data_1GGZ
# 
_entry.id   1GGZ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1GGZ         
RCSB  RCSB001503   
WWPDB D_1000001503 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1CLL 
_pdbx_database_related.details        '1CLL (calmodulin) has 85% sequence homology and similar structure.' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.entry_id                        1GGZ 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2000-10-13 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Han, B.-G.'   1 
'Han, M.'      2 
'Sui, H.'      3 
'Yaswen, P.'   4 
'Walian, P.J.' 5 
'Jap, B.K.'    6 
# 
_citation.id                        primary 
_citation.title                     'Crystal structure of human calmodulin-like protein: insights into its functional role.' 
_citation.journal_abbrev            'FEBS Lett.' 
_citation.journal_volume            521 
_citation.page_first                24 
_citation.page_last                 30 
_citation.year                      2002 
_citation.journal_id_ASTM           FEBLAL 
_citation.country                   NE 
_citation.journal_id_ISSN           0014-5793 
_citation.journal_id_CSD            0165 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12067719 
_citation.pdbx_database_id_DOI      '10.1016/S0014-5793(02)02780-1' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Han, B.G.'    1 
primary 'Han, M.'      2 
primary 'Sui, H.'      3 
primary 'Yaswen, P.'   4 
primary 'Walian, P.J.' 5 
primary 'Jap, B.K.'    6 
# 
_cell.length_a           63.38 
_cell.length_b           93.63 
_cell.length_c           24.86 
_cell.angle_alpha        90.0 
_cell.angle_beta         90.0 
_cell.angle_gamma        90.0 
_cell.entry_id           1GGZ 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              4 
# 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.entry_id                         1GGZ 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                18 
_symmetry.cell_setting                     ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'CALMODULIN-RELATED PROTEIN NB-1' 16778.508 1   ? ? ? ? 
2 non-polymer syn 'CALCIUM ION'                     40.078    4   ? ? ? ? 
3 water       nat water                             18.015    260 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'CALMODULIN-LIKE PROTEIN' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;ADQLTEEQVTEFKEAFSLFDKDGDGCITTRELGTVMRSLGQNPTEAELRDMMSEIDRDGNGTVDFPEFLGMMARKMKDTD
NEEEIREAFRVFDKDGNGFVSAAELRHVMTRLGEKLSDEEVDEMIRAADTDGDGQVNYEEFVRVLVSK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;ADQLTEEQVTEFKEAFSLFDKDGDGCITTRELGTVMRSLGQNPTEAELRDMMSEIDRDGNGTVDFPEFLGMMARKMKDTD
NEEEIREAFRVFDKDGNGFVSAAELRHVMTRLGEKLSDEEVDEMIRAADTDGDGQVNYEEFVRVLVSK
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   ASP n 
1 3   GLN n 
1 4   LEU n 
1 5   THR n 
1 6   GLU n 
1 7   GLU n 
1 8   GLN n 
1 9   VAL n 
1 10  THR n 
1 11  GLU n 
1 12  PHE n 
1 13  LYS n 
1 14  GLU n 
1 15  ALA n 
1 16  PHE n 
1 17  SER n 
1 18  LEU n 
1 19  PHE n 
1 20  ASP n 
1 21  LYS n 
1 22  ASP n 
1 23  GLY n 
1 24  ASP n 
1 25  GLY n 
1 26  CYS n 
1 27  ILE n 
1 28  THR n 
1 29  THR n 
1 30  ARG n 
1 31  GLU n 
1 32  LEU n 
1 33  GLY n 
1 34  THR n 
1 35  VAL n 
1 36  MET n 
1 37  ARG n 
1 38  SER n 
1 39  LEU n 
1 40  GLY n 
1 41  GLN n 
1 42  ASN n 
1 43  PRO n 
1 44  THR n 
1 45  GLU n 
1 46  ALA n 
1 47  GLU n 
1 48  LEU n 
1 49  ARG n 
1 50  ASP n 
1 51  MET n 
1 52  MET n 
1 53  SER n 
1 54  GLU n 
1 55  ILE n 
1 56  ASP n 
1 57  ARG n 
1 58  ASP n 
1 59  GLY n 
1 60  ASN n 
1 61  GLY n 
1 62  THR n 
1 63  VAL n 
1 64  ASP n 
1 65  PHE n 
1 66  PRO n 
1 67  GLU n 
1 68  PHE n 
1 69  LEU n 
1 70  GLY n 
1 71  MET n 
1 72  MET n 
1 73  ALA n 
1 74  ARG n 
1 75  LYS n 
1 76  MET n 
1 77  LYS n 
1 78  ASP n 
1 79  THR n 
1 80  ASP n 
1 81  ASN n 
1 82  GLU n 
1 83  GLU n 
1 84  GLU n 
1 85  ILE n 
1 86  ARG n 
1 87  GLU n 
1 88  ALA n 
1 89  PHE n 
1 90  ARG n 
1 91  VAL n 
1 92  PHE n 
1 93  ASP n 
1 94  LYS n 
1 95  ASP n 
1 96  GLY n 
1 97  ASN n 
1 98  GLY n 
1 99  PHE n 
1 100 VAL n 
1 101 SER n 
1 102 ALA n 
1 103 ALA n 
1 104 GLU n 
1 105 LEU n 
1 106 ARG n 
1 107 HIS n 
1 108 VAL n 
1 109 MET n 
1 110 THR n 
1 111 ARG n 
1 112 LEU n 
1 113 GLY n 
1 114 GLU n 
1 115 LYS n 
1 116 LEU n 
1 117 SER n 
1 118 ASP n 
1 119 GLU n 
1 120 GLU n 
1 121 VAL n 
1 122 ASP n 
1 123 GLU n 
1 124 MET n 
1 125 ILE n 
1 126 ARG n 
1 127 ALA n 
1 128 ALA n 
1 129 ASP n 
1 130 THR n 
1 131 ASP n 
1 132 GLY n 
1 133 ASP n 
1 134 GLY n 
1 135 GLN n 
1 136 VAL n 
1 137 ASN n 
1 138 TYR n 
1 139 GLU n 
1 140 GLU n 
1 141 PHE n 
1 142 VAL n 
1 143 ARG n 
1 144 VAL n 
1 145 LEU n 
1 146 VAL n 
1 147 SER n 
1 148 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 EPITHELIAL 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET-11D 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CALL3_HUMAN 
_struct_ref.pdbx_db_accession          P27482 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MADQLTEEQVTEFKEAFSLFDKDGDGCITTRELGTVMRSLGQNPTEAELRDMMSEIDRDGNGTVDFPEFLGMMARKMKDT
DNEEEIREAFRVFDKDGNGFVSAAELRHVMTRLGEKLSDEEVDEMIRAADTDGDGQVNYEEFVRVLVSK
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1GGZ 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 148 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P27482 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  148 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       148 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CA  non-polymer         . 'CALCIUM ION'   ? 'Ca 2'           40.078  
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          1GGZ 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   44.04 
_exptl_crystal.density_Matthews      2.20 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          EVAPORATION 
_exptl_crystal_grow.pH              4.5 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.pdbx_details    'MPD, Sodium Acetate, Ethanol, CaCl2, pH 4.5, EVAPORATION, temperature 277K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           110 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.00 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ALS BEAMLINE 5.0.2' 
_diffrn_source.pdbx_wavelength             1.00 
_diffrn_source.pdbx_synchrotron_site       ALS 
_diffrn_source.pdbx_synchrotron_beamline   5.0.2 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.d_resolution_high            1.5 
_reflns.d_resolution_low             20.0 
_reflns.number_all                   24588 
_reflns.number_obs                   23940 
_reflns.percent_possible_obs         97.4 
_reflns.pdbx_Rmerge_I_obs            0.0430000 
_reflns.pdbx_netI_over_sigmaI        30.5 
_reflns.B_iso_Wilson_estimate        17.9 
_reflns.pdbx_redundancy              5.6 
_reflns.entry_id                     1GGZ 
_reflns.pdbx_Rsym_value              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.50 
_reflns_shell.d_res_low              1.53 
_reflns_shell.percent_possible_all   78.7 
_reflns_shell.Rmerge_I_obs           0.2100000 
_reflns_shell.pdbx_redundancy        2.58 
_reflns_shell.number_unique_all      944 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.ls_d_res_high                            1.5 
_refine.ls_d_res_low                             20 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     24588 
_refine.ls_number_reflns_obs                     23750 
_refine.ls_number_reflns_R_free                  1153 
_refine.ls_percent_reflns_obs                    96.7 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_work                       0.1830000 
_refine.ls_R_factor_R_free                       0.2210000 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.details                                  ? 
_refine.entry_id                                 1GGZ 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1138 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         4 
_refine_hist.number_atoms_solvent             260 
_refine_hist.number_atoms_total               1402 
_refine_hist.d_res_high                       1.5 
_refine_hist.d_res_low                        20 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d    0.033 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg 2.6   ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1GGZ 
_struct.title                     'CRYSTAL STRUCTURE OF THE CALMODULIN-LIKE PROTEIN (HCLP) FROM HUMAN EPITHELIAL CELLS' 
_struct.pdbx_descriptor           'CALMODULIN-LIKE PROTEIN' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.text            'Ca+2 binding protein, EF hand, METAL BINDING PROTEIN' 
_struct_keywords.entry_id        1GGZ 
_struct_keywords.pdbx_keywords   'METAL BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 2 ? 
E N N 2 ? 
F N N 3 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 THR A 5   ? ASP A 20  ? THR A 5   ASP A 20  1 ? 16 
HELX_P HELX_P2 2 THR A 28  ? LEU A 39  ? THR A 28  LEU A 39  1 ? 12 
HELX_P HELX_P3 3 THR A 44  ? GLU A 54  ? THR A 44  GLU A 54  1 ? 11 
HELX_P HELX_P4 4 PHE A 65  ? ASP A 93  ? PHE A 65  ASP A 93  1 ? 29 
HELX_P HELX_P5 5 SER A 101 ? LEU A 112 ? SER A 101 LEU A 112 1 ? 12 
HELX_P HELX_P6 6 SER A 117 ? ASP A 129 ? SER A 117 ASP A 129 1 ? 13 
HELX_P HELX_P7 7 TYR A 138 ? SER A 147 ? TYR A 138 SER A 147 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A ASP 20  OD1 ? ? ? 1_555 B CA  . CA ? ? A ASP 20  A CA  149 1_555 ? ? ? ? ? ? ? 2.284 ? 
metalc2  metalc ? ? A ASP 22  OD1 ? ? ? 1_555 B CA  . CA ? ? A ASP 22  A CA  149 1_555 ? ? ? ? ? ? ? 2.391 ? 
metalc3  metalc ? ? A ASP 24  OD1 ? ? ? 1_555 B CA  . CA ? ? A ASP 24  A CA  149 1_555 ? ? ? ? ? ? ? 2.406 ? 
metalc4  metalc ? ? A CYS 26  O   ? ? ? 1_555 B CA  . CA ? ? A CYS 26  A CA  149 1_555 ? ? ? ? ? ? ? 2.279 ? 
metalc5  metalc ? ? A GLU 31  OE1 ? ? ? 1_555 B CA  . CA ? ? A GLU 31  A CA  149 1_555 ? ? ? ? ? ? ? 2.443 ? 
metalc6  metalc ? ? A GLU 31  OE2 ? ? ? 1_555 B CA  . CA ? ? A GLU 31  A CA  149 1_555 ? ? ? ? ? ? ? 2.510 ? 
metalc7  metalc ? ? A ASP 56  OD1 ? ? ? 1_555 C CA  . CA ? ? A ASP 56  A CA  150 1_555 ? ? ? ? ? ? ? 2.328 ? 
metalc8  metalc ? ? A ASP 58  OD1 ? ? ? 1_555 C CA  . CA ? ? A ASP 58  A CA  150 1_555 ? ? ? ? ? ? ? 2.370 ? 
metalc9  metalc ? ? A ASN 60  OD1 ? ? ? 1_555 C CA  . CA ? ? A ASN 60  A CA  150 1_555 ? ? ? ? ? ? ? 2.418 ? 
metalc10 metalc ? ? A THR 62  O   ? ? ? 1_555 C CA  . CA ? ? A THR 62  A CA  150 1_555 ? ? ? ? ? ? ? 2.325 ? 
metalc11 metalc ? ? A GLU 67  OE1 ? ? ? 1_555 C CA  . CA ? ? A GLU 67  A CA  150 1_555 ? ? ? ? ? ? ? 2.412 ? 
metalc12 metalc ? ? A GLU 67  OE2 ? ? ? 1_555 C CA  . CA ? ? A GLU 67  A CA  150 1_555 ? ? ? ? ? ? ? 2.519 ? 
metalc13 metalc ? ? A ASP 93  OD1 ? ? ? 1_555 D CA  . CA ? ? A ASP 93  A CA  151 1_555 ? ? ? ? ? ? ? 2.308 ? 
metalc14 metalc ? ? A ASP 95  OD1 ? ? ? 1_555 D CA  . CA ? ? A ASP 95  A CA  151 1_555 ? ? ? ? ? ? ? 2.386 ? 
metalc15 metalc ? ? A ASN 97  OD1 ? ? ? 1_555 D CA  . CA ? ? A ASN 97  A CA  151 1_555 ? ? ? ? ? ? ? 2.430 ? 
metalc16 metalc ? ? A PHE 99  O   ? ? ? 1_555 D CA  . CA ? ? A PHE 99  A CA  151 1_555 ? ? ? ? ? ? ? 2.247 ? 
metalc17 metalc ? ? A GLU 104 OE1 ? ? ? 1_555 D CA  . CA ? ? A GLU 104 A CA  151 1_555 ? ? ? ? ? ? ? 2.451 ? 
metalc18 metalc ? ? A GLU 104 OE2 ? ? ? 1_555 D CA  . CA ? ? A GLU 104 A CA  151 1_555 ? ? ? ? ? ? ? 2.541 ? 
metalc19 metalc ? ? A ASP 129 OD1 ? ? ? 1_555 E CA  . CA ? ? A ASP 129 A CA  152 1_555 ? ? ? ? ? ? ? 2.352 ? 
metalc20 metalc ? ? A ASP 131 OD1 ? ? ? 1_555 E CA  . CA ? ? A ASP 131 A CA  152 1_555 ? ? ? ? ? ? ? 2.336 ? 
metalc21 metalc ? ? A ASP 133 OD1 ? ? ? 1_555 E CA  . CA ? ? A ASP 133 A CA  152 1_555 ? ? ? ? ? ? ? 2.364 ? 
metalc22 metalc ? ? A GLN 135 O   ? ? ? 1_555 E CA  . CA ? ? A GLN 135 A CA  152 1_555 ? ? ? ? ? ? ? 2.349 ? 
metalc23 metalc ? ? A GLU 140 OE1 ? ? ? 1_555 E CA  . CA ? ? A GLU 140 A CA  152 1_555 ? ? ? ? ? ? ? 2.494 ? 
metalc24 metalc ? ? A GLU 140 OE2 ? ? ? 1_555 E CA  . CA ? ? A GLU 140 A CA  152 1_555 ? ? ? ? ? ? ? 2.594 ? 
metalc25 metalc ? ? B CA  .   CA  ? ? ? 1_555 F HOH . O  ? ? A CA  149 A HOH 153 1_555 ? ? ? ? ? ? ? 2.424 ? 
metalc26 metalc ? ? C CA  .   CA  ? ? ? 1_555 F HOH . O  ? ? A CA  150 A HOH 154 1_555 ? ? ? ? ? ? ? 2.352 ? 
metalc27 metalc ? ? D CA  .   CA  ? ? ? 1_555 F HOH . O  ? ? A CA  151 A HOH 155 1_555 ? ? ? ? ? ? ? 2.371 ? 
metalc28 metalc ? ? E CA  .   CA  ? ? ? 1_555 F HOH . O  ? ? A CA  152 A HOH 156 1_555 ? ? ? ? ? ? ? 2.488 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 CYS A 26  ? ILE A 27  ? CYS A 26  ILE A 27  
A 2 VAL A 63  ? ASP A 64  ? VAL A 63  ASP A 64  
B 1 PHE A 99  ? VAL A 100 ? PHE A 99  VAL A 100 
B 2 VAL A 136 ? ASN A 137 ? VAL A 136 ASN A 137 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE A 27  ? N ILE A 27  O VAL A 63  ? O VAL A 63  
B 1 2 N VAL A 100 ? N VAL A 100 O VAL A 136 ? O VAL A 136 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA A 149' 
AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA A 150' 
AC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA A 151' 
AC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA A 152' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 ASP A 20  ? ASP A 20  . ? 1_555 ? 
2  AC1 6 ASP A 22  ? ASP A 22  . ? 1_555 ? 
3  AC1 6 ASP A 24  ? ASP A 24  . ? 1_555 ? 
4  AC1 6 CYS A 26  ? CYS A 26  . ? 1_555 ? 
5  AC1 6 GLU A 31  ? GLU A 31  . ? 1_555 ? 
6  AC1 6 HOH F .   ? HOH A 153 . ? 1_555 ? 
7  AC2 6 ASP A 56  ? ASP A 56  . ? 1_555 ? 
8  AC2 6 ASP A 58  ? ASP A 58  . ? 1_555 ? 
9  AC2 6 ASN A 60  ? ASN A 60  . ? 1_555 ? 
10 AC2 6 THR A 62  ? THR A 62  . ? 1_555 ? 
11 AC2 6 GLU A 67  ? GLU A 67  . ? 1_555 ? 
12 AC2 6 HOH F .   ? HOH A 154 . ? 1_555 ? 
13 AC3 6 ASP A 93  ? ASP A 93  . ? 1_555 ? 
14 AC3 6 ASP A 95  ? ASP A 95  . ? 1_555 ? 
15 AC3 6 ASN A 97  ? ASN A 97  . ? 1_555 ? 
16 AC3 6 PHE A 99  ? PHE A 99  . ? 1_555 ? 
17 AC3 6 GLU A 104 ? GLU A 104 . ? 1_555 ? 
18 AC3 6 HOH F .   ? HOH A 155 . ? 1_555 ? 
19 AC4 6 ASP A 129 ? ASP A 129 . ? 1_555 ? 
20 AC4 6 ASP A 131 ? ASP A 131 . ? 1_555 ? 
21 AC4 6 ASP A 133 ? ASP A 133 . ? 1_555 ? 
22 AC4 6 GLN A 135 ? GLN A 135 . ? 1_555 ? 
23 AC4 6 GLU A 140 ? GLU A 140 . ? 1_555 ? 
24 AC4 6 HOH F .   ? HOH A 156 . ? 1_555 ? 
# 
_atom_sites.entry_id                    1GGZ 
_atom_sites.fract_transf_matrix[1][1]   0.015778 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010680 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.040225 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . LEU A 1 4   ? 25.632 -0.583 17.762  1.00 42.05 ? 4   LEU A N   1 
ATOM   2    C  CA  . LEU A 1 4   ? 25.661 0.535  18.770  1.00 42.65 ? 4   LEU A CA  1 
ATOM   3    C  C   . LEU A 1 4   ? 25.970 0.044  20.161  1.00 41.17 ? 4   LEU A C   1 
ATOM   4    O  O   . LEU A 1 4   ? 25.703 -1.097 20.462  1.00 42.76 ? 4   LEU A O   1 
ATOM   5    C  CB  . LEU A 1 4   ? 24.294 1.211  18.868  1.00 40.43 ? 4   LEU A CB  1 
ATOM   6    C  CG  . LEU A 1 4   ? 23.690 2.005  17.708  1.00 40.85 ? 4   LEU A CG  1 
ATOM   7    C  CD1 . LEU A 1 4   ? 22.254 2.361  18.059  1.00 39.96 ? 4   LEU A CD1 1 
ATOM   8    C  CD2 . LEU A 1 4   ? 24.508 3.216  17.419  1.00 38.53 ? 4   LEU A CD2 1 
ATOM   9    N  N   . THR A 1 5   ? 26.478 0.921  21.036  1.00 40.70 ? 5   THR A N   1 
ATOM   10   C  CA  . THR A 1 5   ? 26.735 0.513  22.433  1.00 39.46 ? 5   THR A CA  1 
ATOM   11   C  C   . THR A 1 5   ? 25.429 0.526  23.269  1.00 41.03 ? 5   THR A C   1 
ATOM   12   O  O   . THR A 1 5   ? 24.427 1.147  22.869  1.00 39.82 ? 5   THR A O   1 
ATOM   13   C  CB  . THR A 1 5   ? 27.705 1.448  23.174  1.00 36.21 ? 5   THR A CB  1 
ATOM   14   O  OG1 . THR A 1 5   ? 27.140 2.761  23.274  1.00 32.11 ? 5   THR A OG1 1 
ATOM   15   C  CG2 . THR A 1 5   ? 29.077 1.533  22.449  1.00 35.21 ? 5   THR A CG2 1 
ATOM   16   N  N   . GLU A 1 6   ? 25.444 -0.141 24.419  1.00 38.41 ? 6   GLU A N   1 
ATOM   17   C  CA  . GLU A 1 6   ? 24.294 -0.170 25.320  1.00 39.50 ? 6   GLU A CA  1 
ATOM   18   C  C   . GLU A 1 6   ? 23.886 1.270  25.629  1.00 38.18 ? 6   GLU A C   1 
ATOM   19   O  O   . GLU A 1 6   ? 22.677 1.638  25.622  1.00 36.97 ? 6   GLU A O   1 
ATOM   20   C  CB  . GLU A 1 6   ? 24.664 -0.842 26.646  1.00 47.33 ? 6   GLU A CB  1 
ATOM   21   C  CG  . GLU A 1 6   ? 23.480 -0.980 27.612  1.00 52.80 ? 6   GLU A CG  1 
ATOM   22   C  CD  . GLU A 1 6   ? 22.394 -1.926 27.084  1.00 56.46 ? 6   GLU A CD  1 
ATOM   23   O  OE1 . GLU A 1 6   ? 21.733 -1.548 26.073  1.00 58.43 ? 6   GLU A OE1 1 
ATOM   24   O  OE2 . GLU A 1 6   ? 22.205 -3.044 27.668  1.00 58.34 ? 6   GLU A OE2 1 
ATOM   25   N  N   . GLU A 1 7   ? 24.897 2.075  25.959  1.00 34.27 ? 7   GLU A N   1 
ATOM   26   C  CA  . GLU A 1 7   ? 24.712 3.469  26.264  1.00 33.27 ? 7   GLU A CA  1 
ATOM   27   C  C   . GLU A 1 7   ? 23.934 4.228  25.186  1.00 30.63 ? 7   GLU A C   1 
ATOM   28   O  O   . GLU A 1 7   ? 23.028 5.036  25.479  1.00 30.24 ? 7   GLU A O   1 
ATOM   29   C  CB  . GLU A 1 7   ? 26.054 4.176  26.393  1.00 43.85 ? 7   GLU A CB  1 
ATOM   30   C  CG  . GLU A 1 7   ? 25.940 5.687  26.526  1.00 47.80 ? 7   GLU A CG  1 
ATOM   31   C  CD  . GLU A 1 7   ? 25.315 6.054  27.854  1.00 52.00 ? 7   GLU A CD  1 
ATOM   32   O  OE1 . GLU A 1 7   ? 26.028 5.806  28.892  1.00 54.69 ? 7   GLU A OE1 1 
ATOM   33   O  OE2 . GLU A 1 7   ? 24.134 6.541  27.867  1.00 53.76 ? 7   GLU A OE2 1 
ATOM   34   N  N   . GLN A 1 8   ? 24.397 4.055  23.955  1.00 29.97 ? 8   GLN A N   1 
ATOM   35   C  CA  . GLN A 1 8   ? 23.781 4.752  22.832  1.00 27.56 ? 8   GLN A CA  1 
ATOM   36   C  C   . GLN A 1 8   ? 22.364 4.301  22.660  1.00 24.02 ? 8   GLN A C   1 
ATOM   37   O  O   . GLN A 1 8   ? 21.461 5.157  22.459  1.00 21.09 ? 8   GLN A O   1 
ATOM   38   C  CB  . GLN A 1 8   ? 24.549 4.494  21.541  1.00 29.70 ? 8   GLN A CB  1 
ATOM   39   C  CG  . GLN A 1 8   ? 25.977 4.970  21.651  1.00 33.09 ? 8   GLN A CG  1 
ATOM   40   C  CD  . GLN A 1 8   ? 26.868 4.591  20.442  1.00 34.24 ? 8   GLN A CD  1 
ATOM   41   O  OE1 . GLN A 1 8   ? 26.906 3.442  19.953  1.00 35.55 ? 8   GLN A OE1 1 
ATOM   42   N  NE2 . GLN A 1 8   ? 27.600 5.571  19.985  1.00 37.71 ? 8   GLN A NE2 1 
ATOM   43   N  N   . VAL A 1 9   ? 22.138 3.013  22.706  1.00 22.71 ? 9   VAL A N   1 
ATOM   44   C  CA  . VAL A 1 9   ? 20.792 2.529  22.542  1.00 22.21 ? 9   VAL A CA  1 
ATOM   45   C  C   . VAL A 1 9   ? 19.926 3.186  23.650  1.00 23.08 ? 9   VAL A C   1 
ATOM   46   O  O   . VAL A 1 9   ? 18.776 3.614  23.412  1.00 20.65 ? 9   VAL A O   1 
ATOM   47   C  CB  . VAL A 1 9   ? 20.711 0.994  22.607  1.00 22.86 ? 9   VAL A CB  1 
ATOM   48   C  CG1 . VAL A 1 9   ? 19.301 0.438  22.482  1.00 23.28 ? 9   VAL A CG1 1 
ATOM   49   C  CG2 . VAL A 1 9   ? 21.440 0.472  21.431  1.00 24.02 ? 9   VAL A CG2 1 
ATOM   50   N  N   . THR A 1 10  ? 20.501 3.370  24.831  1.00 21.43 ? 10  THR A N   1 
ATOM   51   C  CA  . THR A 1 10  ? 19.737 3.966  25.911  1.00 22.97 ? 10  THR A CA  1 
ATOM   52   C  C   . THR A 1 10  ? 19.338 5.463  25.685  1.00 19.45 ? 10  THR A C   1 
ATOM   53   O  O   . THR A 1 10  ? 18.152 5.899  25.896  1.00 19.14 ? 10  THR A O   1 
ATOM   54   C  CB  . THR A 1 10  ? 20.576 3.802  27.238  1.00 29.43 ? 10  THR A CB  1 
ATOM   55   O  OG1 . THR A 1 10  ? 20.469 2.413  27.680  1.00 32.84 ? 10  THR A OG1 1 
ATOM   56   C  CG2 . THR A 1 10  ? 19.965 4.768  28.278  1.00 31.46 ? 10  THR A CG2 1 
ATOM   57   N  N   . GLU A 1 11  ? 20.293 6.242  25.238  1.00 20.85 ? 11  GLU A N   1 
ATOM   58   C  CA  . GLU A 1 11  ? 20.038 7.623  24.927  1.00 21.95 ? 11  GLU A CA  1 
ATOM   59   C  C   . GLU A 1 11  ? 18.975 7.690  23.807  1.00 19.18 ? 11  GLU A C   1 
ATOM   60   O  O   . GLU A 1 11  ? 18.106 8.558  23.824  1.00 17.46 ? 11  GLU A O   1 
ATOM   61   C  CB  . GLU A 1 11  ? 21.331 8.314  24.450  1.00 34.46 ? 11  GLU A CB  1 
ATOM   62   C  CG  . GLU A 1 11  ? 21.141 9.803  24.195  1.00 44.53 ? 11  GLU A CG  1 
ATOM   63   C  CD  . GLU A 1 11  ? 20.696 10.608 25.440  1.00 51.71 ? 11  GLU A CD  1 
ATOM   64   O  OE1 . GLU A 1 11  ? 21.382 10.554 26.500  1.00 55.16 ? 11  GLU A OE1 1 
ATOM   65   O  OE2 . GLU A 1 11  ? 19.663 11.314 25.354  1.00 55.63 ? 11  GLU A OE2 1 
ATOM   66   N  N   . PHE A 1 12  ? 19.088 6.812  22.834  1.00 18.01 ? 12  PHE A N   1 
ATOM   67   C  CA  . PHE A 1 12  ? 18.072 6.853  21.712  1.00 17.02 ? 12  PHE A CA  1 
ATOM   68   C  C   . PHE A 1 12  ? 16.699 6.392  22.229  1.00 14.33 ? 12  PHE A C   1 
ATOM   69   O  O   . PHE A 1 12  ? 15.708 6.919  21.684  1.00 13.45 ? 12  PHE A O   1 
ATOM   70   C  CB  . PHE A 1 12  ? 18.552 6.073  20.510  1.00 17.01 ? 12  PHE A CB  1 
ATOM   71   C  CG  . PHE A 1 12  ? 19.893 6.678  19.865  1.00 19.86 ? 12  PHE A CG  1 
ATOM   72   C  CD1 . PHE A 1 12  ? 20.115 8.056  19.913  1.00 25.53 ? 12  PHE A CD1 1 
ATOM   73   C  CD2 . PHE A 1 12  ? 20.799 5.880  19.304  1.00 25.06 ? 12  PHE A CD2 1 
ATOM   74   C  CE1 . PHE A 1 12  ? 21.340 8.577  19.350  1.00 27.56 ? 12  PHE A CE1 1 
ATOM   75   C  CE2 . PHE A 1 12  ? 21.967 6.386  18.757  1.00 23.77 ? 12  PHE A CE2 1 
ATOM   76   C  CZ  . PHE A 1 12  ? 22.190 7.693  18.803  1.00 24.51 ? 12  PHE A CZ  1 
ATOM   77   N  N   . LYS A 1 13  ? 16.639 5.431  23.112  1.00 14.04 ? 13  LYS A N   1 
ATOM   78   C  CA  . LYS A 1 13  ? 15.338 5.013  23.722  1.00 12.37 ? 13  LYS A CA  1 
ATOM   79   C  C   . LYS A 1 13  ? 14.740 6.215  24.480  1.00 13.83 ? 13  LYS A C   1 
ATOM   80   O  O   . LYS A 1 13  ? 13.461 6.450  24.368  1.00 12.87 ? 13  LYS A O   1 
ATOM   81   C  CB  . LYS A 1 13  ? 15.595 3.806  24.622  1.00 21.81 ? 13  LYS A CB  1 
ATOM   82   C  CG  . LYS A 1 13  ? 14.320 3.170  25.167  1.00 28.55 ? 13  LYS A CG  1 
ATOM   83   C  CD  . LYS A 1 13  ? 14.542 1.737  25.824  1.00 35.06 ? 13  LYS A CD  1 
ATOM   84   C  CE  . LYS A 1 13  ? 15.644 0.934  25.129  1.00 36.62 ? 13  LYS A CE  1 
ATOM   85   N  NZ  . LYS A 1 13  ? 16.242 -0.164 25.890  1.00 37.16 ? 13  LYS A NZ  1 
ATOM   86   N  N   . GLU A 1 14  ? 15.593 6.957  25.247  1.00 14.62 ? 14  GLU A N   1 
ATOM   87   C  CA  . GLU A 1 14  ? 15.021 8.141  25.901  1.00 16.57 ? 14  GLU A CA  1 
ATOM   88   C  C   . GLU A 1 14  ? 14.428 9.140  24.892  1.00 13.40 ? 14  GLU A C   1 
ATOM   89   O  O   . GLU A 1 14  ? 13.320 9.658  25.100  1.00 16.06 ? 14  GLU A O   1 
ATOM   90   C  CB  . GLU A 1 14  ? 16.160 8.822  26.720  1.00 16.68 ? 14  GLU A CB  1 
ATOM   91   C  CG  . GLU A 1 14  ? 16.467 7.917  27.885  1.00 21.86 ? 14  GLU A CG  1 
ATOM   92   C  CD  . GLU A 1 14  ? 17.735 8.401  28.624  1.00 23.91 ? 14  GLU A CD  1 
ATOM   93   O  OE1 . GLU A 1 14  ? 17.944 8.007  29.787  1.00 26.22 ? 14  GLU A OE1 1 
ATOM   94   O  OE2 . GLU A 1 14  ? 18.527 9.159  28.097  1.00 26.89 ? 14  GLU A OE2 1 
ATOM   95   N  N   . ALA A 1 15  ? 15.140 9.440  23.823  1.00 14.47 ? 15  ALA A N   1 
ATOM   96   C  CA  . ALA A 1 15  ? 14.664 10.342 22.817  1.00 12.80 ? 15  ALA A CA  1 
ATOM   97   C  C   . ALA A 1 15  ? 13.342 9.840  22.187  1.00 11.53 ? 15  ALA A C   1 
ATOM   98   O  O   . ALA A 1 15  ? 12.402 10.570 22.017  1.00 12.44 ? 15  ALA A O   1 
ATOM   99   C  CB  . ALA A 1 15  ? 15.725 10.516 21.740  1.00 14.05 ? 15  ALA A CB  1 
ATOM   100  N  N   . PHE A 1 16  ? 13.363 8.575  21.871  1.00 11.01 ? 16  PHE A N   1 
ATOM   101  C  CA  . PHE A 1 16  ? 12.135 7.960  21.251  1.00 10.36 ? 16  PHE A CA  1 
ATOM   102  C  C   . PHE A 1 16  ? 10.933 8.203  22.190  1.00 10.21 ? 16  PHE A C   1 
ATOM   103  O  O   . PHE A 1 16  ? 9.819  8.530  21.716  1.00 10.93 ? 16  PHE A O   1 
ATOM   104  C  CB  . PHE A 1 16  ? 12.357 6.489  21.058  1.00 9.99  ? 16  PHE A CB  1 
ATOM   105  C  CG  . PHE A 1 16  ? 11.217 5.784  20.377  1.00 7.91  ? 16  PHE A CG  1 
ATOM   106  C  CD1 . PHE A 1 16  ? 11.080 5.764  18.995  1.00 9.56  ? 16  PHE A CD1 1 
ATOM   107  C  CD2 . PHE A 1 16  ? 10.251 5.167  21.192  1.00 9.91  ? 16  PHE A CD2 1 
ATOM   108  C  CE1 . PHE A 1 16  ? 9.929  5.073  18.391  1.00 9.98  ? 16  PHE A CE1 1 
ATOM   109  C  CE2 . PHE A 1 16  ? 9.144  4.521  20.594  1.00 10.27 ? 16  PHE A CE2 1 
ATOM   110  C  CZ  . PHE A 1 16  ? 8.993  4.467  19.172  1.00 10.08 ? 16  PHE A CZ  1 
ATOM   111  N  N   . SER A 1 17  ? 11.095 7.935  23.459  1.00 11.73 ? 17  SER A N   1 
ATOM   112  C  CA  . SER A 1 17  ? 10.020 8.140  24.455  1.00 12.11 ? 17  SER A CA  1 
ATOM   113  C  C   . SER A 1 17  ? 9.459  9.554  24.445  1.00 12.14 ? 17  SER A C   1 
ATOM   114  O  O   . SER A 1 17  ? 8.268  9.719  24.774  1.00 13.88 ? 17  SER A O   1 
ATOM   115  C  CB  . SER A 1 17  ? 10.572 7.847  25.913  1.00 14.73 ? 17  SER A CB  1 
ATOM   116  O  OG  . SER A 1 17  ? 11.353 8.859  26.616  1.00 21.34 ? 17  SER A OG  1 
ATOM   117  N  N   . LEU A 1 18  ? 10.246 10.531 24.068  1.00 10.64 ? 18  LEU A N   1 
ATOM   118  C  CA  . LEU A 1 18  ? 9.758  11.879 24.045  1.00 10.44 ? 18  LEU A CA  1 
ATOM   119  C  C   . LEU A 1 18  ? 8.867  12.117 22.842  1.00 11.85 ? 18  LEU A C   1 
ATOM   120  O  O   . LEU A 1 18  ? 7.967  13.011 22.845  1.00 15.97 ? 18  LEU A O   1 
ATOM   121  C  CB  . LEU A 1 18  ? 10.902 12.907 24.066  1.00 13.42 ? 18  LEU A CB  1 
ATOM   122  C  CG  . LEU A 1 18  ? 11.726 12.805 25.326  1.00 15.00 ? 18  LEU A CG  1 
ATOM   123  C  CD1 . LEU A 1 18  ? 13.031 13.686 25.154  1.00 19.39 ? 18  LEU A CD1 1 
ATOM   124  C  CD2 . LEU A 1 18  ? 10.938 13.349 26.512  1.00 17.78 ? 18  LEU A CD2 1 
ATOM   125  N  N   . PHE A 1 19  ? 9.089  11.368 21.774  1.00 10.21 ? 19  PHE A N   1 
ATOM   126  C  CA  . PHE A 1 19  ? 8.221  11.514 20.588  1.00 10.32 ? 19  PHE A CA  1 
ATOM   127  C  C   . PHE A 1 19  ? 6.990  10.672 20.713  1.00 10.59 ? 19  PHE A C   1 
ATOM   128  O  O   . PHE A 1 19  ? 5.917  11.102 20.225  1.00 11.79 ? 19  PHE A O   1 
ATOM   129  C  CB  . PHE A 1 19  ? 8.960  11.009 19.321  1.00 11.99 ? 19  PHE A CB  1 
ATOM   130  C  CG  . PHE A 1 19  ? 10.034 11.913 18.836  1.00 12.49 ? 19  PHE A CG  1 
ATOM   131  C  CD1 . PHE A 1 19  ? 9.741  12.782 17.750  1.00 14.96 ? 19  PHE A CD1 1 
ATOM   132  C  CD2 . PHE A 1 19  ? 11.285 11.899 19.374  1.00 14.29 ? 19  PHE A CD2 1 
ATOM   133  C  CE1 . PHE A 1 19  ? 10.789 13.606 17.220  1.00 15.82 ? 19  PHE A CE1 1 
ATOM   134  C  CE2 . PHE A 1 19  ? 12.308 12.741 18.822  1.00 16.49 ? 19  PHE A CE2 1 
ATOM   135  C  CZ  . PHE A 1 19  ? 12.027 13.574 17.745  1.00 17.16 ? 19  PHE A CZ  1 
ATOM   136  N  N   . ASP A 1 20  ? 7.049  9.519  21.385  1.00 10.85 ? 20  ASP A N   1 
ATOM   137  C  CA  . ASP A 1 20  ? 5.906  8.606  21.421  1.00 9.56  ? 20  ASP A CA  1 
ATOM   138  C  C   . ASP A 1 20  ? 4.945  8.951  22.569  1.00 11.13 ? 20  ASP A C   1 
ATOM   139  O  O   . ASP A 1 20  ? 4.923  8.316  23.619  1.00 11.27 ? 20  ASP A O   1 
ATOM   140  C  CB  . ASP A 1 20  ? 6.474  7.182  21.572  1.00 9.28  ? 20  ASP A CB  1 
ATOM   141  C  CG  . ASP A 1 20  ? 5.352  6.114  21.642  1.00 9.78  ? 20  ASP A CG  1 
ATOM   142  O  OD1 . ASP A 1 20  ? 4.187  6.457  21.219  1.00 10.37 ? 20  ASP A OD1 1 
ATOM   143  O  OD2 . ASP A 1 20  ? 5.631  4.986  22.107  1.00 11.41 ? 20  ASP A OD2 1 
ATOM   144  N  N   . LYS A 1 21  ? 4.171  9.993  22.280  1.00 12.22 ? 21  LYS A N   1 
ATOM   145  C  CA  . LYS A 1 21  ? 3.362  10.616 23.356  1.00 11.78 ? 21  LYS A CA  1 
ATOM   146  C  C   . LYS A 1 21  ? 2.417  9.730  24.028  1.00 12.40 ? 21  LYS A C   1 
ATOM   147  O  O   . LYS A 1 21  ? 2.117  9.907  25.222  1.00 16.18 ? 21  LYS A O   1 
ATOM   148  C  CB  . LYS A 1 21  ? 2.600  11.850 22.756  1.00 12.72 ? 21  LYS A CB  1 
ATOM   149  C  CG  . LYS A 1 21  ? 3.506  12.917 22.175  1.00 12.88 ? 21  LYS A CG  1 
ATOM   150  C  CD  . LYS A 1 21  ? 4.561  13.361 23.215  1.00 11.53 ? 21  LYS A CD  1 
ATOM   151  C  CE  . LYS A 1 21  ? 5.206  14.625 22.670  1.00 12.75 ? 21  LYS A CE  1 
ATOM   152  N  NZ  . LYS A 1 21  ? 6.362  15.116 23.543  1.00 13.47 ? 21  LYS A NZ  1 
ATOM   153  N  N   . ASP A 1 22  ? 1.822  8.803  23.298  1.00 10.26 ? 22  ASP A N   1 
ATOM   154  C  CA  . ASP A 1 22  ? 0.881  7.866  23.931  1.00 12.03 ? 22  ASP A CA  1 
ATOM   155  C  C   . ASP A 1 22  ? 1.468  6.537  24.387  1.00 13.36 ? 22  ASP A C   1 
ATOM   156  O  O   . ASP A 1 22  ? 0.785  5.660  24.931  1.00 15.28 ? 22  ASP A O   1 
ATOM   157  C  CB  . ASP A 1 22  ? -0.344 7.632  23.070  1.00 12.79 ? 22  ASP A CB  1 
ATOM   158  C  CG  . ASP A 1 22  ? -0.056 6.906  21.777  1.00 13.35 ? 22  ASP A CG  1 
ATOM   159  O  OD1 . ASP A 1 22  ? 1.119  6.446  21.564  1.00 11.26 ? 22  ASP A OD1 1 
ATOM   160  O  OD2 . ASP A 1 22  ? -0.877 6.769  20.849  1.00 14.19 ? 22  ASP A OD2 1 
ATOM   161  N  N   . GLY A 1 23  ? 2.813  6.442  24.222  1.00 12.23 ? 23  GLY A N   1 
ATOM   162  C  CA  . GLY A 1 23  ? 3.508  5.271  24.704  1.00 12.36 ? 23  GLY A CA  1 
ATOM   163  C  C   . GLY A 1 23  ? 3.183  4.005  23.996  1.00 13.38 ? 23  GLY A C   1 
ATOM   164  O  O   . GLY A 1 23  ? 3.575  2.926  24.577  1.00 15.98 ? 23  GLY A O   1 
ATOM   165  N  N   . ASP A 1 24  ? 2.588  4.043  22.805  1.00 11.36 ? 24  ASP A N   1 
ATOM   166  C  CA  . ASP A 1 24  ? 2.166  2.780  22.193  1.00 11.55 ? 24  ASP A CA  1 
ATOM   167  C  C   . ASP A 1 24  ? 3.216  2.036  21.372  1.00 10.87 ? 24  ASP A C   1 
ATOM   168  O  O   . ASP A 1 24  ? 2.974  0.988  20.738  1.00 12.96 ? 24  ASP A O   1 
ATOM   169  C  CB  . ASP A 1 24  ? 0.871  2.957  21.377  1.00 13.46 ? 24  ASP A CB  1 
ATOM   170  C  CG  . ASP A 1 24  ? 1.087  3.682  20.071  1.00 15.14 ? 24  ASP A CG  1 
ATOM   171  O  OD1 . ASP A 1 24  ? 2.140  4.265  19.763  1.00 11.63 ? 24  ASP A OD1 1 
ATOM   172  O  OD2 . ASP A 1 24  ? 0.164  3.579  19.243  1.00 17.02 ? 24  ASP A OD2 1 
ATOM   173  N  N   . GLY A 1 25  ? 4.408  2.601  21.357  1.00 11.23 ? 25  GLY A N   1 
ATOM   174  C  CA  . GLY A 1 25  ? 5.513  1.979  20.662  1.00 10.95 ? 25  GLY A CA  1 
ATOM   175  C  C   . GLY A 1 25  ? 5.799  2.434  19.256  1.00 10.54 ? 25  GLY A C   1 
ATOM   176  O  O   . GLY A 1 25  ? 6.686  1.949  18.544  1.00 10.68 ? 25  GLY A O   1 
ATOM   177  N  N   . CYS A 1 26  ? 4.980  3.385  18.787  1.00 10.71 ? 26  CYS A N   1 
ATOM   178  C  CA  . CYS A 1 26  ? 5.303  3.951  17.452  1.00 12.62 ? 26  CYS A CA  1 
ATOM   179  C  C   . CYS A 1 26  ? 5.036  5.431  17.511  1.00 11.15 ? 26  CYS A C   1 
ATOM   180  O  O   . CYS A 1 26  ? 4.215  5.897  18.294  1.00 12.55 ? 26  CYS A O   1 
ATOM   181  C  CB  . CYS A 1 26  ? 4.565  3.317  16.338  1.00 13.63 ? 26  CYS A CB  1 
ATOM   182  S  SG  . CYS A 1 26  ? 2.834  3.736  16.220  1.00 17.03 ? 26  CYS A SG  1 
ATOM   183  N  N   . ILE A 1 27  ? 5.725  6.125  16.651  1.00 8.04  ? 27  ILE A N   1 
ATOM   184  C  CA  . ILE A 1 27  ? 5.570  7.601  16.512  1.00 9.40  ? 27  ILE A CA  1 
ATOM   185  C  C   . ILE A 1 27  ? 4.698  7.796  15.256  1.00 9.41  ? 27  ILE A C   1 
ATOM   186  O  O   . ILE A 1 27  ? 5.033  7.320  14.131  1.00 9.34  ? 27  ILE A O   1 
ATOM   187  C  CB  . ILE A 1 27  ? 6.947  8.276  16.270  1.00 9.23  ? 27  ILE A CB  1 
ATOM   188  C  CG1 . ILE A 1 27  ? 7.873  7.984  17.473  1.00 10.16 ? 27  ILE A CG1 1 
ATOM   189  C  CG2 . ILE A 1 27  ? 6.674  9.877  16.147  1.00 10.18 ? 27  ILE A CG2 1 
ATOM   190  C  CD1 . ILE A 1 27  ? 9.341  8.342  17.165  1.00 11.10 ? 27  ILE A CD1 1 
ATOM   191  N  N   . THR A 1 28  ? 3.556  8.476  15.438  1.00 8.14  ? 28  THR A N   1 
ATOM   192  C  CA  . THR A 1 28  ? 2.728  8.802  14.253  1.00 8.59  ? 28  THR A CA  1 
ATOM   193  C  C   . THR A 1 28  ? 3.047  10.230 13.726  1.00 8.85  ? 28  THR A C   1 
ATOM   194  O  O   . THR A 1 28  ? 3.786  11.029 14.408  1.00 9.27  ? 28  THR A O   1 
ATOM   195  C  CB  . THR A 1 28  ? 1.219  8.841  14.718  1.00 9.49  ? 28  THR A CB  1 
ATOM   196  O  OG1 . THR A 1 28  ? 1.084  9.826  15.733  1.00 9.92  ? 28  THR A OG1 1 
ATOM   197  C  CG2 . THR A 1 28  ? 0.759  7.479  15.280  1.00 11.05 ? 28  THR A CG2 1 
ATOM   198  N  N   . THR A 1 29  ? 2.569  10.528 12.546  1.00 9.68  ? 29  THR A N   1 
ATOM   199  C  CA  . THR A 1 29  ? 2.709  11.893 12.079  1.00 10.04 ? 29  THR A CA  1 
ATOM   200  C  C   . THR A 1 29  ? 2.144  12.922 13.018  1.00 10.14 ? 29  THR A C   1 
ATOM   201  O  O   . THR A 1 29  ? 2.724  14.028 13.151  1.00 10.59 ? 29  THR A O   1 
ATOM   202  C  CB  . THR A 1 29  ? 1.879  11.918 10.717  1.00 15.36 ? 29  THR A CB  1 
ATOM   203  O  OG1 . THR A 1 29  ? 2.486  10.926 9.781   1.00 24.69 ? 29  THR A OG1 1 
ATOM   204  C  CG2 . THR A 1 29  ? 2.272  13.096 10.136  1.00 20.63 ? 29  THR A CG2 1 
ATOM   205  N  N   . ARG A 1 30  ? 1.025  12.619 13.707  1.00 8.71  ? 30  ARG A N   1 
ATOM   206  C  CA  . ARG A 1 30  ? 0.515  13.595 14.662  1.00 9.58  ? 30  ARG A CA  1 
ATOM   207  C  C   . ARG A 1 30  ? 1.433  13.810 15.827  1.00 8.53  ? 30  ARG A C   1 
ATOM   208  O  O   . ARG A 1 30  ? 1.603  14.954 16.320  1.00 9.34  ? 30  ARG A O   1 
ATOM   209  C  CB  . ARG A 1 30  ? -0.849 13.083 15.129  1.00 10.24 ? 30  ARG A CB  1 
ATOM   210  C  CG  . ARG A 1 30  ? -1.923 13.141 13.978  1.00 13.16 ? 30  ARG A CG  1 
ATOM   211  C  CD  . ARG A 1 30  ? -2.299 14.613 13.665  1.00 15.17 ? 30  ARG A CD  1 
ATOM   212  N  NE  . ARG A 1 30  ? -2.773 15.360 14.811  1.00 15.75 ? 30  ARG A NE  1 
ATOM   213  C  CZ  . ARG A 1 30  ? -4.064 15.309 15.273  1.00 17.27 ? 30  ARG A CZ  1 
ATOM   214  N  NH1 . ARG A 1 30  ? -5.000 14.576 14.673  1.00 15.70 ? 30  ARG A NH1 1 
ATOM   215  N  NH2 . ARG A 1 30  ? -4.369 16.021 16.337  1.00 18.63 ? 30  ARG A NH2 1 
ATOM   216  N  N   . GLU A 1 31  ? 2.044  12.706 16.331  1.00 8.67  ? 31  GLU A N   1 
ATOM   217  C  CA  . GLU A 1 31  ? 2.973  12.909 17.452  1.00 9.42  ? 31  GLU A CA  1 
ATOM   218  C  C   . GLU A 1 31  ? 4.182  13.690 16.965  1.00 9.68  ? 31  GLU A C   1 
ATOM   219  O  O   . GLU A 1 31  ? 4.682  14.525 17.748  1.00 10.56 ? 31  GLU A O   1 
ATOM   220  C  CB  . GLU A 1 31  ? 3.386  11.508 17.986  1.00 8.63  ? 31  GLU A CB  1 
ATOM   221  C  CG  . GLU A 1 31  ? 2.232  10.845 18.836  1.00 9.54  ? 31  GLU A CG  1 
ATOM   222  C  CD  . GLU A 1 31  ? 2.448  9.414  19.130  1.00 10.47 ? 31  GLU A CD  1 
ATOM   223  O  OE1 . GLU A 1 31  ? 3.108  8.659  18.405  1.00 9.49  ? 31  GLU A OE1 1 
ATOM   224  O  OE2 . GLU A 1 31  ? 1.913  9.005  20.189  1.00 9.29  ? 31  GLU A OE2 1 
ATOM   225  N  N   . LEU A 1 32  ? 4.661  13.418 15.749  1.00 9.24  ? 32  LEU A N   1 
ATOM   226  C  CA  . LEU A 1 32  ? 5.813  14.197 15.242  1.00 8.59  ? 32  LEU A CA  1 
ATOM   227  C  C   . LEU A 1 32  ? 5.368  15.682 15.142  1.00 9.89  ? 32  LEU A C   1 
ATOM   228  O  O   . LEU A 1 32  ? 6.180  16.560 15.544  1.00 10.00 ? 32  LEU A O   1 
ATOM   229  C  CB  . LEU A 1 32  ? 6.243  13.656 13.898  1.00 9.40  ? 32  LEU A CB  1 
ATOM   230  C  CG  . LEU A 1 32  ? 7.411  14.482 13.323  1.00 10.16 ? 32  LEU A CG  1 
ATOM   231  C  CD1 . LEU A 1 32  ? 8.673  14.393 14.224  1.00 13.27 ? 32  LEU A CD1 1 
ATOM   232  C  CD2 . LEU A 1 32  ? 7.687  13.936 11.849  1.00 13.15 ? 32  LEU A CD2 1 
ATOM   233  N  N   . GLY A 1 33  ? 4.153  15.955 14.724  1.00 8.39  ? 33  GLY A N   1 
ATOM   234  C  CA  . GLY A 1 33  ? 3.627  17.356 14.691  1.00 8.82  ? 33  GLY A CA  1 
ATOM   235  C  C   . GLY A 1 33  ? 3.653  17.988 16.060  1.00 9.94  ? 33  GLY A C   1 
ATOM   236  O  O   . GLY A 1 33  ? 4.081  19.154 16.228  1.00 9.97  ? 33  GLY A O   1 
ATOM   237  N  N   . THR A 1 34  ? 3.183  17.218 17.074  1.00 9.20  ? 34  THR A N   1 
ATOM   238  C  CA  . THR A 1 34  ? 3.118  17.737 18.436  1.00 9.93  ? 34  THR A CA  1 
ATOM   239  C  C   . THR A 1 34  ? 4.585  18.023 18.906  1.00 9.60  ? 34  THR A C   1 
ATOM   240  O  O   . THR A 1 34  ? 4.783  19.153 19.445  1.00 10.10 ? 34  THR A O   1 
ATOM   241  C  CB  . THR A 1 34  ? 2.536  16.714 19.345  1.00 7.94  ? 34  THR A CB  1 
ATOM   242  O  OG1 . THR A 1 34  ? 1.206  16.494 18.932  1.00 11.10 ? 34  THR A OG1 1 
ATOM   243  C  CG2 . THR A 1 34  ? 2.482  17.207 20.794  1.00 11.71 ? 34  THR A CG2 1 
ATOM   244  N  N   . VAL A 1 35  ? 5.540  17.125 18.690  1.00 8.76  ? 35  VAL A N   1 
ATOM   245  C  CA  . VAL A 1 35  ? 6.906  17.433 19.067  1.00 9.82  ? 35  VAL A CA  1 
ATOM   246  C  C   . VAL A 1 35  ? 7.405  18.684 18.330  1.00 9.59  ? 35  VAL A C   1 
ATOM   247  O  O   . VAL A 1 35  ? 7.983  19.575 19.004  1.00 9.84  ? 35  VAL A O   1 
ATOM   248  C  CB  . VAL A 1 35  ? 7.812  16.251 18.678  1.00 10.48 ? 35  VAL A CB  1 
ATOM   249  C  CG1 . VAL A 1 35  ? 9.292  16.658 18.992  1.00 14.82 ? 35  VAL A CG1 1 
ATOM   250  C  CG2 . VAL A 1 35  ? 7.499  15.022 19.601  1.00 14.94 ? 35  VAL A CG2 1 
ATOM   251  N  N   . MET A 1 36  ? 7.256  18.766 17.000  1.00 9.18  ? 36  MET A N   1 
ATOM   252  C  CA  . MET A 1 36  ? 7.838  19.914 16.277  1.00 10.09 ? 36  MET A CA  1 
ATOM   253  C  C   . MET A 1 36  ? 7.203  21.215 16.761  1.00 10.77 ? 36  MET A C   1 
ATOM   254  O  O   . MET A 1 36  ? 7.937  22.236 17.001  1.00 10.62 ? 36  MET A O   1 
ATOM   255  C  CB  . MET A 1 36  ? 7.640  19.749 14.805  1.00 10.64 ? 36  MET A CB  1 
ATOM   256  C  CG  . MET A 1 36  ? 8.439  18.568 14.352  1.00 13.99 ? 36  MET A CG  1 
ATOM   257  S  SD  . MET A 1 36  ? 8.674  18.159 12.671  1.00 17.07 ? 36  MET A SD  1 
ATOM   258  C  CE  . MET A 1 36  ? 9.514  19.724 11.958  1.00 18.04 ? 36  MET A CE  1 
ATOM   259  N  N   . ARG A 1 37  ? 5.891  21.260 16.986  1.00 8.75  ? 37  ARG A N   1 
ATOM   260  C  CA  . ARG A 1 37  ? 5.261  22.519 17.468  1.00 8.65  ? 37  ARG A CA  1 
ATOM   261  C  C   . ARG A 1 37  ? 5.780  22.802 18.855  1.00 9.52  ? 37  ARG A C   1 
ATOM   262  O  O   . ARG A 1 37  ? 5.967  24.008 19.186  1.00 10.70 ? 37  ARG A O   1 
ATOM   263  C  CB  . ARG A 1 37  ? 3.767  22.431 17.435  1.00 10.20 ? 37  ARG A CB  1 
ATOM   264  C  CG  . ARG A 1 37  ? 3.299  22.473 15.954  1.00 10.71 ? 37  ARG A CG  1 
ATOM   265  C  CD  . ARG A 1 37  ? 1.731  22.561 15.886  1.00 12.45 ? 37  ARG A CD  1 
ATOM   266  N  NE  . ARG A 1 37  ? 1.133  21.266 16.275  1.00 13.43 ? 37  ARG A NE  1 
ATOM   267  C  CZ  . ARG A 1 37  ? 0.964  20.239 15.485  1.00 11.92 ? 37  ARG A CZ  1 
ATOM   268  N  NH1 . ARG A 1 37  ? 1.299  20.229 14.206  1.00 12.06 ? 37  ARG A NH1 1 
ATOM   269  N  NH2 . ARG A 1 37  ? 0.416  19.093 16.022  1.00 17.35 ? 37  ARG A NH2 1 
ATOM   270  N  N   . SER A 1 38  ? 6.059  21.793 19.698  1.00 9.42  ? 38  SER A N   1 
ATOM   271  C  CA  . SER A 1 38  ? 6.589  22.061 21.028  1.00 9.06  ? 38  SER A CA  1 
ATOM   272  C  C   . SER A 1 38  ? 7.979  22.649 21.023  1.00 10.55 ? 38  SER A C   1 
ATOM   273  O  O   . SER A 1 38  ? 8.419  23.197 22.032  1.00 12.38 ? 38  SER A O   1 
ATOM   274  C  CB  . SER A 1 38  ? 6.496  20.806 21.890  1.00 11.59 ? 38  SER A CB  1 
ATOM   275  O  OG  . SER A 1 38  ? 7.535  19.920 21.634  1.00 14.29 ? 38  SER A OG  1 
ATOM   276  N  N   . LEU A 1 39  ? 8.652  22.515 19.895  1.00 10.57 ? 39  LEU A N   1 
ATOM   277  C  CA  . LEU A 1 39  ? 10.030 23.062 19.718  1.00 11.52 ? 39  LEU A CA  1 
ATOM   278  C  C   . LEU A 1 39  ? 9.953  24.431 19.059  1.00 10.96 ? 39  LEU A C   1 
ATOM   279  O  O   . LEU A 1 39  ? 11.009 25.017 18.728  1.00 13.29 ? 39  LEU A O   1 
ATOM   280  C  CB  . LEU A 1 39  ? 10.936 22.119 18.870  1.00 13.18 ? 39  LEU A CB  1 
ATOM   281  C  CG  . LEU A 1 39  ? 11.079 20.732 19.493  1.00 14.34 ? 39  LEU A CG  1 
ATOM   282  C  CD1 . LEU A 1 39  ? 11.838 19.818 18.407  1.00 18.06 ? 39  LEU A CD1 1 
ATOM   283  C  CD2 . LEU A 1 39  ? 11.812 20.781 20.849  1.00 16.42 ? 39  LEU A CD2 1 
ATOM   284  N  N   . GLY A 1 40  ? 8.742  25.033 18.877  1.00 10.51 ? 40  GLY A N   1 
ATOM   285  C  CA  . GLY A 1 40  ? 8.628  26.280 18.194  1.00 11.57 ? 40  GLY A CA  1 
ATOM   286  C  C   . GLY A 1 40  ? 8.594  26.181 16.696  1.00 11.09 ? 40  GLY A C   1 
ATOM   287  O  O   . GLY A 1 40  ? 8.681  27.269 16.023  1.00 10.96 ? 40  GLY A O   1 
ATOM   288  N  N   . GLN A 1 41  ? 8.449  24.964 16.171  1.00 9.93  ? 41  GLN A N   1 
ATOM   289  C  CA  . GLN A 1 41  ? 8.336  24.871 14.695  1.00 11.18 ? 41  GLN A CA  1 
ATOM   290  C  C   . GLN A 1 41  ? 6.850  24.808 14.310  1.00 10.15 ? 41  GLN A C   1 
ATOM   291  O  O   . GLN A 1 41  ? 5.932  24.872 15.103  1.00 10.75 ? 41  GLN A O   1 
ATOM   292  C  CB  . GLN A 1 41  ? 9.082  23.652 14.222  1.00 11.68 ? 41  GLN A CB  1 
ATOM   293  C  CG  . GLN A 1 41  ? 10.566 23.793 14.498  1.00 15.33 ? 41  GLN A CG  1 
ATOM   294  C  CD  . GLN A 1 41  ? 11.216 24.796 13.495  1.00 21.19 ? 41  GLN A CD  1 
ATOM   295  O  OE1 . GLN A 1 41  ? 12.225 24.483 12.880  1.00 29.68 ? 41  GLN A OE1 1 
ATOM   296  N  NE2 . GLN A 1 41  ? 10.608 25.999 13.291  1.00 25.40 ? 41  GLN A NE2 1 
ATOM   297  N  N   . ASN A 1 42  ? 6.604  24.737 12.987  1.00 9.64  ? 42  ASN A N   1 
ATOM   298  C  CA  . ASN A 1 42  ? 5.190  24.700 12.572  1.00 10.50 ? 42  ASN A CA  1 
ATOM   299  C  C   . ASN A 1 42  ? 5.088  24.086 11.157  1.00 9.61  ? 42  ASN A C   1 
ATOM   300  O  O   . ASN A 1 42  ? 4.666  24.757 10.201  1.00 10.85 ? 42  ASN A O   1 
ATOM   301  C  CB  . ASN A 1 42  ? 4.596  26.112 12.540  1.00 10.37 ? 42  ASN A CB  1 
ATOM   302  C  CG  . ASN A 1 42  ? 3.061  26.071 12.432  1.00 14.20 ? 42  ASN A CG  1 
ATOM   303  O  OD1 . ASN A 1 42  ? 2.425  25.065 12.733  1.00 15.67 ? 42  ASN A OD1 1 
ATOM   304  N  ND2 . ASN A 1 42  ? 2.445  27.245 12.049  1.00 17.79 ? 42  ASN A ND2 1 
ATOM   305  N  N   . PRO A 1 43  ? 5.441  22.805 10.952  1.00 9.80  ? 43  PRO A N   1 
ATOM   306  C  CA  . PRO A 1 43  ? 5.395  22.167 9.625   1.00 10.53 ? 43  PRO A CA  1 
ATOM   307  C  C   . PRO A 1 43  ? 3.993  21.918 9.165   1.00 10.36 ? 43  PRO A C   1 
ATOM   308  O  O   . PRO A 1 43  ? 3.082  21.732 9.984   1.00 11.86 ? 43  PRO A O   1 
ATOM   309  C  CB  . PRO A 1 43  ? 6.152  20.855 9.874   1.00 12.27 ? 43  PRO A CB  1 
ATOM   310  C  CG  . PRO A 1 43  ? 5.859  20.554 11.318  1.00 11.85 ? 43  PRO A CG  1 
ATOM   311  C  CD  . PRO A 1 43  ? 5.924  21.921 12.042  1.00 10.91 ? 43  PRO A CD  1 
ATOM   312  N  N   . THR A 1 44  ? 3.876  21.830 7.844   1.00 10.08 ? 44  THR A N   1 
ATOM   313  C  CA  . THR A 1 44  ? 2.605  21.423 7.295   1.00 10.46 ? 44  THR A CA  1 
ATOM   314  C  C   . THR A 1 44  ? 2.409  19.938 7.404   1.00 10.90 ? 44  THR A C   1 
ATOM   315  O  O   . THR A 1 44  ? 3.360  19.195 7.631   1.00 11.60 ? 44  THR A O   1 
ATOM   316  C  CB  . THR A 1 44  ? 2.485  21.797 5.820   1.00 12.21 ? 44  THR A CB  1 
ATOM   317  O  OG1 . THR A 1 44  ? 3.390  21.008 5.078   1.00 12.30 ? 44  THR A OG1 1 
ATOM   318  C  CG2 . THR A 1 44  ? 2.717  23.311 5.604   1.00 11.95 ? 44  THR A CG2 1 
ATOM   319  N  N   . GLU A 1 45  ? 1.119  19.528 7.215   1.00 12.02 ? 45  GLU A N   1 
ATOM   320  C  CA  . GLU A 1 45  ? 0.869  18.052 7.293   1.00 13.31 ? 45  GLU A CA  1 
ATOM   321  C  C   . GLU A 1 45  ? 1.659  17.345 6.166   1.00 12.29 ? 45  GLU A C   1 
ATOM   322  O  O   . GLU A 1 45  ? 2.178  16.218 6.350   1.00 12.52 ? 45  GLU A O   1 
ATOM   323  C  CB  . GLU A 1 45  ? -0.668 17.751 7.138   1.00 22.82 ? 45  GLU A CB  1 
ATOM   324  C  CG  . GLU A 1 45  ? -1.150 16.352 7.207   1.00 34.14 ? 45  GLU A CG  1 
ATOM   325  C  CD  . GLU A 1 45  ? -2.685 16.354 7.481   1.00 39.51 ? 45  GLU A CD  1 
ATOM   326  O  OE1 . GLU A 1 45  ? -3.507 16.775 6.618   1.00 44.50 ? 45  GLU A OE1 1 
ATOM   327  O  OE2 . GLU A 1 45  ? -3.082 15.979 8.607   1.00 44.24 ? 45  GLU A OE2 1 
ATOM   328  N  N   . ALA A 1 46  ? 1.715  17.906 4.962   1.00 12.35 ? 46  ALA A N   1 
ATOM   329  C  CA  . ALA A 1 46  ? 2.507  17.257 3.899   1.00 13.82 ? 46  ALA A CA  1 
ATOM   330  C  C   . ALA A 1 46  ? 3.942  17.094 4.273   1.00 12.83 ? 46  ALA A C   1 
ATOM   331  O  O   . ALA A 1 46  ? 4.606  16.102 3.947   1.00 13.51 ? 46  ALA A O   1 
ATOM   332  C  CB  . ALA A 1 46  ? 2.323  18.123 2.558   1.00 13.28 ? 46  ALA A CB  1 
ATOM   333  N  N   . GLU A 1 47  ? 4.542  18.158 4.923   1.00 10.24 ? 47  GLU A N   1 
ATOM   334  C  CA  . GLU A 1 47  ? 5.953  18.099 5.327   1.00 9.63  ? 47  GLU A CA  1 
ATOM   335  C  C   . GLU A 1 47  ? 6.114  16.977 6.418   1.00 9.86  ? 47  GLU A C   1 
ATOM   336  O  O   . GLU A 1 47  ? 7.161  16.262 6.380   1.00 10.01 ? 47  GLU A O   1 
ATOM   337  C  CB  . GLU A 1 47  ? 6.339  19.501 5.939   1.00 10.60 ? 47  GLU A CB  1 
ATOM   338  C  CG  . GLU A 1 47  ? 6.548  20.486 4.726   1.00 11.76 ? 47  GLU A CG  1 
ATOM   339  C  CD  . GLU A 1 47  ? 6.540  21.883 5.151   1.00 11.61 ? 47  GLU A CD  1 
ATOM   340  O  OE1 . GLU A 1 47  ? 6.237  22.229 6.294   1.00 11.91 ? 47  GLU A OE1 1 
ATOM   341  O  OE2 . GLU A 1 47  ? 6.839  22.713 4.232   1.00 13.04 ? 47  GLU A OE2 1 
ATOM   342  N  N   . LEU A 1 48  ? 5.174  16.924 7.373   1.00 9.82  ? 48  LEU A N   1 
ATOM   343  C  CA  . LEU A 1 48  ? 5.311  15.902 8.393   1.00 9.80  ? 48  LEU A CA  1 
ATOM   344  C  C   . LEU A 1 48  ? 5.259  14.456 7.742   1.00 10.67 ? 48  LEU A C   1 
ATOM   345  O  O   . LEU A 1 48  ? 5.999  13.577 8.091   1.00 10.36 ? 48  LEU A O   1 
ATOM   346  C  CB  . LEU A 1 48  ? 4.136  15.986 9.382   1.00 9.83  ? 48  LEU A CB  1 
ATOM   347  C  CG  . LEU A 1 48  ? 4.330  17.205 10.337  1.00 10.37 ? 48  LEU A CG  1 
ATOM   348  C  CD1 . LEU A 1 48  ? 2.984  17.476 11.000  1.00 12.17 ? 48  LEU A CD1 1 
ATOM   349  C  CD2 . LEU A 1 48  ? 5.443  16.909 11.350  1.00 9.91  ? 48  LEU A CD2 1 
ATOM   350  N  N   . ARG A 1 49  ? 4.352  14.277 6.729   1.00 11.62 ? 49  ARG A N   1 
ATOM   351  C  CA  . ARG A 1 49  ? 4.266  12.940 6.057   1.00 11.59 ? 49  ARG A CA  1 
ATOM   352  C  C   . ARG A 1 49  ? 5.617  12.678 5.364   1.00 12.59 ? 49  ARG A C   1 
ATOM   353  O  O   . ARG A 1 49  ? 6.145  11.571 5.320   1.00 12.41 ? 49  ARG A O   1 
ATOM   354  C  CB  . ARG A 1 49  ? 3.120  12.981 5.055   1.00 14.98 ? 49  ARG A CB  1 
ATOM   355  C  CG  . ARG A 1 49  ? 3.014  11.603 4.374   1.00 17.65 ? 49  ARG A CG  1 
ATOM   356  C  CD  . ARG A 1 49  ? 2.837  11.762 2.836   1.00 21.90 ? 49  ARG A CD  1 
ATOM   357  N  NE  . ARG A 1 49  ? 4.128  12.044 2.148   1.00 21.53 ? 49  ARG A NE  1 
ATOM   358  C  CZ  . ARG A 1 49  ? 5.013  11.102 1.817   1.00 21.96 ? 49  ARG A CZ  1 
ATOM   359  N  NH1 . ARG A 1 49  ? 4.655  9.837  2.093   1.00 20.68 ? 49  ARG A NH1 1 
ATOM   360  N  NH2 . ARG A 1 49  ? 6.184  11.397 1.178   1.00 19.76 ? 49  ARG A NH2 1 
ATOM   361  N  N   . ASP A 1 50  ? 6.190  13.661 4.719   1.00 10.53 ? 50  ASP A N   1 
ATOM   362  C  CA  . ASP A 1 50  ? 7.446  13.489 4.067   1.00 12.73 ? 50  ASP A CA  1 
ATOM   363  C  C   . ASP A 1 50  ? 8.596  13.132 5.032   1.00 13.15 ? 50  ASP A C   1 
ATOM   364  O  O   . ASP A 1 50  ? 9.423  12.225 4.828   1.00 12.41 ? 50  ASP A O   1 
ATOM   365  C  CB  . ASP A 1 50  ? 7.825  14.805 3.351   1.00 16.93 ? 50  ASP A CB  1 
ATOM   366  C  CG  . ASP A 1 50  ? 7.085  15.038 2.037   1.00 22.46 ? 50  ASP A CG  1 
ATOM   367  O  OD1 . ASP A 1 50  ? 6.575  14.116 1.466   1.00 23.60 ? 50  ASP A OD1 1 
ATOM   368  O  OD2 . ASP A 1 50  ? 7.090  16.281 1.649   1.00 26.66 ? 50  ASP A OD2 1 
ATOM   369  N  N   . MET A 1 51  ? 8.642  13.779 6.215   1.00 12.43 ? 51  MET A N   1 
ATOM   370  C  CA  . MET A 1 51  ? 9.710  13.535 7.227   1.00 12.25 ? 51  MET A CA  1 
ATOM   371  C  C   . MET A 1 51  ? 9.481  12.048 7.695   1.00 13.34 ? 51  MET A C   1 
ATOM   372  O  O   . MET A 1 51  ? 10.460 11.313 7.864   1.00 14.22 ? 51  MET A O   1 
ATOM   373  C  CB  . MET A 1 51  ? 9.560  14.512 8.386   1.00 16.30 ? 51  MET A CB  1 
ATOM   374  C  CG  . MET A 1 51  ? 9.923  15.914 7.993   1.00 15.96 ? 51  MET A CG  1 
ATOM   375  S  SD  . MET A 1 51  ? 9.556  17.024 9.353   1.00 20.55 ? 51  MET A SD  1 
ATOM   376  C  CE  . MET A 1 51  ? 10.880 16.563 10.598  1.00 25.65 ? 51  MET A CE  1 
ATOM   377  N  N   . MET A 1 52  ? 8.251  11.708 7.950   1.00 11.60 ? 52  MET A N   1 
ATOM   378  C  CA  . MET A 1 52  ? 8.006  10.333 8.437   1.00 13.35 ? 52  MET A CA  1 
ATOM   379  C  C   . MET A 1 52  ? 8.371  9.314  7.353   1.00 14.86 ? 52  MET A C   1 
ATOM   380  O  O   . MET A 1 52  ? 8.946  8.239  7.703   1.00 14.07 ? 52  MET A O   1 
ATOM   381  C  CB  . MET A 1 52  ? 6.490  10.232 8.738   1.00 13.74 ? 52  MET A CB  1 
ATOM   382  C  CG  . MET A 1 52  ? 5.931  11.007 9.967   1.00 19.32 ? 52  MET A CG  1 
ATOM   383  S  SD  . MET A 1 52  ? 6.247  10.150 11.532  1.00 24.28 ? 52  MET A SD  1 
ATOM   384  C  CE  . MET A 1 52  ? 5.432  8.743  11.122  1.00 9.96  ? 52  MET A CE  1 
ATOM   385  N  N   . SER A 1 53  ? 8.032  9.577  6.113   1.00 11.69 ? 53  SER A N   1 
ATOM   386  C  CA  . SER A 1 53  ? 8.363  8.662  5.048   1.00 13.04 ? 53  SER A CA  1 
ATOM   387  C  C   . SER A 1 53  ? 9.792  8.353  4.925   1.00 14.55 ? 53  SER A C   1 
ATOM   388  O  O   . SER A 1 53  ? 10.193 7.195  4.561   1.00 14.62 ? 53  SER A O   1 
ATOM   389  C  CB  . SER A 1 53  ? 7.863  9.293  3.704   1.00 15.68 ? 53  SER A CB  1 
ATOM   390  O  OG  . SER A 1 53  ? 8.815  10.118 3.147   1.00 21.54 ? 53  SER A OG  1 
ATOM   391  N  N   . GLU A 1 54  ? 10.650 9.279  5.276   1.00 13.76 ? 54  GLU A N   1 
ATOM   392  C  CA  . GLU A 1 54  ? 12.061 9.009  5.142   1.00 15.60 ? 54  GLU A CA  1 
ATOM   393  C  C   . GLU A 1 54  ? 12.610 8.021  6.154   1.00 16.06 ? 54  GLU A C   1 
ATOM   394  O  O   . GLU A 1 54  ? 13.732 7.522  5.934   1.00 15.59 ? 54  GLU A O   1 
ATOM   395  C  CB  . GLU A 1 54  ? 12.864 10.354 5.337   1.00 21.28 ? 54  GLU A CB  1 
ATOM   396  C  CG  . GLU A 1 54  ? 12.551 11.276 4.167   1.00 28.14 ? 54  GLU A CG  1 
ATOM   397  C  CD  . GLU A 1 54  ? 13.611 12.373 3.940   1.00 34.62 ? 54  GLU A CD  1 
ATOM   398  O  OE1 . GLU A 1 54  ? 13.456 13.459 4.482   1.00 35.99 ? 54  GLU A OE1 1 
ATOM   399  O  OE2 . GLU A 1 54  ? 14.590 12.114 3.244   1.00 36.69 ? 54  GLU A OE2 1 
ATOM   400  N  N   . ILE A 1 55  ? 11.880 7.846  7.290   1.00 14.22 ? 55  ILE A N   1 
ATOM   401  C  CA  . ILE A 1 55  ? 12.355 7.044  8.435   1.00 15.74 ? 55  ILE A CA  1 
ATOM   402  C  C   . ILE A 1 55  ? 11.544 5.790  8.523   1.00 13.55 ? 55  ILE A C   1 
ATOM   403  O  O   . ILE A 1 55  ? 12.020 4.820  9.102   1.00 13.94 ? 55  ILE A O   1 
ATOM   404  C  CB  . ILE A 1 55  ? 12.107 7.889  9.801   1.00 20.39 ? 55  ILE A CB  1 
ATOM   405  C  CG1 . ILE A 1 55  ? 12.763 9.281  9.701   1.00 23.83 ? 55  ILE A CG1 1 
ATOM   406  C  CG2 . ILE A 1 55  ? 12.777 7.184  11.056  1.00 21.87 ? 55  ILE A CG2 1 
ATOM   407  C  CD1 . ILE A 1 55  ? 12.524 10.265 11.007  1.00 29.28 ? 55  ILE A CD1 1 
ATOM   408  N  N   . ASP A 1 56  ? 10.355 5.766  7.950   1.00 12.91 ? 56  ASP A N   1 
ATOM   409  C  CA  . ASP A 1 56  ? 9.458  4.592  8.038   1.00 12.97 ? 56  ASP A CA  1 
ATOM   410  C  C   . ASP A 1 56  ? 9.853  3.517  7.104   1.00 12.98 ? 56  ASP A C   1 
ATOM   411  O  O   . ASP A 1 56  ? 9.268  3.292  6.047   1.00 15.45 ? 56  ASP A O   1 
ATOM   412  C  CB  . ASP A 1 56  ? 8.052  5.123  7.680   1.00 13.98 ? 56  ASP A CB  1 
ATOM   413  C  CG  . ASP A 1 56  ? 7.015  4.029  7.697   1.00 15.27 ? 56  ASP A CG  1 
ATOM   414  O  OD1 . ASP A 1 56  ? 7.266  2.964  8.298   1.00 12.51 ? 56  ASP A OD1 1 
ATOM   415  O  OD2 . ASP A 1 56  ? 5.962  4.250  7.105   1.00 15.31 ? 56  ASP A OD2 1 
ATOM   416  N  N   . ARG A 1 57  ? 10.814 2.677  7.579   1.00 11.97 ? 57  ARG A N   1 
ATOM   417  C  CA  . ARG A 1 57  ? 11.345 1.685  6.687   1.00 15.16 ? 57  ARG A CA  1 
ATOM   418  C  C   . ARG A 1 57  ? 10.346 0.691  6.123   1.00 15.22 ? 57  ARG A C   1 
ATOM   419  O  O   . ARG A 1 57  ? 10.354 0.427  4.920   1.00 17.15 ? 57  ARG A O   1 
ATOM   420  C  CB  . ARG A 1 57  ? 12.453 0.930  7.434   1.00 14.57 ? 57  ARG A CB  1 
ATOM   421  C  CG  . ARG A 1 57  ? 13.075 -0.086 6.482   1.00 22.54 ? 57  ARG A CG  1 
ATOM   422  C  CD  . ARG A 1 57  ? 13.636 0.664  5.466   1.00 31.03 ? 57  ARG A CD  1 
ATOM   423  N  NE  . ARG A 1 57  ? 14.186 1.853  6.122   1.00 36.68 ? 57  ARG A NE  1 
ATOM   424  C  CZ  . ARG A 1 57  ? 14.967 2.727  5.485   1.00 38.39 ? 57  ARG A CZ  1 
ATOM   425  N  NH1 . ARG A 1 57  ? 15.282 2.471  4.228   1.00 37.43 ? 57  ARG A NH1 1 
ATOM   426  N  NH2 . ARG A 1 57  ? 15.323 3.837  6.091   1.00 40.61 ? 57  ARG A NH2 1 
ATOM   427  N  N   . ASP A 1 58  ? 9.441  0.158  6.933   1.00 11.86 ? 58  ASP A N   1 
ATOM   428  C  CA  . ASP A 1 58  ? 8.539  -0.870 6.439   1.00 13.05 ? 58  ASP A CA  1 
ATOM   429  C  C   . ASP A 1 58  ? 7.302  -0.283 5.768   1.00 15.21 ? 58  ASP A C   1 
ATOM   430  O  O   . ASP A 1 58  ? 6.453  -1.041 5.223   1.00 18.19 ? 58  ASP A O   1 
ATOM   431  C  CB  . ASP A 1 58  ? 8.189  -1.865 7.539   1.00 14.57 ? 58  ASP A CB  1 
ATOM   432  C  CG  . ASP A 1 58  ? 7.237  -1.296 8.588   1.00 14.92 ? 58  ASP A CG  1 
ATOM   433  O  OD1 . ASP A 1 58  ? 7.000  -0.090 8.655   1.00 12.58 ? 58  ASP A OD1 1 
ATOM   434  O  OD2 . ASP A 1 58  ? 6.819  -2.167 9.388   1.00 20.89 ? 58  ASP A OD2 1 
ATOM   435  N  N   . GLY A 1 59  ? 7.199  1.042  5.779   1.00 14.69 ? 59  GLY A N   1 
ATOM   436  C  CA  . GLY A 1 59  ? 6.020  1.641  5.070   1.00 14.65 ? 59  GLY A CA  1 
ATOM   437  C  C   . GLY A 1 59  ? 4.670  1.459  5.700   1.00 17.18 ? 59  GLY A C   1 
ATOM   438  O  O   . GLY A 1 59  ? 3.632  1.613  5.024   1.00 17.60 ? 59  GLY A O   1 
ATOM   439  N  N   . ASN A 1 60  ? 4.635  1.193  6.995   1.00 13.30 ? 60  ASN A N   1 
ATOM   440  C  CA  . ASN A 1 60  ? 3.381  1.003  7.653   1.00 13.05 ? 60  ASN A CA  1 
ATOM   441  C  C   . ASN A 1 60  ? 2.765  2.336  8.140   1.00 12.52 ? 60  ASN A C   1 
ATOM   442  O  O   . ASN A 1 60  ? 1.668  2.357  8.698   1.00 16.90 ? 60  ASN A O   1 
ATOM   443  C  CB  . ASN A 1 60  ? 3.408  -0.026 8.782   1.00 12.84 ? 60  ASN A CB  1 
ATOM   444  C  CG  . ASN A 1 60  ? 4.114  0.463  10.021  1.00 11.51 ? 60  ASN A CG  1 
ATOM   445  O  OD1 . ASN A 1 60  ? 4.804  1.465  9.990   1.00 13.13 ? 60  ASN A OD1 1 
ATOM   446  N  ND2 . ASN A 1 60  ? 3.926  -0.259 11.086  1.00 13.56 ? 60  ASN A ND2 1 
ATOM   447  N  N   . GLY A 1 61  ? 3.499  3.410  7.900   1.00 12.20 ? 61  GLY A N   1 
ATOM   448  C  CA  . GLY A 1 61  ? 2.989  4.766  8.188   1.00 12.12 ? 61  GLY A CA  1 
ATOM   449  C  C   . GLY A 1 61  ? 3.469  5.323  9.503   1.00 12.65 ? 61  GLY A C   1 
ATOM   450  O  O   . GLY A 1 61  ? 3.204  6.549  9.787   1.00 14.68 ? 61  GLY A O   1 
ATOM   451  N  N   . THR A 1 62  ? 4.052  4.518  10.353  1.00 12.72 ? 62  THR A N   1 
ATOM   452  C  CA  . THR A 1 62  ? 4.521  5.060  11.635  1.00 11.25 ? 62  THR A CA  1 
ATOM   453  C  C   . THR A 1 62  ? 5.984  4.568  11.841  1.00 10.29 ? 62  THR A C   1 
ATOM   454  O  O   . THR A 1 62  ? 6.465  3.691  11.112  1.00 11.61 ? 62  THR A O   1 
ATOM   455  C  CB  . THR A 1 62  ? 3.655  4.590  12.809  1.00 10.06 ? 62  THR A CB  1 
ATOM   456  O  OG1 . THR A 1 62  ? 3.724  3.133  12.954  1.00 12.34 ? 62  THR A OG1 1 
ATOM   457  C  CG2 . THR A 1 62  ? 2.173  4.893  12.589  1.00 11.90 ? 62  THR A CG2 1 
ATOM   458  N  N   . VAL A 1 63  ? 6.632  5.156  12.871  1.00 9.47  ? 63  VAL A N   1 
ATOM   459  C  CA  . VAL A 1 63  ? 8.038  4.843  13.117  1.00 10.23 ? 63  VAL A CA  1 
ATOM   460  C  C   . VAL A 1 63  ? 8.160  4.159  14.488  1.00 9.52  ? 63  VAL A C   1 
ATOM   461  O  O   . VAL A 1 63  ? 7.813  4.733  15.572  1.00 9.65  ? 63  VAL A O   1 
ATOM   462  C  CB  . VAL A 1 63  ? 8.818  6.134  13.124  1.00 9.78  ? 63  VAL A CB  1 
ATOM   463  C  CG1 . VAL A 1 63  ? 10.205 5.869  13.594  1.00 11.74 ? 63  VAL A CG1 1 
ATOM   464  C  CG2 . VAL A 1 63  ? 8.815  6.716  11.717  1.00 13.82 ? 63  VAL A CG2 1 
ATOM   465  N  N   . ASP A 1 64  ? 8.642  2.904  14.437  1.00 9.64  ? 64  ASP A N   1 
ATOM   466  C  CA  . ASP A 1 64  ? 8.815  2.174  15.715  1.00 8.38  ? 64  ASP A CA  1 
ATOM   467  C  C   . ASP A 1 64  ? 10.254 2.337  16.182  1.00 9.78  ? 64  ASP A C   1 
ATOM   468  O  O   . ASP A 1 64  ? 11.075 3.005  15.514  1.00 9.27  ? 64  ASP A O   1 
ATOM   469  C  CB  . ASP A 1 64  ? 8.326  0.726  15.586  1.00 8.95  ? 64  ASP A CB  1 
ATOM   470  C  CG  . ASP A 1 64  ? 9.209  -0.112 14.740  1.00 11.48 ? 64  ASP A CG  1 
ATOM   471  O  OD1 . ASP A 1 64  ? 10.289 0.244  14.248  1.00 10.95 ? 64  ASP A OD1 1 
ATOM   472  O  OD2 . ASP A 1 64  ? 8.792  -1.287 14.551  1.00 15.83 ? 64  ASP A OD2 1 
ATOM   473  N  N   . PHE A 1 65  ? 10.543 1.753  17.332  1.00 8.47  ? 65  PHE A N   1 
ATOM   474  C  CA  . PHE A 1 65  ? 11.910 2.024  17.864  1.00 8.54  ? 65  PHE A CA  1 
ATOM   475  C  C   . PHE A 1 65  ? 13.033 1.445  16.968  1.00 9.42  ? 65  PHE A C   1 
ATOM   476  O  O   . PHE A 1 65  ? 14.040 2.151  16.739  1.00 9.71  ? 65  PHE A O   1 
ATOM   477  C  CB  . PHE A 1 65  ? 11.987 1.591  19.338  1.00 10.23 ? 65  PHE A CB  1 
ATOM   478  C  CG  . PHE A 1 65  ? 13.370 1.868  19.901  1.00 10.63 ? 65  PHE A CG  1 
ATOM   479  C  CD1 . PHE A 1 65  ? 13.821 3.154  20.009  1.00 10.29 ? 65  PHE A CD1 1 
ATOM   480  C  CD2 . PHE A 1 65  ? 14.160 0.789  20.344  1.00 12.77 ? 65  PHE A CD2 1 
ATOM   481  C  CE1 . PHE A 1 65  ? 15.083 3.462  20.562  1.00 12.87 ? 65  PHE A CE1 1 
ATOM   482  C  CE2 . PHE A 1 65  ? 15.445 1.083  20.894  1.00 15.13 ? 65  PHE A CE2 1 
ATOM   483  C  CZ  . PHE A 1 65  ? 15.871 2.389  20.989  1.00 13.78 ? 65  PHE A CZ  1 
ATOM   484  N  N   . PRO A 1 66  ? 12.883 0.232  16.421  1.00 9.79  ? 66  PRO A N   1 
ATOM   485  C  CA  . PRO A 1 66  ? 13.953 -0.249 15.520  1.00 10.82 ? 66  PRO A CA  1 
ATOM   486  C  C   . PRO A 1 66  ? 14.135 0.724  14.388  1.00 9.92  ? 66  PRO A C   1 
ATOM   487  O  O   . PRO A 1 66  ? 15.311 0.961  13.995  1.00 11.27 ? 66  PRO A O   1 
ATOM   488  C  CB  . PRO A 1 66  ? 13.439 -1.587 15.040  1.00 12.28 ? 66  PRO A CB  1 
ATOM   489  C  CG  . PRO A 1 66  ? 12.746 -2.119 16.292  1.00 10.94 ? 66  PRO A CG  1 
ATOM   490  C  CD  . PRO A 1 66  ? 11.970 -0.902 16.834  1.00 10.66 ? 66  PRO A CD  1 
ATOM   491  N  N   . GLU A 1 67  ? 13.099 1.276  13.780  1.00 9.13  ? 67  GLU A N   1 
ATOM   492  C  CA  . GLU A 1 67  ? 13.282 2.276  12.706  1.00 10.11 ? 67  GLU A CA  1 
ATOM   493  C  C   . GLU A 1 67  ? 13.903 3.517  13.203  1.00 11.35 ? 67  GLU A C   1 
ATOM   494  O  O   . GLU A 1 67  ? 14.773 4.141  12.528  1.00 11.54 ? 67  GLU A O   1 
ATOM   495  C  CB  . GLU A 1 67  ? 11.880 2.559  12.094  1.00 9.34  ? 67  GLU A CB  1 
ATOM   496  C  CG  . GLU A 1 67  ? 11.395 1.315  11.306  1.00 10.85 ? 67  GLU A CG  1 
ATOM   497  C  CD  . GLU A 1 67  ? 10.007 1.536  10.769  1.00 14.36 ? 67  GLU A CD  1 
ATOM   498  O  OE1 . GLU A 1 67  ? 9.260  2.441  11.223  1.00 13.36 ? 67  GLU A OE1 1 
ATOM   499  O  OE2 . GLU A 1 67  ? 9.530  0.761  9.924   1.00 11.97 ? 67  GLU A OE2 1 
ATOM   500  N  N   . PHE A 1 68  ? 13.548 3.984  14.347  1.00 9.92  ? 68  PHE A N   1 
ATOM   501  C  CA  . PHE A 1 68  ? 14.171 5.185  14.915  1.00 11.42 ? 68  PHE A CA  1 
ATOM   502  C  C   . PHE A 1 68  ? 15.606 4.926  15.190  1.00 11.95 ? 68  PHE A C   1 
ATOM   503  O  O   . PHE A 1 68  ? 16.464 5.820  14.837  1.00 13.32 ? 68  PHE A O   1 
ATOM   504  C  CB  . PHE A 1 68  ? 13.422 5.533  16.222  1.00 10.53 ? 68  PHE A CB  1 
ATOM   505  C  CG  . PHE A 1 68  ? 13.804 6.887  16.840  1.00 11.69 ? 68  PHE A CG  1 
ATOM   506  C  CD1 . PHE A 1 68  ? 14.811 6.878  17.817  1.00 14.07 ? 68  PHE A CD1 1 
ATOM   507  C  CD2 . PHE A 1 68  ? 13.157 8.090  16.505  1.00 15.87 ? 68  PHE A CD2 1 
ATOM   508  C  CE1 . PHE A 1 68  ? 15.149 8.067  18.468  1.00 17.26 ? 68  PHE A CE1 1 
ATOM   509  C  CE2 . PHE A 1 68  ? 13.517 9.324  17.164  1.00 16.27 ? 68  PHE A CE2 1 
ATOM   510  C  CZ  . PHE A 1 68  ? 14.552 9.235  18.161  1.00 16.65 ? 68  PHE A CZ  1 
ATOM   511  N  N   . LEU A 1 69  ? 15.967 3.789  15.756  1.00 12.18 ? 69  LEU A N   1 
ATOM   512  C  CA  . LEU A 1 69  ? 17.384 3.472  15.995  1.00 13.28 ? 69  LEU A CA  1 
ATOM   513  C  C   . LEU A 1 69  ? 18.095 3.365  14.691  1.00 14.66 ? 69  LEU A C   1 
ATOM   514  O  O   . LEU A 1 69  ? 19.276 3.802  14.621  1.00 14.38 ? 69  LEU A O   1 
ATOM   515  C  CB  . LEU A 1 69  ? 17.467 2.126  16.720  1.00 15.84 ? 69  LEU A CB  1 
ATOM   516  C  CG  . LEU A 1 69  ? 18.747 1.971  17.437  1.00 19.14 ? 69  LEU A CG  1 
ATOM   517  C  CD1 . LEU A 1 69  ? 18.803 2.987  18.585  1.00 20.93 ? 69  LEU A CD1 1 
ATOM   518  C  CD2 . LEU A 1 69  ? 18.664 0.506  18.075  1.00 22.12 ? 69  LEU A CD2 1 
ATOM   519  N  N   . GLY A 1 70  ? 17.491 2.807  13.657  1.00 12.29 ? 70  GLY A N   1 
ATOM   520  C  CA  . GLY A 1 70  ? 18.188 2.688  12.349  1.00 14.82 ? 70  GLY A CA  1 
ATOM   521  C  C   . GLY A 1 70  ? 18.497 4.085  11.851  1.00 14.86 ? 70  GLY A C   1 
ATOM   522  O  O   . GLY A 1 70  ? 19.637 4.314  11.291  1.00 16.39 ? 70  GLY A O   1 
ATOM   523  N  N   . MET A 1 71  ? 17.624 5.052  11.977  1.00 13.00 ? 71  MET A N   1 
ATOM   524  C  CA  . MET A 1 71  ? 17.845 6.470  11.520  1.00 15.03 ? 71  MET A CA  1 
ATOM   525  C  C   . MET A 1 71  ? 19.012 7.015  12.281  1.00 16.29 ? 71  MET A C   1 
ATOM   526  O  O   . MET A 1 71  ? 19.896 7.620  11.607  1.00 16.02 ? 71  MET A O   1 
ATOM   527  C  CB  . MET A 1 71  ? 16.603 7.328  11.752  1.00 15.49 ? 71  MET A CB  1 
ATOM   528  C  CG  . MET A 1 71  ? 16.846 8.824  11.369  1.00 23.72 ? 71  MET A CG  1 
ATOM   529  S  SD  . MET A 1 71  ? 17.240 9.606  12.807  1.00 35.49 ? 71  MET A SD  1 
ATOM   530  C  CE  . MET A 1 71  ? 15.545 9.716  13.494  1.00 32.69 ? 71  MET A CE  1 
ATOM   531  N  N   . MET A 1 72  ? 19.049 6.812  13.566  1.00 16.19 ? 72  MET A N   1 
ATOM   532  C  CA  . MET A 1 72  ? 20.188 7.403  14.377  1.00 17.11 ? 72  MET A CA  1 
ATOM   533  C  C   . MET A 1 72  ? 21.471 6.768  14.046  1.00 19.33 ? 72  MET A C   1 
ATOM   534  O  O   . MET A 1 72  ? 22.456 7.515  13.913  1.00 18.67 ? 72  MET A O   1 
ATOM   535  C  CB  . MET A 1 72  ? 19.852 7.282  15.896  1.00 19.22 ? 72  MET A CB  1 
ATOM   536  C  CG  . MET A 1 72  ? 18.615 8.040  16.294  1.00 22.18 ? 72  MET A CG  1 
ATOM   537  S  SD  . MET A 1 72  ? 18.693 9.809  15.950  1.00 26.74 ? 72  MET A SD  1 
ATOM   538  C  CE  . MET A 1 72  ? 18.887 10.525 17.703  1.00 29.88 ? 72  MET A CE  1 
ATOM   539  N  N   . ALA A 1 73  ? 21.513 5.463  13.867  1.00 16.21 ? 73  ALA A N   1 
ATOM   540  C  CA  . ALA A 1 73  ? 22.735 4.744  13.503  1.00 16.37 ? 73  ALA A CA  1 
ATOM   541  C  C   . ALA A 1 73  ? 23.196 5.248  12.155  1.00 19.01 ? 73  ALA A C   1 
ATOM   542  O  O   . ALA A 1 73  ? 24.401 5.561  11.980  1.00 19.63 ? 73  ALA A O   1 
ATOM   543  C  CB  . ALA A 1 73  ? 22.532 3.215  13.531  1.00 17.84 ? 73  ALA A CB  1 
ATOM   544  N  N   . ARG A 1 74  ? 22.328 5.486  11.186  1.00 17.33 ? 74  ARG A N   1 
ATOM   545  C  CA  . ARG A 1 74  ? 22.823 5.940  9.881   1.00 16.65 ? 74  ARG A CA  1 
ATOM   546  C  C   . ARG A 1 74  ? 23.297 7.389  10.005  1.00 18.03 ? 74  ARG A C   1 
ATOM   547  O  O   . ARG A 1 74  ? 24.320 7.749  9.295   1.00 19.34 ? 74  ARG A O   1 
ATOM   548  C  CB  . ARG A 1 74  ? 21.673 5.875  8.871   1.00 18.05 ? 74  ARG A CB  1 
ATOM   549  C  CG  . ARG A 1 74  ? 21.356 4.436  8.404   1.00 21.28 ? 74  ARG A CG  1 
ATOM   550  C  CD  . ARG A 1 74  ? 20.379 4.578  7.224   1.00 23.75 ? 74  ARG A CD  1 
ATOM   551  N  NE  . ARG A 1 74  ? 19.080 5.093  7.634   1.00 25.20 ? 74  ARG A NE  1 
ATOM   552  C  CZ  . ARG A 1 74  ? 18.082 4.397  8.202   1.00 24.19 ? 74  ARG A CZ  1 
ATOM   553  N  NH1 . ARG A 1 74  ? 18.177 3.100  8.463   1.00 24.16 ? 74  ARG A NH1 1 
ATOM   554  N  NH2 . ARG A 1 74  ? 16.997 5.105  8.526   1.00 22.81 ? 74  ARG A NH2 1 
ATOM   555  N  N   . LYS A 1 75  ? 22.703 8.198  10.856  1.00 18.18 ? 75  LYS A N   1 
ATOM   556  C  CA  . LYS A 1 75  ? 23.162 9.595  10.997  1.00 20.18 ? 75  LYS A CA  1 
ATOM   557  C  C   . LYS A 1 75  ? 24.531 9.556  11.632  1.00 20.22 ? 75  LYS A C   1 
ATOM   558  O  O   . LYS A 1 75  ? 25.434 10.313 11.188  1.00 21.68 ? 75  LYS A O   1 
ATOM   559  C  CB  . LYS A 1 75  ? 22.206 10.446 11.844  1.00 24.25 ? 75  LYS A CB  1 
ATOM   560  C  CG  . LYS A 1 75  ? 20.917 10.840 11.059  1.00 32.60 ? 75  LYS A CG  1 
ATOM   561  C  CD  . LYS A 1 75  ? 19.839 11.543 11.966  1.00 37.09 ? 75  LYS A CD  1 
ATOM   562  C  CE  . LYS A 1 75  ? 18.702 12.087 11.074  1.00 37.87 ? 75  LYS A CE  1 
ATOM   563  N  NZ  . LYS A 1 75  ? 19.261 12.845 9.886   1.00 40.64 ? 75  LYS A NZ  1 
ATOM   564  N  N   . MET A 1 76  ? 24.694 8.777  12.668  1.00 18.50 ? 76  MET A N   1 
ATOM   565  C  CA  . MET A 1 76  ? 26.024 8.672  13.307  1.00 20.29 ? 76  MET A CA  1 
ATOM   566  C  C   . MET A 1 76  ? 27.073 8.137  12.306  1.00 21.36 ? 76  MET A C   1 
ATOM   567  O  O   . MET A 1 76  ? 28.247 8.628  12.281  1.00 19.42 ? 76  MET A O   1 
ATOM   568  C  CB  . MET A 1 76  ? 25.947 7.716  14.498  1.00 25.09 ? 76  MET A CB  1 
ATOM   569  C  CG  . MET A 1 76  ? 25.152 8.368  15.550  1.00 29.87 ? 76  MET A CG  1 
ATOM   570  S  SD  . MET A 1 76  ? 25.182 7.269  16.961  1.00 40.69 ? 76  MET A SD  1 
ATOM   571  C  CE  . MET A 1 76  ? 26.566 7.800  17.790  1.00 36.94 ? 76  MET A CE  1 
ATOM   572  N  N   . LYS A 1 77  ? 26.729 7.188  11.465  1.00 19.99 ? 77  LYS A N   1 
ATOM   573  C  CA  . LYS A 1 77  ? 27.716 6.671  10.543  1.00 20.97 ? 77  LYS A CA  1 
ATOM   574  C  C   . LYS A 1 77  ? 28.078 7.769  9.546   1.00 21.64 ? 77  LYS A C   1 
ATOM   575  O  O   . LYS A 1 77  ? 29.283 7.883  9.226   1.00 20.24 ? 77  LYS A O   1 
ATOM   576  C  CB  . LYS A 1 77  ? 27.208 5.443  9.813   1.00 23.23 ? 77  LYS A CB  1 
ATOM   577  C  CG  . LYS A 1 77  ? 28.132 4.839  8.707   1.00 26.86 ? 77  LYS A CG  1 
ATOM   578  C  CD  . LYS A 1 77  ? 29.330 4.178  9.368   1.00 29.83 ? 77  LYS A CD  1 
ATOM   579  C  CE  . LYS A 1 77  ? 30.231 3.581  8.273   1.00 32.44 ? 77  LYS A CE  1 
ATOM   580  N  NZ  . LYS A 1 77  ? 31.272 2.912  9.072   1.00 34.85 ? 77  LYS A NZ  1 
ATOM   581  N  N   . ASP A 1 78  ? 27.127 8.556  9.066   1.00 22.57 ? 78  ASP A N   1 
ATOM   582  C  CA  . ASP A 1 78  ? 27.446 9.654  8.125   1.00 22.67 ? 78  ASP A CA  1 
ATOM   583  C  C   . ASP A 1 78  ? 28.358 10.642 8.770   1.00 21.75 ? 78  ASP A C   1 
ATOM   584  O  O   . ASP A 1 78  ? 29.355 11.068 8.135   1.00 20.72 ? 78  ASP A O   1 
ATOM   585  C  CB  . ASP A 1 78  ? 26.184 10.324 7.601   1.00 27.75 ? 78  ASP A CB  1 
ATOM   586  C  CG  . ASP A 1 78  ? 25.527 9.506  6.426   1.00 35.02 ? 78  ASP A CG  1 
ATOM   587  O  OD1 . ASP A 1 78  ? 25.801 8.311  6.271   1.00 37.64 ? 78  ASP A OD1 1 
ATOM   588  O  OD2 . ASP A 1 78  ? 24.728 10.072 5.633   1.00 40.19 ? 78  ASP A OD2 1 
ATOM   589  N  N   . THR A 1 79  ? 28.103 11.024 9.985   1.00 18.99 ? 79  THR A N   1 
ATOM   590  C  CA  . THR A 1 79  ? 28.984 11.957 10.688  1.00 20.56 ? 79  THR A CA  1 
ATOM   591  C  C   . THR A 1 79  ? 30.372 11.317 10.804  1.00 20.92 ? 79  THR A C   1 
ATOM   592  O  O   . THR A 1 79  ? 31.435 12.007 10.584  1.00 19.15 ? 79  THR A O   1 
ATOM   593  C  CB  . THR A 1 79  ? 28.421 12.279 12.067  1.00 23.11 ? 79  THR A CB  1 
ATOM   594  O  OG1 . THR A 1 79  ? 27.173 12.955 11.846  1.00 29.62 ? 79  THR A OG1 1 
ATOM   595  C  CG2 . THR A 1 79  ? 29.333 13.146 12.902  1.00 25.94 ? 79  THR A CG2 1 
ATOM   596  N  N   . ASP A 1 80  ? 30.449 10.062 11.181  1.00 17.63 ? 80  ASP A N   1 
ATOM   597  C  CA  . ASP A 1 80  ? 31.783 9.419  11.320  1.00 17.57 ? 80  ASP A CA  1 
ATOM   598  C  C   . ASP A 1 80  ? 32.507 9.333  10.014  1.00 19.67 ? 80  ASP A C   1 
ATOM   599  O  O   . ASP A 1 80  ? 33.750 9.529  9.951   1.00 17.51 ? 80  ASP A O   1 
ATOM   600  C  CB  . ASP A 1 80  ? 31.591 7.968  11.867  1.00 24.58 ? 80  ASP A CB  1 
ATOM   601  C  CG  . ASP A 1 80  ? 31.149 7.931  13.295  1.00 30.01 ? 80  ASP A CG  1 
ATOM   602  O  OD1 . ASP A 1 80  ? 31.296 8.935  13.983  1.00 33.50 ? 80  ASP A OD1 1 
ATOM   603  O  OD2 . ASP A 1 80  ? 30.650 6.835  13.749  1.00 34.60 ? 80  ASP A OD2 1 
ATOM   604  N  N   . ASN A 1 81  ? 31.839 9.062  8.919   1.00 20.03 ? 81  ASN A N   1 
ATOM   605  C  CA  . ASN A 1 81  ? 32.565 8.946  7.647   1.00 20.06 ? 81  ASN A CA  1 
ATOM   606  C  C   . ASN A 1 81  ? 33.120 10.328 7.276   1.00 19.98 ? 81  ASN A C   1 
ATOM   607  O  O   . ASN A 1 81  ? 34.267 10.444 6.772   1.00 19.39 ? 81  ASN A O   1 
ATOM   608  C  CB  . ASN A 1 81  ? 31.618 8.563  6.559   1.00 23.37 ? 81  ASN A CB  1 
ATOM   609  C  CG  . ASN A 1 81  ? 31.237 7.112  6.665   1.00 26.87 ? 81  ASN A CG  1 
ATOM   610  O  OD1 . ASN A 1 81  ? 31.918 6.307  7.336   1.00 29.57 ? 81  ASN A OD1 1 
ATOM   611  N  ND2 . ASN A 1 81  ? 30.156 6.778  5.995   1.00 30.55 ? 81  ASN A ND2 1 
ATOM   612  N  N   . GLU A 1 82  ? 32.338 11.361 7.530   1.00 17.86 ? 82  GLU A N   1 
ATOM   613  C  CA  . GLU A 1 82  ? 32.789 12.711 7.167   1.00 19.33 ? 82  GLU A CA  1 
ATOM   614  C  C   . GLU A 1 82  ? 34.050 13.021 8.054   1.00 16.92 ? 82  GLU A C   1 
ATOM   615  O  O   . GLU A 1 82  ? 35.053 13.625 7.563   1.00 15.45 ? 82  GLU A O   1 
ATOM   616  C  CB  . GLU A 1 82  ? 31.690 13.746 7.442   1.00 23.84 ? 82  GLU A CB  1 
ATOM   617  C  CG  . GLU A 1 82  ? 30.605 13.613 6.484   1.00 35.00 ? 82  GLU A CG  1 
ATOM   618  C  CD  . GLU A 1 82  ? 29.515 14.624 6.784   1.00 39.87 ? 82  GLU A CD  1 
ATOM   619  O  OE1 . GLU A 1 82  ? 29.745 15.803 6.415   1.00 43.18 ? 82  GLU A OE1 1 
ATOM   620  O  OE2 . GLU A 1 82  ? 28.458 14.246 7.373   1.00 44.52 ? 82  GLU A OE2 1 
ATOM   621  N  N   . GLU A 1 83  ? 34.046 12.706 9.322   1.00 16.86 ? 83  GLU A N   1 
ATOM   622  C  CA  . GLU A 1 83  ? 35.155 12.941 10.236  1.00 15.03 ? 83  GLU A CA  1 
ATOM   623  C  C   . GLU A 1 83  ? 36.324 12.087 9.852   1.00 14.16 ? 83  GLU A C   1 
ATOM   624  O  O   . GLU A 1 83  ? 37.487 12.578 9.858   1.00 12.43 ? 83  GLU A O   1 
ATOM   625  C  CB  . GLU A 1 83  ? 34.719 12.668 11.730  1.00 17.68 ? 83  GLU A CB  1 
ATOM   626  C  CG  . GLU A 1 83  ? 35.880 12.729 12.701  1.00 21.16 ? 83  GLU A CG  1 
ATOM   627  C  CD  . GLU A 1 83  ? 36.584 14.065 12.741  1.00 24.31 ? 83  GLU A CD  1 
ATOM   628  O  OE1 . GLU A 1 83  ? 35.994 15.011 12.165  1.00 24.03 ? 83  GLU A OE1 1 
ATOM   629  O  OE2 . GLU A 1 83  ? 37.668 14.201 13.372  1.00 23.41 ? 83  GLU A OE2 1 
ATOM   630  N  N   . GLU A 1 84  ? 36.132 10.873 9.452   1.00 15.44 ? 84  GLU A N   1 
ATOM   631  C  CA  . GLU A 1 84  ? 37.219 10.023 9.046   1.00 14.82 ? 84  GLU A CA  1 
ATOM   632  C  C   . GLU A 1 84  ? 37.918 10.602 7.803   1.00 13.96 ? 84  GLU A C   1 
ATOM   633  O  O   . GLU A 1 84  ? 39.185 10.583 7.745   1.00 14.82 ? 84  GLU A O   1 
ATOM   634  C  CB  . GLU A 1 84  ? 36.729 8.625  8.704   1.00 20.29 ? 84  GLU A CB  1 
ATOM   635  C  CG  . GLU A 1 84  ? 36.578 7.606  9.802   1.00 32.66 ? 84  GLU A CG  1 
ATOM   636  C  CD  . GLU A 1 84  ? 35.879 6.398  9.122   1.00 35.68 ? 84  GLU A CD  1 
ATOM   637  O  OE1 . GLU A 1 84  ? 36.380 5.895  8.057   1.00 38.61 ? 84  GLU A OE1 1 
ATOM   638  O  OE2 . GLU A 1 84  ? 34.789 6.003  9.602   1.00 41.89 ? 84  GLU A OE2 1 
ATOM   639  N  N   . ILE A 1 85  ? 37.174 11.127 6.850   1.00 13.10 ? 85  ILE A N   1 
ATOM   640  C  CA  . ILE A 1 85  ? 37.787 11.711 5.632   1.00 12.72 ? 85  ILE A CA  1 
ATOM   641  C  C   . ILE A 1 85  ? 38.550 13.016 6.045   1.00 11.87 ? 85  ILE A C   1 
ATOM   642  O  O   . ILE A 1 85  ? 39.702 13.193 5.559   1.00 12.23 ? 85  ILE A O   1 
ATOM   643  C  CB  . ILE A 1 85  ? 36.727 12.007 4.550   1.00 14.53 ? 85  ILE A CB  1 
ATOM   644  C  CG1 . ILE A 1 85  ? 36.232 10.663 3.961   1.00 17.25 ? 85  ILE A CG1 1 
ATOM   645  C  CG2 . ILE A 1 85  ? 37.324 12.928 3.468   1.00 15.66 ? 85  ILE A CG2 1 
ATOM   646  C  CD1 . ILE A 1 85  ? 34.976 10.901 3.129   1.00 20.89 ? 85  ILE A CD1 1 
ATOM   647  N  N   . ARG A 1 86  ? 38.019 13.798 6.932   1.00 11.27 ? 86  ARG A N   1 
ATOM   648  C  CA  . ARG A 1 86  ? 38.694 15.056 7.386   1.00 11.12 ? 86  ARG A CA  1 
ATOM   649  C  C   . ARG A 1 86  ? 39.970 14.667 8.110   1.00 10.84 ? 86  ARG A C   1 
ATOM   650  O  O   . ARG A 1 86  ? 41.050 15.368 7.890   1.00 10.15 ? 86  ARG A O   1 
ATOM   651  C  CB  . ARG A 1 86  ? 37.824 15.844 8.365   1.00 15.68 ? 86  ARG A CB  1 
ATOM   652  C  CG  . ARG A 1 86  ? 38.238 17.185 8.477   1.00 17.67 ? 86  ARG A CG  1 
ATOM   653  C  CD  . ARG A 1 86  ? 37.701 17.806 9.822   1.00 21.35 ? 86  ARG A CD  1 
ATOM   654  N  NE  . ARG A 1 86  ? 38.118 16.933 10.950  1.00 21.99 ? 86  ARG A NE  1 
ATOM   655  C  CZ  . ARG A 1 86  ? 39.298 17.046 11.538  1.00 21.97 ? 86  ARG A CZ  1 
ATOM   656  N  NH1 . ARG A 1 86  ? 40.106 17.966 11.124  1.00 15.48 ? 86  ARG A NH1 1 
ATOM   657  N  NH2 . ARG A 1 86  ? 39.725 16.202 12.541  1.00 19.03 ? 86  ARG A NH2 1 
ATOM   658  N  N   . GLU A 1 87  ? 39.882 13.669 9.004   1.00 10.10 ? 87  GLU A N   1 
ATOM   659  C  CA  . GLU A 1 87  ? 41.102 13.264 9.705   1.00 10.14 ? 87  GLU A CA  1 
ATOM   660  C  C   . GLU A 1 87  ? 42.131 12.737 8.709   1.00 9.39  ? 87  GLU A C   1 
ATOM   661  O  O   . GLU A 1 87  ? 43.348 13.051 8.895   1.00 11.74 ? 87  GLU A O   1 
ATOM   662  C  CB  . GLU A 1 87  ? 40.819 12.188 10.759  1.00 11.00 ? 87  GLU A CB  1 
ATOM   663  C  CG  . GLU A 1 87  ? 39.988 12.716 11.843  1.00 14.51 ? 87  GLU A CG  1 
ATOM   664  C  CD  . GLU A 1 87  ? 39.679 11.717 12.954  1.00 20.82 ? 87  GLU A CD  1 
ATOM   665  O  OE1 . GLU A 1 87  ? 40.371 10.682 13.035  1.00 25.11 ? 87  GLU A OE1 1 
ATOM   666  O  OE2 . GLU A 1 87  ? 38.769 12.020 13.812  1.00 24.76 ? 87  GLU A OE2 1 
ATOM   667  N  N   . ALA A 1 88  ? 41.709 11.985 7.718   1.00 10.40 ? 88  ALA A N   1 
ATOM   668  C  CA  . ALA A 1 88  ? 42.689 11.488 6.758   1.00 9.46  ? 88  ALA A CA  1 
ATOM   669  C  C   . ALA A 1 88  ? 43.397 12.679 6.050   1.00 9.42  ? 88  ALA A C   1 
ATOM   670  O  O   . ALA A 1 88  ? 44.610 12.662 5.826   1.00 10.39 ? 88  ALA A O   1 
ATOM   671  C  CB  . ALA A 1 88  ? 42.043 10.589 5.754   1.00 12.27 ? 88  ALA A CB  1 
ATOM   672  N  N   . PHE A 1 89  ? 42.577 13.677 5.650   1.00 10.76 ? 89  PHE A N   1 
ATOM   673  C  CA  . PHE A 1 89  ? 43.194 14.812 4.991   1.00 9.10  ? 89  PHE A CA  1 
ATOM   674  C  C   . PHE A 1 89  ? 44.263 15.486 5.905   1.00 9.81  ? 89  PHE A C   1 
ATOM   675  O  O   . PHE A 1 89  ? 45.391 15.798 5.436   1.00 9.55  ? 89  PHE A O   1 
ATOM   676  C  CB  . PHE A 1 89  ? 42.102 15.857 4.593   1.00 9.32  ? 89  PHE A CB  1 
ATOM   677  C  CG  . PHE A 1 89  ? 42.724 17.057 3.891   1.00 8.79  ? 89  PHE A CG  1 
ATOM   678  C  CD1 . PHE A 1 89  ? 43.069 16.892 2.551   1.00 8.94  ? 89  PHE A CD1 1 
ATOM   679  C  CD2 . PHE A 1 89  ? 42.966 18.261 4.543   1.00 8.80  ? 89  PHE A CD2 1 
ATOM   680  C  CE1 . PHE A 1 89  ? 43.638 17.959 1.844   1.00 8.73  ? 89  PHE A CE1 1 
ATOM   681  C  CE2 . PHE A 1 89  ? 43.554 19.317 3.885   1.00 8.95  ? 89  PHE A CE2 1 
ATOM   682  C  CZ  . PHE A 1 89  ? 43.895 19.162 2.513   1.00 9.44  ? 89  PHE A CZ  1 
ATOM   683  N  N   . ARG A 1 90  ? 43.927 15.619 7.176   1.00 9.66  ? 90  ARG A N   1 
ATOM   684  C  CA  . ARG A 1 90  ? 44.881 16.273 8.120   1.00 9.74  ? 90  ARG A CA  1 
ATOM   685  C  C   . ARG A 1 90  ? 46.119 15.374 8.274   1.00 9.28  ? 90  ARG A C   1 
ATOM   686  O  O   . ARG A 1 90  ? 47.271 15.908 8.354   1.00 10.83 ? 90  ARG A O   1 
ATOM   687  C  CB  . ARG A 1 90  ? 44.307 16.528 9.470   1.00 10.30 ? 90  ARG A CB  1 
ATOM   688  C  CG  . ARG A 1 90  ? 43.198 17.510 9.299   1.00 11.81 ? 90  ARG A CG  1 
ATOM   689  C  CD  . ARG A 1 90  ? 43.540 18.638 9.560   1.00 25.08 ? 90  ARG A CD  1 
ATOM   690  N  NE  . ARG A 1 90  ? 43.208 18.687 10.953  1.00 29.36 ? 90  ARG A NE  1 
ATOM   691  C  CZ  . ARG A 1 90  ? 42.533 17.860 11.765  1.00 32.20 ? 90  ARG A CZ  1 
ATOM   692  N  NH1 . ARG A 1 90  ? 41.992 16.724 11.461  1.00 35.16 ? 90  ARG A NH1 1 
ATOM   693  N  NH2 . ARG A 1 90  ? 42.373 18.326 12.998  1.00 31.69 ? 90  ARG A NH2 1 
ATOM   694  N  N   . VAL A 1 91  ? 45.976 14.057 8.242   1.00 9.82  ? 91  VAL A N   1 
ATOM   695  C  CA  . VAL A 1 91  ? 47.168 13.201 8.315   1.00 9.61  ? 91  VAL A CA  1 
ATOM   696  C  C   . VAL A 1 91  ? 47.998 13.321 6.993   1.00 9.05  ? 91  VAL A C   1 
ATOM   697  O  O   . VAL A 1 91  ? 49.205 13.394 7.047   1.00 10.33 ? 91  VAL A O   1 
ATOM   698  C  CB  . VAL A 1 91  ? 46.717 11.754 8.547   1.00 10.57 ? 91  VAL A CB  1 
ATOM   699  C  CG1 . VAL A 1 91  ? 47.927 10.787 8.324   1.00 11.97 ? 91  VAL A CG1 1 
ATOM   700  C  CG2 . VAL A 1 91  ? 46.169 11.632 10.011  1.00 11.50 ? 91  VAL A CG2 1 
ATOM   701  N  N   . PHE A 1 92  ? 47.359 13.353 5.815   1.00 9.84  ? 92  PHE A N   1 
ATOM   702  C  CA  . PHE A 1 92  ? 48.119 13.492 4.554   1.00 8.78  ? 92  PHE A CA  1 
ATOM   703  C  C   . PHE A 1 92  ? 48.810 14.831 4.510   1.00 10.08 ? 92  PHE A C   1 
ATOM   704  O  O   . PHE A 1 92  ? 49.977 14.922 4.000   1.00 10.36 ? 92  PHE A O   1 
ATOM   705  C  CB  . PHE A 1 92  ? 47.179 13.438 3.308   1.00 9.96  ? 92  PHE A CB  1 
ATOM   706  C  CG  . PHE A 1 92  ? 46.803 12.072 2.844   1.00 10.02 ? 92  PHE A CG  1 
ATOM   707  C  CD1 . PHE A 1 92  ? 46.453 11.084 3.742   1.00 11.53 ? 92  PHE A CD1 1 
ATOM   708  C  CD2 . PHE A 1 92  ? 46.772 11.802 1.506   1.00 12.04 ? 92  PHE A CD2 1 
ATOM   709  C  CE1 . PHE A 1 92  ? 46.127 9.809  3.281   1.00 12.55 ? 92  PHE A CE1 1 
ATOM   710  C  CE2 . PHE A 1 92  ? 46.447 10.513 1.014   1.00 13.25 ? 92  PHE A CE2 1 
ATOM   711  C  CZ  . PHE A 1 92  ? 46.155 9.529  1.933   1.00 14.06 ? 92  PHE A CZ  1 
ATOM   712  N  N   . ASP A 1 93  ? 48.204 15.907 5.043   1.00 9.24  ? 93  ASP A N   1 
ATOM   713  C  CA  . ASP A 1 93  ? 48.779 17.292 5.012   1.00 9.94  ? 93  ASP A CA  1 
ATOM   714  C  C   . ASP A 1 93  ? 49.782 17.407 6.180   1.00 10.29 ? 93  ASP A C   1 
ATOM   715  O  O   . ASP A 1 93  ? 49.525 18.083 7.210   1.00 11.22 ? 93  ASP A O   1 
ATOM   716  C  CB  . ASP A 1 93  ? 47.609 18.290 5.205   1.00 8.78  ? 93  ASP A CB  1 
ATOM   717  C  CG  . ASP A 1 93  ? 48.116 19.721 5.289   1.00 13.32 ? 93  ASP A CG  1 
ATOM   718  O  OD1 . ASP A 1 93  ? 49.270 19.977 4.861   1.00 12.65 ? 93  ASP A OD1 1 
ATOM   719  O  OD2 . ASP A 1 93  ? 47.350 20.562 5.877   1.00 14.72 ? 93  ASP A OD2 1 
ATOM   720  N  N   . LYS A 1 94  ? 50.965 16.788 5.984   1.00 10.67 ? 94  LYS A N   1 
ATOM   721  C  CA  . LYS A 1 94  ? 51.932 16.639 7.079   1.00 9.39  ? 94  LYS A CA  1 
ATOM   722  C  C   . LYS A 1 94  ? 52.393 17.998 7.659   1.00 12.65 ? 94  LYS A C   1 
ATOM   723  O  O   . LYS A 1 94  ? 52.457 18.098 8.921   1.00 15.40 ? 94  LYS A O   1 
ATOM   724  C  CB  . LYS A 1 94  ? 53.111 15.832 6.533   1.00 13.19 ? 94  LYS A CB  1 
ATOM   725  C  CG  . LYS A 1 94  ? 54.093 15.527 7.686   1.00 17.25 ? 94  LYS A CG  1 
ATOM   726  C  CD  . LYS A 1 94  ? 55.027 14.428 7.279   1.00 22.25 ? 94  LYS A CD  1 
ATOM   727  C  CE  . LYS A 1 94  ? 56.231 14.094 8.334   1.00 25.42 ? 94  LYS A CE  1 
ATOM   728  N  NZ  . LYS A 1 94  ? 56.663 15.370 8.978   1.00 33.00 ? 94  LYS A NZ  1 
ATOM   729  N  N   . ASP A 1 95  ? 52.547 19.044 6.851   1.00 11.74 ? 95  ASP A N   1 
ATOM   730  C  CA  . ASP A 1 95  ? 53.001 20.328 7.435   1.00 13.25 ? 95  ASP A CA  1 
ATOM   731  C  C   . ASP A 1 95  ? 51.863 21.186 7.844   1.00 15.22 ? 95  ASP A C   1 
ATOM   732  O  O   . ASP A 1 95  ? 52.156 22.320 8.364   1.00 16.30 ? 95  ASP A O   1 
ATOM   733  C  CB  . ASP A 1 95  ? 53.926 21.032 6.489   1.00 13.43 ? 95  ASP A CB  1 
ATOM   734  C  CG  . ASP A 1 95  ? 53.254 21.636 5.231   1.00 14.29 ? 95  ASP A CG  1 
ATOM   735  O  OD1 . ASP A 1 95  ? 52.073 21.528 5.006   1.00 13.79 ? 95  ASP A OD1 1 
ATOM   736  O  OD2 . ASP A 1 95  ? 54.040 22.264 4.382   1.00 17.65 ? 95  ASP A OD2 1 
ATOM   737  N  N   . GLY A 1 96  ? 50.637 20.709 7.759   1.00 14.73 ? 96  GLY A N   1 
ATOM   738  C  CA  . GLY A 1 96  ? 49.470 21.458 8.281   1.00 17.10 ? 96  GLY A CA  1 
ATOM   739  C  C   . GLY A 1 96  ? 49.122 22.761 7.589   1.00 17.44 ? 96  GLY A C   1 
ATOM   740  O  O   . GLY A 1 96  ? 48.325 23.553 8.154   1.00 20.80 ? 96  GLY A O   1 
ATOM   741  N  N   . ASN A 1 97  ? 49.600 22.959 6.378   1.00 13.56 ? 97  ASN A N   1 
ATOM   742  C  CA  . ASN A 1 97  ? 49.283 24.180 5.693   1.00 12.77 ? 97  ASN A CA  1 
ATOM   743  C  C   . ASN A 1 97  ? 47.956 24.232 4.974   1.00 14.28 ? 97  ASN A C   1 
ATOM   744  O  O   . ASN A 1 97  ? 47.622 25.241 4.308   1.00 15.83 ? 97  ASN A O   1 
ATOM   745  C  CB  . ASN A 1 97  ? 50.428 24.592 4.794   1.00 16.24 ? 97  ASN A CB  1 
ATOM   746  C  CG  . ASN A 1 97  ? 50.480 23.826 3.457   1.00 15.53 ? 97  ASN A CG  1 
ATOM   747  O  OD1 . ASN A 1 97  ? 49.960 22.755 3.395   1.00 13.70 ? 97  ASN A OD1 1 
ATOM   748  N  ND2 . ASN A 1 97  ? 51.209 24.329 2.467   1.00 18.03 ? 97  ASN A ND2 1 
ATOM   749  N  N   . GLY A 1 98  ? 47.233 23.143 5.026   1.00 11.90 ? 98  GLY A N   1 
ATOM   750  C  CA  . GLY A 1 98  ? 45.910 23.059 4.429   1.00 14.67 ? 98  GLY A CA  1 
ATOM   751  C  C   . GLY A 1 98  ? 45.909 22.484 2.988   1.00 12.01 ? 98  GLY A C   1 
ATOM   752  O  O   . GLY A 1 98  ? 44.856 22.368 2.347   1.00 13.82 ? 98  GLY A O   1 
ATOM   753  N  N   . PHE A 1 99  ? 47.065 22.090 2.447   1.00 11.59 ? 99  PHE A N   1 
ATOM   754  C  CA  . PHE A 1 99  ? 47.175 21.545 1.089   1.00 12.08 ? 99  PHE A CA  1 
ATOM   755  C  C   . PHE A 1 99  ? 48.091 20.306 1.126   1.00 11.12 ? 99  PHE A C   1 
ATOM   756  O  O   . PHE A 1 99  ? 49.095 20.337 1.837   1.00 14.21 ? 99  PHE A O   1 
ATOM   757  C  CB  . PHE A 1 99  ? 47.814 22.595 0.172   1.00 12.46 ? 99  PHE A CB  1 
ATOM   758  C  CG  . PHE A 1 99  ? 46.979 23.892 0.088   1.00 13.51 ? 99  PHE A CG  1 
ATOM   759  C  CD1 . PHE A 1 99  ? 47.152 24.876 1.019   1.00 14.45 ? 99  PHE A CD1 1 
ATOM   760  C  CD2 . PHE A 1 99  ? 46.013 23.982 -0.894  1.00 16.06 ? 99  PHE A CD2 1 
ATOM   761  C  CE1 . PHE A 1 99  ? 46.324 25.990 0.989   1.00 17.07 ? 99  PHE A CE1 1 
ATOM   762  C  CE2 . PHE A 1 99  ? 45.112 25.128 -0.971  1.00 15.39 ? 99  PHE A CE2 1 
ATOM   763  C  CZ  . PHE A 1 99  ? 45.284 26.134 0.007   1.00 15.75 ? 99  PHE A CZ  1 
ATOM   764  N  N   . VAL A 1 100 ? 47.705 19.291 0.369   1.00 9.06  ? 100 VAL A N   1 
ATOM   765  C  CA  . VAL A 1 100 ? 48.578 18.089 0.248   1.00 9.33  ? 100 VAL A CA  1 
ATOM   766  C  C   . VAL A 1 100 ? 49.424 18.268 -0.995  1.00 9.88  ? 100 VAL A C   1 
ATOM   767  O  O   . VAL A 1 100 ? 48.956 18.360 -2.132  1.00 10.19 ? 100 VAL A O   1 
ATOM   768  C  CB  . VAL A 1 100 ? 47.747 16.830 0.140   1.00 9.68  ? 100 VAL A CB  1 
ATOM   769  C  CG1 . VAL A 1 100 ? 48.717 15.578 -0.116  1.00 9.48  ? 100 VAL A CG1 1 
ATOM   770  C  CG2 . VAL A 1 100 ? 46.939 16.615 1.398   1.00 11.46 ? 100 VAL A CG2 1 
ATOM   771  N  N   . SER A 1 101 ? 50.742 18.334 -0.785  1.00 8.67  ? 101 SER A N   1 
ATOM   772  C  CA  . SER A 1 101 ? 51.657 18.442 -1.912  1.00 9.80  ? 101 SER A CA  1 
ATOM   773  C  C   . SER A 1 101 ? 52.025 17.036 -2.468  1.00 9.22  ? 101 SER A C   1 
ATOM   774  O  O   . SER A 1 101 ? 51.708 16.009 -1.841  1.00 10.19 ? 101 SER A O   1 
ATOM   775  C  CB  . SER A 1 101 ? 52.967 19.056 -1.468  1.00 11.00 ? 101 SER A CB  1 
ATOM   776  O  OG  . SER A 1 101 ? 53.685 18.195 -0.535  1.00 12.49 ? 101 SER A OG  1 
ATOM   777  N  N   . ALA A 1 102 ? 52.611 17.050 -3.656  1.00 10.52 ? 102 ALA A N   1 
ATOM   778  C  CA  . ALA A 1 102 ? 53.072 15.772 -4.208  1.00 11.72 ? 102 ALA A CA  1 
ATOM   779  C  C   . ALA A 1 102 ? 54.073 15.074 -3.269  1.00 10.57 ? 102 ALA A C   1 
ATOM   780  O  O   . ALA A 1 102 ? 53.928 13.830 -3.057  1.00 11.16 ? 102 ALA A O   1 
ATOM   781  C  CB  . ALA A 1 102 ? 53.703 16.032 -5.587  1.00 11.47 ? 102 ALA A CB  1 
ATOM   782  N  N   . ALA A 1 103 ? 55.011 15.823 -2.691  1.00 10.04 ? 103 ALA A N   1 
ATOM   783  C  CA  . ALA A 1 103 ? 55.939 15.141 -1.749  1.00 10.06 ? 103 ALA A CA  1 
ATOM   784  C  C   . ALA A 1 103 ? 55.162 14.558 -0.531  1.00 9.74  ? 103 ALA A C   1 
ATOM   785  O  O   . ALA A 1 103 ? 55.449 13.411 -0.079  1.00 10.73 ? 103 ALA A O   1 
ATOM   786  C  CB  . ALA A 1 103 ? 56.986 16.156 -1.300  1.00 13.29 ? 103 ALA A CB  1 
ATOM   787  N  N   . GLU A 1 104 ? 54.202 15.343 0.016   1.00 9.14  ? 104 GLU A N   1 
ATOM   788  C  CA  . GLU A 1 104 ? 53.431 14.764 1.127   1.00 9.44  ? 104 GLU A CA  1 
ATOM   789  C  C   . GLU A 1 104 ? 52.678 13.528 0.730   1.00 9.62  ? 104 GLU A C   1 
ATOM   790  O  O   . GLU A 1 104 ? 52.606 12.570 1.488   1.00 10.52 ? 104 GLU A O   1 
ATOM   791  C  CB  . GLU A 1 104 ? 52.435 15.824 1.633   1.00 8.51  ? 104 GLU A CB  1 
ATOM   792  C  CG  . GLU A 1 104 ? 53.199 16.910 2.467   1.00 8.78  ? 104 GLU A CG  1 
ATOM   793  C  CD  . GLU A 1 104 ? 52.277 18.065 2.859   1.00 11.97 ? 104 GLU A CD  1 
ATOM   794  O  OE1 . GLU A 1 104 ? 51.258 18.308 2.221   1.00 10.87 ? 104 GLU A OE1 1 
ATOM   795  O  OE2 . GLU A 1 104 ? 52.656 18.815 3.821   1.00 11.17 ? 104 GLU A OE2 1 
ATOM   796  N  N   . LEU A 1 105 ? 52.057 13.539 -0.471  1.00 9.19  ? 105 LEU A N   1 
ATOM   797  C  CA  . LEU A 1 105 ? 51.269 12.390 -0.858  1.00 8.78  ? 105 LEU A CA  1 
ATOM   798  C  C   . LEU A 1 105 ? 52.213 11.136 -1.054  1.00 7.85  ? 105 LEU A C   1 
ATOM   799  O  O   . LEU A 1 105 ? 51.843 10.065 -0.617  1.00 9.31  ? 105 LEU A O   1 
ATOM   800  C  CB  . LEU A 1 105 ? 50.533 12.700 -2.192  1.00 9.75  ? 105 LEU A CB  1 
ATOM   801  C  CG  . LEU A 1 105 ? 49.751 11.549 -2.770  1.00 9.99  ? 105 LEU A CG  1 
ATOM   802  C  CD1 . LEU A 1 105 ? 48.665 11.047 -1.726  1.00 10.29 ? 105 LEU A CD1 1 
ATOM   803  C  CD2 . LEU A 1 105 ? 49.068 12.046 -4.105  1.00 12.42 ? 105 LEU A CD2 1 
ATOM   804  N  N   . ARG A 1 106 ? 53.396 11.353 -1.674  1.00 8.89  ? 106 ARG A N   1 
ATOM   805  C  CA  . ARG A 1 106 ? 54.283 10.179 -1.853  1.00 9.38  ? 106 ARG A CA  1 
ATOM   806  C  C   . ARG A 1 106 ? 54.667 9.601  -0.476  1.00 10.31 ? 106 ARG A C   1 
ATOM   807  O  O   . ARG A 1 106 ? 54.621 8.394  -0.269  1.00 10.58 ? 106 ARG A O   1 
ATOM   808  C  CB  . ARG A 1 106 ? 55.508 10.569 -2.656  1.00 8.47  ? 106 ARG A CB  1 
ATOM   809  C  CG  . ARG A 1 106 ? 56.270 9.295  -3.002  1.00 11.16 ? 106 ARG A CG  1 
ATOM   810  C  CD  . ARG A 1 106 ? 57.291 9.676  -4.079  1.00 12.01 ? 106 ARG A CD  1 
ATOM   811  N  NE  . ARG A 1 106 ? 58.053 8.473  -4.552  1.00 11.26 ? 106 ARG A NE  1 
ATOM   812  C  CZ  . ARG A 1 106 ? 59.357 8.281  -4.436  1.00 13.39 ? 106 ARG A CZ  1 
ATOM   813  N  NH1 . ARG A 1 106 ? 60.140 9.208  -3.872  1.00 12.75 ? 106 ARG A NH1 1 
ATOM   814  N  NH2 . ARG A 1 106 ? 59.921 7.143  -4.895  1.00 13.47 ? 106 ARG A NH2 1 
ATOM   815  N  N   . HIS A 1 107 ? 54.985 10.503 0.437   1.00 10.52 ? 107 HIS A N   1 
ATOM   816  C  CA  . HIS A 1 107 ? 55.373 10.023 1.768   1.00 10.67 ? 107 HIS A CA  1 
ATOM   817  C  C   . HIS A 1 107 ? 54.237 9.341  2.525   1.00 12.11 ? 107 HIS A C   1 
ATOM   818  O  O   . HIS A 1 107 ? 54.423 8.233  3.098   1.00 11.49 ? 107 HIS A O   1 
ATOM   819  C  CB  . HIS A 1 107 ? 55.825 11.185 2.592   1.00 11.91 ? 107 HIS A CB  1 
ATOM   820  C  CG  . HIS A 1 107 ? 56.176 10.769 3.974   1.00 12.72 ? 107 HIS A CG  1 
ATOM   821  N  ND1 . HIS A 1 107 ? 57.252 9.930  4.200   1.00 18.26 ? 107 HIS A ND1 1 
ATOM   822  C  CD2 . HIS A 1 107 ? 55.546 10.978 5.146   1.00 14.73 ? 107 HIS A CD2 1 
ATOM   823  C  CE1 . HIS A 1 107 ? 57.258 9.633  5.504   1.00 21.12 ? 107 HIS A CE1 1 
ATOM   824  N  NE2 . HIS A 1 107 ? 56.245 10.263 6.090   1.00 17.98 ? 107 HIS A NE2 1 
ATOM   825  N  N   . VAL A 1 108 ? 53.038 9.887  2.534   1.00 8.88  ? 108 VAL A N   1 
ATOM   826  C  CA  . VAL A 1 108 ? 52.021 9.253  3.307   1.00 10.46 ? 108 VAL A CA  1 
ATOM   827  C  C   . VAL A 1 108 ? 51.573 7.898  2.632   1.00 10.66 ? 108 VAL A C   1 
ATOM   828  O  O   . VAL A 1 108 ? 51.156 6.982  3.318   1.00 11.04 ? 108 VAL A O   1 
ATOM   829  C  CB  . VAL A 1 108 ? 50.811 10.189 3.503   1.00 11.62 ? 108 VAL A CB  1 
ATOM   830  C  CG1 . VAL A 1 108 ? 49.955 10.330 2.254   1.00 13.42 ? 108 VAL A CG1 1 
ATOM   831  C  CG2 . VAL A 1 108 ? 49.938 9.614  4.587   1.00 13.02 ? 108 VAL A CG2 1 
ATOM   832  N  N   . MET A 1 109 ? 51.659 7.802  1.282   1.00 10.32 ? 109 MET A N   1 
ATOM   833  C  CA  . MET A 1 109 ? 51.316 6.503  0.682   1.00 9.53  ? 109 MET A CA  1 
ATOM   834  C  C   . MET A 1 109 ? 52.259 5.425  1.126   1.00 11.70 ? 109 MET A C   1 
ATOM   835  O  O   . MET A 1 109 ? 51.765 4.285  1.306   1.00 12.44 ? 109 MET A O   1 
ATOM   836  C  CB  . MET A 1 109 ? 51.205 6.687  -0.835  1.00 11.65 ? 109 MET A CB  1 
ATOM   837  C  CG  . MET A 1 109 ? 50.056 7.623  -1.209  1.00 13.58 ? 109 MET A CG  1 
ATOM   838  S  SD  . MET A 1 109 ? 48.414 7.111  -0.682  1.00 16.58 ? 109 MET A SD  1 
ATOM   839  C  CE  . MET A 1 109 ? 48.397 5.644  -1.456  1.00 20.74 ? 109 MET A CE  1 
ATOM   840  N  N   . THR A 1 110 ? 53.521 5.798  1.336   1.00 12.67 ? 110 THR A N   1 
ATOM   841  C  CA  . THR A 1 110 ? 54.435 4.742  1.889   1.00 14.50 ? 110 THR A CA  1 
ATOM   842  C  C   . THR A 1 110 ? 53.951 4.266  3.277   1.00 15.36 ? 110 THR A C   1 
ATOM   843  O  O   . THR A 1 110 ? 54.042 3.131  3.672   1.00 15.32 ? 110 THR A O   1 
ATOM   844  C  CB  . THR A 1 110 ? 55.862 5.145  1.998   1.00 15.55 ? 110 THR A CB  1 
ATOM   845  O  OG1 . THR A 1 110 ? 56.077 6.020  3.162   1.00 20.33 ? 110 THR A OG1 1 
ATOM   846  C  CG2 . THR A 1 110 ? 56.308 5.682  0.677   1.00 16.05 ? 110 THR A CG2 1 
ATOM   847  N  N   . ARG A 1 111 ? 53.403 5.164  4.102   1.00 16.50 ? 111 ARG A N   1 
ATOM   848  C  CA  . ARG A 1 111 ? 52.913 4.771  5.421   1.00 17.34 ? 111 ARG A CA  1 
ATOM   849  C  C   . ARG A 1 111 ? 51.748 3.893  5.337   1.00 20.14 ? 111 ARG A C   1 
ATOM   850  O  O   . ARG A 1 111 ? 51.492 3.163  6.310   1.00 20.05 ? 111 ARG A O   1 
ATOM   851  C  CB  . ARG A 1 111 ? 52.488 6.066  6.181   1.00 18.80 ? 111 ARG A CB  1 
ATOM   852  C  CG  . ARG A 1 111 ? 53.832 6.777  6.408   1.00 24.56 ? 111 ARG A CG  1 
ATOM   853  C  CD  . ARG A 1 111 ? 54.307 7.130  7.809   1.00 21.00 ? 111 ARG A CD  1 
ATOM   854  N  NE  . ARG A 1 111 ? 53.389 6.911  8.965   1.00 18.84 ? 111 ARG A NE  1 
ATOM   855  C  CZ  . ARG A 1 111 ? 53.134 5.761  9.624   1.00 23.55 ? 111 ARG A CZ  1 
ATOM   856  N  NH1 . ARG A 1 111 ? 53.769 4.604  9.258   1.00 24.60 ? 111 ARG A NH1 1 
ATOM   857  N  NH2 . ARG A 1 111 ? 52.127 5.717  10.545  1.00 22.79 ? 111 ARG A NH2 1 
ATOM   858  N  N   . LEU A 1 112 ? 50.990 3.971  4.236   1.00 16.98 ? 112 LEU A N   1 
ATOM   859  C  CA  . LEU A 1 112 ? 49.837 3.150  3.994   1.00 19.11 ? 112 LEU A CA  1 
ATOM   860  C  C   . LEU A 1 112 ? 50.220 1.886  3.279   1.00 17.42 ? 112 LEU A C   1 
ATOM   861  O  O   . LEU A 1 112 ? 49.336 1.146  2.827   1.00 20.45 ? 112 LEU A O   1 
ATOM   862  C  CB  . LEU A 1 112 ? 48.784 3.937  3.249   1.00 18.41 ? 112 LEU A CB  1 
ATOM   863  C  CG  . LEU A 1 112 ? 48.206 5.031  4.135   1.00 20.97 ? 112 LEU A CG  1 
ATOM   864  C  CD1 . LEU A 1 112 ? 47.203 4.440  5.134   1.00 24.19 ? 112 LEU A CD1 1 
ATOM   865  C  CD2 . LEU A 1 112 ? 49.276 5.651  4.844   1.00 26.96 ? 112 LEU A CD2 1 
ATOM   866  N  N   . GLY A 1 113 ? 51.500 1.714  3.043   1.00 16.06 ? 113 GLY A N   1 
ATOM   867  C  CA  . GLY A 1 113 ? 51.983 0.457  2.370   1.00 15.63 ? 113 GLY A CA  1 
ATOM   868  C  C   . GLY A 1 113 ? 52.094 0.499  0.874   1.00 18.14 ? 113 GLY A C   1 
ATOM   869  O  O   . GLY A 1 113 ? 52.238 -0.542 0.252   1.00 17.36 ? 113 GLY A O   1 
ATOM   870  N  N   . GLU A 1 114 ? 52.002 1.669  0.281   1.00 13.74 ? 114 GLU A N   1 
ATOM   871  C  CA  . GLU A 1 114 ? 52.107 1.789  -1.200  1.00 13.29 ? 114 GLU A CA  1 
ATOM   872  C  C   . GLU A 1 114 ? 53.362 2.538  -1.577  1.00 12.57 ? 114 GLU A C   1 
ATOM   873  O  O   . GLU A 1 114 ? 53.521 3.758  -1.253  1.00 14.84 ? 114 GLU A O   1 
ATOM   874  C  CB  . GLU A 1 114 ? 50.912 2.507  -1.774  1.00 12.39 ? 114 GLU A CB  1 
ATOM   875  C  CG  . GLU A 1 114 ? 49.634 1.709  -1.544  1.00 17.01 ? 114 GLU A CG  1 
ATOM   876  C  CD  . GLU A 1 114 ? 48.475 2.214  -2.434  1.00 19.05 ? 114 GLU A CD  1 
ATOM   877  O  OE1 . GLU A 1 114 ? 48.741 2.716  -3.497  1.00 21.72 ? 114 GLU A OE1 1 
ATOM   878  O  OE2 . GLU A 1 114 ? 47.337 2.058  -2.002  1.00 26.65 ? 114 GLU A OE2 1 
ATOM   879  N  N   . LYS A 1 115 ? 54.285 1.934  -2.305  1.00 10.68 ? 115 LYS A N   1 
ATOM   880  C  CA  . LYS A 1 115 ? 55.494 2.578  -2.764  1.00 11.62 ? 115 LYS A CA  1 
ATOM   881  C  C   . LYS A 1 115 ? 55.224 2.977  -4.203  1.00 11.45 ? 115 LYS A C   1 
ATOM   882  O  O   . LYS A 1 115 ? 55.238 2.123  -5.151  1.00 13.48 ? 115 LYS A O   1 
ATOM   883  C  CB  . LYS A 1 115 ? 56.733 1.632  -2.669  1.00 12.73 ? 115 LYS A CB  1 
ATOM   884  C  CG  . LYS A 1 115 ? 57.161 1.396  -1.197  1.00 14.91 ? 115 LYS A CG  1 
ATOM   885  C  CD  . LYS A 1 115 ? 58.416 0.489  -1.088  1.00 17.08 ? 115 LYS A CD  1 
ATOM   886  C  CE  . LYS A 1 115 ? 58.890 0.583  0.330   1.00 17.53 ? 115 LYS A CE  1 
ATOM   887  N  NZ  . LYS A 1 115 ? 60.122 -0.199 0.432   1.00 20.08 ? 115 LYS A NZ  1 
ATOM   888  N  N   . LEU A 1 116 ? 55.003 4.291  -4.432  1.00 9.43  ? 116 LEU A N   1 
ATOM   889  C  CA  . LEU A 1 116 ? 54.679 4.814  -5.684  1.00 8.79  ? 116 LEU A CA  1 
ATOM   890  C  C   . LEU A 1 116 ? 55.814 5.663  -6.216  1.00 9.60  ? 116 LEU A C   1 
ATOM   891  O  O   . LEU A 1 116 ? 56.542 6.292  -5.392  1.00 11.65 ? 116 LEU A O   1 
ATOM   892  C  CB  . LEU A 1 116 ? 53.381 5.683  -5.562  1.00 10.96 ? 116 LEU A CB  1 
ATOM   893  C  CG  . LEU A 1 116 ? 52.182 4.974  -4.907  1.00 12.80 ? 116 LEU A CG  1 
ATOM   894  C  CD1 . LEU A 1 116 ? 51.065 5.994  -4.699  1.00 14.31 ? 116 LEU A CD1 1 
ATOM   895  C  CD2 . LEU A 1 116 ? 51.749 3.822  -5.749  1.00 16.50 ? 116 LEU A CD2 1 
ATOM   896  N  N   . SER A 1 117 ? 56.018 5.761  -7.512  1.00 8.31  ? 117 SER A N   1 
ATOM   897  C  CA  . SER A 1 117 ? 57.083 6.584  -8.126  1.00 7.32  ? 117 SER A CA  1 
ATOM   898  C  C   . SER A 1 117 ? 56.656 8.042  -8.083  1.00 9.64  ? 117 SER A C   1 
ATOM   899  O  O   . SER A 1 117 ? 55.431 8.392  -7.894  1.00 8.78  ? 117 SER A O   1 
ATOM   900  C  CB  . SER A 1 117 ? 57.245 6.219  -9.569  1.00 10.18 ? 117 SER A CB  1 
ATOM   901  O  OG  . SER A 1 117 ? 56.123 6.527  -10.354 1.00 10.18 ? 117 SER A OG  1 
ATOM   902  N  N   . ASP A 1 118 ? 57.609 8.952  -8.274  1.00 8.81  ? 118 ASP A N   1 
ATOM   903  C  CA  . ASP A 1 118 ? 57.268 10.368 -8.324  1.00 9.40  ? 118 ASP A CA  1 
ATOM   904  C  C   . ASP A 1 118 ? 56.326 10.598 -9.486  1.00 10.50 ? 118 ASP A C   1 
ATOM   905  O  O   . ASP A 1 118 ? 55.382 11.390 -9.309  1.00 10.04 ? 118 ASP A O   1 
ATOM   906  C  CB  . ASP A 1 118 ? 58.518 11.206 -8.571  1.00 11.78 ? 118 ASP A CB  1 
ATOM   907  C  CG  . ASP A 1 118 ? 59.373 11.374 -7.347  1.00 14.69 ? 118 ASP A CG  1 
ATOM   908  O  OD1 . ASP A 1 118 ? 58.977 11.136 -6.232  1.00 15.86 ? 118 ASP A OD1 1 
ATOM   909  O  OD2 . ASP A 1 118 ? 60.491 11.878 -7.601  1.00 18.95 ? 118 ASP A OD2 1 
ATOM   910  N  N   . GLU A 1 119 ? 56.468 9.902  -10.632 1.00 9.37  ? 119 GLU A N   1 
ATOM   911  C  CA  . GLU A 1 119 ? 55.538 10.150 -11.712 1.00 10.13 ? 119 GLU A CA  1 
ATOM   912  C  C   . GLU A 1 119 ? 54.140 9.698  -11.345 1.00 10.02 ? 119 GLU A C   1 
ATOM   913  O  O   . GLU A 1 119 ? 53.192 10.410 -11.716 1.00 10.62 ? 119 GLU A O   1 
ATOM   914  C  CB  . GLU A 1 119 ? 56.087 9.411  -12.956 1.00 12.99 ? 119 GLU A CB  1 
ATOM   915  C  CG  . GLU A 1 119 ? 55.155 9.563  -14.094 1.00 17.21 ? 119 GLU A CG  1 
ATOM   916  C  CD  . GLU A 1 119 ? 55.860 9.738  -15.397 1.00 21.75 ? 119 GLU A CD  1 
ATOM   917  O  OE1 . GLU A 1 119 ? 56.851 8.962  -15.551 1.00 23.02 ? 119 GLU A OE1 1 
ATOM   918  O  OE2 . GLU A 1 119 ? 55.389 10.658 -16.202 1.00 21.02 ? 119 GLU A OE2 1 
ATOM   919  N  N   . GLU A 1 120 ? 54.016 8.538  -10.734 1.00 9.17  ? 120 GLU A N   1 
ATOM   920  C  CA  . GLU A 1 120 ? 52.668 8.089  -10.345 1.00 9.75  ? 120 GLU A CA  1 
ATOM   921  C  C   . GLU A 1 120 ? 52.009 9.052  -9.348  1.00 10.09 ? 120 GLU A C   1 
ATOM   922  O  O   . GLU A 1 120 ? 50.801 9.307  -9.476  1.00 11.23 ? 120 GLU A O   1 
ATOM   923  C  CB  . GLU A 1 120 ? 52.731 6.668  -9.654  1.00 8.83  ? 120 GLU A CB  1 
ATOM   924  C  CG  . GLU A 1 120 ? 53.016 5.593  -10.687 1.00 9.71  ? 120 GLU A CG  1 
ATOM   925  C  CD  . GLU A 1 120 ? 53.436 4.224  -10.117 1.00 11.34 ? 120 GLU A CD  1 
ATOM   926  O  OE1 . GLU A 1 120 ? 54.002 4.163  -9.020  1.00 11.44 ? 120 GLU A OE1 1 
ATOM   927  O  OE2 . GLU A 1 120 ? 53.209 3.248  -10.923 1.00 13.74 ? 120 GLU A OE2 1 
ATOM   928  N  N   . VAL A 1 121 ? 52.771 9.561  -8.389  1.00 8.15  ? 121 VAL A N   1 
ATOM   929  C  CA  . VAL A 1 121 ? 52.127 10.477 -7.420  1.00 8.52  ? 121 VAL A CA  1 
ATOM   930  C  C   . VAL A 1 121 ? 51.750 11.744 -8.178  1.00 10.88 ? 121 VAL A C   1 
ATOM   931  O  O   . VAL A 1 121 ? 50.691 12.306 -7.870  1.00 10.28 ? 121 VAL A O   1 
ATOM   932  C  CB  . VAL A 1 121 ? 53.167 10.753 -6.330  1.00 10.71 ? 121 VAL A CB  1 
ATOM   933  C  CG1 . VAL A 1 121 ? 52.666 11.886 -5.474  1.00 12.03 ? 121 VAL A CG1 1 
ATOM   934  C  CG2 . VAL A 1 121 ? 53.324 9.413  -5.507  1.00 12.17 ? 121 VAL A CG2 1 
ATOM   935  N  N   . ASP A 1 122 ? 52.629 12.238 -9.045  1.00 9.08  ? 122 ASP A N   1 
ATOM   936  C  CA  . ASP A 1 122 ? 52.296 13.491 -9.790  1.00 10.55 ? 122 ASP A CA  1 
ATOM   937  C  C   . ASP A 1 122 ? 51.005 13.259 -10.652 1.00 9.44  ? 122 ASP A C   1 
ATOM   938  O  O   . ASP A 1 122 ? 50.196 14.217 -10.689 1.00 11.20 ? 122 ASP A O   1 
ATOM   939  C  CB  . ASP A 1 122 ? 53.461 13.980 -10.651 1.00 11.54 ? 122 ASP A CB  1 
ATOM   940  C  CG  . ASP A 1 122 ? 54.621 14.480 -9.837  1.00 15.46 ? 122 ASP A CG  1 
ATOM   941  O  OD1 . ASP A 1 122 ? 54.478 14.604 -8.561  1.00 16.56 ? 122 ASP A OD1 1 
ATOM   942  O  OD2 . ASP A 1 122 ? 55.637 14.630 -10.470 1.00 15.22 ? 122 ASP A OD2 1 
ATOM   943  N  N   . GLU A 1 123 ? 50.837 12.089 -11.232 1.00 8.87  ? 123 GLU A N   1 
ATOM   944  C  CA  . GLU A 1 123 ? 49.556 11.797 -11.965 1.00 9.92  ? 123 GLU A CA  1 
ATOM   945  C  C   . GLU A 1 123 ? 48.391 11.869 -10.977 1.00 10.17 ? 123 GLU A C   1 
ATOM   946  O  O   . GLU A 1 123 ? 47.336 12.405 -11.352 1.00 11.38 ? 123 GLU A O   1 
ATOM   947  C  CB  . GLU A 1 123 ? 49.664 10.390 -12.569 1.00 10.19 ? 123 GLU A CB  1 
ATOM   948  C  CG  . GLU A 1 123 ? 50.684 10.384 -13.711 1.00 11.19 ? 123 GLU A CG  1 
ATOM   949  C  CD  . GLU A 1 123 ? 50.980 9.048  -14.218 1.00 14.98 ? 123 GLU A CD  1 
ATOM   950  O  OE1 . GLU A 1 123 ? 51.675 8.986  -15.311 1.00 16.04 ? 123 GLU A OE1 1 
ATOM   951  O  OE2 . GLU A 1 123 ? 50.537 8.021  -13.638 1.00 17.44 ? 123 GLU A OE2 1 
ATOM   952  N  N   . MET A 1 124 ? 48.544 11.336 -9.740  1.00 9.41  ? 124 MET A N   1 
ATOM   953  C  CA  . MET A 1 124 ? 47.439 11.378 -8.784  1.00 10.45 ? 124 MET A CA  1 
ATOM   954  C  C   . MET A 1 124 ? 47.105 12.885 -8.479  1.00 10.61 ? 124 MET A C   1 
ATOM   955  O  O   . MET A 1 124 ? 45.918 13.241 -8.330  1.00 11.17 ? 124 MET A O   1 
ATOM   956  C  CB  . MET A 1 124 ? 47.872 10.622 -7.538  1.00 10.61 ? 124 MET A CB  1 
ATOM   957  C  CG  . MET A 1 124 ? 47.889 9.163  -7.786  1.00 11.91 ? 124 MET A CG  1 
ATOM   958  S  SD  . MET A 1 124 ? 48.658 8.275  -6.385  1.00 16.90 ? 124 MET A SD  1 
ATOM   959  C  CE  . MET A 1 124 ? 47.480 8.279  -5.222  1.00 19.47 ? 124 MET A CE  1 
ATOM   960  N  N   . ILE A 1 125 ? 48.135 13.697 -8.229  1.00 10.05 ? 125 ILE A N   1 
ATOM   961  C  CA  . ILE A 1 125 ? 47.968 15.107 -7.940  1.00 9.81  ? 125 ILE A CA  1 
ATOM   962  C  C   . ILE A 1 125 ? 47.206 15.730 -9.171  1.00 11.19 ? 125 ILE A C   1 
ATOM   963  O  O   . ILE A 1 125 ? 46.203 16.427 -8.940  1.00 11.75 ? 125 ILE A O   1 
ATOM   964  C  CB  . ILE A 1 125 ? 49.281 15.827 -7.712  1.00 10.54 ? 125 ILE A CB  1 
ATOM   965  C  CG1 . ILE A 1 125 ? 49.958 15.358 -6.434  1.00 12.00 ? 125 ILE A CG1 1 
ATOM   966  C  CG2 . ILE A 1 125 ? 49.056 17.344 -7.615  1.00 11.82 ? 125 ILE A CG2 1 
ATOM   967  C  CD1 . ILE A 1 125 ? 49.231 15.688 -5.073  1.00 11.98 ? 125 ILE A CD1 1 
ATOM   968  N  N   . ARG A 1 126 ? 47.692 15.497 -10.386 1.00 11.32 ? 126 ARG A N   1 
ATOM   969  C  CA  . ARG A 1 126 ? 46.991 16.220 -11.471 1.00 11.50 ? 126 ARG A CA  1 
ATOM   970  C  C   . ARG A 1 126 ? 45.573 15.733 -11.601 1.00 12.27 ? 126 ARG A C   1 
ATOM   971  O  O   . ARG A 1 126 ? 44.732 16.604 -11.956 1.00 16.22 ? 126 ARG A O   1 
ATOM   972  C  CB  . ARG A 1 126 ? 47.728 15.994 -12.772 1.00 13.61 ? 126 ARG A CB  1 
ATOM   973  C  CG  . ARG A 1 126 ? 49.094 16.671 -12.740 1.00 14.40 ? 126 ARG A CG  1 
ATOM   974  C  CD  . ARG A 1 126 ? 49.675 16.885 -14.130 1.00 15.00 ? 126 ARG A CD  1 
ATOM   975  N  NE  . ARG A 1 126 ? 49.828 15.590 -14.885 1.00 13.96 ? 126 ARG A NE  1 
ATOM   976  C  CZ  . ARG A 1 126 ? 50.814 14.714 -14.746 1.00 13.12 ? 126 ARG A CZ  1 
ATOM   977  N  NH1 . ARG A 1 126 ? 51.795 14.973 -13.818 1.00 14.83 ? 126 ARG A NH1 1 
ATOM   978  N  NH2 . ARG A 1 126 ? 50.886 13.620 -15.555 1.00 12.84 ? 126 ARG A NH2 1 
ATOM   979  N  N   . ALA A 1 127 ? 45.279 14.486 -11.419 1.00 11.74 ? 127 ALA A N   1 
ATOM   980  C  CA  . ALA A 1 127 ? 43.855 13.982 -11.521 1.00 12.27 ? 127 ALA A CA  1 
ATOM   981  C  C   . ALA A 1 127 ? 42.993 14.653 -10.484 1.00 14.68 ? 127 ALA A C   1 
ATOM   982  O  O   . ALA A 1 127 ? 41.842 14.925 -10.781 1.00 16.45 ? 127 ALA A O   1 
ATOM   983  C  CB  . ALA A 1 127 ? 43.828 12.541 -11.332 1.00 14.02 ? 127 ALA A CB  1 
ATOM   984  N  N   . ALA A 1 128 ? 43.521 14.932 -9.254  1.00 11.93 ? 128 ALA A N   1 
ATOM   985  C  CA  . ALA A 1 128 ? 42.617 15.464 -8.230  1.00 12.06 ? 128 ALA A CA  1 
ATOM   986  C  C   . ALA A 1 128 ? 42.666 16.955 -8.171  1.00 10.85 ? 128 ALA A C   1 
ATOM   987  O  O   . ALA A 1 128 ? 41.792 17.607 -7.536  1.00 13.36 ? 128 ALA A O   1 
ATOM   988  C  CB  . ALA A 1 128 ? 43.096 14.937 -6.826  1.00 12.50 ? 128 ALA A CB  1 
ATOM   989  N  N   . ASP A 1 129 ? 43.660 17.592 -8.768  1.00 12.34 ? 129 ASP A N   1 
ATOM   990  C  CA  . ASP A 1 129 ? 43.886 19.042 -8.633  1.00 11.33 ? 129 ASP A CA  1 
ATOM   991  C  C   . ASP A 1 129 ? 43.008 19.924 -9.582  1.00 15.67 ? 129 ASP A C   1 
ATOM   992  O  O   . ASP A 1 129 ? 43.510 20.421 -10.590 1.00 17.77 ? 129 ASP A O   1 
ATOM   993  C  CB  . ASP A 1 129 ? 45.399 19.376 -8.918  1.00 12.80 ? 129 ASP A CB  1 
ATOM   994  C  CG  . ASP A 1 129 ? 45.683 20.811 -8.854  1.00 13.99 ? 129 ASP A CG  1 
ATOM   995  O  OD1 . ASP A 1 129 ? 44.934 21.591 -8.228  1.00 14.37 ? 129 ASP A OD1 1 
ATOM   996  O  OD2 . ASP A 1 129 ? 46.647 21.303 -9.478  1.00 14.73 ? 129 ASP A OD2 1 
ATOM   997  N  N   . THR A 1 130 ? 41.779 20.142 -9.185  1.00 11.71 ? 130 THR A N   1 
ATOM   998  C  CA  . THR A 1 130 ? 40.824 20.761 -10.137 1.00 11.78 ? 130 THR A CA  1 
ATOM   999  C  C   . THR A 1 130 ? 40.954 22.263 -10.207 1.00 12.69 ? 130 THR A C   1 
ATOM   1000 O  O   . THR A 1 130 ? 40.252 22.845 -11.000 1.00 12.97 ? 130 THR A O   1 
ATOM   1001 C  CB  . THR A 1 130 ? 39.376 20.213 -9.757  1.00 12.83 ? 130 THR A CB  1 
ATOM   1002 O  OG1 . THR A 1 130 ? 39.193 20.129 -8.320  1.00 12.85 ? 130 THR A OG1 1 
ATOM   1003 C  CG2 . THR A 1 130 ? 39.154 18.753 -10.214 1.00 12.37 ? 130 THR A CG2 1 
ATOM   1004 N  N   . ASP A 1 131 ? 41.807 22.903 -9.428  1.00 12.66 ? 131 ASP A N   1 
ATOM   1005 C  CA  . ASP A 1 131 ? 41.990 24.376 -9.562  1.00 13.61 ? 131 ASP A CA  1 
ATOM   1006 C  C   . ASP A 1 131 ? 43.359 24.756 -10.117 1.00 14.12 ? 131 ASP A C   1 
ATOM   1007 O  O   . ASP A 1 131 ? 43.663 25.942 -10.106 1.00 16.87 ? 131 ASP A O   1 
ATOM   1008 C  CB  . ASP A 1 131 ? 41.662 25.172 -8.279  1.00 14.55 ? 131 ASP A CB  1 
ATOM   1009 C  CG  . ASP A 1 131 ? 42.548 24.797 -7.069  1.00 14.29 ? 131 ASP A CG  1 
ATOM   1010 O  OD1 . ASP A 1 131 ? 43.557 24.115 -7.290  1.00 12.98 ? 131 ASP A OD1 1 
ATOM   1011 O  OD2 . ASP A 1 131 ? 42.196 25.280 -5.988  1.00 18.00 ? 131 ASP A OD2 1 
ATOM   1012 N  N   . GLY A 1 132 ? 44.181 23.751 -10.408 1.00 16.89 ? 132 GLY A N   1 
ATOM   1013 C  CA  . GLY A 1 132 ? 45.463 23.989 -11.086 1.00 17.72 ? 132 GLY A CA  1 
ATOM   1014 C  C   . GLY A 1 132 ? 46.566 24.565 -10.264 1.00 20.31 ? 132 GLY A C   1 
ATOM   1015 O  O   . GLY A 1 132 ? 47.572 25.103 -10.852 1.00 23.02 ? 132 GLY A O   1 
ATOM   1016 N  N   . ASP A 1 133 ? 46.452 24.514 -8.929  1.00 19.54 ? 133 ASP A N   1 
ATOM   1017 C  CA  . ASP A 1 133 ? 47.540 25.095 -8.101  1.00 18.38 ? 133 ASP A CA  1 
ATOM   1018 C  C   . ASP A 1 133 ? 48.690 24.115 -7.782  1.00 17.84 ? 133 ASP A C   1 
ATOM   1019 O  O   . ASP A 1 133 ? 49.666 24.562 -7.118  1.00 20.57 ? 133 ASP A O   1 
ATOM   1020 C  CB  . ASP A 1 133 ? 46.988 25.777 -6.870  1.00 19.84 ? 133 ASP A CB  1 
ATOM   1021 C  CG  . ASP A 1 133 ? 46.458 24.791 -5.808  1.00 16.61 ? 133 ASP A CG  1 
ATOM   1022 O  OD1 . ASP A 1 133 ? 46.360 23.576 -6.205  1.00 16.45 ? 133 ASP A OD1 1 
ATOM   1023 O  OD2 . ASP A 1 133 ? 46.160 25.361 -4.753  1.00 19.77 ? 133 ASP A OD2 1 
ATOM   1024 N  N   . GLY A 1 134 ? 48.560 22.897 -8.285  1.00 15.31 ? 134 GLY A N   1 
ATOM   1025 C  CA  . GLY A 1 134 ? 49.560 21.859 -8.137  1.00 15.90 ? 134 GLY A CA  1 
ATOM   1026 C  C   . GLY A 1 134 ? 49.494 21.138 -6.794  1.00 14.40 ? 134 GLY A C   1 
ATOM   1027 O  O   . GLY A 1 134 ? 50.400 20.346 -6.473  1.00 15.24 ? 134 GLY A O   1 
ATOM   1028 N  N   . GLN A 1 135 ? 48.515 21.473 -5.986  1.00 14.23 ? 135 GLN A N   1 
ATOM   1029 C  CA  . GLN A 1 135 ? 48.341 20.772 -4.669  1.00 13.69 ? 135 GLN A CA  1 
ATOM   1030 C  C   . GLN A 1 135 ? 46.910 20.324 -4.530  1.00 12.85 ? 135 GLN A C   1 
ATOM   1031 O  O   . GLN A 1 135 ? 45.983 20.800 -5.249  1.00 14.33 ? 135 GLN A O   1 
ATOM   1032 C  CB  . GLN A 1 135 ? 48.768 21.663 -3.491  1.00 16.28 ? 135 GLN A CB  1 
ATOM   1033 C  CG  . GLN A 1 135 ? 50.202 22.092 -3.654  1.00 23.23 ? 135 GLN A CG  1 
ATOM   1034 C  CD  . GLN A 1 135 ? 50.940 22.357 -2.368  1.00 22.11 ? 135 GLN A CD  1 
ATOM   1035 O  OE1 . GLN A 1 135 ? 50.791 21.710 -1.350  1.00 24.65 ? 135 GLN A OE1 1 
ATOM   1036 N  NE2 . GLN A 1 135 ? 51.780 23.395 -2.407  1.00 28.96 ? 135 GLN A NE2 1 
ATOM   1037 N  N   . VAL A 1 136 ? 46.689 19.397 -3.593  1.00 10.83 ? 136 VAL A N   1 
ATOM   1038 C  CA  . VAL A 1 136 ? 45.314 18.911 -3.400  1.00 9.91  ? 136 VAL A CA  1 
ATOM   1039 C  C   . VAL A 1 136 ? 44.756 19.549 -2.110  1.00 9.78  ? 136 VAL A C   1 
ATOM   1040 O  O   . VAL A 1 136 ? 45.314 19.351 -1.003  1.00 11.46 ? 136 VAL A O   1 
ATOM   1041 C  CB  . VAL A 1 136 ? 45.277 17.392 -3.271  1.00 8.93  ? 136 VAL A CB  1 
ATOM   1042 C  CG1 . VAL A 1 136 ? 43.919 16.810 -2.962  1.00 10.38 ? 136 VAL A CG1 1 
ATOM   1043 C  CG2 . VAL A 1 136 ? 45.852 16.770 -4.657  1.00 12.90 ? 136 VAL A CG2 1 
ATOM   1044 N  N   . ASN A 1 137 ? 43.697 20.345 -2.263  1.00 9.81  ? 137 ASN A N   1 
ATOM   1045 C  CA  . ASN A 1 137 ? 43.069 20.963 -1.111  1.00 10.05 ? 137 ASN A CA  1 
ATOM   1046 C  C   . ASN A 1 137 ? 41.987 20.033 -0.531  1.00 9.12  ? 137 ASN A C   1 
ATOM   1047 O  O   . ASN A 1 137 ? 41.710 18.908 -1.037  1.00 8.98  ? 137 ASN A O   1 
ATOM   1048 C  CB  . ASN A 1 137 ? 42.591 22.404 -1.501  1.00 8.49  ? 137 ASN A CB  1 
ATOM   1049 C  CG  . ASN A 1 137 ? 41.335 22.429 -2.379  1.00 11.85 ? 137 ASN A CG  1 
ATOM   1050 O  OD1 . ASN A 1 137 ? 41.193 23.474 -3.197  1.00 15.49 ? 137 ASN A OD1 1 
ATOM   1051 N  ND2 . ASN A 1 137 ? 40.449 21.517 -2.298  1.00 7.59  ? 137 ASN A ND2 1 
ATOM   1052 N  N   . TYR A 1 138 ? 41.410 20.417 0.574   1.00 10.01 ? 138 TYR A N   1 
ATOM   1053 C  CA  . TYR A 1 138 ? 40.479 19.515 1.267   1.00 9.46  ? 138 TYR A CA  1 
ATOM   1054 C  C   . TYR A 1 138 ? 39.254 19.113 0.435   1.00 11.63 ? 138 TYR A C   1 
ATOM   1055 O  O   . TYR A 1 138 ? 38.948 17.955 0.290   1.00 11.67 ? 138 TYR A O   1 
ATOM   1056 C  CB  . TYR A 1 138 ? 40.071 20.209 2.571   1.00 9.24  ? 138 TYR A CB  1 
ATOM   1057 C  CG  . TYR A 1 138 ? 38.959 19.514 3.293   1.00 12.10 ? 138 TYR A CG  1 
ATOM   1058 C  CD1 . TYR A 1 138 ? 39.107 18.107 3.678   1.00 12.71 ? 138 TYR A CD1 1 
ATOM   1059 C  CD2 . TYR A 1 138 ? 37.746 20.177 3.536   1.00 12.77 ? 138 TYR A CD2 1 
ATOM   1060 C  CE1 . TYR A 1 138 ? 38.043 17.447 4.308   1.00 13.76 ? 138 TYR A CE1 1 
ATOM   1061 C  CE2 . TYR A 1 138 ? 36.692 19.469 4.209   1.00 15.61 ? 138 TYR A CE2 1 
ATOM   1062 C  CZ  . TYR A 1 138 ? 36.894 18.113 4.583   1.00 16.07 ? 138 TYR A CZ  1 
ATOM   1063 O  OH  . TYR A 1 138 ? 35.824 17.515 5.275   1.00 21.38 ? 138 TYR A OH  1 
ATOM   1064 N  N   . GLU A 1 139 ? 38.630 20.094 -0.185  1.00 9.66  ? 139 GLU A N   1 
ATOM   1065 C  CA  . GLU A 1 139 ? 37.455 19.731 -0.973  1.00 10.69 ? 139 GLU A CA  1 
ATOM   1066 C  C   . GLU A 1 139 ? 37.839 18.833 -2.210  1.00 11.35 ? 139 GLU A C   1 
ATOM   1067 O  O   . GLU A 1 139 ? 37.129 17.879 -2.546  1.00 12.20 ? 139 GLU A O   1 
ATOM   1068 C  CB  . GLU A 1 139 ? 36.575 20.913 -1.363  1.00 11.53 ? 139 GLU A CB  1 
ATOM   1069 C  CG  . GLU A 1 139 ? 37.174 21.876 -2.446  1.00 11.73 ? 139 GLU A CG  1 
ATOM   1070 C  CD  . GLU A 1 139 ? 36.919 21.353 -3.863  1.00 13.13 ? 139 GLU A CD  1 
ATOM   1071 O  OE1 . GLU A 1 139 ? 36.215 20.378 -4.074  1.00 13.76 ? 139 GLU A OE1 1 
ATOM   1072 O  OE2 . GLU A 1 139 ? 37.523 21.874 -4.816  1.00 12.18 ? 139 GLU A OE2 1 
ATOM   1073 N  N   . GLU A 1 140 ? 39.017 19.073 -2.786  1.00 9.50  ? 140 GLU A N   1 
ATOM   1074 C  CA  . GLU A 1 140 ? 39.538 18.261 -3.925  1.00 11.60 ? 140 GLU A CA  1 
ATOM   1075 C  C   . GLU A 1 140 ? 39.758 16.823 -3.417  1.00 12.10 ? 140 GLU A C   1 
ATOM   1076 O  O   . GLU A 1 140 ? 39.426 15.834 -4.139  1.00 11.91 ? 140 GLU A O   1 
ATOM   1077 C  CB  . GLU A 1 140 ? 40.865 18.826 -4.411  1.00 9.59  ? 140 GLU A CB  1 
ATOM   1078 C  CG  . GLU A 1 140 ? 40.610 20.092 -5.273  1.00 9.55  ? 140 GLU A CG  1 
ATOM   1079 C  CD  . GLU A 1 140 ? 41.905 20.809 -5.556  1.00 10.94 ? 140 GLU A CD  1 
ATOM   1080 O  OE1 . GLU A 1 140 ? 42.974 20.583 -4.919  1.00 10.93 ? 140 GLU A OE1 1 
ATOM   1081 O  OE2 . GLU A 1 140 ? 41.891 21.671 -6.474  1.00 11.39 ? 140 GLU A OE2 1 
ATOM   1082 N  N   . PHE A 1 141 ? 40.278 16.680 -2.196  1.00 10.73 ? 141 PHE A N   1 
ATOM   1083 C  CA  . PHE A 1 141 ? 40.495 15.373 -1.614  1.00 10.64 ? 141 PHE A CA  1 
ATOM   1084 C  C   . PHE A 1 141 ? 39.152 14.719 -1.369  1.00 10.67 ? 141 PHE A C   1 
ATOM   1085 O  O   . PHE A 1 141 ? 39.021 13.484 -1.690  1.00 12.84 ? 141 PHE A O   1 
ATOM   1086 C  CB  . PHE A 1 141 ? 41.233 15.640 -0.247  1.00 12.23 ? 141 PHE A CB  1 
ATOM   1087 C  CG  . PHE A 1 141 ? 41.616 14.343 0.498   1.00 11.65 ? 141 PHE A CG  1 
ATOM   1088 C  CD1 . PHE A 1 141 ? 42.788 13.667 0.177   1.00 13.69 ? 141 PHE A CD1 1 
ATOM   1089 C  CD2 . PHE A 1 141 ? 40.882 13.935 1.549   1.00 11.11 ? 141 PHE A CD2 1 
ATOM   1090 C  CE1 . PHE A 1 141 ? 43.238 12.582 0.928   1.00 13.27 ? 141 PHE A CE1 1 
ATOM   1091 C  CE2 . PHE A 1 141 ? 41.307 12.814 2.366   1.00 12.27 ? 141 PHE A CE2 1 
ATOM   1092 C  CZ  . PHE A 1 141 ? 42.461 12.185 2.027   1.00 12.01 ? 141 PHE A CZ  1 
ATOM   1093 N  N   . VAL A 1 142 ? 38.198 15.428 -0.824  1.00 11.78 ? 142 VAL A N   1 
ATOM   1094 C  CA  . VAL A 1 142 ? 36.898 14.811 -0.599  1.00 14.12 ? 142 VAL A CA  1 
ATOM   1095 C  C   . VAL A 1 142 ? 36.306 14.289 -1.927  1.00 15.93 ? 142 VAL A C   1 
ATOM   1096 O  O   . VAL A 1 142 ? 35.698 13.204 -2.020  1.00 16.31 ? 142 VAL A O   1 
ATOM   1097 C  CB  . VAL A 1 142 ? 35.998 15.776 0.112   1.00 14.41 ? 142 VAL A CB  1 
ATOM   1098 C  CG1 . VAL A 1 142 ? 34.413 15.250 0.171   1.00 16.29 ? 142 VAL A CG1 1 
ATOM   1099 C  CG2 . VAL A 1 142 ? 36.532 16.033 1.547   1.00 15.33 ? 142 VAL A CG2 1 
ATOM   1100 N  N   . ARG A 1 143 ? 36.460 15.077 -2.994  1.00 13.89 ? 143 ARG A N   1 
ATOM   1101 C  CA  . ARG A 1 143 ? 35.874 14.617 -4.291  1.00 15.38 ? 143 ARG A CA  1 
ATOM   1102 C  C   . ARG A 1 143 ? 36.350 13.272 -4.685  1.00 17.89 ? 143 ARG A C   1 
ATOM   1103 O  O   . ARG A 1 143 ? 35.519 12.448 -5.195  1.00 19.27 ? 143 ARG A O   1 
ATOM   1104 C  CB  . ARG A 1 143 ? 36.218 15.541 -5.457  1.00 15.53 ? 143 ARG A CB  1 
ATOM   1105 C  CG  . ARG A 1 143 ? 35.688 16.881 -5.396  1.00 14.47 ? 143 ARG A CG  1 
ATOM   1106 C  CD  . ARG A 1 143 ? 35.824 17.597 -6.805  1.00 19.66 ? 143 ARG A CD  1 
ATOM   1107 N  NE  . ARG A 1 143 ? 35.930 19.055 -6.614  1.00 17.36 ? 143 ARG A NE  1 
ATOM   1108 C  CZ  . ARG A 1 143 ? 35.924 19.937 -7.636  1.00 18.27 ? 143 ARG A CZ  1 
ATOM   1109 N  NH1 . ARG A 1 143 ? 35.744 19.547 -8.949  1.00 15.32 ? 143 ARG A NH1 1 
ATOM   1110 N  NH2 . ARG A 1 143 ? 36.229 21.206 -7.388  1.00 13.64 ? 143 ARG A NH2 1 
ATOM   1111 N  N   . VAL A 1 144 ? 37.633 13.020 -4.542  1.00 16.10 ? 144 VAL A N   1 
ATOM   1112 C  CA  . VAL A 1 144 ? 38.148 11.690 -4.872  1.00 21.90 ? 144 VAL A CA  1 
ATOM   1113 C  C   . VAL A 1 144 ? 37.660 10.629 -3.974  1.00 24.35 ? 144 VAL A C   1 
ATOM   1114 O  O   . VAL A 1 144 ? 37.311 9.517  -4.495  1.00 25.35 ? 144 VAL A O   1 
ATOM   1115 C  CB  . VAL A 1 144 ? 39.686 11.684 -4.830  1.00 26.06 ? 144 VAL A CB  1 
ATOM   1116 C  CG1 . VAL A 1 144 ? 40.279 10.337 -5.194  1.00 28.51 ? 144 VAL A CG1 1 
ATOM   1117 C  CG2 . VAL A 1 144 ? 40.150 12.672 -5.811  1.00 29.03 ? 144 VAL A CG2 1 
ATOM   1118 N  N   . LEU A 1 145 ? 37.661 10.870 -2.679  1.00 24.27 ? 145 LEU A N   1 
ATOM   1119 C  CA  . LEU A 1 145 ? 37.245 9.844  -1.666  1.00 30.03 ? 145 LEU A CA  1 
ATOM   1120 C  C   . LEU A 1 145 ? 35.776 9.529  -1.610  1.00 34.09 ? 145 LEU A C   1 
ATOM   1121 O  O   . LEU A 1 145 ? 35.300 8.676  -0.763  1.00 34.63 ? 145 LEU A O   1 
ATOM   1122 C  CB  . LEU A 1 145 ? 37.654 10.262 -0.271  1.00 39.49 ? 145 LEU A CB  1 
ATOM   1123 C  CG  . LEU A 1 145 ? 37.837 9.145  0.794   1.00 43.39 ? 145 LEU A CG  1 
ATOM   1124 C  CD1 . LEU A 1 145 ? 38.737 7.987  0.225   1.00 43.72 ? 145 LEU A CD1 1 
ATOM   1125 C  CD2 . LEU A 1 145 ? 38.519 9.767  2.043   1.00 45.24 ? 145 LEU A CD2 1 
ATOM   1126 N  N   . VAL A 1 146 ? 35.022 10.254 -2.435  1.00 42.16 ? 146 VAL A N   1 
ATOM   1127 C  CA  . VAL A 1 146 ? 33.592 10.054 -2.480  1.00 45.12 ? 146 VAL A CA  1 
ATOM   1128 C  C   . VAL A 1 146 ? 33.255 9.428  -3.809  1.00 45.59 ? 146 VAL A C   1 
ATOM   1129 O  O   . VAL A 1 146 ? 32.282 8.718  -3.897  1.00 46.82 ? 146 VAL A O   1 
ATOM   1130 C  CB  . VAL A 1 146 ? 32.815 11.415 -2.183  1.00 46.70 ? 146 VAL A CB  1 
ATOM   1131 C  CG1 . VAL A 1 146 ? 31.336 11.315 -2.626  1.00 48.75 ? 146 VAL A CG1 1 
ATOM   1132 C  CG2 . VAL A 1 146 ? 32.893 11.702 -0.644  1.00 47.08 ? 146 VAL A CG2 1 
ATOM   1133 N  N   . SER A 1 147 ? 34.059 9.635  -4.833  1.00 44.15 ? 147 SER A N   1 
ATOM   1134 C  CA  . SER A 1 147 ? 33.740 9.020  -6.123  1.00 45.04 ? 147 SER A CA  1 
ATOM   1135 C  C   . SER A 1 147 ? 33.703 7.472  -6.045  1.00 45.43 ? 147 SER A C   1 
ATOM   1136 O  O   . SER A 1 147 ? 34.621 6.815  -5.496  1.00 45.31 ? 147 SER A O   1 
ATOM   1137 C  CB  . SER A 1 147 ? 34.740 9.465  -7.188  1.00 46.49 ? 147 SER A CB  1 
ATOM   1138 O  OG  . SER A 1 147 ? 36.063 9.200  -6.753  1.00 45.95 ? 147 SER A OG  1 
HETATM 1139 CA CA  . CA  B 2 .   ? 2.538  6.635  19.649  1.00 8.45  ? 149 CA  A CA  1 
HETATM 1140 CA CA  . CA  C 2 .   ? 7.201  1.669  10.231  1.00 10.56 ? 150 CA  A CA  1 
HETATM 1141 CA CA  . CA  D 2 .   ? 50.837 20.494 3.247   1.00 9.74  ? 151 CA  A CA  1 
HETATM 1142 CA CA  . CA  E 2 .   ? 44.372 22.305 -6.059  1.00 11.58 ? 152 CA  A CA  1 
HETATM 1143 O  O   . HOH F 3 .   ? 0.387  6.795  18.544  1.00 11.17 ? 153 HOH A O   1 
HETATM 1144 O  O   . HOH F 3 .   ? 7.231  0.277  12.127  1.00 18.33 ? 154 HOH A O   1 
HETATM 1145 O  O   . HOH F 3 .   ? 52.357 21.391 1.664   1.00 19.16 ? 155 HOH A O   1 
HETATM 1146 O  O   . HOH F 3 .   ? 43.978 23.945 -4.230  1.00 16.51 ? 156 HOH A O   1 
HETATM 1147 O  O   . HOH F 3 .   ? 24.927 6.191  7.128   1.00 43.09 ? 157 HOH A O   1 
HETATM 1148 O  O   . HOH F 3 .   ? 34.874 7.432  5.539   1.00 44.05 ? 158 HOH A O   1 
HETATM 1149 O  O   . HOH F 3 .   ? 6.751  -4.723 8.340   1.00 24.74 ? 159 HOH A O   1 
HETATM 1150 O  O   . HOH F 3 .   ? -2.927 5.390  16.441  1.00 18.09 ? 160 HOH A O   1 
HETATM 1151 O  O   . HOH F 3 .   ? -0.505 10.189 20.833  1.00 13.89 ? 161 HOH A O   1 
HETATM 1152 O  O   . HOH F 3 .   ? 8.779  0.467  19.210  1.00 9.11  ? 162 HOH A O   1 
HETATM 1153 O  O   . HOH F 3 .   ? -0.721 9.243  17.664  1.00 12.35 ? 163 HOH A O   1 
HETATM 1154 O  O   . HOH F 3 .   ? 39.474 22.662 -7.393  1.00 12.17 ? 164 HOH A O   1 
HETATM 1155 O  O   . HOH F 3 .   ? 2.669  22.320 12.652  1.00 13.34 ? 165 HOH A O   1 
HETATM 1156 O  O   . HOH F 3 .   ? 6.938  23.772 24.392  1.00 12.13 ? 166 HOH A O   1 
HETATM 1157 O  O   . HOH F 3 .   ? 1.526  8.274  11.162  1.00 15.33 ? 167 HOH A O   1 
HETATM 1158 O  O   . HOH F 3 .   ? 53.722 -0.786 -2.977  1.00 11.57 ? 168 HOH A O   1 
HETATM 1159 O  O   . HOH F 3 .   ? 42.371 22.911 1.608   1.00 13.21 ? 169 HOH A O   1 
HETATM 1160 O  O   . HOH F 3 .   ? 54.594 6.029  -2.103  1.00 12.10 ? 170 HOH A O   1 
HETATM 1161 O  O   . HOH F 3 .   ? 14.577 4.047  9.748   1.00 13.67 ? 171 HOH A O   1 
HETATM 1162 O  O   . HOH F 3 .   ? 0.511  13.988 19.878  1.00 14.55 ? 172 HOH A O   1 
HETATM 1163 O  O   . HOH F 3 .   ? 59.475 9.099  -11.266 1.00 13.52 ? 173 HOH A O   1 
HETATM 1164 O  O   . HOH F 3 .   ? -2.973 8.096  16.256  1.00 13.62 ? 174 HOH A O   1 
HETATM 1165 O  O   . HOH F 3 .   ? 55.912 18.470 -3.664  1.00 15.32 ? 175 HOH A O   1 
HETATM 1166 O  O   . HOH F 3 .   ? 5.051  26.058 17.488  1.00 14.08 ? 176 HOH A O   1 
HETATM 1167 O  O   . HOH F 3 .   ? 6.826  21.946 1.541   1.00 16.49 ? 177 HOH A O   1 
HETATM 1168 O  O   . HOH F 3 .   ? 2.845  20.762 20.711  1.00 16.18 ? 178 HOH A O   1 
HETATM 1169 O  O   . HOH F 3 .   ? 0.154  17.416 13.171  1.00 16.27 ? 179 HOH A O   1 
HETATM 1170 O  O   . HOH F 3 .   ? -0.319 4.652  16.888  1.00 13.55 ? 180 HOH A O   1 
HETATM 1171 O  O   . HOH F 3 .   ? 43.996 11.472 -7.495  1.00 19.21 ? 181 HOH A O   1 
HETATM 1172 O  O   . HOH F 3 .   ? -0.165 20.003 4.098   1.00 18.41 ? 182 HOH A O   1 
HETATM 1173 O  O   . HOH F 3 .   ? 34.281 18.067 -2.279  1.00 21.11 ? 183 HOH A O   1 
HETATM 1174 O  O   . HOH F 3 .   ? -0.129 14.370 22.557  1.00 19.53 ? 184 HOH A O   1 
HETATM 1175 O  O   . HOH F 3 .   ? 5.171  0.924  13.839  1.00 18.60 ? 185 HOH A O   1 
HETATM 1176 O  O   . HOH F 3 .   ? 56.560 15.140 -7.240  1.00 17.27 ? 186 HOH A O   1 
HETATM 1177 O  O   . HOH F 3 .   ? 52.769 11.275 -16.362 1.00 16.49 ? 187 HOH A O   1 
HETATM 1178 O  O   . HOH F 3 .   ? 45.073 20.607 7.257   1.00 28.71 ? 188 HOH A O   1 
HETATM 1179 O  O   . HOH F 3 .   ? 39.496 16.328 -6.919  1.00 16.44 ? 189 HOH A O   1 
HETATM 1180 O  O   . HOH F 3 .   ? 62.116 12.244 -5.662  1.00 19.51 ? 190 HOH A O   1 
HETATM 1181 O  O   . HOH F 3 .   ? -0.365 3.066  14.553  1.00 25.13 ? 191 HOH A O   1 
HETATM 1182 O  O   . HOH F 3 .   ? -1.071 11.722 23.211  1.00 18.73 ? 192 HOH A O   1 
HETATM 1183 O  O   . HOH F 3 .   ? 57.993 12.286 -0.240  1.00 19.05 ? 193 HOH A O   1 
HETATM 1184 O  O   . HOH F 3 .   ? 3.588  21.748 2.505   1.00 23.65 ? 194 HOH A O   1 
HETATM 1185 O  O   . HOH F 3 .   ? 5.769  3.138  26.409  1.00 23.51 ? 195 HOH A O   1 
HETATM 1186 O  O   . HOH F 3 .   ? -1.047 21.451 6.735   1.00 22.65 ? 196 HOH A O   1 
HETATM 1187 O  O   . HOH F 3 .   ? 53.346 13.287 4.081   1.00 17.81 ? 197 HOH A O   1 
HETATM 1188 O  O   . HOH F 3 .   ? 2.113  -2.571 10.873  1.00 20.96 ? 198 HOH A O   1 
HETATM 1189 O  O   . HOH F 3 .   ? 44.186 10.758 -4.817  1.00 25.27 ? 199 HOH A O   1 
HETATM 1190 O  O   . HOH F 3 .   ? 52.675 19.511 -5.188  1.00 19.96 ? 200 HOH A O   1 
HETATM 1191 O  O   . HOH F 3 .   ? 55.883 1.376  2.296   1.00 19.71 ? 201 HOH A O   1 
HETATM 1192 O  O   . HOH F 3 .   ? 7.549  4.537  24.002  1.00 18.74 ? 202 HOH A O   1 
HETATM 1193 O  O   . HOH F 3 .   ? 12.519 5.776  2.886   1.00 23.74 ? 203 HOH A O   1 
HETATM 1194 O  O   . HOH F 3 .   ? 33.368 20.089 -3.970  1.00 31.13 ? 204 HOH A O   1 
HETATM 1195 O  O   . HOH F 3 .   ? 32.689 16.066 -2.834  1.00 27.08 ? 205 HOH A O   1 
HETATM 1196 O  O   . HOH F 3 .   ? 0.303  1.303  10.678  1.00 19.77 ? 206 HOH A O   1 
HETATM 1197 O  O   . HOH F 3 .   ? 52.417 17.184 -12.016 1.00 20.70 ? 207 HOH A O   1 
HETATM 1198 O  O   . HOH F 3 .   ? 35.635 17.311 14.057  1.00 27.60 ? 208 HOH A O   1 
HETATM 1199 O  O   . HOH F 3 .   ? 53.702 12.772 -13.830 1.00 23.15 ? 209 HOH A O   1 
HETATM 1200 O  O   . HOH F 3 .   ? 34.935 14.984 5.031   1.00 20.52 ? 210 HOH A O   1 
HETATM 1201 O  O   . HOH F 3 .   ? 3.572  14.647 1.719   1.00 22.47 ? 211 HOH A O   1 
HETATM 1202 O  O   . HOH F 3 .   ? 4.223  23.650 23.589  1.00 24.87 ? 212 HOH A O   1 
HETATM 1203 O  O   . HOH F 3 .   ? 0.507  20.877 19.201  1.00 21.03 ? 213 HOH A O   1 
HETATM 1204 O  O   . HOH F 3 .   ? 6.422  7.690  25.733  1.00 24.66 ? 214 HOH A O   1 
HETATM 1205 O  O   . HOH F 3 .   ? 59.487 11.790 -2.448  1.00 19.98 ? 215 HOH A O   1 
HETATM 1206 O  O   . HOH F 3 .   ? -0.738 18.573 18.946  1.00 24.08 ? 216 HOH A O   1 
HETATM 1207 O  O   . HOH F 3 .   ? 55.671 -1.234 1.598   1.00 18.14 ? 217 HOH A O   1 
HETATM 1208 O  O   . HOH F 3 .   ? 47.131 18.866 8.884   1.00 21.02 ? 218 HOH A O   1 
HETATM 1209 O  O   . HOH F 3 .   ? 44.518 10.440 -2.550  1.00 32.63 ? 219 HOH A O   1 
HETATM 1210 O  O   . HOH F 3 .   ? 1.514  1.533  13.260  1.00 18.49 ? 220 HOH A O   1 
HETATM 1211 O  O   . HOH F 3 .   ? 48.229 19.855 -11.135 1.00 24.65 ? 221 HOH A O   1 
HETATM 1212 O  O   . HOH F 3 .   ? -1.019 10.408 12.504  1.00 20.11 ? 222 HOH A O   1 
HETATM 1213 O  O   . HOH F 3 .   ? 6.371  -2.443 15.272  1.00 23.49 ? 223 HOH A O   1 
HETATM 1214 O  O   . HOH F 3 .   ? 15.805 1.523  9.444   1.00 22.81 ? 224 HOH A O   1 
HETATM 1215 O  O   . HOH F 3 .   ? 55.700 19.541 0.896   1.00 29.62 ? 225 HOH A O   1 
HETATM 1216 O  O   . HOH F 3 .   ? 9.510  2.663  3.150   1.00 21.46 ? 226 HOH A O   1 
HETATM 1217 O  O   . HOH F 3 .   ? 3.354  23.274 21.104  1.00 24.23 ? 227 HOH A O   1 
HETATM 1218 O  O   . HOH F 3 .   ? 6.288  5.954  2.815   1.00 22.53 ? 228 HOH A O   1 
HETATM 1219 O  O   . HOH F 3 .   ? 46.554 4.087  -4.903  1.00 41.28 ? 229 HOH A O   1 
HETATM 1220 O  O   . HOH F 3 .   ? 6.245  17.615 22.874  1.00 27.98 ? 230 HOH A O   1 
HETATM 1221 O  O   . HOH F 3 .   ? 10.239 -1.819 10.358  1.00 26.06 ? 231 HOH A O   1 
HETATM 1222 O  O   . HOH F 3 .   ? 51.257 3.240  -12.802 1.00 27.07 ? 232 HOH A O   1 
HETATM 1223 O  O   . HOH F 3 .   ? 51.767 12.468 6.175   1.00 17.68 ? 233 HOH A O   1 
HETATM 1224 O  O   . HOH F 3 .   ? -0.649 16.547 16.315  1.00 27.00 ? 234 HOH A O   1 
HETATM 1225 O  O   . HOH F 3 .   ? 56.185 13.573 -12.868 1.00 23.90 ? 235 HOH A O   1 
HETATM 1226 O  O   . HOH F 3 .   ? 6.457  -4.758 5.551   1.00 30.39 ? 236 HOH A O   1 
HETATM 1227 O  O   . HOH F 3 .   ? 2.237  -1.025 14.137  1.00 24.80 ? 237 HOH A O   1 
HETATM 1228 O  O   . HOH F 3 .   ? 16.203 7.395  31.797  1.00 30.20 ? 238 HOH A O   1 
HETATM 1229 O  O   . HOH F 3 .   ? 24.274 -6.084 29.129  1.00 43.92 ? 239 HOH A O   1 
HETATM 1230 O  O   . HOH F 3 .   ? 4.749  -2.960 13.552  1.00 31.32 ? 240 HOH A O   1 
HETATM 1231 O  O   . HOH F 3 .   ? 1.738  15.679 24.467  1.00 31.25 ? 241 HOH A O   1 
HETATM 1232 O  O   . HOH F 3 .   ? 47.908 27.990 4.064   1.00 36.13 ? 242 HOH A O   1 
HETATM 1233 O  O   . HOH F 3 .   ? 32.778 14.006 3.419   1.00 29.43 ? 243 HOH A O   1 
HETATM 1234 O  O   . HOH F 3 .   ? 56.068 13.184 -5.928  1.00 27.03 ? 244 HOH A O   1 
HETATM 1235 O  O   . HOH F 3 .   ? 55.386 18.448 4.526   1.00 24.56 ? 245 HOH A O   1 
HETATM 1236 O  O   . HOH F 3 .   ? 2.833  8.386  7.739   1.00 27.09 ? 246 HOH A O   1 
HETATM 1237 O  O   . HOH F 3 .   ? -5.431 17.379 19.567  1.00 28.70 ? 247 HOH A O   1 
HETATM 1238 O  O   . HOH F 3 .   ? 55.429 -1.933 -1.132  1.00 27.65 ? 248 HOH A O   1 
HETATM 1239 O  O   . HOH F 3 .   ? 2.692  19.863 23.228  1.00 30.79 ? 249 HOH A O   1 
HETATM 1240 O  O   . HOH F 3 .   ? 47.607 22.830 11.325  1.00 28.33 ? 250 HOH A O   1 
HETATM 1241 O  O   . HOH F 3 .   ? 59.694 13.731 -4.066  1.00 29.12 ? 251 HOH A O   1 
HETATM 1242 O  O   . HOH F 3 .   ? 8.538  5.173  3.577   1.00 22.35 ? 252 HOH A O   1 
HETATM 1243 O  O   . HOH F 3 .   ? 57.095 20.185 -1.821  1.00 31.92 ? 253 HOH A O   1 
HETATM 1244 O  O   . HOH F 3 .   ? 62.365 0.812  -1.373  1.00 31.43 ? 254 HOH A O   1 
HETATM 1245 O  O   . HOH F 3 .   ? 0.659  20.279 10.763  1.00 31.45 ? 255 HOH A O   1 
HETATM 1246 O  O   . HOH F 3 .   ? -4.660 18.997 12.697  1.00 43.79 ? 256 HOH A O   1 
HETATM 1247 O  O   . HOH F 3 .   ? 52.543 16.978 -8.941  1.00 30.94 ? 257 HOH A O   1 
HETATM 1248 O  O   . HOH F 3 .   ? 57.507 5.611  -2.627  1.00 26.63 ? 258 HOH A O   1 
HETATM 1249 O  O   . HOH F 3 .   ? -2.484 3.141  20.085  1.00 28.02 ? 259 HOH A O   1 
HETATM 1250 O  O   . HOH F 3 .   ? 41.577 25.534 0.157   1.00 29.67 ? 260 HOH A O   1 
HETATM 1251 O  O   . HOH F 3 .   ? 45.838 19.523 12.024  1.00 32.98 ? 261 HOH A O   1 
HETATM 1252 O  O   . HOH F 3 .   ? -4.275 4.464  18.561  1.00 22.15 ? 262 HOH A O   1 
HETATM 1253 O  O   . HOH F 3 .   ? 56.200 5.188  -12.612 1.00 23.55 ? 263 HOH A O   1 
HETATM 1254 O  O   . HOH F 3 .   ? 40.853 8.583  8.966   1.00 27.62 ? 264 HOH A O   1 
HETATM 1255 O  O   . HOH F 3 .   ? 60.175 17.996 -0.906  1.00 32.30 ? 265 HOH A O   1 
HETATM 1256 O  O   . HOH F 3 .   ? 60.917 15.458 -2.452  1.00 33.59 ? 266 HOH A O   1 
HETATM 1257 O  O   . HOH F 3 .   ? 58.950 8.407  -0.276  1.00 34.04 ? 267 HOH A O   1 
HETATM 1258 O  O   . HOH F 3 .   ? 45.930 29.618 2.561   1.00 41.11 ? 268 HOH A O   1 
HETATM 1259 O  O   . HOH F 3 .   ? 50.921 28.506 4.552   1.00 36.52 ? 269 HOH A O   1 
HETATM 1260 O  O   . HOH F 3 .   ? 1.336  24.934 19.975  1.00 31.78 ? 270 HOH A O   1 
HETATM 1261 O  O   . HOH F 3 .   ? 17.018 -1.415 14.097  1.00 38.24 ? 271 HOH A O   1 
HETATM 1262 O  O   . HOH F 3 .   ? 52.716 26.960 3.063   1.00 31.22 ? 272 HOH A O   1 
HETATM 1263 O  O   . HOH F 3 .   ? 50.998 2.303  8.826   1.00 33.31 ? 273 HOH A O   1 
HETATM 1264 O  O   . HOH F 3 .   ? 46.003 7.551  -11.783 1.00 48.93 ? 274 HOH A O   1 
HETATM 1265 O  O   . HOH F 3 .   ? -1.007 24.218 6.211   1.00 43.10 ? 275 HOH A O   1 
HETATM 1266 O  O   . HOH F 3 .   ? 56.839 22.250 4.815   1.00 40.25 ? 276 HOH A O   1 
HETATM 1267 O  O   . HOH F 3 .   ? 49.245 7.184  -11.118 1.00 34.66 ? 277 HOH A O   1 
HETATM 1268 O  O   . HOH F 3 .   ? -0.866 24.155 9.456   1.00 43.49 ? 278 HOH A O   1 
HETATM 1269 O  O   . HOH F 3 .   ? -0.338 28.033 11.511  1.00 34.56 ? 279 HOH A O   1 
HETATM 1270 O  O   . HOH F 3 .   ? -3.000 4.774  13.458  1.00 36.67 ? 280 HOH A O   1 
HETATM 1271 O  O   . HOH F 3 .   ? 9.600  18.879 24.073  1.00 34.72 ? 281 HOH A O   1 
HETATM 1272 O  O   . HOH F 3 .   ? 20.887 -6.495 27.792  1.00 41.88 ? 282 HOH A O   1 
HETATM 1273 O  O   . HOH F 3 .   ? 5.816  6.334  5.567   1.00 27.89 ? 283 HOH A O   1 
HETATM 1274 O  O   . HOH F 3 .   ? -4.808 12.446 12.254  1.00 29.21 ? 284 HOH A O   1 
HETATM 1275 O  O   . HOH F 3 .   ? 50.384 27.032 -7.477  1.00 41.12 ? 285 HOH A O   1 
HETATM 1276 O  O   . HOH F 3 .   ? 47.774 7.219  -15.271 1.00 37.66 ? 286 HOH A O   1 
HETATM 1277 O  O   . HOH F 3 .   ? -0.216 14.876 10.882  1.00 29.91 ? 287 HOH A O   1 
HETATM 1278 O  O   . HOH F 3 .   ? 38.194 8.103  -6.836  1.00 46.90 ? 288 HOH A O   1 
HETATM 1279 O  O   . HOH F 3 .   ? 12.756 22.156 14.559  1.00 37.18 ? 289 HOH A O   1 
HETATM 1280 O  O   . HOH F 3 .   ? 59.144 6.455  -12.882 1.00 39.78 ? 290 HOH A O   1 
HETATM 1281 O  O   . HOH F 3 .   ? 4.700  8.952  6.108   1.00 33.91 ? 291 HOH A O   1 
HETATM 1282 O  O   . HOH F 3 .   ? 0.963  14.178 7.962   1.00 33.24 ? 292 HOH A O   1 
HETATM 1283 O  O   . HOH F 3 .   ? 18.741 -3.190 26.207  1.00 41.16 ? 293 HOH A O   1 
HETATM 1284 O  O   . HOH F 3 .   ? 60.814 -0.074 3.078   1.00 32.17 ? 294 HOH A O   1 
HETATM 1285 O  O   . HOH F 3 .   ? 43.696 28.256 -5.473  1.00 40.31 ? 295 HOH A O   1 
HETATM 1286 O  O   . HOH F 3 .   ? 2.268  -3.615 8.557   1.00 38.59 ? 296 HOH A O   1 
HETATM 1287 O  O   . HOH F 3 .   ? 16.696 15.791 7.970   1.00 34.85 ? 297 HOH A O   1 
HETATM 1288 O  O   . HOH F 3 .   ? 15.760 13.197 16.476  1.00 42.98 ? 298 HOH A O   1 
HETATM 1289 O  O   . HOH F 3 .   ? 26.827 9.535  26.552  1.00 40.48 ? 299 HOH A O   1 
HETATM 1290 O  O   . HOH F 3 .   ? 59.955 3.924  0.809   1.00 35.16 ? 300 HOH A O   1 
HETATM 1291 O  O   . HOH F 3 .   ? -0.749 23.144 18.984  1.00 32.92 ? 301 HOH A O   1 
HETATM 1292 O  O   . HOH F 3 .   ? 58.794 8.127  2.162   1.00 33.57 ? 302 HOH A O   1 
HETATM 1293 O  O   . HOH F 3 .   ? 29.054 11.395 5.282   1.00 34.09 ? 303 HOH A O   1 
HETATM 1294 O  O   . HOH F 3 .   ? 48.255 29.608 -12.737 1.00 43.63 ? 304 HOH A O   1 
HETATM 1295 O  O   . HOH F 3 .   ? 51.934 -2.056 -1.728  1.00 31.32 ? 305 HOH A O   1 
HETATM 1296 O  O   . HOH F 3 .   ? 45.690 23.888 8.086   1.00 26.85 ? 306 HOH A O   1 
HETATM 1297 O  O   . HOH F 3 .   ? 57.979 13.763 5.616   1.00 34.78 ? 307 HOH A O   1 
HETATM 1298 O  O   . HOH F 3 .   ? -3.181 20.772 15.371  1.00 47.38 ? 308 HOH A O   1 
HETATM 1299 O  O   . HOH F 3 .   ? 40.884 7.329  -3.031  1.00 40.65 ? 309 HOH A O   1 
HETATM 1300 O  O   . HOH F 3 .   ? 22.909 14.188 12.707  1.00 45.33 ? 310 HOH A O   1 
HETATM 1301 O  O   . HOH F 3 .   ? 57.569 2.234  -6.740  1.00 25.14 ? 311 HOH A O   1 
HETATM 1302 O  O   . HOH F 3 .   ? 12.302 17.011 16.025  1.00 38.34 ? 312 HOH A O   1 
HETATM 1303 O  O   . HOH F 3 .   ? 33.031 18.705 5.296   1.00 37.26 ? 313 HOH A O   1 
HETATM 1304 O  O   . HOH F 3 .   ? 23.671 16.304 6.025   1.00 42.19 ? 314 HOH A O   1 
HETATM 1305 O  O   . HOH F 3 .   ? 26.564 3.983  13.201  1.00 33.15 ? 315 HOH A O   1 
HETATM 1306 O  O   . HOH F 3 .   ? 48.481 25.294 -2.756  1.00 33.09 ? 316 HOH A O   1 
HETATM 1307 O  O   . HOH F 3 .   ? 31.767 8.864  2.170   1.00 32.57 ? 317 HOH A O   1 
HETATM 1308 O  O   . HOH F 3 .   ? 50.930 19.333 -10.850 1.00 31.74 ? 318 HOH A O   1 
HETATM 1309 O  O   . HOH F 3 .   ? 56.754 18.236 -10.746 1.00 43.59 ? 319 HOH A O   1 
HETATM 1310 O  O   . HOH F 3 .   ? -3.415 20.356 7.143   1.00 39.11 ? 320 HOH A O   1 
HETATM 1311 O  O   . HOH F 3 .   ? 55.594 23.699 11.600  1.00 34.49 ? 321 HOH A O   1 
HETATM 1312 O  O   . HOH F 3 .   ? 1.041  26.064 15.097  1.00 31.62 ? 322 HOH A O   1 
HETATM 1313 O  O   . HOH F 3 .   ? -1.006 6.907  12.182  1.00 35.71 ? 323 HOH A O   1 
HETATM 1314 O  O   . HOH F 3 .   ? 60.499 14.642 0.504   1.00 45.26 ? 324 HOH A O   1 
HETATM 1315 O  O   . HOH F 3 .   ? 46.032 0.763  6.848   1.00 48.93 ? 325 HOH A O   1 
HETATM 1316 O  O   . HOH F 3 .   ? 41.640 6.774  13.495  1.00 38.83 ? 326 HOH A O   1 
HETATM 1317 O  O   . HOH F 3 .   ? 35.179 5.835  13.198  1.00 33.30 ? 327 HOH A O   1 
HETATM 1318 O  O   . HOH F 3 .   ? -4.153 26.216 17.268  1.00 47.04 ? 328 HOH A O   1 
HETATM 1319 O  O   . HOH F 3 .   ? 27.831 1.503  26.604  1.00 38.43 ? 329 HOH A O   1 
HETATM 1320 O  O   . HOH F 3 .   ? 34.767 17.068 9.531   1.00 34.44 ? 330 HOH A O   1 
HETATM 1321 O  O   . HOH F 3 .   ? 24.602 12.962 9.944   1.00 31.95 ? 331 HOH A O   1 
HETATM 1322 O  O   . HOH F 3 .   ? 56.298 18.685 7.140   1.00 30.44 ? 332 HOH A O   1 
HETATM 1323 O  O   . HOH F 3 .   ? 57.146 22.617 8.486   1.00 47.98 ? 333 HOH A O   1 
HETATM 1324 O  O   . HOH F 3 .   ? 33.822 21.808 0.716   1.00 33.04 ? 334 HOH A O   1 
HETATM 1325 O  O   . HOH F 3 .   ? 31.542 11.441 3.696   1.00 32.85 ? 335 HOH A O   1 
HETATM 1326 O  O   . HOH F 3 .   ? 43.415 6.637  7.593   1.00 47.13 ? 336 HOH A O   1 
HETATM 1327 O  O   . HOH F 3 .   ? 47.432 26.373 -13.281 1.00 44.97 ? 337 HOH A O   1 
HETATM 1328 O  O   . HOH F 3 .   ? 20.778 9.805  29.197  1.00 37.90 ? 338 HOH A O   1 
HETATM 1329 O  O   . HOH F 3 .   ? -3.335 22.589 2.233   1.00 45.99 ? 339 HOH A O   1 
HETATM 1330 O  O   . HOH F 3 .   ? 52.087 -2.977 1.102   1.00 34.77 ? 340 HOH A O   1 
HETATM 1331 O  O   . HOH F 3 .   ? 12.633 19.423 12.430  1.00 44.23 ? 341 HOH A O   1 
HETATM 1332 O  O   . HOH F 3 .   ? 26.299 0.453  29.925  1.00 42.30 ? 342 HOH A O   1 
HETATM 1333 O  O   . HOH F 3 .   ? 57.390 26.905 5.513   1.00 41.51 ? 343 HOH A O   1 
HETATM 1334 O  O   . HOH F 3 .   ? 31.821 15.436 -5.267  1.00 36.41 ? 344 HOH A O   1 
HETATM 1335 O  O   . HOH F 3 .   ? 24.051 -0.849 15.251  1.00 45.65 ? 345 HOH A O   1 
HETATM 1336 O  O   . HOH F 3 .   ? 0.399  12.687 4.979   1.00 42.50 ? 346 HOH A O   1 
HETATM 1337 O  O   . HOH F 3 .   ? 19.465 9.127  9.203   1.00 35.87 ? 347 HOH A O   1 
HETATM 1338 O  O   . HOH F 3 .   ? 33.278 13.265 -6.598  1.00 38.59 ? 348 HOH A O   1 
HETATM 1339 O  O   . HOH F 3 .   ? -3.088 25.820 4.539   1.00 47.90 ? 349 HOH A O   1 
HETATM 1340 O  O   . HOH F 3 .   ? 13.704 13.632 13.793  1.00 43.29 ? 350 HOH A O   1 
HETATM 1341 O  O   . HOH F 3 .   ? 22.466 2.297  5.726   1.00 47.44 ? 351 HOH A O   1 
HETATM 1342 O  O   . HOH F 3 .   ? 54.562 17.278 10.600  1.00 44.92 ? 352 HOH A O   1 
HETATM 1343 O  O   . HOH F 3 .   ? 9.558  5.158  25.188  1.00 35.31 ? 353 HOH A O   1 
HETATM 1344 O  O   . HOH F 3 .   ? 45.368 27.995 -4.152  1.00 40.58 ? 354 HOH A O   1 
HETATM 1345 O  O   . HOH F 3 .   ? 46.426 29.614 -0.021  1.00 43.85 ? 355 HOH A O   1 
HETATM 1346 O  O   . HOH F 3 .   ? 33.968 19.191 0.504   1.00 37.16 ? 356 HOH A O   1 
HETATM 1347 O  O   . HOH F 3 .   ? -1.643 17.911 3.292   1.00 33.89 ? 357 HOH A O   1 
HETATM 1348 O  O   . HOH F 3 .   ? 1.185  3.925  4.829   1.00 48.96 ? 358 HOH A O   1 
HETATM 1349 O  O   . HOH F 3 .   ? 23.497 -2.786 22.700  1.00 47.93 ? 359 HOH A O   1 
HETATM 1350 O  O   . HOH F 3 .   ? 55.877 17.620 -8.141  1.00 39.80 ? 360 HOH A O   1 
HETATM 1351 O  O   . HOH F 3 .   ? 24.216 1.697  28.576  1.00 45.99 ? 361 HOH A O   1 
HETATM 1352 O  O   . HOH F 3 .   ? 42.375 6.864  9.939   1.00 43.81 ? 362 HOH A O   1 
HETATM 1353 O  O   . HOH F 3 .   ? -1.927 9.560  9.934   1.00 47.20 ? 363 HOH A O   1 
HETATM 1354 O  O   . HOH F 3 .   ? 60.802 12.107 2.169   1.00 45.92 ? 364 HOH A O   1 
HETATM 1355 O  O   . HOH F 3 .   ? 3.356  -5.838 7.646   1.00 41.10 ? 365 HOH A O   1 
HETATM 1356 O  O   . HOH F 3 .   ? 42.707 9.120  12.458  1.00 40.72 ? 366 HOH A O   1 
HETATM 1357 O  O   . HOH F 3 .   ? 37.645 15.555 16.042  1.00 38.30 ? 367 HOH A O   1 
HETATM 1358 O  O   . HOH F 3 .   ? 45.398 7.915  7.123   1.00 45.52 ? 368 HOH A O   1 
HETATM 1359 O  O   . HOH F 3 .   ? -0.116 11.592 25.960  1.00 37.27 ? 369 HOH A O   1 
HETATM 1360 O  O   . HOH F 3 .   ? 2.590  8.231  3.331   1.00 35.29 ? 370 HOH A O   1 
HETATM 1361 O  O   . HOH F 3 .   ? 30.716 7.312  -2.077  1.00 43.32 ? 371 HOH A O   1 
HETATM 1362 O  O   . HOH F 3 .   ? 5.239  20.197 25.835  1.00 35.82 ? 372 HOH A O   1 
HETATM 1363 O  O   . HOH F 3 .   ? -1.405 22.303 12.954  1.00 43.87 ? 373 HOH A O   1 
HETATM 1364 O  O   . HOH F 3 .   ? 16.282 -0.070 11.454  1.00 40.08 ? 374 HOH A O   1 
HETATM 1365 O  O   . HOH F 3 .   ? 50.882 24.413 -11.234 1.00 48.54 ? 375 HOH A O   1 
HETATM 1366 O  O   . HOH F 3 .   ? 40.836 7.695  -8.112  1.00 42.50 ? 376 HOH A O   1 
HETATM 1367 O  O   . HOH F 3 .   ? 28.643 4.636  29.549  1.00 43.89 ? 377 HOH A O   1 
HETATM 1368 O  O   . HOH F 3 .   ? 52.429 19.873 -8.493  1.00 36.09 ? 378 HOH A O   1 
HETATM 1369 O  O   . HOH F 3 .   ? 49.374 25.441 10.106  1.00 41.20 ? 379 HOH A O   1 
HETATM 1370 O  O   . HOH F 3 .   ? 33.284 22.648 -2.081  1.00 36.87 ? 380 HOH A O   1 
HETATM 1371 O  O   . HOH F 3 .   ? 58.746 10.240 1.280   1.00 48.21 ? 381 HOH A O   1 
HETATM 1372 O  O   . HOH F 3 .   ? 41.511 26.388 -2.984  1.00 47.22 ? 382 HOH A O   1 
HETATM 1373 O  O   . HOH F 3 .   ? 15.516 12.061 8.148   1.00 45.47 ? 383 HOH A O   1 
HETATM 1374 O  O   . HOH F 3 .   ? 25.913 12.350 14.416  1.00 43.15 ? 384 HOH A O   1 
HETATM 1375 O  O   . HOH F 3 .   ? -3.713 23.980 17.690  1.00 47.00 ? 385 HOH A O   1 
HETATM 1376 O  O   . HOH F 3 .   ? 28.883 4.520  12.794  1.00 47.08 ? 386 HOH A O   1 
HETATM 1377 O  O   . HOH F 3 .   ? 43.045 30.790 -3.363  1.00 45.21 ? 387 HOH A O   1 
HETATM 1378 O  O   . HOH F 3 .   ? 23.037 11.981 8.013   1.00 35.72 ? 388 HOH A O   1 
HETATM 1379 O  O   . HOH F 3 .   ? -0.139 24.414 13.024  1.00 38.71 ? 389 HOH A O   1 
HETATM 1380 O  O   . HOH F 3 .   ? 25.932 -3.086 17.579  1.00 45.89 ? 390 HOH A O   1 
HETATM 1381 O  O   . HOH F 3 .   ? 25.384 20.124 4.645   1.00 45.21 ? 391 HOH A O   1 
HETATM 1382 O  O   . HOH F 3 .   ? 41.301 4.453  12.340  1.00 48.69 ? 392 HOH A O   1 
HETATM 1383 O  O   . HOH F 3 .   ? 53.553 24.587 -0.884  1.00 41.51 ? 393 HOH A O   1 
HETATM 1384 O  O   . HOH F 3 .   ? 50.963 27.739 -11.658 1.00 41.96 ? 394 HOH A O   1 
HETATM 1385 O  O   . HOH F 3 .   ? 21.805 0.113  11.066  1.00 41.39 ? 395 HOH A O   1 
HETATM 1386 O  O   . HOH F 3 .   ? 51.488 19.922 10.983  1.00 33.35 ? 396 HOH A O   1 
HETATM 1387 O  O   . HOH F 3 .   ? 35.413 5.288  3.385   1.00 47.18 ? 397 HOH A O   1 
HETATM 1388 O  O   . HOH F 3 .   ? 18.487 15.473 4.044   1.00 48.42 ? 398 HOH A O   1 
HETATM 1389 O  O   . HOH F 3 .   ? 31.145 -0.819 24.504  1.00 35.91 ? 399 HOH A O   1 
HETATM 1390 O  O   . HOH F 3 .   ? 58.385 25.441 9.151   1.00 45.16 ? 400 HOH A O   1 
HETATM 1391 O  O   . HOH F 3 .   ? 51.004 26.900 7.527   1.00 43.48 ? 401 HOH A O   1 
HETATM 1392 O  O   . HOH F 3 .   ? -0.011 11.844 7.495   1.00 45.99 ? 402 HOH A O   1 
HETATM 1393 O  O   . HOH F 3 .   ? 30.654 4.412  19.616  1.00 47.36 ? 403 HOH A O   1 
HETATM 1394 O  O   . HOH F 3 .   ? 13.815 -1.232 11.091  1.00 43.90 ? 404 HOH A O   1 
HETATM 1395 O  O   . HOH F 3 .   ? 13.796 25.486 15.111  1.00 39.84 ? 405 HOH A O   1 
HETATM 1396 O  O   . HOH F 3 .   ? 20.305 16.492 24.266  1.00 48.52 ? 406 HOH A O   1 
HETATM 1397 O  O   . HOH F 3 .   ? 27.367 -0.740 9.996   1.00 48.56 ? 407 HOH A O   1 
HETATM 1398 O  O   . HOH F 3 .   ? -1.142 3.570  24.003  1.00 45.77 ? 408 HOH A O   1 
HETATM 1399 O  O   . HOH F 3 .   ? 28.923 14.365 -4.076  1.00 44.12 ? 409 HOH A O   1 
HETATM 1400 O  O   . HOH F 3 .   ? 4.364  -0.448 16.046  1.00 36.17 ? 410 HOH A O   1 
HETATM 1401 O  O   . HOH F 3 .   ? 4.064  -0.649 18.870  1.00 40.61 ? 411 HOH A O   1 
HETATM 1402 O  O   . HOH F 3 .   ? -3.083 4.336  22.841  1.00 38.14 ? 412 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ALA 1   1   ?   ?   ?   A . n 
A 1 2   ASP 2   2   ?   ?   ?   A . n 
A 1 3   GLN 3   3   ?   ?   ?   A . n 
A 1 4   LEU 4   4   4   LEU LEU A . n 
A 1 5   THR 5   5   5   THR THR A . n 
A 1 6   GLU 6   6   6   GLU GLU A . n 
A 1 7   GLU 7   7   7   GLU GLU A . n 
A 1 8   GLN 8   8   8   GLN GLN A . n 
A 1 9   VAL 9   9   9   VAL VAL A . n 
A 1 10  THR 10  10  10  THR THR A . n 
A 1 11  GLU 11  11  11  GLU GLU A . n 
A 1 12  PHE 12  12  12  PHE PHE A . n 
A 1 13  LYS 13  13  13  LYS LYS A . n 
A 1 14  GLU 14  14  14  GLU GLU A . n 
A 1 15  ALA 15  15  15  ALA ALA A . n 
A 1 16  PHE 16  16  16  PHE PHE A . n 
A 1 17  SER 17  17  17  SER SER A . n 
A 1 18  LEU 18  18  18  LEU LEU A . n 
A 1 19  PHE 19  19  19  PHE PHE A . n 
A 1 20  ASP 20  20  20  ASP ASP A . n 
A 1 21  LYS 21  21  21  LYS LYS A . n 
A 1 22  ASP 22  22  22  ASP ASP A . n 
A 1 23  GLY 23  23  23  GLY GLY A . n 
A 1 24  ASP 24  24  24  ASP ASP A . n 
A 1 25  GLY 25  25  25  GLY GLY A . n 
A 1 26  CYS 26  26  26  CYS CYS A . n 
A 1 27  ILE 27  27  27  ILE ILE A . n 
A 1 28  THR 28  28  28  THR THR A . n 
A 1 29  THR 29  29  29  THR THR A . n 
A 1 30  ARG 30  30  30  ARG ARG A . n 
A 1 31  GLU 31  31  31  GLU GLU A . n 
A 1 32  LEU 32  32  32  LEU LEU A . n 
A 1 33  GLY 33  33  33  GLY GLY A . n 
A 1 34  THR 34  34  34  THR THR A . n 
A 1 35  VAL 35  35  35  VAL VAL A . n 
A 1 36  MET 36  36  36  MET MET A . n 
A 1 37  ARG 37  37  37  ARG ARG A . n 
A 1 38  SER 38  38  38  SER SER A . n 
A 1 39  LEU 39  39  39  LEU LEU A . n 
A 1 40  GLY 40  40  40  GLY GLY A . n 
A 1 41  GLN 41  41  41  GLN GLN A . n 
A 1 42  ASN 42  42  42  ASN ASN A . n 
A 1 43  PRO 43  43  43  PRO PRO A . n 
A 1 44  THR 44  44  44  THR THR A . n 
A 1 45  GLU 45  45  45  GLU GLU A . n 
A 1 46  ALA 46  46  46  ALA ALA A . n 
A 1 47  GLU 47  47  47  GLU GLU A . n 
A 1 48  LEU 48  48  48  LEU LEU A . n 
A 1 49  ARG 49  49  49  ARG ARG A . n 
A 1 50  ASP 50  50  50  ASP ASP A . n 
A 1 51  MET 51  51  51  MET MET A . n 
A 1 52  MET 52  52  52  MET MET A . n 
A 1 53  SER 53  53  53  SER SER A . n 
A 1 54  GLU 54  54  54  GLU GLU A . n 
A 1 55  ILE 55  55  55  ILE ILE A . n 
A 1 56  ASP 56  56  56  ASP ASP A . n 
A 1 57  ARG 57  57  57  ARG ARG A . n 
A 1 58  ASP 58  58  58  ASP ASP A . n 
A 1 59  GLY 59  59  59  GLY GLY A . n 
A 1 60  ASN 60  60  60  ASN ASN A . n 
A 1 61  GLY 61  61  61  GLY GLY A . n 
A 1 62  THR 62  62  62  THR THR A . n 
A 1 63  VAL 63  63  63  VAL VAL A . n 
A 1 64  ASP 64  64  64  ASP ASP A . n 
A 1 65  PHE 65  65  65  PHE PHE A . n 
A 1 66  PRO 66  66  66  PRO PRO A . n 
A 1 67  GLU 67  67  67  GLU GLU A . n 
A 1 68  PHE 68  68  68  PHE PHE A . n 
A 1 69  LEU 69  69  69  LEU LEU A . n 
A 1 70  GLY 70  70  70  GLY GLY A . n 
A 1 71  MET 71  71  71  MET MET A . n 
A 1 72  MET 72  72  72  MET MET A . n 
A 1 73  ALA 73  73  73  ALA ALA A . n 
A 1 74  ARG 74  74  74  ARG ARG A . n 
A 1 75  LYS 75  75  75  LYS LYS A . n 
A 1 76  MET 76  76  76  MET MET A . n 
A 1 77  LYS 77  77  77  LYS LYS A . n 
A 1 78  ASP 78  78  78  ASP ASP A . n 
A 1 79  THR 79  79  79  THR THR A . n 
A 1 80  ASP 80  80  80  ASP ASP A . n 
A 1 81  ASN 81  81  81  ASN ASN A . n 
A 1 82  GLU 82  82  82  GLU GLU A . n 
A 1 83  GLU 83  83  83  GLU GLU A . n 
A 1 84  GLU 84  84  84  GLU GLU A . n 
A 1 85  ILE 85  85  85  ILE ILE A . n 
A 1 86  ARG 86  86  86  ARG ARG A . n 
A 1 87  GLU 87  87  87  GLU GLU A . n 
A 1 88  ALA 88  88  88  ALA ALA A . n 
A 1 89  PHE 89  89  89  PHE PHE A . n 
A 1 90  ARG 90  90  90  ARG ARG A . n 
A 1 91  VAL 91  91  91  VAL VAL A . n 
A 1 92  PHE 92  92  92  PHE PHE A . n 
A 1 93  ASP 93  93  93  ASP ASP A . n 
A 1 94  LYS 94  94  94  LYS LYS A . n 
A 1 95  ASP 95  95  95  ASP ASP A . n 
A 1 96  GLY 96  96  96  GLY GLY A . n 
A 1 97  ASN 97  97  97  ASN ASN A . n 
A 1 98  GLY 98  98  98  GLY GLY A . n 
A 1 99  PHE 99  99  99  PHE PHE A . n 
A 1 100 VAL 100 100 100 VAL VAL A . n 
A 1 101 SER 101 101 101 SER SER A . n 
A 1 102 ALA 102 102 102 ALA ALA A . n 
A 1 103 ALA 103 103 103 ALA ALA A . n 
A 1 104 GLU 104 104 104 GLU GLU A . n 
A 1 105 LEU 105 105 105 LEU LEU A . n 
A 1 106 ARG 106 106 106 ARG ARG A . n 
A 1 107 HIS 107 107 107 HIS HIS A . n 
A 1 108 VAL 108 108 108 VAL VAL A . n 
A 1 109 MET 109 109 109 MET MET A . n 
A 1 110 THR 110 110 110 THR THR A . n 
A 1 111 ARG 111 111 111 ARG ARG A . n 
A 1 112 LEU 112 112 112 LEU LEU A . n 
A 1 113 GLY 113 113 113 GLY GLY A . n 
A 1 114 GLU 114 114 114 GLU GLU A . n 
A 1 115 LYS 115 115 115 LYS LYS A . n 
A 1 116 LEU 116 116 116 LEU LEU A . n 
A 1 117 SER 117 117 117 SER SER A . n 
A 1 118 ASP 118 118 118 ASP ASP A . n 
A 1 119 GLU 119 119 119 GLU GLU A . n 
A 1 120 GLU 120 120 120 GLU GLU A . n 
A 1 121 VAL 121 121 121 VAL VAL A . n 
A 1 122 ASP 122 122 122 ASP ASP A . n 
A 1 123 GLU 123 123 123 GLU GLU A . n 
A 1 124 MET 124 124 124 MET MET A . n 
A 1 125 ILE 125 125 125 ILE ILE A . n 
A 1 126 ARG 126 126 126 ARG ARG A . n 
A 1 127 ALA 127 127 127 ALA ALA A . n 
A 1 128 ALA 128 128 128 ALA ALA A . n 
A 1 129 ASP 129 129 129 ASP ASP A . n 
A 1 130 THR 130 130 130 THR THR A . n 
A 1 131 ASP 131 131 131 ASP ASP A . n 
A 1 132 GLY 132 132 132 GLY GLY A . n 
A 1 133 ASP 133 133 133 ASP ASP A . n 
A 1 134 GLY 134 134 134 GLY GLY A . n 
A 1 135 GLN 135 135 135 GLN GLN A . n 
A 1 136 VAL 136 136 136 VAL VAL A . n 
A 1 137 ASN 137 137 137 ASN ASN A . n 
A 1 138 TYR 138 138 138 TYR TYR A . n 
A 1 139 GLU 139 139 139 GLU GLU A . n 
A 1 140 GLU 140 140 140 GLU GLU A . n 
A 1 141 PHE 141 141 141 PHE PHE A . n 
A 1 142 VAL 142 142 142 VAL VAL A . n 
A 1 143 ARG 143 143 143 ARG ARG A . n 
A 1 144 VAL 144 144 144 VAL VAL A . n 
A 1 145 LEU 145 145 145 LEU LEU A . n 
A 1 146 VAL 146 146 146 VAL VAL A . n 
A 1 147 SER 147 147 147 SER SER A . n 
A 1 148 LYS 148 148 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 CA  1   149 148 CA  CA  A . 
C 2 CA  1   150 149 CA  CA  A . 
D 2 CA  1   151 150 CA  CA  A . 
E 2 CA  1   152 151 CA  CA  A . 
F 3 HOH 1   153 152 HOH HOH A . 
F 3 HOH 2   154 153 HOH HOH A . 
F 3 HOH 3   155 154 HOH HOH A . 
F 3 HOH 4   156 155 HOH HOH A . 
F 3 HOH 5   157 156 HOH HOH A . 
F 3 HOH 6   158 157 HOH HOH A . 
F 3 HOH 7   159 158 HOH HOH A . 
F 3 HOH 8   160 159 HOH HOH A . 
F 3 HOH 9   161 160 HOH HOH A . 
F 3 HOH 10  162 161 HOH HOH A . 
F 3 HOH 11  163 162 HOH HOH A . 
F 3 HOH 12  164 163 HOH HOH A . 
F 3 HOH 13  165 164 HOH HOH A . 
F 3 HOH 14  166 165 HOH HOH A . 
F 3 HOH 15  167 166 HOH HOH A . 
F 3 HOH 16  168 167 HOH HOH A . 
F 3 HOH 17  169 168 HOH HOH A . 
F 3 HOH 18  170 169 HOH HOH A . 
F 3 HOH 19  171 170 HOH HOH A . 
F 3 HOH 20  172 171 HOH HOH A . 
F 3 HOH 21  173 172 HOH HOH A . 
F 3 HOH 22  174 173 HOH HOH A . 
F 3 HOH 23  175 174 HOH HOH A . 
F 3 HOH 24  176 175 HOH HOH A . 
F 3 HOH 25  177 176 HOH HOH A . 
F 3 HOH 26  178 177 HOH HOH A . 
F 3 HOH 27  179 178 HOH HOH A . 
F 3 HOH 28  180 179 HOH HOH A . 
F 3 HOH 29  181 180 HOH HOH A . 
F 3 HOH 30  182 181 HOH HOH A . 
F 3 HOH 31  183 182 HOH HOH A . 
F 3 HOH 32  184 183 HOH HOH A . 
F 3 HOH 33  185 184 HOH HOH A . 
F 3 HOH 34  186 185 HOH HOH A . 
F 3 HOH 35  187 186 HOH HOH A . 
F 3 HOH 36  188 187 HOH HOH A . 
F 3 HOH 37  189 188 HOH HOH A . 
F 3 HOH 38  190 189 HOH HOH A . 
F 3 HOH 39  191 190 HOH HOH A . 
F 3 HOH 40  192 191 HOH HOH A . 
F 3 HOH 41  193 192 HOH HOH A . 
F 3 HOH 42  194 193 HOH HOH A . 
F 3 HOH 43  195 194 HOH HOH A . 
F 3 HOH 44  196 195 HOH HOH A . 
F 3 HOH 45  197 196 HOH HOH A . 
F 3 HOH 46  198 197 HOH HOH A . 
F 3 HOH 47  199 198 HOH HOH A . 
F 3 HOH 48  200 199 HOH HOH A . 
F 3 HOH 49  201 200 HOH HOH A . 
F 3 HOH 50  202 201 HOH HOH A . 
F 3 HOH 51  203 202 HOH HOH A . 
F 3 HOH 52  204 203 HOH HOH A . 
F 3 HOH 53  205 204 HOH HOH A . 
F 3 HOH 54  206 205 HOH HOH A . 
F 3 HOH 55  207 206 HOH HOH A . 
F 3 HOH 56  208 207 HOH HOH A . 
F 3 HOH 57  209 208 HOH HOH A . 
F 3 HOH 58  210 209 HOH HOH A . 
F 3 HOH 59  211 210 HOH HOH A . 
F 3 HOH 60  212 211 HOH HOH A . 
F 3 HOH 61  213 212 HOH HOH A . 
F 3 HOH 62  214 213 HOH HOH A . 
F 3 HOH 63  215 214 HOH HOH A . 
F 3 HOH 64  216 215 HOH HOH A . 
F 3 HOH 65  217 216 HOH HOH A . 
F 3 HOH 66  218 217 HOH HOH A . 
F 3 HOH 67  219 218 HOH HOH A . 
F 3 HOH 68  220 219 HOH HOH A . 
F 3 HOH 69  221 220 HOH HOH A . 
F 3 HOH 70  222 221 HOH HOH A . 
F 3 HOH 71  223 222 HOH HOH A . 
F 3 HOH 72  224 223 HOH HOH A . 
F 3 HOH 73  225 224 HOH HOH A . 
F 3 HOH 74  226 225 HOH HOH A . 
F 3 HOH 75  227 226 HOH HOH A . 
F 3 HOH 76  228 227 HOH HOH A . 
F 3 HOH 77  229 228 HOH HOH A . 
F 3 HOH 78  230 229 HOH HOH A . 
F 3 HOH 79  231 230 HOH HOH A . 
F 3 HOH 80  232 231 HOH HOH A . 
F 3 HOH 81  233 232 HOH HOH A . 
F 3 HOH 82  234 233 HOH HOH A . 
F 3 HOH 83  235 234 HOH HOH A . 
F 3 HOH 84  236 235 HOH HOH A . 
F 3 HOH 85  237 236 HOH HOH A . 
F 3 HOH 86  238 237 HOH HOH A . 
F 3 HOH 87  239 238 HOH HOH A . 
F 3 HOH 88  240 239 HOH HOH A . 
F 3 HOH 89  241 240 HOH HOH A . 
F 3 HOH 90  242 241 HOH HOH A . 
F 3 HOH 91  243 242 HOH HOH A . 
F 3 HOH 92  244 243 HOH HOH A . 
F 3 HOH 93  245 244 HOH HOH A . 
F 3 HOH 94  246 245 HOH HOH A . 
F 3 HOH 95  247 246 HOH HOH A . 
F 3 HOH 96  248 247 HOH HOH A . 
F 3 HOH 97  249 248 HOH HOH A . 
F 3 HOH 98  250 249 HOH HOH A . 
F 3 HOH 99  251 250 HOH HOH A . 
F 3 HOH 100 252 251 HOH HOH A . 
F 3 HOH 101 253 252 HOH HOH A . 
F 3 HOH 102 254 253 HOH HOH A . 
F 3 HOH 103 255 254 HOH HOH A . 
F 3 HOH 104 256 255 HOH HOH A . 
F 3 HOH 105 257 256 HOH HOH A . 
F 3 HOH 106 258 257 HOH HOH A . 
F 3 HOH 107 259 258 HOH HOH A . 
F 3 HOH 108 260 259 HOH HOH A . 
F 3 HOH 109 261 260 HOH HOH A . 
F 3 HOH 110 262 261 HOH HOH A . 
F 3 HOH 111 263 262 HOH HOH A . 
F 3 HOH 112 264 263 HOH HOH A . 
F 3 HOH 113 265 264 HOH HOH A . 
F 3 HOH 114 266 265 HOH HOH A . 
F 3 HOH 115 267 266 HOH HOH A . 
F 3 HOH 116 268 267 HOH HOH A . 
F 3 HOH 117 269 268 HOH HOH A . 
F 3 HOH 118 270 269 HOH HOH A . 
F 3 HOH 119 271 270 HOH HOH A . 
F 3 HOH 120 272 271 HOH HOH A . 
F 3 HOH 121 273 272 HOH HOH A . 
F 3 HOH 122 274 273 HOH HOH A . 
F 3 HOH 123 275 274 HOH HOH A . 
F 3 HOH 124 276 275 HOH HOH A . 
F 3 HOH 125 277 276 HOH HOH A . 
F 3 HOH 126 278 277 HOH HOH A . 
F 3 HOH 127 279 278 HOH HOH A . 
F 3 HOH 128 280 279 HOH HOH A . 
F 3 HOH 129 281 280 HOH HOH A . 
F 3 HOH 130 282 281 HOH HOH A . 
F 3 HOH 131 283 282 HOH HOH A . 
F 3 HOH 132 284 283 HOH HOH A . 
F 3 HOH 133 285 284 HOH HOH A . 
F 3 HOH 134 286 285 HOH HOH A . 
F 3 HOH 135 287 286 HOH HOH A . 
F 3 HOH 136 288 287 HOH HOH A . 
F 3 HOH 137 289 288 HOH HOH A . 
F 3 HOH 138 290 289 HOH HOH A . 
F 3 HOH 139 291 290 HOH HOH A . 
F 3 HOH 140 292 291 HOH HOH A . 
F 3 HOH 141 293 292 HOH HOH A . 
F 3 HOH 142 294 293 HOH HOH A . 
F 3 HOH 143 295 294 HOH HOH A . 
F 3 HOH 144 296 295 HOH HOH A . 
F 3 HOH 145 297 296 HOH HOH A . 
F 3 HOH 146 298 297 HOH HOH A . 
F 3 HOH 147 299 298 HOH HOH A . 
F 3 HOH 148 300 299 HOH HOH A . 
F 3 HOH 149 301 300 HOH HOH A . 
F 3 HOH 150 302 301 HOH HOH A . 
F 3 HOH 151 303 302 HOH HOH A . 
F 3 HOH 152 304 303 HOH HOH A . 
F 3 HOH 153 305 304 HOH HOH A . 
F 3 HOH 154 306 305 HOH HOH A . 
F 3 HOH 155 307 306 HOH HOH A . 
F 3 HOH 156 308 307 HOH HOH A . 
F 3 HOH 157 309 308 HOH HOH A . 
F 3 HOH 158 310 309 HOH HOH A . 
F 3 HOH 159 311 310 HOH HOH A . 
F 3 HOH 160 312 311 HOH HOH A . 
F 3 HOH 161 313 312 HOH HOH A . 
F 3 HOH 162 314 313 HOH HOH A . 
F 3 HOH 163 315 314 HOH HOH A . 
F 3 HOH 164 316 315 HOH HOH A . 
F 3 HOH 165 317 316 HOH HOH A . 
F 3 HOH 166 318 317 HOH HOH A . 
F 3 HOH 167 319 318 HOH HOH A . 
F 3 HOH 168 320 319 HOH HOH A . 
F 3 HOH 169 321 320 HOH HOH A . 
F 3 HOH 170 322 321 HOH HOH A . 
F 3 HOH 171 323 322 HOH HOH A . 
F 3 HOH 172 324 323 HOH HOH A . 
F 3 HOH 173 325 324 HOH HOH A . 
F 3 HOH 174 326 325 HOH HOH A . 
F 3 HOH 175 327 326 HOH HOH A . 
F 3 HOH 176 328 327 HOH HOH A . 
F 3 HOH 177 329 328 HOH HOH A . 
F 3 HOH 178 330 329 HOH HOH A . 
F 3 HOH 179 331 330 HOH HOH A . 
F 3 HOH 180 332 331 HOH HOH A . 
F 3 HOH 181 333 332 HOH HOH A . 
F 3 HOH 182 334 333 HOH HOH A . 
F 3 HOH 183 335 334 HOH HOH A . 
F 3 HOH 184 336 335 HOH HOH A . 
F 3 HOH 185 337 336 HOH HOH A . 
F 3 HOH 186 338 337 HOH HOH A . 
F 3 HOH 187 339 338 HOH HOH A . 
F 3 HOH 188 340 339 HOH HOH A . 
F 3 HOH 189 341 340 HOH HOH A . 
F 3 HOH 190 342 341 HOH HOH A . 
F 3 HOH 191 343 342 HOH HOH A . 
F 3 HOH 192 344 343 HOH HOH A . 
F 3 HOH 193 345 344 HOH HOH A . 
F 3 HOH 194 346 345 HOH HOH A . 
F 3 HOH 195 347 346 HOH HOH A . 
F 3 HOH 196 348 347 HOH HOH A . 
F 3 HOH 197 349 348 HOH HOH A . 
F 3 HOH 198 350 349 HOH HOH A . 
F 3 HOH 199 351 350 HOH HOH A . 
F 3 HOH 200 352 351 HOH HOH A . 
F 3 HOH 201 353 352 HOH HOH A . 
F 3 HOH 202 354 353 HOH HOH A . 
F 3 HOH 203 355 354 HOH HOH A . 
F 3 HOH 204 356 355 HOH HOH A . 
F 3 HOH 205 357 356 HOH HOH A . 
F 3 HOH 206 358 357 HOH HOH A . 
F 3 HOH 207 359 358 HOH HOH A . 
F 3 HOH 208 360 359 HOH HOH A . 
F 3 HOH 209 361 360 HOH HOH A . 
F 3 HOH 210 362 361 HOH HOH A . 
F 3 HOH 211 363 362 HOH HOH A . 
F 3 HOH 212 364 363 HOH HOH A . 
F 3 HOH 213 365 364 HOH HOH A . 
F 3 HOH 214 366 365 HOH HOH A . 
F 3 HOH 215 367 366 HOH HOH A . 
F 3 HOH 216 368 367 HOH HOH A . 
F 3 HOH 217 369 368 HOH HOH A . 
F 3 HOH 218 370 369 HOH HOH A . 
F 3 HOH 219 371 370 HOH HOH A . 
F 3 HOH 220 372 371 HOH HOH A . 
F 3 HOH 221 373 372 HOH HOH A . 
F 3 HOH 222 374 373 HOH HOH A . 
F 3 HOH 223 375 374 HOH HOH A . 
F 3 HOH 224 376 375 HOH HOH A . 
F 3 HOH 225 377 376 HOH HOH A . 
F 3 HOH 226 378 377 HOH HOH A . 
F 3 HOH 227 379 378 HOH HOH A . 
F 3 HOH 228 380 379 HOH HOH A . 
F 3 HOH 229 381 380 HOH HOH A . 
F 3 HOH 230 382 381 HOH HOH A . 
F 3 HOH 231 383 382 HOH HOH A . 
F 3 HOH 232 384 383 HOH HOH A . 
F 3 HOH 233 385 384 HOH HOH A . 
F 3 HOH 234 386 385 HOH HOH A . 
F 3 HOH 235 387 386 HOH HOH A . 
F 3 HOH 236 388 387 HOH HOH A . 
F 3 HOH 237 389 388 HOH HOH A . 
F 3 HOH 238 390 389 HOH HOH A . 
F 3 HOH 239 391 390 HOH HOH A . 
F 3 HOH 240 392 391 HOH HOH A . 
F 3 HOH 241 393 392 HOH HOH A . 
F 3 HOH 242 394 393 HOH HOH A . 
F 3 HOH 243 395 394 HOH HOH A . 
F 3 HOH 244 396 395 HOH HOH A . 
F 3 HOH 245 397 396 HOH HOH A . 
F 3 HOH 246 398 397 HOH HOH A . 
F 3 HOH 247 399 398 HOH HOH A . 
F 3 HOH 248 400 399 HOH HOH A . 
F 3 HOH 249 401 400 HOH HOH A . 
F 3 HOH 250 402 401 HOH HOH A . 
F 3 HOH 251 403 402 HOH HOH A . 
F 3 HOH 252 404 403 HOH HOH A . 
F 3 HOH 253 405 404 HOH HOH A . 
F 3 HOH 254 406 405 HOH HOH A . 
F 3 HOH 255 407 406 HOH HOH A . 
F 3 HOH 256 408 407 HOH HOH A . 
F 3 HOH 257 409 408 HOH HOH A . 
F 3 HOH 258 410 409 HOH HOH A . 
F 3 HOH 259 411 410 HOH HOH A . 
F 3 HOH 260 412 411 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD1 ? A ASP 20  ? A ASP 20  ? 1_555 CA ? B CA . ? A CA 149 ? 1_555 OD1 ? A ASP 22  ? A ASP 22  ? 1_555 82.6  ? 
2  OD1 ? A ASP 20  ? A ASP 20  ? 1_555 CA ? B CA . ? A CA 149 ? 1_555 OD1 ? A ASP 24  ? A ASP 24  ? 1_555 90.6  ? 
3  OD1 ? A ASP 22  ? A ASP 22  ? 1_555 CA ? B CA . ? A CA 149 ? 1_555 OD1 ? A ASP 24  ? A ASP 24  ? 1_555 77.6  ? 
4  OD1 ? A ASP 20  ? A ASP 20  ? 1_555 CA ? B CA . ? A CA 149 ? 1_555 O   ? A CYS 26  ? A CYS 26  ? 1_555 81.5  ? 
5  OD1 ? A ASP 22  ? A ASP 22  ? 1_555 CA ? B CA . ? A CA 149 ? 1_555 O   ? A CYS 26  ? A CYS 26  ? 1_555 152.5 ? 
6  OD1 ? A ASP 24  ? A ASP 24  ? 1_555 CA ? B CA . ? A CA 149 ? 1_555 O   ? A CYS 26  ? A CYS 26  ? 1_555 80.3  ? 
7  OD1 ? A ASP 20  ? A ASP 20  ? 1_555 CA ? B CA . ? A CA 149 ? 1_555 OE1 ? A GLU 31  ? A GLU 31  ? 1_555 104.2 ? 
8  OD1 ? A ASP 22  ? A ASP 22  ? 1_555 CA ? B CA . ? A CA 149 ? 1_555 OE1 ? A GLU 31  ? A GLU 31  ? 1_555 127.7 ? 
9  OD1 ? A ASP 24  ? A ASP 24  ? 1_555 CA ? B CA . ? A CA 149 ? 1_555 OE1 ? A GLU 31  ? A GLU 31  ? 1_555 151.5 ? 
10 O   ? A CYS 26  ? A CYS 26  ? 1_555 CA ? B CA . ? A CA 149 ? 1_555 OE1 ? A GLU 31  ? A GLU 31  ? 1_555 78.1  ? 
11 OD1 ? A ASP 20  ? A ASP 20  ? 1_555 CA ? B CA . ? A CA 149 ? 1_555 OE2 ? A GLU 31  ? A GLU 31  ? 1_555 96.1  ? 
12 OD1 ? A ASP 22  ? A ASP 22  ? 1_555 CA ? B CA . ? A CA 149 ? 1_555 OE2 ? A GLU 31  ? A GLU 31  ? 1_555 75.8  ? 
13 OD1 ? A ASP 24  ? A ASP 24  ? 1_555 CA ? B CA . ? A CA 149 ? 1_555 OE2 ? A GLU 31  ? A GLU 31  ? 1_555 151.5 ? 
14 O   ? A CYS 26  ? A CYS 26  ? 1_555 CA ? B CA . ? A CA 149 ? 1_555 OE2 ? A GLU 31  ? A GLU 31  ? 1_555 128.1 ? 
15 OE1 ? A GLU 31  ? A GLU 31  ? 1_555 CA ? B CA . ? A CA 149 ? 1_555 OE2 ? A GLU 31  ? A GLU 31  ? 1_555 52.1  ? 
16 OD1 ? A ASP 20  ? A ASP 20  ? 1_555 CA ? B CA . ? A CA 149 ? 1_555 O   ? F HOH .   ? A HOH 153 ? 1_555 163.6 ? 
17 OD1 ? A ASP 22  ? A ASP 22  ? 1_555 CA ? B CA . ? A CA 149 ? 1_555 O   ? F HOH .   ? A HOH 153 ? 1_555 81.0  ? 
18 OD1 ? A ASP 24  ? A ASP 24  ? 1_555 CA ? B CA . ? A CA 149 ? 1_555 O   ? F HOH .   ? A HOH 153 ? 1_555 86.5  ? 
19 O   ? A CYS 26  ? A CYS 26  ? 1_555 CA ? B CA . ? A CA 149 ? 1_555 O   ? F HOH .   ? A HOH 153 ? 1_555 113.8 ? 
20 OE1 ? A GLU 31  ? A GLU 31  ? 1_555 CA ? B CA . ? A CA 149 ? 1_555 O   ? F HOH .   ? A HOH 153 ? 1_555 85.4  ? 
21 OE2 ? A GLU 31  ? A GLU 31  ? 1_555 CA ? B CA . ? A CA 149 ? 1_555 O   ? F HOH .   ? A HOH 153 ? 1_555 79.3  ? 
22 OD1 ? A ASP 56  ? A ASP 56  ? 1_555 CA ? C CA . ? A CA 150 ? 1_555 OD1 ? A ASP 58  ? A ASP 58  ? 1_555 82.1  ? 
23 OD1 ? A ASP 56  ? A ASP 56  ? 1_555 CA ? C CA . ? A CA 150 ? 1_555 OD1 ? A ASN 60  ? A ASN 60  ? 1_555 89.5  ? 
24 OD1 ? A ASP 58  ? A ASP 58  ? 1_555 CA ? C CA . ? A CA 150 ? 1_555 OD1 ? A ASN 60  ? A ASN 60  ? 1_555 77.7  ? 
25 OD1 ? A ASP 56  ? A ASP 56  ? 1_555 CA ? C CA . ? A CA 150 ? 1_555 O   ? A THR 62  ? A THR 62  ? 1_555 80.8  ? 
26 OD1 ? A ASP 58  ? A ASP 58  ? 1_555 CA ? C CA . ? A CA 150 ? 1_555 O   ? A THR 62  ? A THR 62  ? 1_555 150.5 ? 
27 OD1 ? A ASN 60  ? A ASN 60  ? 1_555 CA ? C CA . ? A CA 150 ? 1_555 O   ? A THR 62  ? A THR 62  ? 1_555 78.3  ? 
28 OD1 ? A ASP 56  ? A ASP 56  ? 1_555 CA ? C CA . ? A CA 150 ? 1_555 OE1 ? A GLU 67  ? A GLU 67  ? 1_555 98.0  ? 
29 OD1 ? A ASP 58  ? A ASP 58  ? 1_555 CA ? C CA . ? A CA 150 ? 1_555 OE1 ? A GLU 67  ? A GLU 67  ? 1_555 125.7 ? 
30 OD1 ? A ASN 60  ? A ASN 60  ? 1_555 CA ? C CA . ? A CA 150 ? 1_555 OE1 ? A GLU 67  ? A GLU 67  ? 1_555 156.1 ? 
31 O   ? A THR 62  ? A THR 62  ? 1_555 CA ? C CA . ? A CA 150 ? 1_555 OE1 ? A GLU 67  ? A GLU 67  ? 1_555 80.6  ? 
32 OD1 ? A ASP 56  ? A ASP 56  ? 1_555 CA ? C CA . ? A CA 150 ? 1_555 OE2 ? A GLU 67  ? A GLU 67  ? 1_555 94.2  ? 
33 OD1 ? A ASP 58  ? A ASP 58  ? 1_555 CA ? C CA . ? A CA 150 ? 1_555 OE2 ? A GLU 67  ? A GLU 67  ? 1_555 74.3  ? 
34 OD1 ? A ASN 60  ? A ASN 60  ? 1_555 CA ? C CA . ? A CA 150 ? 1_555 OE2 ? A GLU 67  ? A GLU 67  ? 1_555 151.0 ? 
35 O   ? A THR 62  ? A THR 62  ? 1_555 CA ? C CA . ? A CA 150 ? 1_555 OE2 ? A GLU 67  ? A GLU 67  ? 1_555 130.7 ? 
36 OE1 ? A GLU 67  ? A GLU 67  ? 1_555 CA ? C CA . ? A CA 150 ? 1_555 OE2 ? A GLU 67  ? A GLU 67  ? 1_555 51.4  ? 
37 OD1 ? A ASP 56  ? A ASP 56  ? 1_555 CA ? C CA . ? A CA 150 ? 1_555 O   ? F HOH .   ? A HOH 154 ? 1_555 176.6 ? 
38 OD1 ? A ASP 58  ? A ASP 58  ? 1_555 CA ? C CA . ? A CA 150 ? 1_555 O   ? F HOH .   ? A HOH 154 ? 1_555 95.6  ? 
39 OD1 ? A ASN 60  ? A ASN 60  ? 1_555 CA ? C CA . ? A CA 150 ? 1_555 O   ? F HOH .   ? A HOH 154 ? 1_555 92.5  ? 
40 O   ? A THR 62  ? A THR 62  ? 1_555 CA ? C CA . ? A CA 150 ? 1_555 O   ? F HOH .   ? A HOH 154 ? 1_555 102.3 ? 
41 OE1 ? A GLU 67  ? A GLU 67  ? 1_555 CA ? C CA . ? A CA 150 ? 1_555 O   ? F HOH .   ? A HOH 154 ? 1_555 81.2  ? 
42 OE2 ? A GLU 67  ? A GLU 67  ? 1_555 CA ? C CA . ? A CA 150 ? 1_555 O   ? F HOH .   ? A HOH 154 ? 1_555 82.7  ? 
43 OD1 ? A ASP 93  ? A ASP 93  ? 1_555 CA ? D CA . ? A CA 151 ? 1_555 OD1 ? A ASP 95  ? A ASP 95  ? 1_555 86.2  ? 
44 OD1 ? A ASP 93  ? A ASP 93  ? 1_555 CA ? D CA . ? A CA 151 ? 1_555 OD1 ? A ASN 97  ? A ASN 97  ? 1_555 85.5  ? 
45 OD1 ? A ASP 95  ? A ASP 95  ? 1_555 CA ? D CA . ? A CA 151 ? 1_555 OD1 ? A ASN 97  ? A ASN 97  ? 1_555 74.9  ? 
46 OD1 ? A ASP 93  ? A ASP 93  ? 1_555 CA ? D CA . ? A CA 151 ? 1_555 O   ? A PHE 99  ? A PHE 99  ? 1_555 84.1  ? 
47 OD1 ? A ASP 95  ? A ASP 95  ? 1_555 CA ? D CA . ? A CA 151 ? 1_555 O   ? A PHE 99  ? A PHE 99  ? 1_555 153.5 ? 
48 OD1 ? A ASN 97  ? A ASN 97  ? 1_555 CA ? D CA . ? A CA 151 ? 1_555 O   ? A PHE 99  ? A PHE 99  ? 1_555 79.8  ? 
49 OD1 ? A ASP 93  ? A ASP 93  ? 1_555 CA ? D CA . ? A CA 151 ? 1_555 OE1 ? A GLU 104 ? A GLU 104 ? 1_555 102.1 ? 
50 OD1 ? A ASP 95  ? A ASP 95  ? 1_555 CA ? D CA . ? A CA 151 ? 1_555 OE1 ? A GLU 104 ? A GLU 104 ? 1_555 127.3 ? 
51 OD1 ? A ASN 97  ? A ASN 97  ? 1_555 CA ? D CA . ? A CA 151 ? 1_555 OE1 ? A GLU 104 ? A GLU 104 ? 1_555 156.5 ? 
52 O   ? A PHE 99  ? A PHE 99  ? 1_555 CA ? D CA . ? A CA 151 ? 1_555 OE1 ? A GLU 104 ? A GLU 104 ? 1_555 78.9  ? 
53 OD1 ? A ASP 93  ? A ASP 93  ? 1_555 CA ? D CA . ? A CA 151 ? 1_555 OE2 ? A GLU 104 ? A GLU 104 ? 1_555 100.4 ? 
54 OD1 ? A ASP 95  ? A ASP 95  ? 1_555 CA ? D CA . ? A CA 151 ? 1_555 OE2 ? A GLU 104 ? A GLU 104 ? 1_555 75.5  ? 
55 OD1 ? A ASN 97  ? A ASN 97  ? 1_555 CA ? D CA . ? A CA 151 ? 1_555 OE2 ? A GLU 104 ? A GLU 104 ? 1_555 149.3 ? 
56 O   ? A PHE 99  ? A PHE 99  ? 1_555 CA ? D CA . ? A CA 151 ? 1_555 OE2 ? A GLU 104 ? A GLU 104 ? 1_555 130.6 ? 
57 OE1 ? A GLU 104 ? A GLU 104 ? 1_555 CA ? D CA . ? A CA 151 ? 1_555 OE2 ? A GLU 104 ? A GLU 104 ? 1_555 51.9  ? 
58 OD1 ? A ASP 93  ? A ASP 93  ? 1_555 CA ? D CA . ? A CA 151 ? 1_555 O   ? F HOH .   ? A HOH 155 ? 1_555 170.7 ? 
59 OD1 ? A ASP 95  ? A ASP 95  ? 1_555 CA ? D CA . ? A CA 151 ? 1_555 O   ? F HOH .   ? A HOH 155 ? 1_555 89.8  ? 
60 OD1 ? A ASN 97  ? A ASN 97  ? 1_555 CA ? D CA . ? A CA 151 ? 1_555 O   ? F HOH .   ? A HOH 155 ? 1_555 85.4  ? 
61 O   ? A PHE 99  ? A PHE 99  ? 1_555 CA ? D CA . ? A CA 151 ? 1_555 O   ? F HOH .   ? A HOH 155 ? 1_555 96.0  ? 
62 OE1 ? A GLU 104 ? A GLU 104 ? 1_555 CA ? D CA . ? A CA 151 ? 1_555 O   ? F HOH .   ? A HOH 155 ? 1_555 87.0  ? 
63 OE2 ? A GLU 104 ? A GLU 104 ? 1_555 CA ? D CA . ? A CA 151 ? 1_555 O   ? F HOH .   ? A HOH 155 ? 1_555 86.7  ? 
64 OD1 ? A ASP 129 ? A ASP 129 ? 1_555 CA ? E CA . ? A CA 152 ? 1_555 OD1 ? A ASP 131 ? A ASP 131 ? 1_555 80.4  ? 
65 OD1 ? A ASP 129 ? A ASP 129 ? 1_555 CA ? E CA . ? A CA 152 ? 1_555 OD1 ? A ASP 133 ? A ASP 133 ? 1_555 84.6  ? 
66 OD1 ? A ASP 131 ? A ASP 131 ? 1_555 CA ? E CA . ? A CA 152 ? 1_555 OD1 ? A ASP 133 ? A ASP 133 ? 1_555 81.0  ? 
67 OD1 ? A ASP 129 ? A ASP 129 ? 1_555 CA ? E CA . ? A CA 152 ? 1_555 O   ? A GLN 135 ? A GLN 135 ? 1_555 87.7  ? 
68 OD1 ? A ASP 131 ? A ASP 131 ? 1_555 CA ? E CA . ? A CA 152 ? 1_555 O   ? A GLN 135 ? A GLN 135 ? 1_555 156.6 ? 
69 OD1 ? A ASP 133 ? A ASP 133 ? 1_555 CA ? E CA . ? A CA 152 ? 1_555 O   ? A GLN 135 ? A GLN 135 ? 1_555 77.8  ? 
70 OD1 ? A ASP 129 ? A ASP 129 ? 1_555 CA ? E CA . ? A CA 152 ? 1_555 OE1 ? A GLU 140 ? A GLU 140 ? 1_555 110.2 ? 
71 OD1 ? A ASP 131 ? A ASP 131 ? 1_555 CA ? E CA . ? A CA 152 ? 1_555 OE1 ? A GLU 140 ? A GLU 140 ? 1_555 125.5 ? 
72 OD1 ? A ASP 133 ? A ASP 133 ? 1_555 CA ? E CA . ? A CA 152 ? 1_555 OE1 ? A GLU 140 ? A GLU 140 ? 1_555 150.6 ? 
73 O   ? A GLN 135 ? A GLN 135 ? 1_555 CA ? E CA . ? A CA 152 ? 1_555 OE1 ? A GLU 140 ? A GLU 140 ? 1_555 77.5  ? 
74 OD1 ? A ASP 129 ? A ASP 129 ? 1_555 CA ? E CA . ? A CA 152 ? 1_555 OE2 ? A GLU 140 ? A GLU 140 ? 1_555 90.4  ? 
75 OD1 ? A ASP 131 ? A ASP 131 ? 1_555 CA ? E CA . ? A CA 152 ? 1_555 OE2 ? A GLU 140 ? A GLU 140 ? 1_555 76.8  ? 
76 OD1 ? A ASP 133 ? A ASP 133 ? 1_555 CA ? E CA . ? A CA 152 ? 1_555 OE2 ? A GLU 140 ? A GLU 140 ? 1_555 157.8 ? 
77 O   ? A GLN 135 ? A GLN 135 ? 1_555 CA ? E CA . ? A CA 152 ? 1_555 OE2 ? A GLU 140 ? A GLU 140 ? 1_555 123.7 ? 
78 OE1 ? A GLU 140 ? A GLU 140 ? 1_555 CA ? E CA . ? A CA 152 ? 1_555 OE2 ? A GLU 140 ? A GLU 140 ? 1_555 50.8  ? 
79 OD1 ? A ASP 129 ? A ASP 129 ? 1_555 CA ? E CA . ? A CA 152 ? 1_555 O   ? F HOH .   ? A HOH 156 ? 1_555 156.4 ? 
80 OD1 ? A ASP 131 ? A ASP 131 ? 1_555 CA ? E CA . ? A CA 152 ? 1_555 O   ? F HOH .   ? A HOH 156 ? 1_555 79.7  ? 
81 OD1 ? A ASP 133 ? A ASP 133 ? 1_555 CA ? E CA . ? A CA 152 ? 1_555 O   ? F HOH .   ? A HOH 156 ? 1_555 79.9  ? 
82 O   ? A GLN 135 ? A GLN 135 ? 1_555 CA ? E CA . ? A CA 152 ? 1_555 O   ? F HOH .   ? A HOH 156 ? 1_555 106.1 ? 
83 OE1 ? A GLU 140 ? A GLU 140 ? 1_555 CA ? E CA . ? A CA 152 ? 1_555 O   ? F HOH .   ? A HOH 156 ? 1_555 91.7  ? 
84 OE2 ? A GLU 140 ? A GLU 140 ? 1_555 CA ? E CA . ? A CA 152 ? 1_555 O   ? F HOH .   ? A HOH 156 ? 1_555 97.3  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2002-06-05 
2 'Structure model' 1 1 2007-10-16 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-04 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
SOLVE     phasing          . ? 1 
CNS       refinement       . ? 2 
DENZO     'data reduction' . ? 3 
SCALEPACK 'data scaling'   . ? 4 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   HOH 
_pdbx_validate_close_contact.auth_seq_id_1    295 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    354 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.15 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    HOH 
_pdbx_validate_symm_contact.auth_seq_id_1     399 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    A 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     399 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   2_655 
_pdbx_validate_symm_contact.dist              1.97 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CG A ARG 90  ? ? CD  A ARG 90  ? ? 1.207 1.515 -0.308 0.025 N 
2 1 CG A TYR 138 ? ? CD1 A TYR 138 ? ? 1.466 1.387 0.079  0.013 N 
3 1 CB A VAL 142 ? ? CG1 A VAL 142 ? ? 1.671 1.524 0.147  0.021 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 CB A ASP 22  ? ? CG A ASP 22  ? ? OD2 A ASP 22  ? ? 124.36 118.30 6.06  0.90 N 
2  1 CB A ASP 24  ? ? CG A ASP 24  ? ? OD1 A ASP 24  ? ? 124.14 118.30 5.84  0.90 N 
3  1 CA A THR 29  ? ? CB A THR 29  ? ? CG2 A THR 29  ? ? 103.07 112.40 -9.33 1.40 N 
4  1 NE A ARG 37  ? ? CZ A ARG 37  ? ? NH1 A ARG 37  ? ? 123.92 120.30 3.62  0.50 N 
5  1 NE A ARG 49  ? ? CZ A ARG 49  ? ? NH1 A ARG 49  ? ? 115.92 120.30 -4.38 0.50 N 
6  1 CB A ASP 58  ? ? CG A ASP 58  ? ? OD2 A ASP 58  ? ? 112.78 118.30 -5.52 0.90 N 
7  1 CB A ASP 64  ? ? CG A ASP 64  ? ? OD1 A ASP 64  ? ? 125.69 118.30 7.39  0.90 N 
8  1 NE A ARG 74  ? ? CZ A ARG 74  ? ? NH2 A ARG 74  ? ? 115.57 120.30 -4.73 0.50 N 
9  1 CD A ARG 90  ? ? NE A ARG 90  ? ? CZ  A ARG 90  ? ? 133.16 123.60 9.56  1.40 N 
10 1 NE A ARG 90  ? ? CZ A ARG 90  ? ? NH1 A ARG 90  ? ? 127.54 120.30 7.24  0.50 N 
11 1 NE A ARG 90  ? ? CZ A ARG 90  ? ? NH2 A ARG 90  ? ? 113.98 120.30 -6.32 0.50 N 
12 1 CB A ASP 118 ? ? CG A ASP 118 ? ? OD2 A ASP 118 ? ? 112.82 118.30 -5.48 0.90 N 
13 1 CB A ASP 133 ? ? CG A ASP 133 ? ? OD2 A ASP 133 ? ? 112.07 118.30 -6.23 0.90 N 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    ASN 
_pdbx_validate_torsion.auth_asym_id    A 
_pdbx_validate_torsion.auth_seq_id     42 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             -158.31 
_pdbx_validate_torsion.psi             64.57 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A ALA 1   ? A ALA 1   
2 1 Y 1 A ASP 2   ? A ASP 2   
3 1 Y 1 A GLN 3   ? A GLN 3   
4 1 Y 1 A LYS 148 ? A LYS 148 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'CALCIUM ION' CA  
3 water         HOH 
#