9.763  -56.148 1.00 15.91  ? 419 GLY A C   1 
ATOM 947  O O   . GLY A 1 135 ? 8.583   -8.717  -56.120 1.00 17.35  ? 419 GLY A O   1 
ATOM 948  N N   . ARG A 1 136 ? 7.563   -10.387 -55.037 1.00 17.82  ? 420 ARG A N   1 
ATOM 949  C CA  . ARG A 1 136 ? 7.928   -9.876  -53.715 1.00 18.23  ? 420 ARG A CA  1 
ATOM 950  C C   . ARG A 1 136 ? 9.134   -10.690 -53.229 1.00 18.77  ? 420 ARG A C   1 
ATOM 951  O O   . ARG A 1 136 ? 9.421   -11.765 -53.754 1.00 14.50  ? 420 ARG A O   1 
ATOM 952  C CB  . ARG A 1 136 ? 6.780   -10.054 -52.707 1.00 20.31  ? 420 ARG A CB  1 
ATOM 953  C CG  . ARG A 1 136 ? 5.435   -9.449  -53.097 1.00 26.25  ? 420 ARG A CG  1 
ATOM 954  C CD  . ARG A 1 136 ? 5.402   -7.917  -53.054 1.00 31.56  ? 420 ARG A CD  1 
ATOM 955  N NE  . ARG A 1 136 ? 5.216   -7.334  -51.719 1.00 34.44  ? 420 ARG A NE  1 
ATOM 956  C CZ  . ARG A 1 136 ? 6.164   -7.235  -50.788 1.00 35.92  ? 420 ARG A CZ  1 
ATOM 957  N NH1 . ARG A 1 136 ? 7.391   -7.688  -51.025 1.00 39.06  ? 420 ARG A NH1 1 
ATOM 958  N NH2 . ARG A 1 136 ? 5.893   -6.658  -49.624 1.00 32.80  ? 420 ARG A NH2 1 
ATOM 959  N N   . ALA A 1 137 ? 9.842   -10.184 -52.227 1.00 19.21  ? 421 ALA A N   1 
ATOM 960  C CA  . ALA A 1 137 ? 10.977  -10.920 -51.704 1.00 17.77  ? 421 ALA A CA  1 
ATOM 961  C C   . ALA A 1 137 ? 10.390  -12.133 -51.001 1.00 19.86  ? 421 ALA A C   1 
ATOM 962  O O   . ALA A 1 137 ? 9.403   -12.019 -50.276 1.00 20.16  ? 421 ALA A O   1 
ATOM 963  C CB  . ALA A 1 137 ? 11.742  -10.074 -50.732 1.00 17.55  ? 421 ALA A CB  1 
ATOM 964  N N   . PRO A 1 138 ? 10.987  -13.315 -51.206 1.00 21.14  ? 422 PRO A N   1 
ATOM 965  C CA  . PRO A 1 138 ? 10.550  -14.582 -50.611 1.00 21.70  ? 422 PRO A CA  1 
ATOM 966  C C   . PRO A 1 138 ? 10.092  -14.504 -49.160 1.00 22.89  ? 422 PRO A C   1 
ATOM 967  O O   . PRO A 1 138 ? 10.882  -14.192 -48.273 1.00 25.39  ? 422 PRO A O   1 
ATOM 968  C CB  . PRO A 1 138 ? 11.777  -15.465 -50.769 1.00 18.02  ? 422 PRO A CB  1 
ATOM 969  C CG  . PRO A 1 138 ? 12.310  -15.019 -52.060 1.00 19.49  ? 422 PRO A CG  1 
ATOM 970  C CD  . PRO A 1 138 ? 12.236  -13.513 -51.958 1.00 21.25  ? 422 PRO A CD  1 
ATOM 971  N N   . GLY A 1 139 ? 8.817   -14.793 -48.922 1.00 24.42  ? 423 GLY A N   1 
ATOM 972  C CA  . GLY A 1 139 ? 8.301   -14.776 -47.564 1.00 26.24  ? 423 GLY A CA  1 
ATOM 973  C C   . GLY A 1 139 ? 7.855   -13.427 -47.040 1.00 26.15  ? 423 GLY A C   1 
ATOM 974  O O   . GLY A 1 139 ? 7.367   -13.326 -45.911 1.00 27.30  ? 423 GLY A O   1 
ATOM 975  N N   . ASP A 1 140 ? 8.021   -12.393 -47.856 1.00 23.80  ? 424 ASP A N   1 
ATOM 976  C CA  . ASP A 1 140 ? 7.629   -11.045 -47.477 1.00 23.28  ? 424 ASP A CA  1 
ATOM 977  C C   . ASP A 1 140 ? 6.339   -10.668 -48.211 1.00 23.10  ? 424 ASP A C   1 
ATOM 978  O O   . ASP A 1 140 ? 6.300   -9.710  -48.985 1.00 24.36  ? 424 ASP A O   1 
ATOM 979  C CB  . ASP A 1 140 ? 8.757   -10.071 -47.822 1.00 26.75  ? 424 ASP A CB  1 
ATOM 980  C CG  . ASP A 1 140 ? 8.424   -8.640  -47.463 1.00 30.96  ? 424 ASP A CG  1 
ATOM 981  O OD1 . ASP A 1 140 ? 7.918   -8.419  -46.345 1.00 33.38  ? 424 ASP A OD1 1 
ATOM 982  O OD2 . ASP A 1 140 ? 8.673   -7.737  -48.292 1.00 32.86  ? 424 ASP A OD2 1 
ATOM 983  N N   . ALA A 1 141 ? 5.280   -11.432 -47.965 1.00 20.32  ? 425 ALA A N   1 
ATOM 984  C CA  . ALA A 1 141 ? 3.995   -11.181 -48.609 1.00 16.32  ? 425 ALA A CA  1 
ATOM 985  C C   . ALA A 1 141 ? 2.899   -12.104 -48.068 1.00 15.55  ? 425 ALA A C   1 
ATOM 986  O O   . ALA A 1 141 ? 3.164   -13.250 -47.702 1.00 17.68  ? 425 ALA A O   1 
ATOM 987  C CB  . ALA A 1 141 ? 4.136   -11.360 -50.122 1.00 10.43  ? 425 ALA A CB  1 
ATOM 988  N N   . VAL A 1 142 ? 1.672   -11.600 -47.998 1.00 13.75  ? 426 VAL A N   1 
ATOM 989  C CA  . VAL A 1 142 ? 0.554   -12.414 -47.535 1.00 14.99  ? 426 VAL A CA  1 
ATOM 990  C C   . VAL A 1 142 ? -0.520  -12.373 -48.610 1.00 14.47  ? 426 VAL A C   1 
ATOM 991  O O   . VAL A 1 142 ? -1.160  -11.347 -48.802 1.00 12.27  ? 426 VAL A O   1 
ATOM 992  C CB  . VAL A 1 142 ? -0.066  -11.888 -46.222 1.00 14.89  ? 426 VAL A CB  1 
ATOM 993  C CG1 . VAL A 1 142 ? -1.112  -12.875 -45.717 1.00 10.89  ? 426 VAL A CG1 1 
ATOM 994  C CG2 . VAL A 1 142 ? 1.006   -11.683 -45.182 1.00 15.97  ? 426 VAL A CG2 1 
ATOM 995  N N   . HIS A 1 143 ? -0.718  -13.489 -49.304 1.00 14.40  ? 427 HIS A N   1 
ATOM 996  C CA  . HIS A 1 143 ? -1.715  -13.543 -50.364 1.00 15.32  ? 427 HIS A CA  1 
ATOM 997  C C   . HIS A 1 143 ? -3.116  -13.826 -49.859 1.00 14.55  ? 427 HIS A C   1 
ATOM 998  O O   . HIS A 1 143 ? -3.421  -14.915 -49.373 1.00 14.49  ? 427 HIS A O   1 
ATOM 999  C CB  . HIS A 1 143 ? -1.299  -14.570 -51.404 1.00 15.50  ? 427 HIS A CB  1 
ATOM 1000 C CG  . HIS A 1 143 ? 0.109   -14.392 -51.859 1.00 19.25  ? 427 HIS A CG  1 
ATOM 1001 N ND1 . HIS A 1 143 ? 1.187   -14.735 -51.073 1.00 23.01  ? 427 HIS A ND1 1 
ATOM 1002 C CD2 . HIS A 1 143 ? 0.620   -13.831 -52.979 1.00 20.11  ? 427 HIS A CD2 1 
ATOM 1003 C CE1 . HIS A 1 143 ? 2.303   -14.393 -51.690 1.00 23.59  ? 427 HIS A CE1 1 
ATOM 1004 N NE2 . HIS A 1 143 ? 1.987   -13.842 -52.848 1.00 24.11  ? 427 HIS A NE2 1 
ATOM 1005 N N   . LYS A 1 144 ? -3.962  -12.813 -49.990 1.00 12.65  ? 428 LYS A N   1 
ATOM 1006 C CA  . LYS A 1 144 ? -5.342  -12.874 -49.552 1.00 12.09  ? 428 LYS A CA  1 
ATOM 1007 C C   . LYS A 1 144 ? -6.263  -13.489 -50.599 1.00 12.30  ? 428 LYS A C   1 
ATOM 1008 O O   . LYS A 1 144 ? -6.523  -12.877 -51.635 1.00 14.27  ? 428 LYS A O   1 
ATOM 1009 C CB  . LYS A 1 144 ? -5.798  -11.456 -49.205 1.00 9.31   ? 428 LYS A CB  1 
ATOM 1010 C CG  . LYS A 1 144 ? -7.282  -11.277 -49.011 1.00 11.82  ? 428 LYS A CG  1 
ATOM 1011 C CD  . LYS A 1 144 ? -7.553  -9.888  -48.476 1.00 16.32  ? 428 LYS A CD  1 
ATOM 1012 C CE  . LYS A 1 144 ? -9.033  -9.590  -48.356 1.00 19.35  ? 428 LYS A CE  1 
ATOM 1013 N NZ  . LYS A 1 144 ? -9.257  -8.391  -47.499 1.00 23.22  ? 428 LYS A NZ  1 
ATOM 1014 N N   . ILE A 1 145 ? -6.745  -14.703 -50.337 1.00 12.11  ? 429 ILE A N   1 
ATOM 1015 C CA  . ILE A 1 145 ? -7.664  -15.360 -51.269 1.00 14.53  ? 429 ILE A CA  1 
ATOM 1016 C C   . ILE A 1 145 ? -9.105  -14.937 -50.948 1.00 16.16  ? 429 ILE A C   1 
ATOM 1017 O O   . ILE A 1 145 ? -9.594  -15.122 -49.833 1.00 18.47  ? 429 ILE A O   1 
ATOM 1018 C CB  . ILE A 1 145 ? -7.607  -16.913 -51.199 1.00 10.47  ? 429 ILE A CB  1 
ATOM 1019 C CG1 . ILE A 1 145 ? -6.164  -17.415 -51.291 1.00 9.96   ? 429 ILE A CG1 1 
ATOM 1020 C CG2 . ILE A 1 145 ? -8.430  -17.497 -52.346 1.00 5.05   ? 429 ILE A CG2 1 
ATOM 1021 C CD1 . ILE A 1 145 ? -5.475  -17.130 -52.616 1.00 11.25  ? 429 ILE A CD1 1 
ATOM 1022 N N   . TYR A 1 146 ? -9.772  -14.361 -51.937 1.00 15.55  ? 430 TYR A N   1 
ATOM 1023 C CA  . TYR A 1 146 ? -11.140 -13.912 -51.785 1.00 14.12  ? 430 TYR A CA  1 
ATOM 1024 C C   . TYR A 1 146 ? -12.095 -15.086 -51.953 1.00 16.15  ? 430 TYR A C   1 
ATOM 1025 O O   . TYR A 1 146 ? -11.807 -16.044 -52.679 1.00 13.92  ? 430 TYR A O   1 
ATOM 1026 C CB  . TYR A 1 146 ? -11.444 -12.832 -52.826 1.00 13.91  ? 430 TYR A CB  1 
ATOM 1027 C CG  . TYR A 1 146 ? -10.837 -11.495 -52.488 1.00 15.32  ? 430 TYR A CG  1 
ATOM 1028 C CD1 . TYR A 1 146 ? -11.620 -10.475 -51.947 1.00 15.64  ? 430 TYR A CD1 1 
ATOM 1029 C CD2 . TYR A 1 146 ? -9.469  -11.267 -52.641 1.00 13.47  ? 430 TYR A CD2 1 
ATOM 1030 C CE1 . TYR A 1 146 ? -11.059 -9.260  -51.558 1.00 15.59  ? 430 TYR A CE1 1 
ATOM 1031 C CE2 . TYR A 1 146 ? -8.900  -10.054 -52.254 1.00 16.82  ? 430 TYR A CE2 1 
ATOM 1032 C CZ  . TYR A 1 146 ? -9.703  -9.056  -51.710 1.00 16.14  ? 430 TYR A CZ  1 
ATOM 1033 O OH  . TYR A 1 146 ? -9.156  -7.862  -51.298 1.00 16.43  ? 430 TYR A OH  1 
ATOM 1034 N N   . PRO A 1 147 ? -13.246 -15.033 -51.265 1.00 16.15  ? 431 PRO A N   1 
ATOM 1035 C CA  . PRO A 1 147 ? -14.232 -16.104 -51.357 1.00 14.78  ? 431 PRO A CA  1 
ATOM 1036 C C   . PRO A 1 147 ? -14.493 -16.453 -52.814 1.00 17.63  ? 431 PRO A C   1 
ATOM 1037 O O   . PRO A 1 147 ? -14.553 -15.561 -53.661 1.00 18.18  ? 431 PRO A O   1 
ATOM 1038 C CB  . PRO A 1 147 ? -15.445 -15.493 -50.679 1.00 13.12  ? 431 PRO A CB  1 
ATOM 1039 C CG  . PRO A 1 147 ? -14.834 -14.671 -49.617 1.00 11.61  ? 431 PRO A CG  1 
ATOM 1040 C CD  . PRO A 1 147 ? -13.696 -13.990 -50.326 1.00 14.98  ? 431 PRO A CD  1 
ATOM 1041 N N   . SER A 1 148 ? -14.625 -17.754 -53.083 1.00 19.32  ? 432 SER A N   1 
ATOM 1042 C CA  . SER A 1 148 ? -14.890 -18.320 -54.413 1.00 18.38  ? 432 SER A CA  1 
ATOM 1043 C C   . SER A 1 148 ? -13.693 -18.325 -55.359 1.00 16.34  ? 432 SER A C   1 
ATOM 1044 O O   . SER A 1 148 ? -13.774 -18.862 -56.469 1.00 15.81  ? 432 SER A O   1 
ATOM 1045 C CB  . SER A 1 148 ? -16.063 -17.607 -55.091 1.00 19.31  ? 432 SER A CB  1 
ATOM 1046 O OG  . SER A 1 148 ? -15.700 -16.311 -55.530 1.00 24.85  ? 432 SER A OG  1 
ATOM 1047 N N   . ALA A 1 149 ? -12.588 -17.725 -54.926 1.00 13.68  ? 433 ALA A N   1 
ATOM 1048 C CA  . ALA A 1 149 ? -11.381 -17.695 -55.740 1.00 13.36  ? 433 ALA A CA  1 
ATOM 1049 C C   . ALA A 1 149 ? -10.787 -19.098 -55.840 1.00 12.40  ? 433 ALA A C   1 
ATOM 1050 O O   . ALA A 1 149 ? -10.821 -19.870 -54.888 1.00 12.04  ? 433 ALA A O   1 
ATOM 1051 C CB  . ALA A 1 149 ? -10.361 -16.746 -55.131 1.00 14.29  ? 433 ALA A CB  1 
ATOM 1052 N N   . TYR A 1 150 ? -10.242 -19.429 -57.000 1.00 12.87  ? 434 TYR A N   1 
ATOM 1053 C CA  . TYR A 1 150 ? -9.641  -20.738 -57.200 1.00 14.69  ? 434 TYR A CA  1 
ATOM 1054 C C   . TYR A 1 150 ? -8.222  -20.531 -57.732 1.00 16.83  ? 434 TYR A C   1 
ATOM 1055 O O   . TYR A 1 150 ? -7.961  -20.718 -58.918 1.00 22.46  ? 434 TYR A O   1 
ATOM 1056 C CB  . TYR A 1 150 ? -10.487 -21.549 -58.186 1.00 13.96  ? 434 TYR A CB  1 
ATOM 1057 C CG  . TYR A 1 150 ? -9.980  -22.942 -58.431 1.00 17.36  ? 434 TYR A CG  1 
ATOM 1058 C CD1 . TYR A 1 150 ? -9.738  -23.813 -57.372 1.00 20.69  ? 434 TYR A CD1 1 
ATOM 1059 C CD2 . TYR A 1 150 ? -9.712  -23.386 -59.725 1.00 18.68  ? 434 TYR A CD2 1 
ATOM 1060 C CE1 . TYR A 1 150 ? -9.232  -25.096 -57.598 1.00 22.87  ? 434 TYR A CE1 1 
ATOM 1061 C CE2 . TYR A 1 150 ? -9.210  -24.661 -59.965 1.00 18.28  ? 434 TYR A CE2 1 
ATOM 1062 C CZ  . TYR A 1 150 ? -8.969  -25.508 -58.899 1.00 21.68  ? 434 TYR A CZ  1 
ATOM 1063 O OH  . TYR A 1 150 ? -8.432  -26.751 -59.128 1.00 24.47  ? 434 TYR A OH  1 
ATOM 1064 N N   . ILE A 1 151 ? -7.317  -20.151 -56.830 1.00 14.90  ? 435 ILE A N   1 
ATOM 1065 C CA  . ILE A 1 151 ? -5.917  -19.865 -57.137 1.00 13.50  ? 435 ILE A CA  1 
ATOM 1066 C C   . ILE A 1 151 ? -4.985  -21.064 -57.040 1.00 14.73  ? 435 ILE A C   1 
ATOM 1067 O O   . ILE A 1 151 ? -5.262  -22.014 -56.324 1.00 18.85  ? 435 ILE A O   1 
ATOM 1068 C CB  . ILE A 1 151 ? -5.375  -18.818 -56.160 1.00 12.74  ? 435 ILE A CB  1 
ATOM 1069 C CG1 . ILE A 1 151 ? -6.383  -17.677 -56.005 1.00 16.30  ? 435 ILE A CG1 1 
ATOM 1070 C CG2 . ILE A 1 151 ? -4.023  -18.339 -56.614 1.00 12.22  ? 435 ILE A CG2 1 
ATOM 1071 C CD1 . ILE A 1 151 ? -6.855  -17.046 -57.316 1.00 19.53  ? 435 ILE A CD1 1 
ATOM 1072 N N   . LYS A 1 152 ? -3.870  -21.014 -57.757 1.00 15.12  ? 436 LYS A N   1 
ATOM 1073 C CA  . LYS A 1 152 ? -2.878  -22.088 -57.686 1.00 16.24  ? 436 LYS A CA  1 
ATOM 1074 C C   . LYS A 1 152 ? -1.823  -21.563 -56.718 1.00 18.76  ? 436 LYS A C   1 
ATOM 1075 O O   . LYS A 1 152 ? -1.293  -20.468 -56.918 1.00 22.56  ? 436 LYS A O   1 
ATOM 1076 C CB  . LYS A 1 152 ? -2.244  -22.336 -59.047 1.00 12.57  ? 436 LYS A CB  1 
ATOM 1077 C CG  . LYS A 1 152 ? -1.078  -23.291 -59.007 1.00 10.98  ? 436 LYS A CG  1 
ATOM 1078 C CD  . LYS A 1 152 ? -0.284  -23.204 -60.302 1.00 11.75  ? 436 LYS A CD  1 
ATOM 1079 C CE  . LYS A 1 152 ? 0.841   -24.216 -60.359 1.00 11.46  ? 436 LYS A CE  1 
ATOM 1080 N NZ  . LYS A 1 152 ? 1.638   -24.040 -61.593 1.00 14.68  ? 436 LYS A NZ  1 
ATOM 1081 N N   . VAL A 1 153 ? -1.506  -22.333 -55.682 1.00 17.82  ? 437 VAL A N   1 
ATOM 1082 C CA  . VAL A 1 153 ? -0.552  -21.868 -54.688 1.00 15.12  ? 437 VAL A CA  1 
ATOM 1083 C C   . VAL A 1 153 ? 0.801   -22.551 -54.620 1.00 14.63  ? 437 VAL A C   1 
ATOM 1084 O O   . VAL A 1 153 ? 1.685   -22.074 -53.916 1.00 16.44  ? 437 VAL A O   1 
ATOM 1085 C CB  . VAL A 1 153 ? -1.171  -21.925 -53.275 1.00 16.14  ? 437 VAL A CB  1 
ATOM 1086 C CG1 . VAL A 1 153 ? -2.373  -21.003 -53.206 1.00 15.81  ? 437 VAL A CG1 1 
ATOM 1087 C CG2 . VAL A 1 153 ? -1.574  -23.359 -52.929 1.00 13.46  ? 437 VAL A CG2 1 
ATOM 1088 N N   . PHE A 1 154 ? 0.985   -23.653 -55.335 1.00 13.95  ? 438 PHE A N   1 
ATOM 1089 C CA  . PHE A 1 154 ? 2.274   -24.344 -55.271 1.00 15.46  ? 438 PHE A CA  1 
ATOM 1090 C C   . PHE A 1 154 ? 2.594   -25.126 -56.533 1.00 17.78  ? 438 PHE A C   1 
ATOM 1091 O O   . PHE A 1 154 ? 1.796   -25.957 -56.968 1.00 20.04  ? 438 PHE A O   1 
ATOM 1092 C CB  . PHE A 1 154 ? 2.293   -25.301 -54.069 1.00 13.21  ? 438 PHE A CB  1 
ATOM 1093 C CG  . PHE A 1 154 ? 3.570   -26.081 -53.918 1.00 8.05   ? 438 PHE A CG  1 
ATOM 1094 C CD1 . PHE A 1 154 ? 4.676   -25.518 -53.297 1.00 7.30   ? 438 PHE A CD1 1 
ATOM 1095 C CD2 . PHE A 1 154 ? 3.660   -27.392 -54.384 1.00 7.24   ? 438 PHE A CD2 1 
ATOM 1096 C CE1 . PHE A 1 154 ? 5.861   -26.252 -53.138 1.00 10.10  ? 438 PHE A CE1 1 
ATOM 1097 C CE2 . PHE A 1 154 ? 4.838   -28.138 -54.232 1.00 4.75   ? 438 PHE A CE2 1 
ATOM 1098 C CZ  . PHE A 1 154 ? 5.940   -27.566 -53.606 1.00 7.32   ? 438 PHE A CZ  1 
ATOM 1099 N N   . ASP A 1 155 ? 3.764   -24.855 -57.112 1.00 18.30  ? 439 ASP A N   1 
ATOM 1100 C CA  . ASP A 1 155 ? 4.216   -25.551 -58.315 1.00 18.67  ? 439 ASP A CA  1 
ATOM 1101 C C   . ASP A 1 155 ? 5.408   -26.435 -57.922 1.00 17.38  ? 439 ASP A C   1 
ATOM 1102 O O   . ASP A 1 155 ? 6.468   -25.934 -57.540 1.00 13.92  ? 439 ASP A O   1 
ATOM 1103 C CB  . ASP A 1 155 ? 4.627   -24.547 -59.409 1.00 19.32  ? 439 ASP A CB  1 
ATOM 1104 C CG  . ASP A 1 155 ? 5.053   -25.235 -60.706 1.00 20.95  ? 439 ASP A CG  1 
ATOM 1105 O OD1 . ASP A 1 155 ? 4.188   -25.808 -61.394 1.00 19.07  ? 439 ASP A OD1 1 
ATOM 1106 O OD2 . ASP A 1 155 ? 6.259   -25.215 -61.034 1.00 23.43  ? 439 ASP A OD2 1 
ATOM 1107 N N   . LEU A 1 156 ? 5.215   -27.749 -58.007 1.00 17.08  ? 440 LEU A N   1 
ATOM 1108 C CA  . LEU A 1 156 ? 6.247   -28.712 -57.642 1.00 15.43  ? 440 LEU A CA  1 
ATOM 1109 C C   . LEU A 1 156 ? 7.555   -28.455 -58.353 1.00 15.92  ? 440 LEU A C   1 
ATOM 1110 O O   . LEU A 1 156 ? 8.588   -28.277 -57.715 1.00 15.82  ? 440 LEU A O   1 
ATOM 1111 C CB  . LEU A 1 156 ? 5.787   -30.135 -57.955 1.00 14.93  ? 440 LEU A CB  1 
ATOM 1112 C CG  . LEU A 1 156 ? 6.795   -31.221 -57.577 1.00 15.73  ? 440 LEU A CG  1 
ATOM 1113 C CD1 . LEU A 1 156 ? 6.954   -31.231 -56.070 1.00 19.05  ? 440 LEU A CD1 1 
ATOM 1114 C CD2 . LEU A 1 156 ? 6.340   -32.583 -58.070 1.00 15.42  ? 440 LEU A CD2 1 
ATOM 1115 N N   . ARG A 1 157 ? 7.501   -28.446 -59.679 1.00 18.47  ? 441 ARG A N   1 
ATOM 1116 C CA  . ARG A 1 157 ? 8.679   -28.233 -60.510 1.00 21.04  ? 441 ARG A CA  1 
ATOM 1117 C C   . ARG A 1 157 ? 9.512   -27.034 -60.062 1.00 20.43  ? 441 ARG A C   1 
ATOM 1118 O O   . ARG A 1 157 ? 10.712  -27.159 -59.822 1.00 20.55  ? 441 ARG A O   1 
ATOM 1119 C CB  . ARG A 1 157 ? 8.253   -28.042 -61.962 1.00 29.43  ? 441 ARG A CB  1 
ATOM 1120 C CG  . ARG A 1 157 ? 9.389   -28.151 -62.974 1.00 42.79  ? 441 ARG A CG  1 
ATOM 1121 C CD  . ARG A 1 157 ? 9.566   -29.583 -63.486 1.00 52.26  ? 441 ARG A CD  1 
ATOM 1122 N NE  . ARG A 1 157 ? 8.392   -30.055 -64.228 1.00 57.75  ? 441 ARG A NE  1 
ATOM 1123 C CZ  . ARG A 1 157 ? 8.272   -31.272 -64.758 1.00 59.95  ? 441 ARG A CZ  1 
ATOM 1124 N NH1 . ARG A 1 157 ? 9.255   -32.154 -64.634 1.00 60.79  ? 441 ARG A NH1 1 
ATOM 1125 N NH2 . ARG A 1 157 ? 7.164   -31.613 -65.407 1.00 60.25  ? 441 ARG A NH2 1 
ATOM 1126 N N   . GLN A 1 158 ? 8.882   -25.869 -59.950 1.00 19.58  ? 442 GLN A N   1 
ATOM 1127 C CA  . GLN A 1 158 ? 9.599   -24.666 -59.532 1.00 19.57  ? 442 GLN A CA  1 
ATOM 1128 C C   . GLN A 1 158 ? 10.303  -24.927 -58.211 1.00 19.01  ? 442 GLN A C   1 
ATOM 1129 O O   . GLN A 1 158 ? 11.499  -24.678 -58.072 1.00 18.35  ? 442 GLN A O   1 
ATOM 1130 C CB  . GLN A 1 158 ? 8.633   -23.503 -59.358 1.00 21.20  ? 442 GLN A CB  1 
ATOM 1131 C CG  . GLN A 1 158 ? 9.312   -22.171 -59.160 1.00 27.12  ? 442 GLN A CG  1 
ATOM 1132 C CD  . GLN A 1 158 ? 8.396   -21.167 -58.513 1.00 33.79  ? 442 GLN A CD  1 
ATOM 1133 O OE1 . GLN A 1 158 ? 8.107   -21.262 -57.319 1.00 40.04  ? 442 GLN A OE1 1 
ATOM 1134 N NE2 . GLN A 1 158 ? 7.919   -20.202 -59.294 1.00 34.35  ? 442 GLN A NE2 1 
ATOM 1135 N N   . CYS A 1 159 ? 9.536   -25.426 -57.244 1.00 20.16  ? 443 CYS A N   1 
ATOM 1136 C CA  . CYS A 1 159 ? 10.037  -25.759 -55.913 1.00 19.02  ? 443 CYS A CA  1 
ATOM 1137 C C   . CYS A 1 159 ? 11.299  -26.591 -56.065 1.00 16.68  ? 443 CYS A C   1 
ATOM 1138 O O   . CYS A 1 159 ? 12.349  -26.268 -55.507 1.00 15.46  ? 443 CYS A O   1 
ATOM 1139 C CB  . CYS A 1 159 ? 8.978   -26.561 -55.142 1.00 19.74  ? 443 CYS A CB  1 
ATOM 1140 S SG  . CYS A 1 159 ? 9.409   -26.977 -53.428 1.00 22.56  ? 443 CYS A SG  1 
ATOM 1141 N N   . HIS A 1 160 ? 11.185  -27.662 -56.841 1.00 14.54  ? 444 HIS A N   1 
ATOM 1142 C CA  . HIS A 1 160 ? 12.308  -28.547 -57.085 1.00 14.35  ? 444 HIS A CA  1 
ATOM 1143 C C   . HIS A 1 160 ? 13.505  -27.767 -57.608 1.00 14.20  ? 444 HIS A C   1 
ATOM 1144 O O   . HIS A 1 160 ? 14.627  -27.907 -57.117 1.00 12.36  ? 444 HIS A O   1 
ATOM 1145 C CB  . HIS A 1 160 ? 11.919  -29.613 -58.097 1.00 14.92  ? 444 HIS A CB  1 
ATOM 1146 C CG  . HIS A 1 160 ? 12.988  -30.628 -58.317 1.00 18.18  ? 444 HIS A CG  1 
ATOM 1147 N ND1 . HIS A 1 160 ? 13.475  -31.419 -57.299 1.00 21.20  ? 444 HIS A ND1 1 
ATOM 1148 C CD2 . HIS A 1 160 ? 13.692  -30.958 -59.423 1.00 18.43  ? 444 HIS A CD2 1 
ATOM 1149 C CE1 . HIS A 1 160 ? 14.435  -32.194 -57.770 1.00 22.36  ? 444 HIS A CE1 1 
ATOM 1150 N NE2 . HIS A 1 160 ? 14.586  -31.934 -59.056 1.00 22.01  ? 444 HIS A NE2 1 
ATOM 1151 N N   . ARG A 1 161 ? 13.253  -26.943 -58.616 1.00 15.49  ? 445 ARG A N   1 
ATOM 1152 C CA  . ARG A 1 161 ? 14.301  -26.130 -59.204 1.00 16.22  ? 445 ARG A CA  1 
ATOM 1153 C C   . ARG A 1 161 ? 14.963  -25.273 -58.139 1.00 15.85  ? 445 ARG A C   1 
ATOM 1154 O O   . ARG A 1 161 ? 16.187  -25.157 -58.088 1.00 16.07  ? 445 ARG A O   1 
ATOM 1155 C CB  . ARG A 1 161 ? 13.718  -25.239 -60.303 1.00 16.25  ? 445 ARG A CB  1 
ATOM 1156 C CG  . ARG A 1 161 ? 13.859  -25.836 -61.692 1.00 20.63  ? 445 ARG A CG  1 
ATOM 1157 C CD  . ARG A 1 161 ? 13.409  -24.887 -62.789 1.00 20.97  ? 445 ARG A CD  1 
ATOM 1158 N NE  . ARG A 1 161 ? 12.067  -25.215 -63.249 1.00 20.56  ? 445 ARG A NE  1 
ATOM 1159 C CZ  . ARG A 1 161 ? 11.022  -24.411 -63.124 1.00 23.18  ? 445 ARG A CZ  1 
ATOM 1160 N NH1 . ARG A 1 161 ? 11.162  -23.212 -62.549 1.00 27.05  ? 445 ARG A NH1 1 
ATOM 1161 N NH2 . ARG A 1 161 ? 9.837   -24.808 -63.573 1.00 23.14  ? 445 ARG A NH2 1 
ATOM 1162 N N   . GLN A 1 162 ? 14.132  -24.691 -57.282 1.00 15.47  ? 446 GLN A N   1 
ATOM 1163 C CA  . GLN A 1 162 ? 14.590  -23.818 -56.218 1.00 14.46  ? 446 GLN A CA  1 
ATOM 1164 C C   . GLN A 1 162 ? 15.311  -24.509 -55.058 1.00 15.74  ? 446 GLN A C   1 
ATOM 1165 O O   . GLN A 1 162 ? 16.359  -24.046 -54.606 1.00 16.96  ? 446 GLN A O   1 
ATOM 1166 C CB  . GLN A 1 162 ? 13.404  -23.014 -55.695 1.00 9.54   ? 446 GLN A CB  1 
ATOM 1167 C CG  . GLN A 1 162 ? 13.713  -22.121 -54.507 1.00 11.99  ? 446 GLN A CG  1 
ATOM 1168 C CD  . GLN A 1 162 ? 14.771  -21.082 -54.804 1.00 12.55  ? 446 GLN A CD  1 
ATOM 1169 O OE1 . GLN A 1 162 ? 14.708  -20.387 -55.814 1.00 14.43  ? 446 GLN A OE1 1 
ATOM 1170 N NE2 . GLN A 1 162 ? 15.747  -20.963 -53.915 1.00 11.46  ? 446 GLN A NE2 1 
ATOM 1171 N N   . MET A 1 163 ? 14.766  -25.608 -54.560 1.00 16.04  ? 447 MET A N   1 
ATOM 1172 C CA  . MET A 1 163 ? 15.432  -26.264 -53.450 1.00 16.68  ? 447 MET A CA  1 
ATOM 1173 C C   . MET A 1 163 ? 16.838  -26.664 -53.852 1.00 17.13  ? 447 MET A C   1 
ATOM 1174 O O   . MET A 1 163 ? 17.762  -26.567 -53.049 1.00 17.24  ? 447 MET A O   1 
ATOM 1175 C CB  . MET A 1 163 ? 14.647  -27.486 -52.985 1.00 17.48  ? 447 MET A CB  1 
ATOM 1176 C CG  . MET A 1 163 ? 14.422  -28.530 -54.042 1.00 17.63  ? 447 MET A CG  1 
ATOM 1177 S SD  . MET A 1 163 ? 13.496  -29.887 -53.340 1.00 24.04  ? 447 MET A SD  1 
ATOM 1178 C CE  . MET A 1 163 ? 11.843  -29.160 -53.294 1.00 17.60  ? 447 MET A CE  1 
ATOM 1179 N N   . GLN A 1 164 ? 17.001  -27.112 -55.096 1.00 15.78  ? 448 GLN A N   1 
ATOM 1180 C CA  . GLN A 1 164 ? 18.317  -27.504 -55.584 1.00 15.43  ? 448 GLN A CA  1 
ATOM 1181 C C   . GLN A 1 164 ? 19.278  -26.322 -55.537 1.00 15.51  ? 448 GLN A C   1 
ATOM 1182 O O   . GLN A 1 164 ? 20.270  -26.353 -54.814 1.00 18.13  ? 448 GLN A O   1 
ATOM 1183 C CB  . GLN A 1 164 ? 18.230  -28.020 -57.016 1.00 14.74  ? 448 GLN A CB  1 
ATOM 1184 C CG  . GLN A 1 164 ? 18.053  -29.507 -57.129 1.00 19.14  ? 448 GLN A CG  1 
ATOM 1185 C CD  . GLN A 1 164 ? 17.701  -29.930 -58.535 1.00 22.06  ? 448 GLN A CD  1 
ATOM 1186 O OE1 . GLN A 1 164 ? 16.695  -29.485 -59.081 1.00 26.71  ? 448 GLN A OE1 1 
ATOM 1187 N NE2 . GLN A 1 164 ? 18.521  -30.792 -59.133 1.00 19.62  ? 448 GLN A NE2 1 
ATOM 1188 N N   . GLN A 1 165 ? 18.976  -25.283 -56.312 1.00 14.08  ? 449 GLN A N   1 
ATOM 1189 C CA  . GLN A 1 165 ? 19.807  -24.089 -56.371 1.00 12.28  ? 449 GLN A CA  1 
ATOM 1190 C C   . GLN A 1 165 ? 20.094  -23.511 -54.986 1.00 13.69  ? 449 GLN A C   1 
ATOM 1191 O O   . GLN A 1 165 ? 21.244  -23.208 -54.653 1.00 9.84   ? 449 GLN A O   1 
ATOM 1192 C CB  . GLN A 1 165 ? 19.132  -23.024 -57.243 1.00 10.25  ? 449 GLN A CB  1 
ATOM 1193 C CG  . GLN A 1 165 ? 19.999  -22.536 -58.395 1.00 10.48  ? 449 GLN A CG  1 
ATOM 1194 C CD  . GLN A 1 165 ? 19.281  -21.598 -59.367 1.00 12.43  ? 449 GLN A CD  1 
ATOM 1195 O OE1 . GLN A 1 165 ? 19.756  -21.371 -60.474 1.00 13.69  ? 449 GLN A OE1 1 
ATOM 1196 N NE2 . GLN A 1 165 ? 18.150  -21.045 -58.954 1.00 13.25  ? 449 GLN A NE2 1 
ATOM 1197 N N   . GLN A 1 166 ? 19.047  -23.373 -54.176 1.00 16.23  ? 450 GLN A N   1 
ATOM 1198 C CA  . GLN A 1 166 ? 19.194  -22.805 -52.841 1.00 18.43  ? 450 GLN A CA  1 
ATOM 1199 C C   . GLN A 1 166 ? 20.067  -23.644 -51.919 1.00 21.44  ? 450 GLN A C   1 
ATOM 1200 O O   . GLN A 1 166 ? 20.692  -23.121 -50.997 1.00 21.22  ? 450 GLN A O   1 
ATOM 1201 C CB  . GLN A 1 166 ? 17.831  -22.595 -52.188 1.00 16.09  ? 450 GLN A CB  1 
ATOM 1202 C CG  . GLN A 1 166 ? 17.937  -21.699 -50.973 1.00 18.52  ? 450 GLN A CG  1 
ATOM 1203 C CD  . GLN A 1 166 ? 16.673  -21.632 -50.148 1.00 19.52  ? 450 GLN A CD  1 
ATOM 1204 O OE1 . GLN A 1 166 ? 15.611  -21.234 -50.635 1.00 19.32  ? 450 GLN A OE1 1 
ATOM 1205 N NE2 . GLN A 1 166 ? 16.783  -22.018 -48.878 1.00 17.81  ? 450 GLN A NE2 1 
ATOM 1206 N N   . ALA A 1 167 ? 20.092  -24.949 -52.164 1.00 24.57  ? 451 ALA A N   1 
ATOM 1207 C CA  . ALA A 1 167 ? 20.899  -25.866 -51.373 1.00 27.05  ? 451 ALA A CA  1 
ATOM 1208 C C   . ALA A 1 167 ? 22.307  -25.838 -51.946 1.00 29.87  ? 451 ALA A C   1 
ATOM 1209 O O   . ALA A 1 167 ? 23.291  -25.953 -51.224 1.00 28.92  ? 451 ALA A O   1 
ATOM 1210 C CB  . ALA A 1 167 ? 20.328  -27.272 -51.464 1.00 27.38  ? 451 ALA A CB  1 
ATOM 1211 N N   . ALA A 1 168 ? 22.388  -25.688 -53.261 1.00 33.35  ? 452 ALA A N   1 
ATOM 1212 C CA  . ALA A 1 168 ? 23.667  -25.636 -53.934 1.00 35.53  ? 452 ALA A CA  1 
ATOM 1213 C C   . ALA A 1 168 ? 24.416  -24.406 -53.462 1.00 37.79  ? 452 ALA A C   1 
ATOM 1214 O O   . ALA A 1 168 ? 25.597  -24.490 -53.146 1.00 40.75  ? 452 ALA A O   1 
ATOM 1215 C CB  . ALA A 1 168 ? 23.470  -25.590 -55.438 1.00 34.78  ? 452 ALA A CB  1 
ATOM 1216 N N   . THR A 1 169 ? 23.735  -23.265 -53.396 1.00 39.81  ? 453 THR A N   1 
ATOM 1217 C CA  . THR A 1 169 ? 24.397  -22.038 -52.958 1.00 44.14  ? 453 THR A CA  1 
ATOM 1218 C C   . THR A 1 169 ? 24.642  -22.065 -51.462 1.00 45.97  ? 453 THR A C   1 
ATOM 1219 O O   . THR A 1 169 ? 25.608  -21.490 -50.979 1.00 47.17  ? 453 THR A O   1 
ATOM 1220 C CB  . THR A 1 169 ? 23.574  -20.769 -53.273 1.00 44.38  ? 453 THR A CB  1 
ATOM 1221 O OG1 . THR A 1 169 ? 22.549  -20.611 -52.290 1.00 48.97  ? 453 THR A OG1 1 
ATOM 1222 C CG2 . THR A 1 169 ? 22.931  -20.864 -54.642 1.00 44.89  ? 453 THR A CG2 1 
ATOM 1223 N N   . ALA A 1 170 ? 23.761  -22.731 -50.728 1.00 51.21  ? 454 ALA A N   1 
ATOM 1224 C CA  . ALA A 1 170 ? 23.901  -22.824 -49.278 1.00 56.65  ? 454 ALA A CA  1 
ATOM 1225 C C   . ALA A 1 170 ? 25.061  -23.746 -48.923 1.00 60.09  ? 454 ALA A C   1 
ATOM 1226 O O   . ALA A 1 170 ? 25.630  -23.661 -47.834 1.00 61.12  ? 454 ALA A O   1 
ATOM 1227 C CB  . ALA A 1 170 ? 22.612  -23.348 -48.661 1.00 56.78  ? 454 ALA A CB  1 
ATOM 1228 N N   . GLN A 1 171 ? 25.398  -24.630 -49.855 1.00 63.09  ? 455 GLN A N   1 
ATOM 1229 C CA  . GLN A 1 171 ? 26.482  -25.583 -49.676 1.00 64.52  ? 455 GLN A CA  1 
ATOM 1230 C C   . GLN A 1 171 ? 27.784  -24.900 -50.059 1.00 66.78  ? 455 GLN A C   1 
ATOM 1231 O O   . GLN A 1 171 ? 28.734  -24.876 -49.281 1.00 67.97  ? 455 GLN A O   1 
ATOM 1232 C CB  . GLN A 1 171 ? 26.246  -26.796 -50.569 1.00 64.87  ? 455 GLN A CB  1 
ATOM 1233 C CG  . GLN A 1 171 ? 27.260  -27.902 -50.428 1.00 64.78  ? 455 GLN A CG  1 
ATOM 1234 C CD  . GLN A 1 171 ? 27.043  -29.002 -51.448 1.00 66.77  ? 455 GLN A CD  1 
ATOM 1235 O OE1 . GLN A 1 171 ? 27.732  -30.020 -51.432 1.00 68.61  ? 455 GLN A OE1 1 
ATOM 1236 N NE2 . GLN A 1 171 ? 26.081  -28.801 -52.347 1.00 66.74  ? 455 GLN A NE2 1 
ATOM 1237 N N   . ALA A 1 172 ? 27.819  -24.341 -51.264 1.00 68.91  ? 456 ALA A N   1 
ATOM 1238 C CA  . ALA A 1 172 ? 29.002  -23.643 -51.753 1.00 70.01  ? 456 ALA A CA  1 
ATOM 1239 C C   . ALA A 1 172 ? 29.382  -22.538 -50.775 1.00 70.70  ? 456 ALA A C   1 
ATOM 1240 O O   . ALA A 1 172 ? 30.540  -22.141 -50.693 1.00 70.19  ? 456 ALA A O   1 
ATOM 1241 C CB  . ALA A 1 172 ? 28.730  -23.056 -53.131 1.00 69.70  ? 456 ALA A CB  1 
ATOM 1242 N N   . ALA A 1 173 ? 28.396  -22.048 -50.032 1.00 72.82  ? 457 ALA A N   1 
ATOM 1243 C CA  . ALA A 1 173 ? 28.631  -21.002 -49.051 1.00 76.43  ? 457 ALA A CA  1 
ATOM 1244 C C   . ALA A 1 173 ? 29.254  -21.615 -47.805 1.00 80.62  ? 457 ALA A C   1 
ATOM 1245 O O   . ALA A 1 173 ? 29.041  -21.137 -46.688 1.00 80.68  ? 457 ALA A O   1 
ATOM 1246 C CB  . ALA A 1 173 ? 27.331  -20.314 -48.698 1.00 76.23  ? 457 ALA A CB  1 
ATOM 1247 N N   . ALA A 1 174 ? 30.011  -22.691 -48.011 1.00 85.21  ? 458 ALA A N   1 
ATOM 1248 C CA  . ALA A 1 174 ? 30.703  -23.385 -46.929 1.00 87.72  ? 458 ALA A CA  1 
ATOM 1249 C C   . ALA A 1 174 ? 32.162  -22.959 -46.971 1.00 89.26  ? 458 ALA A C   1 
ATOM 1250 O O   . ALA A 1 174 ? 32.871  -23.029 -45.971 1.00 89.81  ? 458 ALA A O   1 
ATOM 1251 C CB  . ALA A 1 174 ? 30.599  -24.890 -47.111 1.00 87.59  ? 458 ALA A CB  1 
ATOM 1252 N N   . ALA A 1 175 ? 32.600  -22.516 -48.145 1.00 90.92  ? 459 ALA A N   1 
ATOM 1253 C CA  . ALA A 1 175 ? 33.969  -22.059 -48.333 1.00 92.95  ? 459 ALA A CA  1 
ATOM 1254 C C   . ALA A 1 175 ? 34.239  -20.844 -47.444 1.00 94.68  ? 459 ALA A C   1 
ATOM 1255 O O   . ALA A 1 175 ? 35.371  -20.367 -47.352 1.00 95.86  ? 459 ALA A O   1 
ATOM 1256 C CB  . ALA A 1 175 ? 34.200  -21.703 -49.798 1.00 91.56  ? 459 ALA A CB  1 
ATOM 1257 N N   . ALA A 1 176 ? 33.191  -20.350 -46.789 1.00 95.43  ? 460 ALA A N   1 
ATOM 1258 C CA  . ALA A 1 176 ? 33.308  -19.196 -45.905 1.00 95.76  ? 460 ALA A CA  1 
ATOM 1259 C C   . ALA A 1 176 ? 33.497  -19.639 -44.460 1.00 95.59  ? 460 ALA A C   1 
ATOM 1260 O O   . ALA A 1 176 ? 34.510  -20.250 -44.117 1.00 95.68  ? 460 ALA A O   1 
ATOM 1261 C CB  . ALA A 1 176 ? 32.070  -18.322 -46.024 1.00 95.60  ? 460 ALA A CB  1 
ATOM 1262 N N   . ALA A 1 203 ? 24.430  -17.481 -42.507 1.00 98.12  ? 487 ALA A N   1 
ATOM 1263 C CA  . ALA A 1 203 ? 24.557  -16.481 -43.561 1.00 98.34  ? 487 ALA A CA  1 
ATOM 1264 C C   . ALA A 1 203 ? 24.033  -17.035 -44.883 1.00 98.47  ? 487 ALA A C   1 
ATOM 1265 O O   . ALA A 1 203 ? 22.833  -17.282 -45.029 1.00 98.73  ? 487 ALA A O   1 
ATOM 1266 C CB  . ALA A 1 203 ? 26.020  -16.058 -43.708 1.00 98.17  ? 487 ALA A CB  1 
ATOM 1267 N N   . ALA A 1 204 ? 24.937  -17.228 -45.842 1.00 97.96  ? 488 ALA A N   1 
ATOM 1268 C CA  . ALA A 1 204 ? 24.572  -17.761 -47.153 1.00 96.13  ? 488 ALA A CA  1 
ATOM 1269 C C   . ALA A 1 204 ? 24.300  -19.259 -47.034 1.00 94.84  ? 488 ALA A C   1 
ATOM 1270 O O   . ALA A 1 204 ? 23.628  -19.850 -47.883 1.00 94.26  ? 488 ALA A O   1 
ATOM 1271 C CB  . ALA A 1 204 ? 25.697  -17.502 -48.158 1.00 95.02  ? 488 ALA A CB  1 
ATOM 1272 N N   . GLY A 1 205 ? 24.824  -19.856 -45.965 1.00 93.44  ? 489 GLY A N   1 
ATOM 1273 C CA  . GLY A 1 205 ? 24.642  -21.277 -45.725 1.00 90.20  ? 489 GLY A CA  1 
ATOM 1274 C C   . GLY A 1 205 ? 23.347  -21.618 -45.002 1.00 88.73  ? 489 GLY A C   1 
ATOM 1275 O O   . GLY A 1 205 ? 23.252  -21.506 -43.775 1.00 87.34  ? 489 GLY A O   1 
ATOM 1276 N N   . ILE A 1 206 ? 22.346  -22.034 -45.775 1.00 86.95  ? 490 ILE A N   1 
ATOM 1277 C CA  . ILE A 1 206 ? 21.042  -22.417 -45.237 1.00 83.16  ? 490 ILE A CA  1 
ATOM 1278 C C   . ILE A 1 206 ? 21.067  -23.888 -44.819 1.00 79.99  ? 490 ILE A C   1 
ATOM 1279 O O   . ILE A 1 206 ? 21.785  -24.707 -45.402 1.00 79.56  ? 490 ILE A O   1 
ATOM 1280 C CB  . ILE A 1 206 ? 19.896  -22.182 -46.297 1.00 82.37  ? 490 ILE A CB  1 
ATOM 1281 C CG1 . ILE A 1 206 ? 19.132  -20.895 -45.969 1.00 79.97  ? 490 ILE A CG1 1 
ATOM 1282 C CG2 . ILE A 1 206 ? 18.925  -23.368 -46.334 1.00 80.22  ? 490 ILE A CG2 1 
ATOM 1283 C CD1 . ILE A 1 206 ? 19.986  -19.653 -45.968 1.00 79.47  ? 490 ILE A CD1 1 
ATOM 1284 N N   . GLY A 1 207 ? 20.294  -24.211 -43.791 1.00 76.33  ? 491 GLY A N   1 
ATOM 1285 C CA  . GLY A 1 207 ? 20.225  -25.581 -43.334 1.00 70.46  ? 491 GLY A CA  1 
ATOM 1286 C C   . GLY A 1 207 ? 18.864  -26.129 -43.703 1.00 66.09  ? 491 GLY A C   1 
ATOM 1287 O O   . GLY A 1 207 ? 18.022  -25.419 -44.263 1.00 65.27  ? 491 GLY A O   1 
ATOM 1288 N N   . VAL A 1 208 ? 18.650  -27.399 -43.400 1.00 60.24  ? 492 VAL A N   1 
ATOM 1289 C CA  . VAL A 1 208 ? 17.381  -28.039 -43.682 1.00 55.97  ? 492 VAL A CA  1 
ATOM 1290 C C   . VAL A 1 208 ? 16.198  -27.136 -43.307 1.00 54.39  ? 492 VAL A C   1 
ATOM 1291 O O   . VAL A 1 208 ? 15.254  -26.975 -44.082 1.00 54.37  ? 492 VAL A O   1 
ATOM 1292 C CB  . VAL A 1 208 ? 17.274  -29.366 -42.897 1.00 54.62  ? 492 VAL A CB  1 
ATOM 1293 C CG1 . VAL A 1 208 ? 17.729  -29.145 -41.461 1.00 55.35  ? 492 VAL A CG1 1 
ATOM 1294 C CG2 . VAL A 1 208 ? 15.844  -29.883 -42.913 1.00 53.93  ? 492 VAL A CG2 1 
ATOM 1295 N N   . ASP A 1 209 ? 16.274  -26.529 -42.126 1.00 52.22  ? 493 ASP A N   1 
ATOM 1296 C CA  . ASP A 1 209 ? 15.203  -25.683 -41.600 1.00 47.78  ? 493 ASP A CA  1 
ATOM 1297 C C   . ASP A 1 209 ? 14.848  -24.405 -42.361 1.00 44.42  ? 493 ASP A C   1 
ATOM 1298 O O   . ASP A 1 209 ? 14.136  -23.546 -41.838 1.00 44.42  ? 493 ASP A O   1 
ATOM 1299 C CB  . ASP A 1 209 ? 15.500  -25.343 -40.142 1.00 46.80  ? 493 ASP A CB  1 
ATOM 1300 C CG  . ASP A 1 209 ? 14.271  -25.408 -39.279 1.00 45.72  ? 493 ASP A CG  1 
ATOM 1301 O OD1 . ASP A 1 209 ? 13.374  -24.565 -39.481 1.00 43.29  ? 493 ASP A OD1 1 
ATOM 1302 O OD2 . ASP A 1 209 ? 14.204  -26.307 -38.410 1.00 45.24  ? 493 ASP A OD2 1 
ATOM 1303 N N   . ASP A 1 210 ? 15.335  -24.285 -43.591 1.00 39.92  ? 494 ASP A N   1 
ATOM 1304 C CA  . ASP A 1 210 ? 15.038  -23.129 -44.426 1.00 36.26  ? 494 ASP A CA  1 
ATOM 1305 C C   . ASP A 1 210 ? 14.507  -23.633 -45.752 1.00 32.49  ? 494 ASP A C   1 
ATOM 1306 O O   . ASP A 1 210 ? 13.678  -22.997 -46.392 1.00 29.42  ? 494 ASP A O   1 
ATOM 1307 C CB  . ASP A 1 210 ? 16.296  -22.300 -44.663 1.00 40.98  ? 494 ASP A CB  1 
ATOM 1308 C CG  . ASP A 1 210 ? 16.406  -21.133 -43.712 1.00 45.60  ? 494 ASP A CG  1 
ATOM 1309 O OD1 . ASP A 1 210 ? 15.528  -20.245 -43.774 1.00 47.67  ? 494 ASP A OD1 1 
ATOM 1310 O OD2 . ASP A 1 210 ? 17.363  -21.105 -42.904 1.00 48.36  ? 494 ASP A OD2 1 
ATOM 1311 N N   . LEU A 1 211 ? 15.009  -24.794 -46.150 1.00 30.45  ? 495 LEU A N   1 
ATOM 1312 C CA  . LEU A 1 211 ? 14.614  -25.439 -47.389 1.00 27.39  ? 495 LEU A CA  1 
ATOM 1313 C C   . LEU A 1 211 ? 13.286  -26.159 -47.183 1.00 26.28  ? 495 LEU A C   1 
ATOM 1314 O O   . LEU A 1 211 ? 12.460  -26.223 -48.089 1.00 28.60  ? 495 LEU A O   1 
ATOM 1315 C CB  . LEU A 1 211 ? 15.689  -26.444 -47.811 1.00 26.87  ? 495 LEU A CB  1 
ATOM 1316 C CG  . LEU A 1 211 ? 17.070  -25.888 -48.177 1.00 26.21  ? 495 LEU A CG  1 
ATOM 1317 C CD1 . LEU A 1 211 ? 18.132  -26.977 -48.082 1.00 23.75  ? 495 LEU A CD1 1 
ATOM 1318 C CD2 . LEU A 1 211 ? 17.016  -25.315 -49.575 1.00 25.05  ? 495 LEU A CD2 1 
ATOM 1319 N N   . ARG A 1 212 ? 13.082  -26.700 -45.987 1.00 22.64  ? 496 ARG A N   1 
ATOM 1320 C CA  . ARG A 1 212 ? 11.844  -27.406 -45.686 1.00 17.17  ? 496 ARG A CA  1 
ATOM 1321 C C   . ARG A 1 212 ? 10.664  -26.458 -45.849 1.00 14.97  ? 496 ARG A C   1 
ATOM 1322 O O   . ARG A 1 212 ? 9.576   -26.876 -46.238 1.00 13.01  ? 496 ARG A O   1 
ATOM 1323 C CB  . ARG A 1 212 ? 11.872  -27.951 -44.255 1.00 14.40  ? 496 ARG A CB  1 
ATOM 1324 C CG  . ARG A 1 212 ? 11.757  -26.890 -43.178 1.00 14.03  ? 496 ARG A CG  1 
ATOM 1325 C CD  . ARG A 1 212 ? 11.905  -27.481 -41.772 1.00 16.54  ? 496 ARG A CD  1 
ATOM 1326 N NE  . ARG A 1 212 ? 11.649  -26.486 -40.725 1.00 18.10  ? 496 ARG A NE  1 
ATOM 1327 C CZ  . ARG A 1 212 ? 10.434  -26.145 -40.300 1.00 17.69  ? 496 ARG A CZ  1 
ATOM 1328 N NH1 . ARG A 1 212 ? 9.362   -26.728 -40.825 1.00 20.89  ? 496 ARG A NH1 1 
ATOM 1329 N NH2 . ARG A 1 212 ? 10.284  -25.211 -39.368 1.00 12.86  ? 496 ARG A NH2 1 
ATOM 1330 N N   . ARG A 1 213 ? 10.891  -25.177 -45.564 1.00 14.52  ? 497 ARG A N   1 
ATOM 1331 C CA  . ARG A 1 213 ? 9.834   -24.176 -45.657 1.00 14.05  ? 497 ARG A CA  1 
ATOM 1332 C C   . ARG A 1 213 ? 9.346   -23.978 -47.071 1.00 12.08  ? 497 ARG A C   1 
ATOM 1333 O O   . ARG A 1 213 ? 8.272   -23.426 -47.285 1.00 10.63  ? 497 ARG A O   1 
ATOM 1334 C CB  . ARG A 1 213 ? 10.291  -22.843 -45.058 1.00 17.60  ? 497 ARG A CB  1 
ATOM 1335 C CG  . ARG A 1 213 ? 10.342  -22.848 -43.526 1.00 26.20  ? 497 ARG A CG  1 
ATOM 1336 C CD  . ARG A 1 213 ? 10.759  -21.499 -42.952 1.00 34.89  ? 497 ARG A CD  1 
ATOM 1337 N NE  . ARG A 1 213 ? 10.552  -21.402 -41.505 1.00 45.46  ? 497 ARG A NE  1 
ATOM 1338 C CZ  . ARG A 1 213 ? 9.380   -21.584 -40.892 1.00 51.19  ? 497 ARG A CZ  1 
ATOM 1339 N NH1 . ARG A 1 213 ? 8.296   -21.882 -41.600 1.00 55.09  ? 497 ARG A NH1 1 
ATOM 1340 N NH2 . ARG A 1 213 ? 9.282   -21.454 -39.570 1.00 49.57  ? 497 ARG A NH2 1 
ATOM 1341 N N   . LEU A 1 214 ? 10.130  -24.443 -48.037 1.00 12.04  ? 498 LEU A N   1 
ATOM 1342 C CA  . LEU A 1 214 ? 9.746   -24.335 -49.439 1.00 13.57  ? 498 LEU A CA  1 
ATOM 1343 C C   . LEU A 1 214 ? 8.649   -25.342 -49.732 1.00 17.48  ? 498 LEU A C   1 
ATOM 1344 O O   . LEU A 1 214 ? 7.867   -25.173 -50.667 1.00 21.85  ? 498 LEU A O   1 
ATOM 1345 C CB  . LEU A 1 214 ? 10.926  -24.640 -50.352 1.00 11.26  ? 498 LEU A CB  1 
ATOM 1346 C CG  . LEU A 1 214 ? 12.043  -23.613 -50.420 1.00 11.82  ? 498 LEU A CG  1 
ATOM 1347 C CD1 . LEU A 1 214 ? 13.126  -24.133 -51.355 1.00 10.06  ? 498 LEU A CD1 1 
ATOM 1348 C CD2 . LEU A 1 214 ? 11.478  -22.282 -50.902 1.00 11.30  ? 498 LEU A CD2 1 
ATOM 1349 N N   . CYS A 1 215 ? 8.606   -26.394 -48.922 1.00 17.36  ? 499 CYS A N   1 
ATOM 1350 C CA  . CYS A 1 215 ? 7.632   -27.458 -49.088 1.00 15.52  ? 499 CYS A CA  1 
ATOM 1351 C C   . CYS A 1 215 ? 6.418   -27.291 -48.178 1.00 15.20  ? 499 CYS A C   1 
ATOM 1352 O O   . CYS A 1 215 ? 5.563   -28.172 -48.104 1.00 19.45  ? 499 CYS A O   1 
ATOM 1353 C CB  . CYS A 1 215 ? 8.308   -28.796 -48.804 1.00 14.85  ? 499 CYS A CB  1 
ATOM 1354 S SG  . CYS A 1 215 ? 9.910   -28.981 -49.616 1.00 15.99  ? 499 CYS A SG  1 
ATOM 1355 N N   . ILE A 1 216 ? 6.324   -26.154 -47.502 1.00 13.75  ? 500 ILE A N   1 
ATOM 1356 C CA  . ILE A 1 216 ? 5.213   -25.915 -46.585 1.00 11.62  ? 500 ILE A CA  1 
ATOM 1357 C C   . ILE A 1 216 ? 4.351   -24.693 -46.923 1.00 11.45  ? 500 ILE A C   1 
ATOM 1358 O O   . ILE A 1 216 ? 4.865   -23.653 -47.326 1.00 17.38  ? 500 ILE A O   1 
ATOM 1359 C CB  . ILE A 1 216 ? 5.758   -25.771 -45.139 1.00 8.59   ? 500 ILE A CB  1 
ATOM 1360 C CG1 . ILE A 1 216 ? 6.423   -27.082 -44.715 1.00 4.47   ? 500 ILE A CG1 1 
ATOM 1361 C CG2 . ILE A 1 216 ? 4.642   -25.398 -44.183 1.00 6.25   ? 500 ILE A CG2 1 
ATOM 1362 C CD1 . ILE A 1 216 ? 7.390   -26.930 -43.564 1.00 4.85   ? 500 ILE A CD1 1 
ATOM 1363 N N   . LEU A 1 217 ? 3.039   -24.841 -46.768 1.00 9.16   ? 501 LEU A N   1 
ATOM 1364 C CA  . LEU A 1 217 ? 2.083   -23.757 -47.000 1.00 9.83   ? 501 LEU A CA  1 
ATOM 1365 C C   . LEU A 1 217 ? 1.457   -23.441 -45.646 1.00 13.10  ? 501 LEU A C   1 
ATOM 1366 O O   . LEU A 1 217 ? 1.487   -24.272 -44.737 1.00 17.97  ? 501 LEU A O   1 
ATOM 1367 C CB  . LEU A 1 217 ? 0.979   -24.196 -47.963 1.00 4.50   ? 501 LEU A CB  1 
ATOM 1368 C CG  . LEU A 1 217 ? 1.384   -24.401 -49.420 1.00 4.46   ? 501 LEU A CG  1 
ATOM 1369 C CD1 . LEU A 1 217 ? 0.426   -25.348 -50.108 1.00 4.05   ? 501 LEU A CD1 1 
ATOM 1370 C CD2 . LEU A 1 217 ? 1.414   -23.067 -50.121 1.00 4.29   ? 501 LEU A CD2 1 
ATOM 1371 N N   . ARG A 1 218 ? 0.906   -22.245 -45.499 1.00 12.18  ? 502 ARG A N   1 
ATOM 1372 C CA  . ARG A 1 218 ? 0.256   -21.856 -44.246 1.00 11.59  ? 502 ARG A CA  1 
ATOM 1373 C C   . ARG A 1 218 ? -0.879  -20.914 -44.571 1.00 9.39   ? 502 ARG A C   1 
ATOM 1374 O O   . ARG A 1 218 ? -0.750  -20.071 -45.450 1.00 10.08  ? 502 ARG A O   1 
ATOM 1375 C CB  . ARG A 1 218 ? 1.213   -21.123 -43.315 1.00 12.31  ? 502 ARG A CB  1 
ATOM 1376 C CG  . ARG A 1 218 ? 2.272   -21.956 -42.660 1.00 16.61  ? 502 ARG A CG  1 
ATOM 1377 C CD  . ARG A 1 218 ? 3.077   -21.044 -41.766 1.00 22.98  ? 502 ARG A CD  1 
ATOM 1378 N NE  . ARG A 1 218 ? 4.043   -21.761 -40.949 1.00 29.81  ? 502 ARG A NE  1 
ATOM 1379 C CZ  . ARG A 1 218 ? 4.769   -21.190 -39.996 1.00 33.87  ? 502 ARG A CZ  1 
ATOM 1380 N NH1 . ARG A 1 218 ? 4.625   -19.895 -39.750 1.00 35.61  ? 502 ARG A NH1 1 
ATOM 1381 N NH2 . ARG A 1 218 ? 5.641   -21.906 -39.297 1.00 35.45  ? 502 ARG A NH2 1 
ATOM 1382 N N   . MET A 1 219 ? -1.994  -21.050 -43.875 1.00 6.91   ? 503 MET A N   1 
ATOM 1383 C CA  . MET A 1 219 ? -3.087  -20.153 -44.146 1.00 8.74   ? 503 MET A CA  1 
ATOM 1384 C C   . MET A 1 219 ? -3.914  -19.852 -42.920 1.00 9.84   ? 503 MET A C   1 
ATOM 1385 O O   . MET A 1 219 ? -4.074  -20.687 -42.035 1.00 11.94  ? 503 MET A O   1 
ATOM 1386 C CB  . MET A 1 219 ? -3.971  -20.693 -45.267 1.00 9.17   ? 503 MET A CB  1 
ATOM 1387 C CG  . MET A 1 219 ? -5.143  -21.512 -44.822 1.00 14.02  ? 503 MET A CG  1 
ATOM 1388 S SD  . MET A 1 219 ? -6.322  -21.606 -46.162 1.00 22.37  ? 503 MET A SD  1 
ATOM 1389 C CE  . MET A 1 219 ? -5.274  -22.290 -47.477 1.00 17.79  ? 503 MET A CE  1 
ATOM 1390 N N   . SER A 1 220 ? -4.424  -18.631 -42.876 1.00 9.31   ? 504 SER A N   1 
ATOM 1391 C CA  . SER A 1 220 ? -5.236  -18.187 -41.772 1.00 11.33  ? 504 SER A CA  1 
ATOM 1392 C C   . SER A 1 220 ? -6.665  -18.061 -42.264 1.00 15.80  ? 504 SER A C   1 
ATOM 1393 O O   . SER A 1 220 ? -6.898  -17.695 -43.419 1.00 19.41  ? 504 SER A O   1 
ATOM 1394 C CB  . SER A 1 220 ? -4.738  -16.835 -41.280 1.00 9.39   ? 504 SER A CB  1 
ATOM 1395 O OG  . SER A 1 220 ? -5.530  -16.374 -40.202 1.00 13.76  ? 504 SER A OG  1 
ATOM 1396 N N   . PHE A 1 221 ? -7.617  -18.385 -41.394 1.00 15.28  ? 505 PHE A N   1 
ATOM 1397 C CA  . PHE A 1 221 ? -9.028  -18.283 -41.729 1.00 12.85  ? 505 PHE A CA  1 
ATOM 1398 C C   . PHE A 1 221 ? -9.523  -16.960 -41.166 1.00 13.15  ? 505 PHE A C   1 
ATOM 1399 O O   . PHE A 1 221 ? -9.096  -16.554 -40.087 1.00 13.82  ? 505 PHE A O   1 
ATOM 1400 C CB  . PHE A 1 221 ? -9.809  -19.445 -41.102 1.00 14.06  ? 505 PHE A CB  1 
ATOM 1401 C CG  . PHE A 1 221 ? -9.671  -20.748 -41.846 1.00 14.30  ? 505 PHE A CG  1 
ATOM 1402 C CD1 . PHE A 1 221 ? -10.271 -20.923 -43.089 1.00 14.60  ? 505 PHE A CD1 1 
ATOM 1403 C CD2 . PHE A 1 221 ? -8.930  -21.794 -41.315 1.00 16.61  ? 505 PHE A CD2 1 
ATOM 1404 C CE1 . PHE A 1 221 ? -10.131 -22.119 -43.792 1.00 11.94  ? 505 PHE A CE1 1 
ATOM 1405 C CE2 . PHE A 1 221 ? -8.785  -22.993 -42.010 1.00 14.23  ? 505 PHE A CE2 1 
ATOM 1406 C CZ  . PHE A 1 221 ? -9.387  -23.152 -43.250 1.00 13.11  ? 505 PHE A CZ  1 
ATOM 1407 N N   . VAL A 1 222 ? -10.397 -16.282 -41.904 1.00 14.49  ? 506 VAL A N   1 
ATOM 1408 C CA  . VAL A 1 222 ? -10.968 -15.004 -41.471 1.00 16.45  ? 506 VAL A CA  1 
ATOM 1409 C C   . VAL A 1 222 ? -9.978  -13.847 -41.269 1.00 18.33  ? 506 VAL A C   1 
ATOM 1410 O O   . VAL A 1 222 ? -10.008 -12.864 -42.007 1.00 21.22  ? 506 VAL A O   1 
ATOM 1411 C CB  . VAL A 1 222 ? -11.756 -15.168 -40.159 1.00 14.86  ? 506 VAL A CB  1 
ATOM 1412 C CG1 . VAL A 1 222 ? -12.618 -13.933 -39.915 1.00 15.06  ? 506 VAL A CG1 1 
ATOM 1413 C CG2 . VAL A 1 222 ? -12.598 -16.432 -40.208 1.00 15.42  ? 506 VAL A CG2 1 
ATOM 1414 N N   . LYS A 1 223 ? -9.115  -13.953 -40.263 1.00 17.95  ? 507 LYS A N   1 
ATOM 1415 C CA  . LYS A 1 223 ? -8.150  -12.900 -39.980 1.00 19.81  ? 507 LYS A CA  1 
ATOM 1416 C C   . LYS A 1 223 ? -6.900  -12.975 -40.842 1.00 22.94  ? 507 LYS A C   1 
ATOM 1417 O O   . LYS A 1 223 ? -6.525  -14.044 -41.310 1.00 25.71  ? 507 LYS A O   1 
ATOM 1418 C CB  . LYS A 1 223 ? -7.723  -12.942 -38.512 1.00 18.40  ? 507 LYS A CB  1 
ATOM 1419 C CG  . LYS A 1 223 ? -8.851  -12.754 -37.519 1.00 20.53  ? 507 LYS A CG  1 
ATOM 1420 C CD  . LYS A 1 223 ? -9.662  -11.507 -37.810 1.00 18.27  ? 507 LYS A CD  1 
ATOM 1421 C CE  . LYS A 1 223 ? -10.789 -11.355 -36.814 1.00 18.32  ? 507 LYS A CE  1 
ATOM 1422 N NZ  . LYS A 1 223 ? -11.793 -10.374 -37.284 1.00 22.11  ? 507 LYS A NZ  1 
ATOM 1423 N N   . GLY A 1 224 ? -6.256  -11.824 -41.032 1.00 24.19  ? 508 GLY A N   1 
ATOM 1424 C CA  . GLY A 1 224 ? -5.034  -11.748 -41.811 1.00 19.76  ? 508 GLY A CA  1 
ATOM 1425 C C   . GLY A 1 224 ? -3.930  -11.175 -40.944 1.00 20.37  ? 508 GLY A C   1 
ATOM 1426 O O   . GLY A 1 224 ? -4.196  -10.595 -39.890 1.00 19.28  ? 508 GLY A O   1 
ATOM 1427 N N   . TRP A 1 225 ? -2.687  -11.333 -41.377 1.00 22.23  ? 509 TRP A N   1 
ATOM 1428 C CA  . TRP A 1 225 ? -1.559  -10.824 -40.611 1.00 25.38  ? 509 TRP A CA  1 
ATOM 1429 C C   . TRP A 1 225 ? -0.643  -9.979  -41.501 1.00 30.16  ? 509 TRP A C   1 
ATOM 1430 O O   . TRP A 1 225 ? -0.644  -10.115 -42.727 1.00 28.62  ? 509 TRP A O   1 
ATOM 1431 C CB  . TRP A 1 225 ? -0.776  -11.994 -39.988 1.00 20.08  ? 509 TRP A CB  1 
ATOM 1432 C CG  . TRP A 1 225 ? 0.072   -12.748 -40.969 1.00 15.77  ? 509 TRP A CG  1 
ATOM 1433 C CD1 . TRP A 1 225 ? 1.368   -12.478 -41.311 1.00 12.83  ? 509 TRP A CD1 1 
ATOM 1434 C CD2 . TRP A 1 225 ? -0.335  -13.854 -41.784 1.00 14.39  ? 509 TRP A CD2 1 
ATOM 1435 N NE1 . TRP A 1 225 ? 1.792   -13.346 -42.289 1.00 10.47  ? 509 TRP A NE1 1 
ATOM 1436 C CE2 . TRP A 1 225 ? 0.767   -14.200 -42.599 1.00 13.25  ? 509 TRP A CE2 1 
ATOM 1437 C CE3 . TRP A 1 225 ? -1.525  -14.588 -41.907 1.00 14.07  ? 509 TRP A CE3 1 
ATOM 1438 C CZ2 . TRP A 1 225 ? 0.713   -15.251 -43.527 1.00 13.36  ? 509 TRP A CZ2 1 
ATOM 1439 C CZ3 . TRP A 1 225 ? -1.577  -15.634 -42.829 1.00 13.28  ? 509 TRP A CZ3 1 
ATOM 1440 C CH2 . TRP A 1 225 ? -0.463  -15.953 -43.627 1.00 11.78  ? 509 TRP A CH2 1 
ATOM 1441 N N   . GLY A 1 226 ? 0.134   -9.105  -40.869 1.00 35.08  ? 510 GLY A N   1 
ATOM 1442 C CA  . GLY A 1 226 ? 1.045   -8.248  -41.603 1.00 41.22  ? 510 GLY A CA  1 
ATOM 1443 C C   . GLY A 1 226 ? 1.165   -6.878  -40.958 1.00 46.06  ? 510 GLY A C   1 
ATOM 1444 O O   . GLY A 1 226 ? 0.764   -6.696  -39.803 1.00 45.41  ? 510 GLY A O   1 
ATOM 1445 N N   . PRO A 1 227 ? 1.719   -5.888  -41.679 1.00 49.06  ? 511 PRO A N   1 
ATOM 1446 C CA  . PRO A 1 227 ? 1.878   -4.532  -41.148 1.00 49.81  ? 511 PRO A CA  1 
ATOM 1447 C C   . PRO A 1 227 ? 0.560   -3.752  -41.124 1.00 51.25  ? 511 PRO A C   1 
ATOM 1448 O O   . PRO A 1 227 ? 0.371   -2.873  -40.286 1.00 51.71  ? 511 PRO A O   1 
ATOM 1449 C CB  . PRO A 1 227 ? 2.900   -3.921  -42.098 1.00 50.31  ? 511 PRO A CB  1 
ATOM 1450 C CG  . PRO A 1 227 ? 2.527   -4.546  -43.407 1.00 49.13  ? 511 PRO A CG  1 
ATOM 1451 C CD  . PRO A 1 227 ? 2.313   -5.996  -43.025 1.00 49.15  ? 511 PRO A CD  1 
ATOM 1452 N N   . ASP A 1 228 ? -0.348  -4.084  -42.043 1.00 53.12  ? 512 ASP A N   1 
ATOM 1453 C CA  . ASP A 1 228 ? -1.648  -3.413  -42.138 1.00 54.46  ? 512 ASP A CA  1 
ATOM 1454 C C   . ASP A 1 228 ? -2.691  -4.063  -41.238 1.00 51.71  ? 512 ASP A C   1 
ATOM 1455 O O   . ASP A 1 228 ? -3.882  -3.760  -41.325 1.00 51.80  ? 512 ASP A O   1 
ATOM 1456 C CB  . ASP A 1 228 ? -2.162  -3.448  -43.579 1.00 59.50  ? 512 ASP A CB  1 
ATOM 1457 C CG  . ASP A 1 228 ? -1.112  -3.023  -44.584 1.00 64.92  ? 512 ASP A CG  1 
ATOM 1458 O OD1 . ASP A 1 228 ? -0.129  -3.778  -44.772 1.00 68.40  ? 512 ASP A OD1 1 
ATOM 1459 O OD2 . ASP A 1 228 ? -1.270  -1.934  -45.180 1.00 66.26  ? 512 ASP A OD2 1 
ATOM 1460 N N   . TYR A 1 229 ? -2.237  -4.962  -40.377 1.00 48.42  ? 513 TYR A N   1 
ATOM 1461 C CA  . TYR A 1 229 ? -3.127  -5.668  -39.470 1.00 43.83  ? 513 TYR A CA  1 
ATOM 1462 C C   . TYR A 1 229 ? -2.522  -5.704  -38.083 1.00 41.43  ? 513 TYR A C   1 
ATOM 1463 O O   . TYR A 1 229 ? -1.321  -5.498  -37.908 1.00 40.20  ? 513 TYR A O   1 
ATOM 1464 C CB  . TYR A 1 229 ? -3.324  -7.101  -39.940 1.00 42.55  ? 513 TYR A CB  1 
ATOM 1465 C CG  . TYR A 1 229 ? -3.952  -7.254  -41.300 1.00 38.86  ? 513 TYR A CG  1 
ATOM 1466 C CD1 . TYR A 1 229 ? -5.316  -7.057  -41.482 1.00 38.09  ? 513 TYR A CD1 1 
ATOM 1467 C CD2 . TYR A 1 229 ? -3.197  -7.681  -42.388 1.00 37.90  ? 513 TYR A CD2 1 
ATOM 1468 C CE1 . TYR A 1 229 ? -5.921  -7.297  -42.720 1.00 37.94  ? 513 TYR A CE1 1 
ATOM 1469 C CE2 . TYR A 1 229 ? -3.788  -7.921  -43.632 1.00 36.49  ? 513 TYR A CE2 1 
ATOM 1470 C CZ  . TYR A 1 229 ? -5.151  -7.732  -43.790 1.00 35.89  ? 513 TYR A CZ  1 
ATOM 1471 O OH  . TYR A 1 229 ? -5.746  -7.995  -45.003 1.00 32.12  ? 513 TYR A OH  1 
ATOM 1472 N N   . PRO A 1 230 ? -3.349  -5.980  -37.072 1.00 40.53  ? 514 PRO A N   1 
ATOM 1473 C CA  . PRO A 1 230 ? -2.872  -6.046  -35.689 1.00 41.15  ? 514 PRO A CA  1 
ATOM 1474 C C   . PRO A 1 230 ? -1.933  -7.233  -35.490 1.00 39.91  ? 514 PRO A C   1 
ATOM 1475 O O   . PRO A 1 230 ? -0.945  -7.125  -34.765 1.00 40.67  ? 514 PRO A O   1 
ATOM 1476 C CB  . PRO A 1 230 ? -4.162  -6.169  -34.884 1.00 41.08  ? 514 PRO A CB  1 
ATOM 1477 C CG  . PRO A 1 230 ? -5.057  -6.918  -35.822 1.00 43.30  ? 514 PRO A CG  1 
ATOM 1478 C CD  . PRO A 1 230 ? -4.795  -6.239  -37.147 1.00 40.77  ? 514 PRO A CD  1 
ATOM 1479 N N   . SER A 1 231 ? -2.247  -8.356  -36.138 1.00 38.48  ? 515 SER A N   1 
ATOM 1480 C CA  . SER A 1 231 ? -1.421  -9.564  -36.055 1.00 36.34  ? 515 SER A CA  1 
ATOM 1481 C C   . SER A 1 231 ? -0.202  -9.367  -36.940 1.00 33.89  ? 515 SER A C   1 
ATOM 1482 O O   . SER A 1 231 ? -0.338  -9.194  -38.148 1.00 32.71  ? 515 SER A O   1 
ATOM 1483 C CB  . SER A 1 231 ? -2.190  -10.785 -36.554 1.00 38.47  ? 515 SER A CB  1 
ATOM 1484 O OG  . SER A 1 231 ? -3.370  -11.004 -35.808 1.00 43.47  ? 515 SER A OG  1 
ATOM 1485 N N   . GLN A 1 232 ? 0.984   -9.400  -36.343 1.00 31.99  ? 516 GLN A N   1 
ATOM 1486 C CA  . GLN A 1 232 ? 2.218   -9.208  -37.091 1.00 29.80  ? 516 GLN A CA  1 
ATOM 1487 C C   . GLN A 1 232 ? 2.735   -10.493 -37.718 1.00 29.12  ? 516 GLN A C   1 
ATOM 1488 O O   . GLN A 1 232 ? 3.466   -10.464 -38.712 1.00 26.67  ? 516 GLN A O   1 
ATOM 1489 C CB  . GLN A 1 232 ? 3.273   -8.603  -36.176 1.00 32.11  ? 516 GLN A CB  1 
ATOM 1490 C CG  . GLN A 1 232 ? 2.903   -7.208  -35.724 1.00 38.47  ? 516 GLN A CG  1 
ATOM 1491 C CD  . GLN A 1 232 ? 2.600   -6.288  -36.902 1.00 42.99  ? 516 GLN A CD  1 
ATOM 1492 O OE1 . GLN A 1 232 ? 3.490   -5.950  -37.686 1.00 45.64  ? 516 GLN A OE1 1 
ATOM 1493 N NE2 . GLN A 1 232 ? 1.338   -5.888  -37.035 1.00 42.94  ? 516 GLN A NE2 1 
ATOM 1494 N N   . SER A 1 233 ? 2.334   -11.617 -37.134 1.00 29.29  ? 517 SER A N   1 
ATOM 1495 C CA  . SER A 1 233 ? 2.733   -12.939 -37.600 1.00 26.72  ? 517 SER A CA  1 
ATOM 1496 C C   . SER A 1 233 ? 1.498   -13.835 -37.716 1.00 26.08  ? 517 SER A C   1 
ATOM 1497 O O   . SER A 1 233 ? 0.450   -13.531 -37.143 1.00 25.91  ? 517 SER A O   1 
ATOM 1498 C CB  . SER A 1 233 ? 3.717   -13.546 -36.610 1.00 26.05  ? 517 SER A CB  1 
ATOM 1499 O OG  . SER A 1 233 ? 4.287   -14.724 -37.138 1.00 35.44  ? 517 SER A OG  1 
ATOM 1500 N N   . ILE A 1 234 ? 1.610   -14.936 -38.453 1.00 24.59  ? 518 ILE A N   1 
ATOM 1501 C CA  . ILE A 1 234 ? 0.470   -15.838 -38.602 1.00 22.02  ? 518 ILE A CA  1 
ATOM 1502 C C   . ILE A 1 234 ? 0.143   -16.508 -37.274 1.00 20.50  ? 518 ILE A C   1 
ATOM 1503 O O   . ILE A 1 234 ? -1.019  -16.714 -36.951 1.00 21.77  ? 518 ILE A O   1 
ATOM 1504 C CB  . ILE A 1 234 ? 0.739   -16.930 -39.656 1.00 21.42  ? 518 ILE A CB  1 
ATOM 1505 C CG1 . ILE A 1 234 ? -0.549  -17.702 -39.954 1.00 18.25  ? 518 ILE A CG1 1 
ATOM 1506 C CG2 . ILE A 1 234 ? 1.821   -17.874 -39.161 1.00 23.96  ? 518 ILE A CG2 1 
ATOM 1507 C CD1 . ILE A 1 234 ? -0.459  -18.572 -41.192 1.00 15.85  ? 518 ILE A CD1 1 
ATOM 1508 N N   . LYS A 1 235 ? 1.176   -16.837 -36.505 1.00 18.66  ? 519 LYS A N   1 
ATOM 1509 C CA  . LYS A 1 235 ? 0.998   -17.479 -35.208 1.00 17.59  ? 519 LYS A CA  1 
ATOM 1510 C C   . LYS A 1 235 ? 0.368   -16.513 -34.213 1.00 15.24  ? 519 LYS A C   1 
ATOM 1511 O O   . LYS A 1 235 ? 0.281   -16.814 -33.033 1.00 12.70  ? 519 LYS A O   1 
ATOM 1512 C CB  . LYS A 1 235 ? 2.344   -17.963 -34.659 1.00 19.76  ? 519 LYS A CB  1 
ATOM 1513 C CG  . LYS A 1 235 ? 3.222   -16.840 -34.151 1.00 25.43  ? 519 LYS A CG  1 
ATOM 1514 C CD  . LYS A 1 235 ? 4.644   -17.280 -33.886 1.00 30.60  ? 519 LYS A CD  1 
ATOM 1515 C CE  . LYS A 1 235 ? 5.499   -16.072 -33.522 1.00 35.97  ? 519 LYS A CE  1 
ATOM 1516 N NZ  . LYS A 1 235 ? 6.949   -16.392 -33.351 1.00 42.01  ? 519 LYS A NZ  1 
ATOM 1517 N N   . GLU A 1 236 ? -0.050  -15.344 -34.687 1.00 16.12  ? 520 GLU A N   1 
ATOM 1518 C CA  . GLU A 1 236 ? -0.690  -14.356 -33.823 1.00 17.84  ? 520 GLU A CA  1 
ATOM 1519 C C   . GLU A 1 236 ? -2.114  -14.144 -34.303 1.00 19.14  ? 520 GLU A C   1 
ATOM 1520 O O   . GLU A 1 236 ? -2.710  -13.092 -34.077 1.00 21.62  ? 520 GLU A O   1 
ATOM 1521 C CB  . GLU A 1 236 ? 0.043   -13.019 -33.861 1.00 19.34  ? 520 GLU A CB  1 
ATOM 1522 C CG  . GLU A 1 236 ? 1.473   -13.065 -33.394 1.00 22.38  ? 520 GLU A CG  1 
ATOM 1523 C CD  . GLU A 1 236 ? 2.098   -11.685 -33.326 1.00 26.73  ? 520 GLU A CD  1 
ATOM 1524 O OE1 . GLU A 1 236 ? 3.289   -11.595 -32.963 1.00 29.80  ? 520 GLU A OE1 1 
ATOM 1525 O OE2 . GLU A 1 236 ? 1.403   -10.691 -33.633 1.00 27.29  ? 520 GLU A OE2 1 
ATOM 1526 N N   . THR A 1 237 ? -2.645  -15.150 -34.987 1.00 18.45  ? 521 THR A N   1 
ATOM 1527 C CA  . THR A 1 237 ? -4.006  -15.106 -35.494 1.00 17.99  ? 521 THR A CA  1 
ATOM 1528 C C   . THR A 1 237 ? -4.857  -16.201 -34.827 1.00 19.28  ? 521 THR A C   1 
ATOM 1529 O O   . THR A 1 237 ? -4.370  -17.298 -34.520 1.00 19.84  ? 521 THR A O   1 
ATOM 1530 C CB  . THR A 1 237 ? -4.016  -15.286 -37.015 1.00 18.26  ? 521 THR A CB  1 
ATOM 1531 O OG1 . THR A 1 237 ? -3.463  -16.565 -37.353 1.00 20.88  ? 521 THR A OG1 1 
ATOM 1532 C CG2 . THR A 1 237 ? -3.193  -14.194 -37.671 1.00 17.35  ? 521 THR A CG2 1 
ATOM 1533 N N   . PRO A 1 238 ? -6.148  -15.917 -34.616 1.00 17.53  ? 522 PRO A N   1 
ATOM 1534 C CA  . PRO A 1 238 ? -7.109  -16.826 -33.984 1.00 18.13  ? 522 PRO A CA  1 
ATOM 1535 C C   . PRO A 1 238 ? -7.179  -18.254 -34.526 1.00 18.11  ? 522 PRO A C   1 
ATOM 1536 O O   . PRO A 1 238 ? -7.392  -19.197 -33.763 1.00 19.65  ? 522 PRO A O   1 
ATOM 1537 C CB  . PRO A 1 238 ? -8.431  -16.084 -34.139 1.00 17.05  ? 522 PRO A CB  1 
ATOM 1538 C CG  . PRO A 1 238 ? -8.245  -15.364 -35.426 1.00 18.49  ? 522 PRO A CG  1 
ATOM 1539 C CD  . PRO A 1 238 ? -6.854  -14.803 -35.268 1.00 17.66  ? 522 PRO A CD  1 
ATOM 1540 N N   . CYS A 1 239 ? -7.014  -18.428 -35.830 1.00 16.39  ? 523 CYS A N   1 
ATOM 1541 C CA  . CYS A 1 239 ? -7.077  -19.774 -36.380 1.00 15.89  ? 523 CYS A CA  1 
ATOM 1542 C C   . CYS A 1 239 ? -6.453  -19.934 -37.758 1.00 13.25  ? 523 CYS A C   1 
ATOM 1543 O O   . CYS A 1 239 ? -6.884  -19.327 -38.734 1.00 14.07  ? 523 CYS A O   1 
ATOM 1544 C CB  . CYS A 1 239 ? -8.529  -20.257 -36.387 1.00 18.05  ? 523 CYS A CB  1 
ATOM 1545 S SG  . CYS A 1 239 ? -9.725  -18.996 -36.824 1.00 20.45  ? 523 CYS A SG  1 
ATOM 1546 N N   . TRP A 1 240 ? -5.429  -20.771 -37.817 1.00 9.81   ? 524 TRP A N   1 
ATOM 1547 C CA  . TRP A 1 240 ? -4.718  -21.021 -39.053 1.00 9.26   ? 524 TRP A CA  1 
ATOM 1548 C C   . TRP A 1 240 ? -4.278  -22.465 -39.111 1.00 9.39   ? 524 TRP A C   1 
ATOM 1549 O O   . TRP A 1 240 ? -4.498  -23.229 -38.173 1.00 9.48   ? 524 TRP A O   1 
ATOM 1550 C CB  . TRP A 1 240 ? -3.492  -20.117 -39.154 1.00 9.21   ? 524 TRP A CB  1 
ATOM 1551 C CG  . TRP A 1 240 ? -2.556  -20.205 -37.975 1.00 9.93   ? 524 TRP A CG  1 
ATOM 1552 C CD1 . TRP A 1 240 ? -2.749  -19.673 -36.726 1.00 10.77  ? 524 TRP A CD1 1 
ATOM 1553 C CD2 . TRP A 1 240 ? -1.264  -20.824 -37.949 1.00 8.02   ? 524 TRP A CD2 1 
ATOM 1554 N NE1 . TRP A 1 240 ? -1.654  -19.920 -35.932 1.00 8.26   ? 524 TRP A NE1 1 
ATOM 1555 C CE2 . TRP A 1 240 ? -0.729  -20.623 -36.658 1.00 7.79   ? 524 TRP A CE2 1 
ATOM 1556 C CE3 . TRP A 1 240 ? -0.503  -21.526 -38.894 1.00 6.96   ? 524 TRP A CE3 1 
ATOM 1557 C CZ2 . TRP A 1 240 ? 0.533   -21.098 -36.289 1.00 8.70   ? 524 TRP A CZ2 1 
ATOM 1558 C CZ3 . TRP A 1 240 ? 0.752   -21.996 -38.527 1.00 6.78   ? 524 TRP A CZ3 1 
ATOM 1559 C CH2 . TRP A 1 240 ? 1.257   -21.779 -37.237 1.00 8.09   ? 524 TRP A CH2 1 
ATOM 1560 N N   . ILE A 1 241 ? -3.640  -22.831 -40.215 1.00 6.96   ? 525 ILE A N   1 
ATOM 1561 C CA  . ILE A 1 241 ? -3.176  -24.193 -40.395 1.00 7.62   ? 525 ILE A CA  1 
ATOM 1562 C C   . ILE A 1 241 ? -1.852  -24.240 -41.146 1.00 10.45  ? 525 ILE A C   1 
ATOM 1563 O O   . ILE A 1 241 ? -1.635  -23.460 -42.074 1.00 12.62  ? 525 ILE A O   1 
ATOM 1564 C CB  . ILE A 1 241 ? -4.202  -25.021 -41.195 1.00 3.90   ? 525 ILE A CB  1 
ATOM 1565 C CG1 . ILE A 1 241 ? -4.526  -24.310 -42.503 1.00 2.16   ? 525 ILE A CG1 1 
ATOM 1566 C CG2 . ILE A 1 241 ? -5.468  -25.205 -40.392 1.00 4.29   ? 525 ILE A CG2 1 
ATOM 1567 C CD1 . ILE A 1 241 ? -5.268  -25.161 -43.480 1.00 2.16   ? 525 ILE A CD1 1 
ATOM 1568 N N   . GLU A 1 242 ? -0.966  -25.148 -40.742 1.00 8.84   ? 526 GLU A N   1 
ATOM 1569 C CA  . GLU A 1 242 ? 0.313   -25.301 -41.426 1.00 7.30   ? 526 GLU A CA  1 
ATOM 1570 C C   . GLU A 1 242 ? 0.200   -26.570 -42.272 1.00 8.17   ? 526 GLU A C   1 
ATOM 1571 O O   . GLU A 1 242 ? -0.116  -27.643 -41.752 1.00 9.50   ? 526 GLU A O   1 
ATOM 1572 C CB  . GLU A 1 242 ? 1.458   -25.418 -40.418 1.00 4.67   ? 526 GLU A CB  1 
ATOM 1573 C CG  . GLU A 1 242 ? 2.825   -25.418 -41.071 1.00 5.91   ? 526 GLU A CG  1 
ATOM 1574 C CD  . GLU A 1 242 ? 3.955   -25.589 -40.081 1.00 7.81   ? 526 GLU A CD  1 
ATOM 1575 O OE1 . GLU A 1 242 ? 3.852   -26.484 -39.220 1.00 11.65  ? 526 GLU A OE1 1 
ATOM 1576 O OE2 . GLU A 1 242 ? 4.954   -24.843 -40.170 1.00 8.01   ? 526 GLU A OE2 1 
ATOM 1577 N N   . ILE A 1 243 ? 0.451   -26.443 -43.575 1.00 8.33   ? 527 ILE A N   1 
ATOM 1578 C CA  . ILE A 1 243 ? 0.326   -27.570 -44.505 1.00 6.55   ? 527 ILE A CA  1 
ATOM 1579 C C   . ILE A 1 243 ? 1.665   -28.110 -45.002 1.00 8.65   ? 527 ILE A C   1 
ATOM 1580 O O   . ILE A 1 243 ? 2.418   -27.402 -45.676 1.00 8.76   ? 527 ILE A O   1 
ATOM 1581 C CB  . ILE A 1 243 ? -0.549  -27.171 -45.742 1.00 3.22   ? 527 ILE A CB  1 
ATOM 1582 C CG1 . ILE A 1 243 ? -1.872  -26.571 -45.273 1.00 2.16   ? 527 ILE A CG1 1 
ATOM 1583 C CG2 . ILE A 1 243 ? -0.870  -28.390 -46.597 1.00 2.16   ? 527 ILE A CG2 1 
ATOM 1584 C CD1 . ILE A 1 243 ? -2.656  -25.910 -46.366 1.00 2.16   ? 527 ILE A CD1 1 
ATOM 1585 N N   . HIS A 1 244 ? 1.953   -29.367 -44.665 1.00 8.36   ? 528 HIS A N   1 
ATOM 1586 C CA  . HIS A 1 244 ? 3.192   -30.008 -45.091 1.00 9.15   ? 528 HIS A CA  1 
ATOM 1587 C C   . HIS A 1 244 ? 2.936   -30.811 -46.359 1.00 9.88   ? 528 HIS A C   1 
ATOM 1588 O O   . HIS A 1 244 ? 2.101   -31.717 -46.370 1.00 10.62  ? 528 HIS A O   1 
ATOM 1589 C CB  . HIS A 1 244 ? 3.730   -30.938 -43.995 1.00 9.61   ? 528 HIS A CB  1 
ATOM 1590 C CG  . HIS A 1 244 ? 4.656   -30.268 -43.026 1.00 11.77  ? 528 HIS A CG  1 
ATOM 1591 N ND1 . HIS A 1 244 ? 4.312   -29.129 -42.327 1.00 13.41  ? 528 HIS A ND1 1 
ATOM 1592 C CD2 . HIS A 1 244 ? 5.913   -30.586 -42.629 1.00 11.87  ? 528 HIS A CD2 1 
ATOM 1593 C CE1 . HIS A 1 244 ? 5.317   -28.775 -41.543 1.00 11.47  ? 528 HIS A CE1 1 
ATOM 1594 N NE2 . HIS A 1 244 ? 6.300   -29.642 -41.708 1.00 10.63  ? 528 HIS A NE2 1 
ATOM 1595 N N   . LEU A 1 245 ? 3.651   -30.462 -47.424 1.00 9.70   ? 529 LEU A N   1 
ATOM 1596 C CA  . LEU A 1 245 ? 3.525   -31.139 -48.711 1.00 11.73  ? 529 LEU A CA  1 
ATOM 1597 C C   . LEU A 1 245 ? 4.526   -32.285 -48.765 1.00 14.15  ? 529 LEU A C   1 
ATOM 1598 O O   . LEU A 1 245 ? 5.730   -32.049 -48.836 1.00 16.64  ? 529 LEU A O   1 
ATOM 1599 C CB  . LEU A 1 245 ? 3.792   -30.146 -49.845 1.00 8.45   ? 529 LEU A CB  1 
ATOM 1600 C CG  . LEU A 1 245 ? 2.645   -29.256 -50.351 1.00 7.34   ? 529 LEU A CG  1 
ATOM 1601 C CD1 . LEU A 1 245 ? 1.579   -29.089 -49.296 1.00 8.39   ? 529 LEU A CD1 1 
ATOM 1602 C CD2 . LEU A 1 245 ? 3.200   -27.908 -50.768 1.00 5.66   ? 529 LEU A CD2 1 
ATOM 1603 N N   . HIS A 1 246 ? 4.027   -33.520 -48.747 1.00 13.41  ? 530 HIS A N   1 
ATOM 1604 C CA  . HIS A 1 246 ? 4.896   -34.690 -48.756 1.00 12.67  ? 530 HIS A CA  1 
ATOM 1605 C C   . HIS A 1 246 ? 5.653   -34.996 -50.041 1.00 14.38  ? 530 HIS A C   1 
ATOM 1606 O O   . HIS A 1 246 ? 6.785   -35.455 -49.981 1.00 19.58  ? 530 HIS A O   1 
ATOM 1607 C CB  . HIS A 1 246 ? 4.126   -35.943 -48.333 1.00 10.49  ? 530 HIS A CB  1 
ATOM 1608 C CG  . HIS A 1 246 ? 3.657   -35.920 -46.911 1.00 9.32   ? 530 HIS A CG  1 
ATOM 1609 N ND1 . HIS A 1 246 ? 3.144   -37.033 -46.282 1.00 7.74   ? 530 HIS A ND1 1 
ATOM 1610 C CD2 . HIS A 1 246 ? 3.597   -34.915 -46.005 1.00 8.82   ? 530 HIS A CD2 1 
ATOM 1611 C CE1 . HIS A 1 246 ? 2.786   -36.714 -45.051 1.00 5.16   ? 530 HIS A CE1 1 
ATOM 1612 N NE2 . HIS A 1 246 ? 3.050   -35.435 -44.857 1.00 4.00   ? 530 HIS A NE2 1 
ATOM 1613 N N   . ARG A 1 247 ? 5.064   -34.772 -51.205 1.00 14.72  ? 531 ARG A N   1 
ATOM 1614 C CA  . ARG A 1 247 ? 5.813   -35.076 -52.417 1.00 12.81  ? 531 ARG A CA  1 
ATOM 1615 C C   . ARG A 1 247 ? 7.024   -34.184 -52.536 1.00 12.71  ? 531 ARG A C   1 
ATOM 1616 O O   . ARG A 1 247 ? 8.103   -34.637 -52.906 1.00 10.93  ? 531 ARG A O   1 
ATOM 1617 C CB  . ARG A 1 247 ? 4.972   -34.889 -53.664 1.00 15.47  ? 531 ARG A CB  1 
ATOM 1618 C CG  . ARG A 1 247 ? 5.745   -35.239 -54.911 1.00 17.01  ? 531 ARG A CG  1 
ATOM 1619 C CD  . ARG A 1 247 ? 6.283   -36.658 -54.806 1.00 21.86  ? 531 ARG A CD  1 
ATOM 1620 N NE  . ARG A 1 247 ? 7.004   -37.059 -56.008 1.00 28.24  ? 531 ARG A NE  1 
ATOM 1621 C CZ  . ARG A 1 247 ? 7.503   -38.273 -56.216 1.00 28.42  ? 531 ARG A CZ  1 
ATOM 1622 N NH1 . ARG A 1 247 ? 7.358   -39.215 -55.293 1.00 28.65  ? 531 ARG A NH1 1 
ATOM 1623 N NH2 . ARG A 1 247 ? 8.144   -38.544 -57.348 1.00 27.02  ? 531 ARG A NH2 1 
ATOM 1624 N N   . ALA A 1 248 ? 6.829   -32.905 -52.234 1.00 14.55  ? 532 ALA A N   1 
ATOM 1625 C CA  . ALA A 1 248 ? 7.904   -31.926 -52.301 1.00 13.77  ? 532 ALA A CA  1 
ATOM 1626 C C   . ALA A 1 248 ? 8.966   -32.271 -51.271 1.00 16.01  ? 532 ALA A C   1 
ATOM 1627 O O   . ALA A 1 248 ? 10.163  -32.169 -51.550 1.00 19.32  ? 532 ALA A O   1 
ATOM 1628 C CB  . ALA A 1 248 ? 7.362   -30.538 -52.037 1.00 11.81  ? 532 ALA A CB  1 
ATOM 1629 N N   . LEU A 1 249 ? 8.529   -32.682 -50.080 1.00 12.71  ? 533 LEU A N   1 
ATOM 1630 C CA  . LEU A 1 249 ? 9.467   -33.028 -49.023 1.00 7.41   ? 533 LEU A CA  1 
ATOM 1631 C C   . LEU A 1 249 ? 10.358  -34.182 -49.426 1.00 7.46   ? 533 LEU A C   1 
ATOM 1632 O O   . LEU A 1 249 ? 11.540  -34.197 -49.095 1.00 6.64   ? 533 LEU A O   1 
ATOM 1633 C CB  . LEU A 1 249 ? 8.730   -33.355 -47.729 1.00 2.16   ? 533 LEU A CB  1 
ATOM 1634 C CG  . LEU A 1 249 ? 8.436   -32.130 -46.861 1.00 3.60   ? 533 LEU A CG  1 
ATOM 1635 C CD1 . LEU A 1 249 ? 7.605   -32.538 -45.662 1.00 5.73   ? 533 LEU A CD1 1 
ATOM 1636 C CD2 . LEU A 1 249 ? 9.735   -31.496 -46.406 1.00 2.16   ? 533 LEU A CD2 1 
ATOM 1637 N N   . GLN A 1 250 ? 9.804   -35.146 -50.149 1.00 8.83   ? 534 GLN A N   1 
ATOM 1638 C CA  . GLN A 1 250 ? 10.606  -36.274 -50.584 1.00 10.59  ? 534 GLN A CA  1 
ATOM 1639 C C   . GLN A 1 250 ? 11.736  -35.732 -51.441 1.00 12.56  ? 534 GLN A C   1 
ATOM 1640 O O   . GLN A 1 250 ? 12.905  -35.999 -51.164 1.00 15.76  ? 534 GLN A O   1 
ATOM 1641 C CB  . GLN A 1 250 ? 9.777   -37.271 -51.393 1.00 9.06   ? 534 GLN A CB  1 
ATOM 1642 C CG  . GLN A 1 250 ? 8.640   -37.913 -50.623 1.00 13.85  ? 534 GLN A CG  1 
ATOM 1643 C CD  . GLN A 1 250 ? 8.036   -39.099 -51.358 1.00 16.67  ? 534 GLN A CD  1 
ATOM 1644 O OE1 . GLN A 1 250 ? 7.550   -38.969 -52.476 1.00 18.66  ? 534 GLN A OE1 1 
ATOM 1645 N NE2 . GLN A 1 250 ? 8.069   -40.264 -50.726 1.00 18.28  ? 534 GLN A NE2 1 
ATOM 1646 N N   . LEU A 1 251 ? 11.388  -34.953 -52.465 1.00 12.69  ? 535 LEU A N   1 
ATOM 1647 C CA  . LEU A 1 251 ? 12.387  -34.385 -53.372 1.00 12.60  ? 535 LEU A CA  1 
ATOM 1648 C C   . LEU A 1 251 ? 13.509  -33.694 -52.618 1.00 11.12  ? 535 LEU A C   1 
ATOM 1649 O O   . LEU A 1 251 ? 14.670  -33.744 -53.025 1.00 11.10  ? 535 LEU A O   1 
ATOM 1650 C CB  . LEU A 1 251 ? 11.747  -33.384 -54.327 1.00 14.25  ? 535 LEU A CB  1 
ATOM 1651 C CG  . LEU A 1 251 ? 10.660  -33.899 -55.264 1.00 17.09  ? 535 LEU A CG  1 
ATOM 1652 C CD1 . LEU A 1 251 ? 10.349  -32.806 -56.281 1.00 18.56  ? 535 LEU A CD1 1 
ATOM 1653 C CD2 . LEU A 1 251 ? 11.117  -35.163 -55.970 1.00 14.84  ? 535 LEU A CD2 1 
ATOM 1654 N N   . LEU A 1 252 ? 13.147  -33.044 -51.522 1.00 8.56   ? 536 LEU A N   1 
ATOM 1655 C CA  . LEU A 1 252 ? 14.115  -32.350 -50.706 1.00 8.28   ? 536 LEU A CA  1 
ATOM 1656 C C   . LEU A 1 252 ? 15.042  -33.363 -50.037 1.00 9.79   ? 536 LEU A C   1 
ATOM 1657 O O   . LEU A 1 252 ? 16.248  -33.153 -49.987 1.00 13.23  ? 536 LEU A O   1 
ATOM 1658 C CB  . LEU A 1 252 ? 13.404  -31.499 -49.645 1.00 6.21   ? 536 LEU A CB  1 
ATOM 1659 C CG  . LEU A 1 252 ? 14.339  -30.720 -48.718 1.00 3.44   ? 536 LEU A CG  1 
ATOM 1660 C CD1 . LEU A 1 252 ? 15.250  -29.859 -49.574 1.00 2.16   ? 536 LEU A CD1 1 
ATOM 1661 C CD2 . LEU A 1 252 ? 13.561  -29.872 -47.742 1.00 2.16   ? 536 LEU A CD2 1 
ATOM 1662 N N   . ASP A 1 253 ? 14.486  -34.457 -49.524 1.00 9.52   ? 537 ASP A N   1 
ATOM 1663 C CA  . ASP A 1 253 ? 15.296  -35.477 -48.862 1.00 13.43  ? 537 ASP A CA  1 
ATOM 1664 C C   . ASP A 1 253 ? 16.266  -36.038 -49.903 1.00 17.63  ? 537 ASP A C   1 
ATOM 1665 O O   . ASP A 1 253 ? 17.472  -36.185 -49.663 1.00 18.49  ? 537 ASP A O   1 
ATOM 1666 C CB  . ASP A 1 253 ? 14.397  -36.601 -48.314 1.00 12.96  ? 537 ASP A CB  1 
ATOM 1667 C CG  . ASP A 1 253 ? 15.093  -37.464 -47.249 1.00 12.47  ? 537 ASP A CG  1 
ATOM 1668 O OD1 . ASP A 1 253 ? 15.205  -38.692 -47.447 1.00 11.76  ? 537 ASP A OD1 1 
ATOM 1669 O OD2 . ASP A 1 253 ? 15.520  -36.920 -46.209 1.00 8.98   ? 537 ASP A OD2 1 
ATOM 1670 N N   . GLU A 1 254 ? 15.722  -36.340 -51.071 1.00 19.23  ? 538 GLU A N   1 
ATOM 1671 C CA  . GLU A 1 254 ? 16.504  -36.877 -52.169 1.00 20.64  ? 538 GLU A CA  1 
ATOM 1672 C C   . GLU A 1 254 ? 17.629  -35.911 -52.534 1.00 18.24  ? 538 GLU A C   1 
ATOM 1673 O O   . GLU A 1 254 ? 18.686  -36.319 -53.006 1.00 18.92  ? 538 GLU A O   1 
ATOM 1674 C CB  . GLU A 1 254 ? 15.571  -37.106 -53.356 1.00 25.21  ? 538 GLU A CB  1 
ATOM 1675 C CG  . GLU A 1 254 ? 16.234  -37.428 -54.670 1.00 34.12  ? 538 GLU A CG  1 
ATOM 1676 C CD  . GLU A 1 254 ? 15.206  -37.664 -55.764 1.00 42.10  ? 538 GLU A CD  1 
ATOM 1677 O OE1 . GLU A 1 254 ? 14.460  -38.666 -55.669 1.00 45.00  ? 538 GLU A OE1 1 
ATOM 1678 O OE2 . GLU A 1 254 ? 15.134  -36.842 -56.708 1.00 44.96  ? 538 GLU A OE2 1 
ATOM 1679 N N   . VAL A 1 255 ? 17.396  -34.628 -52.292 1.00 14.87  ? 539 VAL A N   1 
ATOM 1680 C CA  . VAL A 1 255 ? 18.369  -33.599 -52.604 1.00 13.33  ? 539 VAL A CA  1 
ATOM 1681 C C   . VAL A 1 255 ? 19.428  -33.411 -51.526 1.00 17.76  ? 539 VAL A C   1 
ATOM 1682 O O   . VAL A 1 255 ? 20.569  -33.094 -51.842 1.00 20.79  ? 539 VAL A O   1 
ATOM 1683 C CB  . VAL A 1 255 ? 17.664  -32.244 -52.870 1.00 9.22   ? 539 VAL A CB  1 
ATOM 1684 C CG1 . VAL A 1 255 ? 18.646  -31.116 -52.832 1.00 6.34   ? 539 VAL A CG1 1 
ATOM 1685 C CG2 . VAL A 1 255 ? 17.002  -32.271 -54.217 1.00 9.23   ? 539 VAL A CG2 1 
ATOM 1686 N N   . LEU A 1 256 ? 19.064  -33.599 -50.260 1.00 19.78  ? 540 LEU A N   1 
ATOM 1687 C CA  . LEU A 1 256 ? 20.018  -33.426 -49.163 1.00 22.04  ? 540 LEU A CA  1 
ATOM 1688 C C   . LEU A 1 256 ? 20.973  -34.610 -49.057 1.00 27.58  ? 540 LEU A C   1 
ATOM 1689 O O   . LEU A 1 256 ? 21.839  -34.652 -48.177 1.00 26.94  ? 540 LEU A O   1 
ATOM 1690 C CB  . LEU A 1 256 ? 19.276  -33.255 -47.841 1.00 19.88  ? 540 LEU A CB  1 
ATOM 1691 C CG  . LEU A 1 256 ? 18.354  -32.043 -47.713 1.00 20.10  ? 540 LEU A CG  1 
ATOM 1692 C CD1 . LEU A 1 256 ? 17.554  -32.130 -46.428 1.00 19.85  ? 540 LEU A CD1 1 
ATOM 1693 C CD2 . LEU A 1 256 ? 19.173  -30.777 -47.730 1.00 20.16  ? 540 LEU A CD2 1 
ATOM 1694 N N   . HIS A 1 257 ? 20.805  -35.574 -49.958 1.00 34.46  ? 541 HIS A N   1 
ATOM 1695 C CA  . HIS A 1 257 ? 21.644  -36.768 -49.987 1.00 41.60  ? 541 HIS A CA  1 
ATOM 1696 C C   . HIS A 1 257 ? 22.565  -36.762 -51.206 1.00 46.90  ? 541 HIS A C   1 
ATOM 1697 O O   . HIS A 1 257 ? 23.221  -37.757 -51.514 1.00 49.78  ? 541 HIS A O   1 
ATOM 1698 C CB  . HIS A 1 257 ? 20.767  -38.028 -49.991 1.00 40.59  ? 541 HIS A CB  1 
ATOM 1699 C CG  . HIS A 1 257 ? 20.120  -38.317 -48.671 1.00 40.25  ? 541 HIS A CG  1 
ATOM 1700 N ND1 . HIS A 1 257 ? 19.153  -39.285 -48.508 1.00 40.97  ? 541 HIS A ND1 1 
ATOM 1701 C CD2 . HIS A 1 257 ? 20.313  -37.773 -47.447 1.00 39.61  ? 541 HIS A CD2 1 
ATOM 1702 C CE1 . HIS A 1 257 ? 18.778  -39.324 -47.242 1.00 39.19  ? 541 HIS A CE1 1 
ATOM 1703 N NE2 . HIS A 1 257 ? 19.468  -38.415 -46.577 1.00 37.62  ? 541 HIS A NE2 1 
ATOM 1704 N N   . THR A 1 258 ? 22.604  -35.630 -51.896 1.00 51.87  ? 542 THR A N   1 
ATOM 1705 C CA  . THR A 1 258 ? 23.450  -35.462 -53.068 1.00 57.08  ? 542 THR A CA  1 
ATOM 1706 C C   . THR A 1 258 ? 24.246  -34.165 -52.884 1.00 61.55  ? 542 THR A C   1 
ATOM 1707 O O   . THR A 1 258 ? 25.434  -34.100 -53.198 1.00 62.86  ? 542 THR A O   1 
ATOM 1708 C CB  . THR A 1 258 ? 22.596  -35.407 -54.352 1.00 56.49  ? 542 THR A CB  1 
ATOM 1709 O OG1 . THR A 1 258 ? 21.700  -34.291 -54.289 1.00 58.78  ? 542 THR A OG1 1 
ATOM 1710 C CG2 . THR A 1 258 ? 21.776  -36.686 -54.494 1.00 54.07  ? 542 THR A CG2 1 
ATOM 1711 N N   . MET A 1 259 ? 23.576  -33.143 -52.354 1.00 66.10  ? 543 MET A N   1 
ATOM 1712 C CA  . MET A 1 259 ? 24.185  -31.843 -52.071 1.00 69.97  ? 543 MET A CA  1 
ATOM 1713 C C   . MET A 1 259 ? 24.101  -31.620 -50.560 1.00 73.34  ? 543 MET A C   1 
ATOM 1714 O O   . MET A 1 259 ? 23.414  -30.702 -50.103 1.00 73.60  ? 543 MET A O   1 
ATOM 1715 C CB  . MET A 1 259 ? 23.420  -30.710 -52.769 1.00 70.69  ? 543 MET A CB  1 
ATOM 1716 C CG  . MET A 1 259 ? 23.497  -30.699 -54.286 1.00 73.70  ? 543 MET A CG  1 
ATOM 1717 S SD  . MET A 1 259 ? 22.455  -29.406 -55.041 1.00 76.18  ? 543 MET A SD  1 
ATOM 1718 C CE  . MET A 1 259 ? 21.142  -30.415 -55.774 1.00 75.03  ? 543 MET A CE  1 
ATOM 1719 N N   . PRO A 1 260 ? 24.800  -32.453 -49.765 1.00 76.49  ? 544 PRO A N   1 
ATOM 1720 C CA  . PRO A 1 260 ? 24.793  -32.340 -48.299 1.00 80.10  ? 544 PRO A CA  1 
ATOM 1721 C C   . PRO A 1 260 ? 25.099  -30.947 -47.708 1.00 83.94  ? 544 PRO A C   1 
ATOM 1722 O O   . PRO A 1 260 ? 26.081  -30.291 -48.083 1.00 85.47  ? 544 PRO A O   1 
ATOM 1723 C CB  . PRO A 1 260 ? 25.806  -33.408 -47.865 1.00 79.07  ? 544 PRO A CB  1 
ATOM 1724 C CG  . PRO A 1 260 ? 26.731  -33.502 -49.038 1.00 77.70  ? 544 PRO A CG  1 
ATOM 1725 C CD  . PRO A 1 260 ? 25.769  -33.475 -50.198 1.00 77.12  ? 544 PRO A CD  1 
ATOM 1726 N N   . ILE A 1 261 ? 24.243  -30.520 -46.773 1.00 85.72  ? 545 ILE A N   1 
ATOM 1727 C CA  . ILE A 1 261 ? 24.356  -29.221 -46.093 1.00 84.88  ? 545 ILE A CA  1 
ATOM 1728 C C   . ILE A 1 261 ? 25.084  -29.308 -44.746 1.00 85.71  ? 545 ILE A C   1 
ATOM 1729 O O   . ILE A 1 261 ? 26.179  -28.710 -44.629 1.00 85.80  ? 545 ILE A O   1 
ATOM 1730 C CB  . ILE A 1 261 ? 22.946  -28.598 -45.849 1.00 81.53  ? 545 ILE A CB  1 
ATOM 1731 C CG1 . ILE A 1 261 ? 22.333  -28.163 -47.183 1.00 78.86  ? 545 ILE A CG1 1 
ATOM 1732 C CG2 . ILE A 1 261 ? 23.035  -27.434 -44.857 1.00 80.28  ? 545 ILE A CG2 1 
ATOM 1733 C CD1 . ILE A 1 261 ? 23.169  -27.165 -47.955 1.00 76.30  ? 545 ILE A CD1 1 
ATOM 1734 N N   . ASN B 1 1   ? -28.178 -26.609 -2.129  1.00 88.82  ? 285 ASN B N   1 
ATOM 1735 C CA  . ASN B 1 1   ? -28.518 -27.276 -3.426  1.00 88.33  ? 285 ASN B CA  1 
ATOM 1736 C C   . ASN B 1 1   ? -27.328 -28.027 -4.028  1.00 85.07  ? 285 ASN B C   1 
ATOM 1737 O O   . ASN B 1 1   ? -26.266 -27.446 -4.278  1.00 85.94  ? 285 ASN B O   1 
ATOM 1738 C CB  . ASN B 1 1   ? -29.044 -26.247 -4.434  1.00 90.96  ? 285 ASN B CB  1 
ATOM 1739 C CG  . ASN B 1 1   ? -30.459 -25.790 -4.117  1.00 93.39  ? 285 ASN B CG  1 
ATOM 1740 O OD1 . ASN B 1 1   ? -30.728 -25.250 -3.039  1.00 96.05  ? 285 ASN B OD1 1 
ATOM 1741 N ND2 . ASN B 1 1   ? -31.374 -26.007 -5.058  1.00 92.06  ? 285 ASN B ND2 1 
ATOM 1742 N N   . GLY B 1 2   ? -27.528 -29.320 -4.269  1.00 79.03  ? 286 GLY B N   1 
ATOM 1743 C CA  . GLY B 1 2   ? -26.478 -30.152 -4.819  1.00 70.17  ? 286 GLY B CA  1 
ATOM 1744 C C   . GLY B 1 2   ? -26.024 -29.881 -6.245  1.00 64.03  ? 286 GLY B C   1 
ATOM 1745 O O   . GLY B 1 2   ? -26.650 -30.329 -7.210  1.00 61.17  ? 286 GLY B O   1 
ATOM 1746 N N   . HIS B 1 3   ? -24.935 -29.130 -6.381  1.00 57.37  ? 287 HIS B N   1 
ATOM 1747 C CA  . HIS B 1 3   ? -24.374 -28.869 -7.691  1.00 48.76  ? 287 HIS B CA  1 
ATOM 1748 C C   . HIS B 1 3   ? -23.740 -30.205 -8.010  1.00 45.14  ? 287 HIS B C   1 
ATOM 1749 O O   . HIS B 1 3   ? -23.597 -30.591 -9.166  1.00 46.64  ? 287 HIS B O   1 
ATOM 1750 C CB  . HIS B 1 3   ? -23.302 -27.786 -7.619  1.00 47.26  ? 287 HIS B CB  1 
ATOM 1751 C CG  . HIS B 1 3   ? -22.474 -27.671 -8.863  1.00 47.94  ? 287 HIS B CG  1 
ATOM 1752 N ND1 . HIS B 1 3   ? -21.405 -28.500 -9.127  1.00 47.92  ? 287 HIS B ND1 1 
ATOM 1753 C CD2 . HIS B 1 3   ? -22.563 -26.828 -9.919  1.00 47.79  ? 287 HIS B CD2 1 
ATOM 1754 C CE1 . HIS B 1 3   ? -20.870 -28.171 -10.290 1.00 46.59  ? 287 HIS B CE1 1 
ATOM 1755 N NE2 . HIS B 1 3   ? -21.555 -27.160 -10.791 1.00 46.90  ? 287 HIS B NE2 1 
ATOM 1756 N N   . LEU B 1 4   ? -23.378 -30.913 -6.947  1.00 39.32  ? 288 LEU B N   1 
ATOM 1757 C CA  . LEU B 1 4   ? -22.761 -32.225 -7.049  1.00 33.18  ? 288 LEU B CA  1 
ATOM 1758 C C   . LEU B 1 4   ? -23.832 -33.309 -7.027  1.00 29.62  ? 288 LEU B C   1 
ATOM 1759 O O   . LEU B 1 4   ? -24.428 -33.569 -5.993  1.00 32.77  ? 288 LEU B O   1 
ATOM 1760 C CB  . LEU B 1 4   ? -21.790 -32.428 -5.877  1.00 29.84  ? 288 LEU B CB  1 
ATOM 1761 C CG  . LEU B 1 4   ? -21.078 -33.775 -5.723  1.00 27.42  ? 288 LEU B CG  1 
ATOM 1762 C CD1 . LEU B 1 4   ? -20.156 -34.022 -6.888  1.00 27.36  ? 288 LEU B CD1 1 
ATOM 1763 C CD2 . LEU B 1 4   ? -20.290 -33.774 -4.439  1.00 27.58  ? 288 LEU B CD2 1 
ATOM 1764 N N   . GLN B 1 5   ? -24.093 -33.928 -8.170  1.00 26.29  ? 289 GLN B N   1 
ATOM 1765 C CA  . GLN B 1 5   ? -25.087 -34.994 -8.233  1.00 24.20  ? 289 GLN B CA  1 
ATOM 1766 C C   . GLN B 1 5   ? -24.431 -36.308 -7.843  1.00 22.78  ? 289 GLN B C   1 
ATOM 1767 O O   . GLN B 1 5   ? -23.419 -36.690 -8.426  1.00 26.20  ? 289 GLN B O   1 
ATOM 1768 C CB  . GLN B 1 5   ? -25.649 -35.139 -9.647  1.00 23.89  ? 289 GLN B CB  1 
ATOM 1769 C CG  . GLN B 1 5   ? -26.518 -34.002 -10.113 1.00 22.51  ? 289 GLN B CG  1 
ATOM 1770 C CD  . GLN B 1 5   ? -27.615 -33.675 -9.127  1.00 22.71  ? 289 GLN B CD  1 
ATOM 1771 O OE1 . GLN B 1 5   ? -27.442 -32.827 -8.251  1.00 25.35  ? 289 GLN B OE1 1 
ATOM 1772 N NE2 . GLN B 1 5   ? -28.749 -34.356 -9.255  1.00 22.21  ? 289 GLN B NE2 1 
ATOM 1773 N N   . HIS B 1 6   ? -25.004 -37.010 -6.874  1.00 18.98  ? 290 HIS B N   1 
ATOM 1774 C CA  . HIS B 1 6   ? -24.430 -38.278 -6.452  1.00 16.99  ? 290 HIS B CA  1 
ATOM 1775 C C   . HIS B 1 6   ? -25.005 -39.440 -7.234  1.00 17.63  ? 290 HIS B C   1 
ATOM 1776 O O   . HIS B 1 6   ? -26.200 -39.480 -7.510  1.00 19.14  ? 290 HIS B O   1 
ATOM 1777 C CB  . HIS B 1 6   ? -24.664 -38.478 -4.965  1.00 15.26  ? 290 HIS B CB  1 
ATOM 1778 C CG  . HIS B 1 6   ? -23.869 -37.546 -4.113  1.00 13.60  ? 290 HIS B CG  1 
ATOM 1779 N ND1 . HIS B 1 6   ? -22.583 -37.826 -3.710  1.00 12.78  ? 290 HIS B ND1 1 
ATOM 1780 C CD2 . HIS B 1 6   ? -24.142 -36.300 -3.663  1.00 13.79  ? 290 HIS B CD2 1 
ATOM 1781 C CE1 . HIS B 1 6   ? -22.094 -36.789 -3.054  1.00 15.23  ? 290 HIS B CE1 1 
ATOM 1782 N NE2 . HIS B 1 6   ? -23.020 -35.848 -3.012  1.00 13.22  ? 290 HIS B NE2 1 
ATOM 1783 N N   . HIS B 1 7   ? -24.145 -40.382 -7.597  1.00 18.60  ? 291 HIS B N   1 
ATOM 1784 C CA  . HIS B 1 7   ? -24.573 -41.542 -8.362  1.00 20.95  ? 291 HIS B CA  1 
ATOM 1785 C C   . HIS B 1 7   ? -24.080 -42.854 -7.771  1.00 25.08  ? 291 HIS B C   1 
ATOM 1786 O O   . HIS B 1 7   ? -23.123 -43.452 -8.274  1.00 24.87  ? 291 HIS B O   1 
ATOM 1787 C CB  . HIS B 1 7   ? -24.102 -41.413 -9.808  1.00 16.36  ? 291 HIS B CB  1 
ATOM 1788 C CG  . HIS B 1 7   ? -24.734 -40.271 -10.533 1.00 13.64  ? 291 HIS B CG  1 
ATOM 1789 N ND1 . HIS B 1 7   ? -25.859 -40.417 -11.311 1.00 10.80  ? 291 HIS B ND1 1 
ATOM 1790 C CD2 . HIS B 1 7   ? -24.446 -38.948 -10.533 1.00 14.49  ? 291 HIS B CD2 1 
ATOM 1791 C CE1 . HIS B 1 7   ? -26.240 -39.234 -11.757 1.00 12.73  ? 291 HIS B CE1 1 
ATOM 1792 N NE2 . HIS B 1 7   ? -25.399 -38.325 -11.298 1.00 12.55  ? 291 HIS B NE2 1 
ATOM 1793 N N   . PRO B 1 8   ? -24.725 -43.310 -6.678  1.00 25.77  ? 292 PRO B N   1 
ATOM 1794 C CA  . PRO B 1 8   ? -24.360 -44.563 -6.012  1.00 24.04  ? 292 PRO B CA  1 
ATOM 1795 C C   . PRO B 1 8   ? -24.682 -45.754 -6.906  1.00 25.09  ? 292 PRO B C   1 
ATOM 1796 O O   . PRO B 1 8   ? -25.424 -45.622 -7.880  1.00 21.99  ? 292 PRO B O   1 
ATOM 1797 C CB  . PRO B 1 8   ? -25.214 -44.537 -4.747  1.00 22.45  ? 292 PRO B CB  1 
ATOM 1798 C CG  . PRO B 1 8   ? -26.408 -43.723 -5.155  1.00 22.64  ? 292 PRO B CG  1 
ATOM 1799 C CD  . PRO B 1 8   ? -25.783 -42.606 -5.925  1.00 22.90  ? 292 PRO B CD  1 
ATOM 1800 N N   . PRO B 1 9   ? -24.104 -46.930 -6.605  1.00 27.84  ? 293 PRO B N   1 
ATOM 1801 C CA  . PRO B 1 9   ? -24.368 -48.127 -7.415  1.00 31.94  ? 293 PRO B CA  1 
ATOM 1802 C C   . PRO B 1 9   ? -25.769 -48.702 -7.175  1.00 36.70  ? 293 PRO B C   1 
ATOM 1803 O O   . PRO B 1 9   ? -26.198 -48.868 -6.036  1.00 37.28  ? 293 PRO B O   1 
ATOM 1804 C CB  . PRO B 1 9   ? -23.249 -49.080 -6.996  1.00 27.20  ? 293 PRO B CB  1 
ATOM 1805 C CG  . PRO B 1 9   ? -22.943 -48.658 -5.602  1.00 24.51  ? 293 PRO B CG  1 
ATOM 1806 C CD  . PRO B 1 9   ? -22.991 -47.164 -5.666  1.00 25.29  ? 293 PRO B CD  1 
ATOM 1807 N N   . MET B 1 10  ? -26.489 -48.989 -8.254  1.00 42.53  ? 294 MET B N   1 
ATOM 1808 C CA  . MET B 1 10  ? -27.840 -49.525 -8.137  1.00 48.72  ? 294 MET B CA  1 
ATOM 1809 C C   . MET B 1 10  ? -27.922 -50.892 -8.792  1.00 51.75  ? 294 MET B C   1 
ATOM 1810 O O   . MET B 1 10  ? -28.217 -50.995 -9.982  1.00 53.88  ? 294 MET B O   1 
ATOM 1811 C CB  . MET B 1 10  ? -28.856 -48.589 -8.805  1.00 52.88  ? 294 MET B CB  1 
ATOM 1812 C CG  . MET B 1 10  ? -28.828 -47.153 -8.291  1.00 62.33  ? 294 MET B CG  1 
ATOM 1813 S SD  . MET B 1 10  ? -29.162 -46.985 -6.505  1.00 71.27  ? 294 MET B SD  1 
ATOM 1814 C CE  . MET B 1 10  ? -30.843 -46.312 -6.524  1.00 69.64  ? 294 MET B CE  1 
ATOM 1815 N N   . PRO B 1 11  ? -27.667 -51.964 -8.023  1.00 53.90  ? 295 PRO B N   1 
ATOM 1816 C CA  . PRO B 1 11  ? -27.729 -53.318 -8.583  1.00 55.06  ? 295 PRO B CA  1 
ATOM 1817 C C   . PRO B 1 11  ? -29.096 -53.626 -9.211  1.00 57.75  ? 295 PRO B C   1 
ATOM 1818 O O   . PRO B 1 11  ? -30.143 -53.227 -8.687  1.00 57.72  ? 295 PRO B O   1 
ATOM 1819 C CB  . PRO B 1 11  ? -27.415 -54.203 -7.377  1.00 53.78  ? 295 PRO B CB  1 
ATOM 1820 C CG  . PRO B 1 11  ? -27.929 -53.391 -6.220  1.00 53.42  ? 295 PRO B CG  1 
ATOM 1821 C CD  . PRO B 1 11  ? -27.448 -52.007 -6.567  1.00 53.45  ? 295 PRO B CD  1 
ATOM 1822 N N   . PRO B 1 12  ? -29.097 -54.336 -10.352 1.00 58.99  ? 296 PRO B N   1 
ATOM 1823 C CA  . PRO B 1 12  ? -30.315 -54.711 -11.078 1.00 59.36  ? 296 PRO B CA  1 
ATOM 1824 C C   . PRO B 1 12  ? -31.430 -55.249 -10.178 1.00 59.39  ? 296 PRO B C   1 
ATOM 1825 O O   . PRO B 1 12  ? -32.604 -55.247 -10.556 1.00 59.26  ? 296 PRO B O   1 
ATOM 1826 C CB  . PRO B 1 12  ? -29.807 -55.756 -12.064 1.00 59.35  ? 296 PRO B CB  1 
ATOM 1827 C CG  . PRO B 1 12  ? -28.442 -55.240 -12.394 1.00 58.18  ? 296 PRO B CG  1 
ATOM 1828 C CD  . PRO B 1 12  ? -27.900 -54.860 -11.036 1.00 57.74  ? 296 PRO B CD  1 
ATOM 1829 N N   . ALA B 1 25  ? -36.782 -52.278 -32.717 1.00 97.63  ? 309 ALA B N   1 
ATOM 1830 C CA  . ALA B 1 25  ? -37.131 -52.824 -34.024 1.00 97.39  ? 309 ALA B CA  1 
ATOM 1831 C C   . ALA B 1 25  ? -38.362 -52.113 -34.553 1.00 97.22  ? 309 ALA B C   1 
ATOM 1832 O O   . ALA B 1 25  ? -38.708 -52.226 -35.730 1.00 96.68  ? 309 ALA B O   1 
ATOM 1833 C CB  . ALA B 1 25  ? -37.400 -54.316 -33.914 1.00 97.55  ? 309 ALA B CB  1 
ATOM 1834 N N   . PHE B 1 26  ? -39.023 -51.379 -33.666 1.00 97.27  ? 310 PHE B N   1 
ATOM 1835 C CA  . PHE B 1 26  ? -40.217 -50.638 -34.033 1.00 97.93  ? 310 PHE B CA  1 
ATOM 1836 C C   . PHE B 1 26  ? -39.852 -49.217 -34.464 1.00 98.55  ? 310 PHE B C   1 
ATOM 1837 O O   . PHE B 1 26  ? -40.617 -48.563 -35.173 1.00 98.88  ? 310 PHE B O   1 
ATOM 1838 C CB  . PHE B 1 26  ? -41.196 -50.605 -32.856 1.00 97.00  ? 310 PHE B CB  1 
ATOM 1839 C CG  . PHE B 1 26  ? -41.716 -51.961 -32.458 1.00 95.96  ? 310 PHE B CG  1 
ATOM 1840 C CD1 . PHE B 1 26  ? -42.441 -52.737 -33.360 1.00 95.63  ? 310 PHE B CD1 1 
ATOM 1841 C CD2 . PHE B 1 26  ? -41.487 -52.462 -31.180 1.00 95.52  ? 310 PHE B CD2 1 
ATOM 1842 C CE1 . PHE B 1 26  ? -42.932 -53.991 -32.994 1.00 94.59  ? 310 PHE B CE1 1 
ATOM 1843 C CE2 . PHE B 1 26  ? -41.974 -53.715 -30.804 1.00 94.78  ? 310 PHE B CE2 1 
ATOM 1844 C CZ  . PHE B 1 26  ? -42.697 -54.480 -31.713 1.00 94.73  ? 310 PHE B CZ  1 
ATOM 1845 N N   . GLN B 1 27  ? -38.680 -48.745 -34.038 1.00 98.45  ? 311 GLN B N   1 
ATOM 1846 C CA  . GLN B 1 27  ? -38.217 -47.404 -34.398 1.00 96.51  ? 311 GLN B CA  1 
ATOM 1847 C C   . GLN B 1 27  ? -36.926 -47.479 -35.220 1.00 93.34  ? 311 GLN B C   1 
ATOM 1848 O O   . GLN B 1 27  ? -35.947 -48.108 -34.809 1.00 93.18  ? 311 GLN B O   1 
ATOM 1849 C CB  . GLN B 1 27  ? -37.992 -46.558 -33.139 1.00 98.51  ? 311 GLN B CB  1 
ATOM 1850 C CG  . GLN B 1 27  ? -36.858 -47.037 -32.244 1.00 103.02 ? 311 GLN B CG  1 
ATOM 1851 C CD  . GLN B 1 27  ? -36.659 -46.154 -31.021 1.00 105.36 ? 311 GLN B CD  1 
ATOM 1852 O OE1 . GLN B 1 27  ? -35.703 -46.329 -30.261 1.00 107.78 ? 311 GLN B OE1 1 
ATOM 1853 N NE2 . GLN B 1 27  ? -37.566 -45.203 -30.822 1.00 103.42 ? 311 GLN B NE2 1 
ATOM 1854 N N   . PRO B 1 28  ? -36.912 -46.832 -36.400 1.00 89.70  ? 312 PRO B N   1 
ATOM 1855 C CA  . PRO B 1 28  ? -35.762 -46.802 -37.312 1.00 87.03  ? 312 PRO B CA  1 
ATOM 1856 C C   . PRO B 1 28  ? -34.490 -46.213 -36.688 1.00 83.03  ? 312 PRO B C   1 
ATOM 1857 O O   . PRO B 1 28  ? -34.507 -45.768 -35.543 1.00 84.04  ? 312 PRO B O   1 
ATOM 1858 C CB  . PRO B 1 28  ? -36.285 -45.972 -38.487 1.00 87.46  ? 312 PRO B CB  1 
ATOM 1859 C CG  . PRO B 1 28  ? -37.251 -45.042 -37.832 1.00 87.43  ? 312 PRO B CG  1 
ATOM 1860 C CD  . PRO B 1 28  ? -37.992 -45.963 -36.902 1.00 88.51  ? 312 PRO B CD  1 
ATOM 1861 N N   . PRO B 1 29  ? -33.365 -46.224 -37.428 1.00 77.82  ? 313 PRO B N   1 
ATOM 1862 C CA  . PRO B 1 29  ? -32.135 -45.666 -36.866 1.00 72.42  ? 313 PRO B CA  1 
ATOM 1863 C C   . PRO B 1 29  ? -32.278 -44.154 -36.919 1.00 67.18  ? 313 PRO B C   1 
ATOM 1864 O O   . PRO B 1 29  ? -33.161 -43.648 -37.611 1.00 66.09  ? 313 PRO B O   1 
ATOM 1865 C CB  . PRO B 1 29  ? -31.067 -46.185 -37.815 1.00 73.45  ? 313 PRO B CB  1 
ATOM 1866 C CG  . PRO B 1 29  ? -31.768 -46.114 -39.131 1.00 75.23  ? 313 PRO B CG  1 
ATOM 1867 C CD  . PRO B 1 29  ? -33.140 -46.682 -38.812 1.00 77.71  ? 313 PRO B CD  1 
ATOM 1868 N N   . ILE B 1 30  ? -31.430 -43.431 -36.197 1.00 61.18  ? 314 ILE B N   1 
ATOM 1869 C CA  . ILE B 1 30  ? -31.532 -41.983 -36.202 1.00 54.97  ? 314 ILE B CA  1 
ATOM 1870 C C   . ILE B 1 30  ? -31.125 -41.447 -37.563 1.00 52.81  ? 314 ILE B C   1 
ATOM 1871 O O   . ILE B 1 30  ? -31.676 -40.457 -38.040 1.00 50.53  ? 314 ILE B O   1 
ATOM 1872 C CB  . ILE B 1 30  ? -30.660 -41.340 -35.105 1.00 53.34  ? 314 ILE B CB  1 
ATOM 1873 C CG1 . ILE B 1 30  ? -31.119 -41.800 -33.720 1.00 52.94  ? 314 ILE B CG1 1 
ATOM 1874 C CG2 . ILE B 1 30  ? -30.799 -39.834 -35.161 1.00 51.64  ? 314 ILE B CG2 1 
ATOM 1875 C CD1 . ILE B 1 30  ? -30.941 -43.282 -33.456 1.00 53.77  ? 314 ILE B CD1 1 
ATOM 1876 N N   . SER B 1 31  ? -30.168 -42.111 -38.197 1.00 52.46  ? 315 SER B N   1 
ATOM 1877 C CA  . SER B 1 31  ? -29.715 -41.690 -39.514 1.00 54.28  ? 315 SER B CA  1 
ATOM 1878 C C   . SER B 1 31  ? -29.374 -42.873 -40.391 1.00 55.23  ? 315 SER B C   1 
ATOM 1879 O O   . SER B 1 31  ? -28.990 -43.933 -39.898 1.00 54.39  ? 315 SER B O   1 
ATOM 1880 C CB  . SER B 1 31  ? -28.482 -40.793 -39.404 1.00 56.56  ? 315 SER B CB  1 
ATOM 1881 O OG  . SER B 1 31  ? -27.981 -40.462 -40.692 1.00 56.46  ? 315 SER B OG  1 
ATOM 1882 N N   . ASN B 1 32  ? -29.513 -42.684 -41.698 1.00 57.23  ? 316 ASN B N   1 
ATOM 1883 C CA  . ASN B 1 32  ? -29.193 -43.738 -42.641 1.00 59.34  ? 316 ASN B CA  1 
ATOM 1884 C C   . ASN B 1 32  ? -27.677 -43.762 -42.771 1.00 59.78  ? 316 ASN B C   1 
ATOM 1885 O O   . ASN B 1 32  ? -27.079 -44.796 -43.071 1.00 60.89  ? 316 ASN B O   1 
ATOM 1886 C CB  . ASN B 1 32  ? -29.839 -43.452 -43.990 1.00 61.39  ? 316 ASN B CB  1 
ATOM 1887 C CG  . ASN B 1 32  ? -30.548 -44.662 -44.555 1.00 64.44  ? 316 ASN B CG  1 
ATOM 1888 O OD1 . ASN B 1 32  ? -31.082 -44.624 -45.665 1.00 66.15  ? 316 ASN B OD1 1 
ATOM 1889 N ND2 . ASN B 1 32  ? -30.563 -45.750 -43.789 1.00 64.86  ? 316 ASN B ND2 1 
ATOM 1890 N N   . HIS B 1 33  ? -27.076 -42.598 -42.530 1.00 59.49  ? 317 HIS B N   1 
ATOM 1891 C CA  . HIS B 1 33  ? -25.629 -42.398 -42.572 1.00 57.61  ? 317 HIS B CA  1 
ATOM 1892 C C   . HIS B 1 33  ? -24.938 -43.647 -42.007 1.00 54.59  ? 317 HIS B C   1 
ATOM 1893 O O   . HIS B 1 33  ? -25.403 -44.235 -41.030 1.00 54.57  ? 317 HIS B O   1 
ATOM 1894 C CB  . HIS B 1 33  ? -25.286 -41.170 -41.718 1.00 61.16  ? 317 HIS B CB  1 
ATOM 1895 C CG  . HIS B 1 33  ? -24.054 -40.437 -42.151 1.00 66.21  ? 317 HIS B CG  1 
ATOM 1896 N ND1 . HIS B 1 33  ? -22.806 -41.021 -42.183 1.00 68.27  ? 317 HIS B ND1 1 
ATOM 1897 C CD2 . HIS B 1 33  ? -23.875 -39.148 -42.529 1.00 67.61  ? 317 HIS B CD2 1 
ATOM 1898 C CE1 . HIS B 1 33  ? -21.912 -40.123 -42.559 1.00 68.60  ? 317 HIS B CE1 1 
ATOM 1899 N NE2 . HIS B 1 33  ? -22.535 -38.978 -42.775 1.00 67.15  ? 317 HIS B NE2 1 
ATOM 1900 N N   . PRO B 1 34  ? -23.823 -44.075 -42.619 1.00 50.97  ? 318 PRO B N   1 
ATOM 1901 C CA  . PRO B 1 34  ? -23.120 -45.263 -42.124 1.00 46.98  ? 318 PRO B CA  1 
ATOM 1902 C C   . PRO B 1 34  ? -22.250 -44.949 -40.902 1.00 43.65  ? 318 PRO B C   1 
ATOM 1903 O O   . PRO B 1 34  ? -21.692 -43.853 -40.786 1.00 42.50  ? 318 PRO B O   1 
ATOM 1904 C CB  . PRO B 1 34  ? -22.298 -45.691 -43.330 1.00 46.57  ? 318 PRO B CB  1 
ATOM 1905 C CG  . PRO B 1 34  ? -21.885 -44.358 -43.895 1.00 49.59  ? 318 PRO B CG  1 
ATOM 1906 C CD  . PRO B 1 34  ? -23.172 -43.544 -43.832 1.00 49.97  ? 318 PRO B CD  1 
ATOM 1907 N N   . ALA B 1 35  ? -22.141 -45.924 -40.002 1.00 38.68  ? 319 ALA B N   1 
ATOM 1908 C CA  . ALA B 1 35  ? -21.358 -45.787 -38.775 1.00 32.96  ? 319 ALA B CA  1 
ATOM 1909 C C   . ALA B 1 35  ? -19.945 -45.276 -39.033 1.00 29.83  ? 319 ALA B C   1 
ATOM 1910 O O   . ALA B 1 35  ? -19.414 -45.422 -40.129 1.00 29.92  ? 319 ALA B O   1 
ATOM 1911 C CB  . ALA B 1 35  ? -21.299 -47.124 -38.051 1.00 30.22  ? 319 ALA B CB  1 
ATOM 1912 N N   . PRO B 1 36  ? -19.321 -44.658 -38.020 1.00 27.71  ? 320 PRO B N   1 
ATOM 1913 C CA  . PRO B 1 36  ? -17.961 -44.126 -38.143 1.00 28.16  ? 320 PRO B CA  1 
ATOM 1914 C C   . PRO B 1 36  ? -16.929 -45.248 -38.017 1.00 28.78  ? 320 PRO B C   1 
ATOM 1915 O O   . PRO B 1 36  ? -17.283 -46.382 -37.690 1.00 30.47  ? 320 PRO B O   1 
ATOM 1916 C CB  . PRO B 1 36  ? -17.888 -43.142 -36.984 1.00 27.38  ? 320 PRO B CB  1 
ATOM 1917 C CG  . PRO B 1 36  ? -18.689 -43.834 -35.940 1.00 24.65  ? 320 PRO B CG  1 
ATOM 1918 C CD  . PRO B 1 36  ? -19.903 -44.285 -36.718 1.00 25.73  ? 320 PRO B CD  1 
ATOM 1919 N N   . GLU B 1 37  ? -15.659 -44.957 -38.282 1.00 26.70  ? 321 GLU B N   1 
ATOM 1920 C CA  . GLU B 1 37  ? -14.676 -46.013 -38.133 1.00 26.41  ? 321 GLU B CA  1 
ATOM 1921 C C   . GLU B 1 37  ? -14.373 -46.155 -36.644 1.00 24.77  ? 321 GLU B C   1 
ATOM 1922 O O   . GLU B 1 37  ? -14.074 -47.249 -36.173 1.00 28.41  ? 321 GLU B O   1 
ATOM 1923 C CB  . GLU B 1 37  ? -13.411 -45.731 -38.951 1.00 28.34  ? 321 GLU B CB  1 
ATOM 1924 C CG  . GLU B 1 37  ? -12.641 -44.500 -38.563 1.00 34.80  ? 321 GLU B CG  1 
ATOM 1925 C CD  . GLU B 1 37  ? -11.387 -44.329 -39.400 1.00 37.70  ? 321 GLU B CD  1 
ATOM 1926 O OE1 . GLU B 1 37  ? -10.512 -45.227 -39.359 1.00 37.64  ? 321 GLU B OE1 1 
ATOM 1927 O OE2 . GLU B 1 37  ? -11.281 -43.296 -40.100 1.00 39.20  ? 321 GLU B OE2 1 
ATOM 1928 N N   . TYR B 1 38  ? -14.465 -45.052 -35.902 1.00 20.33  ? 322 TYR B N   1 
ATOM 1929 C CA  . TYR B 1 38  ? -14.259 -45.077 -34.452 1.00 16.59  ? 322 TYR B CA  1 
ATOM 1930 C C   . TYR B 1 38  ? -15.545 -44.548 -33.860 1.00 18.22  ? 322 TYR B C   1 
ATOM 1931 O O   . TYR B 1 38  ? -16.156 -43.640 -34.429 1.00 17.33  ? 322 TYR B O   1 
ATOM 1932 C CB  . TYR B 1 38  ? -13.119 -44.159 -34.019 1.00 12.87  ? 322 TYR B CB  1 
ATOM 1933 C CG  . TYR B 1 38  ? -11.806 -44.497 -34.657 1.00 13.39  ? 322 TYR B CG  1 
ATOM 1934 C CD1 . TYR B 1 38  ? -11.192 -45.724 -34.426 1.00 11.94  ? 322 TYR B CD1 1 
ATOM 1935 C CD2 . TYR B 1 38  ? -11.207 -43.618 -35.549 1.00 13.21  ? 322 TYR B CD2 1 
ATOM 1936 C CE1 . TYR B 1 38  ? -10.027 -46.065 -35.076 1.00 12.16  ? 322 TYR B CE1 1 
ATOM 1937 C CE2 . TYR B 1 38  ? -10.043 -43.948 -36.204 1.00 11.50  ? 322 TYR B CE2 1 
ATOM 1938 C CZ  . TYR B 1 38  ? -9.460  -45.172 -35.971 1.00 13.48  ? 322 TYR B CZ  1 
ATOM 1939 O OH  . TYR B 1 38  ? -8.329  -45.512 -36.673 1.00 20.17  ? 322 TYR B OH  1 
ATOM 1940 N N   . TRP B 1 39  ? -15.976 -45.100 -32.729 1.00 18.74  ? 323 TRP B N   1 
ATOM 1941 C CA  . TRP B 1 39  ? -17.205 -44.598 -32.143 1.00 18.07  ? 323 TRP B CA  1 
ATOM 1942 C C   . TRP B 1 39  ? -16.941 -43.386 -31.251 1.00 17.51  ? 323 TRP B C   1 
ATOM 1943 O O   . TRP B 1 39  ? -17.843 -42.580 -30.989 1.00 20.08  ? 323 TRP B O   1 
ATOM 1944 C CB  . TRP B 1 39  ? -17.976 -45.706 -31.409 1.00 17.34  ? 323 TRP B CB  1 
ATOM 1945 C CG  . TRP B 1 39  ? -17.335 -46.336 -30.212 1.00 17.76  ? 323 TRP B CG  1 
ATOM 1946 C CD1 . TRP B 1 39  ? -16.489 -47.417 -30.190 1.00 15.05  ? 323 TRP B CD1 1 
ATOM 1947 C CD2 . TRP B 1 39  ? -17.576 -45.988 -28.843 1.00 15.17  ? 323 TRP B CD2 1 
ATOM 1948 N NE1 . TRP B 1 39  ? -16.201 -47.763 -28.890 1.00 12.84  ? 323 TRP B NE1 1 
ATOM 1949 C CE2 . TRP B 1 39  ? -16.854 -46.901 -28.046 1.00 12.84  ? 323 TRP B CE2 1 
ATOM 1950 C CE3 . TRP B 1 39  ? -18.335 -44.989 -28.214 1.00 12.10  ? 323 TRP B CE3 1 
ATOM 1951 C CZ2 . TRP B 1 39  ? -16.869 -46.845 -26.654 1.00 13.19  ? 323 TRP B CZ2 1 
ATOM 1952 C CZ3 . TRP B 1 39  ? -18.349 -44.932 -26.833 1.00 13.41  ? 323 TRP B CZ3 1 
ATOM 1953 C CH2 . TRP B 1 39  ? -17.620 -45.856 -26.066 1.00 14.87  ? 323 TRP B CH2 1 
ATOM 1954 N N   . CYS B 1 40  ? -15.692 -43.239 -30.821 1.00 12.51  ? 324 CYS B N   1 
ATOM 1955 C CA  . CYS B 1 40  ? -15.302 -42.096 -30.008 1.00 7.98   ? 324 CYS B CA  1 
ATOM 1956 C C   . CYS B 1 40  ? -13.788 -41.971 -30.040 1.00 7.19   ? 324 CYS B C   1 
ATOM 1957 O O   . CYS B 1 40  ? -13.096 -42.870 -30.516 1.00 7.50   ? 324 CYS B O   1 
ATOM 1958 C CB  . CYS B 1 40  ? -15.766 -42.271 -28.556 1.00 7.48   ? 324 CYS B CB  1 
ATOM 1959 S SG  . CYS B 1 40  ? -14.734 -43.356 -27.509 1.00 4.21   ? 324 CYS B SG  1 
ATOM 1960 N N   . SER B 1 41  ? -13.289 -40.840 -29.556 1.00 5.38   ? 325 SER B N   1 
ATOM 1961 C CA  . SER B 1 41  ? -11.857 -40.581 -29.452 1.00 5.44   ? 325 SER B CA  1 
ATOM 1962 C C   . SER B 1 41  ? -11.675 -39.947 -28.065 1.00 9.44   ? 325 SER B C   1 
ATOM 1963 O O   . SER B 1 41  ? -12.492 -39.120 -27.633 1.00 11.93  ? 325 SER B O   1 
ATOM 1964 C CB  . SER B 1 41  ? -11.374 -39.650 -30.567 1.00 2.63   ? 325 SER B CB  1 
ATOM 1965 O OG  . SER B 1 41  ? -12.111 -38.447 -30.617 1.00 5.23   ? 325 SER B OG  1 
ATOM 1966 N N   . ILE B 1 42  ? -10.616 -40.346 -27.364 1.00 10.03  ? 326 ILE B N   1 
ATOM 1967 C CA  . ILE B 1 42  ? -10.369 -39.874 -26.005 1.00 9.46   ? 326 ILE B CA  1 
ATOM 1968 C C   . ILE B 1 42  ? -9.030  -39.171 -25.828 1.00 8.83   ? 326 ILE B C   1 
ATOM 1969 O O   . ILE B 1 42  ? -7.982  -39.708 -26.187 1.00 9.07   ? 326 ILE B O   1 
ATOM 1970 C CB  . ILE B 1 42  ? -10.409 -41.065 -25.019 1.00 10.26  ? 326 ILE B CB  1 
ATOM 1971 C CG1 . ILE B 1 42  ? -11.629 -41.944 -25.310 1.00 8.44   ? 326 ILE B CG1 1 
ATOM 1972 C CG2 . ILE B 1 42  ? -10.434 -40.558 -23.582 1.00 12.72  ? 326 ILE B CG2 1 
ATOM 1973 C CD1 . ILE B 1 42  ? -11.528 -43.336 -24.734 1.00 7.57   ? 326 ILE B CD1 1 
ATOM 1974 N N   . ALA B 1 43  ? -9.077  -37.974 -25.252 1.00 8.87   ? 327 ALA B N   1 
ATOM 1975 C CA  . ALA B 1 43  ? -7.878  -37.189 -24.989 1.00 8.20   ? 327 ALA B CA  1 
ATOM 1976 C C   . ALA B 1 43  ? -7.728  -37.095 -23.473 1.00 9.47   ? 327 ALA B C   1 
ATOM 1977 O O   . ALA B 1 43  ? -8.671  -36.722 -22.772 1.00 9.96   ? 327 ALA B O   1 
ATOM 1978 C CB  . ALA B 1 43  ? -8.013  -35.802 -25.593 1.00 5.79   ? 327 ALA B CB  1 
ATOM 1979 N N   . TYR B 1 44  ? -6.541  -37.436 -22.977 1.00 9.37   ? 328 TYR B N   1 
ATOM 1980 C CA  . TYR B 1 44  ? -6.248  -37.428 -21.542 1.00 6.82   ? 328 TYR B CA  1 
ATOM 1981 C C   . TYR B 1 44  ? -5.518  -36.151 -21.141 1.00 7.17   ? 328 TYR B C   1 
ATOM 1982 O O   . TYR B 1 44  ? -4.629  -35.686 -21.856 1.00 6.99   ? 328 TYR B O   1 
ATOM 1983 C CB  . TYR B 1 44  ? -5.413  -38.673 -21.213 1.00 6.52   ? 328 TYR B CB  1 
ATOM 1984 C CG  . TYR B 1 44  ? -4.707  -38.682 -19.880 1.00 5.90   ? 328 TYR B CG  1 
ATOM 1985 C CD1 . TYR B 1 44  ? -5.414  -38.757 -18.690 1.00 6.33   ? 328 TYR B CD1 1 
ATOM 1986 C CD2 . TYR B 1 44  ? -3.318  -38.623 -19.817 1.00 8.03   ? 328 TYR B CD2 1 
ATOM 1987 C CE1 . TYR B 1 44  ? -4.750  -38.775 -17.469 1.00 8.35   ? 328 TYR B CE1 1 
ATOM 1988 C CE2 . TYR B 1 44  ? -2.648  -38.637 -18.610 1.00 7.78   ? 328 TYR B CE2 1 
ATOM 1989 C CZ  . TYR B 1 44  ? -3.364  -38.714 -17.437 1.00 9.26   ? 328 TYR B CZ  1 
ATOM 1990 O OH  . TYR B 1 44  ? -2.687  -38.719 -16.232 1.00 11.75  ? 328 TYR B OH  1 
ATOM 1991 N N   . PHE B 1 45  ? -5.907  -35.585 -20.001 1.00 7.95   ? 329 PHE B N   1 
ATOM 1992 C CA  . PHE B 1 45  ? -5.301  -34.350 -19.502 1.00 9.05   ? 329 PHE B CA  1 
ATOM 1993 C C   . PHE B 1 45  ? -4.825  -34.387 -18.052 1.00 9.36   ? 329 PHE B C   1 
ATOM 1994 O O   . PHE B 1 45  ? -5.380  -35.084 -17.203 1.00 11.45  ? 329 PHE B O   1 
ATOM 1995 C CB  . PHE B 1 45  ? -6.285  -33.173 -19.610 1.00 9.64   ? 329 PHE B CB  1 
ATOM 1996 C CG  . PHE B 1 45  ? -6.725  -32.864 -21.005 1.00 12.26  ? 329 PHE B CG  1 
ATOM 1997 C CD1 . PHE B 1 45  ? -7.648  -33.681 -21.658 1.00 15.30  ? 329 PHE B CD1 1 
ATOM 1998 C CD2 . PHE B 1 45  ? -6.214  -31.755 -21.678 1.00 12.20  ? 329 PHE B CD2 1 
ATOM 1999 C CE1 . PHE B 1 45  ? -8.059  -33.397 -22.969 1.00 15.73  ? 329 PHE B CE1 1 
ATOM 2000 C CE2 . PHE B 1 45  ? -6.617  -31.461 -22.988 1.00 13.83  ? 329 PHE B CE2 1 
ATOM 2001 C CZ  . PHE B 1 45  ? -7.542  -32.286 -23.633 1.00 13.50  ? 329 PHE B CZ  1 
ATOM 2002 N N   . GLU B 1 46  ? -3.786  -33.614 -17.780 1.00 7.81   ? 330 GLU B N   1 
ATOM 2003 C CA  . GLU B 1 46  ? -3.270  -33.472 -16.434 1.00 8.73   ? 330 GLU B CA  1 
ATOM 2004 C C   . GLU B 1 46  ? -3.308  -31.960 -16.254 1.00 9.81   ? 330 GLU B C   1 
ATOM 2005 O O   . GLU B 1 46  ? -2.453  -31.236 -16.761 1.00 9.69   ? 330 GLU B O   1 
ATOM 2006 C CB  . GLU B 1 46  ? -1.859  -34.041 -16.328 1.00 6.69   ? 330 GLU B CB  1 
ATOM 2007 C CG  . GLU B 1 46  ? -1.846  -35.483 -15.823 1.00 7.06   ? 330 GLU B CG  1 
ATOM 2008 C CD  . GLU B 1 46  ? -0.493  -36.156 -15.984 1.00 8.53   ? 330 GLU B CD  1 
ATOM 2009 O OE1 . GLU B 1 46  ? 0.526   -35.473 -15.757 1.00 5.48   ? 330 GLU B OE1 1 
ATOM 2010 O OE2 . GLU B 1 46  ? -0.450  -37.363 -16.327 1.00 3.41   ? 330 GLU B OE2 1 
ATOM 2011 N N   . MET B 1 47  ? -4.339  -31.495 -15.551 1.00 9.99   ? 331 MET B N   1 
ATOM 2012 C CA  . MET B 1 47  ? -4.570  -30.072 -15.347 1.00 8.15   ? 331 MET B CA  1 
ATOM 2013 C C   . MET B 1 47  ? -4.972  -29.533 -16.714 1.00 10.12  ? 331 MET B C   1 
ATOM 2014 O O   . MET B 1 47  ? -5.902  -30.067 -17.326 1.00 10.83  ? 331 MET B O   1 
ATOM 2015 C CB  . MET B 1 47  ? -3.321  -29.373 -14.825 1.00 5.63   ? 331 MET B CB  1 
ATOM 2016 C CG  . MET B 1 47  ? -2.967  -29.749 -13.390 1.00 8.51   ? 331 MET B CG  1 
ATOM 2017 S SD  . MET B 1 47  ? -4.320  -29.562 -12.183 1.00 13.50  ? 331 MET B SD  1 
ATOM 2018 C CE  . MET B 1 47  ? -4.169  -27.891 -11.708 1.00 11.29  ? 331 MET B CE  1 
ATOM 2019 N N   . ASP B 1 48  ? -4.283  -28.510 -17.218 1.00 10.36  ? 332 ASP B N   1 
ATOM 2020 C CA  . ASP B 1 48  ? -4.641  -27.946 -18.530 1.00 10.84  ? 332 ASP B CA  1 
ATOM 2021 C C   . ASP B 1 48  ? -3.679  -28.373 -19.619 1.00 11.12  ? 332 ASP B C   1 
ATOM 2022 O O   . ASP B 1 48  ? -3.530  -27.683 -20.624 1.00 12.43  ? 332 ASP B O   1 
ATOM 2023 C CB  . ASP B 1 48  ? -4.671  -26.418 -18.477 1.00 10.39  ? 332 ASP B CB  1 
ATOM 2024 C CG  . ASP B 1 48  ? -3.296  -25.807 -18.228 1.00 16.04  ? 332 ASP B CG  1 
ATOM 2025 O OD1 . ASP B 1 48  ? -2.313  -26.556 -18.018 1.00 12.75  ? 332 ASP B OD1 1 
ATOM 2026 O OD2 . ASP B 1 48  ? -3.201  -24.559 -18.236 1.00 21.20  ? 332 ASP B OD2 1 
ATOM 2027 N N   . VAL B 1 49  ? -3.033  -29.513 -19.406 1.00 9.26   ? 333 VAL B N   1 
ATOM 2028 C CA  . VAL B 1 49  ? -2.054  -30.051 -20.336 1.00 8.70   ? 333 VAL B CA  1 
ATOM 2029 C C   . VAL B 1 49  ? -2.460  -31.438 -20.799 1.00 10.56  ? 333 VAL B C   1 
ATOM 2030 O O   . VAL B 1 49  ? -2.784  -32.290 -19.975 1.00 12.71  ? 333 VAL B O   1 
ATOM 2031 C CB  . VAL B 1 49  ? -0.677  -30.179 -19.655 1.00 6.64   ? 333 VAL B CB  1 
ATOM 2032 C CG1 . VAL B 1 49  ? 0.293   -30.880 -20.563 1.00 6.61   ? 333 VAL B CG1 1 
ATOM 2033 C CG2 . VAL B 1 49  ? -0.154  -28.823 -19.288 1.00 10.74  ? 333 VAL B CG2 1 
ATOM 2034 N N   . GLN B 1 50  ? -2.432  -31.680 -22.107 1.00 9.91   ? 334 GLN B N   1 
ATOM 2035 C CA  . GLN B 1 50  ? -2.776  -33.002 -22.596 1.00 10.19  ? 334 GLN B CA  1 
ATOM 2036 C C   . GLN B 1 50  ? -1.541  -33.882 -22.593 1.00 10.77  ? 334 GLN B C   1 
ATOM 2037 O O   . GLN B 1 50  ? -0.519  -33.531 -23.177 1.00 13.54  ? 334 GLN B O   1 
ATOM 2038 C CB  . GLN B 1 50  ? -3.336  -32.957 -24.007 1.00 11.25  ? 334 GLN B CB  1 
ATOM 2039 C CG  . GLN B 1 50  ? -3.752  -34.341 -24.470 1.00 12.84  ? 334 GLN B CG  1 
ATOM 2040 C CD  . GLN B 1 50  ? -4.200  -34.363 -25.899 1.00 14.98  ? 334 GLN B CD  1 
ATOM 2041 O OE1 . GLN B 1 50  ? -4.545  -35.416 -26.436 1.00 17.45  ? 334 GLN B OE1 1 
ATOM 2042 N NE2 . GLN B 1 50  ? -4.199  -33.197 -26.534 1.00 13.99  ? 334 GLN B NE2 1 
ATOM 2043 N N   . VAL B 1 51  ? -1.647  -35.032 -21.936 1.00 11.42  ? 335 VAL B N   1 
ATOM 2044 C CA  . VAL B 1 51  ? -0.545  -35.982 -21.829 1.00 10.04  ? 335 VAL B CA  1 
ATOM 2045 C C   . VAL B 1 51  ? -0.769  -37.187 -22.743 1.00 13.65  ? 335 VAL B C   1 
ATOM 2046 O O   . VAL B 1 51  ? -1.760  -37.902 -22.600 1.00 16.57  ? 335 VAL B O   1 
ATOM 2047 C CB  . VAL B 1 51  ? -0.399  -36.470 -20.371 1.00 6.29   ? 335 VAL B CB  1 
ATOM 2048 C CG1 . VAL B 1 51  ? 0.670   -37.515 -20.281 1.00 7.97   ? 335 VAL B CG1 1 
ATOM 2049 C CG2 . VAL B 1 51  ? -0.057  -35.306 -19.464 1.00 2.78   ? 335 VAL B CG2 1 
ATOM 2050 N N   . GLY B 1 52  ? 0.149   -37.410 -23.679 1.00 12.87  ? 336 GLY B N   1 
ATOM 2051 C CA  . GLY B 1 52  ? 0.008   -38.528 -24.595 1.00 14.05  ? 336 GLY B CA  1 
ATOM 2052 C C   . GLY B 1 52  ? -0.814  -38.139 -25.815 1.00 17.10  ? 336 GLY B C   1 
ATOM 2053 O O   . GLY B 1 52  ? -1.275  -37.003 -25.906 1.00 18.23  ? 336 GLY B O   1 
ATOM 2054 N N   . GLU B 1 53  ? -0.987  -39.075 -26.750 1.00 17.09  ? 337 GLU B N   1 
ATOM 2055 C CA  . GLU B 1 53  ? -1.763  -38.840 -27.969 1.00 16.92  ? 337 GLU B CA  1 
ATOM 2056 C C   . GLU B 1 53  ? -3.244  -39.104 -27.704 1.00 17.14  ? 337 GLU B C   1 
ATOM 2057 O O   . GLU B 1 53  ? -3.621  -39.580 -26.630 1.00 14.61  ? 337 GLU B O   1 
ATOM 2058 C CB  . GLU B 1 53  ? -1.291  -39.766 -29.102 1.00 18.40  ? 337 GLU B CB  1 
ATOM 2059 C CG  . GLU B 1 53  ? 0.170   -39.598 -29.493 0.50 20.98  ? 337 GLU B CG  1 
ATOM 2060 C CD  . GLU B 1 53  ? 0.452   -38.253 -30.138 0.50 22.94  ? 337 GLU B CD  1 
ATOM 2061 O OE1 . GLU B 1 53  ? 1.634   -37.967 -30.426 0.50 22.46  ? 337 GLU B OE1 1 
ATOM 2062 O OE2 . GLU B 1 53  ? -0.510  -37.486 -30.361 0.50 23.94  ? 337 GLU B OE2 1 
ATOM 2063 N N   . THR B 1 54  ? -4.077  -38.782 -28.692 1.00 16.82  ? 338 THR B N   1 
ATOM 2064 C CA  . THR B 1 54  ? -5.514  -38.997 -28.586 1.00 12.36  ? 338 THR B CA  1 
ATOM 2065 C C   . THR B 1 54  ? -5.788  -40.447 -28.912 1.00 11.66  ? 338 THR B C   1 
ATOM 2066 O O   . THR B 1 54  ? -5.312  -40.967 -29.918 1.00 12.41  ? 338 THR B O   1 
ATOM 2067 C CB  . THR B 1 54  ? -6.296  -38.115 -29.560 1.00 10.80  ? 338 THR B CB  1 
ATOM 2068 O OG1 . THR B 1 54  ? -6.335  -36.780 -29.060 1.00 9.16   ? 338 THR B OG1 1 
ATOM 2069 C CG2 . THR B 1 54  ? -7.700  -38.620 -29.711 1.00 12.20  ? 338 THR B CG2 1 
ATOM 2070 N N   . PHE B 1 55  ? -6.560  -41.095 -28.053 1.00 12.01  ? 339 PHE B N   1 
ATOM 2071 C CA  . PHE B 1 55  ? -6.873  -42.500 -28.235 1.00 12.44  ? 339 PHE B CA  1 
ATOM 2072 C C   . PHE B 1 55  ? -8.157  -42.697 -29.017 1.00 13.02  ? 339 PHE B C   1 
ATOM 2073 O O   . PHE B 1 55  ? -9.209  -42.224 -28.613 1.00 15.36  ? 339 PHE B O   1 
ATOM 2074 C CB  . PHE B 1 55  ? -7.002  -43.178 -26.877 1.00 8.07   ? 339 PHE B CB  1 
ATOM 2075 C CG  . PHE B 1 55  ? -7.025  -44.671 -26.952 1.00 6.05   ? 339 PHE B CG  1 
ATOM 2076 C CD1 . PHE B 1 55  ? -5.854  -45.398 -26.836 1.00 2.16   ? 339 PHE B CD1 1 
ATOM 2077 C CD2 . PHE B 1 55  ? -8.224  -45.356 -27.125 1.00 7.67   ? 339 PHE B CD2 1 
ATOM 2078 C CE1 . PHE B 1 55  ? -5.874  -46.791 -26.884 1.00 2.16   ? 339 PHE B CE1 1 
ATOM 2079 C CE2 . PHE B 1 55  ? -8.249  -46.750 -27.174 1.00 5.76   ? 339 PHE B CE2 1 
ATOM 2080 C CZ  . PHE B 1 55  ? -7.072  -47.463 -27.050 1.00 2.16   ? 339 PHE B CZ  1 
ATOM 2081 N N   . LYS B 1 56  ? -8.068  -43.396 -30.140 1.00 14.34  ? 340 LYS B N   1 
ATOM 2082 C CA  . LYS B 1 56  ? -9.246  -43.649 -30.948 1.00 15.06  ? 340 LYS B CA  1 
ATOM 2083 C C   . LYS B 1 56  ? -9.728  -45.068 -30.704 1.00 16.66  ? 340 LYS B C   1 
ATOM 2084 O O   . LYS B 1 56  ? -8.927  -46.002 -30.590 1.00 18.98  ? 340 LYS B O   1 
ATOM 2085 C CB  . LYS B 1 56  ? -8.935  -43.394 -32.419 1.00 14.62  ? 340 LYS B CB  1 
ATOM 2086 C CG  . LYS B 1 56  ? -8.787  -41.904 -32.710 1.00 16.68  ? 340 LYS B CG  1 
ATOM 2087 C CD  . LYS B 1 56  ? -8.563  -41.621 -34.176 1.00 21.83  ? 340 LYS B CD  1 
ATOM 2088 C CE  . LYS B 1 56  ? -7.105  -41.720 -34.535 1.00 27.10  ? 340 LYS B CE  1 
ATOM 2089 N NZ  . LYS B 1 56  ? -6.316  -40.671 -33.829 1.00 32.36  ? 340 LYS B NZ  1 
ATOM 2090 N N   . VAL B 1 57  ? -11.045 -45.213 -30.600 1.00 15.63  ? 341 VAL B N   1 
ATOM 2091 C CA  . VAL B 1 57  ? -11.669 -46.498 -30.314 1.00 15.25  ? 341 VAL B CA  1 
ATOM 2092 C C   . VAL B 1 57  ? -12.556 -46.988 -31.455 1.00 16.49  ? 341 VAL B C   1 
ATOM 2093 O O   . VAL B 1 57  ? -13.639 -46.453 -31.678 1.00 19.23  ? 341 VAL B O   1 
ATOM 2094 C CB  . VAL B 1 57  ? -12.525 -46.390 -29.034 1.00 14.97  ? 341 VAL B CB  1 
ATOM 2095 C CG1 . VAL B 1 57  ? -12.903 -47.769 -28.535 1.00 16.93  ? 341 VAL B CG1 1 
ATOM 2096 C CG2 . VAL B 1 57  ? -11.770 -45.617 -27.971 1.00 12.69  ? 341 VAL B CG2 1 
ATOM 2097 N N   . PRO B 1 58  ? -12.110 -48.023 -32.186 1.00 17.11  ? 342 PRO B N   1 
ATOM 2098 C CA  . PRO B 1 58  ? -12.868 -48.585 -33.308 1.00 15.64  ? 342 PRO B CA  1 
ATOM 2099 C C   . PRO B 1 58  ? -14.282 -48.951 -32.919 1.00 16.21  ? 342 PRO B C   1 
ATOM 2100 O O   . PRO B 1 58  ? -14.513 -49.533 -31.864 1.00 16.37  ? 342 PRO B O   1 
ATOM 2101 C CB  . PRO B 1 58  ? -12.061 -49.818 -33.696 1.00 15.31  ? 342 PRO B CB  1 
ATOM 2102 C CG  . PRO B 1 58  ? -10.676 -49.420 -33.361 1.00 18.41  ? 342 PRO B CG  1 
ATOM 2103 C CD  . PRO B 1 58  ? -10.839 -48.744 -32.015 1.00 17.94  ? 342 PRO B CD  1 
ATOM 2104 N N   . SER B 1 59  ? -15.226 -48.609 -33.785 1.00 17.92  ? 343 SER B N   1 
ATOM 2105 C CA  . SER B 1 59  ? -16.630 -48.904 -33.550 1.00 18.27  ? 343 SER B CA  1 
ATOM 2106 C C   . SER B 1 59  ? -16.803 -50.394 -33.280 1.00 17.18  ? 343 SER B C   1 
ATOM 2107 O O   . SER B 1 59  ? -17.851 -50.834 -32.817 1.00 18.75  ? 343 SER B O   1 
ATOM 2108 C CB  . SER B 1 59  ? -17.449 -48.491 -34.771 1.00 20.62  ? 343 SER B CB  1 
ATOM 2109 O OG  . SER B 1 59  ? -17.284 -47.108 -35.046 1.00 23.44  ? 343 SER B OG  1 
ATOM 2110 N N   . SER B 1 60  ? -15.759 -51.161 -33.572 1.00 17.32  ? 344 SER B N   1 
ATOM 2111 C CA  . SER B 1 60  ? -15.773 -52.603 -33.362 1.00 17.81  ? 344 SER B CA  1 
ATOM 2112 C C   . SER B 1 60  ? -15.361 -52.952 -31.926 1.00 17.12  ? 344 SER B C   1 
ATOM 2113 O O   . SER B 1 60  ? -15.258 -54.125 -31.566 1.00 18.00  ? 344 SER B O   1 
ATOM 2114 C CB  . SER B 1 60  ? -14.822 -53.289 -34.347 1.00 16.71  ? 344 SER B CB  1 
ATOM 2115 O OG  . SER B 1 60  ? -13.475 -53.125 -33.941 1.00 17.68  ? 344 SER B OG  1 
ATOM 2116 N N   . CYS B 1 61  ? -15.108 -51.931 -31.116 1.00 14.94  ? 345 CYS B N   1 
ATOM 2117 C CA  . CYS B 1 61  ? -14.733 -52.135 -29.723 1.00 14.38  ? 345 CYS B CA  1 
ATOM 2118 C C   . CYS B 1 61  ? -15.744 -51.363 -28.923 1.00 14.29  ? 345 CYS B C   1 
ATOM 2119 O O   . CYS B 1 61  ? -15.451 -50.297 -28.393 1.00 15.56  ? 345 CYS B O   1 
ATOM 2120 C CB  . CYS B 1 61  ? -13.336 -51.599 -29.442 1.00 14.07  ? 345 CYS B CB  1 
ATOM 2121 S SG  . CYS B 1 61  ? -12.052 -52.464 -30.343 1.00 21.94  ? 345 CYS B SG  1 
ATOM 2122 N N   . PRO B 1 62  ? -16.965 -51.896 -28.835 1.00 14.31  ? 346 PRO B N   1 
ATOM 2123 C CA  . PRO B 1 62  ? -18.078 -51.286 -28.105 1.00 13.48  ? 346 PRO B CA  1 
ATOM 2124 C C   . PRO B 1 62  ? -17.771 -50.950 -26.649 1.00 12.78  ? 346 PRO B C   1 
ATOM 2125 O O   . PRO B 1 62  ? -18.520 -50.217 -26.009 1.00 17.24  ? 346 PRO B O   1 
ATOM 2126 C CB  . PRO B 1 62  ? -19.193 -52.312 -28.270 1.00 15.06  ? 346 PRO B CB  1 
ATOM 2127 C CG  . PRO B 1 62  ? -18.438 -53.607 -28.409 1.00 13.85  ? 346 PRO B CG  1 
ATOM 2128 C CD  . PRO B 1 62  ? -17.328 -53.234 -29.329 1.00 11.74  ? 346 PRO B CD  1 
ATOM 2129 N N   . ILE B 1 63  ? -16.677 -51.486 -26.124 1.00 9.61   ? 347 ILE B N   1 
ATOM 2130 C CA  . ILE B 1 63  ? -16.286 -51.182 -24.753 1.00 10.83  ? 347 ILE B CA  1 
ATOM 2131 C C   . ILE B 1 63  ? -14.807 -50.855 -24.688 1.00 12.88  ? 347 ILE B C   1 
ATOM 2132 O O   . ILE B 1 63  ? -13.974 -51.697 -24.993 1.00 16.39  ? 347 ILE B O   1 
ATOM 2133 C CB  . ILE B 1 63  ? -16.517 -52.353 -23.793 1.00 9.01   ? 347 ILE B CB  1 
ATOM 2134 C CG1 . ILE B 1 63  ? -17.999 -52.669 -23.684 1.00 6.91   ? 347 ILE B CG1 1 
ATOM 2135 C CG2 . ILE B 1 63  ? -15.980 -51.999 -22.418 1.00 9.47   ? 347 ILE B CG2 1 
ATOM 2136 C CD1 . ILE B 1 63  ? -18.264 -53.850 -22.810 1.00 3.51   ? 347 ILE B CD1 1 
ATOM 2137 N N   . VAL B 1 64  ? -14.475 -49.634 -24.293 1.00 14.33  ? 348 VAL B N   1 
ATOM 2138 C CA  . VAL B 1 64  ? -13.079 -49.250 -24.176 1.00 14.51  ? 348 VAL B CA  1 
ATOM 2139 C C   . VAL B 1 64  ? -12.789 -49.070 -22.696 1.00 15.69  ? 348 VAL B C   1 
ATOM 2140 O O   . VAL B 1 64  ? -13.641 -48.608 -21.936 1.00 15.34  ? 348 VAL B O   1 
ATOM 2141 C CB  . VAL B 1 64  ? -12.778 -47.935 -24.910 1.00 13.38  ? 348 VAL B CB  1 
ATOM 2142 C CG1 . VAL B 1 64  ? -13.535 -46.796 -24.254 1.00 14.33  ? 348 VAL B CG1 1 
ATOM 2143 C CG2 . VAL B 1 64  ? -11.278 -47.666 -24.904 1.00 8.97   ? 348 VAL B CG2 1 
ATOM 2144 N N   . THR B 1 65  ? -11.587 -49.446 -22.285 1.00 15.21  ? 349 THR B N   1 
ATOM 2145 C CA  . THR B 1 65  ? -11.203 -49.324 -20.892 1.00 11.90  ? 349 THR B CA  1 
ATOM 2146 C C   . THR B 1 65  ? -10.079 -48.322 -20.740 1.00 13.32  ? 349 THR B C   1 
ATOM 2147 O O   . THR B 1 65  ? -9.106  -48.338 -21.496 1.00 14.46  ? 349 THR B O   1 
ATOM 2148 C CB  . THR B 1 65  ? -10.733 -50.662 -20.350 1.00 8.64   ? 349 THR B CB  1 
ATOM 2149 O OG1 . THR B 1 65  ? -11.808 -51.601 -20.428 1.00 8.30   ? 349 THR B OG1 1 
ATOM 2150 C CG2 . THR B 1 65  ? -10.274 -50.520 -18.927 1.00 3.67   ? 349 THR B CG2 1 
ATOM 2151 N N   . VAL B 1 66  ? -10.217 -47.453 -19.751 1.00 11.52  ? 350 VAL B N   1 
ATOM 2152 C CA  . VAL B 1 66  ? -9.209  -46.442 -19.478 1.00 7.43   ? 350 VAL B CA  1 
ATOM 2153 C C   . VAL B 1 66  ? -8.784  -46.614 -18.017 1.00 7.26   ? 350 VAL B C   1 
ATOM 2154 O O   . VAL B 1 66  ? -9.449  -46.142 -17.102 1.00 9.62   ? 350 VAL B O   1 
ATOM 2155 C CB  . VAL B 1 66  ? -9.793  -45.035 -19.709 1.00 5.10   ? 350 VAL B CB  1 
ATOM 2156 C CG1 . VAL B 1 66  ? -8.703  -43.987 -19.599 1.00 2.67   ? 350 VAL B CG1 1 
ATOM 2157 C CG2 . VAL B 1 66  ? -10.479 -44.985 -21.066 1.00 2.16   ? 350 VAL B CG2 1 
ATOM 2158 N N   . ASP B 1 67  ? -7.684  -47.318 -17.804 1.00 4.17   ? 351 ASP B N   1 
ATOM 2159 C CA  . ASP B 1 67  ? -7.194  -47.555 -16.459 1.00 3.92   ? 351 ASP B CA  1 
ATOM 2160 C C   . ASP B 1 67  ? -5.865  -46.854 -16.251 1.00 7.47   ? 351 ASP B C   1 
ATOM 2161 O O   . ASP B 1 67  ? -5.414  -46.089 -17.104 1.00 7.23   ? 351 ASP B O   1 
ATOM 2162 C CB  . ASP B 1 67  ? -7.024  -49.051 -16.212 1.00 2.81   ? 351 ASP B CB  1 
ATOM 2163 C CG  . ASP B 1 67  ? -6.139  -49.722 -17.255 1.00 8.71   ? 351 ASP B CG  1 
ATOM 2164 O OD1 . ASP B 1 67  ? -5.035  -49.198 -17.530 1.00 8.50   ? 351 ASP B OD1 1 
ATOM 2165 O OD2 . ASP B 1 67  ? -6.540  -50.780 -17.794 1.00 5.94   ? 351 ASP B OD2 1 
ATOM 2166 N N   . GLY B 1 68  ? -5.235  -47.129 -15.114 1.00 7.72   ? 352 GLY B N   1 
ATOM 2167 C CA  . GLY B 1 68  ? -3.964  -46.504 -14.800 1.00 4.83   ? 352 GLY B CA  1 
ATOM 2168 C C   . GLY B 1 68  ? -2.814  -47.470 -14.925 1.00 3.49   ? 352 GLY B C   1 
ATOM 2169 O O   . GLY B 1 68  ? -1.779  -47.297 -14.281 1.00 2.16   ? 352 GLY B O   1 
ATOM 2170 N N   . TYR B 1 69  ? -3.008  -48.486 -15.761 1.00 5.47   ? 353 TYR B N   1 
ATOM 2171 C CA  . TYR B 1 69  ? -1.995  -49.506 -16.002 1.00 6.51   ? 353 TYR B CA  1 
ATOM 2172 C C   . TYR B 1 69  ? -1.023  -49.092 -17.083 1.00 7.23   ? 353 TYR B C   1 
ATOM 2173 O O   . TYR B 1 69  ? -0.971  -47.916 -17.449 1.00 7.59   ? 353 TYR B O   1 
ATOM 2174 C CB  . TYR B 1 69  ? -2.659  -50.839 -16.334 1.00 10.33  ? 353 TYR B CB  1 
ATOM 2175 C CG  . TYR B 1 69  ? -3.290  -51.428 -15.103 1.00 17.50  ? 353 TYR B CG  1 
ATOM 2176 C CD1 . TYR B 1 69  ? -4.406  -50.833 -14.516 1.00 19.74  ? 353 TYR B CD1 1 
ATOM 2177 C CD2 . TYR B 1 69  ? -2.703  -52.507 -14.448 1.00 23.63  ? 353 TYR B CD2 1 
ATOM 2178 C CE1 . TYR B 1 69  ? -4.913  -51.292 -13.304 1.00 25.93  ? 353 TYR B CE1 1 
ATOM 2179 C CE2 . TYR B 1 69  ? -3.200  -52.977 -13.234 1.00 26.16  ? 353 TYR B CE2 1 
ATOM 2180 C CZ  . TYR B 1 69  ? -4.301  -52.366 -12.664 1.00 28.54  ? 353 TYR B CZ  1 
ATOM 2181 O OH  . TYR B 1 69  ? -4.777  -52.823 -11.451 1.00 31.61  ? 353 TYR B OH  1 
ATOM 2182 N N   . VAL B 1 70  ? -0.272  -50.043 -17.626 1.00 6.64   ? 354 VAL B N   1 
ATOM 2183 C CA  . VAL B 1 70  ? 0.736   -49.660 -18.605 1.00 6.82   ? 354 VAL B CA  1 
ATOM 2184 C C   . VAL B 1 70  ? 0.749   -50.186 -20.028 1.00 7.36   ? 354 VAL B C   1 
ATOM 2185 O O   . VAL B 1 70  ? 1.573   -49.727 -20.808 1.00 7.98   ? 354 VAL B O   1 
ATOM 2186 C CB  . VAL B 1 70  ? 2.149   -49.890 -18.025 1.00 7.30   ? 354 VAL B CB  1 
ATOM 2187 C CG1 . VAL B 1 70  ? 2.301   -49.120 -16.710 1.00 7.44   ? 354 VAL B CG1 1 
ATOM 2188 C CG2 . VAL B 1 70  ? 2.392   -51.383 -17.809 1.00 7.26   ? 354 VAL B CG2 1 
ATOM 2189 N N   . ASP B 1 71  ? -0.133  -51.116 -20.390 1.00 8.34   ? 355 ASP B N   1 
ATOM 2190 C CA  . ASP B 1 71  ? -0.118  -51.636 -21.762 1.00 8.45   ? 355 ASP B CA  1 
ATOM 2191 C C   . ASP B 1 71  ? -0.465  -50.565 -22.794 1.00 10.54  ? 355 ASP B C   1 
ATOM 2192 O O   . ASP B 1 71  ? -1.549  -49.964 -22.756 1.00 10.74  ? 355 ASP B O   1 
ATOM 2193 C CB  . ASP B 1 71  ? -1.076  -52.810 -21.927 1.00 10.58  ? 355 ASP B CB  1 
ATOM 2194 C CG  . ASP B 1 71  ? -0.895  -53.513 -23.259 1.00 14.71  ? 355 ASP B CG  1 
ATOM 2195 O OD1 . ASP B 1 71  ? -0.474  -52.835 -24.215 1.00 16.30  ? 355 ASP B OD1 1 
ATOM 2196 O OD2 . ASP B 1 71  ? -1.174  -54.728 -23.361 1.00 15.78  ? 355 ASP B OD2 1 
ATOM 2197 N N   . PRO B 1 72  ? 0.456   -50.326 -23.747 1.00 13.70  ? 356 PRO B N   1 
ATOM 2198 C CA  . PRO B 1 72  ? 0.346   -49.343 -24.830 1.00 13.93  ? 356 PRO B CA  1 
ATOM 2199 C C   . PRO B 1 72  ? -0.400  -49.813 -26.076 1.00 16.43  ? 356 PRO B C   1 
ATOM 2200 O O   . PRO B 1 72  ? -0.819  -48.995 -26.889 1.00 16.51  ? 356 PRO B O   1 
ATOM 2201 C CB  . PRO B 1 72  ? 1.801   -49.034 -25.137 1.00 10.99  ? 356 PRO B CB  1 
ATOM 2202 C CG  . PRO B 1 72  ? 2.410   -50.383 -25.044 1.00 11.82  ? 356 PRO B CG  1 
ATOM 2203 C CD  . PRO B 1 72  ? 1.792   -50.954 -23.770 1.00 13.33  ? 356 PRO B CD  1 
ATOM 2204 N N   . SER B 1 73  ? -0.549  -51.129 -26.214 1.00 19.97  ? 357 SER B N   1 
ATOM 2205 C CA  . SER B 1 73  ? -1.218  -51.751 -27.356 1.00 20.63  ? 357 SER B CA  1 
ATOM 2206 C C   . SER B 1 73  ? -2.318  -50.948 -28.033 1.00 22.66  ? 357 SER B C   1 
ATOM 2207 O O   . SER B 1 73  ? -2.361  -50.870 -29.253 1.00 26.60  ? 357 SER B O   1 
ATOM 2208 C CB  . SER B 1 73  ? -1.776  -53.113 -26.958 1.00 19.54  ? 357 SER B CB  1 
ATOM 2209 O OG  . SER B 1 73  ? -0.729  -54.025 -26.683 1.00 24.64  ? 357 SER B OG  1 
ATOM 2210 N N   . GLY B 1 74  ? -3.213  -50.348 -27.266 1.00 24.81  ? 358 GLY B N   1 
ATOM 2211 C CA  . GLY B 1 74  ? -4.271  -49.594 -27.908 1.00 25.46  ? 358 GLY B CA  1 
ATOM 2212 C C   . GLY B 1 74  ? -5.455  -50.488 -28.238 1.00 27.61  ? 358 GLY B C   1 
ATOM 2213 O O   . GLY B 1 74  ? -5.601  -51.576 -27.658 1.00 30.86  ? 358 GLY B O   1 
ATOM 2214 N N   . GLY B 1 75  ? -6.300  -50.045 -29.166 1.00 22.50  ? 359 GLY B N   1 
ATOM 2215 C CA  . GLY B 1 75  ? -7.469  -50.827 -29.508 1.00 20.69  ? 359 GLY B CA  1 
ATOM 2216 C C   . GLY B 1 75  ? -8.649  -50.508 -28.602 1.00 20.81  ? 359 GLY B C   1 
ATOM 2217 O O   . GLY B 1 75  ? -9.233  -49.438 -28.723 1.00 21.93  ? 359 GLY B O   1 
ATOM 2218 N N   . ASP B 1 76  ? -8.989  -51.415 -27.681 1.00 21.16  ? 360 ASP B N   1 
ATOM 2219 C CA  . ASP B 1 76  ? -10.133 -51.228 -26.773 1.00 19.93  ? 360 ASP B CA  1 
ATOM 2220 C C   . ASP B 1 76  ? -9.749  -50.917 -25.334 1.00 19.58  ? 360 ASP B C   1 
ATOM 2221 O O   . ASP B 1 76  ? -10.587 -50.954 -24.428 1.00 19.26  ? 360 ASP B O   1 
ATOM 2222 C CB  . ASP B 1 76  ? -11.017 -52.476 -26.759 1.00 20.53  ? 360 ASP B CB  1 
ATOM 2223 C CG  . ASP B 1 76  ? -10.294 -53.690 -26.201 1.00 22.40  ? 360 ASP B CG  1 
ATOM 2224 O OD1 . ASP B 1 76  ? -9.189  -53.510 -25.640 1.00 23.79  ? 360 ASP B OD1 1 
ATOM 2225 O OD2 . ASP B 1 76  ? -10.826 -54.818 -26.319 1.00 20.31  ? 360 ASP B OD2 1 
ATOM 2226 N N   . ARG B 1 77  ? -8.477  -50.637 -25.111 1.00 17.46  ? 361 ARG B N   1 
ATOM 2227 C CA  . ARG B 1 77  ? -8.037  -50.310 -23.773 1.00 12.90  ? 361 ARG B CA  1 
ATOM 2228 C C   . ARG B 1 77  ? -6.970  -49.253 -23.896 1.00 11.25  ? 361 ARG B C   1 
ATOM 2229 O O   . ARG B 1 77  ? -5.975  -49.441 -24.596 1.00 14.63  ? 361 ARG B O   1 
ATOM 2230 C CB  . ARG B 1 77  ? -7.483  -51.545 -23.098 1.00 13.99  ? 361 ARG B CB  1 
ATOM 2231 C CG  . ARG B 1 77  ? -7.178  -51.372 -21.639 1.00 11.15  ? 361 ARG B CG  1 
ATOM 2232 C CD  . ARG B 1 77  ? -6.479  -52.609 -21.130 1.00 8.90   ? 361 ARG B CD  1 
ATOM 2233 N NE  . ARG B 1 77  ? -5.943  -52.400 -19.798 1.00 8.72   ? 361 ARG B NE  1 
ATOM 2234 C CZ  . ARG B 1 77  ? -4.851  -52.995 -19.348 1.00 8.14   ? 361 ARG B CZ  1 
ATOM 2235 N NH1 . ARG B 1 77  ? -4.194  -53.833 -20.140 1.00 2.16   ? 361 ARG B NH1 1 
ATOM 2236 N NH2 . ARG B 1 77  ? -4.416  -52.741 -18.117 1.00 10.07  ? 361 ARG B NH2 1 
ATOM 2237 N N   . PHE B 1 78  ? -7.198  -48.143 -23.210 1.00 6.25   ? 362 PHE B N   1 
ATOM 2238 C CA  . PHE B 1 78  ? -6.307  -46.998 -23.221 1.00 4.59   ? 362 PHE B CA  1 
ATOM 2239 C C   . PHE B 1 78  ? -5.672  -46.808 -21.832 1.00 8.46   ? 362 PHE B C   1 
ATOM 2240 O O   . PHE B 1 78  ? -6.337  -46.366 -20.883 1.00 10.38  ? 362 PHE B O   1 
ATOM 2241 C CB  . PHE B 1 78  ? -7.131  -45.778 -23.649 1.00 2.16   ? 362 PHE B CB  1 
ATOM 2242 C CG  . PHE B 1 78  ? -6.392  -44.476 -23.599 1.00 4.59   ? 362 PHE B CG  1 
ATOM 2243 C CD1 . PHE B 1 78  ? -5.021  -44.413 -23.828 1.00 6.92   ? 362 PHE B CD1 1 
ATOM 2244 C CD2 . PHE B 1 78  ? -7.083  -43.293 -23.375 1.00 4.34   ? 362 PHE B CD2 1 
ATOM 2245 C CE1 . PHE B 1 78  ? -4.356  -43.189 -23.831 1.00 4.35   ? 362 PHE B CE1 1 
ATOM 2246 C CE2 . PHE B 1 78  ? -6.425  -42.067 -23.380 1.00 2.16   ? 362 PHE B CE2 1 
ATOM 2247 C CZ  . PHE B 1 78  ? -5.061  -42.016 -23.607 1.00 2.16   ? 362 PHE B CZ  1 
ATOM 2248 N N   . CYS B 1 79  ? -4.386  -47.150 -21.720 1.00 6.59   ? 363 CYS B N   1 
ATOM 2249 C CA  . CYS B 1 79  ? -3.660  -47.038 -20.454 1.00 4.25   ? 363 CYS B CA  1 
ATOM 2250 C C   . CYS B 1 79  ? -3.021  -45.662 -20.267 1.00 5.28   ? 363 CYS B C   1 
ATOM 2251 O O   . CYS B 1 79  ? -2.557  -45.036 -21.216 1.00 7.26   ? 363 CYS B O   1 
ATOM 2252 C CB  . CYS B 1 79  ? -2.594  -48.140 -20.353 1.00 4.62   ? 363 CYS B CB  1 
ATOM 2253 S SG  . CYS B 1 79  ? -3.250  -49.857 -20.252 1.00 5.07   ? 363 CYS B SG  1 
ATOM 2254 N N   . LEU B 1 80  ? -2.992  -45.197 -19.028 1.00 6.15   ? 364 LEU B N   1 
ATOM 2255 C CA  . LEU B 1 80  ? -2.438  -43.887 -18.731 1.00 6.16   ? 364 LEU B CA  1 
ATOM 2256 C C   . LEU B 1 80  ? -1.216  -43.986 -17.829 1.00 8.00   ? 364 LEU B C   1 
ATOM 2257 O O   . LEU B 1 80  ? -0.458  -43.022 -17.674 1.00 6.23   ? 364 LEU B O   1 
ATOM 2258 C CB  . LEU B 1 80  ? -3.506  -43.037 -18.045 1.00 8.56   ? 364 LEU B CB  1 
ATOM 2259 C CG  . LEU B 1 80  ? -4.922  -43.131 -18.621 1.00 7.43   ? 364 LEU B CG  1 
ATOM 2260 C CD1 . LEU B 1 80  ? -5.848  -42.211 -17.850 1.00 2.16   ? 364 LEU B CD1 1 
ATOM 2261 C CD2 . LEU B 1 80  ? -4.897  -42.772 -20.106 1.00 9.39   ? 364 LEU B CD2 1 
ATOM 2262 N N   . GLY B 1 81  ? -1.027  -45.162 -17.240 1.00 8.86   ? 365 GLY B N   1 
ATOM 2263 C CA  . GLY B 1 81  ? 0.087   -45.372 -16.335 1.00 7.57   ? 365 GLY B CA  1 
ATOM 2264 C C   . GLY B 1 81  ? 1.476   -45.190 -16.908 1.00 7.46   ? 365 GLY B C   1 
ATOM 2265 O O   . GLY B 1 81  ? 2.380   -44.755 -16.193 1.00 9.84   ? 365 GLY B O   1 
ATOM 2266 N N   . GLN B 1 82  ? 1.651   -45.503 -18.188 1.00 6.01   ? 366 GLN B N   1 
ATOM 2267 C CA  . GLN B 1 82  ? 2.961   -45.397 -18.819 1.00 5.45   ? 366 GLN B CA  1 
ATOM 2268 C C   . GLN B 1 82  ? 3.278   -44.049 -19.455 1.00 5.47   ? 366 GLN B C   1 
ATOM 2269 O O   . GLN B 1 82  ? 4.414   -43.804 -19.856 1.00 4.76   ? 366 GLN B O   1 
ATOM 2270 C CB  . GLN B 1 82  ? 3.127   -46.497 -19.868 1.00 5.84   ? 366 GLN B CB  1 
ATOM 2271 C CG  . GLN B 1 82  ? 2.547   -46.162 -21.221 1.00 5.05   ? 366 GLN B CG  1 
ATOM 2272 C CD  . GLN B 1 82  ? 1.063   -46.330 -21.277 1.00 4.43   ? 366 GLN B CD  1 
ATOM 2273 O OE1 . GLN B 1 82  ? 0.391   -46.315 -20.256 1.00 7.79   ? 366 GLN B OE1 1 
ATOM 2274 N NE2 . GLN B 1 82  ? 0.535   -46.478 -22.481 1.00 2.16   ? 366 GLN B NE2 1 
ATOM 2275 N N   . LEU B 1 83  ? 2.280   -43.175 -19.538 1.00 7.06   ? 367 LEU B N   1 
ATOM 2276 C CA  . LEU B 1 83  ? 2.453   -41.848 -20.139 1.00 6.47   ? 367 LEU B CA  1 
ATOM 2277 C C   . LEU B 1 83  ? 3.384   -40.907 -19.363 1.00 6.50   ? 367 LEU B C   1 
ATOM 2278 O O   . LEU B 1 83  ? 3.358   -40.845 -18.129 1.00 2.16   ? 367 LEU B O   1 
ATOM 2279 C CB  . LEU B 1 83  ? 1.091   -41.162 -20.305 1.00 4.62   ? 367 LEU B CB  1 
ATOM 2280 C CG  . LEU B 1 83  ? -0.022  -41.986 -20.949 1.00 6.69   ? 367 LEU B CG  1 
ATOM 2281 C CD1 . LEU B 1 83  ? -1.238  -41.115 -21.171 1.00 4.36   ? 367 LEU B CD1 1 
ATOM 2282 C CD2 . LEU B 1 83  ? 0.463   -42.556 -22.260 1.00 7.11   ? 367 LEU B CD2 1 
ATOM 2283 N N   . SER B 1 84  ? 4.194   -40.164 -20.110 1.00 7.32   ? 368 SER B N   1 
ATOM 2284 C CA  . SER B 1 84  ? 5.121   -39.209 -19.524 1.00 7.34   ? 368 SER B CA  1 
ATOM 2285 C C   . SER B 1 84  ? 4.561   -37.805 -19.640 1.00 7.24   ? 368 SER B C   1 
ATOM 2286 O O   . SER B 1 84  ? 3.649   -37.548 -20.422 1.00 5.11   ? 368 SER B O   1 
ATOM 2287 C CB  . SER B 1 84  ? 6.463   -39.262 -20.241 1.00 6.09   ? 368 SER B CB  1 
ATOM 2288 O OG  . SER B 1 84  ? 7.063   -40.524 -20.058 1.00 16.39  ? 368 SER B OG  1 
ATOM 2289 N N   . ASN B 1 85  ? 5.121   -36.895 -18.855 1.00 8.68   ? 369 ASN B N   1 
ATOM 2290 C CA  . ASN B 1 85  ? 4.699   -35.503 -18.881 1.00 8.32   ? 369 ASN B CA  1 
ATOM 2291 C C   . ASN B 1 85  ? 5.684   -34.672 -18.071 1.00 10.36  ? 369 ASN B C   1 
ATOM 2292 O O   . ASN B 1 85  ? 5.580   -34.602 -16.848 1.00 8.36   ? 369 ASN B O   1 
ATOM 2293 C CB  . ASN B 1 85  ? 3.296   -35.373 -18.312 1.00 6.51   ? 369 ASN B CB  1 
ATOM 2294 C CG  . ASN B 1 85  ? 2.905   -33.950 -18.102 1.00 5.80   ? 369 ASN B CG  1 
ATOM 2295 O OD1 . ASN B 1 85  ? 3.328   -33.073 -18.856 1.00 7.11   ? 369 ASN B OD1 1 
ATOM 2296 N ND2 . ASN B 1 85  ? 2.086   -33.698 -17.084 1.00 2.16   ? 369 ASN B ND2 1 
ATOM 2297 N N   . VAL B 1 86  ? 6.634   -34.044 -18.767 1.00 13.22  ? 370 VAL B N   1 
ATOM 2298 C CA  . VAL B 1 86  ? 7.693   -33.250 -18.137 1.00 14.05  ? 370 VAL B CA  1 
ATOM 2299 C C   . VAL B 1 86  ? 7.264   -32.192 -17.138 1.00 16.92  ? 370 VAL B C   1 
ATOM 2300 O O   . VAL B 1 86  ? 8.081   -31.760 -16.322 1.00 19.20  ? 370 VAL B O   1 
ATOM 2301 C CB  . VAL B 1 86  ? 8.595   -32.575 -19.191 1.00 11.11  ? 370 VAL B CB  1 
ATOM 2302 C CG1 . VAL B 1 86  ? 9.131   -33.618 -20.135 1.00 9.49   ? 370 VAL B CG1 1 
ATOM 2303 C CG2 . VAL B 1 86  ? 7.829   -31.512 -19.942 1.00 9.81   ? 370 VAL B CG2 1 
ATOM 2304 N N   . HIS B 1 87  ? 5.996   -31.784 -17.192 1.00 18.28  ? 371 HIS B N   1 
ATOM 2305 C CA  . HIS B 1 87  ? 5.462   -30.771 -16.275 1.00 19.68  ? 371 HIS B CA  1 
ATOM 2306 C C   . HIS B 1 87  ? 4.710   -31.370 -15.088 1.00 18.92  ? 371 HIS B C   1 
ATOM 2307 O O   . HIS B 1 87  ? 4.274   -30.654 -14.193 1.00 21.99  ? 371 HIS B O   1 
ATOM 2308 C CB  . HIS B 1 87  ? 4.526   -29.837 -17.029 1.00 18.94  ? 371 HIS B CB  1 
ATOM 2309 C CG  . HIS B 1 87  ? 5.167   -29.164 -18.192 1.00 21.36  ? 371 HIS B CG  1 
ATOM 2310 N ND1 . HIS B 1 87  ? 4.493   -28.908 -19.365 1.00 24.77  ? 371 HIS B ND1 1 
ATOM 2311 C CD2 . HIS B 1 87  ? 6.426   -28.699 -18.368 1.00 23.82  ? 371 HIS B CD2 1 
ATOM 2312 C CE1 . HIS B 1 87  ? 5.311   -28.316 -20.217 1.00 28.32  ? 371 HIS B CE1 1 
ATOM 2313 N NE2 . HIS B 1 87  ? 6.490   -28.178 -19.636 1.00 28.58  ? 371 HIS B NE2 1 
ATOM 2314 N N   . ARG B 1 88  ? 4.549   -32.683 -15.092 1.00 17.84  ? 372 ARG B N   1 
ATOM 2315 C CA  . ARG B 1 88  ? 3.848   -33.370 -14.021 1.00 18.96  ? 372 ARG B CA  1 
ATOM 2316 C C   . ARG B 1 88  ? 4.368   -32.931 -12.656 1.00 21.07  ? 372 ARG B C   1 
ATOM 2317 O O   . ARG B 1 88  ? 5.569   -32.746 -12.477 1.00 23.85  ? 372 ARG B O   1 
ATOM 2318 C CB  . ARG B 1 88  ? 4.022   -34.881 -14.195 1.00 15.93  ? 372 ARG B CB  1 
ATOM 2319 C CG  . ARG B 1 88  ? 3.222   -35.735 -13.242 1.00 12.44  ? 372 ARG B CG  1 
ATOM 2320 C CD  . ARG B 1 88  ? 3.269   -37.174 -13.697 1.00 15.03  ? 372 ARG B CD  1 
ATOM 2321 N NE  . ARG B 1 88  ? 2.646   -37.352 -15.006 1.00 16.27  ? 372 ARG B NE  1 
ATOM 2322 C CZ  . ARG B 1 88  ? 2.671   -38.489 -15.697 1.00 19.69  ? 372 ARG B CZ  1 
ATOM 2323 N NH1 . ARG B 1 88  ? 3.293   -39.550 -15.208 1.00 24.29  ? 372 ARG B NH1 1 
ATOM 2324 N NH2 . ARG B 1 88  ? 2.069   -38.575 -16.872 1.00 19.76  ? 372 ARG B NH2 1 
ATOM 2325 N N   . THR B 1 89  ? 3.455   -32.746 -11.705 1.00 23.47  ? 373 THR B N   1 
ATOM 2326 C CA  . THR B 1 89  ? 3.820   -32.345 -10.349 1.00 23.74  ? 373 THR B CA  1 
ATOM 2327 C C   . THR B 1 89  ? 3.671   -33.531 -9.407  1.00 27.30  ? 373 THR B C   1 
ATOM 2328 O O   . THR B 1 89  ? 3.250   -34.623 -9.808  1.00 26.97  ? 373 THR B O   1 
ATOM 2329 C CB  . THR B 1 89  ? 2.917   -31.239 -9.804  1.00 20.05  ? 373 THR B CB  1 
ATOM 2330 O OG1 . THR B 1 89  ? 1.596   -31.752 -9.640  1.00 19.21  ? 373 THR B OG1 1 
ATOM 2331 C CG2 . THR B 1 89  ? 2.875   -30.077 -10.744 1.00 20.90  ? 373 THR B CG2 1 
ATOM 2332 N N   . GLU B 1 90  ? 4.001   -33.292 -8.142  1.00 30.52  ? 374 GLU B N   1 
ATOM 2333 C CA  . GLU B 1 90  ? 3.926   -34.320 -7.112  1.00 29.91  ? 374 GLU B CA  1 
ATOM 2334 C C   . GLU B 1 90  ? 2.475   -34.581 -6.711  1.00 23.78  ? 374 GLU B C   1 
ATOM 2335 O O   . GLU B 1 90  ? 2.173   -35.583 -6.075  1.00 21.32  ? 374 GLU B O   1 
ATOM 2336 C CB  . GLU B 1 90  ? 4.739   -33.882 -5.894  1.00 34.84  ? 374 GLU B CB  1 
ATOM 2337 C CG  . GLU B 1 90  ? 5.109   -35.003 -4.953  1.00 44.55  ? 374 GLU B CG  1 
ATOM 2338 C CD  . GLU B 1 90  ? 5.927   -34.513 -3.768  1.00 52.69  ? 374 GLU B CD  1 
ATOM 2339 O OE1 . GLU B 1 90  ? 6.996   -33.892 -3.988  1.00 52.23  ? 374 GLU B OE1 1 
ATOM 2340 O OE2 . GLU B 1 90  ? 5.498   -34.751 -2.614  1.00 58.16  ? 374 GLU B OE2 1 
ATOM 2341 N N   . ALA B 1 91  ? 1.582   -33.675 -7.086  1.00 19.25  ? 375 ALA B N   1 
ATOM 2342 C CA  . ALA B 1 91  ? 0.178   -33.837 -6.762  1.00 17.41  ? 375 ALA B CA  1 
ATOM 2343 C C   . ALA B 1 91  ? -0.452  -34.749 -7.793  1.00 19.48  ? 375 ALA B C   1 
ATOM 2344 O O   . ALA B 1 91  ? -1.243  -35.638 -7.459  1.00 18.49  ? 375 ALA B O   1 
ATOM 2345 C CB  . ALA B 1 91  ? -0.514  -32.501 -6.770  1.00 15.40  ? 375 ALA B CB  1 
ATOM 2346 N N   . ILE B 1 92  ? -0.096  -34.518 -9.055  1.00 19.91  ? 376 ILE B N   1 
ATOM 2347 C CA  . ILE B 1 92  ? -0.623  -35.318 -10.153 1.00 19.71  ? 376 ILE B CA  1 
ATOM 2348 C C   . ILE B 1 92  ? -0.159  -36.752 -9.974  1.00 22.56  ? 376 ILE B C   1 
ATOM 2349 O O   . ILE B 1 92  ? -0.841  -37.695 -10.376 1.00 21.99  ? 376 ILE B O   1 
ATOM 2350 C CB  . ILE B 1 92  ? -0.129  -34.795 -11.503 1.00 16.07  ? 376 ILE B CB  1 
ATOM 2351 C CG1 . ILE B 1 92  ? -0.656  -33.380 -11.723 1.00 10.71  ? 376 ILE B CG1 1 
ATOM 2352 C CG2 . ILE B 1 92  ? -0.564  -35.735 -12.614 1.00 13.96  ? 376 ILE B CG2 1 
ATOM 2353 C CD1 . ILE B 1 92  ? -0.221  -32.768 -13.015 1.00 7.69   ? 376 ILE B CD1 1 
ATOM 2354 N N   . GLU B 1 93  ? 1.013   -36.906 -9.369  1.00 24.48  ? 377 GLU B N   1 
ATOM 2355 C CA  . GLU B 1 93  ? 1.557   -38.225 -9.109  1.00 26.31  ? 377 GLU B CA  1 
ATOM 2356 C C   . GLU B 1 93  ? 0.699   -38.910 -8.048  1.00 27.74  ? 377 GLU B C   1 
ATOM 2357 O O   . GLU B 1 93  ? 0.336   -40.084 -8.187  1.00 28.38  ? 377 GLU B O   1 
ATOM 2358 C CB  . GLU B 1 93  ? 2.998   -38.108 -8.629  1.00 26.58  ? 377 GLU B CB  1 
ATOM 2359 C CG  . GLU B 1 93  ? 3.973   -37.780 -9.734  1.00 27.12  ? 377 GLU B CG  1 
ATOM 2360 C CD  . GLU B 1 93  ? 5.377   -37.608 -9.215  1.00 28.92  ? 377 GLU B CD  1 
ATOM 2361 O OE1 . GLU B 1 93  ? 5.676   -38.168 -8.140  1.00 28.08  ? 377 GLU B OE1 1 
ATOM 2362 O OE2 . GLU B 1 93  ? 6.181   -36.924 -9.884  1.00 31.46  ? 377 GLU B OE2 1 
ATOM 2363 N N   . ARG B 1 94  ? 0.366   -38.172 -6.991  1.00 27.03  ? 378 ARG B N   1 
ATOM 2364 C CA  . ARG B 1 94  ? -0.459  -38.733 -5.931  1.00 25.35  ? 378 ARG B CA  1 
ATOM 2365 C C   . ARG B 1 94  ? -1.779  -39.224 -6.510  1.00 20.90  ? 378 ARG B C   1 
ATOM 2366 O O   . ARG B 1 94  ? -2.151  -40.374 -6.300  1.00 22.07  ? 378 ARG B O   1 
ATOM 2367 C CB  . ARG B 1 94  ? -0.716  -37.701 -4.825  1.00 28.58  ? 378 ARG B CB  1 
ATOM 2368 C CG  . ARG B 1 94  ? 0.539   -37.246 -4.098  1.00 35.88  ? 378 ARG B CG  1 
ATOM 2369 C CD  . ARG B 1 94  ? 1.358   -38.434 -3.613  1.00 45.35  ? 378 ARG B CD  1 
ATOM 2370 N NE  . ARG B 1 94  ? 2.759   -38.084 -3.362  1.00 54.63  ? 378 ARG B NE  1 
ATOM 2371 C CZ  . ARG B 1 94  ? 3.759   -38.966 -3.324  1.00 58.93  ? 378 ARG B CZ  1 
ATOM 2372 N NH1 . ARG B 1 94  ? 3.521   -40.262 -3.522  1.00 58.37  ? 378 ARG B NH1 1 
ATOM 2373 N NH2 . ARG B 1 94  ? 5.003   -38.553 -3.098  1.00 60.94  ? 378 ARG B NH2 1 
ATOM 2374 N N   . ALA B 1 95  ? -2.470  -38.363 -7.254  1.00 14.83  ? 379 ALA B N   1 
ATOM 2375 C CA  . ALA B 1 95  ? -3.746  -38.729 -7.852  1.00 9.79   ? 379 ALA B CA  1 
ATOM 2376 C C   . ALA B 1 95  ? -3.640  -39.916 -8.796  1.00 10.64  ? 379 ALA B C   1 
ATOM 2377 O O   . ALA B 1 95  ? -4.400  -40.882 -8.674  1.00 11.64  ? 379 ALA B O   1 
ATOM 2378 C CB  . ALA B 1 95  ? -4.326  -37.551 -8.588  1.00 9.19   ? 379 ALA B CB  1 
ATOM 2379 N N   . ARG B 1 96  ? -2.702  -39.850 -9.740  1.00 10.54  ? 380 ARG B N   1 
ATOM 2380 C CA  . ARG B 1 96  ? -2.521  -40.928 -10.716 1.00 10.29  ? 380 ARG B CA  1 
ATOM 2381 C C   . ARG B 1 96  ? -2.422  -42.298 -10.058 1.00 11.37  ? 380 ARG B C   1 
ATOM 2382 O O   . ARG B 1 96  ? -2.675  -43.332 -10.689 1.00 11.61  ? 380 ARG B O   1 
ATOM 2383 C CB  . ARG B 1 96  ? -1.271  -40.678 -11.558 1.00 7.55   ? 380 ARG B CB  1 
ATOM 2384 C CG  . ARG B 1 96  ? -1.485  -39.739 -12.720 1.00 8.11   ? 380 ARG B CG  1 
ATOM 2385 C CD  . ARG B 1 96  ? -0.167  -39.272 -13.314 1.00 9.81   ? 380 ARG B CD  1 
ATOM 2386 N NE  . ARG B 1 96  ? 0.583   -40.339 -13.965 1.00 10.22  ? 380 ARG B NE  1 
ATOM 2387 C CZ  . ARG B 1 96  ? 0.162   -40.989 -15.044 1.00 13.70  ? 380 ARG B CZ  1 
ATOM 2388 N NH1 . ARG B 1 96  ? -1.006  -40.671 -15.581 1.00 15.19  ? 380 ARG B NH1 1 
ATOM 2389 N NH2 . ARG B 1 96  ? 0.911   -41.945 -15.596 1.00 13.82  ? 380 ARG B NH2 1 
ATOM 2390 N N   . LEU B 1 97  ? -2.052  -42.292 -8.782  1.00 11.94  ? 381 LEU B N   1 
ATOM 2391 C CA  . LEU B 1 97  ? -1.903  -43.518 -8.011  1.00 11.21  ? 381 LEU B CA  1 
ATOM 2392 C C   . LEU B 1 97  ? -3.225  -44.222 -7.836  1.00 10.03  ? 381 LEU B C   1 
ATOM 2393 O O   . LEU B 1 97  ? -3.307  -45.437 -7.964  1.00 8.73   ? 381 LEU B O   1 
ATOM 2394 C CB  . LEU B 1 97  ? -1.318  -43.197 -6.638  1.00 11.76  ? 381 LEU B CB  1 
ATOM 2395 C CG  . LEU B 1 97  ? 0.062   -43.752 -6.286  1.00 10.64  ? 381 LEU B CG  1 
ATOM 2396 C CD1 . LEU B 1 97  ? 0.942   -43.857 -7.512  1.00 12.28  ? 381 LEU B CD1 1 
ATOM 2397 C CD2 . LEU B 1 97  ? 0.688   -42.834 -5.258  1.00 11.47  ? 381 LEU B CD2 1 
ATOM 2398 N N   . HIS B 1 98  ? -4.263  -43.438 -7.579  1.00 11.16  ? 382 HIS B N   1 
ATOM 2399 C CA  . HIS B 1 98  ? -5.589  -43.977 -7.338  1.00 14.50  ? 382 HIS B CA  1 
ATOM 2400 C C   . HIS B 1 98  ? -6.501  -44.273 -8.524  1.00 15.19  ? 382 HIS B C   1 
ATOM 2401 O O   . HIS B 1 98  ? -7.580  -44.841 -8.340  1.00 15.57  ? 382 HIS B O   1 
ATOM 2402 C CB  . HIS B 1 98  ? -6.285  -43.077 -6.339  1.00 17.73  ? 382 HIS B CB  1 
ATOM 2403 C CG  . HIS B 1 98  ? -5.559  -42.983 -5.037  1.00 20.20  ? 382 HIS B CG  1 
ATOM 2404 N ND1 . HIS B 1 98  ? -5.393  -44.068 -4.203  1.00 21.25  ? 382 HIS B ND1 1 
ATOM 2405 C CD2 . HIS B 1 98  ? -4.925  -41.947 -4.440  1.00 18.94  ? 382 HIS B CD2 1 
ATOM 2406 C CE1 . HIS B 1 98  ? -4.689  -43.702 -3.147  1.00 21.65  ? 382 HIS B CE1 1 
ATOM 2407 N NE2 . HIS B 1 98  ? -4.393  -42.420 -3.266  1.00 20.26  ? 382 HIS B NE2 1 
ATOM 2408 N N   . ILE B 1 99  ? -6.079  -43.906 -9.732  1.00 14.70  ? 383 ILE B N   1 
ATOM 2409 C CA  . ILE B 1 99  ? -6.872  -44.206 -10.926 1.00 11.68  ? 383 ILE B CA  1 
ATOM 2410 C C   . ILE B 1 99  ? -7.150  -45.717 -10.968 1.00 10.09  ? 383 ILE B C   1 
ATOM 2411 O O   . ILE B 1 99  ? -8.287  -46.135 -11.140 1.00 10.32  ? 383 ILE B O   1 
ATOM 2412 C CB  . ILE B 1 99  ? -6.126  -43.813 -12.228 1.00 11.07  ? 383 ILE B CB  1 
ATOM 2413 C CG1 . ILE B 1 99  ? -5.886  -42.305 -12.260 1.00 7.32   ? 383 ILE B CG1 1 
ATOM 2414 C CG2 . ILE B 1 99  ? -6.924  -44.273 -13.449 1.00 9.17   ? 383 ILE B CG2 1 
ATOM 2415 C CD1 . ILE B 1 99  ? -5.198  -41.841 -13.501 1.00 2.27   ? 383 ILE B CD1 1 
ATOM 2416 N N   . GLY B 1 100 ? -6.097  -46.520 -10.816 1.00 9.16   ? 384 GLY B N   1 
ATOM 2417 C CA  . GLY B 1 100 ? -6.230  -47.969 -10.817 1.00 7.18   ? 384 GLY B CA  1 
ATOM 2418 C C   . GLY B 1 100 ? -7.004  -48.588 -11.964 1.00 9.22   ? 384 GLY B C   1 
ATOM 2419 O O   . GLY B 1 100 ? -6.749  -48.289 -13.127 1.00 9.76   ? 384 GLY B O   1 
ATOM 2420 N N   . LYS B 1 101 ? -7.947  -49.466 -11.631 1.00 12.25  ? 385 LYS B N   1 
ATOM 2421 C CA  . LYS B 1 101 ? -8.775  -50.146 -12.625 1.00 14.67  ? 385 LYS B CA  1 
ATOM 2422 C C   . LYS B 1 101 ? -9.545  -49.188 -13.536 1.00 13.85  ? 385 LYS B C   1 
ATOM 2423 O O   . LYS B 1 101 ? -10.157 -49.619 -14.517 1.00 11.56  ? 385 LYS B O   1 
ATOM 2424 C CB  . LYS B 1 101 ? -9.760  -51.088 -11.932 1.00 19.44  ? 385 LYS B CB  1 
ATOM 2425 C CG  . LYS B 1 101 ? -9.142  -52.333 -11.339 1.00 24.22  ? 385 LYS B CG  1 
ATOM 2426 C CD  . LYS B 1 101 ? -8.587  -53.228 -12.435 1.00 33.11  ? 385 LYS B CD  1 
ATOM 2427 C CE  . LYS B 1 101 ? -8.228  -54.613 -11.904 1.00 37.58  ? 385 LYS B CE  1 
ATOM 2428 N NZ  . LYS B 1 101 ? -7.289  -54.572 -10.743 1.00 39.58  ? 385 LYS B NZ  1 
ATOM 2429 N N   . GLY B 1 102 ? -9.529  -47.902 -13.182 1.00 14.93  ? 386 GLY B N   1 
ATOM 2430 C CA  . GLY B 1 102 ? -10.175 -46.857 -13.971 1.00 16.08  ? 386 GLY B CA  1 
ATOM 2431 C C   . GLY B 1 102 ? -11.662 -46.953 -14.248 1.00 16.34  ? 386 GLY B C   1 
ATOM 2432 O O   . GLY B 1 102 ? -12.468 -47.026 -13.319 1.00 17.75  ? 386 GLY B O   1 
ATOM 2433 N N   . VAL B 1 103 ? -12.023 -46.921 -15.531 1.00 15.85  ? 387 VAL B N   1 
ATOM 2434 C CA  . VAL B 1 103 ? -13.423 -47.017 -15.950 1.00 15.11  ? 387 VAL B CA  1 
ATOM 2435 C C   . VAL B 1 103 ? -13.619 -47.695 -17.302 1.00 15.94  ? 387 VAL B C   1 
ATOM 2436 O O   . VAL B 1 103 ? -12.673 -47.911 -18.070 1.00 16.05  ? 387 VAL B O   1 
ATOM 2437 C CB  . VAL B 1 103 ? -14.095 -45.640 -16.080 1.00 13.06  ? 387 VAL B CB  1 
ATOM 2438 C CG1 . VAL B 1 103 ? -13.917 -44.843 -14.802 1.00 15.39  ? 387 VAL B CG1 1 
ATOM 2439 C CG2 . VAL B 1 103 ? -13.532 -44.909 -17.287 1.00 11.47  ? 387 VAL B CG2 1 
ATOM 2440 N N   . GLN B 1 104 ? -14.876 -48.016 -17.577 1.00 14.43  ? 388 GLN B N   1 
ATOM 2441 C CA  . GLN B 1 104 ? -15.261 -48.628 -18.828 1.00 14.69  ? 388 GLN B CA  1 
ATOM 2442 C C   . GLN B 1 104 ? -16.297 -47.729 -19.463 1.00 16.50  ? 388 GLN B C   1 
ATOM 2443 O O   . GLN B 1 104 ? -17.261 -47.327 -18.812 1.00 18.35  ? 388 GLN B O   1 
ATOM 2444 C CB  . GLN B 1 104 ? -15.896 -49.990 -18.609 1.00 15.56  ? 388 GLN B CB  1 
ATOM 2445 C CG  . GLN B 1 104 ? -14.938 -51.127 -18.434 1.00 19.07  ? 388 GLN B CG  1 
ATOM 2446 C CD  . GLN B 1 104 ? -15.634 -52.473 -18.561 1.00 22.61  ? 388 GLN B CD  1 
ATOM 2447 O OE1 . GLN B 1 104 ? -14.996 -53.525 -18.470 1.00 23.25  ? 388 GLN B OE1 1 
ATOM 2448 N NE2 . GLN B 1 104 ? -16.952 -52.444 -18.778 1.00 20.79  ? 388 GLN B NE2 1 
ATOM 2449 N N   . LEU B 1 105 ? -16.082 -47.401 -20.730 1.00 17.18  ? 389 LEU B N   1 
ATOM 2450 C CA  . LEU B 1 105 ? -17.007 -46.581 -21.490 1.00 15.54  ? 389 LEU B CA  1 
ATOM 2451 C C   . LEU B 1 105 ? -17.592 -47.576 -22.478 1.00 19.01  ? 389 LEU B C   1 
ATOM 2452 O O   . LEU B 1 105 ? -16.886 -48.112 -23.331 1.00 19.39  ? 389 LEU B O   1 
ATOM 2453 C CB  . LEU B 1 105 ? -16.253 -45.469 -22.211 1.00 11.57  ? 389 LEU B CB  1 
ATOM 2454 C CG  . LEU B 1 105 ? -15.417 -44.627 -21.252 1.00 9.40   ? 389 LEU B CG  1 
ATOM 2455 C CD1 . LEU B 1 105 ? -14.742 -43.490 -21.985 1.00 9.39   ? 389 LEU B CD1 1 
ATOM 2456 C CD2 . LEU B 1 105 ? -16.321 -44.098 -20.169 1.00 11.66  ? 389 LEU B CD2 1 
ATOM 2457 N N   . GLU B 1 106 ? -18.883 -47.841 -22.334 1.00 20.71  ? 390 GLU B N   1 
ATOM 2458 C CA  . GLU B 1 106 ? -19.566 -48.804 -23.178 1.00 20.70  ? 390 GLU B CA  1 
ATOM 2459 C C   . GLU B 1 106 ? -20.555 -48.132 -24.105 1.00 19.31  ? 390 GLU B C   1 
ATOM 2460 O O   . GLU B 1 106 ? -21.409 -47.358 -23.674 1.00 17.92  ? 390 GLU B O   1 
ATOM 2461 C CB  . GLU B 1 106 ? -20.298 -49.810 -22.298 1.00 25.18  ? 390 GLU B CB  1 
ATOM 2462 C CG  . GLU B 1 106 ? -20.964 -50.942 -23.034 1.00 30.70  ? 390 GLU B CG  1 
ATOM 2463 C CD  . GLU B 1 106 ? -21.889 -51.726 -22.129 1.00 35.15  ? 390 GLU B CD  1 
ATOM 2464 O OE1 . GLU B 1 106 ? -21.519 -51.971 -20.957 1.00 35.27  ? 390 GLU B OE1 1 
ATOM 2465 O OE2 . GLU B 1 106 ? -22.983 -52.102 -22.594 1.00 36.98  ? 390 GLU B OE2 1 
ATOM 2466 N N   . CYS B 1 107 ? -20.438 -48.448 -25.385 1.00 18.33  ? 391 CYS B N   1 
ATOM 2467 C CA  . CYS B 1 107 ? -21.317 -47.888 -26.392 1.00 18.81  ? 391 CYS B CA  1 
ATOM 2468 C C   . CYS B 1 107 ? -22.419 -48.876 -26.789 1.00 19.65  ? 391 CYS B C   1 
ATOM 2469 O O   . CYS B 1 107 ? -22.150 -49.912 -27.412 1.00 17.57  ? 391 CYS B O   1 
ATOM 2470 C CB  . CYS B 1 107 ? -20.503 -47.501 -27.622 1.00 18.40  ? 391 CYS B CB  1 
ATOM 2471 S SG  . CYS B 1 107 ? -21.498 -46.845 -28.946 1.00 14.66  ? 391 CYS B SG  1 
ATOM 2472 N N   . LYS B 1 108 ? -23.653 -48.541 -26.416 1.00 18.60  ? 392 LYS B N   1 
ATOM 2473 C CA  . LYS B 1 108 ? -24.820 -49.358 -26.716 1.00 18.86  ? 392 LYS B CA  1 
ATOM 2474 C C   . LYS B 1 108 ? -25.665 -48.705 -27.809 1.00 21.32  ? 392 LYS B C   1 
ATOM 2475 O O   . LYS B 1 108 ? -25.553 -47.504 -28.049 1.00 24.42  ? 392 LYS B O   1 
ATOM 2476 C CB  . LYS B 1 108 ? -25.682 -49.521 -25.466 1.00 18.57  ? 392 LYS B CB  1 
ATOM 2477 C CG  . LYS B 1 108 ? -25.112 -50.389 -24.357 1.00 19.09  ? 392 LYS B CG  1 
ATOM 2478 C CD  . LYS B 1 108 ? -26.103 -50.454 -23.196 1.00 20.71  ? 392 LYS B CD  1 
ATOM 2479 C CE  . LYS B 1 108 ? -25.647 -51.378 -22.077 1.00 24.89  ? 392 LYS B CE  1 
ATOM 2480 N NZ  . LYS B 1 108 ? -26.677 -51.539 -20.999 1.00 27.10  ? 392 LYS B NZ  1 
ATOM 2481 N N   . GLY B 1 109 ? -26.517 -49.494 -28.459 1.00 22.72  ? 393 GLY B N   1 
ATOM 2482 C CA  . GLY B 1 109 ? -27.383 -48.971 -29.506 1.00 24.90  ? 393 GLY B CA  1 
ATOM 2483 C C   . GLY B 1 109 ? -26.636 -48.294 -30.637 1.00 27.95  ? 393 GLY B C   1 
ATOM 2484 O O   . GLY B 1 109 ? -25.528 -48.710 -30.984 1.00 29.56  ? 393 GLY B O   1 
ATOM 2485 N N   . GLU B 1 110 ? -27.229 -47.255 -31.224 1.00 29.61  ? 394 GLU B N   1 
ATOM 2486 C CA  . GLU B 1 110 ? -26.561 -46.544 -32.313 1.00 30.27  ? 394 GLU B CA  1 
ATOM 2487 C C   . GLU B 1 110 ? -25.378 -45.768 -31.744 1.00 28.50  ? 394 GLU B C   1 
ATOM 2488 O O   . GLU B 1 110 ? -24.301 -45.740 -32.338 1.00 28.26  ? 394 GLU B O   1 
ATOM 2489 C CB  . GLU B 1 110 ? -27.520 -45.576 -33.023 1.00 33.12  ? 394 GLU B CB  1 
ATOM 2490 C CG  . GLU B 1 110 ? -26.991 -45.061 -34.374 1.00 38.20  ? 394 GLU B CG  1 
ATOM 2491 C CD  . GLU B 1 110 ? -28.028 -44.277 -35.194 1.00 42.48  ? 394 GLU B CD  1 
ATOM 2492 O OE1 . GLU B 1 110 ? -29.161 -44.773 -35.391 1.00 43.02  ? 394 GLU B OE1 1 
ATOM 2493 O OE2 . GLU B 1 110 ? -27.703 -43.163 -35.658 1.00 44.10  ? 394 GLU B OE2 1 
ATOM 2494 N N   . GLY B 1 111 ? -25.574 -45.156 -30.580 1.00 25.27  ? 395 GLY B N   1 
ATOM 2495 C CA  . GLY B 1 111 ? -24.499 -44.389 -29.986 1.00 20.46  ? 395 GLY B CA  1 
ATOM 2496 C C   . GLY B 1 111 ? -24.687 -43.969 -28.545 1.00 17.25  ? 395 GLY B C   1 
ATOM 2497 O O   . GLY B 1 111 ? -24.206 -42.912 -28.141 1.00 13.91  ? 395 GLY B O   1 
ATOM 2498 N N   . ASP B 1 112 ? -25.391 -44.781 -27.769 1.00 17.23  ? 396 ASP B N   1 
ATOM 2499 C CA  . ASP B 1 112 ? -25.591 -44.481 -26.353 1.00 19.68  ? 396 ASP B CA  1 
ATOM 2500 C C   . ASP B 1 112 ? -24.295 -44.810 -25.613 1.00 18.40  ? 396 ASP B C   1 
ATOM 2501 O O   . ASP B 1 112 ? -23.548 -45.701 -26.019 1.00 18.90  ? 396 ASP B O   1 
ATOM 2502 C CB  . ASP B 1 112 ? -26.740 -45.316 -25.789 1.00 20.62  ? 396 ASP B CB  1 
ATOM 2503 C CG  . ASP B 1 112 ? -28.102 -44.818 -26.238 1.00 24.01  ? 396 ASP B CG  1 
ATOM 2504 O OD1 . ASP B 1 112 ? -28.208 -44.208 -27.324 1.00 25.38  ? 396 ASP B OD1 1 
ATOM 2505 O OD2 . ASP B 1 112 ? -29.079 -45.052 -25.504 1.00 28.66  ? 396 ASP B OD2 1 
ATOM 2506 N N   . VAL B 1 113 ? -24.020 -44.097 -24.531 1.00 16.69  ? 397 VAL B N   1 
ATOM 2507 C CA  . VAL B 1 113 ? -22.796 -44.350 -23.795 1.00 17.80  ? 397 VAL B CA  1 
ATOM 2508 C C   . VAL B 1 113 ? -23.015 -44.573 -22.305 1.00 18.21  ? 397 VAL B C   1 
ATOM 2509 O O   . VAL B 1 113 ? -23.741 -43.819 -21.650 1.00 20.12  ? 397 VAL B O   1 
ATOM 2510 C CB  . VAL B 1 113 ? -21.787 -43.199 -23.992 1.00 17.98  ? 397 VAL B CB  1 
ATOM 2511 C CG1 . VAL B 1 113 ? -20.587 -43.419 -23.121 1.00 18.82  ? 397 VAL B CG1 1 
ATOM 2512 C CG2 . VAL B 1 113 ? -21.340 -43.135 -25.436 1.00 18.83  ? 397 VAL B CG2 1 
ATOM 2513 N N   . TRP B 1 114 ? -22.387 -45.627 -21.784 1.00 17.27  ? 398 TRP B N   1 
ATOM 2514 C CA  . TRP B 1 114 ? -22.475 -45.969 -20.365 1.00 16.75  ? 398 TRP B CA  1 
ATOM 2515 C C   . TRP B 1 114 ? -21.087 -45.945 -19.717 1.00 15.55  ? 398 TRP B C   1 
ATOM 2516 O O   . TRP B 1 114 ? -20.069 -46.140 -20.382 1.00 17.19  ? 398 TRP B O   1 
ATOM 2517 C CB  . TRP B 1 114 ? -23.085 -47.364 -20.177 1.00 17.54  ? 398 TRP B CB  1 
ATOM 2518 C CG  . TRP B 1 114 ? -24.538 -47.481 -20.552 1.00 18.12  ? 398 TRP B CG  1 
ATOM 2519 C CD1 . TRP B 1 114 ? -25.071 -47.465 -21.812 1.00 14.43  ? 398 TRP B CD1 1 
ATOM 2520 C CD2 . TRP B 1 114 ? -25.643 -47.614 -19.652 1.00 19.34  ? 398 TRP B CD2 1 
ATOM 2521 N NE1 . TRP B 1 114 ? -26.437 -47.577 -21.752 1.00 11.75  ? 398 TRP B NE1 1 
ATOM 2522 C CE2 . TRP B 1 114 ? -26.818 -47.669 -20.439 1.00 17.82  ? 398 TRP B CE2 1 
ATOM 2523 C CE3 . TRP B 1 114 ? -25.758 -47.689 -18.255 1.00 21.43  ? 398 TRP B CE3 1 
ATOM 2524 C CZ2 . TRP B 1 114 ? -28.098 -47.796 -19.873 1.00 18.74  ? 398 TRP B CZ2 1 
ATOM 2525 C CZ3 . TRP B 1 114 ? -27.036 -47.815 -17.690 1.00 23.44  ? 398 TRP B CZ3 1 
ATOM 2526 C CH2 . TRP B 1 114 ? -28.186 -47.867 -18.502 1.00 20.25  ? 398 TRP B CH2 1 
ATOM 2527 N N   . VAL B 1 115 ? -21.053 -45.696 -18.416 1.00 13.37  ? 399 VAL B N   1 
ATOM 2528 C CA  . VAL B 1 115 ? -19.803 -45.669 -17.675 1.00 11.98  ? 399 VAL B CA  1 
ATOM 2529 C C   . VAL B 1 115 ? -19.842 -46.687 -16.552 1.00 13.79  ? 399 VAL B C   1 
ATOM 2530 O O   . VAL B 1 115 ? -20.851 -46.825 -15.863 1.00 15.59  ? 399 VAL B O   1 
ATOM 2531 C CB  . VAL B 1 115 ? -19.549 -44.297 -17.049 1.00 11.68  ? 399 VAL B CB  1 
ATOM 2532 C CG1 . VAL B 1 115 ? -18.628 -44.434 -15.857 1.00 7.59   ? 399 VAL B CG1 1 
ATOM 2533 C CG2 . VAL B 1 115 ? -18.925 -43.384 -18.070 1.00 13.32  ? 399 VAL B CG2 1 
ATOM 2534 N N   . ARG B 1 116 ? -18.747 -47.411 -16.372 1.00 13.29  ? 400 ARG B N   1 
ATOM 2535 C CA  . ARG B 1 116 ? -18.674 -48.383 -15.292 1.00 12.88  ? 400 ARG B CA  1 
ATOM 2536 C C   . ARG B 1 116 ? -17.443 -48.047 -14.470 1.00 11.62  ? 400 ARG B C   1 
ATOM 2537 O O   . ARG B 1 116 ? -16.326 -48.245 -14.924 1.00 14.12  ? 400 ARG B O   1 
ATOM 2538 C CB  . ARG B 1 116 ? -18.575 -49.807 -15.840 1.00 12.27  ? 400 ARG B CB  1 
ATOM 2539 C CG  . ARG B 1 116 ? -18.356 -50.839 -14.759 1.00 13.92  ? 400 ARG B CG  1 
ATOM 2540 C CD  . ARG B 1 116 ? -18.499 -52.270 -15.270 1.00 22.17  ? 400 ARG B CD  1 
ATOM 2541 N NE  . ARG B 1 116 ? -19.857 -52.804 -15.131 1.00 26.91  ? 400 ARG B NE  1 
ATOM 2542 C CZ  . ARG B 1 116 ? -20.754 -52.857 -16.113 1.00 29.35  ? 400 ARG B CZ  1 
ATOM 2543 N NH1 . ARG B 1 116 ? -20.443 -52.406 -17.327 1.00 32.29  ? 400 ARG B NH1 1 
ATOM 2544 N NH2 . ARG B 1 116 ? -21.960 -53.366 -15.882 1.00 27.02  ? 400 ARG B NH2 1 
ATOM 2545 N N   . CYS B 1 117 ? -17.647 -47.512 -13.271 1.00 8.94   ? 401 CYS B N   1 
ATOM 2546 C CA  . CYS B 1 117 ? -16.527 -47.153 -12.414 1.00 9.04   ? 401 CYS B CA  1 
ATOM 2547 C C   . CYS B 1 117 ? -15.897 -48.404 -11.792 1.00 11.19  ? 401 CYS B C   1 
ATOM 2548 O O   . CYS B 1 117 ? -16.446 -49.009 -10.869 1.00 8.57   ? 401 CYS B O   1 
ATOM 2549 C CB  . CYS B 1 117 ? -16.990 -46.192 -11.320 1.00 8.04   ? 401 CYS B CB  1 
ATOM 2550 S SG  . CYS B 1 117 ? -15.651 -45.491 -10.335 1.00 11.19  ? 401 CYS B SG  1 
ATOM 2551 N N   . LEU B 1 118 ? -14.736 -48.784 -12.318 1.00 13.45  ? 402 LEU B N   1 
ATOM 2552 C CA  . LEU B 1 118 ? -13.998 -49.952 -11.851 1.00 11.16  ? 402 LEU B CA  1 
ATOM 2553 C C   . LEU B 1 118 ? -12.925 -49.533 -10.861 1.00 12.88  ? 402 LEU B C   1 
ATOM 2554 O O   . LEU B 1 118 ? -12.367 -50.363 -10.157 1.00 17.09  ? 402 LEU B O   1 
ATOM 2555 C CB  . LEU B 1 118 ? -13.367 -50.671 -13.038 1.00 7.30   ? 402 LEU B CB  1 
ATOM 2556 C CG  . LEU B 1 118 ? -14.426 -51.226 -13.986 1.00 8.24   ? 402 LEU B CG  1 
ATOM 2557 C CD1 . LEU B 1 118 ? -13.845 -51.520 -15.354 1.00 8.38   ? 402 LEU B CD1 1 
ATOM 2558 C CD2 . LEU B 1 118 ? -15.009 -52.464 -13.363 1.00 7.93   ? 402 LEU B CD2 1 
ATOM 2559 N N   . SER B 1 119 ? -12.635 -48.240 -10.817 1.00 12.93  ? 403 SER B N   1 
ATOM 2560 C CA  . SER B 1 119 ? -11.647 -47.717 -9.897  1.00 13.78  ? 403 SER B CA  1 
ATOM 2561 C C   . SER B 1 119 ? -12.171 -47.883 -8.478  1.00 15.21  ? 403 SER B C   1 
ATOM 2562 O O   . SER B 1 119 ? -13.363 -48.097 -8.293  1.00 16.56  ? 403 SER B O   1 
ATOM 2563 C CB  . SER B 1 119 ? -11.429 -46.245 -10.191 1.00 16.43  ? 403 SER B CB  1 
ATOM 2564 O OG  . SER B 1 119 ? -10.853 -45.595 -9.075  1.00 24.57  ? 403 SER B OG  1 
ATOM 2565 N N   . ASP B 1 120 ? -11.289 -47.797 -7.480  1.00 16.51  ? 404 ASP B N   1 
ATOM 2566 C CA  . ASP B 1 120 ? -11.695 -47.917 -6.072  1.00 16.51  ? 404 ASP B CA  1 
ATOM 2567 C C   . ASP B 1 120 ? -12.229 -46.590 -5.590  1.00 14.53  ? 404 ASP B C   1 
ATOM 2568 O O   . ASP B 1 120 ? -12.908 -46.508 -4.566  1.00 11.67  ? 404 ASP B O   1 
ATOM 2569 C CB  . ASP B 1 120 ? -10.520 -48.283 -5.175  1.00 21.43  ? 404 ASP B CB  1 
ATOM 2570 C CG  . ASP B 1 120 ? -10.064 -49.692 -5.374  1.00 28.51  ? 404 ASP B CG  1 
ATOM 2571 O OD1 . ASP B 1 120 ? -10.933 -50.547 -5.650  1.00 33.17  ? 404 ASP B OD1 1 
ATOM 2572 O OD2 . ASP B 1 120 ? -8.845  -49.945 -5.240  1.00 32.92  ? 404 ASP B OD2 1 
ATOM 2573 N N   . HIS B 1 121 ? -11.887 -45.552 -6.341  1.00 14.56  ? 405 HIS B N   1 
ATOM 2574 C CA  . HIS B 1 121 ? -12.298 -44.196 -6.038  1.00 16.79  ? 405 HIS B CA  1 
ATOM 2575 C C   . HIS B 1 121 ? -13.374 -43.742 -7.001  1.00 14.70  ? 405 HIS B C   1 
ATOM 2576 O O   . HIS B 1 121 ? -13.462 -44.217 -8.131  1.00 11.46  ? 405 HIS B O   1 
ATOM 2577 C CB  . HIS B 1 121 ? -11.089 -43.262 -6.115  1.00 23.07  ? 405 HIS B CB  1 
ATOM 2578 C CG  . HIS B 1 121 ? -10.080 -43.504 -5.038  1.00 25.19  ? 405 HIS B CG  1 
ATOM 2579 N ND1 . HIS B 1 121 ? -10.170 -42.922 -3.792  1.00 27.03  ? 405 HIS B ND1 1 
ATOM 2580 C CD2 . HIS B 1 121 ? -9.001  -44.319 -4.996  1.00 26.32  ? 405 HIS B CD2 1 
ATOM 2581 C CE1 . HIS B 1 121 ? -9.190  -43.370 -3.028  1.00 28.14  ? 405 HIS B CE1 1 
ATOM 2582 N NE2 . HIS B 1 121 ? -8.467  -44.220 -3.735  1.00 28.32  ? 405 HIS B NE2 1 
ATOM 2583 N N   . ALA B 1 122 ? -14.196 -42.815 -6.535  1.00 15.59  ? 406 ALA B N   1 
ATOM 2584 C CA  . ALA B 1 122 ? -15.278 -42.295 -7.340  1.00 17.33  ? 406 ALA B CA  1 
ATOM 2585 C C   . ALA B 1 122 ? -14.745 -41.436 -8.454  1.00 17.99  ? 406 ALA B C   1 
ATOM 2586 O O   . ALA B 1 122 ? -13.739 -40.746 -8.299  1.00 19.78  ? 406 ALA B O   1 
ATOM 2587 C CB  . ALA B 1 122 ? -16.223 -41.486 -6.479  1.00 21.27  ? 406 ALA B CB  1 
ATOM 2588 N N   . VAL B 1 123 ? -15.440 -41.489 -9.580  1.00 19.69  ? 407 VAL B N   1 
ATOM 2589 C CA  . VAL B 1 123 ? -15.096 -40.714 -10.761 1.00 19.70  ? 407 VAL B CA  1 
ATOM 2590 C C   . VAL B 1 123 ? -16.107 -39.572 -10.850 1.00 19.87  ? 407 VAL B C   1 
ATOM 2591 O O   . VAL B 1 123 ? -17.248 -39.720 -10.413 1.00 21.93  ? 407 VAL B O   1 
ATOM 2592 C CB  . VAL B 1 123 ? -15.192 -41.590 -12.018 1.00 19.73  ? 407 VAL B CB  1 
ATOM 2593 C CG1 . VAL B 1 123 ? -15.134 -40.728 -13.252 1.00 23.12  ? 407 VAL B CG1 1 
ATOM 2594 C CG2 . VAL B 1 123 ? -14.057 -42.606 -12.021 1.00 19.33  ? 407 VAL B CG2 1 
ATOM 2595 N N   . PHE B 1 124 ? -15.694 -38.433 -11.396 1.00 16.22  ? 408 PHE B N   1 
ATOM 2596 C CA  . PHE B 1 124 ? -16.601 -37.300 -11.511 1.00 13.21  ? 408 PHE B CA  1 
ATOM 2597 C C   . PHE B 1 124 ? -16.838 -36.915 -12.962 1.00 11.21  ? 408 PHE B C   1 
ATOM 2598 O O   . PHE B 1 124 ? -15.972 -36.354 -13.623 1.00 10.21  ? 408 PHE B O   1 
ATOM 2599 C CB  . PHE B 1 124 ? -16.058 -36.110 -10.728 1.00 12.39  ? 408 PHE B CB  1 
ATOM 2600 C CG  . PHE B 1 124 ? -15.886 -36.384 -9.270  1.00 13.06  ? 408 PHE B CG  1 
ATOM 2601 C CD1 . PHE B 1 124 ? -14.901 -37.260 -8.825  1.00 15.88  ? 408 PHE B CD1 1 
ATOM 2602 C CD2 . PHE B 1 124 ? -16.715 -35.781 -8.335  1.00 14.12  ? 408 PHE B CD2 1 
ATOM 2603 C CE1 . PHE B 1 124 ? -14.745 -37.532 -7.467  1.00 15.43  ? 408 PHE B CE1 1 
ATOM 2604 C CE2 . PHE B 1 124 ? -16.570 -36.043 -6.978  1.00 14.51  ? 408 PHE B CE2 1 
ATOM 2605 C CZ  . PHE B 1 124 ? -15.583 -36.921 -6.543  1.00 16.69  ? 408 PHE B CZ  1 
ATOM 2606 N N   . VAL B 1 125 ? -18.041 -37.210 -13.438 1.00 10.27  ? 409 VAL B N   1 
ATOM 2607 C CA  . VAL B 1 125 ? -18.420 -36.942 -14.816 1.00 9.71   ? 409 VAL B CA  1 
ATOM 2608 C C   . VAL B 1 125 ? -19.059 -35.586 -15.064 1.00 11.76  ? 409 VAL B C   1 
ATOM 2609 O O   . VAL B 1 125 ? -19.677 -34.998 -14.172 1.00 14.82  ? 409 VAL B O   1 
ATOM 2610 C CB  . VAL B 1 125 ? -19.401 -38.019 -15.305 1.00 8.52   ? 409 VAL B CB  1 
ATOM 2611 C CG1 . VAL B 1 125 ? -19.678 -37.851 -16.791 1.00 2.16   ? 409 VAL B CG1 1 
ATOM 2612 C CG2 . VAL B 1 125 ? -18.843 -39.399 -14.988 1.00 5.86   ? 409 VAL B CG2 1 
ATOM 2613 N N   . GLN B 1 126 ? -18.892 -35.103 -16.290 1.00 11.09  ? 410 GLN B N   1 
ATOM 2614 C CA  . GLN B 1 126 ? -19.473 -33.852 -16.752 1.00 12.88  ? 410 GLN B CA  1 
ATOM 2615 C C   . GLN B 1 126 ? -20.289 -34.265 -17.980 1.00 14.86  ? 410 GLN B C   1 
ATOM 2616 O O   . GLN B 1 126 ? -19.732 -34.456 -19.063 1.00 14.98  ? 410 GLN B O   1 
ATOM 2617 C CB  . GLN B 1 126 ? -18.368 -32.876 -17.152 1.00 15.18  ? 410 GLN B CB  1 
ATOM 2618 C CG  . GLN B 1 126 ? -18.842 -31.519 -17.689 1.00 24.78  ? 410 GLN B CG  1 
ATOM 2619 C CD  . GLN B 1 126 ? -19.422 -31.593 -19.099 1.00 31.35  ? 410 GLN B CD  1 
ATOM 2620 O OE1 . GLN B 1 126 ? -18.724 -31.927 -20.059 1.00 30.34  ? 410 GLN B OE1 1 
ATOM 2621 N NE2 . GLN B 1 126 ? -20.706 -31.275 -19.226 1.00 33.85  ? 410 GLN B NE2 1 
ATOM 2622 N N   . SER B 1 127 ? -21.598 -34.433 -17.806 1.00 15.57  ? 411 SER B N   1 
ATOM 2623 C CA  . SER B 1 127 ? -22.473 -34.844 -18.912 1.00 17.79  ? 411 SER B CA  1 
ATOM 2624 C C   . SER B 1 127 ? -23.724 -33.992 -19.063 1.00 18.59  ? 411 SER B C   1 
ATOM 2625 O O   . SER B 1 127 ? -24.471 -33.820 -18.107 1.00 21.93  ? 411 SER B O   1 
ATOM 2626 C CB  . SER B 1 127 ? -22.913 -36.298 -18.737 1.00 16.00  ? 411 SER B CB  1 
ATOM 2627 O OG  . SER B 1 127 ? -24.008 -36.583 -19.594 1.00 13.52  ? 411 SER B OG  1 
ATOM 2628 N N   . TYR B 1 128 ? -23.968 -33.480 -20.264 1.00 19.00  ? 412 TYR B N   1 
ATOM 2629 C CA  . TYR B 1 128 ? -25.149 -32.653 -20.489 1.00 21.04  ? 412 TYR B CA  1 
ATOM 2630 C C   . TYR B 1 128 ? -26.434 -33.434 -20.292 1.00 20.64  ? 412 TYR B C   1 
ATOM 2631 O O   . TYR B 1 128 ? -27.450 -32.881 -19.888 1.00 21.69  ? 412 TYR B O   1 
ATOM 2632 C CB  . TYR B 1 128 ? -25.106 -32.025 -21.883 1.00 22.26  ? 412 TYR B CB  1 
ATOM 2633 C CG  . TYR B 1 128 ? -24.189 -30.841 -21.904 1.00 27.60  ? 412 TYR B CG  1 
ATOM 2634 C CD1 . TYR B 1 128 ? -24.404 -29.766 -21.037 1.00 30.51  ? 412 TYR B CD1 1 
ATOM 2635 C CD2 . TYR B 1 128 ? -23.055 -30.824 -22.705 1.00 30.74  ? 412 TYR B CD2 1 
ATOM 2636 C CE1 . TYR B 1 128 ? -23.513 -28.714 -20.960 1.00 31.43  ? 412 TYR B CE1 1 
ATOM 2637 C CE2 . TYR B 1 128 ? -22.150 -29.769 -22.636 1.00 32.79  ? 412 TYR B CE2 1 
ATOM 2638 C CZ  . TYR B 1 128 ? -22.385 -28.722 -21.759 1.00 33.11  ? 412 TYR B CZ  1 
ATOM 2639 O OH  . TYR B 1 128 ? -21.478 -27.695 -21.655 1.00 34.82  ? 412 TYR B OH  1 
ATOM 2640 N N   . TYR B 1 129 ? -26.375 -34.729 -20.571 1.00 19.93  ? 413 TYR B N   1 
ATOM 2641 C CA  . TYR B 1 129 ? -27.518 -35.608 -20.406 1.00 16.43  ? 413 TYR B CA  1 
ATOM 2642 C C   . TYR B 1 129 ? -27.884 -35.662 -18.927 1.00 16.76  ? 413 TYR B C   1 
ATOM 2643 O O   . TYR B 1 129 ? -28.995 -35.312 -18.538 1.00 16.42  ? 413 TYR B O   1 
ATOM 2644 C CB  . TYR B 1 129 ? -27.150 -36.995 -20.894 1.00 13.78  ? 413 TYR B CB  1 
ATOM 2645 C CG  . TYR B 1 129 ? -28.199 -38.025 -20.620 1.00 16.57  ? 413 TYR B CG  1 
ATOM 2646 C CD1 . TYR B 1 129 ? -29.411 -38.018 -21.309 1.00 16.57  ? 413 TYR B CD1 1 
ATOM 2647 C CD2 . TYR B 1 129 ? -27.975 -39.033 -19.684 1.00 17.68  ? 413 TYR B CD2 1 
ATOM 2648 C CE1 . TYR B 1 129 ? -30.374 -39.000 -21.072 1.00 16.24  ? 413 TYR B CE1 1 
ATOM 2649 C CE2 . TYR B 1 129 ? -28.930 -40.015 -19.441 1.00 16.13  ? 413 TYR B CE2 1 
ATOM 2650 C CZ  . TYR B 1 129 ? -30.123 -39.991 -20.134 1.00 14.70  ? 413 TYR B CZ  1 
ATOM 2651 O OH  . TYR B 1 129 ? -31.070 -40.944 -19.859 1.00 16.81  ? 413 TYR B OH  1 
ATOM 2652 N N   . LEU B 1 130 ? -26.935 -36.098 -18.104 1.00 18.98  ? 414 LEU B N   1 
ATOM 2653 C CA  . LEU B 1 130 ? -27.148 -36.194 -16.663 1.00 19.44  ? 414 LEU B CA  1 
ATOM 2654 C C   . LEU B 1 130 ? -27.649 -34.876 -16.082 1.00 20.93  ? 414 LEU B C   1 
ATOM 2655 O O   . LEU B 1 130 ? -28.439 -34.870 -15.141 1.00 19.71  ? 414 LEU B O   1 
ATOM 2656 C CB  . LEU B 1 130 ? -25.855 -36.607 -15.957 1.00 17.69  ? 414 LEU B CB  1 
ATOM 2657 C CG  . LEU B 1 130 ? -25.185 -37.913 -16.393 1.00 19.27  ? 414 LEU B CG  1 
ATOM 2658 C CD1 . LEU B 1 130 ? -24.084 -38.235 -15.407 1.00 19.89  ? 414 LEU B CD1 1 
ATOM 2659 C CD2 . LEU B 1 130 ? -26.186 -39.060 -16.450 1.00 16.06  ? 414 LEU B CD2 1 
ATOM 2660 N N   . ASP B 1 131 ? -27.186 -33.760 -16.639 1.00 23.01  ? 415 ASP B N   1 
ATOM 2661 C CA  . ASP B 1 131 ? -27.621 -32.455 -16.160 1.00 25.76  ? 415 ASP B CA  1 
ATOM 2662 C C   . ASP B 1 131 ? -29.129 -32.373 -16.335 1.00 27.63  ? 415 ASP B C   1 
ATOM 2663 O O   . ASP B 1 131 ? -29.863 -32.128 -15.378 1.00 29.25  ? 415 ASP B O   1 
ATOM 2664 C CB  . ASP B 1 131 ? -26.971 -31.307 -16.953 1.00 26.06  ? 415 ASP B CB  1 
ATOM 2665 C CG  . ASP B 1 131 ? -25.462 -31.235 -16.771 1.00 30.47  ? 415 ASP B CG  1 
ATOM 2666 O OD1 . ASP B 1 131 ? -24.973 -31.395 -15.627 1.00 30.23  ? 415 ASP B OD1 1 
ATOM 2667 O OD2 . ASP B 1 131 ? -24.762 -31.000 -17.782 1.00 32.37  ? 415 ASP B OD2 1 
ATOM 2668 N N   . ARG B 1 132 ? -29.581 -32.589 -17.569 1.00 28.65  ? 416 ARG B N   1 
ATOM 2669 C CA  . ARG B 1 132 ? -31.000 -32.525 -17.903 1.00 27.50  ? 416 ARG B CA  1 
ATOM 2670 C C   . ARG B 1 132 ? -31.796 -33.504 -17.042 1.00 27.87  ? 416 ARG B C   1 
ATOM 2671 O O   . ARG B 1 132 ? -32.883 -33.173 -16.561 1.00 29.00  ? 416 ARG B O   1 
ATOM 2672 C CB  . ARG B 1 132 ? -31.217 -32.839 -19.391 1.00 24.21  ? 416 ARG B CB  1 
ATOM 2673 C CG  . ARG B 1 132 ? -32.373 -32.066 -20.010 1.00 26.38  ? 416 ARG B CG  1 
ATOM 2674 C CD  . ARG B 1 132 ? -32.865 -32.666 -21.318 1.00 28.91  ? 416 ARG B CD  1 
ATOM 2675 N NE  . ARG B 1 132 ? -33.969 -31.882 -21.873 1.00 31.75  ? 416 ARG B NE  1 
ATOM 2676 C CZ  . ARG B 1 132 ? -34.835 -32.316 -22.791 1.00 36.16  ? 416 ARG B CZ  1 
ATOM 2677 N NH1 . ARG B 1 132 ? -34.777 -33.558 -23.315 1.00 28.56  ? 416 ARG B NH1 1 
ATOM 2678 N NH2 . ARG B 1 132 ? -35.784 -31.482 -23.186 1.00 39.93  ? 416 ARG B NH2 1 
ATOM 2679 N N   . GLU B 1 133 ? -31.242 -34.699 -16.848 1.00 26.11  ? 417 GLU B N   1 
ATOM 2680 C CA  . GLU B 1 133 ? -31.879 -35.736 -16.043 1.00 26.92  ? 417 GLU B CA  1 
ATOM 2681 C C   . GLU B 1 133 ? -32.046 -35.351 -14.574 1.00 27.24  ? 417 GLU B C   1 
ATOM 2682 O O   . GLU B 1 133 ? -32.855 -35.947 -13.863 1.00 30.89  ? 417 GLU B O   1 
ATOM 2683 C CB  . GLU B 1 133 ? -31.069 -37.024 -16.122 1.00 27.30  ? 417 GLU B CB  1 
ATOM 2684 C CG  . GLU B 1 133 ? -31.205 -37.753 -17.429 1.00 30.66  ? 417 GLU B CG  1 
ATOM 2685 C CD  . GLU B 1 133 ? -32.363 -38.724 -17.428 1.00 33.19  ? 417 GLU B CD  1 
ATOM 2686 O OE1 . GLU B 1 133 ? -32.308 -39.710 -16.659 1.00 33.94  ? 417 GLU B OE1 1 
ATOM 2687 O OE2 . GLU B 1 133 ? -33.327 -38.500 -18.193 1.00 35.00  ? 417 GLU B OE2 1 
ATOM 2688 N N   . ALA B 1 134 ? -31.278 -34.370 -14.114 1.00 24.62  ? 418 ALA B N   1 
ATOM 2689 C CA  . ALA B 1 134 ? -31.366 -33.929 -12.726 1.00 21.63  ? 418 ALA B CA  1 
ATOM 2690 C C   . ALA B 1 134 ? -32.144 -32.621 -12.607 1.00 21.13  ? 418 ALA B C   1 
ATOM 2691 O O   . ALA B 1 134 ? -32.196 -32.008 -11.539 1.00 19.22  ? 418 ALA B O   1 
ATOM 2692 C CB  . ALA B 1 134 ? -29.974 -33.759 -12.154 1.00 20.51  ? 418 ALA B CB  1 
ATOM 2693 N N   . GLY B 1 135 ? -32.754 -32.200 -13.709 1.00 21.25  ? 419 GLY B N   1 
ATOM 2694 C CA  . GLY B 1 135 ? -33.505 -30.962 -13.692 1.00 21.50  ? 419 GLY B CA  1 
ATOM 2695 C C   . GLY B 1 135 ? -32.592 -29.780 -13.435 1.00 21.44  ? 419 GLY B C   1 
ATOM 2696 O O   . GLY B 1 135 ? -33.044 -28.735 -12.972 1.00 20.86  ? 419 GLY B O   1 
ATOM 2697 N N   . ARG B 1 136 ? -31.304 -29.957 -13.732 1.00 21.59  ? 420 ARG B N   1 
ATOM 2698 C CA  . ARG B 1 136 ? -30.297 -28.913 -13.564 1.00 20.68  ? 420 ARG B CA  1 
ATOM 2699 C C   . ARG B 1 136 ? -30.061 -28.201 -14.898 1.00 20.95  ? 420 ARG B C   1 
ATOM 2700 O O   . ARG B 1 136 ? -30.420 -28.712 -15.965 1.00 19.19  ? 420 ARG B O   1 
ATOM 2701 C CB  . ARG B 1 136 ? -28.976 -29.518 -13.082 1.00 22.34  ? 420 ARG B CB  1 
ATOM 2702 C CG  . ARG B 1 136 ? -29.032 -30.179 -11.715 1.00 27.77  ? 420 ARG B CG  1 
ATOM 2703 C CD  . ARG B 1 136 ? -28.939 -29.174 -10.576 1.00 33.12  ? 420 ARG B CD  1 
ATOM 2704 N NE  . ARG B 1 136 ? -27.610 -28.576 -10.472 1.00 38.63  ? 420 ARG B NE  1 
ATOM 2705 C CZ  . ARG B 1 136 ? -27.245 -27.708 -9.529  1.00 42.83  ? 420 ARG B CZ  1 
ATOM 2706 N NH1 . ARG B 1 136 ? -28.105 -27.323 -8.592  1.00 42.14  ? 420 ARG B NH1 1 
ATOM 2707 N NH2 . ARG B 1 136 ? -26.011 -27.221 -9.521  1.00 43.94  ? 420 ARG B NH2 1 
ATOM 2708 N N   . ALA B 1 137 ? -29.453 -27.021 -14.828 1.00 22.52  ? 421 ALA B N   1 
ATOM 2709 C CA  . ALA B 1 137 ? -29.156 -26.232 -16.019 1.00 22.95  ? 421 ALA B CA  1 
ATOM 2710 C C   . ALA B 1 137 ? -27.931 -26.793 -16.734 1.00 24.21  ? 421 ALA B C   1 
ATOM 2711 O O   . ALA B 1 137 ? -27.046 -27.377 -16.107 1.00 26.72  ? 421 ALA B O   1 
ATOM 2712 C CB  . ALA B 1 137 ? -28.908 -24.791 -15.631 1.00 22.44  ? 421 ALA B CB  1 
ATOM 2713 N N   . PRO B 1 138 ? -27.857 -26.612 -18.062 1.00 22.80  ? 422 PRO B N   1 
ATOM 2714 C CA  . PRO B 1 138 ? -26.734 -27.103 -18.867 1.00 22.63  ? 422 PRO B CA  1 
ATOM 2715 C C   . PRO B 1 138 ? -25.366 -26.718 -18.310 1.00 23.70  ? 422 PRO B C   1 
ATOM 2716 O O   . PRO B 1 138 ? -25.014 -25.537 -18.234 1.00 24.08  ? 422 PRO B O   1 
ATOM 2717 C CB  . PRO B 1 138 ? -26.988 -26.477 -20.228 1.00 18.71  ? 422 PRO B CB  1 
ATOM 2718 C CG  . PRO B 1 138 ? -28.456 -26.409 -20.282 1.00 21.26  ? 422 PRO B CG  1 
ATOM 2719 C CD  . PRO B 1 138 ? -28.833 -25.913 -18.910 1.00 21.83  ? 422 PRO B CD  1 
ATOM 2720 N N   . GLY B 1 139 ? -24.599 -27.726 -17.919 1.00 23.06  ? 423 GLY B N   1 
ATOM 2721 C CA  . GLY B 1 139 ? -23.280 -27.470 -17.387 1.00 21.58  ? 423 GLY B CA  1 
ATOM 2722 C C   . GLY B 1 139 ? -23.266 -27.050 -15.934 1.00 19.67  ? 423 GLY B C   1 
ATOM 2723 O O   . GLY B 1 139 ? -22.218 -26.719 -15.395 1.00 23.45  ? 423 GLY B O   1 
ATOM 2724 N N   . ASP B 1 140 ? -24.410 -27.061 -15.274 1.00 17.34  ? 424 ASP B N   1 
ATOM 2725 C CA  . ASP B 1 140 ? -24.399 -26.669 -13.881 1.00 19.88  ? 424 ASP B CA  1 
ATOM 2726 C C   . ASP B 1 140 ? -24.572 -27.875 -12.973 1.00 18.96  ? 424 ASP B C   1 
ATOM 2727 O O   . ASP B 1 140 ? -25.637 -28.076 -12.391 1.00 19.47  ? 424 ASP B O   1 
ATOM 2728 C CB  . ASP B 1 140 ? -25.492 -25.637 -13.613 1.00 24.41  ? 424 ASP B CB  1 
ATOM 2729 C CG  . ASP B 1 140 ? -25.418 -25.070 -12.213 1.00 27.25  ? 424 ASP B CG  1 
ATOM 2730 O OD1 . ASP B 1 140 ? -24.343 -24.575 -11.820 1.00 25.27  ? 424 ASP B OD1 1 
ATOM 2731 O OD2 . ASP B 1 140 ? -26.439 -25.121 -11.501 1.00 31.68  ? 424 ASP B OD2 1 
ATOM 2732 N N   . ALA B 1 141 ? -23.513 -28.675 -12.862 1.00 18.35  ? 425 ALA B N   1 
ATOM 2733 C CA  . ALA B 1 141 ? -23.513 -29.881 -12.030 1.00 14.85  ? 425 ALA B CA  1 
ATOM 2734 C C   . ALA B 1 141 ? -22.325 -30.800 -12.315 1.00 13.59  ? 425 ALA B C   1 
ATOM 2735 O O   . ALA B 1 141 ? -21.820 -30.856 -13.429 1.00 12.65  ? 425 ALA B O   1 
ATOM 2736 C CB  . ALA B 1 141 ? -24.813 -30.659 -12.233 1.00 13.60  ? 425 ALA B CB  1 
ATOM 2737 N N   . VAL B 1 142 ? -21.885 -31.516 -11.289 1.00 15.23  ? 426 VAL B N   1 
ATOM 2738 C CA  . VAL B 1 142 ? -20.786 -32.472 -11.413 1.00 17.95  ? 426 VAL B CA  1 
ATOM 2739 C C   . VAL B 1 142 ? -21.363 -33.802 -10.972 1.00 18.31  ? 426 VAL B C   1 
ATOM 2740 O O   . VAL B 1 142 ? -21.780 -33.942 -9.829  1.00 20.17  ? 426 VAL B O   1 
ATOM 2741 C CB  . VAL B 1 142 ? -19.605 -32.123 -10.481 1.00 19.60  ? 426 VAL B CB  1 
ATOM 2742 C CG1 . VAL B 1 142 ? -18.590 -33.254 -10.482 1.00 16.54  ? 426 VAL B CG1 1 
ATOM 2743 C CG2 . VAL B 1 142 ? -18.947 -30.823 -10.939 1.00 23.60  ? 426 VAL B CG2 1 
ATOM 2744 N N   . HIS B 1 143 ? -21.404 -34.778 -11.866 1.00 17.94  ? 427 HIS B N   1 
ATOM 2745 C CA  . HIS B 1 143 ? -21.971 -36.063 -11.490 1.00 16.84  ? 427 HIS B CA  1 
ATOM 2746 C C   . HIS B 1 143 ? -20.938 -37.044 -10.969 1.00 15.02  ? 427 HIS B C   1 
ATOM 2747 O O   . HIS B 1 143 ? -20.124 -37.579 -11.724 1.00 14.19  ? 427 HIS B O   1 
ATOM 2748 C CB  . HIS B 1 143 ? -22.739 -36.670 -12.664 1.00 17.01  ? 427 HIS B CB  1 
ATOM 2749 C CG  . HIS B 1 143 ? -23.867 -35.816 -13.137 1.00 17.78  ? 427 HIS B CG  1 
ATOM 2750 N ND1 . HIS B 1 143 ? -23.690 -34.778 -14.023 1.00 22.40  ? 427 HIS B ND1 1 
ATOM 2751 C CD2 . HIS B 1 143 ? -25.173 -35.792 -12.786 1.00 20.36  ? 427 HIS B CD2 1 
ATOM 2752 C CE1 . HIS B 1 143 ? -24.838 -34.148 -14.196 1.00 23.44  ? 427 HIS B CE1 1 
ATOM 2753 N NE2 . HIS B 1 143 ? -25.754 -34.744 -13.455 1.00 23.18  ? 427 HIS B NE2 1 
ATOM 2754 N N   . LYS B 1 144 ? -20.981 -37.265 -9.661  1.00 11.55  ? 428 LYS B N   1 
ATOM 2755 C CA  . LYS B 1 144 ? -20.070 -38.184 -9.009  1.00 10.46  ? 428 LYS B CA  1 
ATOM 2756 C C   . LYS B 1 144 ? -20.559 -39.619 -9.156  1.00 10.07  ? 428 LYS B C   1 
ATOM 2757 O O   . LYS B 1 144 ? -21.661 -39.949 -8.734  1.00 11.84  ? 428 LYS B O   1 
ATOM 2758 C CB  . LYS B 1 144 ? -19.949 -37.847 -7.523  1.00 7.36   ? 428 LYS B CB  1 
ATOM 2759 C CG  . LYS B 1 144 ? -19.136 -38.871 -6.749  1.00 7.88   ? 428 LYS B CG  1 
ATOM 2760 C CD  . LYS B 1 144 ? -18.936 -38.427 -5.323  1.00 10.21  ? 428 LYS B CD  1 
ATOM 2761 C CE  . LYS B 1 144 ? -18.118 -39.428 -4.525  1.00 9.44   ? 428 LYS B CE  1 
ATOM 2762 N NZ  . LYS B 1 144 ? -18.032 -39.038 -3.080  1.00 9.60   ? 428 LYS B NZ  1 
ATOM 2763 N N   . ILE B 1 145 ? -19.731 -40.466 -9.755  1.00 7.64   ? 429 ILE B N   1 
ATOM 2764 C CA  . ILE B 1 145 ? -20.075 -41.862 -9.937  1.00 6.75   ? 429 ILE B CA  1 
ATOM 2765 C C   . ILE B 1 145 ? -19.296 -42.701 -8.949  1.00 11.78  ? 429 ILE B C   1 
ATOM 2766 O O   . ILE B 1 145 ? -18.069 -42.783 -9.006  1.00 15.46  ? 429 ILE B O   1 
ATOM 2767 C CB  . ILE B 1 145 ? -19.757 -42.329 -11.343 1.00 3.81   ? 429 ILE B CB  1 
ATOM 2768 C CG1 . ILE B 1 145 ? -20.784 -41.738 -12.305 1.00 3.81   ? 429 ILE B CG1 1 
ATOM 2769 C CG2 . ILE B 1 145 ? -19.752 -43.849 -11.400 1.00 2.38   ? 429 ILE B CG2 1 
ATOM 2770 C CD1 . ILE B 1 145 ? -20.433 -41.943 -13.735 1.00 7.24   ? 429 ILE B CD1 1 
ATOM 2771 N N   . TYR B 1 146 ? -20.026 -43.330 -8.040  1.00 13.91  ? 430 TYR B N   1 
ATOM 2772 C CA  . TYR B 1 146 ? -19.425 -44.151 -7.006  1.00 12.77  ? 430 TYR B CA  1 
ATOM 2773 C C   . TYR B 1 146 ? -18.836 -45.452 -7.511  1.00 11.77  ? 430 TYR B C   1 
ATOM 2774 O O   . TYR B 1 146 ? -19.331 -46.050 -8.479  1.00 11.73  ? 430 TYR B O   1 
ATOM 2775 C CB  . TYR B 1 146 ? -20.464 -44.427 -5.926  1.00 14.80  ? 430 TYR B CB  1 
ATOM 2776 C CG  . TYR B 1 146 ? -20.732 -43.214 -5.081  1.00 16.24  ? 430 TYR B CG  1 
ATOM 2777 C CD1 . TYR B 1 146 ? -19.948 -42.947 -3.964  1.00 16.92  ? 430 TYR B CD1 1 
ATOM 2778 C CD2 . TYR B 1 146 ? -21.724 -42.301 -5.425  1.00 14.66  ? 430 TYR B CD2 1 
ATOM 2779 C CE1 . TYR B 1 146 ? -20.134 -41.807 -3.209  1.00 16.52  ? 430 TYR B CE1 1 
ATOM 2780 C CE2 . TYR B 1 146 ? -21.920 -41.149 -4.672  1.00 18.80  ? 430 TYR B CE2 1 
ATOM 2781 C CZ  . TYR B 1 146 ? -21.115 -40.909 -3.561  1.00 17.52  ? 430 TYR B CZ  1 
ATOM 2782 O OH  . TYR B 1 146 ? -21.269 -39.772 -2.800  1.00 18.05  ? 430 TYR B OH  1 
ATOM 2783 N N   . PRO B 1 147 ? -17.760 -45.913 -6.852  1.00 8.34   ? 431 PRO B N   1 
ATOM 2784 C CA  . PRO B 1 147 ? -17.096 -47.156 -7.233  1.00 4.67   ? 431 PRO B CA  1 
ATOM 2785 C C   . PRO B 1 147 ? -18.098 -48.284 -7.442  1.00 3.97   ? 431 PRO B C   1 
ATOM 2786 O O   . PRO B 1 147 ? -18.977 -48.512 -6.614  1.00 2.54   ? 431 PRO B O   1 
ATOM 2787 C CB  . PRO B 1 147 ? -16.162 -47.422 -6.059  1.00 2.16   ? 431 PRO B CB  1 
ATOM 2788 C CG  . PRO B 1 147 ? -15.799 -46.063 -5.606  1.00 3.78   ? 431 PRO B CG  1 
ATOM 2789 C CD  . PRO B 1 147 ? -17.109 -45.310 -5.673  1.00 7.41   ? 431 PRO B CD  1 
ATOM 2790 N N   . SER B 1 148 ? -17.949 -48.964 -8.573  1.00 4.68   ? 432 SER B N   1 
ATOM 2791 C CA  . SER B 1 148 ? -18.771 -50.098 -8.968  1.00 5.05   ? 432 SER B CA  1 
ATOM 2792 C C   . SER B 1 148 ? -20.077 -49.716 -9.649  1.00 6.26   ? 432 SER B C   1 
ATOM 2793 O O   . SER B 1 148 ? -20.714 -50.566 -10.280 1.00 5.29   ? 432 SER B O   1 
ATOM 2794 C CB  . SER B 1 148 ? -19.054 -51.011 -7.769  1.00 2.16   ? 432 SER B CB  1 
ATOM 2795 O OG  . SER B 1 148 ? -20.243 -50.641 -7.109  1.00 2.16   ? 432 SER B OG  1 
ATOM 2796 N N   . ALA B 1 149 ? -20.464 -48.443 -9.542  1.00 7.79   ? 433 ALA B N   1 
ATOM 2797 C CA  . ALA B 1 149 ? -21.704 -47.960 -10.162 1.00 8.23   ? 433 ALA B CA  1 
ATOM 2798 C C   . ALA B 1 149 ? -21.676 -48.098 -11.694 1.00 9.37   ? 433 ALA B C   1 
ATOM 2799 O O   . ALA B 1 149 ? -20.625 -47.992 -12.319 1.00 12.72  ? 433 ALA B O   1 
ATOM 2800 C CB  . ALA B 1 149 ? -21.945 -46.511 -9.768  1.00 2.16   ? 433 ALA B CB  1 
ATOM 2801 N N   . TYR B 1 150 ? -22.831 -48.332 -12.302 1.00 10.41  ? 434 TYR B N   1 
ATOM 2802 C CA  . TYR B 1 150 ? -22.899 -48.483 -13.752 1.00 13.67  ? 434 TYR B CA  1 
ATOM 2803 C C   . TYR B 1 150 ? -24.074 -47.674 -14.313 1.00 15.28  ? 434 TYR B C   1 
ATOM 2804 O O   . TYR B 1 150 ? -25.199 -48.173 -14.351 1.00 15.64  ? 434 TYR B O   1 
ATOM 2805 C CB  . TYR B 1 150 ? -23.058 -49.971 -14.095 1.00 14.02  ? 434 TYR B CB  1 
ATOM 2806 C CG  . TYR B 1 150 ? -23.285 -50.275 -15.561 1.00 13.49  ? 434 TYR B CG  1 
ATOM 2807 C CD1 . TYR B 1 150 ? -22.336 -49.936 -16.524 1.00 13.61  ? 434 TYR B CD1 1 
ATOM 2808 C CD2 . TYR B 1 150 ? -24.454 -50.898 -15.983 1.00 13.82  ? 434 TYR B CD2 1 
ATOM 2809 C CE1 . TYR B 1 150 ? -22.550 -50.211 -17.874 1.00 17.51  ? 434 TYR B CE1 1 
ATOM 2810 C CE2 . TYR B 1 150 ? -24.680 -51.179 -17.329 1.00 17.94  ? 434 TYR B CE2 1 
ATOM 2811 C CZ  . TYR B 1 150 ? -23.729 -50.833 -18.272 1.00 19.27  ? 434 TYR B CZ  1 
ATOM 2812 O OH  . TYR B 1 150 ? -23.968 -51.093 -19.607 1.00 18.93  ? 434 TYR B OH  1 
ATOM 2813 N N   . ILE B 1 151 ? -23.818 -46.443 -14.765 1.00 15.13  ? 435 ILE B N   1 
ATOM 2814 C CA  . ILE B 1 151 ? -24.906 -45.602 -15.273 1.00 17.57  ? 435 ILE B CA  1 
ATOM 2815 C C   . ILE B 1 151 ? -24.734 -44.919 -16.647 1.00 19.81  ? 435 ILE B C   1 
ATOM 2816 O O   . ILE B 1 151 ? -23.636 -44.515 -17.033 1.00 21.52  ? 435 ILE B O   1 
ATOM 2817 C CB  . ILE B 1 151 ? -25.280 -44.513 -14.225 1.00 15.76  ? 435 ILE B CB  1 
ATOM 2818 C CG1 . ILE B 1 151 ? -24.477 -43.247 -14.473 1.00 14.79  ? 435 ILE B CG1 1 
ATOM 2819 C CG2 . ILE B 1 151 ? -24.977 -45.019 -12.808 1.00 10.22  ? 435 ILE B CG2 1 
ATOM 2820 C CD1 . ILE B 1 151 ? -23.007 -43.474 -14.350 1.00 22.95  ? 435 ILE B CD1 1 
ATOM 2821 N N   . LYS B 1 152 ? -25.853 -44.789 -17.360 1.00 19.75  ? 436 LYS B N   1 
ATOM 2822 C CA  . LYS B 1 152 ? -25.918 -44.177 -18.688 1.00 19.01  ? 436 LYS B CA  1 
ATOM 2823 C C   . LYS B 1 152 ? -25.607 -42.682 -18.644 1.00 19.72  ? 436 LYS B C   1 
ATOM 2824 O O   . LYS B 1 152 ? -26.266 -41.914 -17.939 1.00 20.33  ? 436 LYS B O   1 
ATOM 2825 C CB  . LYS B 1 152 ? -27.317 -44.406 -19.255 1.00 19.57  ? 436 LYS B CB  1 
ATOM 2826 C CG  . LYS B 1 152 ? -27.634 -43.768 -20.597 1.00 20.06  ? 436 LYS B CG  1 
ATOM 2827 C CD  . LYS B 1 152 ? -29.054 -44.182 -20.984 1.00 19.91  ? 436 LYS B CD  1 
ATOM 2828 C CE  . LYS B 1 152 ? -29.537 -43.566 -22.284 1.00 20.63  ? 436 LYS B CE  1 
ATOM 2829 N NZ  . LYS B 1 152 ? -30.911 -44.051 -22.607 1.00 17.93  ? 436 LYS B NZ  1 
ATOM 2830 N N   . VAL B 1 153 ? -24.615 -42.264 -19.422 1.00 19.09  ? 437 VAL B N   1 
ATOM 2831 C CA  . VAL B 1 153 ? -24.210 -40.861 -19.429 1.00 15.68  ? 437 VAL B CA  1 
ATOM 2832 C C   . VAL B 1 153 ? -24.483 -40.108 -20.729 1.00 13.91  ? 437 VAL B C   1 
ATOM 2833 O O   . VAL B 1 153 ? -24.170 -38.928 -20.842 1.00 13.64  ? 437 VAL B O   1 
ATOM 2834 C CB  . VAL B 1 153 ? -22.708 -40.739 -19.098 1.00 14.90  ? 437 VAL B CB  1 
ATOM 2835 C CG1 . VAL B 1 153 ? -22.459 -41.141 -17.639 1.00 12.35  ? 437 VAL B CG1 1 
ATOM 2836 C CG2 . VAL B 1 153 ? -21.903 -41.633 -20.034 1.00 9.99   ? 437 VAL B CG2 1 
ATOM 2837 N N   . PHE B 1 154 ? -25.084 -40.776 -21.702 1.00 11.85  ? 438 PHE B N   1 
ATOM 2838 C CA  . PHE B 1 154 ? -25.358 -40.130 -22.969 1.00 13.27  ? 438 PHE B CA  1 
ATOM 2839 C C   . PHE B 1 154 ? -26.398 -40.897 -23.786 1.00 18.17  ? 438 PHE B C   1 
ATOM 2840 O O   . PHE B 1 154 ? -26.271 -42.104 -23.994 1.00 21.78  ? 438 PHE B O   1 
ATOM 2841 C CB  . PHE B 1 154 ? -24.057 -40.023 -23.759 1.00 9.97   ? 438 PHE B CB  1 
ATOM 2842 C CG  . PHE B 1 154 ? -24.236 -39.514 -25.153 1.00 9.58   ? 438 PHE B CG  1 
ATOM 2843 C CD1 . PHE B 1 154 ? -24.283 -38.154 -25.408 1.00 8.43   ? 438 PHE B CD1 1 
ATOM 2844 C CD2 . PHE B 1 154 ? -24.384 -40.399 -26.216 1.00 9.92   ? 438 PHE B CD2 1 
ATOM 2845 C CE1 . PHE B 1 154 ? -24.478 -37.681 -26.706 1.00 10.54  ? 438 PHE B CE1 1 
ATOM 2846 C CE2 . PHE B 1 154 ? -24.581 -39.934 -27.516 1.00 10.14  ? 438 PHE B CE2 1 
ATOM 2847 C CZ  . PHE B 1 154 ? -24.628 -38.574 -27.761 1.00 7.90   ? 438 PHE B CZ  1 
ATOM 2848 N N   . ASP B 1 155 ? -27.432 -40.199 -24.246 1.00 20.68  ? 439 ASP B N   1 
ATOM 2849 C CA  . ASP B 1 155 ? -28.462 -40.841 -25.049 1.00 22.36  ? 439 ASP B CA  1 
ATOM 2850 C C   . ASP B 1 155 ? -28.601 -40.146 -26.399 1.00 21.50  ? 439 ASP B C   1 
ATOM 2851 O O   . ASP B 1 155 ? -29.046 -39.005 -26.478 1.00 21.37  ? 439 ASP B O   1 
ATOM 2852 C CB  . ASP B 1 155 ? -29.801 -40.846 -24.305 1.00 26.62  ? 439 ASP B CB  1 
ATOM 2853 C CG  . ASP B 1 155 ? -30.939 -41.376 -25.162 1.00 32.21  ? 439 ASP B CG  1 
ATOM 2854 O OD1 . ASP B 1 155 ? -30.722 -42.350 -25.917 1.00 34.31  ? 439 ASP B OD1 1 
ATOM 2855 O OD2 . ASP B 1 155 ? -32.057 -40.822 -25.077 1.00 36.27  ? 439 ASP B OD2 1 
ATOM 2856 N N   . LEU B 1 156 ? -28.208 -40.855 -27.454 1.00 20.84  ? 440 LEU B N   1 
ATOM 2857 C CA  . LEU B 1 156 ? -28.249 -40.344 -28.819 1.00 19.76  ? 440 LEU B CA  1 
ATOM 2858 C C   . LEU B 1 156 ? -29.555 -39.633 -29.183 1.00 21.03  ? 440 LEU B C   1 
ATOM 2859 O O   . LEU B 1 156 ? -29.537 -38.514 -29.695 1.00 20.93  ? 440 LEU B O   1 
ATOM 2860 C CB  . LEU B 1 156 ? -28.016 -41.488 -29.803 1.00 18.01  ? 440 LEU B CB  1 
ATOM 2861 C CG  . LEU B 1 156 ? -26.958 -41.341 -30.898 1.00 18.46  ? 440 LEU B CG  1 
ATOM 2862 C CD1 . LEU B 1 156 ? -27.224 -42.380 -31.982 1.00 15.97  ? 440 LEU B CD1 1 
ATOM 2863 C CD2 . LEU B 1 156 ? -26.998 -39.954 -31.491 1.00 19.03  ? 440 LEU B CD2 1 
ATOM 2864 N N   . ARG B 1 157 ? -30.686 -40.287 -28.937 1.00 21.65  ? 441 ARG B N   1 
ATOM 2865 C CA  . ARG B 1 157 ? -31.981 -39.694 -29.258 1.00 22.71  ? 441 ARG B CA  1 
ATOM 2866 C C   . ARG B 1 157 ? -32.164 -38.398 -28.500 1.00 21.23  ? 441 ARG B C   1 
ATOM 2867 O O   . ARG B 1 157 ? -32.517 -37.378 -29.084 1.00 21.28  ? 441 ARG B O   1 
ATOM 2868 C CB  . ARG B 1 157 ? -33.118 -40.645 -28.895 1.00 27.27  ? 441 ARG B CB  1 
ATOM 2869 C CG  . ARG B 1 157 ? -33.170 -41.889 -29.744 1.00 30.94  ? 441 ARG B CG  1 
ATOM 2870 C CD  . ARG B 1 157 ? -33.838 -41.623 -31.073 1.00 34.61  ? 441 ARG B CD  1 
ATOM 2871 N NE  . ARG B 1 157 ? -33.676 -42.765 -31.966 1.00 39.30  ? 441 ARG B NE  1 
ATOM 2872 C CZ  . ARG B 1 157 ? -34.361 -42.947 -33.089 1.00 38.55  ? 441 ARG B CZ  1 
ATOM 2873 N NH1 . ARG B 1 157 ? -35.273 -42.060 -33.470 1.00 38.73  ? 441 ARG B NH1 1 
ATOM 2874 N NH2 . ARG B 1 157 ? -34.123 -44.017 -33.834 1.00 36.05  ? 441 ARG B NH2 1 
ATOM 2875 N N   . GLN B 1 158 ? -31.933 -38.449 -27.193 1.00 19.74  ? 442 GLN B N   1 
ATOM 2876 C CA  . GLN B 1 158 ? -32.073 -37.271 -26.356 1.00 20.98  ? 442 GLN B CA  1 
ATOM 2877 C C   . GLN B 1 158 ? -31.217 -36.141 -26.909 1.00 20.58  ? 442 GLN B C   1 
ATOM 2878 O O   . GLN B 1 158 ? -31.653 -34.992 -26.979 1.00 23.29  ? 442 GLN B O   1 
ATOM 2879 C CB  . GLN B 1 158 ? -31.653 -37.594 -24.919 1.00 23.71  ? 442 GLN B CB  1 
ATOM 2880 C CG  . GLN B 1 158 ? -31.768 -36.420 -23.957 1.00 31.27  ? 442 GLN B CG  1 
ATOM 2881 C CD  . GLN B 1 158 ? -30.724 -35.337 -24.208 1.00 35.50  ? 442 GLN B CD  1 
ATOM 2882 O OE1 . GLN B 1 158 ? -30.951 -34.159 -23.914 1.00 37.66  ? 442 GLN B OE1 1 
ATOM 2883 N NE2 . GLN B 1 158 ? -29.568 -35.734 -24.740 1.00 37.29  ? 442 GLN B NE2 1 
ATOM 2884 N N   . CYS B 1 159 ? -29.994 -36.482 -27.305 1.00 20.24  ? 443 CYS B N   1 
ATOM 2885 C CA  . CYS B 1 159 ? -29.045 -35.517 -27.848 1.00 17.59  ? 443 CYS B CA  1 
ATOM 2886 C C   . CYS B 1 159 ? -29.506 -34.963 -29.180 1.00 15.79  ? 443 CYS B C   1 
ATOM 2887 O O   . CYS B 1 159 ? -29.497 -33.759 -29.394 1.00 14.01  ? 443 CYS B O   1 
ATOM 2888 C CB  . CYS B 1 159 ? -27.680 -36.173 -28.026 1.00 18.37  ? 443 CYS B CB  1 
ATOM 2889 S SG  . CYS B 1 159 ? -26.421 -35.067 -28.664 1.00 20.62  ? 443 CYS B SG  1 
ATOM 2890 N N   . HIS B 1 160 ? -29.908 -35.855 -30.075 1.00 15.98  ? 444 HIS B N   1 
ATOM 2891 C CA  . HIS B 1 160 ? -30.377 -35.464 -31.392 1.00 16.72  ? 444 HIS B CA  1 
ATOM 2892 C C   . HIS B 1 160 ? -31.548 -34.482 -31.309 1.00 18.86  ? 444 HIS B C   1 
ATOM 2893 O O   . HIS B 1 160 ? -31.547 -33.449 -31.979 1.00 20.07  ? 444 HIS B O   1 
ATOM 2894 C CB  . HIS B 1 160 ? -30.802 -36.697 -32.174 1.00 15.54  ? 444 HIS B CB  1 
ATOM 2895 C CG  . HIS B 1 160 ? -31.141 -36.406 -33.595 1.00 18.95  ? 444 HIS B CG  1 
ATOM 2896 N ND1 . HIS B 1 160 ? -30.186 -36.074 -34.531 1.00 22.28  ? 444 HIS B ND1 1 
ATOM 2897 C CD2 . HIS B 1 160 ? -32.332 -36.344 -34.234 1.00 21.11  ? 444 HIS B CD2 1 
ATOM 2898 C CE1 . HIS B 1 160 ? -30.773 -35.818 -35.686 1.00 21.09  ? 444 HIS B CE1 1 
ATOM 2899 N NE2 . HIS B 1 160 ? -32.076 -35.974 -35.533 1.00 23.22  ? 444 HIS B NE2 1 
ATOM 2900 N N   . ARG B 1 161 ? -32.550 -34.813 -30.497 1.00 19.26  ? 445 ARG B N   1 
ATOM 2901 C CA  . ARG B 1 161 ? -33.712 -33.946 -30.312 1.00 17.75  ? 445 ARG B CA  1 
ATOM 2902 C C   . ARG B 1 161 ? -33.237 -32.553 -29.908 1.00 17.61  ? 445 ARG B C   1 
ATOM 2903 O O   . ARG B 1 161 ? -33.589 -31.550 -30.537 1.00 18.29  ? 445 ARG B O   1 
ATOM 2904 C CB  . ARG B 1 161 ? -34.632 -34.493 -29.208 1.00 17.85  ? 445 ARG B CB  1 
ATOM 2905 C CG  . ARG B 1 161 ? -35.536 -35.660 -29.607 1.00 15.89  ? 445 ARG B CG  1 
ATOM 2906 C CD  . ARG B 1 161 ? -36.621 -35.880 -28.551 1.00 15.66  ? 445 ARG B CD  1 
ATOM 2907 N NE  . ARG B 1 161 ? -36.118 -36.440 -27.296 1.00 16.44  ? 445 ARG B NE  1 
ATOM 2908 C CZ  . ARG B 1 161 ? -35.947 -37.744 -27.069 1.00 16.34  ? 445 ARG B CZ  1 
ATOM 2909 N NH1 . ARG B 1 161 ? -36.240 -38.635 -28.008 1.00 15.94  ? 445 ARG B NH1 1 
ATOM 2910 N NH2 . ARG B 1 161 ? -35.474 -38.165 -25.905 1.00 17.76  ? 445 ARG B NH2 1 
ATOM 2911 N N   . GLN B 1 162 ? -32.434 -32.514 -28.848 1.00 15.59  ? 446 GLN B N   1 
ATOM 2912 C CA  . GLN B 1 162 ? -31.880 -31.276 -28.312 1.00 15.53  ? 446 GLN B CA  1 
ATOM 2913 C C   . GLN B 1 162 ? -31.150 -30.430 -29.368 1.00 14.57  ? 446 GLN B C   1 
ATOM 2914 O O   . GLN B 1 162 ? -31.334 -29.210 -29.420 1.00 11.83  ? 446 GLN B O   1 
ATOM 2915 C CB  . GLN B 1 162 ? -30.941 -31.608 -27.144 1.00 15.06  ? 446 GLN B CB  1 
ATOM 2916 C CG  . GLN B 1 162 ? -30.360 -30.402 -26.457 1.00 17.99  ? 446 GLN B CG  1 
ATOM 2917 C CD  . GLN B 1 162 ? -31.423 -29.487 -25.892 1.00 23.79  ? 446 GLN B CD  1 
ATOM 2918 O OE1 . GLN B 1 162 ? -31.162 -28.317 -25.596 1.00 27.76  ? 446 GLN B OE1 1 
ATOM 2919 N NE2 . GLN B 1 162 ? -32.630 -30.012 -25.730 1.00 26.63  ? 446 GLN B NE2 1 
ATOM 2920 N N   . MET B 1 163 ? -30.333 -31.090 -30.196 1.00 14.84  ? 447 MET B N   1 
ATOM 2921 C CA  . MET B 1 163 ? -29.558 -30.460 -31.276 1.00 12.09  ? 447 MET B CA  1 
ATOM 2922 C C   . MET B 1 163 ? -30.427 -29.699 -32.258 1.00 11.91  ? 447 MET B C   1 
ATOM 2923 O O   . MET B 1 163 ? -30.238 -28.506 -32.466 1.00 8.61   ? 447 MET B O   1 
ATOM 2924 C CB  . MET B 1 163 ? -28.811 -31.512 -32.087 1.00 13.99  ? 447 MET B CB  1 
ATOM 2925 C CG  . MET B 1 163 ? -27.553 -32.065 -31.477 1.00 20.13  ? 447 MET B CG  1 
ATOM 2926 S SD  . MET B 1 163 ? -26.779 -33.180 -32.674 1.00 25.79  ? 447 MET B SD  1 
ATOM 2927 C CE  . MET B 1 163 ? -27.089 -34.752 -31.925 1.00 28.35  ? 447 MET B CE  1 
ATOM 2928 N N   . GLN B 1 164 ? -31.352 -30.424 -32.890 1.00 13.07  ? 448 GLN B N   1 
ATOM 2929 C CA  . GLN B 1 164 ? -32.268 -29.856 -33.873 1.00 12.35  ? 448 GLN B CA  1 
ATOM 2930 C C   . GLN B 1 164 ? -32.967 -28.666 -33.264 1.00 15.91  ? 448 GLN B C   1 
ATOM 2931 O O   . GLN B 1 164 ? -33.200 -27.659 -33.934 1.00 17.67  ? 448 GLN B O   1 
ATOM 2932 C CB  . GLN B 1 164 ? -33.328 -30.874 -34.290 1.00 6.43   ? 448 GLN B CB  1 
ATOM 2933 C CG  . GLN B 1 164 ? -32.851 -31.982 -35.172 1.00 8.31   ? 448 GLN B CG  1 
ATOM 2934 C CD  . GLN B 1 164 ? -33.903 -33.063 -35.339 1.00 15.50  ? 448 GLN B CD  1 
ATOM 2935 O OE1 . GLN B 1 164 ? -34.333 -33.684 -34.368 1.00 18.85  ? 448 GLN B OE1 1 
ATOM 2936 N NE2 . GLN B 1 164 ? -34.322 -33.296 -36.573 1.00 17.06  ? 448 GLN B NE2 1 
ATOM 2937 N N   . GLN B 1 165 ? -33.309 -28.793 -31.987 1.00 16.83  ? 449 GLN B N   1 
ATOM 2938 C CA  . GLN B 1 165 ? -33.996 -27.725 -31.293 1.00 20.94  ? 449 GLN B CA  1 
ATOM 2939 C C   . GLN B 1 165 ? -33.071 -26.538 -31.129 1.00 20.58  ? 449 GLN B C   1 
ATOM 2940 O O   . GLN B 1 165 ? -33.379 -25.450 -31.595 1.00 21.90  ? 449 GLN B O   1 
ATOM 2941 C CB  . GLN B 1 165 ? -34.479 -28.200 -29.929 1.00 28.47  ? 449 GLN B CB  1 
ATOM 2942 C CG  . GLN B 1 165 ? -35.628 -27.379 -29.379 1.00 34.26  ? 449 GLN B CG  1 
ATOM 2943 C CD  . GLN B 1 165 ? -36.898 -27.543 -30.196 1.00 39.33  ? 449 GLN B CD  1 
ATOM 2944 O OE1 . GLN B 1 165 ? -37.909 -26.900 -29.920 1.00 43.06  ? 449 GLN B OE1 1 
ATOM 2945 N NE2 . GLN B 1 165 ? -36.852 -28.411 -31.204 1.00 40.41  ? 449 GLN B NE2 1 
ATOM 2946 N N   . GLN B 1 166 ? -31.937 -26.749 -30.467 1.00 21.43  ? 450 GLN B N   1 
ATOM 2947 C CA  . GLN B 1 166 ? -30.964 -25.678 -30.268 1.00 20.74  ? 450 GLN B CA  1 
ATOM 2948 C C   . GLN B 1 166 ? -30.536 -25.050 -31.603 1.00 20.51  ? 450 GLN B C   1 
ATOM 2949 O O   . GLN B 1 166 ? -30.385 -23.831 -31.708 1.00 19.04  ? 450 GLN B O   1 
ATOM 2950 C CB  . GLN B 1 166 ? -29.726 -26.205 -29.537 1.00 19.73  ? 450 GLN B CB  1 
ATOM 2951 C CG  . GLN B 1 166 ? -29.851 -26.288 -28.032 1.00 22.96  ? 450 GLN B CG  1 
ATOM 2952 C CD  . GLN B 1 166 ? -28.498 -26.460 -27.349 1.00 27.10  ? 450 GLN B CD  1 
ATOM 2953 O OE1 . GLN B 1 166 ? -27.538 -25.760 -27.669 1.00 28.00  ? 450 GLN B OE1 1 
ATOM 2954 N NE2 . GLN B 1 166 ? -28.422 -27.381 -26.395 1.00 29.88  ? 450 GLN B NE2 1 
ATOM 2955 N N   . ALA B 1 167 ? -30.339 -25.891 -32.616 1.00 19.82  ? 451 ALA B N   1 
ATOM 2956 C CA  . ALA B 1 167 ? -29.929 -25.429 -33.940 1.00 19.83  ? 451 ALA B CA  1 
ATOM 2957 C C   . ALA B 1 167 ? -30.937 -24.444 -34.496 1.00 21.92  ? 451 ALA B C   1 
ATOM 2958 O O   . ALA B 1 167 ? -30.570 -23.390 -35.007 1.00 23.51  ? 451 ALA B O   1 
ATOM 2959 C CB  . ALA B 1 167 ? -29.793 -26.605 -34.883 1.00 18.24  ? 451 ALA B CB  1 
ATOM 2960 N N   . ALA B 1 168 ? -32.212 -24.805 -34.406 1.00 22.41  ? 452 ALA B N   1 
ATOM 2961 C CA  . ALA B 1 168 ? -33.286 -23.956 -34.885 1.00 21.11  ? 452 ALA B CA  1 
ATOM 2962 C C   . ALA B 1 168 ? -33.248 -22.671 -34.090 1.00 22.93  ? 452 ALA B C   1 
ATOM 2963 O O   . ALA B 1 168 ? -33.159 -21.582 -34.642 1.00 23.92  ? 452 ALA B O   1 
ATOM 2964 C CB  . ALA B 1 168 ? -34.604 -24.645 -34.678 1.00 20.38  ? 452 ALA B CB  1 
ATOM 2965 N N   . THR B 1 169 ? -33.315 -22.817 -32.777 1.00 26.28  ? 453 THR B N   1 
ATOM 2966 C CA  . THR B 1 169 ? -33.288 -21.689 -31.863 1.00 31.57  ? 453 THR B CA  1 
ATOM 2967 C C   . THR B 1 169 ? -32.237 -20.658 -32.274 1.00 32.96  ? 453 THR B C   1 
ATOM 2968 O O   . THR B 1 169 ? -32.507 -19.462 -32.291 1.00 34.33  ? 453 THR B O   1 
ATOM 2969 C CB  . THR B 1 169 ? -32.993 -22.177 -30.427 1.00 34.98  ? 453 THR B CB  1 
ATOM 2970 O OG1 . THR B 1 169 ? -34.094 -22.967 -29.952 1.00 33.97  ? 453 THR B OG1 1 
ATOM 2971 C CG2 . THR B 1 169 ? -32.754 -20.994 -29.491 1.00 38.61  ? 453 THR B CG2 1 
ATOM 2972 N N   . ALA B 1 170 ? -31.041 -21.129 -32.604 1.00 34.45  ? 454 ALA B N   1 
ATOM 2973 C CA  . ALA B 1 170 ? -29.957 -20.243 -33.007 1.00 35.21  ? 454 ALA B CA  1 
ATOM 2974 C C   . ALA B 1 170 ? -30.261 -19.586 -34.339 1.00 36.18  ? 454 ALA B C   1 
ATOM 2975 O O   . ALA B 1 170 ? -30.243 -18.368 -34.448 1.00 35.77  ? 454 ALA B O   1 
ATOM 2976 C CB  . ALA B 1 170 ? -28.663 -21.019 -33.103 1.00 37.56  ? 454 ALA B CB  1 
ATOM 2977 N N   . GLN B 1 171 ? -30.527 -20.408 -35.348 1.00 39.08  ? 455 GLN B N   1 
ATOM 2978 C CA  . GLN B 1 171 ? -30.844 -19.939 -36.693 1.00 41.85  ? 455 GLN B CA  1 
ATOM 2979 C C   . GLN B 1 171 ? -31.848 -18.773 -36.649 1.00 42.07  ? 455 GLN B C   1 
ATOM 2980 O O   . GLN B 1 171 ? -31.833 -17.887 -37.513 1.00 41.79  ? 455 GLN B O   1 
ATOM 2981 C CB  . GLN B 1 171 ? -31.407 -21.111 -37.516 1.00 45.13  ? 455 GLN B CB  1 
ATOM 2982 C CG  . GLN B 1 171 ? -31.754 -20.799 -38.976 1.00 51.12  ? 455 GLN B CG  1 
ATOM 2983 C CD  . GLN B 1 171 ? -30.530 -20.637 -39.871 1.00 55.94  ? 455 GLN B CD  1 
ATOM 2984 O OE1 . GLN B 1 171 ? -29.640 -19.835 -39.587 1.00 62.21  ? 455 GLN B OE1 1 
ATOM 2985 N NE2 . GLN B 1 171 ? -30.490 -21.393 -40.966 1.00 54.28  ? 455 GLN B NE2 1 
ATOM 2986 N N   . ALA B 1 172 ? -32.713 -18.774 -35.639 1.00 41.40  ? 456 ALA B N   1 
ATOM 2987 C CA  . ALA B 1 172 ? -33.702 -17.716 -35.484 1.00 42.91  ? 456 ALA B CA  1 
ATOM 2988 C C   . ALA B 1 172 ? -33.032 -16.478 -34.919 1.00 44.03  ? 456 ALA B C   1 
ATOM 2989 O O   . ALA B 1 172 ? -33.212 -15.386 -35.437 1.00 45.79  ? 456 ALA B O   1 
ATOM 2990 C CB  . ALA B 1 172 ? -34.813 -18.163 -34.567 1.00 45.11  ? 456 ALA B CB  1 
ATOM 2991 N N   . ALA B 1 173 ? -32.262 -16.648 -33.851 1.00 46.78  ? 457 ALA B N   1 
ATOM 2992 C CA  . ALA B 1 173 ? -31.549 -15.526 -33.244 1.00 49.97  ? 457 ALA B CA  1 
ATOM 2993 C C   . ALA B 1 173 ? -30.576 -14.944 -34.276 1.00 52.60  ? 457 ALA B C   1 
ATOM 2994 O O   . ALA B 1 173 ? -29.954 -13.899 -34.053 1.00 51.64  ? 457 ALA B O   1 
ATOM 2995 C CB  . ALA B 1 173 ? -30.794 -15.992 -32.009 1.00 48.76  ? 457 ALA B CB  1 
ATOM 2996 N N   . ALA B 1 174 ? -30.449 -15.647 -35.400 1.00 54.43  ? 458 ALA B N   1 
ATOM 2997 C CA  . ALA B 1 174 ? -29.585 -15.229 -36.493 1.00 55.45  ? 458 ALA B CA  1 
ATOM 2998 C C   . ALA B 1 174 ? -30.359 -14.176 -37.250 1.00 57.05  ? 458 ALA B C   1 
ATOM 2999 O O   . ALA B 1 174 ? -29.954 -13.021 -37.304 1.00 59.08  ? 458 ALA B O   1 
ATOM 3000 C CB  . ALA B 1 174 ? -29.270 -16.406 -37.408 1.00 54.97  ? 458 ALA B CB  1 
ATOM 3001 N N   . ALA B 1 175 ? -31.484 -14.582 -37.828 1.00 59.23  ? 459 ALA B N   1 
ATOM 3002 C CA  . ALA B 1 175 ? -32.329 -13.657 -38.574 1.00 62.29  ? 459 ALA B CA  1 
ATOM 3003 C C   . ALA B 1 175 ? -32.854 -12.571 -37.637 1.00 64.22  ? 459 ALA B C   1 
ATOM 3004 O O   . ALA B 1 175 ? -33.364 -11.546 -38.088 1.00 64.20  ? 459 ALA B O   1 
ATOM 3005 C CB  . ALA B 1 175 ? -33.489 -14.406 -39.210 1.00 61.71  ? 459 ALA B CB  1 
ATOM 3006 N N   . ALA B 1 176 ? -32.724 -12.808 -36.333 1.00 66.02  ? 460 ALA B N   1 
ATOM 3007 C CA  . ALA B 1 176 ? -33.175 -11.861 -35.321 1.00 67.59  ? 460 ALA B CA  1 
ATOM 3008 C C   . ALA B 1 176 ? -32.243 -10.666 -35.306 1.00 69.86  ? 460 ALA B C   1 
ATOM 3009 O O   . ALA B 1 176 ? -32.677 -9.537  -35.516 1.00 71.12  ? 460 ALA B O   1 
ATOM 3010 C CB  . ALA B 1 176 ? -33.194 -12.520 -33.956 1.00 67.77  ? 460 ALA B CB  1 
ATOM 3011 N N   . GLN B 1 177 ? -30.962 -10.915 -35.048 1.00 72.43  ? 461 GLN B N   1 
ATOM 3012 C CA  . GLN B 1 177 ? -29.979 -9.838  -35.031 1.00 75.09  ? 461 GLN B CA  1 
ATOM 3013 C C   . GLN B 1 177 ? -29.936 -9.241  -36.431 1.00 75.43  ? 461 GLN B C   1 
ATOM 3014 O O   . GLN B 1 177 ? -29.643 -8.060  -36.608 1.00 74.94  ? 461 GLN B O   1 
ATOM 3015 C CB  . GLN B 1 177 ? -28.586 -10.367 -34.672 1.00 77.64  ? 461 GLN B CB  1 
ATOM 3016 C CG  . GLN B 1 177 ? -28.464 -11.013 -33.300 1.00 81.48  ? 461 GLN B CG  1 
ATOM 3017 C CD  . GLN B 1 177 ? -27.014 -11.290 -32.917 1.00 83.60  ? 461 GLN B CD  1 
ATOM 3018 O OE1 . GLN B 1 177 ? -26.293 -11.997 -33.623 1.00 83.61  ? 461 GLN B OE1 1 
ATOM 3019 N NE2 . GLN B 1 177 ? -26.583 -10.729 -31.794 1.00 84.75  ? 461 GLN B NE2 1 
ATOM 3020 N N   . ALA B 1 178 ? -30.235 -10.079 -37.420 1.00 76.83  ? 462 ALA B N   1 
ATOM 3021 C CA  . ALA B 1 178 ? -30.237 -9.670  -38.819 1.00 79.14  ? 462 ALA B CA  1 
ATOM 3022 C C   . ALA B 1 178 ? -31.250 -8.562  -39.041 1.00 81.21  ? 462 ALA B C   1 
ATOM 3023 O O   . ALA B 1 178 ? -30.902 -7.472  -39.490 1.00 82.19  ? 462 ALA B O   1 
ATOM 3024 C CB  . ALA B 1 178 ? -30.566 -10.862 -39.707 1.00 79.00  ? 462 ALA B CB  1 
ATOM 3025 N N   . ALA B 1 179 ? -32.509 -8.852  -38.730 1.00 82.97  ? 463 ALA B N   1 
ATOM 3026 C CA  . ALA B 1 179 ? -33.573 -7.874  -38.885 1.00 84.13  ? 463 ALA B CA  1 
ATOM 3027 C C   . ALA B 1 179 ? -33.403 -6.787  -37.833 1.00 86.05  ? 463 ALA B C   1 
ATOM 3028 O O   . ALA B 1 179 ? -34.041 -5.740  -37.904 1.00 85.86  ? 463 ALA B O   1 
ATOM 3029 C CB  . ALA B 1 179 ? -34.925 -8.544  -38.731 1.00 83.25  ? 463 ALA B CB  1 
ATOM 3030 N N   . ALA B 1 180 ? -32.538 -7.046  -36.856 1.00 88.79  ? 464 ALA B N   1 
ATOM 3031 C CA  . ALA B 1 180 ? -32.276 -6.088  -35.788 1.00 91.77  ? 464 ALA B CA  1 
ATOM 3032 C C   . ALA B 1 180 ? -31.674 -4.814  -36.368 1.00 94.01  ? 464 ALA B C   1 
ATOM 3033 O O   . ALA B 1 180 ? -32.404 -3.933  -36.821 1.00 94.30  ? 464 ALA B O   1 
ATOM 3034 C CB  . ALA B 1 180 ? -31.328 -6.692  -34.750 1.00 92.67  ? 464 ALA B CB  1 
ATOM 3035 N N   . VAL B 1 181 ? -30.346 -4.722  -36.361 1.00 96.48  ? 465 VAL B N   1 
ATOM 3036 C CA  . VAL B 1 181 ? -29.656 -3.545  -36.889 1.00 97.25  ? 465 VAL B CA  1 
ATOM 3037 C C   . VAL B 1 181 ? -30.288 -3.084  -38.204 1.00 97.86  ? 465 VAL B C   1 
ATOM 3038 O O   . VAL B 1 181 ? -30.357 -1.887  -38.484 1.00 98.59  ? 465 VAL B O   1 
ATOM 3039 C CB  . VAL B 1 181 ? -28.150 -3.829  -37.120 1.00 96.35  ? 465 VAL B CB  1 
ATOM 3040 C CG1 . VAL B 1 181 ? -27.506 -4.304  -35.825 1.00 95.41  ? 465 VAL B CG1 1 
ATOM 3041 C CG2 . VAL B 1 181 ? -27.973 -4.865  -38.216 1.00 95.70  ? 465 VAL B CG2 1 
ATOM 3042 N N   . ALA B 1 182 ? -30.759 -4.041  -38.998 1.00 97.81  ? 466 ALA B N   1 
ATOM 3043 C CA  . ALA B 1 182 ? -31.393 -3.738  -40.275 1.00 97.82  ? 466 ALA B CA  1 
ATOM 3044 C C   . ALA B 1 182 ? -32.739 -3.056  -40.058 1.00 97.81  ? 466 ALA B C   1 
ATOM 3045 O O   . ALA B 1 182 ? -32.822 -1.831  -39.971 1.00 97.69  ? 466 ALA B O   1 
ATOM 3046 C CB  . ALA B 1 182 ? -31.581 -5.018  -41.079 1.00 98.43  ? 466 ALA B CB  1 
ATOM 3047 N N   . ALA B 1 195 ? -31.524 4.811   -45.929 1.00 90.88  ? 479 ALA B N   1 
ATOM 3048 C CA  . ALA B 1 195 ? -30.482 3.819   -45.685 1.00 90.66  ? 479 ALA B CA  1 
ATOM 3049 C C   . ALA B 1 195 ? -29.587 3.654   -46.911 1.00 89.93  ? 479 ALA B C   1 
ATOM 3050 O O   . ALA B 1 195 ? -30.003 3.928   -48.037 1.00 89.64  ? 479 ALA B O   1 
ATOM 3051 C CB  . ALA B 1 195 ? -31.111 2.475   -45.308 1.00 90.30  ? 479 ALA B CB  1 
ATOM 3052 N N   . PRO B 1 196 ? -28.339 3.206   -46.702 1.00 89.78  ? 480 PRO B N   1 
ATOM 3053 C CA  . PRO B 1 196 ? -27.354 2.992   -47.766 1.00 88.83  ? 480 PRO B CA  1 
ATOM 3054 C C   . PRO B 1 196 ? -27.470 1.619   -48.428 1.00 87.63  ? 480 PRO B C   1 
ATOM 3055 O O   . PRO B 1 196 ? -28.557 1.053   -48.539 1.00 87.83  ? 480 PRO B O   1 
ATOM 3056 C CB  . PRO B 1 196 ? -26.036 3.148   -47.030 1.00 89.94  ? 480 PRO B CB  1 
ATOM 3057 C CG  . PRO B 1 196 ? -26.347 2.453   -45.742 1.00 90.92  ? 480 PRO B CG  1 
ATOM 3058 C CD  . PRO B 1 196 ? -27.709 3.027   -45.380 1.00 90.70  ? 480 PRO B CD  1 
ATOM 3059 N N   . ALA B 1 197 ? -26.328 1.090   -48.854 1.00 85.95  ? 481 ALA B N   1 
ATOM 3060 C CA  . ALA B 1 197 ? -26.268 -0.208  -49.512 1.00 83.77  ? 481 ALA B CA  1 
ATOM 3061 C C   . ALA B 1 197 ? -25.468 -1.196  -48.670 1.00 82.24  ? 481 ALA B C   1 
ATOM 3062 O O   . ALA B 1 197 ? -24.238 -1.249  -48.755 1.00 81.71  ? 481 ALA B O   1 
ATOM 3063 C CB  . ALA B 1 197 ? -25.633 -0.051  -50.875 1.00 84.50  ? 481 ALA B CB  1 
ATOM 3064 N N   . ILE B 1 198 ? -26.172 -1.985  -47.864 1.00 80.00  ? 482 ILE B N   1 
ATOM 3065 C CA  . ILE B 1 198 ? -25.522 -2.955  -46.992 1.00 77.18  ? 482 ILE B CA  1 
ATOM 3066 C C   . ILE B 1 198 ? -26.201 -4.325  -46.955 1.00 75.44  ? 482 ILE B C   1 
ATOM 3067 O O   . ILE B 1 198 ? -27.430 -4.429  -46.974 1.00 75.86  ? 482 ILE B O   1 
ATOM 3068 C CB  . ILE B 1 198 ? -25.430 -2.397  -45.555 1.00 76.39  ? 482 ILE B CB  1 
ATOM 3069 C CG1 . ILE B 1 198 ? -24.340 -1.327  -45.495 1.00 76.78  ? 482 ILE B CG1 1 
ATOM 3070 C CG2 . ILE B 1 198 ? -25.156 -3.511  -44.567 1.00 76.86  ? 482 ILE B CG2 1 
ATOM 3071 C CD1 . ILE B 1 198 ? -24.125 -0.749  -44.116 1.00 78.80  ? 482 ILE B CD1 1 
ATOM 3072 N N   . SER B 1 199 ? -25.384 -5.373  -46.896 1.00 72.27  ? 483 SER B N   1 
ATOM 3073 C CA  . SER B 1 199 ? -25.884 -6.738  -46.845 1.00 69.27  ? 483 SER B CA  1 
ATOM 3074 C C   . SER B 1 199 ? -25.596 -7.394  -45.498 1.00 68.39  ? 483 SER B C   1 
ATOM 3075 O O   . SER B 1 199 ? -24.663 -7.013  -44.791 1.00 67.22  ? 483 SER B O   1 
ATOM 3076 C CB  . SER B 1 199 ? -25.259 -7.566  -47.967 1.00 68.20  ? 483 SER B CB  1 
ATOM 3077 O OG  . SER B 1 199 ? -25.653 -7.074  -49.234 1.00 66.78  ? 483 SER B OG  1 
ATOM 3078 N N   . LEU B 1 200 ? -26.411 -8.386  -45.155 1.00 68.24  ? 484 LEU B N   1 
ATOM 3079 C CA  . LEU B 1 200 ? -26.278 -9.110  -43.898 1.00 66.75  ? 484 LEU B CA  1 
ATOM 3080 C C   . LEU B 1 200 ? -26.237 -10.606 -44.149 1.00 65.70  ? 484 LEU B C   1 
ATOM 3081 O O   . LEU B 1 200 ? -26.771 -11.093 -45.145 1.00 64.05  ? 484 LEU B O   1 
ATOM 3082 C CB  . LEU B 1 200 ? -27.466 -8.810  -42.987 1.00 67.98  ? 484 LEU B CB  1 
ATOM 3083 C CG  . LEU B 1 200 ? -27.716 -7.368  -42.549 1.00 70.12  ? 484 LEU B CG  1 
ATOM 3084 C CD1 . LEU B 1 200 ? -29.058 -7.284  -41.831 1.00 70.23  ? 484 LEU B CD1 1 
ATOM 3085 C CD2 . LEU B 1 200 ? -26.588 -6.909  -41.643 1.00 70.49  ? 484 LEU B CD2 1 
ATOM 3086 N N   . SER B 1 201 ? -25.612 -11.330 -43.227 1.00 65.57  ? 485 SER B N   1 
ATOM 3087 C CA  . SER B 1 201 ? -25.513 -12.778 -43.326 1.00 65.13  ? 485 SER B CA  1 
ATOM 3088 C C   . SER B 1 201 ? -25.298 -13.401 -41.954 1.00 65.45  ? 485 SER B C   1 
ATOM 3089 O O   . SER B 1 201 ? -24.566 -12.860 -41.119 1.00 63.78  ? 485 SER B O   1 
ATOM 3090 C CB  . SER B 1 201 ? -24.364 -13.171 -44.250 1.00 64.67  ? 485 SER B CB  1 
ATOM 3091 O OG  . SER B 1 201 ? -24.571 -12.668 -45.553 1.00 65.51  ? 485 SER B OG  1 
ATOM 3092 N N   . ALA B 1 202 ? -25.948 -14.539 -41.728 1.00 66.42  ? 486 ALA B N   1 
ATOM 3093 C CA  . ALA B 1 202 ? -25.829 -15.254 -40.465 1.00 67.08  ? 486 ALA B CA  1 
ATOM 3094 C C   . ALA B 1 202 ? -24.398 -15.759 -40.310 1.00 68.15  ? 486 ALA B C   1 
ATOM 3095 O O   . ALA B 1 202 ? -23.808 -16.261 -41.274 1.00 68.78  ? 486 ALA B O   1 
ATOM 3096 C CB  . ALA B 1 202 ? -26.807 -16.429 -40.437 1.00 65.28  ? 486 ALA B CB  1 
ATOM 3097 N N   . ALA B 1 203 ? -23.836 -15.612 -39.111 1.00 67.93  ? 487 ALA B N   1 
ATOM 3098 C CA  . ALA B 1 203 ? -22.479 -16.084 -38.848 1.00 67.64  ? 487 ALA B CA  1 
ATOM 3099 C C   . ALA B 1 203 ? -22.443 -17.543 -39.260 1.00 69.04  ? 487 ALA B C   1 
ATOM 3100 O O   . ALA B 1 203 ? -23.115 -18.371 -38.647 1.00 71.25  ? 487 ALA B O   1 
ATOM 3101 C CB  . ALA B 1 203 ? -22.153 -15.964 -37.377 1.00 65.75  ? 487 ALA B CB  1 
ATOM 3102 N N   . ALA B 1 204 ? -21.671 -17.852 -40.300 1.00 68.81  ? 488 ALA B N   1 
ATOM 3103 C CA  . ALA B 1 204 ? -21.556 -19.218 -40.812 1.00 67.03  ? 488 ALA B CA  1 
ATOM 3104 C C   . ALA B 1 204 ? -21.219 -20.227 -39.714 1.00 66.01  ? 488 ALA B C   1 
ATOM 3105 O O   . ALA B 1 204 ? -20.089 -20.715 -39.634 1.00 67.86  ? 488 ALA B O   1 
ATOM 3106 C CB  . ALA B 1 204 ? -20.500 -19.270 -41.913 1.00 66.48  ? 488 ALA B CB  1 
ATOM 3107 N N   . GLY B 1 205 ? -22.205 -20.541 -38.877 1.00 63.86  ? 489 GLY B N   1 
ATOM 3108 C CA  . GLY B 1 205 ? -21.995 -21.485 -37.794 1.00 60.11  ? 489 GLY B CA  1 
ATOM 3109 C C   . GLY B 1 205 ? -22.319 -20.927 -36.418 1.00 56.53  ? 489 GLY B C   1 
ATOM 3110 O O   . GLY B 1 205 ? -21.510 -21.023 -35.499 1.00 54.84  ? 489 GLY B O   1 
ATOM 3111 N N   . ILE B 1 206 ? -23.500 -20.338 -36.270 1.00 54.00  ? 490 ILE B N   1 
ATOM 3112 C CA  . ILE B 1 206 ? -23.899 -19.791 -34.984 1.00 52.02  ? 490 ILE B CA  1 
ATOM 3113 C C   . ILE B 1 206 ? -24.200 -20.948 -34.044 1.00 51.89  ? 490 ILE B C   1 
ATOM 3114 O O   . ILE B 1 206 ? -24.560 -22.033 -34.494 1.00 51.19  ? 490 ILE B O   1 
ATOM 3115 C CB  . ILE B 1 206 ? -25.157 -18.886 -35.100 1.00 52.19  ? 490 ILE B CB  1 
ATOM 3116 C CG1 . ILE B 1 206 ? -26.134 -19.448 -36.153 1.00 50.67  ? 490 ILE B CG1 1 
ATOM 3117 C CG2 . ILE B 1 206 ? -24.731 -17.446 -35.394 1.00 52.82  ? 490 ILE B CG2 1 
ATOM 3118 C CD1 . ILE B 1 206 ? -25.837 -19.075 -37.611 1.00 43.47  ? 490 ILE B CD1 1 
ATOM 3119 N N   . GLY B 1 207 ? -24.032 -20.719 -32.743 1.00 51.14  ? 491 GLY B N   1 
ATOM 3120 C CA  . GLY B 1 207 ? -24.293 -21.752 -31.751 1.00 48.65  ? 491 GLY B CA  1 
ATOM 3121 C C   . GLY B 1 207 ? -23.623 -23.109 -31.956 1.00 46.07  ? 491 GLY B C   1 
ATOM 3122 O O   . GLY B 1 207 ? -24.053 -24.107 -31.372 1.00 46.14  ? 491 GLY B O   1 
ATOM 3123 N N   . VAL B 1 208 ? -22.569 -23.158 -32.766 1.00 41.57  ? 492 VAL B N   1 
ATOM 3124 C CA  . VAL B 1 208 ? -21.869 -24.414 -33.019 1.00 36.74  ? 492 VAL B CA  1 
ATOM 3125 C C   . VAL B 1 208 ? -20.955 -24.852 -31.868 1.00 34.56  ? 492 VAL B C   1 
ATOM 3126 O O   . VAL B 1 208 ? -20.888 -26.033 -31.533 1.00 34.98  ? 492 VAL B O   1 
ATOM 3127 C CB  . VAL B 1 208 ? -21.031 -24.330 -34.317 1.00 35.06  ? 492 VAL B CB  1 
ATOM 3128 C CG1 . VAL B 1 208 ? -20.217 -25.606 -34.515 1.00 28.70  ? 492 VAL B CG1 1 
ATOM 3129 C CG2 . VAL B 1 208 ? -21.946 -24.106 -35.497 1.00 33.40  ? 492 VAL B CG2 1 
ATOM 3130 N N   . ASP B 1 209 ? -20.248 -23.918 -31.256 0.50 30.40  ? 493 ASP B N   1 
ATOM 3131 C CA  . ASP B 1 209 ? -19.366 -24.304 -30.173 0.50 27.59  ? 493 ASP B CA  1 
ATOM 3132 C C   . ASP B 1 209 ? -20.179 -24.802 -28.997 0.50 28.86  ? 493 ASP B C   1 
ATOM 3133 O O   . ASP B 1 209 ? -19.628 -25.263 -28.000 0.50 29.56  ? 493 ASP B O   1 
ATOM 3134 C CB  . ASP B 1 209 ? -18.523 -23.128 -29.726 0.50 24.50  ? 493 ASP B CB  1 
ATOM 3135 C CG  . ASP B 1 209 ? -17.405 -23.548 -28.830 0.50 22.61  ? 493 ASP B CG  1 
ATOM 3136 O OD1 . ASP B 1 209 ? -16.452 -24.162 -29.348 0.50 23.09  ? 493 ASP B OD1 1 
ATOM 3137 O OD2 . ASP B 1 209 ? -17.484 -23.283 -27.614 0.50 18.50  ? 493 ASP B OD2 1 
ATOM 3138 N N   . ASP B 1 210 ? -21.496 -24.705 -29.127 1.00 30.58  ? 494 ASP B N   1 
ATOM 3139 C CA  . ASP B 1 210 ? -22.424 -25.119 -28.078 1.00 32.61  ? 494 ASP B CA  1 
ATOM 3140 C C   . ASP B 1 210 ? -23.096 -26.444 -28.364 1.00 32.81  ? 494 ASP B C   1 
ATOM 3141 O O   . ASP B 1 210 ? -23.386 -27.206 -27.450 1.00 34.53  ? 494 ASP B O   1 
ATOM 3142 C CB  . ASP B 1 210 ? -23.506 -24.066 -27.905 1.00 35.30  ? 494 ASP B CB  1 
ATOM 3143 C CG  . ASP B 1 210 ? -22.949 -22.743 -27.489 1.00 37.39  ? 494 ASP B CG  1 
ATOM 3144 O OD1 . ASP B 1 210 ? -22.768 -22.536 -26.267 1.00 38.14  ? 494 ASP B OD1 1 
ATOM 3145 O OD2 . ASP B 1 210 ? -22.678 -21.921 -28.393 1.00 37.65  ? 494 ASP B OD2 1 
ATOM 3146 N N   . LEU B 1 211 ? -23.381 -26.698 -29.633 1.00 31.72  ? 495 LEU B N   1 
ATOM 3147 C CA  . LEU B 1 211 ? -24.016 -27.946 -30.029 1.00 29.22  ? 495 LEU B CA  1 
ATOM 3148 C C   . LEU B 1 211 ? -22.991 -29.073 -29.954 1.00 28.00  ? 495 LEU B C   1 
ATOM 3149 O O   . LEU B 1 211 ? -23.316 -30.208 -29.612 1.00 28.02  ? 495 LEU B O   1 
ATOM 3150 C CB  . LEU B 1 211 ? -24.563 -27.830 -31.456 1.00 27.61  ? 495 LEU B CB  1 
ATOM 3151 C CG  . LEU B 1 211 ? -25.654 -26.776 -31.652 1.00 25.77  ? 495 LEU B CG  1 
ATOM 3152 C CD1 . LEU B 1 211 ? -25.963 -26.595 -33.130 1.00 22.22  ? 495 LEU B CD1 1 
ATOM 3153 C CD2 . LEU B 1 211 ? -26.888 -27.203 -30.895 1.00 25.18  ? 495 LEU B CD2 1 
ATOM 3154 N N   . ARG B 1 212 ? -21.745 -28.753 -30.274 1.00 26.37  ? 496 ARG B N   1 
ATOM 3155 C CA  . ARG B 1 212 ? -20.696 -29.748 -30.239 1.00 26.03  ? 496 ARG B CA  1 
ATOM 3156 C C   . ARG B 1 212 ? -20.567 -30.220 -28.796 1.00 25.50  ? 496 ARG B C   1 
ATOM 3157 O O   . ARG B 1 212 ? -20.378 -31.405 -28.535 1.00 25.37  ? 496 ARG B O   1 
ATOM 3158 C CB  . ARG B 1 212 ? -19.380 -29.136 -30.709 1.00 27.82  ? 496 ARG B CB  1 
ATOM 3159 C CG  . ARG B 1 212 ? -18.751 -28.196 -29.693 1.00 28.22  ? 496 ARG B CG  1 
ATOM 3160 C CD  . ARG B 1 212 ? -17.512 -27.548 -30.250 1.00 28.32  ? 496 ARG B CD  1 
ATOM 3161 N NE  . ARG B 1 212 ? -16.688 -26.981 -29.192 1.00 28.79  ? 496 ARG B NE  1 
ATOM 3162 C CZ  . ARG B 1 212 ? -15.814 -27.680 -28.479 1.00 25.09  ? 496 ARG B CZ  1 
ATOM 3163 N NH1 . ARG B 1 212 ? -15.653 -28.967 -28.723 1.00 23.15  ? 496 ARG B NH1 1 
ATOM 3164 N NH2 . ARG B 1 212 ? -15.108 -27.093 -27.522 1.00 23.86  ? 496 ARG B NH2 1 
ATOM 3165 N N   . ARG B 1 213 ? -20.680 -29.280 -27.863 1.00 24.27  ? 497 ARG B N   1 
ATOM 3166 C CA  . ARG B 1 213 ? -20.581 -29.583 -26.436 1.00 23.11  ? 497 ARG B CA  1 
ATOM 3167 C C   . ARG B 1 213 ? -21.503 -30.729 -26.026 1.00 20.28  ? 497 ARG B C   1 
ATOM 3168 O O   . ARG B 1 213 ? -21.208 -31.484 -25.097 1.00 18.96  ? 497 ARG B O   1 
ATOM 3169 C CB  . ARG B 1 213 ? -20.923 -28.339 -25.620 1.00 25.82  ? 497 ARG B CB  1 
ATOM 3170 C CG  . ARG B 1 213 ? -19.858 -27.264 -25.651 1.00 28.38  ? 497 ARG B CG  1 
ATOM 3171 C CD  . ARG B 1 213 ? -18.701 -27.634 -24.749 1.00 34.04  ? 497 ARG B CD  1 
ATOM 3172 N NE  . ARG B 1 213 ? -17.684 -26.590 -24.732 1.00 41.48  ? 497 ARG B NE  1 
ATOM 3173 C CZ  . ARG B 1 213 ? -17.897 -25.346 -24.324 1.00 43.85  ? 497 ARG B CZ  1 
ATOM 3174 N NH1 . ARG B 1 213 ? -19.095 -24.986 -23.890 1.00 45.95  ? 497 ARG B NH1 1 
ATOM 3175 N NH2 . ARG B 1 213 ? -16.915 -24.458 -24.361 1.00 45.46  ? 497 ARG B NH2 1 
ATOM 3176 N N   . LEU B 1 214 ? -22.620 -30.853 -26.731 1.00 17.89  ? 498 LEU B N   1 
ATOM 3177 C CA  . LEU B 1 214 ? -23.593 -31.894 -26.451 1.00 15.85  ? 498 LEU B CA  1 
ATOM 3178 C C   . LEU B 1 214 ? -23.087 -33.264 -26.912 1.00 17.63  ? 498 LEU B C   1 
ATOM 3179 O O   . LEU B 1 214 ? -23.653 -34.295 -26.548 1.00 21.41  ? 498 LEU B O   1 
ATOM 3180 C CB  . LEU B 1 214 ? -24.925 -31.576 -27.149 1.00 9.67   ? 498 LEU B CB  1 
ATOM 3181 C CG  . LEU B 1 214 ? -25.645 -30.261 -26.843 1.00 6.03   ? 498 LEU B CG  1 
ATOM 3182 C CD1 . LEU B 1 214 ? -26.925 -30.175 -27.649 1.00 4.78   ? 498 LEU B CD1 1 
ATOM 3183 C CD2 . LEU B 1 214 ? -25.952 -30.176 -25.366 1.00 6.81   ? 498 LEU B CD2 1 
ATOM 3184 N N   . CYS B 1 215 ? -22.027 -33.283 -27.709 1.00 15.42  ? 499 CYS B N   1 
ATOM 3185 C CA  . CYS B 1 215 ? -21.497 -34.548 -28.209 1.00 15.34  ? 499 CYS B CA  1 
ATOM 3186 C C   . CYS B 1 215 ? -20.170 -34.936 -27.554 1.00 14.47  ? 499 CYS B C   1 
ATOM 3187 O O   . CYS B 1 215 ? -19.497 -35.875 -27.989 1.00 12.43  ? 499 CYS B O   1 
ATOM 3188 C CB  . CYS B 1 215 ? -21.316 -34.453 -29.723 1.00 14.73  ? 499 CYS B CB  1 
ATOM 3189 S SG  . CYS B 1 215 ? -22.749 -33.754 -30.554 1.00 15.38  ? 499 CYS B SG  1 
ATOM 3190 N N   . ILE B 1 216 ? -19.810 -34.221 -26.496 1.00 12.51  ? 500 ILE B N   1 
ATOM 3191 C CA  . ILE B 1 216 ? -18.554 -34.466 -25.812 1.00 10.57  ? 500 ILE B CA  1 
ATOM 3192 C C   . ILE B 1 216 ? -18.740 -34.739 -24.330 1.00 10.79  ? 500 ILE B C   1 
ATOM 3193 O O   . ILE B 1 216 ? -19.410 -33.983 -23.640 1.00 12.46  ? 500 ILE B O   1 
ATOM 3194 C CB  . ILE B 1 216 ? -17.625 -33.248 -25.977 1.00 9.54   ? 500 ILE B CB  1 
ATOM 3195 C CG1 . ILE B 1 216 ? -17.401 -32.986 -27.466 1.00 7.82   ? 500 ILE B CG1 1 
ATOM 3196 C CG2 . ILE B 1 216 ? -16.303 -33.476 -25.262 1.00 6.69   ? 500 ILE B CG2 1 
ATOM 3197 C CD1 . ILE B 1 216 ? -16.758 -31.657 -27.768 1.00 8.08   ? 500 ILE B CD1 1 
ATOM 3198 N N   . LEU B 1 217 ? -18.143 -35.827 -23.854 1.00 9.36   ? 501 LEU B N   1 
ATOM 3199 C CA  . LEU B 1 217 ? -18.203 -36.188 -22.445 1.00 10.80  ? 501 LEU B CA  1 
ATOM 3200 C C   . LEU B 1 217 ? -16.865 -35.879 -21.781 1.00 12.10  ? 501 LEU B C   1 
ATOM 3201 O O   . LEU B 1 217 ? -15.852 -35.698 -22.458 1.00 14.99  ? 501 LEU B O   1 
ATOM 3202 C CB  . LEU B 1 217 ? -18.505 -37.675 -22.293 1.00 10.13  ? 501 LEU B CB  1 
ATOM 3203 C CG  . LEU B 1 217 ? -19.931 -38.095 -22.638 1.00 8.29   ? 501 LEU B CG  1 
ATOM 3204 C CD1 . LEU B 1 217 ? -20.012 -39.608 -22.752 1.00 5.75   ? 501 LEU B CD1 1 
ATOM 3205 C CD2 . LEU B 1 217 ? -20.871 -37.572 -21.568 1.00 5.42   ? 501 LEU B CD2 1 
ATOM 3206 N N   . ARG B 1 218 ? -16.862 -35.816 -20.455 1.00 10.83  ? 502 ARG B N   1 
ATOM 3207 C CA  . ARG B 1 218 ? -15.641 -35.539 -19.711 1.00 9.71   ? 502 ARG B CA  1 
ATOM 3208 C C   . ARG B 1 218 ? -15.735 -36.189 -18.366 1.00 12.60  ? 502 ARG B C   1 
ATOM 3209 O O   . ARG B 1 218 ? -16.827 -36.308 -17.818 1.00 18.03  ? 502 ARG B O   1 
ATOM 3210 C CB  . ARG B 1 218 ? -15.460 -34.051 -19.504 1.00 6.63   ? 502 ARG B CB  1 
ATOM 3211 C CG  . ARG B 1 218 ? -14.986 -33.322 -20.720 1.00 10.23  ? 502 ARG B CG  1 
ATOM 3212 C CD  . ARG B 1 218 ? -15.098 -31.858 -20.472 1.00 13.59  ? 502 ARG B CD  1 
ATOM 3213 N NE  . ARG B 1 218 ? -14.227 -31.072 -21.329 1.00 19.05  ? 502 ARG B NE  1 
ATOM 3214 C CZ  . ARG B 1 218 ? -14.179 -29.747 -21.283 1.00 23.01  ? 502 ARG B CZ  1 
ATOM 3215 N NH1 . ARG B 1 218 ? -14.964 -29.102 -20.422 1.00 22.01  ? 502 ARG B NH1 1 
ATOM 3216 N NH2 . ARG B 1 218 ? -13.342 -29.073 -22.072 1.00 24.27  ? 502 ARG B NH2 1 
ATOM 3217 N N   . MET B 1 219 ? -14.603 -36.622 -17.831 1.00 11.40  ? 503 MET B N   1 
ATOM 3218 C CA  . MET B 1 219 ? -14.616 -37.236 -16.521 1.00 13.41  ? 503 MET B CA  1 
ATOM 3219 C C   . MET B 1 219 ? -13.255 -37.180 -15.867 1.00 14.25  ? 503 MET B C   1 
ATOM 3220 O O   . MET B 1 219 ? -12.227 -37.454 -16.488 1.00 15.32  ? 503 MET B O   1 
ATOM 3221 C CB  . MET B 1 219 ? -15.116 -38.674 -16.586 1.00 14.93  ? 503 MET B CB  1 
ATOM 3222 C CG  . MET B 1 219 ? -14.048 -39.706 -16.804 1.00 26.71  ? 503 MET B CG  1 
ATOM 3223 S SD  . MET B 1 219 ? -14.667 -41.333 -16.335 1.00 35.98  ? 503 MET B SD  1 
ATOM 3224 C CE  . MET B 1 219 ? -16.195 -41.376 -17.348 1.00 35.05  ? 503 MET B CE  1 
ATOM 3225 N N   . SER B 1 220 ? -13.271 -36.804 -14.597 1.00 14.13  ? 504 SER B N   1 
ATOM 3226 C CA  . SER B 1 220 ? -12.072 -36.669 -13.811 1.00 13.06  ? 504 SER B CA  1 
ATOM 3227 C C   . SER B 1 220 ? -11.947 -37.833 -12.856 1.00 13.79  ? 504 SER B C   1 
ATOM 3228 O O   . SER B 1 220 ? -12.898 -38.145 -12.140 1.00 17.46  ? 504 SER B O   1 
ATOM 3229 C CB  . SER B 1 220 ? -12.144 -35.374 -13.023 1.00 13.14  ? 504 SER B CB  1 
ATOM 3230 O OG  . SER B 1 220 ? -11.036 -35.272 -12.152 1.00 25.66  ? 504 SER B OG  1 
ATOM 3231 N N   . PHE B 1 221 ? -10.783 -38.479 -12.848 1.00 12.57  ? 505 PHE B N   1 
ATOM 3232 C CA  . PHE B 1 221 ? -10.533 -39.604 -11.946 1.00 14.11  ? 505 PHE B CA  1 
ATOM 3233 C C   . PHE B 1 221 ? -10.198 -39.091 -10.539 1.00 16.47  ? 505 PHE B C   1 
ATOM 3234 O O   . PHE B 1 221 ? -9.708  -37.969 -10.382 1.00 18.21  ? 505 PHE B O   1 
ATOM 3235 C CB  . PHE B 1 221 ? -9.342  -40.433 -12.427 1.00 13.39  ? 505 PHE B CB  1 
ATOM 3236 C CG  . PHE B 1 221 ? -9.537  -41.080 -13.764 1.00 15.07  ? 505 PHE B CG  1 
ATOM 3237 C CD1 . PHE B 1 221 ? -10.377 -42.177 -13.906 1.00 15.80  ? 505 PHE B CD1 1 
ATOM 3238 C CD2 . PHE B 1 221 ? -8.860  -40.605 -14.882 1.00 15.66  ? 505 PHE B CD2 1 
ATOM 3239 C CE1 . PHE B 1 221 ? -10.541 -42.796 -15.139 1.00 15.03  ? 505 PHE B CE1 1 
ATOM 3240 C CE2 . PHE B 1 221 ? -9.018  -41.214 -16.120 1.00 15.09  ? 505 PHE B CE2 1 
ATOM 3241 C CZ  . PHE B 1 221 ? -9.861  -42.314 -16.249 1.00 14.42  ? 505 PHE B CZ  1 
ATOM 3242 N N   . VAL B 1 222 ? -10.467 -39.911 -9.526  1.00 15.23  ? 506 VAL B N   1 
ATOM 3243 C CA  . VAL B 1 222 ? -10.148 -39.568 -8.142  1.00 17.25  ? 506 VAL B CA  1 
ATOM 3244 C C   . VAL B 1 222 ? -10.676 -38.244 -7.582  1.00 20.17  ? 506 VAL B C   1 
ATOM 3245 O O   . VAL B 1 222 ? -11.473 -38.235 -6.641  1.00 24.48  ? 506 VAL B O   1 
ATOM 3246 C CB  . VAL B 1 222 ? -8.627  -39.555 -7.933  1.00 15.00  ? 506 VAL B CB  1 
ATOM 3247 C CG1 . VAL B 1 222 ? -8.309  -39.685 -6.465  1.00 14.08  ? 506 VAL B CG1 1 
ATOM 3248 C CG2 . VAL B 1 222 ? -7.985  -40.669 -8.729  1.00 18.05  ? 506 VAL B CG2 1 
ATOM 3249 N N   . LYS B 1 223 ? -10.208 -37.133 -8.146  1.00 20.87  ? 507 LYS B N   1 
ATOM 3250 C CA  . LYS B 1 223 ? -10.584 -35.795 -7.695  1.00 21.92  ? 507 LYS B CA  1 
ATOM 3251 C C   . LYS B 1 223 ? -11.782 -35.189 -8.412  1.00 23.35  ? 507 LYS B C   1 
ATOM 3252 O O   . LYS B 1 223 ? -11.932 -35.336 -9.622  1.00 24.80  ? 507 LYS B O   1 
ATOM 3253 C CB  . LYS B 1 223 ? -9.391  -34.847 -7.854  1.00 22.50  ? 507 LYS B CB  1 
ATOM 3254 C CG  . LYS B 1 223 ? -8.175  -35.203 -7.009  1.00 25.12  ? 507 LYS B CG  1 
ATOM 3255 C CD  . LYS B 1 223 ? -8.453  -34.953 -5.536  1.00 29.40  ? 507 LYS B CD  1 
ATOM 3256 C CE  . LYS B 1 223 ? -7.200  -35.066 -4.679  1.00 30.81  ? 507 LYS B CE  1 
ATOM 3257 N NZ  . LYS B 1 223 ? -6.635  -36.445 -4.649  1.00 32.17  ? 507 LYS B NZ  1 
ATOM 3258 N N   . GLY B 1 224 ? -12.629 -34.498 -7.653  1.00 24.26  ? 508 GLY B N   1 
ATOM 3259 C CA  . GLY B 1 224 ? -13.794 -33.846 -8.223  1.00 20.64  ? 508 GLY B CA  1 
ATOM 3260 C C   . GLY B 1 224 ? -13.572 -32.345 -8.218  1.00 22.26  ? 508 GLY B C   1 
ATOM 3261 O O   . GLY B 1 224 ? -12.626 -31.852 -7.598  1.00 21.54  ? 508 GLY B O   1 
ATOM 3262 N N   . TRP B 1 225 ? -14.435 -31.607 -8.904  1.00 24.39  ? 509 TRP B N   1 
ATOM 3263 C CA  . TRP B 1 225 ? -14.302 -30.154 -8.962  1.00 27.83  ? 509 TRP B CA  1 
ATOM 3264 C C   . TRP B 1 225 ? -15.644 -29.481 -8.679  1.00 30.43  ? 509 TRP B C   1 
ATOM 3265 O O   . TRP B 1 225 ? -16.659 -30.147 -8.487  1.00 29.56  ? 509 TRP B O   1 
ATOM 3266 C CB  . TRP B 1 225 ? -13.788 -29.733 -10.346 1.00 27.39  ? 509 TRP B CB  1 
ATOM 3267 C CG  . TRP B 1 225 ? -14.806 -29.925 -11.442 1.00 27.60  ? 509 TRP B CG  1 
ATOM 3268 C CD1 . TRP B 1 225 ? -15.666 -28.984 -11.938 1.00 27.00  ? 509 TRP B CD1 1 
ATOM 3269 C CD2 . TRP B 1 225 ? -15.111 -31.147 -12.132 1.00 25.79  ? 509 TRP B CD2 1 
ATOM 3270 N NE1 . TRP B 1 225 ? -16.487 -29.546 -12.892 1.00 25.98  ? 509 TRP B NE1 1 
ATOM 3271 C CE2 . TRP B 1 225 ? -16.167 -30.870 -13.031 1.00 22.17  ? 509 TRP B CE2 1 
ATOM 3272 C CE3 . TRP B 1 225 ? -14.594 -32.449 -12.079 1.00 25.40  ? 509 TRP B CE3 1 
ATOM 3273 C CZ2 . TRP B 1 225 ? -16.713 -31.841 -13.866 1.00 18.52  ? 509 TRP B CZ2 1 
ATOM 3274 C CZ3 . TRP B 1 225 ? -15.143 -33.419 -12.916 1.00 24.34  ? 509 TRP B CZ3 1 
ATOM 3275 C CH2 . TRP B 1 225 ? -16.190 -33.106 -13.796 1.00 20.11  ? 509 TRP B CH2 1 
ATOM 3276 N N   . GLY B 1 226 ? -15.643 -28.154 -8.659  1.00 34.59  ? 510 GLY B N   1 
ATOM 3277 C CA  . GLY B 1 226 ? -16.870 -27.427 -8.408  1.00 39.15  ? 510 GLY B CA  1 
ATOM 3278 C C   . GLY B 1 226 ? -16.868 -26.701 -7.078  1.00 42.98  ? 510 GLY B C   1 
ATOM 3279 O O   . GLY B 1 226 ? -15.871 -26.709 -6.356  1.00 42.32  ? 510 GLY B O   1 
ATOM 3280 N N   . PRO B 1 227 ? -17.992 -26.063 -6.727  1.00 45.85  ? 511 PRO B N   1 
ATOM 3281 C CA  . PRO B 1 227 ? -18.183 -25.309 -5.484  1.00 46.50  ? 511 PRO B CA  1 
ATOM 3282 C C   . PRO B 1 227 ? -17.618 -25.999 -4.238  1.00 47.16  ? 511 PRO B C   1 
ATOM 3283 O O   . PRO B 1 227 ? -16.756 -25.454 -3.543  1.00 45.92  ? 511 PRO B O   1 
ATOM 3284 C CB  . PRO B 1 227 ? -19.699 -25.159 -5.419  1.00 46.28  ? 511 PRO B CB  1 
ATOM 3285 C CG  . PRO B 1 227 ? -20.073 -25.020 -6.868  1.00 45.53  ? 511 PRO B CG  1 
ATOM 3286 C CD  . PRO B 1 227 ? -19.240 -26.101 -7.515  1.00 46.72  ? 511 PRO B CD  1 
ATOM 3287 N N   . ASP B 1 228 ? -18.118 -27.204 -3.975  1.00 49.25  ? 512 ASP B N   1 
ATOM 3288 C CA  . ASP B 1 228 ? -17.717 -28.019 -2.823  1.00 49.95  ? 512 ASP B CA  1 
ATOM 3289 C C   . ASP B 1 228 ? -16.221 -28.361 -2.808  1.00 46.43  ? 512 ASP B C   1 
ATOM 3290 O O   . ASP B 1 228 ? -15.688 -28.818 -1.793  1.00 44.10  ? 512 ASP B O   1 
ATOM 3291 C CB  . ASP B 1 228 ? -18.496 -29.347 -2.814  1.00 54.15  ? 512 ASP B CB  1 
ATOM 3292 C CG  . ASP B 1 228 ? -19.974 -29.179 -3.145  1.00 57.68  ? 512 ASP B CG  1 
ATOM 3293 O OD1 . ASP B 1 228 ? -20.298 -28.630 -4.222  1.00 60.07  ? 512 ASP B OD1 1 
ATOM 3294 O OD2 . ASP B 1 228 ? -20.814 -29.616 -2.331  1.00 59.81  ? 512 ASP B OD2 1 
ATOM 3295 N N   . TYR B 1 229 ? -15.547 -28.144 -3.930  1.00 41.79  ? 513 TYR B N   1 
ATOM 3296 C CA  . TYR B 1 229 ? -14.141 -28.493 -4.028  1.00 36.96  ? 513 TYR B CA  1 
ATOM 3297 C C   . TYR B 1 229 ? -13.224 -27.327 -4.343  1.00 35.35  ? 513 TYR B C   1 
ATOM 3298 O O   . TYR B 1 229 ? -13.675 -26.240 -4.708  1.00 33.45  ? 513 TYR B O   1 
ATOM 3299 C CB  . TYR B 1 229 ? -13.968 -29.562 -5.106  1.00 35.79  ? 513 TYR B CB  1 
ATOM 3300 C CG  . TYR B 1 229 ? -14.826 -30.792 -4.909  1.00 32.25  ? 513 TYR B CG  1 
ATOM 3301 C CD1 . TYR B 1 229 ? -14.318 -31.925 -4.281  1.00 30.65  ? 513 TYR B CD1 1 
ATOM 3302 C CD2 . TYR B 1 229 ? -16.140 -30.828 -5.372  1.00 29.32  ? 513 TYR B CD2 1 
ATOM 3303 C CE1 . TYR B 1 229 ? -15.093 -33.064 -4.124  1.00 31.79  ? 513 TYR B CE1 1 
ATOM 3304 C CE2 . TYR B 1 229 ? -16.926 -31.960 -5.217  1.00 29.09  ? 513 TYR B CE2 1 
ATOM 3305 C CZ  . TYR B 1 229 ? -16.397 -33.080 -4.595  1.00 31.68  ? 513 TYR B CZ  1 
ATOM 3306 O OH  . TYR B 1 229 ? -17.162 -34.223 -4.458  1.00 31.21  ? 513 TYR B OH  1 
ATOM 3307 N N   . PRO B 1 230 ? -11.907 -27.544 -4.191  1.00 34.37  ? 514 PRO B N   1 
ATOM 3308 C CA  . PRO B 1 230 ? -10.922 -26.502 -4.473  1.00 34.85  ? 514 PRO B CA  1 
ATOM 3309 C C   . PRO B 1 230 ? -10.751 -26.301 -5.985  1.00 36.54  ? 514 PRO B C   1 
ATOM 3310 O O   . PRO B 1 230 ? -10.515 -25.185 -6.449  1.00 38.33  ? 514 PRO B O   1 
ATOM 3311 C CB  . PRO B 1 230 ? -9.665  -27.022 -3.769  1.00 31.94  ? 514 PRO B CB  1 
ATOM 3312 C CG  . PRO B 1 230 ? -9.829  -28.492 -3.817  1.00 30.12  ? 514 PRO B CG  1 
ATOM 3313 C CD  . PRO B 1 230 ? -11.278 -28.680 -3.493  1.00 32.54  ? 514 PRO B CD  1 
ATOM 3314 N N   . SER B 1 231 ? -10.881 -27.379 -6.753  1.00 37.04  ? 515 SER B N   1 
ATOM 3315 C CA  . SER B 1 231 ? -10.768 -27.285 -8.208  1.00 38.21  ? 515 SER B CA  1 
ATOM 3316 C C   . SER B 1 231 ? -12.066 -26.663 -8.716  1.00 38.06  ? 515 SER B C   1 
ATOM 3317 O O   . SER B 1 231 ? -13.142 -27.231 -8.514  1.00 36.84  ? 515 SER B O   1 
ATOM 3318 C CB  . SER B 1 231 ? -10.599 -28.676 -8.826  1.00 40.79  ? 515 SER B CB  1 
ATOM 3319 O OG  . SER B 1 231 ? -9.468  -29.346 -8.298  1.00 42.20  ? 515 SER B OG  1 
ATOM 3320 N N   . GLN B 1 232 ? -11.973 -25.512 -9.380  1.00 37.39  ? 516 GLN B N   1 
ATOM 3321 C CA  . GLN B 1 232 ? -13.172 -24.836 -9.877  1.00 37.70  ? 516 GLN B CA  1 
ATOM 3322 C C   . GLN B 1 232 ? -13.748 -25.345 -11.195 1.00 35.11  ? 516 GLN B C   1 
ATOM 3323 O O   . GLN B 1 232 ? -14.962 -25.275 -11.413 1.00 32.63  ? 516 GLN B O   1 
ATOM 3324 C CB  . GLN B 1 232 ? -12.922 -23.329 -9.963  1.00 41.90  ? 516 GLN B CB  1 
ATOM 3325 C CG  . GLN B 1 232 ? -12.698 -22.698 -8.601  1.00 44.91  ? 516 GLN B CG  1 
ATOM 3326 C CD  . GLN B 1 232 ? -13.741 -23.130 -7.573  1.00 47.37  ? 516 GLN B CD  1 
ATOM 3327 O OE1 . GLN B 1 232 ? -13.508 -23.030 -6.370  1.00 49.08  ? 516 GLN B OE1 1 
ATOM 3328 N NE2 . GLN B 1 232 ? -14.897 -23.605 -8.044  1.00 47.24  ? 516 GLN B NE2 1 
ATOM 3329 N N   . SER B 1 233 ? -12.873 -25.847 -12.062 1.00 33.10  ? 517 SER B N   1 
ATOM 3330 C CA  . SER B 1 233 ? -13.260 -26.401 -13.359 1.00 30.96  ? 517 SER B CA  1 
ATOM 3331 C C   . SER B 1 233 ? -12.553 -27.737 -13.463 1.00 28.41  ? 517 SER B C   1 
ATOM 3332 O O   . SER B 1 233 ? -11.808 -28.098 -12.564 1.00 32.11  ? 517 SER B O   1 
ATOM 3333 C CB  . SER B 1 233 ? -12.785 -25.490 -14.481 1.00 32.10  ? 517 SER B CB  1 
ATOM 3334 O OG  . SER B 1 233 ? -11.416 -25.180 -14.309 1.00 34.37  ? 517 SER B OG  1 
ATOM 3335 N N   . ILE B 1 234 ? -12.762 -28.477 -14.542 1.00 25.26  ? 518 ILE B N   1 
ATOM 3336 C CA  . ILE B 1 234 ? -12.081 -29.760 -14.655 1.00 22.71  ? 518 ILE B CA  1 
ATOM 3337 C C   . ILE B 1 234 ? -10.622 -29.523 -15.054 1.00 22.89  ? 518 ILE B C   1 
ATOM 3338 O O   . ILE B 1 234 ? -9.759  -30.350 -14.783 1.00 22.60  ? 518 ILE B O   1 
ATOM 3339 C CB  . ILE B 1 234 ? -12.780 -30.692 -15.682 1.00 21.56  ? 518 ILE B CB  1 
ATOM 3340 C CG1 . ILE B 1 234 ? -12.421 -32.152 -15.395 1.00 20.68  ? 518 ILE B CG1 1 
ATOM 3341 C CG2 . ILE B 1 234 ? -12.367 -30.330 -17.091 1.00 21.25  ? 518 ILE B CG2 1 
ATOM 3342 C CD1 . ILE B 1 234 ? -13.193 -33.158 -16.240 1.00 19.58  ? 518 ILE B CD1 1 
ATOM 3343 N N   . LYS B 1 235 ? -10.357 -28.379 -15.685 1.00 23.14  ? 519 LYS B N   1 
ATOM 3344 C CA  . LYS B 1 235 ? -9.010  -28.002 -16.116 1.00 20.62  ? 519 LYS B CA  1 
ATOM 3345 C C   . LYS B 1 235 ? -8.101  -27.849 -14.905 1.00 20.95  ? 519 LYS B C   1 
ATOM 3346 O O   . LYS B 1 235 ? -6.894  -27.658 -15.043 1.00 21.27  ? 519 LYS B O   1 
ATOM 3347 C CB  . LYS B 1 235 ? -9.051  -26.673 -16.871 1.00 21.10  ? 519 LYS B CB  1 
ATOM 3348 C CG  . LYS B 1 235 ? -9.837  -26.729 -18.160 1.00 29.39  ? 519 LYS B CG  1 
ATOM 3349 C CD  . LYS B 1 235 ? -10.543 -25.408 -18.497 1.00 33.47  ? 519 LYS B CD  1 
ATOM 3350 C CE  . LYS B 1 235 ? -9.584  -24.230 -18.693 1.00 31.59  ? 519 LYS B CE  1 
ATOM 3351 N NZ  . LYS B 1 235 ? -9.187  -23.597 -17.410 1.00 27.16  ? 519 LYS B NZ  1 
ATOM 3352 N N   . GLU B 1 236 ? -8.683  -27.927 -13.714 1.00 19.36  ? 520 GLU B N   1 
ATOM 3353 C CA  . GLU B 1 236 ? -7.902  -27.779 -12.500 1.00 18.04  ? 520 GLU B CA  1 
ATOM 3354 C C   . GLU B 1 236 ? -7.716  -29.087 -11.746 1.00 19.53  ? 520 GLU B C   1 
ATOM 3355 O O   . GLU B 1 236 ? -7.199  -29.093 -10.631 1.00 22.72  ? 520 GLU B O   1 
ATOM 3356 C CB  . GLU B 1 236 ? -8.552  -26.742 -11.593 1.00 17.24  ? 520 GLU B CB  1 
ATOM 3357 C CG  . GLU B 1 236 ? -8.894  -25.453 -12.313 1.00 20.11  ? 520 GLU B CG  1 
ATOM 3358 C CD  . GLU B 1 236 ? -9.309  -24.329 -11.381 1.00 23.54  ? 520 GLU B CD  1 
ATOM 3359 O OE1 . GLU B 1 236 ? -9.832  -23.320 -11.892 1.00 26.21  ? 520 GLU B OE1 1 
ATOM 3360 O OE2 . GLU B 1 236 ? -9.109  -24.439 -10.149 1.00 24.72  ? 520 GLU B OE2 1 
ATOM 3361 N N   . THR B 1 237 ? -8.134  -30.195 -12.349 1.00 18.35  ? 521 THR B N   1 
ATOM 3362 C CA  . THR B 1 237 ? -7.983  -31.498 -11.709 1.00 17.04  ? 521 THR B CA  1 
ATOM 3363 C C   . THR B 1 237 ? -6.754  -32.210 -12.267 1.00 17.58  ? 521 THR B C   1 
ATOM 3364 O O   . THR B 1 237 ? -6.436  -32.095 -13.457 1.00 18.33  ? 521 THR B O   1 
ATOM 3365 C CB  . THR B 1 237 ? -9.238  -32.384 -11.906 1.00 16.91  ? 521 THR B CB  1 
ATOM 3366 O OG1 . THR B 1 237 ? -9.536  -32.491 -13.301 1.00 19.71  ? 521 THR B OG1 1 
ATOM 3367 C CG2 . THR B 1 237 ? -10.436 -31.780 -11.183 1.00 15.01  ? 521 THR B CG2 1 
ATOM 3368 N N   . PRO B 1 238 ? -6.051  -32.966 -11.410 1.00 16.42  ? 522 PRO B N   1 
ATOM 3369 C CA  . PRO B 1 238 ? -4.838  -33.712 -11.759 1.00 15.58  ? 522 PRO B CA  1 
ATOM 3370 C C   . PRO B 1 238 ? -4.892  -34.663 -12.949 1.00 15.84  ? 522 PRO B C   1 
ATOM 3371 O O   . PRO B 1 238 ? -3.902  -34.816 -13.658 1.00 18.85  ? 522 PRO B O   1 
ATOM 3372 C CB  . PRO B 1 238 ? -4.482  -34.425 -10.455 1.00 13.87  ? 522 PRO B CB  1 
ATOM 3373 C CG  . PRO B 1 238 ? -5.805  -34.616 -9.802  1.00 16.15  ? 522 PRO B CG  1 
ATOM 3374 C CD  . PRO B 1 238 ? -6.476  -33.287 -10.038 1.00 16.52  ? 522 PRO B CD  1 
ATOM 3375 N N   . CYS B 1 239 ? -6.028  -35.303 -13.189 1.00 15.78  ? 523 CYS B N   1 
ATOM 3376 C CA  . CYS B 1 239 ? -6.089  -36.227 -14.313 1.00 14.83  ? 523 CYS B CA  1 
ATOM 3377 C C   . CYS B 1 239 ? -7.497  -36.547 -14.770 1.00 13.22  ? 523 CYS B C   1 
ATOM 3378 O O   . CYS B 1 239 ? -8.226  -37.269 -14.098 1.00 12.66  ? 523 CYS B O   1 
ATOM 3379 C CB  . CYS B 1 239 ? -5.358  -37.512 -13.945 1.00 16.30  ? 523 CYS B CB  1 
ATOM 3380 S SG  . CYS B 1 239 ? -5.762  -38.103 -12.296 1.00 16.36  ? 523 CYS B SG  1 
ATOM 3381 N N   . TRP B 1 240 ? -7.865  -36.005 -15.926 1.00 11.28  ? 524 TRP B N   1 
ATOM 3382 C CA  . TRP B 1 240 ? -9.186  -36.214 -16.498 1.00 10.57  ? 524 TRP B CA  1 
ATOM 3383 C C   . TRP B 1 240 ? -9.075  -36.534 -17.972 1.00 12.03  ? 524 TRP B C   1 
ATOM 3384 O O   . TRP B 1 240 ? -7.984  -36.491 -18.539 1.00 12.94  ? 524 TRP B O   1 
ATOM 3385 C CB  . TRP B 1 240 ? -10.056 -34.971 -16.323 1.00 13.22  ? 524 TRP B CB  1 
ATOM 3386 C CG  . TRP B 1 240 ? -9.428  -33.672 -16.806 1.00 14.03  ? 524 TRP B CG  1 
ATOM 3387 C CD1 . TRP B 1 240 ? -8.462  -32.941 -16.171 1.00 12.01  ? 524 TRP B CD1 1 
ATOM 3388 C CD2 . TRP B 1 240 ? -9.780  -32.928 -17.990 1.00 13.69  ? 524 TRP B CD2 1 
ATOM 3389 N NE1 . TRP B 1 240 ? -8.198  -31.790 -16.877 1.00 15.28  ? 524 TRP B NE1 1 
ATOM 3390 C CE2 . TRP B 1 240 ? -8.991  -31.756 -17.995 1.00 13.22  ? 524 TRP B CE2 1 
ATOM 3391 C CE3 . TRP B 1 240 ? -10.687 -33.138 -19.040 1.00 11.14  ? 524 TRP B CE3 1 
ATOM 3392 C CZ2 . TRP B 1 240 ? -9.082  -30.795 -19.011 1.00 10.08  ? 524 TRP B CZ2 1 
ATOM 3393 C CZ3 . TRP B 1 240 ? -10.777 -32.182 -20.046 1.00 9.28   ? 524 TRP B CZ3 1 
ATOM 3394 C CH2 . TRP B 1 240 ? -9.978  -31.025 -20.023 1.00 7.95   ? 524 TRP B CH2 1 
ATOM 3395 N N   . ILE B 1 241 ? -10.210 -36.841 -18.594 1.00 11.75  ? 525 ILE B N   1 
ATOM 3396 C CA  . ILE B 1 241 ? -10.236 -37.183 -20.014 1.00 12.08  ? 525 ILE B CA  1 
ATOM 3397 C C   . ILE B 1 241 ? -11.412 -36.523 -20.721 1.00 11.79  ? 525 ILE B C   1 
ATOM 3398 O O   . ILE B 1 241 ? -12.429 -36.257 -20.096 1.00 15.75  ? 525 ILE B O   1 
ATOM 3399 C CB  . ILE B 1 241 ? -10.372 -38.701 -20.204 1.00 9.94   ? 525 ILE B CB  1 
ATOM 3400 C CG1 . ILE B 1 241 ? -11.667 -39.170 -19.536 1.00 8.64   ? 525 ILE B CG1 1 
ATOM 3401 C CG2 . ILE B 1 241 ? -9.149  -39.423 -19.612 1.00 7.51   ? 525 ILE B CG2 1 
ATOM 3402 C CD1 . ILE B 1 241 ? -12.076 -40.574 -19.886 1.00 10.13  ? 525 ILE B CD1 1 
ATOM 3403 N N   . GLU B 1 242 ? -11.274 -36.258 -22.017 1.00 10.73  ? 526 GLU B N   1 
ATOM 3404 C CA  . GLU B 1 242 ? -12.362 -35.656 -22.793 1.00 9.22   ? 526 GLU B CA  1 
ATOM 3405 C C   . GLU B 1 242 ? -12.771 -36.624 -23.901 1.00 9.46   ? 526 GLU B C   1 
ATOM 3406 O O   . GLU B 1 242 ? -11.998 -36.912 -24.823 1.00 9.29   ? 526 GLU B O   1 
ATOM 3407 C CB  . GLU B 1 242 ? -11.930 -34.316 -23.392 1.00 8.25   ? 526 GLU B CB  1 
ATOM 3408 C CG  . GLU B 1 242 ? -13.015 -33.611 -24.188 1.00 7.62   ? 526 GLU B CG  1 
ATOM 3409 C CD  . GLU B 1 242 ? -12.574 -32.255 -24.731 1.00 10.05  ? 526 GLU B CD  1 
ATOM 3410 O OE1 . GLU B 1 242 ? -11.541 -32.183 -25.433 1.00 7.12   ? 526 GLU B OE1 1 
ATOM 3411 O OE2 . GLU B 1 242 ? -13.270 -31.256 -24.458 1.00 12.29  ? 526 GLU B OE2 1 
ATOM 3412 N N   . ILE B 1 243 ? -13.994 -37.130 -23.799 1.00 8.07   ? 527 ILE B N   1 
ATOM 3413 C CA  . ILE B 1 243 ? -14.500 -38.089 -24.770 1.00 6.53   ? 527 ILE B CA  1 
ATOM 3414 C C   . ILE B 1 243 ? -15.337 -37.436 -25.877 1.00 6.73   ? 527 ILE B C   1 
ATOM 3415 O O   . ILE B 1 243 ? -16.373 -36.822 -25.600 1.00 4.37   ? 527 ILE B O   1 
ATOM 3416 C CB  . ILE B 1 243 ? -15.372 -39.197 -24.082 1.00 5.62   ? 527 ILE B CB  1 
ATOM 3417 C CG1 . ILE B 1 243 ? -14.625 -39.844 -22.911 1.00 2.16   ? 527 ILE B CG1 1 
ATOM 3418 C CG2 . ILE B 1 243 ? -15.716 -40.287 -25.086 1.00 5.50   ? 527 ILE B CG2 1 
ATOM 3419 C CD1 . ILE B 1 243 ? -14.613 -39.021 -21.660 1.00 2.16   ? 527 ILE B CD1 1 
ATOM 3420 N N   . HIS B 1 244 ? -14.878 -37.578 -27.125 1.00 6.02   ? 528 HIS B N   1 
ATOM 3421 C CA  . HIS B 1 244 ? -15.584 -37.039 -28.291 1.00 5.41   ? 528 HIS B CA  1 
ATOM 3422 C C   . HIS B 1 244 ? -16.369 -38.187 -28.931 1.00 8.62   ? 528 HIS B C   1 
ATOM 3423 O O   . HIS B 1 244 ? -15.772 -39.165 -29.395 1.00 13.96  ? 528 HIS B O   1 
ATOM 3424 C CB  . HIS B 1 244 ? -14.594 -36.473 -29.323 1.00 2.84   ? 528 HIS B CB  1 
ATOM 3425 C CG  . HIS B 1 244 ? -14.356 -34.995 -29.209 1.00 3.11   ? 528 HIS B CG  1 
ATOM 3426 N ND1 . HIS B 1 244 ? -13.741 -34.415 -28.120 1.00 8.10   ? 528 HIS B ND1 1 
ATOM 3427 C CD2 . HIS B 1 244 ? -14.662 -33.977 -30.048 1.00 2.63   ? 528 HIS B CD2 1 
ATOM 3428 C CE1 . HIS B 1 244 ? -13.681 -33.106 -28.290 1.00 2.70   ? 528 HIS B CE1 1 
ATOM 3429 N NE2 . HIS B 1 244 ? -14.234 -32.814 -29.452 1.00 2.16   ? 528 HIS B NE2 1 
ATOM 3430 N N   . LEU B 1 245 ? -17.697 -38.079 -28.948 1.00 6.87   ? 529 LEU B N   1 
ATOM 3431 C CA  . LEU B 1 245 ? -18.542 -39.118 -29.543 1.00 5.81   ? 529 LEU B CA  1 
ATOM 3432 C C   . LEU B 1 245 ? -18.731 -38.828 -31.022 1.00 5.52   ? 529 LEU B C   1 
ATOM 3433 O O   . LEU B 1 245 ? -19.284 -37.806 -31.385 1.00 7.06   ? 529 LEU B O   1 
ATOM 3434 C CB  . LEU B 1 245 ? -19.904 -39.170 -28.838 1.00 3.89   ? 529 LEU B CB  1 
ATOM 3435 C CG  . LEU B 1 245 ? -20.021 -39.845 -27.459 1.00 2.50   ? 529 LEU B CG  1 
ATOM 3436 C CD1 . LEU B 1 245 ? -18.683 -40.421 -27.047 1.00 3.18   ? 529 LEU B CD1 1 
ATOM 3437 C CD2 . LEU B 1 245 ? -20.520 -38.850 -26.420 1.00 2.16   ? 529 LEU B CD2 1 
ATOM 3438 N N   . HIS B 1 246 ? -18.299 -39.733 -31.883 1.00 7.39   ? 530 HIS B N   1 
ATOM 3439 C CA  . HIS B 1 246 ? -18.412 -39.478 -33.313 1.00 11.06  ? 530 HIS B CA  1 
ATOM 3440 C C   . HIS B 1 246 ? -19.781 -39.597 -33.966 1.00 11.90  ? 530 HIS B C   1 
ATOM 3441 O O   . HIS B 1 246 ? -20.155 -38.752 -34.774 1.00 11.98  ? 530 HIS B O   1 
ATOM 3442 C CB  . HIS B 1 246 ? -17.390 -40.331 -34.052 1.00 10.87  ? 530 HIS B CB  1 
ATOM 3443 C CG  . HIS B 1 246 ? -15.986 -40.068 -33.608 1.00 15.67  ? 530 HIS B CG  1 
ATOM 3444 N ND1 . HIS B 1 246 ? -14.883 -40.475 -34.325 1.00 16.77  ? 530 HIS B ND1 1 
ATOM 3445 C CD2 . HIS B 1 246 ? -15.509 -39.424 -32.514 1.00 17.00  ? 530 HIS B CD2 1 
ATOM 3446 C CE1 . HIS B 1 246 ? -13.787 -40.091 -33.695 1.00 18.25  ? 530 HIS B CE1 1 
ATOM 3447 N NE2 . HIS B 1 246 ? -14.139 -39.451 -32.593 1.00 17.22  ? 530 HIS B NE2 1 
ATOM 3448 N N   . ARG B 1 247 ? -20.537 -40.631 -33.620 1.00 14.14  ? 531 ARG B N   1 
ATOM 3449 C CA  . ARG B 1 247 ? -21.859 -40.805 -34.209 1.00 12.93  ? 531 ARG B CA  1 
ATOM 3450 C C   . ARG B 1 247 ? -22.774 -39.643 -33.854 1.00 12.28  ? 531 ARG B C   1 
ATOM 3451 O O   . ARG B 1 247 ? -23.727 -39.364 -34.564 1.00 16.54  ? 531 ARG B O   1 
ATOM 3452 C CB  . ARG B 1 247 ? -22.489 -42.111 -33.743 1.00 13.92  ? 531 ARG B CB  1 
ATOM 3453 C CG  . ARG B 1 247 ? -23.847 -42.372 -34.344 1.00 15.16  ? 531 ARG B CG  1 
ATOM 3454 C CD  . ARG B 1 247 ? -23.748 -42.472 -35.840 1.00 18.71  ? 531 ARG B CD  1 
ATOM 3455 N NE  . ARG B 1 247 ? -25.054 -42.711 -36.439 1.00 22.67  ? 531 ARG B NE  1 
ATOM 3456 C CZ  . ARG B 1 247 ? -25.244 -43.002 -37.721 1.00 25.02  ? 531 ARG B CZ  1 
ATOM 3457 N NH1 . ARG B 1 247 ? -24.209 -43.092 -38.550 1.00 24.14  ? 531 ARG B NH1 1 
ATOM 3458 N NH2 . ARG B 1 247 ? -26.474 -43.206 -38.173 1.00 27.48  ? 531 ARG B NH2 1 
ATOM 3459 N N   . ALA B 1 248 ? -22.502 -38.973 -32.746 1.00 9.68   ? 532 ALA B N   1 
ATOM 3460 C CA  . ALA B 1 248 ? -23.320 -37.834 -32.380 1.00 9.83   ? 532 ALA B CA  1 
ATOM 3461 C C   . ALA B 1 248 ? -22.859 -36.699 -33.286 1.00 12.18  ? 532 ALA B C   1 
ATOM 3462 O O   . ALA B 1 248 ? -23.671 -35.973 -33.867 1.00 10.83  ? 532 ALA B O   1 
ATOM 3463 C CB  . ALA B 1 248 ? -23.097 -37.468 -30.924 1.00 8.06   ? 532 ALA B CB  1 
ATOM 3464 N N   . LEU B 1 249 ? -21.540 -36.573 -33.415 1.00 13.13  ? 533 LEU B N   1 
ATOM 3465 C CA  . LEU B 1 249 ? -20.942 -35.532 -34.240 1.00 13.18  ? 533 LEU B CA  1 
ATOM 3466 C C   . LEU B 1 249 ? -21.307 -35.694 -35.703 1.00 13.13  ? 533 LEU B C   1 
ATOM 3467 O O   . LEU B 1 249 ? -21.369 -34.719 -36.431 1.00 15.76  ? 533 LEU B O   1 
ATOM 3468 C CB  . LEU B 1 249 ? -19.420 -35.524 -34.075 1.00 12.24  ? 533 LEU B CB  1 
ATOM 3469 C CG  . LEU B 1 249 ? -18.929 -35.220 -32.652 1.00 13.54  ? 533 LEU B CG  1 
ATOM 3470 C CD1 . LEU B 1 249 ? -17.410 -35.281 -32.595 1.00 10.51  ? 533 LEU B CD1 1 
ATOM 3471 C CD2 . LEU B 1 249 ? -19.432 -33.855 -32.216 1.00 9.20   ? 533 LEU B CD2 1 
ATOM 3472 N N   . GLN B 1 250 ? -21.542 -36.921 -36.144 1.00 13.23  ? 534 GLN B N   1 
ATOM 3473 C CA  . GLN B 1 250 ? -21.924 -37.126 -37.527 1.00 14.05  ? 534 GLN B CA  1 
ATOM 3474 C C   . GLN B 1 250 ? -23.271 -36.454 -37.709 1.00 15.82  ? 534 GLN B C   1 
ATOM 3475 O O   . GLN B 1 250 ? -23.454 -35.620 -38.592 1.00 16.51  ? 534 GLN B O   1 
ATOM 3476 C CB  . GLN B 1 250 ? -22.062 -38.610 -37.837 1.00 15.23  ? 534 GLN B CB  1 
ATOM 3477 C CG  . GLN B 1 250 ? -20.777 -39.395 -37.745 1.00 20.97  ? 534 GLN B CG  1 
ATOM 3478 C CD  . GLN B 1 250 ? -20.838 -40.672 -38.555 1.00 23.42  ? 534 GLN B CD  1 
ATOM 3479 O OE1 . GLN B 1 250 ? -21.631 -41.568 -38.268 1.00 26.26  ? 534 GLN B OE1 1 
ATOM 3480 N NE2 . GLN B 1 250 ? -20.006 -40.755 -39.587 1.00 24.36  ? 534 GLN B NE2 1 
ATOM 3481 N N   . LEU B 1 251 ? -24.211 -36.824 -36.846 1.00 17.95  ? 535 LEU B N   1 
ATOM 3482 C CA  . LEU B 1 251 ? -25.562 -36.283 -36.879 1.00 19.67  ? 535 LEU B CA  1 
ATOM 3483 C C   . LEU B 1 251 ? -25.543 -34.759 -36.875 1.00 21.69  ? 535 LEU B C   1 
ATOM 3484 O O   . LEU B 1 251 ? -26.011 -34.126 -37.817 1.00 23.75  ? 535 LEU B O   1 
ATOM 3485 C CB  . LEU B 1 251 ? -26.359 -36.787 -35.670 1.00 19.23  ? 535 LEU B CB  1 
ATOM 3486 C CG  . LEU B 1 251 ? -26.517 -38.297 -35.456 1.00 18.41  ? 535 LEU B CG  1 
ATOM 3487 C CD1 . LEU B 1 251 ? -27.476 -38.526 -34.314 1.00 19.86  ? 535 LEU B CD1 1 
ATOM 3488 C CD2 . LEU B 1 251 ? -27.043 -38.975 -36.705 1.00 15.81  ? 535 LEU B CD2 1 
ATOM 3489 N N   . LEU B 1 252 ? -25.004 -34.180 -35.806 1.00 21.41  ? 536 LEU B N   1 
ATOM 3490 C CA  . LEU B 1 252 ? -24.909 -32.732 -35.669 1.00 20.19  ? 536 LEU B CA  1 
ATOM 3491 C C   . LEU B 1 252 ? -24.454 -32.053 -36.955 1.00 21.49  ? 536 LEU B C   1 
ATOM 3492 O O   . LEU B 1 252 ? -25.068 -31.086 -37.395 1.00 23.62  ? 536 LEU B O   1 
ATOM 3493 C CB  . LEU B 1 252 ? -23.937 -32.377 -34.541 1.00 20.70  ? 536 LEU B CB  1 
ATOM 3494 C CG  . LEU B 1 252 ? -23.523 -30.908 -34.384 1.00 17.94  ? 536 LEU B CG  1 
ATOM 3495 C CD1 . LEU B 1 252 ? -24.741 -29.990 -34.423 1.00 13.44  ? 536 LEU B CD1 1 
ATOM 3496 C CD2 . LEU B 1 252 ? -22.773 -30.757 -33.073 1.00 17.41  ? 536 LEU B CD2 1 
ATOM 3497 N N   . ASP B 1 253 ? -23.366 -32.548 -37.541 1.00 19.95  ? 537 ASP B N   1 
ATOM 3498 C CA  . ASP B 1 253 ? -22.838 -31.987 -38.780 1.00 17.20  ? 537 ASP B CA  1 
ATOM 3499 C C   . ASP B 1 253 ? -23.948 -32.076 -39.809 1.00 18.35  ? 537 ASP B C   1 
ATOM 3500 O O   . ASP B 1 253 ? -24.313 -31.080 -40.437 1.00 20.25  ? 537 ASP B O   1 
ATOM 3501 C CB  . ASP B 1 253 ? -21.610 -32.790 -39.236 1.00 17.13  ? 537 ASP B CB  1 
ATOM 3502 C CG  . ASP B 1 253 ? -21.063 -32.337 -40.588 1.00 17.12  ? 537 ASP B CG  1 
ATOM 3503 O OD1 . ASP B 1 253 ? -21.409 -32.947 -41.624 1.00 17.14  ? 537 ASP B OD1 1 
ATOM 3504 O OD2 . ASP B 1 253 ? -20.280 -31.371 -40.617 1.00 16.97  ? 537 ASP B OD2 1 
ATOM 3505 N N   . GLU B 1 254 ? -24.495 -33.275 -39.962 1.00 15.23  ? 538 GLU B N   1 
ATOM 3506 C CA  . GLU B 1 254 ? -25.569 -33.510 -40.908 1.00 15.97  ? 538 GLU B CA  1 
ATOM 3507 C C   . GLU B 1 254 ? -26.720 -32.541 -40.639 1.00 15.82  ? 538 GLU B C   1 
ATOM 3508 O O   . GLU B 1 254 ? -27.439 -32.153 -41.549 1.00 17.17  ? 538 GLU B O   1 
ATOM 3509 C CB  . GLU B 1 254 ? -26.023 -34.957 -40.778 1.00 20.61  ? 538 GLU B CB  1 
ATOM 3510 C CG  . GLU B 1 254 ? -27.221 -35.356 -41.596 1.00 26.68  ? 538 GLU B CG  1 
ATOM 3511 C CD  . GLU B 1 254 ? -27.497 -36.845 -41.467 1.00 35.18  ? 538 GLU B CD  1 
ATOM 3512 O OE1 . GLU B 1 254 ? -26.688 -37.644 -42.001 1.00 38.04  ? 538 GLU B OE1 1 
ATOM 3513 O OE2 . GLU B 1 254 ? -28.506 -37.218 -40.820 1.00 36.08  ? 538 GLU B OE2 1 
ATOM 3514 N N   . VAL B 1 255 ? -26.882 -32.142 -39.383 1.00 14.35  ? 539 VAL B N   1 
ATOM 3515 C CA  . VAL B 1 255 ? -27.932 -31.203 -38.997 1.00 14.00  ? 539 VAL B CA  1 
ATOM 3516 C C   . VAL B 1 255 ? -27.550 -29.794 -39.467 1.00 18.37  ? 539 VAL B C   1 
ATOM 3517 O O   . VAL B 1 255 ? -28.357 -29.086 -40.063 1.00 20.48  ? 539 VAL B O   1 
ATOM 3518 C CB  . VAL B 1 255 ? -28.137 -31.212 -37.449 1.00 10.50  ? 539 VAL B CB  1 
ATOM 3519 C CG1 . VAL B 1 255 ? -29.030 -30.081 -37.007 1.00 2.16   ? 539 VAL B CG1 1 
ATOM 3520 C CG2 . VAL B 1 255 ? -28.745 -32.533 -37.022 1.00 13.06  ? 539 VAL B CG2 1 
ATOM 3521 N N   . LEU B 1 256 ? -26.308 -29.400 -39.209 1.00 20.52  ? 540 LEU B N   1 
ATOM 3522 C CA  . LEU B 1 256 ? -25.826 -28.083 -39.596 1.00 21.52  ? 540 LEU B CA  1 
ATOM 3523 C C   . LEU B 1 256 ? -25.924 -27.878 -41.099 1.00 24.62  ? 540 LEU B C   1 
ATOM 3524 O O   . LEU B 1 256 ? -26.025 -26.747 -41.574 1.00 24.58  ? 540 LEU B O   1 
ATOM 3525 C CB  . LEU B 1 256 ? -24.378 -27.906 -39.139 1.00 19.39  ? 540 LEU B CB  1 
ATOM 3526 C CG  . LEU B 1 256 ? -24.140 -27.964 -37.625 1.00 18.27  ? 540 LEU B CG  1 
ATOM 3527 C CD1 . LEU B 1 256 ? -22.644 -27.989 -37.355 1.00 16.58  ? 540 LEU B CD1 1 
ATOM 3528 C CD2 . LEU B 1 256 ? -24.809 -26.772 -36.933 1.00 13.41  ? 540 LEU B CD2 1 
ATOM 3529 N N   . HIS B 1 257 ? -25.902 -28.978 -41.843 1.00 28.39  ? 541 HIS B N   1 
ATOM 3530 C CA  . HIS B 1 257 ? -25.982 -28.917 -43.295 1.00 35.37  ? 541 HIS B CA  1 
ATOM 3531 C C   . HIS B 1 257 ? -27.405 -28.950 -43.837 1.00 38.65  ? 541 HIS B C   1 
ATOM 3532 O O   . HIS B 1 257 ? -27.610 -29.065 -45.046 1.00 39.61  ? 541 HIS B O   1 
ATOM 3533 C CB  . HIS B 1 257 ? -25.172 -30.057 -43.915 1.00 38.71  ? 541 HIS B CB  1 
ATOM 3534 C CG  . HIS B 1 257 ? -23.698 -29.803 -43.939 1.00 43.61  ? 541 HIS B CG  1 
ATOM 3535 N ND1 . HIS B 1 257 ? -22.794 -30.707 -44.456 1.00 46.50  ? 541 HIS B ND1 1 
ATOM 3536 C CD2 . HIS B 1 257 ? -22.970 -28.736 -43.529 1.00 44.82  ? 541 HIS B CD2 1 
ATOM 3537 C CE1 . HIS B 1 257 ? -21.574 -30.207 -44.366 1.00 46.91  ? 541 HIS B CE1 1 
ATOM 3538 N NE2 . HIS B 1 257 ? -21.652 -29.013 -43.807 1.00 46.31  ? 541 HIS B NE2 1 
ATOM 3539 N N   . THR B 1 258 ? -28.386 -28.853 -42.945 1.00 41.82  ? 542 THR B N   1 
ATOM 3540 C CA  . THR B 1 258 ? -29.790 -28.857 -43.351 1.00 44.26  ? 542 THR B CA  1 
ATOM 3541 C C   . THR B 1 258 ? -30.398 -27.505 -43.008 1.00 48.99  ? 542 THR B C   1 
ATOM 3542 O O   . THR B 1 258 ? -31.614 -27.370 -42.864 1.00 47.98  ? 542 THR B O   1 
ATOM 3543 C CB  . THR B 1 258 ? -30.593 -29.937 -42.621 1.00 40.09  ? 542 THR B CB  1 
ATOM 3544 O OG1 . THR B 1 258 ? -30.571 -29.673 -41.215 1.00 37.97  ? 542 THR B OG1 1 
ATOM 3545 C CG2 . THR B 1 258 ? -30.013 -31.305 -42.889 1.00 37.46  ? 542 THR B CG2 1 
ATOM 3546 N N   . MET B 1 259 ? -29.538 -26.504 -42.883 1.00 54.20  ? 543 MET B N   1 
ATOM 3547 C CA  . MET B 1 259 ? -29.981 -25.166 -42.545 1.00 60.27  ? 543 MET B CA  1 
ATOM 3548 C C   . MET B 1 259 ? -29.875 -24.218 -43.726 1.00 64.17  ? 543 MET B C   1 
ATOM 3549 O O   . MET B 1 259 ? -29.011 -24.380 -44.587 1.00 64.54  ? 543 MET B O   1 
ATOM 3550 C CB  . MET B 1 259 ? -29.148 -24.629 -41.390 1.00 61.06  ? 543 MET B CB  1 
ATOM 3551 C CG  . MET B 1 259 ? -29.114 -25.552 -40.206 1.00 62.45  ? 543 MET B CG  1 
ATOM 3552 S SD  . MET B 1 259 ? -29.329 -24.617 -38.711 1.00 66.57  ? 543 MET B SD  1 
ATOM 3553 C CE  . MET B 1 259 ? -31.134 -24.462 -38.676 1.00 65.87  ? 543 MET B CE  1 
ATOM 3554 N N   . PRO B 1 260 ? -30.767 -23.218 -43.788 1.00 68.30  ? 544 PRO B N   1 
ATOM 3555 C CA  . PRO B 1 260 ? -30.749 -22.245 -44.882 1.00 70.99  ? 544 PRO B CA  1 
ATOM 3556 C C   . PRO B 1 260 ? -29.364 -21.612 -45.013 1.00 72.13  ? 544 PRO B C   1 
ATOM 3557 O O   . PRO B 1 260 ? -28.817 -21.100 -44.033 1.00 72.86  ? 544 PRO B O   1 
ATOM 3558 C CB  . PRO B 1 260 ? -31.818 -21.243 -44.458 1.00 71.51  ? 544 PRO B CB  1 
ATOM 3559 C CG  . PRO B 1 260 ? -32.824 -22.123 -43.769 1.00 70.19  ? 544 PRO B CG  1 
ATOM 3560 C CD  . PRO B 1 260 ? -31.943 -23.013 -42.919 1.00 69.19  ? 544 PRO B CD  1 
ATOM 3561 N N   . ILE B 1 261 ? -28.803 -21.660 -46.221 1.00 72.47  ? 545 ILE B N   1 
ATOM 3562 C CA  . ILE B 1 261 ? -27.475 -21.108 -46.489 1.00 72.95  ? 545 ILE B CA  1 
ATOM 3563 C C   . ILE B 1 261 ? -27.406 -19.581 -46.366 1.00 74.59  ? 545 ILE B C   1 
ATOM 3564 O O   . ILE B 1 261 ? -28.354 -18.872 -46.719 1.00 74.15  ? 545 ILE B O   1 
ATOM 3565 C CB  . ILE B 1 261 ? -26.964 -21.578 -47.894 1.00 70.78  ? 545 ILE B CB  1 
ATOM 3566 C CG1 . ILE B 1 261 ? -25.800 -20.704 -48.379 1.00 68.90  ? 545 ILE B CG1 1 
ATOM 3567 C CG2 . ILE B 1 261 ? -28.116 -21.617 -48.877 1.00 70.75  ? 545 ILE B CG2 1 
ATOM 3568 C CD1 . ILE B 1 261 ? -26.204 -19.379 -49.013 1.00 67.57  ? 545 ILE B CD1 1 
ATOM 3569 N N   . ALA B 1 262 ? -26.273 -19.094 -45.853 1.00 76.55  ? 546 ALA B N   1 
ATOM 3570 C CA  . ALA B 1 262 ? -26.034 -17.661 -45.654 1.00 77.51  ? 546 ALA B CA  1 
ATOM 3571 C C   . ALA B 1 262 ? -25.998 -16.907 -46.984 1.00 77.68  ? 546 ALA B C   1 
ATOM 3572 O O   . ALA B 1 262 ? -24.935 -16.629 -47.542 1.00 78.01  ? 546 ALA B O   1 
ATOM 3573 C CB  . ALA B 1 262 ? -24.719 -17.442 -44.879 1.00 76.37  ? 546 ALA B CB  1 
ATOM 3574 N N   . ASP B 1 263 ? -27.186 -16.583 -47.479 1.00 77.83  ? 547 ASP B N   1 
ATOM 3575 C CA  . ASP B 1 263 ? -27.350 -15.865 -48.734 1.00 76.95  ? 547 ASP B CA  1 
ATOM 3576 C C   . ASP B 1 263 ? -27.405 -14.367 -48.416 1.00 76.82  ? 547 ASP B C   1 
ATOM 3577 O O   . ASP B 1 263 ? -28.345 -13.905 -47.761 1.00 77.61  ? 547 ASP B O   1 
ATOM 3578 C CB  . ASP B 1 263 ? -28.657 -16.319 -49.395 1.00 74.25  ? 547 ASP B CB  1 
ATOM 3579 C CG  . ASP B 1 263 ? -28.823 -15.791 -50.799 1.00 71.60  ? 547 ASP B CG  1 
ATOM 3580 O OD1 . ASP B 1 263 ? -29.926 -15.964 -51.348 1.00 70.61  ? 547 ASP B OD1 1 
ATOM 3581 O OD2 . ASP B 1 263 ? -27.866 -15.215 -51.358 1.00 71.11  ? 547 ASP B OD2 1 
ATOM 3582 N N   . PRO B 1 264 ? -26.396 -13.592 -48.865 1.00 75.72  ? 548 PRO B N   1 
ATOM 3583 C CA  . PRO B 1 264 ? -26.372 -12.150 -48.604 1.00 75.67  ? 548 PRO B CA  1 
ATOM 3584 C C   . PRO B 1 264 ? -27.774 -11.545 -48.579 1.00 76.75  ? 548 PRO B C   1 
ATOM 3585 O O   . PRO B 1 264 ? -28.603 -11.824 -49.447 1.00 76.99  ? 548 PRO B O   1 
ATOM 3586 C CB  . PRO B 1 264 ? -25.507 -11.623 -49.740 1.00 73.94  ? 548 PRO B CB  1 
ATOM 3587 C CG  . PRO B 1 264 ? -24.471 -12.687 -49.842 1.00 73.77  ? 548 PRO B CG  1 
ATOM 3588 C CD  . PRO B 1 264 ? -25.290 -13.971 -49.764 1.00 75.01  ? 548 PRO B CD  1 
ATOM 3589 N N   . GLN B 1 265 ? -28.038 -10.720 -47.575 1.00 77.14  ? 549 GLN B N   1 
ATOM 3590 C CA  . GLN B 1 265 ? -29.353 -10.120 -47.441 1.00 78.61  ? 549 GLN B CA  1 
ATOM 3591 C C   . GLN B 1 265 ? -29.332 -8.594  -47.475 1.00 77.97  ? 549 GLN B C   1 
ATOM 3592 O O   . GLN B 1 265 ? -28.925 -7.949  -46.508 1.00 79.44  ? 549 GLN B O   1 
ATOM 3593 C CB  . GLN B 1 265 ? -29.992 -10.596 -46.136 1.00 80.42  ? 549 GLN B CB  1 
ATOM 3594 C CG  . GLN B 1 265 ? -31.490 -10.383 -46.061 1.00 82.52  ? 549 GLN B CG  1 
ATOM 3595 C CD  . GLN B 1 265 ? -32.070 -10.838 -44.741 1.00 83.26  ? 549 GLN B CD  1 
ATOM 3596 O OE1 . GLN B 1 265 ? -33.283 -10.992 -44.603 1.00 84.45  ? 549 GLN B OE1 1 
ATOM 3597 N NE2 . GLN B 1 265 ? -31.204 -11.048 -43.757 1.00 83.75  ? 549 GLN B NE2 1 
ATOM 3598 N N   . PRO B 1 266 ? -29.771 -7.996  -48.594 1.00 76.38  ? 550 PRO B N   1 
ATOM 3599 C CA  . PRO B 1 266 ? -29.794 -6.536  -48.715 1.00 75.14  ? 550 PRO B CA  1 
ATOM 3600 C C   . PRO B 1 266 ? -30.867 -5.909  -47.811 1.00 74.89  ? 550 PRO B C   1 
ATOM 3601 O O   . PRO B 1 266 ? -31.994 -5.682  -48.299 1.00 75.59  ? 550 PRO B O   1 
ATOM 3602 C CB  . PRO B 1 266 ? -30.064 -6.323  -50.204 1.00 74.36  ? 550 PRO B CB  1 
ATOM 3603 C CG  . PRO B 1 266 ? -30.919 -7.496  -50.555 1.00 74.03  ? 550 PRO B CG  1 
ATOM 3604 C CD  . PRO B 1 266 ? -30.211 -8.631  -49.850 1.00 75.29  ? 550 PRO B CD  1 
ATOM 3605 N N   . ASN C 1 1   ? 33.310  -39.788 -9.520  1.00 70.42  ? 285 ASN C N   1 
ATOM 3606 C CA  . ASN C 1 1   ? 31.815  -39.746 -9.537  1.00 71.65  ? 285 ASN C CA  1 
ATOM 3607 C C   . ASN C 1 1   ? 31.267  -40.582 -10.698 1.00 70.67  ? 285 ASN C C   1 
ATOM 3608 O O   . ASN C 1 1   ? 30.348  -41.394 -10.522 1.00 71.34  ? 285 ASN C O   1 
ATOM 3609 C CB  . ASN C 1 1   ? 31.325  -38.294 -9.670  1.00 73.40  ? 285 ASN C CB  1 
ATOM 3610 C CG  . ASN C 1 1   ? 31.555  -37.715 -11.065 1.00 73.55  ? 285 ASN C CG  1 
ATOM 3611 O OD1 . ASN C 1 1   ? 32.667  -37.770 -11.599 1.00 73.25  ? 285 ASN C OD1 1 
ATOM 3612 N ND2 . ASN C 1 1   ? 30.500  -37.154 -11.658 1.00 70.88  ? 285 ASN C ND2 1 
ATOM 3613 N N   . GLY C 1 2   ? 31.841  -40.365 -11.881 1.00 66.86  ? 286 GLY C N   1 
ATOM 3614 C CA  . GLY C 1 2   ? 31.430  -41.084 -13.070 1.00 60.16  ? 286 GLY C CA  1 
ATOM 3615 C C   . GLY C 1 2   ? 29.946  -41.076 -13.402 1.00 55.73  ? 286 GLY C C   1 
ATOM 3616 O O   . GLY C 1 2   ? 29.375  -42.141 -13.626 1.00 56.41  ? 286 GLY C O   1 
ATOM 3617 N N   . HIS C 1 3   ? 29.311  -39.904 -13.440 1.00 49.35  ? 287 HIS C N   1 
ATOM 3618 C CA  . HIS C 1 3   ? 27.893  -39.848 -13.784 1.00 41.66  ? 287 HIS C CA  1 
ATOM 3619 C C   . HIS C 1 3   ? 27.760  -40.104 -15.280 1.00 37.91  ? 287 HIS C C   1 
ATOM 3620 O O   . HIS C 1 3   ? 26.815  -40.753 -15.731 1.00 37.92  ? 287 HIS C O   1 
ATOM 3621 C CB  . HIS C 1 3   ? 27.296  -38.490 -13.436 1.00 40.79  ? 287 HIS C CB  1 
ATOM 3622 C CG  . HIS C 1 3   ? 25.824  -38.398 -13.699 1.00 41.90  ? 287 HIS C CG  1 
ATOM 3623 N ND1 . HIS C 1 3   ? 25.306  -38.030 -14.923 1.00 42.14  ? 287 HIS C ND1 1 
ATOM 3624 C CD2 . HIS C 1 3   ? 24.758  -38.653 -12.903 1.00 41.49  ? 287 HIS C CD2 1 
ATOM 3625 C CE1 . HIS C 1 3   ? 23.986  -38.061 -14.868 1.00 40.23  ? 287 HIS C CE1 1 
ATOM 3626 N NE2 . HIS C 1 3   ? 23.628  -38.437 -13.654 1.00 38.92  ? 287 HIS C NE2 1 
ATOM 3627 N N   . LEU C 1 4   ? 28.725  -39.596 -16.041 1.00 32.60  ? 288 LEU C N   1 
ATOM 3628 C CA  . LEU C 1 4   ? 28.756  -39.780 -17.487 1.00 26.60  ? 288 LEU C CA  1 
ATOM 3629 C C   . LEU C 1 4   ? 29.502  -41.063 -17.824 1.00 23.09  ? 288 LEU C C   1 
ATOM 3630 O O   . LEU C 1 4   ? 30.634  -41.264 -17.392 1.00 21.20  ? 288 LEU C O   1 
ATOM 3631 C CB  . LEU C 1 4   ? 29.451  -38.589 -18.159 1.00 26.55  ? 288 LEU C CB  1 
ATOM 3632 C CG  . LEU C 1 4   ? 29.839  -38.682 -19.646 1.00 25.29  ? 288 LEU C CG  1 
ATOM 3633 C CD1 . LEU C 1 4   ? 28.619  -38.790 -20.533 1.00 26.02  ? 288 LEU C CD1 1 
ATOM 3634 C CD2 . LEU C 1 4   ? 30.628  -37.453 -20.022 1.00 24.81  ? 288 LEU C CD2 1 
ATOM 3635 N N   . GLN C 1 5   ? 28.851  -41.929 -18.590 1.00 22.32  ? 289 GLN C N   1 
ATOM 3636 C CA  . GLN C 1 5   ? 29.438  -43.194 -19.020 1.00 24.25  ? 289 GLN C CA  1 
ATOM 3637 C C   . GLN C 1 5   ? 29.820  -43.088 -20.486 1.00 24.83  ? 289 GLN C C   1 
ATOM 3638 O O   . GLN C 1 5   ? 29.054  -42.563 -21.292 1.00 26.55  ? 289 GLN C O   1 
ATOM 3639 C CB  . GLN C 1 5   ? 28.438  -44.336 -18.851 1.00 26.61  ? 289 GLN C CB  1 
ATOM 3640 C CG  . GLN C 1 5   ? 28.077  -44.615 -17.417 1.00 30.13  ? 289 GLN C CG  1 
ATOM 3641 C CD  . GLN C 1 5   ? 29.284  -44.981 -16.581 1.00 30.76  ? 289 GLN C CD  1 
ATOM 3642 O OE1 . GLN C 1 5   ? 29.890  -46.044 -16.762 1.00 30.88  ? 289 GLN C OE1 1 
ATOM 3643 N NE2 . GLN C 1 5   ? 29.646  -44.097 -15.660 1.00 31.30  ? 289 GLN C NE2 1 
ATOM 3644 N N   . HIS C 1 6   ? 30.997  -43.595 -20.837 1.00 24.60  ? 290 HIS C N   1 
ATOM 3645 C CA  . HIS C 1 6   ? 31.458  -43.534 -22.217 1.00 23.17  ? 290 HIS C CA  1 
ATOM 3646 C C   . HIS C 1 6   ? 31.305  -44.865 -22.930 1.00 23.62  ? 290 HIS C C   1 
ATOM 3647 O O   . HIS C 1 6   ? 31.712  -45.908 -22.427 1.00 24.95  ? 290 HIS C O   1 
ATOM 3648 C CB  . HIS C 1 6   ? 32.911  -43.069 -22.258 1.00 20.43  ? 290 HIS C CB  1 
ATOM 3649 C CG  . HIS C 1 6   ? 33.124  -41.720 -21.639 1.00 20.01  ? 290 HIS C CG  1 
ATOM 3650 N ND1 . HIS C 1 6   ? 33.324  -40.579 -22.385 1.00 21.05  ? 290 HIS C ND1 1 
ATOM 3651 C CD2 . HIS C 1 6   ? 33.136  -41.326 -20.343 1.00 18.35  ? 290 HIS C CD2 1 
ATOM 3652 C CE1 . HIS C 1 6   ? 33.451  -39.541 -21.577 1.00 20.39  ? 290 HIS C CE1 1 
ATOM 3653 N NE2 . HIS C 1 6   ? 33.340  -39.967 -20.332 1.00 18.64  ? 290 HIS C NE2 1 
ATOM 3654 N N   . HIS C 1 7   ? 30.700  -44.809 -24.109 1.00 24.39  ? 291 HIS C N   1 
ATOM 3655 C CA  . HIS C 1 7   ? 30.459  -45.987 -24.923 1.00 24.59  ? 291 HIS C CA  1 
ATOM 3656 C C   . HIS C 1 7   ? 30.990  -45.728 -26.329 1.00 28.83  ? 291 HIS C C   1 
ATOM 3657 O O   . HIS C 1 7   ? 30.237  -45.362 -27.229 1.00 30.96  ? 291 HIS C O   1 
ATOM 3658 C CB  . HIS C 1 7   ? 28.960  -46.263 -24.967 1.00 20.91  ? 291 HIS C CB  1 
ATOM 3659 C CG  . HIS C 1 7   ? 28.356  -46.533 -23.623 1.00 18.82  ? 291 HIS C CG  1 
ATOM 3660 N ND1 . HIS C 1 7   ? 28.275  -47.799 -23.081 1.00 12.22  ? 291 HIS C ND1 1 
ATOM 3661 C CD2 . HIS C 1 7   ? 27.796  -45.699 -22.715 1.00 17.12  ? 291 HIS C CD2 1 
ATOM 3662 C CE1 . HIS C 1 7   ? 27.688  -47.733 -21.901 1.00 13.88  ? 291 HIS C CE1 1 
ATOM 3663 N NE2 . HIS C 1 7   ? 27.387  -46.470 -21.654 1.00 17.84  ? 291 HIS C NE2 1 
ATOM 3664 N N   . PRO C 1 8   ? 32.307  -45.904 -26.530 1.00 32.62  ? 292 PRO C N   1 
ATOM 3665 C CA  . PRO C 1 8   ? 32.960  -45.691 -27.824 1.00 33.25  ? 292 PRO C CA  1 
ATOM 3666 C C   . PRO C 1 8   ? 32.872  -46.930 -28.695 1.00 33.29  ? 292 PRO C C   1 
ATOM 3667 O O   . PRO C 1 8   ? 32.574  -48.016 -28.198 1.00 30.91  ? 292 PRO C O   1 
ATOM 3668 C CB  . PRO C 1 8   ? 34.390  -45.381 -27.425 1.00 33.66  ? 292 PRO C CB  1 
ATOM 3669 C CG  . PRO C 1 8   ? 34.596  -46.342 -26.296 1.00 35.09  ? 292 PRO C CG  1 
ATOM 3670 C CD  . PRO C 1 8   ? 33.310  -46.206 -25.491 1.00 34.92  ? 292 PRO C CD  1 
ATOM 3671 N N   . PRO C 1 9   ? 33.131  -46.784 -30.007 1.00 34.61  ? 293 PRO C N   1 
ATOM 3672 C CA  . PRO C 1 9   ? 33.073  -47.926 -30.923 1.00 36.43  ? 293 PRO C CA  1 
ATOM 3673 C C   . PRO C 1 9   ? 34.189  -48.880 -30.558 1.00 40.31  ? 293 PRO C C   1 
ATOM 3674 O O   . PRO C 1 9   ? 35.340  -48.468 -30.438 1.00 41.53  ? 293 PRO C O   1 
ATOM 3675 C CB  . PRO C 1 9   ? 33.279  -47.282 -32.287 1.00 34.28  ? 293 PRO C CB  1 
ATOM 3676 C CG  . PRO C 1 9   ? 34.180  -46.153 -31.977 1.00 33.59  ? 293 PRO C CG  1 
ATOM 3677 C CD  . PRO C 1 9   ? 33.591  -45.576 -30.711 1.00 32.63  ? 293 PRO C CD  1 
ATOM 3678 N N   . MET C 1 10  ? 33.849  -50.149 -30.371 1.00 45.31  ? 294 MET C N   1 
ATOM 3679 C CA  . MET C 1 10  ? 34.846  -51.143 -29.995 1.00 50.59  ? 294 MET C CA  1 
ATOM 3680 C C   . MET C 1 10  ? 35.005  -52.252 -31.038 1.00 52.84  ? 294 MET C C   1 
ATOM 3681 O O   . MET C 1 10  ? 36.113  -52.515 -31.522 1.00 52.84  ? 294 MET C O   1 
ATOM 3682 C CB  . MET C 1 10  ? 34.474  -51.742 -28.636 1.00 53.54  ? 294 MET C CB  1 
ATOM 3683 C CG  . MET C 1 10  ? 34.307  -50.699 -27.524 1.00 58.81  ? 294 MET C CG  1 
ATOM 3684 S SD  . MET C 1 10  ? 35.841  -49.859 -26.992 1.00 59.97  ? 294 MET C SD  1 
ATOM 3685 C CE  . MET C 1 10  ? 36.037  -50.563 -25.344 1.00 59.99  ? 294 MET C CE  1 
ATOM 3686 N N   . PRO C 1 28  ? 13.846  -68.715 -25.910 1.00 78.68  ? 312 PRO C N   1 
ATOM 3687 C CA  . PRO C 1 28  ? 12.463  -69.003 -25.513 1.00 78.49  ? 312 PRO C CA  1 
ATOM 3688 C C   . PRO C 1 28  ? 11.708  -67.720 -25.171 1.00 77.11  ? 312 PRO C C   1 
ATOM 3689 O O   . PRO C 1 28  ? 12.271  -66.799 -24.579 1.00 77.13  ? 312 PRO C O   1 
ATOM 3690 C CB  . PRO C 1 28  ? 12.634  -69.909 -24.295 1.00 79.61  ? 312 PRO C CB  1 
ATOM 3691 C CG  . PRO C 1 28  ? 13.934  -70.603 -24.573 1.00 80.31  ? 312 PRO C CG  1 
ATOM 3692 C CD  . PRO C 1 28  ? 14.797  -69.475 -25.083 1.00 79.22  ? 312 PRO C CD  1 
ATOM 3693 N N   . PRO C 1 29  ? 10.417  -67.648 -25.533 1.00 75.06  ? 313 PRO C N   1 
ATOM 3694 C CA  . PRO C 1 29  ? 9.587   -66.469 -25.265 1.00 72.41  ? 313 PRO C CA  1 
ATOM 3695 C C   . PRO C 1 29  ? 9.293   -66.252 -23.784 1.00 69.39  ? 313 PRO C C   1 
ATOM 3696 O O   . PRO C 1 29  ? 8.994   -67.198 -23.053 1.00 70.23  ? 313 PRO C O   1 
ATOM 3697 C CB  . PRO C 1 29  ? 8.323   -66.760 -26.062 1.00 72.88  ? 313 PRO C CB  1 
ATOM 3698 C CG  . PRO C 1 29  ? 8.199   -68.242 -25.912 1.00 73.88  ? 313 PRO C CG  1 
ATOM 3699 C CD  . PRO C 1 29  ? 9.617   -68.713 -26.163 1.00 74.53  ? 313 PRO C CD  1 
ATOM 3700 N N   . ILE C 1 30  ? 9.384   -64.998 -23.351 1.00 64.27  ? 314 ILE C N   1 
ATOM 3701 C CA  . ILE C 1 30  ? 9.117   -64.641 -21.965 1.00 58.10  ? 314 ILE C CA  1 
ATOM 3702 C C   . ILE C 1 30  ? 7.609   -64.642 -21.767 1.00 56.39  ? 314 ILE C C   1 
ATOM 3703 O O   . ILE C 1 30  ? 7.112   -64.743 -20.647 1.00 54.02  ? 314 ILE C O   1 
ATOM 3704 C CB  . ILE C 1 30  ? 9.655   -63.235 -21.640 1.00 54.95  ? 314 ILE C CB  1 
ATOM 3705 C CG1 . ILE C 1 30  ? 11.141  -63.160 -21.980 1.00 53.32  ? 314 ILE C CG1 1 
ATOM 3706 C CG2 . ILE C 1 30  ? 9.428   -62.912 -20.175 1.00 51.66  ? 314 ILE C CG2 1 
ATOM 3707 C CD1 . ILE C 1 30  ? 11.767  -61.820 -21.675 1.00 55.76  ? 314 ILE C CD1 1 
ATOM 3708 N N   . SER C 1 31  ? 6.888   -64.527 -22.878 1.00 55.16  ? 315 SER C N   1 
ATOM 3709 C CA  . SER C 1 31  ? 5.434   -64.501 -22.857 1.00 53.49  ? 315 SER C CA  1 
ATOM 3710 C C   . SER C 1 31  ? 4.871   -65.008 -24.178 1.00 55.40  ? 315 SER C C   1 
ATOM 3711 O O   . SER C 1 31  ? 5.529   -64.922 -25.220 1.00 54.40  ? 315 SER C O   1 
ATOM 3712 C CB  . SER C 1 31  ? 4.945   -63.076 -22.600 1.00 49.97  ? 315 SER C CB  1 
ATOM 3713 O OG  . SER C 1 31  ? 3.534   -63.007 -22.630 1.00 46.45  ? 315 SER C OG  1 
ATOM 3714 N N   . ASN C 1 32  ? 3.654   -65.548 -24.119 1.00 58.09  ? 316 ASN C N   1 
ATOM 3715 C CA  . ASN C 1 32  ? 2.962   -66.072 -25.296 1.00 59.23  ? 316 ASN C CA  1 
ATOM 3716 C C   . ASN C 1 32  ? 2.111   -64.959 -25.880 1.00 59.23  ? 316 ASN C C   1 
ATOM 3717 O O   . ASN C 1 32  ? 1.683   -65.020 -27.032 1.00 58.39  ? 316 ASN C O   1 
ATOM 3718 C CB  . ASN C 1 32  ? 2.077   -67.249 -24.906 1.00 61.12  ? 316 ASN C CB  1 
ATOM 3719 C CG  . ASN C 1 32  ? 2.870   -68.396 -24.335 1.00 64.81  ? 316 ASN C CG  1 
ATOM 3720 O OD1 . ASN C 1 32  ? 3.746   -68.947 -25.004 1.00 66.34  ? 316 ASN C OD1 1 
ATOM 3721 N ND2 . ASN C 1 32  ? 2.576   -68.763 -23.089 1.00 65.63  ? 316 ASN C ND2 1 
ATOM 3722 N N   . HIS C 1 33  ? 1.861   -63.952 -25.050 1.00 59.13  ? 317 HIS C N   1 
ATOM 3723 C CA  . HIS C 1 33  ? 1.103   -62.777 -25.438 1.00 57.92  ? 317 HIS C CA  1 
ATOM 3724 C C   . HIS C 1 33  ? 1.652   -62.415 -26.820 1.00 57.56  ? 317 HIS C C   1 
ATOM 3725 O O   . HIS C 1 33  ? 2.864   -62.462 -27.045 1.00 57.44  ? 317 HIS C O   1 
ATOM 3726 C CB  . HIS C 1 33  ? 1.386   -61.663 -24.426 1.00 59.61  ? 317 HIS C CB  1 
ATOM 3727 C CG  . HIS C 1 33  ? 0.461   -60.491 -24.520 1.00 61.27  ? 317 HIS C CG  1 
ATOM 3728 N ND1 . HIS C 1 33  ? 0.307   -59.749 -25.671 1.00 61.90  ? 317 HIS C ND1 1 
ATOM 3729 C CD2 . HIS C 1 33  ? -0.325  -59.903 -23.586 1.00 60.93  ? 317 HIS C CD2 1 
ATOM 3730 C CE1 . HIS C 1 33  ? -0.531  -58.754 -25.443 1.00 62.27  ? 317 HIS C CE1 1 
ATOM 3731 N NE2 . HIS C 1 33  ? -0.928  -58.825 -24.185 1.00 61.64  ? 317 HIS C NE2 1 
ATOM 3732 N N   . PRO C 1 34  ? 0.770   -62.068 -27.770 1.00 56.44  ? 318 PRO C N   1 
ATOM 3733 C CA  . PRO C 1 34  ? 1.177   -61.706 -29.137 1.00 53.74  ? 318 PRO C CA  1 
ATOM 3734 C C   . PRO C 1 34  ? 2.065   -60.465 -29.273 1.00 50.29  ? 318 PRO C C   1 
ATOM 3735 O O   . PRO C 1 34  ? 1.879   -59.463 -28.575 1.00 49.35  ? 318 PRO C O   1 
ATOM 3736 C CB  . PRO C 1 34  ? -0.157  -61.549 -29.862 1.00 55.53  ? 318 PRO C CB  1 
ATOM 3737 C CG  . PRO C 1 34  ? -1.079  -61.078 -28.763 1.00 57.20  ? 318 PRO C CG  1 
ATOM 3738 C CD  . PRO C 1 34  ? -0.692  -61.968 -27.608 1.00 56.54  ? 318 PRO C CD  1 
ATOM 3739 N N   . ALA C 1 35  ? 3.028   -60.546 -30.186 1.00 45.88  ? 319 ALA C N   1 
ATOM 3740 C CA  . ALA C 1 35  ? 3.955   -59.447 -30.431 1.00 41.79  ? 319 ALA C CA  1 
ATOM 3741 C C   . ALA C 1 35  ? 3.178   -58.162 -30.645 1.00 39.23  ? 319 ALA C C   1 
ATOM 3742 O O   . ALA C 1 35  ? 2.162   -58.152 -31.329 1.00 43.30  ? 319 ALA C O   1 
ATOM 3743 C CB  . ALA C 1 35  ? 4.813   -59.744 -31.657 1.00 39.50  ? 319 ALA C CB  1 
ATOM 3744 N N   . PRO C 1 36  ? 3.643   -57.057 -30.054 1.00 35.02  ? 320 PRO C N   1 
ATOM 3745 C CA  . PRO C 1 36  ? 2.956   -55.778 -30.209 1.00 31.65  ? 320 PRO C CA  1 
ATOM 3746 C C   . PRO C 1 36  ? 2.790   -55.401 -31.673 1.00 29.20  ? 320 PRO C C   1 
ATOM 3747 O O   . PRO C 1 36  ? 3.500   -55.910 -32.540 1.00 27.77  ? 320 PRO C O   1 
ATOM 3748 C CB  . PRO C 1 36  ? 3.874   -54.813 -29.473 1.00 32.96  ? 320 PRO C CB  1 
ATOM 3749 C CG  . PRO C 1 36  ? 4.440   -55.654 -28.393 1.00 35.65  ? 320 PRO C CG  1 
ATOM 3750 C CD  . PRO C 1 36  ? 4.780   -56.927 -29.129 1.00 35.84  ? 320 PRO C CD  1 
ATOM 3751 N N   . GLU C 1 37  ? 1.840   -54.513 -31.940 1.00 27.52  ? 321 GLU C N   1 
ATOM 3752 C CA  . GLU C 1 37  ? 1.592   -54.041 -33.296 1.00 28.00  ? 321 GLU C CA  1 
ATOM 3753 C C   . GLU C 1 37  ? 2.813   -53.217 -33.710 1.00 27.65  ? 321 GLU C C   1 
ATOM 3754 O O   . GLU C 1 37  ? 3.303   -53.320 -34.837 1.00 26.60  ? 321 GLU C O   1 
ATOM 3755 C CB  . GLU C 1 37  ? 0.321   -53.196 -33.300 1.00 28.31  ? 321 GLU C CB  1 
ATOM 3756 C CG  . GLU C 1 37  ? 0.078   -52.367 -34.533 1.00 28.12  ? 321 GLU C CG  1 
ATOM 3757 C CD  . GLU C 1 37  ? -1.237  -51.618 -34.438 1.00 31.22  ? 321 GLU C CD  1 
ATOM 3758 O OE1 . GLU C 1 37  ? -1.626  -51.267 -33.301 1.00 30.06  ? 321 GLU C OE1 1 
ATOM 3759 O OE2 . GLU C 1 37  ? -1.878  -51.371 -35.487 1.00 33.55  ? 321 GLU C OE2 1 
ATOM 3760 N N   . TYR C 1 38  ? 3.292   -52.408 -32.769 1.00 27.16  ? 322 TYR C N   1 
ATOM 3761 C CA  . TYR C 1 38  ? 4.472   -51.565 -32.948 1.00 24.99  ? 322 TYR C CA  1 
ATOM 3762 C C   . TYR C 1 38  ? 5.438   -52.028 -31.869 1.00 22.76  ? 322 TYR C C   1 
ATOM 3763 O O   . TYR C 1 38  ? 5.004   -52.450 -30.803 1.00 23.28  ? 322 TYR C O   1 
ATOM 3764 C CB  . TYR C 1 38  ? 4.133   -50.101 -32.682 1.00 25.63  ? 322 TYR C CB  1 
ATOM 3765 C CG  . TYR C 1 38  ? 3.021   -49.556 -33.534 1.00 28.66  ? 322 TYR C CG  1 
ATOM 3766 C CD1 . TYR C 1 38  ? 3.205   -49.341 -34.899 1.00 29.94  ? 322 TYR C CD1 1 
ATOM 3767 C CD2 . TYR C 1 38  ? 1.792   -49.227 -32.975 1.00 28.42  ? 322 TYR C CD2 1 
ATOM 3768 C CE1 . TYR C 1 38  ? 2.196   -48.808 -35.683 1.00 28.68  ? 322 TYR C CE1 1 
ATOM 3769 C CE2 . TYR C 1 38  ? 0.774   -48.692 -33.753 1.00 29.05  ? 322 TYR C CE2 1 
ATOM 3770 C CZ  . TYR C 1 38  ? 0.984   -48.484 -35.105 1.00 28.78  ? 322 TYR C CZ  1 
ATOM 3771 O OH  . TYR C 1 38  ? -0.012  -47.941 -35.877 1.00 28.41  ? 322 TYR C OH  1 
ATOM 3772 N N   . TRP C 1 39  ? 6.740   -51.963 -32.116 1.00 21.22  ? 323 TRP C N   1 
ATOM 3773 C CA  . TRP C 1 39  ? 7.652   -52.384 -31.069 1.00 18.18  ? 323 TRP C CA  1 
ATOM 3774 C C   . TRP C 1 39  ? 8.115   -51.225 -30.193 1.00 18.95  ? 323 TRP C C   1 
ATOM 3775 O O   . TRP C 1 39  ? 8.756   -51.444 -29.161 1.00 18.85  ? 323 TRP C O   1 
ATOM 3776 C CB  . TRP C 1 39  ? 8.843   -53.153 -31.633 1.00 16.49  ? 323 TRP C CB  1 
ATOM 3777 C CG  . TRP C 1 39  ? 9.755   -52.426 -32.556 1.00 12.36  ? 323 TRP C CG  1 
ATOM 3778 C CD1 . TRP C 1 39  ? 9.685   -52.392 -33.914 1.00 12.34  ? 323 TRP C CD1 1 
ATOM 3779 C CD2 . TRP C 1 39  ? 10.969  -51.760 -32.198 1.00 9.31   ? 323 TRP C CD2 1 
ATOM 3780 N NE1 . TRP C 1 39  ? 10.791  -51.762 -34.429 1.00 10.46  ? 323 TRP C NE1 1 
ATOM 3781 C CE2 . TRP C 1 39  ? 11.595  -51.363 -33.396 1.00 8.25   ? 323 TRP C CE2 1 
ATOM 3782 C CE3 . TRP C 1 39  ? 11.590  -51.465 -30.977 1.00 5.70   ? 323 TRP C CE3 1 
ATOM 3783 C CZ2 . TRP C 1 39  ? 12.813  -50.687 -33.414 1.00 6.32   ? 323 TRP C CZ2 1 
ATOM 3784 C CZ3 . TRP C 1 39  ? 12.799  -50.793 -30.992 1.00 5.38   ? 323 TRP C CZ3 1 
ATOM 3785 C CH2 . TRP C 1 39  ? 13.400  -50.411 -32.206 1.00 8.11   ? 323 TRP C CH2 1 
ATOM 3786 N N   . CYS C 1 40  ? 7.770   -50.000 -30.597 1.00 15.57  ? 324 CYS C N   1 
ATOM 3787 C CA  . CYS C 1 40  ? 8.106   -48.814 -29.822 1.00 12.23  ? 324 CYS C CA  1 
ATOM 3788 C C   . CYS C 1 40  ? 7.411   -47.560 -30.345 1.00 12.27  ? 324 CYS C C   1 
ATOM 3789 O O   . CYS C 1 40  ? 6.977   -47.510 -31.495 1.00 13.34  ? 324 CYS C O   1 
ATOM 3790 C CB  . CYS C 1 40  ? 9.622   -48.597 -29.792 1.00 12.56  ? 324 CYS C CB  1 
ATOM 3791 S SG  . CYS C 1 40  ? 10.371  -47.997 -31.321 1.00 10.37  ? 324 CYS C SG  1 
ATOM 3792 N N   . SER C 1 41  ? 7.292   -46.561 -29.472 1.00 12.96  ? 325 SER C N   1 
ATOM 3793 C CA  . SER C 1 41  ? 6.674   -45.272 -29.794 1.00 11.43  ? 325 SER C CA  1 
ATOM 3794 C C   . SER C 1 41  ? 7.753   -44.244 -29.496 1.00 11.98  ? 325 SER C C   1 
ATOM 3795 O O   . SER C 1 41  ? 8.316   -44.234 -28.396 1.00 13.61  ? 325 SER C O   1 
ATOM 3796 C CB  . SER C 1 41  ? 5.480   -44.974 -28.876 1.00 8.95   ? 325 SER C CB  1 
ATOM 3797 O OG  . SER C 1 41  ? 4.779   -46.147 -28.521 1.00 7.33   ? 325 SER C OG  1 
ATOM 3798 N N   . ILE C 1 42  ? 8.039   -43.376 -30.456 1.00 8.98   ? 326 ILE C N   1 
ATOM 3799 C CA  . ILE C 1 42  ? 9.062   -42.367 -30.250 1.00 7.55   ? 326 ILE C CA  1 
ATOM 3800 C C   . ILE C 1 42  ? 8.436   -40.987 -30.226 1.00 8.80   ? 326 ILE C C   1 
ATOM 3801 O O   . ILE C 1 42  ? 7.589   -40.672 -31.056 1.00 10.75  ? 326 ILE C O   1 
ATOM 3802 C CB  . ILE C 1 42  ? 10.113  -42.413 -31.371 1.00 7.57   ? 326 ILE C CB  1 
ATOM 3803 C CG1 . ILE C 1 42  ? 10.742  -43.803 -31.432 1.00 6.44   ? 326 ILE C CG1 1 
ATOM 3804 C CG2 . ILE C 1 42  ? 11.186  -41.362 -31.123 1.00 7.35   ? 326 ILE C CG2 1 
ATOM 3805 C CD1 . ILE C 1 42  ? 11.484  -44.050 -32.709 1.00 7.50   ? 326 ILE C CD1 1 
ATOM 3806 N N   . ALA C 1 43  ? 8.847   -40.168 -29.264 1.00 8.23   ? 327 ALA C N   1 
ATOM 3807 C CA  . ALA C 1 43  ? 8.344   -38.808 -29.150 1.00 7.94   ? 327 ALA C CA  1 
ATOM 3808 C C   . ALA C 1 43  ? 9.535   -37.882 -29.227 1.00 10.18  ? 327 ALA C C   1 
ATOM 3809 O O   . ALA C 1 43  ? 10.531  -38.090 -28.542 1.00 11.16  ? 327 ALA C O   1 
ATOM 3810 C CB  . ALA C 1 43  ? 7.637   -38.611 -27.841 1.00 6.62   ? 327 ALA C CB  1 
ATOM 3811 N N   . TYR C 1 44  ? 9.434   -36.859 -30.068 1.00 12.69  ? 328 TYR C N   1 
ATOM 3812 C CA  . TYR C 1 44  ? 10.520  -35.898 -30.230 1.00 11.83  ? 328 TYR C CA  1 
ATOM 3813 C C   . TYR C 1 44  ? 10.242  -34.679 -29.352 1.00 11.80  ? 328 TYR C C   1 
ATOM 3814 O O   . TYR C 1 44  ? 9.110   -34.194 -29.273 1.00 11.49  ? 328 TYR C O   1 
ATOM 3815 C CB  . TYR C 1 44  ? 10.647  -35.501 -31.722 1.00 12.43  ? 328 TYR C CB  1 
ATOM 3816 C CG  . TYR C 1 44  ? 11.620  -34.378 -32.015 1.00 6.90   ? 328 TYR C CG  1 
ATOM 3817 C CD1 . TYR C 1 44  ? 12.984  -34.509 -31.725 1.00 8.08   ? 328 TYR C CD1 1 
ATOM 3818 C CD2 . TYR C 1 44  ? 11.170  -33.176 -32.550 1.00 4.08   ? 328 TYR C CD2 1 
ATOM 3819 C CE1 . TYR C 1 44  ? 13.876  -33.464 -31.957 1.00 9.81   ? 328 TYR C CE1 1 
ATOM 3820 C CE2 . TYR C 1 44  ? 12.046  -32.121 -32.787 1.00 10.55  ? 328 TYR C CE2 1 
ATOM 3821 C CZ  . TYR C 1 44  ? 13.400  -32.265 -32.485 1.00 13.68  ? 328 TYR C CZ  1 
ATOM 3822 O OH  . TYR C 1 44  ? 14.257  -31.196 -32.673 1.00 13.52  ? 328 TYR C OH  1 
ATOM 3823 N N   . PHE C 1 45  ? 11.275  -34.201 -28.670 1.00 11.61  ? 329 PHE C N   1 
ATOM 3824 C CA  . PHE C 1 45  ? 11.134  -33.041 -27.805 1.00 8.51   ? 329 PHE C CA  1 
ATOM 3825 C C   . PHE C 1 45  ? 12.229  -32.036 -28.062 1.00 7.49   ? 329 PHE C C   1 
ATOM 3826 O O   . PHE C 1 45  ? 13.339  -32.383 -28.463 1.00 7.11   ? 329 PHE C O   1 
ATOM 3827 C CB  . PHE C 1 45  ? 11.246  -33.418 -26.330 1.00 8.60   ? 329 PHE C CB  1 
ATOM 3828 C CG  . PHE C 1 45  ? 10.118  -34.245 -25.812 1.00 12.18  ? 329 PHE C CG  1 
ATOM 3829 C CD1 . PHE C 1 45  ? 10.088  -35.621 -26.028 1.00 16.94  ? 329 PHE C CD1 1 
ATOM 3830 C CD2 . PHE C 1 45  ? 9.108   -33.657 -25.056 1.00 10.38  ? 329 PHE C CD2 1 
ATOM 3831 C CE1 . PHE C 1 45  ? 9.066   -36.408 -25.494 1.00 17.20  ? 329 PHE C CE1 1 
ATOM 3832 C CE2 . PHE C 1 45  ? 8.088   -34.421 -24.519 1.00 11.50  ? 329 PHE C CE2 1 
ATOM 3833 C CZ  . PHE C 1 45  ? 8.064   -35.804 -24.735 1.00 17.49  ? 329 PHE C CZ  1 
ATOM 3834 N N   . GLU C 1 46  ? 11.900  -30.783 -27.809 1.00 5.97   ? 330 GLU C N   1 
ATOM 3835 C CA  . GLU C 1 46  ? 12.849  -29.699 -27.914 1.00 4.98   ? 330 GLU C CA  1 
ATOM 3836 C C   . GLU C 1 46  ? 12.723  -29.107 -26.522 1.00 8.02   ? 330 GLU C C   1 
ATOM 3837 O O   . GLU C 1 46  ? 11.659  -28.630 -26.135 1.00 6.45   ? 330 GLU C O   1 
ATOM 3838 C CB  . GLU C 1 46  ? 12.436  -28.739 -29.028 1.00 4.56   ? 330 GLU C CB  1 
ATOM 3839 C CG  . GLU C 1 46  ? 13.182  -29.055 -30.330 1.00 10.57  ? 330 GLU C CG  1 
ATOM 3840 C CD  . GLU C 1 46  ? 12.594  -28.403 -31.574 1.00 13.67  ? 330 GLU C CD  1 
ATOM 3841 O OE1 . GLU C 1 46  ? 12.141  -27.243 -31.482 1.00 12.62  ? 330 GLU C OE1 1 
ATOM 3842 O OE2 . GLU C 1 46  ? 12.608  -29.052 -32.653 1.00 11.28  ? 330 GLU C OE2 1 
ATOM 3843 N N   . MET C 1 47  ? 13.799  -29.197 -25.744 1.00 12.35  ? 331 MET C N   1 
ATOM 3844 C CA  . MET C 1 47  ? 13.788  -28.718 -24.362 1.00 14.60  ? 331 MET C CA  1 
ATOM 3845 C C   . MET C 1 47  ? 12.651  -29.419 -23.629 1.00 17.02  ? 331 MET C C   1 
ATOM 3846 O O   . MET C 1 47  ? 12.661  -30.645 -23.490 1.00 19.10  ? 331 MET C O   1 
ATOM 3847 C CB  . MET C 1 47  ? 13.594  -27.203 -24.299 1.00 13.67  ? 331 MET C CB  1 
ATOM 3848 C CG  . MET C 1 47  ? 14.755  -26.411 -24.873 1.00 14.89  ? 331 MET C CG  1 
ATOM 3849 S SD  . MET C 1 47  ? 16.323  -26.761 -24.057 1.00 16.06  ? 331 MET C SD  1 
ATOM 3850 C CE  . MET C 1 47  ? 16.261  -25.611 -22.744 1.00 13.30  ? 331 MET C CE  1 
ATOM 3851 N N   . ASP C 1 48  ? 11.662  -28.658 -23.173 1.00 18.65  ? 332 ASP C N   1 
ATOM 3852 C CA  . ASP C 1 48  ? 10.537  -29.261 -22.462 1.00 20.72  ? 332 ASP C CA  1 
ATOM 3853 C C   . ASP C 1 48  ? 9.254   -29.208 -23.293 1.00 20.50  ? 332 ASP C C   1 
ATOM 3854 O O   . ASP C 1 48  ? 8.144   -29.117 -22.754 1.00 20.43  ? 332 ASP C O   1 
ATOM 3855 C CB  . ASP C 1 48  ? 10.337  -28.574 -21.100 1.00 21.64  ? 332 ASP C CB  1 
ATOM 3856 C CG  . ASP C 1 48  ? 9.843   -27.146 -21.222 1.00 25.62  ? 332 ASP C CG  1 
ATOM 3857 O OD1 . ASP C 1 48  ? 10.122  -26.494 -22.257 1.00 28.54  ? 332 ASP C OD1 1 
ATOM 3858 O OD2 . ASP C 1 48  ? 9.187   -26.670 -20.265 1.00 25.85  ? 332 ASP C OD2 1 
ATOM 3859 N N   . VAL C 1 49  ? 9.419   -29.288 -24.611 1.00 16.57  ? 333 VAL C N   1 
ATOM 3860 C CA  . VAL C 1 49  ? 8.294   -29.239 -25.532 1.00 12.38  ? 333 VAL C CA  1 
ATOM 3861 C C   . VAL C 1 49  ? 8.345   -30.400 -26.506 1.00 11.81  ? 333 VAL C C   1 
ATOM 3862 O O   . VAL C 1 49  ? 9.425   -30.788 -26.948 1.00 11.63  ? 333 VAL C O   1 
ATOM 3863 C CB  . VAL C 1 49  ? 8.321   -27.943 -26.347 1.00 10.48  ? 333 VAL C CB  1 
ATOM 3864 C CG1 . VAL C 1 49  ? 7.161   -27.914 -27.316 1.00 11.44  ? 333 VAL C CG1 1 
ATOM 3865 C CG2 . VAL C 1 49  ? 8.288   -26.749 -25.418 1.00 11.28  ? 333 VAL C CG2 1 
ATOM 3866 N N   . GLN C 1 50  ? 7.186   -30.963 -26.838 1.00 12.74  ? 334 GLN C N   1 
ATOM 3867 C CA  . GLN C 1 50  ? 7.168   -32.061 -27.795 1.00 14.43  ? 334 GLN C CA  1 
ATOM 3868 C C   . GLN C 1 50  ? 6.793   -31.560 -29.178 1.00 14.69  ? 334 GLN C C   1 
ATOM 3869 O O   . GLN C 1 50  ? 5.672   -31.135 -29.415 1.00 18.11  ? 334 GLN C O   1 
ATOM 3870 C CB  . GLN C 1 50  ? 6.191   -33.166 -27.412 1.00 11.24  ? 334 GLN C CB  1 
ATOM 3871 C CG  . GLN C 1 50  ? 6.313   -34.327 -28.386 1.00 10.87  ? 334 GLN C CG  1 
ATOM 3872 C CD  . GLN C 1 50  ? 5.086   -35.186 -28.457 1.00 13.69  ? 334 GLN C CD  1 
ATOM 3873 O OE1 . GLN C 1 50  ? 4.988   -36.080 -29.297 1.00 18.40  ? 334 GLN C OE1 1 
ATOM 3874 N NE2 . GLN C 1 50  ? 4.134   -34.926 -27.578 1.00 17.29  ? 334 GLN C NE2 1 
ATOM 3875 N N   . VAL C 1 51  ? 7.745   -31.626 -30.091 1.00 12.87  ? 335 VAL C N   1 
ATOM 3876 C CA  . VAL C 1 51  ? 7.531   -31.176 -31.441 1.00 12.39  ? 335 VAL C CA  1 
ATOM 3877 C C   . VAL C 1 51  ? 7.157   -32.373 -32.292 1.00 15.10  ? 335 VAL C C   1 
ATOM 3878 O O   . VAL C 1 51  ? 7.805   -33.414 -32.224 1.00 16.26  ? 335 VAL C O   1 
ATOM 3879 C CB  . VAL C 1 51  ? 8.811   -30.520 -31.987 1.00 13.51  ? 335 VAL C CB  1 
ATOM 3880 C CG1 . VAL C 1 51  ? 8.628   -30.113 -33.445 1.00 14.47  ? 335 VAL C CG1 1 
ATOM 3881 C CG2 . VAL C 1 51  ? 9.161   -29.307 -31.130 1.00 14.61  ? 335 VAL C CG2 1 
ATOM 3882 N N   . GLY C 1 52  ? 6.098   -32.224 -33.082 1.00 15.76  ? 336 GLY C N   1 
ATOM 3883 C CA  . GLY C 1 52  ? 5.658   -33.302 -33.946 1.00 14.38  ? 336 GLY C CA  1 
ATOM 3884 C C   . GLY C 1 52  ? 4.823   -34.345 -33.236 1.00 14.56  ? 336 GLY C C   1 
ATOM 3885 O O   . GLY C 1 52  ? 4.675   -34.307 -32.014 1.00 17.13  ? 336 GLY C O   1 
ATOM 3886 N N   . GLU C 1 53  ? 4.276   -35.282 -34.004 1.00 13.44  ? 337 GLU C N   1 
ATOM 3887 C CA  . GLU C 1 53  ? 3.452   -36.337 -33.433 1.00 12.49  ? 337 GLU C CA  1 
ATOM 3888 C C   . GLU C 1 53  ? 4.309   -37.520 -33.051 1.00 10.56  ? 337 GLU C C   1 
ATOM 3889 O O   . GLU C 1 53  ? 5.430   -37.659 -33.519 1.00 13.87  ? 337 GLU C O   1 
ATOM 3890 C CB  . GLU C 1 53  ? 2.392   -36.791 -34.432 1.00 14.81  ? 337 GLU C CB  1 
ATOM 3891 C CG  . GLU C 1 53  ? 1.410   -35.712 -34.827 0.50 16.37  ? 337 GLU C CG  1 
ATOM 3892 C CD  . GLU C 1 53  ? 0.106   -36.288 -35.333 0.50 16.98  ? 337 GLU C CD  1 
ATOM 3893 O OE1 . GLU C 1 53  ? 0.135   -37.065 -36.317 0.50 13.89  ? 337 GLU C OE1 1 
ATOM 3894 O OE2 . GLU C 1 53  ? -0.944  -35.961 -34.737 0.50 17.10  ? 337 GLU C OE2 1 
ATOM 3895 N N   . THR C 1 54  ? 3.773   -38.381 -32.202 1.00 7.31   ? 338 THR C N   1 
ATOM 3896 C CA  . THR C 1 54  ? 4.506   -39.560 -31.770 1.00 6.44   ? 338 THR C CA  1 
ATOM 3897 C C   . THR C 1 54  ? 4.616   -40.562 -32.919 1.00 4.75   ? 338 THR C C   1 
ATOM 3898 O O   . THR C 1 54  ? 3.609   -41.071 -33.404 1.00 6.94   ? 338 THR C O   1 
ATOM 3899 C CB  . THR C 1 54  ? 3.802   -40.217 -30.560 1.00 7.96   ? 338 THR C CB  1 
ATOM 3900 O OG1 . THR C 1 54  ? 3.819   -39.304 -29.455 1.00 7.94   ? 338 THR C OG1 1 
ATOM 3901 C CG2 . THR C 1 54  ? 4.484   -41.522 -30.171 1.00 3.87   ? 338 THR C CG2 1 
ATOM 3902 N N   . PHE C 1 55  ? 5.846   -40.833 -33.345 1.00 2.82   ? 339 PHE C N   1 
ATOM 3903 C CA  . PHE C 1 55  ? 6.129   -41.771 -34.432 1.00 2.16   ? 339 PHE C CA  1 
ATOM 3904 C C   . PHE C 1 55  ? 6.061   -43.207 -33.921 1.00 2.16   ? 339 PHE C C   1 
ATOM 3905 O O   . PHE C 1 55  ? 6.812   -43.578 -33.024 1.00 2.16   ? 339 PHE C O   1 
ATOM 3906 C CB  . PHE C 1 55  ? 7.531   -41.496 -34.978 1.00 3.26   ? 339 PHE C CB  1 
ATOM 3907 C CG  . PHE C 1 55  ? 7.865   -42.239 -36.247 1.00 3.40   ? 339 PHE C CG  1 
ATOM 3908 C CD1 . PHE C 1 55  ? 7.832   -41.585 -37.480 1.00 2.16   ? 339 PHE C CD1 1 
ATOM 3909 C CD2 . PHE C 1 55  ? 8.232   -43.587 -36.212 1.00 2.65   ? 339 PHE C CD2 1 
ATOM 3910 C CE1 . PHE C 1 55  ? 8.162   -42.258 -38.659 1.00 2.16   ? 339 PHE C CE1 1 
ATOM 3911 C CE2 . PHE C 1 55  ? 8.561   -44.270 -37.385 1.00 2.25   ? 339 PHE C CE2 1 
ATOM 3912 C CZ  . PHE C 1 55  ? 8.526   -43.602 -38.612 1.00 2.63   ? 339 PHE C CZ  1 
ATOM 3913 N N   . LYS C 1 56  ? 5.163   -44.011 -34.484 1.00 4.20   ? 340 LYS C N   1 
ATOM 3914 C CA  . LYS C 1 56  ? 5.030   -45.406 -34.072 1.00 7.55   ? 340 LYS C CA  1 
ATOM 3915 C C   . LYS C 1 56  ? 5.672   -46.333 -35.094 1.00 9.21   ? 340 LYS C C   1 
ATOM 3916 O O   . LYS C 1 56  ? 5.387   -46.247 -36.289 1.00 8.48   ? 340 LYS C O   1 
ATOM 3917 C CB  . LYS C 1 56  ? 3.555   -45.769 -33.873 1.00 6.79   ? 340 LYS C CB  1 
ATOM 3918 C CG  . LYS C 1 56  ? 2.964   -45.159 -32.612 1.00 11.16  ? 340 LYS C CG  1 
ATOM 3919 C CD  . LYS C 1 56  ? 1.506   -45.547 -32.391 1.00 14.88  ? 340 LYS C CD  1 
ATOM 3920 C CE  . LYS C 1 56  ? 0.582   -44.938 -33.447 1.00 17.19  ? 340 LYS C CE  1 
ATOM 3921 N NZ  . LYS C 1 56  ? -0.887  -45.132 -33.171 1.00 16.16  ? 340 LYS C NZ  1 
ATOM 3922 N N   . VAL C 1 57  ? 6.538   -47.224 -34.619 1.00 12.81  ? 341 VAL C N   1 
ATOM 3923 C CA  . VAL C 1 57  ? 7.243   -48.151 -35.505 1.00 17.00  ? 341 VAL C CA  1 
ATOM 3924 C C   . VAL C 1 57  ? 6.660   -49.564 -35.583 1.00 19.40  ? 341 VAL C C   1 
ATOM 3925 O O   . VAL C 1 57  ? 6.595   -50.282 -34.588 1.00 20.89  ? 341 VAL C O   1 
ATOM 3926 C CB  . VAL C 1 57  ? 8.716   -48.278 -35.094 1.00 15.65  ? 341 VAL C CB  1 
ATOM 3927 C CG1 . VAL C 1 57  ? 9.526   -48.872 -36.254 1.00 14.21  ? 341 VAL C CG1 1 
ATOM 3928 C CG2 . VAL C 1 57  ? 9.245   -46.915 -34.648 1.00 11.04  ? 341 VAL C CG2 1 
ATOM 3929 N N   . PRO C 1 58  ? 6.227   -49.981 -36.780 1.00 20.95  ? 342 PRO C N   1 
ATOM 3930 C CA  . PRO C 1 58  ? 5.657   -51.318 -36.955 1.00 22.30  ? 342 PRO C CA  1 
ATOM 3931 C C   . PRO C 1 58  ? 6.667   -52.377 -36.558 1.00 23.90  ? 342 PRO C C   1 
ATOM 3932 O O   . PRO C 1 58  ? 7.870   -52.178 -36.721 1.00 24.85  ? 342 PRO C O   1 
ATOM 3933 C CB  . PRO C 1 58  ? 5.353   -51.363 -38.445 1.00 19.31  ? 342 PRO C CB  1 
ATOM 3934 C CG  . PRO C 1 58  ? 4.998   -49.937 -38.746 1.00 19.33  ? 342 PRO C CG  1 
ATOM 3935 C CD  . PRO C 1 58  ? 6.080   -49.184 -38.011 1.00 20.78  ? 342 PRO C CD  1 
ATOM 3936 N N   . SER C 1 59  ? 6.181   -53.499 -36.037 1.00 25.00  ? 343 SER C N   1 
ATOM 3937 C CA  . SER C 1 59  ? 7.063   -54.589 -35.644 1.00 24.91  ? 343 SER C CA  1 
ATOM 3938 C C   . SER C 1 59  ? 7.751   -55.145 -36.882 1.00 26.14  ? 343 SER C C   1 
ATOM 3939 O O   . SER C 1 59  ? 8.767   -55.826 -36.778 1.00 28.55  ? 343 SER C O   1 
ATOM 3940 C CB  . SER C 1 59  ? 6.277   -55.713 -34.969 1.00 26.55  ? 343 SER C CB  1 
ATOM 3941 O OG  . SER C 1 59  ? 5.667   -55.282 -33.770 1.00 28.21  ? 343 SER C OG  1 
ATOM 3942 N N   . SER C 1 60  ? 7.189   -54.865 -38.054 1.00 26.55  ? 344 SER C N   1 
ATOM 3943 C CA  . SER C 1 60  ? 7.771   -55.343 -39.304 1.00 26.12  ? 344 SER C CA  1 
ATOM 3944 C C   . SER C 1 60  ? 8.996   -54.513 -39.710 1.00 25.30  ? 344 SER C C   1 
ATOM 3945 O O   . SER C 1 60  ? 9.711   -54.864 -40.648 1.00 25.05  ? 344 SER C O   1 
ATOM 3946 C CB  . SER C 1 60  ? 6.725   -55.316 -40.418 1.00 27.12  ? 344 SER C CB  1 
ATOM 3947 O OG  . SER C 1 60  ? 6.225   -54.007 -40.625 1.00 31.45  ? 344 SER C OG  1 
ATOM 3948 N N   . CYS C 1 61  ? 9.229   -53.411 -39.004 1.00 23.69  ? 345 CYS C N   1 
ATOM 3949 C CA  . CYS C 1 61  ? 10.383  -52.555 -39.271 1.00 23.89  ? 345 CYS C CA  1 
ATOM 3950 C C   . CYS C 1 61  ? 11.303  -52.650 -38.067 1.00 21.91  ? 345 CYS C C   1 
ATOM 3951 O O   . CYS C 1 61  ? 11.400  -51.706 -37.289 1.00 22.29  ? 345 CYS C O   1 
ATOM 3952 C CB  . CYS C 1 61  ? 9.962   -51.094 -39.439 1.00 26.40  ? 345 CYS C CB  1 
ATOM 3953 S SG  . CYS C 1 61  ? 8.883   -50.758 -40.833 1.00 29.96  ? 345 CYS C SG  1 
ATOM 3954 N N   . PRO C 1 62  ? 11.985  -53.795 -37.894 1.00 19.77  ? 346 PRO C N   1 
ATOM 3955 C CA  . PRO C 1 62  ? 12.900  -54.015 -36.770 1.00 18.52  ? 346 PRO C CA  1 
ATOM 3956 C C   . PRO C 1 62  ? 13.958  -52.936 -36.565 1.00 18.37  ? 346 PRO C C   1 
ATOM 3957 O O   . PRO C 1 62  ? 14.483  -52.779 -35.466 1.00 23.29  ? 346 PRO C O   1 
ATOM 3958 C CB  . PRO C 1 62  ? 13.497  -55.385 -37.076 1.00 17.01  ? 346 PRO C CB  1 
ATOM 3959 C CG  . PRO C 1 62  ? 13.416  -55.464 -38.562 1.00 18.62  ? 346 PRO C CG  1 
ATOM 3960 C CD  . PRO C 1 62  ? 12.045  -54.928 -38.828 1.00 17.42  ? 346 PRO C CD  1 
ATOM 3961 N N   . ILE C 1 63  ? 14.276  -52.192 -37.613 1.00 14.94  ? 347 ILE C N   1 
ATOM 3962 C CA  . ILE C 1 63  ? 15.258  -51.125 -37.485 1.00 13.52  ? 347 ILE C CA  1 
ATOM 3963 C C   . ILE C 1 63  ? 14.614  -49.831 -37.934 1.00 15.36  ? 347 ILE C C   1 
ATOM 3964 O O   . ILE C 1 63  ? 14.149  -49.726 -39.075 1.00 20.41  ? 347 ILE C O   1 
ATOM 3965 C CB  . ILE C 1 63  ? 16.499  -51.356 -38.385 1.00 12.91  ? 347 ILE C CB  1 
ATOM 3966 C CG1 . ILE C 1 63  ? 17.243  -52.616 -37.962 1.00 9.05   ? 347 ILE C CG1 1 
ATOM 3967 C CG2 . ILE C 1 63  ? 17.434  -50.155 -38.315 1.00 9.69   ? 347 ILE C CG2 1 
ATOM 3968 C CD1 . ILE C 1 63  ? 18.398  -52.927 -38.864 1.00 4.11   ? 347 ILE C CD1 1 
ATOM 3969 N N   . VAL C 1 64  ? 14.567  -48.847 -37.048 1.00 13.23  ? 348 VAL C N   1 
ATOM 3970 C CA  . VAL C 1 64  ? 14.003  -47.561 -37.427 1.00 13.40  ? 348 VAL C CA  1 
ATOM 3971 C C   . VAL C 1 64  ? 15.158  -46.572 -37.452 1.00 13.25  ? 348 VAL C C   1 
ATOM 3972 O O   . VAL C 1 64  ? 16.109  -46.699 -36.687 1.00 12.63  ? 348 VAL C O   1 
ATOM 3973 C CB  . VAL C 1 64  ? 12.920  -47.060 -36.420 1.00 12.81  ? 348 VAL C CB  1 
ATOM 3974 C CG1 . VAL C 1 64  ? 13.550  -46.745 -35.066 1.00 12.22  ? 348 VAL C CG1 1 
ATOM 3975 C CG2 . VAL C 1 64  ? 12.228  -45.819 -36.973 1.00 7.76   ? 348 VAL C CG2 1 
ATOM 3976 N N   . THR C 1 65  ? 15.086  -45.605 -38.351 1.00 13.12  ? 349 THR C N   1 
ATOM 3977 C CA  . THR C 1 65  ? 16.119  -44.593 -38.442 1.00 13.87  ? 349 THR C CA  1 
ATOM 3978 C C   . THR C 1 65  ? 15.541  -43.257 -38.030 1.00 15.90  ? 349 THR C C   1 
ATOM 3979 O O   . THR C 1 65  ? 14.471  -42.861 -38.493 1.00 17.80  ? 349 THR C O   1 
ATOM 3980 C CB  . THR C 1 65  ? 16.654  -44.452 -39.866 1.00 14.00  ? 349 THR C CB  1 
ATOM 3981 O OG1 . THR C 1 65  ? 17.379  -45.634 -40.210 1.00 16.41  ? 349 THR C OG1 1 
ATOM 3982 C CG2 . THR C 1 65  ? 17.563  -43.222 -39.982 1.00 10.46  ? 349 THR C CG2 1 
ATOM 3983 N N   . VAL C 1 66  ? 16.251  -42.566 -37.151 1.00 14.35  ? 350 VAL C N   1 
ATOM 3984 C CA  . VAL C 1 66  ? 15.818  -41.259 -36.698 1.00 11.62  ? 350 VAL C CA  1 
ATOM 3985 C C   . VAL C 1 66  ? 16.943  -40.319 -37.090 1.00 13.10  ? 350 VAL C C   1 
ATOM 3986 O O   . VAL C 1 66  ? 17.987  -40.301 -36.446 1.00 14.55  ? 350 VAL C O   1 
ATOM 3987 C CB  . VAL C 1 66  ? 15.629  -41.246 -35.173 1.00 9.41   ? 350 VAL C CB  1 
ATOM 3988 C CG1 . VAL C 1 66  ? 15.203  -39.856 -34.693 1.00 7.59   ? 350 VAL C CG1 1 
ATOM 3989 C CG2 . VAL C 1 66  ? 14.602  -42.286 -34.792 1.00 6.54   ? 350 VAL C CG2 1 
ATOM 3990 N N   . ASP C 1 67  ? 16.747  -39.566 -38.166 1.00 11.81  ? 351 ASP C N   1 
ATOM 3991 C CA  . ASP C 1 67  ? 17.777  -38.640 -38.611 1.00 12.27  ? 351 ASP C CA  1 
ATOM 3992 C C   . ASP C 1 67  ? 17.240  -37.230 -38.644 1.00 12.38  ? 351 ASP C C   1 
ATOM 3993 O O   . ASP C 1 67  ? 16.101  -36.983 -38.250 1.00 12.78  ? 351 ASP C O   1 
ATOM 3994 C CB  . ASP C 1 67  ? 18.308  -39.023 -39.997 1.00 12.42  ? 351 ASP C CB  1 
ATOM 3995 C CG  . ASP C 1 67  ? 17.237  -38.998 -41.061 1.00 13.81  ? 351 ASP C CG  1 
ATOM 3996 O OD1 . ASP C 1 67  ? 16.432  -38.042 -41.063 1.00 13.34  ? 351 ASP C OD1 1 
ATOM 3997 O OD2 . ASP C 1 67  ? 17.210  -39.926 -41.904 1.00 11.43  ? 351 ASP C OD2 1 
ATOM 3998 N N   . GLY C 1 68  ? 18.065  -36.308 -39.124 1.00 11.41  ? 352 GLY C N   1 
ATOM 3999 C CA  . GLY C 1 68  ? 17.654  -34.920 -39.181 1.00 11.32  ? 352 GLY C CA  1 
ATOM 4000 C C   . GLY C 1 68  ? 17.189  -34.465 -40.546 1.00 12.89  ? 352 GLY C C   1 
ATOM 4001 O O   . GLY C 1 68  ? 17.093  -33.256 -40.781 1.00 13.64  ? 352 GLY C O   1 
ATOM 4002 N N   . TYR C 1 69  ? 16.886  -35.416 -41.436 1.00 12.51  ? 353 TYR C N   1 
ATOM 4003 C CA  . TYR C 1 69  ? 16.442  -35.090 -42.790 1.00 11.60  ? 353 TYR C CA  1 
ATOM 4004 C C   . TYR C 1 69  ? 14.949  -34.815 -42.898 1.00 12.13  ? 353 TYR C C   1 
ATOM 4005 O O   . TYR C 1 69  ? 14.305  -34.539 -41.884 1.00 14.82  ? 353 TYR C O   1 
ATOM 4006 C CB  . TYR C 1 69  ? 16.881  -36.179 -43.759 1.00 12.25  ? 353 TYR C CB  1 
ATOM 4007 C CG  . TYR C 1 69  ? 18.385  -36.281 -43.841 1.00 15.35  ? 353 TYR C CG  1 
ATOM 4008 C CD1 . TYR C 1 69  ? 19.127  -36.782 -42.772 1.00 19.48  ? 353 TYR C CD1 1 
ATOM 4009 C CD2 . TYR C 1 69  ? 19.075  -35.828 -44.957 1.00 16.59  ? 353 TYR C CD2 1 
ATOM 4010 C CE1 . TYR C 1 69  ? 20.522  -36.827 -42.809 1.00 18.72  ? 353 TYR C CE1 1 
ATOM 4011 C CE2 . TYR C 1 69  ? 20.471  -35.866 -45.002 1.00 20.03  ? 353 TYR C CE2 1 
ATOM 4012 C CZ  . TYR C 1 69  ? 21.187  -36.367 -43.924 1.00 19.90  ? 353 TYR C CZ  1 
ATOM 4013 O OH  . TYR C 1 69  ? 22.564  -36.397 -43.959 1.00 20.73  ? 353 TYR C OH  1 
ATOM 4014 N N   . VAL C 1 70  ? 14.379  -34.893 -44.099 1.00 10.20  ? 354 VAL C N   1 
ATOM 4015 C CA  . VAL C 1 70  ? 12.967  -34.538 -44.224 1.00 11.85  ? 354 VAL C CA  1 
ATOM 4016 C C   . VAL C 1 70  ? 11.918  -35.435 -44.894 1.00 14.00  ? 354 VAL C C   1 
ATOM 4017 O O   . VAL C 1 70  ? 10.840  -34.955 -45.246 1.00 15.02  ? 354 VAL C O   1 
ATOM 4018 C CB  . VAL C 1 70  ? 12.845  -33.129 -44.854 1.00 9.60   ? 354 VAL C CB  1 
ATOM 4019 C CG1 . VAL C 1 70  ? 13.647  -32.137 -44.039 1.00 4.93   ? 354 VAL C CG1 1 
ATOM 4020 C CG2 . VAL C 1 70  ? 13.331  -33.142 -46.298 1.00 10.41  ? 354 VAL C CG2 1 
ATOM 4021 N N   . ASP C 1 71  ? 12.185  -36.721 -45.066 1.00 16.02  ? 355 ASP C N   1 
ATOM 4022 C CA  . ASP C 1 71  ? 11.165  -37.557 -45.684 1.00 17.31  ? 355 ASP C CA  1 
ATOM 4023 C C   . ASP C 1 71  ? 10.077  -37.772 -44.644 1.00 17.52  ? 355 ASP C C   1 
ATOM 4024 O O   . ASP C 1 71  ? 10.348  -38.242 -43.541 1.00 17.62  ? 355 ASP C O   1 
ATOM 4025 C CB  . ASP C 1 71  ? 11.733  -38.910 -46.097 1.00 21.18  ? 355 ASP C CB  1 
ATOM 4026 C CG  . ASP C 1 71  ? 10.864  -39.616 -47.117 1.00 22.09  ? 355 ASP C CG  1 
ATOM 4027 O OD1 . ASP C 1 71  ? 9.640   -39.371 -47.129 1.00 21.15  ? 355 ASP C OD1 1 
ATOM 4028 O OD2 . ASP C 1 71  ? 11.408  -40.419 -47.903 1.00 24.06  ? 355 ASP C OD2 1 
ATOM 4029 N N   . PRO C 1 72  ? 8.830   -37.420 -44.973 1.00 19.56  ? 356 PRO C N   1 
ATOM 4030 C CA  . PRO C 1 72  ? 7.735   -37.601 -44.019 1.00 19.40  ? 356 PRO C CA  1 
ATOM 4031 C C   . PRO C 1 72  ? 7.107   -38.989 -44.096 1.00 19.59  ? 356 PRO C C   1 
ATOM 4032 O O   . PRO C 1 72  ? 6.299   -39.354 -43.245 1.00 18.74  ? 356 PRO C O   1 
ATOM 4033 C CB  . PRO C 1 72  ? 6.755   -36.508 -44.425 1.00 19.77  ? 356 PRO C CB  1 
ATOM 4034 C CG  . PRO C 1 72  ? 6.876   -36.522 -45.909 1.00 18.59  ? 356 PRO C CG  1 
ATOM 4035 C CD  . PRO C 1 72  ? 8.388   -36.614 -46.126 1.00 21.78  ? 356 PRO C CD  1 
ATOM 4036 N N   . SER C 1 73  ? 7.503   -39.750 -45.115 1.00 20.31  ? 357 SER C N   1 
ATOM 4037 C CA  . SER C 1 73  ? 6.984   -41.091 -45.379 1.00 21.98  ? 357 SER C CA  1 
ATOM 4038 C C   . SER C 1 73  ? 6.678   -42.007 -44.206 1.00 23.50  ? 357 SER C C   1 
ATOM 4039 O O   . SER C 1 73  ? 5.906   -42.951 -44.360 1.00 28.78  ? 357 SER C O   1 
ATOM 4040 C CB  . SER C 1 73  ? 7.905   -41.834 -46.347 1.00 24.13  ? 357 SER C CB  1 
ATOM 4041 O OG  . SER C 1 73  ? 7.866   -41.255 -47.642 1.00 26.90  ? 357 SER C OG  1 
ATOM 4042 N N   . GLY C 1 74  ? 7.259   -41.762 -43.040 1.00 22.43  ? 358 GLY C N   1 
ATOM 4043 C CA  . GLY C 1 74  ? 6.960   -42.638 -41.923 1.00 23.54  ? 358 GLY C CA  1 
ATOM 4044 C C   . GLY C 1 74  ? 7.345   -44.072 -42.252 1.00 25.40  ? 358 GLY C C   1 
ATOM 4045 O O   . GLY C 1 74  ? 7.955   -44.326 -43.297 1.00 27.97  ? 358 GLY C O   1 
ATOM 4046 N N   . GLY C 1 75  ? 6.997   -45.008 -41.369 1.00 22.29  ? 359 GLY C N   1 
ATOM 4047 C CA  . GLY C 1 75  ? 7.345   -46.405 -41.582 1.00 19.93  ? 359 GLY C CA  1 
ATOM 4048 C C   . GLY C 1 75  ? 8.589   -46.812 -40.801 1.00 18.66  ? 359 GLY C C   1 
ATOM 4049 O O   . GLY C 1 75  ? 8.538   -46.947 -39.584 1.00 20.45  ? 359 GLY C O   1 
ATOM 4050 N N   . ASP C 1 76  ? 9.711   -47.000 -41.493 1.00 18.44  ? 360 ASP C N   1 
ATOM 4051 C CA  . ASP C 1 76  ? 10.959  -47.389 -40.839 1.00 15.93  ? 360 ASP C CA  1 
ATOM 4052 C C   . ASP C 1 76  ? 11.951  -46.238 -40.707 1.00 12.62  ? 360 ASP C C   1 
ATOM 4053 O O   . ASP C 1 76  ? 13.141  -46.462 -40.482 1.00 12.06  ? 360 ASP C O   1 
ATOM 4054 C CB  . ASP C 1 76  ? 11.641  -48.535 -41.597 1.00 17.81  ? 360 ASP C CB  1 
ATOM 4055 C CG  . ASP C 1 76  ? 12.189  -48.106 -42.951 1.00 18.48  ? 360 ASP C CG  1 
ATOM 4056 O OD1 . ASP C 1 76  ? 12.494  -46.909 -43.127 1.00 19.10  ? 360 ASP C OD1 1 
ATOM 4057 O OD2 . ASP C 1 76  ? 12.336  -48.974 -43.837 1.00 20.46  ? 360 ASP C OD2 1 
ATOM 4058 N N   . ARG C 1 77  ? 11.470  -45.012 -40.850 1.00 10.09  ? 361 ARG C N   1 
ATOM 4059 C CA  . ARG C 1 77  ? 12.353  -43.862 -40.742 1.00 10.58  ? 361 ARG C CA  1 
ATOM 4060 C C   . ARG C 1 77  ? 11.626  -42.595 -40.262 1.00 13.08  ? 361 ARG C C   1 
ATOM 4061 O O   . ARG C 1 77  ? 10.664  -42.110 -40.880 1.00 14.80  ? 361 ARG C O   1 
ATOM 4062 C CB  . ARG C 1 77  ? 13.031  -43.621 -42.089 1.00 10.90  ? 361 ARG C CB  1 
ATOM 4063 C CG  . ARG C 1 77  ? 14.158  -42.610 -42.075 1.00 9.45   ? 361 ARG C CG  1 
ATOM 4064 C CD  . ARG C 1 77  ? 14.523  -42.209 -43.501 1.00 4.82   ? 361 ARG C CD  1 
ATOM 4065 N NE  . ARG C 1 77  ? 15.364  -41.019 -43.518 1.00 4.28   ? 361 ARG C NE  1 
ATOM 4066 C CZ  . ARG C 1 77  ? 15.533  -40.240 -44.579 1.00 4.24   ? 361 ARG C CZ  1 
ATOM 4067 N NH1 . ARG C 1 77  ? 14.917  -40.525 -45.715 1.00 2.16   ? 361 ARG C NH1 1 
ATOM 4068 N NH2 . ARG C 1 77  ? 16.316  -39.173 -44.505 1.00 2.16   ? 361 ARG C NH2 1 
ATOM 4069 N N   . PHE C 1 78  ? 12.105  -42.077 -39.137 1.00 9.81   ? 362 PHE C N   1 
ATOM 4070 C CA  . PHE C 1 78  ? 11.566  -40.886 -38.502 1.00 8.25   ? 362 PHE C CA  1 
ATOM 4071 C C   . PHE C 1 78  ? 12.557  -39.738 -38.770 1.00 9.87   ? 362 PHE C C   1 
ATOM 4072 O O   . PHE C 1 78  ? 13.730  -39.789 -38.364 1.00 8.29   ? 362 PHE C O   1 
ATOM 4073 C CB  . PHE C 1 78  ? 11.406  -41.175 -36.990 1.00 7.02   ? 362 PHE C CB  1 
ATOM 4074 C CG  . PHE C 1 78  ? 10.735  -40.073 -36.181 1.00 4.51   ? 362 PHE C CG  1 
ATOM 4075 C CD1 . PHE C 1 78  ? 9.827   -39.192 -36.751 1.00 5.31   ? 362 PHE C CD1 1 
ATOM 4076 C CD2 . PHE C 1 78  ? 10.947  -39.997 -34.807 1.00 5.56   ? 362 PHE C CD2 1 
ATOM 4077 C CE1 . PHE C 1 78  ? 9.140   -38.261 -35.968 1.00 3.71   ? 362 PHE C CE1 1 
ATOM 4078 C CE2 . PHE C 1 78  ? 10.262  -39.066 -34.014 1.00 5.76   ? 362 PHE C CE2 1 
ATOM 4079 C CZ  . PHE C 1 78  ? 9.358   -38.203 -34.599 1.00 4.46   ? 362 PHE C CZ  1 
ATOM 4080 N N   . CYS C 1 79  ? 12.086  -38.727 -39.495 1.00 7.28   ? 363 CYS C N   1 
ATOM 4081 C CA  . CYS C 1 79  ? 12.899  -37.565 -39.808 1.00 6.19   ? 363 CYS C CA  1 
ATOM 4082 C C   . CYS C 1 79  ? 12.369  -36.412 -38.978 1.00 9.24   ? 363 CYS C C   1 
ATOM 4083 O O   . CYS C 1 79  ? 11.167  -36.178 -38.921 1.00 9.84   ? 363 CYS C O   1 
ATOM 4084 C CB  . CYS C 1 79  ? 12.803  -37.210 -41.291 1.00 6.57   ? 363 CYS C CB  1 
ATOM 4085 S SG  . CYS C 1 79  ? 13.410  -38.466 -42.425 1.00 5.74   ? 363 CYS C SG  1 
ATOM 4086 N N   . LEU C 1 80  ? 13.278  -35.693 -38.335 1.00 11.82  ? 364 LEU C N   1 
ATOM 4087 C CA  . LEU C 1 80  ? 12.923  -34.562 -37.489 1.00 12.39  ? 364 LEU C CA  1 
ATOM 4088 C C   . LEU C 1 80  ? 13.190  -33.267 -38.248 1.00 13.57  ? 364 LEU C C   1 
ATOM 4089 O O   . LEU C 1 80  ? 12.923  -32.166 -37.752 1.00 11.39  ? 364 LEU C O   1 
ATOM 4090 C CB  . LEU C 1 80  ? 13.771  -34.610 -36.215 1.00 13.68  ? 364 LEU C CB  1 
ATOM 4091 C CG  . LEU C 1 80  ? 13.532  -35.734 -35.193 1.00 14.89  ? 364 LEU C CG  1 
ATOM 4092 C CD1 . LEU C 1 80  ? 13.028  -37.007 -35.845 1.00 13.90  ? 364 LEU C CD1 1 
ATOM 4093 C CD2 . LEU C 1 80  ? 14.827  -35.988 -34.461 1.00 13.18  ? 364 LEU C CD2 1 
ATOM 4094 N N   . GLY C 1 81  ? 13.710  -33.425 -39.464 1.00 12.97  ? 365 GLY C N   1 
ATOM 4095 C CA  . GLY C 1 81  ? 14.052  -32.291 -40.295 1.00 12.86  ? 365 GLY C CA  1 
ATOM 4096 C C   . GLY C 1 81  ? 12.940  -31.305 -40.560 1.00 14.69  ? 365 GLY C C   1 
ATOM 4097 O O   . GLY C 1 81  ? 13.093  -30.114 -40.270 1.00 13.76  ? 365 GLY C O   1 
ATOM 4098 N N   . GLN C 1 82  ? 11.827  -31.796 -41.109 1.00 13.46  ? 366 GLN C N   1 
ATOM 4099 C CA  . GLN C 1 82  ? 10.690  -30.941 -41.444 1.00 13.65  ? 366 GLN C CA  1 
ATOM 4100 C C   . GLN C 1 82  ? 9.845   -30.393 -40.293 1.00 12.58  ? 366 GLN C C   1 
ATOM 4101 O O   . GLN C 1 82  ? 9.307   -29.291 -40.392 1.00 12.73  ? 366 GLN C O   1 
ATOM 4102 C CB  . GLN C 1 82  ? 9.769   -31.649 -42.445 1.00 16.03  ? 366 GLN C CB  1 
ATOM 4103 C CG  . GLN C 1 82  ? 10.021  -33.129 -42.660 1.00 18.91  ? 366 GLN C CG  1 
ATOM 4104 C CD  . GLN C 1 82  ? 9.713   -33.960 -41.445 1.00 22.03  ? 366 GLN C CD  1 
ATOM 4105 O OE1 . GLN C 1 82  ? 10.576  -34.169 -40.595 1.00 25.37  ? 366 GLN C OE1 1 
ATOM 4106 N NE2 . GLN C 1 82  ? 8.475   -34.435 -41.346 1.00 17.58  ? 366 GLN C NE2 1 
ATOM 4107 N N   . LEU C 1 83  ? 9.726   -31.161 -39.215 1.00 11.80  ? 367 LEU C N   1 
ATOM 4108 C CA  . LEU C 1 83  ? 8.945   -30.765 -38.041 1.00 9.83   ? 367 LEU C CA  1 
ATOM 4109 C C   . LEU C 1 83  ? 9.062   -29.280 -37.675 1.00 9.31   ? 367 LEU C C   1 
ATOM 4110 O O   . LEU C 1 83  ? 10.151  -28.700 -37.674 1.00 6.32   ? 367 LEU C O   1 
ATOM 4111 C CB  . LEU C 1 83  ? 9.350   -31.628 -36.838 1.00 9.66   ? 367 LEU C CB  1 
ATOM 4112 C CG  . LEU C 1 83  ? 9.190   -33.139 -37.031 1.00 8.96   ? 367 LEU C CG  1 
ATOM 4113 C CD1 . LEU C 1 83  ? 9.758   -33.909 -35.860 1.00 11.93  ? 367 LEU C CD1 1 
ATOM 4114 C CD2 . LEU C 1 83  ? 7.733   -33.448 -37.194 1.00 8.69   ? 367 LEU C CD2 1 
ATOM 4115 N N   . SER C 1 84  ? 7.924   -28.678 -37.345 1.00 10.97  ? 368 SER C N   1 
ATOM 4116 C CA  . SER C 1 84  ? 7.868   -27.270 -36.981 1.00 12.23  ? 368 SER C CA  1 
ATOM 4117 C C   . SER C 1 84  ? 7.618   -27.056 -35.496 1.00 13.37  ? 368 SER C C   1 
ATOM 4118 O O   . SER C 1 84  ? 7.044   -27.915 -34.822 1.00 14.98  ? 368 SER C O   1 
ATOM 4119 C CB  . SER C 1 84  ? 6.757   -26.582 -37.766 1.00 14.67  ? 368 SER C CB  1 
ATOM 4120 O OG  . SER C 1 84  ? 6.975   -26.693 -39.160 1.00 21.87  ? 368 SER C OG  1 
ATOM 4121 N N   . ASN C 1 85  ? 8.053   -25.901 -34.998 1.00 13.11  ? 369 ASN C N   1 
ATOM 4122 C CA  . ASN C 1 85  ? 7.852   -25.528 -33.602 1.00 13.00  ? 369 ASN C CA  1 
ATOM 4123 C C   . ASN C 1 85  ? 7.890   -24.014 -33.440 1.00 12.95  ? 369 ASN C C   1 
ATOM 4124 O O   . ASN C 1 85  ? 8.954   -23.400 -33.518 1.00 11.92  ? 369 ASN C O   1 
ATOM 4125 C CB  . ASN C 1 85  ? 8.910   -26.172 -32.703 1.00 11.64  ? 369 ASN C CB  1 
ATOM 4126 C CG  . ASN C 1 85  ? 8.787   -25.733 -31.253 1.00 11.53  ? 369 ASN C CG  1 
ATOM 4127 O OD1 . ASN C 1 85  ? 7.733   -25.256 -30.815 1.00 11.43  ? 369 ASN C OD1 1 
ATOM 4128 N ND2 . ASN C 1 85  ? 9.861   -25.907 -30.495 1.00 7.86   ? 369 ASN C ND2 1 
ATOM 4129 N N   . VAL C 1 86  ? 6.717   -23.421 -33.209 1.00 14.56  ? 370 VAL C N   1 
ATOM 4130 C CA  . VAL C 1 86  ? 6.600   -21.970 -33.045 1.00 15.07  ? 370 VAL C CA  1 
ATOM 4131 C C   . VAL C 1 86  ? 7.433   -21.460 -31.888 1.00 14.38  ? 370 VAL C C   1 
ATOM 4132 O O   . VAL C 1 86  ? 7.744   -20.275 -31.826 1.00 15.38  ? 370 VAL C O   1 
ATOM 4133 C CB  . VAL C 1 86  ? 5.129   -21.517 -32.808 1.00 13.37  ? 370 VAL C CB  1 
ATOM 4134 C CG1 . VAL C 1 86  ? 4.281   -21.860 -34.004 1.00 12.64  ? 370 VAL C CG1 1 
ATOM 4135 C CG2 . VAL C 1 86  ? 4.568   -22.167 -31.549 1.00 13.70  ? 370 VAL C CG2 1 
ATOM 4136 N N   . HIS C 1 87  ? 7.786   -22.354 -30.970 1.00 14.69  ? 371 HIS C N   1 
ATOM 4137 C CA  . HIS C 1 87  ? 8.590   -21.971 -29.815 1.00 17.20  ? 371 HIS C CA  1 
ATOM 4138 C C   . HIS C 1 87  ? 10.087  -22.144 -30.052 1.00 17.51  ? 371 HIS C C   1 
ATOM 4139 O O   . HIS C 1 87  ? 10.896  -21.639 -29.274 1.00 17.22  ? 371 HIS C O   1 
ATOM 4140 C CB  . HIS C 1 87  ? 8.184   -22.783 -28.592 1.00 17.49  ? 371 HIS C CB  1 
ATOM 4141 C CG  . HIS C 1 87  ? 6.744   -22.635 -28.228 1.00 18.78  ? 371 HIS C CG  1 
ATOM 4142 N ND1 . HIS C 1 87  ? 6.129   -21.407 -28.126 1.00 17.53  ? 371 HIS C ND1 1 
ATOM 4143 C CD2 . HIS C 1 87  ? 5.795   -23.559 -27.950 1.00 18.54  ? 371 HIS C CD2 1 
ATOM 4144 C CE1 . HIS C 1 87  ? 4.860   -21.581 -27.803 1.00 18.28  ? 371 HIS C CE1 1 
ATOM 4145 N NE2 . HIS C 1 87  ? 4.632   -22.877 -27.691 1.00 17.92  ? 371 HIS C NE2 1 
ATOM 4146 N N   . ARG C 1 88  ? 10.446  -22.852 -31.123 1.00 15.77  ? 372 ARG C N   1 
ATOM 4147 C CA  . ARG C 1 88  ? 11.845  -23.095 -31.468 1.00 15.38  ? 372 ARG C CA  1 
ATOM 4148 C C   . ARG C 1 88  ? 12.719  -21.849 -31.359 1.00 17.36  ? 372 ARG C C   1 
ATOM 4149 O O   . ARG C 1 88  ? 12.251  -20.721 -31.541 1.00 17.37  ? 372 ARG C O   1 
ATOM 4150 C CB  . ARG C 1 88  ? 11.940  -23.661 -32.882 1.00 13.11  ? 372 ARG C CB  1 
ATOM 4151 C CG  . ARG C 1 88  ? 13.337  -24.058 -33.308 1.00 9.91   ? 372 ARG C CG  1 
ATOM 4152 C CD  . ARG C 1 88  ? 13.247  -24.909 -34.558 1.00 10.41  ? 372 ARG C CD  1 
ATOM 4153 N NE  . ARG C 1 88  ? 12.513  -26.148 -34.313 1.00 7.70   ? 372 ARG C NE  1 
ATOM 4154 C CZ  . ARG C 1 88  ? 11.910  -26.859 -35.261 1.00 8.32   ? 372 ARG C CZ  1 
ATOM 4155 N NH1 . ARG C 1 88  ? 11.945  -26.459 -36.523 1.00 7.40   ? 372 ARG C NH1 1 
ATOM 4156 N NH2 . ARG C 1 88  ? 11.273  -27.976 -34.948 1.00 9.08   ? 372 ARG C NH2 1 
ATOM 4157 N N   . THR C 1 89  ? 13.996  -22.060 -31.058 1.00 17.47  ? 373 THR C N   1 
ATOM 4158 C CA  . THR C 1 89  ? 14.921  -20.953 -30.916 1.00 17.05  ? 373 THR C CA  1 
ATOM 4159 C C   . THR C 1 89  ? 16.163  -21.186 -31.748 1.00 22.64  ? 373 THR C C   1 
ATOM 4160 O O   . THR C 1 89  ? 16.364  -22.263 -32.310 1.00 22.84  ? 373 THR C O   1 
ATOM 4161 C CB  . THR C 1 89  ? 15.383  -20.780 -29.475 1.00 11.51  ? 373 THR C CB  1 
ATOM 4162 O OG1 . THR C 1 89  ? 16.445  -21.697 -29.213 1.00 13.80  ? 373 THR C OG1 1 
ATOM 4163 C CG2 . THR C 1 89  ? 14.263  -21.054 -28.522 1.00 9.14   ? 373 THR C CG2 1 
ATOM 4164 N N   . GLU C 1 90  ? 17.004  -20.162 -31.805 1.00 28.00  ? 374 GLU C N   1 
ATOM 4165 C CA  . GLU C 1 90  ? 18.235  -20.226 -32.560 1.00 30.97  ? 374 GLU C CA  1 
ATOM 4166 C C   . GLU C 1 90  ? 19.151  -21.318 -31.996 1.00 28.51  ? 374 GLU C C   1 
ATOM 4167 O O   . GLU C 1 90  ? 19.859  -21.990 -32.746 1.00 29.11  ? 374 GLU C O   1 
ATOM 4168 C CB  . GLU C 1 90  ? 18.929  -18.867 -32.517 1.00 37.62  ? 374 GLU C CB  1 
ATOM 4169 C CG  . GLU C 1 90  ? 19.784  -18.590 -33.738 1.00 48.54  ? 374 GLU C CG  1 
ATOM 4170 C CD  . GLU C 1 90  ? 20.553  -17.292 -33.619 1.00 55.88  ? 374 GLU C CD  1 
ATOM 4171 O OE1 . GLU C 1 90  ? 21.422  -17.209 -32.720 1.00 60.25  ? 374 GLU C OE1 1 
ATOM 4172 O OE2 . GLU C 1 90  ? 20.289  -16.360 -34.416 1.00 56.51  ? 374 GLU C OE2 1 
ATOM 4173 N N   . ALA C 1 91  ? 19.140  -21.503 -30.679 1.00 23.37  ? 375 ALA C N   1 
ATOM 4174 C CA  . ALA C 1 91  ? 19.974  -22.535 -30.080 1.00 21.43  ? 375 ALA C CA  1 
ATOM 4175 C C   . ALA C 1 91  ? 19.527  -23.905 -30.583 1.00 23.55  ? 375 ALA C C   1 
ATOM 4176 O O   . ALA C 1 91  ? 20.358  -24.701 -31.033 1.00 24.71  ? 375 ALA C O   1 
ATOM 4177 C CB  . ALA C 1 91  ? 19.885  -22.475 -28.576 1.00 18.83  ? 375 ALA C CB  1 
ATOM 4178 N N   . ILE C 1 92  ? 18.219  -24.177 -30.513 1.00 23.19  ? 376 ILE C N   1 
ATOM 4179 C CA  . ILE C 1 92  ? 17.661  -25.453 -30.983 1.00 22.47  ? 376 ILE C CA  1 
ATOM 4180 C C   . ILE C 1 92  ? 17.962  -25.639 -32.478 1.00 24.58  ? 376 ILE C C   1 
ATOM 4181 O O   . ILE C 1 92  ? 18.207  -26.754 -32.937 1.00 24.36  ? 376 ILE C O   1 
ATOM 4182 C CB  . ILE C 1 92  ? 16.106  -25.533 -30.789 1.00 20.26  ? 376 ILE C CB  1 
ATOM 4183 C CG1 . ILE C 1 92  ? 15.742  -25.639 -29.311 1.00 16.81  ? 376 ILE C CG1 1 
ATOM 4184 C CG2 . ILE C 1 92  ? 15.548  -26.747 -31.504 1.00 19.77  ? 376 ILE C CG2 1 
ATOM 4185 C CD1 . ILE C 1 92  ? 15.918  -24.366 -28.541 1.00 15.09  ? 376 ILE C CD1 1 
ATOM 4186 N N   . GLU C 1 93  ? 17.930  -24.541 -33.232 1.00 26.66  ? 377 GLU C N   1 
ATOM 4187 C CA  . GLU C 1 93  ? 18.207  -24.580 -34.668 1.00 27.84  ? 377 GLU C CA  1 
ATOM 4188 C C   . GLU C 1 93  ? 19.663  -24.951 -34.937 1.00 25.73  ? 377 GLU C C   1 
ATOM 4189 O O   . GLU C 1 93  ? 19.970  -25.680 -35.878 1.00 22.29  ? 377 GLU C O   1 
ATOM 4190 C CB  . GLU C 1 93  ? 17.889  -23.225 -35.310 1.00 32.22  ? 377 GLU C CB  1 
ATOM 4191 C CG  . GLU C 1 93  ? 16.403  -22.936 -35.471 1.00 38.05  ? 377 GLU C CG  1 
ATOM 4192 C CD  . GLU C 1 93  ? 16.129  -21.771 -36.413 1.00 42.60  ? 377 GLU C CD  1 
ATOM 4193 O OE1 . GLU C 1 93  ? 14.965  -21.608 -36.840 1.00 46.10  ? 377 GLU C OE1 1 
ATOM 4194 O OE2 . GLU C 1 93  ? 17.075  -21.017 -36.728 1.00 44.47  ? 377 GLU C OE2 1 
ATOM 4195 N N   . ARG C 1 94  ? 20.564  -24.436 -34.112 1.00 24.17  ? 378 ARG C N   1 
ATOM 4196 C CA  . ARG C 1 94  ? 21.961  -24.761 -34.273 1.00 24.75  ? 378 ARG C CA  1 
ATOM 4197 C C   . ARG C 1 94  ? 22.110  -26.245 -34.015 1.00 24.53  ? 378 ARG C C   1 
ATOM 4198 O O   . ARG C 1 94  ? 22.767  -26.957 -34.772 1.00 28.13  ? 378 ARG C O   1 
ATOM 4199 C CB  . ARG C 1 94  ? 22.816  -23.988 -33.274 1.00 27.72  ? 378 ARG C CB  1 
ATOM 4200 C CG  . ARG C 1 94  ? 23.244  -22.612 -33.749 1.00 33.04  ? 378 ARG C CG  1 
ATOM 4201 C CD  . ARG C 1 94  ? 24.333  -22.048 -32.850 1.00 38.95  ? 378 ARG C CD  1 
ATOM 4202 N NE  . ARG C 1 94  ? 23.825  -21.632 -31.545 1.00 42.47  ? 378 ARG C NE  1 
ATOM 4203 C CZ  . ARG C 1 94  ? 23.031  -20.582 -31.356 1.00 42.61  ? 378 ARG C CZ  1 
ATOM 4204 N NH1 . ARG C 1 94  ? 22.650  -19.840 -32.388 1.00 40.68  ? 378 ARG C NH1 1 
ATOM 4205 N NH2 . ARG C 1 94  ? 22.627  -20.267 -30.134 1.00 44.96  ? 378 ARG C NH2 1 
ATOM 4206 N N   . ALA C 1 95  ? 21.473  -26.710 -32.947 1.00 21.41  ? 379 ALA C N   1 
ATOM 4207 C CA  . ALA C 1 95  ? 21.541  -28.113 -32.557 1.00 18.00  ? 379 ALA C CA  1 
ATOM 4208 C C   . ALA C 1 95  ? 20.948  -29.087 -33.564 1.00 16.27  ? 379 ALA C C   1 
ATOM 4209 O O   . ALA C 1 95  ? 21.520  -30.142 -33.797 1.00 17.13  ? 379 ALA C O   1 
ATOM 4210 C CB  . ALA C 1 95  ? 20.877  -28.302 -31.210 1.00 18.40  ? 379 ALA C CB  1 
ATOM 4211 N N   . ARG C 1 96  ? 19.802  -28.748 -34.148 1.00 15.01  ? 380 ARG C N   1 
ATOM 4212 C CA  . ARG C 1 96  ? 19.163  -29.631 -35.121 1.00 13.19  ? 380 ARG C CA  1 
ATOM 4213 C C   . ARG C 1 96  ? 20.090  -29.846 -36.300 1.00 14.05  ? 380 ARG C C   1 
ATOM 4214 O O   . ARG C 1 96  ? 20.116  -30.915 -36.913 1.00 11.24  ? 380 ARG C O   1 
ATOM 4215 C CB  . ARG C 1 96  ? 17.858  -29.022 -35.616 1.00 10.78  ? 380 ARG C CB  1 
ATOM 4216 C CG  . ARG C 1 96  ? 16.761  -28.988 -34.586 1.00 10.93  ? 380 ARG C CG  1 
ATOM 4217 C CD  . ARG C 1 96  ? 15.714  -27.933 -34.936 1.00 13.10  ? 380 ARG C CD  1 
ATOM 4218 N NE  . ARG C 1 96  ? 15.069  -28.141 -36.234 1.00 9.86   ? 380 ARG C NE  1 
ATOM 4219 C CZ  . ARG C 1 96  ? 14.389  -29.236 -36.561 1.00 9.78   ? 380 ARG C CZ  1 
ATOM 4220 N NH1 . ARG C 1 96  ? 14.273  -30.227 -35.688 1.00 9.16   ? 380 ARG C NH1 1 
ATOM 4221 N NH2 . ARG C 1 96  ? 13.799  -29.331 -37.747 1.00 8.74   ? 380 ARG C NH2 1 
ATOM 4222 N N   . LEU C 1 97  ? 20.854  -28.806 -36.601 1.00 16.60  ? 381 LEU C N   1 
ATOM 4223 C CA  . LEU C 1 97  ? 21.799  -28.808 -37.705 1.00 20.47  ? 381 LEU C CA  1 
ATOM 4224 C C   . LEU C 1 97  ? 22.779  -29.977 -37.636 1.00 21.84  ? 381 LEU C C   1 
ATOM 4225 O O   . LEU C 1 97  ? 23.203  -30.501 -38.668 1.00 23.13  ? 381 LEU C O   1 
ATOM 4226 C CB  . LEU C 1 97  ? 22.562  -27.483 -37.693 1.00 24.10  ? 381 LEU C CB  1 
ATOM 4227 C CG  . LEU C 1 97  ? 22.728  -26.691 -38.990 1.00 27.02  ? 381 LEU C CG  1 
ATOM 4228 C CD1 . LEU C 1 97  ? 21.605  -27.008 -39.975 1.00 29.42  ? 381 LEU C CD1 1 
ATOM 4229 C CD2 . LEU C 1 97  ? 22.752  -25.206 -38.644 1.00 24.17  ? 381 LEU C CD2 1 
ATOM 4230 N N   . HIS C 1 98  ? 23.113  -30.391 -36.415 1.00 20.90  ? 382 HIS C N   1 
ATOM 4231 C CA  . HIS C 1 98  ? 24.065  -31.475 -36.176 1.00 20.29  ? 382 HIS C CA  1 
ATOM 4232 C C   . HIS C 1 98  ? 23.521  -32.888 -35.956 1.00 20.34  ? 382 HIS C C   1 
ATOM 4233 O O   . HIS C 1 98  ? 24.293  -33.791 -35.610 1.00 19.07  ? 382 HIS C O   1 
ATOM 4234 C CB  . HIS C 1 98  ? 24.942  -31.116 -34.982 1.00 24.45  ? 382 HIS C CB  1 
ATOM 4235 C CG  . HIS C 1 98  ? 25.766  -29.891 -35.195 1.00 26.79  ? 382 HIS C CG  1 
ATOM 4236 N ND1 . HIS C 1 98  ? 26.781  -29.833 -36.126 1.00 26.16  ? 382 HIS C ND1 1 
ATOM 4237 C CD2 . HIS C 1 98  ? 25.706  -28.666 -34.625 1.00 28.56  ? 382 HIS C CD2 1 
ATOM 4238 C CE1 . HIS C 1 98  ? 27.309  -28.622 -36.122 1.00 26.85  ? 382 HIS C CE1 1 
ATOM 4239 N NE2 . HIS C 1 98  ? 26.674  -27.895 -35.220 1.00 29.18  ? 382 HIS C NE2 1 
ATOM 4240 N N   . ILE C 1 99  ? 22.217  -33.097 -36.135 1.00 19.05  ? 383 ILE C N   1 
ATOM 4241 C CA  . ILE C 1 99  ? 21.676  -34.442 -35.945 1.00 15.65  ? 383 ILE C CA  1 
ATOM 4242 C C   . ILE C 1 99  ? 22.126  -35.342 -37.088 1.00 16.01  ? 383 ILE C C   1 
ATOM 4243 O O   . ILE C 1 99  ? 22.568  -36.465 -36.861 1.00 14.96  ? 383 ILE C O   1 
ATOM 4244 C CB  . ILE C 1 99  ? 20.141  -34.455 -35.876 1.00 12.73  ? 383 ILE C CB  1 
ATOM 4245 C CG1 . ILE C 1 99  ? 19.664  -33.572 -34.717 1.00 9.97   ? 383 ILE C CG1 1 
ATOM 4246 C CG2 . ILE C 1 99  ? 19.659  -35.889 -35.703 1.00 10.80  ? 383 ILE C CG2 1 
ATOM 4247 C CD1 . ILE C 1 99  ? 18.187  -33.640 -34.446 1.00 2.16   ? 383 ILE C CD1 1 
ATOM 4248 N N   . GLY C 1 100 ? 22.019  -34.836 -38.314 1.00 16.07  ? 384 GLY C N   1 
ATOM 4249 C CA  . GLY C 1 100 ? 22.443  -35.598 -39.476 1.00 16.03  ? 384 GLY C CA  1 
ATOM 4250 C C   . GLY C 1 100 ? 21.886  -37.004 -39.554 1.00 16.40  ? 384 GLY C C   1 
ATOM 4251 O O   . GLY C 1 100 ? 20.707  -37.227 -39.275 1.00 18.04  ? 384 GLY C O   1 
ATOM 4252 N N   . LYS C 1 101 ? 22.727  -37.963 -39.922 1.00 15.78  ? 385 LYS C N   1 
ATOM 4253 C CA  . LYS C 1 101 ? 22.265  -39.337 -40.042 1.00 19.22  ? 385 LYS C CA  1 
ATOM 4254 C C   . LYS C 1 101 ? 21.703  -39.920 -38.733 1.00 20.02  ? 385 LYS C C   1 
ATOM 4255 O O   . LYS C 1 101 ? 21.231  -41.068 -38.690 1.00 18.15  ? 385 LYS C O   1 
ATOM 4256 C CB  . LYS C 1 101 ? 23.392  -40.195 -40.614 1.00 20.74  ? 385 LYS C CB  1 
ATOM 4257 C CG  . LYS C 1 101 ? 23.818  -39.706 -41.991 1.00 23.05  ? 385 LYS C CG  1 
ATOM 4258 C CD  . LYS C 1 101 ? 24.746  -40.675 -42.700 1.00 29.64  ? 385 LYS C CD  1 
ATOM 4259 C CE  . LYS C 1 101 ? 25.064  -40.174 -44.106 1.00 34.93  ? 385 LYS C CE  1 
ATOM 4260 N NZ  . LYS C 1 101 ? 25.981  -41.069 -44.879 1.00 35.84  ? 385 LYS C NZ  1 
ATOM 4261 N N   . GLY C 1 102 ? 21.740  -39.103 -37.680 1.00 20.21  ? 386 GLY C N   1 
ATOM 4262 C CA  . GLY C 1 102 ? 21.223  -39.488 -36.375 1.00 17.03  ? 386 GLY C CA  1 
ATOM 4263 C C   . GLY C 1 102 ? 21.577  -40.882 -35.919 1.00 15.00  ? 386 GLY C C   1 
ATOM 4264 O O   . GLY C 1 102 ? 22.740  -41.279 -35.974 1.00 17.10  ? 386 GLY C O   1 
ATOM 4265 N N   . VAL C 1 103 ? 20.581  -41.625 -35.449 1.00 13.61  ? 387 VAL C N   1 
ATOM 4266 C CA  . VAL C 1 103 ? 20.830  -42.985 -34.994 1.00 14.11  ? 387 VAL C CA  1 
ATOM 4267 C C   . VAL C 1 103 ? 19.908  -44.008 -35.629 1.00 15.24  ? 387 VAL C C   1 
ATOM 4268 O O   . VAL C 1 103 ? 19.001  -43.689 -36.408 1.00 16.28  ? 387 VAL C O   1 
ATOM 4269 C CB  . VAL C 1 103 ? 20.688  -43.150 -33.453 1.00 13.55  ? 387 VAL C CB  1 
ATOM 4270 C CG1 . VAL C 1 103 ? 21.496  -42.090 -32.722 1.00 17.79  ? 387 VAL C CG1 1 
ATOM 4271 C CG2 . VAL C 1 103 ? 19.229  -43.108 -33.058 1.00 12.76  ? 387 VAL C CG2 1 
ATOM 4272 N N   . GLN C 1 104 ? 20.154  -45.249 -35.248 1.00 12.78  ? 388 GLN C N   1 
ATOM 4273 C CA  . GLN C 1 104 ? 19.412  -46.383 -35.733 1.00 10.06  ? 388 GLN C CA  1 
ATOM 4274 C C   . GLN C 1 104 ? 19.057  -47.177 -34.482 1.00 10.87  ? 388 GLN C C   1 
ATOM 4275 O O   . GLN C 1 104 ? 19.929  -47.497 -33.679 1.00 9.55   ? 388 GLN C O   1 
ATOM 4276 C CB  . GLN C 1 104 ? 20.325  -47.186 -36.643 1.00 10.54  ? 388 GLN C CB  1 
ATOM 4277 C CG  . GLN C 1 104 ? 19.672  -47.940 -37.761 1.00 13.98  ? 388 GLN C CG  1 
ATOM 4278 C CD  . GLN C 1 104 ? 20.683  -48.288 -38.833 1.00 16.84  ? 388 GLN C CD  1 
ATOM 4279 O OE1 . GLN C 1 104 ? 21.342  -47.401 -39.382 1.00 18.06  ? 388 GLN C OE1 1 
ATOM 4280 N NE2 . GLN C 1 104 ? 20.822  -49.577 -39.134 1.00 16.63  ? 388 GLN C NE2 1 
ATOM 4281 N N   . LEU C 1 105 ? 17.772  -47.457 -34.300 1.00 11.91  ? 389 LEU C N   1 
ATOM 4282 C CA  . LEU C 1 105 ? 17.310  -48.222 -33.155 1.00 9.50   ? 389 LEU C CA  1 
ATOM 4283 C C   . LEU C 1 105 ? 16.866  -49.555 -33.711 1.00 11.84  ? 389 LEU C C   1 
ATOM 4284 O O   . LEU C 1 105 ? 15.900  -49.632 -34.466 1.00 12.06  ? 389 LEU C O   1 
ATOM 4285 C CB  . LEU C 1 105 ? 16.142  -47.511 -32.483 1.00 8.27   ? 389 LEU C CB  1 
ATOM 4286 C CG  . LEU C 1 105 ? 16.443  -46.054 -32.117 1.00 8.05   ? 389 LEU C CG  1 
ATOM 4287 C CD1 . LEU C 1 105 ? 15.226  -45.416 -31.443 1.00 2.16   ? 389 LEU C CD1 1 
ATOM 4288 C CD2 . LEU C 1 105 ? 17.670  -46.007 -31.212 1.00 6.77   ? 389 LEU C CD2 1 
ATOM 4289 N N   . GLU C 1 106 ? 17.594  -50.604 -33.354 1.00 14.39  ? 390 GLU C N   1 
ATOM 4290 C CA  . GLU C 1 106 ? 17.289  -51.933 -33.840 1.00 16.62  ? 390 GLU C CA  1 
ATOM 4291 C C   . GLU C 1 106 ? 16.644  -52.774 -32.761 1.00 17.76  ? 390 GLU C C   1 
ATOM 4292 O O   . GLU C 1 106 ? 16.931  -52.619 -31.577 1.00 17.15  ? 390 GLU C O   1 
ATOM 4293 C CB  . GLU C 1 106 ? 18.563  -52.606 -34.314 1.00 20.12  ? 390 GLU C CB  1 
ATOM 4294 C CG  . GLU C 1 106 ? 18.354  -53.919 -35.023 1.00 24.06  ? 390 GLU C CG  1 
ATOM 4295 C CD  . GLU C 1 106 ? 19.674  -54.514 -35.469 1.00 29.57  ? 390 GLU C CD  1 
ATOM 4296 O OE1 . GLU C 1 106 ? 20.603  -53.724 -35.785 1.00 30.69  ? 390 GLU C OE1 1 
ATOM 4297 O OE2 . GLU C 1 106 ? 19.780  -55.760 -35.510 1.00 28.40  ? 390 GLU C OE2 1 
ATOM 4298 N N   . CYS C 1 107 ? 15.766  -53.669 -33.187 1.00 19.51  ? 391 CYS C N   1 
ATOM 4299 C CA  . CYS C 1 107 ? 15.059  -54.546 -32.273 1.00 21.16  ? 391 CYS C CA  1 
ATOM 4300 C C   . CYS C 1 107 ? 15.400  -55.991 -32.598 1.00 22.21  ? 391 CYS C C   1 
ATOM 4301 O O   . CYS C 1 107 ? 15.022  -56.515 -33.653 1.00 19.95  ? 391 CYS C O   1 
ATOM 4302 C CB  . CYS C 1 107 ? 13.546  -54.331 -32.393 1.00 21.62  ? 391 CYS C CB  1 
ATOM 4303 S SG  . CYS C 1 107 ? 12.539  -55.290 -31.228 1.00 20.17  ? 391 CYS C SG  1 
ATOM 4304 N N   . LYS C 1 108 ? 16.122  -56.623 -31.678 1.00 23.29  ? 392 LYS C N   1 
ATOM 4305 C CA  . LYS C 1 108 ? 16.527  -58.011 -31.827 1.00 24.51  ? 392 LYS C CA  1 
ATOM 4306 C C   . LYS C 1 108 ? 15.711  -58.898 -30.885 1.00 23.95  ? 392 LYS C C   1 
ATOM 4307 O O   . LYS C 1 108 ? 15.467  -58.539 -29.729 1.00 24.72  ? 392 LYS C O   1 
ATOM 4308 C CB  . LYS C 1 108 ? 18.017  -58.142 -31.519 1.00 25.35  ? 392 LYS C CB  1 
ATOM 4309 C CG  . LYS C 1 108 ? 18.885  -57.257 -32.390 1.00 29.95  ? 392 LYS C CG  1 
ATOM 4310 C CD  . LYS C 1 108 ? 20.347  -57.339 -32.000 1.00 32.39  ? 392 LYS C CD  1 
ATOM 4311 C CE  . LYS C 1 108 ? 21.204  -56.546 -32.965 1.00 33.16  ? 392 LYS C CE  1 
ATOM 4312 N NZ  . LYS C 1 108 ? 22.661  -56.702 -32.694 1.00 36.01  ? 392 LYS C NZ  1 
ATOM 4313 N N   . GLY C 1 109 ? 15.284  -60.051 -31.390 1.00 21.91  ? 393 GLY C N   1 
ATOM 4314 C CA  . GLY C 1 109 ? 14.507  -60.971 -30.585 1.00 21.18  ? 393 GLY C CA  1 
ATOM 4315 C C   . GLY C 1 109 ? 13.135  -60.459 -30.183 1.00 23.44  ? 393 GLY C C   1 
ATOM 4316 O O   . GLY C 1 109 ? 12.502  -59.686 -30.913 1.00 23.72  ? 393 GLY C O   1 
ATOM 4317 N N   . GLU C 1 110 ? 12.681  -60.893 -29.009 1.00 22.80  ? 394 GLU C N   1 
ATOM 4318 C CA  . GLU C 1 110 ? 11.379  -60.512 -28.485 1.00 20.74  ? 394 GLU C CA  1 
ATOM 4319 C C   . GLU C 1 110 ? 11.311  -59.038 -28.078 1.00 21.97  ? 394 GLU C C   1 
ATOM 4320 O O   . GLU C 1 110 ? 10.269  -58.394 -28.239 1.00 23.57  ? 394 GLU C O   1 
ATOM 4321 C CB  . GLU C 1 110 ? 11.026  -61.414 -27.301 1.00 21.21  ? 394 GLU C CB  1 
ATOM 4322 C CG  . GLU C 1 110 ? 9.676   -61.136 -26.670 1.00 23.50  ? 394 GLU C CG  1 
ATOM 4323 C CD  . GLU C 1 110 ? 9.278   -62.189 -25.651 1.00 26.52  ? 394 GLU C CD  1 
ATOM 4324 O OE1 . GLU C 1 110 ? 10.147  -62.624 -24.863 1.00 29.23  ? 394 GLU C OE1 1 
ATOM 4325 O OE2 . GLU C 1 110 ? 8.090   -62.575 -25.629 1.00 26.00  ? 394 GLU C OE2 1 
ATOM 4326 N N   . GLY C 1 111 ? 12.414  -58.495 -27.564 1.00 19.33  ? 395 GLY C N   1 
ATOM 4327 C CA  . GLY C 1 111 ? 12.390  -57.102 -27.169 1.00 14.67  ? 395 GLY C CA  1 
ATOM 4328 C C   . GLY C 1 111 ? 13.699  -56.427 -26.824 1.00 15.47  ? 395 GLY C C   1 
ATOM 4329 O O   . GLY C 1 111 ? 13.691  -55.438 -26.096 1.00 15.74  ? 395 GLY C O   1 
ATOM 4330 N N   . ASP C 1 112 ? 14.825  -56.937 -27.313 1.00 16.88  ? 396 ASP C N   1 
ATOM 4331 C CA  . ASP C 1 112 ? 16.102  -56.286 -27.016 1.00 17.39  ? 396 ASP C CA  1 
ATOM 4332 C C   . ASP C 1 112 ? 16.311  -55.091 -27.942 1.00 17.11  ? 396 ASP C C   1 
ATOM 4333 O O   . ASP C 1 112 ? 16.070  -55.180 -29.152 1.00 16.62  ? 396 ASP C O   1 
ATOM 4334 C CB  . ASP C 1 112 ? 17.274  -57.245 -27.188 1.00 20.52  ? 396 ASP C CB  1 
ATOM 4335 C CG  . ASP C 1 112 ? 17.218  -58.401 -26.237 1.00 25.68  ? 396 ASP C CG  1 
ATOM 4336 O OD1 . ASP C 1 112 ? 16.819  -58.198 -25.072 1.00 26.97  ? 396 ASP C OD1 1 
ATOM 4337 O OD2 . ASP C 1 112 ? 17.589  -59.515 -26.653 1.00 31.39  ? 396 ASP C OD2 1 
ATOM 4338 N N   . VAL C 1 113 ? 16.762  -53.973 -27.380 1.00 13.16  ? 397 VAL C N   1 
ATOM 4339 C CA  . VAL C 1 113 ? 16.980  -52.796 -28.196 1.00 10.27  ? 397 VAL C CA  1 
ATOM 4340 C C   . VAL C 1 113 ? 18.440  -52.414 -28.332 1.00 12.98  ? 397 VAL C C   1 
ATOM 4341 O O   . VAL C 1 113 ? 19.195  -52.410 -27.355 1.00 12.78  ? 397 VAL C O   1 
ATOM 4342 C CB  . VAL C 1 113 ? 16.225  -51.592 -27.656 1.00 6.15   ? 397 VAL C CB  1 
ATOM 4343 C CG1 . VAL C 1 113 ? 16.392  -50.421 -28.604 1.00 2.16   ? 397 VAL C CG1 1 
ATOM 4344 C CG2 . VAL C 1 113 ? 14.771  -51.935 -27.491 1.00 5.57   ? 397 VAL C CG2 1 
ATOM 4345 N N   . TRP C 1 114 ? 18.825  -52.093 -29.563 1.00 13.31  ? 398 TRP C N   1 
ATOM 4346 C CA  . TRP C 1 114 ? 20.184  -51.679 -29.863 1.00 15.86  ? 398 TRP C CA  1 
ATOM 4347 C C   . TRP C 1 114 ? 20.209  -50.290 -30.479 1.00 17.03  ? 398 TRP C C   1 
ATOM 4348 O O   . TRP C 1 114 ? 19.217  -49.824 -31.044 1.00 18.47  ? 398 TRP C O   1 
ATOM 4349 C CB  . TRP C 1 114 ? 20.842  -52.659 -30.818 1.00 17.00  ? 398 TRP C CB  1 
ATOM 4350 C CG  . TRP C 1 114 ? 21.158  -53.947 -30.191 1.00 18.03  ? 398 TRP C CG  1 
ATOM 4351 C CD1 . TRP C 1 114 ? 20.276  -54.851 -29.675 1.00 16.72  ? 398 TRP C CD1 1 
ATOM 4352 C CD2 . TRP C 1 114 ? 22.459  -54.497 -30.005 1.00 19.71  ? 398 TRP C CD2 1 
ATOM 4353 N NE1 . TRP C 1 114 ? 20.952  -55.938 -29.177 1.00 16.50  ? 398 TRP C NE1 1 
ATOM 4354 C CE2 . TRP C 1 114 ? 22.296  -55.746 -29.368 1.00 18.97  ? 398 TRP C CE2 1 
ATOM 4355 C CE3 . TRP C 1 114 ? 23.752  -54.057 -30.317 1.00 19.78  ? 398 TRP C CE3 1 
ATOM 4356 C CZ2 . TRP C 1 114 ? 23.382  -56.562 -29.035 1.00 19.69  ? 398 TRP C CZ2 1 
ATOM 4357 C CZ3 . TRP C 1 114 ? 24.831  -54.869 -29.984 1.00 19.77  ? 398 TRP C CZ3 1 
ATOM 4358 C CH2 . TRP C 1 114 ? 24.637  -56.108 -29.350 1.00 18.92  ? 398 TRP C CH2 1 
ATOM 4359 N N   . VAL C 1 115 ? 21.360  -49.640 -30.362 1.00 14.77  ? 399 VAL C N   1 
ATOM 4360 C CA  . VAL C 1 115 ? 21.551  -48.303 -30.892 1.00 13.20  ? 399 VAL C CA  1 
ATOM 4361 C C   . VAL C 1 115 ? 22.850  -48.216 -31.690 1.00 15.52  ? 399 VAL C C   1 
ATOM 4362 O O   . VAL C 1 115 ? 23.892  -48.721 -31.260 1.00 17.69  ? 399 VAL C O   1 
ATOM 4363 C CB  . VAL C 1 115 ? 21.602  -47.272 -29.756 1.00 10.60  ? 399 VAL C CB  1 
ATOM 4364 C CG1 . VAL C 1 115 ? 21.911  -45.885 -30.323 1.00 11.90  ? 399 VAL C CG1 1 
ATOM 4365 C CG2 . VAL C 1 115 ? 20.284  -47.279 -28.995 1.00 6.13   ? 399 VAL C CG2 1 
ATOM 4366 N N   . ARG C 1 116 ? 22.782  -47.595 -32.864 1.00 13.89  ? 400 ARG C N   1 
ATOM 4367 C CA  . ARG C 1 116 ? 23.967  -47.431 -33.690 1.00 13.47  ? 400 ARG C CA  1 
ATOM 4368 C C   . ARG C 1 116 ? 24.041  -45.965 -34.047 1.00 11.65  ? 400 ARG C C   1 
ATOM 4369 O O   . ARG C 1 116 ? 23.201  -45.465 -34.791 1.00 11.26  ? 400 ARG C O   1 
ATOM 4370 C CB  . ARG C 1 116 ? 23.884  -48.268 -34.967 1.00 13.65  ? 400 ARG C CB  1 
ATOM 4371 C CG  . ARG C 1 116 ? 25.165  -48.238 -35.795 1.00 13.90  ? 400 ARG C CG  1 
ATOM 4372 C CD  . ARG C 1 116 ? 24.934  -48.806 -37.182 1.00 16.17  ? 400 ARG C CD  1 
ATOM 4373 N NE  . ARG C 1 116 ? 24.453  -50.184 -37.160 1.00 18.77  ? 400 ARG C NE  1 
ATOM 4374 C CZ  . ARG C 1 116 ? 25.216  -51.246 -36.913 1.00 19.87  ? 400 ARG C CZ  1 
ATOM 4375 N NH1 . ARG C 1 116 ? 26.512  -51.096 -36.668 1.00 17.86  ? 400 ARG C NH1 1 
ATOM 4376 N NH2 . ARG C 1 116 ? 24.678  -52.460 -36.909 1.00 19.46  ? 400 ARG C NH2 1 
ATOM 4377 N N   . CYS C 1 117 ? 25.039  -45.277 -33.506 1.00 10.48  ? 401 CYS C N   1 
ATOM 4378 C CA  . CYS C 1 117 ? 25.188  -43.861 -33.773 1.00 11.67  ? 401 CYS C CA  1 
ATOM 4379 C C   . CYS C 1 117 ? 25.756  -43.636 -35.164 1.00 12.04  ? 401 CYS C C   1 
ATOM 4380 O O   . CYS C 1 117 ? 26.883  -44.039 -35.448 1.00 10.09  ? 401 CYS C O   1 
ATOM 4381 C CB  . CYS C 1 117 ? 26.096  -43.217 -32.733 1.00 11.24  ? 401 CYS C CB  1 
ATOM 4382 S SG  . CYS C 1 117 ? 26.054  -41.418 -32.786 1.00 12.24  ? 401 CYS C SG  1 
ATOM 4383 N N   . LEU C 1 118 ? 24.961  -42.998 -36.025 1.00 12.43  ? 402 LEU C N   1 
ATOM 4384 C CA  . LEU C 1 118 ? 25.366  -42.699 -37.395 1.00 10.81  ? 402 LEU C CA  1 
ATOM 4385 C C   . LEU C 1 118 ? 25.757  -41.237 -37.490 1.00 12.02  ? 402 LEU C C   1 
ATOM 4386 O O   . LEU C 1 118 ? 26.496  -40.836 -38.388 1.00 15.36  ? 402 LEU C O   1 
ATOM 4387 C CB  . LEU C 1 118 ? 24.230  -42.975 -38.376 1.00 7.75   ? 402 LEU C CB  1 
ATOM 4388 C CG  . LEU C 1 118 ? 23.574  -44.353 -38.324 1.00 9.72   ? 402 LEU C CG  1 
ATOM 4389 C CD1 . LEU C 1 118 ? 22.525  -44.418 -39.408 1.00 11.41  ? 402 LEU C CD1 1 
ATOM 4390 C CD2 . LEU C 1 118 ? 24.598  -45.454 -38.511 1.00 8.39   ? 402 LEU C CD2 1 
ATOM 4391 N N   . SER C 1 119 ? 25.252  -40.439 -36.557 1.00 12.81  ? 403 SER C N   1 
ATOM 4392 C CA  . SER C 1 119 ? 25.568  -39.023 -36.531 1.00 14.53  ? 403 SER C CA  1 
ATOM 4393 C C   . SER C 1 119 ? 27.070  -38.858 -36.377 1.00 12.65  ? 403 SER C C   1 
ATOM 4394 O O   . SER C 1 119 ? 27.761  -39.782 -35.958 1.00 9.40   ? 403 SER C O   1 
ATOM 4395 C CB  . SER C 1 119 ? 24.860  -38.344 -35.358 1.00 18.98  ? 403 SER C CB  1 
ATOM 4396 O OG  . SER C 1 119 ? 25.202  -36.968 -35.276 1.00 24.85  ? 403 SER C OG  1 
ATOM 4397 N N   . ASP C 1 120 ? 27.569  -37.680 -36.736 1.00 15.06  ? 404 ASP C N   1 
ATOM 4398 C CA  . ASP C 1 120 ? 28.989  -37.381 -36.615 1.00 17.17  ? 404 ASP C CA  1 
ATOM 4399 C C   . ASP C 1 120 ? 29.270  -37.002 -35.183 1.00 19.65  ? 404 ASP C C   1 
ATOM 4400 O O   . ASP C 1 120 ? 30.414  -37.014 -34.755 1.00 20.06  ? 404 ASP C O   1 
ATOM 4401 C CB  . ASP C 1 120 ? 29.371  -36.228 -37.529 1.00 19.92  ? 404 ASP C CB  1 
ATOM 4402 C CG  . ASP C 1 120 ? 29.644  -36.682 -38.939 1.00 26.14  ? 404 ASP C CG  1 
ATOM 4403 O OD1 . ASP C 1 120 ? 29.720  -35.817 -39.841 1.00 26.61  ? 404 ASP C OD1 1 
ATOM 4404 O OD2 . ASP C 1 120 ? 29.794  -37.909 -39.142 1.00 31.37  ? 404 ASP C OD2 1 
ATOM 4405 N N   . HIS C 1 121 ? 28.207  -36.649 -34.461 1.00 21.91  ? 405 HIS C N   1 
ATOM 4406 C CA  . HIS C 1 121 ? 28.287  -36.287 -33.050 1.00 22.69  ? 405 HIS C CA  1 
ATOM 4407 C C   . HIS C 1 121 ? 27.688  -37.431 -32.257 1.00 23.14  ? 405 HIS C C   1 
ATOM 4408 O O   . HIS C 1 121 ? 26.710  -38.045 -32.685 1.00 24.16  ? 405 HIS C O   1 
ATOM 4409 C CB  . HIS C 1 121 ? 27.476  -35.028 -32.748 1.00 25.28  ? 405 HIS C CB  1 
ATOM 4410 C CG  . HIS C 1 121 ? 27.942  -33.815 -33.483 1.00 29.47  ? 405 HIS C CG  1 
ATOM 4411 N ND1 . HIS C 1 121 ? 27.768  -33.655 -34.841 1.00 33.09  ? 405 HIS C ND1 1 
ATOM 4412 C CD2 . HIS C 1 121 ? 28.573  -32.698 -33.049 1.00 30.80  ? 405 HIS C CD2 1 
ATOM 4413 C CE1 . HIS C 1 121 ? 28.271  -32.491 -35.212 1.00 33.91  ? 405 HIS C CE1 1 
ATOM 4414 N NE2 . HIS C 1 121 ? 28.765  -31.891 -34.144 1.00 33.14  ? 405 HIS C NE2 1 
ATOM 4415 N N   . ALA C 1 122 ? 28.262  -37.717 -31.098 1.00 22.97  ? 406 ALA C N   1 
ATOM 4416 C CA  . ALA C 1 122 ? 27.745  -38.794 -30.270 1.00 23.00  ? 406 ALA C CA  1 
ATOM 4417 C C   . ALA C 1 122 ? 26.423  -38.363 -29.656 1.00 21.08  ? 406 ALA C C   1 
ATOM 4418 O O   . ALA C 1 122 ? 26.095  -37.173 -29.639 1.00 20.74  ? 406 ALA C O   1 
ATOM 4419 C CB  . ALA C 1 122 ? 28.746  -39.142 -29.172 1.00 25.97  ? 406 ALA C CB  1 
ATOM 4420 N N   . VAL C 1 123 ? 25.669  -39.340 -29.161 1.00 18.49  ? 407 VAL C N   1 
ATOM 4421 C CA  . VAL C 1 123 ? 24.383  -39.086 -28.524 1.00 16.58  ? 407 VAL C CA  1 
ATOM 4422 C C   . VAL C 1 123 ? 24.437  -39.583 -27.081 1.00 15.66  ? 407 VAL C C   1 
ATOM 4423 O O   . VAL C 1 123 ? 25.297  -40.385 -26.732 1.00 17.70  ? 407 VAL C O   1 
ATOM 4424 C CB  . VAL C 1 123 ? 23.244  -39.790 -29.278 1.00 16.34  ? 407 VAL C CB  1 
ATOM 4425 C CG1 . VAL C 1 123 ? 23.188  -39.283 -30.701 1.00 19.59  ? 407 VAL C CG1 1 
ATOM 4426 C CG2 . VAL C 1 123 ? 23.455  -41.284 -29.272 1.00 15.80  ? 407 VAL C CG2 1 
ATOM 4427 N N   . PHE C 1 124 ? 23.518  -39.110 -26.248 1.00 14.44  ? 408 PHE C N   1 
ATOM 4428 C CA  . PHE C 1 124 ? 23.495  -39.489 -24.840 1.00 13.07  ? 408 PHE C CA  1 
ATOM 4429 C C   . PHE C 1 124 ? 22.230  -40.193 -24.391 1.00 12.51  ? 408 PHE C C   1 
ATOM 4430 O O   . PHE C 1 124 ? 21.219  -39.557 -24.100 1.00 11.40  ? 408 PHE C O   1 
ATOM 4431 C CB  . PHE C 1 124 ? 23.700  -38.252 -23.980 1.00 14.95  ? 408 PHE C CB  1 
ATOM 4432 C CG  . PHE C 1 124 ? 24.946  -37.503 -24.307 1.00 17.71  ? 408 PHE C CG  1 
ATOM 4433 C CD1 . PHE C 1 124 ? 25.100  -36.900 -25.555 1.00 18.23  ? 408 PHE C CD1 1 
ATOM 4434 C CD2 . PHE C 1 124 ? 25.969  -37.398 -23.371 1.00 17.75  ? 408 PHE C CD2 1 
ATOM 4435 C CE1 . PHE C 1 124 ? 26.251  -36.204 -25.869 1.00 19.74  ? 408 PHE C CE1 1 
ATOM 4436 C CE2 . PHE C 1 124 ? 27.127  -36.705 -23.670 1.00 19.80  ? 408 PHE C CE2 1 
ATOM 4437 C CZ  . PHE C 1 124 ? 27.271  -36.104 -24.925 1.00 23.24  ? 408 PHE C CZ  1 
ATOM 4438 N N   . VAL C 1 125 ? 22.307  -41.512 -24.305 1.00 11.64  ? 409 VAL C N   1 
ATOM 4439 C CA  . VAL C 1 125 ? 21.168  -42.317 -23.900 1.00 12.31  ? 409 VAL C CA  1 
ATOM 4440 C C   . VAL C 1 125 ? 20.968  -42.433 -22.389 1.00 14.56  ? 409 VAL C C   1 
ATOM 4441 O O   . VAL C 1 125 ? 21.910  -42.309 -21.604 1.00 17.15  ? 409 VAL C O   1 
ATOM 4442 C CB  . VAL C 1 125 ? 21.293  -43.730 -24.495 1.00 10.01  ? 409 VAL C CB  1 
ATOM 4443 C CG1 . VAL C 1 125 ? 20.312  -44.681 -23.841 1.00 9.01   ? 409 VAL C CG1 1 
ATOM 4444 C CG2 . VAL C 1 125 ? 21.047  -43.667 -25.983 1.00 12.12  ? 409 VAL C CG2 1 
ATOM 4445 N N   . GLN C 1 126 ? 19.716  -42.645 -21.999 1.00 14.37  ? 410 GLN C N   1 
ATOM 4446 C CA  . GLN C 1 126 ? 19.353  -42.845 -20.605 1.00 16.43  ? 410 GLN C CA  1 
ATOM 4447 C C   . GLN C 1 126 ? 18.752  -44.245 -20.639 1.00 18.45  ? 410 GLN C C   1 
ATOM 4448 O O   . GLN C 1 126 ? 17.641  -44.448 -21.135 1.00 16.44  ? 410 GLN C O   1 
ATOM 4449 C CB  . GLN C 1 126 ? 18.312  -41.826 -20.154 1.00 17.70  ? 410 GLN C CB  1 
ATOM 4450 C CG  . GLN C 1 126 ? 17.960  -41.911 -18.683 1.00 21.61  ? 410 GLN C CG  1 
ATOM 4451 C CD  . GLN C 1 126 ? 16.483  -42.171 -18.462 1.00 27.58  ? 410 GLN C CD  1 
ATOM 4452 O OE1 . GLN C 1 126 ? 15.980  -43.271 -18.721 1.00 29.20  ? 410 GLN C OE1 1 
ATOM 4453 N NE2 . GLN C 1 126 ? 15.771  -41.151 -17.992 1.00 32.23  ? 410 GLN C NE2 1 
ATOM 4454 N N   . SER C 1 127 ? 19.513  -45.210 -20.135 1.00 18.79  ? 411 SER C N   1 
ATOM 4455 C CA  . SER C 1 127 ? 19.095  -46.597 -20.142 1.00 19.37  ? 411 SER C CA  1 
ATOM 4456 C C   . SER C 1 127 ? 19.312  -47.268 -18.810 1.00 20.90  ? 411 SER C C   1 
ATOM 4457 O O   . SER C 1 127 ? 20.448  -47.457 -18.380 1.00 21.99  ? 411 SER C O   1 
ATOM 4458 C CB  . SER C 1 127 ? 19.873  -47.361 -21.206 1.00 22.19  ? 411 SER C CB  1 
ATOM 4459 O OG  . SER C 1 127 ? 19.857  -48.753 -20.939 1.00 23.54  ? 411 SER C OG  1 
ATOM 4460 N N   . TYR C 1 128 ? 18.214  -47.650 -18.169 1.00 20.99  ? 412 TYR C N   1 
ATOM 4461 C CA  . TYR C 1 128 ? 18.273  -48.313 -16.877 1.00 17.72  ? 412 TYR C CA  1 
ATOM 4462 C C   . TYR C 1 128 ? 19.104  -49.591 -16.932 1.00 16.11  ? 412 TYR C C   1 
ATOM 4463 O O   . TYR C 1 128 ? 19.682  -50.009 -15.925 1.00 15.92  ? 412 TYR C O   1 
ATOM 4464 C CB  . TYR C 1 128 ? 16.853  -48.603 -16.391 1.00 18.96  ? 412 TYR C CB  1 
ATOM 4465 C CG  . TYR C 1 128 ? 16.213  -47.429 -15.685 1.00 17.77  ? 412 TYR C CG  1 
ATOM 4466 C CD1 . TYR C 1 128 ? 16.500  -47.161 -14.352 1.00 19.26  ? 412 TYR C CD1 1 
ATOM 4467 C CD2 . TYR C 1 128 ? 15.349  -46.571 -16.352 1.00 19.10  ? 412 TYR C CD2 1 
ATOM 4468 C CE1 . TYR C 1 128 ? 15.945  -46.069 -13.698 1.00 17.01  ? 412 TYR C CE1 1 
ATOM 4469 C CE2 . TYR C 1 128 ? 14.789  -45.474 -15.704 1.00 18.22  ? 412 TYR C CE2 1 
ATOM 4470 C CZ  . TYR C 1 128 ? 15.097  -45.235 -14.379 1.00 16.44  ? 412 TYR C CZ  1 
ATOM 4471 O OH  . TYR C 1 128 ? 14.573  -44.154 -13.731 1.00 18.39  ? 412 TYR C OH  1 
ATOM 4472 N N   . TYR C 1 129 ? 19.169  -50.196 -18.115 1.00 15.12  ? 413 TYR C N   1 
ATOM 4473 C CA  . TYR C 1 129 ? 19.943  -51.418 -18.333 1.00 14.99  ? 413 TYR C CA  1 
ATOM 4474 C C   . TYR C 1 129 ? 21.429  -51.086 -18.299 1.00 14.56  ? 413 TYR C C   1 
ATOM 4475 O O   . TYR C 1 129 ? 22.217  -51.755 -17.638 1.00 13.62  ? 413 TYR C O   1 
ATOM 4476 C CB  . TYR C 1 129 ? 19.588  -52.019 -19.689 1.00 16.06  ? 413 TYR C CB  1 
ATOM 4477 C CG  . TYR C 1 129 ? 20.560  -53.055 -20.184 1.00 20.89  ? 413 TYR C CG  1 
ATOM 4478 C CD1 . TYR C 1 129 ? 20.480  -54.380 -19.754 1.00 26.81  ? 413 TYR C CD1 1 
ATOM 4479 C CD2 . TYR C 1 129 ? 21.550  -52.720 -21.111 1.00 23.87  ? 413 TYR C CD2 1 
ATOM 4480 C CE1 . TYR C 1 129 ? 21.364  -55.356 -20.244 1.00 30.14  ? 413 TYR C CE1 1 
ATOM 4481 C CE2 . TYR C 1 129 ? 22.439  -53.678 -21.611 1.00 27.66  ? 413 TYR C CE2 1 
ATOM 4482 C CZ  . TYR C 1 129 ? 22.341  -54.998 -21.177 1.00 31.76  ? 413 TYR C CZ  1 
ATOM 4483 O OH  . TYR C 1 129 ? 23.199  -55.957 -21.686 1.00 30.62  ? 413 TYR C OH  1 
ATOM 4484 N N   . LEU C 1 130 ? 21.810  -50.044 -19.024 1.00 15.78  ? 414 LEU C N   1 
ATOM 4485 C CA  . LEU C 1 130 ? 23.197  -49.631 -19.057 1.00 17.51  ? 414 LEU C CA  1 
ATOM 4486 C C   . LEU C 1 130 ? 23.647  -49.234 -17.663 1.00 20.34  ? 414 LEU C C   1 
ATOM 4487 O O   . LEU C 1 130 ? 24.821  -49.399 -17.326 1.00 22.58  ? 414 LEU C O   1 
ATOM 4488 C CB  . LEU C 1 130 ? 23.379  -48.466 -20.023 1.00 16.91  ? 414 LEU C CB  1 
ATOM 4489 C CG  . LEU C 1 130 ? 23.174  -48.817 -21.493 1.00 14.57  ? 414 LEU C CG  1 
ATOM 4490 C CD1 . LEU C 1 130 ? 23.446  -47.602 -22.346 1.00 14.82  ? 414 LEU C CD1 1 
ATOM 4491 C CD2 . LEU C 1 130 ? 24.102  -49.947 -21.875 1.00 13.53  ? 414 LEU C CD2 1 
ATOM 4492 N N   . ASP C 1 131 ? 22.716  -48.709 -16.861 1.00 21.70  ? 415 ASP C N   1 
ATOM 4493 C CA  . ASP C 1 131 ? 23.018  -48.314 -15.478 1.00 23.70  ? 415 ASP C CA  1 
ATOM 4494 C C   . ASP C 1 131 ? 23.403  -49.569 -14.686 1.00 25.24  ? 415 ASP C C   1 
ATOM 4495 O O   . ASP C 1 131 ? 24.399  -49.585 -13.957 1.00 22.81  ? 415 ASP C O   1 
ATOM 4496 C CB  . ASP C 1 131 ? 21.802  -47.661 -14.794 1.00 24.15  ? 415 ASP C CB  1 
ATOM 4497 C CG  . ASP C 1 131 ? 21.459  -46.287 -15.354 1.00 26.31  ? 415 ASP C CG  1 
ATOM 4498 O OD1 . ASP C 1 131 ? 22.377  -45.519 -15.714 1.00 29.46  ? 415 ASP C OD1 1 
ATOM 4499 O OD2 . ASP C 1 131 ? 20.256  -45.962 -15.412 1.00 26.31  ? 415 ASP C OD2 1 
ATOM 4500 N N   . ARG C 1 132 ? 22.587  -50.612 -14.832 1.00 25.13  ? 416 ARG C N   1 
ATOM 4501 C CA  . ARG C 1 132 ? 22.810  -51.889 -14.162 1.00 26.85  ? 416 ARG C CA  1 
ATOM 4502 C C   . ARG C 1 132 ? 24.195  -52.406 -14.522 1.00 27.44  ? 416 ARG C C   1 
ATOM 4503 O O   . ARG C 1 132 ? 24.970  -52.805 -13.658 1.00 28.61  ? 416 ARG C O   1 
ATOM 4504 C CB  . ARG C 1 132 ? 21.744  -52.891 -14.610 1.00 27.92  ? 416 ARG C CB  1 
ATOM 4505 C CG  . ARG C 1 132 ? 21.943  -54.323 -14.141 1.00 29.19  ? 416 ARG C CG  1 
ATOM 4506 C CD  . ARG C 1 132 ? 21.671  -54.494 -12.656 1.00 29.48  ? 416 ARG C CD  1 
ATOM 4507 N NE  . ARG C 1 132 ? 21.449  -55.902 -12.335 1.00 29.92  ? 416 ARG C NE  1 
ATOM 4508 C CZ  . ARG C 1 132 ? 21.233  -56.372 -11.111 1.00 28.52  ? 416 ARG C CZ  1 
ATOM 4509 N NH1 . ARG C 1 132 ? 21.209  -55.556 -10.070 1.00 20.62  ? 416 ARG C NH1 1 
ATOM 4510 N NH2 . ARG C 1 132 ? 21.025  -57.667 -10.932 1.00 35.40  ? 416 ARG C NH2 1 
ATOM 4511 N N   . GLU C 1 133 ? 24.498  -52.395 -15.811 1.00 26.90  ? 417 GLU C N   1 
ATOM 4512 C CA  . GLU C 1 133 ? 25.788  -52.845 -16.286 1.00 27.28  ? 417 GLU C CA  1 
ATOM 4513 C C   . GLU C 1 133 ? 26.916  -52.024 -15.685 1.00 26.18  ? 417 GLU C C   1 
ATOM 4514 O O   . GLU C 1 133 ? 27.839  -52.580 -15.106 1.00 27.53  ? 417 GLU C O   1 
ATOM 4515 C CB  . GLU C 1 133 ? 25.836  -52.750 -17.802 1.00 31.43  ? 417 GLU C CB  1 
ATOM 4516 C CG  . GLU C 1 133 ? 24.902  -53.729 -18.466 1.00 37.36  ? 417 GLU C CG  1 
ATOM 4517 C CD  . GLU C 1 133 ? 25.307  -55.164 -18.209 1.00 39.86  ? 417 GLU C CD  1 
ATOM 4518 O OE1 . GLU C 1 133 ? 26.295  -55.623 -18.822 1.00 41.73  ? 417 GLU C OE1 1 
ATOM 4519 O OE2 . GLU C 1 133 ? 24.644  -55.827 -17.385 1.00 43.34  ? 417 GLU C OE2 1 
ATOM 4520 N N   . ALA C 1 134 ? 26.832  -50.703 -15.820 1.00 25.77  ? 418 ALA C N   1 
ATOM 4521 C CA  . ALA C 1 134 ? 27.854  -49.792 -15.298 1.00 26.14  ? 418 ALA C CA  1 
ATOM 4522 C C   . ALA C 1 134 ? 27.950  -49.748 -13.767 1.00 26.69  ? 418 ALA C C   1 
ATOM 4523 O O   . ALA C 1 134 ? 28.777  -49.029 -13.208 1.00 26.14  ? 418 ALA C O   1 
ATOM 4524 C CB  . ALA C 1 134 ? 27.613  -48.390 -15.837 1.00 23.90  ? 418 ALA C CB  1 
ATOM 4525 N N   . GLY C 1 135 ? 27.105  -50.514 -13.088 1.00 28.35  ? 419 GLY C N   1 
ATOM 4526 C CA  . GLY C 1 135 ? 27.138  -50.532 -11.635 1.00 27.72  ? 419 GLY C CA  1 
ATOM 4527 C C   . GLY C 1 135 ? 26.868  -49.174 -11.022 1.00 26.00  ? 419 GLY C C   1 
ATOM 4528 O O   . GLY C 1 135 ? 27.542  -48.762 -10.072 1.00 25.43  ? 419 GLY C O   1 
ATOM 4529 N N   . ARG C 1 136 ? 25.883  -48.473 -11.575 1.00 23.86  ? 420 ARG C N   1 
ATOM 4530 C CA  . ARG C 1 136 ? 25.507  -47.161 -11.071 1.00 22.81  ? 420 ARG C CA  1 
ATOM 4531 C C   . ARG C 1 136 ? 24.063  -47.140 -10.611 1.00 21.22  ? 420 ARG C C   1 
ATOM 4532 O O   . ARG C 1 136 ? 23.228  -47.882 -11.126 1.00 19.55  ? 420 ARG C O   1 
ATOM 4533 C CB  . ARG C 1 136 ? 25.703  -46.099 -12.137 1.00 21.26  ? 420 ARG C CB  1 
ATOM 4534 C CG  . ARG C 1 136 ? 27.137  -45.826 -12.465 1.00 21.60  ? 420 ARG C CG  1 
ATOM 4535 C CD  . ARG C 1 136 ? 27.217  -44.576 -13.294 1.00 27.42  ? 420 ARG C CD  1 
ATOM 4536 N NE  . ARG C 1 136 ? 27.523  -43.367 -12.527 1.00 32.96  ? 420 ARG C NE  1 
ATOM 4537 C CZ  . ARG C 1 136 ? 26.962  -43.010 -11.375 1.00 33.46  ? 420 ARG C CZ  1 
ATOM 4538 N NH1 . ARG C 1 136 ? 26.037  -43.770 -10.799 1.00 31.81  ? 420 ARG C NH1 1 
ATOM 4539 N NH2 . ARG C 1 136 ? 27.323  -41.867 -10.807 1.00 33.91  ? 420 ARG C NH2 1 
ATOM 4540 N N   . ALA C 1 137 ? 23.781  -46.279 -9.640  1.00 21.78  ? 421 ALA C N   1 
ATOM 4541 C CA  . ALA C 1 137 ? 22.442  -46.144 -9.077  1.00 21.96  ? 421 ALA C CA  1 
ATOM 4542 C C   . ALA C 1 137 ? 21.393  -46.014 -10.171 1.00 21.72  ? 421 ALA C C   1 
ATOM 4543 O O   . ALA C 1 137 ? 21.521  -45.187 -11.069 1.00 22.20  ? 421 ALA C O   1 
ATOM 4544 C CB  . ALA C 1 137 ? 22.395  -44.936 -8.169  1.00 24.45  ? 421 ALA C CB  1 
ATOM 4545 N N   . PRO C 1 138 ? 20.329  -46.823 -10.104 1.00 21.02  ? 422 PRO C N   1 
ATOM 4546 C CA  . PRO C 1 138 ? 19.290  -46.746 -11.131 1.00 22.17  ? 422 PRO C CA  1 
ATOM 4547 C C   . PRO C 1 138 ? 18.922  -45.321 -11.531 1.00 24.80  ? 422 PRO C C   1 
ATOM 4548 O O   . PRO C 1 138 ? 18.563  -44.499 -10.685 1.00 26.44  ? 422 PRO C O   1 
ATOM 4549 C CB  . PRO C 1 138 ? 18.127  -47.494 -10.495 1.00 17.92  ? 422 PRO C CB  1 
ATOM 4550 C CG  . PRO C 1 138 ? 18.822  -48.548 -9.723  1.00 18.29  ? 422 PRO C CG  1 
ATOM 4551 C CD  . PRO C 1 138 ? 19.965  -47.799 -9.066  1.00 19.51  ? 422 PRO C CD  1 
ATOM 4552 N N   . GLY C 1 139 ? 19.036  -45.040 -12.828 1.00 25.70  ? 423 GLY C N   1 
ATOM 4553 C CA  . GLY C 1 139 ? 18.694  -43.730 -13.348 1.00 24.97  ? 423 GLY C CA  1 
ATOM 4554 C C   . GLY C 1 139 ? 19.712  -42.633 -13.116 1.00 25.46  ? 423 GLY C C   1 
ATOM 4555 O O   . GLY C 1 139 ? 19.549  -41.537 -13.635 1.00 28.00  ? 423 GLY C O   1 
ATOM 4556 N N   . ASP C 1 140 ? 20.763  -42.908 -12.355 1.00 25.39  ? 424 ASP C N   1 
ATOM 4557 C CA  . ASP C 1 140 ? 21.766  -41.887 -12.081 1.00 24.88  ? 424 ASP C CA  1 
ATOM 4558 C C   . ASP C 1 140 ? 22.990  -41.921 -13.001 1.00 23.22  ? 424 ASP C C   1 
ATOM 4559 O O   . ASP C 1 140 ? 24.136  -41.997 -12.550 1.00 22.26  ? 424 ASP C O   1 
ATOM 4560 C CB  . ASP C 1 140 ? 22.208  -41.973 -10.620 1.00 27.81  ? 424 ASP C CB  1 
ATOM 4561 C CG  . ASP C 1 140 ? 23.319  -40.998 -10.294 1.00 32.74  ? 424 ASP C CG  1 
ATOM 4562 O OD1 . ASP C 1 140 ? 23.164  -39.796 -10.597 1.00 35.63  ? 424 ASP C OD1 1 
ATOM 4563 O OD2 . ASP C 1 140 ? 24.348  -41.434 -9.735  1.00 36.38  ? 424 ASP C OD2 1 
ATOM 4564 N N   . ALA C 1 141 ? 22.751  -41.845 -14.300 1.00 20.96  ? 425 ALA C N   1 
ATOM 4565 C CA  . ALA C 1 141 ? 23.856  -41.852 -15.239 1.00 20.03  ? 425 ALA C CA  1 
ATOM 4566 C C   . ALA C 1 141 ? 23.438  -41.366 -16.615 1.00 18.86  ? 425 ALA C C   1 
ATOM 4567 O O   . ALA C 1 141 ? 22.255  -41.217 -16.908 1.00 20.49  ? 425 ALA C O   1 
ATOM 4568 C CB  . ALA C 1 141 ? 24.433  -43.245 -15.335 1.00 19.17  ? 425 ALA C CB  1 
ATOM 4569 N N   . VAL C 1 142 ? 24.430  -41.097 -17.449 1.00 15.87  ? 426 VAL C N   1 
ATOM 4570 C CA  . VAL C 1 142 ? 24.189  -40.673 -18.814 1.00 14.97  ? 426 VAL C CA  1 
ATOM 4571 C C   . VAL C 1 142 ? 25.137  -41.495 -19.663 1.00 15.46  ? 426 VAL C C   1 
ATOM 4572 O O   . VAL C 1 142 ? 26.328  -41.562 -19.383 1.00 15.85  ? 426 VAL C O   1 
ATOM 4573 C CB  . VAL C 1 142 ? 24.483  -39.189 -19.008 1.00 14.08  ? 426 VAL C CB  1 
ATOM 4574 C CG1 . VAL C 1 142 ? 24.471  -38.848 -20.481 1.00 13.63  ? 426 VAL C CG1 1 
ATOM 4575 C CG2 . VAL C 1 142 ? 23.440  -38.372 -18.283 1.00 16.22  ? 426 VAL C CG2 1 
ATOM 4576 N N   . HIS C 1 143 ? 24.606  -42.142 -20.688 1.00 15.75  ? 427 HIS C N   1 
ATOM 4577 C CA  . HIS C 1 143 ? 25.437  -42.962 -21.541 1.00 16.13  ? 427 HIS C CA  1 
ATOM 4578 C C   . HIS C 1 143 ? 25.641  -42.331 -22.901 1.00 15.29  ? 427 HIS C C   1 
ATOM 4579 O O   . HIS C 1 143 ? 24.716  -42.240 -23.708 1.00 15.47  ? 427 HIS C O   1 
ATOM 4580 C CB  . HIS C 1 143 ? 24.822  -44.347 -21.665 1.00 18.82  ? 427 HIS C CB  1 
ATOM 4581 C CG  . HIS C 1 143 ? 24.523  -44.975 -20.341 1.00 23.53  ? 427 HIS C CG  1 
ATOM 4582 N ND1 . HIS C 1 143 ? 23.453  -44.588 -19.564 1.00 26.29  ? 427 HIS C ND1 1 
ATOM 4583 C CD2 . HIS C 1 143 ? 25.199  -45.900 -19.620 1.00 23.94  ? 427 HIS C CD2 1 
ATOM 4584 C CE1 . HIS C 1 143 ? 23.483  -45.247 -18.419 1.00 26.66  ? 427 HIS C CE1 1 
ATOM 4585 N NE2 . HIS C 1 143 ? 24.532  -46.049 -18.428 1.00 24.06  ? 427 HIS C NE2 1 
ATOM 4586 N N   . LYS C 1 144 ? 26.875  -41.894 -23.128 1.00 12.89  ? 428 LYS C N   1 
ATOM 4587 C CA  . LYS C 1 144 ? 27.294  -41.249 -24.364 1.00 11.76  ? 428 LYS C CA  1 
ATOM 4588 C C   . LYS C 1 144 ? 27.705  -42.256 -25.435 1.00 9.32   ? 428 LYS C C   1 
ATOM 4589 O O   . LYS C 1 144 ? 28.746  -42.890 -25.326 1.00 8.49   ? 428 LYS C O   1 
ATOM 4590 C CB  . LYS C 1 144 ? 28.464  -40.320 -24.053 1.00 13.08  ? 428 LYS C CB  1 
ATOM 4591 C CG  . LYS C 1 144 ? 29.072  -39.625 -25.253 1.00 16.45  ? 428 LYS C CG  1 
ATOM 4592 C CD  . LYS C 1 144 ? 30.312  -38.852 -24.822 1.00 15.11  ? 428 LYS C CD  1 
ATOM 4593 C CE  . LYS C 1 144 ? 30.965  -38.140 -25.981 1.00 13.39  ? 428 LYS C CE  1 
ATOM 4594 N NZ  . LYS C 1 144 ? 32.275  -37.573 -25.573 1.00 12.13  ? 428 LYS C NZ  1 
ATOM 4595 N N   . ILE C 1 145 ? 26.890  -42.401 -26.471 1.00 9.03   ? 429 ILE C N   1 
ATOM 4596 C CA  . ILE C 1 145 ? 27.204  -43.337 -27.541 1.00 12.15  ? 429 ILE C CA  1 
ATOM 4597 C C   . ILE C 1 145 ? 27.993  -42.626 -28.636 1.00 15.65  ? 429 ILE C C   1 
ATOM 4598 O O   . ILE C 1 145 ? 27.454  -41.797 -29.368 1.00 18.36  ? 429 ILE C O   1 
ATOM 4599 C CB  . ILE C 1 145 ? 25.932  -43.929 -28.175 1.00 12.01  ? 429 ILE C CB  1 
ATOM 4600 C CG1 . ILE C 1 145 ? 24.914  -44.271 -27.094 1.00 11.61  ? 429 ILE C CG1 1 
ATOM 4601 C CG2 . ILE C 1 145 ? 26.280  -45.187 -28.945 1.00 12.62  ? 429 ILE C CG2 1 
ATOM 4602 C CD1 . ILE C 1 145 ? 25.446  -45.188 -26.052 1.00 12.77  ? 429 ILE C CD1 1 
ATOM 4603 N N   . TYR C 1 146 ? 29.273  -42.959 -28.747 1.00 17.04  ? 430 TYR C N   1 
ATOM 4604 C CA  . TYR C 1 146 ? 30.156  -42.359 -29.742 1.00 17.64  ? 430 TYR C CA  1 
ATOM 4605 C C   . TYR C 1 146 ? 29.802  -42.735 -31.189 1.00 17.87  ? 430 TYR C C   1 
ATOM 4606 O O   . TYR C 1 146 ? 29.323  -43.836 -31.453 1.00 19.51  ? 430 TYR C O   1 
ATOM 4607 C CB  . TYR C 1 146 ? 31.597  -42.785 -29.445 1.00 20.48  ? 430 TYR C CB  1 
ATOM 4608 C CG  . TYR C 1 146 ? 32.199  -42.106 -28.243 1.00 21.54  ? 430 TYR C CG  1 
ATOM 4609 C CD1 . TYR C 1 146 ? 32.860  -40.887 -28.372 1.00 21.40  ? 430 TYR C CD1 1 
ATOM 4610 C CD2 . TYR C 1 146 ? 32.068  -42.656 -26.969 1.00 23.81  ? 430 TYR C CD2 1 
ATOM 4611 C CE1 . TYR C 1 146 ? 33.370  -40.230 -27.265 1.00 22.78  ? 430 TYR C CE1 1 
ATOM 4612 C CE2 . TYR C 1 146 ? 32.576  -42.004 -25.849 1.00 24.16  ? 430 TYR C CE2 1 
ATOM 4613 C CZ  . TYR C 1 146 ? 33.221  -40.790 -26.007 1.00 24.13  ? 430 TYR C CZ  1 
ATOM 4614 O OH  . TYR C 1 146 ? 33.678  -40.110 -24.907 1.00 26.31  ? 430 TYR C OH  1 
ATOM 4615 N N   . PRO C 1 147 ? 30.035  -41.820 -32.146 1.00 16.91  ? 431 PRO C N   1 
ATOM 4616 C CA  . PRO C 1 147 ? 29.730  -42.115 -33.548 1.00 15.76  ? 431 PRO C CA  1 
ATOM 4617 C C   . PRO C 1 147 ? 30.352  -43.444 -33.965 1.00 17.63  ? 431 PRO C C   1 
ATOM 4618 O O   . PRO C 1 147 ? 31.519  -43.704 -33.660 1.00 18.69  ? 431 PRO C O   1 
ATOM 4619 C CB  . PRO C 1 147 ? 30.351  -40.937 -34.281 1.00 13.66  ? 431 PRO C CB  1 
ATOM 4620 C CG  . PRO C 1 147 ? 30.108  -39.819 -33.336 1.00 13.31  ? 431 PRO C CG  1 
ATOM 4621 C CD  . PRO C 1 147 ? 30.488  -40.427 -31.997 1.00 15.78  ? 431 PRO C CD  1 
ATOM 4622 N N   . SER C 1 148 ? 29.563  -44.270 -34.654 1.00 16.65  ? 432 SER C N   1 
ATOM 4623 C CA  . SER C 1 148 ? 29.983  -45.587 -35.133 1.00 15.53  ? 432 SER C CA  1 
ATOM 4624 C C   . SER C 1 148 ? 29.653  -46.665 -34.138 1.00 17.97  ? 432 SER C C   1 
ATOM 4625 O O   . SER C 1 148 ? 29.444  -47.821 -34.516 1.00 22.15  ? 432 SER C O   1 
ATOM 4626 C CB  . SER C 1 148 ? 31.478  -45.638 -35.403 1.00 16.17  ? 432 SER C CB  1 
ATOM 4627 O OG  . SER C 1 148 ? 31.802  -44.781 -36.476 1.00 28.60  ? 432 SER C OG  1 
ATOM 4628 N N   . ALA C 1 149 ? 29.603  -46.287 -32.863 1.00 17.53  ? 433 ALA C N   1 
ATOM 4629 C CA  . ALA C 1 149 ? 29.304  -47.232 -31.793 1.00 15.83  ? 433 ALA C CA  1 
ATOM 4630 C C   . ALA C 1 149 ? 28.013  -47.993 -32.061 1.00 15.12  ? 433 ALA C C   1 
ATOM 4631 O O   . ALA C 1 149 ? 27.046  -47.445 -32.580 1.00 16.18  ? 433 ALA C O   1 
ATOM 4632 C CB  . ALA C 1 149 ? 29.211  -46.497 -30.458 1.00 13.77  ? 433 ALA C CB  1 
ATOM 4633 N N   . TYR C 1 150 ? 28.011  -49.268 -31.706 1.00 13.70  ? 434 TYR C N   1 
ATOM 4634 C CA  . TYR C 1 150 ? 26.844  -50.107 -31.888 1.00 13.43  ? 434 TYR C CA  1 
ATOM 4635 C C   . TYR C 1 150 ? 26.663  -50.902 -30.604 1.00 15.40  ? 434 TYR C C   1 
ATOM 4636 O O   . TYR C 1 150 ? 27.106  -52.043 -30.498 1.00 15.30  ? 434 TYR C O   1 
ATOM 4637 C CB  . TYR C 1 150 ? 27.064  -51.041 -33.067 1.00 10.37  ? 434 TYR C CB  1 
ATOM 4638 C CG  . TYR C 1 150 ? 25.901  -51.944 -33.330 1.00 9.79   ? 434 TYR C CG  1 
ATOM 4639 C CD1 . TYR C 1 150 ? 24.610  -51.436 -33.399 1.00 11.50  ? 434 TYR C CD1 1 
ATOM 4640 C CD2 . TYR C 1 150 ? 26.085  -53.307 -33.515 1.00 9.17   ? 434 TYR C CD2 1 
ATOM 4641 C CE1 . TYR C 1 150 ? 23.532  -52.265 -33.647 1.00 15.25  ? 434 TYR C CE1 1 
ATOM 4642 C CE2 . TYR C 1 150 ? 25.014  -54.146 -33.764 1.00 11.78  ? 434 TYR C CE2 1 
ATOM 4643 C CZ  . TYR C 1 150 ? 23.742  -53.617 -33.830 1.00 14.77  ? 434 TYR C CZ  1 
ATOM 4644 O OH  . TYR C 1 150 ? 22.677  -54.432 -34.098 1.00 20.17  ? 434 TYR C OH  1 
ATOM 4645 N N   . ILE C 1 151 ? 26.008  -50.296 -29.622 1.00 17.95  ? 435 ILE C N   1 
ATOM 4646 C CA  . ILE C 1 151 ? 25.825  -50.960 -28.341 1.00 21.33  ? 435 ILE C CA  1 
ATOM 4647 C C   . ILE C 1 151 ? 24.385  -51.311 -27.958 1.00 21.59  ? 435 ILE C C   1 
ATOM 4648 O O   . ILE C 1 151 ? 23.445  -50.584 -28.279 1.00 22.65  ? 435 ILE C O   1 
ATOM 4649 C CB  . ILE C 1 151 ? 26.436  -50.111 -27.203 1.00 22.56  ? 435 ILE C CB  1 
ATOM 4650 C CG1 . ILE C 1 151 ? 25.570  -48.884 -26.945 1.00 23.89  ? 435 ILE C CG1 1 
ATOM 4651 C CG2 . ILE C 1 151 ? 27.838  -49.650 -27.588 1.00 20.50  ? 435 ILE C CG2 1 
ATOM 4652 C CD1 . ILE C 1 151 ? 25.743  -48.331 -25.559 1.00 26.63  ? 435 ILE C CD1 1 
ATOM 4653 N N   . LYS C 1 152 ? 24.234  -52.440 -27.270 1.00 20.01  ? 436 LYS C N   1 
ATOM 4654 C CA  . LYS C 1 152 ? 22.939  -52.914 -26.796 1.00 19.09  ? 436 LYS C CA  1 
ATOM 4655 C C   . LYS C 1 152 ? 22.538  -51.995 -25.644 1.00 19.89  ? 436 LYS C C   1 
ATOM 4656 O O   . LYS C 1 152 ? 23.363  -51.671 -24.787 1.00 20.11  ? 436 LYS C O   1 
ATOM 4657 C CB  . LYS C 1 152 ? 23.082  -54.363 -26.323 1.00 18.88  ? 436 LYS C CB  1 
ATOM 4658 C CG  . LYS C 1 152 ? 21.936  -54.933 -25.492 1.00 19.65  ? 436 LYS C CG  1 
ATOM 4659 C CD  . LYS C 1 152 ? 22.230  -56.400 -25.163 1.00 17.46  ? 436 LYS C CD  1 
ATOM 4660 C CE  . LYS C 1 152 ? 21.207  -57.029 -24.233 1.00 16.21  ? 436 LYS C CE  1 
ATOM 4661 N NZ  . LYS C 1 152 ? 21.480  -58.483 -24.034 1.00 11.68  ? 436 LYS C NZ  1 
ATOM 4662 N N   . VAL C 1 153 ? 21.280  -51.563 -25.626 1.00 17.93  ? 437 VAL C N   1 
ATOM 4663 C CA  . VAL C 1 153 ? 20.825  -50.654 -24.582 1.00 15.84  ? 437 VAL C CA  1 
ATOM 4664 C C   . VAL C 1 153 ? 19.643  -51.152 -23.765 1.00 16.79  ? 437 VAL C C   1 
ATOM 4665 O O   . VAL C 1 153 ? 19.336  -50.588 -22.717 1.00 15.73  ? 437 VAL C O   1 
ATOM 4666 C CB  . VAL C 1 153 ? 20.468  -49.273 -25.175 1.00 13.39  ? 437 VAL C CB  1 
ATOM 4667 C CG1 . VAL C 1 153 ? 21.736  -48.550 -25.588 1.00 13.16  ? 437 VAL C CG1 1 
ATOM 4668 C CG2 . VAL C 1 153 ? 19.545  -49.441 -26.381 1.00 7.99   ? 437 VAL C CG2 1 
ATOM 4669 N N   . PHE C 1 154 ? 18.979  -52.204 -24.238 1.00 17.49  ? 438 PHE C N   1 
ATOM 4670 C CA  . PHE C 1 154 ? 17.835  -52.751 -23.519 1.00 18.09  ? 438 PHE C CA  1 
ATOM 4671 C C   . PHE C 1 154 ? 17.742  -54.273 -23.611 1.00 21.06  ? 438 PHE C C   1 
ATOM 4672 O O   . PHE C 1 154 ? 17.823  -54.839 -24.702 1.00 25.09  ? 438 PHE C O   1 
ATOM 4673 C CB  . PHE C 1 154 ? 16.534  -52.153 -24.049 1.00 14.59  ? 438 PHE C CB  1 
ATOM 4674 C CG  . PHE C 1 154 ? 15.332  -52.576 -23.267 1.00 12.40  ? 438 PHE C CG  1 
ATOM 4675 C CD1 . PHE C 1 154 ? 15.055  -51.993 -22.032 1.00 10.59  ? 438 PHE C CD1 1 
ATOM 4676 C CD2 . PHE C 1 154 ? 14.520  -53.606 -23.725 1.00 9.22   ? 438 PHE C CD2 1 
ATOM 4677 C CE1 . PHE C 1 154 ? 13.993  -52.430 -21.263 1.00 9.48   ? 438 PHE C CE1 1 
ATOM 4678 C CE2 . PHE C 1 154 ? 13.455  -54.053 -22.966 1.00 9.53   ? 438 PHE C CE2 1 
ATOM 4679 C CZ  . PHE C 1 154 ? 13.190  -53.464 -21.730 1.00 11.75  ? 438 PHE C CZ  1 
ATOM 4680 N N   . ASP C 1 155 ? 17.554  -54.930 -22.467 1.00 20.46  ? 439 ASP C N   1 
ATOM 4681 C CA  . ASP C 1 155 ? 17.443  -56.388 -22.425 1.00 19.64  ? 439 ASP C CA  1 
ATOM 4682 C C   . ASP C 1 155 ? 16.137  -56.797 -21.756 1.00 17.56  ? 439 ASP C C   1 
ATOM 4683 O O   . ASP C 1 155 ? 15.956  -56.584 -20.556 1.00 19.18  ? 439 ASP C O   1 
ATOM 4684 C CB  . ASP C 1 155 ? 18.622  -56.997 -21.656 1.00 22.24  ? 439 ASP C CB  1 
ATOM 4685 C CG  . ASP C 1 155 ? 18.576  -58.518 -21.626 1.00 25.25  ? 439 ASP C CG  1 
ATOM 4686 O OD1 . ASP C 1 155 ? 19.505  -59.151 -22.163 1.00 25.07  ? 439 ASP C OD1 1 
ATOM 4687 O OD2 . ASP C 1 155 ? 17.606  -59.082 -21.071 1.00 27.17  ? 439 ASP C OD2 1 
ATOM 4688 N N   . LEU C 1 156 ? 15.240  -57.394 -22.536 1.00 14.66  ? 440 LEU C N   1 
ATOM 4689 C CA  . LEU C 1 156 ? 13.934  -57.826 -22.041 1.00 14.39  ? 440 LEU C CA  1 
ATOM 4690 C C   . LEU C 1 156 ? 14.026  -58.712 -20.805 1.00 16.75  ? 440 LEU C C   1 
ATOM 4691 O O   . LEU C 1 156 ? 13.414  -58.421 -19.780 1.00 16.35  ? 440 LEU C O   1 
ATOM 4692 C CB  . LEU C 1 156 ? 13.174  -58.590 -23.131 1.00 10.18  ? 440 LEU C CB  1 
ATOM 4693 C CG  . LEU C 1 156 ? 11.753  -58.145 -23.487 1.00 8.88   ? 440 LEU C CG  1 
ATOM 4694 C CD1 . LEU C 1 156 ? 10.867  -59.372 -23.687 1.00 2.89   ? 440 LEU C CD1 1 
ATOM 4695 C CD2 . LEU C 1 156 ? 11.197  -57.239 -22.394 1.00 6.93   ? 440 LEU C CD2 1 
ATOM 4696 N N   . ARG C 1 157 ? 14.779  -59.801 -20.926 1.00 18.86  ? 441 ARG C N   1 
ATOM 4697 C CA  . ARG C 1 157 ? 14.962  -60.760 -19.847 1.00 20.58  ? 441 ARG C CA  1 
ATOM 4698 C C   . ARG C 1 157 ? 15.372  -60.039 -18.568 1.00 19.62  ? 441 ARG C C   1 
ATOM 4699 O O   . ARG C 1 157 ? 14.770  -60.211 -17.509 1.00 19.71  ? 441 ARG C O   1 
ATOM 4700 C CB  . ARG C 1 157 ? 16.054  -61.759 -20.225 1.00 25.89  ? 441 ARG C CB  1 
ATOM 4701 C CG  . ARG C 1 157 ? 15.726  -63.223 -19.963 1.00 32.34  ? 441 ARG C CG  1 
ATOM 4702 C CD  . ARG C 1 157 ? 15.101  -63.847 -21.196 1.00 40.50  ? 441 ARG C CD  1 
ATOM 4703 N NE  . ARG C 1 157 ? 14.949  -65.294 -21.081 1.00 47.57  ? 441 ARG C NE  1 
ATOM 4704 C CZ  . ARG C 1 157 ? 14.539  -66.079 -22.075 1.00 51.54  ? 441 ARG C CZ  1 
ATOM 4705 N NH1 . ARG C 1 157 ? 14.239  -65.555 -23.258 1.00 51.77  ? 441 ARG C NH1 1 
ATOM 4706 N NH2 . ARG C 1 157 ? 14.441  -67.391 -21.894 1.00 54.16  ? 441 ARG C NH2 1 
ATOM 4707 N N   . GLN C 1 158 ? 16.410  -59.228 -18.672 1.00 19.00  ? 442 GLN C N   1 
ATOM 4708 C CA  . GLN C 1 158 ? 16.898  -58.503 -17.518 1.00 19.66  ? 442 GLN C CA  1 
ATOM 4709 C C   . GLN C 1 158 ? 15.799  -57.565 -17.034 1.00 20.75  ? 442 GLN C C   1 
ATOM 4710 O O   . GLN C 1 158 ? 15.548  -57.436 -15.834 1.00 20.88  ? 442 GLN C O   1 
ATOM 4711 C CB  . GLN C 1 158 ? 18.163  -57.733 -17.902 1.00 19.50  ? 442 GLN C CB  1 
ATOM 4712 C CG  . GLN C 1 158 ? 18.951  -57.215 -16.731 1.00 22.59  ? 442 GLN C CG  1 
ATOM 4713 C CD  . GLN C 1 158 ? 18.409  -55.917 -16.197 1.00 26.03  ? 442 GLN C CD  1 
ATOM 4714 O OE1 . GLN C 1 158 ? 18.730  -55.522 -15.081 1.00 30.16  ? 442 GLN C OE1 1 
ATOM 4715 N NE2 . GLN C 1 158 ? 17.595  -55.232 -16.998 1.00 29.43  ? 442 GLN C NE2 1 
ATOM 4716 N N   . CYS C 1 159 ? 15.122  -56.924 -17.979 1.00 22.00  ? 443 CYS C N   1 
ATOM 4717 C CA  . CYS C 1 159 ? 14.053  -56.010 -17.626 1.00 21.23  ? 443 CYS C CA  1 
ATOM 4718 C C   . CYS C 1 159 ? 12.916  -56.735 -16.927 1.00 19.92  ? 443 CYS C C   1 
ATOM 4719 O O   . CYS C 1 159 ? 12.429  -56.284 -15.898 1.00 18.60  ? 443 CYS C O   1 
ATOM 4720 C CB  . CYS C 1 159 ? 13.507  -55.317 -18.863 1.00 19.59  ? 443 CYS C CB  1 
ATOM 4721 S SG  . CYS C 1 159 ? 12.242  -54.148 -18.411 1.00 25.42  ? 443 CYS C SG  1 
ATOM 4722 N N   . HIS C 1 160 ? 12.501  -57.861 -17.497 1.00 19.99  ? 444 HIS C N   1 
ATOM 4723 C CA  . HIS C 1 160 ? 11.416  -58.655 -16.941 1.00 19.28  ? 444 HIS C CA  1 
ATOM 4724 C C   . HIS C 1 160 ? 11.710  -59.051 -15.513 1.00 19.06  ? 444 HIS C C   1 
ATOM 4725 O O   . HIS C 1 160 ? 10.875  -58.880 -14.628 1.00 20.49  ? 444 HIS C O   1 
ATOM 4726 C CB  . HIS C 1 160 ? 11.197  -59.913 -17.775 1.00 21.38  ? 444 HIS C CB  1 
ATOM 4727 C CG  . HIS C 1 160 ? 10.065  -60.765 -17.292 1.00 26.89  ? 444 HIS C CG  1 
ATOM 4728 N ND1 . HIS C 1 160 ? 8.779   -60.285 -17.153 1.00 29.88  ? 444 HIS C ND1 1 
ATOM 4729 C CD2 . HIS C 1 160 ? 10.020  -62.068 -16.928 1.00 28.05  ? 444 HIS C CD2 1 
ATOM 4730 C CE1 . HIS C 1 160 ? 7.992   -61.256 -16.726 1.00 28.07  ? 444 HIS C CE1 1 
ATOM 4731 N NE2 . HIS C 1 160 ? 8.720   -62.348 -16.581 1.00 27.27  ? 444 HIS C NE2 1 
ATOM 4732 N N   . ARG C 1 161 ? 12.911  -59.576 -15.301 1.00 19.84  ? 445 ARG C N   1 
ATOM 4733 C CA  . ARG C 1 161 ? 13.370  -60.017 -13.987 1.00 19.88  ? 445 ARG C CA  1 
ATOM 4734 C C   . ARG C 1 161 ? 13.369  -58.873 -12.956 1.00 18.57  ? 445 ARG C C   1 
ATOM 4735 O O   . ARG C 1 161 ? 12.887  -59.024 -11.828 1.00 16.66  ? 445 ARG C O   1 
ATOM 4736 C CB  . ARG C 1 161 ? 14.768  -60.624 -14.145 1.00 21.25  ? 445 ARG C CB  1 
ATOM 4737 C CG  . ARG C 1 161 ? 15.416  -61.117 -12.869 1.00 22.50  ? 445 ARG C CG  1 
ATOM 4738 C CD  . ARG C 1 161 ? 16.567  -62.056 -13.193 1.00 22.37  ? 445 ARG C CD  1 
ATOM 4739 N NE  . ARG C 1 161 ? 17.442  -61.526 -14.237 1.00 22.62  ? 445 ARG C NE  1 
ATOM 4740 C CZ  . ARG C 1 161 ? 17.595  -62.077 -15.436 1.00 18.64  ? 445 ARG C CZ  1 
ATOM 4741 N NH1 . ARG C 1 161 ? 16.928  -63.179 -15.745 1.00 19.66  ? 445 ARG C NH1 1 
ATOM 4742 N NH2 . ARG C 1 161 ? 18.421  -61.533 -16.321 1.00 12.70  ? 445 ARG C NH2 1 
ATOM 4743 N N   . GLN C 1 162 ? 13.903  -57.724 -13.343 1.00 16.93  ? 446 GLN C N   1 
ATOM 4744 C CA  . GLN C 1 162 ? 13.916  -56.588 -12.443 1.00 17.01  ? 446 GLN C CA  1 
ATOM 4745 C C   . GLN C 1 162 ? 12.499  -56.105 -12.110 1.00 18.30  ? 446 GLN C C   1 
ATOM 4746 O O   . GLN C 1 162 ? 12.247  -55.673 -10.989 1.00 18.88  ? 446 GLN C O   1 
ATOM 4747 C CB  . GLN C 1 162 ? 14.696  -55.433 -13.060 1.00 15.90  ? 446 GLN C CB  1 
ATOM 4748 C CG  . GLN C 1 162 ? 14.565  -54.147 -12.265 1.00 18.00  ? 446 GLN C CG  1 
ATOM 4749 C CD  . GLN C 1 162 ? 15.185  -54.244 -10.881 1.00 19.06  ? 446 GLN C CD  1 
ATOM 4750 O OE1 . GLN C 1 162 ? 14.902  -53.428 -9.999  1.00 17.71  ? 446 GLN C OE1 1 
ATOM 4751 N NE2 . GLN C 1 162 ? 16.046  -55.242 -10.687 1.00 19.60  ? 446 GLN C NE2 1 
ATOM 4752 N N   . MET C 1 163 ? 11.588  -56.168 -13.084 1.00 18.00  ? 447 MET C N   1 
ATOM 4753 C CA  . MET C 1 163 ? 10.209  -55.718 -12.891 1.00 17.83  ? 447 MET C CA  1 
ATOM 4754 C C   . MET C 1 163 ? 9.530   -56.411 -11.723 1.00 18.20  ? 447 MET C C   1 
ATOM 4755 O O   . MET C 1 163 ? 9.082   -55.770 -10.767 1.00 16.77  ? 447 MET C O   1 
ATOM 4756 C CB  . MET C 1 163 ? 9.359   -55.993 -14.128 1.00 20.82  ? 447 MET C CB  1 
ATOM 4757 C CG  . MET C 1 163 ? 9.707   -55.207 -15.367 1.00 29.40  ? 447 MET C CG  1 
ATOM 4758 S SD  . MET C 1 163 ? 8.435   -55.407 -16.665 1.00 36.91  ? 447 MET C SD  1 
ATOM 4759 C CE  . MET C 1 163 ? 8.498   -57.161 -17.004 1.00 34.11  ? 447 MET C CE  1 
ATOM 4760 N N   . GLN C 1 164 ? 9.441   -57.733 -11.828 1.00 17.42  ? 448 GLN C N   1 
ATOM 4761 C CA  . GLN C 1 164 ? 8.795   -58.564 -10.816 1.00 17.57  ? 448 GLN C CA  1 
ATOM 4762 C C   . GLN C 1 164 ? 9.330   -58.328 -9.415  1.00 18.28  ? 448 GLN C C   1 
ATOM 4763 O O   . GLN C 1 164 ? 8.560   -58.129 -8.472  1.00 19.66  ? 448 GLN C O   1 
ATOM 4764 C CB  . GLN C 1 164 ? 8.961   -60.032 -11.177 1.00 14.49  ? 448 GLN C CB  1 
ATOM 4765 C CG  . GLN C 1 164 ? 8.583   -60.319 -12.589 1.00 10.40  ? 448 GLN C CG  1 
ATOM 4766 C CD  . GLN C 1 164 ? 8.715   -61.766 -12.921 1.00 11.30  ? 448 GLN C CD  1 
ATOM 4767 O OE1 . GLN C 1 164 ? 7.860   -62.578 -12.575 1.00 14.21  ? 448 GLN C OE1 1 
ATOM 4768 N NE2 . GLN C 1 164 ? 9.799   -62.110 -13.590 1.00 16.52  ? 448 GLN C NE2 1 
ATOM 4769 N N   . GLN C 1 165 ? 10.648  -58.365 -9.278  1.00 16.07  ? 449 GLN C N   1 
ATOM 4770 C CA  . GLN C 1 165 ? 11.253  -58.141 -7.985  1.00 16.02  ? 449 GLN C CA  1 
ATOM 4771 C C   . GLN C 1 165 ? 11.001  -56.719 -7.502  1.00 15.24  ? 449 GLN C C   1 
ATOM 4772 O O   . GLN C 1 165 ? 10.947  -56.459 -6.300  1.00 13.50  ? 449 GLN C O   1 
ATOM 4773 C CB  . GLN C 1 165 ? 12.751  -58.394 -8.055  1.00 17.07  ? 449 GLN C CB  1 
ATOM 4774 C CG  . GLN C 1 165 ? 13.175  -59.631 -7.313  1.00 21.66  ? 449 GLN C CG  1 
ATOM 4775 C CD  . GLN C 1 165 ? 14.570  -59.513 -6.765  1.00 23.63  ? 449 GLN C CD  1 
ATOM 4776 O OE1 . GLN C 1 165 ? 15.042  -60.385 -6.034  1.00 27.85  ? 449 GLN C OE1 1 
ATOM 4777 N NE2 . GLN C 1 165 ? 15.244  -58.426 -7.111  1.00 24.94  ? 449 GLN C NE2 1 
ATOM 4778 N N   . GLN C 1 166 ? 10.838  -55.792 -8.437  1.00 15.72  ? 450 GLN C N   1 
ATOM 4779 C CA  . GLN C 1 166 ? 10.623  -54.412 -8.049  1.00 14.82  ? 450 GLN C CA  1 
ATOM 4780 C C   . GLN C 1 166 ? 9.182   -54.201 -7.654  1.00 15.55  ? 450 GLN C C   1 
ATOM 4781 O O   . GLN C 1 166 ? 8.894   -53.500 -6.686  1.00 16.42  ? 450 GLN C O   1 
ATOM 4782 C CB  . GLN C 1 166 ? 11.008  -53.461 -9.178  1.00 12.85  ? 450 GLN C CB  1 
ATOM 4783 C CG  . GLN C 1 166 ? 11.217  -52.049 -8.681  1.00 16.81  ? 450 GLN C CG  1 
ATOM 4784 C CD  . GLN C 1 166 ? 11.685  -51.087 -9.756  1.00 22.27  ? 450 GLN C CD  1 
ATOM 4785 O OE1 . GLN C 1 166 ? 12.720  -51.299 -10.402 1.00 21.95  ? 450 GLN C OE1 1 
ATOM 4786 N NE2 . GLN C 1 166 ? 10.928  -50.009 -9.945  1.00 26.05  ? 450 GLN C NE2 1 
ATOM 4787 N N   . ALA C 1 167 ? 8.274   -54.815 -8.400  1.00 15.83  ? 451 ALA C N   1 
ATOM 4788 C CA  . ALA C 1 167 ? 6.857   -54.687 -8.098  1.00 15.38  ? 451 ALA C CA  1 
ATOM 4789 C C   . ALA C 1 167 ? 6.627   -55.297 -6.724  1.00 16.80  ? 451 ALA C C   1 
ATOM 4790 O O   . ALA C 1 167 ? 5.924   -54.725 -5.890  1.00 15.95  ? 451 ALA C O   1 
ATOM 4791 C CB  . ALA C 1 167 ? 6.031   -55.417 -9.146  1.00 15.54  ? 451 ALA C CB  1 
ATOM 4792 N N   . ALA C 1 168 ? 7.243   -56.460 -6.503  1.00 18.93  ? 452 ALA C N   1 
ATOM 4793 C CA  . ALA C 1 168 ? 7.151   -57.196 -5.243  1.00 17.98  ? 452 ALA C CA  1 
ATOM 4794 C C   . ALA C 1 168 ? 7.623   -56.354 -4.054  1.00 19.27  ? 452 ALA C C   1 
ATOM 4795 O O   . ALA C 1 168 ? 6.949   -56.300 -3.024  1.00 20.09  ? 452 ALA C O   1 
ATOM 4796 C CB  . ALA C 1 168 ? 7.967   -58.469 -5.336  1.00 13.90  ? 452 ALA C CB  1 
ATOM 4797 N N   . THR C 1 169 ? 8.783   -55.712 -4.195  1.00 18.05  ? 453 THR C N   1 
ATOM 4798 C CA  . THR C 1 169 ? 9.319   -54.859 -3.138  1.00 18.26  ? 453 THR C CA  1 
ATOM 4799 C C   . THR C 1 169 ? 8.334   -53.719 -2.864  1.00 21.03  ? 453 THR C C   1 
ATOM 4800 O O   . THR C 1 169 ? 8.178   -53.269 -1.727  1.00 20.08  ? 453 THR C O   1 
ATOM 4801 C CB  . THR C 1 169 ? 10.665  -54.246 -3.546  1.00 16.65  ? 453 THR C CB  1 
ATOM 4802 O OG1 . THR C 1 169 ? 11.598  -55.289 -3.836  1.00 15.61  ? 453 THR C OG1 1 
ATOM 4803 C CG2 . THR C 1 169 ? 11.215  -53.380 -2.427  1.00 15.64  ? 453 THR C CG2 1 
ATOM 4804 N N   . ALA C 1 170 ? 7.682   -53.250 -3.925  1.00 24.11  ? 454 ALA C N   1 
ATOM 4805 C CA  . ALA C 1 170 ? 6.694   -52.184 -3.821  1.00 25.14  ? 454 ALA C CA  1 
ATOM 4806 C C   . ALA C 1 170 ? 5.616   -52.666 -2.873  1.00 26.46  ? 454 ALA C C   1 
ATOM 4807 O O   . ALA C 1 170 ? 5.328   -52.013 -1.878  1.00 26.55  ? 454 ALA C O   1 
ATOM 4808 C CB  . ALA C 1 170 ? 6.095   -51.894 -5.186  1.00 26.25  ? 454 ALA C CB  1 
ATOM 4809 N N   . GLN C 1 171 ? 5.032   -53.819 -3.195  1.00 29.67  ? 455 GLN C N   1 
ATOM 4810 C CA  . GLN C 1 171 ? 3.989   -54.440 -2.379  1.00 33.65  ? 455 GLN C CA  1 
ATOM 4811 C C   . GLN C 1 171 ? 4.375   -54.507 -0.905  1.00 33.49  ? 455 GLN C C   1 
ATOM 4812 O O   . GLN C 1 171 ? 3.750   -53.869 -0.065  1.00 33.86  ? 455 GLN C O   1 
ATOM 4813 C CB  . GLN C 1 171 ? 3.706   -55.858 -2.876  1.00 38.39  ? 455 GLN C CB  1 
ATOM 4814 C CG  . GLN C 1 171 ? 2.842   -55.927 -4.117  1.00 47.60  ? 455 GLN C CG  1 
ATOM 4815 C CD  . GLN C 1 171 ? 1.398   -55.529 -3.852  1.00 52.52  ? 455 GLN C CD  1 
ATOM 4816 O OE1 . GLN C 1 171 ? 0.562   -55.540 -4.761  1.00 55.83  ? 455 GLN C OE1 1 
ATOM 4817 N NE2 . GLN C 1 171 ? 1.097   -55.178 -2.604  1.00 53.18  ? 455 GLN C NE2 1 
ATOM 4818 N N   . ALA C 1 172 ? 5.400   -55.293 -0.597  1.00 33.56  ? 456 ALA C N   1 
ATOM 4819 C CA  . ALA C 1 172 ? 5.868   -55.439 0.774   1.00 32.49  ? 456 ALA C CA  1 
ATOM 4820 C C   . ALA C 1 172 ? 5.891   -54.089 1.465   1.00 32.67  ? 456 ALA C C   1 
ATOM 4821 O O   . ALA C 1 172 ? 5.300   -53.914 2.524   1.00 33.30  ? 456 ALA C O   1 
ATOM 4822 C CB  . ALA C 1 172 ? 7.254   -56.042 0.782   1.00 32.46  ? 456 ALA C CB  1 
ATOM 4823 N N   . ALA C 1 173 ? 6.575   -53.135 0.852   1.00 34.42  ? 457 ALA C N   1 
ATOM 4824 C CA  . ALA C 1 173 ? 6.684   -51.797 1.403   1.00 36.32  ? 457 ALA C CA  1 
ATOM 4825 C C   . ALA C 1 173 ? 5.327   -51.247 1.808   1.00 39.26  ? 457 ALA C C   1 
ATOM 4826 O O   . ALA C 1 173 ? 5.175   -50.697 2.897   1.00 41.41  ? 457 ALA C O   1 
ATOM 4827 C CB  . ALA C 1 173 ? 7.323   -50.882 0.391   1.00 35.57  ? 457 ALA C CB  1 
ATOM 4828 N N   . ALA C 1 174 ? 4.345   -51.398 0.923   1.00 42.19  ? 458 ALA C N   1 
ATOM 4829 C CA  . ALA C 1 174 ? 2.989   -50.908 1.168   1.00 44.61  ? 458 ALA C CA  1 
ATOM 4830 C C   . ALA C 1 174 ? 2.333   -51.577 2.372   1.00 47.42  ? 458 ALA C C   1 
ATOM 4831 O O   . ALA C 1 174 ? 1.886   -50.902 3.295   1.00 48.85  ? 458 ALA C O   1 
ATOM 4832 C CB  . ALA C 1 174 ? 2.128   -51.112 -0.075  1.00 42.85  ? 458 ALA C CB  1 
ATOM 4833 N N   . ALA C 1 175 ? 2.263   -52.903 2.359   1.00 50.58  ? 459 ALA C N   1 
ATOM 4834 C CA  . ALA C 1 175 ? 1.667   -53.634 3.466   1.00 54.41  ? 459 ALA C CA  1 
ATOM 4835 C C   . ALA C 1 175 ? 2.381   -53.245 4.761   1.00 57.67  ? 459 ALA C C   1 
ATOM 4836 O O   . ALA C 1 175 ? 1.762   -53.143 5.822   1.00 58.76  ? 459 ALA C O   1 
ATOM 4837 C CB  . ALA C 1 175 ? 1.786   -55.133 3.224   1.00 54.50  ? 459 ALA C CB  1 
ATOM 4838 N N   . ALA C 1 176 ? 3.688   -53.022 4.664   1.00 60.26  ? 460 ALA C N   1 
ATOM 4839 C CA  . ALA C 1 176 ? 4.489   -52.633 5.818   1.00 63.86  ? 460 ALA C CA  1 
ATOM 4840 C C   . ALA C 1 176 ? 4.144   -51.210 6.238   1.00 66.73  ? 460 ALA C C   1 
ATOM 4841 O O   . ALA C 1 176 ? 4.549   -50.749 7.303   1.00 66.16  ? 460 ALA C O   1 
ATOM 4842 C CB  . ALA C 1 176 ? 5.965   -52.730 5.479   1.00 63.54  ? 460 ALA C CB  1 
ATOM 4843 N N   . GLN C 1 177 ? 3.398   -50.518 5.385   1.00 70.78  ? 461 GLN C N   1 
ATOM 4844 C CA  . GLN C 1 177 ? 2.983   -49.149 5.653   1.00 74.79  ? 461 GLN C CA  1 
ATOM 4845 C C   . GLN C 1 177 ? 1.647   -49.179 6.380   1.00 76.07  ? 461 GLN C C   1 
ATOM 4846 O O   . GLN C 1 177 ? 1.290   -48.236 7.084   1.00 75.38  ? 461 GLN C O   1 
ATOM 4847 C CB  . GLN C 1 177 ? 2.834   -48.378 4.342   1.00 78.13  ? 461 GLN C CB  1 
ATOM 4848 C CG  . GLN C 1 177 ? 2.608   -46.889 4.522   1.00 83.03  ? 461 GLN C CG  1 
ATOM 4849 C CD  . GLN C 1 177 ? 3.873   -46.150 4.925   1.00 86.31  ? 461 GLN C CD  1 
ATOM 4850 O OE1 . GLN C 1 177 ? 3.843   -44.951 5.217   1.00 86.41  ? 461 GLN C OE1 1 
ATOM 4851 N NE2 . GLN C 1 177 ? 4.996   -46.862 4.934   1.00 87.83  ? 461 GLN C NE2 1 
ATOM 4852 N N   . ALA C 1 178 ? 0.912   -50.272 6.194   1.00 78.54  ? 462 ALA C N   1 
ATOM 4853 C CA  . ALA C 1 178 ? -0.387  -50.448 6.831   1.00 81.20  ? 462 ALA C CA  1 
ATOM 4854 C C   . ALA C 1 178 ? -0.179  -50.769 8.305   1.00 84.08  ? 462 ALA C C   1 
ATOM 4855 O O   . ALA C 1 178 ? -0.786  -50.146 9.180   1.00 86.64  ? 462 ALA C O   1 
ATOM 4856 C CB  . ALA C 1 178 ? -1.156  -51.575 6.154   1.00 80.13  ? 462 ALA C CB  1 
ATOM 4857 N N   . ALA C 1 179 ? 0.682   -51.743 8.578   1.00 85.05  ? 463 ALA C N   1 
ATOM 4858 C CA  . ALA C 1 179 ? 0.971   -52.131 9.953   1.00 86.26  ? 463 ALA C CA  1 
ATOM 4859 C C   . ALA C 1 179 ? 1.453   -50.910 10.735  1.00 86.34  ? 463 ALA C C   1 
ATOM 4860 O O   . ALA C 1 179 ? 1.208   -50.787 11.936  1.00 86.59  ? 463 ALA C O   1 
ATOM 4861 C CB  . ALA C 1 179 ? 2.033   -53.223 9.971   1.00 86.63  ? 463 ALA C CB  1 
ATOM 4862 N N   . ALA C 1 180 ? 2.129   -50.004 10.036  1.00 86.58  ? 464 ALA C N   1 
ATOM 4863 C CA  . ALA C 1 180 ? 2.657   -48.788 10.639  1.00 87.46  ? 464 ALA C CA  1 
ATOM 4864 C C   . ALA C 1 180 ? 1.552   -47.820 11.042  1.00 88.02  ? 464 ALA C C   1 
ATOM 4865 O O   . ALA C 1 180 ? 1.778   -46.611 11.126  1.00 88.48  ? 464 ALA C O   1 
ATOM 4866 C CB  . ALA C 1 180 ? 3.616   -48.105 9.672   1.00 88.22  ? 464 ALA C CB  1 
ATOM 4867 N N   . VAL C 1 181 ? 0.357   -48.347 11.284  1.00 87.78  ? 465 VAL C N   1 
ATOM 4868 C CA  . VAL C 1 181 ? -0.770  -47.514 11.685  1.00 87.25  ? 465 VAL C CA  1 
ATOM 4869 C C   . VAL C 1 181 ? -1.669  -48.264 12.663  1.00 86.89  ? 465 VAL C C   1 
ATOM 4870 O O   . VAL C 1 181 ? -1.232  -48.664 13.744  1.00 85.57  ? 465 VAL C O   1 
ATOM 4871 C CB  . VAL C 1 181 ? -1.610  -47.079 10.464  1.00 86.17  ? 465 VAL C CB  1 
ATOM 4872 C CG1 . VAL C 1 181 ? -2.670  -46.091 10.898  1.00 85.91  ? 465 VAL C CG1 1 
ATOM 4873 C CG2 . VAL C 1 181 ? -0.717  -46.454 9.404   1.00 85.76  ? 465 VAL C CG2 1 
ATOM 4874 N N   . ALA C 1 195 ? -6.824  -45.628 16.419  1.00 94.53  ? 479 ALA C N   1 
ATOM 4875 C CA  . ALA C 1 195 ? -8.174  -45.625 15.862  1.00 93.29  ? 479 ALA C CA  1 
ATOM 4876 C C   . ALA C 1 195 ? -8.503  -46.985 15.248  1.00 92.06  ? 479 ALA C C   1 
ATOM 4877 O O   . ALA C 1 195 ? -8.012  -47.327 14.168  1.00 92.47  ? 479 ALA C O   1 
ATOM 4878 C CB  . ALA C 1 195 ? -8.303  -44.526 14.809  1.00 93.24  ? 479 ALA C CB  1 
ATOM 4879 N N   . PRO C 1 196 ? -9.335  -47.783 15.938  1.00 89.98  ? 480 PRO C N   1 
ATOM 4880 C CA  . PRO C 1 196 ? -9.717  -49.109 15.442  1.00 87.82  ? 480 PRO C CA  1 
ATOM 4881 C C   . PRO C 1 196 ? -10.914 -49.111 14.480  1.00 85.37  ? 480 PRO C C   1 
ATOM 4882 O O   . PRO C 1 196 ? -10.932 -49.858 13.498  1.00 84.47  ? 480 PRO C O   1 
ATOM 4883 C CB  . PRO C 1 196 ? -10.008 -49.872 16.729  1.00 88.10  ? 480 PRO C CB  1 
ATOM 4884 C CG  . PRO C 1 196 ? -10.638 -48.814 17.584  1.00 88.22  ? 480 PRO C CG  1 
ATOM 4885 C CD  . PRO C 1 196 ? -9.749  -47.607 17.344  1.00 88.77  ? 480 PRO C CD  1 
ATOM 4886 N N   . ALA C 1 197 ? -11.899 -48.264 14.764  1.00 82.86  ? 481 ALA C N   1 
ATOM 4887 C CA  . ALA C 1 197 ? -13.116 -48.176 13.960  1.00 81.23  ? 481 ALA C CA  1 
ATOM 4888 C C   . ALA C 1 197 ? -12.954 -47.606 12.545  1.00 80.23  ? 481 ALA C C   1 
ATOM 4889 O O   . ALA C 1 197 ? -13.807 -46.846 12.082  1.00 82.04  ? 481 ALA C O   1 
ATOM 4890 C CB  . ALA C 1 197 ? -14.172 -47.369 14.722  1.00 80.65  ? 481 ALA C CB  1 
ATOM 4891 N N   . ILE C 1 198 ? -11.877 -47.972 11.856  1.00 76.89  ? 482 ILE C N   1 
ATOM 4892 C CA  . ILE C 1 198 ? -11.645 -47.482 10.495  1.00 72.56  ? 482 ILE C CA  1 
ATOM 4893 C C   . ILE C 1 198 ? -10.808 -48.462 9.690   1.00 70.54  ? 482 ILE C C   1 
ATOM 4894 O O   . ILE C 1 198 ? -9.939  -49.149 10.235  1.00 70.01  ? 482 ILE C O   1 
ATOM 4895 C CB  . ILE C 1 198 ? -10.922 -46.106 10.488  1.00 70.84  ? 482 ILE C CB  1 
ATOM 4896 C CG1 . ILE C 1 198 ? -11.870 -45.011 10.980  1.00 68.15  ? 482 ILE C CG1 1 
ATOM 4897 C CG2 . ILE C 1 198 ? -10.433 -45.777 9.081   1.00 68.85  ? 482 ILE C CG2 1 
ATOM 4898 C CD1 . ILE C 1 198 ? -11.214 -43.662 11.152  1.00 65.42  ? 482 ILE C CD1 1 
ATOM 4899 N N   . SER C 1 199 ? -11.077 -48.517 8.389   1.00 67.32  ? 483 SER C N   1 
ATOM 4900 C CA  . SER C 1 199 ? -10.353 -49.404 7.490   1.00 63.77  ? 483 SER C CA  1 
ATOM 4901 C C   . SER C 1 199 ? -9.282  -48.647 6.706   1.00 60.81  ? 483 SER C C   1 
ATOM 4902 O O   . SER C 1 199 ? -9.483  -47.505 6.285   1.00 60.19  ? 483 SER C O   1 
ATOM 4903 C CB  . SER C 1 199 ? -11.332 -50.089 6.530   1.00 63.95  ? 483 SER C CB  1 
ATOM 4904 O OG  . SER C 1 199 ? -12.210 -49.150 5.933   1.00 64.09  ? 483 SER C OG  1 
ATOM 4905 N N   . LEU C 1 200 ? -8.139  -49.298 6.525   1.00 57.03  ? 484 LEU C N   1 
ATOM 4906 C CA  . LEU C 1 200 ? -7.016  -48.714 5.807   1.00 53.17  ? 484 LEU C CA  1 
ATOM 4907 C C   . LEU C 1 200 ? -6.835  -49.467 4.495   1.00 49.30  ? 484 LEU C C   1 
ATOM 4908 O O   . LEU C 1 200 ? -7.222  -50.627 4.385   1.00 47.53  ? 484 LEU C O   1 
ATOM 4909 C CB  . LEU C 1 200 ? -5.754  -48.836 6.655   1.00 56.50  ? 484 LEU C CB  1 
ATOM 4910 C CG  . LEU C 1 200 ? -4.629  -47.850 6.352   1.00 59.00  ? 484 LEU C CG  1 
ATOM 4911 C CD1 . LEU C 1 200 ? -5.121  -46.440 6.629   1.00 58.75  ? 484 LEU C CD1 1 
ATOM 4912 C CD2 . LEU C 1 200 ? -3.412  -48.172 7.214   1.00 59.42  ? 484 LEU C CD2 1 
ATOM 4913 N N   . SER C 1 201 ? -6.240  -48.821 3.500   1.00 46.43  ? 485 SER C N   1 
ATOM 4914 C CA  . SER C 1 201 ? -6.056  -49.481 2.214   1.00 43.59  ? 485 SER C CA  1 
ATOM 4915 C C   . SER C 1 201 ? -4.900  -48.900 1.395   1.00 42.87  ? 485 SER C C   1 
ATOM 4916 O O   . SER C 1 201 ? -4.653  -47.695 1.423   1.00 42.05  ? 485 SER C O   1 
ATOM 4917 C CB  . SER C 1 201 ? -7.360  -49.394 1.418   1.00 40.77  ? 485 SER C CB  1 
ATOM 4918 O OG  . SER C 1 201 ? -7.393  -50.355 0.381   1.00 41.03  ? 485 SER C OG  1 
ATOM 4919 N N   . ALA C 1 202 ? -4.200  -49.770 0.666   1.00 42.52  ? 486 ALA C N   1 
ATOM 4920 C CA  . ALA C 1 202 ? -3.066  -49.368 -0.172  1.00 42.76  ? 486 ALA C CA  1 
ATOM 4921 C C   . ALA C 1 202 ? -3.488  -48.949 -1.595  1.00 42.63  ? 486 ALA C C   1 
ATOM 4922 O O   . ALA C 1 202 ? -4.454  -49.487 -2.153  1.00 42.15  ? 486 ALA C O   1 
ATOM 4923 C CB  . ALA C 1 202 ? -2.051  -50.507 -0.239  1.00 41.07  ? 486 ALA C CB  1 
ATOM 4924 N N   . ALA C 1 203 ? -2.755  -47.995 -2.176  1.00 42.53  ? 487 ALA C N   1 
ATOM 4925 C CA  . ALA C 1 203 ? -3.049  -47.489 -3.524  1.00 42.26  ? 487 ALA C CA  1 
ATOM 4926 C C   . ALA C 1 203 ? -2.863  -48.532 -4.624  1.00 41.84  ? 487 ALA C C   1 
ATOM 4927 O O   . ALA C 1 203 ? -2.011  -49.420 -4.518  1.00 42.30  ? 487 ALA C O   1 
ATOM 4928 C CB  . ALA C 1 203 ? -2.190  -46.274 -3.826  1.00 38.78  ? 487 ALA C CB  1 
ATOM 4929 N N   . ALA C 1 204 ? -3.656  -48.409 -5.685  1.00 39.99  ? 488 ALA C N   1 
ATOM 4930 C CA  . ALA C 1 204 ? -3.587  -49.345 -6.799  1.00 40.91  ? 488 ALA C CA  1 
ATOM 4931 C C   . ALA C 1 204 ? -2.321  -49.160 -7.628  1.00 42.80  ? 488 ALA C C   1 
ATOM 4932 O O   . ALA C 1 204 ? -1.725  -50.133 -8.093  1.00 44.62  ? 488 ALA C O   1 
ATOM 4933 C CB  . ALA C 1 204 ? -4.812  -49.193 -7.680  1.00 39.23  ? 488 ALA C CB  1 
ATOM 4934 N N   . GLY C 1 205 ? -1.904  -47.912 -7.804  1.00 44.30  ? 489 GLY C N   1 
ATOM 4935 C CA  . GLY C 1 205 ? -0.715  -47.640 -8.592  1.00 44.01  ? 489 GLY C CA  1 
ATOM 4936 C C   . GLY C 1 205 ? 0.585   -47.585 -7.810  1.00 44.24  ? 489 GLY C C   1 
ATOM 4937 O O   . GLY C 1 205 ? 1.508   -46.867 -8.196  1.00 43.93  ? 489 GLY C O   1 
ATOM 4938 N N   . ILE C 1 206 ? 0.671   -48.346 -6.723  1.00 44.05  ? 490 ILE C N   1 
ATOM 4939 C CA  . ILE C 1 206 ? 1.877   -48.357 -5.904  1.00 44.04  ? 490 ILE C CA  1 
ATOM 4940 C C   . ILE C 1 206 ? 3.101   -48.715 -6.740  1.00 43.09  ? 490 ILE C C   1 
ATOM 4941 O O   . ILE C 1 206 ? 3.112   -49.736 -7.428  1.00 42.50  ? 490 ILE C O   1 
ATOM 4942 C CB  . ILE C 1 206 ? 1.748   -49.359 -4.734  1.00 45.29  ? 490 ILE C CB  1 
ATOM 4943 C CG1 . ILE C 1 206 ? 1.393   -50.747 -5.266  1.00 47.70  ? 490 ILE C CG1 1 
ATOM 4944 C CG2 . ILE C 1 206 ? 0.695   -48.878 -3.746  1.00 45.00  ? 490 ILE C CG2 1 
ATOM 4945 C CD1 . ILE C 1 206 ? 2.597   -51.615 -5.568  1.00 49.00  ? 490 ILE C CD1 1 
ATOM 4946 N N   . GLY C 1 207 ? 4.116   -47.854 -6.692  1.00 41.19  ? 491 GLY C N   1 
ATOM 4947 C CA  . GLY C 1 207 ? 5.345   -48.083 -7.437  1.00 38.03  ? 491 GLY C CA  1 
ATOM 4948 C C   . GLY C 1 207 ? 5.222   -48.302 -8.938  1.00 35.39  ? 491 GLY C C   1 
ATOM 4949 O O   . GLY C 1 207 ? 6.192   -48.699 -9.587  1.00 35.20  ? 491 GLY C O   1 
ATOM 4950 N N   . VAL C 1 208 ? 4.043   -48.036 -9.496  1.00 31.83  ? 492 VAL C N   1 
ATOM 4951 C CA  . VAL C 1 208 ? 3.811   -48.219 -10.923 1.00 27.66  ? 492 VAL C CA  1 
ATOM 4952 C C   . VAL C 1 208 ? 4.592   -47.265 -11.816 1.00 27.09  ? 492 VAL C C   1 
ATOM 4953 O O   . VAL C 1 208 ? 4.869   -47.586 -12.966 1.00 29.57  ? 492 VAL C O   1 
ATOM 4954 C CB  . VAL C 1 208 ? 2.312   -48.079 -11.264 1.00 26.61  ? 492 VAL C CB  1 
ATOM 4955 C CG1 . VAL C 1 208 ? 2.094   -48.125 -12.781 1.00 22.40  ? 492 VAL C CG1 1 
ATOM 4956 C CG2 . VAL C 1 208 ? 1.540   -49.194 -10.599 1.00 27.72  ? 492 VAL C CG2 1 
ATOM 4957 N N   . ASP C 1 209 ? 4.959   -46.096 -11.310 1.00 23.65  ? 493 ASP C N   1 
ATOM 4958 C CA  . ASP C 1 209 ? 5.688   -45.169 -12.156 1.00 23.28  ? 493 ASP C CA  1 
ATOM 4959 C C   . ASP C 1 209 ? 7.107   -45.642 -12.408 1.00 23.95  ? 493 ASP C C   1 
ATOM 4960 O O   . ASP C 1 209 ? 7.514   -45.858 -13.547 1.00 25.93  ? 493 ASP C O   1 
ATOM 4961 C CB  . ASP C 1 209 ? 5.734   -43.781 -11.539 1.00 22.69  ? 493 ASP C CB  1 
ATOM 4962 C CG  . ASP C 1 209 ? 6.048   -42.722 -12.561 1.00 23.90  ? 493 ASP C CG  1 
ATOM 4963 O OD1 . ASP C 1 209 ? 5.102   -42.199 -13.188 1.00 23.18  ? 493 ASP C OD1 1 
ATOM 4964 O OD2 . ASP C 1 209 ? 7.245   -42.435 -12.758 1.00 27.95  ? 493 ASP C OD2 1 
ATOM 4965 N N   . ASP C 1 210 ? 7.862   -45.792 -11.333 1.00 23.42  ? 494 ASP C N   1 
ATOM 4966 C CA  . ASP C 1 210 ? 9.237   -46.244 -11.425 1.00 22.15  ? 494 ASP C CA  1 
ATOM 4967 C C   . ASP C 1 210 ? 9.360   -47.523 -12.258 1.00 20.81  ? 494 ASP C C   1 
ATOM 4968 O O   . ASP C 1 210 ? 10.401  -47.784 -12.861 1.00 20.98  ? 494 ASP C O   1 
ATOM 4969 C CB  . ASP C 1 210 ? 9.786   -46.465 -10.014 1.00 24.18  ? 494 ASP C CB  1 
ATOM 4970 C CG  . ASP C 1 210 ? 9.942   -45.166 -9.242  1.00 23.62  ? 494 ASP C CG  1 
ATOM 4971 O OD1 . ASP C 1 210 ? 10.972  -44.488 -9.431  1.00 25.60  ? 494 ASP C OD1 1 
ATOM 4972 O OD2 . ASP C 1 210 ? 9.033   -44.816 -8.463  1.00 23.13  ? 494 ASP C OD2 1 
ATOM 4973 N N   . LEU C 1 211 ? 8.299   -48.321 -12.294 1.00 18.94  ? 495 LEU C N   1 
ATOM 4974 C CA  . LEU C 1 211 ? 8.326   -49.557 -13.068 1.00 17.75  ? 495 LEU C CA  1 
ATOM 4975 C C   . LEU C 1 211 ? 8.272   -49.285 -14.565 1.00 17.40  ? 495 LEU C C   1 
ATOM 4976 O O   . LEU C 1 211 ? 9.168   -49.684 -15.306 1.00 17.52  ? 495 LEU C O   1 
ATOM 4977 C CB  . LEU C 1 211 ? 7.169   -50.475 -12.659 1.00 16.92  ? 495 LEU C CB  1 
ATOM 4978 C CG  . LEU C 1 211 ? 7.330   -51.085 -11.262 1.00 18.23  ? 495 LEU C CG  1 
ATOM 4979 C CD1 . LEU C 1 211 ? 6.065   -51.791 -10.859 1.00 19.40  ? 495 LEU C CD1 1 
ATOM 4980 C CD2 . LEU C 1 211 ? 8.491   -52.056 -11.256 1.00 19.71  ? 495 LEU C CD2 1 
ATOM 4981 N N   . ARG C 1 212 ? 7.228   -48.600 -15.010 1.00 17.01  ? 496 ARG C N   1 
ATOM 4982 C CA  . ARG C 1 212 ? 7.095   -48.298 -16.423 1.00 16.74  ? 496 ARG C CA  1 
ATOM 4983 C C   . ARG C 1 212 ? 8.330   -47.558 -16.959 1.00 18.09  ? 496 ARG C C   1 
ATOM 4984 O O   . ARG C 1 212 ? 8.636   -47.644 -18.150 1.00 18.64  ? 496 ARG C O   1 
ATOM 4985 C CB  . ARG C 1 212 ? 5.807   -47.496 -16.668 1.00 15.87  ? 496 ARG C CB  1 
ATOM 4986 C CG  . ARG C 1 212 ? 5.711   -46.157 -15.927 1.00 15.23  ? 496 ARG C CG  1 
ATOM 4987 C CD  . ARG C 1 212 ? 6.151   -44.987 -16.803 1.00 12.54  ? 496 ARG C CD  1 
ATOM 4988 N NE  . ARG C 1 212 ? 6.126   -43.714 -16.086 1.00 10.58  ? 496 ARG C NE  1 
ATOM 4989 C CZ  . ARG C 1 212 ? 6.440   -42.541 -16.632 1.00 10.55  ? 496 ARG C CZ  1 
ATOM 4990 N NH1 . ARG C 1 212 ? 6.806   -42.471 -17.908 1.00 5.45   ? 496 ARG C NH1 1 
ATOM 4991 N NH2 . ARG C 1 212 ? 6.390   -41.434 -15.902 1.00 9.52   ? 496 ARG C NH2 1 
ATOM 4992 N N   . ARG C 1 213 ? 9.050   -46.848 -16.089 1.00 16.44  ? 497 ARG C N   1 
ATOM 4993 C CA  . ARG C 1 213 ? 10.250  -46.131 -16.524 1.00 16.04  ? 497 ARG C CA  1 
ATOM 4994 C C   . ARG C 1 213 ? 11.326  -47.101 -16.978 1.00 14.72  ? 497 ARG C C   1 
ATOM 4995 O O   . ARG C 1 213 ? 12.158  -46.767 -17.812 1.00 13.82  ? 497 ARG C O   1 
ATOM 4996 C CB  . ARG C 1 213 ? 10.822  -45.266 -15.406 1.00 17.56  ? 497 ARG C CB  1 
ATOM 4997 C CG  . ARG C 1 213 ? 10.096  -43.962 -15.163 1.00 20.56  ? 497 ARG C CG  1 
ATOM 4998 C CD  . ARG C 1 213 ? 10.837  -43.163 -14.116 1.00 24.11  ? 497 ARG C CD  1 
ATOM 4999 N NE  . ARG C 1 213 ? 10.066  -42.032 -13.622 1.00 28.58  ? 497 ARG C NE  1 
ATOM 5000 C CZ  . ARG C 1 213 ? 9.701   -40.996 -14.366 1.00 31.63  ? 497 ARG C CZ  1 
ATOM 5001 N NH1 . ARG C 1 213 ? 10.038  -40.950 -15.649 1.00 33.39  ? 497 ARG C NH1 1 
ATOM 5002 N NH2 . ARG C 1 213 ? 9.008   -40.003 -13.825 1.00 32.60  ? 497 ARG C NH2 1 
ATOM 5003 N N   . LEU C 1 214 ? 11.311  -48.300 -16.406 1.00 14.18  ? 498 LEU C N   1 
ATOM 5004 C CA  . LEU C 1 214 ? 12.268  -49.346 -16.757 1.00 13.08  ? 498 LEU C CA  1 
ATOM 5005 C C   . LEU C 1 214 ? 12.041  -49.835 -18.184 1.00 14.89  ? 498 LEU C C   1 
ATOM 5006 O O   . LEU C 1 214 ? 12.867  -50.573 -18.734 1.00 17.87  ? 498 LEU C O   1 
ATOM 5007 C CB  . LEU C 1 214 ? 12.104  -50.544 -15.827 1.00 9.11   ? 498 LEU C CB  1 
ATOM 5008 C CG  . LEU C 1 214 ? 12.411  -50.316 -14.363 1.00 9.80   ? 498 LEU C CG  1 
ATOM 5009 C CD1 . LEU C 1 214 ? 12.046  -51.556 -13.550 1.00 5.21   ? 498 LEU C CD1 1 
ATOM 5010 C CD2 . LEU C 1 214 ? 13.888  -49.968 -14.245 1.00 11.84  ? 498 LEU C CD2 1 
ATOM 5011 N N   . CYS C 1 215 ? 10.917  -49.434 -18.772 1.00 12.66  ? 499 CYS C N   1 
ATOM 5012 C CA  . CYS C 1 215 ? 10.559  -49.862 -20.118 1.00 10.68  ? 499 CYS C CA  1 
ATOM 5013 C C   . CYS C 1 215 ? 10.693  -48.743 -21.153 1.00 10.30  ? 499 CYS C C   1 
ATOM 5014 O O   . CYS C 1 215 ? 10.330  -48.913 -22.316 1.00 10.27  ? 499 CYS C O   1 
ATOM 5015 C CB  . CYS C 1 215 ? 9.122   -50.403 -20.110 1.00 11.78  ? 499 CYS C CB  1 
ATOM 5016 S SG  . CYS C 1 215 ? 8.771   -51.710 -18.860 1.00 10.63  ? 499 CYS C SG  1 
ATOM 5017 N N   . ILE C 1 216 ? 11.230  -47.606 -20.724 1.00 8.55   ? 500 ILE C N   1 
ATOM 5018 C CA  . ILE C 1 216 ? 11.402  -46.450 -21.597 1.00 7.95   ? 500 ILE C CA  1 
ATOM 5019 C C   . ILE C 1 216 ? 12.875  -46.053 -21.748 1.00 10.14  ? 500 ILE C C   1 
ATOM 5020 O O   . ILE C 1 216 ? 13.666  -46.177 -20.813 1.00 12.57  ? 500 ILE C O   1 
ATOM 5021 C CB  . ILE C 1 216 ? 10.624  -45.236 -21.038 1.00 7.40   ? 500 ILE C CB  1 
ATOM 5022 C CG1 . ILE C 1 216 ? 9.140   -45.586 -20.911 1.00 7.22   ? 500 ILE C CG1 1 
ATOM 5023 C CG2 . ILE C 1 216 ? 10.840  -44.010 -21.924 1.00 5.38   ? 500 ILE C CG2 1 
ATOM 5024 C CD1 . ILE C 1 216 ? 8.333   -44.554 -20.132 1.00 7.63   ? 500 ILE C CD1 1 
ATOM 5025 N N   . LEU C 1 217 ? 13.232  -45.571 -22.934 1.00 10.88  ? 501 LEU C N   1 
ATOM 5026 C CA  . LEU C 1 217 ? 14.592  -45.135 -23.227 1.00 10.34  ? 501 LEU C CA  1 
ATOM 5027 C C   . LEU C 1 217 ? 14.541  -43.665 -23.601 1.00 11.67  ? 501 LEU C C   1 
ATOM 5028 O O   . LEU C 1 217 ? 13.535  -43.187 -24.115 1.00 14.40  ? 501 LEU C O   1 
ATOM 5029 C CB  . LEU C 1 217 ? 15.163  -45.924 -24.404 1.00 9.08   ? 501 LEU C CB  1 
ATOM 5030 C CG  . LEU C 1 217 ? 15.328  -47.434 -24.233 1.00 7.08   ? 501 LEU C CG  1 
ATOM 5031 C CD1 . LEU C 1 217 ? 15.663  -48.092 -25.576 1.00 2.16   ? 501 LEU C CD1 1 
ATOM 5032 C CD2 . LEU C 1 217 ? 16.415  -47.681 -23.199 1.00 5.40   ? 501 LEU C CD2 1 
ATOM 5033 N N   . ARG C 1 218 ? 15.620  -42.945 -23.334 1.00 11.96  ? 502 ARG C N   1 
ATOM 5034 C CA  . ARG C 1 218 ? 15.684  -41.532 -23.673 1.00 13.00  ? 502 ARG C CA  1 
ATOM 5035 C C   . ARG C 1 218 ? 17.054  -41.205 -24.232 1.00 14.79  ? 502 ARG C C   1 
ATOM 5036 O O   . ARG C 1 218 ? 18.062  -41.609 -23.659 1.00 17.82  ? 502 ARG C O   1 
ATOM 5037 C CB  . ARG C 1 218 ? 15.450  -40.674 -22.437 1.00 12.83  ? 502 ARG C CB  1 
ATOM 5038 C CG  . ARG C 1 218 ? 14.033  -40.604 -21.985 1.00 14.33  ? 502 ARG C CG  1 
ATOM 5039 C CD  . ARG C 1 218 ? 13.924  -39.645 -20.833 1.00 19.65  ? 502 ARG C CD  1 
ATOM 5040 N NE  . ARG C 1 218 ? 12.544  -39.507 -20.391 1.00 28.05  ? 502 ARG C NE  1 
ATOM 5041 C CZ  . ARG C 1 218 ? 12.164  -38.781 -19.347 1.00 31.39  ? 502 ARG C CZ  1 
ATOM 5042 N NH1 . ARG C 1 218 ? 13.070  -38.125 -18.636 1.00 33.31  ? 502 ARG C NH1 1 
ATOM 5043 N NH2 . ARG C 1 218 ? 10.879  -38.715 -19.011 1.00 33.38  ? 502 ARG C NH2 1 
ATOM 5044 N N   . MET C 1 219 ? 17.109  -40.490 -25.347 1.00 14.73  ? 503 MET C N   1 
ATOM 5045 C CA  . MET C 1 219 ? 18.410  -40.128 -25.884 1.00 17.98  ? 503 MET C CA  1 
ATOM 5046 C C   . MET C 1 219 ? 18.426  -38.720 -26.436 1.00 19.39  ? 503 MET C C   1 
ATOM 5047 O O   . MET C 1 219 ? 17.501  -38.308 -27.133 1.00 23.18  ? 503 MET C O   1 
ATOM 5048 C CB  . MET C 1 219 ? 18.843  -41.094 -26.971 1.00 18.16  ? 503 MET C CB  1 
ATOM 5049 C CG  . MET C 1 219 ? 18.279  -40.795 -28.326 1.00 18.96  ? 503 MET C CG  1 
ATOM 5050 S SD  . MET C 1 219 ? 19.407  -41.435 -29.549 1.00 20.23  ? 503 MET C SD  1 
ATOM 5051 C CE  . MET C 1 219 ? 19.376  -43.224 -29.131 1.00 15.52  ? 503 MET C CE  1 
ATOM 5052 N N   . SER C 1 220 ? 19.485  -37.985 -26.117 1.00 18.83  ? 504 SER C N   1 
ATOM 5053 C CA  . SER C 1 220 ? 19.629  -36.617 -26.580 1.00 20.10  ? 504 SER C CA  1 
ATOM 5054 C C   . SER C 1 220 ? 20.657  -36.529 -27.687 1.00 22.46  ? 504 SER C C   1 
ATOM 5055 O O   . SER C 1 220 ? 21.779  -37.000 -27.526 1.00 25.02  ? 504 SER C O   1 
ATOM 5056 C CB  . SER C 1 220 ? 20.067  -35.710 -25.439 1.00 17.94  ? 504 SER C CB  1 
ATOM 5057 O OG  . SER C 1 220 ? 20.399  -34.429 -25.939 1.00 18.50  ? 504 SER C OG  1 
ATOM 5058 N N   . PHE C 1 221 ? 20.276  -35.929 -28.810 1.00 22.97  ? 505 PHE C N   1 
ATOM 5059 C CA  . PHE C 1 221 ? 21.199  -35.767 -29.931 1.00 23.33  ? 505 PHE C CA  1 
ATOM 5060 C C   . PHE C 1 221 ? 22.088  -34.548 -29.658 1.00 24.45  ? 505 PHE C C   1 
ATOM 5061 O O   . PHE C 1 221 ? 21.670  -33.613 -28.966 1.00 27.04  ? 505 PHE C O   1 
ATOM 5062 C CB  . PHE C 1 221 ? 20.428  -35.527 -31.230 1.00 20.55  ? 505 PHE C CB  1 
ATOM 5063 C CG  . PHE C 1 221 ? 19.588  -36.687 -31.675 1.00 19.07  ? 505 PHE C CG  1 
ATOM 5064 C CD1 . PHE C 1 221 ? 20.116  -37.667 -32.514 1.00 19.71  ? 505 PHE C CD1 1 
ATOM 5065 C CD2 . PHE C 1 221 ? 18.257  -36.788 -31.280 1.00 17.02  ? 505 PHE C CD2 1 
ATOM 5066 C CE1 . PHE C 1 221 ? 19.330  -38.728 -32.957 1.00 18.32  ? 505 PHE C CE1 1 
ATOM 5067 C CE2 . PHE C 1 221 ? 17.462  -37.844 -31.715 1.00 14.96  ? 505 PHE C CE2 1 
ATOM 5068 C CZ  . PHE C 1 221 ? 17.996  -38.815 -32.554 1.00 16.50  ? 505 PHE C CZ  1 
ATOM 5069 N N   . VAL C 1 222 ? 23.307  -34.571 -30.196 1.00 22.90  ? 506 VAL C N   1 
ATOM 5070 C CA  . VAL C 1 222 ? 24.269  -33.471 -30.058 1.00 22.79  ? 506 VAL C CA  1 
ATOM 5071 C C   . VAL C 1 222 ? 24.752  -33.077 -28.652 1.00 24.20  ? 506 VAL C C   1 
ATOM 5072 O O   . VAL C 1 222 ? 25.954  -33.118 -28.371 1.00 25.09  ? 506 VAL C O   1 
ATOM 5073 C CB  . VAL C 1 222 ? 23.737  -32.184 -30.735 1.00 19.58  ? 506 VAL C CB  1 
ATOM 5074 C CG1 . VAL C 1 222 ? 24.821  -31.126 -30.764 1.00 17.49  ? 506 VAL C CG1 1 
ATOM 5075 C CG2 . VAL C 1 222 ? 23.270  -32.492 -32.140 1.00 19.61  ? 506 VAL C CG2 1 
ATOM 5076 N N   . LYS C 1 223 ? 23.824  -32.685 -27.781 1.00 23.87  ? 507 LYS C N   1 
ATOM 5077 C CA  . LYS C 1 223 ? 24.165  -32.245 -26.430 1.00 21.68  ? 507 LYS C CA  1 
ATOM 5078 C C   . LYS C 1 223 ? 23.847  -33.245 -25.327 1.00 22.00  ? 507 LYS C C   1 
ATOM 5079 O O   . LYS C 1 223 ? 22.784  -33.863 -25.314 1.00 22.53  ? 507 LYS C O   1 
ATOM 5080 C CB  . LYS C 1 223 ? 23.430  -30.949 -26.119 1.00 20.76  ? 507 LYS C CB  1 
ATOM 5081 C CG  . LYS C 1 223 ? 23.380  -29.968 -27.274 1.00 23.96  ? 507 LYS C CG  1 
ATOM 5082 C CD  . LYS C 1 223 ? 24.756  -29.407 -27.594 1.00 25.56  ? 507 LYS C CD  1 
ATOM 5083 C CE  . LYS C 1 223 ? 24.677  -28.374 -28.702 1.00 25.73  ? 507 LYS C CE  1 
ATOM 5084 N NZ  . LYS C 1 223 ? 25.988  -27.732 -28.965 1.00 29.40  ? 507 LYS C NZ  1 
ATOM 5085 N N   . GLY C 1 224 ? 24.777  -33.387 -24.392 1.00 22.33  ? 508 GLY C N   1 
ATOM 5086 C CA  . GLY C 1 224 ? 24.568  -34.284 -23.274 1.00 20.92  ? 508 GLY C CA  1 
ATOM 5087 C C   . GLY C 1 224 ? 24.067  -33.482 -22.091 1.00 21.04  ? 508 GLY C C   1 
ATOM 5088 O O   . GLY C 1 224 ? 23.825  -32.286 -22.209 1.00 22.66  ? 508 GLY C O   1 
ATOM 5089 N N   . TRP C 1 225 ? 23.909  -34.130 -20.945 1.00 23.42  ? 509 TRP C N   1 
ATOM 5090 C CA  . TRP C 1 225 ? 23.441  -33.440 -19.747 1.00 24.13  ? 509 TRP C CA  1 
ATOM 5091 C C   . TRP C 1 225 ? 24.063  -34.066 -18.494 1.00 25.21  ? 509 TRP C C   1 
ATOM 5092 O O   . TRP C 1 225 ? 24.654  -35.140 -18.552 1.00 24.95  ? 509 TRP C O   1 
ATOM 5093 C CB  . TRP C 1 225 ? 21.906  -33.478 -19.685 1.00 18.83  ? 509 TRP C CB  1 
ATOM 5094 C CG  . TRP C 1 225 ? 21.331  -34.802 -19.307 1.00 18.05  ? 509 TRP C CG  1 
ATOM 5095 C CD1 . TRP C 1 225 ? 20.982  -35.210 -18.056 1.00 18.48  ? 509 TRP C CD1 1 
ATOM 5096 C CD2 . TRP C 1 225 ? 21.019  -35.892 -20.188 1.00 17.16  ? 509 TRP C CD2 1 
ATOM 5097 N NE1 . TRP C 1 225 ? 20.462  -36.486 -18.097 1.00 19.45  ? 509 TRP C NE1 1 
ATOM 5098 C CE2 . TRP C 1 225 ? 20.473  -36.928 -19.393 1.00 15.73  ? 509 TRP C CE2 1 
ATOM 5099 C CE3 . TRP C 1 225 ? 21.146  -36.094 -21.569 1.00 13.70  ? 509 TRP C CE3 1 
ATOM 5100 C CZ2 . TRP C 1 225 ? 20.054  -38.146 -19.932 1.00 11.66  ? 509 TRP C CZ2 1 
ATOM 5101 C CZ3 . TRP C 1 225 ? 20.732  -37.304 -22.104 1.00 14.13  ? 509 TRP C CZ3 1 
ATOM 5102 C CH2 . TRP C 1 225 ? 20.190  -38.316 -21.284 1.00 13.24  ? 509 TRP C CH2 1 
ATOM 5103 N N   . GLY C 1 226 ? 23.942  -33.382 -17.366 1.00 27.95  ? 510 GLY C N   1 
ATOM 5104 C CA  . GLY C 1 226 ? 24.515  -33.892 -16.137 1.00 33.71  ? 510 GLY C CA  1 
ATOM 5105 C C   . GLY C 1 226 ? 25.467  -32.876 -15.532 1.00 38.80  ? 510 GLY C C   1 
ATOM 5106 O O   . GLY C 1 226 ? 25.553  -31.744 -16.014 1.00 38.28  ? 510 GLY C O   1 
ATOM 5107 N N   . PRO C 1 227 ? 26.200  -33.249 -14.470 1.00 41.93  ? 511 PRO C N   1 
ATOM 5108 C CA  . PRO C 1 227 ? 27.146  -32.341 -13.815 1.00 43.33  ? 511 PRO C CA  1 
ATOM 5109 C C   . PRO C 1 227 ? 28.105  -31.659 -14.798 1.00 45.59  ? 511 PRO C C   1 
ATOM 5110 O O   . PRO C 1 227 ? 28.171  -30.432 -14.865 1.00 46.60  ? 511 PRO C O   1 
ATOM 5111 C CB  . PRO C 1 227 ? 27.874  -33.262 -12.836 1.00 41.37  ? 511 PRO C CB  1 
ATOM 5112 C CG  . PRO C 1 227 ? 26.822  -34.246 -12.465 1.00 39.25  ? 511 PRO C CG  1 
ATOM 5113 C CD  . PRO C 1 227 ? 26.198  -34.564 -13.804 1.00 41.90  ? 511 PRO C CD  1 
ATOM 5114 N N   . ASP C 1 228 ? 28.839  -32.462 -15.562 1.00 46.91  ? 512 ASP C N   1 
ATOM 5115 C CA  . ASP C 1 228 ? 29.801  -31.941 -16.526 1.00 49.44  ? 512 ASP C CA  1 
ATOM 5116 C C   . ASP C 1 228 ? 29.161  -31.169 -17.671 1.00 48.30  ? 512 ASP C C   1 
ATOM 5117 O O   . ASP C 1 228 ? 29.850  -30.757 -18.609 1.00 49.15  ? 512 ASP C O   1 
ATOM 5118 C CB  . ASP C 1 228 ? 30.625  -33.086 -17.117 1.00 55.31  ? 512 ASP C CB  1 
ATOM 5119 C CG  . ASP C 1 228 ? 31.522  -33.746 -16.097 1.00 60.31  ? 512 ASP C CG  1 
ATOM 5120 O OD1 . ASP C 1 228 ? 30.996  -34.233 -15.071 1.00 63.71  ? 512 ASP C OD1 1 
ATOM 5121 O OD2 . ASP C 1 228 ? 32.752  -33.778 -16.324 1.00 61.55  ? 512 ASP C OD2 1 
ATOM 5122 N N   . TYR C 1 229 ? 27.852  -30.965 -17.600 1.00 44.54  ? 513 TYR C N   1 
ATOM 5123 C CA  . TYR C 1 229 ? 27.159  -30.265 -18.669 1.00 39.72  ? 513 TYR C CA  1 
ATOM 5124 C C   . TYR C 1 229 ? 26.315  -29.079 -18.224 1.00 37.84  ? 513 TYR C C   1 
ATOM 5125 O O   . TYR C 1 229 ? 25.776  -29.061 -17.116 1.00 36.08  ? 513 TYR C O   1 
ATOM 5126 C CB  . TYR C 1 229 ? 26.296  -31.265 -19.433 1.00 36.78  ? 513 TYR C CB  1 
ATOM 5127 C CG  . TYR C 1 229 ? 27.108  -32.259 -20.220 1.00 31.08  ? 513 TYR C CG  1 
ATOM 5128 C CD1 . TYR C 1 229 ? 27.658  -31.909 -21.447 1.00 27.58  ? 513 TYR C CD1 1 
ATOM 5129 C CD2 . TYR C 1 229 ? 27.363  -33.536 -19.720 1.00 30.57  ? 513 TYR C CD2 1 
ATOM 5130 C CE1 . TYR C 1 229 ? 28.445  -32.801 -22.163 1.00 27.14  ? 513 TYR C CE1 1 
ATOM 5131 C CE2 . TYR C 1 229 ? 28.155  -34.442 -20.431 1.00 29.08  ? 513 TYR C CE2 1 
ATOM 5132 C CZ  . TYR C 1 229 ? 28.694  -34.063 -21.652 1.00 28.02  ? 513 TYR C CZ  1 
ATOM 5133 O OH  . TYR C 1 229 ? 29.501  -34.925 -22.362 1.00 28.13  ? 513 TYR C OH  1 
ATOM 5134 N N   . PRO C 1 230 ? 26.194  -28.066 -19.097 1.00 36.66  ? 514 PRO C N   1 
ATOM 5135 C CA  . PRO C 1 230 ? 25.417  -26.851 -18.832 1.00 37.13  ? 514 PRO C CA  1 
ATOM 5136 C C   . PRO C 1 230 ? 23.920  -27.142 -18.864 1.00 37.74  ? 514 PRO C C   1 
ATOM 5137 O O   . PRO C 1 230 ? 23.099  -26.291 -18.530 1.00 37.29  ? 514 PRO C O   1 
ATOM 5138 C CB  . PRO C 1 230 ? 25.862  -25.913 -19.949 1.00 34.99  ? 514 PRO C CB  1 
ATOM 5139 C CG  . PRO C 1 230 ? 26.099  -26.854 -21.078 1.00 35.31  ? 514 PRO C CG  1 
ATOM 5140 C CD  . PRO C 1 230 ? 26.832  -28.000 -20.422 1.00 35.37  ? 514 PRO C CD  1 
ATOM 5141 N N   . SER C 1 231 ? 23.587  -28.362 -19.274 1.00 38.28  ? 515 SER C N   1 
ATOM 5142 C CA  . SER C 1 231 ? 22.210  -28.831 -19.357 1.00 36.98  ? 515 SER C CA  1 
ATOM 5143 C C   . SER C 1 231 ? 22.038  -29.845 -18.232 1.00 36.65  ? 515 SER C C   1 
ATOM 5144 O O   . SER C 1 231 ? 22.471  -30.985 -18.356 1.00 37.75  ? 515 SER C O   1 
ATOM 5145 C CB  . SER C 1 231 ? 21.982  -29.503 -20.711 1.00 36.55  ? 515 SER C CB  1 
ATOM 5146 O OG  . SER C 1 231 ? 20.627  -29.883 -20.868 1.00 40.09  ? 515 SER C OG  1 
ATOM 5147 N N   . GLN C 1 232 ? 21.402  -29.438 -17.139 1.00 36.24  ? 516 GLN C N   1 
ATOM 5148 C CA  . GLN C 1 232 ? 21.235  -30.329 -15.990 1.00 36.64  ? 516 GLN C CA  1 
ATOM 5149 C C   . GLN C 1 232 ? 20.344  -31.553 -16.127 1.00 33.12  ? 516 GLN C C   1 
ATOM 5150 O O   . GLN C 1 232 ? 20.458  -32.470 -15.321 1.00 33.45  ? 516 GLN C O   1 
ATOM 5151 C CB  . GLN C 1 232 ? 20.796  -29.534 -14.753 1.00 42.42  ? 516 GLN C CB  1 
ATOM 5152 C CG  . GLN C 1 232 ? 21.867  -28.580 -14.221 1.00 46.52  ? 516 GLN C CG  1 
ATOM 5153 C CD  . GLN C 1 232 ? 23.253  -29.210 -14.209 1.00 47.95  ? 516 GLN C CD  1 
ATOM 5154 O OE1 . GLN C 1 232 ? 23.504  -30.182 -13.494 1.00 48.74  ? 516 GLN C OE1 1 
ATOM 5155 N NE2 . GLN C 1 232 ? 24.157  -28.659 -15.014 1.00 49.10  ? 516 GLN C NE2 1 
ATOM 5156 N N   . SER C 1 233 ? 19.454  -31.577 -17.115 1.00 30.03  ? 517 SER C N   1 
ATOM 5157 C CA  . SER C 1 233 ? 18.576  -32.734 -17.311 1.00 27.20  ? 517 SER C CA  1 
ATOM 5158 C C   . SER C 1 233 ? 18.174  -32.855 -18.767 1.00 24.90  ? 517 SER C C   1 
ATOM 5159 O O   . SER C 1 233 ? 18.215  -31.875 -19.504 1.00 24.40  ? 517 SER C O   1 
ATOM 5160 C CB  . SER C 1 233 ? 17.326  -32.636 -16.430 1.00 28.01  ? 517 SER C CB  1 
ATOM 5161 O OG  . SER C 1 233 ? 16.569  -31.470 -16.707 1.00 32.13  ? 517 SER C OG  1 
ATOM 5162 N N   . ILE C 1 234 ? 17.784  -34.059 -19.177 1.00 23.84  ? 518 ILE C N   1 
ATOM 5163 C CA  . ILE C 1 234 ? 17.404  -34.311 -20.567 1.00 23.60  ? 518 ILE C CA  1 
ATOM 5164 C C   . ILE C 1 234 ? 16.500  -33.232 -21.125 1.00 22.35  ? 518 ILE C C   1 
ATOM 5165 O O   . ILE C 1 234 ? 16.682  -32.802 -22.260 1.00 22.96  ? 518 ILE C O   1 
ATOM 5166 C CB  . ILE C 1 234 ? 16.681  -35.676 -20.737 1.00 23.14  ? 518 ILE C CB  1 
ATOM 5167 C CG1 . ILE C 1 234 ? 16.418  -35.961 -22.212 1.00 20.88  ? 518 ILE C CG1 1 
ATOM 5168 C CG2 . ILE C 1 234 ? 15.359  -35.663 -20.017 1.00 27.30  ? 518 ILE C CG2 1 
ATOM 5169 C CD1 . ILE C 1 234 ? 17.658  -36.276 -23.010 1.00 20.45  ? 518 ILE C CD1 1 
ATOM 5170 N N   . LYS C 1 235 ? 15.539  -32.789 -20.318 1.00 20.95  ? 519 LYS C N   1 
ATOM 5171 C CA  . LYS C 1 235 ? 14.590  -31.777 -20.749 1.00 19.57  ? 519 LYS C CA  1 
ATOM 5172 C C   . LYS C 1 235 ? 15.159  -30.364 -20.791 1.00 19.46  ? 519 LYS C C   1 
ATOM 5173 O O   . LYS C 1 235 ? 14.418  -29.385 -20.863 1.00 21.16  ? 519 LYS C O   1 
ATOM 5174 C CB  . LYS C 1 235 ? 13.338  -31.817 -19.872 1.00 19.56  ? 519 LYS C CB  1 
ATOM 5175 C CG  . LYS C 1 235 ? 13.587  -31.579 -18.402 1.00 22.76  ? 519 LYS C CG  1 
ATOM 5176 C CD  . LYS C 1 235 ? 12.303  -31.172 -17.711 1.00 24.93  ? 519 LYS C CD  1 
ATOM 5177 C CE  . LYS C 1 235 ? 12.515  -30.912 -16.234 1.00 29.81  ? 519 LYS C CE  1 
ATOM 5178 N NZ  . LYS C 1 235 ? 11.262  -30.417 -15.586 1.00 32.63  ? 519 LYS C NZ  1 
ATOM 5179 N N   . GLU C 1 236 ? 16.479  -30.255 -20.747 1.00 19.79  ? 520 GLU C N   1 
ATOM 5180 C CA  . GLU C 1 236 ? 17.122  -28.954 -20.826 1.00 19.90  ? 520 GLU C CA  1 
ATOM 5181 C C   . GLU C 1 236 ? 17.977  -28.943 -22.085 1.00 19.78  ? 520 GLU C C   1 
ATOM 5182 O O   . GLU C 1 236 ? 18.732  -28.003 -22.340 1.00 19.93  ? 520 GLU C O   1 
ATOM 5183 C CB  . GLU C 1 236 ? 17.977  -28.698 -19.586 1.00 23.08  ? 520 GLU C CB  1 
ATOM 5184 C CG  . GLU C 1 236 ? 17.157  -28.407 -18.332 1.00 27.17  ? 520 GLU C CG  1 
ATOM 5185 C CD  . GLU C 1 236 ? 18.011  -28.018 -17.130 1.00 32.87  ? 520 GLU C CD  1 
ATOM 5186 O OE1 . GLU C 1 236 ? 17.429  -27.743 -16.060 1.00 35.40  ? 520 GLU C OE1 1 
ATOM 5187 O OE2 . GLU C 1 236 ? 19.257  -27.985 -17.248 1.00 35.70  ? 520 GLU C OE2 1 
ATOM 5188 N N   . THR C 1 237 ? 17.827  -30.002 -22.878 1.00 18.54  ? 521 THR C N   1 
ATOM 5189 C CA  . THR C 1 237 ? 18.553  -30.168 -24.130 1.00 15.60  ? 521 THR C CA  1 
ATOM 5190 C C   . THR C 1 237 ? 17.683  -29.758 -25.328 1.00 15.51  ? 521 THR C C   1 
ATOM 5191 O O   . THR C 1 237 ? 16.463  -29.915 -25.304 1.00 13.87  ? 521 THR C O   1 
ATOM 5192 C CB  . THR C 1 237 ? 19.010  -31.630 -24.294 1.00 14.08  ? 521 THR C CB  1 
ATOM 5193 O OG1 . THR C 1 237 ? 17.870  -32.480 -24.403 1.00 15.18  ? 521 THR C OG1 1 
ATOM 5194 C CG2 . THR C 1 237 ? 19.796  -32.072 -23.089 1.00 13.09  ? 521 THR C CG2 1 
ATOM 5195 N N   . PRO C 1 238 ? 18.312  -29.240 -26.398 1.00 17.85  ? 522 PRO C N   1 
ATOM 5196 C CA  . PRO C 1 238 ? 17.666  -28.780 -27.633 1.00 18.95  ? 522 PRO C CA  1 
ATOM 5197 C C   . PRO C 1 238 ? 16.816  -29.789 -28.401 1.00 20.90  ? 522 PRO C C   1 
ATOM 5198 O O   . PRO C 1 238 ? 15.762  -29.431 -28.930 1.00 24.05  ? 522 PRO C O   1 
ATOM 5199 C CB  . PRO C 1 238 ? 18.842  -28.284 -28.467 1.00 16.99  ? 522 PRO C CB  1 
ATOM 5200 C CG  . PRO C 1 238 ? 19.934  -29.209 -28.059 1.00 17.91  ? 522 PRO C CG  1 
ATOM 5201 C CD  . PRO C 1 238 ? 19.778  -29.224 -26.561 1.00 19.22  ? 522 PRO C CD  1 
ATOM 5202 N N   . CYS C 1 239 ? 17.266  -31.038 -28.481 1.00 18.98  ? 523 CYS C N   1 
ATOM 5203 C CA  . CYS C 1 239 ? 16.506  -32.045 -29.209 1.00 16.23  ? 523 CYS C CA  1 
ATOM 5204 C C   . CYS C 1 239 ? 16.793  -33.473 -28.765 1.00 14.79  ? 523 CYS C C   1 
ATOM 5205 O O   . CYS C 1 239 ? 17.886  -34.003 -28.977 1.00 14.74  ? 523 CYS C O   1 
ATOM 5206 C CB  . CYS C 1 239 ? 16.767  -31.893 -30.706 1.00 17.67  ? 523 CYS C CB  1 
ATOM 5207 S SG  . CYS C 1 239 ? 18.492  -31.519 -31.117 1.00 23.20  ? 523 CYS C SG  1 
ATOM 5208 N N   . TRP C 1 240 ? 15.791  -34.090 -28.147 1.00 12.32  ? 524 TRP C N   1 
ATOM 5209 C CA  . TRP C 1 240 ? 15.899  -35.458 -27.657 1.00 9.51   ? 524 TRP C CA  1 
ATOM 5210 C C   . TRP C 1 240 ? 14.637  -36.244 -27.964 1.00 10.87  ? 524 TRP C C   1 
ATOM 5211 O O   . TRP C 1 240 ? 13.632  -35.678 -28.409 1.00 13.13  ? 524 TRP C O   1 
ATOM 5212 C CB  . TRP C 1 240 ? 16.118  -35.461 -26.144 1.00 8.10   ? 524 TRP C CB  1 
ATOM 5213 C CG  . TRP C 1 240 ? 15.132  -34.614 -25.366 1.00 7.32   ? 524 TRP C CG  1 
ATOM 5214 C CD1 . TRP C 1 240 ? 15.117  -33.254 -25.269 1.00 7.42   ? 524 TRP C CD1 1 
ATOM 5215 C CD2 . TRP C 1 240 ? 14.045  -35.083 -24.553 1.00 9.91   ? 524 TRP C CD2 1 
ATOM 5216 N NE1 . TRP C 1 240 ? 14.099  -32.844 -24.445 1.00 8.61   ? 524 TRP C NE1 1 
ATOM 5217 C CE2 . TRP C 1 240 ? 13.423  -33.945 -23.992 1.00 9.67   ? 524 TRP C CE2 1 
ATOM 5218 C CE3 . TRP C 1 240 ? 13.537  -36.356 -24.244 1.00 9.47   ? 524 TRP C CE3 1 
ATOM 5219 C CZ2 . TRP C 1 240 ? 12.318  -34.039 -23.137 1.00 9.87   ? 524 TRP C CZ2 1 
ATOM 5220 C CZ3 . TRP C 1 240 ? 12.439  -36.449 -23.393 1.00 8.79   ? 524 TRP C CZ3 1 
ATOM 5221 C CH2 . TRP C 1 240 ? 11.842  -35.296 -22.850 1.00 7.92   ? 524 TRP C CH2 1 
ATOM 5222 N N   . ILE C 1 241 ? 14.682  -37.548 -27.720 1.00 7.55   ? 525 ILE C N   1 
ATOM 5223 C CA  . ILE C 1 241 ? 13.512  -38.383 -27.950 1.00 7.73   ? 525 ILE C CA  1 
ATOM 5224 C C   . ILE C 1 241 ? 13.256  -39.344 -26.789 1.00 8.12   ? 525 ILE C C   1 
ATOM 5225 O O   . ILE C 1 241 ? 14.186  -39.755 -26.097 1.00 10.65  ? 525 ILE C O   1 
ATOM 5226 C CB  . ILE C 1 241 ? 13.651  -39.219 -29.248 1.00 5.37   ? 525 ILE C CB  1 
ATOM 5227 C CG1 . ILE C 1 241 ? 14.852  -40.156 -29.144 1.00 5.94   ? 525 ILE C CG1 1 
ATOM 5228 C CG2 . ILE C 1 241 ? 13.822  -38.306 -30.440 1.00 6.79   ? 525 ILE C CG2 1 
ATOM 5229 C CD1 . ILE C 1 241 ? 14.978  -41.118 -30.301 1.00 2.71   ? 525 ILE C CD1 1 
ATOM 5230 N N   . GLU C 1 242 ? 11.989  -39.670 -26.555 1.00 8.02   ? 526 GLU C N   1 
ATOM 5231 C CA  . GLU C 1 242 ? 11.642  -40.634 -25.524 1.00 8.64   ? 526 GLU C CA  1 
ATOM 5232 C C   . GLU C 1 242 ? 11.072  -41.845 -26.277 1.00 8.64   ? 526 GLU C C   1 
ATOM 5233 O O   . GLU C 1 242 ? 10.140  -41.730 -27.068 1.00 10.02  ? 526 GLU C O   1 
ATOM 5234 C CB  . GLU C 1 242 ? 10.619  -40.062 -24.552 1.00 9.57   ? 526 GLU C CB  1 
ATOM 5235 C CG  . GLU C 1 242 ? 10.301  -41.016 -23.408 1.00 14.83  ? 526 GLU C CG  1 
ATOM 5236 C CD  . GLU C 1 242 ? 9.216   -40.489 -22.484 1.00 19.69  ? 526 GLU C CD  1 
ATOM 5237 O OE1 . GLU C 1 242 ? 8.135   -40.106 -22.990 1.00 20.93  ? 526 GLU C OE1 1 
ATOM 5238 O OE2 . GLU C 1 242 ? 9.443   -40.464 -21.253 1.00 20.01  ? 526 GLU C OE2 1 
ATOM 5239 N N   . ILE C 1 243 ? 11.646  -43.011 -26.036 1.00 8.61   ? 527 ILE C N   1 
ATOM 5240 C CA  . ILE C 1 243 ? 11.233  -44.212 -26.735 1.00 8.28   ? 527 ILE C CA  1 
ATOM 5241 C C   . ILE C 1 243 ? 10.547  -45.208 -25.811 1.00 10.14  ? 527 ILE C C   1 
ATOM 5242 O O   . ILE C 1 243 ? 11.177  -45.750 -24.906 1.00 12.33  ? 527 ILE C O   1 
ATOM 5243 C CB  . ILE C 1 243 ? 12.473  -44.880 -27.375 1.00 6.29   ? 527 ILE C CB  1 
ATOM 5244 C CG1 . ILE C 1 243 ? 13.248  -43.837 -28.186 1.00 5.06   ? 527 ILE C CG1 1 
ATOM 5245 C CG2 . ILE C 1 243 ? 12.059  -46.039 -28.263 1.00 2.16   ? 527 ILE C CG2 1 
ATOM 5246 C CD1 . ILE C 1 243 ? 14.708  -44.168 -28.369 1.00 2.16   ? 527 ILE C CD1 1 
ATOM 5247 N N   . HIS C 1 244 ? 9.258   -45.449 -26.038 1.00 9.72   ? 528 HIS C N   1 
ATOM 5248 C CA  . HIS C 1 244 ? 8.521   -46.406 -25.223 1.00 10.39  ? 528 HIS C CA  1 
ATOM 5249 C C   . HIS C 1 244 ? 8.621   -47.783 -25.862 1.00 10.19  ? 528 HIS C C   1 
ATOM 5250 O O   . HIS C 1 244 ? 8.195   -47.962 -26.999 1.00 12.12  ? 528 HIS C O   1 
ATOM 5251 C CB  . HIS C 1 244 ? 7.045   -46.012 -25.114 1.00 11.19  ? 528 HIS C CB  1 
ATOM 5252 C CG  . HIS C 1 244 ? 6.771   -44.936 -24.107 1.00 12.63  ? 528 HIS C CG  1 
ATOM 5253 N ND1 . HIS C 1 244 ? 7.202   -43.635 -24.264 1.00 16.36  ? 528 HIS C ND1 1 
ATOM 5254 C CD2 . HIS C 1 244 ? 6.116   -44.973 -22.921 1.00 11.73  ? 528 HIS C CD2 1 
ATOM 5255 C CE1 . HIS C 1 244 ? 6.827   -42.918 -23.219 1.00 15.28  ? 528 HIS C CE1 1 
ATOM 5256 N NE2 . HIS C 1 244 ? 6.167   -43.707 -22.389 1.00 13.93  ? 528 HIS C NE2 1 
ATOM 5257 N N   . LEU C 1 245 ? 9.200   -48.742 -25.136 1.00 9.66   ? 529 LEU C N   1 
ATOM 5258 C CA  . LEU C 1 245 ? 9.344   -50.126 -25.612 1.00 7.39   ? 529 LEU C CA  1 
ATOM 5259 C C   . LEU C 1 245 ? 8.018   -50.867 -25.408 1.00 7.65   ? 529 LEU C C   1 
ATOM 5260 O O   . LEU C 1 245 ? 7.609   -51.121 -24.282 1.00 10.34  ? 529 LEU C O   1 
ATOM 5261 C CB  . LEU C 1 245 ? 10.458  -50.840 -24.834 1.00 5.06   ? 529 LEU C CB  1 
ATOM 5262 C CG  . LEU C 1 245 ? 11.931  -50.555 -25.167 1.00 6.44   ? 529 LEU C CG  1 
ATOM 5263 C CD1 . LEU C 1 245 ? 12.033  -49.589 -26.337 1.00 6.94   ? 529 LEU C CD1 1 
ATOM 5264 C CD2 . LEU C 1 245 ? 12.638  -50.002 -23.948 1.00 7.04   ? 529 LEU C CD2 1 
ATOM 5265 N N   . HIS C 1 246 ? 7.343   -51.232 -26.486 1.00 7.63   ? 530 HIS C N   1 
ATOM 5266 C CA  . HIS C 1 246 ? 6.064   -51.887 -26.316 1.00 10.05  ? 530 HIS C CA  1 
ATOM 5267 C C   . HIS C 1 246 ? 6.067   -53.247 -25.642 1.00 13.88  ? 530 HIS C C   1 
ATOM 5268 O O   . HIS C 1 246 ? 5.426   -53.414 -24.607 1.00 18.55  ? 530 HIS C O   1 
ATOM 5269 C CB  . HIS C 1 246 ? 5.319   -51.936 -27.647 1.00 9.48   ? 530 HIS C CB  1 
ATOM 5270 C CG  . HIS C 1 246 ? 4.742   -50.611 -28.047 1.00 12.90  ? 530 HIS C CG  1 
ATOM 5271 N ND1 . HIS C 1 246 ? 3.633   -50.489 -28.857 1.00 16.11  ? 530 HIS C ND1 1 
ATOM 5272 C CD2 . HIS C 1 246 ? 5.105   -49.348 -27.715 1.00 12.86  ? 530 HIS C CD2 1 
ATOM 5273 C CE1 . HIS C 1 246 ? 3.335   -49.209 -29.002 1.00 16.64  ? 530 HIS C CE1 1 
ATOM 5274 N NE2 . HIS C 1 246 ? 4.213   -48.496 -28.319 1.00 12.00  ? 530 HIS C NE2 1 
ATOM 5275 N N   . ARG C 1 247 ? 6.786   -54.216 -26.192 1.00 15.77  ? 531 ARG C N   1 
ATOM 5276 C CA  . ARG C 1 247 ? 6.811   -55.545 -25.588 1.00 13.58  ? 531 ARG C CA  1 
ATOM 5277 C C   . ARG C 1 247 ? 7.120   -55.512 -24.092 1.00 9.93   ? 531 ARG C C   1 
ATOM 5278 O O   . ARG C 1 247 ? 6.532   -56.253 -23.315 1.00 8.42   ? 531 ARG C O   1 
ATOM 5279 C CB  . ARG C 1 247 ? 7.828   -56.432 -26.298 1.00 16.85  ? 531 ARG C CB  1 
ATOM 5280 C CG  . ARG C 1 247 ? 7.805   -57.866 -25.816 1.00 18.46  ? 531 ARG C CG  1 
ATOM 5281 C CD  . ARG C 1 247 ? 6.407   -58.444 -25.921 1.00 21.79  ? 531 ARG C CD  1 
ATOM 5282 N NE  . ARG C 1 247 ? 6.434   -59.904 -25.943 1.00 28.27  ? 531 ARG C NE  1 
ATOM 5283 C CZ  . ARG C 1 247 ? 5.367   -60.675 -26.125 1.00 29.52  ? 531 ARG C CZ  1 
ATOM 5284 N NH1 . ARG C 1 247 ? 4.169   -60.134 -26.298 1.00 29.76  ? 531 ARG C NH1 1 
ATOM 5285 N NH2 . ARG C 1 247 ? 5.502   -61.992 -26.158 1.00 30.96  ? 531 ARG C NH2 1 
ATOM 5286 N N   . ALA C 1 248 ? 8.046   -54.654 -23.691 1.00 6.62   ? 532 ALA C N   1 
ATOM 5287 C CA  . ALA C 1 248 ? 8.395   -54.543 -22.285 1.00 7.03   ? 532 ALA C CA  1 
ATOM 5288 C C   . ALA C 1 248 ? 7.204   -54.022 -21.497 1.00 10.01  ? 532 ALA C C   1 
ATOM 5289 O O   . ALA C 1 248 ? 6.920   -54.490 -20.395 1.00 11.15  ? 532 ALA C O   1 
ATOM 5290 C CB  . ALA C 1 248 ? 9.568   -53.607 -22.110 1.00 4.99   ? 532 ALA C CB  1 
ATOM 5291 N N   . LEU C 1 249 ? 6.502   -53.050 -22.066 1.00 12.49  ? 533 LEU C N   1 
ATOM 5292 C CA  . LEU C 1 249 ? 5.349   -52.467 -21.395 1.00 13.08  ? 533 LEU C CA  1 
ATOM 5293 C C   . LEU C 1 249 ? 4.230   -53.465 -21.168 1.00 14.80  ? 533 LEU C C   1 
ATOM 5294 O O   . LEU C 1 249 ? 3.506   -53.370 -20.172 1.00 15.39  ? 533 LEU C O   1 
ATOM 5295 C CB  . LEU C 1 249 ? 4.838   -51.262 -22.183 1.00 11.78  ? 533 LEU C CB  1 
ATOM 5296 C CG  . LEU C 1 249 ? 5.018   -49.915 -21.466 1.00 12.51  ? 533 LEU C CG  1 
ATOM 5297 C CD1 . LEU C 1 249 ? 6.053   -50.022 -20.364 1.00 11.09  ? 533 LEU C CD1 1 
ATOM 5298 C CD2 . LEU C 1 249 ? 5.431   -48.860 -22.469 1.00 13.05  ? 533 LEU C CD2 1 
ATOM 5299 N N   . GLN C 1 250 ? 4.089   -54.421 -22.084 1.00 15.09  ? 534 GLN C N   1 
ATOM 5300 C CA  . GLN C 1 250 ? 3.058   -55.439 -21.946 1.00 16.25  ? 534 GLN C CA  1 
ATOM 5301 C C   . GLN C 1 250 ? 3.430   -56.316 -20.762 1.00 18.47  ? 534 GLN C C   1 
ATOM 5302 O O   . GLN C 1 250 ? 2.642   -56.503 -19.833 1.00 18.89  ? 534 GLN C O   1 
ATOM 5303 C CB  . GLN C 1 250 ? 2.967   -56.294 -23.207 1.00 17.63  ? 534 GLN C CB  1 
ATOM 5304 C CG  . GLN C 1 250 ? 2.653   -55.509 -24.469 1.00 23.40  ? 534 GLN C CG  1 
ATOM 5305 C CD  . GLN C 1 250 ? 2.448   -56.400 -25.679 1.00 26.05  ? 534 GLN C CD  1 
ATOM 5306 O OE1 . GLN C 1 250 ? 3.289   -57.243 -25.988 1.00 28.18  ? 534 GLN C OE1 1 
ATOM 5307 N NE2 . GLN C 1 250 ? 1.329   -56.214 -26.375 1.00 24.72  ? 534 GLN C NE2 1 
ATOM 5308 N N   . LEU C 1 251 ? 4.649   -56.838 -20.786 1.00 19.05  ? 535 LEU C N   1 
ATOM 5309 C CA  . LEU C 1 251 ? 5.115   -57.695 -19.706 1.00 20.66  ? 535 LEU C CA  1 
ATOM 5310 C C   . LEU C 1 251 ? 4.901   -57.060 -18.330 1.00 20.72  ? 535 LEU C C   1 
ATOM 5311 O O   . LEU C 1 251 ? 4.577   -57.761 -17.369 1.00 22.88  ? 535 LEU C O   1 
ATOM 5312 C CB  . LEU C 1 251 ? 6.593   -58.046 -19.909 1.00 18.30  ? 535 LEU C CB  1 
ATOM 5313 C CG  . LEU C 1 251 ? 6.877   -58.854 -21.178 1.00 17.12  ? 535 LEU C CG  1 
ATOM 5314 C CD1 . LEU C 1 251 ? 8.373   -59.068 -21.323 1.00 19.46  ? 535 LEU C CD1 1 
ATOM 5315 C CD2 . LEU C 1 251 ? 6.153   -60.188 -21.113 1.00 14.26  ? 535 LEU C CD2 1 
ATOM 5316 N N   . LEU C 1 252 ? 5.073   -55.744 -18.231 1.00 18.73  ? 536 LEU C N   1 
ATOM 5317 C CA  . LEU C 1 252 ? 4.881   -55.063 -16.953 1.00 16.87  ? 536 LEU C CA  1 
ATOM 5318 C C   . LEU C 1 252 ? 3.399   -55.011 -16.620 1.00 18.01  ? 536 LEU C C   1 
ATOM 5319 O O   . LEU C 1 252 ? 3.016   -54.982 -15.448 1.00 17.22  ? 536 LEU C O   1 
ATOM 5320 C CB  . LEU C 1 252 ? 5.438   -53.637 -16.991 1.00 13.22  ? 536 LEU C CB  1 
ATOM 5321 C CG  . LEU C 1 252 ? 5.150   -52.779 -15.751 1.00 11.01  ? 536 LEU C CG  1 
ATOM 5322 C CD1 . LEU C 1 252 ? 5.737   -53.403 -14.495 1.00 10.55  ? 536 LEU C CD1 1 
ATOM 5323 C CD2 . LEU C 1 252 ? 5.733   -51.405 -15.959 1.00 13.32  ? 536 LEU C CD2 1 
ATOM 5324 N N   . ASP C 1 253 ? 2.566   -54.994 -17.655 1.00 17.21  ? 537 ASP C N   1 
ATOM 5325 C CA  . ASP C 1 253 ? 1.135   -54.956 -17.437 1.00 17.18  ? 537 ASP C CA  1 
ATOM 5326 C C   . ASP C 1 253 ? 0.748   -56.269 -16.752 1.00 16.57  ? 537 ASP C C   1 
ATOM 5327 O O   . ASP C 1 253 ? 0.067   -56.267 -15.727 1.00 15.84  ? 537 ASP C O   1 
ATOM 5328 C CB  . ASP C 1 253 ? 0.403   -54.806 -18.769 1.00 20.19  ? 537 ASP C CB  1 
ATOM 5329 C CG  . ASP C 1 253 ? -0.970  -54.162 -18.619 1.00 22.99  ? 537 ASP C CG  1 
ATOM 5330 O OD1 . ASP C 1 253 ? -1.814  -54.359 -19.516 1.00 24.49  ? 537 ASP C OD1 1 
ATOM 5331 O OD2 . ASP C 1 253 ? -1.204  -53.447 -17.620 1.00 22.64  ? 537 ASP C OD2 1 
ATOM 5332 N N   . GLU C 1 254 ? 1.207   -57.388 -17.308 1.00 16.23  ? 538 GLU C N   1 
ATOM 5333 C CA  . GLU C 1 254 ? 0.912   -58.698 -16.736 1.00 16.58  ? 538 GLU C CA  1 
ATOM 5334 C C   . GLU C 1 254 ? 1.450   -58.785 -15.323 1.00 14.54  ? 538 GLU C C   1 
ATOM 5335 O O   . GLU C 1 254 ? 0.771   -59.251 -14.414 1.00 15.74  ? 538 GLU C O   1 
ATOM 5336 C CB  . GLU C 1 254 ? 1.527   -59.800 -17.585 1.00 21.41  ? 538 GLU C CB  1 
ATOM 5337 C CG  . GLU C 1 254 ? 0.908   -59.892 -18.956 1.00 34.20  ? 538 GLU C CG  1 
ATOM 5338 C CD  . GLU C 1 254 ? 1.469   -61.031 -19.774 1.00 42.99  ? 538 GLU C CD  1 
ATOM 5339 O OE1 . GLU C 1 254 ? 1.451   -62.179 -19.279 1.00 45.92  ? 538 GLU C OE1 1 
ATOM 5340 O OE2 . GLU C 1 254 ? 1.922   -60.780 -20.914 1.00 47.91  ? 538 GLU C OE2 1 
ATOM 5341 N N   . VAL C 1 255 ? 2.681   -58.339 -15.141 1.00 11.90  ? 539 VAL C N   1 
ATOM 5342 C CA  . VAL C 1 255 ? 3.278   -58.351 -13.824 1.00 10.44  ? 539 VAL C CA  1 
ATOM 5343 C C   . VAL C 1 255 ? 2.363   -57.615 -12.854 1.00 12.86  ? 539 VAL C C   1 
ATOM 5344 O O   . VAL C 1 255 ? 2.157   -58.071 -11.734 1.00 15.48  ? 539 VAL C O   1 
ATOM 5345 C CB  . VAL C 1 255 ? 4.653   -57.657 -13.833 1.00 6.57   ? 539 VAL C CB  1 
ATOM 5346 C CG1 . VAL C 1 255 ? 5.096   -57.362 -12.419 1.00 2.72   ? 539 VAL C CG1 1 
ATOM 5347 C CG2 . VAL C 1 255 ? 5.672   -58.540 -14.533 1.00 6.19   ? 539 VAL C CG2 1 
ATOM 5348 N N   . LEU C 1 256 ? 1.811   -56.484 -13.291 1.00 13.59  ? 540 LEU C N   1 
ATOM 5349 C CA  . LEU C 1 256 ? 0.936   -55.673 -12.445 1.00 15.76  ? 540 LEU C CA  1 
ATOM 5350 C C   . LEU C 1 256 ? -0.377  -56.370 -12.133 1.00 19.34  ? 540 LEU C C   1 
ATOM 5351 O O   . LEU C 1 256 ? -0.972  -56.155 -11.073 1.00 17.31  ? 540 LEU C O   1 
ATOM 5352 C CB  . LEU C 1 256 ? 0.636   -54.330 -13.113 1.00 14.97  ? 540 LEU C CB  1 
ATOM 5353 C CG  . LEU C 1 256 ? 1.781   -53.342 -13.336 1.00 14.09  ? 540 LEU C CG  1 
ATOM 5354 C CD1 . LEU C 1 256 ? 1.265   -52.183 -14.161 1.00 11.02  ? 540 LEU C CD1 1 
ATOM 5355 C CD2 . LEU C 1 256 ? 2.338   -52.857 -12.009 1.00 9.70   ? 540 LEU C CD2 1 
ATOM 5356 N N   . HIS C 1 257 ? -0.830  -57.195 -13.069 1.00 22.83  ? 541 HIS C N   1 
ATOM 5357 C CA  . HIS C 1 257 ? -2.074  -57.925 -12.903 1.00 25.67  ? 541 HIS C CA  1 
ATOM 5358 C C   . HIS C 1 257 ? -1.870  -59.217 -12.131 1.00 26.94  ? 541 HIS C C   1 
ATOM 5359 O O   . HIS C 1 257 ? -2.720  -60.101 -12.160 1.00 30.34  ? 541 HIS C O   1 
ATOM 5360 C CB  . HIS C 1 257 ? -2.690  -58.230 -14.265 1.00 28.25  ? 541 HIS C CB  1 
ATOM 5361 C CG  . HIS C 1 257 ? -3.212  -57.021 -14.971 1.00 32.69  ? 541 HIS C CG  1 
ATOM 5362 N ND1 . HIS C 1 257 ? -4.240  -56.254 -14.468 1.00 36.36  ? 541 HIS C ND1 1 
ATOM 5363 C CD2 . HIS C 1 257 ? -2.852  -56.445 -16.142 1.00 35.30  ? 541 HIS C CD2 1 
ATOM 5364 C CE1 . HIS C 1 257 ? -4.492  -55.258 -15.299 1.00 36.61  ? 541 HIS C CE1 1 
ATOM 5365 N NE2 . HIS C 1 257 ? -3.664  -55.351 -16.323 1.00 36.08  ? 541 HIS C NE2 1 
ATOM 5366 N N   . THR C 1 258 ? -0.735  -59.338 -11.455 1.00 27.66  ? 542 THR C N   1 
ATOM 5367 C CA  . THR C 1 258 ? -0.461  -60.524 -10.658 1.00 27.56  ? 542 THR C CA  1 
ATOM 5368 C C   . THR C 1 258 ? -0.160  -60.039 -9.263  1.00 30.54  ? 542 THR C C   1 
ATOM 5369 O O   . THR C 1 258 ? 0.476   -60.727 -8.478  1.00 32.45  ? 542 THR C O   1 
ATOM 5370 C CB  . THR C 1 258 ? 0.750   -61.330 -11.175 1.00 24.23  ? 542 THR C CB  1 
ATOM 5371 O OG1 . THR C 1 258 ? 1.946   -60.556 -11.023 1.00 22.68  ? 542 THR C OG1 1 
ATOM 5372 C CG2 . THR C 1 258 ? 0.555   -61.711 -12.634 1.00 20.17  ? 542 THR C CG2 1 
ATOM 5373 N N   . MET C 1 259 ? -0.613  -58.830 -8.966  1.00 36.13  ? 543 MET C N   1 
ATOM 5374 C CA  . MET C 1 259 ? -0.410  -58.247 -7.651  1.00 43.65  ? 543 MET C CA  1 
ATOM 5375 C C   . MET C 1 259 ? -1.645  -58.517 -6.808  1.00 45.41  ? 543 MET C C   1 
ATOM 5376 O O   . MET C 1 259 ? -2.768  -58.446 -7.299  1.00 43.94  ? 543 MET C O   1 
ATOM 5377 C CB  . MET C 1 259 ? -0.188  -56.736 -7.758  1.00 48.50  ? 543 MET C CB  1 
ATOM 5378 C CG  . MET C 1 259 ? 1.055   -56.333 -8.529  1.00 53.01  ? 543 MET C CG  1 
ATOM 5379 S SD  . MET C 1 259 ? 2.555   -56.876 -7.713  1.00 58.56  ? 543 MET C SD  1 
ATOM 5380 C CE  . MET C 1 259 ? 2.771   -58.521 -8.446  1.00 55.90  ? 543 MET C CE  1 
ATOM 5381 N N   . PRO C 1 260 ? -1.451  -58.834 -5.522  1.00 48.98  ? 544 PRO C N   1 
ATOM 5382 C CA  . PRO C 1 260 ? -2.571  -59.110 -4.624  1.00 51.11  ? 544 PRO C CA  1 
ATOM 5383 C C   . PRO C 1 260 ? -3.564  -57.957 -4.576  1.00 51.97  ? 544 PRO C C   1 
ATOM 5384 O O   . PRO C 1 260 ? -3.232  -56.861 -4.126  1.00 49.90  ? 544 PRO C O   1 
ATOM 5385 C CB  . PRO C 1 260 ? -1.883  -59.353 -3.281  1.00 50.88  ? 544 PRO C CB  1 
ATOM 5386 C CG  . PRO C 1 260 ? -0.644  -58.528 -3.381  1.00 51.93  ? 544 PRO C CG  1 
ATOM 5387 C CD  . PRO C 1 260 ? -0.180  -58.836 -4.781  1.00 51.42  ? 544 PRO C CD  1 
ATOM 5388 N N   . ILE C 1 261 ? -4.781  -58.220 -5.049  1.00 54.35  ? 545 ILE C N   1 
ATOM 5389 C CA  . ILE C 1 261 ? -5.838  -57.219 -5.073  1.00 57.16  ? 545 ILE C CA  1 
ATOM 5390 C C   . ILE C 1 261 ? -5.872  -56.474 -3.749  1.00 58.55  ? 545 ILE C C   1 
ATOM 5391 O O   . ILE C 1 261 ? -5.750  -57.077 -2.679  1.00 57.09  ? 545 ILE C O   1 
ATOM 5392 C CB  . ILE C 1 261 ? -7.233  -57.860 -5.318  1.00 58.14  ? 545 ILE C CB  1 
ATOM 5393 C CG1 . ILE C 1 261 ? -7.282  -58.533 -6.695  1.00 59.19  ? 545 ILE C CG1 1 
ATOM 5394 C CG2 . ILE C 1 261 ? -8.320  -56.794 -5.225  1.00 56.98  ? 545 ILE C CG2 1 
ATOM 5395 C CD1 . ILE C 1 261 ? -7.293  -57.566 -7.871  1.00 60.07  ? 545 ILE C CD1 1 
ATOM 5396 N N   . ALA C 1 262 ? -6.024  -55.157 -3.833  1.00 61.24  ? 546 ALA C N   1 
ATOM 5397 C CA  . ALA C 1 262 ? -6.085  -54.322 -2.645  1.00 63.15  ? 546 ALA C CA  1 
ATOM 5398 C C   . ALA C 1 262 ? -7.360  -54.674 -1.885  1.00 64.71  ? 546 ALA C C   1 
ATOM 5399 O O   . ALA C 1 262 ? -8.469  -54.544 -2.412  1.00 65.21  ? 546 ALA C O   1 
ATOM 5400 C CB  . ALA C 1 262 ? -6.085  -52.839 -3.036  1.00 61.12  ? 546 ALA C CB  1 
ATOM 5401 N N   . ASP C 1 263 ? -7.191  -55.142 -0.653  1.00 64.88  ? 547 ASP C N   1 
ATOM 5402 C CA  . ASP C 1 263 ? -8.319  -55.508 0.190   1.00 64.36  ? 547 ASP C CA  1 
ATOM 5403 C C   . ASP C 1 263 ? -8.193  -54.727 1.502   1.00 64.10  ? 547 ASP C C   1 
ATOM 5404 O O   . ASP C 1 263 ? -7.350  -55.034 2.349   1.00 63.92  ? 547 ASP C O   1 
ATOM 5405 C CB  . ASP C 1 263 ? -8.312  -57.022 0.437   1.00 63.28  ? 547 ASP C CB  1 
ATOM 5406 C CG  . ASP C 1 263 ? -9.609  -57.524 1.051   1.00 63.14  ? 547 ASP C CG  1 
ATOM 5407 O OD1 . ASP C 1 263 ? -10.699 -57.115 0.587   1.00 61.01  ? 547 ASP C OD1 1 
ATOM 5408 O OD2 . ASP C 1 263 ? -9.534  -58.343 1.992   1.00 64.53  ? 547 ASP C OD2 1 
ATOM 5409 N N   . PRO C 1 264 ? -9.034  -53.698 1.679   1.00 63.26  ? 548 PRO C N   1 
ATOM 5410 C CA  . PRO C 1 264 ? -9.007  -52.872 2.888   1.00 64.05  ? 548 PRO C CA  1 
ATOM 5411 C C   . PRO C 1 264 ? -9.117  -53.667 4.173   1.00 65.39  ? 548 PRO C C   1 
ATOM 5412 O O   . PRO C 1 264 ? -10.097 -54.373 4.392   1.00 68.12  ? 548 PRO C O   1 
ATOM 5413 C CB  . PRO C 1 264 ? -10.193 -51.931 2.691   1.00 62.95  ? 548 PRO C CB  1 
ATOM 5414 C CG  . PRO C 1 264 ? -11.142 -52.754 1.891   1.00 63.61  ? 548 PRO C CG  1 
ATOM 5415 C CD  . PRO C 1 264 ? -10.229 -53.395 0.873   1.00 63.09  ? 548 PRO C CD  1 
ATOM 5416 N N   . GLN C 1 265 ? -8.102  -53.560 5.020   1.00 65.97  ? 549 GLN C N   1 
ATOM 5417 C CA  . GLN C 1 265 ? -8.128  -54.257 6.291   1.00 67.84  ? 549 GLN C CA  1 
ATOM 5418 C C   . GLN C 1 265 ? -8.443  -53.216 7.367   1.00 68.68  ? 549 GLN C C   1 
ATOM 5419 O O   . GLN C 1 265 ? -7.969  -52.082 7.299   1.00 69.37  ? 549 GLN C O   1 
ATOM 5420 C CB  . GLN C 1 265 ? -6.780  -54.938 6.568   1.00 69.67  ? 549 GLN C CB  1 
ATOM 5421 C CG  . GLN C 1 265 ? -5.634  -54.006 6.957   1.00 75.11  ? 549 GLN C CG  1 
ATOM 5422 C CD  . GLN C 1 265 ? -5.008  -53.285 5.776   1.00 78.14  ? 549 GLN C CD  1 
ATOM 5423 O OE1 . GLN C 1 265 ? -5.680  -52.548 5.054   1.00 80.41  ? 549 GLN C OE1 1 
ATOM 5424 N NE2 . GLN C 1 265 ? -3.707  -53.492 5.579   1.00 77.92  ? 549 GLN C NE2 1 
ATOM 5425 N N   . PRO C 1 266 ? -9.275  -53.576 8.358   1.00 69.13  ? 550 PRO C N   1 
ATOM 5426 C CA  . PRO C 1 266 ? -9.628  -52.635 9.429   1.00 68.85  ? 550 PRO C CA  1 
ATOM 5427 C C   . PRO C 1 266 ? -8.504  -52.365 10.444  1.00 68.79  ? 550 PRO C C   1 
ATOM 5428 O O   . PRO C 1 266 ? -7.496  -53.102 10.425  1.00 67.98  ? 550 PRO C O   1 
ATOM 5429 C CB  . PRO C 1 266 ? -10.845 -53.296 10.068  1.00 68.68  ? 550 PRO C CB  1 
ATOM 5430 C CG  . PRO C 1 266 ? -10.563 -54.757 9.884   1.00 68.78  ? 550 PRO C CG  1 
ATOM 5431 C CD  . PRO C 1 266 ? -10.083 -54.806 8.456   1.00 68.66  ? 550 PRO C CD  1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASN 1   285 285 ASN ASN A . n 
A 1 2   GLY 2   286 286 GLY GLY A . n 
A 1 3   HIS 3   287 287 HIS HIS A . n 
A 1 4   LEU 4   288 288 LEU LEU A . n 
A 1 5   GLN 5   289 289 GLN GLN A . n 
A 1 6   HIS 6   290 290 HIS HIS A . n 
A 1 7   HIS 7   291 291 HIS HIS A . n 
A 1 8   PRO 8   292 292 PRO PRO A . n 
A 1 9   PRO 9   293 293 PRO PRO A . n 
A 1 10  MET 10  294 294 MET MET A . n 
A 1 11  PRO 11  295 295 PRO PRO A . n 
A 1 12  PRO 12  296 296 PRO PRO A . n 
A 1 13  HIS 13  297 ?   ?   ?   A . n 
A 1 14  PRO 14  298 ?   ?   ?   A . n 
A 1 15  GLY 15  299 ?   ?   ?   A . n 
A 1 16  HIS 16  300 ?   ?   ?   A . n 
A 1 17  TYR 17  301 ?   ?   ?   A . n 
A 1 18  TRP 18  302 ?   ?   ?   A . n 
A 1 19  PRO 19  303 ?   ?   ?   A . n 
A 1 20  VAL 20  304 ?   ?   ?   A . n 
A 1 21  HIS 21  305 ?   ?   ?   A . n 
A 1 22  ASN 22  306 ?   ?   ?   A . n 
A 1 23  GLU 23  307 ?   ?   ?   A . n 
A 1 24  LEU 24  308 ?   ?   ?   A . n 
A 1 25  ALA 25  309 ?   ?   ?   A . n 
A 1 26  PHE 26  310 ?   ?   ?   A . n 
A 1 27  GLN 27  311 311 GLN GLN A . n 
A 1 28  PRO 28  312 312 PRO PRO A . n 
A 1 29  PRO 29  313 313 PRO PRO A . n 
A 1 30  ILE 30  314 314 ILE ILE A . n 
A 1 31  SER 31  315 315 SER SER A . n 
A 1 32  ASN 32  316 316 ASN ASN A . n 
A 1 33  HIS 33  317 317 HIS HIS A . n 
A 1 34  PRO 34  318 318 PRO PRO A . n 
A 1 35  ALA 35  319 319 ALA ALA A . n 
A 1 36  PRO 36  320 320 PRO PRO A . n 
A 1 37  GLU 37  321 321 GLU GLU A . n 
A 1 38  TYR 38  322 322 TYR TYR A . n 
A 1 39  TRP 39  323 323 TRP TRP A . n 
A 1 40  CYS 40  324 324 CYS CYS A . n 
A 1 41  SER 41  325 325 SER SER A . n 
A 1 42  ILE 42  326 326 ILE ILE A . n 
A 1 43  ALA 43  327 327 ALA ALA A . n 
A 1 44  TYR 44  328 328 TYR TYR A . n 
A 1 45  PHE 45  329 329 PHE PHE A . n 
A 1 46  GLU 46  330 330 GLU GLU A . n 
A 1 47  MET 47  331 331 MET MET A . n 
A 1 48  ASP 48  332 332 ASP ASP A . n 
A 1 49  VAL 49  333 333 VAL VAL A . n 
A 1 50  GLN 50  334 334 GLN GLN A . n 
A 1 51  VAL 51  335 335 VAL VAL A . n 
A 1 52  GLY 52  336 336 GLY GLY A . n 
A 1 53  GLU 53  337 337 GLU GLU A . n 
A 1 54  THR 54  338 338 THR THR A . n 
A 1 55  PHE 55  339 339 PHE PHE A . n 
A 1 56  LYS 56  340 340 LYS LYS A . n 
A 1 57  VAL 57  341 341 VAL VAL A . n 
A 1 58  PRO 58  342 342 PRO PRO A . n 
A 1 59  SER 59  343 343 SER SER A . n 
A 1 60  SER 60  344 344 SER SER A . n 
A 1 61  CYS 61  345 345 CYS CYS A . n 
A 1 62  PRO 62  346 346 PRO PRO A . n 
A 1 63  ILE 63  347 347 ILE ILE A . n 
A 1 64  VAL 64  348 348 VAL VAL A . n 
A 1 65  THR 65  349 349 THR THR A . n 
A 1 66  VAL 66  350 350 VAL VAL A . n 
A 1 67  ASP 67  351 351 ASP ASP A . n 
A 1 68  GLY 68  352 352 GLY GLY A . n 
A 1 69  TYR 69  353 353 TYR TYR A . n 
A 1 70  VAL 70  354 354 VAL VAL A . n 
A 1 71  ASP 71  355 355 ASP ASP A . n 
A 1 72  PRO 72  356 356 PRO PRO A . n 
A 1 73  SER 73  357 357 SER SER A . n 
A 1 74  GLY 74  358 358 GLY GLY A . n 
A 1 75  GLY 75  359 359 GLY GLY A . n 
A 1 76  ASP 76  360 360 ASP ASP A . n 
A 1 77  ARG 77  361 361 ARG ARG A . n 
A 1 78  PHE 78  362 362 PHE PHE A . n 
A 1 79  CYS 79  363 363 CYS CYS A . n 
A 1 80  LEU 80  364 364 LEU LEU A . n 
A 1 81  GLY 81  365 365 GLY GLY A . n 
A 1 82  GLN 82  366 366 GLN GLN A . n 
A 1 83  LEU 83  367 367 LEU LEU A . n 
A 1 84  SER 84  368 368 SER SER A . n 
A 1 85  ASN 85  369 369 ASN ASN A . n 
A 1 86  VAL 86  370 370 VAL VAL A . n 
A 1 87  HIS 87  371 371 HIS HIS A . n 
A 1 88  ARG 88  372 372 ARG ARG A . n 
A 1 89  THR 89  373 373 THR THR A . n 
A 1 90  GLU 90  374 374 GLU GLU A . n 
A 1 91  ALA 91  375 375 ALA ALA A . n 
A 1 92  ILE 92  376 376 ILE ILE A . n 
A 1 93  GLU 93  377 377 GLU GLU A . n 
A 1 94  ARG 94  378 378 ARG ARG A . n 
A 1 95  ALA 95  379 379 ALA ALA A . n 
A 1 96  ARG 96  380 380 ARG ARG A . n 
A 1 97  LEU 97  381 381 LEU LEU A . n 
A 1 98  HIS 98  382 382 HIS HIS A . n 
A 1 99  ILE 99  383 383 ILE ILE A . n 
A 1 100 GLY 100 384 384 GLY GLY A . n 
A 1 101 LYS 101 385 385 LYS LYS A . n 
A 1 102 GLY 102 386 386 GLY GLY A . n 
A 1 103 VAL 103 387 387 VAL VAL A . n 
A 1 104 GLN 104 388 388 GLN GLN A . n 
A 1 105 LEU 105 389 389 LEU LEU A . n 
A 1 106 GLU 106 390 390 GLU GLU A . n 
A 1 107 CYS 107 391 391 CYS CYS A . n 
A 1 108 LYS 108 392 392 LYS LYS A . n 
A 1 109 GLY 109 393 393 GLY GLY A . n 
A 1 110 GLU 110 394 394 GLU GLU A . n 
A 1 111 GLY 111 395 395 GLY GLY A . n 
A 1 112 ASP 112 396 396 ASP ASP A . n 
A 1 113 VAL 113 397 397 VAL VAL A . n 
A 1 114 TRP 114 398 398 TRP TRP A . n 
A 1 115 VAL 115 399 399 VAL VAL A . n 
A 1 116 ARG 116 400 400 ARG ARG A . n 
A 1 117 CYS 117 401 401 CYS CYS A . n 
A 1 118 LEU 118 402 402 LEU LEU A . n 
A 1 119 SER 119 403 403 SER SER A . n 
A 1 120 ASP 120 404 404 ASP ASP A . n 
A 1 121 HIS 121 405 405 HIS HIS A . n 
A 1 122 ALA 122 406 406 ALA ALA A . n 
A 1 123 VAL 123 407 407 VAL VAL A . n 
A 1 124 PHE 124 408 408 PHE PHE A . n 
A 1 125 VAL 125 409 409 VAL VAL A . n 
A 1 126 GLN 126 410 410 GLN GLN A . n 
A 1 127 SER 127 411 411 SER SER A . n 
A 1 128 TYR 128 412 412 TYR TYR A . n 
A 1 129 TYR 129 413 413 TYR TYR A . n 
A 1 130 LEU 130 414 414 LEU LEU A . n 
A 1 131 ASP 131 415 415 ASP ASP A . n 
A 1 132 ARG 132 416 416 ARG ARG A . n 
A 1 133 GLU 133 417 417 GLU GLU A . n 
A 1 134 ALA 134 418 418 ALA ALA A . n 
A 1 135 GLY 135 419 419 GLY GLY A . n 
A 1 136 ARG 136 420 420 ARG ARG A . n 
A 1 137 ALA 137 421 421 ALA ALA A . n 
A 1 138 PRO 138 422 422 PRO PRO A . n 
A 1 139 GLY 139 423 423 GLY GLY A . n 
A 1 140 ASP 140 424 424 ASP ASP A . n 
A 1 141 ALA 141 425 425 ALA ALA A . n 
A 1 142 VAL 142 426 426 VAL VAL A . n 
A 1 143 HIS 143 427 427 HIS HIS A . n 
A 1 144 LYS 144 428 428 LYS LYS A . n 
A 1 145 ILE 145 429 429 ILE ILE A . n 
A 1 146 TYR 146 430 430 TYR TYR A . n 
A 1 147 PRO 147 431 431 PRO PRO A . n 
A 1 148 SER 148 432 432 SER SER A . n 
A 1 149 ALA 149 433 433 ALA ALA A . n 
A 1 150 TYR 150 434 434 TYR TYR A . n 
A 1 151 ILE 151 435 435 ILE ILE A . n 
A 1 152 LYS 152 436 436 LYS LYS A . n 
A 1 153 VAL 153 437 437 VAL VAL A . n 
A 1 154 PHE 154 438 438 PHE PHE A . n 
A 1 155 ASP 155 439 439 ASP ASP A . n 
A 1 156 LEU 156 440 440 LEU LEU A . n 
A 1 157 ARG 157 441 441 ARG ARG A . n 
A 1 158 GLN 158 442 442 GLN GLN A . n 
A 1 159 CYS 159 443 443 CYS CYS A . n 
A 1 160 HIS 160 444 444 HIS HIS A . n 
A 1 161 ARG 161 445 445 ARG ARG A . n 
A 1 162 GLN 162 446 446 GLN GLN A . n 
A 1 163 MET 163 447 447 MET MET A . n 
A 1 164 GLN 164 448 448 GLN GLN A . n 
A 1 165 GLN 165 449 449 GLN GLN A . n 
A 1 166 GLN 166 450 450 GLN GLN A . n 
A 1 167 ALA 167 451 451 ALA ALA A . n 
A 1 168 ALA 168 452 452 ALA ALA A . n 
A 1 169 THR 169 453 453 THR THR A . n 
A 1 170 ALA 170 454 454 ALA ALA A . n 
A 1 171 GLN 171 455 455 GLN GLN A . n 
A 1 172 ALA 172 456 456 ALA ALA A . n 
A 1 173 ALA 173 457 457 ALA ALA A . n 
A 1 174 ALA 174 458 458 ALA ALA A . n 
A 1 175 ALA 175 459 459 ALA ALA A . n 
A 1 176 ALA 176 460 460 ALA ALA A . n 
A 1 177 GLN 177 461 ?   ?   ?   A . n 
A 1 178 ALA 178 462 ?   ?   ?   A . n 
A 1 179 ALA 179 463 ?   ?   ?   A . n 
A 1 180 ALA 180 464 ?   ?   ?   A . n 
A 1 181 VAL 181 465 ?   ?   ?   A . n 
A 1 182 ALA 182 466 ?   ?   ?   A . n 
A 1 183 GLY 183 467 ?   ?   ?   A . n 
A 1 184 ASN 184 468 ?   ?   ?   A . n 
A 1 185 ILE 185 469 ?   ?   ?   A . n 
A 1 186 PRO 186 470 ?   ?   ?   A . n 
A 1 187 GLY 187 471 ?   ?   ?   A . n 
A 1 188 PRO 188 472 ?   ?   ?   A . n 
A 1 189 GLY 189 473 ?   ?   ?   A . n 
A 1 190 SER 190 474 ?   ?   ?   A . n 
A 1 191 VAL 191 475 ?   ?   ?   A . n 
A 1 192 GLY 192 476 ?   ?   ?   A . n 
A 1 193 GLY 193 477 ?   ?   ?   A . n 
A 1 194 ILE 194 478 ?   ?   ?   A . n 
A 1 195 ALA 195 479 ?   ?   ?   A . n 
A 1 196 PRO 196 480 ?   ?   ?   A . n 
A 1 197 ALA 197 481 ?   ?   ?   A . n 
A 1 198 ILE 198 482 ?   ?   ?   A . n 
A 1 199 SER 199 483 ?   ?   ?   A . n 
A 1 200 LEU 200 484 ?   ?   ?   A . n 
A 1 201 SER 201 485 ?   ?   ?   A . n 
A 1 202 ALA 202 486 ?   ?   ?   A . n 
A 1 203 ALA 203 487 487 ALA ALA A . n 
A 1 204 ALA 204 488 488 ALA ALA A . n 
A 1 205 GLY 205 489 489 GLY GLY A . n 
A 1 206 ILE 206 490 490 ILE ILE A . n 
A 1 207 GLY 207 491 491 GLY GLY A . n 
A 1 208 VAL 208 492 492 VAL VAL A . n 
A 1 209 ASP 209 493 493 ASP ASP A . n 
A 1 210 ASP 210 494 494 ASP ASP A . n 
A 1 211 LEU 211 495 495 LEU LEU A . n 
A 1 212 ARG 212 496 496 ARG ARG A . n 
A 1 213 ARG 213 497 497 ARG ARG A . n 
A 1 214 LEU 214 498 498 LEU LEU A . n 
A 1 215 CYS 215 499 499 CYS CYS A . n 
A 1 216 ILE 216 500 500 ILE ILE A . n 
A 1 217 LEU 217 501 501 LEU LEU A . n 
A 1 218 ARG 218 502 502 ARG ARG A . n 
A 1 219 MET 219 503 503 MET MET A . n 
A 1 220 SER 220 504 504 SER SER A . n 
A 1 221 PHE 221 505 505 PHE PHE A . n 
A 1 222 VAL 222 506 506 VAL VAL A . n 
A 1 223 LYS 223 507 507 LYS LYS A . n 
A 1 224 GLY 224 508 508 GLY GLY A . n 
A 1 225 TRP 225 509 509 TRP TRP A . n 
A 1 226 GLY 226 510 510 GLY GLY A . n 
A 1 227 PRO 227 511 511 PRO PRO A . n 
A 1 228 ASP 228 512 512 ASP ASP A . n 
A 1 229 TYR 229 513 513 TYR TYR A . n 
A 1 230 PRO 230 514 514 PRO PRO A . n 
A 1 231 SER 231 515 515 SER SER A . n 
A 1 232 GLN 232 516 516 GLN GLN A . n 
A 1 233 SER 233 517 517 SER SER A . n 
A 1 234 ILE 234 518 518 ILE ILE A . n 
A 1 235 LYS 235 519 519 LYS LYS A . n 
A 1 236 GLU 236 520 520 GLU GLU A . n 
A 1 237 THR 237 521 521 THR THR A . n 
A 1 238 PRO 238 522 522 PRO PRO A . n 
A 1 239 CYS 239 523 523 CYS CYS A . n 
A 1 240 TRP 240 524 524 TRP TRP A . n 
A 1 241 ILE 241 525 525 ILE ILE A . n 
A 1 242 GLU 242 526 526 GLU GLU A . n 
A 1 243 ILE 243 527 527 ILE ILE A . n 
A 1 244 HIS 244 528 528 HIS HIS A . n 
A 1 245 LEU 245 529 529 LEU LEU A . n 
A 1 246 HIS 246 530 530 HIS HIS A . n 
A 1 247 ARG 247 531 531 ARG ARG A . n 
A 1 248 ALA 248 532 532 ALA ALA A . n 
A 1 249 LEU 249 533 533 LEU LEU A . n 
A 1 250 GLN 250 534 534 GLN GLN A . n 
A 1 251 LEU 251 535 535 LEU LEU A . n 
A 1 252 LEU 252 536 536 LEU LEU A . n 
A 1 253 ASP 253 537 537 ASP ASP A . n 
A 1 254 GLU 254 538 538 GLU GLU A . n 
A 1 255 VAL 255 539 539 VAL VAL A . n 
A 1 256 LEU 256 540 540 LEU LEU A . n 
A 1 257 HIS 257 541 541 HIS HIS A . n 
A 1 258 THR 258 542 542 THR THR A . n 
A 1 259 MET 259 543 543 MET MET A . n 
A 1 260 PRO 260 544 544 PRO PRO A . n 
A 1 261 ILE 261 545 545 ILE ILE A . n 
A 1 262 ALA 262 546 ?   ?   ?   A . n 
A 1 263 ASP 263 547 ?   ?   ?   A . n 
A 1 264 PRO 264 548 ?   ?   ?   A . n 
A 1 265 GLN 265 549 ?   ?   ?   A . n 
A 1 266 PRO 266 550 ?   ?   ?   A . n 
A 1 267 LEU 267 551 ?   ?   ?   A . n 
A 1 268 ASP 268 552 ?   ?   ?   A . n 
B 1 1   ASN 1   285 285 ASN ASN B . n 
B 1 2   GLY 2   286 286 GLY GLY B . n 
B 1 3   HIS 3   287 287 HIS HIS B . n 
B 1 4   LEU 4   288 288 LEU LEU B . n 
B 1 5   GLN 5   289 289 GLN GLN B . n 
B 1 6   HIS 6   290 290 HIS HIS B . n 
B 1 7   HIS 7   291 291 HIS HIS B . n 
B 1 8   PRO 8   292 292 PRO PRO B . n 
B 1 9   PRO 9   293 293 PRO PRO B . n 
B 1 10  MET 10  294 294 MET MET B . n 
B 1 11  PRO 11  295 295 PRO PRO B . n 
B 1 12  PRO 12  296 296 PRO PRO B . n 
B 1 13  HIS 13  297 ?   ?   ?   B . n 
B 1 14  PRO 14  298 ?   ?   ?   B . n 
B 1 15  GLY 15  299 ?   ?   ?   B . n 
B 1 16  HIS 16  300 ?   ?   ?   B . n 
B 1 17  TYR 17  301 ?   ?   ?   B . n 
B 1 18  TRP 18  302 ?   ?   ?   B . n 
B 1 19  PRO 19  303 ?   ?   ?   B . n 
B 1 20  VAL 20  304 ?   ?   ?   B . n 
B 1 21  HIS 21  305 ?   ?   ?   B . n 
B 1 22  ASN 22  306 ?   ?   ?   B . n 
B 1 23  GLU 23  307 ?   ?   ?   B . n 
B 1 24  LEU 24  308 ?   ?   ?   B . n 
B 1 25  ALA 25  309 309 ALA ALA B . n 
B 1 26  PHE 26  310 310 PHE PHE B . n 
B 1 27  GLN 27  311 311 GLN GLN B . n 
B 1 28  PRO 28  312 312 PRO PRO B . n 
B 1 29  PRO 29  313 313 PRO PRO B . n 
B 1 30  ILE 30  314 314 ILE ILE B . n 
B 1 31  SER 31  315 315 SER SER B . n 
B 1 32  ASN 32  316 316 ASN ASN B . n 
B 1 33  HIS 33  317 317 HIS HIS B . n 
B 1 34  PRO 34  318 318 PRO PRO B . n 
B 1 35  ALA 35  319 319 ALA ALA B . n 
B 1 36  PRO 36  320 320 PRO PRO B . n 
B 1 37  GLU 37  321 321 GLU GLU B . n 
B 1 38  TYR 38  322 322 TYR TYR B . n 
B 1 39  TRP 39  323 323 TRP TRP B . n 
B 1 40  CYS 40  324 324 CYS CYS B . n 
B 1 41  SER 41  325 325 SER SER B . n 
B 1 42  ILE 42  326 326 ILE ILE B . n 
B 1 43  ALA 43  327 327 ALA ALA B . n 
B 1 44  TYR 44  328 328 TYR TYR B . n 
B 1 45  PHE 45  329 329 PHE PHE B . n 
B 1 46  GLU 46  330 330 GLU GLU B . n 
B 1 47  MET 47  331 331 MET MET B . n 
B 1 48  ASP 48  332 332 ASP ASP B . n 
B 1 49  VAL 49  333 333 VAL VAL B . n 
B 1 50  GLN 50  334 334 GLN GLN B . n 
B 1 51  VAL 51  335 335 VAL VAL B . n 
B 1 52  GLY 52  336 336 GLY GLY B . n 
B 1 53  GLU 53  337 337 GLU GLU B . n 
B 1 54  THR 54  338 338 THR THR B . n 
B 1 55  PHE 55  339 339 PHE PHE B . n 
B 1 56  LYS 56  340 340 LYS LYS B . n 
B 1 57  VAL 57  341 341 VAL VAL B . n 
B 1 58  PRO 58  342 342 PRO PRO B . n 
B 1 59  SER 59  343 343 SER SER B . n 
B 1 60  SER 60  344 344 SER SER B . n 
B 1 61  CYS 61  345 345 CYS CYS B . n 
B 1 62  PRO 62  346 346 PRO PRO B . n 
B 1 63  ILE 63  347 347 ILE ILE B . n 
B 1 64  VAL 64  348 348 VAL VAL B . n 
B 1 65  THR 65  349 349 THR THR B . n 
B 1 66  VAL 66  350 350 VAL VAL B . n 
B 1 67  ASP 67  351 351 ASP ASP B . n 
B 1 68  GLY 68  352 352 GLY GLY B . n 
B 1 69  TYR 69  353 353 TYR TYR B . n 
B 1 70  VAL 70  354 354 VAL VAL B . n 
B 1 71  ASP 71  355 355 ASP ASP B . n 
B 1 72  PRO 72  356 356 PRO PRO B . n 
B 1 73  SER 73  357 357 SER SER B . n 
B 1 74  GLY 74  358 358 GLY GLY B . n 
B 1 75  GLY 75  359 359 GLY GLY B . n 
B 1 76  ASP 76  360 360 ASP ASP B . n 
B 1 77  ARG 77  361 361 ARG ARG B . n 
B 1 78  PHE 78  362 362 PHE PHE B . n 
B 1 79  CYS 79  363 363 CYS CYS B . n 
B 1 80  LEU 80  364 364 LEU LEU B . n 
B 1 81  GLY 81  365 365 GLY GLY B . n 
B 1 82  GLN 82  366 366 GLN GLN B . n 
B 1 83  LEU 83  367 367 LEU LEU B . n 
B 1 84  SER 84  368 368 SER SER B . n 
B 1 85  ASN 85  369 369 ASN ASN B . n 
B 1 86  VAL 86  370 370 VAL VAL B . n 
B 1 87  HIS 87  371 371 HIS HIS B . n 
B 1 88  ARG 88  372 372 ARG ARG B . n 
B 1 89  THR 89  373 373 THR THR B . n 
B 1 90  GLU 90  374 374 GLU GLU B . n 
B 1 91  ALA 91  375 375 ALA ALA B . n 
B 1 92  ILE 92  376 376 ILE ILE B . n 
B 1 93  GLU 93  377 377 GLU GLU B . n 
B 1 94  ARG 94  378 378 ARG ARG B . n 
B 1 95  ALA 95  379 379 ALA ALA B . n 
B 1 96  ARG 96  380 380 ARG ARG B . n 
B 1 97  LEU 97  381 381 LEU LEU B . n 
B 1 98  HIS 98  382 382 HIS HIS B . n 
B 1 99  ILE 99  383 383 ILE ILE B . n 
B 1 100 GLY 100 384 384 GLY GLY B . n 
B 1 101 LYS 101 385 385 LYS LYS B . n 
B 1 102 GLY 102 386 386 GLY GLY B . n 
B 1 103 VAL 103 387 387 VAL VAL B . n 
B 1 104 GLN 104 388 388 GLN GLN B . n 
B 1 105 LEU 105 389 389 LEU LEU B . n 
B 1 106 GLU 106 390 390 GLU GLU B . n 
B 1 107 CYS 107 391 391 CYS CYS B . n 
B 1 108 LYS 108 392 392 LYS LYS B . n 
B 1 109 GLY 109 393 393 GLY GLY B . n 
B 1 110 GLU 110 394 394 GLU GLU B . n 
B 1 111 GLY 111 395 395 GLY GLY B . n 
B 1 112 ASP 112 396 396 ASP ASP B . n 
B 1 113 VAL 113 397 397 VAL VAL B . n 
B 1 114 TRP 114 398 398 TRP TRP B . n 
B 1 115 VAL 115 399 399 VAL VAL B . n 
B 1 116 ARG 116 400 400 ARG ARG B . n 
B 1 117 CYS 117 401 401 CYS CYS B . n 
B 1 118 LEU 118 402 402 LEU LEU B . n 
B 1 119 SER 119 403 403 SER SER B . n 
B 1 120 ASP 120 404 404 ASP ASP B . n 
B 1 121 HIS 121 405 405 HIS HIS B . n 
B 1 122 ALA 122 406 406 ALA ALA B . n 
B 1 123 VAL 123 407 407 VAL VAL B . n 
B 1 124 PHE 124 408 408 PHE PHE B . n 
B 1 125 VAL 125 409 409 VAL VAL B . n 
B 1 126 GLN 126 410 410 GLN GLN B . n 
B 1 127 SER 127 411 411 SER SER B . n 
B 1 128 TYR 128 412 412 TYR TYR B . n 
B 1 129 TYR 129 413 413 TYR TYR B . n 
B 1 130 LEU 130 414 414 LEU LEU B . n 
B 1 131 ASP 131 415 415 ASP ASP B . n 
B 1 132 ARG 132 416 416 ARG ARG B . n 
B 1 133 GLU 133 417 417 GLU GLU B . n 
B 1 134 ALA 134 418 418 ALA ALA B . n 
B 1 135 GLY 135 419 419 GLY GLY B . n 
B 1 136 ARG 136 420 420 ARG ARG B . n 
B 1 137 ALA 137 421 421 ALA ALA B . n 
B 1 138 PRO 138 422 422 PRO PRO B . n 
B 1 139 GLY 139 423 423 GLY GLY B . n 
B 1 140 ASP 140 424 424 ASP ASP B . n 
B 1 141 ALA 141 425 425 ALA ALA B . n 
B 1 142 VAL 142 426 426 VAL VAL B . n 
B 1 143 HIS 143 427 427 HIS HIS B . n 
B 1 144 LYS 144 428 428 LYS LYS B . n 
B 1 145 ILE 145 429 429 ILE ILE B . n 
B 1 146 TYR 146 430 430 TYR TYR B . n 
B 1 147 PRO 147 431 431 PRO PRO B . n 
B 1 148 SER 148 432 432 SER SER B . n 
B 1 149 ALA 149 433 433 ALA ALA B . n 
B 1 150 TYR 150 434 434 TYR TYR B . n 
B 1 151 ILE 151 435 435 ILE ILE B . n 
B 1 152 LYS 152 436 436 LYS LYS B . n 
B 1 153 VAL 153 437 437 VAL VAL B . n 
B 1 154 PHE 154 438 438 PHE PHE B . n 
B 1 155 ASP 155 439 439 ASP ASP B . n 
B 1 156 LEU 156 440 440 LEU LEU B . n 
B 1 157 ARG 157 441 441 ARG ARG B . n 
B 1 158 GLN 158 442 442 GLN GLN B . n 
B 1 159 CYS 159 443 443 CYS CYS B . n 
B 1 160 HIS 160 444 444 HIS HIS B . n 
B 1 161 ARG 161 445 445 ARG ARG B . n 
B 1 162 GLN 162 446 446 GLN GLN B . n 
B 1 163 MET 163 447 447 MET MET B . n 
B 1 164 GLN 164 448 448 GLN GLN B . n 
B 1 165 GLN 165 449 449 GLN GLN B . n 
B 1 166 GLN 166 450 450 GLN GLN B . n 
B 1 167 ALA 167 451 451 ALA ALA B . n 
B 1 168 ALA 168 452 452 ALA ALA B . n 
B 1 169 THR 169 453 453 THR THR B . n 
B 1 170 ALA 170 454 454 ALA ALA B . n 
B 1 171 GLN 171 455 455 GLN GLN B . n 
B 1 172 ALA 172 456 456 ALA ALA B . n 
B 1 173 ALA 173 457 457 ALA ALA B . n 
B 1 174 ALA 174 458 458 ALA ALA B . n 
B 1 175 ALA 175 459 459 ALA ALA B . n 
B 1 176 ALA 176 460 460 ALA ALA B . n 
B 1 177 GLN 177 461 461 GLN GLN B . n 
B 1 178 ALA 178 462 462 ALA ALA B . n 
B 1 179 ALA 179 463 463 ALA ALA B . n 
B 1 180 ALA 180 464 464 ALA ALA B . n 
B 1 181 VAL 181 465 465 VAL VAL B . n 
B 1 182 ALA 182 466 466 ALA ALA B . n 
B 1 183 GLY 183 467 ?   ?   ?   B . n 
B 1 184 ASN 184 468 ?   ?   ?   B . n 
B 1 185 ILE 185 469 ?   ?   ?   B . n 
B 1 186 PRO 186 470 ?   ?   ?   B . n 
B 1 187 GLY 187 471 ?   ?   ?   B . n 
B 1 188 PRO 188 472 ?   ?   ?   B . n 
B 1 189 GLY 189 473 ?   ?   ?   B . n 
B 1 190 SER 190 474 ?   ?   ?   B . n 
B 1 191 VAL 191 475 ?   ?   ?   B . n 
B 1 192 GLY 192 476 ?   ?   ?   B . n 
B 1 193 GLY 193 477 ?   ?   ?   B . n 
B 1 194 ILE 194 478 ?   ?   ?   B . n 
B 1 195 ALA 195 479 479 ALA ALA B . n 
B 1 196 PRO 196 480 480 PRO PRO B . n 
B 1 197 ALA 197 481 481 ALA ALA B . n 
B 1 198 ILE 198 482 482 ILE ILE B . n 
B 1 199 SER 199 483 483 SER SER B . n 
B 1 200 LEU 200 484 484 LEU LEU B . n 
B 1 201 SER 201 485 485 SER SER B . n 
B 1 202 ALA 202 486 486 ALA ALA B . n 
B 1 203 ALA 203 487 487 ALA ALA B . n 
B 1 204 ALA 204 488 488 ALA ALA B . n 
B 1 205 GLY 205 489 489 GLY GLY B . n 
B 1 206 ILE 206 490 490 ILE ILE B . n 
B 1 207 GLY 207 491 491 GLY GLY B . n 
B 1 208 VAL 208 492 492 VAL VAL B . n 
B 1 209 ASP 209 493 493 ASP ASP B . n 
B 1 210 ASP 210 494 494 ASP ASP B . n 
B 1 211 LEU 211 495 495 LEU LEU B . n 
B 1 212 ARG 212 496 496 ARG ARG B . n 
B 1 213 ARG 213 497 497 ARG ARG B . n 
B 1 214 LEU 214 498 498 LEU LEU B . n 
B 1 215 CYS 215 499 499 CYS CYS B . n 
B 1 216 ILE 216 500 500 ILE ILE B . n 
B 1 217 LEU 217 501 501 LEU LEU B . n 
B 1 218 ARG 218 502 502 ARG ARG B . n 
B 1 219 MET 219 503 503 MET MET B . n 
B 1 220 SER 220 504 504 SER SER B . n 
B 1 221 PHE 221 505 505 PHE PHE B . n 
B 1 222 VAL 222 506 506 VAL VAL B . n 
B 1 223 LYS 223 507 507 LYS LYS B . n 
B 1 224 GLY 224 508 508 GLY GLY B . n 
B 1 225 TRP 225 509 509 TRP TRP B . n 
B 1 226 GLY 226 510 510 GLY GLY B . n 
B 1 227 PRO 227 511 511 PRO PRO B . n 
B 1 228 ASP 228 512 512 ASP ASP B . n 
B 1 229 TYR 229 513 513 TYR TYR B . n 
B 1 230 PRO 230 514 514 PRO PRO B . n 
B 1 231 SER 231 515 515 SER SER B . n 
B 1 232 GLN 232 516 516 GLN GLN B . n 
B 1 233 SER 233 517 517 SER SER B . n 
B 1 234 ILE 234 518 518 ILE ILE B . n 
B 1 235 LYS 235 519 519 LYS LYS B . n 
B 1 236 GLU 236 520 520 GLU GLU B . n 
B 1 237 THR 237 521 521 THR THR B . n 
B 1 238 PRO 238 522 522 PRO PRO B . n 
B 1 239 CYS 239 523 523 CYS CYS B . n 
B 1 240 TRP 240 524 524 TRP TRP B . n 
B 1 241 ILE 241 525 525 ILE ILE B . n 
B 1 242 GLU 242 526 526 GLU GLU B . n 
B 1 243 ILE 243 527 527 ILE ILE B . n 
B 1 244 HIS 244 528 528 HIS HIS B . n 
B 1 245 LEU 245 529 529 LEU LEU B . n 
B 1 246 HIS 246 530 530 HIS HIS B . n 
B 1 247 ARG 247 531 531 ARG ARG B . n 
B 1 248 ALA 248 532 532 ALA ALA B . n 
B 1 249 LEU 249 533 533 LEU LEU B . n 
B 1 250 GLN 250 534 534 GLN GLN B . n 
B 1 251 LEU 251 535 535 LEU LEU B . n 
B 1 252 LEU 252 536 536 LEU LEU B . n 
B 1 253 ASP 253 537 537 ASP ASP B . n 
B 1 254 GLU 254 538 538 GLU GLU B . n 
B 1 255 VAL 255 539 539 VAL VAL B . n 
B 1 256 LEU 256 540 540 LEU LEU B . n 
B 1 257 HIS 257 541 541 HIS HIS B . n 
B 1 258 THR 258 542 542 THR THR B . n 
B 1 259 MET 259 543 543 MET MET B . n 
B 1 260 PRO 260 544 544 PRO PRO B . n 
B 1 261 ILE 261 545 545 ILE ILE B . n 
B 1 262 ALA 262 546 546 ALA ALA B . n 
B 1 263 ASP 263 547 547 ASP ASP B . n 
B 1 264 PRO 264 548 548 PRO PRO B . n 
B 1 265 GLN 265 549 549 GLN GLN B . n 
B 1 266 PRO 266 550 550 PRO PRO B . n 
B 1 267 LEU 267 551 ?   ?   ?   B . n 
B 1 268 ASP 268 552 ?   ?   ?   B . n 
C 1 1   ASN 1   285 285 ASN ASN C . n 
C 1 2   GLY 2   286 286 GLY GLY C . n 
C 1 3   HIS 3   287 287 HIS HIS C . n 
C 1 4   LEU 4   288 288 LEU LEU C . n 
C 1 5   GLN 5   289 289 GLN GLN C . n 
C 1 6   HIS 6   290 290 HIS HIS C . n 
C 1 7   HIS 7   291 291 HIS HIS C . n 
C 1 8   PRO 8   292 292 PRO PRO C . n 
C 1 9   PRO 9   293 293 PRO PRO C . n 
C 1 10  MET 10  294 294 MET MET C . n 
C 1 11  PRO 11  295 ?   ?   ?   C . n 
C 1 12  PRO 12  296 ?   ?   ?   C . n 
C 1 13  HIS 13  297 ?   ?   ?   C . n 
C 1 14  PRO 14  298 ?   ?   ?   C . n 
C 1 15  GLY 15  299 ?   ?   ?   C . n 
C 1 16  HIS 16  300 ?   ?   ?   C . n 
C 1 17  TYR 17  301 ?   ?   ?   C . n 
C 1 18  TRP 18  302 ?   ?   ?   C . n 
C 1 19  PRO 19  303 ?   ?   ?   C . n 
C 1 20  VAL 20  304 ?   ?   ?   C . n 
C 1 21  HIS 21  305 ?   ?   ?   C . n 
C 1 22  ASN 22  306 ?   ?   ?   C . n 
C 1 23  GLU 23  307 ?   ?   ?   C . n 
C 1 24  LEU 24  308 ?   ?   ?   C . n 
C 1 25  ALA 25  309 ?   ?   ?   C . n 
C 1 26  PHE 26  310 ?   ?   ?   C . n 
C 1 27  GLN 27  311 ?   ?   ?   C . n 
C 1 28  PRO 28  312 312 PRO PRO C . n 
C 1 29  PRO 29  313 313 PRO PRO C . n 
C 1 30  ILE 30  314 314 ILE ILE C . n 
C 1 31  SER 31  315 315 SER SER C . n 
C 1 32  ASN 32  316 316 ASN ASN C . n 
C 1 33  HIS 33  317 317 HIS HIS C . n 
C 1 34  PRO 34  318 318 PRO PRO C . n 
C 1 35  ALA 35  319 319 ALA ALA C . n 
C 1 36  PRO 36  320 320 PRO PRO C . n 
C 1 37  GLU 37  321 321 GLU GLU C . n 
C 1 38  TYR 38  322 322 TYR TYR C . n 
C 1 39  TRP 39  323 323 TRP TRP C . n 
C 1 40  CYS 40  324 324 CYS CYS C . n 
C 1 41  SER 41  325 325 SER SER C . n 
C 1 42  ILE 42  326 326 ILE ILE C . n 
C 1 43  ALA 43  327 327 ALA ALA C . n 
C 1 44  TYR 44  328 328 TYR TYR C . n 
C 1 45  PHE 45  329 329 PHE PHE C . n 
C 1 46  GLU 46  330 330 GLU GLU C . n 
C 1 47  MET 47  331 331 MET MET C . n 
C 1 48  ASP 48  332 332 ASP ASP C . n 
C 1 49  VAL 49  333 333 VAL VAL C . n 
C 1 50  GLN 50  334 334 GLN GLN C . n 
C 1 51  VAL 51  335 335 VAL VAL C . n 
C 1 52  GLY 52  336 336 GLY GLY C . n 
C 1 53  GLU 53  337 337 GLU GLU C . n 
C 1 54  THR 54  338 338 THR THR C . n 
C 1 55  PHE 55  339 339 PHE PHE C . n 
C 1 56  LYS 56  340 340 LYS LYS C . n 
C 1 57  VAL 57  341 341 VAL VAL C . n 
C 1 58  PRO 58  342 342 PRO PRO C . n 
C 1 59  SER 59  343 343 SER SER C . n 
C 1 60  SER 60  344 344 SER SER C . n 
C 1 61  CYS 61  345 345 CYS CYS C . n 
C 1 62  PRO 62  346 346 PRO PRO C . n 
C 1 63  ILE 63  347 347 ILE ILE C . n 
C 1 64  VAL 64  348 348 VAL VAL C . n 
C 1 65  THR 65  349 349 THR THR C . n 
C 1 66  VAL 66  350 350 VAL VAL C . n 
C 1 67  ASP 67  351 351 ASP ASP C . n 
C 1 68  GLY 68  352 352 GLY GLY C . n 
C 1 69  TYR 69  353 353 TYR TYR C . n 
C 1 70  VAL 70  354 354 VAL VAL C . n 
C 1 71  ASP 71  355 355 ASP ASP C . n 
C 1 72  PRO 72  356 356 PRO PRO C . n 
C 1 73  SER 73  357 357 SER SER C . n 
C 1 74  GLY 74  358 358 GLY GLY C . n 
C 1 75  GLY 75  359 359 GLY GLY C . n 
C 1 76  ASP 76  360 360 ASP ASP C . n 
C 1 77  ARG 77  361 361 ARG ARG C . n 
C 1 78  PHE 78  362 362 PHE PHE C . n 
C 1 79  CYS 79  363 363 CYS CYS C . n 
C 1 80  LEU 80  364 364 LEU LEU C . n 
C 1 81  GLY 81  365 365 GLY GLY C . n 
C 1 82  GLN 82  366 366 GLN GLN C . n 
C 1 83  LEU 83  367 367 LEU LEU C . n 
C 1 84  SER 84  368 368 SER SER C . n 
C 1 85  ASN 85  369 369 ASN ASN C . n 
C 1 86  VAL 86  370 370 VAL VAL C . n 
C 1 87  HIS 87  371 371 HIS HIS C . n 
C 1 88  ARG 88  372 372 ARG ARG C . n 
C 1 89  THR 89  373 373 THR THR C . n 
C 1 90  GLU 90  374 374 GLU GLU C . n 
C 1 91  ALA 91  375 375 ALA ALA C . n 
C 1 92  ILE 92  376 376 ILE ILE C . n 
C 1 93  GLU 93  377 377 GLU GLU C . n 
C 1 94  ARG 94  378 378 ARG ARG C . n 
C 1 95  ALA 95  379 379 ALA ALA C . n 
C 1 96  ARG 96  380 380 ARG ARG C . n 
C 1 97  LEU 97  381 381 LEU LEU C . n 
C 1 98  HIS 98  382 382 HIS HIS C . n 
C 1 99  ILE 99  383 383 ILE ILE C . n 
C 1 100 GLY 100 384 384 GLY GLY C . n 
C 1 101 LYS 101 385 385 LYS LYS C . n 
C 1 102 GLY 102 386 386 GLY GLY C . n 
C 1 103 VAL 103 387 387 VAL VAL C . n 
C 1 104 GLN 104 388 388 GLN GLN C . n 
C 1 105 LEU 105 389 389 LEU LEU C . n 
C 1 106 GLU 106 390 390 GLU GLU C . n 
C 1 107 CYS 107 391 391 CYS CYS C . n 
C 1 108 LYS 108 392 392 LYS LYS C . n 
C 1 109 GLY 109 393 393 GLY GLY C . n 
C 1 110 GLU 110 394 394 GLU GLU C . n 
C 1 111 GLY 111 395 395 GLY GLY C . n 
C 1 112 ASP 112 396 396 ASP ASP C . n 
C 1 113 VAL 113 397 397 VAL VAL C . n 
C 1 114 TRP 114 398 398 TRP TRP C . n 
C 1 115 VAL 115 399 399 VAL VAL C . n 
C 1 116 ARG 116 400 400 ARG ARG C . n 
C 1 117 CYS 117 401 401 CYS CYS C . n 
C 1 118 LEU 118 402 402 LEU LEU C . n 
C 1 119 SER 119 403 403 SER SER C . n 
C 1 120 ASP 120 404 404 ASP ASP C . n 
C 1 121 HIS 121 405 405 HIS HIS C . n 
C 1 122 ALA 122 406 406 ALA ALA C . n 
C 1 123 VAL 123 407 407 VAL VAL C . n 
C 1 124 PHE 124 408 408 PHE PHE C . n 
C 1 125 VAL 125 409 409 VAL VAL C . n 
C 1 126 GLN 126 410 410 GLN GLN C . n 
C 1 127 SER 127 411 411 SER SER C . n 
C 1 128 TYR 128 412 412 TYR TYR C . n 
C 1 129 TYR 129 413 413 TYR TYR C . n 
C 1 130 LEU 130 414 414 LEU LEU C . n 
C 1 131 ASP 131 415 415 ASP ASP C . n 
C 1 132 ARG 132 416 416 ARG ARG C . n 
C 1 133 GLU 133 417 417 GLU GLU C . n 
C 1 134 ALA 134 418 418 ALA ALA C . n 
C 1 135 GLY 135 419 419 GLY GLY C . n 
C 1 136 ARG 136 420 420 ARG ARG C . n 
C 1 137 ALA 137 421 421 ALA ALA C . n 
C 1 138 PRO 138 422 422 PRO PRO C . n 
C 1 139 GLY 139 423 423 GLY GLY C . n 
C 1 140 ASP 140 424 424 ASP ASP C . n 
C 1 141 ALA 141 425 425 ALA ALA C . n 
C 1 142 VAL 142 426 426 VAL VAL C . n 
C 1 143 HIS 143 427 427 HIS HIS C . n 
C 1 144 LYS 144 428 428 LYS LYS C . n 
C 1 145 ILE 145 429 429 ILE ILE C . n 
C 1 146 TYR 146 430 430 TYR TYR C . n 
C 1 147 PRO 147 431 431 PRO PRO C . n 
C 1 148 SER 148 432 432 SER SER C . n 
C 1 149 ALA 149 433 433 ALA ALA C . n 
C 1 150 TYR 150 434 434 TYR TYR C . n 
C 1 151 ILE 151 435 435 ILE ILE C . n 
C 1 152 LYS 152 436 436 LYS LYS C . n 
C 1 153 VAL 153 437 437 VAL VAL C . n 
C 1 154 PHE 154 438 438 PHE PHE C . n 
C 1 155 ASP 155 439 439 ASP ASP C . n 
C 1 156 LEU 156 440 440 LEU LEU C . n 
C 1 157 ARG 157 441 441 ARG ARG C . n 
C 1 158 GLN 158 442 442 GLN GLN C . n 
C 1 159 CYS 159 443 443 CYS CYS C . n 
C 1 160 HIS 160 444 444 HIS HIS C . n 
C 1 161 ARG 161 445 445 ARG ARG C . n 
C 1 162 GLN 162 446 446 GLN GLN C . n 
C 1 163 MET 163 447 447 MET MET C . n 
C 1 164 GLN 164 448 448 GLN GLN C . n 
C 1 165 GLN 165 449 449 GLN GLN C . n 
C 1 166 GLN 166 450 450 GLN GLN C . n 
C 1 167 ALA 167 451 451 ALA ALA C . n 
C 1 168 ALA 168 452 452 ALA ALA C . n 
C 1 169 THR 169 453 453 THR THR C . n 
C 1 170 ALA 170 454 454 ALA ALA C . n 
C 1 171 GLN 171 455 455 GLN GLN C . n 
C 1 172 ALA 172 456 456 ALA ALA C . n 
C 1 173 ALA 173 457 457 ALA ALA C . n 
C 1 174 ALA 174 458 458 ALA ALA C . n 
C 1 175 ALA 175 459 459 ALA ALA C . n 
C 1 176 ALA 176 460 460 ALA ALA C . n 
C 1 177 GLN 177 461 461 GLN GLN C . n 
C 1 178 ALA 178 462 462 ALA ALA C . n 
C 1 179 ALA 179 463 463 ALA ALA C . n 
C 1 180 ALA 180 464 464 ALA ALA C . n 
C 1 181 VAL 181 465 465 VAL VAL C . n 
C 1 182 ALA 182 466 ?   ?   ?   C . n 
C 1 183 GLY 183 467 ?   ?   ?   C . n 
C 1 184 ASN 184 468 ?   ?   ?   C . n 
C 1 185 ILE 185 469 ?   ?   ?   C . n 
C 1 186 PRO 186 470 ?   ?   ?   C . n 
C 1 187 GLY 187 471 ?   ?   ?   C . n 
C 1 188 PRO 188 472 ?   ?   ?   C . n 
C 1 189 GLY 189 473 ?   ?   ?   C . n 
C 1 190 SER 190 474 ?   ?   ?   C . n 
C 1 191 VAL 191 475 ?   ?   ?   C . n 
C 1 192 GLY 192 476 ?   ?   ?   C . n 
C 1 193 GLY 193 477 ?   ?   ?   C . n 
C 1 194 ILE 194 478 ?   ?   ?   C . n 
C 1 195 ALA 195 479 479 ALA ALA C . n 
C 1 196 PRO 196 480 480 PRO PRO C . n 
C 1 197 ALA 197 481 481 ALA ALA C . n 
C 1 198 ILE 198 482 482 ILE ILE C . n 
C 1 199 SER 199 483 483 SER SER C . n 
C 1 200 LEU 200 484 484 LEU LEU C . n 
C 1 201 SER 201 485 485 SER SER C . n 
C 1 202 ALA 202 486 486 ALA ALA C . n 
C 1 203 ALA 203 487 487 ALA ALA C . n 
C 1 204 ALA 204 488 488 ALA ALA C . n 
C 1 205 GLY 205 489 489 GLY GLY C . n 
C 1 206 ILE 206 490 490 ILE ILE C . n 
C 1 207 GLY 207 491 491 GLY GLY C . n 
C 1 208 VAL 208 492 492 VAL VAL C . n 
C 1 209 ASP 209 493 493 ASP ASP C . n 
C 1 210 ASP 210 494 494 ASP ASP C . n 
C 1 211 LEU 211 495 495 LEU LEU C . n 
C 1 212 ARG 212 496 496 ARG ARG C . n 
C 1 213 ARG 213 497 497 ARG ARG C . n 
C 1 214 LEU 214 498 498 LEU LEU C . n 
C 1 215 CYS 215 499 499 CYS CYS C . n 
C 1 216 ILE 216 500 500 ILE ILE C . n 
C 1 217 LEU 217 501 501 LEU LEU C . n 
C 1 218 ARG 218 502 502 ARG ARG C . n 
C 1 219 MET 219 503 503 MET MET C . n 
C 1 220 SER 220 504 504 SER SER C . n 
C 1 221 PHE 221 505 505 PHE PHE C . n 
C 1 222 VAL 222 506 506 VAL VAL C . n 
C 1 223 LYS 223 507 507 LYS LYS C . n 
C 1 224 GLY 224 508 508 GLY GLY C . n 
C 1 225 TRP 225 509 509 TRP TRP C . n 
C 1 226 GLY 226 510 510 GLY GLY C . n 
C 1 227 PRO 227 511 511 PRO PRO C . n 
C 1 228 ASP 228 512 512 ASP ASP C . n 
C 1 229 TYR 229 513 513 TYR TYR C . n 
C 1 230 PRO 230 514 514 PRO PRO C . n 
C 1 231 SER 231 515 515 SER SER C . n 
C 1 232 GLN 232 516 516 GLN GLN C . n 
C 1 233 SER 233 517 517 SER SER C . n 
C 1 234 ILE 234 518 518 ILE ILE C . n 
C 1 235 LYS 235 519 519 LYS LYS C . n 
C 1 236 GLU 236 520 520 GLU GLU C . n 
C 1 237 THR 237 521 521 THR THR C . n 
C 1 238 PRO 238 522 522 PRO PRO C . n 
C 1 239 CYS 239 523 523 CYS CYS C . n 
C 1 240 TRP 240 524 524 TRP TRP C . n 
C 1 241 ILE 241 525 525 ILE ILE C . n 
C 1 242 GLU 242 526 526 GLU GLU C . n 
C 1 243 ILE 243 527 527 ILE ILE C . n 
C 1 244 HIS 244 528 528 HIS HIS C . n 
C 1 245 LEU 245 529 529 LEU LEU C . n 
C 1 246 HIS 246 530 530 HIS HIS C . n 
C 1 247 ARG 247 531 531 ARG ARG C . n 
C 1 248 ALA 248 532 532 ALA ALA C . n 
C 1 249 LEU 249 533 533 LEU LEU C . n 
C 1 250 GLN 250 534 534 GLN GLN C . n 
C 1 251 LEU 251 535 535 LEU LEU C . n 
C 1 252 LEU 252 536 536 LEU LEU C . n 
C 1 253 ASP 253 537 537 ASP ASP C . n 
C 1 254 GLU 254 538 538 GLU GLU C . n 
C 1 255 VAL 255 539 539 VAL VAL C . n 
C 1 256 LEU 256 540 540 LEU LEU C . n 
C 1 257 HIS 257 541 541 HIS HIS C . n 
C 1 258 THR 258 542 542 THR THR C . n 
C 1 259 MET 259 543 543 MET MET C . n 
C 1 260 PRO 260 544 544 PRO PRO C . n 
C 1 261 ILE 261 545 545 ILE ILE C . n 
C 1 262 ALA 262 546 546 ALA ALA C . n 
C 1 263 ASP 263 547 547 ASP ASP C . n 
C 1 264 PRO 264 548 548 PRO PRO C . n 
C 1 265 GLN 265 549 549 GLN GLN C . n 
C 1 266 PRO 266 550 550 PRO PRO C . n 
C 1 267 LEU 267 551 ?   ?   ?   C . n 
C 1 268 ASP 268 552 ?   ?   ?   C . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5230  ? 
1 MORE         -18   ? 
1 'SSA (A^2)'  31240 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2000-11-29 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
AMoRE phasing          .         ? 1 
CNS   refinement       0.9       ? 2 
DENZO 'data reduction' .         ? 3 
CCP4  'data scaling'   '(SCALA)' ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PRO A 312 ? ? -54.27  172.65  
2  1 HIS A 317 ? ? -37.41  139.59  
3  1 MET A 331 ? ? 67.33   -114.05 
4  1 TYR A 353 ? ? -77.83  -161.44 
5  1 SER A 357 ? ? -46.87  155.43  
6  1 ASN A 369 ? ? -162.91 108.31  
7  1 LYS A 385 ? ? -53.49  -8.41   
8  1 PRO A 422 ? ? -39.91  115.97  
9  1 ASP A 424 ? ? -104.93 60.62   
10 1 ALA A 425 ? ? -174.51 146.14  
11 1 SER A 432 ? ? 75.02   -5.40   
12 1 ALA A 457 ? ? -78.06  30.23   
13 1 ASP A 493 ? ? -63.47  13.71   
14 1 VAL A 506 ? ? 62.30   -67.68  
15 1 LYS A 519 ? ? -68.84  7.38    
16 1 CYS A 523 ? ? -161.37 118.29  
17 1 MET A 543 ? ? -117.55 64.98   
18 1 PRO B 312 ? ? -58.85  175.96  
19 1 HIS B 317 ? ? -37.29  140.00  
20 1 MET B 331 ? ? 69.36   -125.31 
21 1 SER B 357 ? ? -29.64  -45.61  
22 1 ASN B 369 ? ? -169.76 97.44   
23 1 ASP B 424 ? ? -106.54 73.88   
24 1 ALA B 425 ? ? 166.43  149.46  
25 1 SER B 432 ? ? 84.16   -14.59  
26 1 ALA B 464 ? ? -62.79  -95.12  
27 1 PRO B 480 ? ? -85.53  -147.39 
28 1 ALA B 488 ? ? -51.62  74.04   
29 1 VAL B 506 ? ? 54.11   -64.46  
30 1 CYS B 523 ? ? -161.10 107.54  
31 1 ALA B 546 ? ? -64.50  82.24   
32 1 PRO B 548 ? ? -33.54  133.98  
33 1 MET C 331 ? ? 55.97   -116.40 
34 1 CYS C 345 ? ? -113.15 72.16   
35 1 SER C 357 ? ? -37.54  -20.99  
36 1 LEU C 367 ? ? -38.88  136.90  
37 1 ARG C 372 ? ? -44.94  150.65  
38 1 LYS C 385 ? ? -59.85  -1.15   
39 1 ASP C 424 ? ? -95.81  55.86   
40 1 SER C 432 ? ? 92.10   -27.70  
41 1 ALA C 464 ? ? -69.26  24.83   
42 1 ALA C 481 ? ? -68.58  40.00   
43 1 VAL C 506 ? ? 61.28   -59.60  
44 1 ASP C 512 ? ? -65.85  5.58    
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A HIS 297 ? A HIS 13  
2   1 Y 1 A PRO 298 ? A PRO 14  
3   1 Y 1 A GLY 299 ? A GLY 15  
4   1 Y 1 A HIS 300 ? A HIS 16  
5   1 Y 1 A TYR 301 ? A TYR 17  
6   1 Y 1 A TRP 302 ? A TRP 18  
7   1 Y 1 A PRO 303 ? A PRO 19  
8   1 Y 1 A VAL 304 ? A VAL 20  
9   1 Y 1 A HIS 305 ? A HIS 21  
10  1 Y 1 A ASN 306 ? A ASN 22  
11  1 Y 1 A GLU 307 ? A GLU 23  
12  1 Y 1 A LEU 308 ? A LEU 24  
13  1 Y 1 A ALA 309 ? A ALA 25  
14  1 Y 1 A PHE 310 ? A PHE 26  
15  1 Y 1 A GLN 461 ? A GLN 177 
16  1 Y 1 A ALA 462 ? A ALA 178 
17  1 Y 1 A ALA 463 ? A ALA 179 
18  1 Y 1 A ALA 464 ? A ALA 180 
19  1 Y 1 A VAL 465 ? A VAL 181 
20  1 Y 1 A ALA 466 ? A ALA 182 
21  1 Y 1 A GLY 467 ? A GLY 183 
22  1 Y 1 A ASN 468 ? A ASN 184 
23  1 Y 1 A ILE 469 ? A ILE 185 
24  1 Y 1 A PRO 470 ? A PRO 186 
25  1 Y 1 A GLY 471 ? A GLY 187 
26  1 Y 1 A PRO 472 ? A PRO 188 
27  1 Y 1 A GLY 473 ? A GLY 189 
28  1 Y 1 A SER 474 ? A SER 190 
29  1 Y 1 A VAL 475 ? A VAL 191 
30  1 Y 1 A GLY 476 ? A GLY 192 
31  1 Y 1 A GLY 477 ? A GLY 193 
32  1 Y 1 A ILE 478 ? A ILE 194 
33  1 Y 1 A ALA 479 ? A ALA 195 
34  1 Y 1 A PRO 480 ? A PRO 196 
35  1 Y 1 A ALA 481 ? A ALA 197 
36  1 Y 1 A ILE 482 ? A ILE 198 
37  1 Y 1 A SER 483 ? A SER 199 
38  1 Y 1 A LEU 484 ? A LEU 200 
39  1 Y 1 A SER 485 ? A SER 201 
40  1 Y 1 A ALA 486 ? A ALA 202 
41  1 Y 1 A ALA 546 ? A ALA 262 
42  1 Y 1 A ASP 547 ? A ASP 263 
43  1 Y 1 A PRO 548 ? A PRO 264 
44  1 Y 1 A GLN 549 ? A GLN 265 
45  1 Y 1 A PRO 550 ? A PRO 266 
46  1 Y 1 A LEU 551 ? A LEU 267 
47  1 Y 1 A ASP 552 ? A ASP 268 
48  1 Y 1 B HIS 297 ? B HIS 13  
49  1 Y 1 B PRO 298 ? B PRO 14  
50  1 Y 1 B GLY 299 ? B GLY 15  
51  1 Y 1 B HIS 300 ? B HIS 16  
52  1 Y 1 B TYR 301 ? B TYR 17  
53  1 Y 1 B TRP 302 ? B TRP 18  
54  1 Y 1 B PRO 303 ? B PRO 19  
55  1 Y 1 B VAL 304 ? B VAL 20  
56  1 Y 1 B HIS 305 ? B HIS 21  
57  1 Y 1 B ASN 306 ? B ASN 22  
58  1 Y 1 B GLU 307 ? B GLU 23  
59  1 Y 1 B LEU 308 ? B LEU 24  
60  1 Y 1 B GLY 467 ? B GLY 183 
61  1 Y 1 B ASN 468 ? B ASN 184 
62  1 Y 1 B ILE 469 ? B ILE 185 
63  1 Y 1 B PRO 470 ? B PRO 186 
64  1 Y 1 B GLY 471 ? B GLY 187 
65  1 Y 1 B PRO 472 ? B PRO 188 
66  1 Y 1 B GLY 473 ? B GLY 189 
67  1 Y 1 B SER 474 ? B SER 190 
68  1 Y 1 B VAL 475 ? B VAL 191 
69  1 Y 1 B GLY 476 ? B GLY 192 
70  1 Y 1 B GLY 477 ? B GLY 193 
71  1 Y 1 B ILE 478 ? B ILE 194 
72  1 Y 1 B LEU 551 ? B LEU 267 
73  1 Y 1 B ASP 552 ? B ASP 268 
74  1 Y 1 C PRO 295 ? C PRO 11  
75  1 Y 1 C PRO 296 ? C PRO 12  
76  1 Y 1 C HIS 297 ? C HIS 13  
77  1 Y 1 C PRO 298 ? C PRO 14  
78  1 Y 1 C GLY 299 ? C GLY 15  
79  1 Y 1 C HIS 300 ? C HIS 16  
80  1 Y 1 C TYR 301 ? C TYR 17  
81  1 Y 1 C TRP 302 ? C TRP 18  
82  1 Y 1 C PRO 303 ? C PRO 19  
83  1 Y 1 C VAL 304 ? C VAL 20  
84  1 Y 1 C HIS 305 ? C HIS 21  
85  1 Y 1 C ASN 306 ? C ASN 22  
86  1 Y 1 C GLU 307 ? C GLU 23  
87  1 Y 1 C LEU 308 ? C LEU 24  
88  1 Y 1 C ALA 309 ? C ALA 25  
89  1 Y 1 C PHE 310 ? C PHE 26  
90  1 Y 1 C GLN 311 ? C GLN 27  
91  1 Y 1 C ALA 466 ? C ALA 182 
92  1 Y 1 C GLY 467 ? C GLY 183 
93  1 Y 1 C ASN 468 ? C ASN 184 
94  1 Y 1 C ILE 469 ? C ILE 185 
95  1 Y 1 C PRO 470 ? C PRO 186 
96  1 Y 1 C GLY 471 ? C GLY 187 
97  1 Y 1 C PRO 472 ? C PRO 188 
98  1 Y 1 C GLY 473 ? C GLY 189 
99  1 Y 1 C SER 474 ? C SER 190 
100 1 Y 1 C VAL 475 ? C VAL 191 
101 1 Y 1 C GLY 476 ? C GLY 192 
102 1 Y 1 C GLY 477 ? C GLY 193 
103 1 Y 1 C ILE 478 ? C ILE 194 
104 1 Y 1 C LEU 551 ? C LEU 267 
105 1 Y 1 C ASP 552 ? C ASP 268 
#