data_1GMO
# 
_entry.id   1GMO 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1GMO         
WWPDB D_1290008602 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 2CEG unspecified '3D STRUCTURE PREDICTION OF THE KRINGLE 4 DOMAIN OF HUMAN HEPATOCYTE GROWTH FACTOR-SCATTER FACTOR (HGF-SF)' 
PDB 2CEE unspecified '3D STRUCTURE PREDICTION OF THE KRINGLE 3 DOMAIN OF HUMAN HEPATOCYTE GROWTH FACTOR-SCATTER FACTOR (HGF-SF)' 
PDB 2HGF unspecified 'HAIRPIN LOOP CONTAINING DOMAIN OF HEPATOCYTE GROWTH FACTOR, NMR, MINIMIZED AVERAGE STRUCTURE' 
PDB 1GP9 unspecified 
;A NEW CRYSTAL FORM OF THE NK1 SPLICE VARIANT OF HGF/SF DEMONSTRATES EXTENSIVE HINGE MOVEMENT AND SUGGESTS THAT THE NK1 DIMER ORIGINATES BY DOMAIN SWAPPING
;
PDB 2CED unspecified '3D STRUCTURE PREDICTION OF THE KRINGLE 2 DOMAIN OF HUMAN HEPATOCYTE GROWTH FACTOR-SCATTER FACTOR (HGF-SF)' 
PDB 1SHY unspecified 'THE CRYSTAL STRUCTURE OF HGF BETA-CHAIN IN COMPLEX WITH THESEMA DOMAIN OF THE MET RECEPTOR.' 
PDB 1BHT unspecified 'NK1 FRAGMENT OF HUMAN HEPATOCYTE GROWTH FACTOR' 
PDB 1SI5 unspecified 'PROTEASE-LIKE DOMAIN FROM 2-CHAIN HEPATOCYTE GROWTH FACTOR' 
PDB 1NK1 unspecified 'NK1 FRAGMENT OF HUMAN HEPATOCYTE GROWTH FACTOR/SCATTER FACTOR (HGF/SF) AT 2.5 ANGSTROM RESOLUTION' 
PDB 1GMN unspecified 
;CRYSTAL STRUCTURES OF NK1-HEPARIN COMPLEXES REVEAL THE BASIS FOR NK1 ACTIVITY AND ENABLE ENGINEERING OF POTENT AGONISTS OF THE MET RECEPTOR
;
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1GMO 
_pdbx_database_status.recvd_initial_deposition_date   2001-09-20 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Lietha, D.'      1 
'Chirgadze, D.Y.' 2 
'Mulloy, B.'      3 
'Blundell, T.L.'  4 
'Gherardi, E.'    5 
# 
_citation.id                        primary 
_citation.title                     
;Crystal Structures of Nk1-Heparin Complexes Reveal the Basis for Nk1 Activity and Enable Engineering of Potent Agonists of the met Receptor
;
_citation.journal_abbrev            'Embo J.' 
_citation.journal_volume            20 
_citation.page_first                5543 
_citation.page_last                 ? 
_citation.year                      2001 
_citation.journal_id_ASTM           EMJODG 
_citation.country                   UK 
_citation.journal_id_ISSN           0261-4189 
_citation.journal_id_CSD            0897 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   11597998 
_citation.pdbx_database_id_DOI      10.1093/EMBOJ/20.20.5543 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Lietha, D.'      1 ? 
primary 'Chirgadze, D.Y.' 2 ? 
primary 'Mulloy, B.'      3 ? 
primary 'Blundell, T.L.'  4 ? 
primary 'Gherardi, E.'    5 ? 
# 
_cell.entry_id           1GMO 
_cell.length_a           179.700 
_cell.length_b           174.100 
_cell.length_c           59.900 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              32 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1GMO 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'HEPATOCYTE GROWTH FACTOR' 21173.260 8   ? YES NK1 'NK1 DIMER IN COMPLEX WITH HEPARIN MOLECULE' 
2 branched    man 
;2-deoxy-6-O-sulfo-2-(sulfoamino)-alpha-D-glucopyranose-(1-4)-2-O-sulfo-alpha-L-idopyranuronic acid-(1-4)-2-deoxy-6-O-sulfo-2-(sulfoamino)-alpha-D-glucopyranose-(1-4)-2-O-sulfo-alpha-L-idopyranuronic acid-(1-4)-2-deoxy-6-O-sulfo-2-(sulfoamino)-alpha-D-glucopyranose-(1-4)-2-O-sulfo-alpha-L-idopyranuronic acid
;
1750.427  1   ? ?   ?   ?                                            
3 branched    man 
;2-O-sulfo-alpha-L-idopyranuronic acid-(1-4)-2-deoxy-6-O-sulfo-2-(sulfoamino)-alpha-D-glucopyranose-(1-4)-2-O-sulfo-alpha-L-idopyranuronic acid-(1-4)-2-deoxy-6-O-sulfo-2-(sulfoamino)-alpha-D-glucopyranose-(1-4)-2-O-sulfo-alpha-L-idopyranuronic acid-(1-4)-2-deoxy-6-O-sulfo-2-(sulfoamino)-alpha-D-glucopyranose-(1-4)-2-O-sulfo-alpha-L-idopyranuronic acid
;
2006.615  1   ? ?   ?   ?                                            
4 branched    man 
;2-deoxy-6-O-sulfo-2-(sulfoamino)-alpha-D-glucopyranose-(1-4)-2-O-sulfo-alpha-L-idopyranuronic acid-(1-4)-2-deoxy-6-O-sulfo-2-(sulfoamino)-alpha-D-glucopyranose-(1-4)-2-O-sulfo-alpha-L-idopyranuronic acid-(1-4)-2-deoxy-6-O-sulfo-2-(sulfoamino)-alpha-D-glucopyranose-(1-4)-2-O-sulfo-alpha-L-idopyranuronic acid-(1-4)-2-deoxy-6-O-sulfo-2-(sulfoamino)-alpha-D-glucopyranose-(1-4)-2-O-sulfo-alpha-L-idopyranuronic acid
;
2327.897  1   ? ?   ?   ?                                            
5 branched    man 
;2-deoxy-6-O-sulfo-2-(sulfoamino)-alpha-D-glucopyranose-(1-4)-2-O-sulfo-alpha-L-idopyranuronic acid-(1-4)-2-deoxy-6-O-sulfo-2-(sulfoamino)-alpha-D-glucopyranose-(1-4)-2-O-sulfo-alpha-L-idopyranuronic acid-(1-4)-2-deoxy-6-O-sulfo-2-(sulfoamino)-alpha-D-glucopyranose-(1-4)-2-O-sulfo-alpha-L-idopyranuronic acid-(1-4)-2-deoxy-6-O-sulfo-2-(sulfoamino)-alpha-D-glucopyranose-(1-4)-2-O-sulfo-alpha-L-idopyranuronic acid-(1-4)-2-deoxy-6-O-sulfo-2-(sulfoamino)-alpha-D-glucopyranose
;
2649.180  1   ? ?   ?   ?                                            
6 branched    man 
;2-O-sulfo-alpha-L-idopyranuronic acid-(1-4)-2-deoxy-6-O-sulfo-2-(sulfoamino)-alpha-D-glucopyranose-(1-4)-2-O-sulfo-alpha-L-idopyranuronic acid-(1-4)-2-deoxy-6-O-sulfo-2-(sulfoamino)-alpha-D-glucopyranose-(1-4)-2-O-sulfo-alpha-L-idopyranuronic acid-(1-4)-2-deoxy-6-O-sulfo-2-(sulfoamino)-alpha-D-glucopyranose
;
1750.427  2   ? ?   ?   ?                                            
7 non-polymer syn 'SULFATE ION' 96.063    8   ? ?   ?   ?                                            
8 non-polymer syn '4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID' 238.305   8   ? ?   ?   ? 
9 water       nat water 18.015    183 ? ?   ?   ?                                            
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'SCATTER FACTOR, SF, HEPATOPOEITIN A, HGF' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;YVEGQRKRRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCADRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSG
VKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGP
WCFTSNPEVRYEVCDIPQCSEVE
;
_entity_poly.pdbx_seq_one_letter_code_can   
;YVEGQRKRRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCADRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSG
VKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGP
WCFTSNPEVRYEVCDIPQCSEVE
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F,G,H 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   TYR n 
1 2   VAL n 
1 3   GLU n 
1 4   GLY n 
1 5   GLN n 
1 6   ARG n 
1 7   LYS n 
1 8   ARG n 
1 9   ARG n 
1 10  ASN n 
1 11  THR n 
1 12  ILE n 
1 13  HIS n 
1 14  GLU n 
1 15  PHE n 
1 16  LYS n 
1 17  LYS n 
1 18  SER n 
1 19  ALA n 
1 20  LYS n 
1 21  THR n 
1 22  THR n 
1 23  LEU n 
1 24  ILE n 
1 25  LYS n 
1 26  ILE n 
1 27  ASP n 
1 28  PRO n 
1 29  ALA n 
1 30  LEU n 
1 31  LYS n 
1 32  ILE n 
1 33  LYS n 
1 34  THR n 
1 35  LYS n 
1 36  LYS n 
1 37  VAL n 
1 38  ASN n 
1 39  THR n 
1 40  ALA n 
1 41  ASP n 
1 42  GLN n 
1 43  CYS n 
1 44  ALA n 
1 45  ASP n 
1 46  ARG n 
1 47  CYS n 
1 48  THR n 
1 49  ARG n 
1 50  ASN n 
1 51  LYS n 
1 52  GLY n 
1 53  LEU n 
1 54  PRO n 
1 55  PHE n 
1 56  THR n 
1 57  CYS n 
1 58  LYS n 
1 59  ALA n 
1 60  PHE n 
1 61  VAL n 
1 62  PHE n 
1 63  ASP n 
1 64  LYS n 
1 65  ALA n 
1 66  ARG n 
1 67  LYS n 
1 68  GLN n 
1 69  CYS n 
1 70  LEU n 
1 71  TRP n 
1 72  PHE n 
1 73  PRO n 
1 74  PHE n 
1 75  ASN n 
1 76  SER n 
1 77  MET n 
1 78  SER n 
1 79  SER n 
1 80  GLY n 
1 81  VAL n 
1 82  LYS n 
1 83  LYS n 
1 84  GLU n 
1 85  PHE n 
1 86  GLY n 
1 87  HIS n 
1 88  GLU n 
1 89  PHE n 
1 90  ASP n 
1 91  LEU n 
1 92  TYR n 
1 93  GLU n 
1 94  ASN n 
1 95  LYS n 
1 96  ASP n 
1 97  TYR n 
1 98  ILE n 
1 99  ARG n 
1 100 ASN n 
1 101 CYS n 
1 102 ILE n 
1 103 ILE n 
1 104 GLY n 
1 105 LYS n 
1 106 GLY n 
1 107 ARG n 
1 108 SER n 
1 109 TYR n 
1 110 LYS n 
1 111 GLY n 
1 112 THR n 
1 113 VAL n 
1 114 SER n 
1 115 ILE n 
1 116 THR n 
1 117 LYS n 
1 118 SER n 
1 119 GLY n 
1 120 ILE n 
1 121 LYS n 
1 122 CYS n 
1 123 GLN n 
1 124 PRO n 
1 125 TRP n 
1 126 SER n 
1 127 SER n 
1 128 MET n 
1 129 ILE n 
1 130 PRO n 
1 131 HIS n 
1 132 GLU n 
1 133 HIS n 
1 134 SER n 
1 135 PHE n 
1 136 LEU n 
1 137 PRO n 
1 138 SER n 
1 139 SER n 
1 140 TYR n 
1 141 ARG n 
1 142 GLY n 
1 143 LYS n 
1 144 ASP n 
1 145 LEU n 
1 146 GLN n 
1 147 GLU n 
1 148 ASN n 
1 149 TYR n 
1 150 CYS n 
1 151 ARG n 
1 152 ASN n 
1 153 PRO n 
1 154 ARG n 
1 155 GLY n 
1 156 GLU n 
1 157 GLU n 
1 158 GLY n 
1 159 GLY n 
1 160 PRO n 
1 161 TRP n 
1 162 CYS n 
1 163 PHE n 
1 164 THR n 
1 165 SER n 
1 166 ASN n 
1 167 PRO n 
1 168 GLU n 
1 169 VAL n 
1 170 ARG n 
1 171 TYR n 
1 172 GLU n 
1 173 VAL n 
1 174 CYS n 
1 175 ASP n 
1 176 ILE n 
1 177 PRO n 
1 178 GLN n 
1 179 CYS n 
1 180 SER n 
1 181 GLU n 
1 182 VAL n 
1 183 GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'PICHIA PASTORIS' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     644223 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               GS115 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               YEAST 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PPIC-9K 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    HGF_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P14210 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1GMO A 1 ? 183 ? P14210 28 ? 210 ? 28 210 
2 1 1GMO B 1 ? 183 ? P14210 28 ? 210 ? 28 210 
3 1 1GMO C 1 ? 183 ? P14210 28 ? 210 ? 28 210 
4 1 1GMO D 1 ? 183 ? P14210 28 ? 210 ? 28 210 
5 1 1GMO E 1 ? 183 ? P14210 28 ? 210 ? 28 210 
6 1 1GMO F 1 ? 183 ? P14210 28 ? 210 ? 28 210 
7 1 1GMO G 1 ? 183 ? P14210 28 ? 210 ? 28 210 
8 1 1GMO H 1 ? 183 ? P14210 28 ? 210 ? 28 210 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1GMO VAL A 2  ? UNP P14210 ALA 29 'engineered mutation' 29 1  
1 1GMO ASP A 45 ? UNP P14210 ASN 72 'engineered mutation' 72 2  
2 1GMO VAL B 2  ? UNP P14210 ALA 29 'engineered mutation' 29 3  
2 1GMO ASP B 45 ? UNP P14210 ASN 72 'engineered mutation' 72 4  
3 1GMO VAL C 2  ? UNP P14210 ALA 29 'engineered mutation' 29 5  
3 1GMO ASP C 45 ? UNP P14210 ASN 72 'engineered mutation' 72 6  
4 1GMO VAL D 2  ? UNP P14210 ALA 29 'engineered mutation' 29 7  
4 1GMO ASP D 45 ? UNP P14210 ASN 72 'engineered mutation' 72 8  
5 1GMO VAL E 2  ? UNP P14210 ALA 29 'engineered mutation' 29 9  
5 1GMO ASP E 45 ? UNP P14210 ASN 72 'engineered mutation' 72 10 
6 1GMO VAL F 2  ? UNP P14210 ALA 29 'engineered mutation' 29 11 
6 1GMO ASP F 45 ? UNP P14210 ASN 72 'engineered mutation' 72 12 
7 1GMO VAL G 2  ? UNP P14210 ALA 29 'engineered mutation' 29 13 
7 1GMO ASP G 45 ? UNP P14210 ASN 72 'engineered mutation' 72 14 
8 1GMO VAL H 2  ? UNP P14210 ALA 29 'engineered mutation' 29 15 
8 1GMO ASP H 45 ? UNP P14210 ASN 72 'engineered mutation' 72 16 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'           y ALANINE                                                  ?                          
'C3 H7 N O2'      89.093  
ARG 'L-peptide linking'           y ARGININE                                                 ?                          
'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking'           y ASPARAGINE                                               ?                          
'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID'                                          ?                          
'C4 H7 N O4'      133.103 
CYS 'L-peptide linking'           y CYSTEINE                                                 ?                          
'C3 H7 N O2 S'    121.158 
EPE non-polymer                   . '4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID'    HEPES                      
'C8 H18 N2 O4 S'  238.305 
GLN 'L-peptide linking'           y GLUTAMINE                                                ?                          
'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID'                                          ?                          
'C5 H9 N O4'      147.129 
GLY 'peptide linking'             y GLYCINE                                                  ?                          
'C2 H5 N O2'      75.067  
HIS 'L-peptide linking'           y HISTIDINE                                                ?                          
'C6 H10 N3 O2 1'  156.162 
HOH non-polymer                   . WATER                                                    ?                          'H2 O' 
18.015  
IDS 'L-saccharide, alpha linking' n '2-O-sulfo-alpha-L-idopyranuronic acid'                  'O2-SULFO-GLUCURONIC ACID' 
'C6 H10 O10 S'    274.203 
ILE 'L-peptide linking'           y ISOLEUCINE                                               ?                          
'C6 H13 N O2'     131.173 
LEU 'L-peptide linking'           y LEUCINE                                                  ?                          
'C6 H13 N O2'     131.173 
LYS 'L-peptide linking'           y LYSINE                                                   ?                          
'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking'           y METHIONINE                                               ?                          
'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking'           y PHENYLALANINE                                            ?                          
'C9 H11 N O2'     165.189 
PRO 'L-peptide linking'           y PROLINE                                                  ?                          
'C5 H9 N O2'      115.130 
SER 'L-peptide linking'           y SERINE                                                   ?                          
'C3 H7 N O3'      105.093 
SGN 'D-saccharide, alpha linking' n '2-deoxy-6-O-sulfo-2-(sulfoamino)-alpha-D-glucopyranose' ?                          
'C6 H13 N O11 S2' 339.298 
SO4 non-polymer                   . 'SULFATE ION'                                            ?                          'O4 S -2' 
96.063  
THR 'L-peptide linking'           y THREONINE                                                ?                          
'C4 H9 N O3'      119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN                                               ?                          
'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking'           y TYROSINE                                                 ?                          
'C9 H11 N O3'     181.189 
VAL 'L-peptide linking'           y VALINE                                                   ?                          
'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1GMO 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.43 
_exptl_crystal.density_percent_sol   49.0 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.50 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
'10% PEG4000, 8% ETHYLENE GLYCOL, 0.10M SODIUM PARA-TOLUENE SULFONATE,0.10M SODIUM HEPES, PH 7.5' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2000-02-17 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.979 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SRS BEAMLINE PX14.2' 
_diffrn_source.pdbx_synchrotron_site       SRS 
_diffrn_source.pdbx_synchrotron_beamline   PX14.2 
_diffrn_source.pdbx_wavelength             0.979 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     1GMO 
_reflns.observed_criterion_sigma_I   3.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20.000 
_reflns.d_resolution_high            2.950 
_reflns.number_obs                   37651 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         95.2 
_reflns.pdbx_Rmerge_I_obs            0.06300 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        12.0000 
_reflns.B_iso_Wilson_estimate        78.3 
_reflns.pdbx_redundancy              6.000 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.95 
_reflns_shell.d_res_low              3.02 
_reflns_shell.percent_possible_all   91.4 
_reflns_shell.Rmerge_I_obs           0.32700 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 1GMO 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     36626 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.00 
_refine.ls_d_res_high                            3.0 
_refine.ls_percent_reflns_obs                    95.3 
_refine.ls_R_factor_obs                          0.254 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.254 
_refine.ls_R_factor_R_free                       0.295 
_refine.ls_R_factor_R_free_error                 0.007 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  1824 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               60.4 
_refine.aniso_B[1][1]                            -4.30 
_refine.aniso_B[2][2]                            1.02 
_refine.aniso_B[3][3]                            3.28 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.28727 
_refine.solvent_model_param_bsol                 22.6753 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'BULK SOLVENT MODEL USED' 
_refine.pdbx_starting_model                      'PDB ENTRIES 1NK1 AND 1BHT' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.entry_id                        1GMO 
_refine_analyze.Luzzati_coordinate_error_obs    0.44 
_refine_analyze.Luzzati_sigma_a_obs             0.38 
_refine_analyze.Luzzati_d_res_low_obs           20.00 
_refine_analyze.Luzzati_coordinate_error_free   0.54 
_refine_analyze.Luzzati_sigma_a_free            0.48 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        10477 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         895 
_refine_hist.number_atoms_solvent             183 
_refine_hist.number_atoms_total               11555 
_refine_hist.d_res_high                       3.0 
_refine_hist.d_res_low                        20.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.009 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.30  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      24.7  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      0.87  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.42  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            2.55  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             1.67  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            2.68  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       3.0 
_refine_ls_shell.d_res_low                        3.19 
_refine_ls_shell.number_reflns_R_work             5441 
_refine_ls_shell.R_factor_R_work                  0.337 
_refine_ls_shell.percent_reflns_obs               91.6 
_refine_ls_shell.R_factor_R_free                  0.386 
_refine_ls_shell.R_factor_R_free_error            0.023 
_refine_ls_shell.percent_reflns_R_free            5.1 
_refine_ls_shell.number_reflns_R_free             293 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.pdbx_refine_id 
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
'X-RAY DIFFRACTION' 1 EPE.PAR       HEPARIN.TOP 
'X-RAY DIFFRACTION' 2 HEPARIN.PARAM SO4.TOP     
'X-RAY DIFFRACTION' 3 SO4.PAR       EPE.TOP     
# 
_struct.entry_id                  1GMO 
_struct.title                     
;CRYSTAL STRUCTURES OF NK1-HEPARIN COMPLEXES REVEAL THE BASIS FOR NK1 ACTIVITY AND ENABLE ENGINEERING OF POTENT AGONISTS OF THE MET RECEPTOR
;
_struct.pdbx_descriptor           'HEPATOCYTE GROWTH FACTOR' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1GMO 
_struct_keywords.pdbx_keywords   HORMONE 
_struct_keywords.text            'HORMONE, GROWTH FACTOR' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 1 ? 
F  N N 1 ? 
G  N N 1 ? 
H  N N 1 ? 
I  N N 2 ? 
J  N N 3 ? 
K  N N 4 ? 
L  N N 5 ? 
M  N N 6 ? 
N  N N 6 ? 
O  N N 7 ? 
P  N N 8 ? 
Q  N N 7 ? 
R  N N 8 ? 
S  N N 7 ? 
T  N N 8 ? 
U  N N 7 ? 
V  N N 8 ? 
W  N N 7 ? 
X  N N 8 ? 
Y  N N 7 ? 
Z  N N 7 ? 
AA N N 8 ? 
BA N N 8 ? 
CA N N 7 ? 
DA N N 8 ? 
EA N N 9 ? 
FA N N 9 ? 
GA N N 9 ? 
HA N N 9 ? 
IA N N 9 ? 
JA N N 9 ? 
KA N N 9 ? 
LA N N 9 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 THR A 11  ? HIS A 13  ? THR A 38  HIS A 40  5 ? 3  
HELX_P HELX_P2  AA2 THR A 39  ? ARG A 49  ? THR A 66  ARG A 76  1 ? 11 
HELX_P HELX_P3  AA3 ASP A 96  ? ILE A 98  ? ASP A 123 ILE A 125 5 ? 3  
HELX_P HELX_P4  AA4 PRO A 137 ? ARG A 141 ? PRO A 164 ARG A 168 5 ? 5  
HELX_P HELX_P5  AA5 THR B 11  ? HIS B 13  ? THR B 38  HIS B 40  5 ? 3  
HELX_P HELX_P6  AA6 THR B 39  ? ARG B 49  ? THR B 66  ARG B 76  1 ? 11 
HELX_P HELX_P7  AA7 ASP B 96  ? ILE B 98  ? ASP B 123 ILE B 125 5 ? 3  
HELX_P HELX_P8  AA8 PRO B 137 ? ARG B 141 ? PRO B 164 ARG B 168 5 ? 5  
HELX_P HELX_P9  AA9 THR C 11  ? HIS C 13  ? THR C 38  HIS C 40  5 ? 3  
HELX_P HELX_P10 AB1 THR C 39  ? ARG C 49  ? THR C 66  ARG C 76  1 ? 11 
HELX_P HELX_P11 AB2 ASP C 96  ? ILE C 98  ? ASP C 123 ILE C 125 5 ? 3  
HELX_P HELX_P12 AB3 LEU C 136 ? TYR C 140 ? LEU C 163 TYR C 167 5 ? 5  
HELX_P HELX_P13 AB4 THR D 11  ? HIS D 13  ? THR D 38  HIS D 40  5 ? 3  
HELX_P HELX_P14 AB5 THR D 39  ? ASN D 50  ? THR D 66  ASN D 77  1 ? 12 
HELX_P HELX_P15 AB6 ASP D 96  ? ILE D 98  ? ASP D 123 ILE D 125 5 ? 3  
HELX_P HELX_P16 AB7 LEU D 136 ? TYR D 140 ? LEU D 163 TYR D 167 5 ? 5  
HELX_P HELX_P17 AB8 THR E 11  ? HIS E 13  ? THR E 38  HIS E 40  5 ? 3  
HELX_P HELX_P18 AB9 THR E 39  ? ARG E 49  ? THR E 66  ARG E 76  1 ? 11 
HELX_P HELX_P19 AC1 ASP E 96  ? ILE E 98  ? ASP E 123 ILE E 125 5 ? 3  
HELX_P HELX_P20 AC2 PRO E 137 ? ARG E 141 ? PRO E 164 ARG E 168 5 ? 5  
HELX_P HELX_P21 AC3 THR F 11  ? HIS F 13  ? THR F 38  HIS F 40  5 ? 3  
HELX_P HELX_P22 AC4 THR F 39  ? ARG F 49  ? THR F 66  ARG F 76  1 ? 11 
HELX_P HELX_P23 AC5 ASP F 96  ? ILE F 98  ? ASP F 123 ILE F 125 5 ? 3  
HELX_P HELX_P24 AC6 THR G 11  ? HIS G 13  ? THR G 38  HIS G 40  5 ? 3  
HELX_P HELX_P25 AC7 THR G 39  ? ARG G 49  ? THR G 66  ARG G 76  1 ? 11 
HELX_P HELX_P26 AC8 ASP G 96  ? ILE G 98  ? ASP G 123 ILE G 125 5 ? 3  
HELX_P HELX_P27 AC9 PRO G 137 ? ARG G 141 ? PRO G 164 ARG G 168 5 ? 5  
HELX_P HELX_P28 AD1 THR H 11  ? HIS H 13  ? THR H 38  HIS H 40  5 ? 3  
HELX_P HELX_P29 AD2 THR H 39  ? ARG H 49  ? THR H 66  ARG H 76  1 ? 11 
HELX_P HELX_P30 AD3 ASP H 96  ? ILE H 98  ? ASP H 123 ILE H 125 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ?   ? A CYS 43  SG ? ? ? 1_555 A CYS 69  SG ? ? A CYS 70  A CYS 96  1_555 ? ? ? ? ? ? ? 2.027 ? ? 
disulf2  disulf ?   ? A CYS 47  SG ? ? ? 1_555 A CYS 57  SG ? ? A CYS 74  A CYS 84  1_555 ? ? ? ? ? ? ? 2.042 ? ? 
disulf3  disulf ?   ? A CYS 101 SG ? ? ? 1_555 A CYS 179 SG ? ? A CYS 128 A CYS 206 1_555 ? ? ? ? ? ? ? 2.033 ? ? 
disulf4  disulf ?   ? A CYS 122 SG ? ? ? 1_555 A CYS 162 SG ? ? A CYS 149 A CYS 189 1_555 ? ? ? ? ? ? ? 2.031 ? ? 
disulf5  disulf ?   ? A CYS 150 SG ? ? ? 1_555 A CYS 174 SG ? ? A CYS 177 A CYS 201 1_555 ? ? ? ? ? ? ? 2.031 ? ? 
disulf6  disulf ?   ? B CYS 43  SG ? ? ? 1_555 B CYS 69  SG ? ? B CYS 70  B CYS 96  1_555 ? ? ? ? ? ? ? 2.024 ? ? 
disulf7  disulf ?   ? B CYS 47  SG ? ? ? 1_555 B CYS 57  SG ? ? B CYS 74  B CYS 84  1_555 ? ? ? ? ? ? ? 2.042 ? ? 
disulf8  disulf ?   ? B CYS 101 SG ? ? ? 1_555 B CYS 179 SG ? ? B CYS 128 B CYS 206 1_555 ? ? ? ? ? ? ? 2.041 ? ? 
disulf9  disulf ?   ? B CYS 122 SG ? ? ? 1_555 B CYS 162 SG ? ? B CYS 149 B CYS 189 1_555 ? ? ? ? ? ? ? 2.022 ? ? 
disulf10 disulf ?   ? B CYS 150 SG ? ? ? 1_555 B CYS 174 SG ? ? B CYS 177 B CYS 201 1_555 ? ? ? ? ? ? ? 2.021 ? ? 
disulf11 disulf ?   ? C CYS 43  SG ? ? ? 1_555 C CYS 69  SG ? ? C CYS 70  C CYS 96  1_555 ? ? ? ? ? ? ? 2.034 ? ? 
disulf12 disulf ?   ? C CYS 47  SG ? ? ? 1_555 C CYS 57  SG ? ? C CYS 74  C CYS 84  1_555 ? ? ? ? ? ? ? 2.041 ? ? 
disulf13 disulf ?   ? C CYS 101 SG ? ? ? 1_555 C CYS 179 SG ? ? C CYS 128 C CYS 206 1_555 ? ? ? ? ? ? ? 2.034 ? ? 
disulf14 disulf ?   ? C CYS 122 SG ? ? ? 1_555 C CYS 162 SG ? ? C CYS 149 C CYS 189 1_555 ? ? ? ? ? ? ? 2.033 ? ? 
disulf15 disulf ?   ? C CYS 150 SG ? ? ? 1_555 C CYS 174 SG ? ? C CYS 177 C CYS 201 1_555 ? ? ? ? ? ? ? 2.019 ? ? 
disulf16 disulf ?   ? D CYS 43  SG ? ? ? 1_555 D CYS 69  SG ? ? D CYS 70  D CYS 96  1_555 ? ? ? ? ? ? ? 2.026 ? ? 
disulf17 disulf ?   ? D CYS 47  SG ? ? ? 1_555 D CYS 57  SG ? ? D CYS 74  D CYS 84  1_555 ? ? ? ? ? ? ? 2.047 ? ? 
disulf18 disulf ?   ? D CYS 101 SG ? ? ? 1_555 D CYS 179 SG ? ? D CYS 128 D CYS 206 1_555 ? ? ? ? ? ? ? 2.043 ? ? 
disulf19 disulf ?   ? D CYS 122 SG ? ? ? 1_555 D CYS 162 SG ? ? D CYS 149 D CYS 189 1_555 ? ? ? ? ? ? ? 2.026 ? ? 
disulf20 disulf ?   ? D CYS 150 SG ? ? ? 1_555 D CYS 174 SG ? ? D CYS 177 D CYS 201 1_555 ? ? ? ? ? ? ? 2.031 ? ? 
disulf21 disulf ?   ? E CYS 43  SG ? ? ? 1_555 E CYS 69  SG ? ? E CYS 70  E CYS 96  1_555 ? ? ? ? ? ? ? 2.026 ? ? 
disulf22 disulf ?   ? E CYS 47  SG ? ? ? 1_555 E CYS 57  SG ? ? E CYS 74  E CYS 84  1_555 ? ? ? ? ? ? ? 2.025 ? ? 
disulf23 disulf ?   ? E CYS 101 SG ? ? ? 1_555 E CYS 179 SG ? ? E CYS 128 E CYS 206 1_555 ? ? ? ? ? ? ? 2.039 ? ? 
disulf24 disulf ?   ? E CYS 122 SG ? ? ? 1_555 E CYS 162 SG ? ? E CYS 149 E CYS 189 1_555 ? ? ? ? ? ? ? 2.028 ? ? 
disulf25 disulf ?   ? E CYS 150 SG ? ? ? 1_555 E CYS 174 SG ? ? E CYS 177 E CYS 201 1_555 ? ? ? ? ? ? ? 2.031 ? ? 
disulf26 disulf ?   ? F CYS 43  SG ? ? ? 1_555 F CYS 69  SG ? ? F CYS 70  F CYS 96  1_555 ? ? ? ? ? ? ? 2.026 ? ? 
disulf27 disulf ?   ? F CYS 47  SG ? ? ? 1_555 F CYS 57  SG ? ? F CYS 74  F CYS 84  1_555 ? ? ? ? ? ? ? 2.044 ? ? 
disulf28 disulf ?   ? F CYS 101 SG ? ? ? 1_555 F CYS 179 SG ? ? F CYS 128 F CYS 206 1_555 ? ? ? ? ? ? ? 2.034 ? ? 
disulf29 disulf ?   ? F CYS 122 SG ? ? ? 1_555 F CYS 162 SG ? ? F CYS 149 F CYS 189 1_555 ? ? ? ? ? ? ? 2.034 ? ? 
disulf30 disulf ?   ? F CYS 150 SG ? ? ? 1_555 F CYS 174 SG ? ? F CYS 177 F CYS 201 1_555 ? ? ? ? ? ? ? 2.036 ? ? 
disulf31 disulf ?   ? G CYS 43  SG ? ? ? 1_555 G CYS 69  SG ? ? G CYS 70  G CYS 96  1_555 ? ? ? ? ? ? ? 2.026 ? ? 
disulf32 disulf ?   ? G CYS 47  SG ? ? ? 1_555 G CYS 57  SG ? ? G CYS 74  G CYS 84  1_555 ? ? ? ? ? ? ? 2.037 ? ? 
disulf33 disulf ?   ? G CYS 101 SG ? ? ? 1_555 G CYS 179 SG ? ? G CYS 128 G CYS 206 1_555 ? ? ? ? ? ? ? 2.036 ? ? 
disulf34 disulf ?   ? G CYS 122 SG ? ? ? 1_555 G CYS 162 SG ? ? G CYS 149 G CYS 189 1_555 ? ? ? ? ? ? ? 2.030 ? ? 
disulf35 disulf ?   ? G CYS 150 SG ? ? ? 1_555 G CYS 174 SG ? ? G CYS 177 G CYS 201 1_555 ? ? ? ? ? ? ? 2.024 ? ? 
disulf36 disulf ?   ? H CYS 43  SG ? ? ? 1_555 H CYS 69  SG ? ? H CYS 70  H CYS 96  1_555 ? ? ? ? ? ? ? 2.030 ? ? 
disulf37 disulf ?   ? H CYS 47  SG ? ? ? 1_555 H CYS 57  SG ? ? H CYS 74  H CYS 84  1_555 ? ? ? ? ? ? ? 2.037 ? ? 
disulf38 disulf ?   ? H CYS 101 SG ? ? ? 1_555 H CYS 179 SG ? ? H CYS 128 H CYS 206 1_555 ? ? ? ? ? ? ? 2.042 ? ? 
disulf39 disulf ?   ? H CYS 122 SG ? ? ? 1_555 H CYS 162 SG ? ? H CYS 149 H CYS 189 1_555 ? ? ? ? ? ? ? 2.035 ? ? 
disulf40 disulf ?   ? H CYS 150 SG ? ? ? 1_555 H CYS 174 SG ? ? H CYS 177 H CYS 201 1_555 ? ? ? ? ? ? ? 2.027 ? ? 
covale1  covale one ? I IDS .   O4 ? ? ? 1_555 I SGN .   C1 ? ? I IDS 1   I SGN 2   1_555 ? ? ? ? ? ? ? 1.408 ? ? 
covale2  covale one ? I SGN .   O4 ? ? ? 1_555 I IDS .   C1 ? ? I SGN 2   I IDS 3   1_555 ? ? ? ? ? ? ? 1.399 ? ? 
covale3  covale one ? I IDS .   O4 ? ? ? 1_555 I SGN .   C1 ? ? I IDS 3   I SGN 4   1_555 ? ? ? ? ? ? ? 1.417 ? ? 
covale4  covale one ? I SGN .   O4 ? ? ? 1_555 I IDS .   C1 ? ? I SGN 4   I IDS 5   1_555 ? ? ? ? ? ? ? 1.404 ? ? 
covale5  covale one ? I IDS .   O4 ? ? ? 1_555 I SGN .   C1 ? ? I IDS 5   I SGN 6   1_555 ? ? ? ? ? ? ? 1.424 ? ? 
covale6  covale one ? J IDS .   O4 ? ? ? 1_555 J SGN .   C1 ? ? J IDS 1   J SGN 2   1_555 ? ? ? ? ? ? ? 1.414 ? ? 
covale7  covale one ? J SGN .   O4 ? ? ? 1_555 J IDS .   C1 ? ? J SGN 2   J IDS 3   1_555 ? ? ? ? ? ? ? 1.421 ? ? 
covale8  covale one ? J IDS .   O4 ? ? ? 1_555 J SGN .   C1 ? ? J IDS 3   J SGN 4   1_555 ? ? ? ? ? ? ? 1.412 ? ? 
covale9  covale one ? J SGN .   O4 ? ? ? 1_555 J IDS .   C1 ? ? J SGN 4   J IDS 5   1_555 ? ? ? ? ? ? ? 1.407 ? ? 
covale10 covale one ? J IDS .   O4 ? ? ? 1_555 J SGN .   C1 ? ? J IDS 5   J SGN 6   1_555 ? ? ? ? ? ? ? 1.414 ? ? 
covale11 covale one ? J SGN .   O4 ? ? ? 1_555 J IDS .   C1 ? ? J SGN 6   J IDS 7   1_555 ? ? ? ? ? ? ? 1.396 ? ? 
covale12 covale one ? K IDS .   O4 ? ? ? 1_555 K SGN .   C1 ? ? K IDS 1   K SGN 2   1_555 ? ? ? ? ? ? ? 1.422 ? ? 
covale13 covale one ? K SGN .   O4 ? ? ? 1_555 K IDS .   C1 ? ? K SGN 2   K IDS 3   1_555 ? ? ? ? ? ? ? 1.407 ? ? 
covale14 covale one ? K IDS .   O4 ? ? ? 1_555 K SGN .   C1 ? ? K IDS 3   K SGN 4   1_555 ? ? ? ? ? ? ? 1.404 ? ? 
covale15 covale one ? K SGN .   O4 ? ? ? 1_555 K IDS .   C1 ? ? K SGN 4   K IDS 5   1_555 ? ? ? ? ? ? ? 1.395 ? ? 
covale16 covale one ? K IDS .   O4 ? ? ? 1_555 K SGN .   C1 ? ? K IDS 5   K SGN 6   1_555 ? ? ? ? ? ? ? 1.419 ? ? 
covale17 covale one ? K SGN .   O4 ? ? ? 1_555 K IDS .   C1 ? ? K SGN 6   K IDS 7   1_555 ? ? ? ? ? ? ? 1.405 ? ? 
covale18 covale one ? K IDS .   O4 ? ? ? 1_555 K SGN .   C1 ? ? K IDS 7   K SGN 8   1_555 ? ? ? ? ? ? ? 1.426 ? ? 
covale19 covale one ? L SGN .   O4 ? ? ? 1_555 L IDS .   C1 ? ? L SGN 1   L IDS 2   1_555 ? ? ? ? ? ? ? 1.400 ? ? 
covale20 covale one ? L IDS .   O4 ? ? ? 1_555 L SGN .   C1 ? ? L IDS 2   L SGN 3   1_555 ? ? ? ? ? ? ? 1.421 ? ? 
covale21 covale one ? L SGN .   O4 ? ? ? 1_555 L IDS .   C1 ? ? L SGN 3   L IDS 4   1_555 ? ? ? ? ? ? ? 1.411 ? ? 
covale22 covale one ? L IDS .   O4 ? ? ? 1_555 L SGN .   C1 ? ? L IDS 4   L SGN 5   1_555 ? ? ? ? ? ? ? 1.396 ? ? 
covale23 covale one ? L SGN .   O4 ? ? ? 1_555 L IDS .   C1 ? ? L SGN 5   L IDS 6   1_555 ? ? ? ? ? ? ? 1.398 ? ? 
covale24 covale one ? L IDS .   O4 ? ? ? 1_555 L SGN .   C1 ? ? L IDS 6   L SGN 7   1_555 ? ? ? ? ? ? ? 1.401 ? ? 
covale25 covale one ? L SGN .   O4 ? ? ? 1_555 L IDS .   C1 ? ? L SGN 7   L IDS 8   1_555 ? ? ? ? ? ? ? 1.400 ? ? 
covale26 covale one ? L IDS .   O4 ? ? ? 1_555 L SGN .   C1 ? ? L IDS 8   L SGN 9   1_555 ? ? ? ? ? ? ? 1.414 ? ? 
covale27 covale one ? M SGN .   O4 ? ? ? 1_555 M IDS .   C1 ? ? M SGN 1   M IDS 2   1_555 ? ? ? ? ? ? ? 1.403 ? ? 
covale28 covale one ? M IDS .   O4 ? ? ? 1_555 M SGN .   C1 ? ? M IDS 2   M SGN 3   1_555 ? ? ? ? ? ? ? 1.413 ? ? 
covale29 covale one ? M SGN .   O4 ? ? ? 1_555 M IDS .   C1 ? ? M SGN 3   M IDS 4   1_555 ? ? ? ? ? ? ? 1.403 ? ? 
covale30 covale one ? M IDS .   O4 ? ? ? 1_555 M SGN .   C1 ? ? M IDS 4   M SGN 5   1_555 ? ? ? ? ? ? ? 1.415 ? ? 
covale31 covale one ? M SGN .   O4 ? ? ? 1_555 M IDS .   C1 ? ? M SGN 5   M IDS 6   1_555 ? ? ? ? ? ? ? 1.408 ? ? 
covale32 covale one ? N SGN .   O4 ? ? ? 1_555 N IDS .   C1 ? ? N SGN 1   N IDS 2   1_555 ? ? ? ? ? ? ? 1.411 ? ? 
covale33 covale one ? N IDS .   O4 ? ? ? 1_555 N SGN .   C1 ? ? N IDS 2   N SGN 3   1_555 ? ? ? ? ? ? ? 1.428 ? ? 
covale34 covale one ? N SGN .   O4 ? ? ? 1_555 N IDS .   C1 ? ? N SGN 3   N IDS 4   1_555 ? ? ? ? ? ? ? 1.405 ? ? 
covale35 covale one ? N IDS .   O4 ? ? ? 1_555 N SGN .   C1 ? ? N IDS 4   N SGN 5   1_555 ? ? ? ? ? ? ? 1.430 ? ? 
covale36 covale one ? N SGN .   O4 ? ? ? 1_555 N IDS .   C1 ? ? N SGN 5   N IDS 6   1_555 ? ? ? ? ? ? ? 1.412 ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ILE 129 A . ? ILE 156 A PRO 130 A ? PRO 157 A 1 -1.69 
2 ILE 129 B . ? ILE 156 B PRO 130 B ? PRO 157 B 1 0.18  
3 ILE 129 C . ? ILE 156 C PRO 130 C ? PRO 157 C 1 -0.11 
4 ILE 129 D . ? ILE 156 D PRO 130 D ? PRO 157 D 1 0.15  
5 ILE 129 E . ? ILE 156 E PRO 130 E ? PRO 157 E 1 0.24  
6 ILE 129 F . ? ILE 156 F PRO 130 F ? PRO 157 F 1 0.38  
7 ILE 129 G . ? ILE 156 G PRO 130 G ? PRO 157 G 1 0.61  
8 ILE 129 H . ? ILE 156 H PRO 130 H ? PRO 157 H 1 0.19  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 5 ? 
AA2 ? 2 ? 
AA3 ? 2 ? 
AA4 ? 5 ? 
AA5 ? 2 ? 
AA6 ? 2 ? 
AA7 ? 5 ? 
AA8 ? 2 ? 
AA9 ? 2 ? 
AB1 ? 5 ? 
AB2 ? 2 ? 
AB3 ? 2 ? 
AB4 ? 5 ? 
AB5 ? 2 ? 
AB6 ? 5 ? 
AB7 ? 2 ? 
AB8 ? 2 ? 
AB9 ? 5 ? 
AC1 ? 2 ? 
AC2 ? 5 ? 
AC3 ? 2 ? 
AC4 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA4 4 5 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA7 3 4 ? anti-parallel 
AA7 4 5 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB1 2 3 ? anti-parallel 
AB1 3 4 ? anti-parallel 
AB1 4 5 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB4 3 4 ? anti-parallel 
AB4 4 5 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB6 2 3 ? anti-parallel 
AB6 3 4 ? anti-parallel 
AB6 4 5 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB8 1 2 ? anti-parallel 
AB9 1 2 ? anti-parallel 
AB9 2 3 ? anti-parallel 
AB9 3 4 ? anti-parallel 
AB9 4 5 ? anti-parallel 
AC1 1 2 ? anti-parallel 
AC2 1 2 ? anti-parallel 
AC2 2 3 ? anti-parallel 
AC2 3 4 ? anti-parallel 
AC2 4 5 ? anti-parallel 
AC3 1 2 ? anti-parallel 
AC4 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 PHE A 15  ? SER A 18  ? PHE A 42  SER A 45  
AA1 2 PHE A 89  ? ASN A 94  ? PHE A 116 ASN A 121 
AA1 3 ALA A 59  ? ASP A 63  ? ALA A 86  ASP A 90  
AA1 4 GLN A 68  ? PHE A 72  ? GLN A 95  PHE A 99  
AA1 5 LYS A 33  ? LYS A 36  ? LYS A 60  LYS A 63  
AA2 1 THR A 21  ? LYS A 25  ? THR A 48  LYS A 52  
AA2 2 VAL A 81  ? PHE A 85  ? VAL A 108 PHE A 112 
AA3 1 TRP A 161 ? PHE A 163 ? TRP A 188 PHE A 190 
AA3 2 TYR A 171 ? VAL A 173 ? TYR A 198 VAL A 200 
AA4 1 PHE B 15  ? ALA B 19  ? PHE B 42  ALA B 46  
AA4 2 PHE B 89  ? ASN B 94  ? PHE B 116 ASN B 121 
AA4 3 ALA B 59  ? ASP B 63  ? ALA B 86  ASP B 90  
AA4 4 GLN B 68  ? PHE B 72  ? GLN B 95  PHE B 99  
AA4 5 LYS B 33  ? LYS B 36  ? LYS B 60  LYS B 63  
AA5 1 THR B 22  ? ILE B 24  ? THR B 49  ILE B 51  
AA5 2 LYS B 82  ? GLU B 84  ? LYS B 109 GLU B 111 
AA6 1 TRP B 161 ? PHE B 163 ? TRP B 188 PHE B 190 
AA6 2 TYR B 171 ? VAL B 173 ? TYR B 198 VAL B 200 
AA7 1 PHE C 15  ? ALA C 19  ? PHE C 42  ALA C 46  
AA7 2 PHE C 89  ? ASN C 94  ? PHE C 116 ASN C 121 
AA7 3 ALA C 59  ? ASP C 63  ? ALA C 86  ASP C 90  
AA7 4 GLN C 68  ? PHE C 72  ? GLN C 95  PHE C 99  
AA7 5 LYS C 33  ? LYS C 36  ? LYS C 60  LYS C 63  
AA8 1 LEU C 23  ? LYS C 25  ? LEU C 50  LYS C 52  
AA8 2 VAL C 81  ? LYS C 83  ? VAL C 108 LYS C 110 
AA9 1 TRP C 161 ? PHE C 163 ? TRP C 188 PHE C 190 
AA9 2 TYR C 171 ? VAL C 173 ? TYR C 198 VAL C 200 
AB1 1 PHE D 15  ? ALA D 19  ? PHE D 42  ALA D 46  
AB1 2 PHE D 89  ? ASN D 94  ? PHE D 116 ASN D 121 
AB1 3 ALA D 59  ? ASP D 63  ? ALA D 86  ASP D 90  
AB1 4 GLN D 68  ? PHE D 72  ? GLN D 95  PHE D 99  
AB1 5 THR D 34  ? LYS D 36  ? THR D 61  LYS D 63  
AB2 1 THR D 22  ? LYS D 25  ? THR D 49  LYS D 52  
AB2 2 VAL D 81  ? GLU D 84  ? VAL D 108 GLU D 111 
AB3 1 TRP D 161 ? PHE D 163 ? TRP D 188 PHE D 190 
AB3 2 TYR D 171 ? VAL D 173 ? TYR D 198 VAL D 200 
AB4 1 PHE E 15  ? ILE E 24  ? PHE E 42  ILE E 51  
AB4 2 LYS E 82  ? ASN E 94  ? LYS E 109 ASN E 121 
AB4 3 ALA E 59  ? ASP E 63  ? ALA E 86  ASP E 90  
AB4 4 GLN E 68  ? PHE E 72  ? GLN E 95  PHE E 99  
AB4 5 LYS E 33  ? LYS E 36  ? LYS E 60  LYS E 63  
AB5 1 TRP E 161 ? PHE E 163 ? TRP E 188 PHE E 190 
AB5 2 TYR E 171 ? VAL E 173 ? TYR E 198 VAL E 200 
AB6 1 PHE F 15  ? ALA F 19  ? PHE F 42  ALA F 46  
AB6 2 ASP F 90  ? ASN F 94  ? ASP F 117 ASN F 121 
AB6 3 ALA F 59  ? ASP F 63  ? ALA F 86  ASP F 90  
AB6 4 GLN F 68  ? PHE F 72  ? GLN F 95  PHE F 99  
AB6 5 LYS F 33  ? LYS F 36  ? LYS F 60  LYS F 63  
AB7 1 LEU F 23  ? ILE F 24  ? LEU F 50  ILE F 51  
AB7 2 LYS F 82  ? LYS F 83  ? LYS F 109 LYS F 110 
AB8 1 TRP F 161 ? PHE F 163 ? TRP F 188 PHE F 190 
AB8 2 TYR F 171 ? VAL F 173 ? TYR F 198 VAL F 200 
AB9 1 PHE G 15  ? THR G 22  ? PHE G 42  THR G 49  
AB9 2 GLU G 84  ? ASN G 94  ? GLU G 111 ASN G 121 
AB9 3 ALA G 59  ? ASP G 63  ? ALA G 86  ASP G 90  
AB9 4 GLN G 68  ? PHE G 72  ? GLN G 95  PHE G 99  
AB9 5 LYS G 33  ? LYS G 36  ? LYS G 60  LYS G 63  
AC1 1 TRP G 161 ? PHE G 163 ? TRP G 188 PHE G 190 
AC1 2 TYR G 171 ? VAL G 173 ? TYR G 198 VAL G 200 
AC2 1 PHE H 15  ? ALA H 19  ? PHE H 42  ALA H 46  
AC2 2 PHE H 89  ? ASN H 94  ? PHE H 116 ASN H 121 
AC2 3 ALA H 59  ? ASP H 63  ? ALA H 86  ASP H 90  
AC2 4 GLN H 68  ? PHE H 72  ? GLN H 95  PHE H 99  
AC2 5 LYS H 33  ? LYS H 36  ? LYS H 60  LYS H 63  
AC3 1 THR H 22  ? ILE H 24  ? THR H 49  ILE H 51  
AC3 2 LYS H 82  ? GLU H 84  ? LYS H 109 GLU H 111 
AC4 1 TRP H 161 ? PHE H 163 ? TRP H 188 PHE H 190 
AC4 2 TYR H 171 ? VAL H 173 ? TYR H 198 VAL H 200 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N LYS A 16  ? N LYS A 43  O GLU A 93  ? O GLU A 120 
AA1 2 3 O TYR A 92  ? O TYR A 119 N PHE A 60  ? N PHE A 87  
AA1 3 4 N ALA A 59  ? N ALA A 86  O PHE A 72  ? O PHE A 99  
AA1 4 5 O CYS A 69  ? O CYS A 96  N LYS A 35  ? N LYS A 62  
AA2 1 2 N ILE A 24  ? N ILE A 51  O LYS A 82  ? O LYS A 109 
AA3 1 2 N CYS A 162 ? N CYS A 189 O GLU A 172 ? O GLU A 199 
AA4 1 2 N LYS B 16  ? N LYS B 43  O GLU B 93  ? O GLU B 120 
AA4 2 3 O TYR B 92  ? O TYR B 119 N PHE B 60  ? N PHE B 87  
AA4 3 4 N ALA B 59  ? N ALA B 86  O PHE B 72  ? O PHE B 99  
AA4 4 5 O TRP B 71  ? O TRP B 98  N LYS B 33  ? N LYS B 60  
AA5 1 2 N ILE B 24  ? N ILE B 51  O LYS B 82  ? O LYS B 109 
AA6 1 2 N CYS B 162 ? N CYS B 189 O GLU B 172 ? O GLU B 199 
AA7 1 2 N SER C 18  ? N SER C 45  O LEU C 91  ? O LEU C 118 
AA7 2 3 O TYR C 92  ? O TYR C 119 N PHE C 60  ? N PHE C 87  
AA7 3 4 N ALA C 59  ? N ALA C 86  O PHE C 72  ? O PHE C 99  
AA7 4 5 O CYS C 69  ? O CYS C 96  N LYS C 35  ? N LYS C 62  
AA8 1 2 N ILE C 24  ? N ILE C 51  O LYS C 82  ? O LYS C 109 
AA9 1 2 N CYS C 162 ? N CYS C 189 O GLU C 172 ? O GLU C 199 
AB1 1 2 N LYS D 16  ? N LYS D 43  O GLU D 93  ? O GLU D 120 
AB1 2 3 O TYR D 92  ? O TYR D 119 N PHE D 60  ? N PHE D 87  
AB1 3 4 N ALA D 59  ? N ALA D 86  O PHE D 72  ? O PHE D 99  
AB1 4 5 O CYS D 69  ? O CYS D 96  N LYS D 35  ? N LYS D 62  
AB2 1 2 N ILE D 24  ? N ILE D 51  O LYS D 82  ? O LYS D 109 
AB3 1 2 N CYS D 162 ? N CYS D 189 O GLU D 172 ? O GLU D 199 
AB4 1 2 N ILE E 24  ? N ILE E 51  O LYS E 82  ? O LYS E 109 
AB4 2 3 O TYR E 92  ? O TYR E 119 N PHE E 60  ? N PHE E 87  
AB4 3 4 N ALA E 59  ? N ALA E 86  O PHE E 72  ? O PHE E 99  
AB4 4 5 O CYS E 69  ? O CYS E 96  N LYS E 35  ? N LYS E 62  
AB5 1 2 N CYS E 162 ? N CYS E 189 O GLU E 172 ? O GLU E 199 
AB6 1 2 N LYS F 16  ? N LYS F 43  O GLU F 93  ? O GLU F 120 
AB6 2 3 O TYR F 92  ? O TYR F 119 N PHE F 60  ? N PHE F 87  
AB6 3 4 N ALA F 59  ? N ALA F 86  O PHE F 72  ? O PHE F 99  
AB6 4 5 O TRP F 71  ? O TRP F 98  N LYS F 33  ? N LYS F 60  
AB7 1 2 N ILE F 24  ? N ILE F 51  O LYS F 82  ? O LYS F 109 
AB8 1 2 N CYS F 162 ? N CYS F 189 O GLU F 172 ? O GLU F 199 
AB9 1 2 N SER G 18  ? N SER G 45  O LEU G 91  ? O LEU G 118 
AB9 2 3 O TYR G 92  ? O TYR G 119 N PHE G 60  ? N PHE G 87  
AB9 3 4 N ALA G 59  ? N ALA G 86  O PHE G 72  ? O PHE G 99  
AB9 4 5 O CYS G 69  ? O CYS G 96  N LYS G 35  ? N LYS G 62  
AC1 1 2 N CYS G 162 ? N CYS G 189 O GLU G 172 ? O GLU G 199 
AC2 1 2 N LYS H 16  ? N LYS H 43  O GLU H 93  ? O GLU H 120 
AC2 2 3 O ASP H 90  ? O ASP H 117 N PHE H 62  ? N PHE H 89  
AC2 3 4 N ALA H 59  ? N ALA H 86  O PHE H 72  ? O PHE H 99  
AC2 4 5 O CYS H 69  ? O CYS H 96  N LYS H 35  ? N LYS H 62  
AC3 1 2 N THR H 22  ? N THR H 49  O GLU H 84  ? O GLU H 111 
AC4 1 2 N CYS H 162 ? N CYS H 189 O GLU H 172 ? O GLU H 199 
# 
_database_PDB_matrix.entry_id          1GMO 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1GMO 
_atom_sites.fract_transf_matrix[1][1]   0.005565 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.005744 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.016694 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . ASN A  1 10  ? 15.249 9.780  8.703   1.00 59.00  ? 37   ASN A N   1 
ATOM   2     C CA  . ASN A  1 10  ? 15.146 11.217 8.315   1.00 58.86  ? 37   ASN A CA  1 
ATOM   3     C C   . ASN A  1 10  ? 15.649 12.133 9.423   1.00 58.41  ? 37   ASN A C   1 
ATOM   4     O O   . ASN A  1 10  ? 16.004 11.684 10.519  1.00 57.98  ? 37   ASN A O   1 
ATOM   5     C CB  . ASN A  1 10  ? 13.683 11.579 7.974   1.00 58.39  ? 37   ASN A CB  1 
ATOM   6     N N   . THR A  1 11  ? 15.683 13.417 9.073   1.00 57.63  ? 38   THR A N   1 
ATOM   7     C CA  . THR A  1 11  ? 16.064 14.549 9.910   1.00 56.50  ? 38   THR A CA  1 
ATOM   8     C C   . THR A  1 11  ? 16.928 14.373 11.147  1.00 55.82  ? 38   THR A C   1 
ATOM   9     O O   . THR A  1 11  ? 17.226 15.342 11.826  1.00 55.92  ? 38   THR A O   1 
ATOM   10    C CB  . THR A  1 11  ? 14.805 15.273 10.352  1.00 56.47  ? 38   THR A CB  1 
ATOM   11    O OG1 . THR A  1 11  ? 14.086 14.443 11.273  1.00 55.81  ? 38   THR A OG1 1 
ATOM   12    C CG2 . THR A  1 11  ? 13.925 15.557 9.141   1.00 56.80  ? 38   THR A CG2 1 
ATOM   13    N N   . ILE A  1 12  ? 17.337 13.165 11.467  1.00 56.31  ? 39   ILE A N   1 
ATOM   14    C CA  . ILE A  1 12  ? 18.136 13.014 12.661  1.00 56.33  ? 39   ILE A CA  1 
ATOM   15    C C   . ILE A  1 12  ? 19.539 13.529 12.376  1.00 57.68  ? 39   ILE A C   1 
ATOM   16    O O   . ILE A  1 12  ? 20.219 14.042 13.270  1.00 58.05  ? 39   ILE A O   1 
ATOM   17    C CB  . ILE A  1 12  ? 18.174 11.543 13.109  1.00 55.63  ? 39   ILE A CB  1 
ATOM   18    C CG1 . ILE A  1 12  ? 18.837 11.450 14.480  1.00 53.04  ? 39   ILE A CG1 1 
ATOM   19    C CG2 . ILE A  1 12  ? 18.843 10.684 12.034  1.00 54.59  ? 39   ILE A CG2 1 
ATOM   20    C CD1 . ILE A  1 12  ? 18.445 10.212 15.245  1.00 52.78  ? 39   ILE A CD1 1 
ATOM   21    N N   . HIS A  1 13  ? 19.943 13.419 11.110  1.00 58.11  ? 40   HIS A N   1 
ATOM   22    C CA  . HIS A  1 13  ? 21.265 13.842 10.660  1.00 57.49  ? 40   HIS A CA  1 
ATOM   23    C C   . HIS A  1 13  ? 21.499 15.340 10.580  1.00 55.48  ? 40   HIS A C   1 
ATOM   24    O O   . HIS A  1 13  ? 22.609 15.772 10.302  1.00 56.08  ? 40   HIS A O   1 
ATOM   25    C CB  . HIS A  1 13  ? 21.564 13.220 9.305   1.00 60.56  ? 40   HIS A CB  1 
ATOM   26    C CG  . HIS A  1 13  ? 21.671 11.731 9.348   1.00 65.13  ? 40   HIS A CG  1 
ATOM   27    N ND1 . HIS A  1 13  ? 22.531 11.072 10.203  1.00 66.34  ? 40   HIS A ND1 1 
ATOM   28    C CD2 . HIS A  1 13  ? 21.017 10.767 8.657   1.00 67.19  ? 40   HIS A CD2 1 
ATOM   29    C CE1 . HIS A  1 13  ? 22.401 9.768  10.038  1.00 67.60  ? 40   HIS A CE1 1 
ATOM   30    N NE2 . HIS A  1 13  ? 21.488 9.555  9.105   1.00 68.05  ? 40   HIS A NE2 1 
ATOM   31    N N   . GLU A  1 14  ? 20.460 16.129 10.818  1.00 52.42  ? 41   GLU A N   1 
ATOM   32    C CA  . GLU A  1 14  ? 20.575 17.578 10.779  1.00 48.96  ? 41   GLU A CA  1 
ATOM   33    C C   . GLU A  1 14  ? 20.911 18.104 12.182  1.00 46.93  ? 41   GLU A C   1 
ATOM   34    O O   . GLU A  1 14  ? 21.082 19.310 12.380  1.00 45.75  ? 41   GLU A O   1 
ATOM   35    C CB  . GLU A  1 14  ? 19.253 18.170 10.277  1.00 50.44  ? 41   GLU A CB  1 
ATOM   36    C CG  . GLU A  1 14  ? 18.920 17.782 8.825   1.00 52.00  ? 41   GLU A CG  1 
ATOM   37    C CD  . GLU A  1 14  ? 17.497 18.161 8.389   1.00 52.75  ? 41   GLU A CD  1 
ATOM   38    O OE1 . GLU A  1 14  ? 16.972 19.205 8.843   1.00 53.16  ? 41   GLU A OE1 1 
ATOM   39    O OE2 . GLU A  1 14  ? 16.909 17.414 7.571   1.00 51.76  ? 41   GLU A OE2 1 
ATOM   40    N N   . PHE A  1 15  ? 21.011 17.187 13.147  1.00 43.91  ? 42   PHE A N   1 
ATOM   41    C CA  . PHE A  1 15  ? 21.314 17.541 14.530  1.00 41.65  ? 42   PHE A CA  1 
ATOM   42    C C   . PHE A  1 15  ? 22.746 17.184 14.849  1.00 42.20  ? 42   PHE A C   1 
ATOM   43    O O   . PHE A  1 15  ? 23.360 16.406 14.132  1.00 42.43  ? 42   PHE A O   1 
ATOM   44    C CB  . PHE A  1 15  ? 20.413 16.783 15.509  1.00 38.53  ? 42   PHE A CB  1 
ATOM   45    C CG  . PHE A  1 15  ? 18.952 17.106 15.386  1.00 34.75  ? 42   PHE A CG  1 
ATOM   46    C CD1 . PHE A  1 15  ? 18.168 16.480 14.426  1.00 32.51  ? 42   PHE A CD1 1 
ATOM   47    C CD2 . PHE A  1 15  ? 18.362 18.042 16.237  1.00 32.96  ? 42   PHE A CD2 1 
ATOM   48    C CE1 . PHE A  1 15  ? 16.812 16.774 14.307  1.00 31.49  ? 42   PHE A CE1 1 
ATOM   49    C CE2 . PHE A  1 15  ? 17.017 18.344 16.129  1.00 31.82  ? 42   PHE A CE2 1 
ATOM   50    C CZ  . PHE A  1 15  ? 16.234 17.705 15.154  1.00 32.37  ? 42   PHE A CZ  1 
ATOM   51    N N   . LYS A  1 16  ? 23.261 17.752 15.936  1.00 42.90  ? 43   LYS A N   1 
ATOM   52    C CA  . LYS A  1 16  ? 24.621 17.504 16.397  1.00 44.31  ? 43   LYS A CA  1 
ATOM   53    C C   . LYS A  1 16  ? 24.535 16.543 17.578  1.00 47.60  ? 43   LYS A C   1 
ATOM   54    O O   . LYS A  1 16  ? 24.095 16.915 18.675  1.00 48.76  ? 43   LYS A O   1 
ATOM   55    C CB  . LYS A  1 16  ? 25.260 18.820 16.830  1.00 41.85  ? 43   LYS A CB  1 
ATOM   56    C CG  . LYS A  1 16  ? 26.605 18.707 17.512  1.00 39.71  ? 43   LYS A CG  1 
ATOM   57    C CD  . LYS A  1 16  ? 26.952 20.062 18.085  1.00 38.59  ? 43   LYS A CD  1 
ATOM   58    C CE  . LYS A  1 16  ? 28.197 20.039 18.931  1.00 39.02  ? 43   LYS A CE  1 
ATOM   59    N NZ  . LYS A  1 16  ? 28.368 21.342 19.625  1.00 39.27  ? 43   LYS A NZ  1 
ATOM   60    N N   . LYS A  1 17  ? 24.963 15.307 17.351  1.00 49.38  ? 44   LYS A N   1 
ATOM   61    C CA  . LYS A  1 17  ? 24.907 14.280 18.374  1.00 51.53  ? 44   LYS A CA  1 
ATOM   62    C C   . LYS A  1 17  ? 25.945 14.451 19.484  1.00 54.39  ? 44   LYS A C   1 
ATOM   63    O O   . LYS A  1 17  ? 27.040 14.940 19.242  1.00 56.60  ? 44   LYS A O   1 
ATOM   64    C CB  . LYS A  1 17  ? 25.079 12.933 17.694  1.00 49.89  ? 44   LYS A CB  1 
ATOM   65    C CG  . LYS A  1 17  ? 24.468 11.785 18.429  1.00 50.47  ? 44   LYS A CG  1 
ATOM   66    C CD  . LYS A  1 17  ? 24.358 10.589 17.515  1.00 48.50  ? 44   LYS A CD  1 
ATOM   67    C CE  . LYS A  1 17  ? 23.804 9.408  18.254  1.00 47.50  ? 44   LYS A CE  1 
ATOM   68    N NZ  . LYS A  1 17  ? 23.920 8.200  17.432  1.00 47.84  ? 44   LYS A NZ  1 
ATOM   69    N N   . SER A  1 18  ? 25.589 14.083 20.707  1.00 57.15  ? 45   SER A N   1 
ATOM   70    C CA  . SER A  1 18  ? 26.520 14.147 21.833  1.00 61.69  ? 45   SER A CA  1 
ATOM   71    C C   . SER A  1 18  ? 26.267 12.929 22.716  1.00 64.86  ? 45   SER A C   1 
ATOM   72    O O   . SER A  1 18  ? 25.540 13.001 23.719  1.00 66.63  ? 45   SER A O   1 
ATOM   73    C CB  . SER A  1 18  ? 26.339 15.424 22.647  1.00 61.61  ? 45   SER A CB  1 
ATOM   74    O OG  . SER A  1 18  ? 26.765 16.538 21.900  1.00 64.29  ? 45   SER A OG  1 
ATOM   75    N N   . ALA A  1 19  ? 26.874 11.809 22.320  1.00 66.24  ? 46   ALA A N   1 
ATOM   76    C CA  . ALA A  1 19  ? 26.746 10.531 23.012  1.00 66.43  ? 46   ALA A CA  1 
ATOM   77    C C   . ALA A  1 19  ? 26.789 10.596 24.536  1.00 67.48  ? 46   ALA A C   1 
ATOM   78    O O   . ALA A  1 19  ? 27.404 11.493 25.135  1.00 67.40  ? 46   ALA A O   1 
ATOM   79    C CB  . ALA A  1 19  ? 27.813 9.579  22.515  1.00 64.91  ? 46   ALA A CB  1 
ATOM   80    N N   . LYS A  1 20  ? 26.114 9.626  25.144  1.00 68.10  ? 47   LYS A N   1 
ATOM   81    C CA  . LYS A  1 20  ? 26.060 9.503  26.586  1.00 69.57  ? 47   LYS A CA  1 
ATOM   82    C C   . LYS A  1 20  ? 25.914 10.843 27.301  1.00 70.62  ? 47   LYS A C   1 
ATOM   83    O O   . LYS A  1 20  ? 26.642 11.123 28.257  1.00 70.99  ? 47   LYS A O   1 
ATOM   84    C CB  . LYS A  1 20  ? 27.309 8.784  27.074  1.00 70.24  ? 47   LYS A CB  1 
ATOM   85    N N   . THR A  1 21  ? 24.979 11.673 26.844  1.00 71.15  ? 48   THR A N   1 
ATOM   86    C CA  . THR A  1 21  ? 24.758 12.974 27.471  1.00 71.86  ? 48   THR A CA  1 
ATOM   87    C C   . THR A  1 21  ? 23.277 13.300 27.572  1.00 72.37  ? 48   THR A C   1 
ATOM   88    O O   . THR A  1 21  ? 22.445 12.679 26.917  1.00 70.71  ? 48   THR A O   1 
ATOM   89    C CB  . THR A  1 21  ? 25.449 14.121 26.683  1.00 71.61  ? 48   THR A CB  1 
ATOM   90    O OG1 . THR A  1 21  ? 26.812 13.771 26.418  1.00 71.87  ? 48   THR A OG1 1 
ATOM   91    C CG2 . THR A  1 21  ? 25.424 15.424 27.493  1.00 70.70  ? 48   THR A CG2 1 
ATOM   92    N N   . THR A  1 22  ? 22.972 14.284 28.409  1.00 73.95  ? 49   THR A N   1 
ATOM   93    C CA  . THR A  1 22  ? 21.616 14.764 28.619  1.00 75.98  ? 49   THR A CA  1 
ATOM   94    C C   . THR A  1 22  ? 21.743 16.113 29.323  1.00 77.27  ? 49   THR A C   1 
ATOM   95    O O   . THR A  1 22  ? 22.845 16.538 29.673  1.00 76.99  ? 49   THR A O   1 
ATOM   96    C CB  . THR A  1 22  ? 20.801 13.803 29.492  1.00 75.75  ? 49   THR A CB  1 
ATOM   97    O OG1 . THR A  1 22  ? 19.453 14.275 29.575  1.00 75.59  ? 49   THR A OG1 1 
ATOM   98    C CG2 . THR A  1 22  ? 21.394 13.724 30.892  1.00 77.08  ? 49   THR A CG2 1 
ATOM   99    N N   . LEU A  1 23  ? 20.633 16.785 29.569  1.00 78.89  ? 50   LEU A N   1 
ATOM   100   C CA  . LEU A  1 23  ? 20.739 18.083 30.206  1.00 80.87  ? 50   LEU A CA  1 
ATOM   101   C C   . LEU A  1 23  ? 20.017 18.147 31.540  1.00 82.00  ? 50   LEU A C   1 
ATOM   102   O O   . LEU A  1 23  ? 19.326 17.207 31.930  1.00 82.39  ? 50   LEU A O   1 
ATOM   103   C CB  . LEU A  1 23  ? 20.210 19.146 29.239  1.00 81.20  ? 50   LEU A CB  1 
ATOM   104   C CG  . LEU A  1 23  ? 20.887 19.101 27.858  1.00 80.74  ? 50   LEU A CG  1 
ATOM   105   C CD1 . LEU A  1 23  ? 19.940 19.625 26.796  1.00 79.95  ? 50   LEU A CD1 1 
ATOM   106   C CD2 . LEU A  1 23  ? 22.198 19.884 27.897  1.00 79.64  ? 50   LEU A CD2 1 
ATOM   107   N N   . ILE A  1 24  ? 20.200 19.252 32.251  1.00 83.51  ? 51   ILE A N   1 
ATOM   108   C CA  . ILE A  1 24  ? 19.547 19.436 33.540  1.00 85.78  ? 51   ILE A CA  1 
ATOM   109   C C   . ILE A  1 24  ? 19.125 20.896 33.694  1.00 87.52  ? 51   ILE A C   1 
ATOM   110   O O   . ILE A  1 24  ? 19.949 21.812 33.587  1.00 87.67  ? 51   ILE A O   1 
ATOM   111   C CB  . ILE A  1 24  ? 20.494 19.033 34.659  1.00 85.13  ? 51   ILE A CB  1 
ATOM   112   N N   . LYS A  1 25  ? 17.836 21.101 33.933  1.00 89.14  ? 52   LYS A N   1 
ATOM   113   C CA  . LYS A  1 25  ? 17.296 22.433 34.083  1.00 91.19  ? 52   LYS A CA  1 
ATOM   114   C C   . LYS A  1 25  ? 17.555 22.989 35.469  1.00 92.93  ? 52   LYS A C   1 
ATOM   115   O O   . LYS A  1 25  ? 16.905 22.589 36.447  1.00 92.72  ? 52   LYS A O   1 
ATOM   116   C CB  . LYS A  1 25  ? 15.807 22.412 33.808  1.00 90.81  ? 52   LYS A CB  1 
ATOM   117   N N   . ILE A  1 26  ? 18.526 23.894 35.558  1.00 95.52  ? 53   ILE A N   1 
ATOM   118   C CA  . ILE A  1 26  ? 18.853 24.535 36.833  1.00 97.89  ? 53   ILE A CA  1 
ATOM   119   C C   . ILE A  1 26  ? 17.741 25.535 37.143  1.00 99.41  ? 53   ILE A C   1 
ATOM   120   O O   . ILE A  1 26  ? 17.517 25.898 38.289  1.00 100.10 ? 53   ILE A O   1 
ATOM   121   C CB  . ILE A  1 26  ? 20.202 25.248 36.745  1.00 97.66  ? 53   ILE A CB  1 
ATOM   122   N N   . ASP A  1 27  ? 17.043 25.972 36.101  1.00 101.04 ? 54   ASP A N   1 
ATOM   123   C CA  . ASP A  1 27  ? 15.933 26.900 36.255  1.00 101.69 ? 54   ASP A CA  1 
ATOM   124   C C   . ASP A  1 27  ? 14.680 26.033 36.173  1.00 101.99 ? 54   ASP A C   1 
ATOM   125   O O   . ASP A  1 27  ? 14.455 25.333 35.180  1.00 102.06 ? 54   ASP A O   1 
ATOM   126   C CB  . ASP A  1 27  ? 15.922 27.944 35.120  1.00 101.79 ? 54   ASP A CB  1 
ATOM   127   C CG  . ASP A  1 27  ? 14.987 29.121 35.403  1.00 101.75 ? 54   ASP A CG  1 
ATOM   128   O OD1 . ASP A  1 27  ? 13.814 28.887 35.751  1.00 101.54 ? 54   ASP A OD1 1 
ATOM   129   O OD2 . ASP A  1 27  ? 15.425 30.280 35.257  1.00 101.17 ? 54   ASP A OD2 1 
ATOM   130   N N   . PRO A  1 28  ? 13.866 26.035 37.234  1.00 101.83 ? 55   PRO A N   1 
ATOM   131   C CA  . PRO A  1 28  ? 12.646 25.229 37.224  1.00 101.26 ? 55   PRO A CA  1 
ATOM   132   C C   . PRO A  1 28  ? 11.587 25.805 36.289  1.00 100.53 ? 55   PRO A C   1 
ATOM   133   O O   . PRO A  1 28  ? 10.568 25.169 36.028  1.00 100.47 ? 55   PRO A O   1 
ATOM   134   C CB  . PRO A  1 28  ? 12.215 25.263 38.685  1.00 101.67 ? 55   PRO A CB  1 
ATOM   135   C CG  . PRO A  1 28  ? 12.598 26.663 39.081  1.00 102.08 ? 55   PRO A CG  1 
ATOM   136   C CD  . PRO A  1 28  ? 13.991 26.790 38.494  1.00 101.99 ? 55   PRO A CD  1 
ATOM   137   N N   . ALA A  1 29  ? 11.844 27.011 35.786  1.00 99.58  ? 56   ALA A N   1 
ATOM   138   C CA  . ALA A  1 29  ? 10.909 27.707 34.895  1.00 98.88  ? 56   ALA A CA  1 
ATOM   139   C C   . ALA A  1 29  ? 10.867 27.232 33.434  1.00 98.18  ? 56   ALA A C   1 
ATOM   140   O O   . ALA A  1 29  ? 9.809  27.281 32.799  1.00 98.49  ? 56   ALA A O   1 
ATOM   141   C CB  . ALA A  1 29  ? 11.177 29.222 34.931  1.00 98.68  ? 56   ALA A CB  1 
ATOM   142   N N   . LEU A  1 30  ? 12.000 26.789 32.892  1.00 96.38  ? 57   LEU A N   1 
ATOM   143   C CA  . LEU A  1 30  ? 12.039 26.320 31.506  1.00 93.83  ? 57   LEU A CA  1 
ATOM   144   C C   . LEU A  1 30  ? 11.131 25.097 31.317  1.00 92.82  ? 57   LEU A C   1 
ATOM   145   O O   . LEU A  1 30  ? 11.184 24.144 32.098  1.00 93.16  ? 57   LEU A O   1 
ATOM   146   C CB  . LEU A  1 30  ? 13.477 25.988 31.111  1.00 93.33  ? 57   LEU A CB  1 
ATOM   147   C CG  . LEU A  1 30  ? 14.504 27.044 31.531  1.00 93.00  ? 57   LEU A CG  1 
ATOM   148   C CD1 . LEU A  1 30  ? 15.818 26.805 30.800  1.00 92.91  ? 57   LEU A CD1 1 
ATOM   149   C CD2 . LEU A  1 30  ? 13.972 28.427 31.210  1.00 93.10  ? 57   LEU A CD2 1 
ATOM   150   N N   . LYS A  1 31  ? 10.305 25.136 30.272  1.00 90.70  ? 58   LYS A N   1 
ATOM   151   C CA  . LYS A  1 31  ? 9.343  24.072 29.964  1.00 87.74  ? 58   LYS A CA  1 
ATOM   152   C C   . LYS A  1 31  ? 9.968  22.830 29.330  1.00 86.03  ? 58   LYS A C   1 
ATOM   153   O O   . LYS A  1 31  ? 11.043 22.902 28.736  1.00 86.56  ? 58   LYS A O   1 
ATOM   154   C CB  . LYS A  1 31  ? 8.286  24.628 29.011  1.00 87.51  ? 58   LYS A CB  1 
ATOM   155   C CG  . LYS A  1 31  ? 8.003  26.103 29.236  1.00 87.70  ? 58   LYS A CG  1 
ATOM   156   C CD  . LYS A  1 31  ? 7.149  26.720 28.134  1.00 87.43  ? 58   LYS A CD  1 
ATOM   157   C CE  . LYS A  1 31  ? 6.912  28.207 28.408  1.00 86.66  ? 58   LYS A CE  1 
ATOM   158   N NZ  . LYS A  1 31  ? 6.123  28.875 27.341  1.00 85.95  ? 58   LYS A NZ  1 
ATOM   159   N N   . ILE A  1 32  ? 9.299  21.686 29.456  1.00 83.46  ? 59   ILE A N   1 
ATOM   160   C CA  . ILE A  1 32  ? 9.803  20.462 28.838  1.00 81.49  ? 59   ILE A CA  1 
ATOM   161   C C   . ILE A  1 32  ? 8.622  19.627 28.376  1.00 79.54  ? 59   ILE A C   1 
ATOM   162   O O   . ILE A  1 32  ? 7.485  19.944 28.696  1.00 79.68  ? 59   ILE A O   1 
ATOM   163   C CB  . ILE A  1 32  ? 10.662 19.621 29.828  1.00 82.73  ? 59   ILE A CB  1 
ATOM   164   C CG1 . ILE A  1 32  ? 11.929 20.400 30.219  1.00 82.80  ? 59   ILE A CG1 1 
ATOM   165   C CG2 . ILE A  1 32  ? 11.042 18.275 29.193  1.00 82.86  ? 59   ILE A CG2 1 
ATOM   166   C CD1 . ILE A  1 32  ? 12.888 19.623 31.111  1.00 84.07  ? 59   ILE A CD1 1 
ATOM   167   N N   . LYS A  1 33  ? 8.876  18.576 27.607  1.00 77.99  ? 60   LYS A N   1 
ATOM   168   C CA  . LYS A  1 33  ? 7.802  17.692 27.156  1.00 77.00  ? 60   LYS A CA  1 
ATOM   169   C C   . LYS A  1 33  ? 8.419  16.391 26.658  1.00 76.36  ? 60   LYS A C   1 
ATOM   170   O O   . LYS A  1 33  ? 9.395  16.388 25.911  1.00 76.22  ? 60   LYS A O   1 
ATOM   171   C CB  . LYS A  1 33  ? 6.955  18.328 26.054  1.00 76.60  ? 60   LYS A CB  1 
ATOM   172   C CG  . LYS A  1 33  ? 5.620  17.613 25.884  1.00 76.79  ? 60   LYS A CG  1 
ATOM   173   C CD  . LYS A  1 33  ? 4.966  17.877 24.536  1.00 77.89  ? 60   LYS A CD  1 
ATOM   174   C CE  . LYS A  1 33  ? 3.794  16.916 24.289  1.00 78.09  ? 60   LYS A CE  1 
ATOM   175   N NZ  . LYS A  1 33  ? 3.331  16.925 22.865  1.00 77.78  ? 60   LYS A NZ  1 
ATOM   176   N N   . THR A  1 34  ? 7.811  15.285 27.064  1.00 75.67  ? 61   THR A N   1 
ATOM   177   C CA  . THR A  1 34  ? 8.310  13.945 26.769  1.00 74.97  ? 61   THR A CA  1 
ATOM   178   C C   . THR A  1 34  ? 7.266  12.980 26.212  1.00 75.00  ? 61   THR A C   1 
ATOM   179   O O   . THR A  1 34  ? 6.090  13.285 26.148  1.00 75.52  ? 61   THR A O   1 
ATOM   180   C CB  . THR A  1 34  ? 8.849  13.320 28.059  1.00 74.31  ? 61   THR A CB  1 
ATOM   181   O OG1 . THR A  1 34  ? 7.753  13.127 28.958  1.00 74.65  ? 61   THR A OG1 1 
ATOM   182   C CG2 . THR A  1 34  ? 9.849  14.249 28.725  1.00 74.66  ? 61   THR A CG2 1 
ATOM   183   N N   . LYS A  1 35  ? 7.725  11.798 25.826  1.00 74.95  ? 62   LYS A N   1 
ATOM   184   C CA  . LYS A  1 35  ? 6.873  10.741 25.302  1.00 76.35  ? 62   LYS A CA  1 
ATOM   185   C C   . LYS A  1 35  ? 7.743  9.517  25.031  1.00 78.24  ? 62   LYS A C   1 
ATOM   186   O O   . LYS A  1 35  ? 8.936  9.658  24.832  1.00 78.77  ? 62   LYS A O   1 
ATOM   187   C CB  . LYS A  1 35  ? 6.159  11.206 24.013  1.00 73.52  ? 62   LYS A CB  1 
ATOM   188   N N   . LYS A  1 36  ? 7.149  8.326  25.010  1.00 80.93  ? 63   LYS A N   1 
ATOM   189   C CA  . LYS A  1 36  ? 7.914  7.108  24.754  1.00 82.90  ? 63   LYS A CA  1 
ATOM   190   C C   . LYS A  1 36  ? 7.678  6.595  23.336  1.00 84.42  ? 63   LYS A C   1 
ATOM   191   O O   . LYS A  1 36  ? 6.552  6.270  22.949  1.00 83.97  ? 63   LYS A O   1 
ATOM   192   C CB  . LYS A  1 36  ? 7.570  6.047  25.768  1.00 82.47  ? 63   LYS A CB  1 
ATOM   193   N N   . VAL A  1 37  ? 8.757  6.493  22.572  1.00 86.58  ? 64   VAL A N   1 
ATOM   194   C CA  . VAL A  1 37  ? 8.624  6.048  21.195  1.00 88.94  ? 64   VAL A CA  1 
ATOM   195   C C   . VAL A  1 37  ? 9.457  4.797  20.915  1.00 90.33  ? 64   VAL A C   1 
ATOM   196   O O   . VAL A  1 37  ? 9.912  4.126  21.847  1.00 91.10  ? 64   VAL A O   1 
ATOM   197   C CB  . VAL A  1 37  ? 9.045  7.160  20.221  1.00 88.29  ? 64   VAL A CB  1 
ATOM   198   C CG1 . VAL A  1 37  ? 8.355  8.455  20.583  1.00 89.21  ? 64   VAL A CG1 1 
ATOM   199   C CG2 . VAL A  1 37  ? 10.546 7.353  20.268  1.00 89.49  ? 64   VAL A CG2 1 
ATOM   200   N N   . ASN A  1 38  ? 9.647  4.491  19.627  1.00 91.34  ? 65   ASN A N   1 
ATOM   201   C CA  . ASN A  1 38  ? 10.431 3.333  19.191  1.00 92.18  ? 65   ASN A CA  1 
ATOM   202   C C   . ASN A  1 38  ? 11.874 3.662  18.801  1.00 91.66  ? 65   ASN A C   1 
ATOM   203   O O   . ASN A  1 38  ? 12.786 2.919  19.151  1.00 91.98  ? 65   ASN A O   1 
ATOM   204   C CB  . ASN A  1 38  ? 9.751  2.631  18.012  1.00 93.92  ? 65   ASN A CB  1 
ATOM   205   C CG  . ASN A  1 38  ? 8.573  1.770  18.438  1.00 95.94  ? 65   ASN A CG  1 
ATOM   206   O OD1 . ASN A  1 38  ? 7.831  1.269  17.587  1.00 96.75  ? 65   ASN A OD1 1 
ATOM   207   N ND2 . ASN A  1 38  ? 8.402  1.577  19.752  1.00 96.27  ? 65   ASN A ND2 1 
ATOM   208   N N   . THR A  1 39  ? 12.094 4.756  18.076  1.00 90.26  ? 66   THR A N   1 
ATOM   209   C CA  . THR A  1 39  ? 13.454 5.118  17.669  1.00 88.60  ? 66   THR A CA  1 
ATOM   210   C C   . THR A  1 39  ? 13.737 6.589  17.927  1.00 88.30  ? 66   THR A C   1 
ATOM   211   O O   . THR A  1 39  ? 12.809 7.387  18.040  1.00 89.49  ? 66   THR A O   1 
ATOM   212   C CB  . THR A  1 39  ? 13.674 4.838  16.175  1.00 87.63  ? 66   THR A CB  1 
ATOM   213   O OG1 . THR A  1 39  ? 12.779 5.644  15.409  1.00 87.00  ? 66   THR A OG1 1 
ATOM   214   C CG2 . THR A  1 39  ? 13.402 3.377  15.862  1.00 86.35  ? 66   THR A CG2 1 
ATOM   215   N N   . ALA A  1 40  ? 15.014 6.949  18.024  1.00 87.28  ? 67   ALA A N   1 
ATOM   216   C CA  . ALA A  1 40  ? 15.383 8.341  18.259  1.00 86.29  ? 67   ALA A CA  1 
ATOM   217   C C   . ALA A  1 40  ? 14.922 9.170  17.064  1.00 85.39  ? 67   ALA A C   1 
ATOM   218   O O   . ALA A  1 40  ? 14.612 10.352 17.201  1.00 85.64  ? 67   ALA A O   1 
ATOM   219   C CB  . ALA A  1 40  ? 16.888 8.469  18.449  1.00 86.13  ? 67   ALA A CB  1 
ATOM   220   N N   . ASP A  1 41  ? 14.864 8.532  15.898  1.00 83.75  ? 68   ASP A N   1 
ATOM   221   C CA  . ASP A  1 41  ? 14.424 9.191  14.674  1.00 83.03  ? 68   ASP A CA  1 
ATOM   222   C C   . ASP A  1 41  ? 13.098 9.882  14.908  1.00 81.56  ? 68   ASP A C   1 
ATOM   223   O O   . ASP A  1 41  ? 12.876 10.995 14.444  1.00 82.92  ? 68   ASP A O   1 
ATOM   224   C CB  . ASP A  1 41  ? 14.254 8.168  13.563  1.00 84.49  ? 68   ASP A CB  1 
ATOM   225   C CG  . ASP A  1 41  ? 15.457 7.275  13.419  1.00 86.11  ? 68   ASP A CG  1 
ATOM   226   O OD1 . ASP A  1 41  ? 16.512 7.767  12.966  1.00 86.97  ? 68   ASP A OD1 1 
ATOM   227   O OD2 . ASP A  1 41  ? 15.350 6.080  13.769  1.00 87.42  ? 68   ASP A OD2 1 
ATOM   228   N N   . GLN A  1 42  ? 12.203 9.203  15.606  1.00 79.56  ? 69   GLN A N   1 
ATOM   229   C CA  . GLN A  1 42  ? 10.914 9.784  15.911  1.00 77.47  ? 69   GLN A CA  1 
ATOM   230   C C   . GLN A  1 42  ? 11.180 11.120 16.607  1.00 75.87  ? 69   GLN A C   1 
ATOM   231   O O   . GLN A  1 42  ? 10.758 12.170 16.133  1.00 76.01  ? 69   GLN A O   1 
ATOM   232   C CB  . GLN A  1 42  ? 10.124 8.853  16.823  1.00 78.14  ? 69   GLN A CB  1 
ATOM   233   N N   . CYS A  1 43  ? 11.910 11.080 17.714  1.00 73.49  ? 70   CYS A N   1 
ATOM   234   C CA  . CYS A  1 43  ? 12.205 12.296 18.454  1.00 72.27  ? 70   CYS A CA  1 
ATOM   235   C C   . CYS A  1 43  ? 12.652 13.407 17.520  1.00 70.95  ? 70   CYS A C   1 
ATOM   236   O O   . CYS A  1 43  ? 12.193 14.538 17.621  1.00 72.17  ? 70   CYS A O   1 
ATOM   237   C CB  . CYS A  1 43  ? 13.312 12.057 19.470  1.00 72.15  ? 70   CYS A CB  1 
ATOM   238   S SG  . CYS A  1 43  ? 13.066 10.651 20.588  1.00 72.98  ? 70   CYS A SG  1 
ATOM   239   N N   . ALA A  1 44  ? 13.564 13.066 16.617  1.00 69.09  ? 71   ALA A N   1 
ATOM   240   C CA  . ALA A  1 44  ? 14.117 14.011 15.652  1.00 66.44  ? 71   ALA A CA  1 
ATOM   241   C C   . ALA A  1 44  ? 13.022 14.587 14.799  1.00 64.87  ? 71   ALA A C   1 
ATOM   242   O O   . ALA A  1 44  ? 12.829 15.798 14.735  1.00 66.22  ? 71   ALA A O   1 
ATOM   243   C CB  . ALA A  1 44  ? 15.128 13.310 14.762  1.00 66.40  ? 71   ALA A CB  1 
ATOM   244   N N   . ASP A  1 45  ? 12.314 13.679 14.150  1.00 62.85  ? 72   ASP A N   1 
ATOM   245   C CA  . ASP A  1 45  ? 11.226 14.011 13.270  1.00 61.20  ? 72   ASP A CA  1 
ATOM   246   C C   . ASP A  1 45  ? 10.242 15.017 13.846  1.00 59.76  ? 72   ASP A C   1 
ATOM   247   O O   . ASP A  1 45  ? 9.927  16.012 13.204  1.00 59.76  ? 72   ASP A O   1 
ATOM   248   C CB  . ASP A  1 45  ? 10.488 12.742 12.878  1.00 63.16  ? 72   ASP A CB  1 
ATOM   249   C CG  . ASP A  1 45  ? 9.270  13.037 12.057  1.00 67.00  ? 72   ASP A CG  1 
ATOM   250   O OD1 . ASP A  1 45  ? 9.214  14.066 11.394  1.00 69.60  ? 72   ASP A OD1 1 
ATOM   251   O OD2 . ASP A  1 45  ? 8.287  12.142 12.082  1.00 69.53  ? 72   ASP A OD2 1 
ATOM   252   N N   . ARG A  1 46  ? 9.757  14.759 15.056  1.00 58.05  ? 73   ARG A N   1 
ATOM   253   C CA  . ARG A  1 46  ? 8.794  15.641 15.704  1.00 54.89  ? 73   ARG A CA  1 
ATOM   254   C C   . ARG A  1 46  ? 9.419  16.936 16.191  1.00 53.30  ? 73   ARG A C   1 
ATOM   255   O O   . ARG A  1 46  ? 8.716  17.904 16.429  1.00 53.75  ? 73   ARG A O   1 
ATOM   256   C CB  . ARG A  1 46  ? 8.118  14.919 16.861  1.00 54.59  ? 73   ARG A CB  1 
ATOM   257   N N   . CYS A  1 47  ? 10.735 16.956 16.351  1.00 52.09  ? 74   CYS A N   1 
ATOM   258   C CA  . CYS A  1 47  ? 11.421 18.166 16.790  1.00 51.54  ? 74   CYS A CA  1 
ATOM   259   C C   . CYS A  1 47  ? 11.633 19.060 15.574  1.00 51.27  ? 74   CYS A C   1 
ATOM   260   O O   . CYS A  1 47  ? 11.382 20.259 15.624  1.00 51.51  ? 74   CYS A O   1 
ATOM   261   C CB  . CYS A  1 47  ? 12.759 17.807 17.434  1.00 50.63  ? 74   CYS A CB  1 
ATOM   262   S SG  . CYS A  1 47  ? 13.791 19.201 17.987  1.00 52.54  ? 74   CYS A SG  1 
ATOM   263   N N   . THR A  1 48  ? 12.078 18.467 14.473  1.00 51.51  ? 75   THR A N   1 
ATOM   264   C CA  . THR A  1 48  ? 12.306 19.225 13.253  1.00 52.37  ? 75   THR A CA  1 
ATOM   265   C C   . THR A  1 48  ? 11.013 19.925 12.857  1.00 52.84  ? 75   THR A C   1 
ATOM   266   O O   . THR A  1 48  ? 11.013 21.118 12.563  1.00 53.96  ? 75   THR A O   1 
ATOM   267   C CB  . THR A  1 48  ? 12.747 18.315 12.104  1.00 51.76  ? 75   THR A CB  1 
ATOM   268   O OG1 . THR A  1 48  ? 13.731 17.394 12.582  1.00 53.14  ? 75   THR A OG1 1 
ATOM   269   C CG2 . THR A  1 48  ? 13.364 19.137 10.992  1.00 52.39  ? 75   THR A CG2 1 
ATOM   270   N N   . ARG A  1 49  ? 9.917  19.172 12.863  1.00 52.67  ? 76   ARG A N   1 
ATOM   271   C CA  . ARG A  1 49  ? 8.594  19.688 12.516  1.00 52.45  ? 76   ARG A CA  1 
ATOM   272   C C   . ARG A  1 49  ? 8.022  20.515 13.661  1.00 51.26  ? 76   ARG A C   1 
ATOM   273   O O   . ARG A  1 49  ? 6.985  21.156 13.518  1.00 50.30  ? 76   ARG A O   1 
ATOM   274   C CB  . ARG A  1 49  ? 7.625  18.532 12.259  1.00 55.53  ? 76   ARG A CB  1 
ATOM   275   C CG  . ARG A  1 49  ? 8.029  17.527 11.186  1.00 58.75  ? 76   ARG A CG  1 
ATOM   276   C CD  . ARG A  1 49  ? 7.571  16.129 11.601  1.00 61.70  ? 76   ARG A CD  1 
ATOM   277   N NE  . ARG A  1 49  ? 6.732  15.444 10.616  1.00 64.42  ? 76   ARG A NE  1 
ATOM   278   C CZ  . ARG A  1 49  ? 5.405  15.538 10.558  1.00 65.38  ? 76   ARG A CZ  1 
ATOM   279   N NH1 . ARG A  1 49  ? 4.750  16.294 11.430  1.00 65.75  ? 76   ARG A NH1 1 
ATOM   280   N NH2 . ARG A  1 49  ? 4.729  14.867 9.635   1.00 66.14  ? 76   ARG A NH2 1 
ATOM   281   N N   . ASN A  1 50  ? 8.703  20.485 14.800  1.00 50.96  ? 77   ASN A N   1 
ATOM   282   C CA  . ASN A  1 50  ? 8.261  21.193 15.998  1.00 50.51  ? 77   ASN A CA  1 
ATOM   283   C C   . ASN A  1 50  ? 6.766  20.973 16.255  1.00 51.49  ? 77   ASN A C   1 
ATOM   284   O O   . ASN A  1 50  ? 6.108  21.828 16.838  1.00 52.34  ? 77   ASN A O   1 
ATOM   285   C CB  . ASN A  1 50  ? 8.543  22.695 15.879  1.00 48.84  ? 77   ASN A CB  1 
ATOM   286   C CG  . ASN A  1 50  ? 8.614  23.380 17.230  1.00 48.39  ? 77   ASN A CG  1 
ATOM   287   O OD1 . ASN A  1 50  ? 9.691  23.752 17.700  1.00 47.63  ? 77   ASN A OD1 1 
ATOM   288   N ND2 . ASN A  1 50  ? 7.465  23.539 17.870  1.00 49.74  ? 77   ASN A ND2 1 
ATOM   289   N N   . LYS A  1 51  ? 6.213  19.842 15.813  1.00 52.58  ? 78   LYS A N   1 
ATOM   290   C CA  . LYS A  1 51  ? 4.781  19.565 16.026  1.00 53.32  ? 78   LYS A CA  1 
ATOM   291   C C   . LYS A  1 51  ? 4.466  19.104 17.463  1.00 53.98  ? 78   LYS A C   1 
ATOM   292   O O   . LYS A  1 51  ? 5.158  18.258 18.023  1.00 54.62  ? 78   LYS A O   1 
ATOM   293   C CB  . LYS A  1 51  ? 4.281  18.517 15.013  1.00 51.34  ? 78   LYS A CB  1 
ATOM   294   N N   . GLY A  1 52  ? 3.427  19.686 18.053  1.00 54.23  ? 79   GLY A N   1 
ATOM   295   C CA  . GLY A  1 52  ? 3.014  19.335 19.399  1.00 55.04  ? 79   GLY A CA  1 
ATOM   296   C C   . GLY A  1 52  ? 3.876  19.850 20.537  1.00 56.70  ? 79   GLY A C   1 
ATOM   297   O O   . GLY A  1 52  ? 3.770  19.369 21.662  1.00 56.69  ? 79   GLY A O   1 
ATOM   298   N N   . LEU A  1 53  ? 4.720  20.835 20.270  1.00 57.72  ? 80   LEU A N   1 
ATOM   299   C CA  . LEU A  1 53  ? 5.584  21.349 21.320  1.00 59.87  ? 80   LEU A CA  1 
ATOM   300   C C   . LEU A  1 53  ? 5.311  22.819 21.594  1.00 59.64  ? 80   LEU A C   1 
ATOM   301   O O   . LEU A  1 53  ? 5.541  23.671 20.743  1.00 59.37  ? 80   LEU A O   1 
ATOM   302   C CB  . LEU A  1 53  ? 7.050  21.142 20.927  1.00 62.61  ? 80   LEU A CB  1 
ATOM   303   C CG  . LEU A  1 53  ? 7.386  19.722 20.429  1.00 64.10  ? 80   LEU A CG  1 
ATOM   304   C CD1 . LEU A  1 53  ? 8.812  19.658 19.908  1.00 63.11  ? 80   LEU A CD1 1 
ATOM   305   C CD2 . LEU A  1 53  ? 7.187  18.729 21.559  1.00 64.93  ? 80   LEU A CD2 1 
ATOM   306   N N   . PRO A  1 54  ? 4.808  23.129 22.796  1.00 59.55  ? 81   PRO A N   1 
ATOM   307   C CA  . PRO A  1 54  ? 4.483  24.493 23.229  1.00 59.08  ? 81   PRO A CA  1 
ATOM   308   C C   . PRO A  1 54  ? 5.687  25.417 23.325  1.00 58.06  ? 81   PRO A C   1 
ATOM   309   O O   . PRO A  1 54  ? 5.717  26.330 24.156  1.00 57.95  ? 81   PRO A O   1 
ATOM   310   C CB  . PRO A  1 54  ? 3.814  24.274 24.584  1.00 59.49  ? 81   PRO A CB  1 
ATOM   311   C CG  . PRO A  1 54  ? 4.498  23.051 25.089  1.00 60.22  ? 81   PRO A CG  1 
ATOM   312   C CD  . PRO A  1 54  ? 4.512  22.163 23.866  1.00 59.51  ? 81   PRO A CD  1 
ATOM   313   N N   . PHE A  1 55  ? 6.673  25.164 22.472  1.00 56.62  ? 82   PHE A N   1 
ATOM   314   C CA  . PHE A  1 55  ? 7.895  25.960 22.421  1.00 55.88  ? 82   PHE A CA  1 
ATOM   315   C C   . PHE A  1 55  ? 8.709  25.544 21.201  1.00 53.86  ? 82   PHE A C   1 
ATOM   316   O O   . PHE A  1 55  ? 8.348  24.603 20.492  1.00 52.33  ? 82   PHE A O   1 
ATOM   317   C CB  . PHE A  1 55  ? 8.719  25.756 23.705  1.00 59.52  ? 82   PHE A CB  1 
ATOM   318   C CG  . PHE A  1 55  ? 9.012  24.300 24.029  1.00 62.97  ? 82   PHE A CG  1 
ATOM   319   C CD1 . PHE A  1 55  ? 9.874  23.545 23.232  1.00 63.87  ? 82   PHE A CD1 1 
ATOM   320   C CD2 . PHE A  1 55  ? 8.401  23.680 25.116  1.00 63.87  ? 82   PHE A CD2 1 
ATOM   321   C CE1 . PHE A  1 55  ? 10.117 22.201 23.510  1.00 64.83  ? 82   PHE A CE1 1 
ATOM   322   C CE2 . PHE A  1 55  ? 8.640  22.336 25.400  1.00 64.69  ? 82   PHE A CE2 1 
ATOM   323   C CZ  . PHE A  1 55  ? 9.499  21.595 24.594  1.00 65.43  ? 82   PHE A CZ  1 
ATOM   324   N N   . THR A  1 56  ? 9.804  26.247 20.950  1.00 52.13  ? 83   THR A N   1 
ATOM   325   C CA  . THR A  1 56  ? 10.664 25.913 19.822  1.00 50.13  ? 83   THR A CA  1 
ATOM   326   C C   . THR A  1 56  ? 11.588 24.791 20.281  1.00 49.20  ? 83   THR A C   1 
ATOM   327   O O   . THR A  1 56  ? 12.330 24.963 21.251  1.00 48.37  ? 83   THR A O   1 
ATOM   328   C CB  . THR A  1 56  ? 11.549 27.111 19.408  1.00 50.81  ? 83   THR A CB  1 
ATOM   329   O OG1 . THR A  1 56  ? 10.748 28.296 19.317  1.00 49.93  ? 83   THR A OG1 1 
ATOM   330   C CG2 . THR A  1 56  ? 12.210 26.842 18.064  1.00 49.77  ? 83   THR A CG2 1 
ATOM   331   N N   . CYS A  1 57  ? 11.548 23.648 19.598  1.00 48.16  ? 84   CYS A N   1 
ATOM   332   C CA  . CYS A  1 57  ? 12.406 22.524 19.966  1.00 47.32  ? 84   CYS A CA  1 
ATOM   333   C C   . CYS A  1 57  ? 13.840 22.780 19.528  1.00 46.34  ? 84   CYS A C   1 
ATOM   334   O O   . CYS A  1 57  ? 14.195 22.538 18.378  1.00 46.09  ? 84   CYS A O   1 
ATOM   335   C CB  . CYS A  1 57  ? 11.910 21.222 19.335  1.00 48.17  ? 84   CYS A CB  1 
ATOM   336   S SG  . CYS A  1 57  ? 13.001 19.826 19.763  1.00 53.43  ? 84   CYS A SG  1 
ATOM   337   N N   . LYS A  1 58  ? 14.658 23.274 20.450  1.00 45.33  ? 85   LYS A N   1 
ATOM   338   C CA  . LYS A  1 58  ? 16.053 23.575 20.165  1.00 45.83  ? 85   LYS A CA  1 
ATOM   339   C C   . LYS A  1 58  ? 16.966 22.359 20.314  1.00 48.00  ? 85   LYS A C   1 
ATOM   340   O O   . LYS A  1 58  ? 18.057 22.305 19.740  1.00 47.74  ? 85   LYS A O   1 
ATOM   341   C CB  . LYS A  1 58  ? 16.544 24.681 21.086  1.00 42.87  ? 85   LYS A CB  1 
ATOM   342   C CG  . LYS A  1 58  ? 15.706 25.923 21.021  1.00 43.48  ? 85   LYS A CG  1 
ATOM   343   C CD  . LYS A  1 58  ? 16.345 27.063 21.795  1.00 42.51  ? 85   LYS A CD  1 
ATOM   344   C CE  . LYS A  1 58  ? 15.474 28.309 21.749  1.00 41.25  ? 85   LYS A CE  1 
ATOM   345   N NZ  . LYS A  1 58  ? 16.113 29.444 22.459  1.00 41.90  ? 85   LYS A NZ  1 
ATOM   346   N N   . ALA A  1 59  ? 16.515 21.381 21.087  1.00 50.46  ? 86   ALA A N   1 
ATOM   347   C CA  . ALA A  1 59  ? 17.301 20.183 21.320  1.00 52.85  ? 86   ALA A CA  1 
ATOM   348   C C   . ALA A  1 59  ? 16.443 19.096 21.922  1.00 55.53  ? 86   ALA A C   1 
ATOM   349   O O   . ALA A  1 59  ? 15.400 19.378 22.499  1.00 57.16  ? 86   ALA A O   1 
ATOM   350   C CB  . ALA A  1 59  ? 18.451 20.498 22.246  1.00 52.07  ? 86   ALA A CB  1 
ATOM   351   N N   . PHE A  1 60  ? 16.884 17.850 21.780  1.00 58.51  ? 87   PHE A N   1 
ATOM   352   C CA  . PHE A  1 60  ? 16.157 16.720 22.324  1.00 60.97  ? 87   PHE A CA  1 
ATOM   353   C C   . PHE A  1 60  ? 17.104 15.607 22.717  1.00 63.86  ? 87   PHE A C   1 
ATOM   354   O O   . PHE A  1 60  ? 18.151 15.419 22.104  1.00 64.31  ? 87   PHE A O   1 
ATOM   355   C CB  . PHE A  1 60  ? 15.128 16.211 21.309  1.00 59.26  ? 87   PHE A CB  1 
ATOM   356   C CG  . PHE A  1 60  ? 15.696 15.335 20.239  1.00 59.79  ? 87   PHE A CG  1 
ATOM   357   C CD1 . PHE A  1 60  ? 16.053 14.020 20.510  1.00 60.86  ? 87   PHE A CD1 1 
ATOM   358   C CD2 . PHE A  1 60  ? 15.850 15.811 18.945  1.00 60.29  ? 87   PHE A CD2 1 
ATOM   359   C CE1 . PHE A  1 60  ? 16.554 13.190 19.502  1.00 61.14  ? 87   PHE A CE1 1 
ATOM   360   C CE2 . PHE A  1 60  ? 16.349 14.991 17.933  1.00 60.13  ? 87   PHE A CE2 1 
ATOM   361   C CZ  . PHE A  1 60  ? 16.700 13.680 18.214  1.00 60.49  ? 87   PHE A CZ  1 
ATOM   362   N N   . VAL A  1 61  ? 16.728 14.876 23.757  1.00 67.97  ? 88   VAL A N   1 
ATOM   363   C CA  . VAL A  1 61  ? 17.519 13.751 24.248  1.00 70.92  ? 88   VAL A CA  1 
ATOM   364   C C   . VAL A  1 61  ? 16.725 12.470 24.059  1.00 72.94  ? 88   VAL A C   1 
ATOM   365   O O   . VAL A  1 61  ? 15.501 12.474 24.146  1.00 73.76  ? 88   VAL A O   1 
ATOM   366   C CB  . VAL A  1 61  ? 17.832 13.888 25.746  1.00 70.05  ? 88   VAL A CB  1 
ATOM   367   C CG1 . VAL A  1 61  ? 18.478 12.621 26.243  1.00 70.73  ? 88   VAL A CG1 1 
ATOM   368   C CG2 . VAL A  1 61  ? 18.742 15.081 25.986  1.00 71.05  ? 88   VAL A CG2 1 
ATOM   369   N N   . PHE A  1 62  ? 17.412 11.374 23.780  1.00 76.00  ? 89   PHE A N   1 
ATOM   370   C CA  . PHE A  1 62  ? 16.721 10.105 23.622  1.00 79.54  ? 89   PHE A CA  1 
ATOM   371   C C   . PHE A  1 62  ? 17.242 9.171  24.697  1.00 81.79  ? 89   PHE A C   1 
ATOM   372   O O   . PHE A  1 62  ? 18.446 8.949  24.783  1.00 83.46  ? 89   PHE A O   1 
ATOM   373   C CB  . PHE A  1 62  ? 16.977 9.497  22.251  1.00 80.54  ? 89   PHE A CB  1 
ATOM   374   C CG  . PHE A  1 62  ? 16.293 8.186  22.053  1.00 81.80  ? 89   PHE A CG  1 
ATOM   375   C CD1 . PHE A  1 62  ? 14.914 8.089  22.187  1.00 83.13  ? 89   PHE A CD1 1 
ATOM   376   C CD2 . PHE A  1 62  ? 17.020 7.046  21.739  1.00 82.43  ? 89   PHE A CD2 1 
ATOM   377   C CE1 . PHE A  1 62  ? 14.264 6.872  22.009  1.00 84.51  ? 89   PHE A CE1 1 
ATOM   378   C CE2 . PHE A  1 62  ? 16.385 5.823  21.558  1.00 82.82  ? 89   PHE A CE2 1 
ATOM   379   C CZ  . PHE A  1 62  ? 15.003 5.733  21.693  1.00 84.07  ? 89   PHE A CZ  1 
ATOM   380   N N   . ASP A  1 63  ? 16.339 8.647  25.530  1.00 83.73  ? 90   ASP A N   1 
ATOM   381   C CA  . ASP A  1 63  ? 16.712 7.739  26.623  1.00 84.54  ? 90   ASP A CA  1 
ATOM   382   C C   . ASP A  1 63  ? 16.503 6.305  26.187  1.00 85.36  ? 90   ASP A C   1 
ATOM   383   O O   . ASP A  1 63  ? 15.492 5.698  26.532  1.00 85.58  ? 90   ASP A O   1 
ATOM   384   C CB  . ASP A  1 63  ? 15.878 8.022  27.876  1.00 83.61  ? 90   ASP A CB  1 
ATOM   385   N N   . LYS A  1 64  ? 17.469 5.782  25.431  1.00 86.09  ? 91   LYS A N   1 
ATOM   386   C CA  . LYS A  1 64  ? 17.442 4.415  24.906  1.00 85.93  ? 91   LYS A CA  1 
ATOM   387   C C   . LYS A  1 64  ? 16.935 3.396  25.927  1.00 86.03  ? 91   LYS A C   1 
ATOM   388   O O   . LYS A  1 64  ? 16.308 2.397  25.559  1.00 85.20  ? 91   LYS A O   1 
ATOM   389   C CB  . LYS A  1 64  ? 18.838 4.024  24.418  1.00 85.21  ? 91   LYS A CB  1 
ATOM   390   N N   . ALA A  1 65  ? 17.210 3.657  27.204  1.00 86.47  ? 92   ALA A N   1 
ATOM   391   C CA  . ALA A  1 65  ? 16.773 2.776  28.278  1.00 87.00  ? 92   ALA A CA  1 
ATOM   392   C C   . ALA A  1 65  ? 15.252 2.654  28.252  1.00 87.71  ? 92   ALA A C   1 
ATOM   393   O O   . ALA A  1 65  ? 14.702 1.573  27.996  1.00 87.63  ? 92   ALA A O   1 
ATOM   394   C CB  . ALA A  1 65  ? 17.235 3.328  29.626  1.00 87.07  ? 92   ALA A CB  1 
ATOM   395   N N   . ARG A  1 66  ? 14.583 3.778  28.500  1.00 87.40  ? 93   ARG A N   1 
ATOM   396   C CA  . ARG A  1 66  ? 13.124 3.837  28.518  1.00 85.52  ? 93   ARG A CA  1 
ATOM   397   C C   . ARG A  1 66  ? 12.514 3.818  27.113  1.00 84.25  ? 93   ARG A C   1 
ATOM   398   O O   . ARG A  1 66  ? 11.460 3.216  26.896  1.00 83.85  ? 93   ARG A O   1 
ATOM   399   C CB  . ARG A  1 66  ? 12.692 5.108  29.246  1.00 85.36  ? 93   ARG A CB  1 
ATOM   400   C CG  . ARG A  1 66  ? 13.418 5.325  30.558  1.00 85.85  ? 93   ARG A CG  1 
ATOM   401   C CD  . ARG A  1 66  ? 12.972 6.615  31.214  1.00 86.96  ? 93   ARG A CD  1 
ATOM   402   N NE  . ARG A  1 66  ? 13.372 6.689  32.616  1.00 87.63  ? 93   ARG A NE  1 
ATOM   403   C CZ  . ARG A  1 66  ? 13.053 7.688  33.432  1.00 87.64  ? 93   ARG A CZ  1 
ATOM   404   N NH1 . ARG A  1 66  ? 12.330 8.707  32.986  1.00 88.19  ? 93   ARG A NH1 1 
ATOM   405   N NH2 . ARG A  1 66  ? 13.446 7.664  34.697  1.00 88.00  ? 93   ARG A NH2 1 
ATOM   406   N N   . LYS A  1 67  ? 13.210 4.458  26.171  1.00 83.13  ? 94   LYS A N   1 
ATOM   407   C CA  . LYS A  1 67  ? 12.784 4.617  24.771  1.00 81.50  ? 94   LYS A CA  1 
ATOM   408   C C   . LYS A  1 67  ? 11.865 5.843  24.760  1.00 81.04  ? 94   LYS A C   1 
ATOM   409   O O   . LYS A  1 67  ? 10.792 5.853  24.142  1.00 79.84  ? 94   LYS A O   1 
ATOM   410   C CB  . LYS A  1 67  ? 12.042 3.377  24.251  1.00 80.10  ? 94   LYS A CB  1 
ATOM   411   C CG  . LYS A  1 67  ? 12.954 2.274  23.761  1.00 77.20  ? 94   LYS A CG  1 
ATOM   412   C CD  . LYS A  1 67  ? 12.211 1.353  22.815  1.00 75.09  ? 94   LYS A CD  1 
ATOM   413   C CE  . LYS A  1 67  ? 13.160 0.365  22.161  1.00 74.70  ? 94   LYS A CE  1 
ATOM   414   N NZ  . LYS A  1 67  ? 12.534 -0.389 21.034  1.00 74.90  ? 94   LYS A NZ  1 
ATOM   415   N N   . GLN A  1 68  ? 12.338 6.882  25.450  1.00 80.13  ? 95   GLN A N   1 
ATOM   416   C CA  . GLN A  1 68  ? 11.608 8.130  25.634  1.00 78.86  ? 95   GLN A CA  1 
ATOM   417   C C   . GLN A  1 68  ? 12.360 9.366  25.114  1.00 77.53  ? 95   GLN A C   1 
ATOM   418   O O   . GLN A  1 68  ? 13.579 9.465  25.253  1.00 78.45  ? 95   GLN A O   1 
ATOM   419   C CB  . GLN A  1 68  ? 11.308 8.278  27.134  1.00 78.66  ? 95   GLN A CB  1 
ATOM   420   C CG  . GLN A  1 68  ? 10.906 9.659  27.602  1.00 80.10  ? 95   GLN A CG  1 
ATOM   421   C CD  . GLN A  1 68  ? 11.091 9.839  29.107  1.00 80.60  ? 95   GLN A CD  1 
ATOM   422   O OE1 . GLN A  1 68  ? 12.198 9.700  29.626  1.00 79.33  ? 95   GLN A OE1 1 
ATOM   423   N NE2 . GLN A  1 68  ? 10.002 10.145 29.811  1.00 81.86  ? 95   GLN A NE2 1 
ATOM   424   N N   . CYS A  1 69  ? 11.629 10.303 24.507  1.00 75.06  ? 96   CYS A N   1 
ATOM   425   C CA  . CYS A  1 69  ? 12.233 11.532 24.002  1.00 71.21  ? 96   CYS A CA  1 
ATOM   426   C C   . CYS A  1 69  ? 12.151 12.596 25.075  1.00 69.00  ? 96   CYS A C   1 
ATOM   427   O O   . CYS A  1 69  ? 11.373 12.490 26.009  1.00 69.24  ? 96   CYS A O   1 
ATOM   428   C CB  . CYS A  1 69  ? 11.493 12.067 22.789  1.00 69.94  ? 96   CYS A CB  1 
ATOM   429   S SG  . CYS A  1 69  ? 11.228 10.938 21.392  1.00 72.00  ? 96   CYS A SG  1 
ATOM   430   N N   . LEU A  1 70  ? 12.968 13.624 24.938  1.00 67.37  ? 97   LEU A N   1 
ATOM   431   C CA  . LEU A  1 70  ? 12.964 14.732 25.878  1.00 67.20  ? 97   LEU A CA  1 
ATOM   432   C C   . LEU A  1 70  ? 13.262 16.020 25.117  1.00 67.29  ? 97   LEU A C   1 
ATOM   433   O O   . LEU A  1 70  ? 14.422 16.426 24.976  1.00 67.89  ? 97   LEU A O   1 
ATOM   434   C CB  . LEU A  1 70  ? 14.000 14.533 26.983  1.00 66.54  ? 97   LEU A CB  1 
ATOM   435   C CG  . LEU A  1 70  ? 13.671 13.530 28.083  1.00 65.92  ? 97   LEU A CG  1 
ATOM   436   C CD1 . LEU A  1 70  ? 13.772 12.107 27.546  1.00 64.18  ? 97   LEU A CD1 1 
ATOM   437   C CD2 . LEU A  1 70  ? 14.637 13.753 29.245  1.00 64.52  ? 97   LEU A CD2 1 
ATOM   438   N N   . TRP A  1 71  ? 12.199 16.649 24.621  1.00 65.69  ? 98   TRP A N   1 
ATOM   439   C CA  . TRP A  1 71  ? 12.294 17.887 23.859  1.00 62.92  ? 98   TRP A CA  1 
ATOM   440   C C   . TRP A  1 71  ? 12.459 19.092 24.792  1.00 63.64  ? 98   TRP A C   1 
ATOM   441   O O   . TRP A  1 71  ? 11.714 19.244 25.753  1.00 64.78  ? 98   TRP A O   1 
ATOM   442   C CB  . TRP A  1 71  ? 11.041 18.022 23.004  1.00 59.02  ? 98   TRP A CB  1 
ATOM   443   C CG  . TRP A  1 71  ? 10.874 16.897 22.009  1.00 55.54  ? 98   TRP A CG  1 
ATOM   444   C CD1 . TRP A  1 71  ? 11.613 16.688 20.881  1.00 55.28  ? 98   TRP A CD1 1 
ATOM   445   C CD2 . TRP A  1 71  ? 9.894  15.847 22.042  1.00 54.01  ? 98   TRP A CD2 1 
ATOM   446   N NE1 . TRP A  1 71  ? 11.153 15.582 20.203  1.00 54.19  ? 98   TRP A NE1 1 
ATOM   447   C CE2 . TRP A  1 71  ? 10.097 15.048 20.891  1.00 53.57  ? 98   TRP A CE2 1 
ATOM   448   C CE3 . TRP A  1 71  ? 8.860  15.510 22.925  1.00 53.01  ? 98   TRP A CE3 1 
ATOM   449   C CZ2 . TRP A  1 71  ? 9.311  13.925 20.606  1.00 52.25  ? 98   TRP A CZ2 1 
ATOM   450   C CZ3 . TRP A  1 71  ? 8.077  14.393 22.639  1.00 52.50  ? 98   TRP A CZ3 1 
ATOM   451   C CH2 . TRP A  1 71  ? 8.307  13.616 21.483  1.00 51.51  ? 98   TRP A CH2 1 
ATOM   452   N N   . PHE A  1 72  ? 13.442 19.942 24.513  1.00 64.46  ? 99   PHE A N   1 
ATOM   453   C CA  . PHE A  1 72  ? 13.702 21.115 25.349  1.00 65.23  ? 99   PHE A CA  1 
ATOM   454   C C   . PHE A  1 72  ? 13.732 22.395 24.535  1.00 64.10  ? 99   PHE A C   1 
ATOM   455   O O   . PHE A  1 72  ? 14.134 22.393 23.378  1.00 64.72  ? 99   PHE A O   1 
ATOM   456   C CB  . PHE A  1 72  ? 15.063 21.012 26.039  1.00 68.22  ? 99   PHE A CB  1 
ATOM   457   C CG  . PHE A  1 72  ? 15.364 19.664 26.600  1.00 71.93  ? 99   PHE A CG  1 
ATOM   458   C CD1 . PHE A  1 72  ? 14.708 19.203 27.732  1.00 72.35  ? 99   PHE A CD1 1 
ATOM   459   C CD2 . PHE A  1 72  ? 16.304 18.842 25.982  1.00 73.85  ? 99   PHE A CD2 1 
ATOM   460   C CE1 . PHE A  1 72  ? 14.980 17.939 28.246  1.00 73.51  ? 99   PHE A CE1 1 
ATOM   461   C CE2 . PHE A  1 72  ? 16.587 17.576 26.486  1.00 75.48  ? 99   PHE A CE2 1 
ATOM   462   C CZ  . PHE A  1 72  ? 15.921 17.122 27.623  1.00 74.63  ? 99   PHE A CZ  1 
ATOM   463   N N   . PRO A  1 73  ? 13.320 23.513 25.144  1.00 62.86  ? 100  PRO A N   1 
ATOM   464   C CA  . PRO A  1 73  ? 13.302 24.824 24.501  1.00 61.40  ? 100  PRO A CA  1 
ATOM   465   C C   . PRO A  1 73  ? 14.659 25.458 24.757  1.00 61.07  ? 100  PRO A C   1 
ATOM   466   O O   . PRO A  1 73  ? 14.775 26.679 24.889  1.00 60.83  ? 100  PRO A O   1 
ATOM   467   C CB  . PRO A  1 73  ? 12.198 25.543 25.246  1.00 60.88  ? 100  PRO A CB  1 
ATOM   468   C CG  . PRO A  1 73  ? 12.437 25.077 26.633  1.00 62.28  ? 100  PRO A CG  1 
ATOM   469   C CD  . PRO A  1 73  ? 12.630 23.575 26.443  1.00 63.24  ? 100  PRO A CD  1 
ATOM   470   N N   . PHE A  1 74  ? 15.679 24.610 24.847  1.00 61.03  ? 101  PHE A N   1 
ATOM   471   C CA  . PHE A  1 74  ? 17.045 25.062 25.102  1.00 61.66  ? 101  PHE A CA  1 
ATOM   472   C C   . PHE A  1 74  ? 18.028 23.984 24.663  1.00 60.36  ? 101  PHE A C   1 
ATOM   473   O O   . PHE A  1 74  ? 17.625 22.896 24.249  1.00 59.72  ? 101  PHE A O   1 
ATOM   474   C CB  . PHE A  1 74  ? 17.227 25.345 26.600  1.00 64.16  ? 101  PHE A CB  1 
ATOM   475   C CG  . PHE A  1 74  ? 16.862 24.178 27.489  1.00 66.93  ? 101  PHE A CG  1 
ATOM   476   C CD1 . PHE A  1 74  ? 17.651 23.027 27.514  1.00 68.42  ? 101  PHE A CD1 1 
ATOM   477   C CD2 . PHE A  1 74  ? 15.693 24.201 28.244  1.00 67.67  ? 101  PHE A CD2 1 
ATOM   478   C CE1 . PHE A  1 74  ? 17.280 21.914 28.269  1.00 69.01  ? 101  PHE A CE1 1 
ATOM   479   C CE2 . PHE A  1 74  ? 15.311 23.094 29.003  1.00 69.01  ? 101  PHE A CE2 1 
ATOM   480   C CZ  . PHE A  1 74  ? 16.106 21.947 29.012  1.00 69.37  ? 101  PHE A CZ  1 
ATOM   481   N N   . ASN A  1 75  ? 19.316 24.295 24.747  1.00 59.23  ? 102  ASN A N   1 
ATOM   482   C CA  . ASN A  1 75  ? 20.355 23.338 24.399  1.00 59.38  ? 102  ASN A CA  1 
ATOM   483   C C   . ASN A  1 75  ? 21.509 23.456 25.399  1.00 60.52  ? 102  ASN A C   1 
ATOM   484   O O   . ASN A  1 75  ? 21.409 24.181 26.386  1.00 60.96  ? 102  ASN A O   1 
ATOM   485   C CB  . ASN A  1 75  ? 20.859 23.567 22.975  1.00 58.81  ? 102  ASN A CB  1 
ATOM   486   C CG  . ASN A  1 75  ? 21.511 24.922 22.788  1.00 57.97  ? 102  ASN A CG  1 
ATOM   487   O OD1 . ASN A  1 75  ? 21.921 25.572 23.748  1.00 57.44  ? 102  ASN A OD1 1 
ATOM   488   N ND2 . ASN A  1 75  ? 21.627 25.346 21.535  1.00 57.78  ? 102  ASN A ND2 1 
ATOM   489   N N   . SER A  1 76  ? 22.611 22.760 25.150  1.00 61.20  ? 103  SER A N   1 
ATOM   490   C CA  . SER A  1 76  ? 23.721 22.811 26.087  1.00 61.70  ? 103  SER A CA  1 
ATOM   491   C C   . SER A  1 76  ? 24.267 24.203 26.399  1.00 62.28  ? 103  SER A C   1 
ATOM   492   O O   . SER A  1 76  ? 24.812 24.409 27.470  1.00 62.36  ? 103  SER A O   1 
ATOM   493   C CB  . SER A  1 76  ? 24.853 21.884 25.630  1.00 61.07  ? 103  SER A CB  1 
ATOM   494   O OG  . SER A  1 76  ? 25.341 22.228 24.350  1.00 62.00  ? 103  SER A OG  1 
ATOM   495   N N   . MET A  1 77  ? 24.130 25.170 25.502  1.00 64.12  ? 104  MET A N   1 
ATOM   496   C CA  . MET A  1 77  ? 24.656 26.491 25.829  1.00 67.33  ? 104  MET A CA  1 
ATOM   497   C C   . MET A  1 77  ? 23.623 27.350 26.531  1.00 68.80  ? 104  MET A C   1 
ATOM   498   O O   . MET A  1 77  ? 23.923 28.463 26.953  1.00 68.60  ? 104  MET A O   1 
ATOM   499   C CB  . MET A  1 77  ? 25.151 27.235 24.589  1.00 69.38  ? 104  MET A CB  1 
ATOM   500   C CG  . MET A  1 77  ? 26.360 26.624 23.903  1.00 72.34  ? 104  MET A CG  1 
ATOM   501   S SD  . MET A  1 77  ? 25.870 25.482 22.592  1.00 76.97  ? 104  MET A SD  1 
ATOM   502   C CE  . MET A  1 77  ? 27.091 24.129 22.817  1.00 77.15  ? 104  MET A CE  1 
ATOM   503   N N   . SER A  1 78  ? 22.406 26.834 26.657  1.00 70.87  ? 105  SER A N   1 
ATOM   504   C CA  . SER A  1 78  ? 21.328 27.571 27.315  1.00 73.06  ? 105  SER A CA  1 
ATOM   505   C C   . SER A  1 78  ? 21.573 27.728 28.821  1.00 76.21  ? 105  SER A C   1 
ATOM   506   O O   . SER A  1 78  ? 21.606 26.738 29.557  1.00 76.63  ? 105  SER A O   1 
ATOM   507   C CB  . SER A  1 78  ? 19.987 26.857 27.103  1.00 71.23  ? 105  SER A CB  1 
ATOM   508   O OG  . SER A  1 78  ? 19.578 26.864 25.751  1.00 67.52  ? 105  SER A OG  1 
ATOM   509   N N   . SER A  1 79  ? 21.734 28.967 29.281  1.00 79.13  ? 106  SER A N   1 
ATOM   510   C CA  . SER A  1 79  ? 21.952 29.218 30.706  1.00 82.12  ? 106  SER A CA  1 
ATOM   511   C C   . SER A  1 79  ? 20.785 28.667 31.533  1.00 83.14  ? 106  SER A C   1 
ATOM   512   O O   . SER A  1 79  ? 19.640 28.641 31.076  1.00 83.05  ? 106  SER A O   1 
ATOM   513   C CB  . SER A  1 79  ? 22.106 30.718 30.971  1.00 82.99  ? 106  SER A CB  1 
ATOM   514   O OG  . SER A  1 79  ? 20.910 31.413 30.661  1.00 85.64  ? 106  SER A OG  1 
ATOM   515   N N   . GLY A  1 80  ? 21.079 28.240 32.757  1.00 84.38  ? 107  GLY A N   1 
ATOM   516   C CA  . GLY A  1 80  ? 20.044 27.677 33.601  1.00 86.08  ? 107  GLY A CA  1 
ATOM   517   C C   . GLY A  1 80  ? 19.919 26.203 33.269  1.00 87.36  ? 107  GLY A C   1 
ATOM   518   O O   . GLY A  1 80  ? 19.045 25.494 33.765  1.00 87.31  ? 107  GLY A O   1 
ATOM   519   N N   . VAL A  1 81  ? 20.806 25.745 32.398  1.00 88.65  ? 108  VAL A N   1 
ATOM   520   C CA  . VAL A  1 81  ? 20.819 24.353 31.982  1.00 90.43  ? 108  VAL A CA  1 
ATOM   521   C C   . VAL A  1 81  ? 22.235 23.863 32.188  1.00 91.49  ? 108  VAL A C   1 
ATOM   522   O O   . VAL A  1 81  ? 23.163 24.665 32.345  1.00 91.82  ? 108  VAL A O   1 
ATOM   523   C CB  . VAL A  1 81  ? 20.473 24.189 30.478  1.00 90.84  ? 108  VAL A CB  1 
ATOM   524   C CG1 . VAL A  1 81  ? 20.360 22.711 30.123  1.00 90.72  ? 108  VAL A CG1 1 
ATOM   525   C CG2 . VAL A  1 81  ? 19.182 24.908 30.150  1.00 91.68  ? 108  VAL A CG2 1 
ATOM   526   N N   . LYS A  1 82  ? 22.398 22.545 32.185  1.00 91.95  ? 109  LYS A N   1 
ATOM   527   C CA  . LYS A  1 82  ? 23.711 21.957 32.361  1.00 91.94  ? 109  LYS A CA  1 
ATOM   528   C C   . LYS A  1 82  ? 23.805 20.561 31.782  1.00 91.52  ? 109  LYS A C   1 
ATOM   529   O O   . LYS A  1 82  ? 22.816 19.827 31.706  1.00 91.23  ? 109  LYS A O   1 
ATOM   530   C CB  . LYS A  1 82  ? 24.080 21.926 33.839  1.00 92.50  ? 109  LYS A CB  1 
ATOM   531   C CG  . LYS A  1 82  ? 24.151 23.291 34.454  1.00 93.10  ? 109  LYS A CG  1 
ATOM   532   C CD  . LYS A  1 82  ? 24.519 23.220 35.891  1.00 93.59  ? 109  LYS A CD  1 
ATOM   533   C CE  . LYS A  1 82  ? 24.648 24.622 36.419  1.00 94.29  ? 109  LYS A CE  1 
ATOM   534   N NZ  . LYS A  1 82  ? 25.578 24.673 37.562  1.00 95.28  ? 109  LYS A NZ  1 
ATOM   535   N N   . LYS A  1 83  ? 25.015 20.201 31.379  1.00 90.96  ? 110  LYS A N   1 
ATOM   536   C CA  . LYS A  1 83  ? 25.257 18.893 30.805  1.00 90.65  ? 110  LYS A CA  1 
ATOM   537   C C   . LYS A  1 83  ? 25.550 17.891 31.918  1.00 90.86  ? 110  LYS A C   1 
ATOM   538   O O   . LYS A  1 83  ? 25.852 18.272 33.057  1.00 90.63  ? 110  LYS A O   1 
ATOM   539   C CB  . LYS A  1 83  ? 26.452 18.953 29.856  1.00 89.64  ? 110  LYS A CB  1 
ATOM   540   C CG  . LYS A  1 83  ? 26.561 20.223 29.037  1.00 88.63  ? 110  LYS A CG  1 
ATOM   541   C CD  . LYS A  1 83  ? 27.685 20.087 28.018  1.00 88.44  ? 110  LYS A CD  1 
ATOM   542   C CE  . LYS A  1 83  ? 27.886 21.352 27.196  1.00 88.51  ? 110  LYS A CE  1 
ATOM   543   N NZ  . LYS A  1 83  ? 28.798 21.115 26.037  1.00 87.38  ? 110  LYS A NZ  1 
ATOM   544   N N   . GLU A  1 84  ? 25.458 16.609 31.580  1.00 90.54  ? 111  GLU A N   1 
ATOM   545   C CA  . GLU A  1 84  ? 25.734 15.549 32.537  1.00 90.34  ? 111  GLU A CA  1 
ATOM   546   C C   . GLU A  1 84  ? 25.792 14.210 31.810  1.00 90.05  ? 111  GLU A C   1 
ATOM   547   O O   . GLU A  1 84  ? 25.079 14.004 30.827  1.00 89.59  ? 111  GLU A O   1 
ATOM   548   C CB  . GLU A  1 84  ? 24.654 15.531 33.618  1.00 90.99  ? 111  GLU A CB  1 
ATOM   549   C CG  . GLU A  1 84  ? 24.892 14.530 34.739  1.00 91.28  ? 111  GLU A CG  1 
ATOM   550   C CD  . GLU A  1 84  ? 23.950 14.743 35.910  1.00 91.40  ? 111  GLU A CD  1 
ATOM   551   O OE1 . GLU A  1 84  ? 24.126 15.738 36.646  1.00 91.42  ? 111  GLU A OE1 1 
ATOM   552   O OE2 . GLU A  1 84  ? 23.026 13.920 36.088  1.00 91.73  ? 111  GLU A OE2 1 
ATOM   553   N N   . PHE A  1 85  ? 26.656 13.317 32.292  1.00 89.61  ? 112  PHE A N   1 
ATOM   554   C CA  . PHE A  1 85  ? 26.832 11.994 31.700  1.00 88.95  ? 112  PHE A CA  1 
ATOM   555   C C   . PHE A  1 85  ? 25.747 11.011 32.118  1.00 87.85  ? 112  PHE A C   1 
ATOM   556   O O   . PHE A  1 85  ? 25.110 11.150 33.164  1.00 87.56  ? 112  PHE A O   1 
ATOM   557   C CB  . PHE A  1 85  ? 28.201 11.409 32.085  1.00 90.43  ? 112  PHE A CB  1 
ATOM   558   C CG  . PHE A  1 85  ? 28.502 10.060 31.457  1.00 90.94  ? 112  PHE A CG  1 
ATOM   559   C CD1 . PHE A  1 85  ? 29.217 9.977  30.262  1.00 90.49  ? 112  PHE A CD1 1 
ATOM   560   C CD2 . PHE A  1 85  ? 28.054 8.877  32.054  1.00 90.23  ? 112  PHE A CD2 1 
ATOM   561   C CE1 . PHE A  1 85  ? 29.478 8.742  29.673  1.00 89.69  ? 112  PHE A CE1 1 
ATOM   562   C CE2 . PHE A  1 85  ? 28.310 7.637  31.471  1.00 88.91  ? 112  PHE A CE2 1 
ATOM   563   C CZ  . PHE A  1 85  ? 29.021 7.570  30.281  1.00 89.37  ? 112  PHE A CZ  1 
ATOM   564   N N   . GLY A  1 86  ? 25.566 10.005 31.275  1.00 87.02  ? 113  GLY A N   1 
ATOM   565   C CA  . GLY A  1 86  ? 24.584 8.967  31.509  1.00 87.05  ? 113  GLY A CA  1 
ATOM   566   C C   . GLY A  1 86  ? 24.727 8.081  30.308  1.00 87.32  ? 113  GLY A C   1 
ATOM   567   O O   . GLY A  1 86  ? 24.676 8.568  29.188  1.00 87.84  ? 113  GLY A O   1 
ATOM   568   N N   . HIS A  1 87  ? 24.934 6.790  30.518  1.00 87.96  ? 114  HIS A N   1 
ATOM   569   C CA  . HIS A  1 87  ? 25.117 5.855  29.396  1.00 88.13  ? 114  HIS A CA  1 
ATOM   570   C C   . HIS A  1 87  ? 23.846 5.610  28.557  1.00 87.96  ? 114  HIS A C   1 
ATOM   571   O O   . HIS A  1 87  ? 23.950 5.253  27.383  1.00 88.16  ? 114  HIS A O   1 
ATOM   572   C CB  . HIS A  1 87  ? 25.652 4.517  29.936  1.00 89.40  ? 114  HIS A CB  1 
ATOM   573   N N   . GLU A  1 88  ? 22.667 5.804  29.153  1.00 87.53  ? 115  GLU A N   1 
ATOM   574   C CA  . GLU A  1 88  ? 21.413 5.590  28.440  1.00 87.07  ? 115  GLU A CA  1 
ATOM   575   C C   . GLU A  1 88  ? 20.947 6.821  27.642  1.00 85.41  ? 115  GLU A C   1 
ATOM   576   O O   . GLU A  1 88  ? 19.939 6.754  26.925  1.00 84.66  ? 115  GLU A O   1 
ATOM   577   C CB  . GLU A  1 88  ? 20.311 5.173  29.427  1.00 88.93  ? 115  GLU A CB  1 
ATOM   578   C CG  . GLU A  1 88  ? 19.756 6.307  30.318  1.00 91.34  ? 115  GLU A CG  1 
ATOM   579   C CD  . GLU A  1 88  ? 20.680 6.704  31.468  1.00 92.39  ? 115  GLU A CD  1 
ATOM   580   O OE1 . GLU A  1 88  ? 21.895 6.888  31.238  1.00 93.08  ? 115  GLU A OE1 1 
ATOM   581   O OE2 . GLU A  1 88  ? 20.183 6.840  32.608  1.00 93.46  ? 115  GLU A OE2 1 
ATOM   582   N N   . PHE A  1 89  ? 21.693 7.925  27.762  1.00 83.21  ? 116  PHE A N   1 
ATOM   583   C CA  . PHE A  1 89  ? 21.351 9.194  27.110  1.00 81.28  ? 116  PHE A CA  1 
ATOM   584   C C   . PHE A  1 89  ? 22.177 9.694  25.909  1.00 78.66  ? 116  PHE A C   1 
ATOM   585   O O   . PHE A  1 89  ? 23.406 9.609  25.890  1.00 79.32  ? 116  PHE A O   1 
ATOM   586   C CB  . PHE A  1 89  ? 21.312 10.299 28.176  1.00 82.95  ? 116  PHE A CB  1 
ATOM   587   C CG  . PHE A  1 89  ? 20.289 10.063 29.247  1.00 84.84  ? 116  PHE A CG  1 
ATOM   588   C CD1 . PHE A  1 89  ? 20.617 10.240 30.592  1.00 85.84  ? 116  PHE A CD1 1 
ATOM   589   C CD2 . PHE A  1 89  ? 18.996 9.641  28.915  1.00 85.14  ? 116  PHE A CD2 1 
ATOM   590   C CE1 . PHE A  1 89  ? 19.666 9.994  31.600  1.00 86.33  ? 116  PHE A CE1 1 
ATOM   591   C CE2 . PHE A  1 89  ? 18.038 9.392  29.907  1.00 84.95  ? 116  PHE A CE2 1 
ATOM   592   C CZ  . PHE A  1 89  ? 18.372 9.567  31.250  1.00 86.13  ? 116  PHE A CZ  1 
ATOM   593   N N   . ASP A  1 90  ? 21.472 10.238 24.917  1.00 74.60  ? 117  ASP A N   1 
ATOM   594   C CA  . ASP A  1 90  ? 22.078 10.788 23.704  1.00 69.60  ? 117  ASP A CA  1 
ATOM   595   C C   . ASP A  1 90  ? 21.517 12.187 23.451  1.00 66.42  ? 117  ASP A C   1 
ATOM   596   O O   . ASP A  1 90  ? 20.304 12.366 23.334  1.00 66.29  ? 117  ASP A O   1 
ATOM   597   C CB  . ASP A  1 90  ? 21.778 9.901  22.494  1.00 67.78  ? 117  ASP A CB  1 
ATOM   598   C CG  . ASP A  1 90  ? 22.784 8.797  22.328  1.00 67.29  ? 117  ASP A CG  1 
ATOM   599   O OD1 . ASP A  1 90  ? 23.836 8.850  22.999  1.00 67.33  ? 117  ASP A OD1 1 
ATOM   600   O OD2 . ASP A  1 90  ? 22.531 7.883  21.518  1.00 67.80  ? 117  ASP A OD2 1 
ATOM   601   N N   . LEU A  1 91  ? 22.404 13.175 23.376  1.00 61.76  ? 118  LEU A N   1 
ATOM   602   C CA  . LEU A  1 91  ? 21.988 14.544 23.137  1.00 55.94  ? 118  LEU A CA  1 
ATOM   603   C C   . LEU A  1 91  ? 22.019 14.903 21.668  1.00 53.48  ? 118  LEU A C   1 
ATOM   604   O O   . LEU A  1 91  ? 22.987 14.623 20.951  1.00 53.82  ? 118  LEU A O   1 
ATOM   605   C CB  . LEU A  1 91  ? 22.865 15.523 23.913  1.00 52.96  ? 118  LEU A CB  1 
ATOM   606   C CG  . LEU A  1 91  ? 22.469 16.986 23.744  1.00 51.05  ? 118  LEU A CG  1 
ATOM   607   C CD1 . LEU A  1 91  ? 20.964 17.135 23.850  1.00 53.11  ? 118  LEU A CD1 1 
ATOM   608   C CD2 . LEU A  1 91  ? 23.152 17.812 24.803  1.00 50.78  ? 118  LEU A CD2 1 
ATOM   609   N N   . TYR A  1 92  ? 20.929 15.527 21.244  1.00 49.86  ? 119  TYR A N   1 
ATOM   610   C CA  . TYR A  1 92  ? 20.756 15.974 19.873  1.00 46.17  ? 119  TYR A CA  1 
ATOM   611   C C   . TYR A  1 92  ? 20.388 17.449 19.882  1.00 43.98  ? 119  TYR A C   1 
ATOM   612   O O   . TYR A  1 92  ? 19.323 17.829 20.340  1.00 42.86  ? 119  TYR A O   1 
ATOM   613   C CB  . TYR A  1 92  ? 19.650 15.176 19.194  1.00 44.02  ? 119  TYR A CB  1 
ATOM   614   C CG  . TYR A  1 92  ? 20.027 13.758 18.881  1.00 42.83  ? 119  TYR A CG  1 
ATOM   615   C CD1 . TYR A  1 92  ? 20.642 12.951 19.827  1.00 42.96  ? 119  TYR A CD1 1 
ATOM   616   C CD2 . TYR A  1 92  ? 19.733 13.209 17.642  1.00 42.99  ? 119  TYR A CD2 1 
ATOM   617   C CE1 . TYR A  1 92  ? 20.951 11.628 19.541  1.00 44.25  ? 119  TYR A CE1 1 
ATOM   618   C CE2 . TYR A  1 92  ? 20.032 11.898 17.346  1.00 42.63  ? 119  TYR A CE2 1 
ATOM   619   C CZ  . TYR A  1 92  ? 20.637 11.105 18.289  1.00 43.70  ? 119  TYR A CZ  1 
ATOM   620   O OH  . TYR A  1 92  ? 20.906 9.789  17.974  1.00 44.43  ? 119  TYR A OH  1 
ATOM   621   N N   . GLU A  1 93  ? 21.283 18.288 19.393  1.00 42.09  ? 120  GLU A N   1 
ATOM   622   C CA  . GLU A  1 93  ? 20.986 19.706 19.353  1.00 40.50  ? 120  GLU A CA  1 
ATOM   623   C C   . GLU A  1 93  ? 20.672 20.158 17.926  1.00 40.23  ? 120  GLU A C   1 
ATOM   624   O O   . GLU A  1 93  ? 21.294 19.694 16.961  1.00 39.03  ? 120  GLU A O   1 
ATOM   625   C CB  . GLU A  1 93  ? 22.154 20.500 19.931  1.00 37.63  ? 120  GLU A CB  1 
ATOM   626   C CG  . GLU A  1 93  ? 22.429 20.157 21.373  1.00 36.92  ? 120  GLU A CG  1 
ATOM   627   C CD  . GLU A  1 93  ? 23.718 20.771 21.901  1.00 37.76  ? 120  GLU A CD  1 
ATOM   628   O OE1 . GLU A  1 93  ? 24.811 20.431 21.380  1.00 38.74  ? 120  GLU A OE1 1 
ATOM   629   O OE2 . GLU A  1 93  ? 23.639 21.588 22.840  1.00 34.85  ? 120  GLU A OE2 1 
ATOM   630   N N   . ASN A  1 94  ? 19.683 21.047 17.810  1.00 39.51  ? 121  ASN A N   1 
ATOM   631   C CA  . ASN A  1 94  ? 19.266 21.594 16.522  1.00 38.25  ? 121  ASN A CA  1 
ATOM   632   C C   . ASN A  1 94  ? 20.308 22.612 16.077  1.00 36.57  ? 121  ASN A C   1 
ATOM   633   O O   . ASN A  1 94  ? 20.564 23.589 16.789  1.00 35.29  ? 121  ASN A O   1 
ATOM   634   C CB  . ASN A  1 94  ? 17.913 22.281 16.644  1.00 38.94  ? 121  ASN A CB  1 
ATOM   635   C CG  . ASN A  1 94  ? 17.407 22.772 15.322  1.00 39.91  ? 121  ASN A CG  1 
ATOM   636   O OD1 . ASN A  1 94  ? 18.187 23.208 14.476  1.00 42.56  ? 121  ASN A OD1 1 
ATOM   637   N ND2 . ASN A  1 94  ? 16.098 22.712 15.127  1.00 39.76  ? 121  ASN A ND2 1 
ATOM   638   N N   . LYS A  1 95  ? 20.894 22.384 14.898  1.00 35.37  ? 122  LYS A N   1 
ATOM   639   C CA  . LYS A  1 95  ? 21.948 23.254 14.385  1.00 34.17  ? 122  LYS A CA  1 
ATOM   640   C C   . LYS A  1 95  ? 21.579 24.723 14.243  1.00 34.07  ? 122  LYS A C   1 
ATOM   641   O O   . LYS A  1 95  ? 22.454 25.574 14.315  1.00 33.58  ? 122  LYS A O   1 
ATOM   642   C CB  . LYS A  1 95  ? 22.489 22.725 13.050  1.00 35.31  ? 122  LYS A CB  1 
ATOM   643   C CG  . LYS A  1 95  ? 23.330 21.454 13.166  1.00 35.71  ? 122  LYS A CG  1 
ATOM   644   C CD  . LYS A  1 95  ? 23.854 20.990 11.817  1.00 38.23  ? 122  LYS A CD  1 
ATOM   645   C CE  . LYS A  1 95  ? 24.486 19.616 11.926  1.00 40.59  ? 122  LYS A CE  1 
ATOM   646   N NZ  . LYS A  1 95  ? 25.011 19.095 10.622  1.00 42.59  ? 122  LYS A NZ  1 
ATOM   647   N N   . ASP A  1 96  ? 20.301 25.041 14.054  1.00 33.50  ? 123  ASP A N   1 
ATOM   648   C CA  . ASP A  1 96  ? 19.893 26.441 13.908  1.00 32.93  ? 123  ASP A CA  1 
ATOM   649   C C   . ASP A  1 96  ? 20.139 27.228 15.186  1.00 32.55  ? 123  ASP A C   1 
ATOM   650   O O   . ASP A  1 96  ? 20.177 28.460 15.184  1.00 32.95  ? 123  ASP A O   1 
ATOM   651   C CB  . ASP A  1 96  ? 18.399 26.569 13.559  1.00 32.91  ? 123  ASP A CB  1 
ATOM   652   C CG  . ASP A  1 96  ? 18.063 26.071 12.165  1.00 34.36  ? 123  ASP A CG  1 
ATOM   653   O OD1 . ASP A  1 96  ? 18.770 26.416 11.186  1.00 35.22  ? 123  ASP A OD1 1 
ATOM   654   O OD2 . ASP A  1 96  ? 17.062 25.337 12.052  1.00 36.15  ? 123  ASP A OD2 1 
ATOM   655   N N   . TYR A  1 97  ? 20.310 26.524 16.291  1.00 32.38  ? 124  TYR A N   1 
ATOM   656   C CA  . TYR A  1 97  ? 20.504 27.216 17.551  1.00 32.10  ? 124  TYR A CA  1 
ATOM   657   C C   . TYR A  1 97  ? 21.904 27.099 18.120  1.00 32.14  ? 124  TYR A C   1 
ATOM   658   O O   . TYR A  1 97  ? 22.148 27.426 19.274  1.00 32.34  ? 124  TYR A O   1 
ATOM   659   C CB  . TYR A  1 97  ? 19.456 26.738 18.549  1.00 31.71  ? 124  TYR A CB  1 
ATOM   660   C CG  . TYR A  1 97  ? 18.061 27.057 18.066  1.00 32.14  ? 124  TYR A CG  1 
ATOM   661   C CD1 . TYR A  1 97  ? 17.495 28.318 18.272  1.00 30.85  ? 124  TYR A CD1 1 
ATOM   662   C CD2 . TYR A  1 97  ? 17.339 26.124 17.335  1.00 31.88  ? 124  TYR A CD2 1 
ATOM   663   C CE1 . TYR A  1 97  ? 16.245 28.635 17.755  1.00 31.38  ? 124  TYR A CE1 1 
ATOM   664   C CE2 . TYR A  1 97  ? 16.092 26.433 16.815  1.00 34.01  ? 124  TYR A CE2 1 
ATOM   665   C CZ  . TYR A  1 97  ? 15.550 27.688 17.026  1.00 32.45  ? 124  TYR A CZ  1 
ATOM   666   O OH  . TYR A  1 97  ? 14.311 27.982 16.508  1.00 33.45  ? 124  TYR A OH  1 
ATOM   667   N N   . ILE A  1 98  ? 22.827 26.626 17.299  1.00 31.17  ? 125  ILE A N   1 
ATOM   668   C CA  . ILE A  1 98  ? 24.205 26.527 17.712  1.00 29.98  ? 125  ILE A CA  1 
ATOM   669   C C   . ILE A  1 98  ? 24.916 27.547 16.836  1.00 29.75  ? 125  ILE A C   1 
ATOM   670   O O   . ILE A  1 98  ? 25.059 27.346 15.628  1.00 29.74  ? 125  ILE A O   1 
ATOM   671   C CB  . ILE A  1 98  ? 24.748 25.123 17.467  1.00 30.09  ? 125  ILE A CB  1 
ATOM   672   C CG1 . ILE A  1 98  ? 24.013 24.143 18.377  1.00 30.06  ? 125  ILE A CG1 1 
ATOM   673   C CG2 . ILE A  1 98  ? 26.243 25.086 17.729  1.00 28.75  ? 125  ILE A CG2 1 
ATOM   674   C CD1 . ILE A  1 98  ? 24.368 22.682 18.140  1.00 31.97  ? 125  ILE A CD1 1 
ATOM   675   N N   . ARG A  1 99  ? 25.330 28.651 17.452  1.00 29.01  ? 126  ARG A N   1 
ATOM   676   C CA  . ARG A  1 99  ? 25.995 29.744 16.756  1.00 28.69  ? 126  ARG A CA  1 
ATOM   677   C C   . ARG A  1 99  ? 26.885 29.231 15.660  1.00 29.24  ? 126  ARG A C   1 
ATOM   678   O O   . ARG A  1 99  ? 27.713 28.374 15.904  1.00 30.62  ? 126  ARG A O   1 
ATOM   679   C CB  . ARG A  1 99  ? 26.827 30.564 17.730  1.00 29.59  ? 126  ARG A CB  1 
ATOM   680   C CG  . ARG A  1 99  ? 27.219 31.919 17.169  1.00 32.78  ? 126  ARG A CG  1 
ATOM   681   C CD  . ARG A  1 99  ? 28.195 32.670 18.053  1.00 35.45  ? 126  ARG A CD  1 
ATOM   682   N NE  . ARG A  1 99  ? 27.756 32.764 19.443  1.00 39.85  ? 126  ARG A NE  1 
ATOM   683   C CZ  . ARG A  1 99  ? 28.343 32.137 20.464  1.00 43.22  ? 126  ARG A CZ  1 
ATOM   684   N NH1 . ARG A  1 99  ? 29.409 31.354 20.267  1.00 43.92  ? 126  ARG A NH1 1 
ATOM   685   N NH2 . ARG A  1 99  ? 27.865 32.300 21.693  1.00 44.19  ? 126  ARG A NH2 1 
ATOM   686   N N   . ASN A  1 100 ? 26.728 29.750 14.452  1.00 29.14  ? 127  ASN A N   1 
ATOM   687   C CA  . ASN A  1 100 ? 27.553 29.291 13.349  1.00 30.56  ? 127  ASN A CA  1 
ATOM   688   C C   . ASN A  1 100 ? 28.529 30.336 12.830  1.00 32.14  ? 127  ASN A C   1 
ATOM   689   O O   . ASN A  1 100 ? 28.963 30.264 11.701  1.00 32.41  ? 127  ASN A O   1 
ATOM   690   C CB  . ASN A  1 100 ? 26.681 28.823 12.187  1.00 32.64  ? 127  ASN A CB  1 
ATOM   691   C CG  . ASN A  1 100 ? 25.679 29.873 11.753  1.00 36.17  ? 127  ASN A CG  1 
ATOM   692   O OD1 . ASN A  1 100 ? 25.863 31.062 11.997  1.00 40.65  ? 127  ASN A OD1 1 
ATOM   693   N ND2 . ASN A  1 100 ? 24.619 29.440 11.096  1.00 36.71  ? 127  ASN A ND2 1 
ATOM   694   N N   . CYS A  1 101 ? 28.857 31.335 13.614  1.00 34.46  ? 128  CYS A N   1 
ATOM   695   C CA  . CYS A  1 101 ? 29.810 32.346 13.182  1.00 39.57  ? 128  CYS A CA  1 
ATOM   696   C C   . CYS A  1 101 ? 30.635 32.576 14.431  1.00 41.40  ? 128  CYS A C   1 
ATOM   697   O O   . CYS A  1 101 ? 30.226 32.167 15.519  1.00 39.38  ? 128  CYS A O   1 
ATOM   698   C CB  . CYS A  1 101 ? 29.107 33.644 12.739  1.00 41.51  ? 128  CYS A CB  1 
ATOM   699   S SG  . CYS A  1 101 ? 27.939 34.346 13.953  1.00 46.68  ? 128  CYS A SG  1 
ATOM   700   N N   . ILE A  1 102 ? 31.794 33.208 14.291  1.00 44.51  ? 129  ILE A N   1 
ATOM   701   C CA  . ILE A  1 102 ? 32.632 33.442 15.452  1.00 48.89  ? 129  ILE A CA  1 
ATOM   702   C C   . ILE A  1 102 ? 32.815 34.919 15.755  1.00 52.02  ? 129  ILE A C   1 
ATOM   703   O O   . ILE A  1 102 ? 32.693 35.773 14.869  1.00 52.53  ? 129  ILE A O   1 
ATOM   704   C CB  . ILE A  1 102 ? 34.040 32.818 15.272  1.00 48.72  ? 129  ILE A CB  1 
ATOM   705   C CG1 . ILE A  1 102 ? 34.707 33.397 14.030  1.00 49.07  ? 129  ILE A CG1 1 
ATOM   706   C CG2 . ILE A  1 102 ? 33.942 31.308 15.141  1.00 48.70  ? 129  ILE A CG2 1 
ATOM   707   C CD1 . ILE A  1 102 ? 36.135 32.961 13.860  1.00 48.75  ? 129  ILE A CD1 1 
ATOM   708   N N   . ILE A  1 103 ? 33.099 35.208 17.022  1.00 55.24  ? 130  ILE A N   1 
ATOM   709   C CA  . ILE A  1 103 ? 33.350 36.573 17.461  1.00 57.55  ? 130  ILE A CA  1 
ATOM   710   C C   . ILE A  1 103 ? 34.855 36.661 17.733  1.00 58.35  ? 130  ILE A C   1 
ATOM   711   O O   . ILE A  1 103 ? 35.348 36.128 18.736  1.00 58.26  ? 130  ILE A O   1 
ATOM   712   C CB  . ILE A  1 103 ? 32.599 36.920 18.768  1.00 59.10  ? 130  ILE A CB  1 
ATOM   713   C CG1 . ILE A  1 103 ? 31.129 36.507 18.671  1.00 59.44  ? 130  ILE A CG1 1 
ATOM   714   C CG2 . ILE A  1 103 ? 32.700 38.421 19.026  1.00 58.54  ? 130  ILE A CG2 1 
ATOM   715   C CD1 . ILE A  1 103 ? 30.351 37.283 17.633  1.00 60.02  ? 130  ILE A CD1 1 
ATOM   716   N N   . GLY A  1 104 ? 35.584 37.301 16.822  1.00 58.61  ? 131  GLY A N   1 
ATOM   717   C CA  . GLY A  1 104 ? 37.020 37.448 16.997  1.00 58.21  ? 131  GLY A CA  1 
ATOM   718   C C   . GLY A  1 104 ? 37.874 36.222 16.709  1.00 57.75  ? 131  GLY A C   1 
ATOM   719   O O   . GLY A  1 104 ? 38.094 35.873 15.548  1.00 58.50  ? 131  GLY A O   1 
ATOM   720   N N   . LYS A  1 105 ? 38.367 35.569 17.760  1.00 56.50  ? 132  LYS A N   1 
ATOM   721   C CA  . LYS A  1 105 ? 39.216 34.388 17.597  1.00 55.96  ? 132  LYS A CA  1 
ATOM   722   C C   . LYS A  1 105 ? 38.453 33.055 17.576  1.00 55.21  ? 132  LYS A C   1 
ATOM   723   O O   . LYS A  1 105 ? 38.904 32.062 16.999  1.00 53.76  ? 132  LYS A O   1 
ATOM   724   C CB  . LYS A  1 105 ? 40.289 34.362 18.694  1.00 56.26  ? 132  LYS A CB  1 
ATOM   725   C CG  . LYS A  1 105 ? 41.301 35.495 18.602  1.00 56.91  ? 132  LYS A CG  1 
ATOM   726   C CD  . LYS A  1 105 ? 42.647 35.109 19.242  1.00 59.17  ? 132  LYS A CD  1 
ATOM   727   C CE  . LYS A  1 105 ? 43.004 35.992 20.455  1.00 59.58  ? 132  LYS A CE  1 
ATOM   728   N NZ  . LYS A  1 105 ? 43.182 37.440 20.102  1.00 60.35  ? 132  LYS A NZ  1 
ATOM   729   N N   . GLY A  1 106 ? 37.302 33.025 18.222  1.00 54.85  ? 133  GLY A N   1 
ATOM   730   C CA  . GLY A  1 106 ? 36.527 31.808 18.209  1.00 55.83  ? 133  GLY A CA  1 
ATOM   731   C C   . GLY A  1 106 ? 36.777 30.845 19.347  1.00 56.21  ? 133  GLY A C   1 
ATOM   732   O O   . GLY A  1 106 ? 36.383 29.685 19.266  1.00 56.11  ? 133  GLY A O   1 
ATOM   733   N N   . ARG A  1 107 ? 37.415 31.296 20.416  1.00 56.64  ? 134  ARG A N   1 
ATOM   734   C CA  . ARG A  1 107 ? 37.676 30.398 21.535  1.00 57.36  ? 134  ARG A CA  1 
ATOM   735   C C   . ARG A  1 107 ? 36.432 29.602 21.906  1.00 56.77  ? 134  ARG A C   1 
ATOM   736   O O   . ARG A  1 107 ? 36.546 28.467 22.362  1.00 56.79  ? 134  ARG A O   1 
ATOM   737   C CB  . ARG A  1 107 ? 38.134 31.170 22.773  1.00 60.17  ? 134  ARG A CB  1 
ATOM   738   C CG  . ARG A  1 107 ? 39.035 32.351 22.484  1.00 64.58  ? 134  ARG A CG  1 
ATOM   739   C CD  . ARG A  1 107 ? 38.247 33.506 21.902  1.00 66.19  ? 134  ARG A CD  1 
ATOM   740   N NE  . ARG A  1 107 ? 39.108 34.620 21.532  1.00 68.97  ? 134  ARG A NE  1 
ATOM   741   C CZ  . ARG A  1 107 ? 38.651 35.801 21.132  1.00 70.79  ? 134  ARG A CZ  1 
ATOM   742   N NH1 . ARG A  1 107 ? 37.341 36.006 21.056  1.00 71.91  ? 134  ARG A NH1 1 
ATOM   743   N NH2 . ARG A  1 107 ? 39.496 36.777 20.818  1.00 71.19  ? 134  ARG A NH2 1 
ATOM   744   N N   . SER A  1 108 ? 35.245 30.184 21.712  1.00 55.81  ? 135  SER A N   1 
ATOM   745   C CA  . SER A  1 108 ? 34.014 29.484 22.083  1.00 54.18  ? 135  SER A CA  1 
ATOM   746   C C   . SER A  1 108 ? 33.210 28.875 20.939  1.00 51.19  ? 135  SER A C   1 
ATOM   747   O O   . SER A  1 108 ? 32.097 28.391 21.150  1.00 51.70  ? 135  SER A O   1 
ATOM   748   C CB  . SER A  1 108 ? 33.104 30.410 22.903  1.00 56.17  ? 135  SER A CB  1 
ATOM   749   O OG  . SER A  1 108 ? 32.630 31.502 22.116  1.00 58.43  ? 135  SER A OG  1 
ATOM   750   N N   . TYR A  1 109 ? 33.763 28.886 19.735  1.00 47.09  ? 136  TYR A N   1 
ATOM   751   C CA  . TYR A  1 109 ? 33.046 28.314 18.599  1.00 43.81  ? 136  TYR A CA  1 
ATOM   752   C C   . TYR A  1 109 ? 32.703 26.850 18.839  1.00 40.92  ? 136  TYR A C   1 
ATOM   753   O O   . TYR A  1 109 ? 33.587 26.040 19.052  1.00 40.94  ? 136  TYR A O   1 
ATOM   754   C CB  . TYR A  1 109 ? 33.880 28.407 17.321  1.00 41.26  ? 136  TYR A CB  1 
ATOM   755   C CG  . TYR A  1 109 ? 33.309 27.565 16.214  1.00 38.13  ? 136  TYR A CG  1 
ATOM   756   C CD1 . TYR A  1 109 ? 32.167 27.968 15.524  1.00 37.81  ? 136  TYR A CD1 1 
ATOM   757   C CD2 . TYR A  1 109 ? 33.891 26.357 15.871  1.00 36.33  ? 136  TYR A CD2 1 
ATOM   758   C CE1 . TYR A  1 109 ? 31.618 27.185 14.511  1.00 35.94  ? 136  TYR A CE1 1 
ATOM   759   C CE2 . TYR A  1 109 ? 33.350 25.568 14.862  1.00 36.97  ? 136  TYR A CE2 1 
ATOM   760   C CZ  . TYR A  1 109 ? 32.214 25.988 14.186  1.00 35.89  ? 136  TYR A CZ  1 
ATOM   761   O OH  . TYR A  1 109 ? 31.684 25.212 13.186  1.00 36.27  ? 136  TYR A OH  1 
ATOM   762   N N   . LYS A  1 110 ? 31.426 26.502 18.785  1.00 38.08  ? 137  LYS A N   1 
ATOM   763   C CA  . LYS A  1 110 ? 31.049 25.117 18.996  1.00 36.97  ? 137  LYS A CA  1 
ATOM   764   C C   . LYS A  1 110 ? 30.185 24.579 17.874  1.00 34.37  ? 137  LYS A C   1 
ATOM   765   O O   . LYS A  1 110 ? 29.419 23.633 18.054  1.00 33.19  ? 137  LYS A O   1 
ATOM   766   C CB  . LYS A  1 110 ? 30.359 24.961 20.347  1.00 39.15  ? 137  LYS A CB  1 
ATOM   767   C CG  . LYS A  1 110 ? 31.349 25.095 21.483  1.00 43.68  ? 137  LYS A CG  1 
ATOM   768   C CD  . LYS A  1 110 ? 30.672 25.254 22.823  1.00 47.24  ? 137  LYS A CD  1 
ATOM   769   C CE  . LYS A  1 110 ? 31.699 25.322 23.943  1.00 47.76  ? 137  LYS A CE  1 
ATOM   770   N NZ  . LYS A  1 110 ? 31.063 25.885 25.160  1.00 51.88  ? 137  LYS A NZ  1 
ATOM   771   N N   . GLY A  1 111 ? 30.337 25.193 16.708  1.00 31.74  ? 138  GLY A N   1 
ATOM   772   C CA  . GLY A  1 111 ? 29.594 24.767 15.546  1.00 28.17  ? 138  GLY A CA  1 
ATOM   773   C C   . GLY A  1 111 ? 30.094 23.413 15.106  1.00 27.24  ? 138  GLY A C   1 
ATOM   774   O O   . GLY A  1 111 ? 30.962 22.846 15.758  1.00 28.20  ? 138  GLY A O   1 
ATOM   775   N N   . THR A  1 112 ? 29.579 22.898 13.993  1.00 25.76  ? 139  THR A N   1 
ATOM   776   C CA  . THR A  1 112 ? 29.991 21.580 13.539  1.00 24.55  ? 139  THR A CA  1 
ATOM   777   C C   . THR A  1 112 ? 30.756 21.492 12.231  1.00 23.69  ? 139  THR A C   1 
ATOM   778   O O   . THR A  1 112 ? 30.775 20.431 11.598  1.00 24.34  ? 139  THR A O   1 
ATOM   779   C CB  . THR A  1 112 ? 28.800 20.644 13.425  1.00 24.30  ? 139  THR A CB  1 
ATOM   780   O OG1 . THR A  1 112 ? 27.914 21.132 12.420  1.00 23.94  ? 139  THR A OG1 1 
ATOM   781   C CG2 . THR A  1 112 ? 28.081 20.565 14.738  1.00 25.34  ? 139  THR A CG2 1 
ATOM   782   N N   . VAL A  1 113 ? 31.390 22.581 11.822  1.00 21.44  ? 140  VAL A N   1 
ATOM   783   C CA  . VAL A  1 113 ? 32.165 22.543 10.596  1.00 22.91  ? 140  VAL A CA  1 
ATOM   784   C C   . VAL A  1 113 ? 33.377 21.634 10.826  1.00 25.22  ? 140  VAL A C   1 
ATOM   785   O O   . VAL A  1 113 ? 34.039 21.718 11.857  1.00 26.73  ? 140  VAL A O   1 
ATOM   786   C CB  . VAL A  1 113 ? 32.660 23.939 10.204  1.00 22.00  ? 140  VAL A CB  1 
ATOM   787   C CG1 . VAL A  1 113 ? 33.699 23.830 9.108   1.00 22.27  ? 140  VAL A CG1 1 
ATOM   788   C CG2 . VAL A  1 113 ? 31.511 24.777 9.742   1.00 18.30  ? 140  VAL A CG2 1 
ATOM   789   N N   . SER A  1 114 ? 33.674 20.762 9.871   1.00 26.02  ? 141  SER A N   1 
ATOM   790   C CA  . SER A  1 114 ? 34.813 19.859 10.021  1.00 26.72  ? 141  SER A CA  1 
ATOM   791   C C   . SER A  1 114 ? 35.636 19.760 8.732   1.00 27.53  ? 141  SER A C   1 
ATOM   792   O O   . SER A  1 114 ? 36.049 18.673 8.322   1.00 27.32  ? 141  SER A O   1 
ATOM   793   C CB  . SER A  1 114 ? 34.318 18.476 10.425  1.00 26.45  ? 141  SER A CB  1 
ATOM   794   O OG  . SER A  1 114 ? 33.299 18.048 9.553   1.00 30.30  ? 141  SER A OG  1 
ATOM   795   N N   . ILE A  1 115 ? 35.879 20.902 8.099   1.00 26.88  ? 142  ILE A N   1 
ATOM   796   C CA  . ILE A  1 115 ? 36.627 20.940 6.861   1.00 26.07  ? 142  ILE A CA  1 
ATOM   797   C C   . ILE A  1 115 ? 37.577 22.130 6.915   1.00 28.41  ? 142  ILE A C   1 
ATOM   798   O O   . ILE A  1 115 ? 37.196 23.219 7.355   1.00 28.91  ? 142  ILE A O   1 
ATOM   799   C CB  . ILE A  1 115 ? 35.644 21.054 5.637   1.00 24.58  ? 142  ILE A CB  1 
ATOM   800   C CG1 . ILE A  1 115 ? 35.406 19.671 5.022   1.00 23.83  ? 142  ILE A CG1 1 
ATOM   801   C CG2 . ILE A  1 115 ? 36.191 22.001 4.564   1.00 22.87  ? 142  ILE A CG2 1 
ATOM   802   C CD1 . ILE A  1 115 ? 34.520 18.759 5.831   1.00 23.16  ? 142  ILE A CD1 1 
ATOM   803   N N   . THR A  1 116 ? 38.818 21.917 6.483   1.00 30.59  ? 143  THR A N   1 
ATOM   804   C CA  . THR A  1 116 ? 39.824 22.977 6.472   1.00 33.37  ? 143  THR A CA  1 
ATOM   805   C C   . THR A  1 116 ? 39.507 23.905 5.310   1.00 36.00  ? 143  THR A C   1 
ATOM   806   O O   . THR A  1 116 ? 38.829 23.500 4.368   1.00 36.83  ? 143  THR A O   1 
ATOM   807   C CB  . THR A  1 116 ? 41.219 22.397 6.289   1.00 32.02  ? 143  THR A CB  1 
ATOM   808   O OG1 . THR A  1 116 ? 41.274 21.671 5.061   1.00 31.49  ? 143  THR A OG1 1 
ATOM   809   C CG2 . THR A  1 116 ? 41.541 21.449 7.429   1.00 33.84  ? 143  THR A CG2 1 
ATOM   810   N N   . LYS A  1 117 ? 39.988 25.144 5.355   1.00 38.64  ? 144  LYS A N   1 
ATOM   811   C CA  . LYS A  1 117 ? 39.676 26.062 4.271   1.00 40.69  ? 144  LYS A CA  1 
ATOM   812   C C   . LYS A  1 117 ? 40.203 25.582 2.929   1.00 40.17  ? 144  LYS A C   1 
ATOM   813   O O   . LYS A  1 117 ? 39.907 26.178 1.903   1.00 41.16  ? 144  LYS A O   1 
ATOM   814   C CB  . LYS A  1 117 ? 40.173 27.480 4.579   1.00 42.64  ? 144  LYS A CB  1 
ATOM   815   C CG  . LYS A  1 117 ? 41.640 27.748 4.365   1.00 47.47  ? 144  LYS A CG  1 
ATOM   816   C CD  . LYS A  1 117 ? 41.904 29.245 4.558   1.00 50.92  ? 144  LYS A CD  1 
ATOM   817   C CE  . LYS A  1 117 ? 43.379 29.605 4.377   1.00 54.45  ? 144  LYS A CE  1 
ATOM   818   N NZ  . LYS A  1 117 ? 43.647 31.037 4.739   1.00 56.48  ? 144  LYS A NZ  1 
ATOM   819   N N   . SER A  1 118 ? 40.965 24.495 2.941   1.00 39.66  ? 145  SER A N   1 
ATOM   820   C CA  . SER A  1 118 ? 41.497 23.923 1.712   1.00 39.93  ? 145  SER A CA  1 
ATOM   821   C C   . SER A  1 118 ? 40.668 22.718 1.334   1.00 38.50  ? 145  SER A C   1 
ATOM   822   O O   . SER A  1 118 ? 41.006 21.981 0.409   1.00 38.87  ? 145  SER A O   1 
ATOM   823   C CB  . SER A  1 118 ? 42.950 23.494 1.887   1.00 41.97  ? 145  SER A CB  1 
ATOM   824   O OG  . SER A  1 118 ? 43.791 24.631 1.959   1.00 45.83  ? 145  SER A OG  1 
ATOM   825   N N   . GLY A  1 119 ? 39.587 22.513 2.073   1.00 37.48  ? 146  GLY A N   1 
ATOM   826   C CA  . GLY A  1 119 ? 38.696 21.402 1.795   1.00 37.33  ? 146  GLY A CA  1 
ATOM   827   C C   . GLY A  1 119 ? 39.117 20.048 2.318   1.00 36.83  ? 146  GLY A C   1 
ATOM   828   O O   . GLY A  1 119 ? 38.625 19.030 1.843   1.00 39.21  ? 146  GLY A O   1 
ATOM   829   N N   . ILE A  1 120 ? 40.024 20.016 3.286   1.00 36.24  ? 147  ILE A N   1 
ATOM   830   C CA  . ILE A  1 120 ? 40.462 18.746 3.839   1.00 33.99  ? 147  ILE A CA  1 
ATOM   831   C C   . ILE A  1 120 ? 39.547 18.381 4.989   1.00 33.23  ? 147  ILE A C   1 
ATOM   832   O O   . ILE A  1 120 ? 39.183 19.245 5.793   1.00 31.24  ? 147  ILE A O   1 
ATOM   833   C CB  . ILE A  1 120 ? 41.889 18.816 4.388   1.00 34.01  ? 147  ILE A CB  1 
ATOM   834   C CG1 . ILE A  1 120 ? 42.848 19.320 3.312   1.00 32.87  ? 147  ILE A CG1 1 
ATOM   835   C CG2 . ILE A  1 120 ? 42.312 17.424 4.889   1.00 35.42  ? 147  ILE A CG2 1 
ATOM   836   C CD1 . ILE A  1 120 ? 44.264 19.535 3.814   1.00 34.88  ? 147  ILE A CD1 1 
ATOM   837   N N   . LYS A  1 121 ? 39.176 17.102 5.056   1.00 33.01  ? 148  LYS A N   1 
ATOM   838   C CA  . LYS A  1 121 ? 38.318 16.608 6.125   1.00 32.98  ? 148  LYS A CA  1 
ATOM   839   C C   . LYS A  1 121 ? 39.155 16.586 7.399   1.00 33.97  ? 148  LYS A C   1 
ATOM   840   O O   . LYS A  1 121 ? 40.323 16.194 7.365   1.00 33.67  ? 148  LYS A O   1 
ATOM   841   C CB  . LYS A  1 121 ? 37.829 15.198 5.809   1.00 31.03  ? 148  LYS A CB  1 
ATOM   842   C CG  . LYS A  1 121 ? 36.954 14.614 6.895   1.00 33.75  ? 148  LYS A CG  1 
ATOM   843   C CD  . LYS A  1 121 ? 36.377 13.265 6.512   1.00 36.24  ? 148  LYS A CD  1 
ATOM   844   C CE  . LYS A  1 121 ? 35.330 12.812 7.531   1.00 37.92  ? 148  LYS A CE  1 
ATOM   845   N NZ  . LYS A  1 121 ? 34.606 11.559 7.141   1.00 39.69  ? 148  LYS A NZ  1 
ATOM   846   N N   . CYS A  1 122 ? 38.568 17.010 8.515   1.00 33.95  ? 149  CYS A N   1 
ATOM   847   C CA  . CYS A  1 122 ? 39.286 17.027 9.777   1.00 34.91  ? 149  CYS A CA  1 
ATOM   848   C C   . CYS A  1 122 ? 39.510 15.640 10.353  1.00 35.58  ? 149  CYS A C   1 
ATOM   849   O O   . CYS A  1 122 ? 38.811 14.680 10.008  1.00 36.26  ? 149  CYS A O   1 
ATOM   850   C CB  . CYS A  1 122 ? 38.537 17.869 10.803  1.00 35.40  ? 149  CYS A CB  1 
ATOM   851   S SG  . CYS A  1 122 ? 38.562 19.661 10.467  1.00 41.01  ? 149  CYS A SG  1 
ATOM   852   N N   . GLN A  1 123 ? 40.505 15.548 11.232  1.00 35.07  ? 150  GLN A N   1 
ATOM   853   C CA  . GLN A  1 123 ? 40.846 14.310 11.918  1.00 32.01  ? 150  GLN A CA  1 
ATOM   854   C C   . GLN A  1 123 ? 40.188 14.355 13.280  1.00 31.09  ? 150  GLN A C   1 
ATOM   855   O O   . GLN A  1 123 ? 40.191 15.388 13.936  1.00 33.18  ? 150  GLN A O   1 
ATOM   856   C CB  . GLN A  1 123 ? 42.351 14.209 12.128  1.00 31.46  ? 150  GLN A CB  1 
ATOM   857   C CG  . GLN A  1 123 ? 42.762 13.059 13.048  1.00 32.70  ? 150  GLN A CG  1 
ATOM   858   C CD  . GLN A  1 123 ? 44.245 13.080 13.413  1.00 33.27  ? 150  GLN A CD  1 
ATOM   859   O OE1 . GLN A  1 123 ? 45.103 13.388 12.584  1.00 31.83  ? 150  GLN A OE1 1 
ATOM   860   N NE2 . GLN A  1 123 ? 44.547 12.735 14.657  1.00 33.90  ? 150  GLN A NE2 1 
ATOM   861   N N   . PRO A  1 124 ? 39.610 13.243 13.729  1.00 29.91  ? 151  PRO A N   1 
ATOM   862   C CA  . PRO A  1 124 ? 38.972 13.236 15.049  1.00 29.12  ? 151  PRO A CA  1 
ATOM   863   C C   . PRO A  1 124 ? 40.000 13.654 16.103  1.00 28.08  ? 151  PRO A C   1 
ATOM   864   O O   . PRO A  1 124 ? 41.159 13.255 16.036  1.00 27.89  ? 151  PRO A O   1 
ATOM   865   C CB  . PRO A  1 124 ? 38.571 11.775 15.231  1.00 27.69  ? 151  PRO A CB  1 
ATOM   866   C CG  . PRO A  1 124 ? 38.336 11.316 13.848  1.00 28.33  ? 151  PRO A CG  1 
ATOM   867   C CD  . PRO A  1 124 ? 39.464 11.940 13.068  1.00 29.12  ? 151  PRO A CD  1 
ATOM   868   N N   . TRP A  1 125 ? 39.594 14.453 17.074  1.00 27.38  ? 152  TRP A N   1 
ATOM   869   C CA  . TRP A  1 125 ? 40.543 14.851 18.090  1.00 27.48  ? 152  TRP A CA  1 
ATOM   870   C C   . TRP A  1 125 ? 40.983 13.628 18.899  1.00 28.47  ? 152  TRP A C   1 
ATOM   871   O O   . TRP A  1 125 ? 42.139 13.493 19.278  1.00 28.85  ? 152  TRP A O   1 
ATOM   872   C CB  . TRP A  1 125 ? 39.922 15.903 19.004  1.00 25.71  ? 152  TRP A CB  1 
ATOM   873   C CG  . TRP A  1 125 ? 39.568 17.154 18.293  1.00 24.47  ? 152  TRP A CG  1 
ATOM   874   C CD1 . TRP A  1 125 ? 38.370 17.462 17.740  1.00 24.07  ? 152  TRP A CD1 1 
ATOM   875   C CD2 . TRP A  1 125 ? 40.443 18.249 17.997  1.00 24.05  ? 152  TRP A CD2 1 
ATOM   876   N NE1 . TRP A  1 125 ? 38.437 18.682 17.115  1.00 23.90  ? 152  TRP A NE1 1 
ATOM   877   C CE2 . TRP A  1 125 ? 39.698 19.188 17.257  1.00 23.49  ? 152  TRP A CE2 1 
ATOM   878   C CE3 . TRP A  1 125 ? 41.784 18.526 18.282  1.00 22.96  ? 152  TRP A CE3 1 
ATOM   879   C CZ2 . TRP A  1 125 ? 40.247 20.388 16.794  1.00 24.50  ? 152  TRP A CZ2 1 
ATOM   880   C CZ3 . TRP A  1 125 ? 42.334 19.720 17.820  1.00 23.51  ? 152  TRP A CZ3 1 
ATOM   881   C CH2 . TRP A  1 125 ? 41.566 20.637 17.085  1.00 24.12  ? 152  TRP A CH2 1 
ATOM   882   N N   . SER A  1 126 ? 40.053 12.725 19.152  1.00 30.16  ? 153  SER A N   1 
ATOM   883   C CA  . SER A  1 126 ? 40.364 11.533 19.916  1.00 31.19  ? 153  SER A CA  1 
ATOM   884   C C   . SER A  1 126 ? 41.363 10.644 19.183  1.00 30.63  ? 153  SER A C   1 
ATOM   885   O O   . SER A  1 126 ? 42.016 9.820  19.807  1.00 31.71  ? 153  SER A O   1 
ATOM   886   C CB  . SER A  1 126 ? 39.080 10.746 20.210  1.00 32.09  ? 153  SER A CB  1 
ATOM   887   O OG  . SER A  1 126 ? 38.483 10.264 19.011  1.00 35.30  ? 153  SER A OG  1 
ATOM   888   N N   . SER A  1 127 ? 41.491 10.799 17.871  1.00 30.16  ? 154  SER A N   1 
ATOM   889   C CA  . SER A  1 127 ? 42.425 9.961  17.126  1.00 32.67  ? 154  SER A CA  1 
ATOM   890   C C   . SER A  1 127 ? 43.863 10.476 17.124  1.00 34.30  ? 154  SER A C   1 
ATOM   891   O O   . SER A  1 127 ? 44.109 11.646 17.404  1.00 35.29  ? 154  SER A O   1 
ATOM   892   C CB  . SER A  1 127 ? 41.976 9.798  15.681  1.00 32.57  ? 154  SER A CB  1 
ATOM   893   O OG  . SER A  1 127 ? 43.027 9.240  14.902  1.00 35.17  ? 154  SER A OG  1 
ATOM   894   N N   . MET A  1 128 ? 44.804 9.588  16.803  1.00 34.33  ? 155  MET A N   1 
ATOM   895   C CA  . MET A  1 128 ? 46.213 9.934  16.741  1.00 33.60  ? 155  MET A CA  1 
ATOM   896   C C   . MET A  1 128 ? 46.661 9.649  15.325  1.00 35.42  ? 155  MET A C   1 
ATOM   897   O O   . MET A  1 128 ? 47.854 9.696  15.013  1.00 36.52  ? 155  MET A O   1 
ATOM   898   C CB  . MET A  1 128 ? 47.019 9.069  17.697  1.00 34.03  ? 155  MET A CB  1 
ATOM   899   C CG  . MET A  1 128 ? 46.784 9.336  19.163  1.00 32.58  ? 155  MET A CG  1 
ATOM   900   S SD  . MET A  1 128 ? 47.272 11.003 19.658  1.00 34.74  ? 155  MET A SD  1 
ATOM   901   C CE  . MET A  1 128 ? 45.887 11.498 20.607  1.00 32.89  ? 155  MET A CE  1 
ATOM   902   N N   . ILE A  1 129 ? 45.695 9.343  14.467  1.00 36.07  ? 156  ILE A N   1 
ATOM   903   C CA  . ILE A  1 129 ? 45.988 9.039  13.071  1.00 36.38  ? 156  ILE A CA  1 
ATOM   904   C C   . ILE A  1 129 ? 45.249 9.991  12.145  1.00 36.54  ? 156  ILE A C   1 
ATOM   905   O O   . ILE A  1 129 ? 44.064 10.262 12.344  1.00 37.06  ? 156  ILE A O   1 
ATOM   906   C CB  . ILE A  1 129 ? 45.589 7.608  12.752  1.00 35.97  ? 156  ILE A CB  1 
ATOM   907   C CG1 . ILE A  1 129 ? 46.290 6.666  13.734  1.00 37.39  ? 156  ILE A CG1 1 
ATOM   908   C CG2 . ILE A  1 129 ? 45.944 7.286  11.317  1.00 36.03  ? 156  ILE A CG2 1 
ATOM   909   C CD1 . ILE A  1 129 ? 45.919 5.220  13.598  1.00 38.07  ? 156  ILE A CD1 1 
ATOM   910   N N   . PRO A  1 130 ? 45.937 10.502 11.110  1.00 35.51  ? 157  PRO A N   1 
ATOM   911   C CA  . PRO A  1 130 ? 47.343 10.246 10.822  1.00 35.57  ? 157  PRO A CA  1 
ATOM   912   C C   . PRO A  1 130 ? 48.278 11.171 11.610  1.00 36.21  ? 157  PRO A C   1 
ATOM   913   O O   . PRO A  1 130 ? 49.466 11.264 11.321  1.00 37.66  ? 157  PRO A O   1 
ATOM   914   C CB  . PRO A  1 130 ? 47.410 10.494 9.312   1.00 34.81  ? 157  PRO A CB  1 
ATOM   915   C CG  . PRO A  1 130 ? 46.517 11.654 9.147   1.00 34.01  ? 157  PRO A CG  1 
ATOM   916   C CD  . PRO A  1 130 ? 45.324 11.273 10.017  1.00 35.77  ? 157  PRO A CD  1 
ATOM   917   N N   . HIS A  1 131 ? 47.752 11.871 12.604  1.00 35.94  ? 158  HIS A N   1 
ATOM   918   C CA  . HIS A  1 131 ? 48.597 12.772 13.362  1.00 36.06  ? 158  HIS A CA  1 
ATOM   919   C C   . HIS A  1 131 ? 48.487 12.627 14.854  1.00 36.51  ? 158  HIS A C   1 
ATOM   920   O O   . HIS A  1 131 ? 47.418 12.741 15.437  1.00 36.58  ? 158  HIS A O   1 
ATOM   921   C CB  . HIS A  1 131 ? 48.315 14.218 13.000  1.00 36.30  ? 158  HIS A CB  1 
ATOM   922   C CG  . HIS A  1 131 ? 48.517 14.524 11.556  1.00 36.58  ? 158  HIS A CG  1 
ATOM   923   N ND1 . HIS A  1 131 ? 47.502 14.430 10.633  1.00 37.77  ? 158  HIS A ND1 1 
ATOM   924   C CD2 . HIS A  1 131 ? 49.611 14.935 10.876  1.00 36.45  ? 158  HIS A CD2 1 
ATOM   925   C CE1 . HIS A  1 131 ? 47.961 14.777 9.445   1.00 39.25  ? 158  HIS A CE1 1 
ATOM   926   N NE2 . HIS A  1 131 ? 49.238 15.088 9.566   1.00 37.51  ? 158  HIS A NE2 1 
ATOM   927   N N   . GLU A  1 132 ? 49.638 12.397 15.457  1.00 37.70  ? 159  GLU A N   1 
ATOM   928   C CA  . GLU A  1 132 ? 49.788 12.220 16.884  1.00 37.61  ? 159  GLU A CA  1 
ATOM   929   C C   . GLU A  1 132 ? 49.723 13.627 17.450  1.00 36.26  ? 159  GLU A C   1 
ATOM   930   O O   . GLU A  1 132 ? 50.356 14.538 16.906  1.00 36.56  ? 159  GLU A O   1 
ATOM   931   C CB  . GLU A  1 132 ? 51.159 11.586 17.108  1.00 41.37  ? 159  GLU A CB  1 
ATOM   932   C CG  . GLU A  1 132 ? 51.568 11.233 18.512  1.00 46.97  ? 159  GLU A CG  1 
ATOM   933   C CD  . GLU A  1 132 ? 52.858 10.434 18.500  1.00 49.72  ? 159  GLU A CD  1 
ATOM   934   O OE1 . GLU A  1 132 ? 53.907 10.990 18.101  1.00 52.27  ? 159  GLU A OE1 1 
ATOM   935   O OE2 . GLU A  1 132 ? 52.815 9.243  18.867  1.00 52.11  ? 159  GLU A OE2 1 
ATOM   936   N N   . HIS A  1 133 ? 48.945 13.820 18.512  1.00 32.92  ? 160  HIS A N   1 
ATOM   937   C CA  . HIS A  1 133 ? 48.850 15.142 19.104  1.00 30.53  ? 160  HIS A CA  1 
ATOM   938   C C   . HIS A  1 133 ? 48.458 15.115 20.567  1.00 30.38  ? 160  HIS A C   1 
ATOM   939   O O   . HIS A  1 133 ? 48.014 14.098 21.089  1.00 29.79  ? 160  HIS A O   1 
ATOM   940   C CB  . HIS A  1 133 ? 47.852 16.006 18.344  1.00 29.26  ? 160  HIS A CB  1 
ATOM   941   C CG  . HIS A  1 133 ? 46.431 15.601 18.559  1.00 26.16  ? 160  HIS A CG  1 
ATOM   942   N ND1 . HIS A  1 133 ? 45.858 14.537 17.898  1.00 23.80  ? 160  HIS A ND1 1 
ATOM   943   C CD2 . HIS A  1 133 ? 45.501 16.049 19.433  1.00 23.47  ? 160  HIS A CD2 1 
ATOM   944   C CE1 . HIS A  1 133 ? 44.639 14.343 18.363  1.00 23.63  ? 160  HIS A CE1 1 
ATOM   945   N NE2 . HIS A  1 133 ? 44.398 15.246 19.297  1.00 22.84  ? 160  HIS A NE2 1 
ATOM   946   N N   . SER A  1 134 ? 48.593 16.279 21.193  1.00 30.77  ? 161  SER A N   1 
ATOM   947   C CA  . SER A  1 134 ? 48.322 16.476 22.607  1.00 31.73  ? 161  SER A CA  1 
ATOM   948   C C   . SER A  1 134 ? 47.016 17.175 22.924  1.00 32.37  ? 161  SER A C   1 
ATOM   949   O O   . SER A  1 134 ? 46.844 17.671 24.034  1.00 33.54  ? 161  SER A O   1 
ATOM   950   C CB  . SER A  1 134 ? 49.450 17.300 23.222  1.00 32.14  ? 161  SER A CB  1 
ATOM   951   O OG  . SER A  1 134 ? 50.696 16.636 23.105  1.00 35.60  ? 161  SER A OG  1 
ATOM   952   N N   . PHE A  1 135 ? 46.103 17.234 21.962  1.00 32.12  ? 162  PHE A N   1 
ATOM   953   C CA  . PHE A  1 135 ? 44.825 17.916 22.168  1.00 29.48  ? 162  PHE A CA  1 
ATOM   954   C C   . PHE A  1 135 ? 43.689 16.936 22.436  1.00 31.80  ? 162  PHE A C   1 
ATOM   955   O O   . PHE A  1 135 ? 42.913 16.594 21.527  1.00 30.88  ? 162  PHE A O   1 
ATOM   956   C CB  . PHE A  1 135 ? 44.486 18.756 20.944  1.00 24.12  ? 162  PHE A CB  1 
ATOM   957   C CG  . PHE A  1 135 ? 45.330 19.971 20.790  1.00 17.71  ? 162  PHE A CG  1 
ATOM   958   C CD1 . PHE A  1 135 ? 44.938 21.175 21.349  1.00 16.76  ? 162  PHE A CD1 1 
ATOM   959   C CD2 . PHE A  1 135 ? 46.506 19.923 20.068  1.00 15.06  ? 162  PHE A CD2 1 
ATOM   960   C CE1 . PHE A  1 135 ? 45.714 22.334 21.184  1.00 17.16  ? 162  PHE A CE1 1 
ATOM   961   C CE2 . PHE A  1 135 ? 47.289 21.067 19.899  1.00 15.03  ? 162  PHE A CE2 1 
ATOM   962   C CZ  . PHE A  1 135 ? 46.893 22.278 20.456  1.00 15.01  ? 162  PHE A CZ  1 
ATOM   963   N N   . LEU A  1 136 ? 43.592 16.472 23.679  1.00 32.80  ? 163  LEU A N   1 
ATOM   964   C CA  . LEU A  1 136 ? 42.529 15.544 24.022  1.00 32.31  ? 163  LEU A CA  1 
ATOM   965   C C   . LEU A  1 136 ? 41.445 16.333 24.741  1.00 33.02  ? 163  LEU A C   1 
ATOM   966   O O   . LEU A  1 136 ? 41.720 17.367 25.369  1.00 29.87  ? 163  LEU A O   1 
ATOM   967   C CB  . LEU A  1 136 ? 43.069 14.418 24.897  1.00 30.50  ? 163  LEU A CB  1 
ATOM   968   N N   . PRO A  1 137 ? 40.188 15.879 24.619  1.00 35.18  ? 164  PRO A N   1 
ATOM   969   C CA  . PRO A  1 137 ? 39.016 16.506 25.241  1.00 37.02  ? 164  PRO A CA  1 
ATOM   970   C C   . PRO A  1 137 ? 39.259 16.553 26.739  1.00 39.13  ? 164  PRO A C   1 
ATOM   971   O O   . PRO A  1 137 ? 39.159 17.600 27.381  1.00 38.57  ? 164  PRO A O   1 
ATOM   972   C CB  . PRO A  1 137 ? 37.890 15.552 24.882  1.00 36.28  ? 164  PRO A CB  1 
ATOM   973   C CG  . PRO A  1 137 ? 38.336 14.989 23.569  1.00 36.43  ? 164  PRO A CG  1 
ATOM   974   C CD  . PRO A  1 137 ? 39.788 14.711 23.821  1.00 36.02  ? 164  PRO A CD  1 
ATOM   975   N N   . SER A  1 138 ? 39.580 15.381 27.277  1.00 40.95  ? 165  SER A N   1 
ATOM   976   C CA  . SER A  1 138 ? 39.886 15.215 28.684  1.00 41.01  ? 165  SER A CA  1 
ATOM   977   C C   . SER A  1 138 ? 40.840 16.328 29.073  1.00 41.07  ? 165  SER A C   1 
ATOM   978   O O   . SER A  1 138 ? 40.519 17.167 29.912  1.00 41.53  ? 165  SER A O   1 
ATOM   979   C CB  . SER A  1 138 ? 40.539 13.860 28.868  1.00 41.60  ? 165  SER A CB  1 
ATOM   980   O OG  . SER A  1 138 ? 40.810 13.313 27.582  1.00 43.86  ? 165  SER A OG  1 
ATOM   981   N N   . SER A  1 139 ? 42.006 16.366 28.442  1.00 41.57  ? 166  SER A N   1 
ATOM   982   C CA  . SER A  1 139 ? 42.958 17.417 28.777  1.00 43.39  ? 166  SER A CA  1 
ATOM   983   C C   . SER A  1 139 ? 42.520 18.810 28.274  1.00 42.06  ? 166  SER A C   1 
ATOM   984   O O   . SER A  1 139 ? 43.273 19.783 28.373  1.00 40.72  ? 166  SER A O   1 
ATOM   985   C CB  . SER A  1 139 ? 44.369 17.057 28.263  1.00 44.43  ? 166  SER A CB  1 
ATOM   986   O OG  . SER A  1 139 ? 44.604 17.508 26.940  1.00 46.98  ? 166  SER A OG  1 
ATOM   987   N N   . TYR A  1 140 ? 41.295 18.901 27.755  1.00 42.02  ? 167  TYR A N   1 
ATOM   988   C CA  . TYR A  1 140 ? 40.751 20.173 27.258  1.00 42.40  ? 167  TYR A CA  1 
ATOM   989   C C   . TYR A  1 140 ? 39.251 20.281 27.457  1.00 43.09  ? 167  TYR A C   1 
ATOM   990   O O   . TYR A  1 140 ? 38.532 20.751 26.575  1.00 43.74  ? 167  TYR A O   1 
ATOM   991   C CB  . TYR A  1 140 ? 41.062 20.356 25.773  1.00 40.09  ? 167  TYR A CB  1 
ATOM   992   C CG  . TYR A  1 140 ? 42.398 21.003 25.513  1.00 37.84  ? 167  TYR A CG  1 
ATOM   993   C CD1 . TYR A  1 140 ? 42.629 22.327 25.878  1.00 34.27  ? 167  TYR A CD1 1 
ATOM   994   C CD2 . TYR A  1 140 ? 43.436 20.289 24.902  1.00 37.25  ? 167  TYR A CD2 1 
ATOM   995   C CE1 . TYR A  1 140 ? 43.854 22.929 25.641  1.00 34.40  ? 167  TYR A CE1 1 
ATOM   996   C CE2 . TYR A  1 140 ? 44.672 20.883 24.659  1.00 36.05  ? 167  TYR A CE2 1 
ATOM   997   C CZ  . TYR A  1 140 ? 44.877 22.207 25.029  1.00 35.58  ? 167  TYR A CZ  1 
ATOM   998   O OH  . TYR A  1 140 ? 46.098 22.814 24.776  1.00 36.50  ? 167  TYR A OH  1 
ATOM   999   N N   . ARG A  1 141 ? 38.791 19.836 28.622  1.00 43.81  ? 168  ARG A N   1 
ATOM   1000  C CA  . ARG A  1 141 ? 37.375 19.860 28.973  1.00 43.00  ? 168  ARG A CA  1 
ATOM   1001  C C   . ARG A  1 141 ? 36.723 21.207 28.687  1.00 42.48  ? 168  ARG A C   1 
ATOM   1002  O O   . ARG A  1 141 ? 37.325 22.267 28.892  1.00 42.80  ? 168  ARG A O   1 
ATOM   1003  C CB  . ARG A  1 141 ? 37.214 19.509 30.447  1.00 43.36  ? 168  ARG A CB  1 
ATOM   1004  N N   . GLY A  1 142 ? 35.496 21.173 28.191  1.00 40.83  ? 169  GLY A N   1 
ATOM   1005  C CA  . GLY A  1 142 ? 34.821 22.430 27.940  1.00 40.81  ? 169  GLY A CA  1 
ATOM   1006  C C   . GLY A  1 142 ? 35.104 23.115 26.617  1.00 40.51  ? 169  GLY A C   1 
ATOM   1007  O O   . GLY A  1 142 ? 34.337 23.973 26.191  1.00 40.99  ? 169  GLY A O   1 
ATOM   1008  N N   . LYS A  1 143 ? 36.199 22.779 25.954  1.00 39.18  ? 170  LYS A N   1 
ATOM   1009  C CA  . LYS A  1 143 ? 36.464 23.401 24.674  1.00 36.43  ? 170  LYS A CA  1 
ATOM   1010  C C   . LYS A  1 143 ? 35.807 22.565 23.581  1.00 34.38  ? 170  LYS A C   1 
ATOM   1011  O O   . LYS A  1 143 ? 35.992 22.802 22.389  1.00 35.32  ? 170  LYS A O   1 
ATOM   1012  C CB  . LYS A  1 143 ? 37.963 23.545 24.463  1.00 38.18  ? 170  LYS A CB  1 
ATOM   1013  C CG  . LYS A  1 143 ? 38.567 24.657 25.314  1.00 42.02  ? 170  LYS A CG  1 
ATOM   1014  C CD  . LYS A  1 143 ? 37.894 26.008 25.027  1.00 45.52  ? 170  LYS A CD  1 
ATOM   1015  C CE  . LYS A  1 143 ? 38.694 27.191 25.582  1.00 47.82  ? 170  LYS A CE  1 
ATOM   1016  N NZ  . LYS A  1 143 ? 38.774 27.190 27.078  1.00 50.83  ? 170  LYS A NZ  1 
ATOM   1017  N N   . ASP A  1 144 ? 35.028 21.586 24.018  1.00 31.06  ? 171  ASP A N   1 
ATOM   1018  C CA  . ASP A  1 144 ? 34.284 20.709 23.138  1.00 30.27  ? 171  ASP A CA  1 
ATOM   1019  C C   . ASP A  1 144 ? 35.050 20.094 21.975  1.00 28.71  ? 171  ASP A C   1 
ATOM   1020  O O   . ASP A  1 144 ? 34.598 20.140 20.840  1.00 27.28  ? 171  ASP A O   1 
ATOM   1021  C CB  . ASP A  1 144 ? 33.055 21.451 22.616  1.00 34.08  ? 171  ASP A CB  1 
ATOM   1022  C CG  . ASP A  1 144 ? 32.105 20.550 21.824  1.00 37.72  ? 171  ASP A CG  1 
ATOM   1023  O OD1 . ASP A  1 144 ? 31.980 19.339 22.135  1.00 39.46  ? 171  ASP A OD1 1 
ATOM   1024  O OD2 . ASP A  1 144 ? 31.461 21.069 20.890  1.00 40.76  ? 171  ASP A OD2 1 
ATOM   1025  N N   . LEU A  1 145 ? 36.207 19.506 22.261  1.00 28.26  ? 172  LEU A N   1 
ATOM   1026  C CA  . LEU A  1 145 ? 37.006 18.851 21.234  1.00 25.10  ? 172  LEU A CA  1 
ATOM   1027  C C   . LEU A  1 145 ? 36.406 17.492 20.913  1.00 25.42  ? 172  LEU A C   1 
ATOM   1028  O O   . LEU A  1 145 ? 37.026 16.463 21.147  1.00 24.60  ? 172  LEU A O   1 
ATOM   1029  C CB  . LEU A  1 145 ? 38.440 18.676 21.716  1.00 23.14  ? 172  LEU A CB  1 
ATOM   1030  C CG  . LEU A  1 145 ? 39.185 19.983 21.942  1.00 21.79  ? 172  LEU A CG  1 
ATOM   1031  C CD1 . LEU A  1 145 ? 40.598 19.696 22.389  1.00 23.14  ? 172  LEU A CD1 1 
ATOM   1032  C CD2 . LEU A  1 145 ? 39.211 20.767 20.662  1.00 23.00  ? 172  LEU A CD2 1 
ATOM   1033  N N   . GLN A  1 146 ? 35.188 17.499 20.388  1.00 27.16  ? 173  GLN A N   1 
ATOM   1034  C CA  . GLN A  1 146 ? 34.490 16.273 20.015  1.00 30.33  ? 173  GLN A CA  1 
ATOM   1035  C C   . GLN A  1 146 ? 34.581 15.977 18.513  1.00 31.15  ? 173  GLN A C   1 
ATOM   1036  O O   . GLN A  1 146 ? 35.120 16.779 17.749  1.00 29.69  ? 173  GLN A O   1 
ATOM   1037  C CB  . GLN A  1 146 ? 33.022 16.353 20.446  1.00 33.81  ? 173  GLN A CB  1 
ATOM   1038  C CG  . GLN A  1 146 ? 32.791 15.858 21.860  1.00 39.24  ? 173  GLN A CG  1 
ATOM   1039  C CD  . GLN A  1 146 ? 33.554 14.564 22.126  1.00 42.71  ? 173  GLN A CD  1 
ATOM   1040  O OE1 . GLN A  1 146 ? 33.639 13.680 21.249  1.00 43.45  ? 173  GLN A OE1 1 
ATOM   1041  N NE2 . GLN A  1 146 ? 34.117 14.443 23.334  1.00 42.72  ? 173  GLN A NE2 1 
ATOM   1042  N N   . GLU A  1 147 ? 34.042 14.833 18.090  1.00 32.92  ? 174  GLU A N   1 
ATOM   1043  C CA  . GLU A  1 147 ? 34.100 14.424 16.680  1.00 34.63  ? 174  GLU A CA  1 
ATOM   1044  C C   . GLU A  1 147 ? 35.377 14.942 16.021  1.00 35.06  ? 174  GLU A C   1 
ATOM   1045  O O   . GLU A  1 147 ? 36.481 14.679 16.495  1.00 37.44  ? 174  GLU A O   1 
ATOM   1046  C CB  . GLU A  1 147 ? 32.890 14.948 15.920  1.00 36.57  ? 174  GLU A CB  1 
ATOM   1047  C CG  . GLU A  1 147 ? 31.582 14.525 16.532  1.00 41.16  ? 174  GLU A CG  1 
ATOM   1048  C CD  . GLU A  1 147 ? 31.462 13.017 16.690  1.00 44.39  ? 174  GLU A CD  1 
ATOM   1049  O OE1 . GLU A  1 147 ? 31.423 12.289 15.664  1.00 44.31  ? 174  GLU A OE1 1 
ATOM   1050  O OE2 . GLU A  1 147 ? 31.402 12.560 17.856  1.00 48.64  ? 174  GLU A OE2 1 
ATOM   1051  N N   . ASN A  1 148 ? 35.231 15.685 14.934  1.00 33.09  ? 175  ASN A N   1 
ATOM   1052  C CA  . ASN A  1 148 ? 36.387 16.241 14.256  1.00 31.53  ? 175  ASN A CA  1 
ATOM   1053  C C   . ASN A  1 148 ? 36.049 17.670 13.872  1.00 30.12  ? 175  ASN A C   1 
ATOM   1054  O O   . ASN A  1 148 ? 36.452 18.157 12.814  1.00 30.06  ? 175  ASN A O   1 
ATOM   1055  C CB  . ASN A  1 148 ? 36.726 15.421 13.011  1.00 32.48  ? 175  ASN A CB  1 
ATOM   1056  C CG  . ASN A  1 148 ? 35.651 15.521 11.941  1.00 34.35  ? 175  ASN A CG  1 
ATOM   1057  O OD1 . ASN A  1 148 ? 34.458 15.495 12.249  1.00 35.01  ? 175  ASN A OD1 1 
ATOM   1058  N ND2 . ASN A  1 148 ? 36.066 15.624 10.678  1.00 33.07  ? 175  ASN A ND2 1 
ATOM   1059  N N   . TYR A  1 149 ? 35.312 18.339 14.751  1.00 28.35  ? 176  TYR A N   1 
ATOM   1060  C CA  . TYR A  1 149 ? 34.895 19.713 14.510  1.00 28.08  ? 176  TYR A CA  1 
ATOM   1061  C C   . TYR A  1 149 ? 36.024 20.697 14.693  1.00 28.12  ? 176  TYR A C   1 
ATOM   1062  O O   . TYR A  1 149 ? 36.809 20.576 15.619  1.00 29.58  ? 176  TYR A O   1 
ATOM   1063  C CB  . TYR A  1 149 ? 33.785 20.112 15.473  1.00 26.63  ? 176  TYR A CB  1 
ATOM   1064  C CG  . TYR A  1 149 ? 32.622 19.158 15.558  1.00 27.40  ? 176  TYR A CG  1 
ATOM   1065  C CD1 . TYR A  1 149 ? 31.933 18.747 14.410  1.00 28.02  ? 176  TYR A CD1 1 
ATOM   1066  C CD2 . TYR A  1 149 ? 32.162 18.713 16.801  1.00 26.03  ? 176  TYR A CD2 1 
ATOM   1067  C CE1 . TYR A  1 149 ? 30.810 17.917 14.507  1.00 29.53  ? 176  TYR A CE1 1 
ATOM   1068  C CE2 . TYR A  1 149 ? 31.047 17.890 16.910  1.00 25.88  ? 176  TYR A CE2 1 
ATOM   1069  C CZ  . TYR A  1 149 ? 30.375 17.495 15.766  1.00 28.76  ? 176  TYR A CZ  1 
ATOM   1070  O OH  . TYR A  1 149 ? 29.264 16.689 15.878  1.00 29.74  ? 176  TYR A OH  1 
ATOM   1071  N N   . CYS A  1 150 ? 36.092 21.689 13.819  1.00 29.04  ? 177  CYS A N   1 
ATOM   1072  C CA  . CYS A  1 150 ? 37.112 22.718 13.927  1.00 30.00  ? 177  CYS A CA  1 
ATOM   1073  C C   . CYS A  1 150 ? 36.912 23.421 15.265  1.00 32.13  ? 177  CYS A C   1 
ATOM   1074  O O   . CYS A  1 150 ? 35.795 23.767 15.650  1.00 32.00  ? 177  CYS A O   1 
ATOM   1075  C CB  . CYS A  1 150 ? 36.957 23.724 12.806  1.00 29.23  ? 177  CYS A CB  1 
ATOM   1076  S SG  . CYS A  1 150 ? 37.037 23.016 11.124  1.00 29.88  ? 177  CYS A SG  1 
ATOM   1077  N N   . ARG A  1 151 ? 38.006 23.626 15.982  1.00 34.19  ? 178  ARG A N   1 
ATOM   1078  C CA  . ARG A  1 151 ? 37.945 24.270 17.278  1.00 33.61  ? 178  ARG A CA  1 
ATOM   1079  C C   . ARG A  1 151 ? 39.183 25.147 17.430  1.00 35.35  ? 178  ARG A C   1 
ATOM   1080  O O   . ARG A  1 151 ? 40.046 25.185 16.552  1.00 35.50  ? 178  ARG A O   1 
ATOM   1081  C CB  . ARG A  1 151 ? 37.901 23.194 18.360  1.00 31.26  ? 178  ARG A CB  1 
ATOM   1082  C CG  . ARG A  1 151 ? 36.631 22.361 18.349  1.00 28.50  ? 178  ARG A CG  1 
ATOM   1083  C CD  . ARG A  1 151 ? 35.552 23.049 19.175  1.00 31.04  ? 178  ARG A CD  1 
ATOM   1084  N NE  . ARG A  1 151 ? 34.279 22.325 19.221  1.00 31.58  ? 178  ARG A NE  1 
ATOM   1085  C CZ  . ARG A  1 151 ? 33.356 22.355 18.264  1.00 31.93  ? 178  ARG A CZ  1 
ATOM   1086  N NH1 . ARG A  1 151 ? 33.550 23.079 17.166  1.00 33.20  ? 178  ARG A NH1 1 
ATOM   1087  N NH2 . ARG A  1 151 ? 32.236 21.662 18.407  1.00 29.77  ? 178  ARG A NH2 1 
ATOM   1088  N N   . ASN A  1 152 ? 39.253 25.873 18.532  1.00 37.81  ? 179  ASN A N   1 
ATOM   1089  C CA  . ASN A  1 152 ? 40.400 26.737 18.817  1.00 40.09  ? 179  ASN A CA  1 
ATOM   1090  C C   . ASN A  1 152 ? 40.543 26.717 20.337  1.00 39.74  ? 179  ASN A C   1 
ATOM   1091  O O   . ASN A  1 152 ? 40.341 27.723 21.013  1.00 37.99  ? 179  ASN A O   1 
ATOM   1092  C CB  . ASN A  1 152 ? 40.134 28.157 18.316  1.00 42.00  ? 179  ASN A CB  1 
ATOM   1093  C CG  . ASN A  1 152 ? 41.321 29.079 18.517  1.00 43.16  ? 179  ASN A CG  1 
ATOM   1094  O OD1 . ASN A  1 152 ? 42.407 28.636 18.885  1.00 44.77  ? 179  ASN A OD1 1 
ATOM   1095  N ND2 . ASN A  1 152 ? 41.122 30.366 18.267  1.00 43.62  ? 179  ASN A ND2 1 
ATOM   1096  N N   . PRO A  1 153 ? 40.906 25.551 20.883  1.00 39.84  ? 180  PRO A N   1 
ATOM   1097  C CA  . PRO A  1 153 ? 41.075 25.326 22.315  1.00 41.19  ? 180  PRO A CA  1 
ATOM   1098  C C   . PRO A  1 153 ? 42.074 26.214 23.054  1.00 42.79  ? 180  PRO A C   1 
ATOM   1099  O O   . PRO A  1 153 ? 42.094 26.232 24.281  1.00 43.80  ? 180  PRO A O   1 
ATOM   1100  C CB  . PRO A  1 153 ? 41.416 23.837 22.382  1.00 39.99  ? 180  PRO A CB  1 
ATOM   1101  C CG  . PRO A  1 153 ? 42.159 23.622 21.140  1.00 40.47  ? 180  PRO A CG  1 
ATOM   1102  C CD  . PRO A  1 153 ? 41.365 24.380 20.118  1.00 39.36  ? 180  PRO A CD  1 
ATOM   1103  N N   . ARG A  1 154 ? 42.895 26.964 22.336  1.00 43.45  ? 181  ARG A N   1 
ATOM   1104  C CA  . ARG A  1 154 ? 43.865 27.827 23.011  1.00 43.77  ? 181  ARG A CA  1 
ATOM   1105  C C   . ARG A  1 154 ? 43.588 29.263 22.629  1.00 44.59  ? 181  ARG A C   1 
ATOM   1106  O O   . ARG A  1 154 ? 44.391 30.152 22.895  1.00 45.99  ? 181  ARG A O   1 
ATOM   1107  C CB  . ARG A  1 154 ? 45.300 27.467 22.606  1.00 43.07  ? 181  ARG A CB  1 
ATOM   1108  C CG  . ARG A  1 154 ? 45.728 26.073 23.012  1.00 43.94  ? 181  ARG A CG  1 
ATOM   1109  C CD  . ARG A  1 154 ? 46.644 25.492 21.960  1.00 45.07  ? 181  ARG A CD  1 
ATOM   1110  N NE  . ARG A  1 154 ? 48.007 25.323 22.429  1.00 46.58  ? 181  ARG A NE  1 
ATOM   1111  C CZ  . ARG A  1 154 ? 49.052 25.181 21.621  1.00 49.55  ? 181  ARG A CZ  1 
ATOM   1112  N NH1 . ARG A  1 154 ? 48.885 25.196 20.303  1.00 50.91  ? 181  ARG A NH1 1 
ATOM   1113  N NH2 . ARG A  1 154 ? 50.268 25.015 22.125  1.00 50.90  ? 181  ARG A NH2 1 
ATOM   1114  N N   . GLY A  1 155 ? 42.453 29.483 21.980  1.00 44.75  ? 182  GLY A N   1 
ATOM   1115  C CA  . GLY A  1 155 ? 42.105 30.828 21.566  1.00 44.80  ? 182  GLY A CA  1 
ATOM   1116  C C   . GLY A  1 155 ? 43.253 31.561 20.902  1.00 44.93  ? 182  GLY A C   1 
ATOM   1117  O O   . GLY A  1 155 ? 43.487 32.731 21.171  1.00 45.41  ? 182  GLY A O   1 
ATOM   1118  N N   . GLU A  1 156 ? 43.975 30.874 20.030  1.00 45.81  ? 183  GLU A N   1 
ATOM   1119  C CA  . GLU A  1 156 ? 45.098 31.480 19.336  1.00 47.30  ? 183  GLU A CA  1 
ATOM   1120  C C   . GLU A  1 156 ? 44.590 32.262 18.126  1.00 47.93  ? 183  GLU A C   1 
ATOM   1121  O O   . GLU A  1 156 ? 43.499 32.002 17.616  1.00 47.87  ? 183  GLU A O   1 
ATOM   1122  C CB  . GLU A  1 156 ? 46.066 30.392 18.850  1.00 47.80  ? 183  GLU A CB  1 
ATOM   1123  C CG  . GLU A  1 156 ? 46.372 29.300 19.877  1.00 48.82  ? 183  GLU A CG  1 
ATOM   1124  C CD  . GLU A  1 156 ? 47.167 28.138 19.283  1.00 49.40  ? 183  GLU A CD  1 
ATOM   1125  O OE1 . GLU A  1 156 ? 48.322 28.346 18.853  1.00 50.98  ? 183  GLU A OE1 1 
ATOM   1126  O OE2 . GLU A  1 156 ? 46.636 27.014 19.238  1.00 48.28  ? 183  GLU A OE2 1 
ATOM   1127  N N   . GLU A  1 157 ? 45.390 33.224 17.676  1.00 48.82  ? 184  GLU A N   1 
ATOM   1128  C CA  . GLU A  1 157 ? 45.059 34.001 16.489  1.00 48.96  ? 184  GLU A CA  1 
ATOM   1129  C C   . GLU A  1 157 ? 44.911 32.914 15.440  1.00 46.32  ? 184  GLU A C   1 
ATOM   1130  O O   . GLU A  1 157 ? 45.532 31.866 15.572  1.00 47.61  ? 184  GLU A O   1 
ATOM   1131  C CB  . GLU A  1 157 ? 46.231 34.898 16.080  1.00 52.12  ? 184  GLU A CB  1 
ATOM   1132  C CG  . GLU A  1 157 ? 46.877 35.676 17.218  1.00 59.79  ? 184  GLU A CG  1 
ATOM   1133  C CD  . GLU A  1 157 ? 45.865 36.444 18.077  1.00 64.92  ? 184  GLU A CD  1 
ATOM   1134  O OE1 . GLU A  1 157 ? 44.926 37.055 17.509  1.00 67.41  ? 184  GLU A OE1 1 
ATOM   1135  O OE2 . GLU A  1 157 ? 46.022 36.446 19.322  1.00 66.75  ? 184  GLU A OE2 1 
ATOM   1136  N N   . GLY A  1 158 ? 44.111 33.145 14.407  1.00 42.64  ? 185  GLY A N   1 
ATOM   1137  C CA  . GLY A  1 158 ? 43.952 32.125 13.388  1.00 37.37  ? 185  GLY A CA  1 
ATOM   1138  C C   . GLY A  1 158 ? 42.622 31.432 13.547  1.00 35.36  ? 185  GLY A C   1 
ATOM   1139  O O   . GLY A  1 158 ? 42.184 30.710 12.655  1.00 35.14  ? 185  GLY A O   1 
ATOM   1140  N N   . GLY A  1 159 ? 41.983 31.656 14.695  1.00 32.67  ? 186  GLY A N   1 
ATOM   1141  C CA  . GLY A  1 159 ? 40.686 31.065 14.961  1.00 29.68  ? 186  GLY A CA  1 
ATOM   1142  C C   . GLY A  1 159 ? 40.663 29.555 14.858  1.00 28.58  ? 186  GLY A C   1 
ATOM   1143  O O   . GLY A  1 159 ? 41.715 28.917 14.853  1.00 29.69  ? 186  GLY A O   1 
ATOM   1144  N N   . PRO A  1 160 ? 39.471 28.953 14.765  1.00 26.21  ? 187  PRO A N   1 
ATOM   1145  C CA  . PRO A  1 160 ? 39.264 27.504 14.665  1.00 25.60  ? 187  PRO A CA  1 
ATOM   1146  C C   . PRO A  1 160 ? 40.112 26.788 13.626  1.00 25.64  ? 187  PRO A C   1 
ATOM   1147  O O   . PRO A  1 160 ? 40.323 27.279 12.519  1.00 26.61  ? 187  PRO A O   1 
ATOM   1148  C CB  . PRO A  1 160 ? 37.781 27.392 14.385  1.00 24.32  ? 187  PRO A CB  1 
ATOM   1149  C CG  . PRO A  1 160 ? 37.240 28.527 15.188  1.00 26.13  ? 187  PRO A CG  1 
ATOM   1150  C CD  . PRO A  1 160 ? 38.183 29.652 14.838  1.00 25.48  ? 187  PRO A CD  1 
ATOM   1151  N N   . TRP A  1 161 ? 40.603 25.617 14.009  1.00 25.17  ? 188  TRP A N   1 
ATOM   1152  C CA  . TRP A  1 161 ? 41.450 24.803 13.151  1.00 24.71  ? 188  TRP A CA  1 
ATOM   1153  C C   . TRP A  1 161 ? 41.187 23.360 13.497  1.00 25.01  ? 188  TRP A C   1 
ATOM   1154  O O   . TRP A  1 161 ? 40.314 23.061 14.307  1.00 25.75  ? 188  TRP A O   1 
ATOM   1155  C CB  . TRP A  1 161 ? 42.927 25.105 13.418  1.00 24.69  ? 188  TRP A CB  1 
ATOM   1156  C CG  . TRP A  1 161 ? 43.314 24.925 14.862  1.00 24.86  ? 188  TRP A CG  1 
ATOM   1157  C CD1 . TRP A  1 161 ? 43.081 25.799 15.895  1.00 24.58  ? 188  TRP A CD1 1 
ATOM   1158  C CD2 . TRP A  1 161 ? 43.945 23.781 15.444  1.00 25.09  ? 188  TRP A CD2 1 
ATOM   1159  N NE1 . TRP A  1 161 ? 43.528 25.266 17.078  1.00 24.99  ? 188  TRP A NE1 1 
ATOM   1160  C CE2 . TRP A  1 161 ? 44.063 24.027 16.830  1.00 25.80  ? 188  TRP A CE2 1 
ATOM   1161  C CE3 . TRP A  1 161 ? 44.423 22.570 14.931  1.00 25.61  ? 188  TRP A CE3 1 
ATOM   1162  C CZ2 . TRP A  1 161 ? 44.642 23.100 17.708  1.00 25.24  ? 188  TRP A CZ2 1 
ATOM   1163  C CZ3 . TRP A  1 161 ? 44.998 21.652 15.806  1.00 26.71  ? 188  TRP A CZ3 1 
ATOM   1164  C CH2 . TRP A  1 161 ? 45.102 21.924 17.176  1.00 25.28  ? 188  TRP A CH2 1 
ATOM   1165  N N   . CYS A  1 162 ? 41.951 22.469 12.886  1.00 25.31  ? 189  CYS A N   1 
ATOM   1166  C CA  . CYS A  1 162 ? 41.817 21.055 13.171  1.00 27.51  ? 189  CYS A CA  1 
ATOM   1167  C C   . CYS A  1 162 ? 42.955 20.273 12.525  1.00 26.18  ? 189  CYS A C   1 
ATOM   1168  O O   . CYS A  1 162 ? 43.617 20.759 11.615  1.00 24.03  ? 189  CYS A O   1 
ATOM   1169  C CB  . CYS A  1 162 ? 40.480 20.547 12.640  1.00 31.39  ? 189  CYS A CB  1 
ATOM   1170  S SG  . CYS A  1 162 ? 40.482 20.205 10.846  1.00 36.81  ? 189  CYS A SG  1 
ATOM   1171  N N   . PHE A  1 163 ? 43.197 19.068 13.017  1.00 26.21  ? 190  PHE A N   1 
ATOM   1172  C CA  . PHE A  1 163 ? 44.222 18.220 12.431  1.00 26.33  ? 190  PHE A CA  1 
ATOM   1173  C C   . PHE A  1 163 ? 43.570 17.635 11.188  1.00 27.94  ? 190  PHE A C   1 
ATOM   1174  O O   . PHE A  1 163 ? 42.462 17.086 11.262  1.00 28.74  ? 190  PHE A O   1 
ATOM   1175  C CB  . PHE A  1 163 ? 44.627 17.111 13.411  1.00 23.19  ? 190  PHE A CB  1 
ATOM   1176  C CG  . PHE A  1 163 ? 45.478 17.601 14.537  1.00 20.74  ? 190  PHE A CG  1 
ATOM   1177  C CD1 . PHE A  1 163 ? 46.785 18.008 14.301  1.00 19.70  ? 190  PHE A CD1 1 
ATOM   1178  C CD2 . PHE A  1 163 ? 44.960 17.725 15.827  1.00 20.87  ? 190  PHE A CD2 1 
ATOM   1179  C CE1 . PHE A  1 163 ? 47.557 18.534 15.328  1.00 20.19  ? 190  PHE A CE1 1 
ATOM   1180  C CE2 . PHE A  1 163 ? 45.730 18.252 16.870  1.00 18.20  ? 190  PHE A CE2 1 
ATOM   1181  C CZ  . PHE A  1 163 ? 47.023 18.656 16.615  1.00 20.01  ? 190  PHE A CZ  1 
ATOM   1182  N N   . THR A  1 164 ? 44.240 17.756 10.043  1.00 28.71  ? 191  THR A N   1 
ATOM   1183  C CA  . THR A  1 164 ? 43.662 17.254 8.797   1.00 28.78  ? 191  THR A CA  1 
ATOM   1184  C C   . THR A  1 164 ? 43.902 15.773 8.572   1.00 29.41  ? 191  THR A C   1 
ATOM   1185  O O   . THR A  1 164 ? 44.905 15.227 8.994   1.00 28.62  ? 191  THR A O   1 
ATOM   1186  C CB  . THR A  1 164 ? 44.179 18.031 7.583   1.00 26.28  ? 191  THR A CB  1 
ATOM   1187  O OG1 . THR A  1 164 ? 45.120 17.229 6.871   1.00 25.50  ? 191  THR A OG1 1 
ATOM   1188  C CG2 . THR A  1 164 ? 44.840 19.320 8.024   1.00 26.43  ? 191  THR A CG2 1 
ATOM   1189  N N   . SER A  1 165 ? 42.953 15.126 7.910   1.00 32.74  ? 192  SER A N   1 
ATOM   1190  C CA  . SER A  1 165 ? 43.049 13.698 7.627   1.00 34.59  ? 192  SER A CA  1 
ATOM   1191  C C   . SER A  1 165 ? 44.110 13.418 6.563   1.00 35.58  ? 192  SER A C   1 
ATOM   1192  O O   . SER A  1 165 ? 44.375 12.271 6.223   1.00 35.90  ? 192  SER A O   1 
ATOM   1193  C CB  . SER A  1 165 ? 41.677 13.153 7.186   1.00 33.93  ? 192  SER A CB  1 
ATOM   1194  O OG  . SER A  1 165 ? 41.044 14.021 6.254   1.00 31.89  ? 192  SER A OG  1 
ATOM   1195  N N   . ASN A  1 166 ? 44.711 14.479 6.043   1.00 36.56  ? 193  ASN A N   1 
ATOM   1196  C CA  . ASN A  1 166 ? 45.747 14.336 5.037   1.00 38.37  ? 193  ASN A CA  1 
ATOM   1197  C C   . ASN A  1 166 ? 47.100 14.208 5.739   1.00 38.45  ? 193  ASN A C   1 
ATOM   1198  O O   . ASN A  1 166 ? 47.563 15.144 6.390   1.00 37.95  ? 193  ASN A O   1 
ATOM   1199  C CB  . ASN A  1 166 ? 45.772 15.557 4.113   1.00 40.95  ? 193  ASN A CB  1 
ATOM   1200  C CG  . ASN A  1 166 ? 46.831 15.439 3.028   1.00 43.71  ? 193  ASN A CG  1 
ATOM   1201  O OD1 . ASN A  1 166 ? 47.877 14.813 3.232   1.00 46.05  ? 193  ASN A OD1 1 
ATOM   1202  N ND2 . ASN A  1 166 ? 46.572 16.043 1.874   1.00 44.51  ? 193  ASN A ND2 1 
ATOM   1203  N N   . PRO A  1 167 ? 47.758 13.052 5.602   1.00 38.78  ? 194  PRO A N   1 
ATOM   1204  C CA  . PRO A  1 167 ? 49.056 12.860 6.249   1.00 38.30  ? 194  PRO A CA  1 
ATOM   1205  C C   . PRO A  1 167 ? 50.061 13.947 5.902   1.00 38.28  ? 194  PRO A C   1 
ATOM   1206  O O   . PRO A  1 167 ? 50.929 14.258 6.703   1.00 39.65  ? 194  PRO A O   1 
ATOM   1207  C CB  . PRO A  1 167 ? 49.482 11.492 5.749   1.00 38.64  ? 194  PRO A CB  1 
ATOM   1208  C CG  . PRO A  1 167 ? 48.150 10.774 5.586   1.00 37.90  ? 194  PRO A CG  1 
ATOM   1209  C CD  . PRO A  1 167 ? 47.334 11.828 4.898   1.00 38.32  ? 194  PRO A CD  1 
ATOM   1210  N N   . GLU A  1 168 ? 49.939 14.540 4.722   1.00 38.39  ? 195  GLU A N   1 
ATOM   1211  C CA  . GLU A  1 168 ? 50.867 15.595 4.310   1.00 38.93  ? 195  GLU A CA  1 
ATOM   1212  C C   . GLU A  1 168 ? 50.531 16.980 4.861   1.00 36.46  ? 195  GLU A C   1 
ATOM   1213  O O   . GLU A  1 168 ? 51.279 17.936 4.693   1.00 35.09  ? 195  GLU A O   1 
ATOM   1214  C CB  . GLU A  1 168 ? 50.961 15.641 2.786   1.00 42.57  ? 195  GLU A CB  1 
ATOM   1215  C CG  . GLU A  1 168 ? 51.833 14.539 2.202   1.00 49.10  ? 195  GLU A CG  1 
ATOM   1216  C CD  . GLU A  1 168 ? 51.496 14.242 0.745   1.00 54.76  ? 195  GLU A CD  1 
ATOM   1217  O OE1 . GLU A  1 168 ? 51.394 15.211 -0.050  1.00 57.65  ? 195  GLU A OE1 1 
ATOM   1218  O OE2 . GLU A  1 168 ? 51.338 13.041 0.399   1.00 56.68  ? 195  GLU A OE2 1 
ATOM   1219  N N   . VAL A  1 169 ? 49.381 17.097 5.493   1.00 35.62  ? 196  VAL A N   1 
ATOM   1220  C CA  . VAL A  1 169 ? 49.018 18.358 6.108   1.00 35.68  ? 196  VAL A CA  1 
ATOM   1221  C C   . VAL A  1 169 ? 48.641 18.035 7.546   1.00 35.58  ? 196  VAL A C   1 
ATOM   1222  O O   . VAL A  1 169 ? 47.564 17.490 7.793   1.00 35.55  ? 196  VAL A O   1 
ATOM   1223  C CB  . VAL A  1 169 ? 47.817 19.014 5.427   1.00 35.79  ? 196  VAL A CB  1 
ATOM   1224  C CG1 . VAL A  1 169 ? 47.692 20.444 5.903   1.00 36.15  ? 196  VAL A CG1 1 
ATOM   1225  C CG2 . VAL A  1 169 ? 47.985 18.976 3.936   1.00 37.21  ? 196  VAL A CG2 1 
ATOM   1226  N N   . ARG A  1 170 ? 49.522 18.364 8.492   1.00 34.10  ? 197  ARG A N   1 
ATOM   1227  C CA  . ARG A  1 170 ? 49.251 18.074 9.897   1.00 32.03  ? 197  ARG A CA  1 
ATOM   1228  C C   . ARG A  1 170 ? 48.008 18.805 10.402  1.00 31.64  ? 197  ARG A C   1 
ATOM   1229  O O   . ARG A  1 170 ? 47.146 18.204 11.051  1.00 32.21  ? 197  ARG A O   1 
ATOM   1230  C CB  . ARG A  1 170 ? 50.459 18.429 10.762  1.00 29.71  ? 197  ARG A CB  1 
ATOM   1231  C CG  . ARG A  1 170 ? 50.257 18.104 12.235  1.00 29.68  ? 197  ARG A CG  1 
ATOM   1232  C CD  . ARG A  1 170 ? 51.496 18.442 13.060  1.00 30.65  ? 197  ARG A CD  1 
ATOM   1233  N NE  . ARG A  1 170 ? 51.250 18.360 14.498  1.00 28.04  ? 197  ARG A NE  1 
ATOM   1234  C CZ  . ARG A  1 170 ? 51.112 17.230 15.183  1.00 27.68  ? 197  ARG A CZ  1 
ATOM   1235  N NH1 . ARG A  1 170 ? 51.200 16.055 14.577  1.00 24.88  ? 197  ARG A NH1 1 
ATOM   1236  N NH2 . ARG A  1 170 ? 50.870 17.281 16.482  1.00 28.95  ? 197  ARG A NH2 1 
ATOM   1237  N N   . TYR A  1 171 ? 47.908 20.089 10.082  1.00 29.11  ? 198  TYR A N   1 
ATOM   1238  C CA  . TYR A  1 171 ? 46.770 20.882 10.507  1.00 29.64  ? 198  TYR A CA  1 
ATOM   1239  C C   . TYR A  1 171 ? 46.532 22.075 9.603   1.00 30.72  ? 198  TYR A C   1 
ATOM   1240  O O   . TYR A  1 171 ? 47.373 22.454 8.787   1.00 32.02  ? 198  TYR A O   1 
ATOM   1241  C CB  . TYR A  1 171 ? 46.985 21.427 11.908  1.00 29.22  ? 198  TYR A CB  1 
ATOM   1242  C CG  . TYR A  1 171 ? 48.117 22.415 11.952  1.00 28.28  ? 198  TYR A CG  1 
ATOM   1243  C CD1 . TYR A  1 171 ? 49.435 21.974 11.960  1.00 28.05  ? 198  TYR A CD1 1 
ATOM   1244  C CD2 . TYR A  1 171 ? 47.879 23.786 11.941  1.00 26.64  ? 198  TYR A CD2 1 
ATOM   1245  C CE1 . TYR A  1 171 ? 50.491 22.859 11.955  1.00 27.66  ? 198  TYR A CE1 1 
ATOM   1246  C CE2 . TYR A  1 171 ? 48.933 24.688 11.935  1.00 28.13  ? 198  TYR A CE2 1 
ATOM   1247  C CZ  . TYR A  1 171 ? 50.241 24.214 11.943  1.00 28.58  ? 198  TYR A CZ  1 
ATOM   1248  O OH  . TYR A  1 171 ? 51.314 25.077 11.941  1.00 29.05  ? 198  TYR A OH  1 
ATOM   1249  N N   . GLU A  1 172 ? 45.374 22.688 9.774   1.00 29.61  ? 199  GLU A N   1 
ATOM   1250  C CA  . GLU A  1 172 ? 45.045 23.853 8.988   1.00 29.76  ? 199  GLU A CA  1 
ATOM   1251  C C   . GLU A  1 172 ? 43.831 24.519 9.578   1.00 28.76  ? 199  GLU A C   1 
ATOM   1252  O O   . GLU A  1 172 ? 43.048 23.885 10.281  1.00 29.62  ? 199  GLU A O   1 
ATOM   1253  C CB  . GLU A  1 172 ? 44.783 23.461 7.538   1.00 30.52  ? 199  GLU A CB  1 
ATOM   1254  C CG  . GLU A  1 172 ? 44.021 24.519 6.771   1.00 32.76  ? 199  GLU A CG  1 
ATOM   1255  C CD  . GLU A  1 172 ? 44.012 24.273 5.276   1.00 34.11  ? 199  GLU A CD  1 
ATOM   1256  O OE1 . GLU A  1 172 ? 43.810 23.107 4.859   1.00 33.46  ? 199  GLU A OE1 1 
ATOM   1257  O OE2 . GLU A  1 172 ? 44.199 25.258 4.521   1.00 34.21  ? 199  GLU A OE2 1 
ATOM   1258  N N   . VAL A  1 173 ? 43.684 25.806 9.307   1.00 27.95  ? 200  VAL A N   1 
ATOM   1259  C CA  . VAL A  1 173 ? 42.549 26.545 9.820   1.00 29.79  ? 200  VAL A CA  1 
ATOM   1260  C C   . VAL A  1 173 ? 41.305 26.278 8.982   1.00 32.27  ? 200  VAL A C   1 
ATOM   1261  O O   . VAL A  1 173 ? 41.397 25.811 7.846   1.00 32.64  ? 200  VAL A O   1 
ATOM   1262  C CB  . VAL A  1 173 ? 42.832 28.045 9.807   1.00 29.22  ? 200  VAL A CB  1 
ATOM   1263  C CG1 . VAL A  1 173 ? 43.913 28.364 10.808  1.00 28.67  ? 200  VAL A CG1 1 
ATOM   1264  C CG2 . VAL A  1 173 ? 43.250 28.482 8.409   1.00 24.85  ? 200  VAL A CG2 1 
ATOM   1265  N N   . CYS A  1 174 ? 40.142 26.580 9.549   1.00 34.06  ? 201  CYS A N   1 
ATOM   1266  C CA  . CYS A  1 174 ? 38.883 26.384 8.855   1.00 35.59  ? 201  CYS A CA  1 
ATOM   1267  C C   . CYS A  1 174 ? 38.277 27.737 8.512   1.00 37.39  ? 201  CYS A C   1 
ATOM   1268  O O   . CYS A  1 174 ? 38.455 28.713 9.230   1.00 36.12  ? 201  CYS A O   1 
ATOM   1269  C CB  . CYS A  1 174 ? 37.916 25.581 9.721   1.00 33.36  ? 201  CYS A CB  1 
ATOM   1270  S SG  . CYS A  1 174 ? 38.610 24.006 10.305  1.00 31.63  ? 201  CYS A SG  1 
ATOM   1271  N N   . ASP A  1 175 ? 37.558 27.768 7.398   1.00 41.41  ? 202  ASP A N   1 
ATOM   1272  C CA  . ASP A  1 175 ? 36.911 28.970 6.892   1.00 43.62  ? 202  ASP A CA  1 
ATOM   1273  C C   . ASP A  1 175 ? 35.627 29.232 7.666   1.00 42.90  ? 202  ASP A C   1 
ATOM   1274  O O   . ASP A  1 175 ? 34.542 28.896 7.200   1.00 43.51  ? 202  ASP A O   1 
ATOM   1275  C CB  . ASP A  1 175 ? 36.573 28.772 5.405   1.00 47.29  ? 202  ASP A CB  1 
ATOM   1276  C CG  . ASP A  1 175 ? 36.628 30.071 4.602   1.00 51.61  ? 202  ASP A CG  1 
ATOM   1277  O OD1 . ASP A  1 175 ? 36.412 31.163 5.192   1.00 54.03  ? 202  ASP A OD1 1 
ATOM   1278  O OD2 . ASP A  1 175 ? 36.872 29.987 3.372   1.00 52.03  ? 202  ASP A OD2 1 
ATOM   1279  N N   . ILE A  1 176 ? 35.732 29.816 8.849   1.00 42.68  ? 203  ILE A N   1 
ATOM   1280  C CA  . ILE A  1 176 ? 34.529 30.090 9.625   1.00 42.99  ? 203  ILE A CA  1 
ATOM   1281  C C   . ILE A  1 176 ? 34.339 31.586 9.768   1.00 44.89  ? 203  ILE A C   1 
ATOM   1282  O O   . ILE A  1 176 ? 35.124 32.264 10.435  1.00 46.49  ? 203  ILE A O   1 
ATOM   1283  C CB  . ILE A  1 176 ? 34.585 29.400 11.007  1.00 41.06  ? 203  ILE A CB  1 
ATOM   1284  C CG1 . ILE A  1 176 ? 34.379 27.899 10.806  1.00 38.72  ? 203  ILE A CG1 1 
ATOM   1285  C CG2 . ILE A  1 176 ? 33.536 29.985 11.948  1.00 39.02  ? 203  ILE A CG2 1 
ATOM   1286  C CD1 . ILE A  1 176 ? 34.392 27.110 12.053  1.00 37.14  ? 203  ILE A CD1 1 
ATOM   1287  N N   . PRO A  1 177 ? 33.278 32.119 9.139   1.00 45.06  ? 204  PRO A N   1 
ATOM   1288  C CA  . PRO A  1 177 ? 32.900 33.534 9.122   1.00 44.62  ? 204  PRO A CA  1 
ATOM   1289  C C   . PRO A  1 177 ? 32.718 34.239 10.458  1.00 44.52  ? 204  PRO A C   1 
ATOM   1290  O O   . PRO A  1 177 ? 32.396 33.617 11.468  1.00 43.98  ? 204  PRO A O   1 
ATOM   1291  C CB  . PRO A  1 177 ? 31.625 33.528 8.291   1.00 44.03  ? 204  PRO A CB  1 
ATOM   1292  C CG  . PRO A  1 177 ? 31.023 32.225 8.643   1.00 44.78  ? 204  PRO A CG  1 
ATOM   1293  C CD  . PRO A  1 177 ? 32.204 31.303 8.549   1.00 45.28  ? 204  PRO A CD  1 
ATOM   1294  N N   . GLN A  1 178 ? 32.946 35.551 10.428  1.00 45.05  ? 205  GLN A N   1 
ATOM   1295  C CA  . GLN A  1 178 ? 32.808 36.448 11.579  1.00 46.28  ? 205  GLN A CA  1 
ATOM   1296  C C   . GLN A  1 178 ? 31.366 36.946 11.658  1.00 47.19  ? 205  GLN A C   1 
ATOM   1297  O O   . GLN A  1 178 ? 30.812 37.396 10.654  1.00 47.65  ? 205  GLN A O   1 
ATOM   1298  C CB  . GLN A  1 178 ? 33.711 37.671 11.399  1.00 46.71  ? 205  GLN A CB  1 
ATOM   1299  C CG  . GLN A  1 178 ? 35.197 37.385 11.399  1.00 45.73  ? 205  GLN A CG  1 
ATOM   1300  C CD  . GLN A  1 178 ? 35.688 36.942 12.755  1.00 44.41  ? 205  GLN A CD  1 
ATOM   1301  O OE1 . GLN A  1 178 ? 35.618 37.695 13.729  1.00 41.88  ? 205  GLN A OE1 1 
ATOM   1302  N NE2 . GLN A  1 178 ? 36.182 35.710 12.831  1.00 42.86  ? 205  GLN A NE2 1 
ATOM   1303  N N   . CYS A  1 179 ? 30.759 36.910 12.837  1.00 47.87  ? 206  CYS A N   1 
ATOM   1304  C CA  . CYS A  1 179 ? 29.381 37.374 12.944  1.00 49.64  ? 206  CYS A CA  1 
ATOM   1305  C C   . CYS A  1 179 ? 29.271 38.825 12.495  1.00 51.76  ? 206  CYS A C   1 
ATOM   1306  O O   . CYS A  1 179 ? 28.238 39.241 11.976  1.00 51.64  ? 206  CYS A O   1 
ATOM   1307  C CB  . CYS A  1 179 ? 28.879 37.253 14.374  1.00 48.54  ? 206  CYS A CB  1 
ATOM   1308  S SG  . CYS A  1 179 ? 29.042 35.600 15.113  1.00 48.61  ? 206  CYS A SG  1 
ATOM   1309  N N   . SER A  1 180 ? 30.346 39.584 12.703  1.00 54.50  ? 207  SER A N   1 
ATOM   1310  C CA  . SER A  1 180 ? 30.412 40.995 12.320  1.00 56.87  ? 207  SER A CA  1 
ATOM   1311  C C   . SER A  1 180 ? 29.990 41.120 10.858  1.00 58.73  ? 207  SER A C   1 
ATOM   1312  O O   . SER A  1 180 ? 29.378 42.114 10.449  1.00 59.63  ? 207  SER A O   1 
ATOM   1313  C CB  . SER A  1 180 ? 31.838 41.499 12.486  1.00 57.32  ? 207  SER A CB  1 
ATOM   1314  O OG  . SER A  1 180 ? 32.664 40.963 11.466  1.00 59.63  ? 207  SER A OG  1 
ATOM   1315  N N   . GLU A  1 181 ? 30.288 40.045 10.124  1.00 59.95  ? 208  GLU A N   1 
ATOM   1316  C CA  . GLU A  1 181 ? 29.988 39.853 8.709   1.00 62.07  ? 208  GLU A CA  1 
ATOM   1317  C C   . GLU A  1 181 ? 31.206 39.360 7.945   1.00 63.50  ? 208  GLU A C   1 
ATOM   1318  O O   . GLU A  1 181 ? 32.010 40.216 7.508   1.00 65.53  ? 208  GLU A O   1 
ATOM   1319  C CB  . GLU A  1 181 ? 29.434 41.124 8.060   1.00 62.53  ? 208  GLU A CB  1 
ATOM   1320  C CG  . GLU A  1 181 ? 27.974 40.969 7.654   1.00 64.16  ? 208  GLU A CG  1 
ATOM   1321  C CD  . GLU A  1 181 ? 27.075 40.561 8.823   1.00 65.22  ? 208  GLU A CD  1 
ATOM   1322  O OE1 . GLU A  1 181 ? 26.665 41.453 9.609   1.00 63.87  ? 208  GLU A OE1 1 
ATOM   1323  O OE2 . GLU A  1 181 ? 26.789 39.343 8.956   1.00 65.06  ? 208  GLU A OE2 1 
ATOM   1324  N N   . VAL A  1 182 ? 31.350 38.118 7.813   1.00 62.64  ? 209  VAL A N   1 
ATOM   1325  N N   . ASN B  1 10  ? 19.946 13.076 -0.508  1.00 60.12  ? 37   ASN B N   1 
ATOM   1326  C CA  . ASN B  1 10  ? 20.117 12.512 0.864   1.00 59.48  ? 37   ASN B CA  1 
ATOM   1327  C C   . ASN B  1 10  ? 20.576 13.594 1.833   1.00 59.07  ? 37   ASN B C   1 
ATOM   1328  O O   . ASN B  1 10  ? 20.804 13.316 3.014   1.00 60.61  ? 37   ASN B O   1 
ATOM   1329  C CB  . ASN B  1 10  ? 21.141 11.381 0.845   1.00 60.31  ? 37   ASN B CB  1 
ATOM   1330  N N   . THR B  1 11  ? 20.715 14.822 1.340   1.00 56.38  ? 38   THR B N   1 
ATOM   1331  C CA  . THR B  1 11  ? 21.164 15.921 2.184   1.00 53.79  ? 38   THR B CA  1 
ATOM   1332  C C   . THR B  1 11  ? 20.651 17.240 1.673   1.00 52.15  ? 38   THR B C   1 
ATOM   1333  O O   . THR B  1 11  ? 20.786 18.264 2.333   1.00 53.17  ? 38   THR B O   1 
ATOM   1334  C CB  . THR B  1 11  ? 22.705 16.028 2.222   1.00 53.72  ? 38   THR B CB  1 
ATOM   1335  O OG1 . THR B  1 11  ? 23.217 16.083 0.885   1.00 52.79  ? 38   THR B OG1 1 
ATOM   1336  C CG2 . THR B  1 11  ? 23.313 14.857 2.955   1.00 52.98  ? 38   THR B CG2 1 
ATOM   1337  N N   . ILE B  1 12  ? 20.074 17.218 0.487   1.00 49.43  ? 39   ILE B N   1 
ATOM   1338  C CA  . ILE B  1 12  ? 19.566 18.432 -0.120  1.00 48.33  ? 39   ILE B CA  1 
ATOM   1339  C C   . ILE B  1 12  ? 18.670 19.274 0.777   1.00 47.36  ? 39   ILE B C   1 
ATOM   1340  O O   . ILE B  1 12  ? 18.544 20.477 0.580   1.00 47.50  ? 39   ILE B O   1 
ATOM   1341  C CB  . ILE B  1 12  ? 18.785 18.104 -1.391  1.00 49.93  ? 39   ILE B CB  1 
ATOM   1342  C CG1 . ILE B  1 12  ? 18.111 16.751 -1.213  1.00 51.59  ? 39   ILE B CG1 1 
ATOM   1343  C CG2 . ILE B  1 12  ? 19.697 18.134 -2.613  1.00 47.92  ? 39   ILE B CG2 1 
ATOM   1344  C CD1 . ILE B  1 12  ? 17.232 16.359 -2.374  1.00 55.64  ? 39   ILE B CD1 1 
ATOM   1345  N N   . HIS B  1 13  ? 18.040 18.665 1.766   1.00 46.34  ? 40   HIS B N   1 
ATOM   1346  C CA  . HIS B  1 13  ? 17.152 19.432 2.619   1.00 44.62  ? 40   HIS B CA  1 
ATOM   1347  C C   . HIS B  1 13  ? 17.871 20.190 3.714   1.00 43.54  ? 40   HIS B C   1 
ATOM   1348  O O   . HIS B  1 13  ? 17.247 20.878 4.510   1.00 44.51  ? 40   HIS B O   1 
ATOM   1349  C CB  . HIS B  1 13  ? 16.096 18.515 3.201   1.00 46.85  ? 40   HIS B CB  1 
ATOM   1350  C CG  . HIS B  1 13  ? 15.433 17.649 2.174   1.00 50.07  ? 40   HIS B CG  1 
ATOM   1351  N ND1 . HIS B  1 13  ? 16.124 16.711 1.439   1.00 51.68  ? 40   HIS B ND1 1 
ATOM   1352  C CD2 . HIS B  1 13  ? 14.144 17.573 1.765   1.00 51.33  ? 40   HIS B CD2 1 
ATOM   1353  C CE1 . HIS B  1 13  ? 15.289 16.089 0.623   1.00 51.02  ? 40   HIS B CE1 1 
ATOM   1354  N NE2 . HIS B  1 13  ? 14.082 16.593 0.801   1.00 51.40  ? 40   HIS B NE2 1 
ATOM   1355  N N   . GLU B  1 14  ? 19.187 20.057 3.765   1.00 42.11  ? 41   GLU B N   1 
ATOM   1356  C CA  . GLU B  1 14  ? 19.974 20.777 4.751   1.00 40.41  ? 41   GLU B CA  1 
ATOM   1357  C C   . GLU B  1 14  ? 20.457 22.069 4.099   1.00 38.72  ? 41   GLU B C   1 
ATOM   1358  O O   . GLU B  1 14  ? 21.194 22.856 4.709   1.00 39.39  ? 41   GLU B O   1 
ATOM   1359  C CB  . GLU B  1 14  ? 21.153 19.916 5.203   1.00 43.08  ? 41   GLU B CB  1 
ATOM   1360  C CG  . GLU B  1 14  ? 20.733 18.765 6.104   1.00 45.00  ? 41   GLU B CG  1 
ATOM   1361  C CD  . GLU B  1 14  ? 21.713 17.613 6.101   1.00 46.54  ? 41   GLU B CD  1 
ATOM   1362  O OE1 . GLU B  1 14  ? 22.923 17.838 6.360   1.00 47.04  ? 41   GLU B OE1 1 
ATOM   1363  O OE2 . GLU B  1 14  ? 21.257 16.477 5.843   1.00 46.66  ? 41   GLU B OE2 1 
ATOM   1364  N N   . PHE B  1 15  ? 20.034 22.272 2.850   1.00 34.52  ? 42   PHE B N   1 
ATOM   1365  C CA  . PHE B  1 15  ? 20.403 23.458 2.099   1.00 31.24  ? 42   PHE B CA  1 
ATOM   1366  C C   . PHE B  1 15  ? 19.212 24.359 1.940   1.00 30.62  ? 42   PHE B C   1 
ATOM   1367  O O   . PHE B  1 15  ? 18.095 23.888 1.770   1.00 31.74  ? 42   PHE B O   1 
ATOM   1368  C CB  . PHE B  1 15  ? 20.905 23.096 0.709   1.00 30.14  ? 42   PHE B CB  1 
ATOM   1369  C CG  . PHE B  1 15  ? 22.211 22.364 0.701   1.00 29.85  ? 42   PHE B CG  1 
ATOM   1370  C CD1 . PHE B  1 15  ? 22.266 21.005 1.004   1.00 28.83  ? 42   PHE B CD1 1 
ATOM   1371  C CD2 . PHE B  1 15  ? 23.393 23.032 0.393   1.00 28.98  ? 42   PHE B CD2 1 
ATOM   1372  C CE1 . PHE B  1 15  ? 23.468 20.320 1.001   1.00 27.12  ? 42   PHE B CE1 1 
ATOM   1373  C CE2 . PHE B  1 15  ? 24.600 22.352 0.387   1.00 30.50  ? 42   PHE B CE2 1 
ATOM   1374  C CZ  . PHE B  1 15  ? 24.638 20.988 0.695   1.00 28.73  ? 42   PHE B CZ  1 
ATOM   1375  N N   . LYS B  1 16  ? 19.455 25.661 1.992   1.00 29.90  ? 43   LYS B N   1 
ATOM   1376  C CA  . LYS B  1 16  ? 18.399 26.642 1.831   1.00 28.89  ? 43   LYS B CA  1 
ATOM   1377  C C   . LYS B  1 16  ? 18.280 26.881 0.344   1.00 30.21  ? 43   LYS B C   1 
ATOM   1378  O O   . LYS B  1 16  ? 19.095 27.606 -0.237  1.00 32.19  ? 43   LYS B O   1 
ATOM   1379  C CB  . LYS B  1 16  ? 18.771 27.941 2.525   1.00 26.08  ? 43   LYS B CB  1 
ATOM   1380  C CG  . LYS B  1 16  ? 17.838 29.084 2.241   1.00 24.03  ? 43   LYS B CG  1 
ATOM   1381  C CD  . LYS B  1 16  ? 18.370 30.353 2.880   1.00 23.45  ? 43   LYS B CD  1 
ATOM   1382  C CE  . LYS B  1 16  ? 17.510 31.545 2.558   1.00 23.09  ? 43   LYS B CE  1 
ATOM   1383  N NZ  . LYS B  1 16  ? 18.092 32.770 3.141   1.00 22.71  ? 43   LYS B NZ  1 
ATOM   1384  N N   . LYS B  1 17  ? 17.259 26.276 -0.264  1.00 30.92  ? 44   LYS B N   1 
ATOM   1385  C CA  . LYS B  1 17  ? 17.011 26.380 -1.706  1.00 29.91  ? 44   LYS B CA  1 
ATOM   1386  C C   . LYS B  1 17  ? 16.423 27.702 -2.189  1.00 28.99  ? 44   LYS B C   1 
ATOM   1387  O O   . LYS B  1 17  ? 15.552 28.270 -1.546  1.00 29.64  ? 44   LYS B O   1 
ATOM   1388  C CB  . LYS B  1 17  ? 16.109 25.229 -2.140  1.00 28.36  ? 44   LYS B CB  1 
ATOM   1389  C CG  . LYS B  1 17  ? 15.931 25.143 -3.624  1.00 30.59  ? 44   LYS B CG  1 
ATOM   1390  C CD  . LYS B  1 17  ? 15.271 23.836 -4.005  1.00 31.64  ? 44   LYS B CD  1 
ATOM   1391  C CE  . LYS B  1 17  ? 14.789 23.869 -5.437  1.00 33.46  ? 44   LYS B CE  1 
ATOM   1392  N NZ  . LYS B  1 17  ? 13.898 22.703 -5.710  1.00 36.67  ? 44   LYS B NZ  1 
ATOM   1393  N N   . SER B  1 18  ? 16.933 28.193 -3.311  1.00 30.12  ? 45   SER B N   1 
ATOM   1394  C CA  . SER B  1 18  ? 16.454 29.427 -3.932  1.00 33.81  ? 45   SER B CA  1 
ATOM   1395  C C   . SER B  1 18  ? 16.227 29.102 -5.403  1.00 36.80  ? 45   SER B C   1 
ATOM   1396  O O   . SER B  1 18  ? 17.140 29.211 -6.220  1.00 36.98  ? 45   SER B O   1 
ATOM   1397  C CB  . SER B  1 18  ? 17.475 30.560 -3.807  1.00 32.70  ? 45   SER B CB  1 
ATOM   1398  O OG  . SER B  1 18  ? 17.346 31.240 -2.571  1.00 32.19  ? 45   SER B OG  1 
ATOM   1399  N N   . ALA B  1 19  ? 15.001 28.687 -5.719  1.00 40.83  ? 46   ALA B N   1 
ATOM   1400  C CA  . ALA B  1 19  ? 14.609 28.300 -7.068  1.00 43.16  ? 46   ALA B CA  1 
ATOM   1401  C C   . ALA B  1 19  ? 14.925 29.353 -8.118  1.00 44.80  ? 46   ALA B C   1 
ATOM   1402  O O   . ALA B  1 19  ? 14.871 30.558 -7.850  1.00 42.65  ? 46   ALA B O   1 
ATOM   1403  C CB  . ALA B  1 19  ? 13.128 27.962 -7.094  1.00 43.41  ? 46   ALA B CB  1 
ATOM   1404  N N   . LYS B  1 20  ? 15.260 28.874 -9.315  1.00 47.77  ? 47   LYS B N   1 
ATOM   1405  C CA  . LYS B  1 20  ? 15.598 29.745 -10.437 1.00 50.73  ? 47   LYS B CA  1 
ATOM   1406  C C   . LYS B  1 20  ? 16.507 30.866 -9.964  1.00 51.03  ? 47   LYS B C   1 
ATOM   1407  O O   . LYS B  1 20  ? 16.149 32.043 -9.984  1.00 49.92  ? 47   LYS B O   1 
ATOM   1408  C CB  . LYS B  1 20  ? 14.326 30.324 -11.073 1.00 53.43  ? 47   LYS B CB  1 
ATOM   1409  C CG  . LYS B  1 20  ? 13.386 29.278 -11.683 1.00 54.57  ? 47   LYS B CG  1 
ATOM   1410  C CD  . LYS B  1 20  ? 11.929 29.535 -11.296 1.00 54.68  ? 47   LYS B CD  1 
ATOM   1411  C CE  . LYS B  1 20  ? 11.013 28.507 -11.934 1.00 55.56  ? 47   LYS B CE  1 
ATOM   1412  N NZ  . LYS B  1 20  ? 9.591  28.744 -11.572 1.00 57.53  ? 47   LYS B NZ  1 
ATOM   1413  N N   . THR B  1 21  ? 17.683 30.475 -9.499  1.00 52.12  ? 48   THR B N   1 
ATOM   1414  C CA  . THR B  1 21  ? 18.663 31.440 -9.043  1.00 53.77  ? 48   THR B CA  1 
ATOM   1415  C C   . THR B  1 21  ? 20.051 30.863 -9.272  1.00 55.45  ? 48   THR B C   1 
ATOM   1416  O O   . THR B  1 21  ? 20.210 29.657 -9.465  1.00 55.89  ? 48   THR B O   1 
ATOM   1417  C CB  . THR B  1 21  ? 18.487 31.777 -7.546  1.00 53.62  ? 48   THR B CB  1 
ATOM   1418  O OG1 . THR B  1 21  ? 17.111 32.082 -7.281  1.00 52.79  ? 48   THR B OG1 1 
ATOM   1419  C CG2 . THR B  1 21  ? 19.335 32.992 -7.170  1.00 53.10  ? 48   THR B CG2 1 
ATOM   1420  N N   . THR B  1 22  ? 21.050 31.738 -9.268  1.00 57.41  ? 49   THR B N   1 
ATOM   1421  C CA  . THR B  1 22  ? 22.437 31.333 -9.467  1.00 59.09  ? 49   THR B CA  1 
ATOM   1422  C C   . THR B  1 22  ? 23.356 32.503 -9.126  1.00 59.68  ? 49   THR B C   1 
ATOM   1423  O O   . THR B  1 22  ? 22.946 33.661 -9.174  1.00 58.70  ? 49   THR B O   1 
ATOM   1424  C CB  . THR B  1 22  ? 22.689 30.889 -10.921 1.00 59.16  ? 49   THR B CB  1 
ATOM   1425  O OG1 . THR B  1 22  ? 24.051 30.460 -11.068 1.00 57.63  ? 49   THR B OG1 1 
ATOM   1426  C CG2 . THR B  1 22  ? 22.399 32.039 -11.875 1.00 59.87  ? 49   THR B CG2 1 
ATOM   1427  N N   . LEU B  1 23  ? 24.596 32.189 -8.773  1.00 61.36  ? 50   LEU B N   1 
ATOM   1428  C CA  . LEU B  1 23  ? 25.576 33.200 -8.401  1.00 63.41  ? 50   LEU B CA  1 
ATOM   1429  C C   . LEU B  1 23  ? 26.632 33.442 -9.481  1.00 64.60  ? 50   LEU B C   1 
ATOM   1430  O O   . LEU B  1 23  ? 27.033 32.522 -10.199 1.00 64.02  ? 50   LEU B O   1 
ATOM   1431  C CB  . LEU B  1 23  ? 26.271 32.780 -7.098  1.00 64.40  ? 50   LEU B CB  1 
ATOM   1432  C CG  . LEU B  1 23  ? 25.608 33.046 -5.737  1.00 65.19  ? 50   LEU B CG  1 
ATOM   1433  C CD1 . LEU B  1 23  ? 24.142 32.685 -5.767  1.00 64.90  ? 50   LEU B CD1 1 
ATOM   1434  C CD2 . LEU B  1 23  ? 26.338 32.252 -4.661  1.00 64.55  ? 50   LEU B CD2 1 
ATOM   1435  N N   . ILE B  1 24  ? 27.076 34.688 -9.610  1.00 66.12  ? 51   ILE B N   1 
ATOM   1436  C CA  . ILE B  1 24  ? 28.115 35.008 -10.583 1.00 68.93  ? 51   ILE B CA  1 
ATOM   1437  C C   . ILE B  1 24  ? 29.368 35.373 -9.794  1.00 71.03  ? 51   ILE B C   1 
ATOM   1438  O O   . ILE B  1 24  ? 29.309 36.175 -8.848  1.00 69.08  ? 51   ILE B O   1 
ATOM   1439  C CB  . ILE B  1 24  ? 27.709 36.189 -11.517 1.00 68.75  ? 51   ILE B CB  1 
ATOM   1440  C CG1 . ILE B  1 24  ? 26.891 35.677 -12.706 1.00 66.93  ? 51   ILE B CG1 1 
ATOM   1441  C CG2 . ILE B  1 24  ? 28.952 36.872 -12.074 1.00 70.34  ? 51   ILE B CG2 1 
ATOM   1442  C CD1 . ILE B  1 24  ? 25.580 35.086 -12.336 1.00 66.39  ? 51   ILE B CD1 1 
ATOM   1443  N N   . LYS B  1 25  ? 30.494 34.779 -10.185 1.00 74.55  ? 52   LYS B N   1 
ATOM   1444  C CA  . LYS B  1 25  ? 31.775 35.005 -9.516  1.00 78.67  ? 52   LYS B CA  1 
ATOM   1445  C C   . LYS B  1 25  ? 32.627 36.086 -10.183 1.00 81.86  ? 52   LYS B C   1 
ATOM   1446  O O   . LYS B  1 25  ? 33.656 35.785 -10.801 1.00 83.41  ? 52   LYS B O   1 
ATOM   1447  C CB  . LYS B  1 25  ? 32.558 33.705 -9.485  1.00 78.23  ? 52   LYS B CB  1 
ATOM   1448  N N   . ILE B  1 26  ? 32.208 37.340 -10.041 1.00 84.90  ? 53   ILE B N   1 
ATOM   1449  C CA  . ILE B  1 26  ? 32.917 38.473 -10.632 1.00 87.48  ? 53   ILE B CA  1 
ATOM   1450  C C   . ILE B  1 26  ? 34.189 38.841 -9.868  1.00 89.10  ? 53   ILE B C   1 
ATOM   1451  O O   . ILE B  1 26  ? 34.281 39.915 -9.279  1.00 89.63  ? 53   ILE B O   1 
ATOM   1452  C CB  . ILE B  1 26  ? 31.983 39.689 -10.716 1.00 87.06  ? 53   ILE B CB  1 
ATOM   1453  N N   . ASP B  1 27  ? 35.164 37.939 -9.890  1.00 90.59  ? 54   ASP B N   1 
ATOM   1454  C CA  . ASP B  1 27  ? 36.443 38.138 -9.221  1.00 92.13  ? 54   ASP B CA  1 
ATOM   1455  C C   . ASP B  1 27  ? 37.236 36.843 -9.268  1.00 92.48  ? 54   ASP B C   1 
ATOM   1456  O O   . ASP B  1 27  ? 37.156 36.010 -8.361  1.00 91.99  ? 54   ASP B O   1 
ATOM   1457  C CB  . ASP B  1 27  ? 36.248 38.568 -7.761  1.00 93.73  ? 54   ASP B CB  1 
ATOM   1458  C CG  . ASP B  1 27  ? 37.560 38.650 -6.992  1.00 95.07  ? 54   ASP B CG  1 
ATOM   1459  O OD1 . ASP B  1 27  ? 38.331 37.674 -7.039  1.00 94.72  ? 54   ASP B OD1 1 
ATOM   1460  O OD2 . ASP B  1 27  ? 37.816 39.684 -6.335  1.00 96.06  ? 54   ASP B OD2 1 
ATOM   1461  N N   . PRO B  1 28  ? 37.991 36.648 -10.354 1.00 93.12  ? 55   PRO B N   1 
ATOM   1462  C CA  . PRO B  1 28  ? 38.817 35.458 -10.550 1.00 93.31  ? 55   PRO B CA  1 
ATOM   1463  C C   . PRO B  1 28  ? 39.887 35.322 -9.478  1.00 93.35  ? 55   PRO B C   1 
ATOM   1464  O O   . PRO B  1 28  ? 41.079 35.353 -9.770  1.00 93.42  ? 55   PRO B O   1 
ATOM   1465  C CB  . PRO B  1 28  ? 39.409 35.678 -11.937 1.00 93.37  ? 55   PRO B CB  1 
ATOM   1466  C CG  . PRO B  1 28  ? 38.310 36.422 -12.643 1.00 93.37  ? 55   PRO B CG  1 
ATOM   1467  C CD  . PRO B  1 28  ? 37.907 37.435 -11.596 1.00 93.42  ? 55   PRO B CD  1 
ATOM   1468  N N   . ALA B  1 29  ? 39.448 35.198 -8.229  1.00 93.83  ? 56   ALA B N   1 
ATOM   1469  C CA  . ALA B  1 29  ? 40.351 35.016 -7.087  1.00 93.98  ? 56   ALA B CA  1 
ATOM   1470  C C   . ALA B  1 29  ? 39.924 33.721 -6.402  1.00 93.38  ? 56   ALA B C   1 
ATOM   1471  O O   . ALA B  1 29  ? 40.713 33.069 -5.707  1.00 93.06  ? 56   ALA B O   1 
ATOM   1472  C CB  . ALA B  1 29  ? 40.236 36.202 -6.117  1.00 94.35  ? 56   ALA B CB  1 
ATOM   1473  N N   . LEU B  1 30  ? 38.652 33.380 -6.612  1.00 92.36  ? 57   LEU B N   1 
ATOM   1474  C CA  . LEU B  1 30  ? 38.050 32.171 -6.066  1.00 90.49  ? 57   LEU B CA  1 
ATOM   1475  C C   . LEU B  1 30  ? 37.730 31.276 -7.258  1.00 88.91  ? 57   LEU B C   1 
ATOM   1476  O O   . LEU B  1 30  ? 37.386 31.776 -8.326  1.00 88.12  ? 57   LEU B O   1 
ATOM   1477  C CB  . LEU B  1 30  ? 36.771 32.519 -5.284  1.00 90.40  ? 57   LEU B CB  1 
ATOM   1478  N N   . LYS B  1 31  ? 37.865 29.965 -7.082  1.00 87.29  ? 58   LYS B N   1 
ATOM   1479  C CA  . LYS B  1 31  ? 37.574 29.026 -8.156  1.00 85.40  ? 58   LYS B CA  1 
ATOM   1480  C C   . LYS B  1 31  ? 36.114 28.570 -8.129  1.00 84.10  ? 58   LYS B C   1 
ATOM   1481  O O   . LYS B  1 31  ? 35.316 29.041 -7.314  1.00 84.41  ? 58   LYS B O   1 
ATOM   1482  C CB  . LYS B  1 31  ? 38.487 27.812 -8.053  1.00 84.93  ? 58   LYS B CB  1 
ATOM   1483  C CG  . LYS B  1 31  ? 39.942 28.176 -8.040  1.00 85.07  ? 58   LYS B CG  1 
ATOM   1484  C CD  . LYS B  1 31  ? 40.811 26.949 -8.175  1.00 86.32  ? 58   LYS B CD  1 
ATOM   1485  C CE  . LYS B  1 31  ? 42.285 27.330 -8.246  1.00 86.37  ? 58   LYS B CE  1 
ATOM   1486  N NZ  . LYS B  1 31  ? 43.170 26.162 -8.512  1.00 85.99  ? 58   LYS B NZ  1 
ATOM   1487  N N   . ILE B  1 32  ? 35.769 27.655 -9.027  1.00 81.84  ? 59   ILE B N   1 
ATOM   1488  C CA  . ILE B  1 32  ? 34.413 27.131 -9.102  1.00 79.36  ? 59   ILE B CA  1 
ATOM   1489  C C   . ILE B  1 32  ? 34.462 25.739 -9.700  1.00 77.33  ? 59   ILE B C   1 
ATOM   1490  O O   . ILE B  1 32  ? 34.618 25.583 -10.907 1.00 77.89  ? 59   ILE B O   1 
ATOM   1491  C CB  . ILE B  1 32  ? 33.501 28.011 -9.995  1.00 80.03  ? 59   ILE B CB  1 
ATOM   1492  C CG1 . ILE B  1 32  ? 33.271 29.377 -9.337  1.00 79.92  ? 59   ILE B CG1 1 
ATOM   1493  C CG2 . ILE B  1 32  ? 32.168 27.291 -10.248 1.00 80.37  ? 59   ILE B CG2 1 
ATOM   1494  C CD1 . ILE B  1 32  ? 32.419 30.325 -10.164 1.00 80.56  ? 59   ILE B CD1 1 
ATOM   1495  N N   . LYS B  1 33  ? 34.320 24.728 -8.858  1.00 73.85  ? 60   LYS B N   1 
ATOM   1496  C CA  . LYS B  1 33  ? 34.344 23.358 -9.334  1.00 70.91  ? 60   LYS B CA  1 
ATOM   1497  C C   . LYS B  1 33  ? 32.954 22.935 -9.858  1.00 69.82  ? 60   LYS B C   1 
ATOM   1498  O O   . LYS B  1 33  ? 31.952 23.032 -9.151  1.00 69.82  ? 60   LYS B O   1 
ATOM   1499  C CB  . LYS B  1 33  ? 34.810 22.451 -8.199  1.00 69.48  ? 60   LYS B CB  1 
ATOM   1500  C CG  . LYS B  1 33  ? 35.118 21.041 -8.619  1.00 67.50  ? 60   LYS B CG  1 
ATOM   1501  C CD  . LYS B  1 33  ? 36.602 20.753 -8.603  1.00 64.87  ? 60   LYS B CD  1 
ATOM   1502  C CE  . LYS B  1 33  ? 36.845 19.307 -9.002  1.00 63.68  ? 60   LYS B CE  1 
ATOM   1503  N NZ  . LYS B  1 33  ? 38.270 18.911 -8.930  1.00 62.29  ? 60   LYS B NZ  1 
ATOM   1504  N N   . THR B  1 34  ? 32.902 22.475 -11.105 1.00 68.55  ? 61   THR B N   1 
ATOM   1505  C CA  . THR B  1 34  ? 31.649 22.054 -11.727 1.00 67.45  ? 61   THR B CA  1 
ATOM   1506  C C   . THR B  1 34  ? 31.741 20.612 -12.201 1.00 68.17  ? 61   THR B C   1 
ATOM   1507  O O   . THR B  1 34  ? 32.833 20.049 -12.260 1.00 67.83  ? 61   THR B O   1 
ATOM   1508  C CB  . THR B  1 34  ? 31.330 22.919 -12.937 1.00 66.06  ? 61   THR B CB  1 
ATOM   1509  O OG1 . THR B  1 34  ? 32.296 22.664 -13.962 1.00 62.44  ? 61   THR B OG1 1 
ATOM   1510  C CG2 . THR B  1 34  ? 31.368 24.390 -12.554 1.00 65.97  ? 61   THR B CG2 1 
ATOM   1511  N N   . LYS B  1 35  ? 30.605 20.012 -12.554 1.00 69.21  ? 62   LYS B N   1 
ATOM   1512  C CA  . LYS B  1 35  ? 30.636 18.626 -13.003 1.00 70.29  ? 62   LYS B CA  1 
ATOM   1513  C C   . LYS B  1 35  ? 29.296 18.010 -13.422 1.00 70.41  ? 62   LYS B C   1 
ATOM   1514  O O   . LYS B  1 35  ? 28.386 17.857 -12.603 1.00 70.82  ? 62   LYS B O   1 
ATOM   1515  C CB  . LYS B  1 35  ? 31.277 17.781 -11.903 1.00 71.42  ? 62   LYS B CB  1 
ATOM   1516  C CG  . LYS B  1 35  ? 31.601 16.365 -12.284 1.00 73.08  ? 62   LYS B CG  1 
ATOM   1517  C CD  . LYS B  1 35  ? 30.422 15.478 -12.064 1.00 74.25  ? 62   LYS B CD  1 
ATOM   1518  C CE  . LYS B  1 35  ? 30.798 14.047 -12.347 1.00 77.15  ? 62   LYS B CE  1 
ATOM   1519  N NZ  . LYS B  1 35  ? 29.643 13.141 -12.074 1.00 79.62  ? 62   LYS B NZ  1 
ATOM   1520  N N   . LYS B  1 36  ? 29.199 17.645 -14.704 1.00 70.62  ? 63   LYS B N   1 
ATOM   1521  C CA  . LYS B  1 36  ? 28.003 17.020 -15.282 1.00 70.14  ? 63   LYS B CA  1 
ATOM   1522  C C   . LYS B  1 36  ? 27.568 15.819 -14.445 1.00 69.53  ? 63   LYS B C   1 
ATOM   1523  O O   . LYS B  1 36  ? 28.270 14.823 -14.320 1.00 68.15  ? 63   LYS B O   1 
ATOM   1524  C CB  . LYS B  1 36  ? 28.276 16.591 -16.729 1.00 69.26  ? 63   LYS B CB  1 
ATOM   1525  N N   . VAL B  1 37  ? 26.377 15.927 -13.892 1.00 70.41  ? 64   VAL B N   1 
ATOM   1526  C CA  . VAL B  1 37  ? 25.828 14.908 -13.021 1.00 72.76  ? 64   VAL B CA  1 
ATOM   1527  C C   . VAL B  1 37  ? 24.377 14.583 -13.389 1.00 74.26  ? 64   VAL B C   1 
ATOM   1528  O O   . VAL B  1 37  ? 23.759 15.262 -14.219 1.00 74.23  ? 64   VAL B O   1 
ATOM   1529  C CB  . VAL B  1 37  ? 25.921 15.404 -11.544 1.00 73.14  ? 64   VAL B CB  1 
ATOM   1530  C CG1 . VAL B  1 37  ? 24.893 14.722 -10.659 1.00 72.66  ? 64   VAL B CG1 1 
ATOM   1531  C CG2 . VAL B  1 37  ? 27.310 15.138 -11.006 1.00 73.63  ? 64   VAL B CG2 1 
ATOM   1532  N N   . ASN B  1 38  ? 23.848 13.531 -12.769 1.00 75.32  ? 65   ASN B N   1 
ATOM   1533  C CA  . ASN B  1 38  ? 22.478 13.094 -12.991 1.00 76.17  ? 65   ASN B CA  1 
ATOM   1534  C C   . ASN B  1 38  ? 21.440 13.924 -12.234 1.00 76.36  ? 65   ASN B C   1 
ATOM   1535  O O   . ASN B  1 38  ? 20.631 14.625 -12.846 1.00 76.39  ? 65   ASN B O   1 
ATOM   1536  C CB  . ASN B  1 38  ? 22.347 11.628 -12.596 1.00 77.32  ? 65   ASN B CB  1 
ATOM   1537  C CG  . ASN B  1 38  ? 22.672 10.699 -13.735 1.00 78.37  ? 65   ASN B CG  1 
ATOM   1538  O OD1 . ASN B  1 38  ? 22.779 9.484  -13.554 1.00 78.76  ? 65   ASN B OD1 1 
ATOM   1539  N ND2 . ASN B  1 38  ? 22.820 11.266 -14.930 1.00 79.46  ? 65   ASN B ND2 1 
ATOM   1540  N N   . THR B  1 39  ? 21.458 13.834 -10.905 1.00 75.77  ? 66   THR B N   1 
ATOM   1541  C CA  . THR B  1 39  ? 20.517 14.577 -10.072 1.00 75.54  ? 66   THR B CA  1 
ATOM   1542  C C   . THR B  1 39  ? 21.203 15.639 -9.219  1.00 75.46  ? 66   THR B C   1 
ATOM   1543  O O   . THR B  1 39  ? 22.422 15.611 -9.037  1.00 76.47  ? 66   THR B O   1 
ATOM   1544  C CB  . THR B  1 39  ? 19.752 13.632 -9.137  1.00 75.38  ? 66   THR B CB  1 
ATOM   1545  O OG1 . THR B  1 39  ? 20.670 13.008 -8.236  1.00 75.16  ? 66   THR B OG1 1 
ATOM   1546  C CG2 . THR B  1 39  ? 19.047 12.557 -9.936  1.00 75.55  ? 66   THR B CG2 1 
ATOM   1547  N N   . ALA B  1 40  ? 20.415 16.581 -8.705  1.00 74.04  ? 67   ALA B N   1 
ATOM   1548  C CA  . ALA B  1 40  ? 20.956 17.636 -7.858  1.00 72.79  ? 67   ALA B CA  1 
ATOM   1549  C C   . ALA B  1 40  ? 21.485 17.022 -6.568  1.00 72.19  ? 67   ALA B C   1 
ATOM   1550  O O   . ALA B  1 40  ? 22.435 17.521 -5.982  1.00 72.31  ? 67   ALA B O   1 
ATOM   1551  C CB  . ALA B  1 40  ? 19.880 18.659 -7.550  1.00 72.58  ? 67   ALA B CB  1 
ATOM   1552  N N   . ASP B  1 41  ? 20.859 15.931 -6.138  1.00 71.84  ? 68   ASP B N   1 
ATOM   1553  C CA  . ASP B  1 41  ? 21.263 15.237 -4.921  1.00 72.40  ? 68   ASP B CA  1 
ATOM   1554  C C   . ASP B  1 41  ? 22.763 14.952 -4.873  1.00 71.50  ? 68   ASP B C   1 
ATOM   1555  O O   . ASP B  1 41  ? 23.399 15.104 -3.826  1.00 71.57  ? 68   ASP B O   1 
ATOM   1556  C CB  . ASP B  1 41  ? 20.482 13.937 -4.775  1.00 74.11  ? 68   ASP B CB  1 
ATOM   1557  C CG  . ASP B  1 41  ? 18.997 14.172 -4.650  1.00 76.72  ? 68   ASP B CG  1 
ATOM   1558  O OD1 . ASP B  1 41  ? 18.392 14.715 -5.605  1.00 77.20  ? 68   ASP B OD1 1 
ATOM   1559  O OD2 . ASP B  1 41  ? 18.433 13.799 -3.600  1.00 78.65  ? 68   ASP B OD2 1 
ATOM   1560  N N   . GLN B  1 42  ? 23.336 14.536 -5.996  1.00 70.14  ? 69   GLN B N   1 
ATOM   1561  C CA  . GLN B  1 42  ? 24.767 14.260 -6.044  1.00 67.68  ? 69   GLN B CA  1 
ATOM   1562  C C   . GLN B  1 42  ? 25.479 15.522 -5.614  1.00 65.10  ? 69   GLN B C   1 
ATOM   1563  O O   . GLN B  1 42  ? 26.350 15.508 -4.763  1.00 63.84  ? 69   GLN B O   1 
ATOM   1564  C CB  . GLN B  1 42  ? 25.193 13.868 -7.476  1.00 68.95  ? 69   GLN B CB  1 
ATOM   1565  N N   . CYS B  1 43  ? 25.086 16.629 -6.217  1.00 62.59  ? 70   CYS B N   1 
ATOM   1566  C CA  . CYS B  1 43  ? 25.705 17.903 -5.897  1.00 61.27  ? 70   CYS B CA  1 
ATOM   1567  C C   . CYS B  1 43  ? 25.735 18.085 -4.399  1.00 61.22  ? 70   CYS B C   1 
ATOM   1568  O O   . CYS B  1 43  ? 26.788 18.341 -3.823  1.00 61.77  ? 70   CYS B O   1 
ATOM   1569  C CB  . CYS B  1 43  ? 24.931 19.069 -6.503  1.00 59.84  ? 70   CYS B CB  1 
ATOM   1570  S SG  . CYS B  1 43  ? 24.612 18.978 -8.282  1.00 57.74  ? 70   CYS B SG  1 
ATOM   1571  N N   . ALA B  1 44  ? 24.567 17.938 -3.779  1.00 60.78  ? 71   ALA B N   1 
ATOM   1572  C CA  . ALA B  1 44  ? 24.410 18.084 -2.339  1.00 60.16  ? 71   ALA B CA  1 
ATOM   1573  C C   . ALA B  1 44  ? 25.403 17.228 -1.569  1.00 60.34  ? 71   ALA B C   1 
ATOM   1574  O O   . ALA B  1 44  ? 26.202 17.752 -0.797  1.00 60.25  ? 71   ALA B O   1 
ATOM   1575  C CB  . ALA B  1 44  ? 23.000 17.721 -1.943  1.00 59.80  ? 71   ALA B CB  1 
ATOM   1576  N N   . ASP B  1 45  ? 25.353 15.917 -1.788  1.00 60.07  ? 72   ASP B N   1 
ATOM   1577  C CA  . ASP B  1 45  ? 26.256 15.001 -1.110  1.00 60.77  ? 72   ASP B CA  1 
ATOM   1578  C C   . ASP B  1 45  ? 27.694 15.441 -1.272  1.00 60.27  ? 72   ASP B C   1 
ATOM   1579  O O   . ASP B  1 45  ? 28.430 15.568 -0.294  1.00 61.39  ? 72   ASP B O   1 
ATOM   1580  C CB  . ASP B  1 45  ? 26.086 13.589 -1.658  1.00 63.66  ? 72   ASP B CB  1 
ATOM   1581  C CG  . ASP B  1 45  ? 24.719 13.010 -1.338  1.00 68.21  ? 72   ASP B CG  1 
ATOM   1582  O OD1 . ASP B  1 45  ? 23.687 13.576 -1.708  1.00 70.26  ? 72   ASP B OD1 1 
ATOM   1583  O OD2 . ASP B  1 45  ? 24.703 11.881 -0.638  1.00 69.68  ? 72   ASP B OD2 1 
ATOM   1584  N N   . ARG B  1 46  ? 28.093 15.680 -2.512  1.00 58.86  ? 73   ARG B N   1 
ATOM   1585  C CA  . ARG B  1 46  ? 29.451 16.119 -2.804  1.00 56.51  ? 73   ARG B CA  1 
ATOM   1586  C C   . ARG B  1 46  ? 29.767 17.343 -1.954  1.00 55.00  ? 73   ARG B C   1 
ATOM   1587  O O   . ARG B  1 46  ? 30.834 17.428 -1.350  1.00 54.00  ? 73   ARG B O   1 
ATOM   1588  C CB  . ARG B  1 46  ? 29.575 16.450 -4.297  1.00 56.14  ? 73   ARG B CB  1 
ATOM   1589  C CG  . ARG B  1 46  ? 30.835 15.920 -4.950  1.00 54.52  ? 73   ARG B CG  1 
ATOM   1590  C CD  . ARG B  1 46  ? 31.939 16.939 -4.895  1.00 55.26  ? 73   ARG B CD  1 
ATOM   1591  N NE  . ARG B  1 46  ? 33.183 16.464 -5.498  1.00 56.92  ? 73   ARG B NE  1 
ATOM   1592  C CZ  . ARG B  1 46  ? 33.284 15.884 -6.691  1.00 57.88  ? 73   ARG B CZ  1 
ATOM   1593  N NH1 . ARG B  1 46  ? 32.208 15.677 -7.446  1.00 58.71  ? 73   ARG B NH1 1 
ATOM   1594  N NH2 . ARG B  1 46  ? 34.479 15.540 -7.147  1.00 57.89  ? 73   ARG B NH2 1 
ATOM   1595  N N   . CYS B  1 47  ? 28.816 18.275 -1.896  1.00 53.83  ? 74   CYS B N   1 
ATOM   1596  C CA  . CYS B  1 47  ? 28.973 19.507 -1.125  1.00 52.22  ? 74   CYS B CA  1 
ATOM   1597  C C   . CYS B  1 47  ? 28.947 19.264 0.388   1.00 51.68  ? 74   CYS B C   1 
ATOM   1598  O O   . CYS B  1 47  ? 29.724 19.860 1.136   1.00 51.13  ? 74   CYS B O   1 
ATOM   1599  C CB  . CYS B  1 47  ? 27.876 20.500 -1.500  1.00 50.37  ? 74   CYS B CB  1 
ATOM   1600  S SG  . CYS B  1 47  ? 28.041 22.159 -0.759  1.00 46.37  ? 74   CYS B SG  1 
ATOM   1601  N N   . THR B  1 48  ? 28.050 18.393 0.838   1.00 50.42  ? 75   THR B N   1 
ATOM   1602  C CA  . THR B  1 48  ? 27.952 18.085 2.255   1.00 49.82  ? 75   THR B CA  1 
ATOM   1603  C C   . THR B  1 48  ? 29.240 17.428 2.718   1.00 50.25  ? 75   THR B C   1 
ATOM   1604  O O   . THR B  1 48  ? 29.911 17.922 3.628   1.00 50.99  ? 75   THR B O   1 
ATOM   1605  C CB  . THR B  1 48  ? 26.789 17.123 2.543   1.00 49.26  ? 75   THR B CB  1 
ATOM   1606  O OG1 . THR B  1 48  ? 25.553 17.754 2.209   1.00 48.82  ? 75   THR B OG1 1 
ATOM   1607  C CG2 . THR B  1 48  ? 26.761 16.748 4.005   1.00 48.07  ? 75   THR B CG2 1 
ATOM   1608  N N   . ARG B  1 49  ? 29.573 16.308 2.080   1.00 50.04  ? 76   ARG B N   1 
ATOM   1609  C CA  . ARG B  1 49  ? 30.778 15.549 2.402   1.00 50.25  ? 76   ARG B CA  1 
ATOM   1610  C C   . ARG B  1 49  ? 32.038 16.224 1.871   1.00 49.17  ? 76   ARG B C   1 
ATOM   1611  O O   . ARG B  1 49  ? 33.139 15.693 1.998   1.00 49.06  ? 76   ARG B O   1 
ATOM   1612  C CB  . ARG B  1 49  ? 30.674 14.154 1.814   1.00 52.33  ? 76   ARG B CB  1 
ATOM   1613  C CG  . ARG B  1 49  ? 29.352 13.490 2.095   1.00 57.94  ? 76   ARG B CG  1 
ATOM   1614  C CD  . ARG B  1 49  ? 29.165 12.324 1.146   1.00 64.75  ? 76   ARG B CD  1 
ATOM   1615  N NE  . ARG B  1 49  ? 27.902 11.616 1.344   1.00 70.37  ? 76   ARG B NE  1 
ATOM   1616  C CZ  . ARG B  1 49  ? 27.432 10.688 0.512   1.00 71.80  ? 76   ARG B CZ  1 
ATOM   1617  N NH1 . ARG B  1 49  ? 28.120 10.367 -0.577  1.00 71.93  ? 76   ARG B NH1 1 
ATOM   1618  N NH2 . ARG B  1 49  ? 26.288 10.064 0.781   1.00 72.96  ? 76   ARG B NH2 1 
ATOM   1619  N N   . ASN B  1 50  ? 31.857 17.388 1.257   1.00 48.28  ? 77   ASN B N   1 
ATOM   1620  C CA  . ASN B  1 50  ? 32.951 18.176 0.709   1.00 46.77  ? 77   ASN B CA  1 
ATOM   1621  C C   . ASN B  1 50  ? 34.046 17.316 0.082   1.00 48.78  ? 77   ASN B C   1 
ATOM   1622  O O   . ASN B  1 50  ? 35.231 17.651 0.188   1.00 50.19  ? 77   ASN B O   1 
ATOM   1623  C CB  . ASN B  1 50  ? 33.541 19.043 1.821   1.00 42.05  ? 77   ASN B CB  1 
ATOM   1624  C CG  . ASN B  1 50  ? 34.173 20.307 1.300   1.00 39.72  ? 77   ASN B CG  1 
ATOM   1625  O OD1 . ASN B  1 50  ? 33.680 21.405 1.548   1.00 40.06  ? 77   ASN B OD1 1 
ATOM   1626  N ND2 . ASN B  1 50  ? 35.265 20.166 0.569   1.00 36.51  ? 77   ASN B ND2 1 
ATOM   1627  N N   . LYS B  1 51  ? 33.666 16.202 -0.550  1.00 49.71  ? 78   LYS B N   1 
ATOM   1628  C CA  . LYS B  1 51  ? 34.647 15.298 -1.189  1.00 50.39  ? 78   LYS B CA  1 
ATOM   1629  C C   . LYS B  1 51  ? 35.142 15.826 -2.552  1.00 51.21  ? 78   LYS B C   1 
ATOM   1630  O O   . LYS B  1 51  ? 34.353 16.259 -3.380  1.00 53.09  ? 78   LYS B O   1 
ATOM   1631  C CB  . LYS B  1 51  ? 34.020 13.911 -1.360  1.00 48.97  ? 78   LYS B CB  1 
ATOM   1632  N N   . GLY B  1 52  ? 36.449 15.784 -2.771  1.00 51.74  ? 79   GLY B N   1 
ATOM   1633  C CA  . GLY B  1 52  ? 37.027 16.245 -4.021  1.00 51.24  ? 79   GLY B CA  1 
ATOM   1634  C C   . GLY B  1 52  ? 36.829 17.716 -4.314  1.00 50.77  ? 79   GLY B C   1 
ATOM   1635  O O   . GLY B  1 52  ? 36.610 18.112 -5.460  1.00 50.55  ? 79   GLY B O   1 
ATOM   1636  N N   . LEU B  1 53  ? 36.901 18.528 -3.270  1.00 50.87  ? 80   LEU B N   1 
ATOM   1637  C CA  . LEU B  1 53  ? 36.732 19.966 -3.407  1.00 51.95  ? 80   LEU B CA  1 
ATOM   1638  C C   . LEU B  1 53  ? 37.877 20.673 -2.685  1.00 51.92  ? 80   LEU B C   1 
ATOM   1639  O O   . LEU B  1 53  ? 38.096 20.471 -1.494  1.00 53.47  ? 80   LEU B O   1 
ATOM   1640  C CB  . LEU B  1 53  ? 35.377 20.383 -2.827  1.00 52.82  ? 80   LEU B CB  1 
ATOM   1641  C CG  . LEU B  1 53  ? 34.150 19.905 -3.617  1.00 52.52  ? 80   LEU B CG  1 
ATOM   1642  C CD1 . LEU B  1 53  ? 32.880 20.076 -2.798  1.00 53.14  ? 80   LEU B CD1 1 
ATOM   1643  C CD2 . LEU B  1 53  ? 34.057 20.691 -4.908  1.00 52.66  ? 80   LEU B CD2 1 
ATOM   1644  N N   . PRO B  1 54  ? 38.630 21.504 -3.408  1.00 51.36  ? 81   PRO B N   1 
ATOM   1645  C CA  . PRO B  1 54  ? 39.768 22.251 -2.869  1.00 50.66  ? 81   PRO B CA  1 
ATOM   1646  C C   . PRO B  1 54  ? 39.376 23.432 -2.002  1.00 50.25  ? 81   PRO B C   1 
ATOM   1647  O O   . PRO B  1 54  ? 40.141 24.387 -1.868  1.00 50.66  ? 81   PRO B O   1 
ATOM   1648  C CB  . PRO B  1 54  ? 40.498 22.702 -4.121  1.00 51.14  ? 81   PRO B CB  1 
ATOM   1649  C CG  . PRO B  1 54  ? 39.357 23.004 -5.040  1.00 52.34  ? 81   PRO B CG  1 
ATOM   1650  C CD  . PRO B  1 54  ? 38.442 21.803 -4.838  1.00 52.07  ? 81   PRO B CD  1 
ATOM   1651  N N   . PHE B  1 55  ? 38.186 23.378 -1.420  1.00 48.85  ? 82   PHE B N   1 
ATOM   1652  C CA  . PHE B  1 55  ? 37.725 24.462 -0.565  1.00 48.05  ? 82   PHE B CA  1 
ATOM   1653  C C   . PHE B  1 55  ? 36.486 24.048 0.213   1.00 47.26  ? 82   PHE B C   1 
ATOM   1654  O O   . PHE B  1 55  ? 36.003 22.917 0.102   1.00 45.62  ? 82   PHE B O   1 
ATOM   1655  C CB  . PHE B  1 55  ? 37.419 25.701 -1.410  1.00 49.39  ? 82   PHE B CB  1 
ATOM   1656  C CG  . PHE B  1 55  ? 36.526 25.417 -2.586  1.00 53.06  ? 82   PHE B CG  1 
ATOM   1657  C CD1 . PHE B  1 55  ? 35.201 25.025 -2.402  1.00 53.24  ? 82   PHE B CD1 1 
ATOM   1658  C CD2 . PHE B  1 55  ? 37.029 25.465 -3.882  1.00 54.59  ? 82   PHE B CD2 1 
ATOM   1659  C CE1 . PHE B  1 55  ? 34.404 24.680 -3.483  1.00 52.70  ? 82   PHE B CE1 1 
ATOM   1660  C CE2 . PHE B  1 55  ? 36.232 25.119 -4.971  1.00 53.81  ? 82   PHE B CE2 1 
ATOM   1661  C CZ  . PHE B  1 55  ? 34.922 24.725 -4.769  1.00 53.52  ? 82   PHE B CZ  1 
ATOM   1662  N N   . THR B  1 56  ? 35.974 24.982 1.001   1.00 46.32  ? 83   THR B N   1 
ATOM   1663  C CA  . THR B  1 56  ? 34.792 24.741 1.801   1.00 45.40  ? 83   THR B CA  1 
ATOM   1664  C C   . THR B  1 56  ? 33.573 25.002 0.927   1.00 43.51  ? 83   THR B C   1 
ATOM   1665  O O   . THR B  1 56  ? 33.366 26.134 0.505   1.00 43.57  ? 83   THR B O   1 
ATOM   1666  C CB  . THR B  1 56  ? 34.771 25.702 2.996   1.00 46.87  ? 83   THR B CB  1 
ATOM   1667  O OG1 . THR B  1 56  ? 36.069 25.739 3.602   1.00 48.91  ? 83   THR B OG1 1 
ATOM   1668  C CG2 . THR B  1 56  ? 33.758 25.247 4.023   1.00 48.86  ? 83   THR B CG2 1 
ATOM   1669  N N   . CYS B  1 57  ? 32.776 23.973 0.644   1.00 41.64  ? 84   CYS B N   1 
ATOM   1670  C CA  . CYS B  1 57  ? 31.585 24.162 -0.187  1.00 41.76  ? 84   CYS B CA  1 
ATOM   1671  C C   . CYS B  1 57  ? 30.486 24.870 0.605   1.00 40.85  ? 84   CYS B C   1 
ATOM   1672  O O   . CYS B  1 57  ? 29.816 24.254 1.428   1.00 41.99  ? 84   CYS B O   1 
ATOM   1673  C CB  . CYS B  1 57  ? 31.059 22.819 -0.717  1.00 43.13  ? 84   CYS B CB  1 
ATOM   1674  S SG  . CYS B  1 57  ? 29.587 23.025 -1.773  1.00 48.41  ? 84   CYS B SG  1 
ATOM   1675  N N   . LYS B  1 58  ? 30.303 26.164 0.352   1.00 39.39  ? 85   LYS B N   1 
ATOM   1676  C CA  . LYS B  1 58  ? 29.295 26.957 1.056   1.00 38.34  ? 85   LYS B CA  1 
ATOM   1677  C C   . LYS B  1 58  ? 27.956 27.036 0.336   1.00 37.32  ? 85   LYS B C   1 
ATOM   1678  O O   . LYS B  1 58  ? 26.944 27.392 0.928   1.00 35.34  ? 85   LYS B O   1 
ATOM   1679  C CB  . LYS B  1 58  ? 29.827 28.365 1.303   1.00 37.73  ? 85   LYS B CB  1 
ATOM   1680  C CG  . LYS B  1 58  ? 31.083 28.352 2.113   1.00 40.58  ? 85   LYS B CG  1 
ATOM   1681  C CD  . LYS B  1 58  ? 31.620 29.734 2.359   1.00 43.23  ? 85   LYS B CD  1 
ATOM   1682  C CE  . LYS B  1 58  ? 32.889 29.650 3.197   1.00 45.72  ? 85   LYS B CE  1 
ATOM   1683  N NZ  . LYS B  1 58  ? 33.489 30.988 3.449   1.00 46.66  ? 85   LYS B NZ  1 
ATOM   1684  N N   . ALA B  1 59  ? 27.956 26.703 -0.946  1.00 37.29  ? 86   ALA B N   1 
ATOM   1685  C CA  . ALA B  1 59  ? 26.735 26.725 -1.728  1.00 37.54  ? 86   ALA B CA  1 
ATOM   1686  C C   . ALA B  1 59  ? 26.985 26.027 -3.050  1.00 38.86  ? 86   ALA B C   1 
ATOM   1687  O O   . ALA B  1 59  ? 28.126 25.865 -3.460  1.00 39.17  ? 86   ALA B O   1 
ATOM   1688  C CB  . ALA B  1 59  ? 26.300 28.150 -1.956  1.00 35.84  ? 86   ALA B CB  1 
ATOM   1689  N N   . PHE B  1 60  ? 25.919 25.587 -3.703  1.00 40.99  ? 87   PHE B N   1 
ATOM   1690  C CA  . PHE B  1 60  ? 26.053 24.924 -4.992  1.00 43.88  ? 87   PHE B CA  1 
ATOM   1691  C C   . PHE B  1 60  ? 24.799 25.165 -5.813  1.00 46.24  ? 87   PHE B C   1 
ATOM   1692  O O   . PHE B  1 60  ? 23.691 25.161 -5.275  1.00 46.24  ? 87   PHE B O   1 
ATOM   1693  C CB  . PHE B  1 60  ? 26.314 23.416 -4.816  1.00 42.38  ? 87   PHE B CB  1 
ATOM   1694  C CG  . PHE B  1 60  ? 25.089 22.603 -4.514  1.00 42.52  ? 87   PHE B CG  1 
ATOM   1695  C CD1 . PHE B  1 60  ? 24.192 22.260 -5.519  1.00 43.06  ? 87   PHE B CD1 1 
ATOM   1696  C CD2 . PHE B  1 60  ? 24.830 22.176 -3.219  1.00 42.23  ? 87   PHE B CD2 1 
ATOM   1697  C CE1 . PHE B  1 60  ? 23.053 21.501 -5.234  1.00 42.86  ? 87   PHE B CE1 1 
ATOM   1698  C CE2 . PHE B  1 60  ? 23.698 21.418 -2.930  1.00 42.73  ? 87   PHE B CE2 1 
ATOM   1699  C CZ  . PHE B  1 60  ? 22.808 21.081 -3.940  1.00 41.92  ? 87   PHE B CZ  1 
ATOM   1700  N N   . VAL B  1 61  ? 24.988 25.398 -7.111  1.00 49.20  ? 88   VAL B N   1 
ATOM   1701  C CA  . VAL B  1 61  ? 23.883 25.640 -8.032  1.00 50.88  ? 88   VAL B CA  1 
ATOM   1702  C C   . VAL B  1 61  ? 23.744 24.444 -8.958  1.00 52.36  ? 88   VAL B C   1 
ATOM   1703  O O   . VAL B  1 61  ? 24.740 23.937 -9.468  1.00 52.54  ? 88   VAL B O   1 
ATOM   1704  C CB  . VAL B  1 61  ? 24.128 26.899 -8.889  1.00 51.25  ? 88   VAL B CB  1 
ATOM   1705  C CG1 . VAL B  1 61  ? 23.016 27.042 -9.921  1.00 51.98  ? 88   VAL B CG1 1 
ATOM   1706  C CG2 . VAL B  1 61  ? 24.194 28.139 -7.997  1.00 50.22  ? 88   VAL B CG2 1 
ATOM   1707  N N   . PHE B  1 62  ? 22.514 23.980 -9.159  1.00 54.80  ? 89   PHE B N   1 
ATOM   1708  C CA  . PHE B  1 62  ? 22.288 22.842 -10.046 1.00 57.56  ? 89   PHE B CA  1 
ATOM   1709  C C   . PHE B  1 62  ? 21.698 23.301 -11.363 1.00 59.62  ? 89   PHE B C   1 
ATOM   1710  O O   . PHE B  1 62  ? 20.642 23.938 -11.400 1.00 59.94  ? 89   PHE B O   1 
ATOM   1711  C CB  . PHE B  1 62  ? 21.359 21.803 -9.418  1.00 56.33  ? 89   PHE B CB  1 
ATOM   1712  C CG  . PHE B  1 62  ? 21.094 20.620 -10.308 1.00 55.39  ? 89   PHE B CG  1 
ATOM   1713  C CD1 . PHE B  1 62  ? 22.144 19.884 -10.840 1.00 54.89  ? 89   PHE B CD1 1 
ATOM   1714  C CD2 . PHE B  1 62  ? 19.795 20.243 -10.620 1.00 55.91  ? 89   PHE B CD2 1 
ATOM   1715  C CE1 . PHE B  1 62  ? 21.903 18.788 -11.669 1.00 55.28  ? 89   PHE B CE1 1 
ATOM   1716  C CE2 . PHE B  1 62  ? 19.545 19.147 -11.449 1.00 54.97  ? 89   PHE B CE2 1 
ATOM   1717  C CZ  . PHE B  1 62  ? 20.600 18.420 -11.972 1.00 54.85  ? 89   PHE B CZ  1 
ATOM   1718  N N   . ASP B  1 63  ? 22.407 22.967 -12.439 1.00 62.49  ? 90   ASP B N   1 
ATOM   1719  C CA  . ASP B  1 63  ? 22.011 23.321 -13.797 1.00 64.65  ? 90   ASP B CA  1 
ATOM   1720  C C   . ASP B  1 63  ? 21.095 22.225 -14.337 1.00 64.65  ? 90   ASP B C   1 
ATOM   1721  O O   . ASP B  1 63  ? 21.562 21.247 -14.915 1.00 62.65  ? 90   ASP B O   1 
ATOM   1722  C CB  . ASP B  1 63  ? 23.262 23.453 -14.675 1.00 67.23  ? 90   ASP B CB  1 
ATOM   1723  C CG  . ASP B  1 63  ? 22.981 24.147 -15.991 1.00 68.87  ? 90   ASP B CG  1 
ATOM   1724  O OD1 . ASP B  1 63  ? 22.269 23.554 -16.830 1.00 69.72  ? 90   ASP B OD1 1 
ATOM   1725  O OD2 . ASP B  1 63  ? 23.466 25.286 -16.180 1.00 68.74  ? 90   ASP B OD2 1 
ATOM   1726  N N   . LYS B  1 64  ? 19.791 22.404 -14.121 1.00 65.83  ? 91   LYS B N   1 
ATOM   1727  C CA  . LYS B  1 64  ? 18.754 21.459 -14.543 1.00 65.88  ? 91   LYS B CA  1 
ATOM   1728  C C   . LYS B  1 64  ? 18.944 21.061 -15.992 1.00 65.94  ? 91   LYS B C   1 
ATOM   1729  O O   . LYS B  1 64  ? 18.897 19.874 -16.357 1.00 64.41  ? 91   LYS B O   1 
ATOM   1730  C CB  . LYS B  1 64  ? 17.379 22.103 -14.375 1.00 65.55  ? 91   LYS B CB  1 
ATOM   1731  C CG  . LYS B  1 64  ? 17.040 22.459 -12.947 1.00 67.06  ? 91   LYS B CG  1 
ATOM   1732  C CD  . LYS B  1 64  ? 15.829 23.368 -12.874 1.00 68.13  ? 91   LYS B CD  1 
ATOM   1733  C CE  . LYS B  1 64  ? 15.424 23.620 -11.436 1.00 68.42  ? 91   LYS B CE  1 
ATOM   1734  N NZ  . LYS B  1 64  ? 14.351 24.643 -11.348 1.00 70.29  ? 91   LYS B NZ  1 
ATOM   1735  N N   . ALA B  1 65  ? 19.155 22.081 -16.813 1.00 66.13  ? 92   ALA B N   1 
ATOM   1736  C CA  . ALA B  1 65  ? 19.355 21.899 -18.239 1.00 66.28  ? 92   ALA B CA  1 
ATOM   1737  C C   . ALA B  1 65  ? 20.568 21.012 -18.529 1.00 66.28  ? 92   ALA B C   1 
ATOM   1738  O O   . ALA B  1 65  ? 20.412 19.837 -18.870 1.00 66.11  ? 92   ALA B O   1 
ATOM   1739  C CB  . ALA B  1 65  ? 19.514 23.257 -18.903 1.00 67.06  ? 92   ALA B CB  1 
ATOM   1740  N N   . ARG B  1 66  ? 21.768 21.574 -18.368 1.00 66.21  ? 93   ARG B N   1 
ATOM   1741  C CA  . ARG B  1 66  ? 23.033 20.867 -18.607 1.00 66.35  ? 93   ARG B CA  1 
ATOM   1742  C C   . ARG B  1 66  ? 23.297 19.672 -17.680 1.00 65.98  ? 93   ARG B C   1 
ATOM   1743  O O   . ARG B  1 66  ? 24.175 18.854 -17.950 1.00 66.00  ? 93   ARG B O   1 
ATOM   1744  C CB  . ARG B  1 66  ? 24.197 21.858 -18.481 1.00 66.73  ? 93   ARG B CB  1 
ATOM   1745  C CG  . ARG B  1 66  ? 24.081 23.082 -19.395 1.00 66.78  ? 93   ARG B CG  1 
ATOM   1746  C CD  . ARG B  1 66  ? 25.022 24.190 -18.949 1.00 67.46  ? 93   ARG B CD  1 
ATOM   1747  N NE  . ARG B  1 66  ? 24.877 25.436 -19.705 1.00 66.94  ? 93   ARG B NE  1 
ATOM   1748  C CZ  . ARG B  1 66  ? 23.738 26.111 -19.841 1.00 66.86  ? 93   ARG B CZ  1 
ATOM   1749  N NH1 . ARG B  1 66  ? 22.622 25.664 -19.280 1.00 66.88  ? 93   ARG B NH1 1 
ATOM   1750  N NH2 . ARG B  1 66  ? 23.714 27.240 -20.536 1.00 66.54  ? 93   ARG B NH2 1 
ATOM   1751  N N   . LYS B  1 67  ? 22.532 19.577 -16.595 1.00 65.95  ? 94   LYS B N   1 
ATOM   1752  C CA  . LYS B  1 67  ? 22.689 18.510 -15.604 1.00 64.39  ? 94   LYS B CA  1 
ATOM   1753  C C   . LYS B  1 67  ? 24.117 18.455 -15.072 1.00 63.09  ? 94   LYS B C   1 
ATOM   1754  O O   . LYS B  1 67  ? 24.825 17.460 -15.217 1.00 62.45  ? 94   LYS B O   1 
ATOM   1755  C CB  . LYS B  1 67  ? 22.276 17.159 -16.187 1.00 64.11  ? 94   LYS B CB  1 
ATOM   1756  C CG  . LYS B  1 67  ? 20.770 17.006 -16.318 1.00 64.07  ? 94   LYS B CG  1 
ATOM   1757  C CD  . LYS B  1 67  ? 20.387 15.639 -16.874 1.00 64.77  ? 94   LYS B CD  1 
ATOM   1758  C CE  . LYS B  1 67  ? 20.850 14.500 -15.967 1.00 65.78  ? 94   LYS B CE  1 
ATOM   1759  N NZ  . LYS B  1 67  ? 20.541 13.152 -16.544 1.00 65.96  ? 94   LYS B NZ  1 
ATOM   1760  N N   . GLN B  1 68  ? 24.525 19.554 -14.454 1.00 61.62  ? 95   GLN B N   1 
ATOM   1761  C CA  . GLN B  1 68  ? 25.852 19.664 -13.887 1.00 60.79  ? 95   GLN B CA  1 
ATOM   1762  C C   . GLN B  1 68  ? 25.849 20.550 -12.634 1.00 60.22  ? 95   GLN B C   1 
ATOM   1763  O O   . GLN B  1 68  ? 25.117 21.552 -12.552 1.00 60.15  ? 95   GLN B O   1 
ATOM   1764  C CB  . GLN B  1 68  ? 26.812 20.245 -14.920 1.00 61.73  ? 95   GLN B CB  1 
ATOM   1765  C CG  . GLN B  1 68  ? 26.368 21.589 -15.493 1.00 61.42  ? 95   GLN B CG  1 
ATOM   1766  C CD  . GLN B  1 68  ? 27.547 22.514 -15.759 1.00 61.51  ? 95   GLN B CD  1 
ATOM   1767  O OE1 . GLN B  1 68  ? 28.676 22.061 -15.982 1.00 61.53  ? 95   GLN B OE1 1 
ATOM   1768  N NE2 . GLN B  1 68  ? 27.287 23.815 -15.747 1.00 59.88  ? 95   GLN B NE2 1 
ATOM   1769  N N   . CYS B  1 69  ? 26.683 20.175 -11.669 1.00 57.40  ? 96   CYS B N   1 
ATOM   1770  C CA  . CYS B  1 69  ? 26.794 20.905 -10.422 1.00 54.88  ? 96   CYS B CA  1 
ATOM   1771  C C   . CYS B  1 69  ? 27.794 22.051 -10.508 1.00 53.75  ? 96   CYS B C   1 
ATOM   1772  O O   . CYS B  1 69  ? 28.756 21.998 -11.269 1.00 52.89  ? 96   CYS B O   1 
ATOM   1773  C CB  . CYS B  1 69  ? 27.259 19.978 -9.309  1.00 55.69  ? 96   CYS B CB  1 
ATOM   1774  S SG  . CYS B  1 69  ? 26.377 18.408 -9.092  1.00 56.81  ? 96   CYS B SG  1 
ATOM   1775  N N   . LEU B  1 70  ? 27.551 23.083 -9.705  1.00 52.27  ? 97   LEU B N   1 
ATOM   1776  C CA  . LEU B  1 70  ? 28.428 24.236 -9.621  1.00 50.51  ? 97   LEU B CA  1 
ATOM   1777  C C   . LEU B  1 70  ? 28.677 24.526 -8.149  1.00 49.33  ? 97   LEU B C   1 
ATOM   1778  O O   . LEU B  1 70  ? 27.951 25.294 -7.527  1.00 49.14  ? 97   LEU B O   1 
ATOM   1779  C CB  . LEU B  1 70  ? 27.802 25.457 -10.286 1.00 51.58  ? 97   LEU B CB  1 
ATOM   1780  C CG  . LEU B  1 70  ? 27.786 25.484 -11.817 1.00 51.46  ? 97   LEU B CG  1 
ATOM   1781  C CD1 . LEU B  1 70  ? 26.833 24.428 -12.344 1.00 51.51  ? 97   LEU B CD1 1 
ATOM   1782  C CD2 . LEU B  1 70  ? 27.358 26.878 -12.283 1.00 52.87  ? 97   LEU B CD2 1 
ATOM   1783  N N   . TRP B  1 71  ? 29.707 23.886 -7.603  1.00 47.11  ? 98   TRP B N   1 
ATOM   1784  C CA  . TRP B  1 71  ? 30.095 24.040 -6.209  1.00 43.69  ? 98   TRP B CA  1 
ATOM   1785  C C   . TRP B  1 71  ? 30.904 25.313 -5.969  1.00 43.34  ? 98   TRP B C   1 
ATOM   1786  O O   . TRP B  1 71  ? 31.957 25.502 -6.554  1.00 42.58  ? 98   TRP B O   1 
ATOM   1787  C CB  . TRP B  1 71  ? 30.907 22.822 -5.797  1.00 41.85  ? 98   TRP B CB  1 
ATOM   1788  C CG  . TRP B  1 71  ? 30.128 21.541 -5.882  1.00 41.92  ? 98   TRP B CG  1 
ATOM   1789  C CD1 . TRP B  1 71  ? 29.088 21.163 -5.082  1.00 42.04  ? 98   TRP B CD1 1 
ATOM   1790  C CD2 . TRP B  1 71  ? 30.343 20.456 -6.795  1.00 41.68  ? 98   TRP B CD2 1 
ATOM   1791  N NE1 . TRP B  1 71  ? 28.645 19.910 -5.433  1.00 41.55  ? 98   TRP B NE1 1 
ATOM   1792  C CE2 . TRP B  1 71  ? 29.400 19.451 -6.480  1.00 42.01  ? 98   TRP B CE2 1 
ATOM   1793  C CE3 . TRP B  1 71  ? 31.245 20.231 -7.844  1.00 41.11  ? 98   TRP B CE3 1 
ATOM   1794  C CZ2 . TRP B  1 71  ? 29.330 18.231 -7.185  1.00 42.12  ? 98   TRP B CZ2 1 
ATOM   1795  C CZ3 . TRP B  1 71  ? 31.175 19.016 -8.545  1.00 39.73  ? 98   TRP B CZ3 1 
ATOM   1796  C CH2 . TRP B  1 71  ? 30.225 18.034 -8.207  1.00 39.91  ? 98   TRP B CH2 1 
ATOM   1797  N N   . PHE B  1 72  ? 30.405 26.190 -5.109  1.00 44.85  ? 99   PHE B N   1 
ATOM   1798  C CA  . PHE B  1 72  ? 31.105 27.434 -4.803  1.00 47.45  ? 99   PHE B CA  1 
ATOM   1799  C C   . PHE B  1 72  ? 31.605 27.478 -3.351  1.00 48.92  ? 99   PHE B C   1 
ATOM   1800  O O   . PHE B  1 72  ? 30.995 26.903 -2.448  1.00 48.52  ? 99   PHE B O   1 
ATOM   1801  C CB  . PHE B  1 72  ? 30.199 28.657 -5.040  1.00 47.31  ? 99   PHE B CB  1 
ATOM   1802  C CG  . PHE B  1 72  ? 29.358 28.554 -6.265  1.00 48.19  ? 99   PHE B CG  1 
ATOM   1803  C CD1 . PHE B  1 72  ? 28.036 28.133 -6.180  1.00 47.82  ? 99   PHE B CD1 1 
ATOM   1804  C CD2 . PHE B  1 72  ? 29.902 28.811 -7.522  1.00 47.89  ? 99   PHE B CD2 1 
ATOM   1805  C CE1 . PHE B  1 72  ? 27.270 27.962 -7.338  1.00 48.55  ? 99   PHE B CE1 1 
ATOM   1806  C CE2 . PHE B  1 72  ? 29.141 28.641 -8.683  1.00 46.41  ? 99   PHE B CE2 1 
ATOM   1807  C CZ  . PHE B  1 72  ? 27.829 28.216 -8.592  1.00 46.64  ? 99   PHE B CZ  1 
ATOM   1808  N N   . PRO B  1 73  ? 32.740 28.157 -3.123  1.00 50.20  ? 100  PRO B N   1 
ATOM   1809  C CA  . PRO B  1 73  ? 33.365 28.324 -1.815  1.00 50.89  ? 100  PRO B CA  1 
ATOM   1810  C C   . PRO B  1 73  ? 32.891 29.660 -1.247  1.00 51.81  ? 100  PRO B C   1 
ATOM   1811  O O   . PRO B  1 73  ? 33.648 30.376 -0.581  1.00 52.42  ? 100  PRO B O   1 
ATOM   1812  C CB  . PRO B  1 73  ? 34.839 28.343 -2.162  1.00 50.90  ? 100  PRO B CB  1 
ATOM   1813  C CG  . PRO B  1 73  ? 34.832 29.146 -3.406  1.00 50.72  ? 100  PRO B CG  1 
ATOM   1814  C CD  . PRO B  1 73  ? 33.694 28.529 -4.184  1.00 51.05  ? 100  PRO B CD  1 
ATOM   1815  N N   . PHE B  1 74  ? 31.631 29.985 -1.530  1.00 51.91  ? 101  PHE B N   1 
ATOM   1816  C CA  . PHE B  1 74  ? 31.010 31.230 -1.081  1.00 51.32  ? 101  PHE B CA  1 
ATOM   1817  C C   . PHE B  1 74  ? 29.498 31.119 -1.309  1.00 50.93  ? 101  PHE B C   1 
ATOM   1818  O O   . PHE B  1 74  ? 29.019 30.114 -1.847  1.00 50.80  ? 101  PHE B O   1 
ATOM   1819  C CB  . PHE B  1 74  ? 31.577 32.395 -1.896  1.00 52.06  ? 101  PHE B CB  1 
ATOM   1820  C CG  . PHE B  1 74  ? 31.447 32.203 -3.383  1.00 53.92  ? 101  PHE B CG  1 
ATOM   1821  C CD1 . PHE B  1 74  ? 30.229 32.426 -4.024  1.00 55.21  ? 101  PHE B CD1 1 
ATOM   1822  C CD2 . PHE B  1 74  ? 32.515 31.727 -4.130  1.00 54.33  ? 101  PHE B CD2 1 
ATOM   1823  C CE1 . PHE B  1 74  ? 30.075 32.175 -5.381  1.00 55.73  ? 101  PHE B CE1 1 
ATOM   1824  C CE2 . PHE B  1 74  ? 32.370 31.471 -5.494  1.00 56.16  ? 101  PHE B CE2 1 
ATOM   1825  C CZ  . PHE B  1 74  ? 31.146 31.694 -6.120  1.00 56.45  ? 101  PHE B CZ  1 
ATOM   1826  N N   . ASN B  1 75  ? 28.750 32.139 -0.893  1.00 49.75  ? 102  ASN B N   1 
ATOM   1827  C CA  . ASN B  1 75  ? 27.305 32.151 -1.098  1.00 48.26  ? 102  ASN B CA  1 
ATOM   1828  C C   . ASN B  1 75  ? 26.794 33.540 -1.468  1.00 49.90  ? 102  ASN B C   1 
ATOM   1829  O O   . ASN B  1 75  ? 27.562 34.483 -1.592  1.00 49.91  ? 102  ASN B O   1 
ATOM   1830  C CB  . ASN B  1 75  ? 26.556 31.627 0.134   1.00 44.30  ? 102  ASN B CB  1 
ATOM   1831  C CG  . ASN B  1 75  ? 26.740 32.495 1.356   1.00 41.61  ? 102  ASN B CG  1 
ATOM   1832  O OD1 . ASN B  1 75  ? 26.922 33.706 1.265   1.00 39.88  ? 102  ASN B OD1 1 
ATOM   1833  N ND2 . ASN B  1 75  ? 26.662 31.876 2.519   1.00 41.37  ? 102  ASN B ND2 1 
ATOM   1834  N N   . SER B  1 76  ? 25.485 33.653 -1.637  1.00 52.43  ? 103  SER B N   1 
ATOM   1835  C CA  . SER B  1 76  ? 24.846 34.899 -2.026  1.00 54.67  ? 103  SER B CA  1 
ATOM   1836  C C   . SER B  1 76  ? 25.233 36.103 -1.179  1.00 56.95  ? 103  SER B C   1 
ATOM   1837  O O   . SER B  1 76  ? 25.188 37.247 -1.643  1.00 57.50  ? 103  SER B O   1 
ATOM   1838  C CB  . SER B  1 76  ? 23.333 34.724 -1.983  1.00 53.74  ? 103  SER B CB  1 
ATOM   1839  O OG  . SER B  1 76  ? 22.904 34.559 -0.647  1.00 53.67  ? 103  SER B OG  1 
ATOM   1840  N N   . MET B  1 77  ? 25.612 35.860 0.063   1.00 59.56  ? 104  MET B N   1 
ATOM   1841  C CA  . MET B  1 77  ? 25.972 36.963 0.932   1.00 63.39  ? 104  MET B CA  1 
ATOM   1842  C C   . MET B  1 77  ? 27.453 37.283 0.847   1.00 65.11  ? 104  MET B C   1 
ATOM   1843  O O   . MET B  1 77  ? 27.929 38.251 1.436   1.00 65.37  ? 104  MET B O   1 
ATOM   1844  C CB  . MET B  1 77  ? 25.586 36.619 2.362   1.00 64.60  ? 104  MET B CB  1 
ATOM   1845  C CG  . MET B  1 77  ? 24.106 36.333 2.523   1.00 66.38  ? 104  MET B CG  1 
ATOM   1846  S SD  . MET B  1 77  ? 23.785 35.470 4.062   1.00 70.37  ? 104  MET B SD  1 
ATOM   1847  C CE  . MET B  1 77  ? 24.219 33.767 3.599   1.00 68.43  ? 104  MET B CE  1 
ATOM   1848  N N   . SER B  1 78  ? 28.178 36.468 0.094   1.00 67.35  ? 105  SER B N   1 
ATOM   1849  C CA  . SER B  1 78  ? 29.610 36.651 -0.062  1.00 69.37  ? 105  SER B CA  1 
ATOM   1850  C C   . SER B  1 78  ? 29.947 37.870 -0.903  1.00 71.71  ? 105  SER B C   1 
ATOM   1851  O O   . SER B  1 78  ? 29.550 37.967 -2.070  1.00 72.64  ? 105  SER B O   1 
ATOM   1852  C CB  . SER B  1 78  ? 30.235 35.410 -0.699  1.00 68.98  ? 105  SER B CB  1 
ATOM   1853  O OG  . SER B  1 78  ? 30.162 34.297 0.172   1.00 70.59  ? 105  SER B OG  1 
ATOM   1854  N N   . SER B  1 79  ? 30.679 38.802 -0.303  1.00 73.55  ? 106  SER B N   1 
ATOM   1855  C CA  . SER B  1 79  ? 31.100 40.007 -1.002  1.00 75.14  ? 106  SER B CA  1 
ATOM   1856  C C   . SER B  1 79  ? 31.957 39.573 -2.189  1.00 76.41  ? 106  SER B C   1 
ATOM   1857  O O   . SER B  1 79  ? 33.010 38.960 -2.013  1.00 76.70  ? 106  SER B O   1 
ATOM   1858  C CB  . SER B  1 79  ? 31.911 40.892 -0.057  1.00 74.90  ? 106  SER B CB  1 
ATOM   1859  O OG  . SER B  1 79  ? 32.906 40.133 0.613   1.00 74.44  ? 106  SER B OG  1 
ATOM   1860  N N   . GLY B  1 80  ? 31.499 39.870 -3.398  1.00 77.84  ? 107  GLY B N   1 
ATOM   1861  C CA  . GLY B  1 80  ? 32.257 39.478 -4.571  1.00 80.44  ? 107  GLY B CA  1 
ATOM   1862  C C   . GLY B  1 80  ? 31.420 38.651 -5.527  1.00 82.02  ? 107  GLY B C   1 
ATOM   1863  O O   . GLY B  1 80  ? 31.929 38.135 -6.528  1.00 81.81  ? 107  GLY B O   1 
ATOM   1864  N N   . VAL B  1 81  ? 30.130 38.524 -5.217  1.00 83.40  ? 108  VAL B N   1 
ATOM   1865  C CA  . VAL B  1 81  ? 29.211 37.761 -6.061  1.00 84.53  ? 108  VAL B CA  1 
ATOM   1866  C C   . VAL B  1 81  ? 27.823 38.402 -6.123  1.00 83.98  ? 108  VAL B C   1 
ATOM   1867  O O   . VAL B  1 81  ? 27.408 39.121 -5.210  1.00 83.38  ? 108  VAL B O   1 
ATOM   1868  C CB  . VAL B  1 81  ? 29.058 36.292 -5.566  1.00 85.61  ? 108  VAL B CB  1 
ATOM   1869  C CG1 . VAL B  1 81  ? 30.396 35.565 -5.636  1.00 86.37  ? 108  VAL B CG1 1 
ATOM   1870  C CG2 . VAL B  1 81  ? 28.527 36.276 -4.153  1.00 85.90  ? 108  VAL B CG2 1 
ATOM   1871  N N   . LYS B  1 82  ? 27.129 38.149 -7.229  1.00 83.80  ? 109  LYS B N   1 
ATOM   1872  C CA  . LYS B  1 82  ? 25.784 38.660 -7.454  1.00 83.59  ? 109  LYS B CA  1 
ATOM   1873  C C   . LYS B  1 82  ? 24.931 37.480 -7.916  1.00 83.65  ? 109  LYS B C   1 
ATOM   1874  O O   . LYS B  1 82  ? 25.429 36.585 -8.600  1.00 83.71  ? 109  LYS B O   1 
ATOM   1875  C CB  . LYS B  1 82  ? 25.809 39.740 -8.523  1.00 83.12  ? 109  LYS B CB  1 
ATOM   1876  N N   . LYS B  1 83  ? 23.657 37.465 -7.538  1.00 83.47  ? 110  LYS B N   1 
ATOM   1877  C CA  . LYS B  1 83  ? 22.767 36.380 -7.937  1.00 83.87  ? 110  LYS B CA  1 
ATOM   1878  C C   . LYS B  1 83  ? 21.857 36.801 -9.076  1.00 83.81  ? 110  LYS B C   1 
ATOM   1879  O O   . LYS B  1 83  ? 21.547 37.984 -9.229  1.00 83.39  ? 110  LYS B O   1 
ATOM   1880  C CB  . LYS B  1 83  ? 21.908 35.921 -6.753  1.00 84.49  ? 110  LYS B CB  1 
ATOM   1881  C CG  . LYS B  1 83  ? 21.443 37.049 -5.852  1.00 85.30  ? 110  LYS B CG  1 
ATOM   1882  C CD  . LYS B  1 83  ? 20.090 36.760 -5.211  1.00 85.93  ? 110  LYS B CD  1 
ATOM   1883  C CE  . LYS B  1 83  ? 20.063 35.465 -4.428  1.00 85.69  ? 110  LYS B CE  1 
ATOM   1884  N NZ  . LYS B  1 83  ? 18.731 35.275 -3.786  1.00 86.08  ? 110  LYS B NZ  1 
ATOM   1885  N N   . GLU B  1 84  ? 21.437 35.832 -9.883  1.00 83.80  ? 111  GLU B N   1 
ATOM   1886  C CA  . GLU B  1 84  ? 20.540 36.142 -10.980 1.00 84.14  ? 111  GLU B CA  1 
ATOM   1887  C C   . GLU B  1 84  ? 19.512 35.051 -11.264 1.00 83.48  ? 111  GLU B C   1 
ATOM   1888  O O   . GLU B  1 84  ? 19.595 33.946 -10.726 1.00 83.58  ? 111  GLU B O   1 
ATOM   1889  C CB  . GLU B  1 84  ? 21.327 36.472 -12.251 1.00 84.96  ? 111  GLU B CB  1 
ATOM   1890  C CG  . GLU B  1 84  ? 20.459 37.184 -13.275 1.00 86.53  ? 111  GLU B CG  1 
ATOM   1891  C CD  . GLU B  1 84  ? 19.318 37.970 -12.611 1.00 87.52  ? 111  GLU B CD  1 
ATOM   1892  O OE1 . GLU B  1 84  ? 19.599 38.834 -11.750 1.00 87.46  ? 111  GLU B OE1 1 
ATOM   1893  O OE2 . GLU B  1 84  ? 18.138 37.717 -12.943 1.00 87.97  ? 111  GLU B OE2 1 
ATOM   1894  N N   . PHE B  1 85  ? 18.541 35.387 -12.111 1.00 82.30  ? 112  PHE B N   1 
ATOM   1895  C CA  . PHE B  1 85  ? 17.460 34.487 -12.493 1.00 80.93  ? 112  PHE B CA  1 
ATOM   1896  C C   . PHE B  1 85  ? 17.794 33.622 -13.712 1.00 79.95  ? 112  PHE B C   1 
ATOM   1897  O O   . PHE B  1 85  ? 18.464 34.065 -14.641 1.00 79.55  ? 112  PHE B O   1 
ATOM   1898  C CB  . PHE B  1 85  ? 16.188 35.307 -12.762 1.00 80.57  ? 112  PHE B CB  1 
ATOM   1899  C CG  . PHE B  1 85  ? 14.983 34.472 -13.098 1.00 80.80  ? 112  PHE B CG  1 
ATOM   1900  C CD1 . PHE B  1 85  ? 14.879 33.829 -14.331 1.00 80.00  ? 112  PHE B CD1 1 
ATOM   1901  C CD2 . PHE B  1 85  ? 13.969 34.292 -12.158 1.00 81.25  ? 112  PHE B CD2 1 
ATOM   1902  C CE1 . PHE B  1 85  ? 13.791 33.018 -14.623 1.00 79.92  ? 112  PHE B CE1 1 
ATOM   1903  C CE2 . PHE B  1 85  ? 12.873 33.482 -12.436 1.00 80.86  ? 112  PHE B CE2 1 
ATOM   1904  C CZ  . PHE B  1 85  ? 12.785 32.842 -13.674 1.00 81.19  ? 112  PHE B CZ  1 
ATOM   1905  N N   . GLY B  1 86  ? 17.313 32.384 -13.689 1.00 79.30  ? 113  GLY B N   1 
ATOM   1906  C CA  . GLY B  1 86  ? 17.537 31.453 -14.780 1.00 78.55  ? 113  GLY B CA  1 
ATOM   1907  C C   . GLY B  1 86  ? 16.644 30.258 -14.529 1.00 78.33  ? 113  GLY B C   1 
ATOM   1908  O O   . GLY B  1 86  ? 16.828 29.548 -13.548 1.00 78.65  ? 113  GLY B O   1 
ATOM   1909  N N   . HIS B  1 87  ? 15.667 30.041 -15.402 1.00 78.18  ? 114  HIS B N   1 
ATOM   1910  C CA  . HIS B  1 87  ? 14.723 28.931 -15.253 1.00 78.34  ? 114  HIS B CA  1 
ATOM   1911  C C   . HIS B  1 87  ? 15.406 27.589 -14.958 1.00 76.22  ? 114  HIS B C   1 
ATOM   1912  O O   . HIS B  1 87  ? 14.848 26.719 -14.279 1.00 76.13  ? 114  HIS B O   1 
ATOM   1913  C CB  . HIS B  1 87  ? 13.872 28.790 -16.529 1.00 81.21  ? 114  HIS B CB  1 
ATOM   1914  C CG  . HIS B  1 87  ? 13.124 30.034 -16.909 1.00 83.78  ? 114  HIS B CG  1 
ATOM   1915  N ND1 . HIS B  1 87  ? 12.003 30.470 -16.233 1.00 84.69  ? 114  HIS B ND1 1 
ATOM   1916  C CD2 . HIS B  1 87  ? 13.345 30.942 -17.891 1.00 84.62  ? 114  HIS B CD2 1 
ATOM   1917  C CE1 . HIS B  1 87  ? 11.568 31.591 -16.781 1.00 85.40  ? 114  HIS B CE1 1 
ATOM   1918  N NE2 . HIS B  1 87  ? 12.365 31.900 -17.790 1.00 85.43  ? 114  HIS B NE2 1 
ATOM   1919  N N   . GLU B  1 88  ? 16.624 27.438 -15.460 1.00 73.17  ? 115  GLU B N   1 
ATOM   1920  C CA  . GLU B  1 88  ? 17.380 26.198 -15.312 1.00 70.51  ? 115  GLU B CA  1 
ATOM   1921  C C   . GLU B  1 88  ? 18.222 26.063 -14.048 1.00 67.69  ? 115  GLU B C   1 
ATOM   1922  O O   . GLU B  1 88  ? 18.781 24.993 -13.786 1.00 66.67  ? 115  GLU B O   1 
ATOM   1923  C CB  . GLU B  1 88  ? 18.299 26.058 -16.511 1.00 71.11  ? 115  GLU B CB  1 
ATOM   1924  C CG  . GLU B  1 88  ? 19.209 27.248 -16.629 1.00 71.71  ? 115  GLU B CG  1 
ATOM   1925  C CD  . GLU B  1 88  ? 20.182 27.097 -17.747 1.00 72.79  ? 115  GLU B CD  1 
ATOM   1926  O OE1 . GLU B  1 88  ? 20.530 25.937 -18.038 1.00 72.78  ? 115  GLU B OE1 1 
ATOM   1927  O OE2 . GLU B  1 88  ? 20.606 28.127 -18.321 1.00 73.28  ? 115  GLU B OE2 1 
ATOM   1928  N N   . PHE B  1 89  ? 18.322 27.145 -13.279 1.00 64.28  ? 116  PHE B N   1 
ATOM   1929  C CA  . PHE B  1 89  ? 19.137 27.152 -12.066 1.00 60.01  ? 116  PHE B CA  1 
ATOM   1930  C C   . PHE B  1 89  ? 18.433 26.994 -10.724 1.00 57.11  ? 116  PHE B C   1 
ATOM   1931  O O   . PHE B  1 89  ? 17.293 27.423 -10.517 1.00 56.87  ? 116  PHE B O   1 
ATOM   1932  C CB  . PHE B  1 89  ? 19.995 28.418 -12.026 1.00 59.43  ? 116  PHE B CB  1 
ATOM   1933  C CG  . PHE B  1 89  ? 20.990 28.505 -13.138 1.00 58.51  ? 116  PHE B CG  1 
ATOM   1934  C CD1 . PHE B  1 89  ? 21.713 27.376 -13.532 1.00 58.77  ? 116  PHE B CD1 1 
ATOM   1935  C CD2 . PHE B  1 89  ? 21.238 29.717 -13.770 1.00 57.38  ? 116  PHE B CD2 1 
ATOM   1936  C CE1 . PHE B  1 89  ? 22.670 27.458 -14.539 1.00 58.34  ? 116  PHE B CE1 1 
ATOM   1937  C CE2 . PHE B  1 89  ? 22.193 29.812 -14.777 1.00 57.17  ? 116  PHE B CE2 1 
ATOM   1938  C CZ  . PHE B  1 89  ? 22.912 28.681 -15.164 1.00 57.87  ? 116  PHE B CZ  1 
ATOM   1939  N N   . ASP B  1 90  ? 19.152 26.374 -9.802  1.00 53.56  ? 117  ASP B N   1 
ATOM   1940  C CA  . ASP B  1 90  ? 18.643 26.143 -8.467  1.00 49.83  ? 117  ASP B CA  1 
ATOM   1941  C C   . ASP B  1 90  ? 19.766 26.273 -7.454  1.00 46.43  ? 117  ASP B C   1 
ATOM   1942  O O   . ASP B  1 90  ? 20.623 25.402 -7.352  1.00 44.57  ? 117  ASP B O   1 
ATOM   1943  C CB  . ASP B  1 90  ? 17.984 24.770 -8.402  1.00 49.72  ? 117  ASP B CB  1 
ATOM   1944  C CG  . ASP B  1 90  ? 16.499 24.844 -8.643  1.00 49.34  ? 117  ASP B CG  1 
ATOM   1945  O OD1 . ASP B  1 90  ? 16.025 25.828 -9.260  1.00 48.24  ? 117  ASP B OD1 1 
ATOM   1946  O OD2 . ASP B  1 90  ? 15.802 23.913 -8.215  1.00 50.94  ? 117  ASP B OD2 1 
ATOM   1947  N N   . LEU B  1 91  ? 19.740 27.392 -6.729  1.00 43.46  ? 118  LEU B N   1 
ATOM   1948  C CA  . LEU B  1 91  ? 20.726 27.737 -5.705  1.00 39.68  ? 118  LEU B CA  1 
ATOM   1949  C C   . LEU B  1 91  ? 20.495 27.052 -4.356  1.00 39.65  ? 118  LEU B C   1 
ATOM   1950  O O   . LEU B  1 91  ? 19.430 27.174 -3.763  1.00 40.92  ? 118  LEU B O   1 
ATOM   1951  C CB  . LEU B  1 91  ? 20.732 29.252 -5.495  1.00 34.60  ? 118  LEU B CB  1 
ATOM   1952  C CG  . LEU B  1 91  ? 21.657 29.722 -4.383  1.00 31.12  ? 118  LEU B CG  1 
ATOM   1953  C CD1 . LEU B  1 91  ? 23.065 29.266 -4.695  1.00 30.93  ? 118  LEU B CD1 1 
ATOM   1954  C CD2 . LEU B  1 91  ? 21.597 31.223 -4.252  1.00 29.01  ? 118  LEU B CD2 1 
ATOM   1955  N N   . TYR B  1 92  ? 21.502 26.335 -3.880  1.00 38.96  ? 119  TYR B N   1 
ATOM   1956  C CA  . TYR B  1 92  ? 21.431 25.648 -2.599  1.00 38.99  ? 119  TYR B CA  1 
ATOM   1957  C C   . TYR B  1 92  ? 22.540 26.169 -1.685  1.00 37.52  ? 119  TYR B C   1 
ATOM   1958  O O   . TYR B  1 92  ? 23.716 25.854 -1.877  1.00 38.16  ? 119  TYR B O   1 
ATOM   1959  C CB  . TYR B  1 92  ? 21.609 24.145 -2.786  1.00 41.56  ? 119  TYR B CB  1 
ATOM   1960  C CG  . TYR B  1 92  ? 20.523 23.474 -3.590  1.00 45.05  ? 119  TYR B CG  1 
ATOM   1961  C CD1 . TYR B  1 92  ? 20.433 23.650 -4.969  1.00 46.35  ? 119  TYR B CD1 1 
ATOM   1962  C CD2 . TYR B  1 92  ? 19.607 22.620 -2.977  1.00 46.39  ? 119  TYR B CD2 1 
ATOM   1963  C CE1 . TYR B  1 92  ? 19.460 22.985 -5.722  1.00 46.80  ? 119  TYR B CE1 1 
ATOM   1964  C CE2 . TYR B  1 92  ? 18.627 21.950 -3.721  1.00 46.60  ? 119  TYR B CE2 1 
ATOM   1965  C CZ  . TYR B  1 92  ? 18.561 22.135 -5.089  1.00 46.83  ? 119  TYR B CZ  1 
ATOM   1966  O OH  . TYR B  1 92  ? 17.601 21.471 -5.823  1.00 47.81  ? 119  TYR B OH  1 
ATOM   1967  N N   . GLU B  1 93  ? 22.169 26.965 -0.694  1.00 34.42  ? 120  GLU B N   1 
ATOM   1968  C CA  . GLU B  1 93  ? 23.154 27.511 0.219   1.00 32.12  ? 120  GLU B CA  1 
ATOM   1969  C C   . GLU B  1 93  ? 23.280 26.685 1.483   1.00 31.15  ? 120  GLU B C   1 
ATOM   1970  O O   . GLU B  1 93  ? 22.295 26.339 2.116   1.00 29.72  ? 120  GLU B O   1 
ATOM   1971  C CB  . GLU B  1 93  ? 22.795 28.943 0.572   1.00 31.69  ? 120  GLU B CB  1 
ATOM   1972  C CG  . GLU B  1 93  ? 22.761 29.858 -0.630  1.00 31.93  ? 120  GLU B CG  1 
ATOM   1973  C CD  . GLU B  1 93  ? 22.349 31.263 -0.255  1.00 33.25  ? 120  GLU B CD  1 
ATOM   1974  O OE1 . GLU B  1 93  ? 21.213 31.439 0.239   1.00 33.63  ? 120  GLU B OE1 1 
ATOM   1975  O OE2 . GLU B  1 93  ? 23.159 32.193 -0.443  1.00 32.46  ? 120  GLU B OE2 1 
ATOM   1976  N N   . ASN B  1 94  ? 24.519 26.373 1.837   1.00 31.48  ? 121  ASN B N   1 
ATOM   1977  C CA  . ASN B  1 94  ? 24.822 25.594 3.022   1.00 30.16  ? 121  ASN B CA  1 
ATOM   1978  C C   . ASN B  1 94  ? 24.414 26.414 4.238   1.00 29.81  ? 121  ASN B C   1 
ATOM   1979  O O   . ASN B  1 94  ? 24.869 27.548 4.421   1.00 27.26  ? 121  ASN B O   1 
ATOM   1980  C CB  . ASN B  1 94  ? 26.313 25.294 3.065   1.00 29.98  ? 121  ASN B CB  1 
ATOM   1981  C CG  . ASN B  1 94  ? 26.653 24.227 4.071   1.00 31.46  ? 121  ASN B CG  1 
ATOM   1982  O OD1 . ASN B  1 94  ? 26.212 24.281 5.222   1.00 32.09  ? 121  ASN B OD1 1 
ATOM   1983  N ND2 . ASN B  1 94  ? 27.449 23.251 3.651   1.00 31.01  ? 121  ASN B ND2 1 
ATOM   1984  N N   . LYS B  1 95  ? 23.552 25.838 5.071   1.00 30.52  ? 122  LYS B N   1 
ATOM   1985  C CA  . LYS B  1 95  ? 23.064 26.550 6.246   1.00 30.10  ? 122  LYS B CA  1 
ATOM   1986  C C   . LYS B  1 95  ? 24.162 26.912 7.204   1.00 30.08  ? 122  LYS B C   1 
ATOM   1987  O O   . LYS B  1 95  ? 24.046 27.909 7.914   1.00 30.87  ? 122  LYS B O   1 
ATOM   1988  C CB  . LYS B  1 95  ? 21.980 25.749 6.970   1.00 28.02  ? 122  LYS B CB  1 
ATOM   1989  C CG  . LYS B  1 95  ? 20.766 25.494 6.109   1.00 30.61  ? 122  LYS B CG  1 
ATOM   1990  C CD  . LYS B  1 95  ? 19.490 25.406 6.907   1.00 32.11  ? 122  LYS B CD  1 
ATOM   1991  C CE  . LYS B  1 95  ? 19.474 24.197 7.808   1.00 35.60  ? 122  LYS B CE  1 
ATOM   1992  N NZ  . LYS B  1 95  ? 18.175 24.040 8.531   1.00 38.08  ? 122  LYS B NZ  1 
ATOM   1993  N N   . ASP B  1 96  ? 25.227 26.112 7.212   1.00 30.08  ? 123  ASP B N   1 
ATOM   1994  C CA  . ASP B  1 96  ? 26.373 26.352 8.094   1.00 31.30  ? 123  ASP B CA  1 
ATOM   1995  C C   . ASP B  1 96  ? 26.987 27.731 7.901   1.00 29.84  ? 123  ASP B C   1 
ATOM   1996  O O   . ASP B  1 96  ? 27.636 28.248 8.801   1.00 30.79  ? 123  ASP B O   1 
ATOM   1997  C CB  . ASP B  1 96  ? 27.482 25.318 7.862   1.00 33.85  ? 123  ASP B CB  1 
ATOM   1998  C CG  . ASP B  1 96  ? 27.164 23.952 8.467   1.00 38.86  ? 123  ASP B CG  1 
ATOM   1999  O OD1 . ASP B  1 96  ? 26.121 23.798 9.166   1.00 40.46  ? 123  ASP B OD1 1 
ATOM   2000  O OD2 . ASP B  1 96  ? 27.976 23.021 8.241   1.00 41.39  ? 123  ASP B OD2 1 
ATOM   2001  N N   . TYR B  1 97  ? 26.774 28.325 6.730   1.00 27.93  ? 124  TYR B N   1 
ATOM   2002  C CA  . TYR B  1 97  ? 27.351 29.615 6.421   1.00 25.17  ? 124  TYR B CA  1 
ATOM   2003  C C   . TYR B  1 97  ? 26.348 30.720 6.227   1.00 24.84  ? 124  TYR B C   1 
ATOM   2004  O O   . TYR B  1 97  ? 26.650 31.707 5.571   1.00 25.91  ? 124  TYR B O   1 
ATOM   2005  C CB  . TYR B  1 97  ? 28.223 29.484 5.190   1.00 24.72  ? 124  TYR B CB  1 
ATOM   2006  C CG  . TYR B  1 97  ? 29.273 28.430 5.370   1.00 26.77  ? 124  TYR B CG  1 
ATOM   2007  C CD1 . TYR B  1 97  ? 30.467 28.709 6.040   1.00 28.30  ? 124  TYR B CD1 1 
ATOM   2008  C CD2 . TYR B  1 97  ? 29.036 27.120 4.958   1.00 27.49  ? 124  TYR B CD2 1 
ATOM   2009  C CE1 . TYR B  1 97  ? 31.398 27.695 6.305   1.00 29.88  ? 124  TYR B CE1 1 
ATOM   2010  C CE2 . TYR B  1 97  ? 29.944 26.105 5.213   1.00 29.42  ? 124  TYR B CE2 1 
ATOM   2011  C CZ  . TYR B  1 97  ? 31.121 26.392 5.892   1.00 31.27  ? 124  TYR B CZ  1 
ATOM   2012  O OH  . TYR B  1 97  ? 31.984 25.359 6.193   1.00 32.83  ? 124  TYR B OH  1 
ATOM   2013  N N   . ILE B  1 98  ? 25.153 30.546 6.783   1.00 22.98  ? 125  ILE B N   1 
ATOM   2014  C CA  . ILE B  1 98  ? 24.095 31.557 6.726   1.00 20.75  ? 125  ILE B CA  1 
ATOM   2015  C C   . ILE B  1 98  ? 23.869 31.895 8.197   1.00 20.63  ? 125  ILE B C   1 
ATOM   2016  O O   . ILE B  1 98  ? 23.162 31.161 8.905   1.00 17.70  ? 125  ILE B O   1 
ATOM   2017  C CB  . ILE B  1 98  ? 22.791 30.988 6.145   1.00 20.13  ? 125  ILE B CB  1 
ATOM   2018  C CG1 . ILE B  1 98  ? 23.017 30.481 4.725   1.00 19.86  ? 125  ILE B CG1 1 
ATOM   2019  C CG2 . ILE B  1 98  ? 21.723 32.043 6.147   1.00 19.22  ? 125  ILE B CG2 1 
ATOM   2020  C CD1 . ILE B  1 98  ? 21.762 29.944 4.075   1.00 20.68  ? 125  ILE B CD1 1 
ATOM   2021  N N   . ARG B  1 99  ? 24.489 32.989 8.648   1.00 21.42  ? 126  ARG B N   1 
ATOM   2022  C CA  . ARG B  1 99  ? 24.424 33.439 10.046  1.00 22.74  ? 126  ARG B CA  1 
ATOM   2023  C C   . ARG B  1 99  ? 23.096 33.103 10.668  1.00 21.85  ? 126  ARG B C   1 
ATOM   2024  O O   . ARG B  1 99  ? 22.082 33.566 10.192  1.00 23.20  ? 126  ARG B O   1 
ATOM   2025  C CB  . ARG B  1 99  ? 24.688 34.947 10.133  1.00 24.77  ? 126  ARG B CB  1 
ATOM   2026  C CG  . ARG B  1 99  ? 24.623 35.523 11.544  1.00 28.61  ? 126  ARG B CG  1 
ATOM   2027  C CD  . ARG B  1 99  ? 25.087 36.974 11.568  1.00 32.68  ? 126  ARG B CD  1 
ATOM   2028  N NE  . ARG B  1 99  ? 24.413 37.801 10.567  1.00 36.72  ? 126  ARG B NE  1 
ATOM   2029  C CZ  . ARG B  1 99  ? 24.484 39.132 10.521  1.00 40.61  ? 126  ARG B CZ  1 
ATOM   2030  N NH1 . ARG B  1 99  ? 25.201 39.787 11.423  1.00 40.99  ? 126  ARG B NH1 1 
ATOM   2031  N NH2 . ARG B  1 99  ? 23.835 39.818 9.581   1.00 41.41  ? 126  ARG B NH2 1 
ATOM   2032  N N   . ASN B  1 100 ? 23.102 32.301 11.727  1.00 23.01  ? 127  ASN B N   1 
ATOM   2033  C CA  . ASN B  1 100 ? 21.864 31.893 12.358  1.00 25.95  ? 127  ASN B CA  1 
ATOM   2034  C C   . ASN B  1 100 ? 21.554 32.572 13.663  1.00 29.80  ? 127  ASN B C   1 
ATOM   2035  O O   . ASN B  1 100 ? 20.770 32.041 14.458  1.00 31.68  ? 127  ASN B O   1 
ATOM   2036  C CB  . ASN B  1 100 ? 21.825 30.379 12.564  1.00 24.88  ? 127  ASN B CB  1 
ATOM   2037  C CG  . ASN B  1 100 ? 22.866 29.902 13.526  1.00 23.41  ? 127  ASN B CG  1 
ATOM   2038  O OD1 . ASN B  1 100 ? 23.574 30.695 14.131  1.00 23.33  ? 127  ASN B OD1 1 
ATOM   2039  N ND2 . ASN B  1 100 ? 22.967 28.593 13.678  1.00 24.81  ? 127  ASN B ND2 1 
ATOM   2040  N N   . CYS B  1 101 ? 22.181 33.727 13.902  1.00 34.04  ? 128  CYS B N   1 
ATOM   2041  C CA  . CYS B  1 101 ? 21.904 34.524 15.106  1.00 38.21  ? 128  CYS B CA  1 
ATOM   2042  C C   . CYS B  1 101 ? 21.661 35.937 14.589  1.00 39.72  ? 128  CYS B C   1 
ATOM   2043  O O   . CYS B  1 101 ? 22.099 36.280 13.477  1.00 37.46  ? 128  CYS B O   1 
ATOM   2044  C CB  . CYS B  1 101 ? 23.062 34.505 16.115  1.00 39.81  ? 128  CYS B CB  1 
ATOM   2045  S SG  . CYS B  1 101 ? 24.702 34.949 15.470  1.00 46.87  ? 128  CYS B SG  1 
ATOM   2046  N N   . ILE B  1 102 ? 20.948 36.745 15.370  1.00 41.45  ? 129  ILE B N   1 
ATOM   2047  C CA  . ILE B  1 102 ? 20.631 38.100 14.940  1.00 44.21  ? 129  ILE B CA  1 
ATOM   2048  C C   . ILE B  1 102 ? 21.319 39.176 15.743  1.00 46.79  ? 129  ILE B C   1 
ATOM   2049  O O   . ILE B  1 102 ? 21.657 38.981 16.909  1.00 49.01  ? 129  ILE B O   1 
ATOM   2050  C CB  . ILE B  1 102 ? 19.116 38.390 15.019  1.00 42.82  ? 129  ILE B CB  1 
ATOM   2051  C CG1 . ILE B  1 102 ? 18.628 38.171 16.456  1.00 43.51  ? 129  ILE B CG1 1 
ATOM   2052  C CG2 . ILE B  1 102 ? 18.360 37.500 14.051  1.00 43.44  ? 129  ILE B CG2 1 
ATOM   2053  C CD1 . ILE B  1 102 ? 17.234 38.691 16.744  1.00 40.87  ? 129  ILE B CD1 1 
ATOM   2054  N N   . ILE B  1 103 ? 21.516 40.320 15.100  1.00 49.77  ? 130  ILE B N   1 
ATOM   2055  C CA  . ILE B  1 103 ? 22.122 41.479 15.743  1.00 51.87  ? 130  ILE B CA  1 
ATOM   2056  C C   . ILE B  1 103 ? 20.996 42.490 15.936  1.00 52.72  ? 130  ILE B C   1 
ATOM   2057  O O   . ILE B  1 103 ? 20.432 43.010 14.963  1.00 53.22  ? 130  ILE B O   1 
ATOM   2058  C CB  . ILE B  1 103 ? 23.190 42.151 14.864  1.00 52.17  ? 130  ILE B CB  1 
ATOM   2059  C CG1 . ILE B  1 103 ? 24.155 41.110 14.301  1.00 53.89  ? 130  ILE B CG1 1 
ATOM   2060  C CG2 . ILE B  1 103 ? 23.962 43.154 15.694  1.00 53.02  ? 130  ILE B CG2 1 
ATOM   2061  C CD1 . ILE B  1 103 ? 25.139 41.682 13.288  1.00 52.86  ? 130  ILE B CD1 1 
ATOM   2062  N N   . GLY B  1 104 ? 20.655 42.755 17.188  1.00 51.73  ? 131  GLY B N   1 
ATOM   2063  C CA  . GLY B  1 104 ? 19.606 43.714 17.444  1.00 52.40  ? 131  GLY B CA  1 
ATOM   2064  C C   . GLY B  1 104 ? 18.244 43.214 17.036  1.00 52.31  ? 131  GLY B C   1 
ATOM   2065  O O   . GLY B  1 104 ? 17.831 42.141 17.461  1.00 53.20  ? 131  GLY B O   1 
ATOM   2066  N N   . LYS B  1 105 ? 17.547 43.989 16.208  1.00 52.56  ? 132  LYS B N   1 
ATOM   2067  C CA  . LYS B  1 105 ? 16.196 43.637 15.756  1.00 51.94  ? 132  LYS B CA  1 
ATOM   2068  C C   . LYS B  1 105 ? 16.192 42.499 14.734  1.00 51.55  ? 132  LYS B C   1 
ATOM   2069  O O   . LYS B  1 105 ? 15.166 41.845 14.514  1.00 50.47  ? 132  LYS B O   1 
ATOM   2070  C CB  . LYS B  1 105 ? 15.501 44.878 15.169  1.00 51.02  ? 132  LYS B CB  1 
ATOM   2071  N N   . GLY B  1 106 ? 17.342 42.273 14.108  1.00 50.96  ? 133  GLY B N   1 
ATOM   2072  C CA  . GLY B  1 106 ? 17.439 41.210 13.128  1.00 50.50  ? 133  GLY B CA  1 
ATOM   2073  C C   . GLY B  1 106 ? 16.872 41.591 11.777  1.00 49.16  ? 133  GLY B C   1 
ATOM   2074  O O   . GLY B  1 106 ? 16.319 40.748 11.061  1.00 48.85  ? 133  GLY B O   1 
ATOM   2075  N N   . ARG B  1 107 ? 17.038 42.867 11.432  1.00 48.21  ? 134  ARG B N   1 
ATOM   2076  C CA  . ARG B  1 107 ? 16.554 43.423 10.172  1.00 47.33  ? 134  ARG B CA  1 
ATOM   2077  C C   . ARG B  1 107 ? 17.074 42.681 8.940   1.00 46.02  ? 134  ARG B C   1 
ATOM   2078  O O   . ARG B  1 107 ? 16.451 42.701 7.882   1.00 45.45  ? 134  ARG B O   1 
ATOM   2079  C CB  . ARG B  1 107 ? 16.935 44.899 10.087  1.00 47.28  ? 134  ARG B CB  1 
ATOM   2080  N N   . SER B  1 108 ? 18.212 42.018 9.077   1.00 44.77  ? 135  SER B N   1 
ATOM   2081  C CA  . SER B  1 108 ? 18.784 41.307 7.944   1.00 44.08  ? 135  SER B CA  1 
ATOM   2082  C C   . SER B  1 108 ? 18.834 39.786 8.123   1.00 42.05  ? 135  SER B C   1 
ATOM   2083  O O   . SER B  1 108 ? 19.474 39.078 7.329   1.00 42.41  ? 135  SER B O   1 
ATOM   2084  C CB  . SER B  1 108 ? 20.196 41.821 7.669   1.00 44.86  ? 135  SER B CB  1 
ATOM   2085  O OG  . SER B  1 108 ? 21.101 41.318 8.639   1.00 47.23  ? 135  SER B OG  1 
ATOM   2086  N N   . TYR B  1 109 ? 18.173 39.278 9.157   1.00 37.50  ? 136  TYR B N   1 
ATOM   2087  C CA  . TYR B  1 109 ? 18.167 37.841 9.372   1.00 34.18  ? 136  TYR B CA  1 
ATOM   2088  C C   . TYR B  1 109 ? 17.709 37.101 8.119   1.00 30.97  ? 136  TYR B C   1 
ATOM   2089  O O   . TYR B  1 109 ? 16.676 37.414 7.550   1.00 31.60  ? 136  TYR B O   1 
ATOM   2090  C CB  . TYR B  1 109 ? 17.244 37.478 10.527  1.00 33.87  ? 136  TYR B CB  1 
ATOM   2091  C CG  . TYR B  1 109 ? 17.082 35.995 10.703  1.00 32.59  ? 136  TYR B CG  1 
ATOM   2092  C CD1 . TYR B  1 109 ? 18.170 35.194 11.038  1.00 32.87  ? 136  TYR B CD1 1 
ATOM   2093  C CD2 . TYR B  1 109 ? 15.848 35.391 10.533  1.00 32.55  ? 136  TYR B CD2 1 
ATOM   2094  C CE1 . TYR B  1 109 ? 18.033 33.820 11.202  1.00 33.51  ? 136  TYR B CE1 1 
ATOM   2095  C CE2 . TYR B  1 109 ? 15.695 34.023 10.693  1.00 35.18  ? 136  TYR B CE2 1 
ATOM   2096  C CZ  . TYR B  1 109 ? 16.792 33.238 11.028  1.00 34.82  ? 136  TYR B CZ  1 
ATOM   2097  O OH  . TYR B  1 109 ? 16.641 31.872 11.174  1.00 35.49  ? 136  TYR B OH  1 
ATOM   2098  N N   . LYS B  1 110 ? 18.482 36.119 7.690   1.00 28.73  ? 137  LYS B N   1 
ATOM   2099  C CA  . LYS B  1 110 ? 18.124 35.343 6.520   1.00 26.49  ? 137  LYS B CA  1 
ATOM   2100  C C   . LYS B  1 110 ? 18.279 33.869 6.820   1.00 24.78  ? 137  LYS B C   1 
ATOM   2101  O O   . LYS B  1 110 ? 18.581 33.079 5.940   1.00 23.74  ? 137  LYS B O   1 
ATOM   2102  C CB  . LYS B  1 110 ? 19.005 35.729 5.340   1.00 27.37  ? 137  LYS B CB  1 
ATOM   2103  C CG  . LYS B  1 110 ? 18.975 37.201 5.045   1.00 29.83  ? 137  LYS B CG  1 
ATOM   2104  C CD  . LYS B  1 110 ? 19.630 37.513 3.720   1.00 32.65  ? 137  LYS B CD  1 
ATOM   2105  C CE  . LYS B  1 110 ? 19.639 39.017 3.465   1.00 36.15  ? 137  LYS B CE  1 
ATOM   2106  N NZ  . LYS B  1 110 ? 18.273 39.621 3.588   1.00 39.12  ? 137  LYS B NZ  1 
ATOM   2107  N N   . GLY B  1 111 ? 18.077 33.509 8.080   1.00 24.25  ? 138  GLY B N   1 
ATOM   2108  C CA  . GLY B  1 111 ? 18.181 32.124 8.479   1.00 22.92  ? 138  GLY B CA  1 
ATOM   2109  C C   . GLY B  1 111 ? 16.962 31.390 7.984   1.00 22.55  ? 138  GLY B C   1 
ATOM   2110  O O   . GLY B  1 111 ? 16.155 31.957 7.263   1.00 23.09  ? 138  GLY B O   1 
ATOM   2111  N N   . THR B  1 112 ? 16.803 30.138 8.379   1.00 22.68  ? 139  THR B N   1 
ATOM   2112  C CA  . THR B  1 112 ? 15.665 29.380 7.900   1.00 22.86  ? 139  THR B CA  1 
ATOM   2113  C C   . THR B  1 112 ? 14.724 28.917 8.987   1.00 22.83  ? 139  THR B C   1 
ATOM   2114  O O   . THR B  1 112 ? 13.938 27.984 8.767   1.00 22.00  ? 139  THR B O   1 
ATOM   2115  C CB  . THR B  1 112 ? 16.115 28.169 7.116   1.00 22.33  ? 139  THR B CB  1 
ATOM   2116  O OG1 . THR B  1 112 ? 16.837 27.295 7.988   1.00 26.46  ? 139  THR B OG1 1 
ATOM   2117  C CG2 . THR B  1 112 ? 17.008 28.591 5.984   1.00 21.64  ? 139  THR B CG2 1 
ATOM   2118  N N   . VAL B  1 113 ? 14.792 29.552 10.155  1.00 22.16  ? 140  VAL B N   1 
ATOM   2119  C CA  . VAL B  1 113 ? 13.875 29.174 11.223  1.00 23.46  ? 140  VAL B CA  1 
ATOM   2120  C C   . VAL B  1 113 ? 12.443 29.509 10.770  1.00 23.33  ? 140  VAL B C   1 
ATOM   2121  O O   . VAL B  1 113 ? 12.162 30.620 10.330  1.00 23.61  ? 140  VAL B O   1 
ATOM   2122  C CB  . VAL B  1 113 ? 14.175 29.921 12.530  1.00 23.46  ? 140  VAL B CB  1 
ATOM   2123  C CG1 . VAL B  1 113 ? 13.006 29.758 13.487  1.00 22.84  ? 140  VAL B CG1 1 
ATOM   2124  C CG2 . VAL B  1 113 ? 15.441 29.377 13.167  1.00 23.62  ? 140  VAL B CG2 1 
ATOM   2125  N N   . SER B  1 114 ? 11.540 28.546 10.866  1.00 22.99  ? 141  SER B N   1 
ATOM   2126  C CA  . SER B  1 114 ? 10.174 28.784 10.450  1.00 22.26  ? 141  SER B CA  1 
ATOM   2127  C C   . SER B  1 114 ? 9.163  28.351 11.504  1.00 22.75  ? 141  SER B C   1 
ATOM   2128  O O   . SER B  1 114 ? 8.085  27.857 11.173  1.00 22.08  ? 141  SER B O   1 
ATOM   2129  C CB  . SER B  1 114 ? 9.916  28.040 9.156   1.00 22.57  ? 141  SER B CB  1 
ATOM   2130  O OG  . SER B  1 114 ? 10.174 26.661 9.322   1.00 27.34  ? 141  SER B OG  1 
ATOM   2131  N N   . ILE B  1 115 ? 9.520  28.530 12.773  1.00 23.55  ? 142  ILE B N   1 
ATOM   2132  C CA  . ILE B  1 115 ? 8.650  28.160 13.887  1.00 25.81  ? 142  ILE B CA  1 
ATOM   2133  C C   . ILE B  1 115 ? 8.571  29.325 14.872  1.00 28.39  ? 142  ILE B C   1 
ATOM   2134  O O   . ILE B  1 115 ? 9.575  29.990 15.126  1.00 29.14  ? 142  ILE B O   1 
ATOM   2135  C CB  . ILE B  1 115 ? 9.170  26.890 14.653  1.00 23.11  ? 142  ILE B CB  1 
ATOM   2136  C CG1 . ILE B  1 115 ? 8.606  25.606 14.032  1.00 21.70  ? 142  ILE B CG1 1 
ATOM   2137  C CG2 . ILE B  1 115 ? 8.724  26.925 16.103  1.00 23.46  ? 142  ILE B CG2 1 
ATOM   2138  C CD1 . ILE B  1 115 ? 9.211  25.224 12.731  1.00 19.18  ? 142  ILE B CD1 1 
ATOM   2139  N N   . THR B  1 116 ? 7.378  29.565 15.422  1.00 30.49  ? 143  THR B N   1 
ATOM   2140  C CA  . THR B  1 116 ? 7.177  30.644 16.389  1.00 31.84  ? 143  THR B CA  1 
ATOM   2141  C C   . THR B  1 116 ? 7.644  30.219 17.785  1.00 33.47  ? 143  THR B C   1 
ATOM   2142  O O   . THR B  1 116 ? 7.943  29.046 18.021  1.00 32.99  ? 143  THR B O   1 
ATOM   2143  C CB  . THR B  1 116 ? 5.694  31.053 16.478  1.00 30.43  ? 143  THR B CB  1 
ATOM   2144  O OG1 . THR B  1 116 ? 4.908  29.913 16.833  1.00 29.92  ? 143  THR B OG1 1 
ATOM   2145  C CG2 . THR B  1 116 ? 5.207  31.581 15.154  1.00 29.47  ? 143  THR B CG2 1 
ATOM   2146  N N   . LYS B  1 117 ? 7.683  31.180 18.707  1.00 35.60  ? 144  LYS B N   1 
ATOM   2147  C CA  . LYS B  1 117 ? 8.115  30.939 20.083  1.00 37.14  ? 144  LYS B CA  1 
ATOM   2148  C C   . LYS B  1 117 ? 7.162  30.009 20.828  1.00 36.98  ? 144  LYS B C   1 
ATOM   2149  O O   . LYS B  1 117 ? 7.454  29.534 21.922  1.00 38.24  ? 144  LYS B O   1 
ATOM   2150  C CB  . LYS B  1 117 ? 8.238  32.260 20.832  1.00 38.47  ? 144  LYS B CB  1 
ATOM   2151  C CG  . LYS B  1 117 ? 8.836  32.128 22.218  1.00 42.93  ? 144  LYS B CG  1 
ATOM   2152  C CD  . LYS B  1 117 ? 8.876  33.490 22.891  1.00 47.18  ? 144  LYS B CD  1 
ATOM   2153  C CE  . LYS B  1 117 ? 9.315  33.404 24.346  1.00 49.25  ? 144  LYS B CE  1 
ATOM   2154  N NZ  . LYS B  1 117 ? 9.264  34.747 25.001  1.00 51.74  ? 144  LYS B NZ  1 
ATOM   2155  N N   . SER B  1 118 ? 6.007  29.771 20.234  1.00 35.85  ? 145  SER B N   1 
ATOM   2156  C CA  . SER B  1 118 ? 5.034  28.864 20.808  1.00 34.84  ? 145  SER B CA  1 
ATOM   2157  C C   . SER B  1 118 ? 5.086  27.543 20.060  1.00 34.41  ? 145  SER B C   1 
ATOM   2158  O O   . SER B  1 118 ? 4.266  26.653 20.305  1.00 33.73  ? 145  SER B O   1 
ATOM   2159  C CB  . SER B  1 118 ? 3.633  29.440 20.682  1.00 35.96  ? 145  SER B CB  1 
ATOM   2160  O OG  . SER B  1 118 ? 3.515  30.621 21.441  1.00 38.33  ? 145  SER B OG  1 
ATOM   2161  N N   . GLY B  1 119 ? 6.028  27.433 19.123  1.00 33.49  ? 146  GLY B N   1 
ATOM   2162  C CA  . GLY B  1 119 ? 6.167  26.206 18.356  1.00 32.08  ? 146  GLY B CA  1 
ATOM   2163  C C   . GLY B  1 119 ? 5.179  26.042 17.224  1.00 32.07  ? 146  GLY B C   1 
ATOM   2164  O O   . GLY B  1 119 ? 4.916  24.932 16.770  1.00 32.76  ? 146  GLY B O   1 
ATOM   2165  N N   . ILE B  1 120 ? 4.618  27.145 16.756  1.00 31.50  ? 147  ILE B N   1 
ATOM   2166  C CA  . ILE B  1 120 ? 3.668  27.068 15.662  1.00 30.13  ? 147  ILE B CA  1 
ATOM   2167  C C   . ILE B  1 120 ? 4.459  27.194 14.365  1.00 29.56  ? 147  ILE B C   1 
ATOM   2168  O O   . ILE B  1 120 ? 5.388  28.009 14.267  1.00 28.28  ? 147  ILE B O   1 
ATOM   2169  C CB  . ILE B  1 120 ? 2.643  28.217 15.710  1.00 30.64  ? 147  ILE B CB  1 
ATOM   2170  C CG1 . ILE B  1 120 ? 2.047  28.340 17.107  1.00 29.84  ? 147  ILE B CG1 1 
ATOM   2171  C CG2 . ILE B  1 120 ? 1.536  27.960 14.697  1.00 31.41  ? 147  ILE B CG2 1 
ATOM   2172  C CD1 . ILE B  1 120 ? 1.232  29.596 17.299  1.00 30.68  ? 147  ILE B CD1 1 
ATOM   2173  N N   . LYS B  1 121 ? 4.090  26.378 13.380  1.00 27.63  ? 148  LYS B N   1 
ATOM   2174  C CA  . LYS B  1 121 ? 4.726  26.394 12.070  1.00 25.29  ? 148  LYS B CA  1 
ATOM   2175  C C   . LYS B  1 121 ? 4.297  27.686 11.364  1.00 25.79  ? 148  LYS B C   1 
ATOM   2176  O O   . LYS B  1 121 ? 3.107  28.015 11.311  1.00 25.09  ? 148  LYS B O   1 
ATOM   2177  C CB  . LYS B  1 121 ? 4.257  25.183 11.267  1.00 23.08  ? 148  LYS B CB  1 
ATOM   2178  C CG  . LYS B  1 121 ? 4.939  25.022 9.945   1.00 23.86  ? 148  LYS B CG  1 
ATOM   2179  C CD  . LYS B  1 121 ? 4.364  23.856 9.157   1.00 26.06  ? 148  LYS B CD  1 
ATOM   2180  C CE  . LYS B  1 121 ? 5.189  23.605 7.895   1.00 25.45  ? 148  LYS B CE  1 
ATOM   2181  N NZ  . LYS B  1 121 ? 4.631  22.557 7.004   1.00 24.86  ? 148  LYS B NZ  1 
ATOM   2182  N N   . CYS B  1 122 ? 5.261  28.426 10.834  1.00 25.02  ? 149  CYS B N   1 
ATOM   2183  C CA  . CYS B  1 122 ? 4.950  29.661 10.144  1.00 25.23  ? 149  CYS B CA  1 
ATOM   2184  C C   . CYS B  1 122 ? 4.114  29.424 8.894   1.00 26.67  ? 149  CYS B C   1 
ATOM   2185  O O   . CYS B  1 122 ? 4.129  28.335 8.320   1.00 27.84  ? 149  CYS B O   1 
ATOM   2186  C CB  . CYS B  1 122 ? 6.227  30.371 9.732   1.00 25.18  ? 149  CYS B CB  1 
ATOM   2187  S SG  . CYS B  1 122 ? 7.205  31.103 11.081  1.00 27.95  ? 149  CYS B SG  1 
ATOM   2188  N N   . GLN B  1 123 ? 3.383  30.458 8.483   1.00 26.11  ? 150  GLN B N   1 
ATOM   2189  C CA  . GLN B  1 123 ? 2.558  30.421 7.283   1.00 22.68  ? 150  GLN B CA  1 
ATOM   2190  C C   . GLN B  1 123 ? 3.439  31.009 6.196   1.00 23.55  ? 150  GLN B C   1 
ATOM   2191  O O   . GLN B  1 123 ? 4.197  31.935 6.442   1.00 24.01  ? 150  GLN B O   1 
ATOM   2192  C CB  . GLN B  1 123 ? 1.318  31.302 7.442   1.00 21.75  ? 150  GLN B CB  1 
ATOM   2193  C CG  . GLN B  1 123 ? 0.598  31.580 6.110   1.00 22.28  ? 150  GLN B CG  1 
ATOM   2194  C CD  . GLN B  1 123 ? -0.467 32.689 6.183   1.00 20.81  ? 150  GLN B CD  1 
ATOM   2195  O OE1 . GLN B  1 123 ? -1.322 32.698 7.072   1.00 20.11  ? 150  GLN B OE1 1 
ATOM   2196  N NE2 . GLN B  1 123 ? -0.420 33.614 5.230   1.00 17.73  ? 150  GLN B NE2 1 
ATOM   2197  N N   . PRO B  1 124 ? 3.354  30.481 4.973   1.00 25.92  ? 151  PRO B N   1 
ATOM   2198  C CA  . PRO B  1 124 ? 4.170  30.997 3.870   1.00 23.79  ? 151  PRO B CA  1 
ATOM   2199  C C   . PRO B  1 124 ? 3.798  32.456 3.621   1.00 25.50  ? 151  PRO B C   1 
ATOM   2200  O O   . PRO B  1 124 ? 2.633  32.825 3.729   1.00 26.93  ? 151  PRO B O   1 
ATOM   2201  C CB  . PRO B  1 124 ? 3.764  30.109 2.706   1.00 22.55  ? 151  PRO B CB  1 
ATOM   2202  C CG  . PRO B  1 124 ? 3.322  28.861 3.359   1.00 21.99  ? 151  PRO B CG  1 
ATOM   2203  C CD  . PRO B  1 124 ? 2.528  29.352 4.520   1.00 24.38  ? 151  PRO B CD  1 
ATOM   2204  N N   . TRP B  1 125 ? 4.775  33.284 3.288   1.00 26.09  ? 152  TRP B N   1 
ATOM   2205  C CA  . TRP B  1 125 ? 4.502  34.689 3.046   1.00 26.40  ? 152  TRP B CA  1 
ATOM   2206  C C   . TRP B  1 125 ? 3.694  34.894 1.784   1.00 27.96  ? 152  TRP B C   1 
ATOM   2207  O O   . TRP B  1 125 ? 2.908  35.834 1.689   1.00 28.89  ? 152  TRP B O   1 
ATOM   2208  C CB  . TRP B  1 125 ? 5.803  35.476 2.931   1.00 24.73  ? 152  TRP B CB  1 
ATOM   2209  C CG  . TRP B  1 125 ? 6.622  35.464 4.170   1.00 26.02  ? 152  TRP B CG  1 
ATOM   2210  C CD1 . TRP B  1 125 ? 7.647  34.615 4.473   1.00 23.86  ? 152  TRP B CD1 1 
ATOM   2211  C CD2 . TRP B  1 125 ? 6.484  36.343 5.288   1.00 25.38  ? 152  TRP B CD2 1 
ATOM   2212  N NE1 . TRP B  1 125 ? 8.153  34.915 5.709   1.00 23.64  ? 152  TRP B NE1 1 
ATOM   2213  C CE2 . TRP B  1 125 ? 7.457  35.970 6.233   1.00 24.54  ? 152  TRP B CE2 1 
ATOM   2214  C CE3 . TRP B  1 125 ? 5.630  37.410 5.583   1.00 26.96  ? 152  TRP B CE3 1 
ATOM   2215  C CZ2 . TRP B  1 125 ? 7.603  36.628 7.455   1.00 27.12  ? 152  TRP B CZ2 1 
ATOM   2216  C CZ3 . TRP B  1 125 ? 5.775  38.069 6.804   1.00 27.13  ? 152  TRP B CZ3 1 
ATOM   2217  C CH2 . TRP B  1 125 ? 6.753  37.674 7.723   1.00 27.12  ? 152  TRP B CH2 1 
ATOM   2218  N N   . SER B  1 126 ? 3.891  34.017 0.807   1.00 29.67  ? 153  SER B N   1 
ATOM   2219  C CA  . SER B  1 126 ? 3.188  34.133 -0.465  1.00 31.16  ? 153  SER B CA  1 
ATOM   2220  C C   . SER B  1 126 ? 1.725  33.752 -0.317  1.00 32.74  ? 153  SER B C   1 
ATOM   2221  O O   . SER B  1 126 ? 0.906  34.071 -1.182  1.00 34.62  ? 153  SER B O   1 
ATOM   2222  C CB  . SER B  1 126 ? 3.799  33.207 -1.498  1.00 31.54  ? 153  SER B CB  1 
ATOM   2223  O OG  . SER B  1 126 ? 3.361  31.886 -1.253  1.00 32.32  ? 153  SER B OG  1 
ATOM   2224  N N   . SER B  1 127 ? 1.398  33.054 0.765   1.00 32.10  ? 154  SER B N   1 
ATOM   2225  C CA  . SER B  1 127 ? 0.026  32.632 0.997   1.00 30.14  ? 154  SER B CA  1 
ATOM   2226  C C   . SER B  1 127 ? -0.818 33.681 1.719   1.00 30.44  ? 154  SER B C   1 
ATOM   2227  O O   . SER B  1 127 ? -0.302 34.474 2.509   1.00 31.54  ? 154  SER B O   1 
ATOM   2228  C CB  . SER B  1 127 ? 0.014  31.341 1.801   1.00 29.33  ? 154  SER B CB  1 
ATOM   2229  O OG  . SER B  1 127 ? -1.318 30.971 2.112   1.00 28.64  ? 154  SER B OG  1 
ATOM   2230  N N   . MET B  1 128 ? -2.120 33.682 1.446   1.00 29.21  ? 155  MET B N   1 
ATOM   2231  C CA  . MET B  1 128 ? -3.031 34.619 2.089   1.00 28.96  ? 155  MET B CA  1 
ATOM   2232  C C   . MET B  1 128 ? -3.915 33.864 3.068   1.00 29.28  ? 155  MET B C   1 
ATOM   2233  O O   . MET B  1 128 ? -4.851 34.423 3.629   1.00 31.19  ? 155  MET B O   1 
ATOM   2234  C CB  . MET B  1 128 ? -3.912 35.330 1.060   1.00 28.68  ? 155  MET B CB  1 
ATOM   2235  C CG  . MET B  1 128 ? -3.199 36.345 0.203   1.00 30.24  ? 155  MET B CG  1 
ATOM   2236  S SD  . MET B  1 128 ? -2.538 37.718 1.135   1.00 35.35  ? 155  MET B SD  1 
ATOM   2237  C CE  . MET B  1 128 ? -0.833 37.724 0.536   1.00 32.18  ? 155  MET B CE  1 
ATOM   2238  N N   . ILE B  1 129 ? -3.632 32.583 3.258   1.00 27.97  ? 156  ILE B N   1 
ATOM   2239  C CA  . ILE B  1 129 ? -4.402 31.772 4.188   1.00 27.16  ? 156  ILE B CA  1 
ATOM   2240  C C   . ILE B  1 129 ? -3.434 31.010 5.085   1.00 26.96  ? 156  ILE B C   1 
ATOM   2241  O O   . ILE B  1 129 ? -2.359 30.594 4.658   1.00 26.10  ? 156  ILE B O   1 
ATOM   2242  C CB  . ILE B  1 129 ? -5.291 30.763 3.459   1.00 27.97  ? 156  ILE B CB  1 
ATOM   2243  C CG1 . ILE B  1 129 ? -4.425 29.849 2.601   1.00 31.52  ? 156  ILE B CG1 1 
ATOM   2244  C CG2 . ILE B  1 129 ? -6.283 31.481 2.572   1.00 27.42  ? 156  ILE B CG2 1 
ATOM   2245  C CD1 . ILE B  1 129 ? -5.210 28.884 1.747   1.00 35.39  ? 156  ILE B CD1 1 
ATOM   2246  N N   . PRO B  1 130 ? -3.815 30.804 6.341   1.00 25.85  ? 157  PRO B N   1 
ATOM   2247  C CA  . PRO B  1 130 ? -5.083 31.255 6.892   1.00 26.33  ? 157  PRO B CA  1 
ATOM   2248  C C   . PRO B  1 130 ? -5.145 32.753 7.151   1.00 27.52  ? 157  PRO B C   1 
ATOM   2249  O O   . PRO B  1 130 ? -6.192 33.268 7.512   1.00 29.08  ? 157  PRO B O   1 
ATOM   2250  C CB  . PRO B  1 130 ? -5.173 30.464 8.182   1.00 26.62  ? 157  PRO B CB  1 
ATOM   2251  C CG  . PRO B  1 130 ? -3.776 30.481 8.645   1.00 26.81  ? 157  PRO B CG  1 
ATOM   2252  C CD  . PRO B  1 130 ? -3.008 30.149 7.381   1.00 26.58  ? 157  PRO B CD  1 
ATOM   2253  N N   . HIS B  1 131 ? -4.036 33.458 6.978   1.00 28.20  ? 158  HIS B N   1 
ATOM   2254  C CA  . HIS B  1 131 ? -4.042 34.880 7.255   1.00 27.72  ? 158  HIS B CA  1 
ATOM   2255  C C   . HIS B  1 131 ? -3.746 35.731 6.049   1.00 28.38  ? 158  HIS B C   1 
ATOM   2256  O O   . HIS B  1 131 ? -2.724 35.559 5.379   1.00 27.84  ? 158  HIS B O   1 
ATOM   2257  C CB  . HIS B  1 131 ? -3.058 35.183 8.381   1.00 29.40  ? 158  HIS B CB  1 
ATOM   2258  C CG  . HIS B  1 131 ? -3.285 34.351 9.605   1.00 32.24  ? 158  HIS B CG  1 
ATOM   2259  N ND1 . HIS B  1 131 ? -4.405 34.481 10.397  1.00 33.66  ? 158  HIS B ND1 1 
ATOM   2260  C CD2 . HIS B  1 131 ? -2.581 33.317 10.121  1.00 33.82  ? 158  HIS B CD2 1 
ATOM   2261  C CE1 . HIS B  1 131 ? -4.386 33.561 11.346  1.00 33.70  ? 158  HIS B CE1 1 
ATOM   2262  N NE2 . HIS B  1 131 ? -3.290 32.840 11.200  1.00 34.73  ? 158  HIS B NE2 1 
ATOM   2263  N N   . GLU B  1 132 ? -4.675 36.639 5.770   1.00 29.25  ? 159  GLU B N   1 
ATOM   2264  C CA  . GLU B  1 132 ? -4.568 37.572 4.659   1.00 29.88  ? 159  GLU B CA  1 
ATOM   2265  C C   . GLU B  1 132 ? -3.634 38.697 5.122   1.00 28.37  ? 159  GLU B C   1 
ATOM   2266  O O   . GLU B  1 132 ? -3.730 39.150 6.261   1.00 27.33  ? 159  GLU B O   1 
ATOM   2267  C CB  . GLU B  1 132 ? -5.958 38.097 4.350   1.00 32.21  ? 159  GLU B CB  1 
ATOM   2268  C CG  . GLU B  1 132 ? -6.038 38.982 3.148   1.00 39.23  ? 159  GLU B CG  1 
ATOM   2269  C CD  . GLU B  1 132 ? -7.394 39.644 3.046   1.00 43.83  ? 159  GLU B CD  1 
ATOM   2270  O OE1 . GLU B  1 132 ? -7.973 39.960 4.119   1.00 47.87  ? 159  GLU B OE1 1 
ATOM   2271  O OE2 . GLU B  1 132 ? -7.878 39.856 1.910   1.00 46.07  ? 159  GLU B OE2 1 
ATOM   2272  N N   . HIS B  1 133 ? -2.725 39.145 4.268   1.00 26.67  ? 160  HIS B N   1 
ATOM   2273  C CA  . HIS B  1 133 ? -1.798 40.177 4.694   1.00 28.07  ? 160  HIS B CA  1 
ATOM   2274  C C   . HIS B  1 133 ? -1.201 40.887 3.503   1.00 29.26  ? 160  HIS B C   1 
ATOM   2275  O O   . HIS B  1 133 ? -1.307 40.421 2.384   1.00 29.52  ? 160  HIS B O   1 
ATOM   2276  C CB  . HIS B  1 133 ? -0.692 39.551 5.546   1.00 28.22  ? 160  HIS B CB  1 
ATOM   2277  C CG  . HIS B  1 133 ? 0.163  38.581 4.795   1.00 26.76  ? 160  HIS B CG  1 
ATOM   2278  N ND1 . HIS B  1 133 ? 1.284  38.966 4.091   1.00 26.03  ? 160  HIS B ND1 1 
ATOM   2279  C CD2 . HIS B  1 133 ? 0.024  37.253 4.587   1.00 26.81  ? 160  HIS B CD2 1 
ATOM   2280  C CE1 . HIS B  1 133 ? 1.796  37.915 3.479   1.00 26.90  ? 160  HIS B CE1 1 
ATOM   2281  N NE2 . HIS B  1 133 ? 1.050  36.864 3.762   1.00 27.19  ? 160  HIS B NE2 1 
ATOM   2282  N N   . SER B  1 134 ? -0.574 42.022 3.757   1.00 31.59  ? 161  SER B N   1 
ATOM   2283  C CA  . SER B  1 134 ? 0.019  42.829 2.706   1.00 34.19  ? 161  SER B CA  1 
ATOM   2284  C C   . SER B  1 134 ? 1.530  42.625 2.505   1.00 36.38  ? 161  SER B C   1 
ATOM   2285  O O   . SER B  1 134 ? 2.144  43.260 1.635   1.00 37.40  ? 161  SER B O   1 
ATOM   2286  C CB  . SER B  1 134 ? -0.279 44.293 3.018   1.00 34.22  ? 161  SER B CB  1 
ATOM   2287  O OG  . SER B  1 134 ? -0.170 44.530 4.417   1.00 32.61  ? 161  SER B OG  1 
ATOM   2288  N N   . PHE B  1 135 ? 2.129  41.741 3.298   1.00 37.11  ? 162  PHE B N   1 
ATOM   2289  C CA  . PHE B  1 135 ? 3.560  41.506 3.192   1.00 37.85  ? 162  PHE B CA  1 
ATOM   2290  C C   . PHE B  1 135 ? 3.925  40.668 1.975   1.00 38.83  ? 162  PHE B C   1 
ATOM   2291  O O   . PHE B  1 135 ? 3.808  39.449 1.975   1.00 39.58  ? 162  PHE B O   1 
ATOM   2292  C CB  . PHE B  1 135 ? 4.079  40.863 4.481   1.00 37.50  ? 162  PHE B CB  1 
ATOM   2293  C CG  . PHE B  1 135 ? 4.005  41.772 5.677   1.00 37.43  ? 162  PHE B CG  1 
ATOM   2294  C CD1 . PHE B  1 135 ? 2.830  41.885 6.411   1.00 36.92  ? 162  PHE B CD1 1 
ATOM   2295  C CD2 . PHE B  1 135 ? 5.096  42.554 6.041   1.00 36.57  ? 162  PHE B CD2 1 
ATOM   2296  C CE1 . PHE B  1 135 ? 2.743  42.769 7.490   1.00 37.62  ? 162  PHE B CE1 1 
ATOM   2297  C CE2 . PHE B  1 135 ? 5.020  43.441 7.117   1.00 36.64  ? 162  PHE B CE2 1 
ATOM   2298  C CZ  . PHE B  1 135 ? 3.843  43.549 7.842   1.00 37.20  ? 162  PHE B CZ  1 
ATOM   2299  N N   . LEU B  1 136 ? 4.365  41.339 0.926   1.00 39.34  ? 163  LEU B N   1 
ATOM   2300  C CA  . LEU B  1 136 ? 4.731  40.650 -0.287  1.00 40.99  ? 163  LEU B CA  1 
ATOM   2301  C C   . LEU B  1 136 ? 6.213  40.748 -0.541  1.00 42.74  ? 163  LEU B C   1 
ATOM   2302  O O   . LEU B  1 136 ? 6.869  41.708 -0.128  1.00 42.68  ? 163  LEU B O   1 
ATOM   2303  C CB  . LEU B  1 136 ? 3.987  41.249 -1.467  1.00 42.91  ? 163  LEU B CB  1 
ATOM   2304  C CG  . LEU B  1 136 ? 2.471  41.229 -1.334  1.00 44.46  ? 163  LEU B CG  1 
ATOM   2305  C CD1 . LEU B  1 136 ? 1.830  41.742 -2.621  1.00 43.38  ? 163  LEU B CD1 1 
ATOM   2306  C CD2 . LEU B  1 136 ? 2.024  39.804 -1.034  1.00 46.46  ? 163  LEU B CD2 1 
ATOM   2307  N N   . PRO B  1 137 ? 6.771  39.755 -1.237  1.00 44.08  ? 164  PRO B N   1 
ATOM   2308  C CA  . PRO B  1 137 ? 8.201  39.810 -1.510  1.00 45.94  ? 164  PRO B CA  1 
ATOM   2309  C C   . PRO B  1 137 ? 8.446  41.137 -2.214  1.00 48.41  ? 164  PRO B C   1 
ATOM   2310  O O   . PRO B  1 137 ? 9.321  41.910 -1.843  1.00 48.36  ? 164  PRO B O   1 
ATOM   2311  C CB  . PRO B  1 137 ? 8.418  38.600 -2.410  1.00 45.52  ? 164  PRO B CB  1 
ATOM   2312  C CG  . PRO B  1 137 ? 7.364  37.642 -1.936  1.00 44.62  ? 164  PRO B CG  1 
ATOM   2313  C CD  . PRO B  1 137 ? 6.171  38.542 -1.809  1.00 44.31  ? 164  PRO B CD  1 
ATOM   2314  N N   . SER B  1 138 ? 7.627  41.405 -3.220  1.00 51.84  ? 165  SER B N   1 
ATOM   2315  C CA  . SER B  1 138 ? 7.715  42.641 -3.983  1.00 54.22  ? 165  SER B CA  1 
ATOM   2316  C C   . SER B  1 138 ? 7.778  43.842 -3.040  1.00 54.12  ? 165  SER B C   1 
ATOM   2317  O O   . SER B  1 138 ? 8.745  44.604 -3.062  1.00 53.40  ? 165  SER B O   1 
ATOM   2318  C CB  . SER B  1 138 ? 6.484  42.763 -4.877  1.00 56.33  ? 165  SER B CB  1 
ATOM   2319  O OG  . SER B  1 138 ? 6.240  41.538 -5.550  1.00 60.41  ? 165  SER B OG  1 
ATOM   2320  N N   . SER B  1 139 ? 6.738  43.993 -2.218  1.00 54.32  ? 166  SER B N   1 
ATOM   2321  C CA  . SER B  1 139 ? 6.637  45.095 -1.256  1.00 54.77  ? 166  SER B CA  1 
ATOM   2322  C C   . SER B  1 139 ? 7.856  45.203 -0.354  1.00 54.78  ? 166  SER B C   1 
ATOM   2323  O O   . SER B  1 139 ? 8.164  46.288 0.141   1.00 54.14  ? 166  SER B O   1 
ATOM   2324  C CB  . SER B  1 139 ? 5.387  44.949 -0.365  1.00 54.96  ? 166  SER B CB  1 
ATOM   2325  O OG  . SER B  1 139 ? 4.171  45.061 -1.092  1.00 54.91  ? 166  SER B OG  1 
ATOM   2326  N N   . TYR B  1 140 ? 8.540  44.080 -0.133  1.00 55.14  ? 167  TYR B N   1 
ATOM   2327  C CA  . TYR B  1 140 ? 9.728  44.063 0.725   1.00 55.21  ? 167  TYR B CA  1 
ATOM   2328  C C   . TYR B  1 140 ? 10.922 43.356 0.112   1.00 55.88  ? 167  TYR B C   1 
ATOM   2329  O O   . TYR B  1 140 ? 11.634 42.622 0.804   1.00 55.50  ? 167  TYR B O   1 
ATOM   2330  C CB  . TYR B  1 140 ? 9.413  43.396 2.051   1.00 53.97  ? 167  TYR B CB  1 
ATOM   2331  C CG  . TYR B  1 140 ? 8.426  44.156 2.873   1.00 54.33  ? 167  TYR B CG  1 
ATOM   2332  C CD1 . TYR B  1 140 ? 8.789  45.323 3.516   1.00 54.88  ? 167  TYR B CD1 1 
ATOM   2333  C CD2 . TYR B  1 140 ? 7.125  43.705 3.017   1.00 55.51  ? 167  TYR B CD2 1 
ATOM   2334  C CE1 . TYR B  1 140 ? 7.883  46.021 4.291   1.00 55.86  ? 167  TYR B CE1 1 
ATOM   2335  C CE2 . TYR B  1 140 ? 6.214  44.393 3.781   1.00 56.58  ? 167  TYR B CE2 1 
ATOM   2336  C CZ  . TYR B  1 140 ? 6.598  45.551 4.420   1.00 56.91  ? 167  TYR B CZ  1 
ATOM   2337  O OH  . TYR B  1 140 ? 5.690  46.233 5.196   1.00 59.78  ? 167  TYR B OH  1 
ATOM   2338  N N   . ARG B  1 141 ? 11.140 43.566 -1.184  1.00 56.91  ? 168  ARG B N   1 
ATOM   2339  C CA  . ARG B  1 141 ? 12.274 42.947 -1.858  1.00 57.10  ? 168  ARG B CA  1 
ATOM   2340  C C   . ARG B  1 141 ? 13.526 43.219 -1.012  1.00 57.08  ? 168  ARG B C   1 
ATOM   2341  O O   . ARG B  1 141 ? 13.658 44.273 -0.371  1.00 57.59  ? 168  ARG B O   1 
ATOM   2342  C CB  . ARG B  1 141 ? 12.433 43.528 -3.269  1.00 56.90  ? 168  ARG B CB  1 
ATOM   2343  N N   . GLY B  1 142 ? 14.441 42.262 -1.004  1.00 55.39  ? 169  GLY B N   1 
ATOM   2344  C CA  . GLY B  1 142 ? 15.647 42.413 -0.216  1.00 53.30  ? 169  GLY B CA  1 
ATOM   2345  C C   . GLY B  1 142 ? 15.518 41.843 1.192   1.00 52.05  ? 169  GLY B C   1 
ATOM   2346  O O   . GLY B  1 142 ? 16.490 41.350 1.758   1.00 51.40  ? 169  GLY B O   1 
ATOM   2347  N N   . LYS B  1 143 ? 14.331 41.921 1.776   1.00 50.46  ? 170  LYS B N   1 
ATOM   2348  C CA  . LYS B  1 143 ? 14.110 41.380 3.108   1.00 48.80  ? 170  LYS B CA  1 
ATOM   2349  C C   . LYS B  1 143 ? 14.066 39.843 3.079   1.00 46.56  ? 170  LYS B C   1 
ATOM   2350  O O   . LYS B  1 143 ? 13.960 39.195 4.114   1.00 46.49  ? 170  LYS B O   1 
ATOM   2351  C CB  . LYS B  1 143 ? 12.786 41.907 3.662   1.00 51.67  ? 170  LYS B CB  1 
ATOM   2352  C CG  . LYS B  1 143 ? 12.876 43.145 4.560   1.00 56.64  ? 170  LYS B CG  1 
ATOM   2353  C CD  . LYS B  1 143 ? 13.349 44.410 3.846   1.00 58.37  ? 170  LYS B CD  1 
ATOM   2354  C CE  . LYS B  1 143 ? 14.714 44.838 4.376   1.00 58.95  ? 170  LYS B CE  1 
ATOM   2355  N NZ  . LYS B  1 143 ? 14.745 44.769 5.867   1.00 57.45  ? 170  LYS B NZ  1 
ATOM   2356  N N   . ASP B  1 144 ? 14.164 39.265 1.890   1.00 43.05  ? 171  ASP B N   1 
ATOM   2357  C CA  . ASP B  1 144 ? 14.093 37.823 1.727   1.00 40.25  ? 171  ASP B CA  1 
ATOM   2358  C C   . ASP B  1 144 ? 12.865 37.195 2.400   1.00 38.94  ? 171  ASP B C   1 
ATOM   2359  O O   . ASP B  1 144 ? 12.991 36.421 3.352   1.00 36.77  ? 171  ASP B O   1 
ATOM   2360  C CB  . ASP B  1 144 ? 15.372 37.150 2.236   1.00 40.12  ? 171  ASP B CB  1 
ATOM   2361  C CG  . ASP B  1 144 ? 15.357 35.619 2.047   1.00 40.33  ? 171  ASP B CG  1 
ATOM   2362  O OD1 . ASP B  1 144 ? 14.819 35.129 1.027   1.00 39.54  ? 171  ASP B OD1 1 
ATOM   2363  O OD2 . ASP B  1 144 ? 15.901 34.897 2.913   1.00 37.91  ? 171  ASP B OD2 1 
ATOM   2364  N N   . LEU B  1 145 ? 11.675 37.539 1.901   1.00 37.65  ? 172  LEU B N   1 
ATOM   2365  C CA  . LEU B  1 145 ? 10.438 36.975 2.423   1.00 33.67  ? 172  LEU B CA  1 
ATOM   2366  C C   . LEU B  1 145 ? 10.086 35.745 1.604   1.00 33.44  ? 172  LEU B C   1 
ATOM   2367  O O   . LEU B  1 145 ? 9.140  35.754 0.818   1.00 34.27  ? 172  LEU B O   1 
ATOM   2368  C CB  . LEU B  1 145 ? 9.309  37.985 2.344   1.00 30.68  ? 172  LEU B CB  1 
ATOM   2369  C CG  . LEU B  1 145 ? 9.372  39.065 3.407   1.00 29.74  ? 172  LEU B CG  1 
ATOM   2370  C CD1 . LEU B  1 145 ? 8.260  40.050 3.202   1.00 31.01  ? 172  LEU B CD1 1 
ATOM   2371  C CD2 . LEU B  1 145 ? 9.231  38.439 4.751   1.00 29.27  ? 172  LEU B CD2 1 
ATOM   2372  N N   . GLN B  1 146 ? 10.872 34.690 1.787   1.00 32.82  ? 173  GLN B N   1 
ATOM   2373  C CA  . GLN B  1 146 ? 10.643 33.446 1.073   1.00 32.47  ? 173  GLN B CA  1 
ATOM   2374  C C   . GLN B  1 146 ? 10.014 32.386 1.960   1.00 30.67  ? 173  GLN B C   1 
ATOM   2375  O O   . GLN B  1 146 ? 9.834  32.594 3.165   1.00 29.72  ? 173  GLN B O   1 
ATOM   2376  C CB  . GLN B  1 146 ? 11.952 32.920 0.492   1.00 34.83  ? 173  GLN B CB  1 
ATOM   2377  C CG  . GLN B  1 146 ? 12.572 33.872 -0.501  1.00 38.60  ? 173  GLN B CG  1 
ATOM   2378  C CD  . GLN B  1 146 ? 11.527 34.514 -1.399  1.00 41.38  ? 173  GLN B CD  1 
ATOM   2379  O OE1 . GLN B  1 146 ? 10.797 33.827 -2.123  1.00 43.58  ? 173  GLN B OE1 1 
ATOM   2380  N NE2 . GLN B  1 146 ? 11.445 35.840 -1.352  1.00 42.34  ? 173  GLN B NE2 1 
ATOM   2381  N N   . GLU B  1 147 ? 9.672  31.255 1.349   1.00 27.93  ? 174  GLU B N   1 
ATOM   2382  C CA  . GLU B  1 147 ? 9.065  30.150 2.078   1.00 25.98  ? 174  GLU B CA  1 
ATOM   2383  C C   . GLU B  1 147 ? 8.228  30.666 3.224   1.00 24.51  ? 174  GLU B C   1 
ATOM   2384  O O   . GLU B  1 147 ? 7.311  31.444 3.029   1.00 28.31  ? 174  GLU B O   1 
ATOM   2385  C CB  . GLU B  1 147 ? 10.144 29.216 2.617   1.00 26.55  ? 174  GLU B CB  1 
ATOM   2386  C CG  . GLU B  1 147 ? 10.986 28.554 1.540   1.00 27.60  ? 174  GLU B CG  1 
ATOM   2387  C CD  . GLU B  1 147 ? 10.138 27.856 0.485   1.00 28.85  ? 174  GLU B CD  1 
ATOM   2388  O OE1 . GLU B  1 147 ? 9.264  27.051 0.848   1.00 29.79  ? 174  GLU B OE1 1 
ATOM   2389  O OE2 . GLU B  1 147 ? 10.339 28.107 -0.717  1.00 30.79  ? 174  GLU B OE2 1 
ATOM   2390  N N   . ASN B  1 148 ? 8.549  30.246 4.431   1.00 21.97  ? 175  ASN B N   1 
ATOM   2391  C CA  . ASN B  1 148 ? 7.794  30.699 5.578   1.00 19.31  ? 175  ASN B CA  1 
ATOM   2392  C C   . ASN B  1 148 ? 8.768  31.007 6.690   1.00 19.16  ? 175  ASN B C   1 
ATOM   2393  O O   . ASN B  1 148 ? 8.487  30.793 7.853   1.00 18.55  ? 175  ASN B O   1 
ATOM   2394  C CB  . ASN B  1 148 ? 6.789  29.629 6.009   1.00 18.17  ? 175  ASN B CB  1 
ATOM   2395  C CG  . ASN B  1 148 ? 7.452  28.382 6.566   1.00 15.28  ? 175  ASN B CG  1 
ATOM   2396  O OD1 . ASN B  1 148 ? 8.487  27.951 6.094   1.00 11.06  ? 175  ASN B OD1 1 
ATOM   2397  N ND2 . ASN B  1 148 ? 6.833  27.791 7.574   1.00 18.07  ? 175  ASN B ND2 1 
ATOM   2398  N N   . TYR B  1 149 ? 9.928  31.525 6.312   1.00 20.38  ? 176  TYR B N   1 
ATOM   2399  C CA  . TYR B  1 149 ? 10.959 31.881 7.271   1.00 20.89  ? 176  TYR B CA  1 
ATOM   2400  C C   . TYR B  1 149 ? 10.583 33.063 8.146   1.00 21.40  ? 176  TYR B C   1 
ATOM   2401  O O   . TYR B  1 149 ? 9.879  33.970 7.723   1.00 22.10  ? 176  TYR B O   1 
ATOM   2402  C CB  . TYR B  1 149 ? 12.242 32.225 6.536   1.00 22.14  ? 176  TYR B CB  1 
ATOM   2403  C CG  . TYR B  1 149 ? 12.710 31.155 5.584   1.00 25.18  ? 176  TYR B CG  1 
ATOM   2404  C CD1 . TYR B  1 149 ? 12.875 29.842 6.012   1.00 25.89  ? 176  TYR B CD1 1 
ATOM   2405  C CD2 . TYR B  1 149 ? 13.025 31.461 4.257   1.00 25.01  ? 176  TYR B CD2 1 
ATOM   2406  C CE1 . TYR B  1 149 ? 13.345 28.859 5.145   1.00 27.70  ? 176  TYR B CE1 1 
ATOM   2407  C CE2 . TYR B  1 149 ? 13.491 30.485 3.384   1.00 25.13  ? 176  TYR B CE2 1 
ATOM   2408  C CZ  . TYR B  1 149 ? 13.649 29.192 3.831   1.00 26.32  ? 176  TYR B CZ  1 
ATOM   2409  O OH  . TYR B  1 149 ? 14.110 28.237 2.963   1.00 27.92  ? 176  TYR B OH  1 
ATOM   2410  N N   . CYS B  1 150 ? 11.063 33.053 9.377   1.00 22.29  ? 177  CYS B N   1 
ATOM   2411  C CA  . CYS B  1 150 ? 10.810 34.150 10.289  1.00 23.90  ? 177  CYS B CA  1 
ATOM   2412  C C   . CYS B  1 150 ? 11.589 35.330 9.756   1.00 25.68  ? 177  CYS B C   1 
ATOM   2413  O O   . CYS B  1 150 ? 12.749 35.187 9.368   1.00 25.83  ? 177  CYS B O   1 
ATOM   2414  C CB  . CYS B  1 150 ? 11.335 33.816 11.665  1.00 24.10  ? 177  CYS B CB  1 
ATOM   2415  S SG  . CYS B  1 150 ? 10.496 32.418 12.448  1.00 28.56  ? 177  CYS B SG  1 
ATOM   2416  N N   . ARG B  1 151 ? 10.962 36.499 9.730   1.00 26.69  ? 178  ARG B N   1 
ATOM   2417  C CA  . ARG B  1 151 ? 11.636 37.686 9.227   1.00 26.39  ? 178  ARG B CA  1 
ATOM   2418  C C   . ARG B  1 151 ? 11.170 38.918 9.969   1.00 28.34  ? 178  ARG B C   1 
ATOM   2419  O O   . ARG B  1 151 ? 10.184 38.880 10.695  1.00 28.39  ? 178  ARG B O   1 
ATOM   2420  C CB  . ARG B  1 151 ? 11.365 37.846 7.736   1.00 22.99  ? 178  ARG B CB  1 
ATOM   2421  C CG  . ARG B  1 151 ? 11.937 36.740 6.886   1.00 19.78  ? 178  ARG B CG  1 
ATOM   2422  C CD  . ARG B  1 151 ? 13.415 36.911 6.751   1.00 19.43  ? 178  ARG B CD  1 
ATOM   2423  N NE  . ARG B  1 151 ? 14.000 35.977 5.805   1.00 19.92  ? 178  ARG B NE  1 
ATOM   2424  C CZ  . ARG B  1 151 ? 14.567 34.833 6.160   1.00 21.31  ? 178  ARG B CZ  1 
ATOM   2425  N NH1 . ARG B  1 151 ? 14.611 34.506 7.445   1.00 18.65  ? 178  ARG B NH1 1 
ATOM   2426  N NH2 . ARG B  1 151 ? 15.090 34.025 5.235   1.00 18.57  ? 178  ARG B NH2 1 
ATOM   2427  N N   . ASN B  1 152 ? 11.903 40.006 9.790   1.00 30.85  ? 179  ASN B N   1 
ATOM   2428  C CA  . ASN B  1 152 ? 11.573 41.276 10.415  1.00 33.40  ? 179  ASN B CA  1 
ATOM   2429  C C   . ASN B  1 152 ? 11.720 42.285 9.292   1.00 35.50  ? 179  ASN B C   1 
ATOM   2430  O O   . ASN B  1 152 ? 12.598 43.145 9.322   1.00 35.04  ? 179  ASN B O   1 
ATOM   2431  C CB  . ASN B  1 152 ? 12.561 41.598 11.530  1.00 35.86  ? 179  ASN B CB  1 
ATOM   2432  C CG  . ASN B  1 152 ? 12.077 42.727 12.425  1.00 37.25  ? 179  ASN B CG  1 
ATOM   2433  O OD1 . ASN B  1 152 ? 11.246 43.534 12.019  1.00 38.46  ? 179  ASN B OD1 1 
ATOM   2434  N ND2 . ASN B  1 152 ? 12.603 42.791 13.643  1.00 37.15  ? 179  ASN B ND2 1 
ATOM   2435  N N   . PRO B  1 153 ? 10.844 42.191 8.282   1.00 37.99  ? 180  PRO B N   1 
ATOM   2436  C CA  . PRO B  1 153 ? 10.837 43.063 7.109   1.00 40.45  ? 180  PRO B CA  1 
ATOM   2437  C C   . PRO B  1 153 ? 10.858 44.562 7.411   1.00 43.83  ? 180  PRO B C   1 
ATOM   2438  O O   . PRO B  1 153 ? 11.459 45.343 6.667   1.00 43.35  ? 180  PRO B O   1 
ATOM   2439  C CB  . PRO B  1 153 ? 9.578  42.617 6.376   1.00 38.97  ? 180  PRO B CB  1 
ATOM   2440  C CG  . PRO B  1 153 ? 8.675  42.230 7.493   1.00 37.09  ? 180  PRO B CG  1 
ATOM   2441  C CD  . PRO B  1 153 ? 9.584  41.430 8.362   1.00 37.53  ? 180  PRO B CD  1 
ATOM   2442  N N   . ARG B  1 154 ? 10.206 44.948 8.507   1.00 47.55  ? 181  ARG B N   1 
ATOM   2443  C CA  . ARG B  1 154 ? 10.116 46.348 8.938   1.00 52.15  ? 181  ARG B CA  1 
ATOM   2444  C C   . ARG B  1 154 ? 11.103 46.707 10.053  1.00 54.14  ? 181  ARG B C   1 
ATOM   2445  O O   . ARG B  1 154 ? 10.977 47.768 10.674  1.00 55.30  ? 181  ARG B O   1 
ATOM   2446  C CB  . ARG B  1 154 ? 8.702  46.649 9.442   1.00 53.12  ? 181  ARG B CB  1 
ATOM   2447  C CG  . ARG B  1 154 ? 7.654  46.864 8.366   1.00 56.44  ? 181  ARG B CG  1 
ATOM   2448  C CD  . ARG B  1 154 ? 6.269  46.597 8.961   1.00 59.00  ? 181  ARG B CD  1 
ATOM   2449  N NE  . ARG B  1 154 ? 5.172  47.214 8.215   1.00 60.27  ? 181  ARG B NE  1 
ATOM   2450  C CZ  . ARG B  1 154 ? 4.954  48.524 8.157   1.00 60.58  ? 181  ARG B CZ  1 
ATOM   2451  N NH1 . ARG B  1 154 ? 5.765  49.362 8.801   1.00 60.44  ? 181  ARG B NH1 1 
ATOM   2452  N NH2 . ARG B  1 154 ? 3.920  48.991 7.467   1.00 60.03  ? 181  ARG B NH2 1 
ATOM   2453  N N   . GLY B  1 155 ? 12.076 45.834 10.309  1.00 55.03  ? 182  GLY B N   1 
ATOM   2454  C CA  . GLY B  1 155 ? 13.035 46.090 11.370  1.00 54.76  ? 182  GLY B CA  1 
ATOM   2455  C C   . GLY B  1 155 ? 12.378 46.614 12.636  1.00 54.34  ? 182  GLY B C   1 
ATOM   2456  O O   . GLY B  1 155 ? 12.921 47.485 13.308  1.00 54.96  ? 182  GLY B O   1 
ATOM   2457  N N   . GLU B  1 156 ? 11.205 46.085 12.958  1.00 54.30  ? 183  GLU B N   1 
ATOM   2458  C CA  . GLU B  1 156 ? 10.469 46.516 14.143  1.00 54.98  ? 183  GLU B CA  1 
ATOM   2459  C C   . GLU B  1 156 ? 11.116 46.012 15.424  1.00 55.25  ? 183  GLU B C   1 
ATOM   2460  O O   . GLU B  1 156 ? 12.165 45.377 15.406  1.00 54.87  ? 183  GLU B O   1 
ATOM   2461  C CB  . GLU B  1 156 ? 9.008  46.022 14.087  1.00 54.38  ? 183  GLU B CB  1 
ATOM   2462  C CG  . GLU B  1 156 ? 8.188  46.545 12.901  1.00 53.27  ? 183  GLU B CG  1 
ATOM   2463  C CD  . GLU B  1 156 ? 6.928  45.721 12.633  1.00 53.72  ? 183  GLU B CD  1 
ATOM   2464  O OE1 . GLU B  1 156 ? 6.128  45.509 13.570  1.00 52.68  ? 183  GLU B OE1 1 
ATOM   2465  O OE2 . GLU B  1 156 ? 6.736  45.286 11.476  1.00 53.18  ? 183  GLU B OE2 1 
ATOM   2466  N N   . GLU B  1 157 ? 10.463 46.323 16.534  1.00 56.68  ? 184  GLU B N   1 
ATOM   2467  C CA  . GLU B  1 157 ? 10.895 45.928 17.870  1.00 57.26  ? 184  GLU B CA  1 
ATOM   2468  C C   . GLU B  1 157 ? 10.151 44.620 18.167  1.00 55.49  ? 184  GLU B C   1 
ATOM   2469  O O   . GLU B  1 157 ? 8.917  44.604 18.276  1.00 55.55  ? 184  GLU B O   1 
ATOM   2470  C CB  . GLU B  1 157 ? 10.499 47.037 18.856  1.00 60.15  ? 184  GLU B CB  1 
ATOM   2471  C CG  . GLU B  1 157 ? 10.666 46.713 20.331  1.00 65.53  ? 184  GLU B CG  1 
ATOM   2472  C CD  . GLU B  1 157 ? 12.119 46.641 20.769  1.00 68.38  ? 184  GLU B CD  1 
ATOM   2473  O OE1 . GLU B  1 157 ? 12.866 47.629 20.549  1.00 70.03  ? 184  GLU B OE1 1 
ATOM   2474  O OE2 . GLU B  1 157 ? 12.503 45.592 21.340  1.00 69.81  ? 184  GLU B OE2 1 
ATOM   2475  N N   . GLY B  1 158 ? 10.897 43.528 18.287  1.00 52.69  ? 185  GLY B N   1 
ATOM   2476  C CA  . GLY B  1 158 ? 10.265 42.243 18.521  1.00 50.65  ? 185  GLY B CA  1 
ATOM   2477  C C   . GLY B  1 158 ? 11.042 41.200 17.747  1.00 49.27  ? 185  GLY B C   1 
ATOM   2478  O O   . GLY B  1 158 ? 10.892 39.993 17.956  1.00 49.47  ? 185  GLY B O   1 
ATOM   2479  N N   . GLY B  1 159 ? 11.891 41.686 16.846  1.00 47.55  ? 186  GLY B N   1 
ATOM   2480  C CA  . GLY B  1 159 ? 12.723 40.805 16.049  1.00 44.32  ? 186  GLY B CA  1 
ATOM   2481  C C   . GLY B  1 159 ? 11.929 39.993 15.057  1.00 41.88  ? 186  GLY B C   1 
ATOM   2482  O O   . GLY B  1 159 ? 10.731 40.207 14.892  1.00 41.95  ? 186  GLY B O   1 
ATOM   2483  N N   . PRO B  1 160 ? 12.574 39.050 14.373  1.00 39.43  ? 187  PRO B N   1 
ATOM   2484  C CA  . PRO B  1 160 ? 11.857 38.234 13.399  1.00 38.13  ? 187  PRO B CA  1 
ATOM   2485  C C   . PRO B  1 160 ? 10.555 37.653 13.952  1.00 37.10  ? 187  PRO B C   1 
ATOM   2486  O O   . PRO B  1 160 ? 10.434 37.353 15.145  1.00 37.43  ? 187  PRO B O   1 
ATOM   2487  C CB  . PRO B  1 160 ? 12.881 37.167 13.036  1.00 39.16  ? 187  PRO B CB  1 
ATOM   2488  C CG  . PRO B  1 160 ? 14.166 37.935 13.101  1.00 39.22  ? 187  PRO B CG  1 
ATOM   2489  C CD  . PRO B  1 160 ? 14.008 38.726 14.381  1.00 39.16  ? 187  PRO B CD  1 
ATOM   2490  N N   . TRP B  1 161 ? 9.586  37.517 13.053  1.00 34.63  ? 188  TRP B N   1 
ATOM   2491  C CA  . TRP B  1 161 ? 8.260  36.998 13.358  1.00 31.14  ? 188  TRP B CA  1 
ATOM   2492  C C   . TRP B  1 161 ? 7.714  36.388 12.071  1.00 30.80  ? 188  TRP B C   1 
ATOM   2493  O O   . TRP B  1 161 ? 8.413  36.331 11.050  1.00 29.77  ? 188  TRP B O   1 
ATOM   2494  C CB  . TRP B  1 161 ? 7.343  38.135 13.779  1.00 29.82  ? 188  TRP B CB  1 
ATOM   2495  C CG  . TRP B  1 161 ? 7.243  39.208 12.717  1.00 26.91  ? 188  TRP B CG  1 
ATOM   2496  C CD1 . TRP B  1 161 ? 8.152  40.195 12.451  1.00 26.05  ? 188  TRP B CD1 1 
ATOM   2497  C CD2 . TRP B  1 161 ? 6.206  39.349 11.745  1.00 25.97  ? 188  TRP B CD2 1 
ATOM   2498  N NE1 . TRP B  1 161 ? 7.746  40.938 11.374  1.00 25.27  ? 188  TRP B NE1 1 
ATOM   2499  C CE2 . TRP B  1 161 ? 6.554  40.440 10.919  1.00 24.93  ? 188  TRP B CE2 1 
ATOM   2500  C CE3 . TRP B  1 161 ? 5.011  38.657 11.489  1.00 25.66  ? 188  TRP B CE3 1 
ATOM   2501  C CZ2 . TRP B  1 161 ? 5.755  40.853 9.855   1.00 23.52  ? 188  TRP B CZ2 1 
ATOM   2502  C CZ3 . TRP B  1 161 ? 4.215  39.073 10.427  1.00 24.43  ? 188  TRP B CZ3 1 
ATOM   2503  C CH2 . TRP B  1 161 ? 4.591  40.159 9.627   1.00 23.98  ? 188  TRP B CH2 1 
ATOM   2504  N N   . CYS B  1 162 ? 6.459  35.957 12.112  1.00 29.57  ? 189  CYS B N   1 
ATOM   2505  C CA  . CYS B  1 162 ? 5.838  35.368 10.938  1.00 29.21  ? 189  CYS B CA  1 
ATOM   2506  C C   . CYS B  1 162 ? 4.354  35.099 11.186  1.00 29.06  ? 189  CYS B C   1 
ATOM   2507  O O   . CYS B  1 162 ? 3.912  34.996 12.324  1.00 29.40  ? 189  CYS B O   1 
ATOM   2508  C CB  . CYS B  1 162 ? 6.540  34.049 10.595  1.00 28.78  ? 189  CYS B CB  1 
ATOM   2509  S SG  . CYS B  1 162 ? 6.068  32.663 11.682  1.00 27.09  ? 189  CYS B SG  1 
ATOM   2510  N N   . PHE B  1 163 ? 3.574  34.998 10.123  1.00 28.32  ? 190  PHE B N   1 
ATOM   2511  C CA  . PHE B  1 163 ? 2.169  34.687 10.296  1.00 28.41  ? 190  PHE B CA  1 
ATOM   2512  C C   . PHE B  1 163 ? 2.155  33.191 10.599  1.00 28.33  ? 190  PHE B C   1 
ATOM   2513  O O   . PHE B  1 163 ? 2.869  32.426 9.960   1.00 29.23  ? 190  PHE B O   1 
ATOM   2514  C CB  . PHE B  1 163 ? 1.396  35.012 9.017   1.00 28.26  ? 190  PHE B CB  1 
ATOM   2515  C CG  . PHE B  1 163 ? 1.316  36.479 8.730   1.00 28.41  ? 190  PHE B CG  1 
ATOM   2516  C CD1 . PHE B  1 163 ? 0.510  37.313 9.513   1.00 29.52  ? 190  PHE B CD1 1 
ATOM   2517  C CD2 . PHE B  1 163 ? 2.106  37.048 7.743   1.00 28.25  ? 190  PHE B CD2 1 
ATOM   2518  C CE1 . PHE B  1 163 ? 0.507  38.702 9.319   1.00 29.02  ? 190  PHE B CE1 1 
ATOM   2519  C CE2 . PHE B  1 163 ? 2.111  38.439 7.540   1.00 30.60  ? 190  PHE B CE2 1 
ATOM   2520  C CZ  . PHE B  1 163 ? 1.311  39.266 8.332   1.00 29.22  ? 190  PHE B CZ  1 
ATOM   2521  N N   . THR B  1 164 ? 1.370  32.780 11.588  1.00 27.63  ? 191  THR B N   1 
ATOM   2522  C CA  . THR B  1 164 ? 1.312  31.373 11.980  1.00 26.88  ? 191  THR B CA  1 
ATOM   2523  C C   . THR B  1 164 ? 0.298  30.560 11.191  1.00 26.87  ? 191  THR B C   1 
ATOM   2524  O O   . THR B  1 164 ? -0.672 31.094 10.676  1.00 26.76  ? 191  THR B O   1 
ATOM   2525  C CB  . THR B  1 164 ? 0.987  31.222 13.462  1.00 25.35  ? 191  THR B CB  1 
ATOM   2526  O OG1 . THR B  1 164 ? -0.401 30.910 13.603  1.00 26.33  ? 191  THR B OG1 1 
ATOM   2527  C CG2 . THR B  1 164 ? 1.309  32.506 14.209  1.00 22.73  ? 191  THR B CG2 1 
ATOM   2528  N N   . SER B  1 165 ? 0.531  29.258 11.098  1.00 27.23  ? 192  SER B N   1 
ATOM   2529  C CA  . SER B  1 165 ? -0.363 28.404 10.348  1.00 28.80  ? 192  SER B CA  1 
ATOM   2530  C C   . SER B  1 165 ? -1.585 28.090 11.180  1.00 30.48  ? 192  SER B C   1 
ATOM   2531  O O   . SER B  1 165 ? -2.489 27.375 10.731  1.00 29.92  ? 192  SER B O   1 
ATOM   2532  C CB  . SER B  1 165 ? 0.356  27.124 9.937   1.00 28.71  ? 192  SER B CB  1 
ATOM   2533  O OG  . SER B  1 165 ? 0.997  26.534 11.047  1.00 28.71  ? 192  SER B OG  1 
ATOM   2534  N N   . ASN B  1 166 ? -1.603 28.635 12.397  1.00 31.45  ? 193  ASN B N   1 
ATOM   2535  C CA  . ASN B  1 166 ? -2.727 28.449 13.312  1.00 32.08  ? 193  ASN B CA  1 
ATOM   2536  C C   . ASN B  1 166 ? -3.727 29.583 13.066  1.00 33.07  ? 193  ASN B C   1 
ATOM   2537  O O   . ASN B  1 166 ? -3.442 30.756 13.342  1.00 31.76  ? 193  ASN B O   1 
ATOM   2538  C CB  . ASN B  1 166 ? -2.261 28.501 14.764  1.00 32.95  ? 193  ASN B CB  1 
ATOM   2539  C CG  . ASN B  1 166 ? -3.388 28.205 15.745  1.00 34.39  ? 193  ASN B CG  1 
ATOM   2540  O OD1 . ASN B  1 166 ? -4.491 28.734 15.624  1.00 34.49  ? 193  ASN B OD1 1 
ATOM   2541  N ND2 . ASN B  1 166 ? -3.111 27.359 16.724  1.00 33.93  ? 193  ASN B ND2 1 
ATOM   2542  N N   . PRO B  1 167 ? -4.910 29.247 12.533  1.00 34.15  ? 194  PRO B N   1 
ATOM   2543  C CA  . PRO B  1 167 ? -5.955 30.230 12.242  1.00 34.42  ? 194  PRO B CA  1 
ATOM   2544  C C   . PRO B  1 167 ? -6.241 31.143 13.428  1.00 34.46  ? 194  PRO B C   1 
ATOM   2545  O O   . PRO B  1 167 ? -6.440 32.350 13.267  1.00 34.22  ? 194  PRO B O   1 
ATOM   2546  C CB  . PRO B  1 167 ? -7.146 29.354 11.875  1.00 33.84  ? 194  PRO B CB  1 
ATOM   2547  C CG  . PRO B  1 167 ? -6.498 28.205 11.195  1.00 34.43  ? 194  PRO B CG  1 
ATOM   2548  C CD  . PRO B  1 167 ? -5.350 27.899 12.136  1.00 35.56  ? 194  PRO B CD  1 
ATOM   2549  N N   . GLU B  1 168 ? -6.239 30.572 14.625  1.00 34.52  ? 195  GLU B N   1 
ATOM   2550  C CA  . GLU B  1 168 ? -6.515 31.354 15.815  1.00 34.70  ? 195  GLU B CA  1 
ATOM   2551  C C   . GLU B  1 168 ? -5.348 32.202 16.261  1.00 32.90  ? 195  GLU B C   1 
ATOM   2552  O O   . GLU B  1 168 ? -5.446 32.921 17.249  1.00 33.41  ? 195  GLU B O   1 
ATOM   2553  C CB  . GLU B  1 168 ? -6.983 30.452 16.962  1.00 38.91  ? 195  GLU B CB  1 
ATOM   2554  C CG  . GLU B  1 168 ? -8.404 29.888 16.767  1.00 45.01  ? 195  GLU B CG  1 
ATOM   2555  C CD  . GLU B  1 168 ? -9.274 30.744 15.819  1.00 49.16  ? 195  GLU B CD  1 
ATOM   2556  O OE1 . GLU B  1 168 ? -9.413 31.984 16.046  1.00 49.29  ? 195  GLU B OE1 1 
ATOM   2557  O OE2 . GLU B  1 168 ? -9.818 30.160 14.842  1.00 50.28  ? 195  GLU B OE2 1 
ATOM   2558  N N   . VAL B  1 169 ? -4.242 32.130 15.531  1.00 31.15  ? 196  VAL B N   1 
ATOM   2559  C CA  . VAL B  1 169 ? -3.077 32.941 15.866  1.00 29.60  ? 196  VAL B CA  1 
ATOM   2560  C C   . VAL B  1 169 ? -2.507 33.563 14.601  1.00 29.10  ? 196  VAL B C   1 
ATOM   2561  O O   . VAL B  1 169 ? -1.731 32.938 13.903  1.00 26.71  ? 196  VAL B O   1 
ATOM   2562  C CB  . VAL B  1 169 ? -1.965 32.108 16.558  1.00 29.57  ? 196  VAL B CB  1 
ATOM   2563  C CG1 . VAL B  1 169 ? -1.013 33.037 17.294  1.00 25.53  ? 196  VAL B CG1 1 
ATOM   2564  C CG2 . VAL B  1 169 ? -2.580 31.078 17.504  1.00 27.31  ? 196  VAL B CG2 1 
ATOM   2565  N N   . ARG B  1 170 ? -2.897 34.804 14.320  1.00 31.03  ? 197  ARG B N   1 
ATOM   2566  C CA  . ARG B  1 170 ? -2.438 35.503 13.126  1.00 31.47  ? 197  ARG B CA  1 
ATOM   2567  C C   . ARG B  1 170 ? -0.918 35.491 13.001  1.00 33.92  ? 197  ARG B C   1 
ATOM   2568  O O   . ARG B  1 170 ? -0.390 34.949 12.040  1.00 35.35  ? 197  ARG B O   1 
ATOM   2569  C CB  . ARG B  1 170 ? -2.972 36.937 13.109  1.00 27.74  ? 197  ARG B CB  1 
ATOM   2570  C CG  . ARG B  1 170 ? -2.671 37.691 11.837  1.00 27.60  ? 197  ARG B CG  1 
ATOM   2571  C CD  . ARG B  1 170 ? -3.283 39.096 11.864  1.00 27.23  ? 197  ARG B CD  1 
ATOM   2572  N NE  . ARG B  1 170 ? -2.882 39.924 10.720  1.00 25.20  ? 197  ARG B NE  1 
ATOM   2573  C CZ  . ARG B  1 170 ? -3.295 39.744 9.464   1.00 23.73  ? 197  ARG B CZ  1 
ATOM   2574  N NH1 . ARG B  1 170 ? -4.138 38.761 9.175   1.00 22.58  ? 197  ARG B NH1 1 
ATOM   2575  N NH2 . ARG B  1 170 ? -2.847 40.534 8.490   1.00 20.28  ? 197  ARG B NH2 1 
ATOM   2576  N N   . TYR B  1 171 ? -0.213 36.067 13.965  1.00 35.79  ? 198  TYR B N   1 
ATOM   2577  C CA  . TYR B  1 171 ? 1.246  36.086 13.914  1.00 38.01  ? 198  TYR B CA  1 
ATOM   2578  C C   . TYR B  1 171 ? 1.859  35.951 15.302  1.00 38.03  ? 198  TYR B C   1 
ATOM   2579  O O   . TYR B  1 171 ? 1.171  36.023 16.319  1.00 39.88  ? 198  TYR B O   1 
ATOM   2580  C CB  . TYR B  1 171 ? 1.750  37.385 13.311  1.00 41.78  ? 198  TYR B CB  1 
ATOM   2581  C CG  . TYR B  1 171 ? 1.420  38.568 14.182  1.00 47.87  ? 198  TYR B CG  1 
ATOM   2582  C CD1 . TYR B  1 171 ? 0.151  39.156 14.132  1.00 50.36  ? 198  TYR B CD1 1 
ATOM   2583  C CD2 . TYR B  1 171 ? 2.345  39.066 15.099  1.00 48.72  ? 198  TYR B CD2 1 
ATOM   2584  C CE1 . TYR B  1 171 ? -0.194 40.205 14.969  1.00 51.56  ? 198  TYR B CE1 1 
ATOM   2585  C CE2 . TYR B  1 171 ? 2.009  40.112 15.944  1.00 51.71  ? 198  TYR B CE2 1 
ATOM   2586  C CZ  . TYR B  1 171 ? 0.733  40.678 15.871  1.00 52.78  ? 198  TYR B CZ  1 
ATOM   2587  O OH  . TYR B  1 171 ? 0.366  41.713 16.703  1.00 56.14  ? 198  TYR B OH  1 
ATOM   2588  N N   . GLU B  1 172 ? 3.173  35.781 15.324  1.00 36.64  ? 199  GLU B N   1 
ATOM   2589  C CA  . GLU B  1 172 ? 3.924  35.637 16.556  1.00 34.08  ? 199  GLU B CA  1 
ATOM   2590  C C   . GLU B  1 172 ? 5.402  35.761 16.256  1.00 33.99  ? 199  GLU B C   1 
ATOM   2591  O O   . GLU B  1 172 ? 5.854  35.464 15.145  1.00 33.82  ? 199  GLU B O   1 
ATOM   2592  C CB  . GLU B  1 172 ? 3.638  34.284 17.194  1.00 33.69  ? 199  GLU B CB  1 
ATOM   2593  C CG  . GLU B  1 172 ? 4.545  33.962 18.364  1.00 33.65  ? 199  GLU B CG  1 
ATOM   2594  C CD  . GLU B  1 172 ? 4.036  32.801 19.209  1.00 34.23  ? 199  GLU B CD  1 
ATOM   2595  O OE1 . GLU B  1 172 ? 3.780  31.705 18.662  1.00 35.08  ? 199  GLU B OE1 1 
ATOM   2596  O OE2 . GLU B  1 172 ? 3.894  32.990 20.434  1.00 32.32  ? 199  GLU B OE2 1 
ATOM   2597  N N   . VAL B  1 173 ? 6.158  36.216 17.245  1.00 33.43  ? 200  VAL B N   1 
ATOM   2598  C CA  . VAL B  1 173 ? 7.596  36.376 17.072  1.00 32.74  ? 200  VAL B CA  1 
ATOM   2599  C C   . VAL B  1 173 ? 8.264  35.011 17.141  1.00 32.04  ? 200  VAL B C   1 
ATOM   2600  O O   . VAL B  1 173 ? 7.682  34.049 17.632  1.00 32.16  ? 200  VAL B O   1 
ATOM   2601  C CB  . VAL B  1 173 ? 8.193  37.266 18.165  1.00 31.98  ? 200  VAL B CB  1 
ATOM   2602  C CG1 . VAL B  1 173 ? 7.856  38.720 17.907  1.00 31.78  ? 200  VAL B CG1 1 
ATOM   2603  C CG2 . VAL B  1 173 ? 7.659  36.834 19.502  1.00 32.31  ? 200  VAL B CG2 1 
ATOM   2604  N N   . CYS B  1 174 ? 9.483  34.925 16.637  1.00 31.61  ? 201  CYS B N   1 
ATOM   2605  C CA  . CYS B  1 174 ? 10.206 33.674 16.666  1.00 33.10  ? 201  CYS B CA  1 
ATOM   2606  C C   . CYS B  1 174 ? 11.343 33.827 17.670  1.00 35.29  ? 201  CYS B C   1 
ATOM   2607  O O   . CYS B  1 174 ? 11.862 34.929 17.860  1.00 36.25  ? 201  CYS B O   1 
ATOM   2608  C CB  . CYS B  1 174 ? 10.770 33.366 15.284  1.00 32.50  ? 201  CYS B CB  1 
ATOM   2609  S SG  . CYS B  1 174 ? 9.512  33.294 13.981  1.00 27.91  ? 201  CYS B SG  1 
ATOM   2610  N N   . ASP B  1 175 ? 11.716 32.723 18.315  1.00 37.30  ? 202  ASP B N   1 
ATOM   2611  C CA  . ASP B  1 175 ? 12.784 32.683 19.323  1.00 37.83  ? 202  ASP B CA  1 
ATOM   2612  C C   . ASP B  1 175 ? 14.150 32.577 18.643  1.00 36.28  ? 202  ASP B C   1 
ATOM   2613  O O   . ASP B  1 175 ? 14.737 31.504 18.582  1.00 34.99  ? 202  ASP B O   1 
ATOM   2614  C CB  . ASP B  1 175 ? 12.552 31.462 20.223  1.00 43.03  ? 202  ASP B CB  1 
ATOM   2615  C CG  . ASP B  1 175 ? 13.476 31.415 21.431  1.00 47.31  ? 202  ASP B CG  1 
ATOM   2616  O OD1 . ASP B  1 175 ? 14.686 31.738 21.286  1.00 50.69  ? 202  ASP B OD1 1 
ATOM   2617  O OD2 . ASP B  1 175 ? 12.965 31.023 22.509  1.00 47.64  ? 202  ASP B OD2 1 
ATOM   2618  N N   . ILE B  1 176 ? 14.660 33.688 18.133  1.00 36.06  ? 203  ILE B N   1 
ATOM   2619  C CA  . ILE B  1 176 ? 15.938 33.655 17.442  1.00 36.67  ? 203  ILE B CA  1 
ATOM   2620  C C   . ILE B  1 176 ? 17.028 34.377 18.198  1.00 38.18  ? 203  ILE B C   1 
ATOM   2621  O O   . ILE B  1 176 ? 17.018 35.602 18.320  1.00 37.95  ? 203  ILE B O   1 
ATOM   2622  C CB  . ILE B  1 176 ? 15.794 34.218 16.015  1.00 37.06  ? 203  ILE B CB  1 
ATOM   2623  C CG1 . ILE B  1 176 ? 14.989 33.214 15.187  1.00 36.86  ? 203  ILE B CG1 1 
ATOM   2624  C CG2 . ILE B  1 176 ? 17.162 34.506 15.396  1.00 34.69  ? 203  ILE B CG2 1 
ATOM   2625  C CD1 . ILE B  1 176 ? 14.936 33.519 13.729  1.00 38.70  ? 203  ILE B CD1 1 
ATOM   2626  N N   . PRO B  1 177 ? 18.010 33.608 18.693  1.00 39.61  ? 204  PRO B N   1 
ATOM   2627  C CA  . PRO B  1 177 ? 19.172 34.038 19.468  1.00 40.10  ? 204  PRO B CA  1 
ATOM   2628  C C   . PRO B  1 177 ? 20.001 35.198 18.942  1.00 41.62  ? 204  PRO B C   1 
ATOM   2629  O O   . PRO B  1 177 ? 20.203 35.361 17.739  1.00 41.28  ? 204  PRO B O   1 
ATOM   2630  C CB  . PRO B  1 177 ? 19.983 32.758 19.588  1.00 40.58  ? 204  PRO B CB  1 
ATOM   2631  C CG  . PRO B  1 177 ? 19.649 32.035 18.339  1.00 40.68  ? 204  PRO B CG  1 
ATOM   2632  C CD  . PRO B  1 177 ? 18.167 32.203 18.283  1.00 39.73  ? 204  PRO B CD  1 
ATOM   2633  N N   . GLN B  1 178 ? 20.480 36.000 19.882  1.00 44.10  ? 205  GLN B N   1 
ATOM   2634  C CA  . GLN B  1 178 ? 21.319 37.152 19.594  1.00 47.90  ? 205  GLN B CA  1 
ATOM   2635  C C   . GLN B  1 178 ? 22.731 36.630 19.410  1.00 50.01  ? 205  GLN B C   1 
ATOM   2636  O O   . GLN B  1 178 ? 23.139 35.697 20.105  1.00 49.76  ? 205  GLN B O   1 
ATOM   2637  C CB  . GLN B  1 178 ? 21.306 38.120 20.778  1.00 50.15  ? 205  GLN B CB  1 
ATOM   2638  C CG  . GLN B  1 178 ? 20.004 38.864 20.999  1.00 51.90  ? 205  GLN B CG  1 
ATOM   2639  C CD  . GLN B  1 178 ? 19.799 39.958 19.968  1.00 54.02  ? 205  GLN B CD  1 
ATOM   2640  O OE1 . GLN B  1 178 ? 20.723 40.722 19.661  1.00 54.56  ? 205  GLN B OE1 1 
ATOM   2641  N NE2 . GLN B  1 178 ? 18.585 40.047 19.431  1.00 54.75  ? 205  GLN B NE2 1 
ATOM   2642  N N   . CYS B  1 179 ? 23.481 37.219 18.485  1.00 51.97  ? 206  CYS B N   1 
ATOM   2643  C CA  . CYS B  1 179 ? 24.851 36.770 18.273  1.00 55.06  ? 206  CYS B CA  1 
ATOM   2644  C C   . CYS B  1 179 ? 25.696 37.028 19.508  1.00 57.95  ? 206  CYS B C   1 
ATOM   2645  O O   . CYS B  1 179 ? 26.692 36.345 19.743  1.00 59.38  ? 206  CYS B O   1 
ATOM   2646  C CB  . CYS B  1 179 ? 25.485 37.469 17.075  1.00 53.24  ? 206  CYS B CB  1 
ATOM   2647  S SG  . CYS B  1 179 ? 24.783 36.988 15.464  1.00 54.51  ? 206  CYS B SG  1 
ATOM   2648  N N   . SER B  1 180 ? 25.296 38.019 20.296  1.00 61.10  ? 207  SER B N   1 
ATOM   2649  C CA  . SER B  1 180 ? 26.009 38.360 21.517  1.00 63.30  ? 207  SER B CA  1 
ATOM   2650  C C   . SER B  1 180 ? 25.279 37.718 22.698  1.00 64.61  ? 207  SER B C   1 
ATOM   2651  O O   . SER B  1 180 ? 24.570 38.394 23.436  1.00 64.35  ? 207  SER B O   1 
ATOM   2652  C CB  . SER B  1 180 ? 26.051 39.880 21.687  1.00 63.59  ? 207  SER B CB  1 
ATOM   2653  O OG  . SER B  1 180 ? 24.742 40.403 21.843  1.00 65.11  ? 207  SER B OG  1 
ATOM   2654  N N   . GLU B  1 181 ? 25.421 36.402 22.849  1.00 67.05  ? 208  GLU B N   1 
ATOM   2655  C CA  . GLU B  1 181 ? 24.774 35.668 23.945  1.00 68.98  ? 208  GLU B CA  1 
ATOM   2656  C C   . GLU B  1 181 ? 25.715 34.696 24.652  1.00 69.51  ? 208  GLU B C   1 
ATOM   2657  O O   . GLU B  1 181 ? 25.371 33.496 24.709  1.00 69.62  ? 208  GLU B O   1 
ATOM   2658  C CB  . GLU B  1 181 ? 23.553 34.890 23.434  1.00 69.68  ? 208  GLU B CB  1 
ATOM   2659  C CG  . GLU B  1 181 ? 22.235 35.644 23.563  1.00 72.76  ? 208  GLU B CG  1 
ATOM   2660  C CD  . GLU B  1 181 ? 21.041 34.859 23.024  1.00 73.67  ? 208  GLU B CD  1 
ATOM   2661  O OE1 . GLU B  1 181 ? 20.988 33.632 23.263  1.00 74.39  ? 208  GLU B OE1 1 
ATOM   2662  O OE2 . GLU B  1 181 ? 20.154 35.469 22.379  1.00 73.55  ? 208  GLU B OE2 1 
ATOM   2663  N N   . VAL B  1 182 ? 26.777 35.140 25.146  1.00 70.33  ? 209  VAL B N   1 
ATOM   2664  N N   . ASN C  1 10  ? 74.893 13.432 30.432  1.00 57.89  ? 37   ASN C N   1 
ATOM   2665  C CA  . ASN C  1 10  ? 75.691 14.681 30.663  1.00 57.53  ? 37   ASN C CA  1 
ATOM   2666  C C   . ASN C  1 10  ? 74.929 15.628 31.599  1.00 55.92  ? 37   ASN C C   1 
ATOM   2667  O O   . ASN C  1 10  ? 74.465 15.231 32.669  1.00 56.42  ? 37   ASN C O   1 
ATOM   2668  C CB  . ASN C  1 10  ? 75.965 15.378 29.315  1.00 57.87  ? 37   ASN C CB  1 
ATOM   2669  N N   . THR C  1 11  ? 74.813 16.884 31.187  1.00 53.33  ? 38   THR C N   1 
ATOM   2670  C CA  . THR C  1 11  ? 74.082 17.869 31.958  1.00 50.19  ? 38   THR C CA  1 
ATOM   2671  C C   . THR C  1 11  ? 72.661 17.782 31.458  1.00 49.18  ? 38   THR C C   1 
ATOM   2672  O O   . THR C  1 11  ? 71.735 18.318 32.058  1.00 48.43  ? 38   THR C O   1 
ATOM   2673  C CB  . THR C  1 11  ? 74.546 19.256 31.649  1.00 48.88  ? 38   THR C CB  1 
ATOM   2674  O OG1 . THR C  1 11  ? 75.967 19.279 31.600  1.00 51.43  ? 38   THR C OG1 1 
ATOM   2675  C CG2 . THR C  1 11  ? 74.096 20.179 32.705  1.00 50.09  ? 38   THR C CG2 1 
ATOM   2676  N N   . ILE C  1 12  ? 72.524 17.096 30.331  1.00 48.01  ? 39   ILE C N   1 
ATOM   2677  C CA  . ILE C  1 12  ? 71.260 16.921 29.657  1.00 47.14  ? 39   ILE C CA  1 
ATOM   2678  C C   . ILE C  1 12  ? 70.238 16.166 30.493  1.00 47.77  ? 39   ILE C C   1 
ATOM   2679  O O   . ILE C  1 12  ? 69.037 16.169 30.200  1.00 46.89  ? 39   ILE C O   1 
ATOM   2680  C CB  . ILE C  1 12  ? 71.476 16.200 28.319  1.00 46.78  ? 39   ILE C CB  1 
ATOM   2681  C CG1 . ILE C  1 12  ? 70.224 16.357 27.453  1.00 48.10  ? 39   ILE C CG1 1 
ATOM   2682  C CG2 . ILE C  1 12  ? 71.806 14.737 28.562  1.00 45.33  ? 39   ILE C CG2 1 
ATOM   2683  C CD1 . ILE C  1 12  ? 70.446 16.147 25.976  1.00 48.85  ? 39   ILE C CD1 1 
ATOM   2684  N N   . HIS C  1 13  ? 70.710 15.521 31.546  1.00 48.46  ? 40   HIS C N   1 
ATOM   2685  C CA  . HIS C  1 13  ? 69.800 14.786 32.405  1.00 48.97  ? 40   HIS C CA  1 
ATOM   2686  C C   . HIS C  1 13  ? 69.219 15.758 33.414  1.00 46.16  ? 40   HIS C C   1 
ATOM   2687  O O   . HIS C  1 13  ? 68.147 15.526 33.968  1.00 46.88  ? 40   HIS C O   1 
ATOM   2688  C CB  . HIS C  1 13  ? 70.544 13.647 33.086  1.00 54.26  ? 40   HIS C CB  1 
ATOM   2689  C CG  . HIS C  1 13  ? 71.221 12.726 32.121  1.00 59.50  ? 40   HIS C CG  1 
ATOM   2690  N ND1 . HIS C  1 13  ? 70.579 12.214 31.011  1.00 60.96  ? 40   HIS C ND1 1 
ATOM   2691  C CD2 . HIS C  1 13  ? 72.481 12.227 32.091  1.00 61.52  ? 40   HIS C CD2 1 
ATOM   2692  C CE1 . HIS C  1 13  ? 71.413 11.439 30.340  1.00 62.67  ? 40   HIS C CE1 1 
ATOM   2693  N NE2 . HIS C  1 13  ? 72.574 11.429 30.974  1.00 63.48  ? 40   HIS C NE2 1 
ATOM   2694  N N   . GLU C  1 14  ? 69.936 16.856 33.632  1.00 41.87  ? 41   GLU C N   1 
ATOM   2695  C CA  . GLU C  1 14  ? 69.497 17.913 34.531  1.00 38.46  ? 41   GLU C CA  1 
ATOM   2696  C C   . GLU C  1 14  ? 68.341 18.708 33.874  1.00 36.34  ? 41   GLU C C   1 
ATOM   2697  O O   . GLU C  1 14  ? 68.027 19.846 34.262  1.00 33.57  ? 41   GLU C O   1 
ATOM   2698  C CB  . GLU C  1 14  ? 70.669 18.831 34.828  1.00 39.22  ? 41   GLU C CB  1 
ATOM   2699  N N   . PHE C  1 15  ? 67.730 18.102 32.853  1.00 35.01  ? 42   PHE C N   1 
ATOM   2700  C CA  . PHE C  1 15  ? 66.614 18.728 32.143  1.00 32.42  ? 42   PHE C CA  1 
ATOM   2701  C C   . PHE C  1 15  ? 65.485 17.731 31.964  1.00 31.46  ? 42   PHE C C   1 
ATOM   2702  O O   . PHE C  1 15  ? 65.698 16.516 32.035  1.00 32.55  ? 42   PHE C O   1 
ATOM   2703  C CB  . PHE C  1 15  ? 67.027 19.211 30.751  1.00 31.12  ? 42   PHE C CB  1 
ATOM   2704  C CG  . PHE C  1 15  ? 68.083 20.265 30.753  1.00 32.20  ? 42   PHE C CG  1 
ATOM   2705  C CD1 . PHE C  1 15  ? 69.427 19.924 30.830  1.00 32.00  ? 42   PHE C CD1 1 
ATOM   2706  C CD2 . PHE C  1 15  ? 67.737 21.606 30.680  1.00 33.17  ? 42   PHE C CD2 1 
ATOM   2707  C CE1 . PHE C  1 15  ? 70.408 20.901 30.835  1.00 31.70  ? 42   PHE C CE1 1 
ATOM   2708  C CE2 . PHE C  1 15  ? 68.714 22.593 30.684  1.00 32.89  ? 42   PHE C CE2 1 
ATOM   2709  C CZ  . PHE C  1 15  ? 70.051 22.239 30.761  1.00 32.67  ? 42   PHE C CZ  1 
ATOM   2710  N N   . LYS C  1 16  ? 64.288 18.254 31.711  1.00 28.05  ? 43   LYS C N   1 
ATOM   2711  C CA  . LYS C  1 16  ? 63.104 17.423 31.496  1.00 26.07  ? 43   LYS C CA  1 
ATOM   2712  C C   . LYS C  1 16  ? 62.824 17.396 29.996  1.00 24.32  ? 43   LYS C C   1 
ATOM   2713  O O   . LYS C  1 16  ? 62.422 18.387 29.420  1.00 25.04  ? 43   LYS C O   1 
ATOM   2714  C CB  . LYS C  1 16  ? 61.928 18.025 32.254  1.00 26.90  ? 43   LYS C CB  1 
ATOM   2715  C CG  . LYS C  1 16  ? 60.583 17.383 32.019  1.00 27.25  ? 43   LYS C CG  1 
ATOM   2716  C CD  . LYS C  1 16  ? 59.531 18.293 32.637  1.00 31.47  ? 43   LYS C CD  1 
ATOM   2717  C CE  . LYS C  1 16  ? 58.105 17.938 32.265  1.00 32.86  ? 43   LYS C CE  1 
ATOM   2718  N NZ  . LYS C  1 16  ? 57.169 19.029 32.708  1.00 32.39  ? 43   LYS C NZ  1 
ATOM   2719  N N   . LYS C  1 17  ? 63.028 16.259 29.355  1.00 23.10  ? 44   LYS C N   1 
ATOM   2720  C CA  . LYS C  1 17  ? 62.821 16.174 27.912  1.00 21.38  ? 44   LYS C CA  1 
ATOM   2721  C C   . LYS C  1 17  ? 61.393 16.005 27.485  1.00 20.96  ? 44   LYS C C   1 
ATOM   2722  O O   . LYS C  1 17  ? 60.616 15.321 28.123  1.00 21.11  ? 44   LYS C O   1 
ATOM   2723  C CB  . LYS C  1 17  ? 63.651 15.032 27.325  1.00 20.75  ? 44   LYS C CB  1 
ATOM   2724  C CG  . LYS C  1 17  ? 63.424 14.717 25.873  1.00 18.31  ? 44   LYS C CG  1 
ATOM   2725  C CD  . LYS C  1 17  ? 64.544 13.797 25.441  1.00 23.40  ? 44   LYS C CD  1 
ATOM   2726  C CE  . LYS C  1 17  ? 64.394 13.288 24.022  1.00 26.78  ? 44   LYS C CE  1 
ATOM   2727  N NZ  . LYS C  1 17  ? 63.379 12.194 23.869  1.00 29.48  ? 44   LYS C NZ  1 
ATOM   2728  N N   . SER C  1 18  ? 61.059 16.640 26.377  1.00 22.80  ? 45   SER C N   1 
ATOM   2729  C CA  . SER C  1 18  ? 59.718 16.561 25.809  1.00 23.26  ? 45   SER C CA  1 
ATOM   2730  C C   . SER C  1 18  ? 59.855 16.339 24.311  1.00 23.10  ? 45   SER C C   1 
ATOM   2731  O O   . SER C  1 18  ? 59.903 17.288 23.534  1.00 22.09  ? 45   SER C O   1 
ATOM   2732  C CB  . SER C  1 18  ? 58.948 17.841 26.082  1.00 22.19  ? 45   SER C CB  1 
ATOM   2733  O OG  . SER C  1 18  ? 58.682 17.949 27.461  1.00 26.36  ? 45   SER C OG  1 
ATOM   2734  N N   . ALA C  1 19  ? 59.937 15.067 23.928  1.00 24.31  ? 46   ALA C N   1 
ATOM   2735  C CA  . ALA C  1 19  ? 60.100 14.650 22.535  1.00 24.88  ? 46   ALA C CA  1 
ATOM   2736  C C   . ALA C  1 19  ? 59.168 15.345 21.547  1.00 25.16  ? 46   ALA C C   1 
ATOM   2737  O O   . ALA C  1 19  ? 58.080 15.782 21.918  1.00 24.29  ? 46   ALA C O   1 
ATOM   2738  C CB  . ALA C  1 19  ? 59.920 13.145 22.431  1.00 25.20  ? 46   ALA C CB  1 
ATOM   2739  N N   . LYS C  1 20  ? 59.609 15.451 20.289  1.00 25.75  ? 47   LYS C N   1 
ATOM   2740  C CA  . LYS C  1 20  ? 58.834 16.062 19.195  1.00 26.35  ? 47   LYS C CA  1 
ATOM   2741  C C   . LYS C  1 20  ? 58.156 17.358 19.577  1.00 26.01  ? 47   LYS C C   1 
ATOM   2742  O O   . LYS C  1 20  ? 57.009 17.613 19.197  1.00 25.51  ? 47   LYS C O   1 
ATOM   2743  C CB  . LYS C  1 20  ? 57.759 15.094 18.682  1.00 27.50  ? 47   LYS C CB  1 
ATOM   2744  C CG  . LYS C  1 20  ? 58.288 13.885 17.941  1.00 29.89  ? 47   LYS C CG  1 
ATOM   2745  C CD  . LYS C  1 20  ? 57.266 12.748 17.932  1.00 33.01  ? 47   LYS C CD  1 
ATOM   2746  C CE  . LYS C  1 20  ? 57.635 11.651 16.910  1.00 35.44  ? 47   LYS C CE  1 
ATOM   2747  N NZ  . LYS C  1 20  ? 57.639 12.090 15.455  1.00 35.03  ? 47   LYS C NZ  1 
ATOM   2748  N N   . THR C  1 21  ? 58.867 18.190 20.320  1.00 25.71  ? 48   THR C N   1 
ATOM   2749  C CA  . THR C  1 21  ? 58.276 19.452 20.729  1.00 25.17  ? 48   THR C CA  1 
ATOM   2750  C C   . THR C  1 21  ? 59.229 20.625 20.576  1.00 25.02  ? 48   THR C C   1 
ATOM   2751  O O   . THR C  1 21  ? 60.436 20.458 20.423  1.00 25.37  ? 48   THR C O   1 
ATOM   2752  C CB  . THR C  1 21  ? 57.808 19.379 22.192  1.00 25.02  ? 48   THR C CB  1 
ATOM   2753  O OG1 . THR C  1 21  ? 57.028 18.188 22.377  1.00 26.04  ? 48   THR C OG1 1 
ATOM   2754  C CG2 . THR C  1 21  ? 56.971 20.589 22.544  1.00 22.51  ? 48   THR C CG2 1 
ATOM   2755  N N   . THR C  1 22  ? 58.660 21.819 20.613  1.00 24.46  ? 49   THR C N   1 
ATOM   2756  C CA  . THR C  1 22  ? 59.425 23.058 20.524  1.00 25.65  ? 49   THR C CA  1 
ATOM   2757  C C   . THR C  1 22  ? 58.520 24.177 21.040  1.00 26.21  ? 49   THR C C   1 
ATOM   2758  O O   . THR C  1 22  ? 57.325 23.955 21.263  1.00 25.66  ? 49   THR C O   1 
ATOM   2759  C CB  . THR C  1 22  ? 59.850 23.361 19.082  1.00 25.36  ? 49   THR C CB  1 
ATOM   2760  O OG1 . THR C  1 22  ? 60.636 24.559 19.060  1.00 25.72  ? 49   THR C OG1 1 
ATOM   2761  C CG2 . THR C  1 22  ? 58.642 23.559 18.214  1.00 23.45  ? 49   THR C CG2 1 
ATOM   2762  N N   . LEU C  1 23  ? 59.075 25.366 21.248  1.00 26.69  ? 50   LEU C N   1 
ATOM   2763  C CA  . LEU C  1 23  ? 58.268 26.474 21.752  1.00 29.13  ? 50   LEU C CA  1 
ATOM   2764  C C   . LEU C  1 23  ? 58.303 27.669 20.818  1.00 31.61  ? 50   LEU C C   1 
ATOM   2765  O O   . LEU C  1 23  ? 59.371 28.050 20.363  1.00 33.47  ? 50   LEU C O   1 
ATOM   2766  C CB  . LEU C  1 23  ? 58.776 26.909 23.118  1.00 26.88  ? 50   LEU C CB  1 
ATOM   2767  C CG  . LEU C  1 23  ? 59.005 25.794 24.129  1.00 24.76  ? 50   LEU C CG  1 
ATOM   2768  C CD1 . LEU C  1 23  ? 59.895 26.331 25.226  1.00 23.46  ? 50   LEU C CD1 1 
ATOM   2769  C CD2 . LEU C  1 23  ? 57.690 25.287 24.666  1.00 22.48  ? 50   LEU C CD2 1 
ATOM   2770  N N   . ILE C  1 24  ? 57.144 28.255 20.526  1.00 35.18  ? 51   ILE C N   1 
ATOM   2771  C CA  . ILE C  1 24  ? 57.079 29.433 19.652  1.00 40.30  ? 51   ILE C CA  1 
ATOM   2772  C C   . ILE C  1 24  ? 56.624 30.581 20.546  1.00 43.66  ? 51   ILE C C   1 
ATOM   2773  O O   . ILE C  1 24  ? 55.754 30.386 21.412  1.00 42.61  ? 51   ILE C O   1 
ATOM   2774  C CB  . ILE C  1 24  ? 56.050 29.267 18.513  1.00 40.17  ? 51   ILE C CB  1 
ATOM   2775  C CG1 . ILE C  1 24  ? 54.653 29.136 19.114  1.00 43.11  ? 51   ILE C CG1 1 
ATOM   2776  C CG2 . ILE C  1 24  ? 56.388 28.063 17.665  1.00 37.40  ? 51   ILE C CG2 1 
ATOM   2777  C CD1 . ILE C  1 24  ? 53.538 28.964 18.106  1.00 47.89  ? 51   ILE C CD1 1 
ATOM   2778  N N   . LYS C  1 25  ? 57.203 31.766 20.339  1.00 47.38  ? 52   LYS C N   1 
ATOM   2779  C CA  . LYS C  1 25  ? 56.876 32.934 21.166  1.00 51.64  ? 52   LYS C CA  1 
ATOM   2780  C C   . LYS C  1 25  ? 55.811 33.883 20.616  1.00 54.08  ? 52   LYS C C   1 
ATOM   2781  O O   . LYS C  1 25  ? 56.063 34.664 19.694  1.00 54.69  ? 52   LYS C O   1 
ATOM   2782  C CB  . LYS C  1 25  ? 58.147 33.732 21.463  1.00 52.60  ? 52   LYS C CB  1 
ATOM   2783  C CG  . LYS C  1 25  ? 58.927 34.136 20.221  1.00 53.03  ? 52   LYS C CG  1 
ATOM   2784  C CD  . LYS C  1 25  ? 59.967 35.197 20.557  1.00 54.36  ? 52   LYS C CD  1 
ATOM   2785  C CE  . LYS C  1 25  ? 60.660 35.712 19.303  1.00 55.75  ? 52   LYS C CE  1 
ATOM   2786  N NZ  . LYS C  1 25  ? 61.365 37.013 19.516  1.00 57.65  ? 52   LYS C NZ  1 
ATOM   2787  N N   . ILE C  1 26  ? 54.622 33.814 21.206  1.00 56.69  ? 53   ILE C N   1 
ATOM   2788  C CA  . ILE C  1 26  ? 53.504 34.660 20.806  1.00 59.79  ? 53   ILE C CA  1 
ATOM   2789  C C   . ILE C  1 26  ? 53.992 36.102 20.850  1.00 61.58  ? 53   ILE C C   1 
ATOM   2790  O O   . ILE C  1 26  ? 53.811 36.864 19.911  1.00 61.15  ? 53   ILE C O   1 
ATOM   2791  C CB  . ILE C  1 26  ? 52.289 34.462 21.774  1.00 60.37  ? 53   ILE C CB  1 
ATOM   2792  C CG1 . ILE C  1 26  ? 51.687 33.060 21.589  1.00 60.23  ? 53   ILE C CG1 1 
ATOM   2793  C CG2 . ILE C  1 26  ? 51.234 35.537 21.539  1.00 60.54  ? 53   ILE C CG2 1 
ATOM   2794  C CD1 . ILE C  1 26  ? 51.081 32.789 20.192  1.00 59.97  ? 53   ILE C CD1 1 
ATOM   2795  N N   . ASP C  1 27  ? 54.626 36.452 21.958  1.00 65.10  ? 54   ASP C N   1 
ATOM   2796  C CA  . ASP C  1 27  ? 55.182 37.780 22.165  1.00 69.06  ? 54   ASP C CA  1 
ATOM   2797  C C   . ASP C  1 27  ? 56.404 37.866 21.248  1.00 70.59  ? 54   ASP C C   1 
ATOM   2798  O O   . ASP C  1 27  ? 57.156 36.903 21.136  1.00 71.49  ? 54   ASP C O   1 
ATOM   2799  C CB  . ASP C  1 27  ? 55.619 37.909 23.631  1.00 71.61  ? 54   ASP C CB  1 
ATOM   2800  C CG  . ASP C  1 27  ? 56.082 39.318 24.004  1.00 74.22  ? 54   ASP C CG  1 
ATOM   2801  O OD1 . ASP C  1 27  ? 56.606 40.042 23.126  1.00 73.99  ? 54   ASP C OD1 1 
ATOM   2802  O OD2 . ASP C  1 27  ? 55.935 39.687 25.197  1.00 75.61  ? 54   ASP C OD2 1 
ATOM   2803  N N   . PRO C  1 28  ? 56.606 39.006 20.562  1.00 71.68  ? 55   PRO C N   1 
ATOM   2804  C CA  . PRO C  1 28  ? 57.777 39.105 19.686  1.00 71.92  ? 55   PRO C CA  1 
ATOM   2805  C C   . PRO C  1 28  ? 58.909 39.738 20.483  1.00 71.71  ? 55   PRO C C   1 
ATOM   2806  O O   . PRO C  1 28  ? 60.078 39.634 20.117  1.00 71.94  ? 55   PRO C O   1 
ATOM   2807  C CB  . PRO C  1 28  ? 57.290 40.020 18.573  1.00 71.92  ? 55   PRO C CB  1 
ATOM   2808  C CG  . PRO C  1 28  ? 56.489 41.032 19.355  1.00 72.53  ? 55   PRO C CG  1 
ATOM   2809  C CD  . PRO C  1 28  ? 55.696 40.149 20.339  1.00 72.98  ? 55   PRO C CD  1 
ATOM   2810  N N   . ALA C  1 29  ? 58.532 40.395 21.576  1.00 71.52  ? 56   ALA C N   1 
ATOM   2811  C CA  . ALA C  1 29  ? 59.473 41.077 22.455  1.00 72.03  ? 56   ALA C CA  1 
ATOM   2812  C C   . ALA C  1 29  ? 60.499 40.136 23.084  1.00 72.04  ? 56   ALA C C   1 
ATOM   2813  O O   . ALA C  1 29  ? 61.621 40.550 23.391  1.00 72.63  ? 56   ALA C O   1 
ATOM   2814  C CB  . ALA C  1 29  ? 58.707 41.818 23.557  1.00 71.90  ? 56   ALA C CB  1 
ATOM   2815  N N   . LEU C  1 30  ? 60.112 38.875 23.267  1.00 70.43  ? 57   LEU C N   1 
ATOM   2816  C CA  . LEU C  1 30  ? 60.976 37.873 23.887  1.00 68.13  ? 57   LEU C CA  1 
ATOM   2817  C C   . LEU C  1 30  ? 62.213 37.562 23.052  1.00 65.81  ? 57   LEU C C   1 
ATOM   2818  O O   . LEU C  1 30  ? 62.103 37.188 21.889  1.00 64.83  ? 57   LEU C O   1 
ATOM   2819  C CB  . LEU C  1 30  ? 60.173 36.595 24.125  1.00 69.81  ? 57   LEU C CB  1 
ATOM   2820  C CG  . LEU C  1 30  ? 58.807 36.836 24.785  1.00 70.98  ? 57   LEU C CG  1 
ATOM   2821  C CD1 . LEU C  1 30  ? 57.889 35.604 24.630  1.00 71.65  ? 57   LEU C CD1 1 
ATOM   2822  C CD2 . LEU C  1 30  ? 59.031 37.198 26.242  1.00 70.87  ? 57   LEU C CD2 1 
ATOM   2823  N N   . LYS C  1 31  ? 63.390 37.720 23.655  1.00 63.59  ? 58   LYS C N   1 
ATOM   2824  C CA  . LYS C  1 31  ? 64.655 37.454 22.970  1.00 60.64  ? 58   LYS C CA  1 
ATOM   2825  C C   . LYS C  1 31  ? 64.925 35.953 22.891  1.00 58.01  ? 58   LYS C C   1 
ATOM   2826  O O   . LYS C  1 31  ? 64.292 35.165 23.581  1.00 59.20  ? 58   LYS C O   1 
ATOM   2827  C CB  . LYS C  1 31  ? 65.796 38.152 23.696  1.00 60.82  ? 58   LYS C CB  1 
ATOM   2828  N N   . ILE C  1 32  ? 65.879 35.569 22.054  1.00 53.94  ? 59   ILE C N   1 
ATOM   2829  C CA  . ILE C  1 32  ? 66.240 34.169 21.845  1.00 50.11  ? 59   ILE C CA  1 
ATOM   2830  C C   . ILE C  1 32  ? 67.682 34.150 21.365  1.00 48.86  ? 59   ILE C C   1 
ATOM   2831  O O   . ILE C  1 32  ? 68.267 35.203 21.124  1.00 49.44  ? 59   ILE C O   1 
ATOM   2832  C CB  . ILE C  1 32  ? 65.330 33.511 20.754  1.00 49.22  ? 59   ILE C CB  1 
ATOM   2833  C CG1 . ILE C  1 32  ? 63.898 33.387 21.275  1.00 50.10  ? 59   ILE C CG1 1 
ATOM   2834  C CG2 . ILE C  1 32  ? 65.851 32.143 20.344  1.00 45.63  ? 59   ILE C CG2 1 
ATOM   2835  C CD1 . ILE C  1 32  ? 62.945 32.678 20.309  1.00 50.98  ? 59   ILE C CD1 1 
ATOM   2836  N N   . LYS C  1 33  ? 68.249 32.957 21.242  1.00 47.10  ? 60   LYS C N   1 
ATOM   2837  C CA  . LYS C  1 33  ? 69.607 32.791 20.780  1.00 45.46  ? 60   LYS C CA  1 
ATOM   2838  C C   . LYS C  1 33  ? 69.787 31.374 20.257  1.00 44.90  ? 60   LYS C C   1 
ATOM   2839  O O   . LYS C  1 33  ? 69.270 30.416 20.822  1.00 43.86  ? 60   LYS C O   1 
ATOM   2840  C CB  . LYS C  1 33  ? 70.594 33.081 21.904  1.00 46.07  ? 60   LYS C CB  1 
ATOM   2841  C CG  . LYS C  1 33  ? 72.050 32.910 21.480  1.00 48.09  ? 60   LYS C CG  1 
ATOM   2842  C CD  . LYS C  1 33  ? 72.846 34.209 21.494  1.00 47.83  ? 60   LYS C CD  1 
ATOM   2843  C CE  . LYS C  1 33  ? 74.295 33.907 21.134  1.00 49.26  ? 60   LYS C CE  1 
ATOM   2844  N NZ  . LYS C  1 33  ? 75.266 34.962 21.569  1.00 52.23  ? 60   LYS C NZ  1 
ATOM   2845  N N   . THR C  1 34  ? 70.535 31.253 19.168  1.00 45.33  ? 61   THR C N   1 
ATOM   2846  C CA  . THR C  1 34  ? 70.753 29.968 18.519  1.00 45.88  ? 61   THR C CA  1 
ATOM   2847  C C   . THR C  1 34  ? 72.189 29.758 18.064  1.00 45.54  ? 61   THR C C   1 
ATOM   2848  O O   . THR C  1 34  ? 72.989 30.703 18.032  1.00 45.59  ? 61   THR C O   1 
ATOM   2849  C CB  . THR C  1 34  ? 69.843 29.843 17.276  1.00 47.42  ? 61   THR C CB  1 
ATOM   2850  O OG1 . THR C  1 34  ? 70.241 30.813 16.296  1.00 48.56  ? 61   THR C OG1 1 
ATOM   2851  C CG2 . THR C  1 34  ? 68.382 30.111 17.650  1.00 48.67  ? 61   THR C CG2 1 
ATOM   2852  N N   . LYS C  1 35  ? 72.506 28.504 17.733  1.00 44.49  ? 62   LYS C N   1 
ATOM   2853  C CA  . LYS C  1 35  ? 73.833 28.115 17.240  1.00 44.79  ? 62   LYS C CA  1 
ATOM   2854  C C   . LYS C  1 35  ? 73.805 26.666 16.760  1.00 45.23  ? 62   LYS C C   1 
ATOM   2855  O O   . LYS C  1 35  ? 73.219 25.804 17.406  1.00 46.28  ? 62   LYS C O   1 
ATOM   2856  C CB  . LYS C  1 35  ? 74.892 28.291 18.326  1.00 42.95  ? 62   LYS C CB  1 
ATOM   2857  N N   . LYS C  1 36  ? 74.422 26.413 15.608  1.00 45.82  ? 63   LYS C N   1 
ATOM   2858  C CA  . LYS C  1 36  ? 74.477 25.073 15.021  1.00 46.05  ? 63   LYS C CA  1 
ATOM   2859  C C   . LYS C  1 36  ? 75.601 24.285 15.689  1.00 45.91  ? 63   LYS C C   1 
ATOM   2860  O O   . LYS C  1 36  ? 76.742 24.726 15.698  1.00 46.40  ? 63   LYS C O   1 
ATOM   2861  C CB  . LYS C  1 36  ? 74.723 25.166 13.505  1.00 44.26  ? 63   LYS C CB  1 
ATOM   2862  N N   . VAL C  1 37  ? 75.279 23.129 16.261  1.00 46.34  ? 64   VAL C N   1 
ATOM   2863  C CA  . VAL C  1 37  ? 76.283 22.315 16.936  1.00 47.28  ? 64   VAL C CA  1 
ATOM   2864  C C   . VAL C  1 37  ? 76.246 20.865 16.497  1.00 48.60  ? 64   VAL C C   1 
ATOM   2865  O O   . VAL C  1 37  ? 75.648 20.533 15.475  1.00 50.35  ? 64   VAL C O   1 
ATOM   2866  C CB  . VAL C  1 37  ? 76.097 22.360 18.458  1.00 47.42  ? 64   VAL C CB  1 
ATOM   2867  C CG1 . VAL C  1 37  ? 75.947 23.800 18.913  1.00 47.00  ? 64   VAL C CG1 1 
ATOM   2868  C CG2 . VAL C  1 37  ? 74.889 21.541 18.862  1.00 48.23  ? 64   VAL C CG2 1 
ATOM   2869  N N   . ASN C  1 38  ? 76.879 20.000 17.281  1.00 49.53  ? 65   ASN C N   1 
ATOM   2870  C CA  . ASN C  1 38  ? 76.931 18.576 16.961  1.00 51.58  ? 65   ASN C CA  1 
ATOM   2871  C C   . ASN C  1 38  ? 75.859 17.783 17.682  1.00 51.53  ? 65   ASN C C   1 
ATOM   2872  O O   . ASN C  1 38  ? 74.997 17.146 17.075  1.00 52.60  ? 65   ASN C O   1 
ATOM   2873  C CB  . ASN C  1 38  ? 78.288 17.965 17.360  1.00 54.25  ? 65   ASN C CB  1 
ATOM   2874  C CG  . ASN C  1 38  ? 79.454 18.502 16.551  1.00 55.71  ? 65   ASN C CG  1 
ATOM   2875  O OD1 . ASN C  1 38  ? 79.749 19.697 16.581  1.00 56.52  ? 65   ASN C OD1 1 
ATOM   2876  N ND2 . ASN C  1 38  ? 80.132 17.612 15.828  1.00 56.04  ? 65   ASN C ND2 1 
ATOM   2877  N N   . THR C  1 39  ? 75.936 17.814 19.000  1.00 50.87  ? 66   THR C N   1 
ATOM   2878  C CA  . THR C  1 39  ? 75.013 17.054 19.812  1.00 49.70  ? 66   THR C CA  1 
ATOM   2879  C C   . THR C  1 39  ? 74.163 17.940 20.691  1.00 49.37  ? 66   THR C C   1 
ATOM   2880  O O   . THR C  1 39  ? 74.522 19.082 20.966  1.00 49.29  ? 66   THR C O   1 
ATOM   2881  C CB  . THR C  1 39  ? 75.787 16.077 20.699  1.00 50.04  ? 66   THR C CB  1 
ATOM   2882  O OG1 . THR C  1 39  ? 76.628 16.818 21.597  1.00 49.53  ? 66   THR C OG1 1 
ATOM   2883  C CG2 . THR C  1 39  ? 76.654 15.158 19.837  1.00 48.51  ? 66   THR C CG2 1 
ATOM   2884  N N   . ALA C  1 40  ? 73.029 17.411 21.130  1.00 48.64  ? 67   ALA C N   1 
ATOM   2885  C CA  . ALA C  1 40  ? 72.144 18.173 21.996  1.00 49.16  ? 67   ALA C CA  1 
ATOM   2886  C C   . ALA C  1 40  ? 72.879 18.467 23.305  1.00 49.15  ? 67   ALA C C   1 
ATOM   2887  O O   . ALA C  1 40  ? 72.628 19.474 23.966  1.00 49.05  ? 67   ALA C O   1 
ATOM   2888  C CB  . ALA C  1 40  ? 70.866 17.385 22.262  1.00 48.45  ? 67   ALA C CB  1 
ATOM   2889  N N   . ASP C  1 41  ? 73.803 17.580 23.661  1.00 49.50  ? 68   ASP C N   1 
ATOM   2890  C CA  . ASP C  1 41  ? 74.593 17.728 24.881  1.00 49.28  ? 68   ASP C CA  1 
ATOM   2891  C C   . ASP C  1 41  ? 75.222 19.115 24.918  1.00 48.46  ? 68   ASP C C   1 
ATOM   2892  O O   . ASP C  1 41  ? 75.266 19.777 25.957  1.00 47.13  ? 68   ASP C O   1 
ATOM   2893  C CB  . ASP C  1 41  ? 75.694 16.670 24.923  1.00 50.53  ? 68   ASP C CB  1 
ATOM   2894  C CG  . ASP C  1 41  ? 75.171 15.281 24.646  1.00 52.28  ? 68   ASP C CG  1 
ATOM   2895  O OD1 . ASP C  1 41  ? 74.460 14.723 25.500  1.00 53.56  ? 68   ASP C OD1 1 
ATOM   2896  O OD2 . ASP C  1 41  ? 75.465 14.743 23.563  1.00 54.78  ? 68   ASP C OD2 1 
ATOM   2897  N N   . GLN C  1 42  ? 75.720 19.552 23.773  1.00 47.74  ? 69   GLN C N   1 
ATOM   2898  C CA  . GLN C  1 42  ? 76.322 20.863 23.701  1.00 47.20  ? 69   GLN C CA  1 
ATOM   2899  C C   . GLN C  1 42  ? 75.322 21.906 24.139  1.00 45.80  ? 69   GLN C C   1 
ATOM   2900  O O   . GLN C  1 42  ? 75.630 22.755 24.970  1.00 47.74  ? 69   GLN C O   1 
ATOM   2901  C CB  . GLN C  1 42  ? 76.792 21.155 22.283  1.00 48.36  ? 69   GLN C CB  1 
ATOM   2902  C CG  . GLN C  1 42  ? 78.090 20.474 21.936  1.00 49.77  ? 69   GLN C CG  1 
ATOM   2903  C CD  . GLN C  1 42  ? 78.496 20.729 20.515  1.00 50.73  ? 69   GLN C CD  1 
ATOM   2904  O OE1 . GLN C  1 42  ? 78.146 19.962 19.611  1.00 51.26  ? 69   GLN C OE1 1 
ATOM   2905  N NE2 . GLN C  1 42  ? 79.223 21.826 20.296  1.00 49.78  ? 69   GLN C NE2 1 
ATOM   2906  N N   . CYS C  1 43  ? 74.119 21.839 23.585  1.00 43.19  ? 70   CYS C N   1 
ATOM   2907  C CA  . CYS C  1 43  ? 73.084 22.792 23.943  1.00 41.41  ? 70   CYS C CA  1 
ATOM   2908  C C   . CYS C  1 43  ? 72.884 22.800 25.451  1.00 39.53  ? 70   CYS C C   1 
ATOM   2909  O O   . CYS C  1 43  ? 72.751 23.847 26.074  1.00 37.20  ? 70   CYS C O   1 
ATOM   2910  C CB  . CYS C  1 43  ? 71.767 22.404 23.292  1.00 42.53  ? 70   CYS C CB  1 
ATOM   2911  S SG  . CYS C  1 43  ? 71.841 22.136 21.509  1.00 41.75  ? 70   CYS C SG  1 
ATOM   2912  N N   . ALA C  1 44  ? 72.846 21.604 26.021  1.00 39.79  ? 71   ALA C N   1 
ATOM   2913  C CA  . ALA C  1 44  ? 72.656 21.423 27.451  1.00 40.87  ? 71   ALA C CA  1 
ATOM   2914  C C   . ALA C  1 44  ? 73.749 22.109 28.251  1.00 42.15  ? 71   ALA C C   1 
ATOM   2915  O O   . ALA C  1 44  ? 73.474 23.000 29.054  1.00 42.24  ? 71   ALA C O   1 
ATOM   2916  C CB  . ALA C  1 44  ? 72.629 19.950 27.777  1.00 39.59  ? 71   ALA C CB  1 
ATOM   2917  N N   . ASP C  1 45  ? 74.990 21.691 28.030  1.00 43.35  ? 72   ASP C N   1 
ATOM   2918  C CA  . ASP C  1 45  ? 76.112 22.280 28.740  1.00 44.53  ? 72   ASP C CA  1 
ATOM   2919  C C   . ASP C  1 45  ? 76.017 23.794 28.778  1.00 43.02  ? 72   ASP C C   1 
ATOM   2920  O O   . ASP C  1 45  ? 75.888 24.391 29.837  1.00 42.52  ? 72   ASP C O   1 
ATOM   2921  C CB  . ASP C  1 45  ? 77.436 21.877 28.086  1.00 48.62  ? 72   ASP C CB  1 
ATOM   2922  C CG  . ASP C  1 45  ? 77.755 20.399 28.276  1.00 53.08  ? 72   ASP C CG  1 
ATOM   2923  O OD1 . ASP C  1 45  ? 78.835 19.931 27.899  1.00 56.29  ? 72   ASP C OD1 1 
ATOM   2924  O OD2 . ASP C  1 45  ? 76.815 19.654 28.860  1.00 53.94  ? 72   ASP C OD2 1 
ATOM   2925  N N   . ARG C  1 46  ? 76.069 24.418 27.614  1.00 40.80  ? 73   ARG C N   1 
ATOM   2926  C CA  . ARG C  1 46  ? 76.020 25.862 27.568  1.00 39.82  ? 73   ARG C CA  1 
ATOM   2927  C C   . ARG C  1 46  ? 74.851 26.452 28.322  1.00 40.02  ? 73   ARG C C   1 
ATOM   2928  O O   . ARG C  1 46  ? 74.944 27.541 28.887  1.00 39.88  ? 73   ARG C O   1 
ATOM   2929  C CB  . ARG C  1 46  ? 75.978 26.351 26.123  1.00 38.42  ? 73   ARG C CB  1 
ATOM   2930  C CG  . ARG C  1 46  ? 75.793 27.862 26.014  1.00 36.80  ? 73   ARG C CG  1 
ATOM   2931  C CD  . ARG C  1 46  ? 76.417 28.371 24.753  1.00 35.30  ? 73   ARG C CD  1 
ATOM   2932  N NE  . ARG C  1 46  ? 76.234 29.802 24.565  1.00 32.73  ? 73   ARG C NE  1 
ATOM   2933  C CZ  . ARG C  1 46  ? 76.640 30.437 23.474  1.00 31.81  ? 73   ARG C CZ  1 
ATOM   2934  N NH1 . ARG C  1 46  ? 77.232 29.743 22.507  1.00 28.48  ? 73   ARG C NH1 1 
ATOM   2935  N NH2 . ARG C  1 46  ? 76.473 31.752 23.359  1.00 30.95  ? 73   ARG C NH2 1 
ATOM   2936  N N   . CYS C  1 47  ? 73.735 25.744 28.319  1.00 40.18  ? 74   CYS C N   1 
ATOM   2937  C CA  . CYS C  1 47  ? 72.568 26.264 28.995  1.00 40.14  ? 74   CYS C CA  1 
ATOM   2938  C C   . CYS C  1 47  ? 72.780 26.175 30.484  1.00 40.03  ? 74   CYS C C   1 
ATOM   2939  O O   . CYS C  1 47  ? 72.524 27.133 31.211  1.00 40.78  ? 74   CYS C O   1 
ATOM   2940  C CB  . CYS C  1 47  ? 71.327 25.488 28.585  1.00 39.61  ? 74   CYS C CB  1 
ATOM   2941  S SG  . CYS C  1 47  ? 69.772 26.013 29.394  1.00 41.76  ? 74   CYS C SG  1 
ATOM   2942  N N   . THR C  1 48  ? 73.265 25.029 30.940  1.00 40.20  ? 75   THR C N   1 
ATOM   2943  C CA  . THR C  1 48  ? 73.527 24.837 32.365  1.00 39.31  ? 75   THR C CA  1 
ATOM   2944  C C   . THR C  1 48  ? 74.483 25.919 32.870  1.00 38.68  ? 75   THR C C   1 
ATOM   2945  O O   . THR C  1 48  ? 74.224 26.556 33.872  1.00 37.89  ? 75   THR C O   1 
ATOM   2946  C CB  . THR C  1 48  ? 74.145 23.460 32.634  1.00 39.34  ? 75   THR C CB  1 
ATOM   2947  O OG1 . THR C  1 48  ? 73.458 22.480 31.852  1.00 40.49  ? 75   THR C OG1 1 
ATOM   2948  C CG2 . THR C  1 48  ? 74.019 23.096 34.100  1.00 36.65  ? 75   THR C CG2 1 
ATOM   2949  N N   . ARG C  1 49  ? 75.583 26.138 32.173  1.00 39.42  ? 76   ARG C N   1 
ATOM   2950  C CA  . ARG C  1 49  ? 76.534 27.152 32.590  1.00 41.39  ? 76   ARG C CA  1 
ATOM   2951  C C   . ARG C  1 49  ? 76.042 28.542 32.205  1.00 41.35  ? 76   ARG C C   1 
ATOM   2952  O O   . ARG C  1 49  ? 76.629 29.548 32.589  1.00 42.13  ? 76   ARG C O   1 
ATOM   2953  C CB  . ARG C  1 49  ? 77.885 26.860 31.942  1.00 43.35  ? 76   ARG C CB  1 
ATOM   2954  C CG  . ARG C  1 49  ? 78.402 25.486 32.323  1.00 47.82  ? 76   ARG C CG  1 
ATOM   2955  C CD  . ARG C  1 49  ? 79.536 25.014 31.434  1.00 52.55  ? 76   ARG C CD  1 
ATOM   2956  N NE  . ARG C  1 49  ? 80.008 23.693 31.847  1.00 58.13  ? 76   ARG C NE  1 
ATOM   2957  C CZ  . ARG C  1 49  ? 80.704 23.452 32.960  1.00 61.08  ? 76   ARG C CZ  1 
ATOM   2958  N NH1 . ARG C  1 49  ? 81.026 24.443 33.788  1.00 60.88  ? 76   ARG C NH1 1 
ATOM   2959  N NH2 . ARG C  1 49  ? 81.079 22.210 33.254  1.00 62.60  ? 76   ARG C NH2 1 
ATOM   2960  N N   . ASN C  1 50  ? 74.954 28.587 31.444  1.00 40.89  ? 77   ASN C N   1 
ATOM   2961  C CA  . ASN C  1 50  ? 74.381 29.845 30.985  1.00 39.21  ? 77   ASN C CA  1 
ATOM   2962  C C   . ASN C  1 50  ? 75.442 30.741 30.335  1.00 39.20  ? 77   ASN C C   1 
ATOM   2963  O O   . ASN C  1 50  ? 75.356 31.963 30.427  1.00 37.68  ? 77   ASN C O   1 
ATOM   2964  C CB  . ASN C  1 50  ? 73.745 30.583 32.159  1.00 38.26  ? 77   ASN C CB  1 
ATOM   2965  C CG  . ASN C  1 50  ? 72.700 31.606 31.723  1.00 40.15  ? 77   ASN C CG  1 
ATOM   2966  O OD1 . ASN C  1 50  ? 71.494 31.391 31.900  1.00 39.94  ? 77   ASN C OD1 1 
ATOM   2967  N ND2 . ASN C  1 50  ? 73.154 32.724 31.156  1.00 40.11  ? 77   ASN C ND2 1 
ATOM   2968  N N   . LYS C  1 51  ? 76.439 30.139 29.684  1.00 39.68  ? 78   LYS C N   1 
ATOM   2969  C CA  . LYS C  1 51  ? 77.506 30.897 29.020  1.00 40.72  ? 78   LYS C CA  1 
ATOM   2970  C C   . LYS C  1 51  ? 77.130 31.493 27.640  1.00 41.84  ? 78   LYS C C   1 
ATOM   2971  O O   . LYS C  1 51  ? 76.664 30.794 26.736  1.00 42.60  ? 78   LYS C O   1 
ATOM   2972  C CB  . LYS C  1 51  ? 78.752 30.017 28.884  1.00 38.72  ? 78   LYS C CB  1 
ATOM   2973  N N   . GLY C  1 52  ? 77.344 32.796 27.493  1.00 42.13  ? 79   GLY C N   1 
ATOM   2974  C CA  . GLY C  1 52  ? 77.059 33.477 26.244  1.00 43.08  ? 79   GLY C CA  1 
ATOM   2975  C C   . GLY C  1 52  ? 75.603 33.773 25.971  1.00 44.59  ? 79   GLY C C   1 
ATOM   2976  O O   . GLY C  1 52  ? 75.234 34.042 24.829  1.00 46.61  ? 79   GLY C O   1 
ATOM   2977  N N   . LEU C  1 53  ? 74.769 33.748 27.003  1.00 44.87  ? 80   LEU C N   1 
ATOM   2978  C CA  . LEU C  1 53  ? 73.345 33.996 26.804  1.00 44.31  ? 80   LEU C CA  1 
ATOM   2979  C C   . LEU C  1 53  ? 72.904 35.229 27.566  1.00 42.91  ? 80   LEU C C   1 
ATOM   2980  O O   . LEU C  1 53  ? 72.932 35.253 28.793  1.00 44.01  ? 80   LEU C O   1 
ATOM   2981  C CB  . LEU C  1 53  ? 72.537 32.777 27.260  1.00 45.36  ? 80   LEU C CB  1 
ATOM   2982  C CG  . LEU C  1 53  ? 73.053 31.450 26.693  1.00 46.31  ? 80   LEU C CG  1 
ATOM   2983  C CD1 . LEU C  1 53  ? 72.314 30.296 27.333  1.00 46.56  ? 80   LEU C CD1 1 
ATOM   2984  C CD2 . LEU C  1 53  ? 72.906 31.440 25.179  1.00 47.07  ? 80   LEU C CD2 1 
ATOM   2985  N N   . PRO C  1 54  ? 72.487 36.272 26.841  1.00 41.00  ? 81   PRO C N   1 
ATOM   2986  C CA  . PRO C  1 54  ? 72.029 37.540 27.410  1.00 39.86  ? 81   PRO C CA  1 
ATOM   2987  C C   . PRO C  1 54  ? 70.752 37.416 28.211  1.00 39.37  ? 81   PRO C C   1 
ATOM   2988  O O   . PRO C  1 54  ? 69.937 38.333 28.239  1.00 38.39  ? 81   PRO C O   1 
ATOM   2989  C CB  . PRO C  1 54  ? 71.856 38.421 26.186  1.00 39.71  ? 81   PRO C CB  1 
ATOM   2990  C CG  . PRO C  1 54  ? 71.461 37.439 25.142  1.00 39.68  ? 81   PRO C CG  1 
ATOM   2991  C CD  . PRO C  1 54  ? 72.423 36.310 25.375  1.00 40.30  ? 81   PRO C CD  1 
ATOM   2992  N N   . PHE C  1 55  ? 70.584 36.269 28.855  1.00 40.03  ? 82   PHE C N   1 
ATOM   2993  C CA  . PHE C  1 55  ? 69.416 35.998 29.690  1.00 41.35  ? 82   PHE C CA  1 
ATOM   2994  C C   . PHE C  1 55  ? 69.630 34.683 30.427  1.00 41.02  ? 82   PHE C C   1 
ATOM   2995  O O   . PHE C  1 55  ? 70.642 34.005 30.215  1.00 41.22  ? 82   PHE C O   1 
ATOM   2996  C CB  . PHE C  1 55  ? 68.138 35.922 28.834  1.00 43.87  ? 82   PHE C CB  1 
ATOM   2997  C CG  . PHE C  1 55  ? 68.226 34.950 27.670  1.00 45.59  ? 82   PHE C CG  1 
ATOM   2998  C CD1 . PHE C  1 55  ? 68.314 33.572 27.884  1.00 44.86  ? 82   PHE C CD1 1 
ATOM   2999  C CD2 . PHE C  1 55  ? 68.263 35.420 26.363  1.00 45.54  ? 82   PHE C CD2 1 
ATOM   3000  C CE1 . PHE C  1 55  ? 68.444 32.682 26.814  1.00 44.19  ? 82   PHE C CE1 1 
ATOM   3001  C CE2 . PHE C  1 55  ? 68.393 34.535 25.290  1.00 46.07  ? 82   PHE C CE2 1 
ATOM   3002  C CZ  . PHE C  1 55  ? 68.486 33.163 25.517  1.00 44.36  ? 82   PHE C CZ  1 
ATOM   3003  N N   . THR C  1 56  ? 68.689 34.325 31.297  1.00 40.05  ? 83   THR C N   1 
ATOM   3004  C CA  . THR C  1 56  ? 68.801 33.072 32.035  1.00 40.49  ? 83   THR C CA  1 
ATOM   3005  C C   . THR C  1 56  ? 68.245 31.976 31.135  1.00 38.62  ? 83   THR C C   1 
ATOM   3006  O O   . THR C  1 56  ? 67.100 32.066 30.698  1.00 38.07  ? 83   THR C O   1 
ATOM   3007  C CB  . THR C  1 56  ? 67.968 33.096 33.337  1.00 42.83  ? 83   THR C CB  1 
ATOM   3008  O OG1 . THR C  1 56  ? 68.226 34.305 34.059  1.00 44.80  ? 83   THR C OG1 1 
ATOM   3009  C CG2 . THR C  1 56  ? 68.343 31.914 34.222  1.00 43.95  ? 83   THR C CG2 1 
ATOM   3010  N N   . CYS C  1 57  ? 69.047 30.955 30.845  1.00 35.98  ? 84   CYS C N   1 
ATOM   3011  C CA  . CYS C  1 57  ? 68.580 29.877 29.993  1.00 34.84  ? 84   CYS C CA  1 
ATOM   3012  C C   . CYS C  1 57  ? 67.665 28.946 30.776  1.00 35.14  ? 84   CYS C C   1 
ATOM   3013  O O   . CYS C  1 57  ? 68.131 28.050 31.477  1.00 36.65  ? 84   CYS C O   1 
ATOM   3014  C CB  . CYS C  1 57  ? 69.744 29.072 29.424  1.00 35.53  ? 84   CYS C CB  1 
ATOM   3015  S SG  . CYS C  1 57  ? 69.147 27.688 28.409  1.00 37.01  ? 84   CYS C SG  1 
ATOM   3016  N N   . LYS C  1 58  ? 66.358 29.159 30.645  1.00 33.89  ? 85   LYS C N   1 
ATOM   3017  C CA  . LYS C  1 58  ? 65.352 28.357 31.332  1.00 31.34  ? 85   LYS C CA  1 
ATOM   3018  C C   . LYS C  1 58  ? 64.994 27.090 30.582  1.00 31.10  ? 85   LYS C C   1 
ATOM   3019  O O   . LYS C  1 58  ? 64.514 26.129 31.176  1.00 32.20  ? 85   LYS C O   1 
ATOM   3020  C CB  . LYS C  1 58  ? 64.085 29.172 31.537  1.00 30.22  ? 85   LYS C CB  1 
ATOM   3021  C CG  . LYS C  1 58  ? 64.331 30.476 32.240  1.00 31.90  ? 85   LYS C CG  1 
ATOM   3022  C CD  . LYS C  1 58  ? 63.038 31.133 32.624  1.00 31.79  ? 85   LYS C CD  1 
ATOM   3023  C CE  . LYS C  1 58  ? 63.292 32.428 33.365  1.00 34.43  ? 85   LYS C CE  1 
ATOM   3024  N NZ  . LYS C  1 58  ? 62.014 33.070 33.781  1.00 34.88  ? 85   LYS C NZ  1 
ATOM   3025  N N   . ALA C  1 59  ? 65.217 27.090 29.272  1.00 29.95  ? 86   ALA C N   1 
ATOM   3026  C CA  . ALA C  1 59  ? 64.917 25.924 28.444  1.00 29.09  ? 86   ALA C CA  1 
ATOM   3027  C C   . ALA C  1 59  ? 65.608 26.027 27.090  1.00 28.87  ? 86   ALA C C   1 
ATOM   3028  O O   . ALA C  1 59  ? 66.001 27.116 26.657  1.00 31.25  ? 86   ALA C O   1 
ATOM   3029  C CB  . ALA C  1 59  ? 63.425 25.798 28.251  1.00 26.52  ? 86   ALA C CB  1 
ATOM   3030  N N   . PHE C  1 60  ? 65.764 24.891 26.424  1.00 26.56  ? 87   PHE C N   1 
ATOM   3031  C CA  . PHE C  1 60  ? 66.401 24.885 25.122  1.00 25.45  ? 87   PHE C CA  1 
ATOM   3032  C C   . PHE C  1 60  ? 65.841 23.754 24.283  1.00 24.73  ? 87   PHE C C   1 
ATOM   3033  O O   . PHE C  1 60  ? 65.433 22.716 24.805  1.00 23.60  ? 87   PHE C O   1 
ATOM   3034  C CB  . PHE C  1 60  ? 67.934 24.750 25.257  1.00 25.48  ? 87   PHE C CB  1 
ATOM   3035  C CG  . PHE C  1 60  ? 68.416 23.339 25.516  1.00 24.74  ? 87   PHE C CG  1 
ATOM   3036  C CD1 . PHE C  1 60  ? 68.435 22.392 24.505  1.00 22.94  ? 87   PHE C CD1 1 
ATOM   3037  C CD2 . PHE C  1 60  ? 68.838 22.957 26.780  1.00 25.64  ? 87   PHE C CD2 1 
ATOM   3038  C CE1 . PHE C  1 60  ? 68.865 21.090 24.747  1.00 21.49  ? 87   PHE C CE1 1 
ATOM   3039  C CE2 . PHE C  1 60  ? 69.268 21.656 27.024  1.00 24.65  ? 87   PHE C CE2 1 
ATOM   3040  C CZ  . PHE C  1 60  ? 69.278 20.724 26.000  1.00 21.42  ? 87   PHE C CZ  1 
ATOM   3041  N N   . VAL C  1 61  ? 65.821 23.971 22.975  1.00 24.40  ? 88   VAL C N   1 
ATOM   3042  C CA  . VAL C  1 61  ? 65.323 22.974 22.035  1.00 23.22  ? 88   VAL C CA  1 
ATOM   3043  C C   . VAL C  1 61  ? 66.468 22.568 21.131  1.00 22.77  ? 88   VAL C C   1 
ATOM   3044  O O   . VAL C  1 61  ? 67.337 23.373 20.812  1.00 21.48  ? 88   VAL C O   1 
ATOM   3045  C CB  . VAL C  1 61  ? 64.176 23.541 21.138  1.00 22.27  ? 88   VAL C CB  1 
ATOM   3046  C CG1 . VAL C  1 61  ? 63.832 22.553 20.066  1.00 20.62  ? 88   VAL C CG1 1 
ATOM   3047  C CG2 . VAL C  1 61  ? 62.941 23.845 21.971  1.00 21.95  ? 88   VAL C CG2 1 
ATOM   3048  N N   . PHE C  1 62  ? 66.479 21.311 20.733  1.00 23.11  ? 89   PHE C N   1 
ATOM   3049  C CA  . PHE C  1 62  ? 67.501 20.865 19.824  1.00 24.90  ? 89   PHE C CA  1 
ATOM   3050  C C   . PHE C  1 62  ? 66.838 20.418 18.545  1.00 26.49  ? 89   PHE C C   1 
ATOM   3051  O O   . PHE C  1 62  ? 65.934 19.579 18.557  1.00 24.35  ? 89   PHE C O   1 
ATOM   3052  C CB  . PHE C  1 62  ? 68.301 19.708 20.388  1.00 25.46  ? 89   PHE C CB  1 
ATOM   3053  C CG  . PHE C  1 62  ? 69.364 19.210 19.451  1.00 25.12  ? 89   PHE C CG  1 
ATOM   3054  C CD1 . PHE C  1 62  ? 70.386 20.065 19.030  1.00 24.33  ? 89   PHE C CD1 1 
ATOM   3055  C CD2 . PHE C  1 62  ? 69.347 17.894 18.991  1.00 23.64  ? 89   PHE C CD2 1 
ATOM   3056  C CE1 . PHE C  1 62  ? 71.378 19.619 18.169  1.00 25.25  ? 89   PHE C CE1 1 
ATOM   3057  C CE2 . PHE C  1 62  ? 70.329 17.431 18.128  1.00 24.15  ? 89   PHE C CE2 1 
ATOM   3058  C CZ  . PHE C  1 62  ? 71.352 18.294 17.714  1.00 25.68  ? 89   PHE C CZ  1 
ATOM   3059  N N   . ASP C  1 63  ? 67.317 21.000 17.453  1.00 29.37  ? 90   ASP C N   1 
ATOM   3060  C CA  . ASP C  1 63  ? 66.834 20.724 16.112  1.00 31.28  ? 90   ASP C CA  1 
ATOM   3061  C C   . ASP C  1 63  ? 67.711 19.624 15.526  1.00 31.80  ? 90   ASP C C   1 
ATOM   3062  O O   . ASP C  1 63  ? 68.797 19.891 15.028  1.00 31.08  ? 90   ASP C O   1 
ATOM   3063  C CB  . ASP C  1 63  ? 66.971 21.983 15.281  1.00 33.08  ? 90   ASP C CB  1 
ATOM   3064  C CG  . ASP C  1 63  ? 66.208 21.912 14.012  1.00 34.11  ? 90   ASP C CG  1 
ATOM   3065  O OD1 . ASP C  1 63  ? 66.242 20.842 13.367  1.00 34.68  ? 90   ASP C OD1 1 
ATOM   3066  O OD2 . ASP C  1 63  ? 65.586 22.938 13.666  1.00 35.67  ? 90   ASP C OD2 1 
ATOM   3067  N N   . LYS C  1 64  ? 67.242 18.387 15.595  1.00 32.42  ? 91   LYS C N   1 
ATOM   3068  C CA  . LYS C  1 64  ? 68.016 17.267 15.098  1.00 32.99  ? 91   LYS C CA  1 
ATOM   3069  C C   . LYS C  1 64  ? 68.203 17.361 13.601  1.00 33.53  ? 91   LYS C C   1 
ATOM   3070  O O   . LYS C  1 64  ? 69.117 16.771 13.044  1.00 33.14  ? 91   LYS C O   1 
ATOM   3071  C CB  . LYS C  1 64  ? 67.314 15.963 15.453  1.00 33.44  ? 91   LYS C CB  1 
ATOM   3072  C CG  . LYS C  1 64  ? 67.235 15.709 16.937  1.00 35.40  ? 91   LYS C CG  1 
ATOM   3073  C CD  . LYS C  1 64  ? 66.318 14.532 17.276  1.00 37.48  ? 91   LYS C CD  1 
ATOM   3074  C CE  . LYS C  1 64  ? 64.852 14.911 17.102  1.00 41.20  ? 91   LYS C CE  1 
ATOM   3075  N NZ  . LYS C  1 64  ? 63.912 13.898 17.658  1.00 43.33  ? 91   LYS C NZ  1 
ATOM   3076  N N   . ALA C  1 65  ? 67.318 18.107 12.956  1.00 35.53  ? 92   ALA C N   1 
ATOM   3077  C CA  . ALA C  1 65  ? 67.355 18.285 11.512  1.00 37.12  ? 92   ALA C CA  1 
ATOM   3078  C C   . ALA C  1 65  ? 68.537 19.155 11.104  1.00 38.11  ? 92   ALA C C   1 
ATOM   3079  O O   . ALA C  1 65  ? 69.485 18.686 10.470  1.00 38.04  ? 92   ALA C O   1 
ATOM   3080  C CB  . ALA C  1 65  ? 66.055 18.915 11.042  1.00 36.87  ? 92   ALA C CB  1 
ATOM   3081  N N   . ARG C  1 66  ? 68.473 20.432 11.458  1.00 38.86  ? 93   ARG C N   1 
ATOM   3082  C CA  . ARG C  1 66  ? 69.550 21.353 11.135  1.00 40.33  ? 93   ARG C CA  1 
ATOM   3083  C C   . ARG C  1 66  ? 70.725 21.219 12.107  1.00 41.10  ? 93   ARG C C   1 
ATOM   3084  O O   . ARG C  1 66  ? 71.803 21.738 11.840  1.00 42.57  ? 93   ARG C O   1 
ATOM   3085  C CB  . ARG C  1 66  ? 69.057 22.796 11.209  1.00 40.82  ? 93   ARG C CB  1 
ATOM   3086  C CG  . ARG C  1 66  ? 67.892 23.164 10.316  1.00 41.43  ? 93   ARG C CG  1 
ATOM   3087  C CD  . ARG C  1 66  ? 67.509 24.621 10.575  1.00 43.02  ? 93   ARG C CD  1 
ATOM   3088  N NE  . ARG C  1 66  ? 66.121 24.930 10.229  1.00 47.65  ? 93   ARG C NE  1 
ATOM   3089  C CZ  . ARG C  1 66  ? 65.078 24.128 10.467  1.00 50.20  ? 93   ARG C CZ  1 
ATOM   3090  N NH1 . ARG C  1 66  ? 65.247 22.943 11.043  1.00 51.53  ? 93   ARG C NH1 1 
ATOM   3091  N NH2 . ARG C  1 66  ? 63.846 24.522 10.164  1.00 50.78  ? 93   ARG C NH2 1 
ATOM   3092  N N   . LYS C  1 67  ? 70.514 20.520 13.222  1.00 41.91  ? 94   LYS C N   1 
ATOM   3093  C CA  . LYS C  1 67  ? 71.521 20.373 14.271  1.00 40.70  ? 94   LYS C CA  1 
ATOM   3094  C C   . LYS C  1 67  ? 71.820 21.778 14.773  1.00 41.23  ? 94   LYS C C   1 
ATOM   3095  O O   . LYS C  1 67  ? 72.908 22.313 14.594  1.00 42.23  ? 94   LYS C O   1 
ATOM   3096  C CB  . LYS C  1 67  ? 72.790 19.712 13.751  1.00 40.66  ? 94   LYS C CB  1 
ATOM   3097  C CG  . LYS C  1 67  ? 72.598 18.275 13.366  1.00 41.36  ? 94   LYS C CG  1 
ATOM   3098  C CD  . LYS C  1 67  ? 73.911 17.537 13.426  1.00 43.26  ? 94   LYS C CD  1 
ATOM   3099  C CE  . LYS C  1 67  ? 73.684 16.056 13.209  1.00 45.76  ? 94   LYS C CE  1 
ATOM   3100  N NZ  . LYS C  1 67  ? 74.927 15.244 13.396  1.00 48.75  ? 94   LYS C NZ  1 
ATOM   3101  N N   . GLN C  1 68  ? 70.817 22.370 15.400  1.00 41.47  ? 95   GLN C N   1 
ATOM   3102  C CA  . GLN C  1 68  ? 70.908 23.717 15.937  1.00 41.66  ? 95   GLN C CA  1 
ATOM   3103  C C   . GLN C  1 68  ? 70.227 23.801 17.327  1.00 41.28  ? 95   GLN C C   1 
ATOM   3104  O O   . GLN C  1 68  ? 69.211 23.138 17.581  1.00 41.87  ? 95   GLN C O   1 
ATOM   3105  C CB  . GLN C  1 68  ? 70.244 24.667 14.933  1.00 41.50  ? 95   GLN C CB  1 
ATOM   3106  C CG  . GLN C  1 68  ? 69.833 26.027 15.469  1.00 46.36  ? 95   GLN C CG  1 
ATOM   3107  C CD  . GLN C  1 68  ? 68.807 26.715 14.568  1.00 49.63  ? 95   GLN C CD  1 
ATOM   3108  O OE1 . GLN C  1 68  ? 67.732 26.168 14.296  1.00 52.87  ? 95   GLN C OE1 1 
ATOM   3109  N NE2 . GLN C  1 68  ? 69.134 27.916 14.103  1.00 50.54  ? 95   GLN C NE2 1 
ATOM   3110  N N   . CYS C  1 69  ? 70.798 24.594 18.232  1.00 38.60  ? 96   CYS C N   1 
ATOM   3111  C CA  . CYS C  1 69  ? 70.208 24.762 19.550  1.00 37.87  ? 96   CYS C CA  1 
ATOM   3112  C C   . CYS C  1 69  ? 69.303 25.988 19.518  1.00 37.77  ? 96   CYS C C   1 
ATOM   3113  O O   . CYS C  1 69  ? 69.430 26.842 18.642  1.00 38.79  ? 96   CYS C O   1 
ATOM   3114  C CB  . CYS C  1 69  ? 71.262 25.020 20.624  1.00 38.42  ? 96   CYS C CB  1 
ATOM   3115  S SG  . CYS C  1 69  ? 72.649 23.864 20.804  1.00 42.05  ? 96   CYS C SG  1 
ATOM   3116  N N   . LEU C  1 70  ? 68.391 26.066 20.482  1.00 36.20  ? 97   LEU C N   1 
ATOM   3117  C CA  . LEU C  1 70  ? 67.489 27.194 20.609  1.00 34.63  ? 97   LEU C CA  1 
ATOM   3118  C C   . LEU C  1 70  ? 67.282 27.478 22.096  1.00 34.50  ? 97   LEU C C   1 
ATOM   3119  O O   . LEU C  1 70  ? 66.381 26.920 22.729  1.00 36.43  ? 97   LEU C O   1 
ATOM   3120  C CB  . LEU C  1 70  ? 66.149 26.902 19.932  1.00 34.38  ? 97   LEU C CB  1 
ATOM   3121  C CG  . LEU C  1 70  ? 66.126 26.980 18.412  1.00 33.19  ? 97   LEU C CG  1 
ATOM   3122  C CD1 . LEU C  1 70  ? 66.799 25.781 17.817  1.00 34.94  ? 97   LEU C CD1 1 
ATOM   3123  C CD2 . LEU C  1 70  ? 64.700 27.028 17.961  1.00 36.14  ? 97   LEU C CD2 1 
ATOM   3124  N N   . TRP C  1 71  ? 68.135 28.337 22.646  1.00 30.47  ? 98   TRP C N   1 
ATOM   3125  C CA  . TRP C  1 71  ? 68.066 28.708 24.048  1.00 27.06  ? 98   TRP C CA  1 
ATOM   3126  C C   . TRP C  1 71  ? 66.986 29.792 24.266  1.00 27.47  ? 98   TRP C C   1 
ATOM   3127  O O   . TRP C  1 71  ? 66.947 30.789 23.549  1.00 27.39  ? 98   TRP C O   1 
ATOM   3128  C CB  . TRP C  1 71  ? 69.448 29.204 24.488  1.00 25.14  ? 98   TRP C CB  1 
ATOM   3129  C CG  . TRP C  1 71  ? 70.537 28.160 24.383  1.00 23.38  ? 98   TRP C CG  1 
ATOM   3130  C CD1 . TRP C  1 71  ? 70.665 27.045 25.148  1.00 25.28  ? 98   TRP C CD1 1 
ATOM   3131  C CD2 . TRP C  1 71  ? 71.612 28.113 23.433  1.00 22.37  ? 98   TRP C CD2 1 
ATOM   3132  N NE1 . TRP C  1 71  ? 71.747 26.302 24.740  1.00 23.51  ? 98   TRP C NE1 1 
ATOM   3133  C CE2 . TRP C  1 71  ? 72.347 26.934 23.689  1.00 22.62  ? 98   TRP C CE2 1 
ATOM   3134  C CE3 . TRP C  1 71  ? 72.030 28.954 22.395  1.00 23.52  ? 98   TRP C CE3 1 
ATOM   3135  C CZ2 . TRP C  1 71  ? 73.464 26.558 22.930  1.00 23.28  ? 98   TRP C CZ2 1 
ATOM   3136  C CZ3 . TRP C  1 71  ? 73.147 28.584 21.636  1.00 23.20  ? 98   TRP C CZ3 1 
ATOM   3137  C CH2 . TRP C  1 71  ? 73.852 27.399 21.914  1.00 23.13  ? 98   TRP C CH2 1 
ATOM   3138  N N   . PHE C  1 72  ? 66.110 29.597 25.249  1.00 25.53  ? 99   PHE C N   1 
ATOM   3139  C CA  . PHE C  1 72  ? 65.060 30.568 25.520  1.00 26.35  ? 99   PHE C CA  1 
ATOM   3140  C C   . PHE C  1 72  ? 65.073 31.015 26.969  1.00 27.15  ? 99   PHE C C   1 
ATOM   3141  O O   . PHE C  1 72  ? 65.462 30.266 27.848  1.00 27.90  ? 99   PHE C O   1 
ATOM   3142  C CB  . PHE C  1 72  ? 63.690 29.962 25.265  1.00 27.96  ? 99   PHE C CB  1 
ATOM   3143  C CG  . PHE C  1 72  ? 63.598 29.164 24.017  1.00 28.72  ? 99   PHE C CG  1 
ATOM   3144  C CD1 . PHE C  1 72  ? 63.602 29.785 22.780  1.00 29.90  ? 99   PHE C CD1 1 
ATOM   3145  C CD2 . PHE C  1 72  ? 63.506 27.779 24.075  1.00 28.26  ? 99   PHE C CD2 1 
ATOM   3146  C CE1 . PHE C  1 72  ? 63.516 29.033 21.610  1.00 30.17  ? 99   PHE C CE1 1 
ATOM   3147  C CE2 . PHE C  1 72  ? 63.419 27.020 22.910  1.00 27.20  ? 99   PHE C CE2 1 
ATOM   3148  C CZ  . PHE C  1 72  ? 63.424 27.643 21.679  1.00 27.27  ? 99   PHE C CZ  1 
ATOM   3149  N N   . PRO C  1 73  ? 64.632 32.245 27.233  1.00 27.93  ? 100  PRO C N   1 
ATOM   3150  C CA  . PRO C  1 73  ? 64.571 32.814 28.577  1.00 29.76  ? 100  PRO C CA  1 
ATOM   3151  C C   . PRO C  1 73  ? 63.181 32.490 29.139  1.00 31.07  ? 100  PRO C C   1 
ATOM   3152  O O   . PRO C  1 73  ? 62.602 33.249 29.924  1.00 30.82  ? 100  PRO C O   1 
ATOM   3153  C CB  . PRO C  1 73  ? 64.741 34.299 28.308  1.00 29.25  ? 100  PRO C CB  1 
ATOM   3154  C CG  . PRO C  1 73  ? 63.923 34.467 27.106  1.00 27.10  ? 100  PRO C CG  1 
ATOM   3155  C CD  . PRO C  1 73  ? 64.395 33.300 26.238  1.00 28.57  ? 100  PRO C CD  1 
ATOM   3156  N N   . PHE C  1 74  ? 62.650 31.350 28.712  1.00 31.26  ? 101  PHE C N   1 
ATOM   3157  C CA  . PHE C  1 74  ? 61.329 30.914 29.138  1.00 31.47  ? 101  PHE C CA  1 
ATOM   3158  C C   . PHE C  1 74  ? 61.202 29.422 28.902  1.00 30.94  ? 101  PHE C C   1 
ATOM   3159  O O   . PHE C  1 74  ? 62.108 28.796 28.340  1.00 31.15  ? 101  PHE C O   1 
ATOM   3160  C CB  . PHE C  1 74  ? 60.260 31.650 28.327  1.00 33.37  ? 101  PHE C CB  1 
ATOM   3161  C CG  . PHE C  1 74  ? 60.437 31.523 26.831  1.00 36.46  ? 101  PHE C CG  1 
ATOM   3162  C CD1 . PHE C  1 74  ? 60.199 30.303 26.183  1.00 37.59  ? 101  PHE C CD1 1 
ATOM   3163  C CD2 . PHE C  1 74  ? 60.900 32.607 26.078  1.00 36.95  ? 101  PHE C CD2 1 
ATOM   3164  C CE1 . PHE C  1 74  ? 60.425 30.158 24.808  1.00 38.29  ? 101  PHE C CE1 1 
ATOM   3165  C CE2 . PHE C  1 74  ? 61.131 32.483 24.707  1.00 38.14  ? 101  PHE C CE2 1 
ATOM   3166  C CZ  . PHE C  1 74  ? 60.895 31.251 24.068  1.00 39.92  ? 101  PHE C CZ  1 
ATOM   3167  N N   . ASN C  1 75  ? 60.081 28.855 29.338  1.00 29.29  ? 102  ASN C N   1 
ATOM   3168  C CA  . ASN C  1 75  ? 59.821 27.439 29.133  1.00 29.30  ? 102  ASN C CA  1 
ATOM   3169  C C   . ASN C  1 75  ? 58.355 27.241 28.754  1.00 29.32  ? 102  ASN C C   1 
ATOM   3170  O O   . ASN C  1 75  ? 57.639 28.211 28.517  1.00 29.02  ? 102  ASN C O   1 
ATOM   3171  C CB  . ASN C  1 75  ? 60.168 26.635 30.378  1.00 28.86  ? 102  ASN C CB  1 
ATOM   3172  C CG  . ASN C  1 75  ? 59.337 27.031 31.576  1.00 31.08  ? 102  ASN C CG  1 
ATOM   3173  O OD1 . ASN C  1 75  ? 58.288 27.644 31.440  1.00 30.83  ? 102  ASN C OD1 1 
ATOM   3174  N ND2 . ASN C  1 75  ? 59.796 26.658 32.765  1.00 31.81  ? 102  ASN C ND2 1 
ATOM   3175  N N   . SER C  1 76  ? 57.892 26.001 28.707  1.00 28.63  ? 103  SER C N   1 
ATOM   3176  C CA  . SER C  1 76  ? 56.515 25.774 28.312  1.00 29.42  ? 103  SER C CA  1 
ATOM   3177  C C   . SER C  1 76  ? 55.495 26.433 29.222  1.00 29.78  ? 103  SER C C   1 
ATOM   3178  O O   . SER C  1 76  ? 54.362 26.635 28.819  1.00 29.81  ? 103  SER C O   1 
ATOM   3179  C CB  . SER C  1 76  ? 56.214 24.281 28.235  1.00 30.28  ? 103  SER C CB  1 
ATOM   3180  O OG  . SER C  1 76  ? 56.083 23.720 29.529  1.00 32.41  ? 103  SER C OG  1 
ATOM   3181  N N   . MET C  1 77  ? 55.876 26.776 30.441  1.00 31.42  ? 104  MET C N   1 
ATOM   3182  C CA  . MET C  1 77  ? 54.916 27.382 31.344  1.00 34.41  ? 104  MET C CA  1 
ATOM   3183  C C   . MET C  1 77  ? 54.932 28.907 31.330  1.00 35.65  ? 104  MET C C   1 
ATOM   3184  O O   . MET C  1 77  ? 54.234 29.536 32.104  1.00 35.90  ? 104  MET C O   1 
ATOM   3185  C CB  . MET C  1 77  ? 55.137 26.879 32.774  1.00 37.21  ? 104  MET C CB  1 
ATOM   3186  C CG  . MET C  1 77  ? 55.033 25.362 32.967  1.00 43.00  ? 104  MET C CG  1 
ATOM   3187  S SD  . MET C  1 77  ? 56.678 24.527 33.168  1.00 55.15  ? 104  MET C SD  1 
ATOM   3188  C CE  . MET C  1 77  ? 56.208 22.739 33.450  1.00 50.48  ? 104  MET C CE  1 
ATOM   3189  N N   . SER C  1 78  ? 55.712 29.511 30.444  1.00 38.18  ? 105  SER C N   1 
ATOM   3190  C CA  . SER C  1 78  ? 55.790 30.974 30.389  1.00 40.40  ? 105  SER C CA  1 
ATOM   3191  C C   . SER C  1 78  ? 54.689 31.533 29.492  1.00 41.97  ? 105  SER C C   1 
ATOM   3192  O O   . SER C  1 78  ? 54.392 30.966 28.440  1.00 42.35  ? 105  SER C O   1 
ATOM   3193  C CB  . SER C  1 78  ? 57.153 31.429 29.832  1.00 40.73  ? 105  SER C CB  1 
ATOM   3194  O OG  . SER C  1 78  ? 58.243 30.624 30.270  1.00 41.72  ? 105  SER C OG  1 
ATOM   3195  N N   . SER C  1 79  ? 54.089 32.650 29.885  1.00 43.42  ? 106  SER C N   1 
ATOM   3196  C CA  . SER C  1 79  ? 53.043 33.231 29.052  1.00 44.73  ? 106  SER C CA  1 
ATOM   3197  C C   . SER C  1 79  ? 53.675 33.795 27.782  1.00 44.63  ? 106  SER C C   1 
ATOM   3198  O O   . SER C  1 79  ? 54.849 34.187 27.779  1.00 44.31  ? 106  SER C O   1 
ATOM   3199  C CB  . SER C  1 79  ? 52.286 34.331 29.806  1.00 45.87  ? 106  SER C CB  1 
ATOM   3200  O OG  . SER C  1 79  ? 53.133 35.417 30.123  1.00 46.38  ? 106  SER C OG  1 
ATOM   3201  N N   . GLY C  1 80  ? 52.892 33.829 26.707  1.00 44.89  ? 107  GLY C N   1 
ATOM   3202  C CA  . GLY C  1 80  ? 53.398 34.323 25.434  1.00 46.08  ? 107  GLY C CA  1 
ATOM   3203  C C   . GLY C  1 80  ? 54.302 33.259 24.840  1.00 46.58  ? 107  GLY C C   1 
ATOM   3204  O O   . GLY C  1 80  ? 55.212 33.528 24.035  1.00 47.63  ? 107  GLY C O   1 
ATOM   3205  N N   . VAL C  1 81  ? 54.030 32.028 25.259  1.00 45.25  ? 108  VAL C N   1 
ATOM   3206  C CA  . VAL C  1 81  ? 54.798 30.884 24.835  1.00 43.63  ? 108  VAL C CA  1 
ATOM   3207  C C   . VAL C  1 81  ? 53.890 29.673 24.676  1.00 43.49  ? 108  VAL C C   1 
ATOM   3208  O O   . VAL C  1 81  ? 53.114 29.338 25.579  1.00 42.82  ? 108  VAL C O   1 
ATOM   3209  C CB  . VAL C  1 81  ? 55.891 30.604 25.862  1.00 42.79  ? 108  VAL C CB  1 
ATOM   3210  C CG1 . VAL C  1 81  ? 56.550 29.271 25.593  1.00 44.60  ? 108  VAL C CG1 1 
ATOM   3211  C CG2 . VAL C  1 81  ? 56.915 31.713 25.798  1.00 44.18  ? 108  VAL C CG2 1 
ATOM   3212  N N   . LYS C  1 82  ? 53.989 29.025 23.515  1.00 42.19  ? 109  LYS C N   1 
ATOM   3213  C CA  . LYS C  1 82  ? 53.175 27.853 23.216  1.00 39.18  ? 109  LYS C CA  1 
ATOM   3214  C C   . LYS C  1 82  ? 54.017 26.689 22.663  1.00 36.99  ? 109  LYS C C   1 
ATOM   3215  O O   . LYS C  1 82  ? 54.996 26.898 21.941  1.00 35.48  ? 109  LYS C O   1 
ATOM   3216  C CB  . LYS C  1 82  ? 52.061 28.242 22.208  1.00 39.32  ? 109  LYS C CB  1 
ATOM   3217  N N   . LYS C  1 83  ? 53.630 25.468 23.034  1.00 35.02  ? 110  LYS C N   1 
ATOM   3218  C CA  . LYS C  1 83  ? 54.284 24.239 22.572  1.00 32.55  ? 110  LYS C CA  1 
ATOM   3219  C C   . LYS C  1 83  ? 53.829 23.979 21.147  1.00 32.99  ? 110  LYS C C   1 
ATOM   3220  O O   . LYS C  1 83  ? 52.712 24.349 20.763  1.00 33.95  ? 110  LYS C O   1 
ATOM   3221  C CB  . LYS C  1 83  ? 53.858 23.045 23.421  1.00 29.39  ? 110  LYS C CB  1 
ATOM   3222  C CG  . LYS C  1 83  ? 54.640 22.832 24.666  1.00 27.07  ? 110  LYS C CG  1 
ATOM   3223  C CD  . LYS C  1 83  ? 53.835 21.960 25.583  1.00 27.98  ? 110  LYS C CD  1 
ATOM   3224  C CE  . LYS C  1 83  ? 54.654 21.399 26.721  1.00 27.35  ? 110  LYS C CE  1 
ATOM   3225  N NZ  . LYS C  1 83  ? 53.797 20.498 27.536  1.00 25.90  ? 110  LYS C NZ  1 
ATOM   3226  N N   . GLU C  1 84  ? 54.655 23.293 20.371  1.00 32.22  ? 111  GLU C N   1 
ATOM   3227  C CA  . GLU C  1 84  ? 54.278 23.044 18.996  1.00 30.85  ? 111  GLU C CA  1 
ATOM   3228  C C   . GLU C  1 84  ? 54.974 21.874 18.333  1.00 29.88  ? 111  GLU C C   1 
ATOM   3229  O O   . GLU C  1 84  ? 56.182 21.885 18.144  1.00 31.38  ? 111  GLU C O   1 
ATOM   3230  C CB  . GLU C  1 84  ? 54.530 24.310 18.209  1.00 31.45  ? 111  GLU C CB  1 
ATOM   3231  C CG  . GLU C  1 84  ? 54.081 24.259 16.798  1.00 34.21  ? 111  GLU C CG  1 
ATOM   3232  C CD  . GLU C  1 84  ? 53.746 25.637 16.307  1.00 36.79  ? 111  GLU C CD  1 
ATOM   3233  O OE1 . GLU C  1 84  ? 52.693 26.149 16.743  1.00 37.39  ? 111  GLU C OE1 1 
ATOM   3234  O OE2 . GLU C  1 84  ? 54.533 26.213 15.515  1.00 38.44  ? 111  GLU C OE2 1 
ATOM   3235  N N   . PHE C  1 85  ? 54.198 20.867 17.964  1.00 28.36  ? 112  PHE C N   1 
ATOM   3236  C CA  . PHE C  1 85  ? 54.734 19.683 17.310  1.00 27.12  ? 112  PHE C CA  1 
ATOM   3237  C C   . PHE C  1 85  ? 55.726 19.961 16.173  1.00 28.05  ? 112  PHE C C   1 
ATOM   3238  O O   . PHE C  1 85  ? 55.652 20.976 15.481  1.00 28.62  ? 112  PHE C O   1 
ATOM   3239  C CB  . PHE C  1 85  ? 53.595 18.829 16.761  1.00 24.93  ? 112  PHE C CB  1 
ATOM   3240  C CG  . PHE C  1 85  ? 54.054 17.524 16.189  1.00 23.66  ? 112  PHE C CG  1 
ATOM   3241  C CD1 . PHE C  1 85  ? 54.125 16.383 16.992  1.00 23.05  ? 112  PHE C CD1 1 
ATOM   3242  C CD2 . PHE C  1 85  ? 54.493 17.447 14.866  1.00 20.85  ? 112  PHE C CD2 1 
ATOM   3243  C CE1 . PHE C  1 85  ? 54.634 15.185 16.482  1.00 23.21  ? 112  PHE C CE1 1 
ATOM   3244  C CE2 . PHE C  1 85  ? 55.001 16.264 14.353  1.00 19.97  ? 112  PHE C CE2 1 
ATOM   3245  C CZ  . PHE C  1 85  ? 55.076 15.130 15.157  1.00 21.05  ? 112  PHE C CZ  1 
ATOM   3246  N N   . GLY C  1 86  ? 56.642 19.017 15.994  1.00 28.27  ? 113  GLY C N   1 
ATOM   3247  C CA  . GLY C  1 86  ? 57.666 19.082 14.970  1.00 28.34  ? 113  GLY C CA  1 
ATOM   3248  C C   . GLY C  1 86  ? 58.399 17.773 15.168  1.00 29.37  ? 113  GLY C C   1 
ATOM   3249  O O   . GLY C  1 86  ? 58.716 17.440 16.302  1.00 30.94  ? 113  GLY C O   1 
ATOM   3250  N N   . HIS C  1 87  ? 58.645 17.010 14.108  1.00 29.08  ? 114  HIS C N   1 
ATOM   3251  C CA  . HIS C  1 87  ? 59.328 15.722 14.251  1.00 27.73  ? 114  HIS C CA  1 
ATOM   3252  C C   . HIS C  1 87  ? 60.781 15.873 14.621  1.00 27.47  ? 114  HIS C C   1 
ATOM   3253  O O   . HIS C  1 87  ? 61.343 15.062 15.344  1.00 29.53  ? 114  HIS C O   1 
ATOM   3254  C CB  . HIS C  1 87  ? 59.260 14.945 12.948  1.00 27.85  ? 114  HIS C CB  1 
ATOM   3255  C CG  . HIS C  1 87  ? 57.872 14.609 12.517  1.00 28.45  ? 114  HIS C CG  1 
ATOM   3256  N ND1 . HIS C  1 87  ? 57.175 13.535 13.028  1.00 29.87  ? 114  HIS C ND1 1 
ATOM   3257  C CD2 . HIS C  1 87  ? 57.053 15.197 11.615  1.00 27.36  ? 114  HIS C CD2 1 
ATOM   3258  C CE1 . HIS C  1 87  ? 55.987 13.473 12.453  1.00 28.86  ? 114  HIS C CE1 1 
ATOM   3259  N NE2 . HIS C  1 87  ? 55.888 14.469 11.592  1.00 27.77  ? 114  HIS C NE2 1 
ATOM   3260  N N   . GLU C  1 88  ? 61.373 16.937 14.116  1.00 26.94  ? 115  GLU C N   1 
ATOM   3261  C CA  . GLU C  1 88  ? 62.780 17.258 14.287  1.00 28.24  ? 115  GLU C CA  1 
ATOM   3262  C C   . GLU C  1 88  ? 63.180 17.972 15.594  1.00 29.00  ? 115  GLU C C   1 
ATOM   3263  O O   . GLU C  1 88  ? 64.378 18.212 15.823  1.00 30.11  ? 115  GLU C O   1 
ATOM   3264  C CB  . GLU C  1 88  ? 63.229 18.113 13.088  1.00 27.81  ? 115  GLU C CB  1 
ATOM   3265  C CG  . GLU C  1 88  ? 62.749 19.576 13.122  1.00 27.80  ? 115  GLU C CG  1 
ATOM   3266  C CD  . GLU C  1 88  ? 61.274 19.754 12.792  1.00 27.83  ? 115  GLU C CD  1 
ATOM   3267  O OE1 . GLU C  1 88  ? 60.430 19.013 13.325  1.00 27.84  ? 115  GLU C OE1 1 
ATOM   3268  O OE2 . GLU C  1 88  ? 60.955 20.662 12.003  1.00 30.51  ? 115  GLU C OE2 1 
ATOM   3269  N N   . PHE C  1 89  ? 62.205 18.317 16.437  1.00 26.53  ? 116  PHE C N   1 
ATOM   3270  C CA  . PHE C  1 89  ? 62.511 19.017 17.674  1.00 25.21  ? 116  PHE C CA  1 
ATOM   3271  C C   . PHE C  1 89  ? 62.387 18.206 18.964  1.00 25.24  ? 116  PHE C C   1 
ATOM   3272  O O   . PHE C  1 89  ? 61.597 17.255 19.060  1.00 26.08  ? 116  PHE C O   1 
ATOM   3273  C CB  . PHE C  1 89  ? 61.635 20.258 17.793  1.00 26.97  ? 116  PHE C CB  1 
ATOM   3274  C CG  . PHE C  1 89  ? 61.839 21.258 16.697  1.00 31.99  ? 116  PHE C CG  1 
ATOM   3275  C CD1 . PHE C  1 89  ? 63.092 21.841 16.486  1.00 33.44  ? 116  PHE C CD1 1 
ATOM   3276  C CD2 . PHE C  1 89  ? 60.774 21.642 15.879  1.00 33.32  ? 116  PHE C CD2 1 
ATOM   3277  C CE1 . PHE C  1 89  ? 63.284 22.795 15.476  1.00 32.60  ? 116  PHE C CE1 1 
ATOM   3278  C CE2 . PHE C  1 89  ? 60.957 22.594 14.867  1.00 32.90  ? 116  PHE C CE2 1 
ATOM   3279  C CZ  . PHE C  1 89  ? 62.217 23.169 14.669  1.00 32.73  ? 116  PHE C CZ  1 
ATOM   3280  N N   . ASP C  1 90  ? 63.190 18.604 19.952  1.00 23.32  ? 117  ASP C N   1 
ATOM   3281  C CA  . ASP C  1 90  ? 63.201 18.008 21.278  1.00 20.85  ? 117  ASP C CA  1 
ATOM   3282  C C   . ASP C  1 90  ? 63.279 19.139 22.291  1.00 19.52  ? 117  ASP C C   1 
ATOM   3283  O O   . ASP C  1 90  ? 64.183 19.977 22.215  1.00 17.10  ? 117  ASP C O   1 
ATOM   3284  C CB  . ASP C  1 90  ? 64.403 17.087 21.459  1.00 22.71  ? 117  ASP C CB  1 
ATOM   3285  C CG  . ASP C  1 90  ? 64.125 15.667 21.004  1.00 25.85  ? 117  ASP C CG  1 
ATOM   3286  O OD1 . ASP C  1 90  ? 62.939 15.321 20.817  1.00 26.28  ? 117  ASP C OD1 1 
ATOM   3287  O OD2 . ASP C  1 90  ? 65.094 14.888 20.845  1.00 26.12  ? 117  ASP C OD2 1 
ATOM   3288  N N   . LEU C  1 91  ? 62.324 19.169 23.223  1.00 18.17  ? 118  LEU C N   1 
ATOM   3289  C CA  . LEU C  1 91  ? 62.311 20.199 24.256  1.00 17.25  ? 118  LEU C CA  1 
ATOM   3290  C C   . LEU C  1 91  ? 62.973 19.722 25.534  1.00 17.04  ? 118  LEU C C   1 
ATOM   3291  O O   . LEU C  1 91  ? 62.696 18.630 26.012  1.00 15.59  ? 118  LEU C O   1 
ATOM   3292  C CB  . LEU C  1 91  ? 60.882 20.652 24.571  1.00 14.91  ? 118  LEU C CB  1 
ATOM   3293  C CG  . LEU C  1 91  ? 60.773 21.782 25.596  1.00 11.98  ? 118  LEU C CG  1 
ATOM   3294  C CD1 . LEU C  1 91  ? 61.782 22.874 25.296  1.00 10.33  ? 118  LEU C CD1 1 
ATOM   3295  C CD2 . LEU C  1 91  ? 59.397 22.330 25.571  1.00 9.55   ? 118  LEU C CD2 1 
ATOM   3296  N N   . TYR C  1 92  ? 63.864 20.557 26.057  1.00 18.37  ? 119  TYR C N   1 
ATOM   3297  C CA  . TYR C  1 92  ? 64.580 20.276 27.291  1.00 19.25  ? 119  TYR C CA  1 
ATOM   3298  C C   . TYR C  1 92  ? 64.440 21.490 28.210  1.00 21.12  ? 119  TYR C C   1 
ATOM   3299  O O   . TYR C  1 92  ? 65.047 22.543 27.966  1.00 22.00  ? 119  TYR C O   1 
ATOM   3300  C CB  . TYR C  1 92  ? 66.063 20.013 27.014  1.00 17.60  ? 119  TYR C CB  1 
ATOM   3301  C CG  . TYR C  1 92  ? 66.342 18.773 26.189  1.00 18.16  ? 119  TYR C CG  1 
ATOM   3302  C CD1 . TYR C  1 92  ? 66.492 18.844 24.801  1.00 17.44  ? 119  TYR C CD1 1 
ATOM   3303  C CD2 . TYR C  1 92  ? 66.473 17.526 26.799  1.00 17.93  ? 119  TYR C CD2 1 
ATOM   3304  C CE1 . TYR C  1 92  ? 66.767 17.705 24.045  1.00 17.12  ? 119  TYR C CE1 1 
ATOM   3305  C CE2 . TYR C  1 92  ? 66.748 16.381 26.058  1.00 17.90  ? 119  TYR C CE2 1 
ATOM   3306  C CZ  . TYR C  1 92  ? 66.894 16.475 24.681  1.00 19.07  ? 119  TYR C CZ  1 
ATOM   3307  O OH  . TYR C  1 92  ? 67.153 15.335 23.952  1.00 18.40  ? 119  TYR C OH  1 
ATOM   3308  N N   . GLU C  1 93  ? 63.633 21.348 29.258  1.00 21.16  ? 120  GLU C N   1 
ATOM   3309  C CA  . GLU C  1 93  ? 63.427 22.424 30.213  1.00 23.14  ? 120  GLU C CA  1 
ATOM   3310  C C   . GLU C  1 93  ? 64.301 22.246 31.459  1.00 25.49  ? 120  GLU C C   1 
ATOM   3311  O O   . GLU C  1 93  ? 64.511 21.126 31.949  1.00 24.83  ? 120  GLU C O   1 
ATOM   3312  C CB  . GLU C  1 93  ? 61.963 22.480 30.600  1.00 21.79  ? 120  GLU C CB  1 
ATOM   3313  C CG  . GLU C  1 93  ? 61.047 22.730 29.406  1.00 22.86  ? 120  GLU C CG  1 
ATOM   3314  C CD  . GLU C  1 93  ? 59.572 22.560 29.754  1.00 22.95  ? 120  GLU C CD  1 
ATOM   3315  O OE1 . GLU C  1 93  ? 59.163 21.450 30.179  1.00 20.67  ? 120  GLU C OE1 1 
ATOM   3316  O OE2 . GLU C  1 93  ? 58.825 23.549 29.609  1.00 22.81  ? 120  GLU C OE2 1 
ATOM   3317  N N   . ASN C  1 94  ? 64.823 23.367 31.943  1.00 26.84  ? 121  ASN C N   1 
ATOM   3318  C CA  . ASN C  1 94  ? 65.670 23.402 33.116  1.00 28.42  ? 121  ASN C CA  1 
ATOM   3319  C C   . ASN C  1 94  ? 64.796 23.169 34.334  1.00 29.59  ? 121  ASN C C   1 
ATOM   3320  O O   . ASN C  1 94  ? 63.821 23.897 34.538  1.00 29.06  ? 121  ASN C O   1 
ATOM   3321  C CB  . ASN C  1 94  ? 66.302 24.771 33.214  1.00 31.64  ? 121  ASN C CB  1 
ATOM   3322  C CG  . ASN C  1 94  ? 67.675 24.724 33.787  1.00 34.24  ? 121  ASN C CG  1 
ATOM   3323  O OD1 . ASN C  1 94  ? 68.176 23.647 34.113  1.00 37.46  ? 121  ASN C OD1 1 
ATOM   3324  N ND2 . ASN C  1 94  ? 68.314 25.890 33.905  1.00 33.00  ? 121  ASN C ND2 1 
ATOM   3325  N N   . LYS C  1 95  ? 65.140 22.169 35.145  1.00 30.54  ? 122  LYS C N   1 
ATOM   3326  C CA  . LYS C  1 95  ? 64.351 21.843 36.333  1.00 32.00  ? 122  LYS C CA  1 
ATOM   3327  C C   . LYS C  1 95  ? 64.270 22.972 37.335  1.00 31.62  ? 122  LYS C C   1 
ATOM   3328  O O   . LYS C  1 95  ? 63.328 23.027 38.149  1.00 32.83  ? 122  LYS C O   1 
ATOM   3329  C CB  . LYS C  1 95  ? 64.908 20.602 37.015  1.00 32.85  ? 122  LYS C CB  1 
ATOM   3330  C CG  . LYS C  1 95  ? 64.657 19.340 36.220  1.00 38.34  ? 122  LYS C CG  1 
ATOM   3331  C CD  . LYS C  1 95  ? 65.167 18.089 36.938  1.00 41.61  ? 122  LYS C CD  1 
ATOM   3332  C CE  . LYS C  1 95  ? 65.081 16.852 36.026  1.00 41.63  ? 122  LYS C CE  1 
ATOM   3333  N NZ  . LYS C  1 95  ? 65.565 15.594 36.668  1.00 43.41  ? 122  LYS C NZ  1 
ATOM   3334  N N   . ASP C  1 96  ? 65.260 23.865 37.240  1.00 29.79  ? 123  ASP C N   1 
ATOM   3335  C CA  . ASP C  1 96  ? 65.384 25.030 38.106  1.00 29.57  ? 123  ASP C CA  1 
ATOM   3336  C C   . ASP C  1 96  ? 64.249 26.038 37.901  1.00 26.35  ? 123  ASP C C   1 
ATOM   3337  O O   . ASP C  1 96  ? 64.165 27.012 38.634  1.00 26.90  ? 123  ASP C O   1 
ATOM   3338  C CB  . ASP C  1 96  ? 66.728 25.766 37.863  1.00 34.96  ? 123  ASP C CB  1 
ATOM   3339  C CG  . ASP C  1 96  ? 67.997 24.872 38.066  1.00 39.40  ? 123  ASP C CG  1 
ATOM   3340  O OD1 . ASP C  1 96  ? 67.984 23.898 38.868  1.00 41.75  ? 123  ASP C OD1 1 
ATOM   3341  O OD2 . ASP C  1 96  ? 69.044 25.178 37.434  1.00 38.77  ? 123  ASP C OD2 1 
ATOM   3342  N N   . TYR C  1 97  ? 63.386 25.812 36.913  1.00 23.98  ? 124  TYR C N   1 
ATOM   3343  C CA  . TYR C  1 97  ? 62.297 26.726 36.611  1.00 22.85  ? 124  TYR C CA  1 
ATOM   3344  C C   . TYR C  1 97  ? 60.970 26.034 36.407  1.00 24.42  ? 124  TYR C C   1 
ATOM   3345  O O   . TYR C  1 97  ? 60.035 26.616 35.855  1.00 27.77  ? 124  TYR C O   1 
ATOM   3346  C CB  . TYR C  1 97  ? 62.650 27.540 35.381  1.00 22.74  ? 124  TYR C CB  1 
ATOM   3347  C CG  . TYR C  1 97  ? 63.866 28.393 35.606  1.00 21.94  ? 124  TYR C CG  1 
ATOM   3348  C CD1 . TYR C  1 97  ? 63.747 29.651 36.200  1.00 23.60  ? 124  TYR C CD1 1 
ATOM   3349  C CD2 . TYR C  1 97  ? 65.150 27.908 35.307  1.00 19.36  ? 124  TYR C CD2 1 
ATOM   3350  C CE1 . TYR C  1 97  ? 64.877 30.407 36.500  1.00 25.37  ? 124  TYR C CE1 1 
ATOM   3351  C CE2 . TYR C  1 97  ? 66.279 28.642 35.600  1.00 20.17  ? 124  TYR C CE2 1 
ATOM   3352  C CZ  . TYR C  1 97  ? 66.142 29.893 36.199  1.00 24.31  ? 124  TYR C CZ  1 
ATOM   3353  O OH  . TYR C  1 97  ? 67.254 30.625 36.520  1.00 24.10  ? 124  TYR C OH  1 
ATOM   3354  N N   . ILE C  1 98  ? 60.892 24.783 36.840  1.00 22.88  ? 125  ILE C N   1 
ATOM   3355  C CA  . ILE C  1 98  ? 59.659 24.035 36.763  1.00 22.59  ? 125  ILE C CA  1 
ATOM   3356  C C   . ILE C  1 98  ? 59.260 23.868 38.212  1.00 21.96  ? 125  ILE C C   1 
ATOM   3357  O O   . ILE C  1 98  ? 59.896 23.126 38.943  1.00 21.16  ? 125  ILE C O   1 
ATOM   3358  C CB  . ILE C  1 98  ? 59.884 22.685 36.098  1.00 22.90  ? 125  ILE C CB  1 
ATOM   3359  C CG1 . ILE C  1 98  ? 60.268 22.921 34.637  1.00 26.09  ? 125  ILE C CG1 1 
ATOM   3360  C CG2 . ILE C  1 98  ? 58.622 21.827 36.187  1.00 21.92  ? 125  ILE C CG2 1 
ATOM   3361  C CD1 . ILE C  1 98  ? 60.681 21.658 33.893  1.00 26.84  ? 125  ILE C CD1 1 
ATOM   3362  N N   . ARG C  1 99  ? 58.223 24.598 38.624  1.00 23.11  ? 126  ARG C N   1 
ATOM   3363  C CA  . ARG C  1 99  ? 57.731 24.583 40.000  1.00 22.18  ? 126  ARG C CA  1 
ATOM   3364  C C   . ARG C  1 99  ? 57.868 23.203 40.584  1.00 22.70  ? 126  ARG C C   1 
ATOM   3365  O O   . ARG C  1 99  ? 57.411 22.226 39.998  1.00 23.07  ? 126  ARG C O   1 
ATOM   3366  C CB  . ARG C  1 99  ? 56.269 25.022 40.061  1.00 22.08  ? 126  ARG C CB  1 
ATOM   3367  C CG  . ARG C  1 99  ? 55.838 25.394 41.448  1.00 24.57  ? 126  ARG C CG  1 
ATOM   3368  C CD  . ARG C  1 99  ? 54.343 25.619 41.540  1.00 30.88  ? 126  ARG C CD  1 
ATOM   3369  N NE  . ARG C  1 99  ? 53.855 26.573 40.559  1.00 34.46  ? 126  ARG C NE  1 
ATOM   3370  C CZ  . ARG C  1 99  ? 53.052 26.261 39.548  1.00 36.91  ? 126  ARG C CZ  1 
ATOM   3371  N NH1 . ARG C  1 99  ? 52.645 25.012 39.387  1.00 34.81  ? 126  ARG C NH1 1 
ATOM   3372  N NH2 . ARG C  1 99  ? 52.650 27.205 38.700  1.00 42.76  ? 126  ARG C NH2 1 
ATOM   3373  N N   . ASN C  1 100 ? 58.520 23.109 41.730  1.00 23.31  ? 127  ASN C N   1 
ATOM   3374  C CA  . ASN C  1 100 ? 58.688 21.812 42.347  1.00 26.52  ? 127  ASN C CA  1 
ATOM   3375  C C   . ASN C  1 100 ? 57.858 21.809 43.581  1.00 27.74  ? 127  ASN C C   1 
ATOM   3376  O O   . ASN C  1 100 ? 58.076 21.006 44.509  1.00 31.02  ? 127  ASN C O   1 
ATOM   3377  C CB  . ASN C  1 100 ? 60.134 21.562 42.709  1.00 26.20  ? 127  ASN C CB  1 
ATOM   3378  C CG  . ASN C  1 100 ? 60.731 22.706 43.484  1.00 24.23  ? 127  ASN C CG  1 
ATOM   3379  O OD1 . ASN C  1 100 ? 60.026 23.473 44.105  1.00 22.75  ? 127  ASN C OD1 1 
ATOM   3380  N ND2 . ASN C  1 100 ? 62.039 22.812 43.461  1.00 24.33  ? 127  ASN C ND2 1 
ATOM   3381  N N   . CYS C  1 101 ? 56.981 22.805 43.614  1.00 27.50  ? 128  CYS C N   1 
ATOM   3382  C CA  . CYS C  1 101 ? 56.070 22.858 44.715  1.00 29.24  ? 128  CYS C CA  1 
ATOM   3383  C C   . CYS C  1 101 ? 54.702 22.709 44.092  1.00 29.79  ? 128  CYS C C   1 
ATOM   3384  O O   . CYS C  1 101 ? 54.508 22.977 42.901  1.00 30.33  ? 128  CYS C O   1 
ATOM   3385  C CB  . CYS C  1 101 ? 56.192 24.155 45.530  1.00 28.30  ? 128  CYS C CB  1 
ATOM   3386  S SG  . CYS C  1 101 ? 55.814 25.696 44.646  1.00 35.94  ? 128  CYS C SG  1 
ATOM   3387  N N   . ILE C  1 102 ? 53.754 22.242 44.888  1.00 31.50  ? 129  ILE C N   1 
ATOM   3388  C CA  . ILE C  1 102 ? 52.408 22.062 44.387  1.00 34.99  ? 129  ILE C CA  1 
ATOM   3389  C C   . ILE C  1 102 ? 51.406 22.984 45.064  1.00 37.37  ? 129  ILE C C   1 
ATOM   3390  O O   . ILE C  1 102 ? 51.615 23.451 46.182  1.00 36.63  ? 129  ILE C O   1 
ATOM   3391  C CB  . ILE C  1 102 ? 51.941 20.610 44.585  1.00 33.74  ? 129  ILE C CB  1 
ATOM   3392  C CG1 . ILE C  1 102 ? 52.040 20.241 46.061  1.00 33.57  ? 129  ILE C CG1 1 
ATOM   3393  C CG2 . ILE C  1 102 ? 52.800 19.662 43.772  1.00 33.27  ? 129  ILE C CG2 1 
ATOM   3394  C CD1 . ILE C  1 102 ? 51.425 18.913 46.388  1.00 33.72  ? 129  ILE C CD1 1 
ATOM   3395  N N   . ILE C  1 103 ? 50.319 23.253 44.358  1.00 41.47  ? 130  ILE C N   1 
ATOM   3396  C CA  . ILE C  1 103 ? 49.221 24.064 44.884  1.00 45.49  ? 130  ILE C CA  1 
ATOM   3397  C C   . ILE C  1 103 ? 48.068 23.095 45.224  1.00 45.54  ? 130  ILE C C   1 
ATOM   3398  O O   . ILE C  1 103 ? 47.361 22.596 44.334  1.00 44.66  ? 130  ILE C O   1 
ATOM   3399  C CB  . ILE C  1 103 ? 48.708 25.093 43.841  1.00 47.88  ? 130  ILE C CB  1 
ATOM   3400  C CG1 . ILE C  1 103 ? 49.890 25.850 43.215  1.00 48.82  ? 130  ILE C CG1 1 
ATOM   3401  C CG2 . ILE C  1 103 ? 47.737 26.055 44.518  1.00 48.20  ? 130  ILE C CG2 1 
ATOM   3402  C CD1 . ILE C  1 103 ? 50.668 26.696 44.207  1.00 52.63  ? 130  ILE C CD1 1 
ATOM   3403  N N   . GLY C  1 104 ? 47.907 22.803 46.509  1.00 44.88  ? 131  GLY C N   1 
ATOM   3404  C CA  . GLY C  1 104 ? 46.843 21.907 46.906  1.00 44.85  ? 131  GLY C CA  1 
ATOM   3405  C C   . GLY C  1 104 ? 47.036 20.427 46.630  1.00 43.67  ? 131  GLY C C   1 
ATOM   3406  O O   . GLY C  1 104 ? 47.779 19.748 47.347  1.00 43.53  ? 131  GLY C O   1 
ATOM   3407  N N   . LYS C  1 105 ? 46.361 19.936 45.589  1.00 41.89  ? 132  LYS C N   1 
ATOM   3408  C CA  . LYS C  1 105 ? 46.405 18.520 45.233  1.00 41.74  ? 132  LYS C CA  1 
ATOM   3409  C C   . LYS C  1 105 ? 47.502 18.097 44.247  1.00 40.92  ? 132  LYS C C   1 
ATOM   3410  O O   . LYS C  1 105 ? 47.887 16.925 44.179  1.00 39.72  ? 132  LYS C O   1 
ATOM   3411  C CB  . LYS C  1 105 ? 45.015 18.066 44.744  1.00 41.21  ? 132  LYS C CB  1 
ATOM   3412  C CG  . LYS C  1 105 ? 44.107 17.634 45.898  1.00 41.21  ? 132  LYS C CG  1 
ATOM   3413  C CD  . LYS C  1 105 ? 42.842 16.927 45.439  1.00 41.45  ? 132  LYS C CD  1 
ATOM   3414  C CE  . LYS C  1 105 ? 41.821 17.893 44.856  1.00 41.75  ? 132  LYS C CE  1 
ATOM   3415  N NZ  . LYS C  1 105 ? 40.466 17.283 44.877  1.00 40.71  ? 132  LYS C NZ  1 
ATOM   3416  N N   . GLY C  1 106 ? 48.005 19.051 43.482  1.00 40.09  ? 133  GLY C N   1 
ATOM   3417  C CA  . GLY C  1 106 ? 49.080 18.751 42.556  1.00 37.72  ? 133  GLY C CA  1 
ATOM   3418  C C   . GLY C  1 106 ? 48.633 18.285 41.195  1.00 36.43  ? 133  GLY C C   1 
ATOM   3419  O O   . GLY C  1 106 ? 49.432 17.744 40.426  1.00 37.06  ? 133  GLY C O   1 
ATOM   3420  N N   . ARG C  1 107 ? 47.372 18.558 40.873  1.00 34.50  ? 134  ARG C N   1 
ATOM   3421  C CA  . ARG C  1 107 ? 46.800 18.110 39.608  1.00 32.54  ? 134  ARG C CA  1 
ATOM   3422  C C   . ARG C  1 107 ? 47.655 18.465 38.426  1.00 30.12  ? 134  ARG C C   1 
ATOM   3423  O O   . ARG C  1 107 ? 47.547 17.856 37.369  1.00 31.20  ? 134  ARG C O   1 
ATOM   3424  C CB  . ARG C  1 107 ? 45.399 18.683 39.420  1.00 32.43  ? 134  ARG C CB  1 
ATOM   3425  N N   . SER C  1 108 ? 48.519 19.444 38.612  1.00 26.97  ? 135  SER C N   1 
ATOM   3426  C CA  . SER C  1 108 ? 49.360 19.902 37.527  1.00 24.74  ? 135  SER C CA  1 
ATOM   3427  C C   . SER C  1 108 ? 50.857 19.843 37.815  1.00 21.63  ? 135  SER C C   1 
ATOM   3428  O O   . SER C  1 108 ? 51.661 20.371 37.055  1.00 19.37  ? 135  SER C O   1 
ATOM   3429  C CB  . SER C  1 108 ? 48.960 21.327 37.152  1.00 26.87  ? 135  SER C CB  1 
ATOM   3430  O OG  . SER C  1 108 ? 49.231 22.232 38.210  1.00 29.48  ? 135  SER C OG  1 
ATOM   3431  N N   . TYR C  1 109 ? 51.241 19.206 38.909  1.00 19.30  ? 136  TYR C N   1 
ATOM   3432  C CA  . TYR C  1 109 ? 52.654 19.087 39.211  1.00 17.68  ? 136  TYR C CA  1 
ATOM   3433  C C   . TYR C  1 109 ? 53.403 18.429 38.056  1.00 17.23  ? 136  TYR C C   1 
ATOM   3434  O O   . TYR C  1 109 ? 53.169 17.256 37.735  1.00 17.10  ? 136  TYR C O   1 
ATOM   3435  C CB  . TYR C  1 109 ? 52.877 18.257 40.460  1.00 15.01  ? 136  TYR C CB  1 
ATOM   3436  C CG  . TYR C  1 109 ? 54.319 17.870 40.623  1.00 16.58  ? 136  TYR C CG  1 
ATOM   3437  C CD1 . TYR C  1 109 ? 55.268 18.803 41.033  1.00 16.74  ? 136  TYR C CD1 1 
ATOM   3438  C CD2 . TYR C  1 109 ? 54.750 16.575 40.353  1.00 15.79  ? 136  TYR C CD2 1 
ATOM   3439  C CE1 . TYR C  1 109 ? 56.607 18.457 41.176  1.00 15.46  ? 136  TYR C CE1 1 
ATOM   3440  C CE2 . TYR C  1 109 ? 56.092 16.223 40.497  1.00 14.76  ? 136  TYR C CE2 1 
ATOM   3441  C CZ  . TYR C  1 109 ? 57.012 17.167 40.910  1.00 13.20  ? 136  TYR C CZ  1 
ATOM   3442  O OH  . TYR C  1 109 ? 58.334 16.823 41.074  1.00 12.97  ? 136  TYR C OH  1 
ATOM   3443  N N   . LYS C  1 110 ? 54.308 19.202 37.456  1.00 16.75  ? 137  LYS C N   1 
ATOM   3444  C CA  . LYS C  1 110 ? 55.120 18.745 36.338  1.00 17.25  ? 137  LYS C CA  1 
ATOM   3445  C C   . LYS C  1 110 ? 56.631 18.677 36.671  1.00 17.02  ? 137  LYS C C   1 
ATOM   3446  O O   . LYS C  1 110 ? 57.476 18.716 35.771  1.00 17.52  ? 137  LYS C O   1 
ATOM   3447  C CB  . LYS C  1 110 ? 54.877 19.659 35.146  1.00 17.53  ? 137  LYS C CB  1 
ATOM   3448  N N   . GLY C  1 111 ? 56.968 18.558 37.955  1.00 15.82  ? 138  GLY C N   1 
ATOM   3449  C CA  . GLY C  1 111 ? 58.369 18.505 38.348  1.00 13.47  ? 138  GLY C CA  1 
ATOM   3450  C C   . GLY C  1 111 ? 58.988 17.165 38.022  1.00 12.22  ? 138  GLY C C   1 
ATOM   3451  O O   . GLY C  1 111 ? 58.329 16.318 37.425  1.00 13.54  ? 138  GLY C O   1 
ATOM   3452  N N   . THR C  1 112 ? 60.237 16.950 38.420  1.00 10.49  ? 139  THR C N   1 
ATOM   3453  C CA  . THR C  1 112 ? 60.899 15.689 38.125  1.00 9.35   ? 139  THR C CA  1 
ATOM   3454  C C   . THR C  1 112 ? 61.291 14.827 39.315  1.00 10.16  ? 139  THR C C   1 
ATOM   3455  O O   . THR C  1 112 ? 62.202 14.019 39.200  1.00 10.71  ? 139  THR C O   1 
ATOM   3456  C CB  . THR C  1 112 ? 62.148 15.912 37.321  1.00 9.84   ? 139  THR C CB  1 
ATOM   3457  O OG1 . THR C  1 112 ? 63.084 16.654 38.117  1.00 12.00  ? 139  THR C OG1 1 
ATOM   3458  C CG2 . THR C  1 112 ? 61.823 16.676 36.066  1.00 7.34   ? 139  THR C CG2 1 
ATOM   3459  N N   . VAL C  1 113 ? 60.633 14.995 40.455  1.00 10.40  ? 140  VAL C N   1 
ATOM   3460  C CA  . VAL C  1 113 ? 60.934 14.148 41.600  1.00 11.40  ? 140  VAL C CA  1 
ATOM   3461  C C   . VAL C  1 113 ? 60.462 12.735 41.254  1.00 13.62  ? 140  VAL C C   1 
ATOM   3462  O O   . VAL C  1 113 ? 59.385 12.545 40.693  1.00 13.49  ? 140  VAL C O   1 
ATOM   3463  C CB  . VAL C  1 113 ? 60.197 14.615 42.835  1.00 10.74  ? 140  VAL C CB  1 
ATOM   3464  C CG1 . VAL C  1 113 ? 60.294 13.565 43.913  1.00 11.40  ? 140  VAL C CG1 1 
ATOM   3465  C CG2 . VAL C  1 113 ? 60.781 15.923 43.298  1.00 11.96  ? 140  VAL C CG2 1 
ATOM   3466  N N   . SER C  1 114 ? 61.269 11.740 41.579  1.00 16.86  ? 141  SER C N   1 
ATOM   3467  C CA  . SER C  1 114 ? 60.909 10.363 41.269  1.00 19.90  ? 141  SER C CA  1 
ATOM   3468  C C   . SER C  1 114 ? 61.217 9.426  42.434  1.00 21.31  ? 141  SER C C   1 
ATOM   3469  O O   . SER C  1 114 ? 61.774 8.344  42.267  1.00 21.56  ? 141  SER C O   1 
ATOM   3470  C CB  . SER C  1 114 ? 61.659 9.922  40.020  1.00 18.85  ? 141  SER C CB  1 
ATOM   3471  O OG  . SER C  1 114 ? 63.041 10.185 40.175  1.00 17.93  ? 141  SER C OG  1 
ATOM   3472  N N   . ILE C  1 115 ? 60.822 9.856  43.615  1.00 23.21  ? 142  ILE C N   1 
ATOM   3473  C CA  . ILE C  1 115 ? 61.053 9.086  44.804  1.00 25.33  ? 142  ILE C CA  1 
ATOM   3474  C C   . ILE C  1 115 ? 59.842 9.180  45.719  1.00 28.54  ? 142  ILE C C   1 
ATOM   3475  O O   . ILE C  1 115 ? 59.164 10.219 45.796  1.00 29.51  ? 142  ILE C O   1 
ATOM   3476  C CB  . ILE C  1 115 ? 62.303 9.601  45.529  1.00 23.50  ? 142  ILE C CB  1 
ATOM   3477  C CG1 . ILE C  1 115 ? 63.528 9.141  44.769  1.00 22.41  ? 142  ILE C CG1 1 
ATOM   3478  C CG2 . ILE C  1 115 ? 62.321 9.131  46.981  1.00 24.20  ? 142  ILE C CG2 1 
ATOM   3479  C CD1 . ILE C  1 115 ? 64.669 8.775  45.652  1.00 23.54  ? 142  ILE C CD1 1 
ATOM   3480  N N   . THR C  1 116 ? 59.560 8.079  46.400  1.00 29.86  ? 143  THR C N   1 
ATOM   3481  C CA  . THR C  1 116 ? 58.444 8.044  47.327  1.00 30.81  ? 143  THR C CA  1 
ATOM   3482  C C   . THR C  1 116 ? 58.947 8.624  48.644  1.00 32.90  ? 143  THR C C   1 
ATOM   3483  O O   . THR C  1 116 ? 60.165 8.631  48.900  1.00 31.52  ? 143  THR C O   1 
ATOM   3484  C CB  . THR C  1 116 ? 57.983 6.622  47.540  1.00 29.42  ? 143  THR C CB  1 
ATOM   3485  O OG1 . THR C  1 116 ? 59.061 5.848  48.076  1.00 27.56  ? 143  THR C OG1 1 
ATOM   3486  C CG2 . THR C  1 116 ? 57.556 6.026  46.230  1.00 29.16  ? 143  THR C CG2 1 
ATOM   3487  N N   . LYS C  1 117 ? 58.027 9.102  49.484  1.00 34.07  ? 144  LYS C N   1 
ATOM   3488  C CA  . LYS C  1 117 ? 58.452 9.707  50.739  1.00 35.38  ? 144  LYS C CA  1 
ATOM   3489  C C   . LYS C  1 117 ? 59.185 8.727  51.641  1.00 34.23  ? 144  LYS C C   1 
ATOM   3490  O O   . LYS C  1 117 ? 59.731 9.104  52.676  1.00 33.44  ? 144  LYS C O   1 
ATOM   3491  C CB  . LYS C  1 117 ? 57.271 10.364 51.466  1.00 37.48  ? 144  LYS C CB  1 
ATOM   3492  C CG  . LYS C  1 117 ? 56.346 9.449  52.213  1.00 41.25  ? 144  LYS C CG  1 
ATOM   3493  C CD  . LYS C  1 117 ? 55.354 10.293 53.013  1.00 44.22  ? 144  LYS C CD  1 
ATOM   3494  C CE  . LYS C  1 117 ? 54.362 9.426  53.797  1.00 46.37  ? 144  LYS C CE  1 
ATOM   3495  N NZ  . LYS C  1 117 ? 53.282 10.248 54.437  1.00 47.26  ? 144  LYS C NZ  1 
ATOM   3496  N N   . SER C  1 118 ? 59.218 7.469  51.228  1.00 33.82  ? 145  SER C N   1 
ATOM   3497  C CA  . SER C  1 118 ? 59.925 6.453  51.989  1.00 34.63  ? 145  SER C CA  1 
ATOM   3498  C C   . SER C  1 118 ? 61.255 6.180  51.319  1.00 33.90  ? 145  SER C C   1 
ATOM   3499  O O   . SER C  1 118 ? 61.972 5.251  51.696  1.00 34.68  ? 145  SER C O   1 
ATOM   3500  C CB  . SER C  1 118 ? 59.124 5.158  52.047  1.00 37.02  ? 145  SER C CB  1 
ATOM   3501  O OG  . SER C  1 118 ? 57.996 5.298  52.889  1.00 41.58  ? 145  SER C OG  1 
ATOM   3502  N N   . GLY C  1 119 ? 61.566 6.971  50.298  1.00 31.54  ? 146  GLY C N   1 
ATOM   3503  C CA  . GLY C  1 119 ? 62.827 6.808  49.606  1.00 30.27  ? 146  GLY C CA  1 
ATOM   3504  C C   . GLY C  1 119 ? 62.898 5.714  48.558  1.00 29.74  ? 146  GLY C C   1 
ATOM   3505  O O   . GLY C  1 119 ? 63.984 5.292  48.174  1.00 29.35  ? 146  GLY C O   1 
ATOM   3506  N N   . ILE C  1 120 ? 61.754 5.247  48.086  1.00 28.99  ? 147  ILE C N   1 
ATOM   3507  C CA  . ILE C  1 120 ? 61.753 4.217  47.062  1.00 28.57  ? 147  ILE C CA  1 
ATOM   3508  C C   . ILE C  1 120 ? 61.789 4.890  45.700  1.00 27.60  ? 147  ILE C C   1 
ATOM   3509  O O   . ILE C  1 120 ? 61.103 5.894  45.477  1.00 27.99  ? 147  ILE C O   1 
ATOM   3510  C CB  . ILE C  1 120 ? 60.476 3.359  47.113  1.00 31.65  ? 147  ILE C CB  1 
ATOM   3511  C CG1 . ILE C  1 120 ? 60.290 2.767  48.511  1.00 33.20  ? 147  ILE C CG1 1 
ATOM   3512  C CG2 . ILE C  1 120 ? 60.544 2.262  46.057  1.00 30.57  ? 147  ILE C CG2 1 
ATOM   3513  C CD1 . ILE C  1 120 ? 58.974 2.009  48.679  1.00 34.58  ? 147  ILE C CD1 1 
ATOM   3514  N N   . LYS C  1 121 ? 62.583 4.334  44.792  1.00 26.46  ? 148  LYS C N   1 
ATOM   3515  C CA  . LYS C  1 121 ? 62.684 4.865  43.440  1.00 25.44  ? 148  LYS C CA  1 
ATOM   3516  C C   . LYS C  1 121 ? 61.387 4.529  42.712  1.00 25.33  ? 148  LYS C C   1 
ATOM   3517  O O   . LYS C  1 121 ? 60.849 3.443  42.871  1.00 25.95  ? 148  LYS C O   1 
ATOM   3518  C CB  . LYS C  1 121 ? 63.865 4.237  42.717  1.00 26.02  ? 148  LYS C CB  1 
ATOM   3519  C CG  . LYS C  1 121 ? 64.026 4.720  41.293  1.00 27.75  ? 148  LYS C CG  1 
ATOM   3520  C CD  . LYS C  1 121 ? 65.263 4.136  40.639  1.00 27.79  ? 148  LYS C CD  1 
ATOM   3521  C CE  . LYS C  1 121 ? 65.505 4.768  39.282  1.00 31.66  ? 148  LYS C CE  1 
ATOM   3522  N NZ  . LYS C  1 121 ? 66.796 4.349  38.642  1.00 33.45  ? 148  LYS C NZ  1 
ATOM   3523  N N   . CYS C  1 122 ? 60.882 5.457  41.914  1.00 24.21  ? 149  CYS C N   1 
ATOM   3524  C CA  . CYS C  1 122 ? 59.638 5.215  41.220  1.00 25.41  ? 149  CYS C CA  1 
ATOM   3525  C C   . CYS C  1 122 ? 59.778 4.258  40.050  1.00 25.70  ? 149  CYS C C   1 
ATOM   3526  O O   . CYS C  1 122 ? 60.865 4.065  39.515  1.00 28.37  ? 149  CYS C O   1 
ATOM   3527  C CB  . CYS C  1 122 ? 59.063 6.532  40.706  1.00 26.64  ? 149  CYS C CB  1 
ATOM   3528  S SG  . CYS C  1 122 ? 58.404 7.671  41.959  1.00 28.77  ? 149  CYS C SG  1 
ATOM   3529  N N   . GLN C  1 123 ? 58.662 3.665  39.652  1.00 24.47  ? 150  GLN C N   1 
ATOM   3530  C CA  . GLN C  1 123 ? 58.623 2.754  38.517  1.00 23.81  ? 150  GLN C CA  1 
ATOM   3531  C C   . GLN C  1 123 ? 58.155 3.544  37.303  1.00 23.58  ? 150  GLN C C   1 
ATOM   3532  O O   . GLN C  1 123 ? 57.236 4.347  37.401  1.00 21.20  ? 150  GLN C O   1 
ATOM   3533  C CB  . GLN C  1 123 ? 57.620 1.626  38.758  1.00 23.71  ? 150  GLN C CB  1 
ATOM   3534  C CG  . GLN C  1 123 ? 57.309 0.804  37.514  1.00 21.73  ? 150  GLN C CG  1 
ATOM   3535  C CD  . GLN C  1 123 ? 56.148 -0.138 37.715  1.00 21.72  ? 150  GLN C CD  1 
ATOM   3536  O OE1 . GLN C  1 123 ? 55.988 -0.717 38.788  1.00 21.65  ? 150  GLN C OE1 1 
ATOM   3537  N NE2 . GLN C  1 123 ? 55.339 -0.314 36.676  1.00 19.88  ? 150  GLN C NE2 1 
ATOM   3538  N N   . PRO C  1 124 ? 58.783 3.323  36.140  1.00 24.19  ? 151  PRO C N   1 
ATOM   3539  C CA  . PRO C  1 124 ? 58.361 4.053  34.943  1.00 23.98  ? 151  PRO C CA  1 
ATOM   3540  C C   . PRO C  1 124 ? 56.870 3.805  34.708  1.00 25.90  ? 151  PRO C C   1 
ATOM   3541  O O   . PRO C  1 124 ? 56.384 2.698  34.873  1.00 25.22  ? 151  PRO C O   1 
ATOM   3542  C CB  . PRO C  1 124 ? 59.209 3.425  33.846  1.00 22.20  ? 151  PRO C CB  1 
ATOM   3543  C CG  . PRO C  1 124 ? 60.430 2.988  34.570  1.00 20.16  ? 151  PRO C CG  1 
ATOM   3544  C CD  . PRO C  1 124 ? 59.915 2.426  35.846  1.00 22.48  ? 151  PRO C CD  1 
ATOM   3545  N N   . TRP C  1 125 ? 56.133 4.829  34.323  1.00 28.66  ? 152  TRP C N   1 
ATOM   3546  C CA  . TRP C  1 125 ? 54.720 4.621  34.079  1.00 29.33  ? 152  TRP C CA  1 
ATOM   3547  C C   . TRP C  1 125 ? 54.550 3.680  32.890  1.00 29.98  ? 152  TRP C C   1 
ATOM   3548  O O   . TRP C  1 125 ? 53.651 2.853  32.868  1.00 30.15  ? 152  TRP C O   1 
ATOM   3549  C CB  . TRP C  1 125 ? 54.029 5.959  33.799  1.00 31.03  ? 152  TRP C CB  1 
ATOM   3550  C CG  . TRP C  1 125 ? 54.107 6.902  34.947  1.00 33.25  ? 152  TRP C CG  1 
ATOM   3551  C CD1 . TRP C  1 125 ? 55.061 7.859  35.171  1.00 33.14  ? 152  TRP C CD1 1 
ATOM   3552  C CD2 . TRP C  1 125 ? 53.232 6.934  36.076  1.00 33.77  ? 152  TRP C CD2 1 
ATOM   3553  N NE1 . TRP C  1 125 ? 54.829 8.482  36.376  1.00 33.34  ? 152  TRP C NE1 1 
ATOM   3554  C CE2 . TRP C  1 125 ? 53.712 7.933  36.952  1.00 33.01  ? 152  TRP C CE2 1 
ATOM   3555  C CE3 . TRP C  1 125 ? 52.087 6.213  36.434  1.00 33.72  ? 152  TRP C CE3 1 
ATOM   3556  C CZ2 . TRP C  1 125 ? 53.087 8.229  38.163  1.00 32.49  ? 152  TRP C CZ2 1 
ATOM   3557  C CZ3 . TRP C  1 125 ? 51.466 6.506  37.637  1.00 32.78  ? 152  TRP C CZ3 1 
ATOM   3558  C CH2 . TRP C  1 125 ? 51.969 7.507  38.488  1.00 33.13  ? 152  TRP C CH2 1 
ATOM   3559  N N   . SER C  1 126 ? 55.425 3.801  31.896  1.00 31.38  ? 153  SER C N   1 
ATOM   3560  C CA  . SER C  1 126 ? 55.327 2.963  30.708  1.00 31.36  ? 153  SER C CA  1 
ATOM   3561  C C   . SER C  1 126 ? 55.582 1.489  31.027  1.00 31.18  ? 153  SER C C   1 
ATOM   3562  O O   . SER C  1 126 ? 55.193 0.613  30.255  1.00 30.30  ? 153  SER C O   1 
ATOM   3563  C CB  . SER C  1 126 ? 56.317 3.438  29.657  1.00 30.95  ? 153  SER C CB  1 
ATOM   3564  O OG  . SER C  1 126 ? 57.638 3.271  30.136  1.00 33.86  ? 153  SER C OG  1 
ATOM   3565  N N   . SER C  1 127 ? 56.228 1.210  32.158  1.00 29.76  ? 154  SER C N   1 
ATOM   3566  C CA  . SER C  1 127 ? 56.491 -0.177 32.528  1.00 28.88  ? 154  SER C CA  1 
ATOM   3567  C C   . SER C  1 127 ? 55.338 -0.864 33.285  1.00 30.41  ? 154  SER C C   1 
ATOM   3568  O O   . SER C  1 127 ? 54.430 -0.220 33.834  1.00 28.81  ? 154  SER C O   1 
ATOM   3569  C CB  . SER C  1 127 ? 57.756 -0.284 33.372  1.00 28.77  ? 154  SER C CB  1 
ATOM   3570  O OG  . SER C  1 127 ? 57.869 -1.592 33.908  1.00 26.42  ? 154  SER C OG  1 
ATOM   3571  N N   . MET C  1 128 ? 55.387 -2.192 33.303  1.00 30.37  ? 155  MET C N   1 
ATOM   3572  C CA  . MET C  1 128 ? 54.389 -2.993 33.991  1.00 30.27  ? 155  MET C CA  1 
ATOM   3573  C C   . MET C  1 128 ? 55.133 -3.803 35.039  1.00 30.93  ? 155  MET C C   1 
ATOM   3574  O O   . MET C  1 128 ? 54.580 -4.700 35.666  1.00 32.12  ? 155  MET C O   1 
ATOM   3575  C CB  . MET C  1 128 ? 53.693 -3.939 33.028  1.00 28.66  ? 155  MET C CB  1 
ATOM   3576  C CG  . MET C  1 128 ? 52.822 -3.265 32.022  1.00 32.93  ? 155  MET C CG  1 
ATOM   3577  S SD  . MET C  1 128 ? 51.412 -2.443 32.761  1.00 37.08  ? 155  MET C SD  1 
ATOM   3578  C CE  . MET C  1 128 ? 51.442 -0.915 31.871  1.00 37.26  ? 155  MET C CE  1 
ATOM   3579  N N   . ILE C  1 129 ? 56.399 -3.477 35.231  1.00 30.58  ? 156  ILE C N   1 
ATOM   3580  C CA  . ILE C  1 129 ? 57.203 -4.194 36.196  1.00 32.11  ? 156  ILE C CA  1 
ATOM   3581  C C   . ILE C  1 129 ? 57.800 -3.234 37.203  1.00 31.56  ? 156  ILE C C   1 
ATOM   3582  O O   . ILE C  1 129 ? 58.270 -2.167 36.839  1.00 31.16  ? 156  ILE C O   1 
ATOM   3583  C CB  . ILE C  1 129 ? 58.345 -4.949 35.488  1.00 35.46  ? 156  ILE C CB  1 
ATOM   3584  C CG1 . ILE C  1 129 ? 57.753 -5.871 34.422  1.00 36.40  ? 156  ILE C CG1 1 
ATOM   3585  C CG2 . ILE C  1 129 ? 59.180 -5.733 36.500  1.00 34.38  ? 156  ILE C CG2 1 
ATOM   3586  C CD1 . ILE C  1 129 ? 58.785 -6.538 33.566  1.00 39.58  ? 156  ILE C CD1 1 
ATOM   3587  N N   . PRO C  1 130 ? 57.764 -3.593 38.490  1.00 31.97  ? 157  PRO C N   1 
ATOM   3588  C CA  . PRO C  1 130 ? 57.193 -4.836 39.003  1.00 33.29  ? 157  PRO C CA  1 
ATOM   3589  C C   . PRO C  1 130 ? 55.688 -4.738 39.232  1.00 33.90  ? 157  PRO C C   1 
ATOM   3590  O O   . PRO C  1 130 ? 55.099 -5.608 39.867  1.00 34.02  ? 157  PRO C O   1 
ATOM   3591  C CB  . PRO C  1 130 ? 57.950 -5.038 40.308  1.00 33.61  ? 157  PRO C CB  1 
ATOM   3592  C CG  . PRO C  1 130 ? 58.085 -3.667 40.811  1.00 34.03  ? 157  PRO C CG  1 
ATOM   3593  C CD  . PRO C  1 130 ? 58.493 -2.892 39.558  1.00 33.57  ? 157  PRO C CD  1 
ATOM   3594  N N   . HIS C  1 131 ? 55.057 -3.687 38.720  1.00 34.48  ? 158  HIS C N   1 
ATOM   3595  C CA  . HIS C  1 131 ? 53.628 -3.541 38.930  1.00 34.72  ? 158  HIS C CA  1 
ATOM   3596  C C   . HIS C  1 131 ? 52.841 -3.264 37.690  1.00 35.74  ? 158  HIS C C   1 
ATOM   3597  O O   . HIS C  1 131 ? 53.075 -2.283 36.988  1.00 36.73  ? 158  HIS C O   1 
ATOM   3598  C CB  . HIS C  1 131 ? 53.341 -2.447 39.943  1.00 34.26  ? 158  HIS C CB  1 
ATOM   3599  C CG  . HIS C  1 131 ? 53.964 -2.688 41.277  1.00 34.11  ? 158  HIS C CG  1 
ATOM   3600  N ND1 . HIS C  1 131 ? 55.216 -2.221 41.607  1.00 34.25  ? 158  HIS C ND1 1 
ATOM   3601  C CD2 . HIS C  1 131 ? 53.516 -3.366 42.359  1.00 34.65  ? 158  HIS C CD2 1 
ATOM   3602  C CE1 . HIS C  1 131 ? 55.516 -2.599 42.836  1.00 33.69  ? 158  HIS C CE1 1 
ATOM   3603  N NE2 . HIS C  1 131 ? 54.501 -3.294 43.314  1.00 34.49  ? 158  HIS C NE2 1 
ATOM   3604  N N   . GLU C  1 132 ? 51.876 -4.143 37.461  1.00 37.36  ? 159  GLU C N   1 
ATOM   3605  C CA  . GLU C  1 132 ? 50.993 -4.076 36.315  1.00 39.17  ? 159  GLU C CA  1 
ATOM   3606  C C   . GLU C  1 132 ? 49.908 -3.030 36.626  1.00 39.03  ? 159  GLU C C   1 
ATOM   3607  O O   . GLU C  1 132 ? 49.207 -3.157 37.629  1.00 39.49  ? 159  GLU C O   1 
ATOM   3608  C CB  . GLU C  1 132 ? 50.388 -5.463 36.104  1.00 40.67  ? 159  GLU C CB  1 
ATOM   3609  C CG  . GLU C  1 132 ? 49.764 -5.664 34.751  1.00 44.61  ? 159  GLU C CG  1 
ATOM   3610  C CD  . GLU C  1 132 ? 48.601 -6.626 34.789  1.00 44.98  ? 159  GLU C CD  1 
ATOM   3611  O OE1 . GLU C  1 132 ? 48.814 -7.761 35.277  1.00 46.27  ? 159  GLU C OE1 1 
ATOM   3612  O OE2 . GLU C  1 132 ? 47.486 -6.242 34.338  1.00 43.50  ? 159  GLU C OE2 1 
ATOM   3613  N N   . HIS C  1 133 ? 49.765 -2.009 35.775  1.00 37.63  ? 160  HIS C N   1 
ATOM   3614  C CA  . HIS C  1 133 ? 48.793 -0.968 36.042  1.00 36.27  ? 160  HIS C CA  1 
ATOM   3615  C C   . HIS C  1 133 ? 48.123 -0.462 34.787  1.00 36.54  ? 160  HIS C C   1 
ATOM   3616  O O   . HIS C  1 133 ? 48.604 -0.656 33.676  1.00 37.84  ? 160  HIS C O   1 
ATOM   3617  C CB  . HIS C  1 133 ? 49.461 0.189  36.775  1.00 36.43  ? 160  HIS C CB  1 
ATOM   3618  C CG  . HIS C  1 133 ? 50.400 0.975  35.919  1.00 36.74  ? 160  HIS C CG  1 
ATOM   3619  N ND1 . HIS C  1 133 ? 51.690 0.559  35.656  1.00 35.68  ? 160  HIS C ND1 1 
ATOM   3620  C CD2 . HIS C  1 133 ? 50.206 2.102  35.191  1.00 34.64  ? 160  HIS C CD2 1 
ATOM   3621  C CE1 . HIS C  1 133 ? 52.244 1.393  34.795  1.00 36.21  ? 160  HIS C CE1 1 
ATOM   3622  N NE2 . HIS C  1 133 ? 51.364 2.336  34.496  1.00 35.48  ? 160  HIS C NE2 1 
ATOM   3623  N N   . SER C  1 134 ? 46.995 0.192  34.992  1.00 36.47  ? 161  SER C N   1 
ATOM   3624  C CA  . SER C  1 134 ? 46.181 0.683  33.913  1.00 35.46  ? 161  SER C CA  1 
ATOM   3625  C C   . SER C  1 134 ? 46.492 2.090  33.501  1.00 35.95  ? 161  SER C C   1 
ATOM   3626  O O   . SER C  1 134 ? 46.050 2.541  32.447  1.00 36.71  ? 161  SER C O   1 
ATOM   3627  C CB  . SER C  1 134 ? 44.727 0.579  34.340  1.00 35.80  ? 161  SER C CB  1 
ATOM   3628  O OG  . SER C  1 134 ? 44.527 -0.642 35.039  1.00 35.84  ? 161  SER C OG  1 
ATOM   3629  N N   . PHE C  1 135 ? 47.250 2.793  34.328  1.00 37.09  ? 162  PHE C N   1 
ATOM   3630  C CA  . PHE C  1 135 ? 47.577 4.178  34.032  1.00 37.30  ? 162  PHE C CA  1 
ATOM   3631  C C   . PHE C  1 135 ? 48.392 4.257  32.771  1.00 37.90  ? 162  PHE C C   1 
ATOM   3632  O O   . PHE C  1 135 ? 49.607 4.414  32.795  1.00 38.09  ? 162  PHE C O   1 
ATOM   3633  C CB  . PHE C  1 135 ? 48.310 4.791  35.208  1.00 36.71  ? 162  PHE C CB  1 
ATOM   3634  C CG  . PHE C  1 135 ? 47.424 5.039  36.393  1.00 35.76  ? 162  PHE C CG  1 
ATOM   3635  C CD1 . PHE C  1 135 ? 46.440 6.024  36.340  1.00 33.73  ? 162  PHE C CD1 1 
ATOM   3636  C CD2 . PHE C  1 135 ? 47.571 4.290  37.563  1.00 34.31  ? 162  PHE C CD2 1 
ATOM   3637  C CE1 . PHE C  1 135 ? 45.623 6.262  37.425  1.00 32.81  ? 162  PHE C CE1 1 
ATOM   3638  C CE2 . PHE C  1 135 ? 46.753 4.524  38.653  1.00 33.43  ? 162  PHE C CE2 1 
ATOM   3639  C CZ  . PHE C  1 135 ? 45.779 5.512  38.583  1.00 33.71  ? 162  PHE C CZ  1 
ATOM   3640  N N   . LEU C  1 136 ? 47.689 4.127  31.660  1.00 39.52  ? 163  LEU C N   1 
ATOM   3641  C CA  . LEU C  1 136 ? 48.299 4.159  30.352  1.00 42.43  ? 163  LEU C CA  1 
ATOM   3642  C C   . LEU C  1 136 ? 48.211 5.552  29.796  1.00 45.25  ? 163  LEU C C   1 
ATOM   3643  O O   . LEU C  1 136 ? 47.130 6.130  29.734  1.00 46.11  ? 163  LEU C O   1 
ATOM   3644  C CB  . LEU C  1 136 ? 47.576 3.190  29.421  1.00 40.22  ? 163  LEU C CB  1 
ATOM   3645  C CG  . LEU C  1 136 ? 47.662 1.756  29.935  1.00 39.62  ? 163  LEU C CG  1 
ATOM   3646  C CD1 . LEU C  1 136 ? 46.916 0.808  29.032  1.00 39.03  ? 163  LEU C CD1 1 
ATOM   3647  C CD2 . LEU C  1 136 ? 49.123 1.358  30.016  1.00 40.06  ? 163  LEU C CD2 1 
ATOM   3648  N N   . PRO C  1 137 ? 49.354 6.129  29.411  1.00 47.67  ? 164  PRO C N   1 
ATOM   3649  C CA  . PRO C  1 137 ? 49.311 7.481  28.852  1.00 49.28  ? 164  PRO C CA  1 
ATOM   3650  C C   . PRO C  1 137 ? 48.177 7.538  27.814  1.00 50.15  ? 164  PRO C C   1 
ATOM   3651  O O   . PRO C  1 137 ? 47.520 8.576  27.626  1.00 50.30  ? 164  PRO C O   1 
ATOM   3652  C CB  . PRO C  1 137 ? 50.698 7.625  28.239  1.00 48.75  ? 164  PRO C CB  1 
ATOM   3653  C CG  . PRO C  1 137 ? 51.543 6.899  29.250  1.00 49.28  ? 164  PRO C CG  1 
ATOM   3654  C CD  . PRO C  1 137 ? 50.741 5.640  29.506  1.00 48.44  ? 164  PRO C CD  1 
ATOM   3655  N N   . SER C  1 138 ? 47.950 6.400  27.159  1.00 49.41  ? 165  SER C N   1 
ATOM   3656  C CA  . SER C  1 138 ? 46.896 6.281  26.167  1.00 48.97  ? 165  SER C CA  1 
ATOM   3657  C C   . SER C  1 138 ? 45.645 7.009  26.651  1.00 48.16  ? 165  SER C C   1 
ATOM   3658  O O   . SER C  1 138 ? 45.057 7.806  25.931  1.00 49.53  ? 165  SER C O   1 
ATOM   3659  C CB  . SER C  1 138 ? 46.573 4.805  25.929  1.00 50.06  ? 165  SER C CB  1 
ATOM   3660  O OG  . SER C  1 138 ? 45.260 4.658  25.414  1.00 51.47  ? 165  SER C OG  1 
ATOM   3661  N N   . SER C  1 139 ? 45.254 6.739  27.887  1.00 47.24  ? 166  SER C N   1 
ATOM   3662  C CA  . SER C  1 139 ? 44.077 7.353  28.470  1.00 45.53  ? 166  SER C CA  1 
ATOM   3663  C C   . SER C  1 139 ? 44.470 8.299  29.583  1.00 44.74  ? 166  SER C C   1 
ATOM   3664  O O   . SER C  1 139 ? 43.772 8.413  30.584  1.00 43.23  ? 166  SER C O   1 
ATOM   3665  C CB  . SER C  1 139 ? 43.151 6.268  29.016  1.00 46.52  ? 166  SER C CB  1 
ATOM   3666  O OG  . SER C  1 139 ? 43.870 5.360  29.835  1.00 45.53  ? 166  SER C OG  1 
ATOM   3667  N N   . TYR C  1 140 ? 45.594 8.982  29.403  1.00 45.74  ? 167  TYR C N   1 
ATOM   3668  C CA  . TYR C  1 140 ? 46.078 9.919  30.410  1.00 46.51  ? 167  TYR C CA  1 
ATOM   3669  C C   . TYR C  1 140 ? 47.008 10.990 29.874  1.00 47.63  ? 167  TYR C C   1 
ATOM   3670  O O   . TYR C  1 140 ? 47.869 11.474 30.605  1.00 49.39  ? 167  TYR C O   1 
ATOM   3671  C CB  . TYR C  1 140 ? 46.792 9.167  31.524  1.00 44.39  ? 167  TYR C CB  1 
ATOM   3672  C CG  . TYR C  1 140 ? 45.870 8.606  32.569  1.00 43.99  ? 167  TYR C CG  1 
ATOM   3673  C CD1 . TYR C  1 140 ? 45.224 9.439  33.468  1.00 43.05  ? 167  TYR C CD1 1 
ATOM   3674  C CD2 . TYR C  1 140 ? 45.657 7.229  32.673  1.00 45.43  ? 167  TYR C CD2 1 
ATOM   3675  C CE1 . TYR C  1 140 ? 44.391 8.917  34.458  1.00 43.71  ? 167  TYR C CE1 1 
ATOM   3676  C CE2 . TYR C  1 140 ? 44.824 6.695  33.654  1.00 43.58  ? 167  TYR C CE2 1 
ATOM   3677  C CZ  . TYR C  1 140 ? 44.199 7.546  34.543  1.00 43.07  ? 167  TYR C CZ  1 
ATOM   3678  O OH  . TYR C  1 140 ? 43.400 7.032  35.526  1.00 42.08  ? 167  TYR C OH  1 
ATOM   3679  N N   . ARG C  1 141 ? 46.839 11.367 28.609  1.00 48.84  ? 168  ARG C N   1 
ATOM   3680  C CA  . ARG C  1 141 ? 47.687 12.396 28.002  1.00 48.79  ? 168  ARG C CA  1 
ATOM   3681  C C   . ARG C  1 141 ? 47.648 13.705 28.804  1.00 47.94  ? 168  ARG C C   1 
ATOM   3682  O O   . ARG C  1 141 ? 46.794 13.887 29.682  1.00 47.98  ? 168  ARG C O   1 
ATOM   3683  C CB  . ARG C  1 141 ? 47.243 12.645 26.557  1.00 48.07  ? 168  ARG C CB  1 
ATOM   3684  N N   . GLY C  1 142 ? 48.597 14.596 28.531  1.00 47.58  ? 169  GLY C N   1 
ATOM   3685  C CA  . GLY C  1 142 ? 48.607 15.882 29.210  1.00 46.96  ? 169  GLY C CA  1 
ATOM   3686  C C   . GLY C  1 142 ? 48.890 15.796 30.688  1.00 46.25  ? 169  GLY C C   1 
ATOM   3687  O O   . GLY C  1 142 ? 49.193 16.812 31.330  1.00 46.77  ? 169  GLY C O   1 
ATOM   3688  N N   . LYS C  1 143 ? 48.782 14.578 31.217  1.00 44.79  ? 170  LYS C N   1 
ATOM   3689  C CA  . LYS C  1 143 ? 49.040 14.302 32.622  1.00 42.69  ? 170  LYS C CA  1 
ATOM   3690  C C   . LYS C  1 143 ? 50.530 13.991 32.773  1.00 41.62  ? 170  LYS C C   1 
ATOM   3691  O O   . LYS C  1 143 ? 50.982 13.495 33.800  1.00 43.35  ? 170  LYS C O   1 
ATOM   3692  C CB  . LYS C  1 143 ? 48.182 13.122 33.087  1.00 42.40  ? 170  LYS C CB  1 
ATOM   3693  C CG  . LYS C  1 143 ? 46.672 13.410 33.105  1.00 41.90  ? 170  LYS C CG  1 
ATOM   3694  C CD  . LYS C  1 143 ? 46.290 14.338 34.263  1.00 42.26  ? 170  LYS C CD  1 
ATOM   3695  C CE  . LYS C  1 143 ? 44.799 14.672 34.265  1.00 41.61  ? 170  LYS C CE  1 
ATOM   3696  N NZ  . LYS C  1 143 ? 44.373 15.539 33.123  1.00 43.02  ? 170  LYS C NZ  1 
ATOM   3697  N N   . ASP C  1 144 ? 51.282 14.303 31.726  1.00 39.60  ? 171  ASP C N   1 
ATOM   3698  C CA  . ASP C  1 144 ? 52.721 14.096 31.675  1.00 36.99  ? 171  ASP C CA  1 
ATOM   3699  C C   . ASP C  1 144 ? 53.238 12.883 32.450  1.00 34.11  ? 171  ASP C C   1 
ATOM   3700  O O   . ASP C  1 144 ? 54.178 12.989 33.231  1.00 35.17  ? 171  ASP C O   1 
ATOM   3701  C CB  . ASP C  1 144 ? 53.435 15.369 32.145  1.00 38.64  ? 171  ASP C CB  1 
ATOM   3702  C CG  . ASP C  1 144 ? 54.945 15.311 31.932  1.00 41.17  ? 171  ASP C CG  1 
ATOM   3703  O OD1 . ASP C  1 144 ? 55.399 14.664 30.959  1.00 39.64  ? 171  ASP C OD1 1 
ATOM   3704  O OD2 . ASP C  1 144 ? 55.679 15.929 32.736  1.00 43.18  ? 171  ASP C OD2 1 
ATOM   3705  N N   . LEU C  1 145 ? 52.628 11.725 32.230  1.00 28.95  ? 172  LEU C N   1 
ATOM   3706  C CA  . LEU C  1 145 ? 53.074 10.516 32.900  1.00 23.80  ? 172  LEU C CA  1 
ATOM   3707  C C   . LEU C  1 145 ? 54.299 9.990  32.173  1.00 22.55  ? 172  LEU C C   1 
ATOM   3708  O O   . LEU C  1 145 ? 54.272 8.889  31.606  1.00 22.89  ? 172  LEU C O   1 
ATOM   3709  C CB  . LEU C  1 145 ? 51.966 9.466  32.890  1.00 21.74  ? 172  LEU C CB  1 
ATOM   3710  C CG  . LEU C  1 145 ? 50.742 9.799  33.736  1.00 18.45  ? 172  LEU C CG  1 
ATOM   3711  C CD1 . LEU C  1 145 ? 49.740 8.687  33.650  1.00 15.30  ? 172  LEU C CD1 1 
ATOM   3712  C CD2 . LEU C  1 145 ? 51.161 9.985  35.165  1.00 18.10  ? 172  LEU C CD2 1 
ATOM   3713  N N   . GLN C  1 146 ? 55.373 10.776 32.173  1.00 19.48  ? 173  GLN C N   1 
ATOM   3714  C CA  . GLN C  1 146 ? 56.574 10.351 31.490  1.00 18.69  ? 173  GLN C CA  1 
ATOM   3715  C C   . GLN C  1 146 ? 57.613 9.865  32.467  1.00 17.41  ? 173  GLN C C   1 
ATOM   3716  O O   . GLN C  1 146 ? 57.512 10.135 33.640  1.00 16.45  ? 173  GLN C O   1 
ATOM   3717  C CB  . GLN C  1 146 ? 57.121 11.479 30.629  1.00 20.95  ? 173  GLN C CB  1 
ATOM   3718  C CG  . GLN C  1 146 ? 57.835 12.569 31.353  1.00 23.49  ? 173  GLN C CG  1 
ATOM   3719  C CD  . GLN C  1 146 ? 58.489 13.547 30.383  1.00 26.32  ? 173  GLN C CD  1 
ATOM   3720  O OE1 . GLN C  1 146 ? 57.826 14.417 29.812  1.00 27.99  ? 173  GLN C OE1 1 
ATOM   3721  N NE2 . GLN C  1 146 ? 59.798 13.397 30.182  1.00 28.04  ? 173  GLN C NE2 1 
ATOM   3722  N N   . GLU C  1 147 ? 58.595 9.114  31.980  1.00 19.90  ? 174  GLU C N   1 
ATOM   3723  C CA  . GLU C  1 147 ? 59.656 8.558  32.826  1.00 20.53  ? 174  GLU C CA  1 
ATOM   3724  C C   . GLU C  1 147 ? 59.072 7.908  34.067  1.00 20.92  ? 174  GLU C C   1 
ATOM   3725  O O   . GLU C  1 147 ? 58.176 7.065  33.958  1.00 21.56  ? 174  GLU C O   1 
ATOM   3726  C CB  . GLU C  1 147 ? 60.633 9.651  33.231  1.00 22.64  ? 174  GLU C CB  1 
ATOM   3727  C CG  . GLU C  1 147 ? 61.381 10.267 32.072  1.00 23.53  ? 174  GLU C CG  1 
ATOM   3728  C CD  . GLU C  1 147 ? 62.272 9.275  31.355  1.00 24.69  ? 174  GLU C CD  1 
ATOM   3729  O OE1 . GLU C  1 147 ? 63.013 8.531  32.040  1.00 24.81  ? 174  GLU C OE1 1 
ATOM   3730  O OE2 . GLU C  1 147 ? 62.237 9.248  30.102  1.00 27.62  ? 174  GLU C OE2 1 
ATOM   3731  N N   . ASN C  1 148 ? 59.572 8.289  35.244  1.00 20.48  ? 175  ASN C N   1 
ATOM   3732  C CA  . ASN C  1 148 ? 59.051 7.729  36.485  1.00 20.93  ? 175  ASN C CA  1 
ATOM   3733  C C   . ASN C  1 148 ? 58.809 8.841  37.497  1.00 21.47  ? 175  ASN C C   1 
ATOM   3734  O O   . ASN C  1 148 ? 58.974 8.652  38.701  1.00 21.90  ? 175  ASN C O   1 
ATOM   3735  C CB  . ASN C  1 148 ? 60.013 6.677  37.046  1.00 19.00  ? 175  ASN C CB  1 
ATOM   3736  C CG  . ASN C  1 148 ? 61.288 7.277  37.563  1.00 19.92  ? 175  ASN C CG  1 
ATOM   3737  O OD1 . ASN C  1 148 ? 61.845 8.188  36.959  1.00 20.68  ? 175  ASN C OD1 1 
ATOM   3738  N ND2 . ASN C  1 148 ? 61.769 6.764  38.689  1.00 23.42  ? 175  ASN C ND2 1 
ATOM   3739  N N   . TYR C  1 149 ? 58.403 10.001 36.990  1.00 22.11  ? 176  TYR C N   1 
ATOM   3740  C CA  . TYR C  1 149 ? 58.136 11.154 37.838  1.00 24.14  ? 176  TYR C CA  1 
ATOM   3741  C C   . TYR C  1 149 ? 56.824 11.032 38.612  1.00 24.07  ? 176  TYR C C   1 
ATOM   3742  O O   . TYR C  1 149 ? 55.811 10.596 38.076  1.00 22.73  ? 176  TYR C O   1 
ATOM   3743  C CB  . TYR C  1 149 ? 58.056 12.430 37.008  1.00 26.14  ? 176  TYR C CB  1 
ATOM   3744  C CG  . TYR C  1 149 ? 59.192 12.661 36.047  1.00 30.12  ? 176  TYR C CG  1 
ATOM   3745  C CD1 . TYR C  1 149 ? 60.524 12.638 36.473  1.00 31.09  ? 176  TYR C CD1 1 
ATOM   3746  C CD2 . TYR C  1 149 ? 58.930 12.956 34.706  1.00 31.05  ? 176  TYR C CD2 1 
ATOM   3747  C CE1 . TYR C  1 149 ? 61.559 12.907 35.585  1.00 32.80  ? 176  TYR C CE1 1 
ATOM   3748  C CE2 . TYR C  1 149 ? 59.950 13.220 33.812  1.00 31.75  ? 176  TYR C CE2 1 
ATOM   3749  C CZ  . TYR C  1 149 ? 61.260 13.198 34.251  1.00 34.03  ? 176  TYR C CZ  1 
ATOM   3750  O OH  . TYR C  1 149 ? 62.268 13.485 33.356  1.00 36.48  ? 176  TYR C OH  1 
ATOM   3751  N N   . CYS C  1 150 ? 56.850 11.446 39.873  1.00 24.41  ? 177  CYS C N   1 
ATOM   3752  C CA  . CYS C  1 150 ? 55.666 11.431 40.707  1.00 23.69  ? 177  CYS C CA  1 
ATOM   3753  C C   . CYS C  1 150 ? 54.639 12.311 40.025  1.00 22.94  ? 177  CYS C C   1 
ATOM   3754  O O   . CYS C  1 150 ? 54.940 13.404 39.572  1.00 21.75  ? 177  CYS C O   1 
ATOM   3755  C CB  . CYS C  1 150 ? 55.976 12.011 42.076  1.00 23.65  ? 177  CYS C CB  1 
ATOM   3756  S SG  . CYS C  1 150 ? 57.300 11.170 42.977  1.00 25.74  ? 177  CYS C SG  1 
ATOM   3757  N N   . ARG C  1 151 ? 53.418 11.827 39.960  1.00 23.47  ? 178  ARG C N   1 
ATOM   3758  C CA  . ARG C  1 151 ? 52.359 12.575 39.333  1.00 24.61  ? 178  ARG C CA  1 
ATOM   3759  C C   . ARG C  1 151 ? 51.074 12.282 40.087  1.00 26.44  ? 178  ARG C C   1 
ATOM   3760  O O   . ARG C  1 151 ? 51.063 11.475 41.017  1.00 26.94  ? 178  ARG C O   1 
ATOM   3761  C CB  . ARG C  1 151 ? 52.238 12.150 37.875  1.00 23.78  ? 178  ARG C CB  1 
ATOM   3762  C CG  . ARG C  1 151 ? 53.425 12.524 37.028  1.00 22.32  ? 178  ARG C CG  1 
ATOM   3763  C CD  . ARG C  1 151 ? 53.230 13.924 36.451  1.00 21.37  ? 178  ARG C CD  1 
ATOM   3764  N NE  . ARG C  1 151 ? 54.346 14.383 35.616  1.00 21.34  ? 178  ARG C NE  1 
ATOM   3765  C CZ  . ARG C  1 151 ? 55.511 14.839 36.086  1.00 22.00  ? 178  ARG C CZ  1 
ATOM   3766  N NH1 . ARG C  1 151 ? 55.734 14.910 37.393  1.00 17.50  ? 178  ARG C NH1 1 
ATOM   3767  N NH2 . ARG C  1 151 ? 56.461 15.222 35.244  1.00 22.23  ? 178  ARG C NH2 1 
ATOM   3768  N N   . ASN C  1 152 ? 50.001 12.952 39.690  1.00 28.15  ? 179  ASN C N   1 
ATOM   3769  C CA  . ASN C  1 152 ? 48.703 12.774 40.313  1.00 30.70  ? 179  ASN C CA  1 
ATOM   3770  C C   . ASN C  1 152 ? 47.712 12.985 39.194  1.00 30.87  ? 179  ASN C C   1 
ATOM   3771  O O   . ASN C  1 152 ? 46.975 13.960 39.179  1.00 30.77  ? 179  ASN C O   1 
ATOM   3772  C CB  . ASN C  1 152 ? 48.494 13.813 41.418  1.00 33.06  ? 179  ASN C CB  1 
ATOM   3773  C CG  . ASN C  1 152 ? 47.203 13.607 42.164  1.00 36.84  ? 179  ASN C CG  1 
ATOM   3774  O OD1 . ASN C  1 152 ? 46.514 12.600 41.963  1.00 39.02  ? 179  ASN C OD1 1 
ATOM   3775  N ND2 . ASN C  1 152 ? 46.861 14.553 43.039  1.00 38.96  ? 179  ASN C ND2 1 
ATOM   3776  N N   . PRO C  1 153 ? 47.688 12.055 38.233  1.00 32.15  ? 180  PRO C N   1 
ATOM   3777  C CA  . PRO C  1 153 ? 46.810 12.087 37.060  1.00 34.32  ? 180  PRO C CA  1 
ATOM   3778  C C   . PRO C  1 153 ? 45.313 12.098 37.336  1.00 37.49  ? 180  PRO C C   1 
ATOM   3779  O O   . PRO C  1 153 ? 44.506 12.350 36.442  1.00 38.62  ? 180  PRO C O   1 
ATOM   3780  C CB  . PRO C  1 153 ? 47.255 10.862 36.266  1.00 31.88  ? 180  PRO C CB  1 
ATOM   3781  C CG  . PRO C  1 153 ? 47.653 9.905  37.338  1.00 31.56  ? 180  PRO C CG  1 
ATOM   3782  C CD  . PRO C  1 153 ? 48.418 10.775 38.307  1.00 31.24  ? 180  PRO C CD  1 
ATOM   3783  N N   . ARG C  1 154 ? 44.921 11.825 38.565  1.00 40.45  ? 181  ARG C N   1 
ATOM   3784  C CA  . ARG C  1 154 ? 43.505 11.849 38.846  1.00 44.06  ? 181  ARG C CA  1 
ATOM   3785  C C   . ARG C  1 154 ? 43.175 12.898 39.888  1.00 44.83  ? 181  ARG C C   1 
ATOM   3786  O O   . ARG C  1 154 ? 42.057 12.946 40.391  1.00 46.05  ? 181  ARG C O   1 
ATOM   3787  C CB  . ARG C  1 154 ? 43.033 10.460 39.268  1.00 46.68  ? 181  ARG C CB  1 
ATOM   3788  C CG  . ARG C  1 154 ? 42.587 9.614  38.080  1.00 50.43  ? 181  ARG C CG  1 
ATOM   3789  C CD  . ARG C  1 154 ? 42.361 8.181  38.483  1.00 54.59  ? 181  ARG C CD  1 
ATOM   3790  N NE  . ARG C  1 154 ? 42.150 8.057  39.920  1.00 59.12  ? 181  ARG C NE  1 
ATOM   3791  C CZ  . ARG C  1 154 ? 42.026 6.895  40.552  1.00 61.46  ? 181  ARG C CZ  1 
ATOM   3792  N NH1 . ARG C  1 154 ? 42.089 5.763  39.867  1.00 62.97  ? 181  ARG C NH1 1 
ATOM   3793  N NH2 . ARG C  1 154 ? 41.852 6.858  41.868  1.00 62.94  ? 181  ARG C NH2 1 
ATOM   3794  N N   . GLY C  1 155 ? 44.155 13.751 40.184  1.00 44.82  ? 182  GLY C N   1 
ATOM   3795  C CA  . GLY C  1 155 ? 43.973 14.815 41.156  1.00 44.08  ? 182  GLY C CA  1 
ATOM   3796  C C   . GLY C  1 155 ? 43.316 14.342 42.433  1.00 44.56  ? 182  GLY C C   1 
ATOM   3797  O O   . GLY C  1 155 ? 42.460 15.010 42.983  1.00 44.55  ? 182  GLY C O   1 
ATOM   3798  N N   . GLU C  1 156 ? 43.716 13.176 42.908  1.00 45.61  ? 183  GLU C N   1 
ATOM   3799  C CA  . GLU C  1 156 ? 43.153 12.622 44.122  1.00 47.41  ? 183  GLU C CA  1 
ATOM   3800  C C   . GLU C  1 156 ? 43.851 13.260 45.312  1.00 48.23  ? 183  GLU C C   1 
ATOM   3801  O O   . GLU C  1 156 ? 44.987 13.723 45.197  1.00 48.39  ? 183  GLU C O   1 
ATOM   3802  C CB  . GLU C  1 156 ? 43.388 11.110 44.159  1.00 50.30  ? 183  GLU C CB  1 
ATOM   3803  C CG  . GLU C  1 156 ? 43.092 10.393 42.846  1.00 54.34  ? 183  GLU C CG  1 
ATOM   3804  C CD  . GLU C  1 156 ? 43.502 8.935  42.878  1.00 57.47  ? 183  GLU C CD  1 
ATOM   3805  O OE1 . GLU C  1 156 ? 42.913 8.186  43.688  1.00 60.65  ? 183  GLU C OE1 1 
ATOM   3806  O OE2 . GLU C  1 156 ? 44.407 8.536  42.104  1.00 58.03  ? 183  GLU C OE2 1 
ATOM   3807  N N   . GLU C  1 157 ? 43.174 13.293 46.458  1.00 48.62  ? 184  GLU C N   1 
ATOM   3808  C CA  . GLU C  1 157 ? 43.785 13.842 47.659  1.00 47.59  ? 184  GLU C CA  1 
ATOM   3809  C C   . GLU C  1 157 ? 45.029 12.971 47.758  1.00 46.08  ? 184  GLU C C   1 
ATOM   3810  O O   . GLU C  1 157 ? 45.072 11.897 47.152  1.00 45.82  ? 184  GLU C O   1 
ATOM   3811  C CB  . GLU C  1 157 ? 42.888 13.606 48.884  1.00 48.96  ? 184  GLU C CB  1 
ATOM   3812  C CG  . GLU C  1 157 ? 41.499 14.258 48.843  1.00 53.57  ? 184  GLU C CG  1 
ATOM   3813  C CD  . GLU C  1 157 ? 41.520 15.778 49.056  1.00 56.65  ? 184  GLU C CD  1 
ATOM   3814  O OE1 . GLU C  1 157 ? 42.068 16.220 50.094  1.00 57.18  ? 184  GLU C OE1 1 
ATOM   3815  O OE2 . GLU C  1 157 ? 40.983 16.532 48.198  1.00 57.82  ? 184  GLU C OE2 1 
ATOM   3816  N N   . GLY C  1 158 ? 46.035 13.415 48.503  1.00 44.40  ? 185  GLY C N   1 
ATOM   3817  C CA  . GLY C  1 158 ? 47.244 12.617 48.636  1.00 42.14  ? 185  GLY C CA  1 
ATOM   3818  C C   . GLY C  1 158 ? 48.317 13.149 47.712  1.00 40.96  ? 185  GLY C C   1 
ATOM   3819  O O   . GLY C  1 158 ? 49.494 12.811 47.841  1.00 41.90  ? 185  GLY C O   1 
ATOM   3820  N N   . GLY C  1 159 ? 47.893 13.984 46.766  1.00 38.68  ? 186  GLY C N   1 
ATOM   3821  C CA  . GLY C  1 159 ? 48.812 14.586 45.820  1.00 34.50  ? 186  GLY C CA  1 
ATOM   3822  C C   . GLY C  1 159 ? 49.613 13.588 45.015  1.00 32.10  ? 186  GLY C C   1 
ATOM   3823  O O   . GLY C  1 159 ? 49.261 12.418 44.949  1.00 31.81  ? 186  GLY C O   1 
ATOM   3824  N N   . PRO C  1 160 ? 50.706 14.034 44.385  1.00 30.11  ? 187  PRO C N   1 
ATOM   3825  C CA  . PRO C  1 160 ? 51.589 13.204 43.565  1.00 28.60  ? 187  PRO C CA  1 
ATOM   3826  C C   . PRO C  1 160 ? 52.061 11.896 44.192  1.00 27.55  ? 187  PRO C C   1 
ATOM   3827  O O   . PRO C  1 160 ? 52.457 11.836 45.362  1.00 28.11  ? 187  PRO C O   1 
ATOM   3828  C CB  . PRO C  1 160 ? 52.739 14.147 43.259  1.00 29.26  ? 187  PRO C CB  1 
ATOM   3829  C CG  . PRO C  1 160 ? 52.037 15.458 43.145  1.00 28.95  ? 187  PRO C CG  1 
ATOM   3830  C CD  . PRO C  1 160 ? 51.134 15.442 44.342  1.00 28.60  ? 187  PRO C CD  1 
ATOM   3831  N N   . TRP C  1 161 ? 52.025 10.849 43.379  1.00 25.25  ? 188  TRP C N   1 
ATOM   3832  C CA  . TRP C  1 161 ? 52.432 9.522  43.800  1.00 24.06  ? 188  TRP C CA  1 
ATOM   3833  C C   . TRP C  1 161 ? 53.082 8.822  42.607  1.00 26.02  ? 188  TRP C C   1 
ATOM   3834  O O   . TRP C  1 161 ? 53.266 9.417  41.540  1.00 24.54  ? 188  TRP C O   1 
ATOM   3835  C CB  . TRP C  1 161 ? 51.210 8.723  44.237  1.00 18.34  ? 188  TRP C CB  1 
ATOM   3836  C CG  . TRP C  1 161 ? 50.179 8.630  43.173  1.00 13.54  ? 188  TRP C CG  1 
ATOM   3837  C CD1 . TRP C  1 161 ? 49.251 9.569  42.848  1.00 14.21  ? 188  TRP C CD1 1 
ATOM   3838  C CD2 . TRP C  1 161 ? 49.978 7.541  42.271  1.00 14.44  ? 188  TRP C CD2 1 
ATOM   3839  N NE1 . TRP C  1 161 ? 48.471 9.138  41.803  1.00 11.50  ? 188  TRP C NE1 1 
ATOM   3840  C CE2 . TRP C  1 161 ? 48.898 7.894  41.425  1.00 13.23  ? 188  TRP C CE2 1 
ATOM   3841  C CE3 . TRP C  1 161 ? 50.606 6.292  42.091  1.00 14.86  ? 188  TRP C CE3 1 
ATOM   3842  C CZ2 . TRP C  1 161 ? 48.432 7.044  40.409  1.00 12.87  ? 188  TRP C CZ2 1 
ATOM   3843  C CZ3 . TRP C  1 161 ? 50.140 5.447  41.084  1.00 12.47  ? 188  TRP C CZ3 1 
ATOM   3844  C CH2 . TRP C  1 161 ? 49.065 5.830  40.257  1.00 13.07  ? 188  TRP C CH2 1 
ATOM   3845  N N   . CYS C  1 162 ? 53.412 7.547  42.785  1.00 26.28  ? 189  CYS C N   1 
ATOM   3846  C CA  . CYS C  1 162 ? 54.005 6.792  41.707  1.00 25.37  ? 189  CYS C CA  1 
ATOM   3847  C C   . CYS C  1 162 ? 54.075 5.331  42.113  1.00 25.12  ? 189  CYS C C   1 
ATOM   3848  O O   . CYS C  1 162 ? 53.983 5.006  43.288  1.00 26.00  ? 189  CYS C O   1 
ATOM   3849  C CB  . CYS C  1 162 ? 55.404 7.333  41.399  1.00 25.12  ? 189  CYS C CB  1 
ATOM   3850  S SG  . CYS C  1 162 ? 56.679 6.775  42.556  1.00 30.34  ? 189  CYS C SG  1 
ATOM   3851  N N   . PHE C  1 163 ? 54.209 4.449  41.134  1.00 24.38  ? 190  PHE C N   1 
ATOM   3852  C CA  . PHE C  1 163 ? 54.333 3.035  41.420  1.00 23.61  ? 190  PHE C CA  1 
ATOM   3853  C C   . PHE C  1 163 ? 55.783 2.842  41.833  1.00 25.04  ? 190  PHE C C   1 
ATOM   3854  O O   . PHE C  1 163 ? 56.688 3.269  41.125  1.00 26.80  ? 190  PHE C O   1 
ATOM   3855  C CB  . PHE C  1 163 ? 54.008 2.227  40.169  1.00 22.10  ? 190  PHE C CB  1 
ATOM   3856  C CG  . PHE C  1 163 ? 52.544 2.172  39.860  1.00 21.83  ? 190  PHE C CG  1 
ATOM   3857  C CD1 . PHE C  1 163 ? 51.686 1.430  40.656  1.00 21.36  ? 190  PHE C CD1 1 
ATOM   3858  C CD2 . PHE C  1 163 ? 52.012 2.895  38.805  1.00 21.75  ? 190  PHE C CD2 1 
ATOM   3859  C CE1 . PHE C  1 163 ? 50.331 1.416  40.403  1.00 21.58  ? 190  PHE C CE1 1 
ATOM   3860  C CE2 . PHE C  1 163 ? 50.638 2.883  38.550  1.00 22.62  ? 190  PHE C CE2 1 
ATOM   3861  C CZ  . PHE C  1 163 ? 49.802 2.148  39.346  1.00 20.56  ? 190  PHE C CZ  1 
ATOM   3862  N N   . THR C  1 164 ? 56.019 2.212  42.977  1.00 26.93  ? 191  THR C N   1 
ATOM   3863  C CA  . THR C  1 164 ? 57.394 2.019  43.441  1.00 30.04  ? 191  THR C CA  1 
ATOM   3864  C C   . THR C  1 164 ? 58.093 0.806  42.842  1.00 30.62  ? 191  THR C C   1 
ATOM   3865  O O   . THR C  1 164 ? 57.460 -0.206 42.551  1.00 30.48  ? 191  THR C O   1 
ATOM   3866  C CB  . THR C  1 164 ? 57.461 1.914  44.970  1.00 30.02  ? 191  THR C CB  1 
ATOM   3867  O OG1 . THR C  1 164 ? 57.702 0.556  45.342  1.00 31.46  ? 191  THR C OG1 1 
ATOM   3868  C CG2 . THR C  1 164 ? 56.149 2.393  45.591  1.00 32.53  ? 191  THR C CG2 1 
ATOM   3869  N N   . SER C  1 165 ? 59.404 0.922  42.655  1.00 32.52  ? 192  SER C N   1 
ATOM   3870  C CA  . SER C  1 165 ? 60.198 -0.156 42.080  1.00 35.13  ? 192  SER C CA  1 
ATOM   3871  C C   . SER C  1 165 ? 60.338 -1.333 43.036  1.00 37.45  ? 192  SER C C   1 
ATOM   3872  O O   . SER C  1 165 ? 60.927 -2.352 42.690  1.00 37.78  ? 192  SER C O   1 
ATOM   3873  C CB  . SER C  1 165 ? 61.585 0.360  41.671  1.00 33.47  ? 192  SER C CB  1 
ATOM   3874  O OG  . SER C  1 165 ? 62.164 1.129  42.698  1.00 31.35  ? 192  SER C OG  1 
ATOM   3875  N N   . ASN C  1 166 ? 59.792 -1.182 44.239  1.00 40.16  ? 193  ASN C N   1 
ATOM   3876  C CA  . ASN C  1 166 ? 59.829 -2.241 45.247  1.00 41.07  ? 193  ASN C CA  1 
ATOM   3877  C C   . ASN C  1 166 ? 58.608 -3.137 45.059  1.00 41.54  ? 193  ASN C C   1 
ATOM   3878  O O   . ASN C  1 166 ? 57.469 -2.706 45.248  1.00 40.27  ? 193  ASN C O   1 
ATOM   3879  C CB  . ASN C  1 166 ? 59.789 -1.651 46.645  1.00 42.86  ? 193  ASN C CB  1 
ATOM   3880  C CG  . ASN C  1 166 ? 59.844 -2.712 47.711  1.00 45.64  ? 193  ASN C CG  1 
ATOM   3881  O OD1 . ASN C  1 166 ? 59.369 -3.839 47.503  1.00 46.57  ? 193  ASN C OD1 1 
ATOM   3882  N ND2 . ASN C  1 166 ? 60.414 -2.366 48.870  1.00 45.95  ? 193  ASN C ND2 1 
ATOM   3883  N N   . PRO C  1 167 ? 58.834 -4.408 44.701  1.00 42.00  ? 194  PRO C N   1 
ATOM   3884  C CA  . PRO C  1 167 ? 57.716 -5.328 44.489  1.00 42.02  ? 194  PRO C CA  1 
ATOM   3885  C C   . PRO C  1 167 ? 56.792 -5.395 45.682  1.00 42.02  ? 194  PRO C C   1 
ATOM   3886  O O   . PRO C  1 167 ? 55.597 -5.628 45.534  1.00 42.19  ? 194  PRO C O   1 
ATOM   3887  C CB  . PRO C  1 167 ? 58.416 -6.648 44.210  1.00 41.83  ? 194  PRO C CB  1 
ATOM   3888  C CG  . PRO C  1 167 ? 59.688 -6.204 43.539  1.00 41.54  ? 194  PRO C CG  1 
ATOM   3889  C CD  . PRO C  1 167 ? 60.117 -5.075 44.425  1.00 40.90  ? 194  PRO C CD  1 
ATOM   3890  N N   . GLU C  1 168 ? 57.349 -5.174 46.865  1.00 42.02  ? 195  GLU C N   1 
ATOM   3891  C CA  . GLU C  1 168 ? 56.548 -5.222 48.074  1.00 42.78  ? 195  GLU C CA  1 
ATOM   3892  C C   . GLU C  1 168 ? 55.609 -4.041 48.202  1.00 40.57  ? 195  GLU C C   1 
ATOM   3893  O O   . GLU C  1 168 ? 54.540 -4.155 48.773  1.00 41.89  ? 195  GLU C O   1 
ATOM   3894  C CB  . GLU C  1 168 ? 57.444 -5.279 49.304  1.00 47.01  ? 195  GLU C CB  1 
ATOM   3895  C CG  . GLU C  1 168 ? 57.406 -6.614 50.045  1.00 53.51  ? 195  GLU C CG  1 
ATOM   3896  C CD  . GLU C  1 168 ? 58.733 -7.358 49.976  1.00 57.23  ? 195  GLU C CD  1 
ATOM   3897  O OE1 . GLU C  1 168 ? 59.791 -6.748 50.292  1.00 58.28  ? 195  GLU C OE1 1 
ATOM   3898  O OE2 . GLU C  1 168 ? 58.715 -8.558 49.609  1.00 59.73  ? 195  GLU C OE2 1 
ATOM   3899  N N   . VAL C  1 169 ? 56.000 -2.903 47.655  1.00 38.87  ? 196  VAL C N   1 
ATOM   3900  C CA  . VAL C  1 169 ? 55.181 -1.697 47.745  1.00 35.71  ? 196  VAL C CA  1 
ATOM   3901  C C   . VAL C  1 169 ? 54.669 -1.327 46.359  1.00 35.12  ? 196  VAL C C   1 
ATOM   3902  O O   . VAL C  1 169 ? 55.433 -0.838 45.527  1.00 36.24  ? 196  VAL C O   1 
ATOM   3903  C CB  . VAL C  1 169 ? 56.013 -0.521 48.299  1.00 33.12  ? 196  VAL C CB  1 
ATOM   3904  C CG1 . VAL C  1 169 ? 55.112 0.596  48.704  1.00 29.59  ? 196  VAL C CG1 1 
ATOM   3905  C CG2 . VAL C  1 169 ? 56.850 -0.983 49.465  1.00 32.09  ? 196  VAL C CG2 1 
ATOM   3906  N N   . ARG C  1 170 ? 53.386 -1.559 46.102  1.00 32.92  ? 197  ARG C N   1 
ATOM   3907  C CA  . ARG C  1 170 ? 52.833 -1.243 44.793  1.00 32.12  ? 197  ARG C CA  1 
ATOM   3908  C C   . ARG C  1 170 ? 52.953 0.235  44.436  1.00 34.71  ? 197  ARG C C   1 
ATOM   3909  O O   . ARG C  1 170 ? 53.375 0.572  43.328  1.00 36.51  ? 197  ARG C O   1 
ATOM   3910  C CB  . ARG C  1 170 ? 51.370 -1.685 44.701  1.00 28.98  ? 197  ARG C CB  1 
ATOM   3911  C CG  . ARG C  1 170 ? 50.717 -1.436 43.341  1.00 24.81  ? 197  ARG C CG  1 
ATOM   3912  C CD  . ARG C  1 170 ? 49.282 -1.920 43.320  1.00 21.00  ? 197  ARG C CD  1 
ATOM   3913  N NE  . ARG C  1 170 ? 48.560 -1.507 42.119  1.00 20.77  ? 197  ARG C NE  1 
ATOM   3914  C CZ  . ARG C  1 170 ? 48.759 -2.010 40.899  1.00 19.45  ? 197  ARG C CZ  1 
ATOM   3915  N NH1 . ARG C  1 170 ? 49.668 -2.961 40.708  1.00 16.97  ? 197  ARG C NH1 1 
ATOM   3916  N NH2 . ARG C  1 170 ? 48.054 -1.553 39.863  1.00 15.31  ? 197  ARG C NH2 1 
ATOM   3917  N N   . TYR C  1 171 ? 52.584 1.118  45.359  1.00 35.87  ? 198  TYR C N   1 
ATOM   3918  C CA  . TYR C  1 171 ? 52.668 2.557  45.111  1.00 36.14  ? 198  TYR C CA  1 
ATOM   3919  C C   . TYR C  1 171 ? 52.763 3.302  46.423  1.00 35.69  ? 198  TYR C C   1 
ATOM   3920  O O   . TYR C  1 171 ? 52.477 2.748  47.471  1.00 37.10  ? 198  TYR C O   1 
ATOM   3921  C CB  . TYR C  1 171 ? 51.432 3.057  44.373  1.00 36.92  ? 198  TYR C CB  1 
ATOM   3922  C CG  . TYR C  1 171 ? 50.228 3.189  45.268  1.00 38.94  ? 198  TYR C CG  1 
ATOM   3923  C CD1 . TYR C  1 171 ? 50.151 4.190  46.231  1.00 38.97  ? 198  TYR C CD1 1 
ATOM   3924  C CD2 . TYR C  1 171 ? 49.183 2.281  45.181  1.00 40.54  ? 198  TYR C CD2 1 
ATOM   3925  C CE1 . TYR C  1 171 ? 49.068 4.273  47.083  1.00 41.52  ? 198  TYR C CE1 1 
ATOM   3926  C CE2 . TYR C  1 171 ? 48.100 2.359  46.023  1.00 42.21  ? 198  TYR C CE2 1 
ATOM   3927  C CZ  . TYR C  1 171 ? 48.043 3.352  46.976  1.00 42.47  ? 198  TYR C CZ  1 
ATOM   3928  O OH  . TYR C  1 171 ? 46.967 3.397  47.834  1.00 44.76  ? 198  TYR C OH  1 
ATOM   3929  N N   . GLU C  1 172 ? 53.120 4.574  46.349  1.00 34.46  ? 199  GLU C N   1 
ATOM   3930  C CA  . GLU C  1 172 ? 53.244 5.416  47.522  1.00 33.59  ? 199  GLU C CA  1 
ATOM   3931  C C   . GLU C  1 172 ? 53.318 6.865  47.084  1.00 32.79  ? 199  GLU C C   1 
ATOM   3932  O O   . GLU C  1 172 ? 53.679 7.164  45.952  1.00 33.61  ? 199  GLU C O   1 
ATOM   3933  C CB  . GLU C  1 172 ? 54.495 5.048  48.313  1.00 33.15  ? 199  GLU C CB  1 
ATOM   3934  C CG  . GLU C  1 172 ? 54.918 6.123  49.277  1.00 37.04  ? 199  GLU C CG  1 
ATOM   3935  C CD  . GLU C  1 172 ? 55.982 5.662  50.254  1.00 41.52  ? 199  GLU C CD  1 
ATOM   3936  O OE1 . GLU C  1 172 ? 56.918 4.938  49.836  1.00 43.13  ? 199  GLU C OE1 1 
ATOM   3937  O OE2 . GLU C  1 172 ? 55.887 6.038  51.446  1.00 42.83  ? 199  GLU C OE2 1 
ATOM   3938  N N   . VAL C  1 173 ? 52.968 7.772  47.979  1.00 32.11  ? 200  VAL C N   1 
ATOM   3939  C CA  . VAL C  1 173 ? 53.005 9.188  47.654  1.00 30.98  ? 200  VAL C CA  1 
ATOM   3940  C C   . VAL C  1 173 ? 54.426 9.714  47.757  1.00 32.95  ? 200  VAL C C   1 
ATOM   3941  O O   . VAL C  1 173 ? 55.298 9.080  48.373  1.00 34.70  ? 200  VAL C O   1 
ATOM   3942  C CB  . VAL C  1 173 ? 52.130 9.979  48.608  1.00 28.11  ? 200  VAL C CB  1 
ATOM   3943  C CG1 . VAL C  1 173 ? 50.686 9.629  48.373  1.00 28.60  ? 200  VAL C CG1 1 
ATOM   3944  C CG2 . VAL C  1 173 ? 52.521 9.657  50.032  1.00 26.87  ? 200  VAL C CG2 1 
ATOM   3945  N N   . CYS C  1 174 ? 54.663 10.876 47.151  1.00 32.53  ? 201  CYS C N   1 
ATOM   3946  C CA  . CYS C  1 174 ? 55.983 11.488 47.191  1.00 32.16  ? 201  CYS C CA  1 
ATOM   3947  C C   . CYS C  1 174 ? 55.934 12.735 48.037  1.00 32.81  ? 201  CYS C C   1 
ATOM   3948  O O   . CYS C  1 174 ? 54.926 13.430 48.069  1.00 33.06  ? 201  CYS C O   1 
ATOM   3949  C CB  . CYS C  1 174 ? 56.434 11.859 45.792  1.00 30.98  ? 201  CYS C CB  1 
ATOM   3950  S SG  . CYS C  1 174 ? 56.357 10.478 44.623  1.00 33.48  ? 201  CYS C SG  1 
ATOM   3951  N N   . ASP C  1 175 ? 57.042 13.019 48.706  1.00 34.20  ? 202  ASP C N   1 
ATOM   3952  C CA  . ASP C  1 175 ? 57.174 14.181 49.581  1.00 35.07  ? 202  ASP C CA  1 
ATOM   3953  C C   . ASP C  1 175 ? 57.362 15.455 48.770  1.00 33.87  ? 202  ASP C C   1 
ATOM   3954  O O   . ASP C  1 175 ? 58.483 15.928 48.632  1.00 35.12  ? 202  ASP C O   1 
ATOM   3955  C CB  . ASP C  1 175 ? 58.399 13.994 50.475  1.00 38.91  ? 202  ASP C CB  1 
ATOM   3956  C CG  . ASP C  1 175 ? 58.237 14.626 51.840  1.00 43.04  ? 202  ASP C CG  1 
ATOM   3957  O OD1 . ASP C  1 175 ? 57.484 15.627 51.960  1.00 45.04  ? 202  ASP C OD1 1 
ATOM   3958  O OD2 . ASP C  1 175 ? 58.886 14.121 52.792  1.00 44.36  ? 202  ASP C OD2 1 
ATOM   3959  N N   . ILE C  1 176 ? 56.292 16.020 48.231  1.00 32.24  ? 203  ILE C N   1 
ATOM   3960  C CA  . ILE C  1 176 ? 56.441 17.236 47.445  1.00 31.37  ? 203  ILE C CA  1 
ATOM   3961  C C   . ILE C  1 176 ? 55.751 18.388 48.154  1.00 30.77  ? 203  ILE C C   1 
ATOM   3962  O O   . ILE C  1 176 ? 54.533 18.407 48.307  1.00 30.31  ? 203  ILE C O   1 
ATOM   3963  C CB  . ILE C  1 176 ? 55.897 17.029 46.007  1.00 31.66  ? 203  ILE C CB  1 
ATOM   3964  C CG1 . ILE C  1 176 ? 56.884 16.157 45.228  1.00 30.10  ? 203  ILE C CG1 1 
ATOM   3965  C CG2 . ILE C  1 176 ? 55.676 18.361 45.308  1.00 32.03  ? 203  ILE C CG2 1 
ATOM   3966  C CD1 . ILE C  1 176 ? 56.469 15.890 43.821  1.00 31.16  ? 203  ILE C CD1 1 
ATOM   3967  N N   . PRO C  1 177 ? 56.540 19.369 48.604  1.00 30.60  ? 204  PRO C N   1 
ATOM   3968  C CA  . PRO C  1 177 ? 56.110 20.570 49.322  1.00 31.62  ? 204  PRO C CA  1 
ATOM   3969  C C   . PRO C  1 177 ? 55.041 21.446 48.646  1.00 33.54  ? 204  PRO C C   1 
ATOM   3970  O O   . PRO C  1 177 ? 54.907 21.454 47.418  1.00 34.73  ? 204  PRO C O   1 
ATOM   3971  C CB  . PRO C  1 177 ? 57.422 21.303 49.551  1.00 28.90  ? 204  PRO C CB  1 
ATOM   3972  C CG  . PRO C  1 177 ? 58.198 20.946 48.358  1.00 30.72  ? 204  PRO C CG  1 
ATOM   3973  C CD  . PRO C  1 177 ? 57.962 19.472 48.251  1.00 30.08  ? 204  PRO C CD  1 
ATOM   3974  N N   . GLN C  1 178 ? 54.264 22.148 49.476  1.00 34.79  ? 205  GLN C N   1 
ATOM   3975  C CA  . GLN C  1 178 ? 53.193 23.046 49.037  1.00 36.22  ? 205  GLN C CA  1 
ATOM   3976  C C   . GLN C  1 178 ? 53.846 24.410 48.855  1.00 37.39  ? 205  GLN C C   1 
ATOM   3977  O O   . GLN C  1 178 ? 54.689 24.793 49.662  1.00 36.90  ? 205  GLN C O   1 
ATOM   3978  C CB  . GLN C  1 178 ? 52.101 23.137 50.115  1.00 37.24  ? 205  GLN C CB  1 
ATOM   3979  C CG  . GLN C  1 178 ? 51.138 21.940 50.248  1.00 37.59  ? 205  GLN C CG  1 
ATOM   3980  C CD  . GLN C  1 178 ? 49.973 21.982 49.245  1.00 40.65  ? 205  GLN C CD  1 
ATOM   3981  O OE1 . GLN C  1 178 ? 49.392 23.037 48.981  1.00 42.06  ? 205  GLN C OE1 1 
ATOM   3982  N NE2 . GLN C  1 178 ? 49.625 20.827 48.698  1.00 41.72  ? 205  GLN C NE2 1 
ATOM   3983  N N   . CYS C  1 179 ? 53.481 25.145 47.808  1.00 39.34  ? 206  CYS C N   1 
ATOM   3984  C CA  . CYS C  1 179 ? 54.092 26.451 47.564  1.00 41.87  ? 206  CYS C CA  1 
ATOM   3985  C C   . CYS C  1 179 ? 53.762 27.393 48.704  1.00 46.05  ? 206  CYS C C   1 
ATOM   3986  O O   . CYS C  1 179 ? 54.530 28.300 49.015  1.00 47.31  ? 206  CYS C O   1 
ATOM   3987  C CB  . CYS C  1 179 ? 53.588 27.050 46.259  1.00 37.72  ? 206  CYS C CB  1 
ATOM   3988  S SG  . CYS C  1 179 ? 53.808 25.991 44.813  1.00 33.77  ? 206  CYS C SG  1 
ATOM   3989  N N   . SER C  1 180 ? 52.602 27.164 49.315  1.00 51.16  ? 207  SER C N   1 
ATOM   3990  C CA  . SER C  1 180 ? 52.110 27.964 50.439  1.00 56.03  ? 207  SER C CA  1 
ATOM   3991  C C   . SER C  1 180 ? 53.166 28.055 51.535  1.00 59.25  ? 207  SER C C   1 
ATOM   3992  O O   . SER C  1 180 ? 53.375 29.119 52.132  1.00 60.38  ? 207  SER C O   1 
ATOM   3993  C CB  . SER C  1 180 ? 50.872 27.308 51.023  1.00 56.99  ? 207  SER C CB  1 
ATOM   3994  O OG  . SER C  1 180 ? 51.249 26.152 51.758  1.00 58.21  ? 207  SER C OG  1 
ATOM   3995  N N   . GLU C  1 181 ? 53.807 26.910 51.774  1.00 61.35  ? 208  GLU C N   1 
ATOM   3996  C CA  . GLU C  1 181 ? 54.875 26.727 52.752  1.00 63.85  ? 208  GLU C CA  1 
ATOM   3997  C C   . GLU C  1 181 ? 54.574 25.563 53.659  1.00 65.78  ? 208  GLU C C   1 
ATOM   3998  O O   . GLU C  1 181 ? 53.751 25.751 54.585  1.00 67.71  ? 208  GLU C O   1 
ATOM   3999  C CB  . GLU C  1 181 ? 55.095 27.967 53.607  1.00 64.30  ? 208  GLU C CB  1 
ATOM   4000  C CG  . GLU C  1 181 ? 55.898 27.706 54.870  1.00 64.90  ? 208  GLU C CG  1 
ATOM   4001  C CD  . GLU C  1 181 ? 56.261 28.984 55.597  1.00 65.15  ? 208  GLU C CD  1 
ATOM   4002  O OE1 . GLU C  1 181 ? 55.378 29.864 55.760  1.00 63.45  ? 208  GLU C OE1 1 
ATOM   4003  O OE2 . GLU C  1 181 ? 57.437 29.097 56.010  1.00 66.40  ? 208  GLU C OE2 1 
ATOM   4004  N N   . VAL C  1 182 ? 55.165 24.484 53.426  1.00 67.29  ? 209  VAL C N   1 
ATOM   4005  N N   . ASN D  1 10  ? 80.346 14.333 42.201  1.00 80.72  ? 37   ASN D N   1 
ATOM   4006  C CA  . ASN D  1 10  ? 79.861 14.667 40.829  1.00 81.03  ? 37   ASN D CA  1 
ATOM   4007  C C   . ASN D  1 10  ? 78.441 15.217 40.919  1.00 80.77  ? 37   ASN D C   1 
ATOM   4008  O O   . ASN D  1 10  ? 77.845 15.607 39.907  1.00 80.97  ? 37   ASN D O   1 
ATOM   4009  C CB  . ASN D  1 10  ? 79.893 13.419 39.928  1.00 82.10  ? 37   ASN D CB  1 
ATOM   4010  C CG  . ASN D  1 10  ? 78.917 12.337 40.377  1.00 83.32  ? 37   ASN D CG  1 
ATOM   4011  O OD1 . ASN D  1 10  ? 78.658 12.173 41.574  1.00 84.74  ? 37   ASN D OD1 1 
ATOM   4012  N ND2 . ASN D  1 10  ? 78.385 11.579 39.417  1.00 82.76  ? 37   ASN D ND2 1 
ATOM   4013  N N   . THR D  1 11  ? 77.915 15.250 42.145  1.00 79.85  ? 38   THR D N   1 
ATOM   4014  C CA  . THR D  1 11  ? 76.566 15.751 42.406  1.00 77.71  ? 38   THR D CA  1 
ATOM   4015  C C   . THR D  1 11  ? 76.578 16.884 43.431  1.00 76.76  ? 38   THR D C   1 
ATOM   4016  O O   . THR D  1 11  ? 75.641 17.679 43.476  1.00 76.42  ? 38   THR D O   1 
ATOM   4017  C CB  . THR D  1 11  ? 75.639 14.649 42.973  1.00 77.18  ? 38   THR D CB  1 
ATOM   4018  O OG1 . THR D  1 11  ? 76.144 14.222 44.243  1.00 77.65  ? 38   THR D OG1 1 
ATOM   4019  C CG2 . THR D  1 11  ? 75.571 13.449 42.043  1.00 76.44  ? 38   THR D CG2 1 
ATOM   4020  N N   . ILE D  1 12  ? 77.631 16.962 44.247  1.00 75.33  ? 39   ILE D N   1 
ATOM   4021  C CA  . ILE D  1 12  ? 77.701 17.994 45.284  1.00 74.48  ? 39   ILE D CA  1 
ATOM   4022  C C   . ILE D  1 12  ? 77.338 19.399 44.830  1.00 73.94  ? 39   ILE D C   1 
ATOM   4023  O O   . ILE D  1 12  ? 76.934 20.236 45.636  1.00 73.73  ? 39   ILE D O   1 
ATOM   4024  C CB  . ILE D  1 12  ? 79.094 18.074 45.924  1.00 74.50  ? 39   ILE D CB  1 
ATOM   4025  C CG1 . ILE D  1 12  ? 80.154 17.764 44.871  1.00 75.21  ? 39   ILE D CG1 1 
ATOM   4026  C CG2 . ILE D  1 12  ? 79.174 17.150 47.129  1.00 74.49  ? 39   ILE D CG2 1 
ATOM   4027  C CD1 . ILE D  1 12  ? 81.573 17.913 45.370  1.00 76.50  ? 39   ILE D CD1 1 
ATOM   4028  N N   . HIS D  1 13  ? 77.478 19.660 43.540  1.00 73.36  ? 40   HIS D N   1 
ATOM   4029  C CA  . HIS D  1 13  ? 77.177 20.981 43.016  1.00 72.02  ? 40   HIS D CA  1 
ATOM   4030  C C   . HIS D  1 13  ? 75.677 21.233 42.950  1.00 71.13  ? 40   HIS D C   1 
ATOM   4031  O O   . HIS D  1 13  ? 75.224 22.378 42.959  1.00 71.30  ? 40   HIS D O   1 
ATOM   4032  C CB  . HIS D  1 13  ? 77.790 21.125 41.643  1.00 72.78  ? 40   HIS D CB  1 
ATOM   4033  N N   . GLU D  1 14  ? 74.908 20.155 42.896  1.00 69.56  ? 41   GLU D N   1 
ATOM   4034  C CA  . GLU D  1 14  ? 73.465 20.259 42.797  1.00 68.27  ? 41   GLU D CA  1 
ATOM   4035  C C   . GLU D  1 14  ? 72.839 20.572 44.145  1.00 66.31  ? 41   GLU D C   1 
ATOM   4036  O O   . GLU D  1 14  ? 71.617 20.657 44.274  1.00 67.23  ? 41   GLU D O   1 
ATOM   4037  C CB  . GLU D  1 14  ? 72.912 18.959 42.223  1.00 70.52  ? 41   GLU D CB  1 
ATOM   4038  C CG  . GLU D  1 14  ? 73.303 18.752 40.768  1.00 73.71  ? 41   GLU D CG  1 
ATOM   4039  C CD  . GLU D  1 14  ? 73.316 17.295 40.353  1.00 76.36  ? 41   GLU D CD  1 
ATOM   4040  O OE1 . GLU D  1 14  ? 72.291 16.595 40.553  1.00 76.55  ? 41   GLU D OE1 1 
ATOM   4041  O OE2 . GLU D  1 14  ? 74.363 16.860 39.818  1.00 77.83  ? 41   GLU D OE2 1 
ATOM   4042  N N   . PHE D  1 15  ? 73.690 20.747 45.150  1.00 63.18  ? 42   PHE D N   1 
ATOM   4043  C CA  . PHE D  1 15  ? 73.235 21.067 46.497  1.00 59.34  ? 42   PHE D CA  1 
ATOM   4044  C C   . PHE D  1 15  ? 73.599 22.498 46.847  1.00 57.11  ? 42   PHE D C   1 
ATOM   4045  O O   . PHE D  1 15  ? 74.658 22.992 46.467  1.00 56.09  ? 42   PHE D O   1 
ATOM   4046  C CB  . PHE D  1 15  ? 73.880 20.149 47.537  1.00 58.06  ? 42   PHE D CB  1 
ATOM   4047  C CG  . PHE D  1 15  ? 73.465 18.719 47.429  1.00 56.72  ? 42   PHE D CG  1 
ATOM   4048  C CD1 . PHE D  1 15  ? 74.004 17.891 46.452  1.00 56.38  ? 42   PHE D CD1 1 
ATOM   4049  C CD2 . PHE D  1 15  ? 72.539 18.195 48.313  1.00 56.17  ? 42   PHE D CD2 1 
ATOM   4050  C CE1 . PHE D  1 15  ? 73.624 16.561 46.359  1.00 55.63  ? 42   PHE D CE1 1 
ATOM   4051  C CE2 . PHE D  1 15  ? 72.153 16.868 48.226  1.00 55.74  ? 42   PHE D CE2 1 
ATOM   4052  C CZ  . PHE D  1 15  ? 72.697 16.048 47.251  1.00 55.39  ? 42   PHE D CZ  1 
ATOM   4053  N N   . LYS D  1 16  ? 72.713 23.156 47.579  1.00 54.75  ? 43   LYS D N   1 
ATOM   4054  C CA  . LYS D  1 16  ? 72.946 24.516 48.009  1.00 53.25  ? 43   LYS D CA  1 
ATOM   4055  C C   . LYS D  1 16  ? 73.721 24.416 49.305  1.00 55.25  ? 43   LYS D C   1 
ATOM   4056  O O   . LYS D  1 16  ? 73.142 24.127 50.359  1.00 56.09  ? 43   LYS D O   1 
ATOM   4057  C CB  . LYS D  1 16  ? 71.624 25.219 48.264  1.00 50.82  ? 43   LYS D CB  1 
ATOM   4058  C CG  . LYS D  1 16  ? 71.760 26.577 48.918  1.00 47.58  ? 43   LYS D CG  1 
ATOM   4059  C CD  . LYS D  1 16  ? 70.403 27.132 49.242  1.00 46.13  ? 43   LYS D CD  1 
ATOM   4060  C CE  . LYS D  1 16  ? 70.506 28.453 49.944  1.00 46.43  ? 43   LYS D CE  1 
ATOM   4061  N NZ  . LYS D  1 16  ? 69.161 28.973 50.304  1.00 48.81  ? 43   LYS D NZ  1 
ATOM   4062  N N   . LYS D  1 17  ? 75.030 24.653 49.239  1.00 56.78  ? 44   LYS D N   1 
ATOM   4063  C CA  . LYS D  1 17  ? 75.880 24.560 50.430  1.00 57.05  ? 44   LYS D CA  1 
ATOM   4064  C C   . LYS D  1 17  ? 75.770 25.751 51.363  1.00 57.01  ? 44   LYS D C   1 
ATOM   4065  O O   . LYS D  1 17  ? 75.545 26.885 50.939  1.00 57.48  ? 44   LYS D O   1 
ATOM   4066  C CB  . LYS D  1 17  ? 77.357 24.356 50.028  1.00 56.32  ? 44   LYS D CB  1 
ATOM   4067  N N   . SER D  1 18  ? 75.918 25.459 52.645  1.00 57.21  ? 45   SER D N   1 
ATOM   4068  C CA  . SER D  1 18  ? 75.897 26.459 53.698  1.00 58.32  ? 45   SER D CA  1 
ATOM   4069  C C   . SER D  1 18  ? 77.037 26.094 54.632  1.00 60.46  ? 45   SER D C   1 
ATOM   4070  O O   . SER D  1 18  ? 76.861 25.329 55.580  1.00 61.42  ? 45   SER D O   1 
ATOM   4071  C CB  . SER D  1 18  ? 74.577 26.435 54.458  1.00 56.36  ? 45   SER D CB  1 
ATOM   4072  O OG  . SER D  1 18  ? 73.600 27.192 53.777  1.00 56.46  ? 45   SER D OG  1 
ATOM   4073  N N   . ALA D  1 19  ? 78.214 26.640 54.346  1.00 62.16  ? 46   ALA D N   1 
ATOM   4074  C CA  . ALA D  1 19  ? 79.411 26.367 55.130  1.00 63.56  ? 46   ALA D CA  1 
ATOM   4075  C C   . ALA D  1 19  ? 79.226 26.571 56.629  1.00 64.65  ? 46   ALA D C   1 
ATOM   4076  O O   . ALA D  1 19  ? 78.442 27.422 57.070  1.00 64.36  ? 46   ALA D O   1 
ATOM   4077  C CB  . ALA D  1 19  ? 80.566 27.231 54.624  1.00 63.95  ? 46   ALA D CB  1 
ATOM   4078  N N   . LYS D  1 20  ? 79.961 25.775 57.401  1.00 65.73  ? 47   LYS D N   1 
ATOM   4079  C CA  . LYS D  1 20  ? 79.941 25.842 58.858  1.00 67.18  ? 47   LYS D CA  1 
ATOM   4080  C C   . LYS D  1 20  ? 78.519 25.896 59.372  1.00 67.11  ? 47   LYS D C   1 
ATOM   4081  O O   . LYS D  1 20  ? 78.168 26.791 60.138  1.00 66.70  ? 47   LYS D O   1 
ATOM   4082  C CB  . LYS D  1 20  ? 80.711 27.084 59.332  1.00 68.05  ? 47   LYS D CB  1 
ATOM   4083  C CG  . LYS D  1 20  ? 82.029 27.308 58.595  1.00 69.19  ? 47   LYS D CG  1 
ATOM   4084  C CD  . LYS D  1 20  ? 82.407 28.787 58.535  1.00 70.05  ? 47   LYS D CD  1 
ATOM   4085  C CE  . LYS D  1 20  ? 83.495 29.041 57.486  1.00 70.95  ? 47   LYS D CE  1 
ATOM   4086  N NZ  . LYS D  1 20  ? 83.829 30.488 57.343  1.00 71.08  ? 47   LYS D NZ  1 
ATOM   4087  N N   . THR D  1 21  ? 77.698 24.944 58.949  1.00 68.12  ? 48   THR D N   1 
ATOM   4088  C CA  . THR D  1 21  ? 76.305 24.918 59.383  1.00 69.91  ? 48   THR D CA  1 
ATOM   4089  C C   . THR D  1 21  ? 75.858 23.477 59.583  1.00 70.93  ? 48   THR D C   1 
ATOM   4090  O O   . THR D  1 21  ? 76.506 22.547 59.098  1.00 69.67  ? 48   THR D O   1 
ATOM   4091  C CB  . THR D  1 21  ? 75.362 25.605 58.340  1.00 69.38  ? 48   THR D CB  1 
ATOM   4092  O OG1 . THR D  1 21  ? 75.913 26.870 57.944  1.00 68.12  ? 48   THR D OG1 1 
ATOM   4093  C CG2 . THR D  1 21  ? 73.975 25.840 58.942  1.00 68.50  ? 48   THR D CG2 1 
ATOM   4094  N N   . THR D  1 22  ? 74.755 23.305 60.307  1.00 72.52  ? 49   THR D N   1 
ATOM   4095  C CA  . THR D  1 22  ? 74.208 21.982 60.572  1.00 74.45  ? 49   THR D CA  1 
ATOM   4096  C C   . THR D  1 22  ? 72.813 22.104 61.161  1.00 75.45  ? 49   THR D C   1 
ATOM   4097  O O   . THR D  1 22  ? 72.450 23.142 61.714  1.00 74.39  ? 49   THR D O   1 
ATOM   4098  C CB  . THR D  1 22  ? 75.098 21.183 61.548  1.00 74.18  ? 49   THR D CB  1 
ATOM   4099  O OG1 . THR D  1 22  ? 74.543 19.878 61.743  1.00 74.20  ? 49   THR D OG1 1 
ATOM   4100  C CG2 . THR D  1 22  ? 75.193 21.896 62.883  1.00 74.19  ? 49   THR D CG2 1 
ATOM   4101  N N   . LEU D  1 23  ? 72.040 21.033 61.046  1.00 77.76  ? 50   LEU D N   1 
ATOM   4102  C CA  . LEU D  1 23  ? 70.682 21.043 61.559  1.00 79.87  ? 50   LEU D CA  1 
ATOM   4103  C C   . LEU D  1 23  ? 70.485 20.222 62.829  1.00 80.46  ? 50   LEU D C   1 
ATOM   4104  O O   . LEU D  1 23  ? 71.235 19.282 63.124  1.00 79.27  ? 50   LEU D O   1 
ATOM   4105  C CB  . LEU D  1 23  ? 69.696 20.562 60.479  1.00 80.76  ? 50   LEU D CB  1 
ATOM   4106  C CG  . LEU D  1 23  ? 69.293 21.513 59.346  1.00 80.33  ? 50   LEU D CG  1 
ATOM   4107  C CD1 . LEU D  1 23  ? 70.511 21.882 58.532  1.00 80.45  ? 50   LEU D CD1 1 
ATOM   4108  C CD2 . LEU D  1 23  ? 68.254 20.847 58.464  1.00 80.16  ? 50   LEU D CD2 1 
ATOM   4109  N N   . ILE D  1 24  ? 69.452 20.612 63.572  1.00 81.63  ? 51   ILE D N   1 
ATOM   4110  C CA  . ILE D  1 24  ? 69.073 19.963 64.811  1.00 82.54  ? 51   ILE D CA  1 
ATOM   4111  C C   . ILE D  1 24  ? 67.672 19.408 64.656  1.00 82.60  ? 51   ILE D C   1 
ATOM   4112  O O   . ILE D  1 24  ? 66.740 20.123 64.271  1.00 81.59  ? 51   ILE D O   1 
ATOM   4113  C CB  . ILE D  1 24  ? 69.101 20.952 65.994  1.00 83.05  ? 51   ILE D CB  1 
ATOM   4114  C CG1 . ILE D  1 24  ? 70.552 21.199 66.418  1.00 83.97  ? 51   ILE D CG1 1 
ATOM   4115  C CG2 . ILE D  1 24  ? 68.278 20.414 67.160  1.00 82.43  ? 51   ILE D CG2 1 
ATOM   4116  C CD1 . ILE D  1 24  ? 71.424 21.855 65.348  1.00 85.03  ? 51   ILE D CD1 1 
ATOM   4117  N N   . LYS D  1 25  ? 67.552 18.119 64.948  1.00 83.37  ? 52   LYS D N   1 
ATOM   4118  C CA  . LYS D  1 25  ? 66.295 17.395 64.868  1.00 84.03  ? 52   LYS D CA  1 
ATOM   4119  C C   . LYS D  1 25  ? 65.533 17.497 66.181  1.00 84.64  ? 52   LYS D C   1 
ATOM   4120  O O   . LYS D  1 25  ? 66.015 17.054 67.224  1.00 84.12  ? 52   LYS D O   1 
ATOM   4121  C CB  . LYS D  1 25  ? 66.563 15.924 64.535  1.00 83.40  ? 52   LYS D CB  1 
ATOM   4122  C CG  . LYS D  1 25  ? 67.775 15.326 65.240  1.00 83.88  ? 52   LYS D CG  1 
ATOM   4123  C CD  . LYS D  1 25  ? 69.080 15.913 64.704  1.00 84.68  ? 52   LYS D CD  1 
ATOM   4124  C CE  . LYS D  1 25  ? 70.296 15.235 65.318  1.00 86.89  ? 52   LYS D CE  1 
ATOM   4125  N NZ  . LYS D  1 25  ? 71.588 15.832 64.857  1.00 87.27  ? 52   LYS D NZ  1 
ATOM   4126  N N   . ILE D  1 26  ? 64.349 18.101 66.121  1.00 86.11  ? 53   ILE D N   1 
ATOM   4127  C CA  . ILE D  1 26  ? 63.496 18.249 67.296  1.00 87.10  ? 53   ILE D CA  1 
ATOM   4128  C C   . ILE D  1 26  ? 62.361 17.239 67.168  1.00 87.72  ? 53   ILE D C   1 
ATOM   4129  O O   . ILE D  1 26  ? 62.590 16.039 67.345  1.00 88.25  ? 53   ILE D O   1 
ATOM   4130  C CB  . ILE D  1 26  ? 62.942 19.664 67.385  1.00 87.09  ? 53   ILE D CB  1 
ATOM   4131  N N   . ASP D  1 27  ? 61.154 17.714 66.847  1.00 87.68  ? 54   ASP D N   1 
ATOM   4132  C CA  . ASP D  1 27  ? 59.994 16.829 66.697  1.00 87.50  ? 54   ASP D CA  1 
ATOM   4133  C C   . ASP D  1 27  ? 60.477 15.455 66.244  1.00 87.49  ? 54   ASP D C   1 
ATOM   4134  O O   . ASP D  1 27  ? 60.836 15.270 65.085  1.00 88.06  ? 54   ASP D O   1 
ATOM   4135  C CB  . ASP D  1 27  ? 59.017 17.403 65.682  1.00 87.03  ? 54   ASP D CB  1 
ATOM   4136  N N   . PRO D  1 28  ? 60.517 14.481 67.173  1.00 87.22  ? 55   PRO D N   1 
ATOM   4137  C CA  . PRO D  1 28  ? 60.954 13.098 66.947  1.00 85.94  ? 55   PRO D CA  1 
ATOM   4138  C C   . PRO D  1 28  ? 60.132 12.315 65.938  1.00 84.74  ? 55   PRO D C   1 
ATOM   4139  O O   . PRO D  1 28  ? 59.449 12.887 65.089  1.00 84.53  ? 55   PRO D O   1 
ATOM   4140  C CB  . PRO D  1 28  ? 60.876 12.480 68.340  1.00 86.52  ? 55   PRO D CB  1 
ATOM   4141  C CG  . PRO D  1 28  ? 61.132 13.650 69.241  1.00 87.43  ? 55   PRO D CG  1 
ATOM   4142  C CD  . PRO D  1 28  ? 60.259 14.703 68.606  1.00 87.49  ? 55   PRO D CD  1 
ATOM   4143  N N   . ALA D  1 29  ? 60.191 10.993 66.064  1.00 83.34  ? 56   ALA D N   1 
ATOM   4144  C CA  . ALA D  1 29  ? 59.493 10.093 65.156  1.00 81.90  ? 56   ALA D CA  1 
ATOM   4145  C C   . ALA D  1 29  ? 60.205 10.197 63.809  1.00 80.65  ? 56   ALA D C   1 
ATOM   4146  O O   . ALA D  1 29  ? 59.685 9.759  62.780  1.00 80.96  ? 56   ALA D O   1 
ATOM   4147  C CB  . ALA D  1 29  ? 58.021 10.492 65.019  1.00 81.72  ? 56   ALA D CB  1 
ATOM   4148  N N   . LEU D  1 30  ? 61.405 10.781 63.834  1.00 78.38  ? 57   LEU D N   1 
ATOM   4149  C CA  . LEU D  1 30  ? 62.209 10.953 62.630  1.00 75.56  ? 57   LEU D CA  1 
ATOM   4150  C C   . LEU D  1 30  ? 63.400 10.015 62.562  1.00 74.39  ? 57   LEU D C   1 
ATOM   4151  O O   . LEU D  1 30  ? 63.718 9.320  63.529  1.00 74.16  ? 57   LEU D O   1 
ATOM   4152  C CB  . LEU D  1 30  ? 62.690 12.401 62.514  1.00 73.78  ? 57   LEU D CB  1 
ATOM   4153  C CG  . LEU D  1 30  ? 61.571 13.361 62.106  1.00 73.43  ? 57   LEU D CG  1 
ATOM   4154  C CD1 . LEU D  1 30  ? 62.105 14.772 61.892  1.00 72.60  ? 57   LEU D CD1 1 
ATOM   4155  C CD2 . LEU D  1 30  ? 60.932 12.835 60.829  1.00 72.83  ? 57   LEU D CD2 1 
ATOM   4156  N N   . LYS D  1 31  ? 64.041 9.991  61.397  1.00 73.36  ? 58   LYS D N   1 
ATOM   4157  C CA  . LYS D  1 31  ? 65.214 9.153  61.167  1.00 73.05  ? 58   LYS D CA  1 
ATOM   4158  C C   . LYS D  1 31  ? 66.358 10.035 60.702  1.00 72.76  ? 58   LYS D C   1 
ATOM   4159  O O   . LYS D  1 31  ? 66.137 11.134 60.192  1.00 73.55  ? 58   LYS D O   1 
ATOM   4160  C CB  . LYS D  1 31  ? 64.922 8.084  60.112  1.00 72.28  ? 58   LYS D CB  1 
ATOM   4161  N N   . ILE D  1 32  ? 67.579 9.544  60.876  1.00 71.69  ? 59   ILE D N   1 
ATOM   4162  C CA  . ILE D  1 32  ? 68.768 10.282 60.488  1.00 70.79  ? 59   ILE D CA  1 
ATOM   4163  C C   . ILE D  1 32  ? 69.868 9.314  60.121  1.00 70.22  ? 59   ILE D C   1 
ATOM   4164  O O   . ILE D  1 32  ? 70.810 9.134  60.871  1.00 71.18  ? 59   ILE D O   1 
ATOM   4165  C CB  . ILE D  1 32  ? 69.285 11.163 61.653  1.00 71.51  ? 59   ILE D CB  1 
ATOM   4166  C CG1 . ILE D  1 32  ? 68.278 12.271 61.966  1.00 71.52  ? 59   ILE D CG1 1 
ATOM   4167  C CG2 . ILE D  1 32  ? 70.658 11.745 61.314  1.00 70.24  ? 59   ILE D CG2 1 
ATOM   4168  C CD1 . ILE D  1 32  ? 68.738 13.194 63.071  1.00 71.61  ? 59   ILE D CD1 1 
ATOM   4169  N N   . LYS D  1 33  ? 69.757 8.673  58.975  1.00 70.55  ? 60   LYS D N   1 
ATOM   4170  C CA  . LYS D  1 33  ? 70.800 7.745  58.575  1.00 72.28  ? 60   LYS D CA  1 
ATOM   4171  C C   . LYS D  1 33  ? 72.173 8.433  58.656  1.00 73.44  ? 60   LYS D C   1 
ATOM   4172  O O   . LYS D  1 33  ? 72.411 9.453  57.998  1.00 72.93  ? 60   LYS D O   1 
ATOM   4173  C CB  . LYS D  1 33  ? 70.553 7.265  57.145  1.00 72.96  ? 60   LYS D CB  1 
ATOM   4174  C CG  . LYS D  1 33  ? 71.487 6.166  56.670  1.00 73.10  ? 60   LYS D CG  1 
ATOM   4175  C CD  . LYS D  1 33  ? 71.028 4.799  57.144  1.00 74.35  ? 60   LYS D CD  1 
ATOM   4176  C CE  . LYS D  1 33  ? 71.731 3.693  56.362  1.00 75.35  ? 60   LYS D CE  1 
ATOM   4177  N NZ  . LYS D  1 33  ? 71.104 2.362  56.584  1.00 75.95  ? 60   LYS D NZ  1 
ATOM   4178  N N   . THR D  1 34  ? 73.063 7.879  59.478  1.00 75.19  ? 61   THR D N   1 
ATOM   4179  C CA  . THR D  1 34  ? 74.421 8.405  59.641  1.00 76.76  ? 61   THR D CA  1 
ATOM   4180  C C   . THR D  1 34  ? 75.383 7.296  59.239  1.00 78.10  ? 61   THR D C   1 
ATOM   4181  O O   . THR D  1 34  ? 75.073 6.120  59.422  1.00 78.59  ? 61   THR D O   1 
ATOM   4182  C CB  . THR D  1 34  ? 74.705 8.795  61.098  1.00 76.09  ? 61   THR D CB  1 
ATOM   4183  O OG1 . THR D  1 34  ? 74.297 7.725  61.958  1.00 76.92  ? 61   THR D OG1 1 
ATOM   4184  C CG2 . THR D  1 34  ? 73.955 10.066 61.473  1.00 75.86  ? 61   THR D CG2 1 
ATOM   4185  N N   . LYS D  1 35  ? 76.538 7.659  58.686  1.00 79.44  ? 62   LYS D N   1 
ATOM   4186  C CA  . LYS D  1 35  ? 77.515 6.662  58.252  1.00 81.24  ? 62   LYS D CA  1 
ATOM   4187  C C   . LYS D  1 35  ? 78.872 7.289  57.982  1.00 82.81  ? 62   LYS D C   1 
ATOM   4188  O O   . LYS D  1 35  ? 78.974 8.263  57.237  1.00 82.70  ? 62   LYS D O   1 
ATOM   4189  C CB  . LYS D  1 35  ? 77.018 5.950  56.991  1.00 80.13  ? 62   LYS D CB  1 
ATOM   4190  N N   . LYS D  1 36  ? 79.913 6.720  58.587  1.00 84.84  ? 63   LYS D N   1 
ATOM   4191  C CA  . LYS D  1 36  ? 81.280 7.216  58.415  1.00 85.96  ? 63   LYS D CA  1 
ATOM   4192  C C   . LYS D  1 36  ? 81.658 7.208  56.930  1.00 86.42  ? 63   LYS D C   1 
ATOM   4193  O O   . LYS D  1 36  ? 81.210 6.335  56.184  1.00 86.16  ? 63   LYS D O   1 
ATOM   4194  C CB  . LYS D  1 36  ? 82.254 6.346  59.220  1.00 85.50  ? 63   LYS D CB  1 
ATOM   4195  N N   . VAL D  1 37  ? 82.470 8.176  56.498  1.00 87.41  ? 64   VAL D N   1 
ATOM   4196  C CA  . VAL D  1 37  ? 82.872 8.237  55.092  1.00 88.14  ? 64   VAL D CA  1 
ATOM   4197  C C   . VAL D  1 37  ? 84.153 9.034  54.856  1.00 88.53  ? 64   VAL D C   1 
ATOM   4198  O O   . VAL D  1 37  ? 84.628 9.759  55.733  1.00 88.64  ? 64   VAL D O   1 
ATOM   4199  C CB  . VAL D  1 37  ? 81.719 8.830  54.223  1.00 88.48  ? 64   VAL D CB  1 
ATOM   4200  C CG1 . VAL D  1 37  ? 82.250 9.359  52.904  1.00 88.35  ? 64   VAL D CG1 1 
ATOM   4201  C CG2 . VAL D  1 37  ? 80.671 7.758  53.950  1.00 88.23  ? 64   VAL D CG2 1 
ATOM   4202  N N   . ASN D  1 38  ? 84.717 8.878  53.663  1.00 88.86  ? 65   ASN D N   1 
ATOM   4203  C CA  . ASN D  1 38  ? 85.927 9.598  53.295  1.00 89.39  ? 65   ASN D CA  1 
ATOM   4204  C C   . ASN D  1 38  ? 85.636 11.062 52.989  1.00 88.87  ? 65   ASN D C   1 
ATOM   4205  O O   . ASN D  1 38  ? 85.898 11.945 53.815  1.00 88.16  ? 65   ASN D O   1 
ATOM   4206  C CB  . ASN D  1 38  ? 86.575 8.955  52.068  1.00 90.63  ? 65   ASN D CB  1 
ATOM   4207  C CG  . ASN D  1 38  ? 87.628 7.934  52.436  1.00 91.97  ? 65   ASN D CG  1 
ATOM   4208  O OD1 . ASN D  1 38  ? 88.272 7.355  51.561  1.00 93.09  ? 65   ASN D OD1 1 
ATOM   4209  N ND2 . ASN D  1 38  ? 87.815 7.710  53.736  1.00 91.79  ? 65   ASN D ND2 1 
ATOM   4210  N N   . THR D  1 39  ? 85.083 11.296 51.797  1.00 88.33  ? 66   THR D N   1 
ATOM   4211  C CA  . THR D  1 39  ? 84.756 12.639 51.313  1.00 86.58  ? 66   THR D CA  1 
ATOM   4212  C C   . THR D  1 39  ? 83.263 12.983 51.371  1.00 86.12  ? 66   THR D C   1 
ATOM   4213  O O   . THR D  1 39  ? 82.403 12.100 51.478  1.00 85.94  ? 66   THR D O   1 
ATOM   4214  C CB  . THR D  1 39  ? 85.229 12.820 49.858  1.00 85.50  ? 66   THR D CB  1 
ATOM   4215  O OG1 . THR D  1 39  ? 84.480 11.953 49.000  1.00 83.99  ? 66   THR D OG1 1 
ATOM   4216  C CG2 . THR D  1 39  ? 86.699 12.473 49.740  1.00 84.74  ? 66   THR D CG2 1 
ATOM   4217  N N   . ALA D  1 40  ? 82.963 14.276 51.300  1.00 84.99  ? 67   ALA D N   1 
ATOM   4218  C CA  . ALA D  1 40  ? 81.583 14.741 51.336  1.00 83.38  ? 67   ALA D CA  1 
ATOM   4219  C C   . ALA D  1 40  ? 80.851 14.249 50.093  1.00 82.60  ? 67   ALA D C   1 
ATOM   4220  O O   . ALA D  1 40  ? 79.658 13.973 50.133  1.00 82.06  ? 67   ALA D O   1 
ATOM   4221  C CB  . ALA D  1 40  ? 81.548 16.263 51.405  1.00 82.57  ? 67   ALA D CB  1 
ATOM   4222  N N   . ASP D  1 41  ? 81.588 14.134 48.993  1.00 82.44  ? 68   ASP D N   1 
ATOM   4223  C CA  . ASP D  1 41  ? 81.035 13.680 47.721  1.00 81.79  ? 68   ASP D CA  1 
ATOM   4224  C C   . ASP D  1 41  ? 80.253 12.395 47.887  1.00 80.69  ? 68   ASP D C   1 
ATOM   4225  O O   . ASP D  1 41  ? 79.177 12.230 47.317  1.00 80.32  ? 68   ASP D O   1 
ATOM   4226  C CB  . ASP D  1 41  ? 82.156 13.454 46.707  1.00 83.48  ? 68   ASP D CB  1 
ATOM   4227  C CG  . ASP D  1 41  ? 82.920 14.723 46.391  1.00 84.57  ? 68   ASP D CG  1 
ATOM   4228  O OD1 . ASP D  1 41  ? 83.538 15.301 47.315  1.00 84.85  ? 68   ASP D OD1 1 
ATOM   4229  O OD2 . ASP D  1 41  ? 82.897 15.144 45.215  1.00 85.06  ? 68   ASP D OD2 1 
ATOM   4230  N N   . GLN D  1 42  ? 80.811 11.473 48.656  1.00 80.03  ? 69   GLN D N   1 
ATOM   4231  C CA  . GLN D  1 42  ? 80.141 10.214 48.884  1.00 78.90  ? 69   GLN D CA  1 
ATOM   4232  C C   . GLN D  1 42  ? 78.757 10.531 49.435  1.00 78.69  ? 69   GLN D C   1 
ATOM   4233  O O   . GLN D  1 42  ? 77.767 9.982  48.957  1.00 79.93  ? 69   GLN D O   1 
ATOM   4234  C CB  . GLN D  1 42  ? 80.934 9.369  49.857  1.00 78.76  ? 69   GLN D CB  1 
ATOM   4235  N N   . CYS D  1 43  ? 78.685 11.437 50.413  1.00 77.16  ? 70   CYS D N   1 
ATOM   4236  C CA  . CYS D  1 43  ? 77.412 11.831 51.013  1.00 75.94  ? 70   CYS D CA  1 
ATOM   4237  C C   . CYS D  1 43  ? 76.429 12.259 49.932  1.00 74.91  ? 70   CYS D C   1 
ATOM   4238  O O   . CYS D  1 43  ? 75.287 11.789 49.873  1.00 74.65  ? 70   CYS D O   1 
ATOM   4239  C CB  . CYS D  1 43  ? 77.610 13.009 51.956  1.00 76.78  ? 70   CYS D CB  1 
ATOM   4240  S SG  . CYS D  1 43  ? 78.871 12.808 53.243  1.00 77.61  ? 70   CYS D SG  1 
ATOM   4241  N N   . ALA D  1 44  ? 76.892 13.174 49.087  1.00 73.35  ? 71   ALA D N   1 
ATOM   4242  C CA  . ALA D  1 44  ? 76.096 13.704 47.991  1.00 72.48  ? 71   ALA D CA  1 
ATOM   4243  C C   . ALA D  1 44  ? 75.498 12.598 47.136  1.00 71.77  ? 71   ALA D C   1 
ATOM   4244  O O   . ALA D  1 44  ? 74.281 12.529 46.972  1.00 72.66  ? 71   ALA D O   1 
ATOM   4245  C CB  . ALA D  1 44  ? 76.946 14.619 47.128  1.00 72.45  ? 71   ALA D CB  1 
ATOM   4246  N N   . ASP D  1 45  ? 76.355 11.743 46.586  1.00 70.33  ? 72   ASP D N   1 
ATOM   4247  C CA  . ASP D  1 45  ? 75.899 10.639 45.747  1.00 69.18  ? 72   ASP D CA  1 
ATOM   4248  C C   . ASP D  1 45  ? 74.849 9.810  46.467  1.00 66.73  ? 72   ASP D C   1 
ATOM   4249  O O   . ASP D  1 45  ? 73.784 9.533  45.918  1.00 66.33  ? 72   ASP D O   1 
ATOM   4250  C CB  . ASP D  1 45  ? 77.078 9.758  45.353  1.00 72.45  ? 72   ASP D CB  1 
ATOM   4251  C CG  . ASP D  1 45  ? 78.058 10.480 44.450  1.00 75.10  ? 72   ASP D CG  1 
ATOM   4252  O OD1 . ASP D  1 45  ? 78.615 11.523 44.817  1.00 75.98  ? 72   ASP D OD1 1 
ATOM   4253  O OD2 . ASP D  1 45  ? 78.275 9.930  43.256  1.00 76.94  ? 72   ASP D OD2 1 
ATOM   4254  N N   . ARG D  1 46  ? 75.157 9.426  47.701  1.00 63.63  ? 73   ARG D N   1 
ATOM   4255  C CA  . ARG D  1 46  ? 74.240 8.654  48.526  1.00 60.81  ? 73   ARG D CA  1 
ATOM   4256  C C   . ARG D  1 46  ? 72.900 9.357  48.550  1.00 59.26  ? 73   ARG D C   1 
ATOM   4257  O O   . ARG D  1 46  ? 71.854 8.746  48.349  1.00 59.02  ? 73   ARG D O   1 
ATOM   4258  C CB  . ARG D  1 46  ? 74.770 8.566  49.931  1.00 61.19  ? 73   ARG D CB  1 
ATOM   4259  N N   . CYS D  1 47  ? 72.959 10.660 48.795  1.00 56.96  ? 74   CYS D N   1 
ATOM   4260  C CA  . CYS D  1 47  ? 71.775 11.495 48.882  1.00 54.89  ? 74   CYS D CA  1 
ATOM   4261  C C   . CYS D  1 47  ? 71.080 11.702 47.549  1.00 54.41  ? 74   CYS D C   1 
ATOM   4262  O O   . CYS D  1 47  ? 69.858 11.681 47.478  1.00 55.35  ? 74   CYS D O   1 
ATOM   4263  C CB  . CYS D  1 47  ? 72.148 12.839 49.482  1.00 52.91  ? 74   CYS D CB  1 
ATOM   4264  S SG  . CYS D  1 47  ? 70.743 13.928 49.858  1.00 51.89  ? 74   CYS D SG  1 
ATOM   4265  N N   . THR D  1 48  ? 71.855 11.905 46.493  1.00 54.32  ? 75   THR D N   1 
ATOM   4266  C CA  . THR D  1 48  ? 71.288 12.099 45.166  1.00 54.40  ? 75   THR D CA  1 
ATOM   4267  C C   . THR D  1 48  ? 70.547 10.842 44.708  1.00 54.40  ? 75   THR D C   1 
ATOM   4268  O O   . THR D  1 48  ? 69.358 10.891 44.399  1.00 54.98  ? 75   THR D O   1 
ATOM   4269  C CB  . THR D  1 48  ? 72.384 12.432 44.127  1.00 55.23  ? 75   THR D CB  1 
ATOM   4270  O OG1 . THR D  1 48  ? 73.006 13.681 44.461  1.00 54.99  ? 75   THR D OG1 1 
ATOM   4271  C CG2 . THR D  1 48  ? 71.783 12.529 42.734  1.00 55.79  ? 75   THR D CG2 1 
ATOM   4272  N N   . ARG D  1 49  ? 71.255 9.718  44.666  1.00 54.80  ? 76   ARG D N   1 
ATOM   4273  C CA  . ARG D  1 49  ? 70.672 8.447  44.244  1.00 54.86  ? 76   ARG D CA  1 
ATOM   4274  C C   . ARG D  1 49  ? 69.747 7.897  45.332  1.00 55.33  ? 76   ARG D C   1 
ATOM   4275  O O   . ARG D  1 49  ? 69.014 6.931  45.120  1.00 55.74  ? 76   ARG D O   1 
ATOM   4276  C CB  . ARG D  1 49  ? 71.780 7.450  43.937  1.00 54.03  ? 76   ARG D CB  1 
ATOM   4277  N N   . ASN D  1 50  ? 69.790 8.525  46.499  1.00 55.55  ? 77   ASN D N   1 
ATOM   4278  C CA  . ASN D  1 50  ? 68.961 8.127  47.626  1.00 56.12  ? 77   ASN D CA  1 
ATOM   4279  C C   . ASN D  1 50  ? 69.102 6.638  47.925  1.00 56.65  ? 77   ASN D C   1 
ATOM   4280  O O   . ASN D  1 50  ? 68.123 5.951  48.205  1.00 56.96  ? 77   ASN D O   1 
ATOM   4281  C CB  . ASN D  1 50  ? 67.501 8.478  47.340  1.00 54.92  ? 77   ASN D CB  1 
ATOM   4282  C CG  . ASN D  1 50  ? 66.704 8.713  48.601  1.00 54.22  ? 77   ASN D CG  1 
ATOM   4283  O OD1 . ASN D  1 50  ? 66.293 9.838  48.894  1.00 53.10  ? 77   ASN D OD1 1 
ATOM   4284  N ND2 . ASN D  1 50  ? 66.491 7.650  49.367  1.00 54.37  ? 77   ASN D ND2 1 
ATOM   4285  N N   . LYS D  1 51  ? 70.338 6.155  47.884  1.00 58.08  ? 78   LYS D N   1 
ATOM   4286  C CA  . LYS D  1 51  ? 70.632 4.746  48.143  1.00 59.54  ? 78   LYS D CA  1 
ATOM   4287  C C   . LYS D  1 51  ? 70.625 4.390  49.624  1.00 59.64  ? 78   LYS D C   1 
ATOM   4288  O O   . LYS D  1 51  ? 71.132 5.137  50.464  1.00 59.90  ? 78   LYS D O   1 
ATOM   4289  C CB  . LYS D  1 51  ? 71.999 4.367  47.540  1.00 59.39  ? 78   LYS D CB  1 
ATOM   4290  N N   . GLY D  1 52  ? 70.053 3.234  49.934  1.00 59.26  ? 79   GLY D N   1 
ATOM   4291  C CA  . GLY D  1 52  ? 70.024 2.783  51.311  1.00 58.93  ? 79   GLY D CA  1 
ATOM   4292  C C   . GLY D  1 52  ? 69.546 3.823  52.299  1.00 58.77  ? 79   GLY D C   1 
ATOM   4293  O O   . GLY D  1 52  ? 70.120 3.984  53.373  1.00 59.13  ? 79   GLY D O   1 
ATOM   4294  N N   . LEU D  1 53  ? 68.487 4.531  51.931  1.00 58.30  ? 80   LEU D N   1 
ATOM   4295  C CA  . LEU D  1 53  ? 67.911 5.552  52.786  1.00 57.34  ? 80   LEU D CA  1 
ATOM   4296  C C   . LEU D  1 53  ? 66.413 5.312  52.860  1.00 55.98  ? 80   LEU D C   1 
ATOM   4297  O O   . LEU D  1 53  ? 65.727 5.307  51.839  1.00 57.35  ? 80   LEU D O   1 
ATOM   4298  C CB  . LEU D  1 53  ? 68.200 6.939  52.214  1.00 59.54  ? 80   LEU D CB  1 
ATOM   4299  C CG  . LEU D  1 53  ? 69.667 7.370  52.301  1.00 61.94  ? 80   LEU D CG  1 
ATOM   4300  C CD1 . LEU D  1 53  ? 69.919 8.594  51.435  1.00 63.03  ? 80   LEU D CD1 1 
ATOM   4301  C CD2 . LEU D  1 53  ? 70.016 7.653  53.759  1.00 61.71  ? 80   LEU D CD2 1 
ATOM   4302  N N   . PRO D  1 54  ? 65.887 5.105  54.072  1.00 53.51  ? 81   PRO D N   1 
ATOM   4303  C CA  . PRO D  1 54  ? 64.465 4.854  54.323  1.00 51.49  ? 81   PRO D CA  1 
ATOM   4304  C C   . PRO D  1 54  ? 63.585 6.083  54.185  1.00 50.30  ? 81   PRO D C   1 
ATOM   4305  O O   . PRO D  1 54  ? 62.497 6.139  54.767  1.00 49.98  ? 81   PRO D O   1 
ATOM   4306  C CB  . PRO D  1 54  ? 64.465 4.326  55.744  1.00 52.65  ? 81   PRO D CB  1 
ATOM   4307  C CG  . PRO D  1 54  ? 65.542 5.146  56.371  1.00 53.45  ? 81   PRO D CG  1 
ATOM   4308  C CD  . PRO D  1 54  ? 66.646 5.103  55.332  1.00 52.83  ? 81   PRO D CD  1 
ATOM   4309  N N   . PHE D  1 55  ? 64.051 7.065  53.420  1.00 48.49  ? 82   PHE D N   1 
ATOM   4310  C CA  . PHE D  1 55  ? 63.285 8.288  53.222  1.00 47.26  ? 82   PHE D CA  1 
ATOM   4311  C C   . PHE D  1 55  ? 63.854 9.116  52.086  1.00 45.55  ? 82   PHE D C   1 
ATOM   4312  O O   . PHE D  1 55  ? 64.834 8.736  51.452  1.00 44.99  ? 82   PHE D O   1 
ATOM   4313  C CB  . PHE D  1 55  ? 63.291 9.115  54.508  1.00 48.36  ? 82   PHE D CB  1 
ATOM   4314  C CG  . PHE D  1 55  ? 64.659 9.314  55.082  1.00 50.09  ? 82   PHE D CG  1 
ATOM   4315  C CD1 . PHE D  1 55  ? 65.601 10.087 54.411  1.00 50.96  ? 82   PHE D CD1 1 
ATOM   4316  C CD2 . PHE D  1 55  ? 65.031 8.678  56.265  1.00 51.32  ? 82   PHE D CD2 1 
ATOM   4317  C CE1 . PHE D  1 55  ? 66.896 10.221 54.904  1.00 52.07  ? 82   PHE D CE1 1 
ATOM   4318  C CE2 . PHE D  1 55  ? 66.329 8.804  56.770  1.00 51.69  ? 82   PHE D CE2 1 
ATOM   4319  C CZ  . PHE D  1 55  ? 67.264 9.576  56.086  1.00 52.31  ? 82   PHE D CZ  1 
ATOM   4320  N N   . THR D  1 56  ? 63.232 10.261 51.846  1.00 43.74  ? 83   THR D N   1 
ATOM   4321  C CA  . THR D  1 56  ? 63.659 11.169 50.794  1.00 42.03  ? 83   THR D CA  1 
ATOM   4322  C C   . THR D  1 56  ? 64.765 12.048 51.362  1.00 40.73  ? 83   THR D C   1 
ATOM   4323  O O   . THR D  1 56  ? 64.521 12.822 52.281  1.00 39.06  ? 83   THR D O   1 
ATOM   4324  C CB  . THR D  1 56  ? 62.483 12.073 50.348  1.00 42.75  ? 83   THR D CB  1 
ATOM   4325  O OG1 . THR D  1 56  ? 61.304 11.278 50.155  1.00 41.75  ? 83   THR D OG1 1 
ATOM   4326  C CG2 . THR D  1 56  ? 62.817 12.781 49.051  1.00 41.42  ? 83   THR D CG2 1 
ATOM   4327  N N   . CYS D  1 57  ? 65.976 11.929 50.827  1.00 40.81  ? 84   CYS D N   1 
ATOM   4328  C CA  . CYS D  1 57  ? 67.090 12.741 51.323  1.00 41.98  ? 84   CYS D CA  1 
ATOM   4329  C C   . CYS D  1 57  ? 66.967 14.182 50.821  1.00 41.14  ? 84   CYS D C   1 
ATOM   4330  O O   . CYS D  1 57  ? 67.263 14.481 49.660  1.00 40.31  ? 84   CYS D O   1 
ATOM   4331  C CB  . CYS D  1 57  ? 68.442 12.142 50.898  1.00 44.34  ? 84   CYS D CB  1 
ATOM   4332  S SG  . CYS D  1 57  ? 69.852 13.121 51.515  1.00 48.79  ? 84   CYS D SG  1 
ATOM   4333  N N   . LYS D  1 58  ? 66.536 15.076 51.703  1.00 39.89  ? 85   LYS D N   1 
ATOM   4334  C CA  . LYS D  1 58  ? 66.353 16.467 51.331  1.00 40.43  ? 85   LYS D CA  1 
ATOM   4335  C C   . LYS D  1 58  ? 67.553 17.338 51.639  1.00 40.40  ? 85   LYS D C   1 
ATOM   4336  O O   . LYS D  1 58  ? 67.683 18.444 51.124  1.00 39.30  ? 85   LYS D O   1 
ATOM   4337  C CB  . LYS D  1 58  ? 65.120 17.017 52.027  1.00 41.55  ? 85   LYS D CB  1 
ATOM   4338  C CG  . LYS D  1 58  ? 63.868 16.279 51.652  1.00 44.04  ? 85   LYS D CG  1 
ATOM   4339  C CD  . LYS D  1 58  ? 62.643 16.820 52.355  1.00 46.43  ? 85   LYS D CD  1 
ATOM   4340  C CE  . LYS D  1 58  ? 61.422 16.023 51.946  1.00 48.15  ? 85   LYS D CE  1 
ATOM   4341  N NZ  . LYS D  1 58  ? 60.211 16.503 52.641  1.00 50.89  ? 85   LYS D NZ  1 
ATOM   4342  N N   . ALA D  1 59  ? 68.435 16.833 52.485  1.00 41.84  ? 86   ALA D N   1 
ATOM   4343  C CA  . ALA D  1 59  ? 69.628 17.570 52.857  1.00 44.12  ? 86   ALA D CA  1 
ATOM   4344  C C   . ALA D  1 59  ? 70.583 16.647 53.595  1.00 45.78  ? 86   ALA D C   1 
ATOM   4345  O O   . ALA D  1 59  ? 70.176 15.617 54.131  1.00 45.25  ? 86   ALA D O   1 
ATOM   4346  C CB  . ALA D  1 59  ? 69.256 18.752 53.739  1.00 43.39  ? 86   ALA D CB  1 
ATOM   4347  N N   . PHE D  1 60  ? 71.858 17.014 53.609  1.00 48.26  ? 87   PHE D N   1 
ATOM   4348  C CA  . PHE D  1 60  ? 72.860 16.226 54.297  1.00 50.80  ? 87   PHE D CA  1 
ATOM   4349  C C   . PHE D  1 60  ? 73.985 17.125 54.792  1.00 53.64  ? 87   PHE D C   1 
ATOM   4350  O O   . PHE D  1 60  ? 74.403 18.059 54.108  1.00 53.35  ? 87   PHE D O   1 
ATOM   4351  C CB  . PHE D  1 60  ? 73.405 15.127 53.374  1.00 49.94  ? 87   PHE D CB  1 
ATOM   4352  C CG  . PHE D  1 60  ? 74.448 15.597 52.396  1.00 49.19  ? 87   PHE D CG  1 
ATOM   4353  C CD1 . PHE D  1 60  ? 75.763 15.811 52.800  1.00 48.55  ? 87   PHE D CD1 1 
ATOM   4354  C CD2 . PHE D  1 60  ? 74.118 15.803 51.066  1.00 48.75  ? 87   PHE D CD2 1 
ATOM   4355  C CE1 . PHE D  1 60  ? 76.728 16.218 51.892  1.00 47.54  ? 87   PHE D CE1 1 
ATOM   4356  C CE2 . PHE D  1 60  ? 75.077 16.208 50.156  1.00 48.66  ? 87   PHE D CE2 1 
ATOM   4357  C CZ  . PHE D  1 60  ? 76.387 16.415 50.573  1.00 48.30  ? 87   PHE D CZ  1 
ATOM   4358  N N   . VAL D  1 61  ? 74.460 16.840 55.998  1.00 57.62  ? 88   VAL D N   1 
ATOM   4359  C CA  . VAL D  1 61  ? 75.541 17.609 56.601  1.00 61.13  ? 88   VAL D CA  1 
ATOM   4360  C C   . VAL D  1 61  ? 76.793 16.744 56.638  1.00 64.16  ? 88   VAL D C   1 
ATOM   4361  O O   . VAL D  1 61  ? 76.727 15.569 56.987  1.00 65.63  ? 88   VAL D O   1 
ATOM   4362  C CB  . VAL D  1 61  ? 75.195 18.040 58.047  1.00 59.54  ? 88   VAL D CB  1 
ATOM   4363  C CG1 . VAL D  1 61  ? 76.385 18.737 58.670  1.00 59.07  ? 88   VAL D CG1 1 
ATOM   4364  C CG2 . VAL D  1 61  ? 73.985 18.961 58.050  1.00 59.56  ? 88   VAL D CG2 1 
ATOM   4365  N N   . PHE D  1 62  ? 77.931 17.316 56.261  1.00 67.60  ? 89   PHE D N   1 
ATOM   4366  C CA  . PHE D  1 62  ? 79.179 16.567 56.286  1.00 70.10  ? 89   PHE D CA  1 
ATOM   4367  C C   . PHE D  1 62  ? 80.060 17.039 57.423  1.00 71.09  ? 89   PHE D C   1 
ATOM   4368  O O   . PHE D  1 62  ? 80.323 18.227 57.571  1.00 70.20  ? 89   PHE D O   1 
ATOM   4369  C CB  . PHE D  1 62  ? 79.953 16.719 54.978  1.00 71.42  ? 89   PHE D CB  1 
ATOM   4370  C CG  . PHE D  1 62  ? 81.261 15.978 54.972  1.00 73.72  ? 89   PHE D CG  1 
ATOM   4371  C CD1 . PHE D  1 62  ? 81.296 14.610 55.244  1.00 74.50  ? 89   PHE D CD1 1 
ATOM   4372  C CD2 . PHE D  1 62  ? 82.457 16.638 54.710  1.00 74.81  ? 89   PHE D CD2 1 
ATOM   4373  C CE1 . PHE D  1 62  ? 82.503 13.908 55.256  1.00 74.71  ? 89   PHE D CE1 1 
ATOM   4374  C CE2 . PHE D  1 62  ? 83.671 15.945 54.720  1.00 75.67  ? 89   PHE D CE2 1 
ATOM   4375  C CZ  . PHE D  1 62  ? 83.691 14.576 54.993  1.00 75.42  ? 89   PHE D CZ  1 
ATOM   4376  N N   . ASP D  1 63  ? 80.543 16.098 58.213  1.00 73.38  ? 90   ASP D N   1 
ATOM   4377  C CA  . ASP D  1 63  ? 81.403 16.444 59.326  1.00 76.27  ? 90   ASP D CA  1 
ATOM   4378  C C   . ASP D  1 63  ? 82.858 16.277 58.916  1.00 77.37  ? 90   ASP D C   1 
ATOM   4379  O O   . ASP D  1 63  ? 83.391 15.179 58.973  1.00 77.78  ? 90   ASP D O   1 
ATOM   4380  C CB  . ASP D  1 63  ? 81.095 15.544 60.520  1.00 77.19  ? 90   ASP D CB  1 
ATOM   4381  C CG  . ASP D  1 63  ? 81.876 15.931 61.748  1.00 78.22  ? 90   ASP D CG  1 
ATOM   4382  O OD1 . ASP D  1 63  ? 83.118 16.024 61.648  1.00 77.92  ? 90   ASP D OD1 1 
ATOM   4383  O OD2 . ASP D  1 63  ? 81.247 16.140 62.811  1.00 79.14  ? 90   ASP D OD2 1 
ATOM   4384  N N   . LYS D  1 64  ? 83.501 17.363 58.501  1.00 79.09  ? 91   LYS D N   1 
ATOM   4385  C CA  . LYS D  1 64  ? 84.902 17.297 58.095  1.00 80.55  ? 91   LYS D CA  1 
ATOM   4386  C C   . LYS D  1 64  ? 85.769 16.703 59.213  1.00 81.73  ? 91   LYS D C   1 
ATOM   4387  O O   . LYS D  1 64  ? 86.810 16.097 58.937  1.00 81.20  ? 91   LYS D O   1 
ATOM   4388  C CB  . LYS D  1 64  ? 85.417 18.692 57.726  1.00 80.06  ? 91   LYS D CB  1 
ATOM   4389  C CG  . LYS D  1 64  ? 84.693 19.358 56.568  1.00 78.86  ? 91   LYS D CG  1 
ATOM   4390  C CD  . LYS D  1 64  ? 84.921 20.861 56.624  1.00 78.62  ? 91   LYS D CD  1 
ATOM   4391  C CE  . LYS D  1 64  ? 83.990 21.625 55.694  1.00 78.51  ? 91   LYS D CE  1 
ATOM   4392  N NZ  . LYS D  1 64  ? 83.963 23.089 56.003  1.00 78.48  ? 91   LYS D NZ  1 
ATOM   4393  N N   . ALA D  1 65  ? 85.346 16.874 60.469  1.00 83.22  ? 92   ALA D N   1 
ATOM   4394  C CA  . ALA D  1 65  ? 86.106 16.329 61.593  1.00 84.95  ? 92   ALA D CA  1 
ATOM   4395  C C   . ALA D  1 65  ? 85.979 14.804 61.620  1.00 85.86  ? 92   ALA D C   1 
ATOM   4396  O O   . ALA D  1 65  ? 86.918 14.092 61.246  1.00 86.28  ? 92   ALA D O   1 
ATOM   4397  C CB  . ALA D  1 65  ? 85.614 16.929 62.914  1.00 85.38  ? 92   ALA D CB  1 
ATOM   4398  N N   . ARG D  1 66  ? 84.815 14.308 62.037  1.00 85.91  ? 93   ARG D N   1 
ATOM   4399  C CA  . ARG D  1 66  ? 84.572 12.871 62.103  1.00 86.07  ? 93   ARG D CA  1 
ATOM   4400  C C   . ARG D  1 66  ? 84.445 12.263 60.699  1.00 86.63  ? 93   ARG D C   1 
ATOM   4401  O O   . ARG D  1 66  ? 84.199 11.064 60.555  1.00 87.38  ? 93   ARG D O   1 
ATOM   4402  C CB  . ARG D  1 66  ? 83.288 12.589 62.888  1.00 85.57  ? 93   ARG D CB  1 
ATOM   4403  C CG  . ARG D  1 66  ? 83.142 13.357 64.192  1.00 85.09  ? 93   ARG D CG  1 
ATOM   4404  C CD  . ARG D  1 66  ? 81.880 12.929 64.916  1.00 85.19  ? 93   ARG D CD  1 
ATOM   4405  N NE  . ARG D  1 66  ? 81.617 13.723 66.113  1.00 86.88  ? 93   ARG D NE  1 
ATOM   4406  C CZ  . ARG D  1 66  ? 80.615 13.487 66.960  1.00 87.88  ? 93   ARG D CZ  1 
ATOM   4407  N NH1 . ARG D  1 66  ? 79.780 12.476 66.737  1.00 88.17  ? 93   ARG D NH1 1 
ATOM   4408  N NH2 . ARG D  1 66  ? 80.446 14.257 68.032  1.00 87.59  ? 93   ARG D NH2 1 
ATOM   4409  N N   . LYS D  1 67  ? 84.620 13.094 59.672  1.00 86.35  ? 94   LYS D N   1 
ATOM   4410  C CA  . LYS D  1 67  ? 84.510 12.668 58.276  1.00 85.34  ? 94   LYS D CA  1 
ATOM   4411  C C   . LYS D  1 67  ? 83.368 11.665 58.067  1.00 84.93  ? 94   LYS D C   1 
ATOM   4412  O O   . LYS D  1 67  ? 83.589 10.534 57.644  1.00 84.58  ? 94   LYS D O   1 
ATOM   4413  C CB  . LYS D  1 67  ? 85.835 12.079 57.797  1.00 84.84  ? 94   LYS D CB  1 
ATOM   4414  N N   . GLN D  1 68  ? 82.143 12.087 58.373  1.00 84.68  ? 95   GLN D N   1 
ATOM   4415  C CA  . GLN D  1 68  ? 80.980 11.226 58.202  1.00 84.40  ? 95   GLN D CA  1 
ATOM   4416  C C   . GLN D  1 68  ? 79.747 12.011 57.712  1.00 83.49  ? 95   GLN D C   1 
ATOM   4417  O O   . GLN D  1 68  ? 79.661 13.227 57.890  1.00 83.49  ? 95   GLN D O   1 
ATOM   4418  C CB  . GLN D  1 68  ? 80.665 10.502 59.515  1.00 85.54  ? 95   GLN D CB  1 
ATOM   4419  C CG  . GLN D  1 68  ? 79.745 11.251 60.453  1.00 86.91  ? 95   GLN D CG  1 
ATOM   4420  C CD  . GLN D  1 68  ? 78.736 10.321 61.100  1.00 88.42  ? 95   GLN D CD  1 
ATOM   4421  O OE1 . GLN D  1 68  ? 78.048 9.553  60.411  1.00 88.21  ? 95   GLN D OE1 1 
ATOM   4422  N NE2 . GLN D  1 68  ? 78.634 10.384 62.425  1.00 88.91  ? 95   GLN D NE2 1 
ATOM   4423  N N   . CYS D  1 69  ? 78.789 11.308 57.111  1.00 81.60  ? 96   CYS D N   1 
ATOM   4424  C CA  . CYS D  1 69  ? 77.593 11.949 56.576  1.00 78.77  ? 96   CYS D CA  1 
ATOM   4425  C C   . CYS D  1 69  ? 76.390 11.911 57.511  1.00 77.76  ? 96   CYS D C   1 
ATOM   4426  O O   . CYS D  1 69  ? 76.237 10.998 58.326  1.00 78.61  ? 96   CYS D O   1 
ATOM   4427  C CB  . CYS D  1 69  ? 77.175 11.286 55.270  1.00 78.40  ? 96   CYS D CB  1 
ATOM   4428  S SG  . CYS D  1 69  ? 78.478 10.985 54.034  1.00 80.19  ? 96   CYS D SG  1 
ATOM   4429  N N   . LEU D  1 70  ? 75.532 12.913 57.375  1.00 75.73  ? 97   LEU D N   1 
ATOM   4430  C CA  . LEU D  1 70  ? 74.308 13.005 58.162  1.00 73.15  ? 97   LEU D CA  1 
ATOM   4431  C C   . LEU D  1 70  ? 73.169 13.331 57.208  1.00 71.93  ? 97   LEU D C   1 
ATOM   4432  O O   . LEU D  1 70  ? 72.860 14.496 56.964  1.00 71.79  ? 97   LEU D O   1 
ATOM   4433  C CB  . LEU D  1 70  ? 74.415 14.094 59.232  1.00 71.90  ? 97   LEU D CB  1 
ATOM   4434  C CG  . LEU D  1 70  ? 75.276 13.787 60.453  1.00 69.89  ? 97   LEU D CG  1 
ATOM   4435  C CD1 . LEU D  1 70  ? 76.738 13.714 60.059  1.00 68.38  ? 97   LEU D CD1 1 
ATOM   4436  C CD2 . LEU D  1 70  ? 75.070 14.877 61.484  1.00 69.95  ? 97   LEU D CD2 1 
ATOM   4437  N N   . TRP D  1 71  ? 72.559 12.281 56.669  1.00 70.19  ? 98   TRP D N   1 
ATOM   4438  C CA  . TRP D  1 71  ? 71.460 12.408 55.726  1.00 68.02  ? 98   TRP D CA  1 
ATOM   4439  C C   . TRP D  1 71  ? 70.124 12.685 56.424  1.00 66.78  ? 98   TRP D C   1 
ATOM   4440  O O   . TRP D  1 71  ? 69.671 11.886 57.234  1.00 66.10  ? 98   TRP D O   1 
ATOM   4441  C CB  . TRP D  1 71  ? 71.377 11.125 54.901  1.00 68.06  ? 98   TRP D CB  1 
ATOM   4442  C CG  . TRP D  1 71  ? 72.607 10.867 54.067  1.00 68.55  ? 98   TRP D CG  1 
ATOM   4443  C CD1 . TRP D  1 71  ? 73.024 11.581 52.979  1.00 68.88  ? 98   TRP D CD1 1 
ATOM   4444  C CD2 . TRP D  1 71  ? 73.567 9.813  54.243  1.00 68.92  ? 98   TRP D CD2 1 
ATOM   4445  N NE1 . TRP D  1 71  ? 74.176 11.036 52.465  1.00 69.23  ? 98   TRP D NE1 1 
ATOM   4446  C CE2 . TRP D  1 71  ? 74.532 9.949  53.220  1.00 68.71  ? 98   TRP D CE2 1 
ATOM   4447  C CE3 . TRP D  1 71  ? 73.701 8.762  55.162  1.00 68.79  ? 98   TRP D CE3 1 
ATOM   4448  C CZ2 . TRP D  1 71  ? 75.620 9.077  53.091  1.00 67.66  ? 98   TRP D CZ2 1 
ATOM   4449  C CZ3 . TRP D  1 71  ? 74.784 7.892  55.031  1.00 68.10  ? 98   TRP D CZ3 1 
ATOM   4450  C CH2 . TRP D  1 71  ? 75.726 8.057  54.002  1.00 68.01  ? 98   TRP D CH2 1 
ATOM   4451  N N   . PHE D  1 72  ? 69.499 13.819 56.102  1.00 65.80  ? 99   PHE D N   1 
ATOM   4452  C CA  . PHE D  1 72  ? 68.218 14.201 56.703  1.00 65.48  ? 99   PHE D CA  1 
ATOM   4453  C C   . PHE D  1 72  ? 67.057 14.203 55.713  1.00 63.68  ? 99   PHE D C   1 
ATOM   4454  O O   . PHE D  1 72  ? 67.221 14.607 54.562  1.00 65.08  ? 99   PHE D O   1 
ATOM   4455  C CB  . PHE D  1 72  ? 68.300 15.607 57.293  1.00 67.79  ? 99   PHE D CB  1 
ATOM   4456  C CG  . PHE D  1 72  ? 69.448 15.809 58.220  1.00 71.11  ? 99   PHE D CG  1 
ATOM   4457  C CD1 . PHE D  1 72  ? 69.444 15.255 59.494  1.00 72.26  ? 99   PHE D CD1 1 
ATOM   4458  C CD2 . PHE D  1 72  ? 70.557 16.538 57.807  1.00 73.14  ? 99   PHE D CD2 1 
ATOM   4459  C CE1 . PHE D  1 72  ? 70.539 15.424 60.348  1.00 73.93  ? 99   PHE D CE1 1 
ATOM   4460  C CE2 . PHE D  1 72  ? 71.656 16.714 58.649  1.00 74.46  ? 99   PHE D CE2 1 
ATOM   4461  C CZ  . PHE D  1 72  ? 71.648 16.155 59.923  1.00 74.30  ? 99   PHE D CZ  1 
ATOM   4462  N N   . PRO D  1 73  ? 65.863 13.764 56.155  1.00 61.28  ? 100  PRO D N   1 
ATOM   4463  C CA  . PRO D  1 73  ? 64.640 13.707 55.350  1.00 58.97  ? 100  PRO D CA  1 
ATOM   4464  C C   . PRO D  1 73  ? 63.898 15.027 55.521  1.00 56.44  ? 100  PRO D C   1 
ATOM   4465  O O   . PRO D  1 73  ? 62.675 15.070 55.568  1.00 54.37  ? 100  PRO D O   1 
ATOM   4466  C CB  . PRO D  1 73  ? 63.883 12.560 55.981  1.00 60.50  ? 100  PRO D CB  1 
ATOM   4467  C CG  . PRO D  1 73  ? 64.160 12.785 57.423  1.00 60.90  ? 100  PRO D CG  1 
ATOM   4468  C CD  . PRO D  1 73  ? 65.660 13.047 57.427  1.00 61.50  ? 100  PRO D CD  1 
ATOM   4469  N N   . PHE D  1 74  ? 64.668 16.102 55.616  1.00 55.70  ? 101  PHE D N   1 
ATOM   4470  C CA  . PHE D  1 74  ? 64.133 17.446 55.809  1.00 54.36  ? 101  PHE D CA  1 
ATOM   4471  C C   . PHE D  1 74  ? 65.272 18.440 55.584  1.00 53.47  ? 101  PHE D C   1 
ATOM   4472  O O   . PHE D  1 74  ? 66.418 18.039 55.362  1.00 52.83  ? 101  PHE D O   1 
ATOM   4473  C CB  . PHE D  1 74  ? 63.606 17.581 57.246  1.00 55.12  ? 101  PHE D CB  1 
ATOM   4474  C CG  . PHE D  1 74  ? 64.628 17.228 58.304  1.00 56.43  ? 101  PHE D CG  1 
ATOM   4475  C CD1 . PHE D  1 74  ? 65.645 18.118 58.640  1.00 57.10  ? 101  PHE D CD1 1 
ATOM   4476  C CD2 . PHE D  1 74  ? 64.623 15.974 58.903  1.00 56.77  ? 101  PHE D CD2 1 
ATOM   4477  C CE1 . PHE D  1 74  ? 66.647 17.762 59.552  1.00 57.90  ? 101  PHE D CE1 1 
ATOM   4478  C CE2 . PHE D  1 74  ? 65.624 15.608 59.819  1.00 58.11  ? 101  PHE D CE2 1 
ATOM   4479  C CZ  . PHE D  1 74  ? 66.637 16.506 60.139  1.00 57.85  ? 101  PHE D CZ  1 
ATOM   4480  N N   . ASN D  1 75  ? 64.959 19.730 55.636  1.00 53.06  ? 102  ASN D N   1 
ATOM   4481  C CA  . ASN D  1 75  ? 65.982 20.758 55.474  1.00 53.72  ? 102  ASN D CA  1 
ATOM   4482  C C   . ASN D  1 75  ? 65.761 21.944 56.418  1.00 55.58  ? 102  ASN D C   1 
ATOM   4483  O O   . ASN D  1 75  ? 64.827 21.961 57.211  1.00 55.35  ? 102  ASN D O   1 
ATOM   4484  C CB  . ASN D  1 75  ? 66.055 21.245 54.021  1.00 50.65  ? 102  ASN D CB  1 
ATOM   4485  C CG  . ASN D  1 75  ? 64.795 21.940 53.566  1.00 47.59  ? 102  ASN D CG  1 
ATOM   4486  O OD1 . ASN D  1 75  ? 64.078 22.530 54.359  1.00 47.82  ? 102  ASN D OD1 1 
ATOM   4487  N ND2 . ASN D  1 75  ? 64.535 21.893 52.274  1.00 46.08  ? 102  ASN D ND2 1 
ATOM   4488  N N   . SER D  1 76  ? 66.634 22.936 56.318  1.00 58.17  ? 103  SER D N   1 
ATOM   4489  C CA  . SER D  1 76  ? 66.572 24.118 57.162  1.00 60.49  ? 103  SER D CA  1 
ATOM   4490  C C   . SER D  1 76  ? 65.201 24.777 57.244  1.00 61.83  ? 103  SER D C   1 
ATOM   4491  O O   . SER D  1 76  ? 64.870 25.404 58.239  1.00 61.76  ? 103  SER D O   1 
ATOM   4492  C CB  . SER D  1 76  ? 67.585 25.148 56.672  1.00 61.09  ? 103  SER D CB  1 
ATOM   4493  O OG  . SER D  1 76  ? 67.195 25.659 55.408  1.00 61.72  ? 103  SER D OG  1 
ATOM   4494  N N   . MET D  1 77  ? 64.403 24.653 56.197  1.00 65.15  ? 104  MET D N   1 
ATOM   4495  C CA  . MET D  1 77  ? 63.085 25.273 56.198  1.00 69.48  ? 104  MET D CA  1 
ATOM   4496  C C   . MET D  1 77  ? 62.019 24.294 56.670  1.00 71.93  ? 104  MET D C   1 
ATOM   4497  O O   . MET D  1 77  ? 60.821 24.571 56.581  1.00 72.64  ? 104  MET D O   1 
ATOM   4498  C CB  . MET D  1 77  ? 62.748 25.788 54.799  1.00 71.04  ? 104  MET D CB  1 
ATOM   4499  C CG  . MET D  1 77  ? 63.736 26.817 54.274  1.00 74.37  ? 104  MET D CG  1 
ATOM   4500  S SD  . MET D  1 77  ? 64.008 26.665 52.482  1.00 78.80  ? 104  MET D SD  1 
ATOM   4501  C CE  . MET D  1 77  ? 65.283 25.364 52.425  1.00 78.03  ? 104  MET D CE  1 
ATOM   4502  N N   . SER D  1 78  ? 62.460 23.141 57.165  1.00 74.21  ? 105  SER D N   1 
ATOM   4503  C CA  . SER D  1 78  ? 61.541 22.133 57.679  1.00 76.37  ? 105  SER D CA  1 
ATOM   4504  C C   . SER D  1 78  ? 61.140 22.457 59.118  1.00 77.99  ? 105  SER D C   1 
ATOM   4505  O O   . SER D  1 78  ? 61.982 22.535 60.023  1.00 76.89  ? 105  SER D O   1 
ATOM   4506  C CB  . SER D  1 78  ? 62.178 20.743 57.635  1.00 76.82  ? 105  SER D CB  1 
ATOM   4507  O OG  . SER D  1 78  ? 62.352 20.289 56.308  1.00 78.45  ? 105  SER D OG  1 
ATOM   4508  N N   . SER D  1 79  ? 59.845 22.660 59.318  1.00 80.09  ? 106  SER D N   1 
ATOM   4509  C CA  . SER D  1 79  ? 59.324 22.957 60.641  1.00 81.96  ? 106  SER D CA  1 
ATOM   4510  C C   . SER D  1 79  ? 59.683 21.782 61.542  1.00 83.15  ? 106  SER D C   1 
ATOM   4511  O O   . SER D  1 79  ? 59.253 20.653 61.301  1.00 84.21  ? 106  SER D O   1 
ATOM   4512  C CB  . SER D  1 79  ? 57.806 23.132 60.569  1.00 81.66  ? 106  SER D CB  1 
ATOM   4513  O OG  . SER D  1 79  ? 57.213 22.074 59.831  1.00 81.70  ? 106  SER D OG  1 
ATOM   4514  N N   . GLY D  1 80  ? 60.489 22.042 62.566  1.00 84.00  ? 107  GLY D N   1 
ATOM   4515  C CA  . GLY D  1 80  ? 60.887 20.980 63.475  1.00 84.20  ? 107  GLY D CA  1 
ATOM   4516  C C   . GLY D  1 80  ? 62.392 20.847 63.585  1.00 84.45  ? 107  GLY D C   1 
ATOM   4517  O O   . GLY D  1 80  ? 62.898 19.914 64.207  1.00 83.32  ? 107  GLY D O   1 
ATOM   4518  N N   . VAL D  1 81  ? 63.106 21.784 62.966  1.00 85.25  ? 108  VAL D N   1 
ATOM   4519  C CA  . VAL D  1 81  ? 64.560 21.785 62.998  1.00 85.65  ? 108  VAL D CA  1 
ATOM   4520  C C   . VAL D  1 81  ? 65.123 23.189 63.063  1.00 85.75  ? 108  VAL D C   1 
ATOM   4521  O O   . VAL D  1 81  ? 64.462 24.175 62.703  1.00 85.13  ? 108  VAL D O   1 
ATOM   4522  C CB  . VAL D  1 81  ? 65.174 21.081 61.767  1.00 86.42  ? 108  VAL D CB  1 
ATOM   4523  C CG1 . VAL D  1 81  ? 64.755 19.620 61.746  1.00 87.11  ? 108  VAL D CG1 1 
ATOM   4524  C CG2 . VAL D  1 81  ? 64.737 21.784 60.489  1.00 86.81  ? 108  VAL D CG2 1 
ATOM   4525  N N   . LYS D  1 82  ? 66.370 23.246 63.513  1.00 85.99  ? 109  LYS D N   1 
ATOM   4526  C CA  . LYS D  1 82  ? 67.094 24.492 63.672  1.00 85.87  ? 109  LYS D CA  1 
ATOM   4527  C C   . LYS D  1 82  ? 68.530 24.258 63.208  1.00 85.59  ? 109  LYS D C   1 
ATOM   4528  O O   . LYS D  1 82  ? 68.996 23.120 63.156  1.00 84.87  ? 109  LYS D O   1 
ATOM   4529  C CB  . LYS D  1 82  ? 67.063 24.906 65.153  1.00 85.84  ? 109  LYS D CB  1 
ATOM   4530  C CG  . LYS D  1 82  ? 65.671 24.792 65.788  1.00 84.37  ? 109  LYS D CG  1 
ATOM   4531  C CD  . LYS D  1 82  ? 65.575 25.468 67.145  1.00 82.98  ? 109  LYS D CD  1 
ATOM   4532  C CE  . LYS D  1 82  ? 64.118 25.599 67.581  1.00 82.61  ? 109  LYS D CE  1 
ATOM   4533  N NZ  . LYS D  1 82  ? 63.946 26.525 68.740  1.00 81.59  ? 109  LYS D NZ  1 
ATOM   4534  N N   . LYS D  1 83  ? 69.223 25.333 62.859  1.00 85.47  ? 110  LYS D N   1 
ATOM   4535  C CA  . LYS D  1 83  ? 70.599 25.207 62.419  1.00 86.19  ? 110  LYS D CA  1 
ATOM   4536  C C   . LYS D  1 83  ? 71.546 25.805 63.456  1.00 86.09  ? 110  LYS D C   1 
ATOM   4537  O O   . LYS D  1 83  ? 71.119 26.512 64.364  1.00 85.66  ? 110  LYS D O   1 
ATOM   4538  C CB  . LYS D  1 83  ? 70.794 25.893 61.052  1.00 86.75  ? 110  LYS D CB  1 
ATOM   4539  C CG  . LYS D  1 83  ? 70.139 27.270 60.921  1.00 87.30  ? 110  LYS D CG  1 
ATOM   4540  C CD  . LYS D  1 83  ? 70.599 28.028 59.669  1.00 86.89  ? 110  LYS D CD  1 
ATOM   4541  C CE  . LYS D  1 83  ? 70.140 27.363 58.383  1.00 87.73  ? 110  LYS D CE  1 
ATOM   4542  N NZ  . LYS D  1 83  ? 70.395 28.218 57.179  1.00 88.66  ? 110  LYS D NZ  1 
ATOM   4543  N N   . GLU D  1 84  ? 72.831 25.502 63.323  1.00 86.32  ? 111  GLU D N   1 
ATOM   4544  C CA  . GLU D  1 84  ? 73.841 26.024 64.232  1.00 86.85  ? 111  GLU D CA  1 
ATOM   4545  C C   . GLU D  1 84  ? 75.167 26.081 63.490  1.00 87.22  ? 111  GLU D C   1 
ATOM   4546  O O   . GLU D  1 84  ? 75.241 25.720 62.309  1.00 87.18  ? 111  GLU D O   1 
ATOM   4547  C CB  . GLU D  1 84  ? 73.954 25.133 65.472  1.00 87.17  ? 111  GLU D CB  1 
ATOM   4548  N N   . PHE D  1 85  ? 76.219 26.527 64.170  1.00 87.10  ? 112  PHE D N   1 
ATOM   4549  C CA  . PHE D  1 85  ? 77.538 26.621 63.540  1.00 87.06  ? 112  PHE D CA  1 
ATOM   4550  C C   . PHE D  1 85  ? 78.462 25.427 63.839  1.00 87.02  ? 112  PHE D C   1 
ATOM   4551  O O   . PHE D  1 85  ? 78.108 24.504 64.565  1.00 86.45  ? 112  PHE D O   1 
ATOM   4552  C CB  . PHE D  1 85  ? 78.210 27.912 63.959  1.00 87.62  ? 112  PHE D CB  1 
ATOM   4553  N N   . GLY D  1 86  ? 79.648 25.470 63.243  1.00 87.20  ? 113  GLY D N   1 
ATOM   4554  C CA  . GLY D  1 86  ? 80.634 24.422 63.402  1.00 87.38  ? 113  GLY D CA  1 
ATOM   4555  C C   . GLY D  1 86  ? 81.656 24.588 62.294  1.00 88.02  ? 113  GLY D C   1 
ATOM   4556  O O   . GLY D  1 86  ? 81.406 24.192 61.162  1.00 88.21  ? 113  GLY D O   1 
ATOM   4557  N N   . HIS D  1 87  ? 82.799 25.188 62.618  1.00 88.80  ? 114  HIS D N   1 
ATOM   4558  C CA  . HIS D  1 87  ? 83.874 25.441 61.652  1.00 88.98  ? 114  HIS D CA  1 
ATOM   4559  C C   . HIS D  1 87  ? 84.219 24.184 60.846  1.00 88.59  ? 114  HIS D C   1 
ATOM   4560  O O   . HIS D  1 87  ? 84.971 24.235 59.867  1.00 88.58  ? 114  HIS D O   1 
ATOM   4561  C CB  . HIS D  1 87  ? 85.126 25.931 62.391  1.00 89.37  ? 114  HIS D CB  1 
ATOM   4562  C CG  . HIS D  1 87  ? 84.845 26.945 63.459  1.00 90.36  ? 114  HIS D CG  1 
ATOM   4563  N ND1 . HIS D  1 87  ? 84.715 28.292 63.194  1.00 90.88  ? 114  HIS D ND1 1 
ATOM   4564  C CD2 . HIS D  1 87  ? 84.657 26.805 64.794  1.00 90.04  ? 114  HIS D CD2 1 
ATOM   4565  C CE1 . HIS D  1 87  ? 84.459 28.937 64.319  1.00 90.51  ? 114  HIS D CE1 1 
ATOM   4566  N NE2 . HIS D  1 87  ? 84.419 28.058 65.304  1.00 89.85  ? 114  HIS D NE2 1 
ATOM   4567  N N   . GLU D  1 88  ? 83.656 23.059 61.271  1.00 87.74  ? 115  GLU D N   1 
ATOM   4568  C CA  . GLU D  1 88  ? 83.888 21.776 60.629  1.00 86.88  ? 115  GLU D CA  1 
ATOM   4569  C C   . GLU D  1 88  ? 82.737 21.395 59.694  1.00 86.20  ? 115  GLU D C   1 
ATOM   4570  O O   . GLU D  1 88  ? 82.929 20.617 58.758  1.00 86.23  ? 115  GLU D O   1 
ATOM   4571  C CB  . GLU D  1 88  ? 84.033 20.681 61.699  1.00 86.96  ? 115  GLU D CB  1 
ATOM   4572  C CG  . GLU D  1 88  ? 82.692 20.230 62.305  1.00 86.41  ? 115  GLU D CG  1 
ATOM   4573  C CD  . GLU D  1 88  ? 82.526 20.586 63.778  1.00 86.16  ? 115  GLU D CD  1 
ATOM   4574  O OE1 . GLU D  1 88  ? 82.949 19.788 64.638  1.00 85.60  ? 115  GLU D OE1 1 
ATOM   4575  O OE2 . GLU D  1 88  ? 81.973 21.666 64.079  1.00 86.31  ? 115  GLU D OE2 1 
ATOM   4576  N N   . PHE D  1 89  ? 81.551 21.954 59.951  1.00 85.04  ? 116  PHE D N   1 
ATOM   4577  C CA  . PHE D  1 89  ? 80.329 21.643 59.191  1.00 82.61  ? 116  PHE D CA  1 
ATOM   4578  C C   . PHE D  1 89  ? 80.019 22.316 57.853  1.00 79.08  ? 116  PHE D C   1 
ATOM   4579  O O   . PHE D  1 89  ? 80.270 23.495 57.641  1.00 78.16  ? 116  PHE D O   1 
ATOM   4580  C CB  . PHE D  1 89  ? 79.105 21.806 60.101  1.00 84.38  ? 116  PHE D CB  1 
ATOM   4581  C CG  . PHE D  1 89  ? 79.056 20.813 61.223  1.00 85.38  ? 116  PHE D CG  1 
ATOM   4582  C CD1 . PHE D  1 89  ? 79.126 19.447 60.959  1.00 85.95  ? 116  PHE D CD1 1 
ATOM   4583  C CD2 . PHE D  1 89  ? 78.958 21.237 62.544  1.00 86.20  ? 116  PHE D CD2 1 
ATOM   4584  C CE1 . PHE D  1 89  ? 79.100 18.513 61.993  1.00 86.24  ? 116  PHE D CE1 1 
ATOM   4585  C CE2 . PHE D  1 89  ? 78.931 20.310 63.591  1.00 86.92  ? 116  PHE D CE2 1 
ATOM   4586  C CZ  . PHE D  1 89  ? 79.003 18.944 63.313  1.00 86.57  ? 116  PHE D CZ  1 
ATOM   4587  N N   . ASP D  1 90  ? 79.437 21.518 56.967  1.00 75.11  ? 117  ASP D N   1 
ATOM   4588  C CA  . ASP D  1 90  ? 79.054 21.951 55.636  1.00 70.90  ? 117  ASP D CA  1 
ATOM   4589  C C   . ASP D  1 90  ? 77.691 21.351 55.293  1.00 67.72  ? 117  ASP D C   1 
ATOM   4590  O O   . ASP D  1 90  ? 77.601 20.185 54.918  1.00 66.96  ? 117  ASP D O   1 
ATOM   4591  C CB  . ASP D  1 90  ? 80.091 21.481 54.612  1.00 70.48  ? 117  ASP D CB  1 
ATOM   4592  C CG  . ASP D  1 90  ? 80.916 22.619 54.048  1.00 70.04  ? 117  ASP D CG  1 
ATOM   4593  O OD1 . ASP D  1 90  ? 81.573 23.322 54.843  1.00 69.98  ? 117  ASP D OD1 1 
ATOM   4594  O OD2 . ASP D  1 90  ? 80.909 22.807 52.810  1.00 69.70  ? 117  ASP D OD2 1 
ATOM   4595  N N   . LEU D  1 91  ? 76.636 22.149 55.442  1.00 63.93  ? 118  LEU D N   1 
ATOM   4596  C CA  . LEU D  1 91  ? 75.278 21.715 55.123  1.00 59.72  ? 118  LEU D CA  1 
ATOM   4597  C C   . LEU D  1 91  ? 75.024 21.764 53.619  1.00 58.08  ? 118  LEU D C   1 
ATOM   4598  O O   . LEU D  1 91  ? 75.424 22.703 52.936  1.00 57.99  ? 118  LEU D O   1 
ATOM   4599  C CB  . LEU D  1 91  ? 74.253 22.600 55.825  1.00 57.50  ? 118  LEU D CB  1 
ATOM   4600  C CG  . LEU D  1 91  ? 72.816 22.401 55.361  1.00 54.60  ? 118  LEU D CG  1 
ATOM   4601  C CD1 . LEU D  1 91  ? 72.438 20.942 55.513  1.00 55.44  ? 118  LEU D CD1 1 
ATOM   4602  C CD2 . LEU D  1 91  ? 71.894 23.296 56.163  1.00 53.30  ? 118  LEU D CD2 1 
ATOM   4603  N N   . TYR D  1 92  ? 74.350 20.744 53.110  1.00 56.52  ? 119  TYR D N   1 
ATOM   4604  C CA  . TYR D  1 92  ? 74.041 20.655 51.689  1.00 54.97  ? 119  TYR D CA  1 
ATOM   4605  C C   . TYR D  1 92  ? 72.558 20.375 51.517  1.00 52.23  ? 119  TYR D C   1 
ATOM   4606  O O   . TYR D  1 92  ? 72.096 19.270 51.784  1.00 52.78  ? 119  TYR D O   1 
ATOM   4607  C CB  . TYR D  1 92  ? 74.838 19.524 51.043  1.00 56.73  ? 119  TYR D CB  1 
ATOM   4608  C CG  . TYR D  1 92  ? 76.335 19.711 51.065  1.00 59.12  ? 119  TYR D CG  1 
ATOM   4609  C CD1 . TYR D  1 92  ? 77.060 19.598 52.249  1.00 59.97  ? 119  TYR D CD1 1 
ATOM   4610  C CD2 . TYR D  1 92  ? 77.034 19.974 49.886  1.00 61.12  ? 119  TYR D CD2 1 
ATOM   4611  C CE1 . TYR D  1 92  ? 78.452 19.739 52.254  1.00 61.86  ? 119  TYR D CE1 1 
ATOM   4612  C CE2 . TYR D  1 92  ? 78.422 20.116 49.876  1.00 61.94  ? 119  TYR D CE2 1 
ATOM   4613  C CZ  . TYR D  1 92  ? 79.124 19.997 51.059  1.00 62.46  ? 119  TYR D CZ  1 
ATOM   4614  O OH  . TYR D  1 92  ? 80.493 20.124 51.030  1.00 62.61  ? 119  TYR D OH  1 
ATOM   4615  N N   . GLU D  1 93  ? 71.808 21.370 51.068  1.00 48.37  ? 120  GLU D N   1 
ATOM   4616  C CA  . GLU D  1 93  ? 70.381 21.175 50.885  1.00 44.51  ? 120  GLU D CA  1 
ATOM   4617  C C   . GLU D  1 93  ? 70.042 20.829 49.453  1.00 41.87  ? 120  GLU D C   1 
ATOM   4618  O O   . GLU D  1 93  ? 70.513 21.469 48.518  1.00 42.16  ? 120  GLU D O   1 
ATOM   4619  C CB  . GLU D  1 93  ? 69.619 22.421 51.313  1.00 44.03  ? 120  GLU D CB  1 
ATOM   4620  C CG  . GLU D  1 93  ? 69.810 22.748 52.769  1.00 44.95  ? 120  GLU D CG  1 
ATOM   4621  C CD  . GLU D  1 93  ? 69.125 24.032 53.174  1.00 46.09  ? 120  GLU D CD  1 
ATOM   4622  O OE1 . GLU D  1 93  ? 69.507 25.105 52.652  1.00 48.30  ? 120  GLU D OE1 1 
ATOM   4623  O OE2 . GLU D  1 93  ? 68.204 23.973 54.014  1.00 44.89  ? 120  GLU D OE2 1 
ATOM   4624  N N   . ASN D  1 94  ? 69.228 19.797 49.293  1.00 38.90  ? 121  ASN D N   1 
ATOM   4625  C CA  . ASN D  1 94  ? 68.802 19.353 47.978  1.00 36.80  ? 121  ASN D CA  1 
ATOM   4626  C C   . ASN D  1 94  ? 67.944 20.452 47.358  1.00 35.71  ? 121  ASN D C   1 
ATOM   4627  O O   . ASN D  1 94  ? 66.946 20.876 47.951  1.00 35.07  ? 121  ASN D O   1 
ATOM   4628  C CB  . ASN D  1 94  ? 67.984 18.083 48.112  1.00 36.21  ? 121  ASN D CB  1 
ATOM   4629  C CG  . ASN D  1 94  ? 67.800 17.387 46.809  1.00 36.19  ? 121  ASN D CG  1 
ATOM   4630  O OD1 . ASN D  1 94  ? 67.435 18.005 45.811  1.00 36.84  ? 121  ASN D OD1 1 
ATOM   4631  N ND2 . ASN D  1 94  ? 68.051 16.082 46.798  1.00 38.18  ? 121  ASN D ND2 1 
ATOM   4632  N N   . LYS D  1 95  ? 68.325 20.906 46.167  1.00 33.47  ? 122  LYS D N   1 
ATOM   4633  C CA  . LYS D  1 95  ? 67.593 21.972 45.508  1.00 31.25  ? 122  LYS D CA  1 
ATOM   4634  C C   . LYS D  1 95  ? 66.168 21.629 45.175  1.00 30.56  ? 122  LYS D C   1 
ATOM   4635  O O   . LYS D  1 95  ? 65.305 22.504 45.224  1.00 32.37  ? 122  LYS D O   1 
ATOM   4636  C CB  . LYS D  1 95  ? 68.312 22.415 44.245  1.00 31.19  ? 122  LYS D CB  1 
ATOM   4637  C CG  . LYS D  1 95  ? 69.687 22.971 44.519  1.00 34.55  ? 122  LYS D CG  1 
ATOM   4638  C CD  . LYS D  1 95  ? 70.092 24.039 43.520  1.00 38.25  ? 122  LYS D CD  1 
ATOM   4639  C CE  . LYS D  1 95  ? 70.267 23.480 42.110  1.00 41.56  ? 122  LYS D CE  1 
ATOM   4640  N NZ  . LYS D  1 95  ? 70.792 24.512 41.147  1.00 44.38  ? 122  LYS D NZ  1 
ATOM   4641  N N   . ASP D  1 96  ? 65.917 20.369 44.823  1.00 29.14  ? 123  ASP D N   1 
ATOM   4642  C CA  . ASP D  1 96  ? 64.568 19.921 44.473  1.00 28.86  ? 123  ASP D CA  1 
ATOM   4643  C C   . ASP D  1 96  ? 63.592 20.102 45.617  1.00 26.64  ? 123  ASP D C   1 
ATOM   4644  O O   . ASP D  1 96  ? 62.422 19.745 45.493  1.00 27.11  ? 123  ASP D O   1 
ATOM   4645  C CB  . ASP D  1 96  ? 64.567 18.439 44.087  1.00 34.53  ? 123  ASP D CB  1 
ATOM   4646  C CG  . ASP D  1 96  ? 65.263 18.165 42.750  1.00 40.99  ? 123  ASP D CG  1 
ATOM   4647  O OD1 . ASP D  1 96  ? 64.659 18.489 41.688  1.00 43.58  ? 123  ASP D OD1 1 
ATOM   4648  O OD2 . ASP D  1 96  ? 66.409 17.629 42.768  1.00 41.10  ? 123  ASP D OD2 1 
ATOM   4649  N N   . TYR D  1 97  ? 64.061 20.644 46.736  1.00 23.68  ? 124  TYR D N   1 
ATOM   4650  C CA  . TYR D  1 97  ? 63.194 20.828 47.884  1.00 22.09  ? 124  TYR D CA  1 
ATOM   4651  C C   . TYR D  1 97  ? 63.281 22.201 48.471  1.00 21.59  ? 124  TYR D C   1 
ATOM   4652  O O   . TYR D  1 97  ? 62.839 22.426 49.588  1.00 24.59  ? 124  TYR D O   1 
ATOM   4653  C CB  . TYR D  1 97  ? 63.499 19.781 48.947  1.00 21.50  ? 124  TYR D CB  1 
ATOM   4654  C CG  . TYR D  1 97  ? 63.204 18.415 48.425  1.00 23.27  ? 124  TYR D CG  1 
ATOM   4655  C CD1 . TYR D  1 97  ? 61.890 18.045 48.138  1.00 24.18  ? 124  TYR D CD1 1 
ATOM   4656  C CD2 . TYR D  1 97  ? 64.233 17.537 48.083  1.00 22.01  ? 124  TYR D CD2 1 
ATOM   4657  C CE1 . TYR D  1 97  ? 61.604 16.843 47.511  1.00 25.16  ? 124  TYR D CE1 1 
ATOM   4658  C CE2 . TYR D  1 97  ? 63.958 16.333 47.457  1.00 23.90  ? 124  TYR D CE2 1 
ATOM   4659  C CZ  . TYR D  1 97  ? 62.635 15.993 47.170  1.00 25.38  ? 124  TYR D CZ  1 
ATOM   4660  O OH  . TYR D  1 97  ? 62.336 14.822 46.517  1.00 26.73  ? 124  TYR D OH  1 
ATOM   4661  N N   . ILE D  1 98  ? 63.870 23.114 47.722  1.00 18.27  ? 125  ILE D N   1 
ATOM   4662  C CA  . ILE D  1 98  ? 63.991 24.498 48.133  1.00 16.88  ? 125  ILE D CA  1 
ATOM   4663  C C   . ILE D  1 98  ? 63.111 25.207 47.118  1.00 15.39  ? 125  ILE D C   1 
ATOM   4664  O O   . ILE D  1 98  ? 63.512 25.393 45.979  1.00 15.44  ? 125  ILE D O   1 
ATOM   4665  C CB  . ILE D  1 98  ? 65.435 24.986 47.990  1.00 18.19  ? 125  ILE D CB  1 
ATOM   4666  C CG1 . ILE D  1 98  ? 66.349 24.170 48.896  1.00 19.75  ? 125  ILE D CG1 1 
ATOM   4667  C CG2 . ILE D  1 98  ? 65.534 26.459 48.351  1.00 18.53  ? 125  ILE D CG2 1 
ATOM   4668  C CD1 . ILE D  1 98  ? 67.801 24.591 48.818  1.00 19.85  ? 125  ILE D CD1 1 
ATOM   4669  N N   . ARG D  1 99  ? 61.903 25.568 47.523  1.00 13.50  ? 126  ARG D N   1 
ATOM   4670  C CA  . ARG D  1 99  ? 60.983 26.218 46.625  1.00 14.36  ? 126  ARG D CA  1 
ATOM   4671  C C   . ARG D  1 99  ? 61.707 27.087 45.638  1.00 16.46  ? 126  ARG D C   1 
ATOM   4672  O O   . ARG D  1 99  ? 62.483 27.952 46.042  1.00 16.79  ? 126  ARG D O   1 
ATOM   4673  C CB  . ARG D  1 99  ? 59.997 27.076 47.377  1.00 14.70  ? 126  ARG D CB  1 
ATOM   4674  C CG  . ARG D  1 99  ? 59.125 27.905 46.448  1.00 20.51  ? 126  ARG D CG  1 
ATOM   4675  C CD  . ARG D  1 99  ? 57.980 28.517 47.217  1.00 24.18  ? 126  ARG D CD  1 
ATOM   4676  N NE  . ARG D  1 99  ? 58.307 28.532 48.638  1.00 27.06  ? 126  ARG D NE  1 
ATOM   4677  C CZ  . ARG D  1 99  ? 58.322 29.623 49.392  1.00 29.35  ? 126  ARG D CZ  1 
ATOM   4678  N NH1 . ARG D  1 99  ? 58.024 30.807 48.868  1.00 31.02  ? 126  ARG D NH1 1 
ATOM   4679  N NH2 . ARG D  1 99  ? 58.637 29.529 50.675  1.00 31.91  ? 126  ARG D NH2 1 
ATOM   4680  N N   . ASN D  1 100 ? 61.444 26.863 44.344  1.00 18.58  ? 127  ASN D N   1 
ATOM   4681  C CA  . ASN D  1 100 ? 62.098 27.632 43.299  1.00 17.03  ? 127  ASN D CA  1 
ATOM   4682  C C   . ASN D  1 100 ? 61.233 28.623 42.576  1.00 19.39  ? 127  ASN D C   1 
ATOM   4683  O O   . ASN D  1 100 ? 61.514 28.980 41.433  1.00 20.82  ? 127  ASN D O   1 
ATOM   4684  C CB  . ASN D  1 100 ? 62.779 26.724 42.284  1.00 14.42  ? 127  ASN D CB  1 
ATOM   4685  C CG  . ASN D  1 100 ? 61.811 25.884 41.504  1.00 13.86  ? 127  ASN D CG  1 
ATOM   4686  O OD1 . ASN D  1 100 ? 60.612 25.998 41.663  1.00 16.10  ? 127  ASN D OD1 1 
ATOM   4687  N ND2 . ASN D  1 100 ? 62.334 25.024 40.649  1.00 14.23  ? 127  ASN D ND2 1 
ATOM   4688  N N   . CYS D  1 101 ? 60.191 29.083 43.246  1.00 20.73  ? 128  CYS D N   1 
ATOM   4689  C CA  . CYS D  1 101 ? 59.344 30.107 42.672  1.00 23.18  ? 128  CYS D CA  1 
ATOM   4690  C C   . CYS D  1 101 ? 59.102 31.047 43.830  1.00 25.19  ? 128  CYS D C   1 
ATOM   4691  O O   . CYS D  1 101 ? 59.272 30.657 44.990  1.00 24.53  ? 128  CYS D O   1 
ATOM   4692  C CB  . CYS D  1 101 ? 58.027 29.546 42.123  1.00 24.22  ? 128  CYS D CB  1 
ATOM   4693  S SG  . CYS D  1 101 ? 57.049 28.516 43.244  1.00 30.49  ? 128  CYS D SG  1 
ATOM   4694  N N   . ILE D  1 102 ? 58.729 32.286 43.522  1.00 27.86  ? 129  ILE D N   1 
ATOM   4695  C CA  . ILE D  1 102 ? 58.497 33.281 44.560  1.00 31.91  ? 129  ILE D CA  1 
ATOM   4696  C C   . ILE D  1 102 ? 57.049 33.718 44.688  1.00 35.16  ? 129  ILE D C   1 
ATOM   4697  O O   . ILE D  1 102 ? 56.295 33.698 43.721  1.00 35.79  ? 129  ILE D O   1 
ATOM   4698  C CB  . ILE D  1 102 ? 59.315 34.555 44.316  1.00 30.59  ? 129  ILE D CB  1 
ATOM   4699  C CG1 . ILE D  1 102 ? 58.938 35.133 42.953  1.00 29.20  ? 129  ILE D CG1 1 
ATOM   4700  C CG2 . ILE D  1 102 ? 60.798 34.251 44.419  1.00 29.30  ? 129  ILE D CG2 1 
ATOM   4701  C CD1 . ILE D  1 102 ? 59.420 36.529 42.730  1.00 29.94  ? 129  ILE D CD1 1 
ATOM   4702  N N   . ILE D  1 103 ? 56.684 34.130 45.898  1.00 39.20  ? 130  ILE D N   1 
ATOM   4703  C CA  . ILE D  1 103 ? 55.350 34.620 46.194  1.00 42.41  ? 130  ILE D CA  1 
ATOM   4704  C C   . ILE D  1 103 ? 55.485 36.118 46.383  1.00 43.58  ? 130  ILE D C   1 
ATOM   4705  O O   . ILE D  1 103 ? 56.121 36.581 47.329  1.00 43.74  ? 130  ILE D O   1 
ATOM   4706  C CB  . ILE D  1 103 ? 54.796 34.055 47.504  1.00 44.10  ? 130  ILE D CB  1 
ATOM   4707  C CG1 . ILE D  1 103 ? 55.026 32.540 47.578  1.00 44.91  ? 130  ILE D CG1 1 
ATOM   4708  C CG2 . ILE D  1 103 ? 53.316 34.379 47.586  1.00 43.92  ? 130  ILE D CG2 1 
ATOM   4709  C CD1 . ILE D  1 103 ? 54.662 31.927 48.934  1.00 45.97  ? 130  ILE D CD1 1 
ATOM   4710  N N   . GLY D  1 104 ? 54.901 36.872 45.468  1.00 45.05  ? 131  GLY D N   1 
ATOM   4711  C CA  . GLY D  1 104 ? 54.962 38.310 45.576  1.00 47.70  ? 131  GLY D CA  1 
ATOM   4712  C C   . GLY D  1 104 ? 56.344 38.846 45.308  1.00 49.19  ? 131  GLY D C   1 
ATOM   4713  O O   . GLY D  1 104 ? 56.948 38.526 44.280  1.00 50.02  ? 131  GLY D O   1 
ATOM   4714  N N   . LYS D  1 105 ? 56.833 39.669 46.233  1.00 48.91  ? 132  LYS D N   1 
ATOM   4715  C CA  . LYS D  1 105 ? 58.143 40.276 46.105  1.00 47.55  ? 132  LYS D CA  1 
ATOM   4716  C C   . LYS D  1 105 ? 59.265 39.229 46.190  1.00 46.73  ? 132  LYS D C   1 
ATOM   4717  O O   . LYS D  1 105 ? 60.324 39.400 45.599  1.00 47.77  ? 132  LYS D O   1 
ATOM   4718  C CB  . LYS D  1 105 ? 58.310 41.348 47.182  1.00 47.31  ? 132  LYS D CB  1 
ATOM   4719  N N   . GLY D  1 106 ? 59.027 38.134 46.897  1.00 45.02  ? 133  GLY D N   1 
ATOM   4720  C CA  . GLY D  1 106 ? 60.051 37.114 47.022  1.00 45.32  ? 133  GLY D CA  1 
ATOM   4721  C C   . GLY D  1 106 ? 60.989 37.381 48.183  1.00 44.11  ? 133  GLY D C   1 
ATOM   4722  O O   . GLY D  1 106 ? 62.157 36.993 48.164  1.00 44.18  ? 133  GLY D O   1 
ATOM   4723  N N   . ARG D  1 107 ? 60.460 38.043 49.198  1.00 43.01  ? 134  ARG D N   1 
ATOM   4724  C CA  . ARG D  1 107 ? 61.231 38.372 50.373  1.00 43.13  ? 134  ARG D CA  1 
ATOM   4725  C C   . ARG D  1 107 ? 61.983 37.174 50.936  1.00 42.09  ? 134  ARG D C   1 
ATOM   4726  O O   . ARG D  1 107 ? 63.137 37.297 51.354  1.00 42.46  ? 134  ARG D O   1 
ATOM   4727  C CB  . ARG D  1 107 ? 60.297 38.932 51.436  1.00 46.47  ? 134  ARG D CB  1 
ATOM   4728  C CG  . ARG D  1 107 ? 59.288 39.928 50.869  1.00 52.36  ? 134  ARG D CG  1 
ATOM   4729  C CD  . ARG D  1 107 ? 57.855 39.370 50.814  1.00 55.34  ? 134  ARG D CD  1 
ATOM   4730  N NE  . ARG D  1 107 ? 56.978 40.130 49.909  1.00 58.35  ? 134  ARG D NE  1 
ATOM   4731  C CZ  . ARG D  1 107 ? 55.656 39.970 49.829  1.00 59.75  ? 134  ARG D CZ  1 
ATOM   4732  N NH1 . ARG D  1 107 ? 55.046 39.077 50.603  1.00 60.80  ? 134  ARG D NH1 1 
ATOM   4733  N NH2 . ARG D  1 107 ? 54.936 40.695 48.977  1.00 60.12  ? 134  ARG D NH2 1 
ATOM   4734  N N   . SER D  1 108 ? 61.349 36.004 50.918  1.00 39.95  ? 135  SER D N   1 
ATOM   4735  C CA  . SER D  1 108 ? 61.965 34.812 51.492  1.00 36.96  ? 135  SER D CA  1 
ATOM   4736  C C   . SER D  1 108 ? 62.594 33.832 50.506  1.00 33.91  ? 135  SER D C   1 
ATOM   4737  O O   . SER D  1 108 ? 62.963 32.719 50.889  1.00 33.90  ? 135  SER D O   1 
ATOM   4738  C CB  . SER D  1 108 ? 60.936 34.072 52.330  1.00 38.02  ? 135  SER D CB  1 
ATOM   4739  O OG  . SER D  1 108 ? 60.040 33.400 51.473  1.00 41.65  ? 135  SER D OG  1 
ATOM   4740  N N   . TYR D  1 109 ? 62.712 34.230 49.245  1.00 29.97  ? 136  TYR D N   1 
ATOM   4741  C CA  . TYR D  1 109 ? 63.325 33.357 48.254  1.00 27.35  ? 136  TYR D CA  1 
ATOM   4742  C C   . TYR D  1 109 ? 64.696 32.869 48.721  1.00 26.46  ? 136  TYR D C   1 
ATOM   4743  O O   . TYR D  1 109 ? 65.535 33.659 49.142  1.00 28.44  ? 136  TYR D O   1 
ATOM   4744  C CB  . TYR D  1 109 ? 63.493 34.094 46.934  1.00 26.16  ? 136  TYR D CB  1 
ATOM   4745  C CG  . TYR D  1 109 ? 64.249 33.292 45.896  1.00 25.71  ? 136  TYR D CG  1 
ATOM   4746  C CD1 . TYR D  1 109 ? 63.721 32.113 45.387  1.00 25.48  ? 136  TYR D CD1 1 
ATOM   4747  C CD2 . TYR D  1 109 ? 65.487 33.709 45.430  1.00 24.78  ? 136  TYR D CD2 1 
ATOM   4748  C CE1 . TYR D  1 109 ? 64.398 31.376 44.446  1.00 25.28  ? 136  TYR D CE1 1 
ATOM   4749  C CE2 . TYR D  1 109 ? 66.174 32.978 44.492  1.00 25.66  ? 136  TYR D CE2 1 
ATOM   4750  C CZ  . TYR D  1 109 ? 65.627 31.809 43.999  1.00 26.97  ? 136  TYR D CZ  1 
ATOM   4751  O OH  . TYR D  1 109 ? 66.317 31.059 43.065  1.00 29.30  ? 136  TYR D OH  1 
ATOM   4752  N N   . LYS D  1 110 ? 64.926 31.572 48.654  1.00 24.27  ? 137  LYS D N   1 
ATOM   4753  C CA  . LYS D  1 110 ? 66.207 31.042 49.072  1.00 23.96  ? 137  LYS D CA  1 
ATOM   4754  C C   . LYS D  1 110 ? 66.689 30.050 48.038  1.00 23.70  ? 137  LYS D C   1 
ATOM   4755  O O   . LYS D  1 110 ? 67.393 29.094 48.350  1.00 22.33  ? 137  LYS D O   1 
ATOM   4756  C CB  . LYS D  1 110 ? 66.085 30.369 50.433  1.00 25.10  ? 137  LYS D CB  1 
ATOM   4757  C CG  . LYS D  1 110 ? 65.514 31.269 51.491  1.00 27.77  ? 137  LYS D CG  1 
ATOM   4758  C CD  . LYS D  1 110 ? 65.590 30.621 52.867  1.00 34.63  ? 137  LYS D CD  1 
ATOM   4759  C CE  . LYS D  1 110 ? 64.993 31.537 53.938  1.00 35.69  ? 137  LYS D CE  1 
ATOM   4760  N NZ  . LYS D  1 110 ? 65.590 32.915 53.867  1.00 36.01  ? 137  LYS D NZ  1 
ATOM   4761  N N   . GLY D  1 111 ? 66.289 30.282 46.793  1.00 23.56  ? 138  GLY D N   1 
ATOM   4762  C CA  . GLY D  1 111 ? 66.694 29.400 45.718  1.00 22.42  ? 138  GLY D CA  1 
ATOM   4763  C C   . GLY D  1 111 ? 68.148 29.652 45.415  1.00 22.10  ? 138  GLY D C   1 
ATOM   4764  O O   . GLY D  1 111 ? 68.805 30.409 46.119  1.00 23.55  ? 138  GLY D O   1 
ATOM   4765  N N   . THR D  1 112 ? 68.660 29.038 44.364  1.00 20.79  ? 139  THR D N   1 
ATOM   4766  C CA  . THR D  1 112 ? 70.050 29.232 44.037  1.00 18.83  ? 139  THR D CA  1 
ATOM   4767  C C   . THR D  1 112 ? 70.290 29.898 42.697  1.00 19.55  ? 139  THR D C   1 
ATOM   4768  O O   . THR D  1 112 ? 71.382 29.786 42.141  1.00 22.97  ? 139  THR D O   1 
ATOM   4769  C CB  . THR D  1 112 ? 70.787 27.916 44.061  1.00 17.45  ? 139  THR D CB  1 
ATOM   4770  O OG1 . THR D  1 112 ? 70.260 27.070 43.039  1.00 19.26  ? 139  THR D OG1 1 
ATOM   4771  C CG2 . THR D  1 112 ? 70.605 27.253 45.384  1.00 16.64  ? 139  THR D CG2 1 
ATOM   4772  N N   . VAL D  1 113 ? 69.289 30.585 42.161  1.00 17.96  ? 140  VAL D N   1 
ATOM   4773  C CA  . VAL D  1 113 ? 69.499 31.274 40.893  1.00 18.36  ? 140  VAL D CA  1 
ATOM   4774  C C   . VAL D  1 113 ? 70.546 32.384 41.104  1.00 19.09  ? 140  VAL D C   1 
ATOM   4775  O O   . VAL D  1 113 ? 70.432 33.210 42.018  1.00 19.57  ? 140  VAL D O   1 
ATOM   4776  C CB  . VAL D  1 113 ? 68.199 31.909 40.370  1.00 16.95  ? 140  VAL D CB  1 
ATOM   4777  C CG1 . VAL D  1 113 ? 68.535 32.917 39.292  1.00 16.57  ? 140  VAL D CG1 1 
ATOM   4778  C CG2 . VAL D  1 113 ? 67.283 30.846 39.823  1.00 13.44  ? 140  VAL D CG2 1 
ATOM   4779  N N   . SER D  1 114 ? 71.566 32.410 40.261  1.00 19.03  ? 141  SER D N   1 
ATOM   4780  C CA  . SER D  1 114 ? 72.607 33.412 40.415  1.00 20.06  ? 141  SER D CA  1 
ATOM   4781  C C   . SER D  1 114 ? 72.930 34.140 39.108  1.00 20.68  ? 141  SER D C   1 
ATOM   4782  O O   . SER D  1 114 ? 74.079 34.497 38.841  1.00 19.34  ? 141  SER D O   1 
ATOM   4783  C CB  . SER D  1 114 ? 73.867 32.755 40.983  1.00 19.86  ? 141  SER D CB  1 
ATOM   4784  O OG  . SER D  1 114 ? 74.304 31.690 40.150  1.00 17.17  ? 141  SER D OG  1 
ATOM   4785  N N   . ILE D  1 115 ? 71.904 34.348 38.293  1.00 22.67  ? 142  ILE D N   1 
ATOM   4786  C CA  . ILE D  1 115 ? 72.061 35.050 37.023  1.00 24.56  ? 142  ILE D CA  1 
ATOM   4787  C C   . ILE D  1 115 ? 70.992 36.126 36.917  1.00 26.00  ? 142  ILE D C   1 
ATOM   4788  O O   . ILE D  1 115 ? 69.857 35.927 37.359  1.00 26.94  ? 142  ILE D O   1 
ATOM   4789  C CB  . ILE D  1 115 ? 71.926 34.084 35.809  1.00 24.90  ? 142  ILE D CB  1 
ATOM   4790  C CG1 . ILE D  1 115 ? 73.281 33.486 35.454  1.00 23.31  ? 142  ILE D CG1 1 
ATOM   4791  C CG2 . ILE D  1 115 ? 71.416 34.820 34.594  1.00 25.00  ? 142  ILE D CG2 1 
ATOM   4792  C CD1 . ILE D  1 115 ? 73.763 32.453 36.412  1.00 24.97  ? 142  ILE D CD1 1 
ATOM   4793  N N   . THR D  1 116 ? 71.358 37.266 36.341  1.00 27.43  ? 143  THR D N   1 
ATOM   4794  C CA  . THR D  1 116 ? 70.401 38.358 36.162  1.00 30.27  ? 143  THR D CA  1 
ATOM   4795  C C   . THR D  1 116 ? 69.504 38.122 34.937  1.00 31.74  ? 143  THR D C   1 
ATOM   4796  O O   . THR D  1 116 ? 69.762 37.217 34.122  1.00 31.02  ? 143  THR D O   1 
ATOM   4797  C CB  . THR D  1 116 ? 71.113 39.709 35.982  1.00 28.04  ? 143  THR D CB  1 
ATOM   4798  O OG1 . THR D  1 116 ? 72.012 39.636 34.870  1.00 27.79  ? 143  THR D OG1 1 
ATOM   4799  C CG2 . THR D  1 116 ? 71.891 40.049 37.214  1.00 30.62  ? 143  THR D CG2 1 
ATOM   4800  N N   . LYS D  1 117 ? 68.449 38.930 34.826  1.00 32.99  ? 144  LYS D N   1 
ATOM   4801  C CA  . LYS D  1 117 ? 67.526 38.848 33.697  1.00 34.40  ? 144  LYS D CA  1 
ATOM   4802  C C   . LYS D  1 117 ? 68.304 38.913 32.372  1.00 34.48  ? 144  LYS D C   1 
ATOM   4803  O O   . LYS D  1 117 ? 67.941 38.241 31.414  1.00 35.58  ? 144  LYS D O   1 
ATOM   4804  C CB  . LYS D  1 117 ? 66.528 39.997 33.775  1.00 36.79  ? 144  LYS D CB  1 
ATOM   4805  C CG  . LYS D  1 117 ? 65.389 39.905 32.793  1.00 42.14  ? 144  LYS D CG  1 
ATOM   4806  C CD  . LYS D  1 117 ? 64.271 40.894 33.151  1.00 46.36  ? 144  LYS D CD  1 
ATOM   4807  C CE  . LYS D  1 117 ? 63.039 40.707 32.253  1.00 47.86  ? 144  LYS D CE  1 
ATOM   4808  N NZ  . LYS D  1 117 ? 63.327 40.924 30.794  1.00 49.51  ? 144  LYS D NZ  1 
ATOM   4809  N N   . SER D  1 118 ? 69.383 39.707 32.346  1.00 34.34  ? 145  SER D N   1 
ATOM   4810  C CA  . SER D  1 118 ? 70.248 39.897 31.182  1.00 32.60  ? 145  SER D CA  1 
ATOM   4811  C C   . SER D  1 118 ? 71.286 38.808 31.033  1.00 31.37  ? 145  SER D C   1 
ATOM   4812  O O   . SER D  1 118 ? 72.132 38.863 30.145  1.00 31.65  ? 145  SER D O   1 
ATOM   4813  C CB  . SER D  1 118 ? 70.970 41.233 31.275  1.00 34.96  ? 145  SER D CB  1 
ATOM   4814  O OG  . SER D  1 118 ? 70.042 42.297 31.326  1.00 39.71  ? 145  SER D OG  1 
ATOM   4815  N N   . GLY D  1 119 ? 71.240 37.823 31.913  1.00 30.66  ? 146  GLY D N   1 
ATOM   4816  C CA  . GLY D  1 119 ? 72.192 36.731 31.823  1.00 31.75  ? 146  GLY D CA  1 
ATOM   4817  C C   . GLY D  1 119 ? 73.555 37.010 32.425  1.00 31.48  ? 146  GLY D C   1 
ATOM   4818  O O   . GLY D  1 119 ? 74.522 36.306 32.137  1.00 33.01  ? 146  GLY D O   1 
ATOM   4819  N N   . ILE D  1 120 ? 73.644 38.035 33.262  1.00 30.04  ? 147  ILE D N   1 
ATOM   4820  C CA  . ILE D  1 120 ? 74.910 38.365 33.895  1.00 28.90  ? 147  ILE D CA  1 
ATOM   4821  C C   . ILE D  1 120 ? 75.051 37.557 35.185  1.00 28.39  ? 147  ILE D C   1 
ATOM   4822  O O   . ILE D  1 120 ? 74.094 37.442 35.970  1.00 27.36  ? 147  ILE D O   1 
ATOM   4823  C CB  . ILE D  1 120 ? 74.992 39.853 34.265  1.00 30.26  ? 147  ILE D CB  1 
ATOM   4824  C CG1 . ILE D  1 120 ? 74.568 40.719 33.078  1.00 29.97  ? 147  ILE D CG1 1 
ATOM   4825  C CG2 . ILE D  1 120 ? 76.419 40.202 34.703  1.00 29.70  ? 147  ILE D CG2 1 
ATOM   4826  C CD1 . ILE D  1 120 ? 74.353 42.180 33.452  1.00 29.19  ? 147  ILE D CD1 1 
ATOM   4827  N N   . LYS D  1 121 ? 76.246 37.006 35.394  1.00 25.42  ? 148  LYS D N   1 
ATOM   4828  C CA  . LYS D  1 121 ? 76.538 36.213 36.574  1.00 23.20  ? 148  LYS D CA  1 
ATOM   4829  C C   . LYS D  1 121 ? 76.551 37.157 37.755  1.00 24.56  ? 148  LYS D C   1 
ATOM   4830  O O   . LYS D  1 121 ? 77.163 38.211 37.694  1.00 25.95  ? 148  LYS D O   1 
ATOM   4831  C CB  . LYS D  1 121 ? 77.900 35.549 36.423  1.00 20.01  ? 148  LYS D CB  1 
ATOM   4832  C CG  . LYS D  1 121 ? 78.254 34.608 37.523  1.00 17.90  ? 148  LYS D CG  1 
ATOM   4833  C CD  . LYS D  1 121 ? 79.633 34.020 37.308  1.00 18.40  ? 148  LYS D CD  1 
ATOM   4834  C CE  . LYS D  1 121 ? 79.920 32.925 38.358  1.00 20.45  ? 148  LYS D CE  1 
ATOM   4835  N NZ  . LYS D  1 121 ? 81.330 32.426 38.378  1.00 21.07  ? 148  LYS D NZ  1 
ATOM   4836  N N   . CYS D  1 122 ? 75.867 36.795 38.828  1.00 25.35  ? 149  CYS D N   1 
ATOM   4837  C CA  . CYS D  1 122 ? 75.828 37.655 39.994  1.00 25.52  ? 149  CYS D CA  1 
ATOM   4838  C C   . CYS D  1 122 ? 77.188 37.766 40.638  1.00 26.37  ? 149  CYS D C   1 
ATOM   4839  O O   . CYS D  1 122 ? 78.048 36.902 40.451  1.00 25.78  ? 149  CYS D O   1 
ATOM   4840  C CB  . CYS D  1 122 ? 74.865 37.105 41.034  1.00 25.21  ? 149  CYS D CB  1 
ATOM   4841  S SG  . CYS D  1 122 ? 73.122 37.268 40.612  1.00 28.22  ? 149  CYS D SG  1 
ATOM   4842  N N   . GLN D  1 123 ? 77.369 38.845 41.397  1.00 27.29  ? 150  GLN D N   1 
ATOM   4843  C CA  . GLN D  1 123 ? 78.594 39.083 42.154  1.00 26.35  ? 150  GLN D CA  1 
ATOM   4844  C C   . GLN D  1 123 ? 78.320 38.539 43.554  1.00 25.86  ? 150  GLN D C   1 
ATOM   4845  O O   . GLN D  1 123 ? 77.202 38.658 44.058  1.00 25.57  ? 150  GLN D O   1 
ATOM   4846  C CB  . GLN D  1 123 ? 78.892 40.578 42.269  1.00 26.41  ? 150  GLN D CB  1 
ATOM   4847  C CG  . GLN D  1 123 ? 79.990 40.902 43.300  1.00 26.86  ? 150  GLN D CG  1 
ATOM   4848  C CD  . GLN D  1 123 ? 80.092 42.379 43.620  1.00 26.99  ? 150  GLN D CD  1 
ATOM   4849  O OE1 . GLN D  1 123 ? 80.141 43.227 42.726  1.00 27.08  ? 150  GLN D OE1 1 
ATOM   4850  N NE2 . GLN D  1 123 ? 80.132 42.695 44.904  1.00 29.29  ? 150  GLN D NE2 1 
ATOM   4851  N N   . PRO D  1 124 ? 79.329 37.936 44.198  1.00 25.26  ? 151  PRO D N   1 
ATOM   4852  C CA  . PRO D  1 124 ? 79.139 37.394 45.546  1.00 24.49  ? 151  PRO D CA  1 
ATOM   4853  C C   . PRO D  1 124 ? 78.794 38.536 46.492  1.00 24.86  ? 151  PRO D C   1 
ATOM   4854  O O   . PRO D  1 124 ? 79.336 39.629 46.355  1.00 24.71  ? 151  PRO D O   1 
ATOM   4855  C CB  . PRO D  1 124 ? 80.497 36.795 45.867  1.00 23.91  ? 151  PRO D CB  1 
ATOM   4856  C CG  . PRO D  1 124 ? 81.047 36.457 44.525  1.00 23.36  ? 151  PRO D CG  1 
ATOM   4857  C CD  . PRO D  1 124 ? 80.692 37.667 43.723  1.00 23.63  ? 151  PRO D CD  1 
ATOM   4858  N N   . TRP D  1 125 ? 77.897 38.296 47.442  1.00 24.68  ? 152  TRP D N   1 
ATOM   4859  C CA  . TRP D  1 125 ? 77.517 39.349 48.371  1.00 24.10  ? 152  TRP D CA  1 
ATOM   4860  C C   . TRP D  1 125 ? 78.668 39.727 49.310  1.00 24.00  ? 152  TRP D C   1 
ATOM   4861  O O   . TRP D  1 125 ? 78.802 40.872 49.730  1.00 24.03  ? 152  TRP D O   1 
ATOM   4862  C CB  . TRP D  1 125 ? 76.312 38.909 49.199  1.00 23.53  ? 152  TRP D CB  1 
ATOM   4863  C CG  . TRP D  1 125 ? 75.095 38.658 48.407  1.00 23.93  ? 152  TRP D CG  1 
ATOM   4864  C CD1 . TRP D  1 125 ? 74.676 37.467 47.914  1.00 24.68  ? 152  TRP D CD1 1 
ATOM   4865  C CD2 . TRP D  1 125 ? 74.126 39.629 48.001  1.00 23.47  ? 152  TRP D CD2 1 
ATOM   4866  N NE1 . TRP D  1 125 ? 73.498 37.629 47.221  1.00 23.97  ? 152  TRP D NE1 1 
ATOM   4867  C CE2 . TRP D  1 125 ? 73.142 38.947 47.256  1.00 21.19  ? 152  TRP D CE2 1 
ATOM   4868  C CE3 . TRP D  1 125 ? 74.001 41.009 48.185  1.00 23.34  ? 152  TRP D CE3 1 
ATOM   4869  C CZ2 . TRP D  1 125 ? 72.042 39.590 46.706  1.00 20.63  ? 152  TRP D CZ2 1 
ATOM   4870  C CZ3 . TRP D  1 125 ? 72.904 41.652 47.633  1.00 24.98  ? 152  TRP D CZ3 1 
ATOM   4871  C CH2 . TRP D  1 125 ? 71.936 40.937 46.896  1.00 23.26  ? 152  TRP D CH2 1 
ATOM   4872  N N   . SER D  1 126 ? 79.497 38.752 49.645  1.00 23.80  ? 153  SER D N   1 
ATOM   4873  C CA  . SER D  1 126 ? 80.606 38.990 50.543  1.00 23.84  ? 153  SER D CA  1 
ATOM   4874  C C   . SER D  1 126 ? 81.683 39.813 49.873  1.00 25.55  ? 153  SER D C   1 
ATOM   4875  O O   . SER D  1 126 ? 82.559 40.341 50.540  1.00 27.75  ? 153  SER D O   1 
ATOM   4876  C CB  . SER D  1 126 ? 81.228 37.678 50.961  1.00 22.56  ? 153  SER D CB  1 
ATOM   4877  O OG  . SER D  1 126 ? 82.019 37.190 49.894  1.00 22.06  ? 153  SER D OG  1 
ATOM   4878  N N   . SER D  1 127 ? 81.636 39.907 48.553  1.00 26.62  ? 154  SER D N   1 
ATOM   4879  C CA  . SER D  1 127 ? 82.641 40.654 47.819  1.00 26.79  ? 154  SER D CA  1 
ATOM   4880  C C   . SER D  1 127 ? 82.276 42.117 47.652  1.00 27.78  ? 154  SER D C   1 
ATOM   4881  O O   . SER D  1 127 ? 81.107 42.477 47.616  1.00 26.23  ? 154  SER D O   1 
ATOM   4882  C CB  . SER D  1 127 ? 82.862 40.020 46.451  1.00 26.70  ? 154  SER D CB  1 
ATOM   4883  O OG  . SER D  1 127 ? 83.773 40.787 45.690  1.00 30.20  ? 154  SER D OG  1 
ATOM   4884  N N   . MET D  1 128 ? 83.297 42.963 47.562  1.00 31.31  ? 155  MET D N   1 
ATOM   4885  C CA  . MET D  1 128 ? 83.091 44.397 47.381  1.00 33.60  ? 155  MET D CA  1 
ATOM   4886  C C   . MET D  1 128 ? 83.520 44.799 45.983  1.00 34.17  ? 155  MET D C   1 
ATOM   4887  O O   . MET D  1 128 ? 83.558 45.977 45.658  1.00 36.10  ? 155  MET D O   1 
ATOM   4888  C CB  . MET D  1 128 ? 83.887 45.211 48.416  1.00 33.97  ? 155  MET D CB  1 
ATOM   4889  C CG  . MET D  1 128 ? 83.359 45.134 49.847  1.00 32.13  ? 155  MET D CG  1 
ATOM   4890  S SD  . MET D  1 128 ? 81.696 45.807 50.026  1.00 32.11  ? 155  MET D SD  1 
ATOM   4891  C CE  . MET D  1 128 ? 80.912 44.471 50.870  1.00 31.48  ? 155  MET D CE  1 
ATOM   4892  N N   . ILE D  1 129 ? 83.855 43.814 45.165  1.00 34.25  ? 156  ILE D N   1 
ATOM   4893  C CA  . ILE D  1 129 ? 84.258 44.078 43.802  1.00 36.55  ? 156  ILE D CA  1 
ATOM   4894  C C   . ILE D  1 129 ? 83.500 43.142 42.886  1.00 37.21  ? 156  ILE D C   1 
ATOM   4895  O O   . ILE D  1 129 ? 83.220 41.995 43.234  1.00 37.02  ? 156  ILE D O   1 
ATOM   4896  C CB  . ILE D  1 129 ? 85.767 43.855 43.601  1.00 37.91  ? 156  ILE D CB  1 
ATOM   4897  C CG1 . ILE D  1 129 ? 86.124 42.408 43.942  1.00 38.43  ? 156  ILE D CG1 1 
ATOM   4898  C CG2 . ILE D  1 129 ? 86.556 44.831 44.470  1.00 39.36  ? 156  ILE D CG2 1 
ATOM   4899  C CD1 . ILE D  1 129 ? 87.604 42.108 43.917  1.00 38.28  ? 156  ILE D CD1 1 
ATOM   4900  N N   . PRO D  1 130 ? 83.165 43.618 41.689  1.00 38.22  ? 157  PRO D N   1 
ATOM   4901  C CA  . PRO D  1 130 ? 83.484 44.962 41.220  1.00 38.41  ? 157  PRO D CA  1 
ATOM   4902  C C   . PRO D  1 130 ? 82.628 46.051 41.850  1.00 38.60  ? 157  PRO D C   1 
ATOM   4903  O O   . PRO D  1 130 ? 82.861 47.230 41.619  1.00 39.71  ? 157  PRO D O   1 
ATOM   4904  C CB  . PRO D  1 130 ? 83.237 44.850 39.726  1.00 39.07  ? 157  PRO D CB  1 
ATOM   4905  C CG  . PRO D  1 130 ? 82.026 43.996 39.690  1.00 38.74  ? 157  PRO D CG  1 
ATOM   4906  C CD  . PRO D  1 130 ? 82.392 42.887 40.670  1.00 38.77  ? 157  PRO D CD  1 
ATOM   4907  N N   . HIS D  1 131 ? 81.639 45.677 42.643  1.00 38.85  ? 158  HIS D N   1 
ATOM   4908  C CA  . HIS D  1 131 ? 80.778 46.687 43.226  1.00 39.21  ? 158  HIS D CA  1 
ATOM   4909  C C   . HIS D  1 131 ? 80.806 46.712 44.737  1.00 39.81  ? 158  HIS D C   1 
ATOM   4910  O O   . HIS D  1 131 ? 80.601 45.698 45.404  1.00 40.90  ? 158  HIS D O   1 
ATOM   4911  C CB  . HIS D  1 131 ? 79.358 46.484 42.728  1.00 40.31  ? 158  HIS D CB  1 
ATOM   4912  C CG  . HIS D  1 131 ? 79.258 46.424 41.239  1.00 42.09  ? 158  HIS D CG  1 
ATOM   4913  N ND1 . HIS D  1 131 ? 79.443 47.529 40.435  1.00 42.29  ? 158  HIS D ND1 1 
ATOM   4914  C CD2 . HIS D  1 131 ? 79.043 45.382 40.403  1.00 43.16  ? 158  HIS D CD2 1 
ATOM   4915  C CE1 . HIS D  1 131 ? 79.347 47.169 39.168  1.00 43.03  ? 158  HIS D CE1 1 
ATOM   4916  N NE2 . HIS D  1 131 ? 79.105 45.872 39.121  1.00 44.47  ? 158  HIS D NE2 1 
ATOM   4917  N N   . GLU D  1 132 ? 81.067 47.896 45.271  1.00 39.56  ? 159  GLU D N   1 
ATOM   4918  C CA  . GLU D  1 132 ? 81.139 48.096 46.704  1.00 38.22  ? 159  GLU D CA  1 
ATOM   4919  C C   . GLU D  1 132 ? 79.711 48.290 47.180  1.00 38.07  ? 159  GLU D C   1 
ATOM   4920  O O   . GLU D  1 132 ? 78.910 48.972 46.529  1.00 37.88  ? 159  GLU D O   1 
ATOM   4921  C CB  . GLU D  1 132 ? 81.990 49.325 46.973  1.00 39.59  ? 159  GLU D CB  1 
ATOM   4922  C CG  . GLU D  1 132 ? 82.341 49.571 48.414  1.00 42.60  ? 159  GLU D CG  1 
ATOM   4923  C CD  . GLU D  1 132 ? 83.615 50.376 48.537  1.00 43.97  ? 159  GLU D CD  1 
ATOM   4924  O OE1 . GLU D  1 132 ? 83.798 51.308 47.710  1.00 46.04  ? 159  GLU D OE1 1 
ATOM   4925  O OE2 . GLU D  1 132 ? 84.422 50.075 49.449  1.00 42.09  ? 159  GLU D OE2 1 
ATOM   4926  N N   . HIS D  1 133 ? 79.375 47.695 48.310  1.00 36.53  ? 160  HIS D N   1 
ATOM   4927  C CA  . HIS D  1 133 ? 78.009 47.819 48.768  1.00 37.19  ? 160  HIS D CA  1 
ATOM   4928  C C   . HIS D  1 133 ? 77.867 47.544 50.243  1.00 39.17  ? 160  HIS D C   1 
ATOM   4929  O O   . HIS D  1 133 ? 78.807 47.051 50.891  1.00 39.54  ? 160  HIS D O   1 
ATOM   4930  C CB  . HIS D  1 133 ? 77.125 46.854 47.983  1.00 34.64  ? 160  HIS D CB  1 
ATOM   4931  C CG  . HIS D  1 133 ? 77.466 45.419 48.215  1.00 31.60  ? 160  HIS D CG  1 
ATOM   4932  N ND1 . HIS D  1 133 ? 76.934 44.687 49.256  1.00 29.89  ? 160  HIS D ND1 1 
ATOM   4933  C CD2 . HIS D  1 133 ? 78.347 44.601 47.593  1.00 30.16  ? 160  HIS D CD2 1 
ATOM   4934  C CE1 . HIS D  1 133 ? 77.475 43.484 49.266  1.00 28.83  ? 160  HIS D CE1 1 
ATOM   4935  N NE2 . HIS D  1 133 ? 78.336 43.406 48.267  1.00 29.17  ? 160  HIS D NE2 1 
ATOM   4936  N N   . SER D  1 134 ? 76.663 47.852 50.741  1.00 40.54  ? 161  SER D N   1 
ATOM   4937  C CA  . SER D  1 134 ? 76.312 47.697 52.153  1.00 41.66  ? 161  SER D CA  1 
ATOM   4938  C C   . SER D  1 134 ? 75.565 46.407 52.461  1.00 40.30  ? 161  SER D C   1 
ATOM   4939  O O   . SER D  1 134 ? 75.329 46.100 53.634  1.00 41.00  ? 161  SER D O   1 
ATOM   4940  C CB  . SER D  1 134 ? 75.463 48.882 52.628  1.00 43.46  ? 161  SER D CB  1 
ATOM   4941  O OG  . SER D  1 134 ? 74.118 48.740 52.192  1.00 47.57  ? 161  SER D OG  1 
ATOM   4942  N N   . PHE D  1 135 ? 75.189 45.658 51.424  1.00 36.99  ? 162  PHE D N   1 
ATOM   4943  C CA  . PHE D  1 135 ? 74.487 44.401 51.636  1.00 34.29  ? 162  PHE D CA  1 
ATOM   4944  C C   . PHE D  1 135 ? 75.366 43.185 51.974  1.00 34.83  ? 162  PHE D C   1 
ATOM   4945  O O   . PHE D  1 135 ? 75.341 42.183 51.272  1.00 36.28  ? 162  PHE D O   1 
ATOM   4946  C CB  . PHE D  1 135 ? 73.637 44.053 50.427  1.00 30.44  ? 162  PHE D CB  1 
ATOM   4947  C CG  . PHE D  1 135 ? 72.507 44.986 50.199  1.00 27.54  ? 162  PHE D CG  1 
ATOM   4948  C CD1 . PHE D  1 135 ? 72.642 46.057 49.336  1.00 26.11  ? 162  PHE D CD1 1 
ATOM   4949  C CD2 . PHE D  1 135 ? 71.291 44.782 50.831  1.00 26.42  ? 162  PHE D CD2 1 
ATOM   4950  C CE1 . PHE D  1 135 ? 71.575 46.914 49.102  1.00 25.89  ? 162  PHE D CE1 1 
ATOM   4951  C CE2 . PHE D  1 135 ? 70.214 45.635 50.606  1.00 25.66  ? 162  PHE D CE2 1 
ATOM   4952  C CZ  . PHE D  1 135 ? 70.353 46.700 49.743  1.00 25.80  ? 162  PHE D CZ  1 
ATOM   4953  N N   . LEU D  1 136 ? 76.142 43.254 53.044  1.00 34.53  ? 163  LEU D N   1 
ATOM   4954  C CA  . LEU D  1 136 ? 76.935 42.097 53.418  1.00 34.99  ? 163  LEU D CA  1 
ATOM   4955  C C   . LEU D  1 136 ? 76.027 41.185 54.223  1.00 35.03  ? 163  LEU D C   1 
ATOM   4956  O O   . LEU D  1 136 ? 74.955 41.595 54.682  1.00 34.93  ? 163  LEU D O   1 
ATOM   4957  C CB  . LEU D  1 136 ? 78.117 42.494 54.307  1.00 37.11  ? 163  LEU D CB  1 
ATOM   4958  C CG  . LEU D  1 136 ? 79.329 43.167 53.658  1.00 39.33  ? 163  LEU D CG  1 
ATOM   4959  C CD1 . LEU D  1 136 ? 80.241 43.718 54.746  1.00 40.52  ? 163  LEU D CD1 1 
ATOM   4960  C CD2 . LEU D  1 136 ? 80.077 42.166 52.786  1.00 39.13  ? 163  LEU D CD2 1 
ATOM   4961  N N   . PRO D  1 137 ? 76.429 39.918 54.383  1.00 34.42  ? 164  PRO D N   1 
ATOM   4962  C CA  . PRO D  1 137 ? 75.624 38.981 55.159  1.00 32.87  ? 164  PRO D CA  1 
ATOM   4963  C C   . PRO D  1 137 ? 75.461 39.531 56.581  1.00 32.05  ? 164  PRO D C   1 
ATOM   4964  O O   . PRO D  1 137 ? 74.406 39.412 57.196  1.00 31.72  ? 164  PRO D O   1 
ATOM   4965  C CB  . PRO D  1 137 ? 76.470 37.718 55.116  1.00 30.68  ? 164  PRO D CB  1 
ATOM   4966  C CG  . PRO D  1 137 ? 77.002 37.758 53.762  1.00 30.66  ? 164  PRO D CG  1 
ATOM   4967  C CD  . PRO D  1 137 ? 77.449 39.192 53.609  1.00 33.05  ? 164  PRO D CD  1 
ATOM   4968  N N   . SER D  1 138 ? 76.523 40.142 57.086  1.00 32.64  ? 165  SER D N   1 
ATOM   4969  C CA  . SER D  1 138 ? 76.536 40.710 58.429  1.00 34.19  ? 165  SER D CA  1 
ATOM   4970  C C   . SER D  1 138 ? 75.473 41.776 58.617  1.00 33.85  ? 165  SER D C   1 
ATOM   4971  O O   . SER D  1 138 ? 74.975 41.982 59.722  1.00 35.16  ? 165  SER D O   1 
ATOM   4972  C CB  . SER D  1 138 ? 77.894 41.336 58.714  1.00 35.23  ? 165  SER D CB  1 
ATOM   4973  O OG  . SER D  1 138 ? 78.908 40.663 57.995  1.00 39.76  ? 165  SER D OG  1 
ATOM   4974  N N   . SER D  1 139 ? 75.131 42.459 57.536  1.00 33.40  ? 166  SER D N   1 
ATOM   4975  C CA  . SER D  1 139 ? 74.145 43.522 57.597  1.00 33.35  ? 166  SER D CA  1 
ATOM   4976  C C   . SER D  1 139 ? 72.717 43.051 57.387  1.00 34.61  ? 166  SER D C   1 
ATOM   4977  O O   . SER D  1 139 ? 71.809 43.874 57.384  1.00 34.91  ? 166  SER D O   1 
ATOM   4978  C CB  . SER D  1 139 ? 74.475 44.587 56.551  1.00 33.34  ? 166  SER D CB  1 
ATOM   4979  O OG  . SER D  1 139 ? 75.777 45.118 56.751  1.00 33.13  ? 166  SER D OG  1 
ATOM   4980  N N   . TYR D  1 140 ? 72.507 41.742 57.213  1.00 35.74  ? 167  TYR D N   1 
ATOM   4981  C CA  . TYR D  1 140 ? 71.162 41.219 56.974  1.00 34.59  ? 167  TYR D CA  1 
ATOM   4982  C C   . TYR D  1 140 ? 70.776 39.790 57.418  1.00 36.79  ? 167  TYR D C   1 
ATOM   4983  O O   . TYR D  1 140 ? 69.866 39.206 56.818  1.00 39.04  ? 167  TYR D O   1 
ATOM   4984  C CB  . TYR D  1 140 ? 70.846 41.358 55.496  1.00 30.72  ? 167  TYR D CB  1 
ATOM   4985  C CG  . TYR D  1 140 ? 70.572 42.761 55.039  1.00 29.53  ? 167  TYR D CG  1 
ATOM   4986  C CD1 . TYR D  1 140 ? 69.289 43.287 55.070  1.00 28.56  ? 167  TYR D CD1 1 
ATOM   4987  C CD2 . TYR D  1 140 ? 71.596 43.559 54.541  1.00 31.07  ? 167  TYR D CD2 1 
ATOM   4988  C CE1 . TYR D  1 140 ? 69.026 44.578 54.610  1.00 29.24  ? 167  TYR D CE1 1 
ATOM   4989  C CE2 . TYR D  1 140 ? 71.345 44.849 54.082  1.00 31.73  ? 167  TYR D CE2 1 
ATOM   4990  C CZ  . TYR D  1 140 ? 70.058 45.350 54.117  1.00 30.05  ? 167  TYR D CZ  1 
ATOM   4991  O OH  . TYR D  1 140 ? 69.820 46.612 53.632  1.00 30.32  ? 167  TYR D OH  1 
ATOM   4992  N N   . ARG D  1 141 ? 71.420 39.235 58.453  1.00 36.75  ? 168  ARG D N   1 
ATOM   4993  C CA  . ARG D  1 141 ? 71.104 37.877 58.954  1.00 36.30  ? 168  ARG D CA  1 
ATOM   4994  C C   . ARG D  1 141 ? 69.614 37.436 58.785  1.00 35.65  ? 168  ARG D C   1 
ATOM   4995  O O   . ARG D  1 141 ? 68.701 38.185 59.177  1.00 34.29  ? 168  ARG D O   1 
ATOM   4996  C CB  . ARG D  1 141 ? 71.514 37.787 60.422  1.00 37.04  ? 168  ARG D CB  1 
ATOM   4997  N N   . GLY D  1 142 ? 69.400 36.233 58.208  1.00 34.93  ? 169  GLY D N   1 
ATOM   4998  C CA  . GLY D  1 142 ? 68.071 35.662 57.945  1.00 34.40  ? 169  GLY D CA  1 
ATOM   4999  C C   . GLY D  1 142 ? 67.669 35.741 56.480  1.00 32.85  ? 169  GLY D C   1 
ATOM   5000  O O   . GLY D  1 142 ? 66.935 34.883 55.955  1.00 34.28  ? 169  GLY D O   1 
ATOM   5001  N N   . LYS D  1 143 ? 68.160 36.802 55.840  1.00 30.49  ? 170  LYS D N   1 
ATOM   5002  C CA  . LYS D  1 143 ? 67.914 37.055 54.432  1.00 29.03  ? 170  LYS D CA  1 
ATOM   5003  C C   . LYS D  1 143 ? 68.850 36.221 53.529  1.00 27.18  ? 170  LYS D C   1 
ATOM   5004  O O   . LYS D  1 143 ? 69.030 36.531 52.359  1.00 26.58  ? 170  LYS D O   1 
ATOM   5005  C CB  . LYS D  1 143 ? 68.067 38.542 54.148  1.00 28.36  ? 170  LYS D CB  1 
ATOM   5006  N N   . ASP D  1 144 ? 69.424 35.160 54.091  1.00 25.52  ? 171  ASP D N   1 
ATOM   5007  C CA  . ASP D  1 144 ? 70.314 34.244 53.378  1.00 25.56  ? 171  ASP D CA  1 
ATOM   5008  C C   . ASP D  1 144 ? 71.081 34.856 52.223  1.00 23.78  ? 171  ASP D C   1 
ATOM   5009  O O   . ASP D  1 144 ? 70.865 34.503 51.073  1.00 25.15  ? 171  ASP D O   1 
ATOM   5010  C CB  . ASP D  1 144 ? 69.516 33.027 52.877  1.00 29.35  ? 171  ASP D CB  1 
ATOM   5011  C CG  . ASP D  1 144 ? 70.385 32.009 52.148  1.00 31.12  ? 171  ASP D CG  1 
ATOM   5012  O OD1 . ASP D  1 144 ? 71.564 31.863 52.528  1.00 33.00  ? 171  ASP D OD1 1 
ATOM   5013  O OD2 . ASP D  1 144 ? 69.883 31.349 51.208  1.00 31.73  ? 171  ASP D OD2 1 
ATOM   5014  N N   . LEU D  1 145 ? 71.977 35.780 52.531  1.00 23.06  ? 172  LEU D N   1 
ATOM   5015  C CA  . LEU D  1 145 ? 72.788 36.430 51.507  1.00 21.98  ? 172  LEU D CA  1 
ATOM   5016  C C   . LEU D  1 145 ? 74.089 35.664 51.368  1.00 21.26  ? 172  LEU D C   1 
ATOM   5017  O O   . LEU D  1 145 ? 75.156 36.173 51.709  1.00 21.38  ? 172  LEU D O   1 
ATOM   5018  C CB  . LEU D  1 145 ? 73.073 37.885 51.889  1.00 22.41  ? 172  LEU D CB  1 
ATOM   5019  C CG  . LEU D  1 145 ? 71.889 38.834 51.707  1.00 21.44  ? 172  LEU D CG  1 
ATOM   5020  C CD1 . LEU D  1 145 ? 72.236 40.214 52.202  1.00 20.16  ? 172  LEU D CD1 1 
ATOM   5021  C CD2 . LEU D  1 145 ? 71.529 38.869 50.241  1.00 21.38  ? 172  LEU D CD2 1 
ATOM   5022  N N   . GLN D  1 146 ? 73.974 34.426 50.876  1.00 20.34  ? 173  GLN D N   1 
ATOM   5023  C CA  . GLN D  1 146 ? 75.097 33.509 50.660  1.00 17.15  ? 173  GLN D CA  1 
ATOM   5024  C C   . GLN D  1 146 ? 75.581 33.577 49.223  1.00 16.16  ? 173  GLN D C   1 
ATOM   5025  O O   . GLN D  1 146 ? 74.941 34.189 48.382  1.00 14.31  ? 173  GLN D O   1 
ATOM   5026  C CB  . GLN D  1 146 ? 74.663 32.091 50.983  1.00 15.25  ? 173  GLN D CB  1 
ATOM   5027  N N   . GLU D  1 147 ? 76.720 32.951 48.954  1.00 18.61  ? 174  GLU D N   1 
ATOM   5028  C CA  . GLU D  1 147 ? 77.291 32.902 47.612  1.00 21.67  ? 174  GLU D CA  1 
ATOM   5029  C C   . GLU D  1 147 ? 76.956 34.151 46.815  1.00 22.70  ? 174  GLU D C   1 
ATOM   5030  O O   . GLU D  1 147 ? 77.277 35.270 47.226  1.00 23.73  ? 174  GLU D O   1 
ATOM   5031  C CB  . GLU D  1 147 ? 76.760 31.673 46.879  1.00 24.20  ? 174  GLU D CB  1 
ATOM   5032  C CG  . GLU D  1 147 ? 77.087 30.370 47.556  1.00 27.84  ? 174  GLU D CG  1 
ATOM   5033  C CD  . GLU D  1 147 ? 78.567 30.215 47.779  1.00 31.94  ? 174  GLU D CD  1 
ATOM   5034  O OE1 . GLU D  1 147 ? 79.344 30.453 46.830  1.00 35.75  ? 174  GLU D OE1 1 
ATOM   5035  O OE2 . GLU D  1 147 ? 78.962 29.851 48.904  1.00 35.71  ? 174  GLU D OE2 1 
ATOM   5036  N N   . ASN D  1 148 ? 76.309 33.962 45.672  1.00 21.57  ? 175  ASN D N   1 
ATOM   5037  C CA  . ASN D  1 148 ? 75.929 35.092 44.842  1.00 22.12  ? 175  ASN D CA  1 
ATOM   5038  C C   . ASN D  1 148 ? 74.505 34.872 44.354  1.00 21.43  ? 175  ASN D C   1 
ATOM   5039  O O   . ASN D  1 148 ? 74.158 35.178 43.213  1.00 20.57  ? 175  ASN D O   1 
ATOM   5040  C CB  . ASN D  1 148 ? 76.901 35.234 43.665  1.00 21.64  ? 175  ASN D CB  1 
ATOM   5041  C CG  . ASN D  1 148 ? 76.784 34.095 42.672  1.00 23.05  ? 175  ASN D CG  1 
ATOM   5042  O OD1 . ASN D  1 148 ? 76.574 32.943 43.051  1.00 22.13  ? 175  ASN D OD1 1 
ATOM   5043  N ND2 . ASN D  1 148 ? 76.941 34.410 41.389  1.00 25.28  ? 175  ASN D ND2 1 
ATOM   5044  N N   . TYR D  1 149 ? 73.678 34.341 45.241  1.00 21.59  ? 176  TYR D N   1 
ATOM   5045  C CA  . TYR D  1 149 ? 72.294 34.067 44.901  1.00 23.50  ? 176  TYR D CA  1 
ATOM   5046  C C   . TYR D  1 149 ? 71.467 35.334 44.805  1.00 24.51  ? 176  TYR D C   1 
ATOM   5047  O O   . TYR D  1 149 ? 71.723 36.313 45.500  1.00 24.70  ? 176  TYR D O   1 
ATOM   5048  C CB  . TYR D  1 149 ? 71.665 33.162 45.951  1.00 22.47  ? 176  TYR D CB  1 
ATOM   5049  C CG  . TYR D  1 149 ? 72.422 31.887 46.189  1.00 22.00  ? 176  TYR D CG  1 
ATOM   5050  C CD1 . TYR D  1 149 ? 72.752 31.040 45.127  1.00 20.52  ? 176  TYR D CD1 1 
ATOM   5051  C CD2 . TYR D  1 149 ? 72.779 31.502 47.477  1.00 21.62  ? 176  TYR D CD2 1 
ATOM   5052  C CE1 . TYR D  1 149 ? 73.412 29.836 45.346  1.00 20.17  ? 176  TYR D CE1 1 
ATOM   5053  C CE2 . TYR D  1 149 ? 73.443 30.300 47.706  1.00 22.55  ? 176  TYR D CE2 1 
ATOM   5054  C CZ  . TYR D  1 149 ? 73.753 29.473 46.639  1.00 21.05  ? 176  TYR D CZ  1 
ATOM   5055  O OH  . TYR D  1 149 ? 74.389 28.280 46.866  1.00 22.30  ? 176  TYR D OH  1 
ATOM   5056  N N   . CYS D  1 150 ? 70.474 35.308 43.930  1.00 25.44  ? 177  CYS D N   1 
ATOM   5057  C CA  . CYS D  1 150 ? 69.582 36.434 43.784  1.00 26.16  ? 177  CYS D CA  1 
ATOM   5058  C C   . CYS D  1 150 ? 68.769 36.505 45.072  1.00 27.25  ? 177  CYS D C   1 
ATOM   5059  O O   . CYS D  1 150 ? 68.293 35.480 45.575  1.00 26.52  ? 177  CYS D O   1 
ATOM   5060  C CB  . CYS D  1 150 ? 68.656 36.195 42.620  1.00 24.65  ? 177  CYS D CB  1 
ATOM   5061  S SG  . CYS D  1 150 ? 69.515 36.149 41.028  1.00 28.99  ? 177  CYS D SG  1 
ATOM   5062  N N   . ARG D  1 151 ? 68.617 37.709 45.616  1.00 27.08  ? 178  ARG D N   1 
ATOM   5063  C CA  . ARG D  1 151 ? 67.855 37.866 46.840  1.00 26.33  ? 178  ARG D CA  1 
ATOM   5064  C C   . ARG D  1 151 ? 67.141 39.188 46.847  1.00 28.33  ? 178  ARG D C   1 
ATOM   5065  O O   . ARG D  1 151 ? 67.414 40.049 46.022  1.00 29.85  ? 178  ARG D O   1 
ATOM   5066  C CB  . ARG D  1 151 ? 68.778 37.772 48.039  1.00 22.91  ? 178  ARG D CB  1 
ATOM   5067  C CG  . ARG D  1 151 ? 69.428 36.415 48.203  1.00 19.75  ? 178  ARG D CG  1 
ATOM   5068  C CD  . ARG D  1 151 ? 68.434 35.444 48.784  1.00 20.58  ? 178  ARG D CD  1 
ATOM   5069  N NE  . ARG D  1 151 ? 69.020 34.151 49.117  1.00 14.47  ? 178  ARG D NE  1 
ATOM   5070  C CZ  . ARG D  1 151 ? 69.026 33.115 48.295  1.00 16.03  ? 178  ARG D CZ  1 
ATOM   5071  N NH1 . ARG D  1 151 ? 68.476 33.217 47.092  1.00 18.48  ? 178  ARG D NH1 1 
ATOM   5072  N NH2 . ARG D  1 151 ? 69.583 31.980 48.670  1.00 15.95  ? 178  ARG D NH2 1 
ATOM   5073  N N   . ASN D  1 152 ? 66.201 39.325 47.770  1.00 30.25  ? 179  ASN D N   1 
ATOM   5074  C CA  . ASN D  1 152 ? 65.432 40.551 47.926  1.00 32.13  ? 179  ASN D CA  1 
ATOM   5075  C C   . ASN D  1 152 ? 65.447 40.795 49.433  1.00 32.54  ? 179  ASN D C   1 
ATOM   5076  O O   . ASN D  1 152 ? 64.423 40.726 50.110  1.00 30.44  ? 179  ASN D O   1 
ATOM   5077  C CB  . ASN D  1 152 ? 63.998 40.364 47.432  1.00 33.31  ? 179  ASN D CB  1 
ATOM   5078  C CG  . ASN D  1 152 ? 63.259 41.676 47.280  1.00 36.42  ? 179  ASN D CG  1 
ATOM   5079  O OD1 . ASN D  1 152 ? 63.625 42.683 47.894  1.00 37.13  ? 179  ASN D OD1 1 
ATOM   5080  N ND2 . ASN D  1 152 ? 62.205 41.674 46.467  1.00 37.19  ? 179  ASN D ND2 1 
ATOM   5081  N N   . PRO D  1 153 ? 66.633 41.098 49.970  1.00 33.68  ? 180  PRO D N   1 
ATOM   5082  C CA  . PRO D  1 153 ? 66.847 41.355 51.393  1.00 34.66  ? 180  PRO D CA  1 
ATOM   5083  C C   . PRO D  1 153 ? 65.914 42.396 51.999  1.00 36.55  ? 180  PRO D C   1 
ATOM   5084  O O   . PRO D  1 153 ? 65.564 42.296 53.161  1.00 35.57  ? 180  PRO D O   1 
ATOM   5085  C CB  . PRO D  1 153 ? 68.309 41.775 51.439  1.00 33.97  ? 180  PRO D CB  1 
ATOM   5086  C CG  . PRO D  1 153 ? 68.474 42.487 50.112  1.00 33.73  ? 180  PRO D CG  1 
ATOM   5087  C CD  . PRO D  1 153 ? 67.787 41.560 49.172  1.00 33.19  ? 180  PRO D CD  1 
ATOM   5088  N N   . ARG D  1 154 ? 65.511 43.387 51.211  1.00 40.11  ? 181  ARG D N   1 
ATOM   5089  C CA  . ARG D  1 154 ? 64.628 44.446 51.693  1.00 44.05  ? 181  ARG D CA  1 
ATOM   5090  C C   . ARG D  1 154 ? 63.195 44.290 51.180  1.00 45.55  ? 181  ARG D C   1 
ATOM   5091  O O   . ARG D  1 154 ? 62.419 45.241 51.178  1.00 46.25  ? 181  ARG D O   1 
ATOM   5092  C CB  . ARG D  1 154 ? 65.135 45.819 51.243  1.00 47.53  ? 181  ARG D CB  1 
ATOM   5093  C CG  . ARG D  1 154 ? 66.581 46.164 51.575  1.00 51.18  ? 181  ARG D CG  1 
ATOM   5094  C CD  . ARG D  1 154 ? 66.841 47.626 51.227  1.00 53.98  ? 181  ARG D CD  1 
ATOM   5095  N NE  . ARG D  1 154 ? 67.075 48.421 52.427  1.00 57.22  ? 181  ARG D NE  1 
ATOM   5096  C CZ  . ARG D  1 154 ? 66.883 49.735 52.510  1.00 58.15  ? 181  ARG D CZ  1 
ATOM   5097  N NH1 . ARG D  1 154 ? 66.440 50.413 51.455  1.00 58.97  ? 181  ARG D NH1 1 
ATOM   5098  N NH2 . ARG D  1 154 ? 67.154 50.371 53.646  1.00 58.14  ? 181  ARG D NH2 1 
ATOM   5099  N N   . GLY D  1 155 ? 62.846 43.101 50.720  1.00 46.95  ? 182  GLY D N   1 
ATOM   5100  C CA  . GLY D  1 155 ? 61.502 42.888 50.227  1.00 46.58  ? 182  GLY D CA  1 
ATOM   5101  C C   . GLY D  1 155 ? 60.990 44.068 49.441  1.00 47.21  ? 182  GLY D C   1 
ATOM   5102  O O   . GLY D  1 155 ? 59.814 44.384 49.486  1.00 48.60  ? 182  GLY D O   1 
ATOM   5103  N N   . GLU D  1 156 ? 61.878 44.757 48.753  1.00 48.13  ? 183  GLU D N   1 
ATOM   5104  C CA  . GLU D  1 156 ? 61.458 45.886 47.957  1.00 50.88  ? 183  GLU D CA  1 
ATOM   5105  C C   . GLU D  1 156 ? 60.688 45.322 46.754  1.00 51.45  ? 183  GLU D C   1 
ATOM   5106  O O   . GLU D  1 156 ? 60.601 44.106 46.573  1.00 51.65  ? 183  GLU D O   1 
ATOM   5107  C CB  . GLU D  1 156 ? 62.683 46.653 47.458  1.00 54.45  ? 183  GLU D CB  1 
ATOM   5108  C CG  . GLU D  1 156 ? 63.764 46.921 48.504  1.00 58.79  ? 183  GLU D CG  1 
ATOM   5109  C CD  . GLU D  1 156 ? 65.030 47.519 47.891  1.00 61.56  ? 183  GLU D CD  1 
ATOM   5110  O OE1 . GLU D  1 156 ? 64.944 48.637 47.334  1.00 63.40  ? 183  GLU D OE1 1 
ATOM   5111  O OE2 . GLU D  1 156 ? 66.103 46.872 47.958  1.00 62.39  ? 183  GLU D OE2 1 
ATOM   5112  N N   . GLU D  1 157 ? 60.126 46.207 45.936  1.00 51.59  ? 184  GLU D N   1 
ATOM   5113  C CA  . GLU D  1 157 ? 59.412 45.795 44.733  1.00 51.14  ? 184  GLU D CA  1 
ATOM   5114  C C   . GLU D  1 157 ? 60.491 45.571 43.670  1.00 49.03  ? 184  GLU D C   1 
ATOM   5115  O O   . GLU D  1 157 ? 61.459 46.317 43.622  1.00 49.14  ? 184  GLU D O   1 
ATOM   5116  C CB  . GLU D  1 157 ? 58.461 46.909 44.298  1.00 54.41  ? 184  GLU D CB  1 
ATOM   5117  C CG  . GLU D  1 157 ? 57.240 47.072 45.199  1.00 60.79  ? 184  GLU D CG  1 
ATOM   5118  C CD  . GLU D  1 157 ? 56.620 48.480 45.137  1.00 65.57  ? 184  GLU D CD  1 
ATOM   5119  O OE1 . GLU D  1 157 ? 56.518 49.046 44.016  1.00 67.20  ? 184  GLU D OE1 1 
ATOM   5120  O OE2 . GLU D  1 157 ? 56.223 49.015 46.210  1.00 67.45  ? 184  GLU D OE2 1 
ATOM   5121  N N   . GLY D  1 158 ? 60.329 44.564 42.819  1.00 46.70  ? 185  GLY D N   1 
ATOM   5122  C CA  . GLY D  1 158 ? 61.325 44.286 41.794  1.00 44.12  ? 185  GLY D CA  1 
ATOM   5123  C C   . GLY D  1 158 ? 61.749 42.846 41.959  1.00 42.65  ? 185  GLY D C   1 
ATOM   5124  O O   . GLY D  1 158 ? 62.316 42.213 41.062  1.00 40.80  ? 185  GLY D O   1 
ATOM   5125  N N   . GLY D  1 159 ? 61.465 42.330 43.149  1.00 42.46  ? 186  GLY D N   1 
ATOM   5126  C CA  . GLY D  1 159 ? 61.788 40.952 43.460  1.00 41.69  ? 186  GLY D CA  1 
ATOM   5127  C C   . GLY D  1 159 ? 63.269 40.715 43.605  1.00 40.25  ? 186  GLY D C   1 
ATOM   5128  O O   . GLY D  1 159 ? 64.055 41.653 43.600  1.00 42.27  ? 186  GLY D O   1 
ATOM   5129  N N   . PRO D  1 160 ? 63.685 39.460 43.752  1.00 38.62  ? 187  PRO D N   1 
ATOM   5130  C CA  . PRO D  1 160 ? 65.110 39.184 43.897  1.00 37.31  ? 187  PRO D CA  1 
ATOM   5131  C C   . PRO D  1 160 ? 65.959 39.888 42.840  1.00 36.58  ? 187  PRO D C   1 
ATOM   5132  O O   . PRO D  1 160 ? 65.523 40.105 41.697  1.00 37.50  ? 187  PRO D O   1 
ATOM   5133  C CB  . PRO D  1 160 ? 65.169 37.663 43.797  1.00 38.10  ? 187  PRO D CB  1 
ATOM   5134  C CG  . PRO D  1 160 ? 63.891 37.251 44.471  1.00 37.59  ? 187  PRO D CG  1 
ATOM   5135  C CD  . PRO D  1 160 ? 62.887 38.228 43.886  1.00 38.43  ? 187  PRO D CD  1 
ATOM   5136  N N   . TRP D  1 161 ? 67.171 40.248 43.255  1.00 34.05  ? 188  TRP D N   1 
ATOM   5137  C CA  . TRP D  1 161 ? 68.144 40.931 42.414  1.00 30.87  ? 188  TRP D CA  1 
ATOM   5138  C C   . TRP D  1 161 ? 69.524 40.566 42.951  1.00 29.55  ? 188  TRP D C   1 
ATOM   5139  O O   . TRP D  1 161 ? 69.641 39.758 43.869  1.00 28.07  ? 188  TRP D O   1 
ATOM   5140  C CB  . TRP D  1 161 ? 67.948 42.435 42.523  1.00 29.71  ? 188  TRP D CB  1 
ATOM   5141  C CG  . TRP D  1 161 ? 68.070 42.914 43.937  1.00 27.23  ? 188  TRP D CG  1 
ATOM   5142  C CD1 . TRP D  1 161 ? 67.121 42.840 44.908  1.00 26.62  ? 188  TRP D CD1 1 
ATOM   5143  C CD2 . TRP D  1 161 ? 69.234 43.471 44.555  1.00 27.68  ? 188  TRP D CD2 1 
ATOM   5144  N NE1 . TRP D  1 161 ? 67.620 43.312 46.097  1.00 27.21  ? 188  TRP D NE1 1 
ATOM   5145  C CE2 . TRP D  1 161 ? 68.916 43.707 45.908  1.00 27.48  ? 188  TRP D CE2 1 
ATOM   5146  C CE3 . TRP D  1 161 ? 70.519 43.795 44.095  1.00 29.16  ? 188  TRP D CE3 1 
ATOM   5147  C CZ2 . TRP D  1 161 ? 69.836 44.249 46.810  1.00 27.24  ? 188  TRP D CZ2 1 
ATOM   5148  C CZ3 . TRP D  1 161 ? 71.434 44.335 44.992  1.00 28.76  ? 188  TRP D CZ3 1 
ATOM   5149  C CH2 . TRP D  1 161 ? 71.085 44.557 46.335  1.00 28.19  ? 188  TRP D CH2 1 
ATOM   5150  N N   . CYS D  1 162 ? 70.562 41.165 42.379  1.00 28.82  ? 189  CYS D N   1 
ATOM   5151  C CA  . CYS D  1 162 ? 71.925 40.917 42.828  1.00 29.39  ? 189  CYS D CA  1 
ATOM   5152  C C   . CYS D  1 162 ? 72.916 41.864 42.152  1.00 30.65  ? 189  CYS D C   1 
ATOM   5153  O O   . CYS D  1 162 ? 72.640 42.428 41.097  1.00 32.24  ? 189  CYS D O   1 
ATOM   5154  C CB  . CYS D  1 162 ? 72.322 39.486 42.511  1.00 27.57  ? 189  CYS D CB  1 
ATOM   5155  S SG  . CYS D  1 162 ? 72.764 39.256 40.770  1.00 27.13  ? 189  CYS D SG  1 
ATOM   5156  N N   . PHE D  1 163 ? 74.073 42.060 42.759  1.00 30.37  ? 190  PHE D N   1 
ATOM   5157  C CA  . PHE D  1 163 ? 75.059 42.915 42.126  1.00 31.05  ? 190  PHE D CA  1 
ATOM   5158  C C   . PHE D  1 163 ? 75.647 42.035 41.025  1.00 32.11  ? 190  PHE D C   1 
ATOM   5159  O O   . PHE D  1 163 ? 75.914 40.850 41.244  1.00 31.07  ? 190  PHE D O   1 
ATOM   5160  C CB  . PHE D  1 163 ? 76.124 43.352 43.147  1.00 30.02  ? 190  PHE D CB  1 
ATOM   5161  C CG  . PHE D  1 163 ? 75.594 44.290 44.185  1.00 29.84  ? 190  PHE D CG  1 
ATOM   5162  C CD1 . PHE D  1 163 ? 75.265 45.608 43.852  1.00 30.20  ? 190  PHE D CD1 1 
ATOM   5163  C CD2 . PHE D  1 163 ? 75.330 43.841 45.478  1.00 30.23  ? 190  PHE D CD2 1 
ATOM   5164  C CE1 . PHE D  1 163 ? 74.669 46.466 44.801  1.00 29.86  ? 190  PHE D CE1 1 
ATOM   5165  C CE2 . PHE D  1 163 ? 74.734 44.687 46.434  1.00 29.35  ? 190  PHE D CE2 1 
ATOM   5166  C CZ  . PHE D  1 163 ? 74.403 46.000 46.092  1.00 29.25  ? 190  PHE D CZ  1 
ATOM   5167  N N   . THR D  1 164 ? 75.827 42.602 39.835  1.00 33.43  ? 191  THR D N   1 
ATOM   5168  C CA  . THR D  1 164 ? 76.354 41.833 38.711  1.00 34.26  ? 191  THR D CA  1 
ATOM   5169  C C   . THR D  1 164 ? 77.870 41.832 38.647  1.00 32.75  ? 191  THR D C   1 
ATOM   5170  O O   . THR D  1 164 ? 78.510 42.748 39.129  1.00 31.99  ? 191  THR D O   1 
ATOM   5171  C CB  . THR D  1 164 ? 75.832 42.367 37.379  1.00 35.23  ? 191  THR D CB  1 
ATOM   5172  O OG1 . THR D  1 164 ? 76.837 43.191 36.782  1.00 37.52  ? 191  THR D OG1 1 
ATOM   5173  C CG2 . THR D  1 164 ? 74.561 43.188 37.596  1.00 35.92  ? 191  THR D CG2 1 
ATOM   5174  N N   . SER D  1 165 ? 78.433 40.791 38.043  1.00 33.44  ? 192  SER D N   1 
ATOM   5175  C CA  . SER D  1 165 ? 79.880 40.664 37.918  1.00 33.47  ? 192  SER D CA  1 
ATOM   5176  C C   . SER D  1 165 ? 80.387 41.554 36.792  1.00 34.51  ? 192  SER D C   1 
ATOM   5177  O O   . SER D  1 165 ? 81.589 41.604 36.512  1.00 31.97  ? 192  SER D O   1 
ATOM   5178  C CB  . SER D  1 165 ? 80.279 39.206 37.662  1.00 31.60  ? 192  SER D CB  1 
ATOM   5179  O OG  . SER D  1 165 ? 79.582 38.674 36.557  1.00 27.10  ? 192  SER D OG  1 
ATOM   5180  N N   . ASN D  1 166 ? 79.456 42.258 36.158  1.00 36.30  ? 193  ASN D N   1 
ATOM   5181  C CA  . ASN D  1 166 ? 79.794 43.166 35.081  1.00 38.42  ? 193  ASN D CA  1 
ATOM   5182  C C   . ASN D  1 166 ? 80.021 44.533 35.697  1.00 39.20  ? 193  ASN D C   1 
ATOM   5183  O O   . ASN D  1 166 ? 79.088 45.164 36.203  1.00 39.39  ? 193  ASN D O   1 
ATOM   5184  C CB  . ASN D  1 166 ? 78.656 43.261 34.078  1.00 41.88  ? 193  ASN D CB  1 
ATOM   5185  C CG  . ASN D  1 166 ? 79.015 44.111 32.875  1.00 44.65  ? 193  ASN D CG  1 
ATOM   5186  O OD1 . ASN D  1 166 ? 79.529 45.221 33.014  1.00 47.57  ? 193  ASN D OD1 1 
ATOM   5187  N ND2 . ASN D  1 166 ? 78.736 43.595 31.683  1.00 45.92  ? 193  ASN D ND2 1 
ATOM   5188  N N   . PRO D  1 167 ? 81.271 45.014 35.659  1.00 40.54  ? 194  PRO D N   1 
ATOM   5189  C CA  . PRO D  1 167 ? 81.632 46.317 36.217  1.00 40.39  ? 194  PRO D CA  1 
ATOM   5190  C C   . PRO D  1 167 ? 80.712 47.421 35.730  1.00 40.93  ? 194  PRO D C   1 
ATOM   5191  O O   . PRO D  1 167 ? 80.303 48.285 36.499  1.00 42.85  ? 194  PRO D O   1 
ATOM   5192  C CB  . PRO D  1 167 ? 83.061 46.498 35.742  1.00 40.52  ? 194  PRO D CB  1 
ATOM   5193  C CG  . PRO D  1 167 ? 83.587 45.097 35.741  1.00 39.20  ? 194  PRO D CG  1 
ATOM   5194  C CD  . PRO D  1 167 ? 82.456 44.346 35.091  1.00 40.44  ? 194  PRO D CD  1 
ATOM   5195  N N   . GLU D  1 168 ? 80.380 47.392 34.450  1.00 41.09  ? 195  GLU D N   1 
ATOM   5196  C CA  . GLU D  1 168 ? 79.506 48.411 33.902  1.00 43.82  ? 195  GLU D CA  1 
ATOM   5197  C C   . GLU D  1 168 ? 78.069 48.327 34.412  1.00 43.94  ? 195  GLU D C   1 
ATOM   5198  O O   . GLU D  1 168 ? 77.295 49.267 34.239  1.00 44.27  ? 195  GLU D O   1 
ATOM   5199  C CB  . GLU D  1 168 ? 79.507 48.325 32.378  1.00 48.36  ? 195  GLU D CB  1 
ATOM   5200  C CG  . GLU D  1 168 ? 80.842 48.695 31.711  1.00 53.18  ? 195  GLU D CG  1 
ATOM   5201  C CD  . GLU D  1 168 ? 81.339 50.083 32.092  1.00 56.33  ? 195  GLU D CD  1 
ATOM   5202  O OE1 . GLU D  1 168 ? 80.499 50.902 32.547  1.00 56.27  ? 195  GLU D OE1 1 
ATOM   5203  O OE2 . GLU D  1 168 ? 82.560 50.331 31.912  1.00 57.59  ? 195  GLU D OE2 1 
ATOM   5204  N N   . VAL D  1 169 ? 77.712 47.211 35.045  1.00 44.23  ? 196  VAL D N   1 
ATOM   5205  C CA  . VAL D  1 169 ? 76.349 47.021 35.546  1.00 44.54  ? 196  VAL D CA  1 
ATOM   5206  C C   . VAL D  1 169 ? 76.346 46.695 37.030  1.00 44.06  ? 196  VAL D C   1 
ATOM   5207  O O   . VAL D  1 169 ? 76.525 45.541 37.416  1.00 43.30  ? 196  VAL D O   1 
ATOM   5208  C CB  . VAL D  1 169 ? 75.641 45.871 34.797  1.00 45.74  ? 196  VAL D CB  1 
ATOM   5209  C CG1 . VAL D  1 169 ? 74.130 45.999 34.958  1.00 45.22  ? 196  VAL D CG1 1 
ATOM   5210  C CG2 . VAL D  1 169 ? 76.049 45.878 33.325  1.00 44.87  ? 196  VAL D CG2 1 
ATOM   5211  N N   . ARG D  1 170 ? 76.122 47.710 37.859  1.00 43.70  ? 197  ARG D N   1 
ATOM   5212  C CA  . ARG D  1 170 ? 76.129 47.513 39.298  1.00 44.06  ? 197  ARG D CA  1 
ATOM   5213  C C   . ARG D  1 170 ? 75.195 46.392 39.740  1.00 44.44  ? 197  ARG D C   1 
ATOM   5214  O O   . ARG D  1 170 ? 75.641 45.370 40.266  1.00 44.39  ? 197  ARG D O   1 
ATOM   5215  C CB  . ARG D  1 170 ? 75.764 48.813 40.007  1.00 43.13  ? 197  ARG D CB  1 
ATOM   5216  C CG  . ARG D  1 170 ? 75.912 48.746 41.522  1.00 44.93  ? 197  ARG D CG  1 
ATOM   5217  C CD  . ARG D  1 170 ? 75.600 50.085 42.166  1.00 44.27  ? 197  ARG D CD  1 
ATOM   5218  N NE  . ARG D  1 170 ? 75.562 50.020 43.625  1.00 45.51  ? 197  ARG D NE  1 
ATOM   5219  C CZ  . ARG D  1 170 ? 76.622 49.859 44.416  1.00 46.69  ? 197  ARG D CZ  1 
ATOM   5220  N NH1 . ARG D  1 170 ? 77.836 49.747 43.894  1.00 46.02  ? 197  ARG D NH1 1 
ATOM   5221  N NH2 . ARG D  1 170 ? 76.464 49.792 45.737  1.00 47.28  ? 197  ARG D NH2 1 
ATOM   5222  N N   . TYR D  1 171 ? 73.899 46.583 39.527  1.00 44.46  ? 198  TYR D N   1 
ATOM   5223  C CA  . TYR D  1 171 ? 72.916 45.571 39.906  1.00 44.21  ? 198  TYR D CA  1 
ATOM   5224  C C   . TYR D  1 171 ? 71.846 45.338 38.831  1.00 43.30  ? 198  TYR D C   1 
ATOM   5225  O O   . TYR D  1 171 ? 71.742 46.075 37.851  1.00 44.84  ? 198  TYR D O   1 
ATOM   5226  C CB  . TYR D  1 171 ? 72.216 45.981 41.199  1.00 44.87  ? 198  TYR D CB  1 
ATOM   5227  C CG  . TYR D  1 171 ? 71.250 47.127 41.016  1.00 46.20  ? 198  TYR D CG  1 
ATOM   5228  C CD1 . TYR D  1 171 ? 71.581 48.407 41.418  1.00 48.23  ? 198  TYR D CD1 1 
ATOM   5229  C CD2 . TYR D  1 171 ? 70.000 46.926 40.446  1.00 47.30  ? 198  TYR D CD2 1 
ATOM   5230  C CE1 . TYR D  1 171 ? 70.690 49.469 41.266  1.00 49.99  ? 198  TYR D CE1 1 
ATOM   5231  C CE2 . TYR D  1 171 ? 69.102 47.977 40.286  1.00 50.07  ? 198  TYR D CE2 1 
ATOM   5232  C CZ  . TYR D  1 171 ? 69.453 49.250 40.701  1.00 50.39  ? 198  TYR D CZ  1 
ATOM   5233  O OH  . TYR D  1 171 ? 68.569 50.302 40.565  1.00 51.05  ? 198  TYR D OH  1 
ATOM   5234  N N   . GLU D  1 172 ? 71.043 44.304 39.037  1.00 41.20  ? 199  GLU D N   1 
ATOM   5235  C CA  . GLU D  1 172 ? 69.953 43.975 38.136  1.00 38.61  ? 199  GLU D CA  1 
ATOM   5236  C C   . GLU D  1 172 ? 69.062 42.927 38.785  1.00 36.91  ? 199  GLU D C   1 
ATOM   5237  O O   . GLU D  1 172 ? 69.513 42.120 39.591  1.00 36.73  ? 199  GLU D O   1 
ATOM   5238  C CB  . GLU D  1 172 ? 70.483 43.457 36.800  1.00 38.70  ? 199  GLU D CB  1 
ATOM   5239  C CG  . GLU D  1 172 ? 69.388 42.947 35.876  1.00 41.95  ? 199  GLU D CG  1 
ATOM   5240  C CD  . GLU D  1 172 ? 69.843 42.758 34.430  1.00 44.77  ? 199  GLU D CD  1 
ATOM   5241  O OE1 . GLU D  1 172 ? 70.866 42.077 34.191  1.00 46.71  ? 199  GLU D OE1 1 
ATOM   5242  O OE2 . GLU D  1 172 ? 69.165 43.290 33.524  1.00 46.60  ? 199  GLU D OE2 1 
ATOM   5243  N N   . VAL D  1 173 ? 67.783 42.955 38.448  1.00 34.67  ? 200  VAL D N   1 
ATOM   5244  C CA  . VAL D  1 173 ? 66.848 41.988 38.987  1.00 31.45  ? 200  VAL D CA  1 
ATOM   5245  C C   . VAL D  1 173 ? 67.056 40.644 38.294  1.00 31.92  ? 200  VAL D C   1 
ATOM   5246  O O   . VAL D  1 173 ? 67.632 40.566 37.200  1.00 31.19  ? 200  VAL D O   1 
ATOM   5247  C CB  . VAL D  1 173 ? 65.402 42.433 38.752  1.00 30.03  ? 200  VAL D CB  1 
ATOM   5248  C CG1 . VAL D  1 173 ? 65.038 43.538 39.699  1.00 29.18  ? 200  VAL D CG1 1 
ATOM   5249  C CG2 . VAL D  1 173 ? 65.238 42.902 37.327  1.00 28.41  ? 200  VAL D CG2 1 
ATOM   5250  N N   . CYS D  1 174 ? 66.584 39.585 38.938  1.00 30.80  ? 201  CYS D N   1 
ATOM   5251  C CA  . CYS D  1 174 ? 66.711 38.264 38.377  1.00 30.50  ? 201  CYS D CA  1 
ATOM   5252  C C   . CYS D  1 174 ? 65.352 37.826 37.906  1.00 31.59  ? 201  CYS D C   1 
ATOM   5253  O O   . CYS D  1 174 ? 64.329 38.240 38.448  1.00 32.09  ? 201  CYS D O   1 
ATOM   5254  C CB  . CYS D  1 174 ? 67.232 37.310 39.425  1.00 30.93  ? 201  CYS D CB  1 
ATOM   5255  S SG  . CYS D  1 174 ? 68.810 37.847 40.166  1.00 28.47  ? 201  CYS D SG  1 
ATOM   5256  N N   . ASP D  1 175 ? 65.347 36.974 36.896  1.00 32.81  ? 202  ASP D N   1 
ATOM   5257  C CA  . ASP D  1 175 ? 64.106 36.488 36.308  1.00 32.90  ? 202  ASP D CA  1 
ATOM   5258  C C   . ASP D  1 175 ? 63.600 35.275 37.094  1.00 31.03  ? 202  ASP D C   1 
ATOM   5259  O O   . ASP D  1 175 ? 63.830 34.135 36.711  1.00 31.66  ? 202  ASP D O   1 
ATOM   5260  C CB  . ASP D  1 175 ? 64.395 36.130 34.848  1.00 35.87  ? 202  ASP D CB  1 
ATOM   5261  C CG  . ASP D  1 175 ? 63.179 36.246 33.965  1.00 40.77  ? 202  ASP D CG  1 
ATOM   5262  O OD1 . ASP D  1 175 ? 62.093 36.572 34.498  1.00 42.85  ? 202  ASP D OD1 1 
ATOM   5263  O OD2 . ASP D  1 175 ? 63.311 36.003 32.737  1.00 42.77  ? 202  ASP D OD2 1 
ATOM   5264  N N   . ILE D  1 176 ? 62.917 35.507 38.202  1.00 29.03  ? 203  ILE D N   1 
ATOM   5265  C CA  . ILE D  1 176 ? 62.452 34.378 39.000  1.00 29.49  ? 203  ILE D CA  1 
ATOM   5266  C C   . ILE D  1 176 ? 60.943 34.263 39.065  1.00 30.59  ? 203  ILE D C   1 
ATOM   5267  O O   . ILE D  1 176 ? 60.263 35.103 39.654  1.00 31.68  ? 203  ILE D O   1 
ATOM   5268  C CB  . ILE D  1 176 ? 63.057 34.428 40.419  1.00 29.31  ? 203  ILE D CB  1 
ATOM   5269  C CG1 . ILE D  1 176 ? 64.560 34.116 40.315  1.00 27.96  ? 203  ILE D CG1 1 
ATOM   5270  C CG2 . ILE D  1 176 ? 62.329 33.480 41.348  1.00 25.48  ? 203  ILE D CG2 1 
ATOM   5271  C CD1 . ILE D  1 176 ? 65.257 33.970 41.610  1.00 26.58  ? 203  ILE D CD1 1 
ATOM   5272  N N   . PRO D  1 177 ? 60.405 33.190 38.468  1.00 31.35  ? 204  PRO D N   1 
ATOM   5273  C CA  . PRO D  1 177 ? 58.991 32.838 38.365  1.00 32.61  ? 204  PRO D CA  1 
ATOM   5274  C C   . PRO D  1 177 ? 58.136 32.859 39.618  1.00 35.00  ? 204  PRO D C   1 
ATOM   5275  O O   . PRO D  1 177 ? 58.572 32.487 40.707  1.00 36.03  ? 204  PRO D O   1 
ATOM   5276  C CB  . PRO D  1 177 ? 59.030 31.463 37.727  1.00 31.28  ? 204  PRO D CB  1 
ATOM   5277  C CG  . PRO D  1 177 ? 60.293 30.912 38.209  1.00 30.81  ? 204  PRO D CG  1 
ATOM   5278  C CD  . PRO D  1 177 ? 61.233 32.055 38.036  1.00 31.54  ? 204  PRO D CD  1 
ATOM   5279  N N   . GLN D  1 178 ? 56.902 33.316 39.437  1.00 37.51  ? 205  GLN D N   1 
ATOM   5280  C CA  . GLN D  1 178 ? 55.928 33.392 40.512  1.00 39.55  ? 205  GLN D CA  1 
ATOM   5281  C C   . GLN D  1 178 ? 55.355 31.989 40.686  1.00 40.89  ? 205  GLN D C   1 
ATOM   5282  O O   . GLN D  1 178 ? 55.174 31.257 39.709  1.00 41.05  ? 205  GLN D O   1 
ATOM   5283  C CB  . GLN D  1 178 ? 54.804 34.355 40.119  1.00 39.88  ? 205  GLN D CB  1 
ATOM   5284  C CG  . GLN D  1 178 ? 55.185 35.826 40.073  1.00 39.96  ? 205  GLN D CG  1 
ATOM   5285  C CD  . GLN D  1 178 ? 55.329 36.424 41.456  1.00 41.60  ? 205  GLN D CD  1 
ATOM   5286  O OE1 . GLN D  1 178 ? 54.493 36.196 42.338  1.00 41.17  ? 205  GLN D OE1 1 
ATOM   5287  N NE2 . GLN D  1 178 ? 56.387 37.202 41.655  1.00 42.91  ? 205  GLN D NE2 1 
ATOM   5288  N N   . CYS D  1 179 ? 55.073 31.601 41.919  1.00 41.77  ? 206  CYS D N   1 
ATOM   5289  C CA  . CYS D  1 179 ? 54.510 30.287 42.147  1.00 44.29  ? 206  CYS D CA  1 
ATOM   5290  C C   . CYS D  1 179 ? 53.127 30.190 41.515  1.00 49.55  ? 206  CYS D C   1 
ATOM   5291  O O   . CYS D  1 179 ? 52.665 29.105 41.166  1.00 49.43  ? 206  CYS D O   1 
ATOM   5292  C CB  . CYS D  1 179 ? 54.403 30.005 43.634  1.00 38.78  ? 206  CYS D CB  1 
ATOM   5293  S SG  . CYS D  1 179 ? 56.012 29.807 44.440  1.00 34.43  ? 206  CYS D SG  1 
ATOM   5294  N N   . SER D  1 180 ? 52.462 31.332 41.385  1.00 55.34  ? 207  SER D N   1 
ATOM   5295  C CA  . SER D  1 180 ? 51.135 31.369 40.790  1.00 60.25  ? 207  SER D CA  1 
ATOM   5296  C C   . SER D  1 180 ? 51.230 31.724 39.310  1.00 63.87  ? 207  SER D C   1 
ATOM   5297  O O   . SER D  1 180 ? 51.032 32.879 38.904  1.00 64.38  ? 207  SER D O   1 
ATOM   5298  C CB  . SER D  1 180 ? 50.256 32.380 41.518  1.00 59.86  ? 207  SER D CB  1 
ATOM   5299  O OG  . SER D  1 180 ? 50.791 33.683 41.392  1.00 62.76  ? 207  SER D OG  1 
ATOM   5300  N N   . GLU D  1 181 ? 51.548 30.698 38.524  1.00 67.66  ? 208  GLU D N   1 
ATOM   5301  C CA  . GLU D  1 181 ? 51.669 30.801 37.080  1.00 71.88  ? 208  GLU D CA  1 
ATOM   5302  C C   . GLU D  1 181 ? 51.028 29.551 36.486  1.00 72.47  ? 208  GLU D C   1 
ATOM   5303  O O   . GLU D  1 181 ? 51.751 28.744 35.858  1.00 73.18  ? 208  GLU D O   1 
ATOM   5304  C CB  . GLU D  1 181 ? 53.144 30.889 36.667  1.00 75.09  ? 208  GLU D CB  1 
ATOM   5305  C CG  . GLU D  1 181 ? 53.809 32.249 36.932  1.00 80.56  ? 208  GLU D CG  1 
ATOM   5306  C CD  . GLU D  1 181 ? 53.976 33.098 35.670  1.00 83.24  ? 208  GLU D CD  1 
ATOM   5307  O OE1 . GLU D  1 181 ? 54.498 32.563 34.661  1.00 83.98  ? 208  GLU D OE1 1 
ATOM   5308  O OE2 . GLU D  1 181 ? 53.598 34.299 35.691  1.00 84.39  ? 208  GLU D OE2 1 
ATOM   5309  N N   . VAL D  1 182 ? 49.803 29.388 36.672  1.00 72.90  ? 209  VAL D N   1 
ATOM   5310  N N   . ASN E  1 10  ? 79.726 80.600 13.457  1.00 91.14  ? 37   ASN E N   1 
ATOM   5311  C CA  . ASN E  1 10  ? 79.904 79.716 12.271  1.00 91.01  ? 37   ASN E CA  1 
ATOM   5312  C C   . ASN E  1 10  ? 78.968 78.516 12.337  1.00 90.79  ? 37   ASN E C   1 
ATOM   5313  O O   . ASN E  1 10  ? 78.638 77.920 11.313  1.00 91.64  ? 37   ASN E O   1 
ATOM   5314  C CB  . ASN E  1 10  ? 81.352 79.247 12.185  1.00 91.36  ? 37   ASN E CB  1 
ATOM   5315  N N   . THR E  1 11  ? 78.541 78.164 13.546  1.00 90.50  ? 38   THR E N   1 
ATOM   5316  C CA  . THR E  1 11  ? 77.645 77.027 13.738  1.00 90.33  ? 38   THR E CA  1 
ATOM   5317  C C   . THR E  1 11  ? 76.648 77.239 14.875  1.00 89.19  ? 38   THR E C   1 
ATOM   5318  O O   . THR E  1 11  ? 75.772 76.408 15.101  1.00 89.31  ? 38   THR E O   1 
ATOM   5319  C CB  . THR E  1 11  ? 78.434 75.740 14.063  1.00 91.86  ? 38   THR E CB  1 
ATOM   5320  O OG1 . THR E  1 11  ? 79.172 75.933 15.279  1.00 92.58  ? 38   THR E OG1 1 
ATOM   5321  C CG2 . THR E  1 11  ? 79.393 75.387 12.929  1.00 92.58  ? 38   THR E CG2 1 
ATOM   5322  N N   . ILE E  1 12  ? 76.783 78.344 15.599  1.00 87.15  ? 39   ILE E N   1 
ATOM   5323  C CA  . ILE E  1 12  ? 75.879 78.629 16.712  1.00 84.72  ? 39   ILE E CA  1 
ATOM   5324  C C   . ILE E  1 12  ? 74.408 78.595 16.291  1.00 83.32  ? 39   ILE E C   1 
ATOM   5325  O O   . ILE E  1 12  ? 73.528 78.344 17.112  1.00 83.20  ? 39   ILE E O   1 
ATOM   5326  C CB  . ILE E  1 12  ? 76.213 79.981 17.310  1.00 84.78  ? 39   ILE E CB  1 
ATOM   5327  N N   . HIS E  1 13  ? 74.147 78.843 15.012  1.00 81.64  ? 40   HIS E N   1 
ATOM   5328  C CA  . HIS E  1 13  ? 72.784 78.841 14.504  1.00 79.68  ? 40   HIS E CA  1 
ATOM   5329  C C   . HIS E  1 13  ? 72.253 77.442 14.196  1.00 78.51  ? 40   HIS E C   1 
ATOM   5330  O O   . HIS E  1 13  ? 71.171 77.299 13.615  1.00 79.10  ? 40   HIS E O   1 
ATOM   5331  C CB  . HIS E  1 13  ? 72.700 79.700 13.270  1.00 79.88  ? 40   HIS E CB  1 
ATOM   5332  N N   . GLU E  1 14  ? 73.023 76.417 14.560  1.00 76.59  ? 41   GLU E N   1 
ATOM   5333  C CA  . GLU E  1 14  ? 72.615 75.033 14.330  1.00 73.52  ? 41   GLU E CA  1 
ATOM   5334  C C   . GLU E  1 14  ? 72.187 74.387 15.651  1.00 70.04  ? 41   GLU E C   1 
ATOM   5335  O O   . GLU E  1 14  ? 71.810 73.218 15.699  1.00 68.93  ? 41   GLU E O   1 
ATOM   5336  C CB  . GLU E  1 14  ? 73.763 74.247 13.672  1.00 75.72  ? 41   GLU E CB  1 
ATOM   5337  C CG  . GLU E  1 14  ? 74.040 74.671 12.219  1.00 76.91  ? 41   GLU E CG  1 
ATOM   5338  C CD  . GLU E  1 14  ? 75.261 73.997 11.607  1.00 78.02  ? 41   GLU E CD  1 
ATOM   5339  O OE1 . GLU E  1 14  ? 75.294 72.747 11.546  1.00 78.45  ? 41   GLU E OE1 1 
ATOM   5340  O OE2 . GLU E  1 14  ? 76.188 74.723 11.177  1.00 78.86  ? 41   GLU E OE2 1 
ATOM   5341  N N   . PHE E  1 15  ? 72.256 75.178 16.718  1.00 65.87  ? 42   PHE E N   1 
ATOM   5342  C CA  . PHE E  1 15  ? 71.865 74.761 18.055  1.00 61.92  ? 42   PHE E CA  1 
ATOM   5343  C C   . PHE E  1 15  ? 70.538 75.421 18.411  1.00 60.05  ? 42   PHE E C   1 
ATOM   5344  O O   . PHE E  1 15  ? 70.108 76.363 17.743  1.00 60.18  ? 42   PHE E O   1 
ATOM   5345  C CB  . PHE E  1 15  ? 72.909 75.198 19.078  1.00 60.29  ? 42   PHE E CB  1 
ATOM   5346  C CG  . PHE E  1 15  ? 74.246 74.543 18.905  1.00 58.06  ? 42   PHE E CG  1 
ATOM   5347  C CD1 . PHE E  1 15  ? 75.163 75.027 17.979  1.00 55.49  ? 42   PHE E CD1 1 
ATOM   5348  C CD2 . PHE E  1 15  ? 74.604 73.459 19.702  1.00 56.99  ? 42   PHE E CD2 1 
ATOM   5349  C CE1 . PHE E  1 15  ? 76.419 74.447 17.858  1.00 53.91  ? 42   PHE E CE1 1 
ATOM   5350  C CE2 . PHE E  1 15  ? 75.858 72.872 19.585  1.00 55.03  ? 42   PHE E CE2 1 
ATOM   5351  C CZ  . PHE E  1 15  ? 76.768 73.368 18.663  1.00 53.50  ? 42   PHE E CZ  1 
ATOM   5352  N N   . LYS E  1 16  ? 69.901 74.925 19.468  1.00 57.39  ? 43   LYS E N   1 
ATOM   5353  C CA  . LYS E  1 16  ? 68.633 75.465 19.946  1.00 55.26  ? 43   LYS E CA  1 
ATOM   5354  C C   . LYS E  1 16  ? 68.903 76.288 21.206  1.00 55.17  ? 43   LYS E C   1 
ATOM   5355  O O   . LYS E  1 16  ? 69.223 75.743 22.260  1.00 54.61  ? 43   LYS E O   1 
ATOM   5356  C CB  . LYS E  1 16  ? 67.684 74.321 20.265  1.00 53.61  ? 43   LYS E CB  1 
ATOM   5357  C CG  . LYS E  1 16  ? 66.396 74.711 20.944  1.00 52.43  ? 43   LYS E CG  1 
ATOM   5358  C CD  . LYS E  1 16  ? 65.710 73.443 21.400  1.00 51.06  ? 43   LYS E CD  1 
ATOM   5359  C CE  . LYS E  1 16  ? 64.535 73.710 22.287  1.00 51.03  ? 43   LYS E CE  1 
ATOM   5360  N NZ  . LYS E  1 16  ? 64.078 72.416 22.874  1.00 53.52  ? 43   LYS E NZ  1 
ATOM   5361  N N   . LYS E  1 17  ? 68.765 77.605 21.083  1.00 55.22  ? 44   LYS E N   1 
ATOM   5362  C CA  . LYS E  1 17  ? 69.008 78.535 22.183  1.00 54.04  ? 44   LYS E CA  1 
ATOM   5363  C C   . LYS E  1 17  ? 67.924 78.574 23.252  1.00 53.24  ? 44   LYS E C   1 
ATOM   5364  O O   . LYS E  1 17  ? 66.727 78.519 22.955  1.00 52.31  ? 44   LYS E O   1 
ATOM   5365  C CB  . LYS E  1 17  ? 69.223 79.943 21.628  1.00 53.16  ? 44   LYS E CB  1 
ATOM   5366  N N   . SER E  1 18  ? 68.370 78.679 24.498  1.00 52.21  ? 45   SER E N   1 
ATOM   5367  C CA  . SER E  1 18  ? 67.472 78.774 25.627  1.00 53.23  ? 45   SER E CA  1 
ATOM   5368  C C   . SER E  1 18  ? 68.007 79.834 26.582  1.00 55.31  ? 45   SER E C   1 
ATOM   5369  O O   . SER E  1 18  ? 68.703 79.532 27.564  1.00 57.89  ? 45   SER E O   1 
ATOM   5370  C CB  . SER E  1 18  ? 67.353 77.428 26.322  1.00 52.85  ? 45   SER E CB  1 
ATOM   5371  O OG  . SER E  1 18  ? 66.682 76.508 25.482  1.00 53.24  ? 45   SER E OG  1 
ATOM   5372  N N   . ALA E  1 19  ? 67.668 81.085 26.275  1.00 54.93  ? 46   ALA E N   1 
ATOM   5373  C CA  . ALA E  1 19  ? 68.102 82.240 27.046  1.00 54.02  ? 46   ALA E CA  1 
ATOM   5374  C C   . ALA E  1 19  ? 68.014 82.070 28.545  1.00 53.26  ? 46   ALA E C   1 
ATOM   5375  O O   . ALA E  1 19  ? 67.238 81.274 29.061  1.00 52.65  ? 46   ALA E O   1 
ATOM   5376  C CB  . ALA E  1 19  ? 67.309 83.461 26.625  1.00 54.04  ? 46   ALA E CB  1 
ATOM   5377  N N   . LYS E  1 20  ? 68.828 82.839 29.237  1.00 53.60  ? 47   LYS E N   1 
ATOM   5378  C CA  . LYS E  1 20  ? 68.826 82.803 30.674  1.00 55.41  ? 47   LYS E CA  1 
ATOM   5379  C C   . LYS E  1 20  ? 68.642 81.393 31.231  1.00 56.99  ? 47   LYS E C   1 
ATOM   5380  O O   . LYS E  1 20  ? 67.753 81.164 32.056  1.00 57.71  ? 47   LYS E O   1 
ATOM   5381  C CB  . LYS E  1 20  ? 67.733 83.727 31.198  1.00 54.53  ? 47   LYS E CB  1 
ATOM   5382  N N   . THR E  1 21  ? 69.474 80.451 30.784  1.00 58.13  ? 48   THR E N   1 
ATOM   5383  C CA  . THR E  1 21  ? 69.395 79.084 31.293  1.00 59.24  ? 48   THR E CA  1 
ATOM   5384  C C   . THR E  1 21  ? 70.760 78.407 31.374  1.00 60.94  ? 48   THR E C   1 
ATOM   5385  O O   . THR E  1 21  ? 71.729 78.848 30.760  1.00 60.53  ? 48   THR E O   1 
ATOM   5386  C CB  . THR E  1 21  ? 68.484 78.201 30.415  1.00 58.17  ? 48   THR E CB  1 
ATOM   5387  O OG1 . THR E  1 21  ? 67.253 78.884 30.165  1.00 57.70  ? 48   THR E OG1 1 
ATOM   5388  C CG2 . THR E  1 21  ? 68.180 76.876 31.120  1.00 57.14  ? 48   THR E CG2 1 
ATOM   5389  N N   . THR E  1 22  ? 70.815 77.333 32.150  1.00 63.15  ? 49   THR E N   1 
ATOM   5390  C CA  . THR E  1 22  ? 72.020 76.541 32.310  1.00 65.80  ? 49   THR E CA  1 
ATOM   5391  C C   . THR E  1 22  ? 71.609 75.187 32.859  1.00 68.14  ? 49   THR E C   1 
ATOM   5392  O O   . THR E  1 22  ? 70.454 74.985 33.277  1.00 68.76  ? 49   THR E O   1 
ATOM   5393  C CB  . THR E  1 22  ? 73.023 77.189 33.274  1.00 65.60  ? 49   THR E CB  1 
ATOM   5394  O OG1 . THR E  1 22  ? 74.212 76.390 33.332  1.00 66.28  ? 49   THR E OG1 1 
ATOM   5395  C CG2 . THR E  1 22  ? 72.429 77.290 34.668  1.00 66.44  ? 49   THR E CG2 1 
ATOM   5396  N N   . LEU E  1 23  ? 72.555 74.258 32.826  1.00 70.06  ? 50   LEU E N   1 
ATOM   5397  C CA  . LEU E  1 23  ? 72.307 72.918 33.312  1.00 71.86  ? 50   LEU E CA  1 
ATOM   5398  C C   . LEU E  1 23  ? 73.100 72.695 34.596  1.00 73.29  ? 50   LEU E C   1 
ATOM   5399  O O   . LEU E  1 23  ? 74.154 73.306 34.811  1.00 72.73  ? 50   LEU E O   1 
ATOM   5400  C CB  . LEU E  1 23  ? 72.698 71.902 32.240  1.00 71.54  ? 50   LEU E CB  1 
ATOM   5401  N N   . ILE E  1 24  ? 72.575 71.834 35.457  1.00 75.24  ? 51   ILE E N   1 
ATOM   5402  C CA  . ILE E  1 24  ? 73.230 71.524 36.716  1.00 77.80  ? 51   ILE E CA  1 
ATOM   5403  C C   . ILE E  1 24  ? 73.220 70.016 36.865  1.00 79.42  ? 51   ILE E C   1 
ATOM   5404  O O   . ILE E  1 24  ? 72.171 69.388 36.766  1.00 79.89  ? 51   ILE E O   1 
ATOM   5405  C CB  . ILE E  1 24  ? 72.478 72.177 37.876  1.00 77.69  ? 51   ILE E CB  1 
ATOM   5406  N N   . LYS E  1 25  ? 74.383 69.431 37.106  1.00 81.52  ? 52   LYS E N   1 
ATOM   5407  C CA  . LYS E  1 25  ? 74.460 67.988 37.245  1.00 84.40  ? 52   LYS E CA  1 
ATOM   5408  C C   . LYS E  1 25  ? 74.137 67.485 38.648  1.00 86.90  ? 52   LYS E C   1 
ATOM   5409  O O   . LYS E  1 25  ? 74.889 67.728 39.595  1.00 86.87  ? 52   LYS E O   1 
ATOM   5410  C CB  . LYS E  1 25  ? 75.840 67.504 36.827  1.00 84.31  ? 52   LYS E CB  1 
ATOM   5411  N N   . ILE E  1 26  ? 73.006 66.793 38.775  1.00 89.86  ? 53   ILE E N   1 
ATOM   5412  C CA  . ILE E  1 26  ? 72.595 66.208 40.051  1.00 92.36  ? 53   ILE E CA  1 
ATOM   5413  C C   . ILE E  1 26  ? 73.505 64.991 40.203  1.00 94.33  ? 53   ILE E C   1 
ATOM   5414  O O   . ILE E  1 26  ? 74.038 64.709 41.281  1.00 94.78  ? 53   ILE E O   1 
ATOM   5415  C CB  . ILE E  1 26  ? 71.125 65.767 39.990  1.00 92.10  ? 53   ILE E CB  1 
ATOM   5416  N N   . ASP E  1 27  ? 73.675 64.288 39.085  1.00 95.95  ? 54   ASP E N   1 
ATOM   5417  C CA  . ASP E  1 27  ? 74.520 63.106 38.994  1.00 96.83  ? 54   ASP E CA  1 
ATOM   5418  C C   . ASP E  1 27  ? 75.971 63.596 39.070  1.00 97.01  ? 54   ASP E C   1 
ATOM   5419  O O   . ASP E  1 27  ? 76.409 64.401 38.246  1.00 97.13  ? 54   ASP E O   1 
ATOM   5420  C CB  . ASP E  1 27  ? 74.271 62.408 37.650  1.00 97.76  ? 54   ASP E CB  1 
ATOM   5421  C CG  . ASP E  1 27  ? 74.695 60.951 37.650  1.00 98.47  ? 54   ASP E CG  1 
ATOM   5422  O OD1 . ASP E  1 27  ? 75.850 60.659 38.034  1.00 99.05  ? 54   ASP E OD1 1 
ATOM   5423  O OD2 . ASP E  1 27  ? 73.869 60.098 37.254  1.00 98.49  ? 54   ASP E OD2 1 
ATOM   5424  N N   . PRO E  1 28  ? 76.729 63.127 40.070  1.00 97.00  ? 55   PRO E N   1 
ATOM   5425  C CA  . PRO E  1 28  ? 78.129 63.533 40.233  1.00 97.06  ? 55   PRO E CA  1 
ATOM   5426  C C   . PRO E  1 28  ? 79.044 62.817 39.242  1.00 96.85  ? 55   PRO E C   1 
ATOM   5427  O O   . PRO E  1 28  ? 80.205 63.193 39.064  1.00 96.79  ? 55   PRO E O   1 
ATOM   5428  C CB  . PRO E  1 28  ? 78.429 63.120 41.664  1.00 97.25  ? 55   PRO E CB  1 
ATOM   5429  C CG  . PRO E  1 28  ? 77.673 61.820 41.758  1.00 96.85  ? 55   PRO E CG  1 
ATOM   5430  C CD  . PRO E  1 28  ? 76.336 62.175 41.125  1.00 96.74  ? 55   PRO E CD  1 
ATOM   5431  N N   . ALA E  1 29  ? 78.503 61.783 38.603  1.00 96.33  ? 56   ALA E N   1 
ATOM   5432  C CA  . ALA E  1 29  ? 79.251 60.974 37.648  1.00 95.76  ? 56   ALA E CA  1 
ATOM   5433  C C   . ALA E  1 29  ? 79.337 61.534 36.219  1.00 95.54  ? 56   ALA E C   1 
ATOM   5434  O O   . ALA E  1 29  ? 80.174 61.086 35.426  1.00 95.62  ? 56   ALA E O   1 
ATOM   5435  C CB  . ALA E  1 29  ? 78.674 59.568 37.621  1.00 95.15  ? 56   ALA E CB  1 
ATOM   5436  N N   . LEU E  1 30  ? 78.483 62.500 35.881  1.00 94.79  ? 57   LEU E N   1 
ATOM   5437  C CA  . LEU E  1 30  ? 78.507 63.091 34.543  1.00 93.20  ? 57   LEU E CA  1 
ATOM   5438  C C   . LEU E  1 30  ? 79.697 64.035 34.409  1.00 91.91  ? 57   LEU E C   1 
ATOM   5439  O O   . LEU E  1 30  ? 79.803 65.029 35.131  1.00 92.09  ? 57   LEU E O   1 
ATOM   5440  C CB  . LEU E  1 30  ? 77.194 63.839 34.266  1.00 93.01  ? 57   LEU E CB  1 
ATOM   5441  N N   . LYS E  1 31  ? 80.600 63.713 33.490  1.00 90.37  ? 58   LYS E N   1 
ATOM   5442  C CA  . LYS E  1 31  ? 81.790 64.533 33.266  1.00 88.77  ? 58   LYS E CA  1 
ATOM   5443  C C   . LYS E  1 31  ? 81.406 65.877 32.658  1.00 87.31  ? 58   LYS E C   1 
ATOM   5444  O O   . LYS E  1 31  ? 80.284 66.053 32.195  1.00 87.63  ? 58   LYS E O   1 
ATOM   5445  C CB  . LYS E  1 31  ? 82.758 63.798 32.336  1.00 89.19  ? 58   LYS E CB  1 
ATOM   5446  N N   . ILE E  1 32  ? 82.339 66.822 32.680  1.00 85.10  ? 59   ILE E N   1 
ATOM   5447  C CA  . ILE E  1 32  ? 82.118 68.150 32.120  1.00 83.22  ? 59   ILE E CA  1 
ATOM   5448  C C   . ILE E  1 32  ? 83.461 68.717 31.699  1.00 81.27  ? 59   ILE E C   1 
ATOM   5449  O O   . ILE E  1 32  ? 84.497 68.119 31.959  1.00 81.10  ? 59   ILE E O   1 
ATOM   5450  C CB  . ILE E  1 32  ? 81.465 69.118 33.159  1.00 84.05  ? 59   ILE E CB  1 
ATOM   5451  C CG1 . ILE E  1 32  ? 80.044 68.648 33.488  1.00 84.85  ? 59   ILE E CG1 1 
ATOM   5452  C CG2 . ILE E  1 32  ? 81.418 70.553 32.611  1.00 83.39  ? 59   ILE E CG2 1 
ATOM   5453  C CD1 . ILE E  1 32  ? 79.275 69.573 34.434  1.00 86.06  ? 59   ILE E CD1 1 
ATOM   5454  N N   . LYS E  1 33  ? 83.432 69.863 31.034  1.00 79.59  ? 60   LYS E N   1 
ATOM   5455  C CA  . LYS E  1 33  ? 84.640 70.526 30.595  1.00 78.21  ? 60   LYS E CA  1 
ATOM   5456  C C   . LYS E  1 33  ? 84.303 71.996 30.493  1.00 77.92  ? 60   LYS E C   1 
ATOM   5457  O O   . LYS E  1 33  ? 83.140 72.361 30.348  1.00 77.27  ? 60   LYS E O   1 
ATOM   5458  C CB  . LYS E  1 33  ? 85.082 69.986 29.253  1.00 77.74  ? 60   LYS E CB  1 
ATOM   5459  N N   . THR E  1 34  ? 85.321 72.839 30.601  1.00 78.90  ? 61   THR E N   1 
ATOM   5460  C CA  . THR E  1 34  ? 85.139 74.288 30.508  1.00 80.24  ? 61   THR E CA  1 
ATOM   5461  C C   . THR E  1 34  ? 86.415 74.990 30.019  1.00 80.22  ? 61   THR E C   1 
ATOM   5462  O O   . THR E  1 34  ? 87.497 74.393 29.998  1.00 79.93  ? 61   THR E O   1 
ATOM   5463  C CB  . THR E  1 34  ? 84.766 74.899 31.878  1.00 81.03  ? 61   THR E CB  1 
ATOM   5464  O OG1 . THR E  1 34  ? 85.869 74.747 32.783  1.00 81.49  ? 61   THR E OG1 1 
ATOM   5465  C CG2 . THR E  1 34  ? 83.542 74.206 32.463  1.00 81.20  ? 61   THR E CG2 1 
ATOM   5466  N N   . LYS E  1 35  ? 86.281 76.257 29.629  1.00 80.19  ? 62   LYS E N   1 
ATOM   5467  C CA  . LYS E  1 35  ? 87.411 77.060 29.160  1.00 80.57  ? 62   LYS E CA  1 
ATOM   5468  C C   . LYS E  1 35  ? 86.907 78.452 28.823  1.00 81.14  ? 62   LYS E C   1 
ATOM   5469  O O   . LYS E  1 35  ? 85.962 78.604 28.053  1.00 80.94  ? 62   LYS E O   1 
ATOM   5470  C CB  . LYS E  1 35  ? 88.051 76.426 27.932  1.00 80.22  ? 62   LYS E CB  1 
ATOM   5471  N N   . LYS E  1 36  ? 87.546 79.464 29.404  1.00 82.02  ? 63   LYS E N   1 
ATOM   5472  C CA  . LYS E  1 36  ? 87.179 80.867 29.189  1.00 82.29  ? 63   LYS E CA  1 
ATOM   5473  C C   . LYS E  1 36  ? 87.561 81.370 27.788  1.00 82.32  ? 63   LYS E C   1 
ATOM   5474  O O   . LYS E  1 36  ? 88.735 81.341 27.421  1.00 82.18  ? 63   LYS E O   1 
ATOM   5475  C CB  . LYS E  1 36  ? 87.847 81.730 30.254  1.00 81.75  ? 63   LYS E CB  1 
ATOM   5476  N N   . VAL E  1 37  ? 86.576 81.850 27.023  1.00 82.44  ? 64   VAL E N   1 
ATOM   5477  C CA  . VAL E  1 37  ? 86.813 82.336 25.666  1.00 83.41  ? 64   VAL E CA  1 
ATOM   5478  C C   . VAL E  1 37  ? 86.321 83.749 25.421  1.00 83.82  ? 64   VAL E C   1 
ATOM   5479  O O   . VAL E  1 37  ? 86.027 84.488 26.355  1.00 84.63  ? 64   VAL E O   1 
ATOM   5480  C CB  . VAL E  1 37  ? 86.145 81.417 24.630  1.00 84.21  ? 64   VAL E CB  1 
ATOM   5481  C CG1 . VAL E  1 37  ? 86.503 79.974 24.933  1.00 84.79  ? 64   VAL E CG1 1 
ATOM   5482  C CG2 . VAL E  1 37  ? 84.628 81.616 24.642  1.00 84.54  ? 64   VAL E CG2 1 
ATOM   5483  N N   . ASN E  1 38  ? 86.233 84.107 24.146  1.00 84.55  ? 65   ASN E N   1 
ATOM   5484  C CA  . ASN E  1 38  ? 85.792 85.432 23.750  1.00 85.85  ? 65   ASN E CA  1 
ATOM   5485  C C   . ASN E  1 38  ? 84.298 85.492 23.472  1.00 87.15  ? 65   ASN E C   1 
ATOM   5486  O O   . ASN E  1 38  ? 83.570 86.219 24.145  1.00 86.99  ? 65   ASN E O   1 
ATOM   5487  C CB  . ASN E  1 38  ? 86.563 85.884 22.526  1.00 85.53  ? 65   ASN E CB  1 
ATOM   5488  N N   . THR E  1 39  ? 83.846 84.719 22.486  1.00 88.56  ? 66   THR E N   1 
ATOM   5489  C CA  . THR E  1 39  ? 82.436 84.691 22.094  1.00 89.75  ? 66   THR E CA  1 
ATOM   5490  C C   . THR E  1 39  ? 81.805 83.307 22.257  1.00 89.43  ? 66   THR E C   1 
ATOM   5491  O O   . THR E  1 39  ? 82.509 82.297 22.324  1.00 89.20  ? 66   THR E O   1 
ATOM   5492  C CB  . THR E  1 39  ? 82.283 85.126 20.627  1.00 90.65  ? 66   THR E CB  1 
ATOM   5493  O OG1 . THR E  1 39  ? 82.967 84.189 19.782  1.00 91.61  ? 66   THR E OG1 1 
ATOM   5494  C CG2 . THR E  1 39  ? 82.885 86.515 20.427  1.00 91.12  ? 66   THR E CG2 1 
ATOM   5495  N N   . ALA E  1 40  ? 80.477 83.269 22.328  1.00 88.98  ? 67   ALA E N   1 
ATOM   5496  C CA  . ALA E  1 40  ? 79.768 82.006 22.467  1.00 87.88  ? 67   ALA E CA  1 
ATOM   5497  C C   . ALA E  1 40  ? 80.044 81.171 21.219  1.00 87.23  ? 67   ALA E C   1 
ATOM   5498  O O   . ALA E  1 40  ? 80.065 79.944 21.275  1.00 86.32  ? 67   ALA E O   1 
ATOM   5499  C CB  . ALA E  1 40  ? 78.269 82.259 22.628  1.00 87.52  ? 67   ALA E CB  1 
ATOM   5500  N N   . ASP E  1 41  ? 80.270 81.852 20.096  1.00 86.98  ? 68   ASP E N   1 
ATOM   5501  C CA  . ASP E  1 41  ? 80.564 81.191 18.827  1.00 86.71  ? 68   ASP E CA  1 
ATOM   5502  C C   . ASP E  1 41  ? 81.697 80.193 19.031  1.00 86.32  ? 68   ASP E C   1 
ATOM   5503  O O   . ASP E  1 41  ? 81.680 79.096 18.475  1.00 85.40  ? 68   ASP E O   1 
ATOM   5504  C CB  . ASP E  1 41  ? 80.979 82.228 17.789  1.00 86.75  ? 68   ASP E CB  1 
ATOM   5505  C CG  . ASP E  1 41  ? 80.020 83.395 17.728  1.00 87.88  ? 68   ASP E CG  1 
ATOM   5506  O OD1 . ASP E  1 41  ? 78.884 83.210 17.239  1.00 87.91  ? 68   ASP E OD1 1 
ATOM   5507  O OD2 . ASP E  1 41  ? 80.401 84.495 18.183  1.00 88.19  ? 68   ASP E OD2 1 
ATOM   5508  N N   . GLN E  1 42  ? 82.665 80.599 19.854  1.00 86.79  ? 69   GLN E N   1 
ATOM   5509  C CA  . GLN E  1 42  ? 83.852 79.807 20.196  1.00 87.21  ? 69   GLN E CA  1 
ATOM   5510  C C   . GLN E  1 42  ? 83.476 78.505 20.887  1.00 86.88  ? 69   GLN E C   1 
ATOM   5511  O O   . GLN E  1 42  ? 84.143 77.477 20.745  1.00 87.66  ? 69   GLN E O   1 
ATOM   5512  C CB  . GLN E  1 42  ? 84.779 80.626 21.108  1.00 87.09  ? 69   GLN E CB  1 
ATOM   5513  N N   . CYS E  1 43  ? 82.412 78.569 21.666  1.00 85.87  ? 70   CYS E N   1 
ATOM   5514  C CA  . CYS E  1 43  ? 81.920 77.402 22.368  1.00 84.61  ? 70   CYS E CA  1 
ATOM   5515  C C   . CYS E  1 43  ? 81.245 76.494 21.350  1.00 83.21  ? 70   CYS E C   1 
ATOM   5516  O O   . CYS E  1 43  ? 81.413 75.277 21.382  1.00 82.30  ? 70   CYS E O   1 
ATOM   5517  C CB  . CYS E  1 43  ? 80.890 77.825 23.413  1.00 85.48  ? 70   CYS E CB  1 
ATOM   5518  S SG  . CYS E  1 43  ? 81.428 79.068 24.638  1.00 84.91  ? 70   CYS E SG  1 
ATOM   5519  N N   . ALA E  1 44  ? 80.479 77.118 20.454  1.00 81.90  ? 71   ALA E N   1 
ATOM   5520  C CA  . ALA E  1 44  ? 79.734 76.418 19.417  1.00 80.35  ? 71   ALA E CA  1 
ATOM   5521  C C   . ALA E  1 44  ? 80.626 75.601 18.495  1.00 79.47  ? 71   ALA E C   1 
ATOM   5522  O O   . ALA E  1 44  ? 80.528 74.371 18.445  1.00 79.17  ? 71   ALA E O   1 
ATOM   5523  C CB  . ALA E  1 44  ? 78.921 77.420 18.598  1.00 79.96  ? 71   ALA E CB  1 
ATOM   5524  N N   . ASP E  1 45  ? 81.488 76.288 17.753  1.00 78.12  ? 72   ASP E N   1 
ATOM   5525  C CA  . ASP E  1 45  ? 82.382 75.627 16.812  1.00 75.06  ? 72   ASP E CA  1 
ATOM   5526  C C   . ASP E  1 45  ? 83.182 74.500 17.438  1.00 72.63  ? 72   ASP E C   1 
ATOM   5527  O O   . ASP E  1 45  ? 83.357 73.465 16.811  1.00 72.53  ? 72   ASP E O   1 
ATOM   5528  C CB  . ASP E  1 45  ? 83.290 76.663 16.161  1.00 75.29  ? 72   ASP E CB  1 
ATOM   5529  C CG  . ASP E  1 45  ? 82.506 77.647 15.304  1.00 76.43  ? 72   ASP E CG  1 
ATOM   5530  O OD1 . ASP E  1 45  ? 82.988 78.725 14.959  1.00 78.33  ? 72   ASP E OD1 1 
ATOM   5531  O OD2 . ASP E  1 45  ? 81.285 77.269 14.952  1.00 75.89  ? 72   ASP E OD2 1 
ATOM   5532  N N   . ARG E  1 46  ? 83.653 74.676 18.668  1.00 70.28  ? 73   ARG E N   1 
ATOM   5533  C CA  . ARG E  1 46  ? 84.406 73.602 19.311  1.00 69.30  ? 73   ARG E CA  1 
ATOM   5534  C C   . ARG E  1 46  ? 83.509 72.421 19.659  1.00 68.51  ? 73   ARG E C   1 
ATOM   5535  O O   . ARG E  1 46  ? 83.965 71.280 19.710  1.00 69.78  ? 73   ARG E O   1 
ATOM   5536  C CB  . ARG E  1 46  ? 85.107 74.069 20.593  1.00 68.93  ? 73   ARG E CB  1 
ATOM   5537  C CG  . ARG E  1 46  ? 85.685 72.896 21.411  1.00 68.04  ? 73   ARG E CG  1 
ATOM   5538  C CD  . ARG E  1 46  ? 86.624 73.348 22.507  1.00 68.19  ? 73   ARG E CD  1 
ATOM   5539  N NE  . ARG E  1 46  ? 87.177 72.233 23.276  1.00 68.38  ? 73   ARG E NE  1 
ATOM   5540  C CZ  . ARG E  1 46  ? 88.197 72.353 24.125  1.00 69.37  ? 73   ARG E CZ  1 
ATOM   5541  N NH1 . ARG E  1 46  ? 88.774 73.536 24.303  1.00 69.32  ? 73   ARG E NH1 1 
ATOM   5542  N NH2 . ARG E  1 46  ? 88.637 71.300 24.807  1.00 69.06  ? 73   ARG E NH2 1 
ATOM   5543  N N   . CYS E  1 47  ? 82.237 72.696 19.915  1.00 66.49  ? 74   CYS E N   1 
ATOM   5544  C CA  . CYS E  1 47  ? 81.289 71.647 20.254  1.00 63.42  ? 74   CYS E CA  1 
ATOM   5545  C C   . CYS E  1 47  ? 80.893 70.922 18.976  1.00 62.73  ? 74   CYS E C   1 
ATOM   5546  O O   . CYS E  1 47  ? 80.858 69.695 18.941  1.00 63.02  ? 74   CYS E O   1 
ATOM   5547  C CB  . CYS E  1 47  ? 80.066 72.260 20.922  1.00 61.73  ? 74   CYS E CB  1 
ATOM   5548  S SG  . CYS E  1 47  ? 78.733 71.108 21.352  1.00 57.01  ? 74   CYS E SG  1 
ATOM   5549  N N   . THR E  1 48  ? 80.612 71.684 17.923  1.00 61.39  ? 75   THR E N   1 
ATOM   5550  C CA  . THR E  1 48  ? 80.232 71.090 16.651  1.00 61.95  ? 75   THR E CA  1 
ATOM   5551  C C   . THR E  1 48  ? 81.340 70.145 16.211  1.00 62.73  ? 75   THR E C   1 
ATOM   5552  O O   . THR E  1 48  ? 81.082 69.005 15.817  1.00 63.86  ? 75   THR E O   1 
ATOM   5553  C CB  . THR E  1 48  ? 80.047 72.157 15.564  1.00 61.16  ? 75   THR E CB  1 
ATOM   5554  O OG1 . THR E  1 48  ? 79.307 73.256 16.099  1.00 61.29  ? 75   THR E OG1 1 
ATOM   5555  C CG2 . THR E  1 48  ? 79.277 71.587 14.385  1.00 61.08  ? 75   THR E CG2 1 
ATOM   5556  N N   . ARG E  1 49  ? 82.574 70.641 16.295  1.00 62.64  ? 76   ARG E N   1 
ATOM   5557  C CA  . ARG E  1 49  ? 83.767 69.891 15.932  1.00 61.53  ? 76   ARG E CA  1 
ATOM   5558  C C   . ARG E  1 49  ? 84.221 68.998 17.071  1.00 60.40  ? 76   ARG E C   1 
ATOM   5559  O O   . ARG E  1 49  ? 85.311 68.450 17.032  1.00 60.09  ? 76   ARG E O   1 
ATOM   5560  C CB  . ARG E  1 49  ? 84.885 70.854 15.544  1.00 63.38  ? 76   ARG E CB  1 
ATOM   5561  C CG  . ARG E  1 49  ? 84.619 71.544 14.214  1.00 67.46  ? 76   ARG E CG  1 
ATOM   5562  C CD  . ARG E  1 49  ? 85.044 73.011 14.203  1.00 71.41  ? 76   ARG E CD  1 
ATOM   5563  N NE  . ARG E  1 49  ? 86.170 73.277 13.305  1.00 74.75  ? 76   ARG E NE  1 
ATOM   5564  C CZ  . ARG E  1 49  ? 87.434 72.928 13.549  1.00 76.49  ? 76   ARG E CZ  1 
ATOM   5565  N NH1 . ARG E  1 49  ? 87.759 72.291 14.671  1.00 76.66  ? 76   ARG E NH1 1 
ATOM   5566  N NH2 . ARG E  1 49  ? 88.379 73.224 12.666  1.00 77.49  ? 76   ARG E NH2 1 
ATOM   5567  N N   . ASN E  1 50  ? 83.364 68.855 18.077  1.00 60.14  ? 77   ASN E N   1 
ATOM   5568  C CA  . ASN E  1 50  ? 83.626 68.026 19.249  1.00 59.94  ? 77   ASN E CA  1 
ATOM   5569  C C   . ASN E  1 50  ? 85.124 67.908 19.546  1.00 60.65  ? 77   ASN E C   1 
ATOM   5570  O O   . ASN E  1 50  ? 85.603 66.865 19.990  1.00 62.08  ? 77   ASN E O   1 
ATOM   5571  C CB  . ASN E  1 50  ? 83.015 66.641 19.036  1.00 59.83  ? 77   ASN E CB  1 
ATOM   5572  C CG  . ASN E  1 50  ? 82.762 65.905 20.343  1.00 61.38  ? 77   ASN E CG  1 
ATOM   5573  O OD1 . ASN E  1 50  ? 81.623 65.770 20.789  1.00 61.94  ? 77   ASN E OD1 1 
ATOM   5574  N ND2 . ASN E  1 50  ? 83.829 65.432 20.969  1.00 61.51  ? 77   ASN E ND2 1 
ATOM   5575  N N   . LYS E  1 51  ? 85.854 68.998 19.323  1.00 60.85  ? 78   LYS E N   1 
ATOM   5576  C CA  . LYS E  1 51  ? 87.302 69.028 19.541  1.00 60.77  ? 78   LYS E CA  1 
ATOM   5577  C C   . LYS E  1 51  ? 87.739 69.146 21.009  1.00 60.61  ? 78   LYS E C   1 
ATOM   5578  O O   . LYS E  1 51  ? 87.279 70.016 21.756  1.00 60.68  ? 78   LYS E O   1 
ATOM   5579  C CB  . LYS E  1 51  ? 87.931 70.168 18.713  1.00 59.83  ? 78   LYS E CB  1 
ATOM   5580  N N   . GLY E  1 52  ? 88.633 68.253 21.415  1.00 60.20  ? 79   GLY E N   1 
ATOM   5581  C CA  . GLY E  1 52  ? 89.141 68.283 22.771  1.00 59.13  ? 79   GLY E CA  1 
ATOM   5582  C C   . GLY E  1 52  ? 88.163 67.924 23.868  1.00 58.99  ? 79   GLY E C   1 
ATOM   5583  O O   . GLY E  1 52  ? 88.363 68.278 25.023  1.00 58.98  ? 79   GLY E O   1 
ATOM   5584  N N   . LEU E  1 53  ? 87.110 67.202 23.529  1.00 59.33  ? 80   LEU E N   1 
ATOM   5585  C CA  . LEU E  1 53  ? 86.134 66.850 24.538  1.00 61.16  ? 80   LEU E CA  1 
ATOM   5586  C C   . LEU E  1 53  ? 86.055 65.344 24.699  1.00 61.82  ? 80   LEU E C   1 
ATOM   5587  O O   . LEU E  1 53  ? 85.641 64.639 23.788  1.00 62.91  ? 80   LEU E O   1 
ATOM   5588  C CB  . LEU E  1 53  ? 84.765 67.418 24.150  1.00 62.84  ? 80   LEU E CB  1 
ATOM   5589  C CG  . LEU E  1 53  ? 84.784 68.905 23.772  1.00 63.63  ? 80   LEU E CG  1 
ATOM   5590  C CD1 . LEU E  1 53  ? 83.432 69.333 23.243  1.00 63.20  ? 80   LEU E CD1 1 
ATOM   5591  C CD2 . LEU E  1 53  ? 85.179 69.728 24.984  1.00 63.61  ? 80   LEU E CD2 1 
ATOM   5592  N N   . PRO E  1 54  ? 86.459 64.830 25.870  1.00 62.48  ? 81   PRO E N   1 
ATOM   5593  C CA  . PRO E  1 54  ? 86.448 63.396 26.195  1.00 62.30  ? 81   PRO E CA  1 
ATOM   5594  C C   . PRO E  1 54  ? 85.050 62.778 26.224  1.00 62.81  ? 81   PRO E C   1 
ATOM   5595  O O   . PRO E  1 54  ? 84.796 61.836 26.982  1.00 62.91  ? 81   PRO E O   1 
ATOM   5596  C CB  . PRO E  1 54  ? 87.122 63.351 27.563  1.00 61.52  ? 81   PRO E CB  1 
ATOM   5597  C CG  . PRO E  1 54  ? 86.736 64.660 28.165  1.00 61.67  ? 81   PRO E CG  1 
ATOM   5598  C CD  . PRO E  1 54  ? 86.952 65.616 27.013  1.00 62.24  ? 81   PRO E CD  1 
ATOM   5599  N N   . PHE E  1 55  ? 84.156 63.322 25.399  1.00 62.83  ? 82   PHE E N   1 
ATOM   5600  C CA  . PHE E  1 55  ? 82.774 62.857 25.289  1.00 61.63  ? 82   PHE E CA  1 
ATOM   5601  C C   . PHE E  1 55  ? 82.105 63.541 24.100  1.00 60.52  ? 82   PHE E C   1 
ATOM   5602  O O   . PHE E  1 55  ? 82.698 64.406 23.444  1.00 58.45  ? 82   PHE E O   1 
ATOM   5603  C CB  . PHE E  1 55  ? 81.998 63.166 26.584  1.00 62.32  ? 82   PHE E CB  1 
ATOM   5604  C CG  . PHE E  1 55  ? 82.065 64.611 27.008  1.00 62.63  ? 82   PHE E CG  1 
ATOM   5605  C CD1 . PHE E  1 55  ? 81.420 65.605 26.270  1.00 63.23  ? 82   PHE E CD1 1 
ATOM   5606  C CD2 . PHE E  1 55  ? 82.790 64.982 28.135  1.00 63.28  ? 82   PHE E CD2 1 
ATOM   5607  C CE1 . PHE E  1 55  ? 81.497 66.948 26.645  1.00 63.44  ? 82   PHE E CE1 1 
ATOM   5608  C CE2 . PHE E  1 55  ? 82.876 66.323 28.520  1.00 64.69  ? 82   PHE E CE2 1 
ATOM   5609  C CZ  . PHE E  1 55  ? 82.226 67.308 27.770  1.00 64.54  ? 82   PHE E CZ  1 
ATOM   5610  N N   . THR E  1 56  ? 80.870 63.150 23.817  1.00 60.35  ? 83   THR E N   1 
ATOM   5611  C CA  . THR E  1 56  ? 80.136 63.759 22.717  1.00 60.79  ? 83   THR E CA  1 
ATOM   5612  C C   . THR E  1 56  ? 79.505 65.043 23.251  1.00 59.38  ? 83   THR E C   1 
ATOM   5613  O O   . THR E  1 56  ? 78.745 65.006 24.218  1.00 58.07  ? 83   THR E O   1 
ATOM   5614  C CB  . THR E  1 56  ? 79.003 62.843 22.213  1.00 62.21  ? 83   THR E CB  1 
ATOM   5615  O OG1 . THR E  1 56  ? 79.492 61.504 22.043  1.00 64.15  ? 83   THR E OG1 1 
ATOM   5616  C CG2 . THR E  1 56  ? 78.473 63.360 20.888  1.00 63.18  ? 83   THR E CG2 1 
ATOM   5617  N N   . CYS E  1 57  ? 79.826 66.177 22.638  1.00 57.90  ? 84   CYS E N   1 
ATOM   5618  C CA  . CYS E  1 57  ? 79.258 67.441 23.083  1.00 58.17  ? 84   CYS E CA  1 
ATOM   5619  C C   . CYS E  1 57  ? 77.801 67.572 22.637  1.00 58.31  ? 84   CYS E C   1 
ATOM   5620  O O   . CYS E  1 57  ? 77.529 67.999 21.519  1.00 58.32  ? 84   CYS E O   1 
ATOM   5621  C CB  . CYS E  1 57  ? 80.062 68.619 22.531  1.00 58.78  ? 84   CYS E CB  1 
ATOM   5622  S SG  . CYS E  1 57  ? 79.378 70.222 23.055  1.00 59.37  ? 84   CYS E SG  1 
ATOM   5623  N N   . LYS E  1 58  ? 76.872 67.218 23.519  1.00 58.04  ? 85   LYS E N   1 
ATOM   5624  C CA  . LYS E  1 58  ? 75.453 67.276 23.210  1.00 58.09  ? 85   LYS E CA  1 
ATOM   5625  C C   . LYS E  1 58  ? 74.857 68.658 23.441  1.00 59.85  ? 85   LYS E C   1 
ATOM   5626  O O   . LYS E  1 58  ? 73.811 69.004 22.876  1.00 59.76  ? 85   LYS E O   1 
ATOM   5627  C CB  . LYS E  1 58  ? 74.707 66.249 24.059  1.00 55.55  ? 85   LYS E CB  1 
ATOM   5628  C CG  . LYS E  1 58  ? 75.243 64.848 23.912  1.00 53.79  ? 85   LYS E CG  1 
ATOM   5629  C CD  . LYS E  1 58  ? 74.336 63.849 24.590  1.00 54.12  ? 85   LYS E CD  1 
ATOM   5630  C CE  . LYS E  1 58  ? 74.863 62.435 24.435  1.00 54.08  ? 85   LYS E CE  1 
ATOM   5631  N NZ  . LYS E  1 58  ? 73.970 61.434 25.082  1.00 54.95  ? 85   LYS E NZ  1 
ATOM   5632  N N   . ALA E  1 59  ? 75.520 69.449 24.274  1.00 62.02  ? 86   ALA E N   1 
ATOM   5633  C CA  . ALA E  1 59  ? 75.031 70.785 24.596  1.00 64.55  ? 86   ALA E CA  1 
ATOM   5634  C C   . ALA E  1 59  ? 76.117 71.591 25.289  1.00 65.78  ? 86   ALA E C   1 
ATOM   5635  O O   . ALA E  1 59  ? 77.052 71.033 25.868  1.00 66.63  ? 86   ALA E O   1 
ATOM   5636  C CB  . ALA E  1 59  ? 73.799 70.687 25.510  1.00 64.73  ? 86   ALA E CB  1 
ATOM   5637  N N   . PHE E  1 60  ? 75.987 72.909 25.236  1.00 66.73  ? 87   PHE E N   1 
ATOM   5638  C CA  . PHE E  1 60  ? 76.954 73.777 25.877  1.00 67.68  ? 87   PHE E CA  1 
ATOM   5639  C C   . PHE E  1 60  ? 76.291 75.064 26.360  1.00 70.43  ? 87   PHE E C   1 
ATOM   5640  O O   . PHE E  1 60  ? 75.337 75.558 25.758  1.00 70.25  ? 87   PHE E O   1 
ATOM   5641  C CB  . PHE E  1 60  ? 78.086 74.098 24.904  1.00 63.69  ? 87   PHE E CB  1 
ATOM   5642  C CG  . PHE E  1 60  ? 77.749 75.160 23.902  1.00 61.01  ? 87   PHE E CG  1 
ATOM   5643  C CD1 . PHE E  1 60  ? 77.711 76.500 24.269  1.00 61.17  ? 87   PHE E CD1 1 
ATOM   5644  C CD2 . PHE E  1 60  ? 77.496 74.830 22.585  1.00 59.89  ? 87   PHE E CD2 1 
ATOM   5645  C CE1 . PHE E  1 60  ? 77.428 77.491 23.333  1.00 61.09  ? 87   PHE E CE1 1 
ATOM   5646  C CE2 . PHE E  1 60  ? 77.211 75.817 21.640  1.00 59.52  ? 87   PHE E CE2 1 
ATOM   5647  C CZ  . PHE E  1 60  ? 77.179 77.147 22.012  1.00 59.66  ? 87   PHE E CZ  1 
ATOM   5648  N N   . VAL E  1 61  ? 76.807 75.602 27.454  1.00 73.95  ? 88   VAL E N   1 
ATOM   5649  C CA  . VAL E  1 61  ? 76.292 76.840 28.014  1.00 77.31  ? 88   VAL E CA  1 
ATOM   5650  C C   . VAL E  1 61  ? 77.370 77.903 27.915  1.00 78.62  ? 88   VAL E C   1 
ATOM   5651  O O   . VAL E  1 61  ? 78.561 77.604 28.013  1.00 79.32  ? 88   VAL E O   1 
ATOM   5652  C CB  . VAL E  1 61  ? 75.933 76.675 29.507  1.00 78.21  ? 88   VAL E CB  1 
ATOM   5653  C CG1 . VAL E  1 61  ? 75.583 78.026 30.113  1.00 79.32  ? 88   VAL E CG1 1 
ATOM   5654  C CG2 . VAL E  1 61  ? 74.771 75.711 29.663  1.00 80.09  ? 88   VAL E CG2 1 
ATOM   5655  N N   . PHE E  1 62  ? 76.958 79.144 27.707  1.00 80.33  ? 89   PHE E N   1 
ATOM   5656  C CA  . PHE E  1 62  ? 77.918 80.233 27.656  1.00 82.66  ? 89   PHE E CA  1 
ATOM   5657  C C   . PHE E  1 62  ? 77.600 81.195 28.803  1.00 82.68  ? 89   PHE E C   1 
ATOM   5658  O O   . PHE E  1 62  ? 76.477 81.673 28.925  1.00 82.52  ? 89   PHE E O   1 
ATOM   5659  C CB  . PHE E  1 62  ? 77.855 80.974 26.323  1.00 84.04  ? 89   PHE E CB  1 
ATOM   5660  C CG  . PHE E  1 62  ? 78.843 82.095 26.228  1.00 86.25  ? 89   PHE E CG  1 
ATOM   5661  C CD1 . PHE E  1 62  ? 80.211 81.847 26.374  1.00 86.35  ? 89   PHE E CD1 1 
ATOM   5662  C CD2 . PHE E  1 62  ? 78.411 83.399 26.025  1.00 87.30  ? 89   PHE E CD2 1 
ATOM   5663  C CE1 . PHE E  1 62  ? 81.136 82.881 26.319  1.00 87.36  ? 89   PHE E CE1 1 
ATOM   5664  C CE2 . PHE E  1 62  ? 79.327 84.445 25.967  1.00 88.87  ? 89   PHE E CE2 1 
ATOM   5665  C CZ  . PHE E  1 62  ? 80.695 84.186 26.115  1.00 88.84  ? 89   PHE E CZ  1 
ATOM   5666  N N   . ASP E  1 63  ? 78.590 81.475 29.644  1.00 82.64  ? 90   ASP E N   1 
ATOM   5667  C CA  . ASP E  1 63  ? 78.418 82.359 30.797  1.00 81.42  ? 90   ASP E CA  1 
ATOM   5668  C C   . ASP E  1 63  ? 78.853 83.793 30.466  1.00 80.80  ? 90   ASP E C   1 
ATOM   5669  O O   . ASP E  1 63  ? 79.960 84.183 30.808  1.00 81.25  ? 90   ASP E O   1 
ATOM   5670  C CB  . ASP E  1 63  ? 79.268 81.815 31.946  1.00 80.28  ? 90   ASP E CB  1 
ATOM   5671  C CG  . ASP E  1 63  ? 78.896 82.399 33.270  1.00 79.44  ? 90   ASP E CG  1 
ATOM   5672  O OD1 . ASP E  1 63  ? 78.367 83.526 33.294  1.00 79.61  ? 90   ASP E OD1 1 
ATOM   5673  O OD2 . ASP E  1 63  ? 79.147 81.734 34.292  1.00 78.91  ? 90   ASP E OD2 1 
ATOM   5674  N N   . LYS E  1 64  ? 77.993 84.569 29.811  1.00 80.30  ? 91   LYS E N   1 
ATOM   5675  C CA  . LYS E  1 64  ? 78.319 85.951 29.434  1.00 81.17  ? 91   LYS E CA  1 
ATOM   5676  C C   . LYS E  1 64  ? 79.040 86.774 30.510  1.00 81.47  ? 91   LYS E C   1 
ATOM   5677  O O   . LYS E  1 64  ? 79.654 87.814 30.217  1.00 80.69  ? 91   LYS E O   1 
ATOM   5678  C CB  . LYS E  1 64  ? 77.049 86.689 29.030  1.00 81.52  ? 91   LYS E CB  1 
ATOM   5679  C CG  . LYS E  1 64  ? 76.403 86.145 27.792  1.00 82.09  ? 91   LYS E CG  1 
ATOM   5680  C CD  . LYS E  1 64  ? 74.909 86.422 27.801  1.00 82.23  ? 91   LYS E CD  1 
ATOM   5681  C CE  . LYS E  1 64  ? 74.214 85.642 28.902  1.00 80.84  ? 91   LYS E CE  1 
ATOM   5682  N NZ  . LYS E  1 64  ? 72.751 85.886 28.882  1.00 81.94  ? 91   LYS E NZ  1 
ATOM   5683  N N   . ALA E  1 65  ? 78.950 86.311 31.752  1.00 81.27  ? 92   ALA E N   1 
ATOM   5684  C CA  . ALA E  1 65  ? 79.592 86.985 32.876  1.00 80.61  ? 92   ALA E CA  1 
ATOM   5685  C C   . ALA E  1 65  ? 81.095 86.699 32.866  1.00 79.95  ? 92   ALA E C   1 
ATOM   5686  O O   . ALA E  1 65  ? 81.910 87.604 32.665  1.00 79.62  ? 92   ALA E O   1 
ATOM   5687  C CB  . ALA E  1 65  ? 78.979 86.506 34.184  1.00 80.52  ? 92   ALA E CB  1 
ATOM   5688  N N   . ARG E  1 66  ? 81.435 85.428 33.085  1.00 78.79  ? 93   ARG E N   1 
ATOM   5689  C CA  . ARG E  1 66  ? 82.815 84.953 33.104  1.00 77.80  ? 93   ARG E CA  1 
ATOM   5690  C C   . ARG E  1 66  ? 83.334 84.721 31.692  1.00 77.63  ? 93   ARG E C   1 
ATOM   5691  O O   . ARG E  1 66  ? 84.525 84.470 31.499  1.00 78.49  ? 93   ARG E O   1 
ATOM   5692  C CB  . ARG E  1 66  ? 82.915 83.610 33.811  1.00 76.84  ? 93   ARG E CB  1 
ATOM   5693  C CG  . ARG E  1 66  ? 82.120 83.449 35.051  1.00 76.22  ? 93   ARG E CG  1 
ATOM   5694  C CD  . ARG E  1 66  ? 82.130 81.980 35.375  1.00 77.78  ? 93   ARG E CD  1 
ATOM   5695  N NE  . ARG E  1 66  ? 81.751 81.706 36.754  1.00 79.71  ? 93   ARG E NE  1 
ATOM   5696  C CZ  . ARG E  1 66  ? 81.915 80.529 37.351  1.00 80.35  ? 93   ARG E CZ  1 
ATOM   5697  N NH1 . ARG E  1 66  ? 82.451 79.511 36.686  1.00 81.02  ? 93   ARG E NH1 1 
ATOM   5698  N NH2 . ARG E  1 66  ? 81.559 80.374 38.620  1.00 81.40  ? 93   ARG E NH2 1 
ATOM   5699  N N   . LYS E  1 67  ? 82.445 84.778 30.708  1.00 76.85  ? 94   LYS E N   1 
ATOM   5700  C CA  . LYS E  1 67  ? 82.842 84.520 29.332  1.00 76.07  ? 94   LYS E CA  1 
ATOM   5701  C C   . LYS E  1 67  ? 83.580 83.183 29.310  1.00 75.70  ? 94   LYS E C   1 
ATOM   5702  O O   . LYS E  1 67  ? 84.742 83.085 28.931  1.00 75.36  ? 94   LYS E O   1 
ATOM   5703  C CB  . LYS E  1 67  ? 83.722 85.654 28.815  1.00 75.38  ? 94   LYS E CB  1 
ATOM   5704  C CG  . LYS E  1 67  ? 82.929 86.888 28.448  1.00 74.47  ? 94   LYS E CG  1 
ATOM   5705  C CD  . LYS E  1 67  ? 83.571 87.594 27.273  1.00 75.07  ? 94   LYS E CD  1 
ATOM   5706  C CE  . LYS E  1 67  ? 82.537 88.366 26.462  1.00 75.00  ? 94   LYS E CE  1 
ATOM   5707  N NZ  . LYS E  1 67  ? 83.127 89.059 25.270  1.00 75.38  ? 94   LYS E NZ  1 
ATOM   5708  N N   . GLN E  1 68  ? 82.861 82.157 29.745  1.00 76.32  ? 95   GLN E N   1 
ATOM   5709  C CA  . GLN E  1 68  ? 83.347 80.784 29.837  1.00 77.27  ? 95   GLN E CA  1 
ATOM   5710  C C   . GLN E  1 68  ? 82.330 79.790 29.228  1.00 78.08  ? 95   GLN E C   1 
ATOM   5711  O O   . GLN E  1 68  ? 81.116 79.960 29.370  1.00 76.90  ? 95   GLN E O   1 
ATOM   5712  C CB  . GLN E  1 68  ? 83.586 80.457 31.317  1.00 76.28  ? 95   GLN E CB  1 
ATOM   5713  C CG  . GLN E  1 68  ? 83.669 78.983 31.681  1.00 74.24  ? 95   GLN E CG  1 
ATOM   5714  C CD  . GLN E  1 68  ? 83.455 78.757 33.177  1.00 73.10  ? 95   GLN E CD  1 
ATOM   5715  O OE1 . GLN E  1 68  ? 82.441 79.168 33.735  1.00 70.75  ? 95   GLN E OE1 1 
ATOM   5716  N NE2 . GLN E  1 68  ? 84.412 78.103 33.829  1.00 73.27  ? 95   GLN E NE2 1 
ATOM   5717  N N   . CYS E  1 69  ? 82.830 78.764 28.541  1.00 78.85  ? 96   CYS E N   1 
ATOM   5718  C CA  . CYS E  1 69  ? 81.962 77.758 27.945  1.00 79.07  ? 96   CYS E CA  1 
ATOM   5719  C C   . CYS E  1 69  ? 81.784 76.625 28.940  1.00 78.94  ? 96   CYS E C   1 
ATOM   5720  O O   . CYS E  1 69  ? 82.582 76.466 29.869  1.00 80.04  ? 96   CYS E O   1 
ATOM   5721  C CB  . CYS E  1 69  ? 82.581 77.154 26.693  1.00 80.57  ? 96   CYS E CB  1 
ATOM   5722  S SG  . CYS E  1 69  ? 83.138 78.288 25.395  1.00 83.93  ? 96   CYS E SG  1 
ATOM   5723  N N   . LEU E  1 70  ? 80.737 75.835 28.738  1.00 77.65  ? 97   LEU E N   1 
ATOM   5724  C CA  . LEU E  1 70  ? 80.456 74.679 29.583  1.00 76.19  ? 97   LEU E CA  1 
ATOM   5725  C C   . LEU E  1 70  ? 79.878 73.565 28.717  1.00 75.16  ? 97   LEU E C   1 
ATOM   5726  O O   . LEU E  1 70  ? 78.662 73.469 28.528  1.00 75.01  ? 97   LEU E O   1 
ATOM   5727  C CB  . LEU E  1 70  ? 79.478 75.036 30.706  1.00 75.97  ? 97   LEU E CB  1 
ATOM   5728  C CG  . LEU E  1 70  ? 80.019 75.852 31.886  1.00 75.57  ? 97   LEU E CG  1 
ATOM   5729  C CD1 . LEU E  1 70  ? 80.244 77.297 31.463  1.00 76.09  ? 97   LEU E CD1 1 
ATOM   5730  C CD2 . LEU E  1 70  ? 79.028 75.794 33.030  1.00 74.40  ? 97   LEU E CD2 1 
ATOM   5731  N N   . TRP E  1 71  ? 80.770 72.736 28.181  1.00 73.23  ? 98   TRP E N   1 
ATOM   5732  C CA  . TRP E  1 71  ? 80.397 71.622 27.325  1.00 71.23  ? 98   TRP E CA  1 
ATOM   5733  C C   . TRP E  1 71  ? 79.935 70.423 28.163  1.00 70.62  ? 98   TRP E C   1 
ATOM   5734  O O   . TRP E  1 71  ? 80.612 70.025 29.108  1.00 70.55  ? 98   TRP E O   1 
ATOM   5735  C CB  . TRP E  1 71  ? 81.596 71.257 26.453  1.00 70.05  ? 98   TRP E CB  1 
ATOM   5736  C CG  . TRP E  1 71  ? 82.037 72.389 25.546  1.00 69.21  ? 98   TRP E CG  1 
ATOM   5737  C CD1 . TRP E  1 71  ? 81.373 72.870 24.447  1.00 69.27  ? 98   TRP E CD1 1 
ATOM   5738  C CD2 . TRP E  1 71  ? 83.238 73.172 25.657  1.00 69.11  ? 98   TRP E CD2 1 
ATOM   5739  N NE1 . TRP E  1 71  ? 82.086 73.896 23.864  1.00 68.19  ? 98   TRP E NE1 1 
ATOM   5740  C CE2 . TRP E  1 71  ? 83.236 74.099 24.582  1.00 68.80  ? 98   TRP E CE2 1 
ATOM   5741  C CE3 . TRP E  1 71  ? 84.325 73.171 26.551  1.00 68.38  ? 98   TRP E CE3 1 
ATOM   5742  C CZ2 . TRP E  1 71  ? 84.267 75.026 24.387  1.00 68.10  ? 98   TRP E CZ2 1 
ATOM   5743  C CZ3 . TRP E  1 71  ? 85.350 74.092 26.358  1.00 67.25  ? 98   TRP E CZ3 1 
ATOM   5744  C CH2 . TRP E  1 71  ? 85.316 75.003 25.278  1.00 68.23  ? 98   TRP E CH2 1 
ATOM   5745  N N   . PHE E  1 72  ? 78.780 69.857 27.820  1.00 69.90  ? 99   PHE E N   1 
ATOM   5746  C CA  . PHE E  1 72  ? 78.230 68.725 28.567  1.00 69.30  ? 99   PHE E CA  1 
ATOM   5747  C C   . PHE E  1 72  ? 77.913 67.551 27.665  1.00 68.05  ? 99   PHE E C   1 
ATOM   5748  O O   . PHE E  1 72  ? 77.541 67.730 26.513  1.00 67.64  ? 99   PHE E O   1 
ATOM   5749  C CB  . PHE E  1 72  ? 76.916 69.098 29.262  1.00 69.79  ? 99   PHE E CB  1 
ATOM   5750  C CG  . PHE E  1 72  ? 76.933 70.430 29.934  1.00 71.12  ? 99   PHE E CG  1 
ATOM   5751  C CD1 . PHE E  1 72  ? 77.659 70.633 31.102  1.00 71.72  ? 99   PHE E CD1 1 
ATOM   5752  C CD2 . PHE E  1 72  ? 76.226 71.494 29.387  1.00 72.59  ? 99   PHE E CD2 1 
ATOM   5753  C CE1 . PHE E  1 72  ? 77.683 71.884 31.717  1.00 72.19  ? 99   PHE E CE1 1 
ATOM   5754  C CE2 . PHE E  1 72  ? 76.241 72.748 29.990  1.00 73.23  ? 99   PHE E CE2 1 
ATOM   5755  C CZ  . PHE E  1 72  ? 76.971 72.943 31.157  1.00 73.10  ? 99   PHE E CZ  1 
ATOM   5756  N N   . PRO E  1 73  ? 78.037 66.327 28.196  1.00 67.45  ? 100  PRO E N   1 
ATOM   5757  C CA  . PRO E  1 73  ? 77.756 65.094 27.459  1.00 66.52  ? 100  PRO E CA  1 
ATOM   5758  C C   . PRO E  1 73  ? 76.286 64.777 27.666  1.00 65.62  ? 100  PRO E C   1 
ATOM   5759  O O   . PRO E  1 73  ? 75.891 63.609 27.700  1.00 65.21  ? 100  PRO E O   1 
ATOM   5760  C CB  . PRO E  1 73  ? 78.645 64.079 28.154  1.00 66.78  ? 100  PRO E CB  1 
ATOM   5761  C CG  . PRO E  1 73  ? 78.500 64.489 29.580  1.00 66.43  ? 100  PRO E CG  1 
ATOM   5762  C CD  . PRO E  1 73  ? 78.660 66.010 29.495  1.00 67.45  ? 100  PRO E CD  1 
ATOM   5763  N N   . PHE E  1 74  ? 75.492 65.834 27.824  1.00 64.75  ? 101  PHE E N   1 
ATOM   5764  C CA  . PHE E  1 74  ? 74.054 65.716 28.050  1.00 63.53  ? 101  PHE E CA  1 
ATOM   5765  C C   . PHE E  1 74  ? 73.370 67.041 27.700  1.00 62.70  ? 101  PHE E C   1 
ATOM   5766  O O   . PHE E  1 74  ? 74.030 68.037 27.368  1.00 62.25  ? 101  PHE E O   1 
ATOM   5767  C CB  . PHE E  1 74  ? 73.794 65.375 29.518  1.00 64.26  ? 101  PHE E CB  1 
ATOM   5768  C CG  . PHE E  1 74  ? 74.410 66.354 30.481  1.00 67.10  ? 101  PHE E CG  1 
ATOM   5769  C CD1 . PHE E  1 74  ? 73.906 67.649 30.603  1.00 69.01  ? 101  PHE E CD1 1 
ATOM   5770  C CD2 . PHE E  1 74  ? 75.534 66.006 31.226  1.00 67.38  ? 101  PHE E CD2 1 
ATOM   5771  C CE1 . PHE E  1 74  ? 74.518 68.586 31.450  1.00 69.67  ? 101  PHE E CE1 1 
ATOM   5772  C CE2 . PHE E  1 74  ? 76.151 66.932 32.073  1.00 68.46  ? 101  PHE E CE2 1 
ATOM   5773  C CZ  . PHE E  1 74  ? 75.643 68.225 32.184  1.00 69.39  ? 101  PHE E CZ  1 
ATOM   5774  N N   . ASN E  1 75  ? 72.045 67.048 27.770  1.00 61.06  ? 102  ASN E N   1 
ATOM   5775  C CA  . ASN E  1 75  ? 71.281 68.247 27.489  1.00 59.32  ? 102  ASN E CA  1 
ATOM   5776  C C   . ASN E  1 75  ? 70.126 68.363 28.484  1.00 59.47  ? 102  ASN E C   1 
ATOM   5777  O O   . ASN E  1 75  ? 69.990 67.545 29.393  1.00 58.12  ? 102  ASN E O   1 
ATOM   5778  C CB  . ASN E  1 75  ? 70.764 68.235 26.042  1.00 57.78  ? 102  ASN E CB  1 
ATOM   5779  C CG  . ASN E  1 75  ? 69.829 67.083 25.757  1.00 56.90  ? 102  ASN E CG  1 
ATOM   5780  O OD1 . ASN E  1 75  ? 69.289 66.460 26.672  1.00 59.69  ? 102  ASN E OD1 1 
ATOM   5781  N ND2 . ASN E  1 75  ? 69.616 66.804 24.482  1.00 56.29  ? 102  ASN E ND2 1 
ATOM   5782  N N   . SER E  1 76  ? 69.313 69.399 28.322  1.00 59.69  ? 103  SER E N   1 
ATOM   5783  C CA  . SER E  1 76  ? 68.181 69.636 29.202  1.00 60.72  ? 103  SER E CA  1 
ATOM   5784  C C   . SER E  1 76  ? 67.357 68.386 29.482  1.00 63.15  ? 103  SER E C   1 
ATOM   5785  O O   . SER E  1 76  ? 66.877 68.200 30.596  1.00 63.40  ? 103  SER E O   1 
ATOM   5786  C CB  . SER E  1 76  ? 67.273 70.698 28.605  1.00 59.23  ? 103  SER E CB  1 
ATOM   5787  O OG  . SER E  1 76  ? 66.688 70.228 27.407  1.00 58.10  ? 103  SER E OG  1 
ATOM   5788  N N   . MET E  1 77  ? 67.173 67.539 28.473  1.00 66.22  ? 104  MET E N   1 
ATOM   5789  C CA  . MET E  1 77  ? 66.393 66.318 28.660  1.00 69.47  ? 104  MET E CA  1 
ATOM   5790  C C   . MET E  1 77  ? 67.207 65.256 29.346  1.00 71.70  ? 104  MET E C   1 
ATOM   5791  O O   . MET E  1 77  ? 66.775 64.113 29.440  1.00 72.88  ? 104  MET E O   1 
ATOM   5792  C CB  . MET E  1 77  ? 65.900 65.742 27.331  1.00 69.55  ? 104  MET E CB  1 
ATOM   5793  C CG  . MET E  1 77  ? 64.715 66.448 26.754  1.00 71.61  ? 104  MET E CG  1 
ATOM   5794  S SD  . MET E  1 77  ? 65.206 67.993 26.019  1.00 75.75  ? 104  MET E SD  1 
ATOM   5795  C CE  . MET E  1 77  ? 64.994 67.594 24.256  1.00 76.40  ? 104  MET E CE  1 
ATOM   5796  N N   . SER E  1 78  ? 68.381 65.622 29.838  1.00 74.12  ? 105  SER E N   1 
ATOM   5797  C CA  . SER E  1 78  ? 69.240 64.643 30.488  1.00 77.10  ? 105  SER E CA  1 
ATOM   5798  C C   . SER E  1 78  ? 68.813 64.194 31.880  1.00 78.52  ? 105  SER E C   1 
ATOM   5799  O O   . SER E  1 78  ? 68.462 65.015 32.732  1.00 78.79  ? 105  SER E O   1 
ATOM   5800  C CB  . SER E  1 78  ? 70.666 65.178 30.549  1.00 77.53  ? 105  SER E CB  1 
ATOM   5801  O OG  . SER E  1 78  ? 71.133 65.461 29.244  1.00 78.20  ? 105  SER E OG  1 
ATOM   5802  N N   . SER E  1 79  ? 68.839 62.881 32.104  1.00 80.49  ? 106  SER E N   1 
ATOM   5803  C CA  . SER E  1 79  ? 68.496 62.337 33.415  1.00 82.64  ? 106  SER E CA  1 
ATOM   5804  C C   . SER E  1 79  ? 69.777 62.347 34.268  1.00 83.12  ? 106  SER E C   1 
ATOM   5805  O O   . SER E  1 79  ? 70.802 61.756 33.904  1.00 83.03  ? 106  SER E O   1 
ATOM   5806  C CB  . SER E  1 79  ? 67.917 60.917 33.290  1.00 82.92  ? 106  SER E CB  1 
ATOM   5807  O OG  . SER E  1 79  ? 68.815 60.027 32.653  1.00 85.05  ? 106  SER E OG  1 
ATOM   5808  N N   . GLY E  1 80  ? 69.708 63.047 35.398  1.00 83.64  ? 107  GLY E N   1 
ATOM   5809  C CA  . GLY E  1 80  ? 70.857 63.177 36.280  1.00 83.48  ? 107  GLY E CA  1 
ATOM   5810  C C   . GLY E  1 80  ? 71.427 64.579 36.123  1.00 83.02  ? 107  GLY E C   1 
ATOM   5811  O O   . GLY E  1 80  ? 72.631 64.805 36.274  1.00 82.53  ? 107  GLY E O   1 
ATOM   5812  N N   . VAL E  1 81  ? 70.539 65.520 35.804  1.00 82.54  ? 108  VAL E N   1 
ATOM   5813  C CA  . VAL E  1 81  ? 70.887 66.926 35.590  1.00 81.61  ? 108  VAL E CA  1 
ATOM   5814  C C   . VAL E  1 81  ? 69.636 67.782 35.834  1.00 80.46  ? 108  VAL E C   1 
ATOM   5815  O O   . VAL E  1 81  ? 68.516 67.266 35.818  1.00 81.07  ? 108  VAL E O   1 
ATOM   5816  C CB  . VAL E  1 81  ? 71.366 67.164 34.126  1.00 81.67  ? 108  VAL E CB  1 
ATOM   5817  C CG1 . VAL E  1 81  ? 71.876 68.587 33.963  1.00 81.15  ? 108  VAL E CG1 1 
ATOM   5818  C CG2 . VAL E  1 81  ? 72.450 66.161 33.753  1.00 81.75  ? 108  VAL E CG2 1 
ATOM   5819  N N   . LYS E  1 82  ? 69.820 69.082 36.051  1.00 78.49  ? 109  LYS E N   1 
ATOM   5820  C CA  . LYS E  1 82  ? 68.683 69.970 36.281  1.00 76.31  ? 109  LYS E CA  1 
ATOM   5821  C C   . LYS E  1 82  ? 68.846 71.355 35.637  1.00 74.68  ? 109  LYS E C   1 
ATOM   5822  O O   . LYS E  1 82  ? 69.955 71.897 35.539  1.00 72.95  ? 109  LYS E O   1 
ATOM   5823  C CB  . LYS E  1 82  ? 68.428 70.105 37.783  1.00 76.72  ? 109  LYS E CB  1 
ATOM   5824  N N   . LYS E  1 83  ? 67.718 71.910 35.196  1.00 73.52  ? 110  LYS E N   1 
ATOM   5825  C CA  . LYS E  1 83  ? 67.674 73.227 34.557  1.00 72.94  ? 110  LYS E CA  1 
ATOM   5826  C C   . LYS E  1 83  ? 67.484 74.338 35.598  1.00 72.04  ? 110  LYS E C   1 
ATOM   5827  O O   . LYS E  1 83  ? 66.691 74.192 36.542  1.00 72.48  ? 110  LYS E O   1 
ATOM   5828  C CB  . LYS E  1 83  ? 66.531 73.274 33.530  1.00 72.17  ? 110  LYS E CB  1 
ATOM   5829  N N   . GLU E  1 84  ? 68.207 75.446 35.420  1.00 69.12  ? 111  GLU E N   1 
ATOM   5830  C CA  . GLU E  1 84  ? 68.115 76.571 36.343  1.00 66.09  ? 111  GLU E CA  1 
ATOM   5831  C C   . GLU E  1 84  ? 68.251 77.902 35.626  1.00 64.69  ? 111  GLU E C   1 
ATOM   5832  O O   . GLU E  1 84  ? 69.163 78.085 34.826  1.00 63.88  ? 111  GLU E O   1 
ATOM   5833  C CB  . GLU E  1 84  ? 69.182 76.450 37.412  1.00 66.54  ? 111  GLU E CB  1 
ATOM   5834  N N   . PHE E  1 85  ? 67.339 78.829 35.919  1.00 63.59  ? 112  PHE E N   1 
ATOM   5835  C CA  . PHE E  1 85  ? 67.351 80.160 35.312  1.00 62.53  ? 112  PHE E CA  1 
ATOM   5836  C C   . PHE E  1 85  ? 68.667 80.871 35.611  1.00 62.24  ? 112  PHE E C   1 
ATOM   5837  O O   . PHE E  1 85  ? 69.416 80.466 36.501  1.00 62.59  ? 112  PHE E O   1 
ATOM   5838  C CB  . PHE E  1 85  ? 66.197 80.997 35.864  1.00 61.38  ? 112  PHE E CB  1 
ATOM   5839  C CG  . PHE E  1 85  ? 66.158 82.418 35.341  1.00 61.22  ? 112  PHE E CG  1 
ATOM   5840  C CD1 . PHE E  1 85  ? 65.673 82.700 34.068  1.00 62.11  ? 112  PHE E CD1 1 
ATOM   5841  C CD2 . PHE E  1 85  ? 66.579 83.480 36.138  1.00 61.19  ? 112  PHE E CD2 1 
ATOM   5842  C CE1 . PHE E  1 85  ? 65.603 84.027 33.599  1.00 61.59  ? 112  PHE E CE1 1 
ATOM   5843  C CE2 . PHE E  1 85  ? 66.514 84.803 35.677  1.00 59.80  ? 112  PHE E CE2 1 
ATOM   5844  C CZ  . PHE E  1 85  ? 66.024 85.074 34.408  1.00 60.19  ? 112  PHE E CZ  1 
ATOM   5845  N N   . GLY E  1 86  ? 68.943 81.936 34.869  1.00 61.13  ? 113  GLY E N   1 
ATOM   5846  C CA  . GLY E  1 86  ? 70.161 82.683 35.090  1.00 60.26  ? 113  GLY E CA  1 
ATOM   5847  C C   . GLY E  1 86  ? 70.294 83.782 34.069  1.00 60.40  ? 113  GLY E C   1 
ATOM   5848  O O   . GLY E  1 86  ? 70.106 83.561 32.887  1.00 59.87  ? 113  GLY E O   1 
ATOM   5849  N N   . HIS E  1 87  ? 70.611 84.984 34.511  1.00 61.82  ? 114  HIS E N   1 
ATOM   5850  C CA  . HIS E  1 87  ? 70.759 86.074 33.566  1.00 63.20  ? 114  HIS E CA  1 
ATOM   5851  C C   . HIS E  1 87  ? 72.068 85.980 32.786  1.00 64.07  ? 114  HIS E C   1 
ATOM   5852  O O   . HIS E  1 87  ? 72.121 86.342 31.603  1.00 62.45  ? 114  HIS E O   1 
ATOM   5853  C CB  . HIS E  1 87  ? 70.669 87.415 34.298  1.00 63.40  ? 114  HIS E CB  1 
ATOM   5854  C CG  . HIS E  1 87  ? 69.265 87.845 34.588  1.00 63.99  ? 114  HIS E CG  1 
ATOM   5855  N ND1 . HIS E  1 87  ? 68.434 88.372 33.623  1.00 63.30  ? 114  HIS E ND1 1 
ATOM   5856  C CD2 . HIS E  1 87  ? 68.537 87.800 35.731  1.00 64.43  ? 114  HIS E CD2 1 
ATOM   5857  C CE1 . HIS E  1 87  ? 67.255 88.635 34.159  1.00 63.93  ? 114  HIS E CE1 1 
ATOM   5858  N NE2 . HIS E  1 87  ? 67.291 88.297 35.436  1.00 64.17  ? 114  HIS E NE2 1 
ATOM   5859  N N   . GLU E  1 88  ? 73.115 85.479 33.447  1.00 65.23  ? 115  GLU E N   1 
ATOM   5860  C CA  . GLU E  1 88  ? 74.421 85.360 32.803  1.00 66.44  ? 115  GLU E CA  1 
ATOM   5861  C C   . GLU E  1 88  ? 74.602 84.094 31.933  1.00 66.73  ? 115  GLU E C   1 
ATOM   5862  O O   . GLU E  1 88  ? 75.599 83.971 31.215  1.00 66.97  ? 115  GLU E O   1 
ATOM   5863  C CB  . GLU E  1 88  ? 75.549 85.433 33.849  1.00 66.68  ? 115  GLU E CB  1 
ATOM   5864  C CG  . GLU E  1 88  ? 75.799 84.140 34.636  1.00 67.81  ? 115  GLU E CG  1 
ATOM   5865  C CD  . GLU E  1 88  ? 74.803 83.908 35.761  1.00 68.72  ? 115  GLU E CD  1 
ATOM   5866  O OE1 . GLU E  1 88  ? 73.584 84.060 35.534  1.00 68.94  ? 115  GLU E OE1 1 
ATOM   5867  O OE2 . GLU E  1 88  ? 75.243 83.558 36.877  1.00 69.87  ? 115  GLU E OE2 1 
ATOM   5868  N N   . PHE E  1 89  ? 73.646 83.165 31.984  1.00 65.88  ? 116  PHE E N   1 
ATOM   5869  C CA  . PHE E  1 89  ? 73.736 81.931 31.202  1.00 65.73  ? 116  PHE E CA  1 
ATOM   5870  C C   . PHE E  1 89  ? 72.872 81.906 29.926  1.00 65.17  ? 116  PHE E C   1 
ATOM   5871  O O   . PHE E  1 89  ? 71.886 82.627 29.803  1.00 66.15  ? 116  PHE E O   1 
ATOM   5872  C CB  . PHE E  1 89  ? 73.346 80.720 32.067  1.00 66.06  ? 116  PHE E CB  1 
ATOM   5873  C CG  . PHE E  1 89  ? 74.141 80.585 33.337  1.00 67.65  ? 116  PHE E CG  1 
ATOM   5874  C CD1 . PHE E  1 89  ? 75.526 80.471 33.305  1.00 68.59  ? 116  PHE E CD1 1 
ATOM   5875  C CD2 . PHE E  1 89  ? 73.499 80.555 34.574  1.00 68.30  ? 116  PHE E CD2 1 
ATOM   5876  C CE1 . PHE E  1 89  ? 76.263 80.329 34.489  1.00 68.26  ? 116  PHE E CE1 1 
ATOM   5877  C CE2 . PHE E  1 89  ? 74.228 80.414 35.766  1.00 68.14  ? 116  PHE E CE2 1 
ATOM   5878  C CZ  . PHE E  1 89  ? 75.612 80.301 35.720  1.00 68.05  ? 116  PHE E CZ  1 
ATOM   5879  N N   . ASP E  1 90  ? 73.280 81.071 28.976  1.00 64.19  ? 117  ASP E N   1 
ATOM   5880  C CA  . ASP E  1 90  ? 72.574 80.839 27.707  1.00 61.80  ? 117  ASP E CA  1 
ATOM   5881  C C   . ASP E  1 90  ? 72.796 79.371 27.331  1.00 60.48  ? 117  ASP E C   1 
ATOM   5882  O O   . ASP E  1 90  ? 73.942 78.910 27.199  1.00 60.66  ? 117  ASP E O   1 
ATOM   5883  C CB  . ASP E  1 90  ? 73.105 81.726 26.578  1.00 60.99  ? 117  ASP E CB  1 
ATOM   5884  C CG  . ASP E  1 90  ? 72.393 83.057 26.499  1.00 61.40  ? 117  ASP E CG  1 
ATOM   5885  O OD1 . ASP E  1 90  ? 71.355 83.220 27.169  1.00 60.25  ? 117  ASP E OD1 1 
ATOM   5886  O OD2 . ASP E  1 90  ? 72.863 83.940 25.755  1.00 62.16  ? 117  ASP E OD2 1 
ATOM   5887  N N   . LEU E  1 91  ? 71.704 78.630 27.175  1.00 57.66  ? 118  LEU E N   1 
ATOM   5888  C CA  . LEU E  1 91  ? 71.800 77.218 26.823  1.00 53.57  ? 118  LEU E CA  1 
ATOM   5889  C C   . LEU E  1 91  ? 71.682 76.998 25.319  1.00 52.94  ? 118  LEU E C   1 
ATOM   5890  O O   . LEU E  1 91  ? 70.775 77.528 24.685  1.00 52.94  ? 118  LEU E O   1 
ATOM   5891  C CB  . LEU E  1 91  ? 70.715 76.423 27.547  1.00 49.57  ? 118  LEU E CB  1 
ATOM   5892  C CG  . LEU E  1 91  ? 70.746 74.926 27.295  1.00 46.02  ? 118  LEU E CG  1 
ATOM   5893  C CD1 . LEU E  1 91  ? 72.163 74.418 27.393  1.00 45.54  ? 118  LEU E CD1 1 
ATOM   5894  C CD2 . LEU E  1 91  ? 69.869 74.236 28.305  1.00 44.66  ? 118  LEU E CD2 1 
ATOM   5895  N N   . TYR E  1 92  ? 72.622 76.242 24.750  1.00 52.81  ? 119  TYR E N   1 
ATOM   5896  C CA  . TYR E  1 92  ? 72.626 75.903 23.314  1.00 51.72  ? 119  TYR E CA  1 
ATOM   5897  C C   . TYR E  1 92  ? 72.736 74.379 23.169  1.00 48.52  ? 119  TYR E C   1 
ATOM   5898  O O   . TYR E  1 92  ? 73.806 73.811 23.351  1.00 48.21  ? 119  TYR E O   1 
ATOM   5899  C CB  . TYR E  1 92  ? 73.809 76.544 22.573  1.00 53.62  ? 119  TYR E CB  1 
ATOM   5900  C CG  . TYR E  1 92  ? 73.724 78.044 22.357  1.00 56.90  ? 119  TYR E CG  1 
ATOM   5901  C CD1 . TYR E  1 92  ? 74.074 78.942 23.372  1.00 58.27  ? 119  TYR E CD1 1 
ATOM   5902  C CD2 . TYR E  1 92  ? 73.308 78.570 21.129  1.00 57.29  ? 119  TYR E CD2 1 
ATOM   5903  C CE1 . TYR E  1 92  ? 74.013 80.330 23.165  1.00 57.94  ? 119  TYR E CE1 1 
ATOM   5904  C CE2 . TYR E  1 92  ? 73.239 79.950 20.916  1.00 57.14  ? 119  TYR E CE2 1 
ATOM   5905  C CZ  . TYR E  1 92  ? 73.591 80.821 21.937  1.00 57.67  ? 119  TYR E CZ  1 
ATOM   5906  O OH  . TYR E  1 92  ? 73.498 82.181 21.742  1.00 58.00  ? 119  TYR E OH  1 
ATOM   5907  N N   . GLU E  1 93  ? 71.629 73.723 22.848  1.00 44.76  ? 120  GLU E N   1 
ATOM   5908  C CA  . GLU E  1 93  ? 71.617 72.277 22.703  1.00 41.28  ? 120  GLU E CA  1 
ATOM   5909  C C   . GLU E  1 93  ? 71.820 71.862 21.249  1.00 41.41  ? 120  GLU E C   1 
ATOM   5910  O O   . GLU E  1 93  ? 71.322 72.518 20.339  1.00 41.03  ? 120  GLU E O   1 
ATOM   5911  C CB  . GLU E  1 93  ? 70.296 71.725 23.235  1.00 38.04  ? 120  GLU E CB  1 
ATOM   5912  C CG  . GLU E  1 93  ? 70.068 72.013 24.705  1.00 33.26  ? 120  GLU E CG  1 
ATOM   5913  C CD  . GLU E  1 93  ? 68.675 71.671 25.163  1.00 30.80  ? 120  GLU E CD  1 
ATOM   5914  O OE1 . GLU E  1 93  ? 67.707 72.275 24.661  1.00 31.50  ? 120  GLU E OE1 1 
ATOM   5915  O OE2 . GLU E  1 93  ? 68.553 70.798 26.033  1.00 30.31  ? 120  GLU E OE2 1 
ATOM   5916  N N   . ASN E  1 94  ? 72.566 70.775 21.043  1.00 41.86  ? 121  ASN E N   1 
ATOM   5917  C CA  . ASN E  1 94  ? 72.842 70.241 19.705  1.00 41.93  ? 121  ASN E CA  1 
ATOM   5918  C C   . ASN E  1 94  ? 71.594 69.534 19.173  1.00 41.63  ? 121  ASN E C   1 
ATOM   5919  O O   . ASN E  1 94  ? 71.109 68.563 19.760  1.00 40.24  ? 121  ASN E O   1 
ATOM   5920  C CB  . ASN E  1 94  ? 74.001 69.234 19.760  1.00 43.32  ? 121  ASN E CB  1 
ATOM   5921  C CG  . ASN E  1 94  ? 74.518 68.843 18.371  1.00 44.03  ? 121  ASN E CG  1 
ATOM   5922  O OD1 . ASN E  1 94  ? 73.751 68.427 17.499  1.00 45.41  ? 121  ASN E OD1 1 
ATOM   5923  N ND2 . ASN E  1 94  ? 75.826 68.976 18.168  1.00 43.25  ? 121  ASN E ND2 1 
ATOM   5924  N N   . LYS E  1 95  ? 71.088 70.005 18.045  1.00 41.43  ? 122  LYS E N   1 
ATOM   5925  C CA  . LYS E  1 95  ? 69.880 69.431 17.476  1.00 41.57  ? 122  LYS E CA  1 
ATOM   5926  C C   . LYS E  1 95  ? 69.920 67.942 17.232  1.00 41.21  ? 122  LYS E C   1 
ATOM   5927  O O   . LYS E  1 95  ? 68.876 67.302 17.223  1.00 41.26  ? 122  LYS E O   1 
ATOM   5928  C CB  . LYS E  1 95  ? 69.508 70.142 16.176  1.00 42.63  ? 122  LYS E CB  1 
ATOM   5929  C CG  . LYS E  1 95  ? 69.023 71.564 16.378  1.00 46.46  ? 122  LYS E CG  1 
ATOM   5930  C CD  . LYS E  1 95  ? 68.623 72.231 15.069  1.00 48.90  ? 122  LYS E CD  1 
ATOM   5931  C CE  . LYS E  1 95  ? 68.327 73.715 15.294  1.00 52.63  ? 122  LYS E CE  1 
ATOM   5932  N NZ  . LYS E  1 95  ? 67.972 74.444 14.040  1.00 53.85  ? 122  LYS E NZ  1 
ATOM   5933  N N   . ASP E  1 96  ? 71.105 67.376 17.038  1.00 41.04  ? 123  ASP E N   1 
ATOM   5934  C CA  . ASP E  1 96  ? 71.190 65.936 16.777  1.00 41.06  ? 123  ASP E CA  1 
ATOM   5935  C C   . ASP E  1 96  ? 70.864 65.073 18.000  1.00 39.17  ? 123  ASP E C   1 
ATOM   5936  O O   . ASP E  1 96  ? 70.832 63.846 17.917  1.00 38.27  ? 123  ASP E O   1 
ATOM   5937  C CB  . ASP E  1 96  ? 72.579 65.550 16.233  1.00 43.14  ? 123  ASP E CB  1 
ATOM   5938  C CG  . ASP E  1 96  ? 72.820 66.043 14.802  1.00 44.47  ? 123  ASP E CG  1 
ATOM   5939  O OD1 . ASP E  1 96  ? 71.852 66.105 14.010  1.00 46.39  ? 123  ASP E OD1 1 
ATOM   5940  O OD2 . ASP E  1 96  ? 73.986 66.350 14.457  1.00 46.96  ? 123  ASP E OD2 1 
ATOM   5941  N N   . TYR E  1 97  ? 70.623 65.713 19.136  1.00 37.61  ? 124  TYR E N   1 
ATOM   5942  C CA  . TYR E  1 97  ? 70.298 64.964 20.342  1.00 35.17  ? 124  TYR E CA  1 
ATOM   5943  C C   . TYR E  1 97  ? 68.971 65.388 20.928  1.00 33.87  ? 124  TYR E C   1 
ATOM   5944  O O   . TYR E  1 97  ? 68.653 65.066 22.062  1.00 34.77  ? 124  TYR E O   1 
ATOM   5945  C CB  . TYR E  1 97  ? 71.415 65.103 21.378  1.00 33.48  ? 124  TYR E CB  1 
ATOM   5946  C CG  . TYR E  1 97  ? 72.705 64.523 20.878  1.00 32.00  ? 124  TYR E CG  1 
ATOM   5947  C CD1 . TYR E  1 97  ? 72.969 63.167 21.008  1.00 31.13  ? 124  TYR E CD1 1 
ATOM   5948  C CD2 . TYR E  1 97  ? 73.627 65.320 20.187  1.00 33.16  ? 124  TYR E CD2 1 
ATOM   5949  C CE1 . TYR E  1 97  ? 74.116 62.607 20.460  1.00 32.41  ? 124  TYR E CE1 1 
ATOM   5950  C CE2 . TYR E  1 97  ? 74.777 64.776 19.633  1.00 34.13  ? 124  TYR E CE2 1 
ATOM   5951  C CZ  . TYR E  1 97  ? 75.016 63.416 19.769  1.00 34.01  ? 124  TYR E CZ  1 
ATOM   5952  O OH  . TYR E  1 97  ? 76.137 62.873 19.190  1.00 33.12  ? 124  TYR E OH  1 
ATOM   5953  N N   . ILE E  1 98  ? 68.201 66.134 20.156  1.00 32.31  ? 125  ILE E N   1 
ATOM   5954  C CA  . ILE E  1 98  ? 66.880 66.537 20.599  1.00 31.71  ? 125  ILE E CA  1 
ATOM   5955  C C   . ILE E  1 98  ? 65.940 65.806 19.653  1.00 31.46  ? 125  ILE E C   1 
ATOM   5956  O O   . ILE E  1 98  ? 65.849 66.146 18.463  1.00 31.66  ? 125  ILE E O   1 
ATOM   5957  C CB  . ILE E  1 98  ? 66.693 68.041 20.478  1.00 33.05  ? 125  ILE E CB  1 
ATOM   5958  C CG1 . ILE E  1 98  ? 67.615 68.746 21.470  1.00 31.21  ? 125  ILE E CG1 1 
ATOM   5959  C CG2 . ILE E  1 98  ? 65.246 68.411 20.735  1.00 31.87  ? 125  ILE E CG2 1 
ATOM   5960  C CD1 . ILE E  1 98  ? 67.657 70.247 21.286  1.00 34.53  ? 125  ILE E CD1 1 
ATOM   5961  N N   . ARG E  1 99  ? 65.267 64.792 20.191  1.00 29.86  ? 126  ARG E N   1 
ATOM   5962  C CA  . ARG E  1 99  ? 64.363 63.950 19.417  1.00 30.40  ? 126  ARG E CA  1 
ATOM   5963  C C   . ARG E  1 99  ? 63.621 64.728 18.357  1.00 29.66  ? 126  ARG E C   1 
ATOM   5964  O O   . ARG E  1 99  ? 63.004 65.725 18.666  1.00 29.55  ? 126  ARG E O   1 
ATOM   5965  C CB  . ARG E  1 99  ? 63.356 63.268 20.331  1.00 29.81  ? 126  ARG E CB  1 
ATOM   5966  C CG  . ARG E  1 99  ? 62.665 62.112 19.655  1.00 32.26  ? 126  ARG E CG  1 
ATOM   5967  C CD  . ARG E  1 99  ? 61.533 61.538 20.490  1.00 37.10  ? 126  ARG E CD  1 
ATOM   5968  N NE  . ARG E  1 99  ? 61.926 61.239 21.865  1.00 38.70  ? 126  ARG E NE  1 
ATOM   5969  C CZ  . ARG E  1 99  ? 61.484 61.903 22.929  1.00 40.21  ? 126  ARG E CZ  1 
ATOM   5970  N NH1 . ARG E  1 99  ? 60.630 62.913 22.783  1.00 42.29  ? 126  ARG E NH1 1 
ATOM   5971  N NH2 . ARG E  1 99  ? 61.883 61.548 24.145  1.00 39.81  ? 126  ARG E NH2 1 
ATOM   5972  N N   . ASN E  1 100 ? 63.686 64.281 17.109  1.00 29.29  ? 127  ASN E N   1 
ATOM   5973  C CA  . ASN E  1 100 ? 63.005 64.984 16.050  1.00 28.82  ? 127  ASN E CA  1 
ATOM   5974  C C   . ASN E  1 100 ? 61.755 64.284 15.530  1.00 30.36  ? 127  ASN E C   1 
ATOM   5975  O O   . ASN E  1 100 ? 61.418 64.445 14.360  1.00 32.13  ? 127  ASN E O   1 
ATOM   5976  C CB  . ASN E  1 100 ? 63.975 65.293 14.892  1.00 29.46  ? 127  ASN E CB  1 
ATOM   5977  C CG  . ASN E  1 100 ? 64.716 64.074 14.392  1.00 30.56  ? 127  ASN E CG  1 
ATOM   5978  O OD1 . ASN E  1 100 ? 64.256 62.944 14.538  1.00 31.98  ? 127  ASN E OD1 1 
ATOM   5979  N ND2 . ASN E  1 100 ? 65.867 64.301 13.773  1.00 33.33  ? 127  ASN E ND2 1 
ATOM   5980  N N   . CYS E  1 101 ? 61.050 63.538 16.391  1.00 30.88  ? 128  CYS E N   1 
ATOM   5981  C CA  . CYS E  1 101 ? 59.797 62.837 16.037  1.00 33.24  ? 128  CYS E CA  1 
ATOM   5982  C C   . CYS E  1 101 ? 58.957 62.830 17.305  1.00 34.36  ? 128  CYS E C   1 
ATOM   5983  O O   . CYS E  1 101 ? 59.487 63.050 18.392  1.00 33.40  ? 128  CYS E O   1 
ATOM   5984  C CB  . CYS E  1 101 ? 60.044 61.395 15.561  1.00 35.03  ? 128  CYS E CB  1 
ATOM   5985  S SG  . CYS E  1 101 ? 60.967 60.312 16.704  1.00 41.54  ? 128  CYS E SG  1 
ATOM   5986  N N   . ILE E  1 102 ? 57.655 62.599 17.186  1.00 36.00  ? 129  ILE E N   1 
ATOM   5987  C CA  . ILE E  1 102 ? 56.808 62.612 18.371  1.00 39.79  ? 129  ILE E CA  1 
ATOM   5988  C C   . ILE E  1 102 ? 56.168 61.265 18.644  1.00 42.20  ? 129  ILE E C   1 
ATOM   5989  O O   . ILE E  1 102 ? 56.012 60.444 17.744  1.00 43.34  ? 129  ILE E O   1 
ATOM   5990  C CB  . ILE E  1 102 ? 55.664 63.662 18.248  1.00 39.65  ? 129  ILE E CB  1 
ATOM   5991  C CG1 . ILE E  1 102 ? 54.815 63.361 17.009  1.00 39.75  ? 129  ILE E CG1 1 
ATOM   5992  C CG2 . ILE E  1 102 ? 56.244 65.062 18.156  1.00 39.50  ? 129  ILE E CG2 1 
ATOM   5993  C CD1 . ILE E  1 102 ? 53.596 64.220 16.870  1.00 39.81  ? 129  ILE E CD1 1 
ATOM   5994  N N   . ILE E  1 103 ? 55.806 61.046 19.901  1.00 43.96  ? 130  ILE E N   1 
ATOM   5995  C CA  . ILE E  1 103 ? 55.129 59.823 20.312  1.00 45.49  ? 130  ILE E CA  1 
ATOM   5996  C C   . ILE E  1 103 ? 53.678 60.225 20.616  1.00 44.93  ? 130  ILE E C   1 
ATOM   5997  O O   . ILE E  1 103 ? 53.388 60.871 21.638  1.00 45.19  ? 130  ILE E O   1 
ATOM   5998  C CB  . ILE E  1 103 ? 55.751 59.218 21.596  1.00 48.23  ? 130  ILE E CB  1 
ATOM   5999  C CG1 . ILE E  1 103 ? 57.276 59.153 21.468  1.00 50.36  ? 130  ILE E CG1 1 
ATOM   6000  C CG2 . ILE E  1 103 ? 55.182 57.825 21.836  1.00 46.38  ? 130  ILE E CG2 1 
ATOM   6001  C CD1 . ILE E  1 103 ? 57.751 58.218 20.383  1.00 51.53  ? 130  ILE E CD1 1 
ATOM   6002  N N   . GLY E  1 104 ? 52.774 59.872 19.711  1.00 42.94  ? 131  GLY E N   1 
ATOM   6003  C CA  . GLY E  1 104 ? 51.375 60.196 19.916  1.00 41.66  ? 131  GLY E CA  1 
ATOM   6004  C C   . GLY E  1 104 ? 50.956 61.638 19.670  1.00 40.92  ? 131  GLY E C   1 
ATOM   6005  O O   . GLY E  1 104 ? 50.864 62.080 18.529  1.00 41.38  ? 131  GLY E O   1 
ATOM   6006  N N   . LYS E  1 105 ? 50.686 62.377 20.741  1.00 39.70  ? 132  LYS E N   1 
ATOM   6007  C CA  . LYS E  1 105 ? 50.247 63.762 20.620  1.00 37.20  ? 132  LYS E CA  1 
ATOM   6008  C C   . LYS E  1 105 ? 51.397 64.765 20.534  1.00 35.86  ? 132  LYS E C   1 
ATOM   6009  O O   . LYS E  1 105 ? 51.298 65.770 19.840  1.00 33.99  ? 132  LYS E O   1 
ATOM   6010  C CB  . LYS E  1 105 ? 49.327 64.103 21.780  1.00 36.65  ? 132  LYS E CB  1 
ATOM   6011  N N   . GLY E  1 106 ? 52.485 64.487 21.244  1.00 36.68  ? 133  GLY E N   1 
ATOM   6012  C CA  . GLY E  1 106 ? 53.634 65.375 21.214  1.00 36.70  ? 133  GLY E CA  1 
ATOM   6013  C C   . GLY E  1 106 ? 53.757 66.293 22.410  1.00 35.81  ? 133  GLY E C   1 
ATOM   6014  O O   . GLY E  1 106 ? 54.512 67.261 22.380  1.00 35.55  ? 133  GLY E O   1 
ATOM   6015  N N   . ARG E  1 107 ? 53.027 65.993 23.473  1.00 35.81  ? 134  ARG E N   1 
ATOM   6016  C CA  . ARG E  1 107 ? 53.091 66.846 24.637  1.00 36.99  ? 134  ARG E CA  1 
ATOM   6017  C C   . ARG E  1 107 ? 54.535 67.231 24.940  1.00 37.69  ? 134  ARG E C   1 
ATOM   6018  O O   . ARG E  1 107 ? 54.807 68.373 25.285  1.00 40.95  ? 134  ARG E O   1 
ATOM   6019  C CB  . ARG E  1 107 ? 52.454 66.158 25.852  1.00 36.31  ? 134  ARG E CB  1 
ATOM   6020  N N   . SER E  1 108 ? 55.474 66.312 24.763  1.00 36.59  ? 135  SER E N   1 
ATOM   6021  C CA  . SER E  1 108 ? 56.857 66.626 25.102  1.00 35.88  ? 135  SER E CA  1 
ATOM   6022  C C   . SER E  1 108 ? 57.797 66.990 23.953  1.00 33.11  ? 135  SER E C   1 
ATOM   6023  O O   . SER E  1 108 ? 59.009 67.113 24.156  1.00 32.50  ? 135  SER E O   1 
ATOM   6024  C CB  . SER E  1 108 ? 57.464 65.474 25.918  1.00 37.39  ? 135  SER E CB  1 
ATOM   6025  O OG  . SER E  1 108 ? 57.574 64.290 25.144  1.00 43.17  ? 135  SER E OG  1 
ATOM   6026  N N   . TYR E  1 109 ? 57.254 67.170 22.756  1.00 29.92  ? 136  TYR E N   1 
ATOM   6027  C CA  . TYR E  1 109 ? 58.094 67.527 21.620  1.00 28.16  ? 136  TYR E CA  1 
ATOM   6028  C C   . TYR E  1 109 ? 58.875 68.825 21.896  1.00 28.09  ? 136  TYR E C   1 
ATOM   6029  O O   . TYR E  1 109 ? 58.280 69.867 22.122  1.00 28.40  ? 136  TYR E O   1 
ATOM   6030  C CB  . TYR E  1 109 ? 57.247 67.730 20.371  1.00 23.68  ? 136  TYR E CB  1 
ATOM   6031  C CG  . TYR E  1 109 ? 58.030 68.369 19.261  1.00 24.21  ? 136  TYR E CG  1 
ATOM   6032  C CD1 . TYR E  1 109 ? 58.983 67.649 18.552  1.00 23.79  ? 136  TYR E CD1 1 
ATOM   6033  C CD2 . TYR E  1 109 ? 57.841 69.706 18.933  1.00 25.86  ? 136  TYR E CD2 1 
ATOM   6034  C CE1 . TYR E  1 109 ? 59.731 68.246 17.536  1.00 25.31  ? 136  TYR E CE1 1 
ATOM   6035  C CE2 . TYR E  1 109 ? 58.585 70.319 17.918  1.00 26.75  ? 136  TYR E CE2 1 
ATOM   6036  C CZ  . TYR E  1 109 ? 59.527 69.585 17.221  1.00 27.37  ? 136  TYR E CZ  1 
ATOM   6037  O OH  . TYR E  1 109 ? 60.254 70.184 16.209  1.00 27.89  ? 136  TYR E OH  1 
ATOM   6038  N N   . LYS E  1 110 ? 60.201 68.779 21.874  1.00 27.77  ? 137  LYS E N   1 
ATOM   6039  C CA  . LYS E  1 110 ? 60.982 69.984 22.107  1.00 27.31  ? 137  LYS E CA  1 
ATOM   6040  C C   . LYS E  1 110 ? 61.904 70.255 20.951  1.00 25.74  ? 137  LYS E C   1 
ATOM   6041  O O   . LYS E  1 110 ? 62.897 70.935 21.126  1.00 25.00  ? 137  LYS E O   1 
ATOM   6042  C CB  . LYS E  1 110 ? 61.817 69.852 23.372  1.00 31.79  ? 137  LYS E CB  1 
ATOM   6043  C CG  . LYS E  1 110 ? 60.970 69.726 24.641  1.00 39.88  ? 137  LYS E CG  1 
ATOM   6044  C CD  . LYS E  1 110 ? 61.815 69.380 25.864  1.00 43.35  ? 137  LYS E CD  1 
ATOM   6045  C CE  . LYS E  1 110 ? 60.935 69.076 27.072  1.00 46.97  ? 137  LYS E CE  1 
ATOM   6046  N NZ  . LYS E  1 110 ? 61.756 68.437 28.155  1.00 50.65  ? 137  LYS E NZ  1 
ATOM   6047  N N   . GLY E  1 111 ? 61.584 69.705 19.779  1.00 24.83  ? 138  GLY E N   1 
ATOM   6048  C CA  . GLY E  1 111 ? 62.401 69.905 18.594  1.00 22.30  ? 138  GLY E CA  1 
ATOM   6049  C C   . GLY E  1 111 ? 62.366 71.359 18.187  1.00 21.21  ? 138  GLY E C   1 
ATOM   6050  O O   . GLY E  1 111 ? 61.738 72.156 18.863  1.00 20.42  ? 138  GLY E O   1 
ATOM   6051  N N   . THR E  1 112 ? 62.999 71.704 17.072  1.00 21.35  ? 139  THR E N   1 
ATOM   6052  C CA  . THR E  1 112 ? 63.049 73.090 16.651  1.00 21.56  ? 139  THR E CA  1 
ATOM   6053  C C   . THR E  1 112 ? 62.348 73.441 15.367  1.00 20.74  ? 139  THR E C   1 
ATOM   6054  O O   . THR E  1 112 ? 62.679 74.447 14.740  1.00 20.17  ? 139  THR E O   1 
ATOM   6055  C CB  . THR E  1 112 ? 64.500 73.569 16.523  1.00 25.38  ? 139  THR E CB  1 
ATOM   6056  O OG1 . THR E  1 112 ? 65.169 72.820 15.500  1.00 26.56  ? 139  THR E OG1 1 
ATOM   6057  C CG2 . THR E  1 112 ? 65.234 73.377 17.842  1.00 27.10  ? 139  THR E CG2 1 
ATOM   6058  N N   . VAL E  1 113 ? 61.395 72.620 14.953  1.00 22.22  ? 140  VAL E N   1 
ATOM   6059  C CA  . VAL E  1 113 ? 60.637 72.932 13.740  1.00 23.60  ? 140  VAL E CA  1 
ATOM   6060  C C   . VAL E  1 113 ? 59.778 74.178 14.015  1.00 24.00  ? 140  VAL E C   1 
ATOM   6061  O O   . VAL E  1 113 ? 59.134 74.285 15.057  1.00 22.77  ? 140  VAL E O   1 
ATOM   6062  C CB  . VAL E  1 113 ? 59.708 71.771 13.331  1.00 22.85  ? 140  VAL E CB  1 
ATOM   6063  C CG1 . VAL E  1 113 ? 58.735 72.243 12.271  1.00 20.81  ? 140  VAL E CG1 1 
ATOM   6064  C CG2 . VAL E  1 113 ? 60.528 70.617 12.814  1.00 20.37  ? 140  VAL E CG2 1 
ATOM   6065  N N   . SER E  1 114 ? 59.763 75.116 13.080  1.00 24.52  ? 141  SER E N   1 
ATOM   6066  C CA  . SER E  1 114 ? 58.994 76.337 13.272  1.00 25.05  ? 141  SER E CA  1 
ATOM   6067  C C   . SER E  1 114 ? 58.231 76.716 12.015  1.00 24.45  ? 141  SER E C   1 
ATOM   6068  O O   . SER E  1 114 ? 58.196 77.876 11.628  1.00 22.70  ? 141  SER E O   1 
ATOM   6069  C CB  . SER E  1 114 ? 59.936 77.471 13.690  1.00 25.96  ? 141  SER E CB  1 
ATOM   6070  O OG  . SER E  1 114 ? 61.033 77.572 12.802  1.00 27.06  ? 141  SER E OG  1 
ATOM   6071  N N   . ILE E  1 115 ? 57.612 75.716 11.398  1.00 26.90  ? 142  ILE E N   1 
ATOM   6072  C CA  . ILE E  1 115 ? 56.852 75.891 10.163  1.00 29.81  ? 142  ILE E CA  1 
ATOM   6073  C C   . ILE E  1 115 ? 55.559 75.108 10.244  1.00 31.62  ? 142  ILE E C   1 
ATOM   6074  O O   . ILE E  1 115 ? 55.530 73.965 10.701  1.00 31.75  ? 142  ILE E O   1 
ATOM   6075  C CB  . ILE E  1 115 ? 57.656 75.374 8.924   1.00 31.47  ? 142  ILE E CB  1 
ATOM   6076  C CG1 . ILE E  1 115 ? 58.887 76.254 8.694   1.00 34.10  ? 142  ILE E CG1 1 
ATOM   6077  C CG2 . ILE E  1 115 ? 56.788 75.349 7.672   1.00 30.59  ? 142  ILE E CG2 1 
ATOM   6078  C CD1 . ILE E  1 115 ? 58.580 77.637 8.183   1.00 35.19  ? 142  ILE E CD1 1 
ATOM   6079  N N   . THR E  1 116 ? 54.481 75.737 9.803   1.00 34.58  ? 143  THR E N   1 
ATOM   6080  C CA  . THR E  1 116 ? 53.184 75.081 9.801   1.00 37.68  ? 143  THR E CA  1 
ATOM   6081  C C   . THR E  1 116 ? 53.184 74.142 8.603   1.00 39.85  ? 143  THR E C   1 
ATOM   6082  O O   . THR E  1 116 ? 53.960 74.332 7.661   1.00 38.74  ? 143  THR E O   1 
ATOM   6083  C CB  . THR E  1 116 ? 52.060 76.106 9.658   1.00 36.55  ? 143  THR E CB  1 
ATOM   6084  O OG1 . THR E  1 116 ? 52.233 76.838 8.440   1.00 34.69  ? 143  THR E OG1 1 
ATOM   6085  C CG2 . THR E  1 116 ? 52.095 77.073 10.826  1.00 36.09  ? 143  THR E CG2 1 
ATOM   6086  N N   . LYS E  1 117 ? 52.319 73.134 8.620   1.00 43.19  ? 144  LYS E N   1 
ATOM   6087  C CA  . LYS E  1 117 ? 52.297 72.195 7.508   1.00 46.13  ? 144  LYS E CA  1 
ATOM   6088  C C   . LYS E  1 117 ? 51.920 72.856 6.194   1.00 46.16  ? 144  LYS E C   1 
ATOM   6089  O O   . LYS E  1 117 ? 51.973 72.221 5.148   1.00 47.27  ? 144  LYS E O   1 
ATOM   6090  C CB  . LYS E  1 117 ? 51.375 71.005 7.798   1.00 48.33  ? 144  LYS E CB  1 
ATOM   6091  C CG  . LYS E  1 117 ? 49.896 71.238 7.630   1.00 51.38  ? 144  LYS E CG  1 
ATOM   6092  C CD  . LYS E  1 117 ? 49.170 69.902 7.815   1.00 55.01  ? 144  LYS E CD  1 
ATOM   6093  C CE  . LYS E  1 117 ? 47.655 70.032 7.684   1.00 56.77  ? 144  LYS E CE  1 
ATOM   6094  N NZ  . LYS E  1 117 ? 46.975 68.744 8.014   1.00 57.78  ? 144  LYS E NZ  1 
ATOM   6095  N N   . SER E  1 118 ? 51.552 74.131 6.247   1.00 46.21  ? 145  SER E N   1 
ATOM   6096  C CA  . SER E  1 118 ? 51.218 74.871 5.040   1.00 46.31  ? 145  SER E CA  1 
ATOM   6097  C C   . SER E  1 118 ? 52.392 75.754 4.675   1.00 46.02  ? 145  SER E C   1 
ATOM   6098  O O   . SER E  1 118 ? 52.303 76.580 3.768   1.00 47.04  ? 145  SER E O   1 
ATOM   6099  C CB  . SER E  1 118 ? 49.989 75.739 5.246   1.00 48.32  ? 145  SER E CB  1 
ATOM   6100  O OG  . SER E  1 118 ? 48.824 74.940 5.278   1.00 53.30  ? 145  SER E OG  1 
ATOM   6101  N N   . GLY E  1 119 ? 53.490 75.594 5.406   1.00 44.79  ? 146  GLY E N   1 
ATOM   6102  C CA  . GLY E  1 119 ? 54.685 76.360 5.116   1.00 42.96  ? 146  GLY E CA  1 
ATOM   6103  C C   . GLY E  1 119 ? 54.734 77.763 5.676   1.00 41.78  ? 146  GLY E C   1 
ATOM   6104  O O   . GLY E  1 119 ? 55.526 78.587 5.205   1.00 42.81  ? 146  GLY E O   1 
ATOM   6105  N N   . ILE E  1 120 ? 53.899 78.051 6.669   1.00 39.64  ? 147  ILE E N   1 
ATOM   6106  C CA  . ILE E  1 120 ? 53.905 79.377 7.271   1.00 37.81  ? 147  ILE E CA  1 
ATOM   6107  C C   . ILE E  1 120 ? 54.920 79.407 8.406   1.00 37.64  ? 147  ILE E C   1 
ATOM   6108  O O   . ILE E  1 120 ? 55.010 78.464 9.191   1.00 38.09  ? 147  ILE E O   1 
ATOM   6109  C CB  . ILE E  1 120 ? 52.530 79.754 7.861   1.00 37.15  ? 147  ILE E CB  1 
ATOM   6110  C CG1 . ILE E  1 120 ? 51.442 79.634 6.793   1.00 35.18  ? 147  ILE E CG1 1 
ATOM   6111  C CG2 . ILE E  1 120 ? 52.580 81.178 8.422   1.00 36.74  ? 147  ILE E CG2 1 
ATOM   6112  C CD1 . ILE E  1 120 ? 50.053 79.869 7.321   1.00 31.36  ? 147  ILE E CD1 1 
ATOM   6113  N N   . LYS E  1 121 ? 55.687 80.489 8.483   1.00 36.68  ? 148  LYS E N   1 
ATOM   6114  C CA  . LYS E  1 121 ? 56.668 80.643 9.537   1.00 36.08  ? 148  LYS E CA  1 
ATOM   6115  C C   . LYS E  1 121 ? 55.900 80.888 10.831  1.00 37.83  ? 148  LYS E C   1 
ATOM   6116  O O   . LYS E  1 121 ? 54.898 81.603 10.838  1.00 38.09  ? 148  LYS E O   1 
ATOM   6117  C CB  . LYS E  1 121 ? 57.581 81.830 9.245   1.00 34.89  ? 148  LYS E CB  1 
ATOM   6118  C CG  . LYS E  1 121 ? 58.629 82.057 10.307  1.00 35.14  ? 148  LYS E CG  1 
ATOM   6119  C CD  . LYS E  1 121 ? 59.587 83.164 9.926   1.00 36.30  ? 148  LYS E CD  1 
ATOM   6120  C CE  . LYS E  1 121 ? 60.744 83.252 10.933  1.00 38.69  ? 148  LYS E CE  1 
ATOM   6121  N NZ  . LYS E  1 121 ? 61.834 84.218 10.561  1.00 39.02  ? 148  LYS E NZ  1 
ATOM   6122  N N   . CYS E  1 122 ? 56.363 80.292 11.925  1.00 38.57  ? 149  CYS E N   1 
ATOM   6123  C CA  . CYS E  1 122 ? 55.694 80.465 13.204  1.00 38.69  ? 149  CYS E CA  1 
ATOM   6124  C C   . CYS E  1 122 ? 55.934 81.836 13.818  1.00 38.72  ? 149  CYS E C   1 
ATOM   6125  O O   . CYS E  1 122 ? 56.903 82.525 13.478  1.00 37.44  ? 149  CYS E O   1 
ATOM   6126  C CB  . CYS E  1 122 ? 56.147 79.401 14.195  1.00 37.31  ? 149  CYS E CB  1 
ATOM   6127  S SG  . CYS E  1 122 ? 55.543 77.723 13.847  1.00 39.21  ? 149  CYS E SG  1 
ATOM   6128  N N   . GLN E  1 123 ? 55.023 82.218 14.714  1.00 38.00  ? 150  GLN E N   1 
ATOM   6129  C CA  . GLN E  1 123 ? 55.102 83.478 15.436  1.00 37.13  ? 150  GLN E CA  1 
ATOM   6130  C C   . GLN E  1 123 ? 55.730 83.187 16.785  1.00 36.76  ? 150  GLN E C   1 
ATOM   6131  O O   . GLN E  1 123 ? 55.397 82.196 17.430  1.00 37.78  ? 150  GLN E O   1 
ATOM   6132  C CB  . GLN E  1 123 ? 53.712 84.057 15.677  1.00 37.39  ? 150  GLN E CB  1 
ATOM   6133  C CG  . GLN E  1 123 ? 53.702 85.239 16.665  1.00 35.03  ? 150  GLN E CG  1 
ATOM   6134  C CD  . GLN E  1 123 ? 52.298 85.670 17.052  1.00 34.24  ? 150  GLN E CD  1 
ATOM   6135  O OE1 . GLN E  1 123 ? 51.373 85.654 16.231  1.00 33.58  ? 150  GLN E OE1 1 
ATOM   6136  N NE2 . GLN E  1 123 ? 52.135 86.073 18.304  1.00 34.45  ? 150  GLN E NE2 1 
ATOM   6137  N N   . PRO E  1 124 ? 56.652 84.037 17.230  1.00 35.84  ? 151  PRO E N   1 
ATOM   6138  C CA  . PRO E  1 124 ? 57.275 83.790 18.532  1.00 35.77  ? 151  PRO E CA  1 
ATOM   6139  C C   . PRO E  1 124 ? 56.171 83.700 19.591  1.00 35.67  ? 151  PRO E C   1 
ATOM   6140  O O   . PRO E  1 124 ? 55.182 84.436 19.528  1.00 34.88  ? 151  PRO E O   1 
ATOM   6141  C CB  . PRO E  1 124 ? 58.155 85.022 18.734  1.00 35.05  ? 151  PRO E CB  1 
ATOM   6142  C CG  . PRO E  1 124 ? 58.492 85.428 17.357  1.00 36.18  ? 151  PRO E CG  1 
ATOM   6143  C CD  . PRO E  1 124 ? 57.200 85.241 16.591  1.00 35.79  ? 151  PRO E CD  1 
ATOM   6144  N N   . TRP E  1 125 ? 56.322 82.800 20.551  1.00 34.80  ? 152  TRP E N   1 
ATOM   6145  C CA  . TRP E  1 125 ? 55.317 82.700 21.588  1.00 36.60  ? 152  TRP E CA  1 
ATOM   6146  C C   . TRP E  1 125 ? 55.301 83.979 22.433  1.00 37.62  ? 152  TRP E C   1 
ATOM   6147  O O   . TRP E  1 125 ? 54.250 84.470 22.842  1.00 36.31  ? 152  TRP E O   1 
ATOM   6148  C CB  . TRP E  1 125 ? 55.585 81.480 22.469  1.00 36.22  ? 152  TRP E CB  1 
ATOM   6149  C CG  . TRP E  1 125 ? 55.500 80.199 21.726  1.00 35.53  ? 152  TRP E CG  1 
ATOM   6150  C CD1 . TRP E  1 125 ? 56.526 79.530 21.140  1.00 36.22  ? 152  TRP E CD1 1 
ATOM   6151  C CD2 . TRP E  1 125 ? 54.313 79.458 21.426  1.00 34.88  ? 152  TRP E CD2 1 
ATOM   6152  N NE1 . TRP E  1 125 ? 56.059 78.418 20.487  1.00 35.61  ? 152  TRP E NE1 1 
ATOM   6153  C CE2 . TRP E  1 125 ? 54.701 78.349 20.644  1.00 35.00  ? 152  TRP E CE2 1 
ATOM   6154  C CE3 . TRP E  1 125 ? 52.961 79.627 21.735  1.00 34.39  ? 152  TRP E CE3 1 
ATOM   6155  C CZ2 . TRP E  1 125 ? 53.784 77.407 20.160  1.00 35.09  ? 152  TRP E CZ2 1 
ATOM   6156  C CZ3 . TRP E  1 125 ? 52.046 78.688 21.251  1.00 36.75  ? 152  TRP E CZ3 1 
ATOM   6157  C CH2 . TRP E  1 125 ? 52.467 77.591 20.470  1.00 35.39  ? 152  TRP E CH2 1 
ATOM   6158  N N   . SER E  1 126 ? 56.478 84.524 22.681  1.00 39.92  ? 153  SER E N   1 
ATOM   6159  C CA  . SER E  1 126 ? 56.580 85.731 23.468  1.00 43.22  ? 153  SER E CA  1 
ATOM   6160  C C   . SER E  1 126 ? 55.913 86.923 22.785  1.00 44.88  ? 153  SER E C   1 
ATOM   6161  O O   . SER E  1 126 ? 55.580 87.901 23.450  1.00 47.73  ? 153  SER E O   1 
ATOM   6162  C CB  . SER E  1 126 ? 58.044 86.054 23.725  1.00 44.65  ? 153  SER E CB  1 
ATOM   6163  O OG  . SER E  1 126 ? 58.704 86.327 22.504  1.00 47.20  ? 153  SER E OG  1 
ATOM   6164  N N   . SER E  1 127 ? 55.721 86.859 21.469  1.00 44.68  ? 154  SER E N   1 
ATOM   6165  C CA  . SER E  1 127 ? 55.093 87.967 20.757  1.00 45.08  ? 154  SER E CA  1 
ATOM   6166  C C   . SER E  1 127 ? 53.571 87.945 20.775  1.00 45.68  ? 154  SER E C   1 
ATOM   6167  O O   . SER E  1 127 ? 52.962 86.907 21.029  1.00 46.91  ? 154  SER E O   1 
ATOM   6168  C CB  . SER E  1 127 ? 55.550 88.002 19.309  1.00 45.07  ? 154  SER E CB  1 
ATOM   6169  O OG  . SER E  1 127 ? 54.721 88.889 18.572  1.00 49.00  ? 154  SER E OG  1 
ATOM   6170  N N   . MET E  1 128 ? 52.967 89.101 20.498  1.00 45.76  ? 155  MET E N   1 
ATOM   6171  C CA  . MET E  1 128 ? 51.514 89.240 20.463  1.00 47.11  ? 155  MET E CA  1 
ATOM   6172  C C   . MET E  1 128 ? 51.139 89.678 19.066  1.00 48.11  ? 155  MET E C   1 
ATOM   6173  O O   . MET E  1 128 ? 49.983 90.022 18.781  1.00 49.05  ? 155  MET E O   1 
ATOM   6174  C CB  . MET E  1 128 ? 51.042 90.300 21.461  1.00 46.28  ? 155  MET E CB  1 
ATOM   6175  C CG  . MET E  1 128 ? 51.188 89.922 22.919  1.00 44.02  ? 155  MET E CG  1 
ATOM   6176  S SD  . MET E  1 128 ? 50.189 88.516 23.330  1.00 43.57  ? 155  MET E SD  1 
ATOM   6177  C CE  . MET E  1 128 ? 51.386 87.567 24.288  1.00 41.50  ? 155  MET E CE  1 
ATOM   6178  N N   . ILE E  1 129 ? 52.135 89.664 18.190  1.00 48.15  ? 156  ILE E N   1 
ATOM   6179  C CA  . ILE E  1 129 ? 51.933 90.082 16.809  1.00 47.75  ? 156  ILE E CA  1 
ATOM   6180  C C   . ILE E  1 129 ? 52.323 88.976 15.845  1.00 45.91  ? 156  ILE E C   1 
ATOM   6181  O O   . ILE E  1 129 ? 53.363 88.348 16.007  1.00 46.40  ? 156  ILE E O   1 
ATOM   6182  C CB  . ILE E  1 129 ? 52.777 91.335 16.506  1.00 48.92  ? 156  ILE E CB  1 
ATOM   6183  C CG1 . ILE E  1 129 ? 52.435 92.427 17.531  1.00 50.19  ? 156  ILE E CG1 1 
ATOM   6184  C CG2 . ILE E  1 129 ? 52.519 91.811 15.077  1.00 48.79  ? 156  ILE E CG2 1 
ATOM   6185  C CD1 . ILE E  1 129 ? 53.273 93.672 17.438  1.00 49.65  ? 156  ILE E CD1 1 
ATOM   6186  N N   . PRO E  1 130 ? 51.487 88.720 14.831  1.00 44.01  ? 157  PRO E N   1 
ATOM   6187  C CA  . PRO E  1 130 ? 50.231 89.421 14.572  1.00 44.16  ? 157  PRO E CA  1 
ATOM   6188  C C   . PRO E  1 130 ? 49.064 88.850 15.358  1.00 44.42  ? 157  PRO E C   1 
ATOM   6189  O O   . PRO E  1 130 ? 47.911 89.169 15.073  1.00 44.98  ? 157  PRO E O   1 
ATOM   6190  C CB  . PRO E  1 130 ? 50.043 89.226 13.072  1.00 43.91  ? 157  PRO E CB  1 
ATOM   6191  C CG  . PRO E  1 130 ? 50.530 87.861 12.871  1.00 41.85  ? 157  PRO E CG  1 
ATOM   6192  C CD  . PRO E  1 130 ? 51.817 87.835 13.704  1.00 41.93  ? 157  PRO E CD  1 
ATOM   6193  N N   . HIS E  1 131 ? 49.342 87.999 16.336  1.00 44.30  ? 158  HIS E N   1 
ATOM   6194  C CA  . HIS E  1 131 ? 48.249 87.417 17.097  1.00 44.91  ? 158  HIS E CA  1 
ATOM   6195  C C   . HIS E  1 131 ? 48.441 87.503 18.598  1.00 44.77  ? 158  HIS E C   1 
ATOM   6196  O O   . HIS E  1 131 ? 49.463 87.055 19.129  1.00 45.31  ? 158  HIS E O   1 
ATOM   6197  C CB  . HIS E  1 131 ? 48.041 85.956 16.705  1.00 45.94  ? 158  HIS E CB  1 
ATOM   6198  C CG  . HIS E  1 131 ? 47.748 85.752 15.254  1.00 46.99  ? 158  HIS E CG  1 
ATOM   6199  N ND1 . HIS E  1 131 ? 48.735 85.549 14.313  1.00 47.41  ? 158  HIS E ND1 1 
ATOM   6200  C CD2 . HIS E  1 131 ? 46.574 85.718 14.581  1.00 47.74  ? 158  HIS E CD2 1 
ATOM   6201  C CE1 . HIS E  1 131 ? 48.181 85.396 13.123  1.00 47.49  ? 158  HIS E CE1 1 
ATOM   6202  N NE2 . HIS E  1 131 ? 46.872 85.493 13.258  1.00 47.76  ? 158  HIS E NE2 1 
ATOM   6203  N N   . GLU E  1 132 ? 47.449 88.092 19.269  1.00 44.11  ? 159  GLU E N   1 
ATOM   6204  C CA  . GLU E  1 132 ? 47.431 88.243 20.733  1.00 43.04  ? 159  GLU E CA  1 
ATOM   6205  C C   . GLU E  1 132 ? 47.020 86.847 21.250  1.00 41.26  ? 159  GLU E C   1 
ATOM   6206  O O   . GLU E  1 132 ? 46.133 86.193 20.683  1.00 38.64  ? 159  GLU E O   1 
ATOM   6207  C CB  . GLU E  1 132 ? 46.383 89.322 21.115  1.00 44.00  ? 159  GLU E CB  1 
ATOM   6208  C CG  . GLU E  1 132 ? 46.220 89.716 22.599  1.00 44.58  ? 159  GLU E CG  1 
ATOM   6209  C CD  . GLU E  1 132 ? 47.168 90.832 23.058  1.00 45.82  ? 159  GLU E CD  1 
ATOM   6210  O OE1 . GLU E  1 132 ? 47.564 91.670 22.225  1.00 46.35  ? 159  GLU E OE1 1 
ATOM   6211  O OE2 . GLU E  1 132 ? 47.506 90.891 24.266  1.00 45.60  ? 159  GLU E OE2 1 
ATOM   6212  N N   . HIS E  1 133 ? 47.693 86.367 22.284  1.00 38.54  ? 160  HIS E N   1 
ATOM   6213  C CA  . HIS E  1 133 ? 47.353 85.057 22.824  1.00 38.71  ? 160  HIS E CA  1 
ATOM   6214  C C   . HIS E  1 133 ? 47.822 84.976 24.284  1.00 39.20  ? 160  HIS E C   1 
ATOM   6215  O O   . HIS E  1 133 ? 48.551 85.839 24.747  1.00 37.84  ? 160  HIS E O   1 
ATOM   6216  C CB  . HIS E  1 133 ? 48.029 83.954 22.011  1.00 37.71  ? 160  HIS E CB  1 
ATOM   6217  C CG  . HIS E  1 133 ? 49.509 83.900 22.203  1.00 37.05  ? 160  HIS E CG  1 
ATOM   6218  N ND1 . HIS E  1 133 ? 50.380 84.741 21.541  1.00 35.79  ? 160  HIS E ND1 1 
ATOM   6219  C CD2 . HIS E  1 133 ? 50.267 83.169 23.054  1.00 36.12  ? 160  HIS E CD2 1 
ATOM   6220  C CE1 . HIS E  1 133 ? 51.608 84.533 21.981  1.00 34.24  ? 160  HIS E CE1 1 
ATOM   6221  N NE2 . HIS E  1 133 ? 51.567 83.586 22.900  1.00 34.59  ? 160  HIS E NE2 1 
ATOM   6222  N N   . SER E  1 134 ? 47.444 83.941 25.025  1.00 39.86  ? 161  SER E N   1 
ATOM   6223  C CA  . SER E  1 134 ? 47.883 83.879 26.417  1.00 39.75  ? 161  SER E CA  1 
ATOM   6224  C C   . SER E  1 134 ? 48.986 82.871 26.720  1.00 39.82  ? 161  SER E C   1 
ATOM   6225  O O   . SER E  1 134 ? 49.479 82.807 27.836  1.00 38.74  ? 161  SER E O   1 
ATOM   6226  C CB  . SER E  1 134 ? 46.683 83.627 27.318  1.00 39.67  ? 161  SER E CB  1 
ATOM   6227  O OG  . SER E  1 134 ? 45.827 84.753 27.285  1.00 39.14  ? 161  SER E OG  1 
ATOM   6228  N N   . PHE E  1 135 ? 49.381 82.105 25.712  1.00 40.76  ? 162  PHE E N   1 
ATOM   6229  C CA  . PHE E  1 135 ? 50.417 81.091 25.852  1.00 39.90  ? 162  PHE E CA  1 
ATOM   6230  C C   . PHE E  1 135 ? 51.786 81.702 26.076  1.00 41.64  ? 162  PHE E C   1 
ATOM   6231  O O   . PHE E  1 135 ? 52.693 81.543 25.263  1.00 41.78  ? 162  PHE E O   1 
ATOM   6232  C CB  . PHE E  1 135 ? 50.456 80.229 24.598  1.00 37.18  ? 162  PHE E CB  1 
ATOM   6233  C CG  . PHE E  1 135 ? 49.241 79.388 24.412  1.00 35.21  ? 162  PHE E CG  1 
ATOM   6234  C CD1 . PHE E  1 135 ? 49.178 78.108 24.946  1.00 34.28  ? 162  PHE E CD1 1 
ATOM   6235  C CD2 . PHE E  1 135 ? 48.143 79.881 23.724  1.00 34.47  ? 162  PHE E CD2 1 
ATOM   6236  C CE1 . PHE E  1 135 ? 48.042 77.333 24.799  1.00 32.60  ? 162  PHE E CE1 1 
ATOM   6237  C CE2 . PHE E  1 135 ? 46.995 79.107 23.576  1.00 33.39  ? 162  PHE E CE2 1 
ATOM   6238  C CZ  . PHE E  1 135 ? 46.947 77.833 24.114  1.00 32.82  ? 162  PHE E CZ  1 
ATOM   6239  N N   . LEU E  1 136 ? 51.947 82.407 27.179  1.00 43.60  ? 163  LEU E N   1 
ATOM   6240  C CA  . LEU E  1 136 ? 53.234 83.010 27.465  1.00 46.42  ? 163  LEU E CA  1 
ATOM   6241  C C   . LEU E  1 136 ? 54.156 81.957 28.058  1.00 47.45  ? 163  LEU E C   1 
ATOM   6242  O O   . LEU E  1 136 ? 53.710 81.014 28.711  1.00 46.91  ? 163  LEU E O   1 
ATOM   6243  C CB  . LEU E  1 136 ? 53.064 84.167 28.451  1.00 47.51  ? 163  LEU E CB  1 
ATOM   6244  C CG  . LEU E  1 136 ? 52.165 85.302 27.957  1.00 47.54  ? 163  LEU E CG  1 
ATOM   6245  C CD1 . LEU E  1 136 ? 51.838 86.253 29.108  1.00 48.27  ? 163  LEU E CD1 1 
ATOM   6246  C CD2 . LEU E  1 136 ? 52.870 86.024 26.810  1.00 47.32  ? 163  LEU E CD2 1 
ATOM   6247  N N   . PRO E  1 137 ? 55.458 82.092 27.814  1.00 48.82  ? 164  PRO E N   1 
ATOM   6248  C CA  . PRO E  1 137 ? 56.428 81.137 28.345  1.00 50.30  ? 164  PRO E CA  1 
ATOM   6249  C C   . PRO E  1 137 ? 56.310 80.975 29.867  1.00 52.15  ? 164  PRO E C   1 
ATOM   6250  O O   . PRO E  1 137 ? 56.633 79.919 30.410  1.00 52.49  ? 164  PRO E O   1 
ATOM   6251  C CB  . PRO E  1 137 ? 57.757 81.745 27.921  1.00 50.22  ? 164  PRO E CB  1 
ATOM   6252  C CG  . PRO E  1 137 ? 57.419 82.366 26.597  1.00 49.71  ? 164  PRO E CG  1 
ATOM   6253  C CD  . PRO E  1 137 ? 56.097 83.034 26.877  1.00 49.48  ? 164  PRO E CD  1 
ATOM   6254  N N   . SER E  1 138 ? 55.840 82.018 30.551  1.00 54.08  ? 165  SER E N   1 
ATOM   6255  C CA  . SER E  1 138 ? 55.697 81.976 32.010  1.00 54.73  ? 165  SER E CA  1 
ATOM   6256  C C   . SER E  1 138 ? 54.551 81.067 32.451  1.00 54.26  ? 165  SER E C   1 
ATOM   6257  O O   . SER E  1 138 ? 54.771 80.044 33.097  1.00 55.72  ? 165  SER E O   1 
ATOM   6258  C CB  . SER E  1 138 ? 55.487 83.391 32.576  1.00 55.46  ? 165  SER E CB  1 
ATOM   6259  O OG  . SER E  1 138 ? 54.267 83.965 32.130  1.00 57.51  ? 165  SER E OG  1 
ATOM   6260  N N   . SER E  1 139 ? 53.323 81.432 32.112  1.00 53.33  ? 166  SER E N   1 
ATOM   6261  C CA  . SER E  1 139 ? 52.200 80.598 32.500  1.00 52.63  ? 166  SER E CA  1 
ATOM   6262  C C   . SER E  1 139 ? 52.215 79.294 31.707  1.00 51.91  ? 166  SER E C   1 
ATOM   6263  O O   . SER E  1 139 ? 51.169 78.757 31.353  1.00 50.80  ? 166  SER E O   1 
ATOM   6264  C CB  . SER E  1 139 ? 50.877 81.345 32.292  1.00 53.11  ? 166  SER E CB  1 
ATOM   6265  O OG  . SER E  1 139 ? 50.933 82.230 31.187  1.00 52.02  ? 166  SER E OG  1 
ATOM   6266  N N   . TYR E  1 140 ? 53.416 78.789 31.450  1.00 51.00  ? 167  TYR E N   1 
ATOM   6267  C CA  . TYR E  1 140 ? 53.605 77.555 30.706  1.00 50.10  ? 167  TYR E CA  1 
ATOM   6268  C C   . TYR E  1 140 ? 55.075 77.127 30.764  1.00 49.03  ? 167  TYR E C   1 
ATOM   6269  O O   . TYR E  1 140 ? 55.665 76.730 29.755  1.00 48.96  ? 167  TYR E O   1 
ATOM   6270  C CB  . TYR E  1 140 ? 53.156 77.744 29.247  1.00 51.18  ? 167  TYR E CB  1 
ATOM   6271  C CG  . TYR E  1 140 ? 51.657 77.595 29.027  1.00 53.15  ? 167  TYR E CG  1 
ATOM   6272  C CD1 . TYR E  1 140 ? 50.984 76.446 29.451  1.00 52.69  ? 167  TYR E CD1 1 
ATOM   6273  C CD2 . TYR E  1 140 ? 50.905 78.599 28.392  1.00 54.00  ? 167  TYR E CD2 1 
ATOM   6274  C CE1 . TYR E  1 140 ? 49.603 76.294 29.253  1.00 52.13  ? 167  TYR E CE1 1 
ATOM   6275  C CE2 . TYR E  1 140 ? 49.512 78.453 28.190  1.00 52.40  ? 167  TYR E CE2 1 
ATOM   6276  C CZ  . TYR E  1 140 ? 48.877 77.293 28.628  1.00 51.89  ? 167  TYR E CZ  1 
ATOM   6277  O OH  . TYR E  1 140 ? 47.523 77.113 28.461  1.00 51.52  ? 167  TYR E OH  1 
ATOM   6278  N N   . ARG E  1 141 ? 55.668 77.229 31.950  1.00 47.44  ? 168  ARG E N   1 
ATOM   6279  C CA  . ARG E  1 141 ? 57.063 76.838 32.139  1.00 46.47  ? 168  ARG E CA  1 
ATOM   6280  C C   . ARG E  1 141 ? 57.155 75.326 31.956  1.00 45.54  ? 168  ARG E C   1 
ATOM   6281  O O   . ARG E  1 141 ? 56.228 74.597 32.312  1.00 45.80  ? 168  ARG E O   1 
ATOM   6282  C CB  . ARG E  1 141 ? 57.539 77.238 33.534  1.00 45.18  ? 168  ARG E CB  1 
ATOM   6283  N N   . GLY E  1 142 ? 58.258 74.862 31.381  1.00 44.03  ? 169  GLY E N   1 
ATOM   6284  C CA  . GLY E  1 142 ? 58.430 73.438 31.166  1.00 44.45  ? 169  GLY E CA  1 
ATOM   6285  C C   . GLY E  1 142 ? 57.899 72.944 29.835  1.00 44.30  ? 169  GLY E C   1 
ATOM   6286  O O   . GLY E  1 142 ? 58.324 71.899 29.336  1.00 46.41  ? 169  GLY E O   1 
ATOM   6287  N N   . LYS E  1 143 ? 56.950 73.681 29.270  1.00 43.52  ? 170  LYS E N   1 
ATOM   6288  C CA  . LYS E  1 143 ? 56.385 73.321 27.982  1.00 41.74  ? 170  LYS E CA  1 
ATOM   6289  C C   . LYS E  1 143 ? 57.232 73.987 26.880  1.00 41.41  ? 170  LYS E C   1 
ATOM   6290  O O   . LYS E  1 143 ? 56.807 74.111 25.735  1.00 42.57  ? 170  LYS E O   1 
ATOM   6291  C CB  . LYS E  1 143 ? 54.930 73.760 27.911  1.00 39.73  ? 170  LYS E CB  1 
ATOM   6292  N N   . ASP E  1 144 ? 58.437 74.406 27.259  1.00 40.07  ? 171  ASP E N   1 
ATOM   6293  C CA  . ASP E  1 144 ? 59.420 75.021 26.370  1.00 39.94  ? 171  ASP E CA  1 
ATOM   6294  C C   . ASP E  1 144 ? 58.877 75.878 25.239  1.00 37.60  ? 171  ASP E C   1 
ATOM   6295  O O   . ASP E  1 144 ? 59.255 75.723 24.080  1.00 36.49  ? 171  ASP E O   1 
ATOM   6296  C CB  . ASP E  1 144 ? 60.349 73.928 25.812  1.00 43.18  ? 171  ASP E CB  1 
ATOM   6297  C CG  . ASP E  1 144 ? 61.513 74.491 25.009  1.00 45.82  ? 171  ASP E CG  1 
ATOM   6298  O OD1 . ASP E  1 144 ? 62.044 75.575 25.353  1.00 48.40  ? 171  ASP E OD1 1 
ATOM   6299  O OD2 . ASP E  1 144 ? 61.906 73.832 24.033  1.00 48.92  ? 171  ASP E OD2 1 
ATOM   6300  N N   . LEU E  1 145 ? 57.995 76.802 25.583  1.00 36.57  ? 172  LEU E N   1 
ATOM   6301  C CA  . LEU E  1 145 ? 57.424 77.693 24.584  1.00 35.79  ? 172  LEU E CA  1 
ATOM   6302  C C   . LEU E  1 145 ? 58.427 78.786 24.230  1.00 36.34  ? 172  LEU E C   1 
ATOM   6303  O O   . LEU E  1 145 ? 58.197 79.971 24.489  1.00 37.20  ? 172  LEU E O   1 
ATOM   6304  C CB  . LEU E  1 145 ? 56.127 78.311 25.107  1.00 31.65  ? 172  LEU E CB  1 
ATOM   6305  C CG  . LEU E  1 145 ? 54.990 77.319 25.287  1.00 28.22  ? 172  LEU E CG  1 
ATOM   6306  C CD1 . LEU E  1 145 ? 53.787 78.046 25.793  1.00 28.73  ? 172  LEU E CD1 1 
ATOM   6307  C CD2 . LEU E  1 145 ? 54.689 76.632 23.966  1.00 29.01  ? 172  LEU E CD2 1 
ATOM   6308  N N   . GLN E  1 146 ? 59.533 78.369 23.621  1.00 36.28  ? 173  GLN E N   1 
ATOM   6309  C CA  . GLN E  1 146 ? 60.586 79.284 23.227  1.00 36.02  ? 173  GLN E CA  1 
ATOM   6310  C C   . GLN E  1 146 ? 60.632 79.600 21.738  1.00 33.65  ? 173  GLN E C   1 
ATOM   6311  O O   . GLN E  1 146 ? 60.028 78.909 20.916  1.00 32.68  ? 173  GLN E O   1 
ATOM   6312  C CB  . GLN E  1 146 ? 61.919 78.734 23.689  1.00 40.12  ? 173  GLN E CB  1 
ATOM   6313  C CG  . GLN E  1 146 ? 62.048 78.757 25.187  1.00 47.50  ? 173  GLN E CG  1 
ATOM   6314  C CD  . GLN E  1 146 ? 63.425 78.350 25.647  1.00 51.46  ? 173  GLN E CD  1 
ATOM   6315  O OE1 . GLN E  1 146 ? 64.372 78.320 24.855  1.00 54.55  ? 173  GLN E OE1 1 
ATOM   6316  N NE2 . GLN E  1 146 ? 63.553 78.044 26.935  1.00 54.28  ? 173  GLN E NE2 1 
ATOM   6317  N N   . GLU E  1 147 ? 61.368 80.652 21.407  1.00 31.31  ? 174  GLU E N   1 
ATOM   6318  C CA  . GLU E  1 147 ? 61.479 81.123 20.040  1.00 30.77  ? 174  GLU E CA  1 
ATOM   6319  C C   . GLU E  1 147 ? 60.104 81.014 19.386  1.00 30.27  ? 174  GLU E C   1 
ATOM   6320  O O   . GLU E  1 147 ? 59.123 81.566 19.882  1.00 30.85  ? 174  GLU E O   1 
ATOM   6321  C CB  . GLU E  1 147 ? 62.504 80.307 19.257  1.00 31.45  ? 174  GLU E CB  1 
ATOM   6322  C CG  . GLU E  1 147 ? 63.937 80.293 19.840  1.00 33.11  ? 174  GLU E CG  1 
ATOM   6323  C CD  . GLU E  1 147 ? 64.672 81.651 19.814  1.00 32.83  ? 174  GLU E CD  1 
ATOM   6324  O OE1 . GLU E  1 147 ? 64.435 82.466 18.899  1.00 30.74  ? 174  GLU E OE1 1 
ATOM   6325  O OE2 . GLU E  1 147 ? 65.518 81.888 20.711  1.00 33.86  ? 174  GLU E OE2 1 
ATOM   6326  N N   . ASN E  1 148 ? 60.022 80.305 18.275  1.00 28.99  ? 175  ASN E N   1 
ATOM   6327  C CA  . ASN E  1 148 ? 58.744 80.151 17.601  1.00 28.07  ? 175  ASN E CA  1 
ATOM   6328  C C   . ASN E  1 148 ? 58.599 78.695 17.169  1.00 26.90  ? 175  ASN E C   1 
ATOM   6329  O O   . ASN E  1 148 ? 58.053 78.385 16.112  1.00 22.86  ? 175  ASN E O   1 
ATOM   6330  C CB  . ASN E  1 148 ? 58.672 81.085 16.393  1.00 29.66  ? 175  ASN E CB  1 
ATOM   6331  C CG  . ASN E  1 148 ? 59.647 80.697 15.303  1.00 30.94  ? 175  ASN E CG  1 
ATOM   6332  O OD1 . ASN E  1 148 ? 60.787 80.335 15.589  1.00 32.31  ? 175  ASN E OD1 1 
ATOM   6333  N ND2 . ASN E  1 148 ? 59.209 80.776 14.044  1.00 30.53  ? 175  ASN E ND2 1 
ATOM   6334  N N   . TYR E  1 149 ? 59.093 77.803 18.020  1.00 27.27  ? 176  TYR E N   1 
ATOM   6335  C CA  . TYR E  1 149 ? 59.038 76.378 17.755  1.00 26.79  ? 176  TYR E CA  1 
ATOM   6336  C C   . TYR E  1 149 ? 57.652 75.806 17.969  1.00 25.50  ? 176  TYR E C   1 
ATOM   6337  O O   . TYR E  1 149 ? 56.992 76.137 18.939  1.00 24.60  ? 176  TYR E O   1 
ATOM   6338  C CB  . TYR E  1 149 ? 59.982 75.628 18.682  1.00 27.84  ? 176  TYR E CB  1 
ATOM   6339  C CG  . TYR E  1 149 ? 61.393 76.163 18.756  1.00 29.46  ? 176  TYR E CG  1 
ATOM   6340  C CD1 . TYR E  1 149 ? 62.154 76.354 17.612  1.00 29.02  ? 176  TYR E CD1 1 
ATOM   6341  C CD2 . TYR E  1 149 ? 61.990 76.411 19.994  1.00 32.59  ? 176  TYR E CD2 1 
ATOM   6342  C CE1 . TYR E  1 149 ? 63.480 76.773 17.697  1.00 31.22  ? 176  TYR E CE1 1 
ATOM   6343  C CE2 . TYR E  1 149 ? 63.313 76.831 20.092  1.00 33.08  ? 176  TYR E CE2 1 
ATOM   6344  C CZ  . TYR E  1 149 ? 64.053 77.008 18.942  1.00 32.49  ? 176  TYR E CZ  1 
ATOM   6345  O OH  . TYR E  1 149 ? 65.363 77.409 19.055  1.00 33.42  ? 176  TYR E OH  1 
ATOM   6346  N N   . CYS E  1 150 ? 57.223 74.934 17.064  1.00 24.68  ? 177  CYS E N   1 
ATOM   6347  C CA  . CYS E  1 150 ? 55.933 74.279 17.192  1.00 23.59  ? 177  CYS E CA  1 
ATOM   6348  C C   . CYS E  1 150 ? 55.930 73.528 18.513  1.00 24.26  ? 177  CYS E C   1 
ATOM   6349  O O   . CYS E  1 150 ? 56.889 72.856 18.872  1.00 25.24  ? 177  CYS E O   1 
ATOM   6350  C CB  . CYS E  1 150 ? 55.729 73.282 16.074  1.00 23.09  ? 177  CYS E CB  1 
ATOM   6351  S SG  . CYS E  1 150 ? 55.832 74.022 14.437  1.00 29.29  ? 177  CYS E SG  1 
ATOM   6352  N N   . ARG E  1 151 ? 54.837 73.637 19.239  1.00 24.71  ? 178  ARG E N   1 
ATOM   6353  C CA  . ARG E  1 151 ? 54.726 72.978 20.515  1.00 24.89  ? 178  ARG E CA  1 
ATOM   6354  C C   . ARG E  1 151 ? 53.275 72.530 20.676  1.00 27.09  ? 178  ARG E C   1 
ATOM   6355  O O   . ARG E  1 151 ? 52.434 72.785 19.819  1.00 26.90  ? 178  ARG E O   1 
ATOM   6356  C CB  . ARG E  1 151 ? 55.125 73.963 21.618  1.00 23.33  ? 178  ARG E CB  1 
ATOM   6357  C CG  . ARG E  1 151 ? 56.603 74.348 21.616  1.00 22.86  ? 178  ARG E CG  1 
ATOM   6358  C CD  . ARG E  1 151 ? 57.426 73.314 22.391  1.00 25.03  ? 178  ARG E CD  1 
ATOM   6359  N NE  . ARG E  1 151 ? 58.866 73.582 22.416  1.00 24.26  ? 178  ARG E NE  1 
ATOM   6360  C CZ  . ARG E  1 151 ? 59.717 73.283 21.433  1.00 24.23  ? 178  ARG E CZ  1 
ATOM   6361  N NH1 . ARG E  1 151 ? 59.293 72.693 20.318  1.00 22.36  ? 178  ARG E NH1 1 
ATOM   6362  N NH2 . ARG E  1 151 ? 60.999 73.590 21.561  1.00 20.21  ? 178  ARG E NH2 1 
ATOM   6363  N N   . ASN E  1 152 ? 52.991 71.837 21.764  1.00 29.09  ? 179  ASN E N   1 
ATOM   6364  C CA  . ASN E  1 152 ? 51.644 71.385 22.046  1.00 31.56  ? 179  ASN E CA  1 
ATOM   6365  C C   . ASN E  1 152 ? 51.550 71.405 23.563  1.00 34.56  ? 179  ASN E C   1 
ATOM   6366  O O   . ASN E  1 152 ? 51.474 70.352 24.216  1.00 34.87  ? 179  ASN E O   1 
ATOM   6367  C CB  . ASN E  1 152 ? 51.439 69.974 21.517  1.00 31.70  ? 179  ASN E CB  1 
ATOM   6368  C CG  . ASN E  1 152 ? 50.033 69.481 21.749  1.00 32.88  ? 179  ASN E CG  1 
ATOM   6369  O OD1 . ASN E  1 152 ? 49.160 70.255 22.147  1.00 35.51  ? 179  ASN E OD1 1 
ATOM   6370  N ND2 . ASN E  1 152 ? 49.793 68.203 21.491  1.00 32.75  ? 179  ASN E ND2 1 
ATOM   6371  N N   . PRO E  1 153 ? 51.559 72.618 24.145  1.00 36.14  ? 180  PRO E N   1 
ATOM   6372  C CA  . PRO E  1 153 ? 51.494 72.852 25.589  1.00 37.44  ? 180  PRO E CA  1 
ATOM   6373  C C   . PRO E  1 153 ? 50.274 72.311 26.322  1.00 38.68  ? 180  PRO E C   1 
ATOM   6374  O O   . PRO E  1 153 ? 50.289 72.220 27.544  1.00 38.66  ? 180  PRO E O   1 
ATOM   6375  C CB  . PRO E  1 153 ? 51.647 74.369 25.697  1.00 35.53  ? 180  PRO E CB  1 
ATOM   6376  C CG  . PRO E  1 153 ? 50.982 74.838 24.478  1.00 35.82  ? 180  PRO E CG  1 
ATOM   6377  C CD  . PRO E  1 153 ? 51.479 73.892 23.414  1.00 35.36  ? 180  PRO E CD  1 
ATOM   6378  N N   . ARG E  1 154 ? 49.215 71.957 25.601  1.00 41.10  ? 181  ARG E N   1 
ATOM   6379  C CA  . ARG E  1 154 ? 48.039 71.393 26.269  1.00 44.84  ? 181  ARG E CA  1 
ATOM   6380  C C   . ARG E  1 154 ? 47.889 69.920 25.935  1.00 46.66  ? 181  ARG E C   1 
ATOM   6381  O O   . ARG E  1 154 ? 46.942 69.274 26.374  1.00 48.28  ? 181  ARG E O   1 
ATOM   6382  C CB  . ARG E  1 154 ? 46.753 72.108 25.856  1.00 45.12  ? 181  ARG E CB  1 
ATOM   6383  C CG  . ARG E  1 154 ? 46.537 73.469 26.483  1.00 46.55  ? 181  ARG E CG  1 
ATOM   6384  C CD  . ARG E  1 154 ? 46.205 74.415 25.382  1.00 46.47  ? 181  ARG E CD  1 
ATOM   6385  N NE  . ARG E  1 154 ? 44.883 74.994 25.473  1.00 45.69  ? 181  ARG E NE  1 
ATOM   6386  C CZ  . ARG E  1 154 ? 44.235 75.474 24.420  1.00 48.07  ? 181  ARG E CZ  1 
ATOM   6387  N NH1 . ARG E  1 154 ? 44.783 75.417 23.217  1.00 48.79  ? 181  ARG E NH1 1 
ATOM   6388  N NH2 . ARG E  1 154 ? 43.068 76.070 24.566  1.00 50.30  ? 181  ARG E NH2 1 
ATOM   6389  N N   . GLY E  1 155 ? 48.831 69.391 25.164  1.00 48.31  ? 182  GLY E N   1 
ATOM   6390  C CA  . GLY E  1 155 ? 48.755 68.001 24.764  1.00 48.74  ? 182  GLY E CA  1 
ATOM   6391  C C   . GLY E  1 155 ? 47.426 67.686 24.105  1.00 48.73  ? 182  GLY E C   1 
ATOM   6392  O O   . GLY E  1 155 ? 46.845 66.637 24.357  1.00 50.13  ? 182  GLY E O   1 
ATOM   6393  N N   . GLU E  1 156 ? 46.941 68.592 23.265  1.00 49.02  ? 183  GLU E N   1 
ATOM   6394  C CA  . GLU E  1 156 ? 45.673 68.390 22.572  1.00 50.46  ? 183  GLU E CA  1 
ATOM   6395  C C   . GLU E  1 156 ? 45.889 67.508 21.337  1.00 50.37  ? 183  GLU E C   1 
ATOM   6396  O O   . GLU E  1 156 ? 46.995 67.443 20.799  1.00 49.27  ? 183  GLU E O   1 
ATOM   6397  C CB  . GLU E  1 156 ? 45.096 69.736 22.133  1.00 51.25  ? 183  GLU E CB  1 
ATOM   6398  C CG  . GLU E  1 156 ? 45.163 70.824 23.196  1.00 54.76  ? 183  GLU E CG  1 
ATOM   6399  C CD  . GLU E  1 156 ? 44.781 72.203 22.652  1.00 56.59  ? 183  GLU E CD  1 
ATOM   6400  O OE1 . GLU E  1 156 ? 43.614 72.374 22.232  1.00 56.39  ? 183  GLU E OE1 1 
ATOM   6401  O OE2 . GLU E  1 156 ? 45.651 73.109 22.642  1.00 56.76  ? 183  GLU E OE2 1 
ATOM   6402  N N   . GLU E  1 157 ? 44.843 66.809 20.898  1.00 50.87  ? 184  GLU E N   1 
ATOM   6403  C CA  . GLU E  1 157 ? 44.963 65.972 19.710  1.00 51.68  ? 184  GLU E CA  1 
ATOM   6404  C C   . GLU E  1 157 ? 45.340 67.005 18.669  1.00 51.19  ? 184  GLU E C   1 
ATOM   6405  O O   . GLU E  1 157 ? 44.972 68.172 18.805  1.00 51.57  ? 184  GLU E O   1 
ATOM   6406  C CB  . GLU E  1 157 ? 43.620 65.348 19.310  1.00 53.97  ? 184  GLU E CB  1 
ATOM   6407  C CG  . GLU E  1 157 ? 42.679 64.983 20.459  1.00 58.80  ? 184  GLU E CG  1 
ATOM   6408  C CD  . GLU E  1 157 ? 43.060 63.704 21.190  1.00 60.65  ? 184  GLU E CD  1 
ATOM   6409  O OE1 . GLU E  1 157 ? 43.253 62.672 20.512  1.00 62.31  ? 184  GLU E OE1 1 
ATOM   6410  O OE2 . GLU E  1 157 ? 43.149 63.722 22.440  1.00 61.48  ? 184  GLU E OE2 1 
ATOM   6411  N N   . GLY E  1 158 ? 46.047 66.590 17.626  1.00 50.22  ? 185  GLY E N   1 
ATOM   6412  C CA  . GLY E  1 158 ? 46.463 67.536 16.604  1.00 48.27  ? 185  GLY E CA  1 
ATOM   6413  C C   . GLY E  1 158 ? 47.950 67.777 16.747  1.00 46.95  ? 185  GLY E C   1 
ATOM   6414  O O   . GLY E  1 158 ? 48.592 68.348 15.863  1.00 47.74  ? 185  GLY E O   1 
ATOM   6415  N N   . GLY E  1 159 ? 48.497 67.342 17.879  1.00 44.97  ? 186  GLY E N   1 
ATOM   6416  C CA  . GLY E  1 159 ? 49.918 67.492 18.121  1.00 42.00  ? 186  GLY E CA  1 
ATOM   6417  C C   . GLY E  1 159 ? 50.420 68.913 18.040  1.00 39.68  ? 186  GLY E C   1 
ATOM   6418  O O   . GLY E  1 159 ? 49.634 69.850 18.063  1.00 39.62  ? 186  GLY E O   1 
ATOM   6419  N N   . PRO E  1 160 ? 51.739 69.099 17.941  1.00 38.63  ? 187  PRO E N   1 
ATOM   6420  C CA  . PRO E  1 160 ? 52.400 70.406 17.858  1.00 37.94  ? 187  PRO E CA  1 
ATOM   6421  C C   . PRO E  1 160 ? 51.810 71.391 16.858  1.00 36.91  ? 187  PRO E C   1 
ATOM   6422  O O   . PRO E  1 160 ? 51.459 71.040 15.729  1.00 37.52  ? 187  PRO E O   1 
ATOM   6423  C CB  . PRO E  1 160 ? 53.842 70.037 17.536  1.00 38.78  ? 187  PRO E CB  1 
ATOM   6424  C CG  . PRO E  1 160 ? 54.014 68.756 18.307  1.00 40.13  ? 187  PRO E CG  1 
ATOM   6425  C CD  . PRO E  1 160 ? 52.733 68.012 17.970  1.00 38.89  ? 187  PRO E CD  1 
ATOM   6426  N N   . TRP E  1 161 ? 51.713 72.639 17.295  1.00 35.09  ? 188  TRP E N   1 
ATOM   6427  C CA  . TRP E  1 161 ? 51.160 73.716 16.481  1.00 32.40  ? 188  TRP E CA  1 
ATOM   6428  C C   . TRP E  1 161 ? 51.869 74.998 16.854  1.00 32.12  ? 188  TRP E C   1 
ATOM   6429  O O   . TRP E  1 161 ? 52.789 74.998 17.673  1.00 33.09  ? 188  TRP E O   1 
ATOM   6430  C CB  . TRP E  1 161 ? 49.666 73.884 16.769  1.00 28.83  ? 188  TRP E CB  1 
ATOM   6431  C CG  . TRP E  1 161 ? 49.379 74.137 18.208  1.00 23.39  ? 188  TRP E CG  1 
ATOM   6432  C CD1 . TRP E  1 161 ? 49.307 73.214 19.198  1.00 22.10  ? 188  TRP E CD1 1 
ATOM   6433  C CD2 . TRP E  1 161 ? 49.173 75.407 18.826  1.00 22.96  ? 188  TRP E CD2 1 
ATOM   6434  N NE1 . TRP E  1 161 ? 49.065 73.823 20.400  1.00 23.23  ? 188  TRP E NE1 1 
ATOM   6435  C CE2 . TRP E  1 161 ? 48.980 75.175 20.201  1.00 23.11  ? 188  TRP E CE2 1 
ATOM   6436  C CE3 . TRP E  1 161 ? 49.129 76.725 18.351  1.00 23.55  ? 188  TRP E CE3 1 
ATOM   6437  C CZ2 . TRP E  1 161 ? 48.746 76.219 21.117  1.00 23.57  ? 188  TRP E CZ2 1 
ATOM   6438  C CZ3 . TRP E  1 161 ? 48.893 77.762 19.260  1.00 23.46  ? 188  TRP E CZ3 1 
ATOM   6439  C CH2 . TRP E  1 161 ? 48.705 77.500 20.625  1.00 22.76  ? 188  TRP E CH2 1 
ATOM   6440  N N   . CYS E  1 162 ? 51.429 76.097 16.271  1.00 31.41  ? 189  CYS E N   1 
ATOM   6441  C CA  . CYS E  1 162 ? 52.038 77.371 16.589  1.00 34.33  ? 189  CYS E CA  1 
ATOM   6442  C C   . CYS E  1 162 ? 51.207 78.496 15.982  1.00 34.68  ? 189  CYS E C   1 
ATOM   6443  O O   . CYS E  1 162 ? 50.416 78.266 15.075  1.00 35.44  ? 189  CYS E O   1 
ATOM   6444  C CB  . CYS E  1 162 ? 53.468 77.422 16.037  1.00 33.71  ? 189  CYS E CB  1 
ATOM   6445  S SG  . CYS E  1 162 ? 53.558 77.785 14.258  1.00 35.30  ? 189  CYS E SG  1 
ATOM   6446  N N   . PHE E  1 163 ? 51.371 79.706 16.501  1.00 34.72  ? 190  PHE E N   1 
ATOM   6447  C CA  . PHE E  1 163 ? 50.667 80.848 15.956  1.00 34.75  ? 190  PHE E CA  1 
ATOM   6448  C C   . PHE E  1 163 ? 51.459 81.231 14.714  1.00 35.04  ? 190  PHE E C   1 
ATOM   6449  O O   . PHE E  1 163 ? 52.673 81.429 14.787  1.00 32.75  ? 190  PHE E O   1 
ATOM   6450  C CB  . PHE E  1 163 ? 50.659 81.997 16.966  1.00 35.56  ? 190  PHE E CB  1 
ATOM   6451  C CG  . PHE E  1 163 ? 49.701 81.789 18.107  1.00 36.14  ? 190  PHE E CG  1 
ATOM   6452  C CD1 . PHE E  1 163 ? 48.329 81.841 17.897  1.00 34.79  ? 190  PHE E CD1 1 
ATOM   6453  C CD2 . PHE E  1 163 ? 50.169 81.479 19.380  1.00 37.29  ? 190  PHE E CD2 1 
ATOM   6454  C CE1 . PHE E  1 163 ? 47.449 81.581 18.930  1.00 34.99  ? 190  PHE E CE1 1 
ATOM   6455  C CE2 . PHE E  1 163 ? 49.279 81.214 20.433  1.00 35.72  ? 190  PHE E CE2 1 
ATOM   6456  C CZ  . PHE E  1 163 ? 47.927 81.265 20.204  1.00 34.97  ? 190  PHE E CZ  1 
ATOM   6457  N N   . THR E  1 164 ? 50.779 81.329 13.573  1.00 36.30  ? 191  THR E N   1 
ATOM   6458  C CA  . THR E  1 164 ? 51.457 81.662 12.317  1.00 36.74  ? 191  THR E CA  1 
ATOM   6459  C C   . THR E  1 164 ? 51.696 83.155 12.120  1.00 37.80  ? 191  THR E C   1 
ATOM   6460  O O   . THR E  1 164 ? 50.904 83.980 12.550  1.00 37.89  ? 191  THR E O   1 
ATOM   6461  C CB  . THR E  1 164 ? 50.678 81.129 11.106  1.00 35.25  ? 191  THR E CB  1 
ATOM   6462  O OG1 . THR E  1 164 ? 50.039 82.218 10.441  1.00 35.72  ? 191  THR E OG1 1 
ATOM   6463  C CG2 . THR E  1 164 ? 49.627 80.113 11.546  1.00 32.73  ? 191  THR E CG2 1 
ATOM   6464  N N   . SER E  1 165 ? 52.802 83.491 11.468  1.00 39.50  ? 192  SER E N   1 
ATOM   6465  C CA  . SER E  1 165 ? 53.150 84.885 11.218  1.00 40.18  ? 192  SER E CA  1 
ATOM   6466  C C   . SER E  1 165 ? 52.237 85.523 10.174  1.00 40.35  ? 192  SER E C   1 
ATOM   6467  O O   . SER E  1 165 ? 52.382 86.704 9.853   1.00 37.41  ? 192  SER E O   1 
ATOM   6468  C CB  . SER E  1 165 ? 54.610 84.992 10.779  1.00 40.77  ? 192  SER E CB  1 
ATOM   6469  O OG  . SER E  1 165 ? 54.907 84.040 9.777   1.00 43.69  ? 192  SER E OG  1 
ATOM   6470  N N   . ASN E  1 166 ? 51.301 84.734 9.654   1.00 42.54  ? 193  ASN E N   1 
ATOM   6471  C CA  . ASN E  1 166 ? 50.341 85.221 8.669   1.00 46.15  ? 193  ASN E CA  1 
ATOM   6472  C C   . ASN E  1 166 ? 49.108 85.746 9.401   1.00 47.78  ? 193  ASN E C   1 
ATOM   6473  O O   . ASN E  1 166 ? 48.372 84.979 10.023  1.00 49.36  ? 193  ASN E O   1 
ATOM   6474  C CB  . ASN E  1 166 ? 49.906 84.102 7.732   1.00 48.55  ? 193  ASN E CB  1 
ATOM   6475  C CG  . ASN E  1 166 ? 48.931 84.581 6.681   1.00 51.99  ? 193  ASN E CG  1 
ATOM   6476  O OD1 . ASN E  1 166 ? 48.144 85.501 6.923   1.00 55.12  ? 193  ASN E OD1 1 
ATOM   6477  N ND2 . ASN E  1 166 ? 48.964 83.955 5.508   1.00 53.48  ? 193  ASN E ND2 1 
ATOM   6478  N N   . PRO E  1 167 ? 48.854 87.060 9.321   1.00 48.18  ? 194  PRO E N   1 
ATOM   6479  C CA  . PRO E  1 167 ? 47.698 87.641 9.995   1.00 47.37  ? 194  PRO E CA  1 
ATOM   6480  C C   . PRO E  1 167 ? 46.396 86.941 9.652   1.00 47.63  ? 194  PRO E C   1 
ATOM   6481  O O   . PRO E  1 167 ? 45.494 86.864 10.476  1.00 46.46  ? 194  PRO E O   1 
ATOM   6482  C CB  . PRO E  1 167 ? 47.726 89.086 9.527   1.00 46.52  ? 194  PRO E CB  1 
ATOM   6483  C CG  . PRO E  1 167 ? 49.185 89.345 9.366   1.00 47.45  ? 194  PRO E CG  1 
ATOM   6484  C CD  . PRO E  1 167 ? 49.624 88.106 8.629   1.00 48.87  ? 194  PRO E CD  1 
ATOM   6485  N N   . GLU E  1 168 ? 46.280 86.415 8.445   1.00 49.42  ? 195  GLU E N   1 
ATOM   6486  C CA  . GLU E  1 168 ? 45.032 85.756 8.098   1.00 51.92  ? 195  GLU E CA  1 
ATOM   6487  C C   . GLU E  1 168 ? 44.885 84.403 8.767   1.00 52.05  ? 195  GLU E C   1 
ATOM   6488  O O   . GLU E  1 168 ? 43.769 83.940 8.981   1.00 53.31  ? 195  GLU E O   1 
ATOM   6489  C CB  . GLU E  1 168 ? 44.882 85.607 6.579   1.00 54.42  ? 195  GLU E CB  1 
ATOM   6490  C CG  . GLU E  1 168 ? 44.608 86.918 5.831   1.00 59.50  ? 195  GLU E CG  1 
ATOM   6491  C CD  . GLU E  1 168 ? 44.076 86.699 4.406   1.00 63.17  ? 195  GLU E CD  1 
ATOM   6492  O OE1 . GLU E  1 168 ? 43.893 85.526 3.998   1.00 64.74  ? 195  GLU E OE1 1 
ATOM   6493  O OE2 . GLU E  1 168 ? 43.835 87.702 3.695   1.00 64.48  ? 195  GLU E OE2 1 
ATOM   6494  N N   . VAL E  1 169 ? 46.005 83.771 9.107   1.00 51.60  ? 196  VAL E N   1 
ATOM   6495  C CA  . VAL E  1 169 ? 45.960 82.457 9.747   1.00 49.90  ? 196  VAL E CA  1 
ATOM   6496  C C   . VAL E  1 169 ? 46.454 82.591 11.171  1.00 47.84  ? 196  VAL E C   1 
ATOM   6497  O O   . VAL E  1 169 ? 47.649 82.742 11.393  1.00 47.88  ? 196  VAL E O   1 
ATOM   6498  C CB  . VAL E  1 169 ? 46.859 81.447 9.019   1.00 50.47  ? 196  VAL E CB  1 
ATOM   6499  C CG1 . VAL E  1 169 ? 46.528 80.047 9.482   1.00 51.00  ? 196  VAL E CG1 1 
ATOM   6500  C CG2 . VAL E  1 169 ? 46.679 81.572 7.522   1.00 50.13  ? 196  VAL E CG2 1 
ATOM   6501  N N   . ARG E  1 170 ? 45.540 82.531 12.134  1.00 46.33  ? 197  ARG E N   1 
ATOM   6502  C CA  . ARG E  1 170 ? 45.916 82.678 13.544  1.00 43.78  ? 197  ARG E CA  1 
ATOM   6503  C C   . ARG E  1 170 ? 46.845 81.569 14.026  1.00 43.07  ? 197  ARG E C   1 
ATOM   6504  O O   . ARG E  1 170 ? 47.875 81.840 14.651  1.00 40.31  ? 197  ARG E O   1 
ATOM   6505  C CB  . ARG E  1 170 ? 44.663 82.728 14.435  1.00 41.44  ? 197  ARG E CB  1 
ATOM   6506  C CG  . ARG E  1 170 ? 44.955 82.901 15.927  1.00 36.83  ? 197  ARG E CG  1 
ATOM   6507  C CD  . ARG E  1 170 ? 43.663 82.941 16.751  1.00 32.21  ? 197  ARG E CD  1 
ATOM   6508  N NE  . ARG E  1 170 ? 43.908 82.915 18.193  1.00 29.04  ? 197  ARG E NE  1 
ATOM   6509  C CZ  . ARG E  1 170 ? 44.435 83.913 18.899  1.00 26.50  ? 197  ARG E CZ  1 
ATOM   6510  N NH1 . ARG E  1 170 ? 44.778 85.045 18.309  1.00 25.77  ? 197  ARG E NH1 1 
ATOM   6511  N NH2 . ARG E  1 170 ? 44.651 83.766 20.199  1.00 24.22  ? 197  ARG E NH2 1 
ATOM   6512  N N   . TYR E  1 171 ? 46.474 80.326 13.733  1.00 42.10  ? 198  TYR E N   1 
ATOM   6513  C CA  . TYR E  1 171 ? 47.279 79.199 14.151  1.00 42.63  ? 198  TYR E CA  1 
ATOM   6514  C C   . TYR E  1 171 ? 47.087 78.003 13.225  1.00 41.89  ? 198  TYR E C   1 
ATOM   6515  O O   . TYR E  1 171 ? 46.089 77.909 12.521  1.00 41.92  ? 198  TYR E O   1 
ATOM   6516  C CB  . TYR E  1 171 ? 46.912 78.803 15.583  1.00 44.01  ? 198  TYR E CB  1 
ATOM   6517  C CG  . TYR E  1 171 ? 45.613 78.032 15.686  1.00 46.27  ? 198  TYR E CG  1 
ATOM   6518  C CD1 . TYR E  1 171 ? 44.424 78.666 16.051  1.00 46.88  ? 198  TYR E CD1 1 
ATOM   6519  C CD2 . TYR E  1 171 ? 45.566 76.666 15.376  1.00 46.36  ? 198  TYR E CD2 1 
ATOM   6520  C CE1 . TYR E  1 171 ? 43.222 77.961 16.100  1.00 46.12  ? 198  TYR E CE1 1 
ATOM   6521  C CE2 . TYR E  1 171 ? 44.376 75.960 15.419  1.00 45.93  ? 198  TYR E CE2 1 
ATOM   6522  C CZ  . TYR E  1 171 ? 43.212 76.614 15.780  1.00 46.75  ? 198  TYR E CZ  1 
ATOM   6523  O OH  . TYR E  1 171 ? 42.033 75.914 15.799  1.00 49.97  ? 198  TYR E OH  1 
ATOM   6524  N N   . GLU E  1 172 ? 48.051 77.088 13.236  1.00 41.24  ? 199  GLU E N   1 
ATOM   6525  C CA  . GLU E  1 172 ? 47.983 75.884 12.420  1.00 40.34  ? 199  GLU E CA  1 
ATOM   6526  C C   . GLU E  1 172 ? 48.948 74.851 12.960  1.00 39.05  ? 199  GLU E C   1 
ATOM   6527  O O   . GLU E  1 172 ? 49.924 75.195 13.630  1.00 38.17  ? 199  GLU E O   1 
ATOM   6528  C CB  . GLU E  1 172 ? 48.324 76.195 10.962  1.00 40.72  ? 199  GLU E CB  1 
ATOM   6529  C CG  . GLU E  1 172 ? 48.708 74.963 10.171  1.00 42.60  ? 199  GLU E CG  1 
ATOM   6530  C CD  . GLU E  1 172 ? 48.824 75.215 8.692   1.00 44.04  ? 199  GLU E CD  1 
ATOM   6531  O OE1 . GLU E  1 172 ? 49.395 76.261 8.298   1.00 44.04  ? 199  GLU E OE1 1 
ATOM   6532  O OE2 . GLU E  1 172 ? 48.346 74.347 7.925   1.00 45.80  ? 199  GLU E OE2 1 
ATOM   6533  N N   . VAL E  1 173 ? 48.669 73.585 12.672  1.00 38.56  ? 200  VAL E N   1 
ATOM   6534  C CA  . VAL E  1 173 ? 49.526 72.501 13.128  1.00 38.42  ? 200  VAL E CA  1 
ATOM   6535  C C   . VAL E  1 173 ? 50.772 72.379 12.259  1.00 39.58  ? 200  VAL E C   1 
ATOM   6536  O O   . VAL E  1 173 ? 50.811 72.876 11.128  1.00 39.12  ? 200  VAL E O   1 
ATOM   6537  C CB  . VAL E  1 173 ? 48.789 71.172 13.091  1.00 37.11  ? 200  VAL E CB  1 
ATOM   6538  C CG1 . VAL E  1 173 ? 47.682 71.168 14.114  1.00 35.93  ? 200  VAL E CG1 1 
ATOM   6539  C CG2 . VAL E  1 173 ? 48.241 70.941 11.706  1.00 35.52  ? 200  VAL E CG2 1 
ATOM   6540  N N   . CYS E  1 174 ? 51.793 71.720 12.798  1.00 40.02  ? 201  CYS E N   1 
ATOM   6541  C CA  . CYS E  1 174 ? 53.033 71.523 12.064  1.00 39.44  ? 201  CYS E CA  1 
ATOM   6542  C C   . CYS E  1 174 ? 53.168 70.058 11.688  1.00 40.75  ? 201  CYS E C   1 
ATOM   6543  O O   . CYS E  1 174 ? 52.701 69.174 12.405  1.00 40.69  ? 201  CYS E O   1 
ATOM   6544  C CB  . CYS E  1 174 ? 54.217 71.948 12.911  1.00 37.11  ? 201  CYS E CB  1 
ATOM   6545  S SG  . CYS E  1 174 ? 54.022 73.606 13.614  1.00 32.00  ? 201  CYS E SG  1 
ATOM   6546  N N   . ASP E  1 175 ? 53.809 69.821 10.553  1.00 42.88  ? 202  ASP E N   1 
ATOM   6547  C CA  . ASP E  1 175 ? 54.020 68.483 10.014  1.00 44.03  ? 202  ASP E CA  1 
ATOM   6548  C C   . ASP E  1 175 ? 55.170 67.808 10.757  1.00 42.75  ? 202  ASP E C   1 
ATOM   6549  O O   . ASP E  1 175 ? 56.302 67.818 10.288  1.00 43.57  ? 202  ASP E O   1 
ATOM   6550  C CB  . ASP E  1 175 ? 54.373 68.604 8.525   1.00 48.49  ? 202  ASP E CB  1 
ATOM   6551  C CG  . ASP E  1 175 ? 53.895 67.424 7.699   1.00 52.34  ? 202  ASP E CG  1 
ATOM   6552  O OD1 . ASP E  1 175 ? 53.760 66.307 8.257   1.00 54.22  ? 202  ASP E OD1 1 
ATOM   6553  O OD2 . ASP E  1 175 ? 53.671 67.627 6.478   1.00 54.78  ? 202  ASP E OD2 1 
ATOM   6554  N N   . ILE E  1 176 ? 54.900 67.230 11.916  1.00 41.25  ? 203  ILE E N   1 
ATOM   6555  C CA  . ILE E  1 176 ? 55.966 66.570 12.659  1.00 40.63  ? 203  ILE E CA  1 
ATOM   6556  C C   . ILE E  1 176 ? 55.668 65.087 12.763  1.00 39.96  ? 203  ILE E C   1 
ATOM   6557  O O   . ILE E  1 176 ? 54.721 64.676 13.422  1.00 39.37  ? 203  ILE E O   1 
ATOM   6558  C CB  . ILE E  1 176 ? 56.155 67.213 14.059  1.00 41.34  ? 203  ILE E CB  1 
ATOM   6559  C CG1 . ILE E  1 176 ? 56.827 68.583 13.883  1.00 41.05  ? 203  ILE E CG1 1 
ATOM   6560  C CG2 . ILE E  1 176 ? 56.967 66.301 14.974  1.00 39.80  ? 203  ILE E CG2 1 
ATOM   6561  C CD1 . ILE E  1 176 ? 57.082 69.321 15.165  1.00 40.58  ? 203  ILE E CD1 1 
ATOM   6562  N N   . PRO E  1 177 ? 56.496 64.264 12.105  1.00 40.22  ? 204  PRO E N   1 
ATOM   6563  C CA  . PRO E  1 177 ? 56.417 62.807 12.034  1.00 40.58  ? 204  PRO E CA  1 
ATOM   6564  C C   . PRO E  1 177 ? 56.399 62.033 13.327  1.00 40.98  ? 204  PRO E C   1 
ATOM   6565  O O   . PRO E  1 177 ? 56.891 62.490 14.361  1.00 42.73  ? 204  PRO E O   1 
ATOM   6566  C CB  . PRO E  1 177 ? 57.618 62.447 11.183  1.00 39.74  ? 204  PRO E CB  1 
ATOM   6567  C CG  . PRO E  1 177 ? 58.599 63.472 11.579  1.00 39.44  ? 204  PRO E CG  1 
ATOM   6568  C CD  . PRO E  1 177 ? 57.770 64.718 11.525  1.00 40.44  ? 204  PRO E CD  1 
ATOM   6569  N N   . GLN E  1 178 ? 55.834 60.836 13.228  1.00 40.84  ? 205  GLN E N   1 
ATOM   6570  C CA  . GLN E  1 178 ? 55.718 59.927 14.351  1.00 41.92  ? 205  GLN E CA  1 
ATOM   6571  C C   . GLN E  1 178 ? 56.968 59.070 14.413  1.00 44.20  ? 205  GLN E C   1 
ATOM   6572  O O   . GLN E  1 178 ? 57.522 58.677 13.384  1.00 44.08  ? 205  GLN E O   1 
ATOM   6573  C CB  . GLN E  1 178 ? 54.510 59.008 14.174  1.00 40.13  ? 205  GLN E CB  1 
ATOM   6574  C CG  . GLN E  1 178 ? 53.159 59.680 14.267  1.00 37.81  ? 205  GLN E CG  1 
ATOM   6575  C CD  . GLN E  1 178 ? 52.849 60.180 15.663  1.00 35.98  ? 205  GLN E CD  1 
ATOM   6576  O OE1 . GLN E  1 178 ? 52.983 59.442 16.639  1.00 34.56  ? 205  GLN E OE1 1 
ATOM   6577  N NE2 . GLN E  1 178 ? 52.422 61.437 15.765  1.00 33.58  ? 205  GLN E NE2 1 
ATOM   6578  N N   . CYS E  1 179 ? 57.425 58.771 15.616  1.00 46.48  ? 206  CYS E N   1 
ATOM   6579  C CA  . CYS E  1 179 ? 58.598 57.931 15.704  1.00 49.64  ? 206  CYS E CA  1 
ATOM   6580  C C   . CYS E  1 179 ? 58.221 56.536 15.218  1.00 53.62  ? 206  CYS E C   1 
ATOM   6581  O O   . CYS E  1 179 ? 59.060 55.823 14.673  1.00 53.80  ? 206  CYS E O   1 
ATOM   6582  C CB  . CYS E  1 179 ? 59.124 57.858 17.137  1.00 48.42  ? 206  CYS E CB  1 
ATOM   6583  S SG  . CYS E  1 179 ? 59.578 59.452 17.924  1.00 46.00  ? 206  CYS E SG  1 
ATOM   6584  N N   . SER E  1 180 ? 56.951 56.162 15.411  1.00 58.10  ? 207  SER E N   1 
ATOM   6585  C CA  . SER E  1 180 ? 56.414 54.855 15.008  1.00 59.12  ? 207  SER E CA  1 
ATOM   6586  C C   . SER E  1 180 ? 56.695 54.658 13.541  1.00 60.24  ? 207  SER E C   1 
ATOM   6587  O O   . SER E  1 180 ? 57.049 53.567 13.101  1.00 62.21  ? 207  SER E O   1 
ATOM   6588  C CB  . SER E  1 180 ? 54.896 54.818 15.209  1.00 60.34  ? 207  SER E CB  1 
ATOM   6589  O OG  . SER E  1 180 ? 54.248 55.623 14.233  1.00 63.37  ? 207  SER E OG  1 
ATOM   6590  N N   . GLU E  1 181 ? 56.548 55.769 12.822  1.00 62.85  ? 208  GLU E N   1 
ATOM   6591  C CA  . GLU E  1 181 ? 56.724 55.906 11.380  1.00 67.73  ? 208  GLU E CA  1 
ATOM   6592  C C   . GLU E  1 181 ? 57.772 55.072 10.699  1.00 69.81  ? 208  GLU E C   1 
ATOM   6593  O O   . GLU E  1 181 ? 58.924 55.037 11.138  1.00 69.68  ? 208  GLU E O   1 
ATOM   6594  C CB  . GLU E  1 181 ? 57.045 57.340 11.044  1.00 68.99  ? 208  GLU E CB  1 
ATOM   6595  C CG  . GLU E  1 181 ? 56.871 57.607 9.583   1.00 72.21  ? 208  GLU E CG  1 
ATOM   6596  C CD  . GLU E  1 181 ? 56.669 59.066 9.296   1.00 74.04  ? 208  GLU E CD  1 
ATOM   6597  O OE1 . GLU E  1 181 ? 56.141 59.789 10.182  1.00 76.36  ? 208  GLU E OE1 1 
ATOM   6598  O OE2 . GLU E  1 181 ? 57.008 59.499 8.171   1.00 75.61  ? 208  GLU E OE2 1 
ATOM   6599  N N   . VAL E  1 182 ? 57.337 54.481 9.590   1.00 71.05  ? 209  VAL E N   1 
ATOM   6600  C CA  . VAL E  1 182 ? 58.121 53.635 8.724   1.00 73.67  ? 209  VAL E CA  1 
ATOM   6601  C C   . VAL E  1 182 ? 57.289 52.355 8.579   1.00 74.17  ? 209  VAL E C   1 
ATOM   6602  O O   . VAL E  1 182 ? 56.458 52.089 9.480   1.00 73.81  ? 209  VAL E O   1 
ATOM   6603  C CB  . VAL E  1 182 ? 59.502 53.335 9.366   1.00 72.13  ? 209  VAL E CB  1 
ATOM   6604  C CG1 . VAL E  1 182 ? 60.109 52.040 8.811   1.00 73.47  ? 209  VAL E CG1 1 
ATOM   6605  C CG2 . VAL E  1 182 ? 60.448 54.497 9.117   1.00 73.30  ? 209  VAL E CG2 1 
ATOM   6606  N N   . GLU E  1 183 ? 57.454 51.637 7.577   1.00 74.25  ? 210  GLU E N   1 
ATOM   6607  N N   . ASN F  1 10  ? 74.566 79.319 2.814   1.00 81.61  ? 37   ASN F N   1 
ATOM   6608  C CA  . ASN F  1 10  ? 75.181 79.165 4.165   1.00 81.97  ? 37   ASN F CA  1 
ATOM   6609  C C   . ASN F  1 10  ? 74.382 78.170 5.006   1.00 81.84  ? 37   ASN F C   1 
ATOM   6610  O O   . ASN F  1 10  ? 74.609 78.046 6.214   1.00 81.76  ? 37   ASN F O   1 
ATOM   6611  C CB  . ASN F  1 10  ? 75.207 80.514 4.890   1.00 82.53  ? 37   ASN F CB  1 
ATOM   6612  C CG  . ASN F  1 10  ? 73.854 80.882 5.500   1.00 83.28  ? 37   ASN F CG  1 
ATOM   6613  O OD1 . ASN F  1 10  ? 72.833 80.925 4.804   1.00 83.49  ? 37   ASN F OD1 1 
ATOM   6614  N ND2 . ASN F  1 10  ? 73.844 81.150 6.807   1.00 82.37  ? 37   ASN F ND2 1 
ATOM   6615  N N   . THR F  1 11  ? 73.460 77.456 4.358   1.00 81.22  ? 38   THR F N   1 
ATOM   6616  C CA  . THR F  1 11  ? 72.595 76.488 5.040   1.00 80.22  ? 38   THR F CA  1 
ATOM   6617  C C   . THR F  1 11  ? 72.708 75.039 4.549   1.00 79.46  ? 38   THR F C   1 
ATOM   6618  O O   . THR F  1 11  ? 72.241 74.113 5.213   1.00 78.64  ? 38   THR F O   1 
ATOM   6619  C CB  . THR F  1 11  ? 71.109 76.925 4.933   1.00 80.23  ? 38   THR F CB  1 
ATOM   6620  O OG1 . THR F  1 11  ? 70.846 77.415 3.611   1.00 79.35  ? 38   THR F OG1 1 
ATOM   6621  C CG2 . THR F  1 11  ? 70.793 78.016 5.946   1.00 79.68  ? 38   THR F CG2 1 
ATOM   6622  N N   . ILE F  1 12  ? 73.335 74.854 3.392   1.00 78.93  ? 39   ILE F N   1 
ATOM   6623  C CA  . ILE F  1 12  ? 73.505 73.539 2.776   1.00 78.21  ? 39   ILE F CA  1 
ATOM   6624  C C   . ILE F  1 12  ? 74.144 72.456 3.648   1.00 76.87  ? 39   ILE F C   1 
ATOM   6625  O O   . ILE F  1 12  ? 73.956 71.268 3.397   1.00 76.91  ? 39   ILE F O   1 
ATOM   6626  C CB  . ILE F  1 12  ? 74.340 73.653 1.493   1.00 79.20  ? 39   ILE F CB  1 
ATOM   6627  C CG1 . ILE F  1 12  ? 75.391 74.748 1.684   1.00 80.81  ? 39   ILE F CG1 1 
ATOM   6628  C CG2 . ILE F  1 12  ? 73.441 73.910 0.288   1.00 78.74  ? 39   ILE F CG2 1 
ATOM   6629  C CD1 . ILE F  1 12  ? 76.342 74.905 0.524   1.00 82.00  ? 39   ILE F CD1 1 
ATOM   6630  N N   . HIS F  1 13  ? 74.898 72.853 4.664   1.00 75.56  ? 40   HIS F N   1 
ATOM   6631  C CA  . HIS F  1 13  ? 75.565 71.890 5.541   1.00 74.74  ? 40   HIS F CA  1 
ATOM   6632  C C   . HIS F  1 13  ? 74.577 71.206 6.464   1.00 72.65  ? 40   HIS F C   1 
ATOM   6633  O O   . HIS F  1 13  ? 74.831 70.104 6.959   1.00 72.70  ? 40   HIS F O   1 
ATOM   6634  C CB  . HIS F  1 13  ? 76.607 72.595 6.406   1.00 77.14  ? 40   HIS F CB  1 
ATOM   6635  C CG  . HIS F  1 13  ? 77.430 73.593 5.658   1.00 79.56  ? 40   HIS F CG  1 
ATOM   6636  N ND1 . HIS F  1 13  ? 78.160 74.575 6.291   1.00 79.95  ? 40   HIS F ND1 1 
ATOM   6637  C CD2 . HIS F  1 13  ? 77.622 73.775 4.329   1.00 80.61  ? 40   HIS F CD2 1 
ATOM   6638  C CE1 . HIS F  1 13  ? 78.764 75.322 5.384   1.00 81.48  ? 40   HIS F CE1 1 
ATOM   6639  N NE2 . HIS F  1 13  ? 78.453 74.859 4.185   1.00 81.74  ? 40   HIS F NE2 1 
ATOM   6640  N N   . GLU F  1 14  ? 73.452 71.868 6.696   1.00 69.67  ? 41   GLU F N   1 
ATOM   6641  C CA  . GLU F  1 14  ? 72.433 71.342 7.588   1.00 66.98  ? 41   GLU F CA  1 
ATOM   6642  C C   . GLU F  1 14  ? 71.600 70.265 6.915   1.00 63.48  ? 41   GLU F C   1 
ATOM   6643  O O   . GLU F  1 14  ? 70.666 69.719 7.508   1.00 62.77  ? 41   GLU F O   1 
ATOM   6644  C CB  . GLU F  1 14  ? 71.554 72.490 8.079   1.00 69.70  ? 41   GLU F CB  1 
ATOM   6645  C CG  . GLU F  1 14  ? 72.304 73.450 8.987   1.00 73.04  ? 41   GLU F CG  1 
ATOM   6646  C CD  . GLU F  1 14  ? 71.702 74.837 9.005   1.00 74.87  ? 41   GLU F CD  1 
ATOM   6647  O OE1 . GLU F  1 14  ? 70.477 74.951 9.248   1.00 76.19  ? 41   GLU F OE1 1 
ATOM   6648  O OE2 . GLU F  1 14  ? 72.459 75.811 8.781   1.00 74.81  ? 41   GLU F OE2 1 
ATOM   6649  N N   . PHE F  1 15  ? 71.953 69.961 5.670   1.00 58.80  ? 42   PHE F N   1 
ATOM   6650  C CA  . PHE F  1 15  ? 71.260 68.936 4.913   1.00 54.80  ? 42   PHE F CA  1 
ATOM   6651  C C   . PHE F  1 15  ? 72.144 67.721 4.744   1.00 54.04  ? 42   PHE F C   1 
ATOM   6652  O O   . PHE F  1 15  ? 73.357 67.843 4.597   1.00 54.70  ? 42   PHE F O   1 
ATOM   6653  C CB  . PHE F  1 15  ? 70.869 69.448 3.532   1.00 50.78  ? 42   PHE F CB  1 
ATOM   6654  C CG  . PHE F  1 15  ? 69.835 70.528 3.556   1.00 46.64  ? 42   PHE F CG  1 
ATOM   6655  C CD1 . PHE F  1 15  ? 70.186 71.837 3.861   1.00 44.57  ? 42   PHE F CD1 1 
ATOM   6656  C CD2 . PHE F  1 15  ? 68.510 70.238 3.254   1.00 43.63  ? 42   PHE F CD2 1 
ATOM   6657  C CE1 . PHE F  1 15  ? 69.235 72.843 3.861   1.00 42.76  ? 42   PHE F CE1 1 
ATOM   6658  C CE2 . PHE F  1 15  ? 67.554 71.231 3.253   1.00 42.35  ? 42   PHE F CE2 1 
ATOM   6659  C CZ  . PHE F  1 15  ? 67.914 72.540 3.555   1.00 42.92  ? 42   PHE F CZ  1 
ATOM   6660  N N   . LYS F  1 16  ? 71.531 66.547 4.773   1.00 53.20  ? 43   LYS F N   1 
ATOM   6661  C CA  . LYS F  1 16  ? 72.264 65.306 4.585   1.00 52.79  ? 43   LYS F CA  1 
ATOM   6662  C C   . LYS F  1 16  ? 72.312 65.060 3.089   1.00 54.14  ? 43   LYS F C   1 
ATOM   6663  O O   . LYS F  1 16  ? 71.324 64.615 2.495   1.00 54.00  ? 43   LYS F O   1 
ATOM   6664  C CB  . LYS F  1 16  ? 71.538 64.159 5.264   1.00 50.75  ? 43   LYS F CB  1 
ATOM   6665  C CG  . LYS F  1 16  ? 72.109 62.799 4.951   1.00 47.56  ? 43   LYS F CG  1 
ATOM   6666  C CD  . LYS F  1 16  ? 71.254 61.730 5.587   1.00 44.80  ? 43   LYS F CD  1 
ATOM   6667  C CE  . LYS F  1 16  ? 71.739 60.358 5.235   1.00 43.70  ? 43   LYS F CE  1 
ATOM   6668  N NZ  . LYS F  1 16  ? 70.860 59.321 5.815   1.00 42.95  ? 43   LYS F NZ  1 
ATOM   6669  N N   . LYS F  1 17  ? 73.463 65.347 2.485   1.00 56.14  ? 44   LYS F N   1 
ATOM   6670  C CA  . LYS F  1 17  ? 73.638 65.191 1.042   1.00 57.31  ? 44   LYS F CA  1 
ATOM   6671  C C   . LYS F  1 17  ? 73.867 63.761 0.546   1.00 56.91  ? 44   LYS F C   1 
ATOM   6672  O O   . LYS F  1 17  ? 74.558 62.959 1.179   1.00 56.77  ? 44   LYS F O   1 
ATOM   6673  C CB  . LYS F  1 17  ? 74.773 66.105 0.551   1.00 58.92  ? 44   LYS F CB  1 
ATOM   6674  C CG  . LYS F  1 17  ? 74.910 66.149 -0.974  1.00 60.42  ? 44   LYS F CG  1 
ATOM   6675  C CD  . LYS F  1 17  ? 75.569 67.430 -1.475  1.00 60.17  ? 44   LYS F CD  1 
ATOM   6676  C CE  . LYS F  1 17  ? 76.977 67.614 -0.932  1.00 61.86  ? 44   LYS F CE  1 
ATOM   6677  N NZ  . LYS F  1 17  ? 77.599 68.883 -1.426  1.00 62.45  ? 44   LYS F NZ  1 
ATOM   6678  N N   . SER F  1 18  ? 73.246 63.462 -0.589  1.00 56.57  ? 45   SER F N   1 
ATOM   6679  C CA  . SER F  1 18  ? 73.347 62.167 -1.236  1.00 57.86  ? 45   SER F CA  1 
ATOM   6680  C C   . SER F  1 18  ? 73.644 62.450 -2.696  1.00 60.12  ? 45   SER F C   1 
ATOM   6681  O O   . SER F  1 18  ? 72.726 62.613 -3.514  1.00 60.22  ? 45   SER F O   1 
ATOM   6682  C CB  . SER F  1 18  ? 72.033 61.391 -1.120  1.00 57.52  ? 45   SER F CB  1 
ATOM   6683  O OG  . SER F  1 18  ? 71.920 60.744 0.135   1.00 57.78  ? 45   SER F OG  1 
ATOM   6684  N N   . ALA F  1 19  ? 74.935 62.518 -3.015  1.00 61.96  ? 46   ALA F N   1 
ATOM   6685  C CA  . ALA F  1 19  ? 75.398 62.801 -4.372  1.00 63.38  ? 46   ALA F CA  1 
ATOM   6686  C C   . ALA F  1 19  ? 74.789 61.904 -5.457  1.00 64.25  ? 46   ALA F C   1 
ATOM   6687  O O   . ALA F  1 19  ? 74.510 60.721 -5.231  1.00 63.47  ? 46   ALA F O   1 
ATOM   6688  C CB  . ALA F  1 19  ? 76.916 62.718 -4.416  1.00 63.79  ? 46   ALA F CB  1 
ATOM   6689  N N   . LYS F  1 20  ? 74.593 62.503 -6.634  1.00 65.60  ? 47   LYS F N   1 
ATOM   6690  C CA  . LYS F  1 20  ? 74.026 61.852 -7.821  1.00 66.94  ? 47   LYS F CA  1 
ATOM   6691  C C   . LYS F  1 20  ? 72.790 61.034 -7.497  1.00 67.63  ? 47   LYS F C   1 
ATOM   6692  O O   . LYS F  1 20  ? 72.672 59.874 -7.905  1.00 67.94  ? 47   LYS F O   1 
ATOM   6693  C CB  . LYS F  1 20  ? 75.084 60.968 -8.508  1.00 67.14  ? 47   LYS F CB  1 
ATOM   6694  N N   . THR F  1 21  ? 71.864 61.654 -6.774  1.00 68.07  ? 48   THR F N   1 
ATOM   6695  C CA  . THR F  1 21  ? 70.629 60.993 -6.372  1.00 68.91  ? 48   THR F CA  1 
ATOM   6696  C C   . THR F  1 21  ? 69.453 61.934 -6.604  1.00 69.85  ? 48   THR F C   1 
ATOM   6697  O O   . THR F  1 21  ? 69.635 63.132 -6.802  1.00 69.47  ? 48   THR F O   1 
ATOM   6698  C CB  . THR F  1 21  ? 70.674 60.587 -4.865  1.00 68.09  ? 48   THR F CB  1 
ATOM   6699  O OG1 . THR F  1 21  ? 71.902 59.902 -4.582  1.00 68.09  ? 48   THR F OG1 1 
ATOM   6700  C CG2 . THR F  1 21  ? 69.522 59.654 -4.524  1.00 67.15  ? 48   THR F CG2 1 
ATOM   6701  N N   . THR F  1 22  ? 68.249 61.381 -6.597  1.00 71.72  ? 49   THR F N   1 
ATOM   6702  C CA  . THR F  1 22  ? 67.047 62.174 -6.785  1.00 74.35  ? 49   THR F CA  1 
ATOM   6703  C C   . THR F  1 22  ? 65.813 61.349 -6.458  1.00 76.67  ? 49   THR F C   1 
ATOM   6704  O O   . THR F  1 22  ? 65.851 60.117 -6.456  1.00 77.27  ? 49   THR F O   1 
ATOM   6705  C CB  . THR F  1 22  ? 66.929 62.688 -8.220  1.00 74.10  ? 49   THR F CB  1 
ATOM   6706  O OG1 . THR F  1 22  ? 65.744 63.485 -8.348  1.00 74.15  ? 49   THR F OG1 1 
ATOM   6707  C CG2 . THR F  1 22  ? 66.860 61.524 -9.184  1.00 74.26  ? 49   THR F CG2 1 
ATOM   6708  N N   . LEU F  1 23  ? 64.714 62.049 -6.210  1.00 79.17  ? 50   LEU F N   1 
ATOM   6709  C CA  . LEU F  1 23  ? 63.464 61.408 -5.849  1.00 82.14  ? 50   LEU F CA  1 
ATOM   6710  C C   . LEU F  1 23  ? 62.440 61.328 -6.977  1.00 84.35  ? 50   LEU F C   1 
ATOM   6711  O O   . LEU F  1 23  ? 62.332 62.237 -7.806  1.00 84.69  ? 50   LEU F O   1 
ATOM   6712  C CB  . LEU F  1 23  ? 62.848 62.147 -4.656  1.00 81.58  ? 50   LEU F CB  1 
ATOM   6713  C CG  . LEU F  1 23  ? 63.499 61.956 -3.283  1.00 81.55  ? 50   LEU F CG  1 
ATOM   6714  C CD1 . LEU F  1 23  ? 65.009 62.038 -3.374  1.00 81.31  ? 50   LEU F CD1 1 
ATOM   6715  C CD2 . LEU F  1 23  ? 62.958 63.010 -2.341  1.00 81.58  ? 50   LEU F CD2 1 
ATOM   6716  N N   . ILE F  1 24  ? 61.694 60.224 -6.995  1.00 86.52  ? 51   ILE F N   1 
ATOM   6717  C CA  . ILE F  1 24  ? 60.638 60.005 -7.975  1.00 88.86  ? 51   ILE F CA  1 
ATOM   6718  C C   . ILE F  1 24  ? 59.313 60.063 -7.215  1.00 91.08  ? 51   ILE F C   1 
ATOM   6719  O O   . ILE F  1 24  ? 59.039 59.209 -6.366  1.00 91.42  ? 51   ILE F O   1 
ATOM   6720  C CB  . ILE F  1 24  ? 60.789 58.635 -8.670  1.00 88.07  ? 51   ILE F CB  1 
ATOM   6721  C CG1 . ILE F  1 24  ? 61.690 58.775 -9.896  1.00 88.27  ? 51   ILE F CG1 1 
ATOM   6722  C CG2 . ILE F  1 24  ? 59.435 58.108 -9.101  1.00 88.11  ? 51   ILE F CG2 1 
ATOM   6723  C CD1 . ILE F  1 24  ? 63.076 59.278 -9.598  1.00 89.13  ? 51   ILE F CD1 1 
ATOM   6724  N N   . LYS F  1 25  ? 58.509 61.085 -7.510  1.00 93.05  ? 52   LYS F N   1 
ATOM   6725  C CA  . LYS F  1 25  ? 57.216 61.277 -6.854  1.00 95.10  ? 52   LYS F CA  1 
ATOM   6726  C C   . LYS F  1 25  ? 56.114 60.493 -7.567  1.00 97.34  ? 52   LYS F C   1 
ATOM   6727  O O   . LYS F  1 25  ? 55.267 61.077 -8.252  1.00 98.30  ? 52   LYS F O   1 
ATOM   6728  C CB  . LYS F  1 25  ? 56.869 62.759 -6.827  1.00 93.89  ? 52   LYS F CB  1 
ATOM   6729  N N   . ILE F  1 26  ? 56.125 59.171 -7.392  1.00 99.07  ? 53   ILE F N   1 
ATOM   6730  C CA  . ILE F  1 26  ? 55.142 58.289 -8.021  1.00 100.36 ? 53   ILE F CA  1 
ATOM   6731  C C   . ILE F  1 26  ? 53.830 58.198 -7.240  1.00 101.63 ? 53   ILE F C   1 
ATOM   6732  O O   . ILE F  1 26  ? 53.534 57.171 -6.625  1.00 101.17 ? 53   ILE F O   1 
ATOM   6733  C CB  . ILE F  1 26  ? 55.740 56.905 -8.193  1.00 99.89  ? 53   ILE F CB  1 
ATOM   6734  N N   . ASP F  1 27  ? 53.050 59.279 -7.283  1.00 103.39 ? 54   ASP F N   1 
ATOM   6735  C CA  . ASP F  1 27  ? 51.764 59.365 -6.592  1.00 105.24 ? 54   ASP F CA  1 
ATOM   6736  C C   . ASP F  1 27  ? 51.231 60.804 -6.626  1.00 106.47 ? 54   ASP F C   1 
ATOM   6737  O O   . ASP F  1 27  ? 51.287 61.523 -5.628  1.00 106.50 ? 54   ASP F O   1 
ATOM   6738  C CB  . ASP F  1 27  ? 51.905 58.891 -5.140  1.00 104.96 ? 54   ASP F CB  1 
ATOM   6739  N N   . PRO F  1 28  ? 50.707 61.237 -7.784  1.00 107.69 ? 55   PRO F N   1 
ATOM   6740  C CA  . PRO F  1 28  ? 50.157 62.585 -7.980  1.00 108.51 ? 55   PRO F CA  1 
ATOM   6741  C C   . PRO F  1 28  ? 49.178 63.049 -6.897  1.00 108.76 ? 55   PRO F C   1 
ATOM   6742  O O   . PRO F  1 28  ? 47.967 63.101 -7.109  1.00 108.93 ? 55   PRO F O   1 
ATOM   6743  C CB  . PRO F  1 28  ? 49.502 62.491 -9.356  1.00 108.70 ? 55   PRO F CB  1 
ATOM   6744  C CG  . PRO F  1 28  ? 50.415 61.541 -10.079 1.00 108.51 ? 55   PRO F CG  1 
ATOM   6745  C CD  . PRO F  1 28  ? 50.647 60.461 -9.037  1.00 108.24 ? 55   PRO F CD  1 
ATOM   6746  N N   . ALA F  1 29  ? 49.723 63.390 -5.737  1.00 108.84 ? 56   ALA F N   1 
ATOM   6747  C CA  . ALA F  1 29  ? 48.934 63.870 -4.610  1.00 109.09 ? 56   ALA F CA  1 
ATOM   6748  C C   . ALA F  1 29  ? 49.711 65.023 -3.962  1.00 108.96 ? 56   ALA F C   1 
ATOM   6749  O O   . ALA F  1 29  ? 49.128 66.005 -3.485  1.00 109.12 ? 56   ALA F O   1 
ATOM   6750  C CB  . ALA F  1 29  ? 48.710 62.726 -3.602  1.00 108.98 ? 56   ALA F CB  1 
ATOM   6751  N N   . LEU F  1 30  ? 51.035 64.890 -3.965  1.00 108.31 ? 57   LEU F N   1 
ATOM   6752  C CA  . LEU F  1 30  ? 51.920 65.895 -3.387  1.00 106.81 ? 57   LEU F CA  1 
ATOM   6753  C C   . LEU F  1 30  ? 52.489 66.764 -4.497  1.00 105.53 ? 57   LEU F C   1 
ATOM   6754  O O   . LEU F  1 30  ? 52.669 66.304 -5.624  1.00 105.09 ? 57   LEU F O   1 
ATOM   6755  C CB  . LEU F  1 30  ? 53.054 65.214 -2.604  1.00 107.53 ? 57   LEU F CB  1 
ATOM   6756  N N   . LYS F  1 31  ? 52.754 68.025 -4.173  1.00 103.93 ? 58   LYS F N   1 
ATOM   6757  C CA  . LYS F  1 31  ? 53.307 68.960 -5.139  1.00 102.50 ? 58   LYS F CA  1 
ATOM   6758  C C   . LYS F  1 31  ? 54.830 68.993 -5.059  1.00 101.41 ? 58   LYS F C   1 
ATOM   6759  O O   . LYS F  1 31  ? 55.421 68.555 -4.078  1.00 101.91 ? 58   LYS F O   1 
ATOM   6760  C CB  . LYS F  1 31  ? 52.750 70.343 -4.900  1.00 102.30 ? 58   LYS F CB  1 
ATOM   6761  N N   . ILE F  1 32  ? 55.454 69.518 -6.106  1.00 100.13 ? 59   ILE F N   1 
ATOM   6762  C CA  . ILE F  1 32  ? 56.903 69.630 -6.188  1.00 98.29  ? 59   ILE F CA  1 
ATOM   6763  C C   . ILE F  1 32  ? 57.178 71.006 -6.769  1.00 97.19  ? 59   ILE F C   1 
ATOM   6764  O O   . ILE F  1 32  ? 57.008 71.212 -7.968  1.00 97.45  ? 59   ILE F O   1 
ATOM   6765  C CB  . ILE F  1 32  ? 57.505 68.590 -7.161  1.00 98.53  ? 59   ILE F CB  1 
ATOM   6766  C CG1 . ILE F  1 32  ? 57.024 67.181 -6.809  1.00 99.12  ? 59   ILE F CG1 1 
ATOM   6767  C CG2 . ILE F  1 32  ? 59.024 68.660 -7.118  1.00 98.52  ? 59   ILE F CG2 1 
ATOM   6768  C CD1 . ILE F  1 32  ? 57.477 66.117 -7.804  1.00 99.65  ? 59   ILE F CD1 1 
ATOM   6769  N N   . LYS F  1 33  ? 57.596 71.952 -5.939  1.00 95.51  ? 60   LYS F N   1 
ATOM   6770  C CA  . LYS F  1 33  ? 57.873 73.289 -6.447  1.00 93.78  ? 60   LYS F CA  1 
ATOM   6771  C C   . LYS F  1 33  ? 59.292 73.408 -6.987  1.00 92.53  ? 60   LYS F C   1 
ATOM   6772  O O   . LYS F  1 33  ? 60.260 73.229 -6.253  1.00 92.08  ? 60   LYS F O   1 
ATOM   6773  C CB  . LYS F  1 33  ? 57.633 74.329 -5.354  1.00 93.81  ? 60   LYS F CB  1 
ATOM   6774  N N   . THR F  1 34  ? 59.408 73.698 -8.280  1.00 92.12  ? 61   THR F N   1 
ATOM   6775  C CA  . THR F  1 34  ? 60.715 73.861 -8.917  1.00 91.76  ? 61   THR F CA  1 
ATOM   6776  C C   . THR F  1 34  ? 60.941 75.322 -9.318  1.00 91.60  ? 61   THR F C   1 
ATOM   6777  O O   . THR F  1 34  ? 60.008 76.125 -9.340  1.00 91.58  ? 61   THR F O   1 
ATOM   6778  C CB  . THR F  1 34  ? 60.847 72.989 -10.183 1.00 91.36  ? 61   THR F CB  1 
ATOM   6779  O OG1 . THR F  1 34  ? 59.933 73.452 -11.187 1.00 90.77  ? 61   THR F OG1 1 
ATOM   6780  C CG2 . THR F  1 34  ? 60.559 71.533 -9.856  1.00 90.76  ? 61   THR F CG2 1 
ATOM   6781  N N   . LYS F  1 35  ? 62.188 75.663 -9.619  1.00 91.02  ? 62   LYS F N   1 
ATOM   6782  C CA  . LYS F  1 35  ? 62.527 77.019 -10.015 1.00 91.08  ? 62   LYS F CA  1 
ATOM   6783  C C   . LYS F  1 35  ? 63.996 77.121 -10.420 1.00 91.26  ? 62   LYS F C   1 
ATOM   6784  O O   . LYS F  1 35  ? 64.896 76.816 -9.624  1.00 91.41  ? 62   LYS F O   1 
ATOM   6785  C CB  . LYS F  1 35  ? 62.229 77.989 -8.875  1.00 90.36  ? 62   LYS F CB  1 
ATOM   6786  N N   . LYS F  1 36  ? 64.232 77.548 -11.660 1.00 91.06  ? 63   LYS F N   1 
ATOM   6787  C CA  . LYS F  1 36  ? 65.583 77.692 -12.175 1.00 90.52  ? 63   LYS F CA  1 
ATOM   6788  C C   . LYS F  1 36  ? 66.373 78.566 -11.209 1.00 90.31  ? 63   LYS F C   1 
ATOM   6789  O O   . LYS F  1 36  ? 65.853 79.565 -10.699 1.00 89.81  ? 63   LYS F O   1 
ATOM   6790  C CB  . LYS F  1 36  ? 65.546 78.313 -13.570 1.00 89.78  ? 63   LYS F CB  1 
ATOM   6791  N N   . VAL F  1 37  ? 67.630 78.196 -10.966 1.00 90.78  ? 64   VAL F N   1 
ATOM   6792  C CA  . VAL F  1 37  ? 68.481 78.950 -10.046 1.00 90.89  ? 64   VAL F CA  1 
ATOM   6793  C C   . VAL F  1 37  ? 69.957 78.838 -10.416 1.00 90.53  ? 64   VAL F C   1 
ATOM   6794  O O   . VAL F  1 37  ? 70.343 78.011 -11.242 1.00 90.18  ? 64   VAL F O   1 
ATOM   6795  C CB  . VAL F  1 37  ? 68.247 78.459 -8.578  1.00 91.55  ? 64   VAL F CB  1 
ATOM   6796  C CG1 . VAL F  1 37  ? 69.441 78.775 -7.694  1.00 91.08  ? 64   VAL F CG1 1 
ATOM   6797  C CG2 . VAL F  1 37  ? 67.002 79.110 -8.011  1.00 91.32  ? 64   VAL F CG2 1 
ATOM   6798  N N   . ASN F  1 38  ? 70.778 79.687 -9.816  1.00 90.68  ? 65   ASN F N   1 
ATOM   6799  C CA  . ASN F  1 38  ? 72.204 79.647 -10.077 1.00 91.74  ? 65   ASN F CA  1 
ATOM   6800  C C   . ASN F  1 38  ? 72.915 78.536 -9.287  1.00 92.19  ? 65   ASN F C   1 
ATOM   6801  O O   . ASN F  1 38  ? 73.370 77.554 -9.877  1.00 92.58  ? 65   ASN F O   1 
ATOM   6802  C CB  . ASN F  1 38  ? 72.829 81.009 -9.770  1.00 91.83  ? 65   ASN F CB  1 
ATOM   6803  C CG  . ASN F  1 38  ? 72.615 82.015 -10.891 1.00 92.21  ? 65   ASN F CG  1 
ATOM   6804  O OD1 . ASN F  1 38  ? 73.079 83.149 -10.814 1.00 93.03  ? 65   ASN F OD1 1 
ATOM   6805  N ND2 . ASN F  1 38  ? 71.915 81.597 -11.945 1.00 91.18  ? 65   ASN F ND2 1 
ATOM   6806  N N   . THR F  1 39  ? 73.003 78.678 -7.963  1.00 92.19  ? 66   THR F N   1 
ATOM   6807  C CA  . THR F  1 39  ? 73.671 77.678 -7.126  1.00 91.64  ? 66   THR F CA  1 
ATOM   6808  C C   . THR F  1 39  ? 72.704 76.847 -6.277  1.00 91.12  ? 66   THR F C   1 
ATOM   6809  O O   . THR F  1 39  ? 71.549 77.225 -6.077  1.00 90.96  ? 66   THR F O   1 
ATOM   6810  C CB  . THR F  1 39  ? 74.692 78.343 -6.174  1.00 91.85  ? 66   THR F CB  1 
ATOM   6811  O OG1 . THR F  1 39  ? 74.001 79.186 -5.243  1.00 92.27  ? 66   THR F OG1 1 
ATOM   6812  C CG2 . THR F  1 39  ? 75.688 79.178 -6.961  1.00 91.40  ? 66   THR F CG2 1 
ATOM   6813  N N   . ALA F  1 40  ? 73.191 75.713 -5.778  1.00 90.26  ? 67   ALA F N   1 
ATOM   6814  C CA  . ALA F  1 40  ? 72.379 74.837 -4.944  1.00 89.45  ? 67   ALA F CA  1 
ATOM   6815  C C   . ALA F  1 40  ? 72.055 75.551 -3.643  1.00 88.92  ? 67   ALA F C   1 
ATOM   6816  O O   . ALA F  1 40  ? 71.000 75.336 -3.057  1.00 88.46  ? 67   ALA F O   1 
ATOM   6817  C CB  . ALA F  1 40  ? 73.126 73.546 -4.655  1.00 89.50  ? 67   ALA F CB  1 
ATOM   6818  N N   . ASP F  1 41  ? 72.973 76.404 -3.203  1.00 88.67  ? 68   ASP F N   1 
ATOM   6819  C CA  . ASP F  1 41  ? 72.802 77.159 -1.971  1.00 88.72  ? 68   ASP F CA  1 
ATOM   6820  C C   . ASP F  1 41  ? 71.464 77.869 -1.950  1.00 87.90  ? 68   ASP F C   1 
ATOM   6821  O O   . ASP F  1 41  ? 70.781 77.899 -0.921  1.00 87.74  ? 68   ASP F O   1 
ATOM   6822  C CB  . ASP F  1 41  ? 73.924 78.181 -1.823  1.00 91.05  ? 68   ASP F CB  1 
ATOM   6823  C CG  . ASP F  1 41  ? 75.284 77.531 -1.714  1.00 93.61  ? 68   ASP F CG  1 
ATOM   6824  O OD1 . ASP F  1 41  ? 75.690 76.843 -2.675  1.00 95.12  ? 68   ASP F OD1 1 
ATOM   6825  O OD2 . ASP F  1 41  ? 75.944 77.703 -0.666  1.00 95.31  ? 68   ASP F OD2 1 
ATOM   6826  N N   . GLN F  1 42  ? 71.098 78.447 -3.091  1.00 86.68  ? 69   GLN F N   1 
ATOM   6827  C CA  . GLN F  1 42  ? 69.831 79.157 -3.208  1.00 85.75  ? 69   GLN F CA  1 
ATOM   6828  C C   . GLN F  1 42  ? 68.667 78.226 -2.878  1.00 84.11  ? 69   GLN F C   1 
ATOM   6829  O O   . GLN F  1 42  ? 67.665 78.654 -2.301  1.00 84.44  ? 69   GLN F O   1 
ATOM   6830  C CB  . GLN F  1 42  ? 69.663 79.735 -4.618  1.00 87.23  ? 69   GLN F CB  1 
ATOM   6831  C CG  . GLN F  1 42  ? 70.673 80.829 -4.968  1.00 89.32  ? 69   GLN F CG  1 
ATOM   6832  C CD  . GLN F  1 42  ? 70.223 81.707 -6.134  1.00 90.55  ? 69   GLN F CD  1 
ATOM   6833  O OE1 . GLN F  1 42  ? 70.084 81.241 -7.267  1.00 91.47  ? 69   GLN F OE1 1 
ATOM   6834  N NE2 . GLN F  1 42  ? 69.992 82.988 -5.853  1.00 90.15  ? 69   GLN F NE2 1 
ATOM   6835  N N   . CYS F  1 43  ? 68.808 76.955 -3.253  1.00 81.59  ? 70   CYS F N   1 
ATOM   6836  C CA  . CYS F  1 43  ? 67.796 75.939 -2.980  1.00 78.38  ? 70   CYS F CA  1 
ATOM   6837  C C   . CYS F  1 43  ? 67.703 75.742 -1.476  1.00 77.59  ? 70   CYS F C   1 
ATOM   6838  O O   . CYS F  1 43  ? 66.616 75.759 -0.896  1.00 77.04  ? 70   CYS F O   1 
ATOM   6839  C CB  . CYS F  1 43  ? 68.191 74.604 -3.604  1.00 76.67  ? 70   CYS F CB  1 
ATOM   6840  S SG  . CYS F  1 43  ? 68.557 74.641 -5.378  1.00 73.36  ? 70   CYS F SG  1 
ATOM   6841  N N   . ALA F  1 44  ? 68.866 75.541 -0.862  1.00 76.61  ? 71   ALA F N   1 
ATOM   6842  C CA  . ALA F  1 44  ? 68.966 75.317 0.573   1.00 76.54  ? 71   ALA F CA  1 
ATOM   6843  C C   . ALA F  1 44  ? 68.264 76.407 1.370   1.00 76.47  ? 71   ALA F C   1 
ATOM   6844  O O   . ALA F  1 44  ? 67.369 76.125 2.174   1.00 76.40  ? 71   ALA F O   1 
ATOM   6845  C CB  . ALA F  1 44  ? 70.430 75.227 0.982   1.00 76.52  ? 71   ALA F CB  1 
ATOM   6846  N N   . ASP F  1 45  ? 68.673 77.650 1.147   1.00 75.83  ? 72   ASP F N   1 
ATOM   6847  C CA  . ASP F  1 45  ? 68.079 78.773 1.848   1.00 75.36  ? 72   ASP F CA  1 
ATOM   6848  C C   . ASP F  1 45  ? 66.575 78.773 1.689   1.00 73.55  ? 72   ASP F C   1 
ATOM   6849  O O   . ASP F  1 45  ? 65.840 78.843 2.673   1.00 73.96  ? 72   ASP F O   1 
ATOM   6850  C CB  . ASP F  1 45  ? 68.656 80.082 1.324   1.00 78.15  ? 72   ASP F CB  1 
ATOM   6851  C CG  . ASP F  1 45  ? 70.130 80.236 1.653   1.00 81.94  ? 72   ASP F CG  1 
ATOM   6852  O OD1 . ASP F  1 45  ? 70.957 79.409 1.257   1.00 83.09  ? 72   ASP F OD1 1 
ATOM   6853  O OD2 . ASP F  1 45  ? 70.467 81.295 2.390   1.00 83.95  ? 72   ASP F OD2 1 
ATOM   6854  N N   . ARG F  1 46  ? 66.117 78.679 0.448   1.00 70.76  ? 73   ARG F N   1 
ATOM   6855  C CA  . ARG F  1 46  ? 64.689 78.677 0.178   1.00 68.99  ? 73   ARG F CA  1 
ATOM   6856  C C   . ARG F  1 46  ? 64.006 77.515 0.914   1.00 67.68  ? 73   ARG F C   1 
ATOM   6857  O O   . ARG F  1 46  ? 62.852 77.623 1.330   1.00 67.39  ? 73   ARG F O   1 
ATOM   6858  C CB  . ARG F  1 46  ? 64.456 78.609 -1.338  1.00 69.44  ? 73   ARG F CB  1 
ATOM   6859  C CG  . ARG F  1 46  ? 63.231 79.380 -1.835  1.00 70.03  ? 73   ARG F CG  1 
ATOM   6860  C CD  . ARG F  1 46  ? 62.022 78.468 -1.933  1.00 71.56  ? 73   ARG F CD  1 
ATOM   6861  N NE  . ARG F  1 46  ? 60.837 79.108 -2.505  1.00 72.18  ? 73   ARG F NE  1 
ATOM   6862  C CZ  . ARG F  1 46  ? 60.830 79.862 -3.600  1.00 71.65  ? 73   ARG F CZ  1 
ATOM   6863  N NH1 . ARG F  1 46  ? 61.952 80.103 -4.267  1.00 71.22  ? 73   ARG F NH1 1 
ATOM   6864  N NH2 . ARG F  1 46  ? 59.682 80.351 -4.046  1.00 71.32  ? 73   ARG F NH2 1 
ATOM   6865  N N   . CYS F  1 47  ? 64.728 76.411 1.090   1.00 66.04  ? 74   CYS F N   1 
ATOM   6866  C CA  . CYS F  1 47  ? 64.197 75.246 1.793   1.00 63.76  ? 74   CYS F CA  1 
ATOM   6867  C C   . CYS F  1 47  ? 64.292 75.435 3.303   1.00 63.72  ? 74   CYS F C   1 
ATOM   6868  O O   . CYS F  1 47  ? 63.382 75.058 4.043   1.00 64.68  ? 74   CYS F O   1 
ATOM   6869  C CB  . CYS F  1 47  ? 64.964 73.992 1.387   1.00 60.55  ? 74   CYS F CB  1 
ATOM   6870  S SG  . CYS F  1 47  ? 64.341 72.448 2.122   1.00 57.79  ? 74   CYS F SG  1 
ATOM   6871  N N   . THR F  1 48  ? 65.395 76.014 3.760   1.00 62.98  ? 75   THR F N   1 
ATOM   6872  C CA  . THR F  1 48  ? 65.581 76.243 5.183   1.00 63.71  ? 75   THR F CA  1 
ATOM   6873  C C   . THR F  1 48  ? 64.532 77.213 5.706   1.00 63.81  ? 75   THR F C   1 
ATOM   6874  O O   . THR F  1 48  ? 63.783 76.895 6.627   1.00 64.09  ? 75   THR F O   1 
ATOM   6875  C CB  . THR F  1 48  ? 66.977 76.824 5.484   1.00 64.45  ? 75   THR F CB  1 
ATOM   6876  O OG1 . THR F  1 48  ? 67.978 75.871 5.117   1.00 65.17  ? 75   THR F OG1 1 
ATOM   6877  C CG2 . THR F  1 48  ? 67.117 77.154 6.965   1.00 63.58  ? 75   THR F CG2 1 
ATOM   6878  N N   . ARG F  1 49  ? 64.475 78.395 5.113   1.00 63.14  ? 76   ARG F N   1 
ATOM   6879  C CA  . ARG F  1 49  ? 63.520 79.393 5.550   1.00 63.02  ? 76   ARG F CA  1 
ATOM   6880  C C   . ARG F  1 49  ? 62.120 79.031 5.107   1.00 62.64  ? 76   ARG F C   1 
ATOM   6881  O O   . ARG F  1 49  ? 61.139 79.582 5.598   1.00 63.77  ? 76   ARG F O   1 
ATOM   6882  C CB  . ARG F  1 49  ? 63.949 80.743 5.014   1.00 64.07  ? 76   ARG F CB  1 
ATOM   6883  C CG  . ARG F  1 49  ? 65.374 81.013 5.431   1.00 67.48  ? 76   ARG F CG  1 
ATOM   6884  C CD  . ARG F  1 49  ? 65.995 82.181 4.720   1.00 70.47  ? 76   ARG F CD  1 
ATOM   6885  N NE  . ARG F  1 49  ? 67.448 82.145 4.857   1.00 72.05  ? 76   ARG F NE  1 
ATOM   6886  C CZ  . ARG F  1 49  ? 68.268 82.990 4.248   1.00 73.02  ? 76   ARG F CZ  1 
ATOM   6887  N NH1 . ARG F  1 49  ? 67.769 83.937 3.461   1.00 74.04  ? 76   ARG F NH1 1 
ATOM   6888  N NH2 . ARG F  1 49  ? 69.580 82.887 4.424   1.00 73.03  ? 76   ARG F NH2 1 
ATOM   6889  N N   . ASN F  1 50  ? 62.037 78.075 4.194   1.00 61.75  ? 77   ASN F N   1 
ATOM   6890  C CA  . ASN F  1 50  ? 60.762 77.607 3.676   1.00 61.07  ? 77   ASN F CA  1 
ATOM   6891  C C   . ASN F  1 50  ? 59.971 78.757 3.058   1.00 61.13  ? 77   ASN F C   1 
ATOM   6892  O O   . ASN F  1 50  ? 58.749 78.847 3.202   1.00 61.34  ? 77   ASN F O   1 
ATOM   6893  C CB  . ASN F  1 50  ? 59.951 76.950 4.796   1.00 60.19  ? 77   ASN F CB  1 
ATOM   6894  C CG  . ASN F  1 50  ? 58.979 75.914 4.273   1.00 60.48  ? 77   ASN F CG  1 
ATOM   6895  O OD1 . ASN F  1 50  ? 59.141 74.720 4.513   1.00 60.08  ? 77   ASN F OD1 1 
ATOM   6896  N ND2 . ASN F  1 50  ? 57.969 76.366 3.537   1.00 60.69  ? 77   ASN F ND2 1 
ATOM   6897  N N   . LYS F  1 51  ? 60.683 79.631 2.359   1.00 60.89  ? 78   LYS F N   1 
ATOM   6898  C CA  . LYS F  1 51  ? 60.069 80.779 1.714   1.00 61.23  ? 78   LYS F CA  1 
ATOM   6899  C C   . LYS F  1 51  ? 59.324 80.390 0.432   1.00 61.39  ? 78   LYS F C   1 
ATOM   6900  O O   . LYS F  1 51  ? 59.793 79.548 -0.329  1.00 61.34  ? 78   LYS F O   1 
ATOM   6901  C CB  . LYS F  1 51  ? 61.144 81.819 1.406   1.00 60.60  ? 78   LYS F CB  1 
ATOM   6902  N N   . GLY F  1 52  ? 58.154 80.992 0.215   1.00 61.56  ? 79   GLY F N   1 
ATOM   6903  C CA  . GLY F  1 52  ? 57.378 80.726 -0.986  1.00 61.67  ? 79   GLY F CA  1 
ATOM   6904  C C   . GLY F  1 52  ? 57.171 79.260 -1.301  1.00 62.16  ? 79   GLY F C   1 
ATOM   6905  O O   . GLY F  1 52  ? 57.290 78.828 -2.447  1.00 63.01  ? 79   GLY F O   1 
ATOM   6906  N N   . LEU F  1 53  ? 56.858 78.488 -0.273  1.00 62.78  ? 80   LEU F N   1 
ATOM   6907  C CA  . LEU F  1 53  ? 56.622 77.060 -0.428  1.00 63.22  ? 80   LEU F CA  1 
ATOM   6908  C C   . LEU F  1 53  ? 55.329 76.701 0.302   1.00 62.99  ? 80   LEU F C   1 
ATOM   6909  O O   . LEU F  1 53  ? 55.195 76.920 1.509   1.00 63.07  ? 80   LEU F O   1 
ATOM   6910  C CB  . LEU F  1 53  ? 57.804 76.273 0.143   1.00 64.12  ? 80   LEU F CB  1 
ATOM   6911  C CG  . LEU F  1 53  ? 59.111 76.403 -0.648  1.00 63.31  ? 80   LEU F CG  1 
ATOM   6912  C CD1 . LEU F  1 53  ? 60.279 75.863 0.168   1.00 62.98  ? 80   LEU F CD1 1 
ATOM   6913  C CD2 . LEU F  1 53  ? 58.967 75.654 -1.963  1.00 63.38  ? 80   LEU F CD2 1 
ATOM   6914  N N   . PRO F  1 54  ? 54.356 76.148 -0.433  1.00 62.33  ? 81   PRO F N   1 
ATOM   6915  C CA  . PRO F  1 54  ? 53.052 75.751 0.098   1.00 61.54  ? 81   PRO F CA  1 
ATOM   6916  C C   . PRO F  1 54  ? 53.096 74.497 0.950   1.00 61.19  ? 81   PRO F C   1 
ATOM   6917  O O   . PRO F  1 54  ? 52.095 73.786 1.067   1.00 62.03  ? 81   PRO F O   1 
ATOM   6918  C CB  . PRO F  1 54  ? 52.230 75.540 -1.161  1.00 62.17  ? 81   PRO F CB  1 
ATOM   6919  C CG  . PRO F  1 54  ? 53.233 74.933 -2.081  1.00 62.28  ? 81   PRO F CG  1 
ATOM   6920  C CD  . PRO F  1 54  ? 54.453 75.820 -1.867  1.00 62.81  ? 81   PRO F CD  1 
ATOM   6921  N N   . PHE F  1 55  ? 54.251 74.217 1.538   1.00 59.71  ? 82   PHE F N   1 
ATOM   6922  C CA  . PHE F  1 55  ? 54.391 73.027 2.364   1.00 58.26  ? 82   PHE F CA  1 
ATOM   6923  C C   . PHE F  1 55  ? 55.696 73.047 3.136   1.00 57.57  ? 82   PHE F C   1 
ATOM   6924  O O   . PHE F  1 55  ? 56.483 73.988 3.043   1.00 56.70  ? 82   PHE F O   1 
ATOM   6925  C CB  . PHE F  1 55  ? 54.328 71.770 1.483   1.00 57.53  ? 82   PHE F CB  1 
ATOM   6926  C CG  . PHE F  1 55  ? 55.255 71.821 0.298   1.00 55.35  ? 82   PHE F CG  1 
ATOM   6927  C CD1 . PHE F  1 55  ? 56.633 71.819 0.476   1.00 55.27  ? 82   PHE F CD1 1 
ATOM   6928  C CD2 . PHE F  1 55  ? 54.750 71.929 -0.987  1.00 53.82  ? 82   PHE F CD2 1 
ATOM   6929  C CE1 . PHE F  1 55  ? 57.493 71.929 -0.606  1.00 54.90  ? 82   PHE F CE1 1 
ATOM   6930  C CE2 . PHE F  1 55  ? 55.600 72.041 -2.075  1.00 54.18  ? 82   PHE F CE2 1 
ATOM   6931  C CZ  . PHE F  1 55  ? 56.976 72.041 -1.884  1.00 54.81  ? 82   PHE F CZ  1 
ATOM   6932  N N   . THR F  1 56  ? 55.912 71.988 3.900   1.00 57.91  ? 83   THR F N   1 
ATOM   6933  C CA  . THR F  1 56  ? 57.118 71.850 4.696   1.00 57.68  ? 83   THR F CA  1 
ATOM   6934  C C   . THR F  1 56  ? 58.210 71.250 3.803   1.00 56.07  ? 83   THR F C   1 
ATOM   6935  O O   . THR F  1 56  ? 58.078 70.110 3.363   1.00 55.01  ? 83   THR F O   1 
ATOM   6936  C CB  . THR F  1 56  ? 56.859 70.905 5.896   1.00 59.09  ? 83   THR F CB  1 
ATOM   6937  O OG1 . THR F  1 56  ? 55.601 71.236 6.506   1.00 58.12  ? 83   THR F OG1 1 
ATOM   6938  C CG2 . THR F  1 56  ? 57.978 71.039 6.935   1.00 59.97  ? 83   THR F CG2 1 
ATOM   6939  N N   . CYS F  1 57  ? 59.269 72.014 3.526   1.00 54.57  ? 84   CYS F N   1 
ATOM   6940  C CA  . CYS F  1 57  ? 60.363 71.516 2.689   1.00 53.29  ? 84   CYS F CA  1 
ATOM   6941  C C   . CYS F  1 57  ? 61.223 70.509 3.463   1.00 51.88  ? 84   CYS F C   1 
ATOM   6942  O O   . CYS F  1 57  ? 62.062 70.892 4.282   1.00 52.43  ? 84   CYS F O   1 
ATOM   6943  C CB  . CYS F  1 57  ? 61.248 72.667 2.190   1.00 54.09  ? 84   CYS F CB  1 
ATOM   6944  S SG  . CYS F  1 57  ? 62.599 72.053 1.128   1.00 57.55  ? 84   CYS F SG  1 
ATOM   6945  N N   . LYS F  1 58  ? 61.019 69.223 3.195   1.00 49.44  ? 85   LYS F N   1 
ATOM   6946  C CA  . LYS F  1 58  ? 61.757 68.170 3.881   1.00 47.58  ? 85   LYS F CA  1 
ATOM   6947  C C   . LYS F  1 58  ? 63.015 67.724 3.143   1.00 47.30  ? 85   LYS F C   1 
ATOM   6948  O O   . LYS F  1 58  ? 63.885 67.066 3.715   1.00 47.15  ? 85   LYS F O   1 
ATOM   6949  C CB  . LYS F  1 58  ? 60.839 66.974 4.113   1.00 45.71  ? 85   LYS F CB  1 
ATOM   6950  C CG  . LYS F  1 58  ? 59.647 67.332 4.953   1.00 45.54  ? 85   LYS F CG  1 
ATOM   6951  C CD  . LYS F  1 58  ? 58.725 66.162 5.168   1.00 45.28  ? 85   LYS F CD  1 
ATOM   6952  C CE  . LYS F  1 58  ? 57.543 66.586 6.026   1.00 45.89  ? 85   LYS F CE  1 
ATOM   6953  N NZ  . LYS F  1 58  ? 56.588 65.471 6.258   1.00 47.38  ? 85   LYS F NZ  1 
ATOM   6954  N N   . ALA F  1 59  ? 63.107 68.082 1.873   1.00 46.43  ? 86   ALA F N   1 
ATOM   6955  C CA  . ALA F  1 59  ? 64.258 67.720 1.077   1.00 46.24  ? 86   ALA F CA  1 
ATOM   6956  C C   . ALA F  1 59  ? 64.210 68.472 -0.240  1.00 47.03  ? 86   ALA F C   1 
ATOM   6957  O O   . ALA F  1 59  ? 63.153 68.952 -0.658  1.00 45.89  ? 86   ALA F O   1 
ATOM   6958  C CB  . ALA F  1 59  ? 64.262 66.228 0.829   1.00 46.42  ? 86   ALA F CB  1 
ATOM   6959  N N   . PHE F  1 60  ? 65.363 68.595 -0.884  1.00 48.55  ? 87   PHE F N   1 
ATOM   6960  C CA  . PHE F  1 60  ? 65.430 69.272 -2.166  1.00 50.76  ? 87   PHE F CA  1 
ATOM   6961  C C   . PHE F  1 60  ? 66.558 68.690 -3.001  1.00 52.81  ? 87   PHE F C   1 
ATOM   6962  O O   . PHE F  1 60  ? 67.623 68.354 -2.485  1.00 52.18  ? 87   PHE F O   1 
ATOM   6963  C CB  . PHE F  1 60  ? 65.613 70.786 -1.975  1.00 49.48  ? 87   PHE F CB  1 
ATOM   6964  C CG  . PHE F  1 60  ? 67.023 71.206 -1.658  1.00 48.17  ? 87   PHE F CG  1 
ATOM   6965  C CD1 . PHE F  1 60  ? 67.973 71.324 -2.669  1.00 47.75  ? 87   PHE F CD1 1 
ATOM   6966  C CD2 . PHE F  1 60  ? 67.402 71.490 -0.354  1.00 46.63  ? 87   PHE F CD2 1 
ATOM   6967  C CE1 . PHE F  1 60  ? 69.281 71.718 -2.380  1.00 46.18  ? 87   PHE F CE1 1 
ATOM   6968  C CE2 . PHE F  1 60  ? 68.707 71.884 -0.063  1.00 45.72  ? 87   PHE F CE2 1 
ATOM   6969  C CZ  . PHE F  1 60  ? 69.645 71.998 -1.076  1.00 44.85  ? 87   PHE F CZ  1 
ATOM   6970  N N   . VAL F  1 61  ? 66.302 68.553 -4.296  1.00 56.91  ? 88   VAL F N   1 
ATOM   6971  C CA  . VAL F  1 61  ? 67.284 68.018 -5.227  1.00 61.34  ? 88   VAL F CA  1 
ATOM   6972  C C   . VAL F  1 61  ? 67.759 69.132 -6.148  1.00 63.92  ? 88   VAL F C   1 
ATOM   6973  O O   . VAL F  1 61  ? 66.949 69.900 -6.670  1.00 64.27  ? 88   VAL F O   1 
ATOM   6974  C CB  . VAL F  1 61  ? 66.678 66.901 -6.104  1.00 61.14  ? 88   VAL F CB  1 
ATOM   6975  C CG1 . VAL F  1 61  ? 67.699 66.460 -7.136  1.00 62.82  ? 88   VAL F CG1 1 
ATOM   6976  C CG2 . VAL F  1 61  ? 66.247 65.724 -5.241  1.00 60.41  ? 88   VAL F CG2 1 
ATOM   6977  N N   . PHE F  1 62  ? 69.070 69.229 -6.344  1.00 67.14  ? 89   PHE F N   1 
ATOM   6978  C CA  . PHE F  1 62  ? 69.610 70.259 -7.227  1.00 70.56  ? 89   PHE F CA  1 
ATOM   6979  C C   . PHE F  1 62  ? 70.066 69.659 -8.559  1.00 71.87  ? 89   PHE F C   1 
ATOM   6980  O O   . PHE F  1 62  ? 70.894 68.744 -8.582  1.00 72.19  ? 89   PHE F O   1 
ATOM   6981  C CB  . PHE F  1 62  ? 70.789 70.988 -6.572  1.00 71.64  ? 89   PHE F CB  1 
ATOM   6982  C CG  . PHE F  1 62  ? 71.390 72.058 -7.444  1.00 73.66  ? 89   PHE F CG  1 
ATOM   6983  C CD1 . PHE F  1 62  ? 70.591 73.076 -7.964  1.00 73.73  ? 89   PHE F CD1 1 
ATOM   6984  C CD2 . PHE F  1 62  ? 72.749 72.041 -7.764  1.00 74.62  ? 89   PHE F CD2 1 
ATOM   6985  C CE1 . PHE F  1 62  ? 71.136 74.064 -8.792  1.00 74.38  ? 89   PHE F CE1 1 
ATOM   6986  C CE2 . PHE F  1 62  ? 73.302 73.029 -8.592  1.00 74.60  ? 89   PHE F CE2 1 
ATOM   6987  C CZ  . PHE F  1 62  ? 72.492 74.040 -9.106  1.00 73.87  ? 89   PHE F CZ  1 
ATOM   6988  N N   . ASP F  1 63  ? 69.521 70.182 -9.662  1.00 72.83  ? 90   ASP F N   1 
ATOM   6989  C CA  . ASP F  1 63  ? 69.852 69.723 -11.018 1.00 73.14  ? 90   ASP F CA  1 
ATOM   6990  C C   . ASP F  1 63  ? 71.073 70.484 -11.562 1.00 73.54  ? 90   ASP F C   1 
ATOM   6991  O O   . ASP F  1 63  ? 70.915 71.485 -12.264 1.00 73.46  ? 90   ASP F O   1 
ATOM   6992  C CB  . ASP F  1 63  ? 68.655 69.959 -11.951 1.00 72.91  ? 90   ASP F CB  1 
ATOM   6993  C CG  . ASP F  1 63  ? 68.847 69.337 -13.326 1.00 73.43  ? 90   ASP F CG  1 
ATOM   6994  O OD1 . ASP F  1 63  ? 69.974 69.392 -13.859 1.00 73.51  ? 90   ASP F OD1 1 
ATOM   6995  O OD2 . ASP F  1 63  ? 67.863 68.802 -13.884 1.00 73.71  ? 90   ASP F OD2 1 
ATOM   6996  N N   . LYS F  1 64  ? 72.278 70.010 -11.240 1.00 73.67  ? 91   LYS F N   1 
ATOM   6997  C CA  . LYS F  1 64  ? 73.519 70.643 -11.690 1.00 73.15  ? 91   LYS F CA  1 
ATOM   6998  C C   . LYS F  1 64  ? 73.456 71.046 -13.159 1.00 73.29  ? 91   LYS F C   1 
ATOM   6999  O O   . LYS F  1 64  ? 73.999 72.088 -13.555 1.00 73.32  ? 91   LYS F O   1 
ATOM   7000  C CB  . LYS F  1 64  ? 74.710 69.699 -11.490 1.00 72.74  ? 91   LYS F CB  1 
ATOM   7001  C CG  . LYS F  1 64  ? 74.999 69.328 -10.051 1.00 72.59  ? 91   LYS F CG  1 
ATOM   7002  C CD  . LYS F  1 64  ? 76.156 68.336 -9.942  1.00 72.18  ? 91   LYS F CD  1 
ATOM   7003  C CE  . LYS F  1 64  ? 76.441 68.009 -8.482  1.00 72.23  ? 91   LYS F CE  1 
ATOM   7004  N NZ  . LYS F  1 64  ? 77.504 66.984 -8.300  1.00 72.70  ? 91   LYS F NZ  1 
ATOM   7005  N N   . ALA F  1 65  ? 72.802 70.212 -13.962 1.00 72.82  ? 92   ALA F N   1 
ATOM   7006  C CA  . ALA F  1 65  ? 72.668 70.456 -15.385 1.00 72.58  ? 92   ALA F CA  1 
ATOM   7007  C C   . ALA F  1 65  ? 71.776 71.635 -15.709 1.00 73.37  ? 92   ALA F C   1 
ATOM   7008  O O   . ALA F  1 65  ? 72.259 72.730 -15.999 1.00 72.91  ? 92   ALA F O   1 
ATOM   7009  C CB  . ALA F  1 65  ? 72.128 69.218 -16.069 1.00 72.79  ? 92   ALA F CB  1 
ATOM   7010  N N   . ARG F  1 66  ? 70.465 71.428 -15.664 1.00 74.35  ? 93   ARG F N   1 
ATOM   7011  C CA  . ARG F  1 66  ? 69.511 72.502 -16.010 1.00 74.84  ? 93   ARG F CA  1 
ATOM   7012  C C   . ARG F  1 66  ? 69.528 73.724 -15.107 1.00 75.10  ? 93   ARG F C   1 
ATOM   7013  O O   . ARG F  1 66  ? 68.931 74.732 -15.449 1.00 72.80  ? 93   ARG F O   1 
ATOM   7014  C CB  . ARG F  1 66  ? 68.109 71.922 -16.039 1.00 76.38  ? 93   ARG F CB  1 
ATOM   7015  C CG  . ARG F  1 66  ? 67.099 72.676 -16.908 1.00 78.20  ? 93   ARG F CG  1 
ATOM   7016  C CD  . ARG F  1 66  ? 65.832 71.852 -16.942 1.00 80.99  ? 93   ARG F CD  1 
ATOM   7017  N NE  . ARG F  1 66  ? 66.254 70.468 -17.135 1.00 82.29  ? 93   ARG F NE  1 
ATOM   7018  C CZ  . ARG F  1 66  ? 65.480 69.468 -17.535 1.00 82.18  ? 93   ARG F CZ  1 
ATOM   7019  N NH1 . ARG F  1 66  ? 64.192 69.665 -17.797 1.00 80.96  ? 93   ARG F NH1 1 
ATOM   7020  N NH2 . ARG F  1 66  ? 66.018 68.266 -17.699 1.00 80.58  ? 93   ARG F NH2 1 
ATOM   7021  N N   . LYS F  1 67  ? 70.204 73.629 -13.962 1.00 75.21  ? 94   LYS F N   1 
ATOM   7022  C CA  . LYS F  1 67  ? 70.282 74.770 -13.036 1.00 74.16  ? 94   LYS F CA  1 
ATOM   7023  C C   . LYS F  1 67  ? 68.967 75.110 -12.334 1.00 73.50  ? 94   LYS F C   1 
ATOM   7024  O O   . LYS F  1 67  ? 68.538 76.261 -12.360 1.00 71.65  ? 94   LYS F O   1 
ATOM   7025  C CB  . LYS F  1 67  ? 70.768 76.011 -13.810 1.00 74.74  ? 94   LYS F CB  1 
ATOM   7026  C CG  . LYS F  1 67  ? 72.219 75.922 -14.222 1.00 74.34  ? 94   LYS F CG  1 
ATOM   7027  C CD  . LYS F  1 67  ? 73.109 76.400 -13.092 1.00 75.11  ? 94   LYS F CD  1 
ATOM   7028  C CE  . LYS F  1 67  ? 74.533 75.903 -13.235 1.00 75.83  ? 94   LYS F CE  1 
ATOM   7029  N NZ  . LYS F  1 67  ? 74.770 74.652 -12.469 1.00 73.17  ? 94   LYS F NZ  1 
ATOM   7030  N N   . GLN F  1 68  ? 68.344 74.126 -11.699 1.00 73.04  ? 95   GLN F N   1 
ATOM   7031  C CA  . GLN F  1 68  ? 67.098 74.388 -10.999 1.00 72.96  ? 95   GLN F CA  1 
ATOM   7032  C C   . GLN F  1 68  ? 66.873 73.525 -9.751  1.00 72.79  ? 95   GLN F C   1 
ATOM   7033  O O   . GLN F  1 68  ? 67.325 72.374 -9.675  1.00 72.11  ? 95   GLN F O   1 
ATOM   7034  C CB  . GLN F  1 68  ? 65.909 74.214 -11.933 1.00 72.27  ? 95   GLN F CB  1 
ATOM   7035  C CG  . GLN F  1 68  ? 65.627 72.776 -12.261 1.00 72.18  ? 95   GLN F CG  1 
ATOM   7036  C CD  . GLN F  1 68  ? 64.283 72.601 -12.909 1.00 72.13  ? 95   GLN F CD  1 
ATOM   7037  O OE1 . GLN F  1 68  ? 63.524 73.562 -13.056 1.00 72.40  ? 95   GLN F OE1 1 
ATOM   7038  N NE2 . GLN F  1 68  ? 63.969 71.372 -13.295 1.00 72.02  ? 95   GLN F NE2 1 
ATOM   7039  N N   . CYS F  1 69  ? 66.159 74.098 -8.781  1.00 72.36  ? 96   CYS F N   1 
ATOM   7040  C CA  . CYS F  1 69  ? 65.857 73.417 -7.532  1.00 71.84  ? 96   CYS F CA  1 
ATOM   7041  C C   . CYS F  1 69  ? 64.566 72.608 -7.621  1.00 71.45  ? 96   CYS F C   1 
ATOM   7042  O O   . CYS F  1 69  ? 63.650 72.941 -8.382  1.00 70.96  ? 96   CYS F O   1 
ATOM   7043  C CB  . CYS F  1 69  ? 65.694 74.423 -6.390  1.00 71.81  ? 96   CYS F CB  1 
ATOM   7044  S SG  . CYS F  1 69  ? 66.990 75.675 -6.139  1.00 71.96  ? 96   CYS F SG  1 
ATOM   7045  N N   . LEU F  1 70  ? 64.503 71.547 -6.822  1.00 70.79  ? 97   LEU F N   1 
ATOM   7046  C CA  . LEU F  1 70  ? 63.324 70.689 -6.754  1.00 69.76  ? 97   LEU F CA  1 
ATOM   7047  C C   . LEU F  1 70  ? 63.004 70.462 -5.286  1.00 67.86  ? 97   LEU F C   1 
ATOM   7048  O O   . LEU F  1 70  ? 63.474 69.510 -4.671  1.00 67.22  ? 97   LEU F O   1 
ATOM   7049  C CB  . LEU F  1 70  ? 63.571 69.344 -7.449  1.00 71.27  ? 97   LEU F CB  1 
ATOM   7050  C CG  . LEU F  1 70  ? 63.588 69.324 -8.980  1.00 71.58  ? 97   LEU F CG  1 
ATOM   7051  C CD1 . LEU F  1 70  ? 64.807 70.068 -9.506  1.00 72.66  ? 97   LEU F CD1 1 
ATOM   7052  C CD2 . LEU F  1 70  ? 63.604 67.882 -9.455  1.00 71.21  ? 97   LEU F CD2 1 
ATOM   7053  N N   . TRP F  1 71  ? 62.202 71.363 -4.737  1.00 65.84  ? 98   TRP F N   1 
ATOM   7054  C CA  . TRP F  1 71  ? 61.800 71.311 -3.343  1.00 64.13  ? 98   TRP F CA  1 
ATOM   7055  C C   . TRP F  1 71  ? 60.655 70.328 -3.098  1.00 63.16  ? 98   TRP F C   1 
ATOM   7056  O O   . TRP F  1 71  ? 59.583 70.450 -3.695  1.00 63.08  ? 98   TRP F O   1 
ATOM   7057  C CB  . TRP F  1 71  ? 61.383 72.712 -2.900  1.00 63.67  ? 98   TRP F CB  1 
ATOM   7058  C CG  . TRP F  1 71  ? 62.494 73.716 -2.966  1.00 63.04  ? 98   TRP F CG  1 
ATOM   7059  C CD1 . TRP F  1 71  ? 63.615 73.754 -2.184  1.00 63.80  ? 98   TRP F CD1 1 
ATOM   7060  C CD2 . TRP F  1 71  ? 62.591 74.832 -3.855  1.00 62.68  ? 98   TRP F CD2 1 
ATOM   7061  N NE1 . TRP F  1 71  ? 64.405 74.824 -2.528  1.00 62.46  ? 98   TRP F NE1 1 
ATOM   7062  C CE2 . TRP F  1 71  ? 63.801 75.504 -3.551  1.00 62.48  ? 98   TRP F CE2 1 
ATOM   7063  C CE3 . TRP F  1 71  ? 61.775 75.332 -4.879  1.00 61.78  ? 98   TRP F CE3 1 
ATOM   7064  C CZ2 . TRP F  1 71  ? 64.216 76.650 -4.238  1.00 62.19  ? 98   TRP F CZ2 1 
ATOM   7065  C CZ3 . TRP F  1 71  ? 62.189 76.474 -5.566  1.00 61.90  ? 98   TRP F CZ3 1 
ATOM   7066  C CH2 . TRP F  1 71  ? 63.401 77.120 -5.239  1.00 62.58  ? 98   TRP F CH2 1 
ATOM   7067  N N   . PHE F  1 72  ? 60.869 69.357 -2.216  1.00 61.39  ? 99   PHE F N   1 
ATOM   7068  C CA  . PHE F  1 72  ? 59.810 68.399 -1.935  1.00 60.42  ? 99   PHE F CA  1 
ATOM   7069  C C   . PHE F  1 72  ? 59.304 68.520 -0.518  1.00 58.56  ? 99   PHE F C   1 
ATOM   7070  O O   . PHE F  1 72  ? 59.971 69.058 0.360   1.00 57.29  ? 99   PHE F O   1 
ATOM   7071  C CB  . PHE F  1 72  ? 60.273 66.950 -2.125  1.00 61.43  ? 99   PHE F CB  1 
ATOM   7072  C CG  . PHE F  1 72  ? 61.171 66.738 -3.305  1.00 62.61  ? 99   PHE F CG  1 
ATOM   7073  C CD1 . PHE F  1 72  ? 60.773 67.111 -4.579  1.00 62.87  ? 99   PHE F CD1 1 
ATOM   7074  C CD2 . PHE F  1 72  ? 62.411 66.131 -3.139  1.00 62.90  ? 99   PHE F CD2 1 
ATOM   7075  C CE1 . PHE F  1 72  ? 61.592 66.880 -5.669  1.00 63.35  ? 99   PHE F CE1 1 
ATOM   7076  C CE2 . PHE F  1 72  ? 63.238 65.894 -4.219  1.00 63.56  ? 99   PHE F CE2 1 
ATOM   7077  C CZ  . PHE F  1 72  ? 62.830 66.269 -5.489  1.00 64.02  ? 99   PHE F CZ  1 
ATOM   7078  N N   . PRO F  1 73  ? 58.083 68.046 -0.293  1.00 58.03  ? 100  PRO F N   1 
ATOM   7079  C CA  . PRO F  1 73  ? 57.437 68.060 1.019   1.00 57.64  ? 100  PRO F CA  1 
ATOM   7080  C C   . PRO F  1 73  ? 57.518 66.637 1.566   1.00 57.57  ? 100  PRO F C   1 
ATOM   7081  O O   . PRO F  1 73  ? 56.600 66.161 2.228   1.00 56.66  ? 100  PRO F O   1 
ATOM   7082  C CB  . PRO F  1 73  ? 56.015 68.456 0.685   1.00 57.35  ? 100  PRO F CB  1 
ATOM   7083  C CG  . PRO F  1 73  ? 55.798 67.714 -0.594  1.00 57.18  ? 100  PRO F CG  1 
ATOM   7084  C CD  . PRO F  1 73  ? 57.069 67.989 -1.363  1.00 56.71  ? 100  PRO F CD  1 
ATOM   7085  N N   . PHE F  1 74  ? 58.625 65.966 1.257   1.00 57.90  ? 101  PHE F N   1 
ATOM   7086  C CA  . PHE F  1 74  ? 58.864 64.591 1.684   1.00 57.88  ? 101  PHE F CA  1 
ATOM   7087  C C   . PHE F  1 74  ? 60.340 64.260 1.445   1.00 57.61  ? 101  PHE F C   1 
ATOM   7088  O O   . PHE F  1 74  ? 61.089 65.085 0.915   1.00 56.94  ? 101  PHE F O   1 
ATOM   7089  C CB  . PHE F  1 74  ? 57.994 63.656 0.859   1.00 58.11  ? 101  PHE F CB  1 
ATOM   7090  C CG  . PHE F  1 74  ? 58.180 63.828 -0.622  1.00 60.94  ? 101  PHE F CG  1 
ATOM   7091  C CD1 . PHE F  1 74  ? 59.286 63.276 -1.271  1.00 61.37  ? 101  PHE F CD1 1 
ATOM   7092  C CD2 . PHE F  1 74  ? 57.290 64.603 -1.362  1.00 61.82  ? 101  PHE F CD2 1 
ATOM   7093  C CE1 . PHE F  1 74  ? 59.504 63.498 -2.627  1.00 60.88  ? 101  PHE F CE1 1 
ATOM   7094  C CE2 . PHE F  1 74  ? 57.499 64.833 -2.719  1.00 61.81  ? 101  PHE F CE2 1 
ATOM   7095  C CZ  . PHE F  1 74  ? 58.609 64.280 -3.353  1.00 61.77  ? 101  PHE F CZ  1 
ATOM   7096  N N   . ASN F  1 75  ? 60.758 63.062 1.844   1.00 56.86  ? 102  ASN F N   1 
ATOM   7097  C CA  . ASN F  1 75  ? 62.139 62.647 1.631   1.00 56.27  ? 102  ASN F CA  1 
ATOM   7098  C C   . ASN F  1 75  ? 62.232 61.177 1.234   1.00 55.75  ? 102  ASN F C   1 
ATOM   7099  O O   . ASN F  1 75  ? 61.222 60.496 1.096   1.00 54.84  ? 102  ASN F O   1 
ATOM   7100  C CB  . ASN F  1 75  ? 63.014 62.926 2.866   1.00 55.31  ? 102  ASN F CB  1 
ATOM   7101  C CG  . ASN F  1 75  ? 62.601 62.122 4.084   1.00 54.99  ? 102  ASN F CG  1 
ATOM   7102  O OD1 . ASN F  1 75  ? 62.081 61.013 3.971   1.00 54.40  ? 102  ASN F OD1 1 
ATOM   7103  N ND2 . ASN F  1 75  ? 62.860 62.675 5.264   1.00 54.47  ? 102  ASN F ND2 1 
ATOM   7104  N N   . SER F  1 76  ? 63.457 60.703 1.046   1.00 56.16  ? 103  SER F N   1 
ATOM   7105  C CA  . SER F  1 76  ? 63.715 59.332 0.633   1.00 57.21  ? 103  SER F CA  1 
ATOM   7106  C C   . SER F  1 76  ? 62.998 58.280 1.465   1.00 57.94  ? 103  SER F C   1 
ATOM   7107  O O   . SER F  1 76  ? 62.721 57.181 0.993   1.00 58.26  ? 103  SER F O   1 
ATOM   7108  C CB  . SER F  1 76  ? 65.216 59.053 0.679   1.00 55.47  ? 103  SER F CB  1 
ATOM   7109  O OG  . SER F  1 76  ? 65.671 59.075 2.015   1.00 55.95  ? 103  SER F OG  1 
ATOM   7110  N N   . MET F  1 77  ? 62.687 58.601 2.703   1.00 59.15  ? 104  MET F N   1 
ATOM   7111  C CA  . MET F  1 77  ? 62.041 57.607 3.532   1.00 61.30  ? 104  MET F CA  1 
ATOM   7112  C C   . MET F  1 77  ? 60.530 57.757 3.511   1.00 61.58  ? 104  MET F C   1 
ATOM   7113  O O   . MET F  1 77  ? 59.802 57.003 4.158   1.00 61.57  ? 104  MET F O   1 
ATOM   7114  C CB  . MET F  1 77  ? 62.594 57.706 4.951   1.00 62.80  ? 104  MET F CB  1 
ATOM   7115  C CG  . MET F  1 77  ? 64.118 57.604 4.998   1.00 65.78  ? 104  MET F CG  1 
ATOM   7116  S SD  . MET F  1 77  ? 64.839 58.068 6.603   1.00 71.22  ? 104  MET F SD  1 
ATOM   7117  C CE  . MET F  1 77  ? 64.856 59.997 6.526   1.00 70.96  ? 104  MET F CE  1 
ATOM   7118  N N   . SER F  1 78  ? 60.066 58.729 2.738   1.00 62.50  ? 105  SER F N   1 
ATOM   7119  C CA  . SER F  1 78  ? 58.644 59.001 2.613   1.00 63.51  ? 105  SER F CA  1 
ATOM   7120  C C   . SER F  1 78  ? 57.966 57.947 1.752   1.00 65.14  ? 105  SER F C   1 
ATOM   7121  O O   . SER F  1 78  ? 58.308 57.763 0.582   1.00 64.45  ? 105  SER F O   1 
ATOM   7122  C CB  . SER F  1 78  ? 58.416 60.388 1.997   1.00 62.41  ? 105  SER F CB  1 
ATOM   7123  O OG  . SER F  1 78  ? 58.817 61.431 2.869   1.00 58.99  ? 105  SER F OG  1 
ATOM   7124  N N   . SER F  1 79  ? 57.005 57.249 2.348   1.00 67.37  ? 106  SER F N   1 
ATOM   7125  C CA  . SER F  1 79  ? 56.253 56.227 1.636   1.00 69.04  ? 106  SER F CA  1 
ATOM   7126  C C   . SER F  1 79  ? 55.554 56.911 0.463   1.00 69.27  ? 106  SER F C   1 
ATOM   7127  O O   . SER F  1 79  ? 54.725 57.801 0.659   1.00 69.62  ? 106  SER F O   1 
ATOM   7128  C CB  . SER F  1 79  ? 55.227 55.590 2.578   1.00 69.70  ? 106  SER F CB  1 
ATOM   7129  O OG  . SER F  1 79  ? 54.510 56.588 3.286   1.00 71.05  ? 106  SER F OG  1 
ATOM   7130  N N   . GLY F  1 80  ? 55.907 56.510 -0.753  1.00 69.19  ? 107  GLY F N   1 
ATOM   7131  C CA  . GLY F  1 80  ? 55.301 57.111 -1.926  1.00 69.36  ? 107  GLY F CA  1 
ATOM   7132  C C   . GLY F  1 80  ? 56.332 57.682 -2.879  1.00 70.22  ? 107  GLY F C   1 
ATOM   7133  O O   . GLY F  1 80  ? 55.985 58.336 -3.863  1.00 69.72  ? 107  GLY F O   1 
ATOM   7134  N N   . VAL F  1 81  ? 57.606 57.438 -2.577  1.00 71.42  ? 108  VAL F N   1 
ATOM   7135  C CA  . VAL F  1 81  ? 58.708 57.917 -3.405  1.00 72.54  ? 108  VAL F CA  1 
ATOM   7136  C C   . VAL F  1 81  ? 59.862 56.920 -3.435  1.00 73.17  ? 108  VAL F C   1 
ATOM   7137  O O   . VAL F  1 81  ? 59.970 56.040 -2.584  1.00 72.15  ? 108  VAL F O   1 
ATOM   7138  C CB  . VAL F  1 81  ? 59.260 59.265 -2.895  1.00 72.29  ? 108  VAL F CB  1 
ATOM   7139  C CG1 . VAL F  1 81  ? 58.183 60.328 -2.948  1.00 72.48  ? 108  VAL F CG1 1 
ATOM   7140  C CG2 . VAL F  1 81  ? 59.775 59.108 -1.482  1.00 72.70  ? 108  VAL F CG2 1 
ATOM   7141  N N   . LYS F  1 82  ? 60.740 57.079 -4.414  1.00 74.86  ? 109  LYS F N   1 
ATOM   7142  C CA  . LYS F  1 82  ? 61.888 56.200 -4.549  1.00 76.27  ? 109  LYS F CA  1 
ATOM   7143  C C   . LYS F  1 82  ? 63.026 56.971 -5.193  1.00 77.62  ? 109  LYS F C   1 
ATOM   7144  O O   . LYS F  1 82  ? 62.805 57.892 -5.987  1.00 77.79  ? 109  LYS F O   1 
ATOM   7145  C CB  . LYS F  1 82  ? 61.525 54.997 -5.401  1.00 76.50  ? 109  LYS F CB  1 
ATOM   7146  N N   . LYS F  1 83  ? 64.247 56.594 -4.843  1.00 78.69  ? 110  LYS F N   1 
ATOM   7147  C CA  . LYS F  1 83  ? 65.411 57.253 -5.399  1.00 79.69  ? 110  LYS F CA  1 
ATOM   7148  C C   . LYS F  1 83  ? 65.985 56.486 -6.586  1.00 80.65  ? 110  LYS F C   1 
ATOM   7149  O O   . LYS F  1 83  ? 65.711 55.299 -6.768  1.00 80.12  ? 110  LYS F O   1 
ATOM   7150  C CB  . LYS F  1 83  ? 66.484 57.433 -4.315  1.00 79.12  ? 110  LYS F CB  1 
ATOM   7151  C CG  . LYS F  1 83  ? 66.651 56.238 -3.387  1.00 78.23  ? 110  LYS F CG  1 
ATOM   7152  C CD  . LYS F  1 83  ? 67.894 56.385 -2.521  1.00 77.76  ? 110  LYS F CD  1 
ATOM   7153  C CE  . LYS F  1 83  ? 67.881 57.664 -1.694  1.00 78.17  ? 110  LYS F CE  1 
ATOM   7154  N NZ  . LYS F  1 83  ? 69.164 57.882 -0.947  1.00 77.53  ? 110  LYS F NZ  1 
ATOM   7155  N N   . GLU F  1 84  ? 66.773 57.187 -7.395  1.00 82.47  ? 111  GLU F N   1 
ATOM   7156  C CA  . GLU F  1 84  ? 67.419 56.606 -8.563  1.00 84.00  ? 111  GLU F CA  1 
ATOM   7157  C C   . GLU F  1 84  ? 68.849 57.135 -8.665  1.00 85.17  ? 111  GLU F C   1 
ATOM   7158  O O   . GLU F  1 84  ? 69.553 57.265 -7.661  1.00 85.05  ? 111  GLU F O   1 
ATOM   7159  C CB  . GLU F  1 84  ? 66.624 56.956 -9.830  1.00 83.80  ? 111  GLU F CB  1 
ATOM   7160  N N   . PHE F  1 85  ? 69.272 57.432 -9.888  1.00 86.57  ? 112  PHE F N   1 
ATOM   7161  C CA  . PHE F  1 85  ? 70.608 57.955 -10.133 1.00 87.71  ? 112  PHE F CA  1 
ATOM   7162  C C   . PHE F  1 85  ? 70.540 58.977 -11.265 1.00 88.29  ? 112  PHE F C   1 
ATOM   7163  O O   . PHE F  1 85  ? 69.644 58.919 -12.111 1.00 88.34  ? 112  PHE F O   1 
ATOM   7164  C CB  . PHE F  1 85  ? 71.564 56.811 -10.494 1.00 87.61  ? 112  PHE F CB  1 
ATOM   7165  C CG  . PHE F  1 85  ? 72.969 57.251 -10.762 1.00 88.27  ? 112  PHE F CG  1 
ATOM   7166  C CD1 . PHE F  1 85  ? 73.317 57.823 -11.985 1.00 88.90  ? 112  PHE F CD1 1 
ATOM   7167  C CD2 . PHE F  1 85  ? 73.943 57.122 -9.779  1.00 89.11  ? 112  PHE F CD2 1 
ATOM   7168  C CE1 . PHE F  1 85  ? 74.620 58.266 -12.227 1.00 89.79  ? 112  PHE F CE1 1 
ATOM   7169  C CE2 . PHE F  1 85  ? 75.250 57.560 -10.004 1.00 90.02  ? 112  PHE F CE2 1 
ATOM   7170  C CZ  . PHE F  1 85  ? 75.590 58.135 -11.233 1.00 90.42  ? 112  PHE F CZ  1 
ATOM   7171  N N   . GLY F  1 86  ? 71.481 59.918 -11.256 1.00 89.13  ? 113  GLY F N   1 
ATOM   7172  C CA  . GLY F  1 86  ? 71.545 60.956 -12.271 1.00 89.60  ? 113  GLY F CA  1 
ATOM   7173  C C   . GLY F  1 86  ? 72.678 61.861 -11.857 1.00 90.27  ? 113  GLY F C   1 
ATOM   7174  O O   . GLY F  1 86  ? 72.537 62.604 -10.884 1.00 90.60  ? 113  GLY F O   1 
ATOM   7175  N N   . HIS F  1 87  ? 73.800 61.792 -12.573 1.00 90.82  ? 114  HIS F N   1 
ATOM   7176  C CA  . HIS F  1 87  ? 74.995 62.595 -12.255 1.00 91.39  ? 114  HIS F CA  1 
ATOM   7177  C C   . HIS F  1 87  ? 74.713 64.081 -12.061 1.00 91.60  ? 114  HIS F C   1 
ATOM   7178  O O   . HIS F  1 87  ? 75.322 64.742 -11.209 1.00 91.21  ? 114  HIS F O   1 
ATOM   7179  C CB  . HIS F  1 87  ? 76.040 62.415 -13.359 1.00 91.72  ? 114  HIS F CB  1 
ATOM   7180  N N   . GLU F  1 88  ? 73.778 64.582 -12.864 1.00 91.49  ? 115  GLU F N   1 
ATOM   7181  C CA  . GLU F  1 88  ? 73.353 65.981 -12.851 1.00 91.15  ? 115  GLU F CA  1 
ATOM   7182  C C   . GLU F  1 88  ? 72.609 66.388 -11.571 1.00 89.64  ? 115  GLU F C   1 
ATOM   7183  O O   . GLU F  1 88  ? 72.363 67.571 -11.333 1.00 89.06  ? 115  GLU F O   1 
ATOM   7184  C CB  . GLU F  1 88  ? 72.430 66.204 -14.036 1.00 92.12  ? 115  GLU F CB  1 
ATOM   7185  C CG  . GLU F  1 88  ? 71.214 65.303 -13.962 1.00 93.21  ? 115  GLU F CG  1 
ATOM   7186  C CD  . GLU F  1 88  ? 70.511 65.148 -15.286 1.00 94.39  ? 115  GLU F CD  1 
ATOM   7187  O OE1 . GLU F  1 88  ? 70.206 66.180 -15.924 1.00 95.05  ? 115  GLU F OE1 1 
ATOM   7188  O OE2 . GLU F  1 88  ? 70.257 63.988 -15.684 1.00 94.67  ? 115  GLU F OE2 1 
ATOM   7189  N N   . PHE F  1 89  ? 72.244 65.398 -10.764 1.00 87.47  ? 116  PHE F N   1 
ATOM   7190  C CA  . PHE F  1 89  ? 71.501 65.636 -9.541  1.00 84.61  ? 116  PHE F CA  1 
ATOM   7191  C C   . PHE F  1 89  ? 72.293 65.445 -8.262  1.00 82.93  ? 116  PHE F C   1 
ATOM   7192  O O   . PHE F  1 89  ? 73.394 64.893 -8.261  1.00 83.41  ? 116  PHE F O   1 
ATOM   7193  C CB  . PHE F  1 89  ? 70.292 64.713 -9.502  1.00 84.74  ? 116  PHE F CB  1 
ATOM   7194  C CG  . PHE F  1 89  ? 69.370 64.892 -10.658 1.00 85.29  ? 116  PHE F CG  1 
ATOM   7195  C CD1 . PHE F  1 89  ? 68.566 66.019 -10.746 1.00 84.96  ? 116  PHE F CD1 1 
ATOM   7196  C CD2 . PHE F  1 89  ? 69.308 63.939 -11.668 1.00 85.80  ? 116  PHE F CD2 1 
ATOM   7197  C CE1 . PHE F  1 89  ? 67.710 66.199 -11.824 1.00 85.24  ? 116  PHE F CE1 1 
ATOM   7198  C CE2 . PHE F  1 89  ? 68.452 64.109 -12.754 1.00 85.86  ? 116  PHE F CE2 1 
ATOM   7199  C CZ  . PHE F  1 89  ? 67.651 65.244 -12.831 1.00 85.32  ? 116  PHE F CZ  1 
ATOM   7200  N N   . ASP F  1 90  ? 71.694 65.918 -7.173  1.00 79.79  ? 117  ASP F N   1 
ATOM   7201  C CA  . ASP F  1 90  ? 72.243 65.823 -5.827  1.00 75.72  ? 117  ASP F CA  1 
ATOM   7202  C C   . ASP F  1 90  ? 71.007 65.827 -4.917  1.00 72.82  ? 117  ASP F C   1 
ATOM   7203  O O   . ASP F  1 90  ? 70.001 66.465 -5.237  1.00 71.69  ? 117  ASP F O   1 
ATOM   7204  C CB  . ASP F  1 90  ? 73.173 67.015 -5.546  1.00 75.32  ? 117  ASP F CB  1 
ATOM   7205  C CG  . ASP F  1 90  ? 74.644 66.693 -5.823  1.00 74.49  ? 117  ASP F CG  1 
ATOM   7206  O OD1 . ASP F  1 90  ? 74.925 65.782 -6.627  1.00 72.89  ? 117  ASP F OD1 1 
ATOM   7207  O OD2 . ASP F  1 90  ? 75.526 67.359 -5.240  1.00 74.83  ? 117  ASP F OD2 1 
ATOM   7208  N N   . LEU F  1 91  ? 71.068 65.089 -3.812  1.00 69.51  ? 118  LEU F N   1 
ATOM   7209  C CA  . LEU F  1 91  ? 69.937 65.001 -2.884  1.00 66.41  ? 118  LEU F CA  1 
ATOM   7210  C C   . LEU F  1 91  ? 70.236 65.623 -1.519  1.00 65.00  ? 118  LEU F C   1 
ATOM   7211  O O   . LEU F  1 91  ? 71.186 65.224 -0.844  1.00 65.58  ? 118  LEU F O   1 
ATOM   7212  C CB  . LEU F  1 91  ? 69.534 63.536 -2.688  1.00 63.59  ? 118  LEU F CB  1 
ATOM   7213  C CG  . LEU F  1 91  ? 68.536 63.293 -1.561  1.00 61.11  ? 118  LEU F CG  1 
ATOM   7214  C CD1 . LEU F  1 91  ? 67.273 64.078 -1.847  1.00 61.75  ? 118  LEU F CD1 1 
ATOM   7215  C CD2 . LEU F  1 91  ? 68.230 61.821 -1.438  1.00 59.11  ? 118  LEU F CD2 1 
ATOM   7216  N N   . TYR F  1 92  ? 69.424 66.591 -1.107  1.00 62.37  ? 119  TYR F N   1 
ATOM   7217  C CA  . TYR F  1 92  ? 69.638 67.226 0.188   1.00 60.26  ? 119  TYR F CA  1 
ATOM   7218  C C   . TYR F  1 92  ? 68.434 67.027 1.091   1.00 57.02  ? 119  TYR F C   1 
ATOM   7219  O O   . TYR F  1 92  ? 67.399 67.667 0.902   1.00 57.35  ? 119  TYR F O   1 
ATOM   7220  C CB  . TYR F  1 92  ? 69.894 68.720 0.020   1.00 62.17  ? 119  TYR F CB  1 
ATOM   7221  C CG  . TYR F  1 92  ? 71.124 69.063 -0.783  1.00 64.26  ? 119  TYR F CG  1 
ATOM   7222  C CD1 . TYR F  1 92  ? 71.156 68.878 -2.165  1.00 64.64  ? 119  TYR F CD1 1 
ATOM   7223  C CD2 . TYR F  1 92  ? 72.248 69.605 -0.163  1.00 65.80  ? 119  TYR F CD2 1 
ATOM   7224  C CE1 . TYR F  1 92  ? 72.278 69.232 -2.912  1.00 66.15  ? 119  TYR F CE1 1 
ATOM   7225  C CE2 . TYR F  1 92  ? 73.375 69.961 -0.895  1.00 67.19  ? 119  TYR F CE2 1 
ATOM   7226  C CZ  . TYR F  1 92  ? 73.386 69.776 -2.269  1.00 67.66  ? 119  TYR F CZ  1 
ATOM   7227  O OH  . TYR F  1 92  ? 74.504 70.146 -2.991  1.00 68.52  ? 119  TYR F OH  1 
ATOM   7228  N N   . GLU F  1 93  ? 68.568 66.145 2.073   1.00 52.46  ? 120  GLU F N   1 
ATOM   7229  C CA  . GLU F  1 93  ? 67.470 65.876 2.984   1.00 48.63  ? 120  GLU F CA  1 
ATOM   7230  C C   . GLU F  1 93  ? 67.587 66.678 4.266   1.00 47.59  ? 120  GLU F C   1 
ATOM   7231  O O   . GLU F  1 93  ? 68.640 66.698 4.905   1.00 47.85  ? 120  GLU F O   1 
ATOM   7232  C CB  . GLU F  1 93  ? 67.412 64.388 3.304   1.00 46.33  ? 120  GLU F CB  1 
ATOM   7233  C CG  . GLU F  1 93  ? 67.151 63.540 2.085   1.00 43.39  ? 120  GLU F CG  1 
ATOM   7234  C CD  . GLU F  1 93  ? 67.150 62.077 2.396   1.00 41.25  ? 120  GLU F CD  1 
ATOM   7235  O OE1 . GLU F  1 93  ? 68.194 61.570 2.841   1.00 42.11  ? 120  GLU F OE1 1 
ATOM   7236  O OE2 . GLU F  1 93  ? 66.109 61.431 2.197   1.00 41.86  ? 120  GLU F OE2 1 
ATOM   7237  N N   . ASN F  1 94  ? 66.490 67.341 4.629   1.00 45.26  ? 121  ASN F N   1 
ATOM   7238  C CA  . ASN F  1 94  ? 66.427 68.155 5.830   1.00 41.61  ? 121  ASN F CA  1 
ATOM   7239  C C   . ASN F  1 94  ? 66.583 67.229 7.027   1.00 40.71  ? 121  ASN F C   1 
ATOM   7240  O O   . ASN F  1 94  ? 65.812 66.279 7.195   1.00 39.40  ? 121  ASN F O   1 
ATOM   7241  C CB  . ASN F  1 94  ? 65.083 68.862 5.890   1.00 40.50  ? 121  ASN F CB  1 
ATOM   7242  C CG  . ASN F  1 94  ? 65.056 69.961 6.907   1.00 39.37  ? 121  ASN F CG  1 
ATOM   7243  O OD1 . ASN F  1 94  ? 65.481 69.778 8.049   1.00 39.10  ? 121  ASN F OD1 1 
ATOM   7244  N ND2 . ASN F  1 94  ? 64.548 71.121 6.504   1.00 38.49  ? 121  ASN F ND2 1 
ATOM   7245  N N   . LYS F  1 95  ? 67.577 67.510 7.863   1.00 39.75  ? 122  LYS F N   1 
ATOM   7246  C CA  . LYS F  1 95  ? 67.831 66.668 9.017   1.00 39.10  ? 122  LYS F CA  1 
ATOM   7247  C C   . LYS F  1 95  ? 66.681 66.580 9.994   1.00 38.44  ? 122  LYS F C   1 
ATOM   7248  O O   . LYS F  1 95  ? 66.556 65.579 10.682  1.00 39.72  ? 122  LYS F O   1 
ATOM   7249  C CB  . LYS F  1 95  ? 69.099 67.110 9.741   1.00 41.11  ? 122  LYS F CB  1 
ATOM   7250  C CG  . LYS F  1 95  ? 70.335 67.033 8.871   1.00 46.35  ? 122  LYS F CG  1 
ATOM   7251  C CD  . LYS F  1 95  ? 71.591 66.725 9.671   1.00 50.54  ? 122  LYS F CD  1 
ATOM   7252  C CE  . LYS F  1 95  ? 71.965 67.860 10.601  1.00 54.97  ? 122  LYS F CE  1 
ATOM   7253  N NZ  . LYS F  1 95  ? 73.259 67.606 11.330  1.00 57.80  ? 122  LYS F NZ  1 
ATOM   7254  N N   . ASP F  1 96  ? 65.824 67.593 10.066  1.00 37.63  ? 123  ASP F N   1 
ATOM   7255  C CA  . ASP F  1 96  ? 64.694 67.534 11.005  1.00 36.93  ? 123  ASP F CA  1 
ATOM   7256  C C   . ASP F  1 96  ? 63.720 66.404 10.707  1.00 33.76  ? 123  ASP F C   1 
ATOM   7257  O O   . ASP F  1 96  ? 62.925 65.999 11.563  1.00 33.28  ? 123  ASP F O   1 
ATOM   7258  C CB  . ASP F  1 96  ? 63.899 68.837 11.000  1.00 39.63  ? 123  ASP F CB  1 
ATOM   7259  C CG  . ASP F  1 96  ? 64.574 69.931 11.774  1.00 42.96  ? 123  ASP F CG  1 
ATOM   7260  O OD1 . ASP F  1 96  ? 65.130 69.635 12.862  1.00 45.98  ? 123  ASP F OD1 1 
ATOM   7261  O OD2 . ASP F  1 96  ? 64.531 71.089 11.300  1.00 44.31  ? 123  ASP F OD2 1 
ATOM   7262  N N   . TYR F  1 97  ? 63.781 65.898 9.488   1.00 29.93  ? 124  TYR F N   1 
ATOM   7263  C CA  . TYR F  1 97  ? 62.863 64.856 9.104   1.00 28.58  ? 124  TYR F CA  1 
ATOM   7264  C C   . TYR F  1 97  ? 63.539 63.523 8.864   1.00 26.28  ? 124  TYR F C   1 
ATOM   7265  O O   . TYR F  1 97  ? 63.033 62.655 8.150   1.00 26.23  ? 124  TYR F O   1 
ATOM   7266  C CB  . TYR F  1 97  ? 62.064 65.342 7.899   1.00 30.74  ? 124  TYR F CB  1 
ATOM   7267  C CG  . TYR F  1 97  ? 61.365 66.656 8.221   1.00 31.78  ? 124  TYR F CG  1 
ATOM   7268  C CD1 . TYR F  1 97  ? 60.155 66.674 8.912   1.00 32.10  ? 124  TYR F CD1 1 
ATOM   7269  C CD2 . TYR F  1 97  ? 61.962 67.877 7.918   1.00 30.86  ? 124  TYR F CD2 1 
ATOM   7270  C CE1 . TYR F  1 97  ? 59.564 67.876 9.296   1.00 33.98  ? 124  TYR F CE1 1 
ATOM   7271  C CE2 . TYR F  1 97  ? 61.383 69.081 8.303   1.00 32.58  ? 124  TYR F CE2 1 
ATOM   7272  C CZ  . TYR F  1 97  ? 60.184 69.080 8.994   1.00 33.31  ? 124  TYR F CZ  1 
ATOM   7273  O OH  . TYR F  1 97  ? 59.612 70.272 9.400   1.00 31.04  ? 124  TYR F OH  1 
ATOM   7274  N N   . ILE F  1 98  ? 64.699 63.375 9.486   1.00 22.35  ? 125  ILE F N   1 
ATOM   7275  C CA  . ILE F  1 98  ? 65.435 62.134 9.426   1.00 18.11  ? 125  ILE F CA  1 
ATOM   7276  C C   . ILE F  1 98  ? 65.541 61.734 10.886  1.00 16.92  ? 125  ILE F C   1 
ATOM   7277  O O   . ILE F  1 98  ? 66.386 62.251 11.599  1.00 17.09  ? 125  ILE F O   1 
ATOM   7278  C CB  . ILE F  1 98  ? 66.833 62.337 8.861   1.00 17.48  ? 125  ILE F CB  1 
ATOM   7279  C CG1 . ILE F  1 98  ? 66.749 62.892 7.444   1.00 17.18  ? 125  ILE F CG1 1 
ATOM   7280  C CG2 . ILE F  1 98  ? 67.579 61.017 8.853   1.00 17.30  ? 125  ILE F CG2 1 
ATOM   7281  C CD1 . ILE F  1 98  ? 68.120 63.068 6.787   1.00 18.29  ? 125  ILE F CD1 1 
ATOM   7282  N N   . ARG F  1 99  ? 64.678 60.822 11.326  1.00 16.41  ? 126  ARG F N   1 
ATOM   7283  C CA  . ARG F  1 99  ? 64.640 60.374 12.715  1.00 17.78  ? 126  ARG F CA  1 
ATOM   7284  C C   . ARG F  1 99  ? 66.007 60.334 13.347  1.00 19.22  ? 126  ARG F C   1 
ATOM   7285  O O   . ARG F  1 99  ? 66.878 59.625 12.872  1.00 23.62  ? 126  ARG F O   1 
ATOM   7286  C CB  . ARG F  1 99  ? 64.001 58.997 12.815  1.00 17.86  ? 126  ARG F CB  1 
ATOM   7287  C CG  . ARG F  1 99  ? 63.810 58.480 14.242  1.00 22.03  ? 126  ARG F CG  1 
ATOM   7288  C CD  . ARG F  1 99  ? 62.863 57.295 14.231  1.00 26.75  ? 126  ARG F CD  1 
ATOM   7289  N NE  . ARG F  1 99  ? 62.862 56.625 12.920  1.00 33.22  ? 126  ARG F NE  1 
ATOM   7290  C CZ  . ARG F  1 99  ? 62.746 55.309 12.729  1.00 35.67  ? 126  ARG F CZ  1 
ATOM   7291  N NH1 . ARG F  1 99  ? 62.614 54.472 13.760  1.00 36.80  ? 126  ARG F NH1 1 
ATOM   7292  N NH2 . ARG F  1 99  ? 62.785 54.821 11.497  1.00 37.79  ? 126  ARG F NH2 1 
ATOM   7293  N N   . ASN F  1 100 ? 66.200 61.086 14.419  1.00 18.82  ? 127  ASN F N   1 
ATOM   7294  C CA  . ASN F  1 100 ? 67.489 61.114 15.060  1.00 19.77  ? 127  ASN F CA  1 
ATOM   7295  C C   . ASN F  1 100 ? 67.590 60.341 16.380  1.00 23.51  ? 127  ASN F C   1 
ATOM   7296  O O   . ASN F  1 100 ? 68.488 60.602 17.175  1.00 24.43  ? 127  ASN F O   1 
ATOM   7297  C CB  . ASN F  1 100 ? 67.939 62.560 15.265  1.00 19.40  ? 127  ASN F CB  1 
ATOM   7298  C CG  . ASN F  1 100 ? 67.104 63.298 16.283  1.00 20.22  ? 127  ASN F CG  1 
ATOM   7299  O OD1 . ASN F  1 100 ? 66.238 62.736 16.935  1.00 21.32  ? 127  ASN F OD1 1 
ATOM   7300  N ND2 . ASN F  1 100 ? 67.376 64.570 16.431  1.00 24.17  ? 127  ASN F ND2 1 
ATOM   7301  N N   . CYS F  1 101 ? 66.666 59.422 16.650  1.00 26.38  ? 128  CYS F N   1 
ATOM   7302  C CA  . CYS F  1 101 ? 66.757 58.590 17.853  1.00 31.23  ? 128  CYS F CA  1 
ATOM   7303  C C   . CYS F  1 101 ? 66.611 57.176 17.325  1.00 31.83  ? 128  CYS F C   1 
ATOM   7304  O O   . CYS F  1 101 ? 66.105 56.978 16.221  1.00 31.34  ? 128  CYS F O   1 
ATOM   7305  C CB  . CYS F  1 101 ? 65.667 58.899 18.896  1.00 34.70  ? 128  CYS F CB  1 
ATOM   7306  S SG  . CYS F  1 101 ? 63.950 58.912 18.307  1.00 46.59  ? 128  CYS F SG  1 
ATOM   7307  N N   . ILE F  1 102 ? 67.064 56.196 18.096  1.00 34.16  ? 129  ILE F N   1 
ATOM   7308  C CA  . ILE F  1 102 ? 66.996 54.803 17.658  1.00 36.52  ? 129  ILE F CA  1 
ATOM   7309  C C   . ILE F  1 102 ? 66.049 53.924 18.462  1.00 38.42  ? 129  ILE F C   1 
ATOM   7310  O O   . ILE F  1 102 ? 65.801 54.156 19.645  1.00 39.57  ? 129  ILE F O   1 
ATOM   7311  C CB  . ILE F  1 102 ? 68.386 54.115 17.714  1.00 35.38  ? 129  ILE F CB  1 
ATOM   7312  C CG1 . ILE F  1 102 ? 68.918 54.160 19.146  1.00 32.77  ? 129  ILE F CG1 1 
ATOM   7313  C CG2 . ILE F  1 102 ? 69.344 54.778 16.740  1.00 34.19  ? 129  ILE F CG2 1 
ATOM   7314  C CD1 . ILE F  1 102 ? 70.080 53.268 19.379  1.00 30.71  ? 129  ILE F CD1 1 
ATOM   7315  N N   . ILE F  1 103 ? 65.531 52.898 17.800  1.00 40.85  ? 130  ILE F N   1 
ATOM   7316  C CA  . ILE F  1 103 ? 64.646 51.937 18.439  1.00 42.86  ? 130  ILE F CA  1 
ATOM   7317  C C   . ILE F  1 103 ? 65.458 50.657 18.607  1.00 43.29  ? 130  ILE F C   1 
ATOM   7318  O O   . ILE F  1 103 ? 65.859 50.025 17.625  1.00 42.09  ? 130  ILE F O   1 
ATOM   7319  C CB  . ILE F  1 103 ? 63.417 51.602 17.571  1.00 43.51  ? 130  ILE F CB  1 
ATOM   7320  C CG1 . ILE F  1 103 ? 62.790 52.883 17.007  1.00 44.17  ? 130  ILE F CG1 1 
ATOM   7321  C CG2 . ILE F  1 103 ? 62.407 50.837 18.413  1.00 42.57  ? 130  ILE F CG2 1 
ATOM   7322  C CD1 . ILE F  1 103 ? 61.686 52.634 15.994  1.00 43.49  ? 130  ILE F CD1 1 
ATOM   7323  N N   . GLY F  1 104 ? 65.724 50.292 19.852  1.00 43.59  ? 131  GLY F N   1 
ATOM   7324  C CA  . GLY F  1 104 ? 66.480 49.082 20.092  1.00 45.30  ? 131  GLY F CA  1 
ATOM   7325  C C   . GLY F  1 104 ? 67.919 49.193 19.641  1.00 46.06  ? 131  GLY F C   1 
ATOM   7326  O O   . GLY F  1 104 ? 68.614 50.123 20.044  1.00 47.34  ? 131  GLY F O   1 
ATOM   7327  N N   . LYS F  1 105 ? 68.359 48.258 18.797  1.00 45.98  ? 132  LYS F N   1 
ATOM   7328  C CA  . LYS F  1 105 ? 69.739 48.228 18.309  1.00 45.76  ? 132  LYS F CA  1 
ATOM   7329  C C   . LYS F  1 105 ? 70.042 49.303 17.271  1.00 44.98  ? 132  LYS F C   1 
ATOM   7330  O O   . LYS F  1 105 ? 71.204 49.558 16.935  1.00 44.59  ? 132  LYS F O   1 
ATOM   7331  C CB  . LYS F  1 105 ? 70.060 46.847 17.733  1.00 46.91  ? 132  LYS F CB  1 
ATOM   7332  C CG  . LYS F  1 105 ? 69.846 45.735 18.717  1.00 49.62  ? 132  LYS F CG  1 
ATOM   7333  C CD  . LYS F  1 105 ? 69.863 44.368 18.053  1.00 53.89  ? 132  LYS F CD  1 
ATOM   7334  C CE  . LYS F  1 105 ? 69.099 43.347 18.929  1.00 57.49  ? 132  LYS F CE  1 
ATOM   7335  N NZ  . LYS F  1 105 ? 69.373 41.898 18.618  1.00 59.85  ? 132  LYS F NZ  1 
ATOM   7336  N N   . GLY F  1 106 ? 68.993 49.921 16.750  1.00 42.86  ? 133  GLY F N   1 
ATOM   7337  C CA  . GLY F  1 106 ? 69.198 50.977 15.778  1.00 40.33  ? 133  GLY F CA  1 
ATOM   7338  C C   . GLY F  1 106 ? 69.671 50.486 14.432  1.00 38.46  ? 133  GLY F C   1 
ATOM   7339  O O   . GLY F  1 106 ? 70.408 51.176 13.737  1.00 36.38  ? 133  GLY F O   1 
ATOM   7340  N N   . ARG F  1 107 ? 69.222 49.300 14.047  1.00 38.68  ? 134  ARG F N   1 
ATOM   7341  C CA  . ARG F  1 107 ? 69.628 48.731 12.777  1.00 38.93  ? 134  ARG F CA  1 
ATOM   7342  C C   . ARG F  1 107 ? 69.290 49.633 11.619  1.00 37.72  ? 134  ARG F C   1 
ATOM   7343  O O   . ARG F  1 107 ? 69.997 49.627 10.627  1.00 37.93  ? 134  ARG F O   1 
ATOM   7344  C CB  . ARG F  1 107 ? 68.972 47.376 12.558  1.00 42.14  ? 134  ARG F CB  1 
ATOM   7345  C CG  . ARG F  1 107 ? 68.834 46.579 13.834  1.00 45.82  ? 134  ARG F CG  1 
ATOM   7346  C CD  . ARG F  1 107 ? 67.599 47.007 14.584  1.00 47.38  ? 134  ARG F CD  1 
ATOM   7347  N NE  . ARG F  1 107 ? 67.572 46.458 15.932  1.00 49.33  ? 134  ARG F NE  1 
ATOM   7348  C CZ  . ARG F  1 107 ? 66.454 46.302 16.631  1.00 51.15  ? 134  ARG F CZ  1 
ATOM   7349  N NH1 . ARG F  1 107 ? 65.299 46.654 16.080  1.00 52.04  ? 134  ARG F NH1 1 
ATOM   7350  N NH2 . ARG F  1 107 ? 66.481 45.813 17.873  1.00 49.44  ? 134  ARG F NH2 1 
ATOM   7351  N N   . SER F  1 108 ? 68.224 50.418 11.735  1.00 36.75  ? 135  SER F N   1 
ATOM   7352  C CA  . SER F  1 108 ? 67.848 51.289 10.627  1.00 36.40  ? 135  SER F CA  1 
ATOM   7353  C C   . SER F  1 108 ? 68.208 52.762 10.807  1.00 33.34  ? 135  SER F C   1 
ATOM   7354  O O   . SER F  1 108 ? 67.762 53.612 10.035  1.00 31.76  ? 135  SER F O   1 
ATOM   7355  C CB  . SER F  1 108 ? 66.355 51.178 10.363  1.00 39.35  ? 135  SER F CB  1 
ATOM   7356  O OG  . SER F  1 108 ? 65.633 51.887 11.355  1.00 45.21  ? 135  SER F OG  1 
ATOM   7357  N N   . TYR F  1 109 ? 69.015 53.065 11.814  1.00 30.29  ? 136  TYR F N   1 
ATOM   7358  C CA  . TYR F  1 109 ? 69.406 54.439 12.047  1.00 28.58  ? 136  TYR F CA  1 
ATOM   7359  C C   . TYR F  1 109 ? 70.032 55.045 10.803  1.00 28.26  ? 136  TYR F C   1 
ATOM   7360  O O   . TYR F  1 109 ? 70.929 54.473 10.210  1.00 29.91  ? 136  TYR F O   1 
ATOM   7361  C CB  . TYR F  1 109 ? 70.404 54.520 13.187  1.00 27.50  ? 136  TYR F CB  1 
ATOM   7362  C CG  . TYR F  1 109 ? 70.958 55.907 13.382  1.00 27.10  ? 136  TYR F CG  1 
ATOM   7363  C CD1 . TYR F  1 109 ? 70.135 56.959 13.759  1.00 27.00  ? 136  TYR F CD1 1 
ATOM   7364  C CD2 . TYR F  1 109 ? 72.305 56.169 13.184  1.00 27.15  ? 136  TYR F CD2 1 
ATOM   7365  C CE1 . TYR F  1 109 ? 70.641 58.237 13.938  1.00 27.44  ? 136  TYR F CE1 1 
ATOM   7366  C CE2 . TYR F  1 109 ? 72.817 57.444 13.358  1.00 28.06  ? 136  TYR F CE2 1 
ATOM   7367  C CZ  . TYR F  1 109 ? 71.978 58.475 13.737  1.00 27.41  ? 136  TYR F CZ  1 
ATOM   7368  O OH  . TYR F  1 109 ? 72.463 59.750 13.911  1.00 27.66  ? 136  TYR F OH  1 
ATOM   7369  N N   . LYS F  1 110 ? 69.560 56.211 10.404  1.00 27.73  ? 137  LYS F N   1 
ATOM   7370  C CA  . LYS F  1 110 ? 70.109 56.863 9.234   1.00 27.78  ? 137  LYS F CA  1 
ATOM   7371  C C   . LYS F  1 110 ? 70.368 58.316 9.537   1.00 28.28  ? 137  LYS F C   1 
ATOM   7372  O O   . LYS F  1 110 ? 70.280 59.171 8.653   1.00 27.87  ? 137  LYS F O   1 
ATOM   7373  C CB  . LYS F  1 110 ? 69.151 56.747 8.058   1.00 27.90  ? 137  LYS F CB  1 
ATOM   7374  C CG  . LYS F  1 110 ? 68.802 55.319 7.738   1.00 30.90  ? 137  LYS F CG  1 
ATOM   7375  C CD  . LYS F  1 110 ? 68.048 55.210 6.425   1.00 33.20  ? 137  LYS F CD  1 
ATOM   7376  C CE  . LYS F  1 110 ? 67.641 53.766 6.165   1.00 34.21  ? 137  LYS F CE  1 
ATOM   7377  N NZ  . LYS F  1 110 ? 68.798 52.828 6.325   1.00 32.14  ? 137  LYS F NZ  1 
ATOM   7378  N N   . GLY F  1 111 ? 70.676 58.587 10.802  1.00 28.52  ? 138  GLY F N   1 
ATOM   7379  C CA  . GLY F  1 111 ? 70.960 59.945 11.217  1.00 27.87  ? 138  GLY F CA  1 
ATOM   7380  C C   . GLY F  1 111 ? 72.329 60.327 10.709  1.00 26.49  ? 138  GLY F C   1 
ATOM   7381  O O   . GLY F  1 111 ? 72.953 59.570 9.975   1.00 26.76  ? 138  GLY F O   1 
ATOM   7382  N N   . THR F  1 112 ? 72.818 61.488 11.109  1.00 25.64  ? 139  THR F N   1 
ATOM   7383  C CA  . THR F  1 112 ? 74.110 61.914 10.632  1.00 23.87  ? 139  THR F CA  1 
ATOM   7384  C C   . THR F  1 112 ? 75.139 62.071 11.727  1.00 22.69  ? 139  THR F C   1 
ATOM   7385  O O   . THR F  1 112 ? 76.150 62.738 11.531  1.00 24.86  ? 139  THR F O   1 
ATOM   7386  C CB  . THR F  1 112 ? 73.991 63.235 9.865   1.00 25.46  ? 139  THR F CB  1 
ATOM   7387  O OG1 . THR F  1 112 ? 73.551 64.271 10.754  1.00 27.19  ? 139  THR F OG1 1 
ATOM   7388  C CG2 . THR F  1 112 ? 72.985 63.099 8.745   1.00 25.52  ? 139  THR F CG2 1 
ATOM   7389  N N   . VAL F  1 113 ? 74.904 61.476 12.885  1.00 20.80  ? 140  VAL F N   1 
ATOM   7390  C CA  . VAL F  1 113 ? 75.891 61.588 13.953  1.00 22.56  ? 140  VAL F CA  1 
ATOM   7391  C C   . VAL F  1 113 ? 77.185 60.900 13.490  1.00 24.79  ? 140  VAL F C   1 
ATOM   7392  O O   . VAL F  1 113 ? 77.181 59.744 13.061  1.00 25.36  ? 140  VAL F O   1 
ATOM   7393  C CB  . VAL F  1 113 ? 75.404 60.924 15.257  1.00 20.66  ? 140  VAL F CB  1 
ATOM   7394  C CG1 . VAL F  1 113 ? 76.557 60.707 16.181  1.00 19.35  ? 140  VAL F CG1 1 
ATOM   7395  C CG2 . VAL F  1 113 ? 74.385 61.804 15.941  1.00 18.11  ? 140  VAL F CG2 1 
ATOM   7396  N N   . SER F  1 114 ? 78.301 61.606 13.572  1.00 26.09  ? 141  SER F N   1 
ATOM   7397  C CA  . SER F  1 114 ? 79.559 61.013 13.146  1.00 27.85  ? 141  SER F CA  1 
ATOM   7398  C C   . SER F  1 114 ? 80.672 61.126 14.196  1.00 29.50  ? 141  SER F C   1 
ATOM   7399  O O   . SER F  1 114 ? 81.841 61.311 13.854  1.00 29.47  ? 141  SER F O   1 
ATOM   7400  C CB  . SER F  1 114 ? 80.005 61.660 11.843  1.00 26.29  ? 141  SER F CB  1 
ATOM   7401  O OG  . SER F  1 114 ? 80.141 63.046 12.008  1.00 26.26  ? 141  SER F OG  1 
ATOM   7402  N N   . ILE F  1 115 ? 80.298 61.006 15.470  1.00 30.61  ? 142  ILE F N   1 
ATOM   7403  C CA  . ILE F  1 115 ? 81.242 61.096 16.575  1.00 31.96  ? 142  ILE F CA  1 
ATOM   7404  C C   . ILE F  1 115 ? 80.992 59.947 17.534  1.00 33.03  ? 142  ILE F C   1 
ATOM   7405  O O   . ILE F  1 115 ? 79.854 59.576 17.789  1.00 33.13  ? 142  ILE F O   1 
ATOM   7406  C CB  . ILE F  1 115 ? 81.096 62.452 17.365  1.00 32.80  ? 142  ILE F CB  1 
ATOM   7407  C CG1 . ILE F  1 115 ? 81.969 63.544 16.744  1.00 34.19  ? 142  ILE F CG1 1 
ATOM   7408  C CG2 . ILE F  1 115 ? 81.557 62.299 18.800  1.00 33.35  ? 142  ILE F CG2 1 
ATOM   7409  C CD1 . ILE F  1 115 ? 81.450 64.100 15.427  1.00 35.35  ? 142  ILE F CD1 1 
ATOM   7410  N N   . THR F  1 116 ? 82.066 59.388 18.071  1.00 35.14  ? 143  THR F N   1 
ATOM   7411  C CA  . THR F  1 116 ? 81.956 58.288 19.020  1.00 38.27  ? 143  THR F CA  1 
ATOM   7412  C C   . THR F  1 116 ? 81.612 58.827 20.410  1.00 40.72  ? 143  THR F C   1 
ATOM   7413  O O   . THR F  1 116 ? 81.674 60.035 20.656  1.00 41.03  ? 143  THR F O   1 
ATOM   7414  C CB  . THR F  1 116 ? 83.288 57.481 19.114  1.00 39.58  ? 143  THR F CB  1 
ATOM   7415  O OG1 . THR F  1 116 ? 84.367 58.336 19.531  1.00 38.57  ? 143  THR F OG1 1 
ATOM   7416  C CG2 . THR F  1 116 ? 83.635 56.872 17.764  1.00 40.82  ? 143  THR F CG2 1 
ATOM   7417  N N   . LYS F  1 117 ? 81.242 57.931 21.318  1.00 42.76  ? 144  LYS F N   1 
ATOM   7418  C CA  . LYS F  1 117 ? 80.904 58.317 22.683  1.00 43.26  ? 144  LYS F CA  1 
ATOM   7419  C C   . LYS F  1 117 ? 82.088 59.108 23.287  1.00 44.45  ? 144  LYS F C   1 
ATOM   7420  O O   . LYS F  1 117 ? 81.887 60.074 24.034  1.00 45.38  ? 144  LYS F O   1 
ATOM   7421  C CB  . LYS F  1 117 ? 80.621 57.053 23.500  1.00 43.52  ? 144  LYS F CB  1 
ATOM   7422  C CG  . LYS F  1 117 ? 80.004 57.284 24.867  1.00 44.76  ? 144  LYS F CG  1 
ATOM   7423  C CD  . LYS F  1 117 ? 79.782 55.949 25.595  1.00 45.79  ? 144  LYS F CD  1 
ATOM   7424  C CE  . LYS F  1 117 ? 79.016 56.106 26.928  1.00 44.95  ? 144  LYS F CE  1 
ATOM   7425  N NZ  . LYS F  1 117 ? 79.739 56.913 27.965  1.00 43.25  ? 144  LYS F NZ  1 
ATOM   7426  N N   . SER F  1 118 ? 83.315 58.711 22.940  1.00 44.07  ? 145  SER F N   1 
ATOM   7427  C CA  . SER F  1 118 ? 84.525 59.373 23.440  1.00 43.99  ? 145  SER F CA  1 
ATOM   7428  C C   . SER F  1 118 ? 84.835 60.676 22.723  1.00 43.19  ? 145  SER F C   1 
ATOM   7429  O O   . SER F  1 118 ? 85.849 61.321 22.999  1.00 43.79  ? 145  SER F O   1 
ATOM   7430  C CB  . SER F  1 118 ? 85.735 58.447 23.300  1.00 45.26  ? 145  SER F CB  1 
ATOM   7431  O OG  . SER F  1 118 ? 85.562 57.276 24.079  1.00 47.73  ? 145  SER F OG  1 
ATOM   7432  N N   . GLY F  1 119 ? 83.973 61.053 21.787  1.00 42.19  ? 146  GLY F N   1 
ATOM   7433  C CA  . GLY F  1 119 ? 84.183 62.282 21.044  1.00 40.18  ? 146  GLY F CA  1 
ATOM   7434  C C   . GLY F  1 119 ? 85.167 62.185 19.896  1.00 38.57  ? 146  GLY F C   1 
ATOM   7435  O O   . GLY F  1 119 ? 85.705 63.198 19.453  1.00 38.74  ? 146  GLY F O   1 
ATOM   7436  N N   . ILE F  1 120 ? 85.417 60.972 19.413  1.00 37.04  ? 147  ILE F N   1 
ATOM   7437  C CA  . ILE F  1 120 ? 86.331 60.789 18.299  1.00 34.99  ? 147  ILE F CA  1 
ATOM   7438  C C   . ILE F  1 120 ? 85.526 60.895 17.004  1.00 33.81  ? 147  ILE F C   1 
ATOM   7439  O O   . ILE F  1 120 ? 84.423 60.353 16.899  1.00 35.25  ? 147  ILE F O   1 
ATOM   7440  C CB  . ILE F  1 120 ? 86.998 59.407 18.331  1.00 35.74  ? 147  ILE F CB  1 
ATOM   7441  C CG1 . ILE F  1 120 ? 87.536 59.109 19.724  1.00 34.88  ? 147  ILE F CG1 1 
ATOM   7442  C CG2 . ILE F  1 120 ? 88.129 59.355 17.312  1.00 36.00  ? 147  ILE F CG2 1 
ATOM   7443  C CD1 . ILE F  1 120 ? 87.987 57.665 19.880  1.00 34.77  ? 147  ILE F CD1 1 
ATOM   7444  N N   . LYS F  1 121 ? 86.078 61.606 16.029  1.00 30.51  ? 148  LYS F N   1 
ATOM   7445  C CA  . LYS F  1 121 ? 85.436 61.778 14.741  1.00 27.86  ? 148  LYS F CA  1 
ATOM   7446  C C   . LYS F  1 121 ? 85.497 60.433 14.036  1.00 29.59  ? 148  LYS F C   1 
ATOM   7447  O O   . LYS F  1 121 ? 86.550 59.783 14.015  1.00 31.25  ? 148  LYS F O   1 
ATOM   7448  C CB  . LYS F  1 121 ? 86.201 62.816 13.935  1.00 27.01  ? 148  LYS F CB  1 
ATOM   7449  C CG  . LYS F  1 121 ? 85.595 63.167 12.607  1.00 26.32  ? 148  LYS F CG  1 
ATOM   7450  C CD  . LYS F  1 121 ? 86.472 64.164 11.862  1.00 26.02  ? 148  LYS F CD  1 
ATOM   7451  C CE  . LYS F  1 121 ? 85.761 64.665 10.624  1.00 27.91  ? 148  LYS F CE  1 
ATOM   7452  N NZ  . LYS F  1 121 ? 86.613 65.507 9.750   1.00 27.86  ? 148  LYS F NZ  1 
ATOM   7453  N N   . CYS F  1 122 ? 84.375 60.005 13.469  1.00 28.46  ? 149  CYS F N   1 
ATOM   7454  C CA  . CYS F  1 122 ? 84.334 58.732 12.769  1.00 27.17  ? 149  CYS F CA  1 
ATOM   7455  C C   . CYS F  1 122 ? 85.193 58.744 11.515  1.00 26.33  ? 149  CYS F C   1 
ATOM   7456  O O   . CYS F  1 122 ? 85.464 59.807 10.947  1.00 24.32  ? 149  CYS F O   1 
ATOM   7457  C CB  . CYS F  1 122 ? 82.910 58.406 12.356  1.00 26.97  ? 149  CYS F CB  1 
ATOM   7458  S SG  . CYS F  1 122 ? 81.808 57.905 13.703  1.00 30.71  ? 149  CYS F SG  1 
ATOM   7459  N N   . GLN F  1 123 ? 85.623 57.550 11.107  1.00 25.63  ? 150  GLN F N   1 
ATOM   7460  C CA  . GLN F  1 123 ? 86.402 57.360 9.887   1.00 25.31  ? 150  GLN F CA  1 
ATOM   7461  C C   . GLN F  1 123 ? 85.391 57.037 8.796   1.00 24.92  ? 150  GLN F C   1 
ATOM   7462  O O   . GLN F  1 123 ? 84.414 56.324 9.034   1.00 24.81  ? 150  GLN F O   1 
ATOM   7463  C CB  . GLN F  1 123 ? 87.353 56.173 10.010  1.00 27.58  ? 150  GLN F CB  1 
ATOM   7464  C CG  . GLN F  1 123 ? 87.967 55.731 8.658   1.00 29.52  ? 150  GLN F CG  1 
ATOM   7465  C CD  . GLN F  1 123 ? 88.707 54.381 8.716   1.00 30.87  ? 150  GLN F CD  1 
ATOM   7466  O OE1 . GLN F  1 123 ? 89.549 54.135 9.595   1.00 28.92  ? 150  GLN F OE1 1 
ATOM   7467  N NE2 . GLN F  1 123 ? 88.397 53.511 7.765   1.00 29.28  ? 150  GLN F NE2 1 
ATOM   7468  N N   . PRO F  1 124 ? 85.606 57.553 7.584   1.00 24.35  ? 151  PRO F N   1 
ATOM   7469  C CA  . PRO F  1 124 ? 84.679 57.286 6.483   1.00 23.96  ? 151  PRO F CA  1 
ATOM   7470  C C   . PRO F  1 124 ? 84.643 55.787 6.224   1.00 25.26  ? 151  PRO F C   1 
ATOM   7471  O O   . PRO F  1 124 ? 85.667 55.112 6.324   1.00 26.15  ? 151  PRO F O   1 
ATOM   7472  C CB  . PRO F  1 124 ? 85.307 58.040 5.319   1.00 23.44  ? 151  PRO F CB  1 
ATOM   7473  C CG  . PRO F  1 124 ? 86.061 59.137 5.995   1.00 22.25  ? 151  PRO F CG  1 
ATOM   7474  C CD  . PRO F  1 124 ? 86.695 58.435 7.147   1.00 22.92  ? 151  PRO F CD  1 
ATOM   7475  N N   . TRP F  1 125 ? 83.475 55.259 5.890   1.00 25.96  ? 152  TRP F N   1 
ATOM   7476  C CA  . TRP F  1 125 ? 83.357 53.832 5.634   1.00 26.10  ? 152  TRP F CA  1 
ATOM   7477  C C   . TRP F  1 125 ? 84.082 53.427 4.350   1.00 29.11  ? 152  TRP F C   1 
ATOM   7478  O O   . TRP F  1 125 ? 84.608 52.323 4.240   1.00 29.87  ? 152  TRP F O   1 
ATOM   7479  C CB  . TRP F  1 125 ? 81.888 53.439 5.530   1.00 22.40  ? 152  TRP F CB  1 
ATOM   7480  C CG  . TRP F  1 125 ? 81.116 53.654 6.774   1.00 19.68  ? 152  TRP F CG  1 
ATOM   7481  C CD1 . TRP F  1 125 ? 80.369 54.744 7.100   1.00 17.89  ? 152  TRP F CD1 1 
ATOM   7482  C CD2 . TRP F  1 125 ? 81.015 52.756 7.875   1.00 19.18  ? 152  TRP F CD2 1 
ATOM   7483  N NE1 . TRP F  1 125 ? 79.807 54.584 8.333   1.00 15.02  ? 152  TRP F NE1 1 
ATOM   7484  C CE2 . TRP F  1 125 ? 80.186 53.370 8.836   1.00 17.37  ? 152  TRP F CE2 1 
ATOM   7485  C CE3 . TRP F  1 125 ? 81.546 51.488 8.146   1.00 19.41  ? 152  TRP F CE3 1 
ATOM   7486  C CZ2 . TRP F  1 125 ? 79.870 52.761 10.050  1.00 17.67  ? 152  TRP F CZ2 1 
ATOM   7487  C CZ3 . TRP F  1 125 ? 81.234 50.882 9.352   1.00 19.80  ? 152  TRP F CZ3 1 
ATOM   7488  C CH2 . TRP F  1 125 ? 80.400 51.522 10.293  1.00 19.73  ? 152  TRP F CH2 1 
ATOM   7489  N N   . SER F  1 126 ? 84.103 54.329 3.378   1.00 31.12  ? 153  SER F N   1 
ATOM   7490  C CA  . SER F  1 126 ? 84.741 54.055 2.106   1.00 32.73  ? 153  SER F CA  1 
ATOM   7491  C C   . SER F  1 126 ? 86.250 54.041 2.242   1.00 33.40  ? 153  SER F C   1 
ATOM   7492  O O   . SER F  1 126 ? 86.950 53.574 1.348   1.00 33.89  ? 153  SER F O   1 
ATOM   7493  C CB  . SER F  1 126 ? 84.392 55.133 1.107   1.00 35.16  ? 153  SER F CB  1 
ATOM   7494  O OG  . SER F  1 126 ? 85.168 56.286 1.394   1.00 38.25  ? 153  SER F OG  1 
ATOM   7495  N N   . SER F  1 127 ? 86.757 54.579 3.341   1.00 33.41  ? 154  SER F N   1 
ATOM   7496  C CA  . SER F  1 127 ? 88.197 54.613 3.551   1.00 32.76  ? 154  SER F CA  1 
ATOM   7497  C C   . SER F  1 127 ? 88.721 53.369 4.249   1.00 32.47  ? 154  SER F C   1 
ATOM   7498  O O   . SER F  1 127 ? 88.002 52.729 5.018   1.00 33.76  ? 154  SER F O   1 
ATOM   7499  C CB  . SER F  1 127 ? 88.578 55.834 4.372   1.00 32.97  ? 154  SER F CB  1 
ATOM   7500  O OG  . SER F  1 127 ? 89.963 55.819 4.656   1.00 33.72  ? 154  SER F OG  1 
ATOM   7501  N N   . MET F  1 128 ? 89.977 53.027 3.968   1.00 31.35  ? 155  MET F N   1 
ATOM   7502  C CA  . MET F  1 128 ? 90.620 51.872 4.584   1.00 30.22  ? 155  MET F CA  1 
ATOM   7503  C C   . MET F  1 128 ? 91.693 52.331 5.550   1.00 30.35  ? 155  MET F C   1 
ATOM   7504  O O   . MET F  1 128 ? 92.457 51.523 6.063   1.00 31.01  ? 155  MET F O   1 
ATOM   7505  C CB  . MET F  1 128 ? 91.257 50.966 3.537   1.00 28.48  ? 155  MET F CB  1 
ATOM   7506  C CG  . MET F  1 128 ? 90.279 50.185 2.698   1.00 27.56  ? 155  MET F CG  1 
ATOM   7507  S SD  . MET F  1 128 ? 89.273 49.045 3.671   1.00 28.67  ? 155  MET F SD  1 
ATOM   7508  C CE  . MET F  1 128 ? 87.656 49.484 3.001   1.00 23.40  ? 155  MET F CE  1 
ATOM   7509  N N   . ILE F  1 129 ? 91.760 53.636 5.779   1.00 30.21  ? 156  ILE F N   1 
ATOM   7510  C CA  . ILE F  1 129 ? 92.726 54.200 6.707   1.00 30.21  ? 156  ILE F CA  1 
ATOM   7511  C C   . ILE F  1 129 ? 92.003 55.173 7.618   1.00 30.24  ? 156  ILE F C   1 
ATOM   7512  O O   . ILE F  1 129 ? 91.096 55.884 7.198   1.00 30.08  ? 156  ILE F O   1 
ATOM   7513  C CB  . ILE F  1 129 ? 93.854 54.947 5.975   1.00 31.21  ? 156  ILE F CB  1 
ATOM   7514  C CG1 . ILE F  1 129 ? 93.270 56.094 5.160   1.00 34.07  ? 156  ILE F CG1 1 
ATOM   7515  C CG2 . ILE F  1 129 ? 94.604 53.998 5.056   1.00 30.30  ? 156  ILE F CG2 1 
ATOM   7516  C CD1 . ILE F  1 129 ? 94.285 56.809 4.311   1.00 36.64  ? 156  ILE F CD1 1 
ATOM   7517  N N   . PRO F  1 130 ? 92.429 55.249 8.874   1.00 30.00  ? 157  PRO F N   1 
ATOM   7518  C CA  . PRO F  1 130 ? 93.534 54.470 9.406   1.00 30.89  ? 157  PRO F CA  1 
ATOM   7519  C C   . PRO F  1 130 ? 93.186 53.020 9.659   1.00 32.21  ? 157  PRO F C   1 
ATOM   7520  O O   . PRO F  1 130 ? 94.046 52.231 10.024  1.00 34.45  ? 157  PRO F O   1 
ATOM   7521  C CB  . PRO F  1 130 ? 93.854 55.200 10.696  1.00 31.56  ? 157  PRO F CB  1 
ATOM   7522  C CG  . PRO F  1 130 ? 92.503 55.558 11.181  1.00 30.56  ? 157  PRO F CG  1 
ATOM   7523  C CD  . PRO F  1 130 ? 91.840 56.088 9.928   1.00 30.49  ? 157  PRO F CD  1 
ATOM   7524  N N   . HIS F  1 131 ? 91.931 52.651 9.470   1.00 32.61  ? 158  HIS F N   1 
ATOM   7525  C CA  . HIS F  1 131 ? 91.554 51.276 9.744   1.00 32.24  ? 158  HIS F CA  1 
ATOM   7526  C C   . HIS F  1 131 ? 91.019 50.536 8.541   1.00 33.44  ? 158  HIS F C   1 
ATOM   7527  O O   . HIS F  1 131 ? 90.074 50.979 7.884   1.00 34.23  ? 158  HIS F O   1 
ATOM   7528  C CB  . HIS F  1 131 ? 90.539 51.251 10.883  1.00 30.57  ? 158  HIS F CB  1 
ATOM   7529  C CG  . HIS F  1 131 ? 90.997 51.986 12.102  1.00 29.18  ? 158  HIS F CG  1 
ATOM   7530  N ND1 . HIS F  1 131 ? 92.020 51.530 12.904  1.00 29.60  ? 158  HIS F ND1 1 
ATOM   7531  C CD2 . HIS F  1 131 ? 90.610 53.171 12.627  1.00 28.78  ? 158  HIS F CD2 1 
ATOM   7532  C CE1 . HIS F  1 131 ? 92.243 52.404 13.868  1.00 28.12  ? 158  HIS F CE1 1 
ATOM   7533  N NE2 . HIS F  1 131 ? 91.401 53.409 13.723  1.00 26.44  ? 158  HIS F NE2 1 
ATOM   7534  N N   . GLU F  1 132 ? 91.650 49.405 8.252   1.00 34.32  ? 159  GLU F N   1 
ATOM   7535  C CA  . GLU F  1 132 ? 91.263 48.561 7.136   1.00 35.71  ? 159  GLU F CA  1 
ATOM   7536  C C   . GLU F  1 132 ? 90.041 47.790 7.610   1.00 34.23  ? 159  GLU F C   1 
ATOM   7537  O O   . GLU F  1 132 ? 89.959 47.436 8.782   1.00 33.70  ? 159  GLU F O   1 
ATOM   7538  C CB  . GLU F  1 132 ? 92.406 47.611 6.814   1.00 39.17  ? 159  GLU F CB  1 
ATOM   7539  C CG  . GLU F  1 132 ? 92.178 46.760 5.594   1.00 47.94  ? 159  GLU F CG  1 
ATOM   7540  C CD  . GLU F  1 132 ? 93.374 45.874 5.268   1.00 51.99  ? 159  GLU F CD  1 
ATOM   7541  O OE1 . GLU F  1 132 ? 93.582 44.847 5.965   1.00 54.46  ? 159  GLU F OE1 1 
ATOM   7542  O OE2 . GLU F  1 132 ? 94.108 46.218 4.312   1.00 54.13  ? 159  GLU F OE2 1 
ATOM   7543  N N   . HIS F  1 133 ? 89.078 47.547 6.731   1.00 31.86  ? 160  HIS F N   1 
ATOM   7544  C CA  . HIS F  1 133 ? 87.887 46.818 7.155   1.00 30.83  ? 160  HIS F CA  1 
ATOM   7545  C C   . HIS F  1 133 ? 87.085 46.328 5.965   1.00 31.58  ? 160  HIS F C   1 
ATOM   7546  O O   . HIS F  1 133 ? 87.356 46.711 4.836   1.00 31.95  ? 160  HIS F O   1 
ATOM   7547  C CB  . HIS F  1 133 ? 87.020 47.715 8.022   1.00 30.30  ? 160  HIS F CB  1 
ATOM   7548  C CG  . HIS F  1 133 ? 86.467 48.894 7.287   1.00 29.26  ? 160  HIS F CG  1 
ATOM   7549  N ND1 . HIS F  1 133 ? 85.264 48.852 6.614   1.00 26.47  ? 160  HIS F ND1 1 
ATOM   7550  C CD2 . HIS F  1 133 ? 86.988 50.125 7.057   1.00 27.35  ? 160  HIS F CD2 1 
ATOM   7551  C CE1 . HIS F  1 133 ? 85.070 50.005 6.000   1.00 26.12  ? 160  HIS F CE1 1 
ATOM   7552  N NE2 . HIS F  1 133 ? 86.101 50.794 6.251   1.00 25.11  ? 160  HIS F NE2 1 
ATOM   7553  N N   . SER F  1 134 ? 86.074 45.507 6.219   1.00 32.17  ? 161  SER F N   1 
ATOM   7554  C CA  . SER F  1 134 ? 85.261 44.926 5.144   1.00 33.50  ? 161  SER F CA  1 
ATOM   7555  C C   . SER F  1 134 ? 83.857 45.507 4.883   1.00 33.52  ? 161  SER F C   1 
ATOM   7556  O O   . SER F  1 134 ? 83.221 45.172 3.866   1.00 33.38  ? 161  SER F O   1 
ATOM   7557  C CB  . SER F  1 134 ? 85.103 43.435 5.410   1.00 34.71  ? 161  SER F CB  1 
ATOM   7558  O OG  . SER F  1 134 ? 84.456 43.247 6.665   1.00 38.47  ? 161  SER F OG  1 
ATOM   7559  N N   . PHE F  1 135 ? 83.355 46.339 5.797   1.00 31.54  ? 162  PHE F N   1 
ATOM   7560  C CA  . PHE F  1 135 ? 82.028 46.912 5.620   1.00 28.76  ? 162  PHE F CA  1 
ATOM   7561  C C   . PHE F  1 135 ? 81.968 47.883 4.451   1.00 28.69  ? 162  PHE F C   1 
ATOM   7562  O O   . PHE F  1 135 ? 82.414 49.027 4.545   1.00 27.54  ? 162  PHE F O   1 
ATOM   7563  C CB  . PHE F  1 135 ? 81.568 47.647 6.872   1.00 25.93  ? 162  PHE F CB  1 
ATOM   7564  C CG  . PHE F  1 135 ? 81.577 46.812 8.108   1.00 23.03  ? 162  PHE F CG  1 
ATOM   7565  C CD1 . PHE F  1 135 ? 82.767 46.565 8.784   1.00 21.07  ? 162  PHE F CD1 1 
ATOM   7566  C CD2 . PHE F  1 135 ? 80.388 46.305 8.631   1.00 20.22  ? 162  PHE F CD2 1 
ATOM   7567  C CE1 . PHE F  1 135 ? 82.770 45.828 9.966   1.00 18.65  ? 162  PHE F CE1 1 
ATOM   7568  C CE2 . PHE F  1 135 ? 80.390 45.567 9.809   1.00 18.83  ? 162  PHE F CE2 1 
ATOM   7569  C CZ  . PHE F  1 135 ? 81.585 45.331 10.475  1.00 17.07  ? 162  PHE F CZ  1 
ATOM   7570  N N   . LEU F  1 136 ? 81.425 47.416 3.339   1.00 28.54  ? 163  LEU F N   1 
ATOM   7571  C CA  . LEU F  1 136 ? 81.288 48.271 2.187   1.00 29.81  ? 163  LEU F CA  1 
ATOM   7572  C C   . LEU F  1 136 ? 79.813 48.445 2.004   1.00 31.50  ? 163  LEU F C   1 
ATOM   7573  O O   . LEU F  1 136 ? 79.013 47.625 2.469   1.00 31.13  ? 163  LEU F O   1 
ATOM   7574  C CB  . LEU F  1 136 ? 81.887 47.624 0.946   1.00 31.17  ? 163  LEU F CB  1 
ATOM   7575  C CG  . LEU F  1 136 ? 83.369 47.265 1.100   1.00 31.84  ? 163  LEU F CG  1 
ATOM   7576  C CD1 . LEU F  1 136 ? 83.894 46.636 -0.170  1.00 30.30  ? 163  LEU F CD1 1 
ATOM   7577  C CD2 . LEU F  1 136 ? 84.164 48.521 1.444   1.00 33.18  ? 163  LEU F CD2 1 
ATOM   7578  N N   . PRO F  1 137 ? 79.418 49.531 1.345   1.00 33.56  ? 164  PRO F N   1 
ATOM   7579  C CA  . PRO F  1 137 ? 77.991 49.754 1.134   1.00 34.48  ? 164  PRO F CA  1 
ATOM   7580  C C   . PRO F  1 137 ? 77.460 48.573 0.328   1.00 36.06  ? 164  PRO F C   1 
ATOM   7581  O O   . PRO F  1 137 ? 76.294 48.198 0.443   1.00 35.92  ? 164  PRO F O   1 
ATOM   7582  C CB  . PRO F  1 137 ? 77.967 51.058 0.346   1.00 34.62  ? 164  PRO F CB  1 
ATOM   7583  C CG  . PRO F  1 137 ? 79.247 51.754 0.795   1.00 34.77  ? 164  PRO F CG  1 
ATOM   7584  C CD  . PRO F  1 137 ? 80.222 50.621 0.770   1.00 33.77  ? 164  PRO F CD  1 
ATOM   7585  N N   . SER F  1 138 ? 78.355 47.972 -0.457  1.00 37.12  ? 165  SER F N   1 
ATOM   7586  C CA  . SER F  1 138 ? 78.033 46.841 -1.330  1.00 37.77  ? 165  SER F CA  1 
ATOM   7587  C C   . SER F  1 138 ? 77.658 45.513 -0.688  1.00 35.95  ? 165  SER F C   1 
ATOM   7588  O O   . SER F  1 138 ? 77.194 44.611 -1.373  1.00 35.55  ? 165  SER F O   1 
ATOM   7589  C CB  . SER F  1 138 ? 79.193 46.599 -2.286  1.00 39.40  ? 165  SER F CB  1 
ATOM   7590  O OG  . SER F  1 138 ? 79.475 47.791 -2.995  1.00 44.66  ? 165  SER F OG  1 
ATOM   7591  N N   . SER F  1 139 ? 77.867 45.380 0.608   1.00 34.10  ? 166  SER F N   1 
ATOM   7592  C CA  . SER F  1 139 ? 77.547 44.138 1.276   1.00 34.71  ? 166  SER F CA  1 
ATOM   7593  C C   . SER F  1 139 ? 76.447 44.414 2.275   1.00 36.76  ? 166  SER F C   1 
ATOM   7594  O O   . SER F  1 139 ? 75.845 43.505 2.861   1.00 39.70  ? 166  SER F O   1 
ATOM   7595  C CB  . SER F  1 139 ? 78.777 43.597 1.995   1.00 34.60  ? 166  SER F CB  1 
ATOM   7596  O OG  . SER F  1 139 ? 79.828 43.335 1.081   1.00 36.42  ? 166  SER F OG  1 
ATOM   7597  N N   . TYR F  1 140 ? 76.191 45.692 2.480   1.00 36.53  ? 167  TYR F N   1 
ATOM   7598  C CA  . TYR F  1 140 ? 75.168 46.095 3.404   1.00 34.48  ? 167  TYR F CA  1 
ATOM   7599  C C   . TYR F  1 140 ? 74.294 47.046 2.617   1.00 35.53  ? 167  TYR F C   1 
ATOM   7600  O O   . TYR F  1 140 ? 74.092 48.201 3.002   1.00 34.70  ? 167  TYR F O   1 
ATOM   7601  C CB  . TYR F  1 140 ? 75.818 46.779 4.593   1.00 33.45  ? 167  TYR F CB  1 
ATOM   7602  C CG  . TYR F  1 140 ? 76.728 45.868 5.365   1.00 33.36  ? 167  TYR F CG  1 
ATOM   7603  C CD1 . TYR F  1 140 ? 76.215 44.819 6.116   1.00 32.29  ? 167  TYR F CD1 1 
ATOM   7604  C CD2 . TYR F  1 140 ? 78.112 46.042 5.332   1.00 34.51  ? 167  TYR F CD2 1 
ATOM   7605  C CE1 . TYR F  1 140 ? 77.057 43.961 6.822   1.00 32.55  ? 167  TYR F CE1 1 
ATOM   7606  C CE2 . TYR F  1 140 ? 78.968 45.180 6.035   1.00 32.58  ? 167  TYR F CE2 1 
ATOM   7607  C CZ  . TYR F  1 140 ? 78.430 44.144 6.778   1.00 31.81  ? 167  TYR F CZ  1 
ATOM   7608  O OH  . TYR F  1 140 ? 79.254 43.297 7.485   1.00 30.35  ? 167  TYR F OH  1 
ATOM   7609  N N   . ARG F  1 141 ? 73.803 46.557 1.478   1.00 36.65  ? 168  ARG F N   1 
ATOM   7610  C CA  . ARG F  1 141 ? 72.937 47.373 0.631   1.00 37.69  ? 168  ARG F CA  1 
ATOM   7611  C C   . ARG F  1 141 ? 71.793 47.830 1.504   1.00 38.04  ? 168  ARG F C   1 
ATOM   7612  O O   . ARG F  1 141 ? 71.106 47.012 2.142   1.00 39.01  ? 168  ARG F O   1 
ATOM   7613  C CB  . ARG F  1 141 ? 72.404 46.570 -0.545  1.00 36.19  ? 168  ARG F CB  1 
ATOM   7614  N N   . GLY F  1 142 ? 71.604 49.136 1.591   1.00 37.02  ? 169  GLY F N   1 
ATOM   7615  C CA  . GLY F  1 142 ? 70.498 49.562 2.407   1.00 36.57  ? 169  GLY F CA  1 
ATOM   7616  C C   . GLY F  1 142 ? 70.819 49.991 3.826   1.00 36.86  ? 169  GLY F C   1 
ATOM   7617  O O   . GLY F  1 142 ? 70.031 50.714 4.410   1.00 38.85  ? 169  GLY F O   1 
ATOM   7618  N N   . LYS F  1 143 ? 71.930 49.557 4.413   1.00 36.29  ? 170  LYS F N   1 
ATOM   7619  C CA  . LYS F  1 143 ? 72.258 50.000 5.771   1.00 34.06  ? 170  LYS F CA  1 
ATOM   7620  C C   . LYS F  1 143 ? 72.914 51.404 5.722   1.00 33.53  ? 170  LYS F C   1 
ATOM   7621  O O   . LYS F  1 143 ? 73.558 51.846 6.674   1.00 33.84  ? 170  LYS F O   1 
ATOM   7622  C CB  . LYS F  1 143 ? 73.181 48.984 6.460   1.00 30.75  ? 170  LYS F CB  1 
ATOM   7623  N N   . ASP F  1 144 ? 72.754 52.084 4.589   1.00 32.68  ? 171  ASP F N   1 
ATOM   7624  C CA  . ASP F  1 144 ? 73.276 53.434 4.390   1.00 31.98  ? 171  ASP F CA  1 
ATOM   7625  C C   . ASP F  1 144 ? 74.635 53.703 5.020   1.00 31.05  ? 171  ASP F C   1 
ATOM   7626  O O   . ASP F  1 144 ? 74.745 54.473 5.960   1.00 29.56  ? 171  ASP F O   1 
ATOM   7627  C CB  . ASP F  1 144 ? 72.247 54.432 4.916   1.00 33.83  ? 171  ASP F CB  1 
ATOM   7628  C CG  . ASP F  1 144 ? 72.669 55.869 4.730   1.00 34.59  ? 171  ASP F CG  1 
ATOM   7629  O OD1 . ASP F  1 144 ? 73.311 56.170 3.699   1.00 36.11  ? 171  ASP F OD1 1 
ATOM   7630  O OD2 . ASP F  1 144 ? 72.339 56.693 5.616   1.00 33.17  ? 171  ASP F OD2 1 
ATOM   7631  N N   . LEU F  1 145 ? 75.670 53.050 4.504   1.00 31.06  ? 172  LEU F N   1 
ATOM   7632  C CA  . LEU F  1 145 ? 77.020 53.255 5.018   1.00 29.69  ? 172  LEU F CA  1 
ATOM   7633  C C   . LEU F  1 145 ? 77.689 54.326 4.203   1.00 27.73  ? 172  LEU F C   1 
ATOM   7634  O O   . LEU F  1 145 ? 78.580 54.043 3.410   1.00 25.61  ? 172  LEU F O   1 
ATOM   7635  C CB  . LEU F  1 145 ? 77.848 51.978 4.930   1.00 30.89  ? 172  LEU F CB  1 
ATOM   7636  C CG  . LEU F  1 145 ? 77.486 50.930 5.979   1.00 33.58  ? 172  LEU F CG  1 
ATOM   7637  C CD1 . LEU F  1 145 ? 78.283 49.665 5.748   1.00 34.84  ? 172  LEU F CD1 1 
ATOM   7638  C CD2 . LEU F  1 145 ? 77.783 51.475 7.353   1.00 34.72  ? 172  LEU F CD2 1 
ATOM   7639  N N   . GLN F  1 146 ? 77.256 55.559 4.397   1.00 26.65  ? 173  GLN F N   1 
ATOM   7640  C CA  . GLN F  1 146 ? 77.839 56.642 3.654   1.00 27.19  ? 173  GLN F CA  1 
ATOM   7641  C C   . GLN F  1 146 ? 78.637 57.563 4.574   1.00 27.68  ? 173  GLN F C   1 
ATOM   7642  O O   . GLN F  1 146 ? 78.613 57.396 5.804   1.00 27.04  ? 173  GLN F O   1 
ATOM   7643  C CB  . GLN F  1 146 ? 76.734 57.375 2.898   1.00 28.56  ? 173  GLN F CB  1 
ATOM   7644  C CG  . GLN F  1 146 ? 75.928 56.458 1.952   1.00 31.30  ? 173  GLN F CG  1 
ATOM   7645  C CD  . GLN F  1 146 ? 76.801 55.714 0.925   1.00 34.04  ? 173  GLN F CD  1 
ATOM   7646  O OE1 . GLN F  1 146 ? 77.649 56.322 0.257   1.00 36.01  ? 173  GLN F OE1 1 
ATOM   7647  N NE2 . GLN F  1 146 ? 76.585 54.395 0.789   1.00 33.45  ? 173  GLN F NE2 1 
ATOM   7648  N N   . GLU F  1 147 ? 79.344 58.526 3.978   1.00 27.24  ? 174  GLU F N   1 
ATOM   7649  C CA  . GLU F  1 147 ? 80.196 59.446 4.727   1.00 25.99  ? 174  GLU F CA  1 
ATOM   7650  C C   . GLU F  1 147 ? 80.874 58.709 5.872   1.00 25.56  ? 174  GLU F C   1 
ATOM   7651  O O   . GLU F  1 147 ? 81.554 57.709 5.670   1.00 24.62  ? 174  GLU F O   1 
ATOM   7652  C CB  . GLU F  1 147 ? 79.388 60.609 5.279   1.00 26.17  ? 174  GLU F CB  1 
ATOM   7653  C CG  . GLU F  1 147 ? 78.770 61.481 4.224   1.00 28.25  ? 174  GLU F CG  1 
ATOM   7654  C CD  . GLU F  1 147 ? 79.773 61.952 3.188   1.00 31.21  ? 174  GLU F CD  1 
ATOM   7655  O OE1 . GLU F  1 147 ? 80.851 62.453 3.559   1.00 34.24  ? 174  GLU F OE1 1 
ATOM   7656  O OE2 . GLU F  1 147 ? 79.488 61.832 1.984   1.00 34.52  ? 174  GLU F OE2 1 
ATOM   7657  N N   . ASN F  1 148 ? 80.678 59.195 7.083   1.00 25.64  ? 175  ASN F N   1 
ATOM   7658  C CA  . ASN F  1 148 ? 81.281 58.547 8.223   1.00 27.20  ? 175  ASN F CA  1 
ATOM   7659  C C   . ASN F  1 148 ? 80.270 58.496 9.343   1.00 26.67  ? 175  ASN F C   1 
ATOM   7660  O O   . ASN F  1 148 ? 80.603 58.622 10.516  1.00 26.07  ? 175  ASN F O   1 
ATOM   7661  C CB  . ASN F  1 148 ? 82.549 59.297 8.652   1.00 29.28  ? 175  ASN F CB  1 
ATOM   7662  C CG  . ASN F  1 148 ? 82.262 60.670 9.243   1.00 29.30  ? 175  ASN F CG  1 
ATOM   7663  O OD1 . ASN F  1 148 ? 81.364 61.386 8.789   1.00 29.41  ? 175  ASN F OD1 1 
ATOM   7664  N ND2 . ASN F  1 148 ? 83.045 61.050 10.254  1.00 28.92  ? 175  ASN F ND2 1 
ATOM   7665  N N   . TYR F  1 149 ? 79.019 58.301 8.963   1.00 27.16  ? 176  TYR F N   1 
ATOM   7666  C CA  . TYR F  1 149 ? 77.943 58.234 9.937   1.00 27.91  ? 176  TYR F CA  1 
ATOM   7667  C C   . TYR F  1 149 ? 77.995 56.975 10.798  1.00 28.23  ? 176  TYR F C   1 
ATOM   7668  O O   . TYR F  1 149 ? 78.431 55.914 10.360  1.00 27.05  ? 176  TYR F O   1 
ATOM   7669  C CB  . TYR F  1 149 ? 76.595 58.275 9.223   1.00 26.77  ? 176  TYR F CB  1 
ATOM   7670  C CG  . TYR F  1 149 ? 76.435 59.449 8.290   1.00 27.81  ? 176  TYR F CG  1 
ATOM   7671  C CD1 . TYR F  1 149 ? 76.609 60.758 8.747   1.00 26.48  ? 176  TYR F CD1 1 
ATOM   7672  C CD2 . TYR F  1 149 ? 76.071 59.256 6.954   1.00 27.69  ? 176  TYR F CD2 1 
ATOM   7673  C CE1 . TYR F  1 149 ? 76.422 61.840 7.904   1.00 25.49  ? 176  TYR F CE1 1 
ATOM   7674  C CE2 . TYR F  1 149 ? 75.884 60.330 6.100   1.00 26.51  ? 176  TYR F CE2 1 
ATOM   7675  C CZ  . TYR F  1 149 ? 76.063 61.621 6.581   1.00 27.08  ? 176  TYR F CZ  1 
ATOM   7676  O OH  . TYR F  1 149 ? 75.899 62.695 5.735   1.00 28.27  ? 176  TYR F OH  1 
ATOM   7677  N N   . CYS F  1 150 ? 77.543 57.109 12.034  1.00 28.50  ? 177  CYS F N   1 
ATOM   7678  C CA  . CYS F  1 150 ? 77.479 55.983 12.935  1.00 29.08  ? 177  CYS F CA  1 
ATOM   7679  C C   . CYS F  1 150 ? 76.404 55.058 12.403  1.00 29.37  ? 177  CYS F C   1 
ATOM   7680  O O   . CYS F  1 150 ? 75.314 55.511 12.061  1.00 30.49  ? 177  CYS F O   1 
ATOM   7681  C CB  . CYS F  1 150 ? 77.074 56.464 14.301  1.00 29.54  ? 177  CYS F CB  1 
ATOM   7682  S SG  . CYS F  1 150 ? 78.317 57.533 15.055  1.00 34.37  ? 177  CYS F SG  1 
ATOM   7683  N N   . ARG F  1 151 ? 76.695 53.766 12.339  1.00 28.79  ? 178  ARG F N   1 
ATOM   7684  C CA  . ARG F  1 151 ? 75.723 52.815 11.836  1.00 27.93  ? 178  ARG F CA  1 
ATOM   7685  C C   . ARG F  1 151 ? 75.845 51.505 12.568  1.00 30.16  ? 178  ARG F C   1 
ATOM   7686  O O   . ARG F  1 151 ? 76.802 51.289 13.310  1.00 29.75  ? 178  ARG F O   1 
ATOM   7687  C CB  . ARG F  1 151 ? 75.933 52.596 10.351  1.00 24.25  ? 178  ARG F CB  1 
ATOM   7688  C CG  . ARG F  1 151 ? 75.655 53.815 9.522   1.00 21.60  ? 178  ARG F CG  1 
ATOM   7689  C CD  . ARG F  1 151 ? 74.168 54.056 9.407   1.00 19.86  ? 178  ARG F CD  1 
ATOM   7690  N NE  . ARG F  1 151 ? 73.847 55.146 8.481   1.00 20.22  ? 178  ARG F NE  1 
ATOM   7691  C CZ  . ARG F  1 151 ? 73.632 56.408 8.841   1.00 18.79  ? 178  ARG F CZ  1 
ATOM   7692  N NH1 . ARG F  1 151 ? 73.700 56.741 10.123  1.00 19.86  ? 178  ARG F NH1 1 
ATOM   7693  N NH2 . ARG F  1 151 ? 73.355 57.335 7.924   1.00 11.78  ? 178  ARG F NH2 1 
ATOM   7694  N N   . ASN F  1 152 ? 74.848 50.648 12.374  1.00 32.74  ? 179  ASN F N   1 
ATOM   7695  C CA  . ASN F  1 152 ? 74.808 49.329 12.992  1.00 35.41  ? 179  ASN F CA  1 
ATOM   7696  C C   . ASN F  1 152 ? 74.381 48.417 11.854  1.00 37.18  ? 179  ASN F C   1 
ATOM   7697  O O   . ASN F  1 152 ? 73.303 47.829 11.871  1.00 37.54  ? 179  ASN F O   1 
ATOM   7698  C CB  . ASN F  1 152 ? 73.778 49.289 14.125  1.00 34.99  ? 179  ASN F CB  1 
ATOM   7699  C CG  . ASN F  1 152 ? 73.932 48.065 15.004  1.00 37.78  ? 179  ASN F CG  1 
ATOM   7700  O OD1 . ASN F  1 152 ? 74.507 47.057 14.581  1.00 40.94  ? 179  ASN F OD1 1 
ATOM   7701  N ND2 . ASN F  1 152 ? 73.413 48.137 16.232  1.00 37.13  ? 179  ASN F ND2 1 
ATOM   7702  N N   . PRO F  1 153 ? 75.239 48.291 10.841  1.00 39.24  ? 180  PRO F N   1 
ATOM   7703  C CA  . PRO F  1 153 ? 75.002 47.471 9.652   1.00 42.04  ? 180  PRO F CA  1 
ATOM   7704  C C   . PRO F  1 153 ? 74.611 46.040 9.957   1.00 44.60  ? 180  PRO F C   1 
ATOM   7705  O O   . PRO F  1 153 ? 73.860 45.413 9.206   1.00 45.08  ? 180  PRO F O   1 
ATOM   7706  C CB  . PRO F  1 153 ? 76.326 47.564 8.911   1.00 41.54  ? 180  PRO F CB  1 
ATOM   7707  C CG  . PRO F  1 153 ? 77.313 47.672 10.039  1.00 41.66  ? 180  PRO F CG  1 
ATOM   7708  C CD  . PRO F  1 153 ? 76.658 48.672 10.936  1.00 39.66  ? 180  PRO F CD  1 
ATOM   7709  N N   . ARG F  1 154 ? 75.141 45.541 11.067  1.00 47.45  ? 181  ARG F N   1 
ATOM   7710  C CA  . ARG F  1 154 ? 74.892 44.183 11.521  1.00 50.55  ? 181  ARG F CA  1 
ATOM   7711  C C   . ARG F  1 154 ? 73.977 44.136 12.745  1.00 51.51  ? 181  ARG F C   1 
ATOM   7712  O O   . ARG F  1 154 ? 74.109 43.257 13.590  1.00 51.74  ? 181  ARG F O   1 
ATOM   7713  C CB  . ARG F  1 154 ? 76.220 43.502 11.852  1.00 52.28  ? 181  ARG F CB  1 
ATOM   7714  C CG  . ARG F  1 154 ? 76.987 43.003 10.648  1.00 55.85  ? 181  ARG F CG  1 
ATOM   7715  C CD  . ARG F  1 154 ? 78.374 42.526 11.059  1.00 59.99  ? 181  ARG F CD  1 
ATOM   7716  N NE  . ARG F  1 154 ? 78.915 41.553 10.116  1.00 63.42  ? 181  ARG F NE  1 
ATOM   7717  C CZ  . ARG F  1 154 ? 78.545 40.274 10.064  1.00 65.15  ? 181  ARG F CZ  1 
ATOM   7718  N NH1 . ARG F  1 154 ? 77.630 39.804 10.909  1.00 64.46  ? 181  ARG F NH1 1 
ATOM   7719  N NH2 . ARG F  1 154 ? 79.086 39.464 9.159   1.00 65.67  ? 181  ARG F NH2 1 
ATOM   7720  N N   . GLY F  1 155 ? 73.056 45.087 12.840  1.00 52.65  ? 182  GLY F N   1 
ATOM   7721  C CA  . GLY F  1 155 ? 72.131 45.123 13.959  1.00 54.41  ? 182  GLY F CA  1 
ATOM   7722  C C   . GLY F  1 155 ? 72.608 44.419 15.220  1.00 55.27  ? 182  GLY F C   1 
ATOM   7723  O O   . GLY F  1 155 ? 71.857 43.666 15.846  1.00 55.92  ? 182  GLY F O   1 
ATOM   7724  N N   . GLU F  1 156 ? 73.843 44.681 15.623  1.00 55.81  ? 183  GLU F N   1 
ATOM   7725  C CA  . GLU F  1 156 ? 74.383 44.036 16.813  1.00 57.77  ? 183  GLU F CA  1 
ATOM   7726  C C   . GLU F  1 156 ? 74.188 44.842 18.078  1.00 57.17  ? 183  GLU F C   1 
ATOM   7727  O O   . GLU F  1 156 ? 74.112 46.071 18.040  1.00 57.49  ? 183  GLU F O   1 
ATOM   7728  C CB  . GLU F  1 156 ? 75.875 43.778 16.644  1.00 59.93  ? 183  GLU F CB  1 
ATOM   7729  C CG  . GLU F  1 156 ? 76.700 45.045 16.641  1.00 62.34  ? 183  GLU F CG  1 
ATOM   7730  C CD  . GLU F  1 156 ? 78.121 44.810 16.178  1.00 63.91  ? 183  GLU F CD  1 
ATOM   7731  O OE1 . GLU F  1 156 ? 78.942 44.292 16.969  1.00 62.41  ? 183  GLU F OE1 1 
ATOM   7732  O OE2 . GLU F  1 156 ? 78.407 45.140 15.006  1.00 66.23  ? 183  GLU F OE2 1 
ATOM   7733  N N   . GLU F  1 157 ? 74.110 44.145 19.207  1.00 57.02  ? 184  GLU F N   1 
ATOM   7734  C CA  . GLU F  1 157 ? 73.968 44.844 20.469  1.00 56.37  ? 184  GLU F CA  1 
ATOM   7735  C C   . GLU F  1 157 ? 75.128 45.803 20.478  1.00 53.73  ? 184  GLU F C   1 
ATOM   7736  O O   . GLU F  1 157 ? 76.224 45.498 20.016  1.00 54.70  ? 184  GLU F O   1 
ATOM   7737  C CB  . GLU F  1 157 ? 74.094 43.914 21.683  1.00 58.34  ? 184  GLU F CB  1 
ATOM   7738  C CG  . GLU F  1 157 ? 73.075 42.803 21.760  1.00 63.51  ? 184  GLU F CG  1 
ATOM   7739  C CD  . GLU F  1 157 ? 71.732 43.175 21.149  1.00 67.29  ? 184  GLU F CD  1 
ATOM   7740  O OE1 . GLU F  1 157 ? 71.305 44.350 21.286  1.00 69.30  ? 184  GLU F OE1 1 
ATOM   7741  O OE2 . GLU F  1 157 ? 71.096 42.278 20.542  1.00 68.66  ? 184  GLU F OE2 1 
ATOM   7742  N N   . GLY F  1 158 ? 74.869 46.982 20.988  1.00 50.41  ? 185  GLY F N   1 
ATOM   7743  C CA  . GLY F  1 158 ? 75.906 47.975 21.062  1.00 46.95  ? 185  GLY F CA  1 
ATOM   7744  C C   . GLY F  1 158 ? 75.387 49.187 20.333  1.00 44.99  ? 185  GLY F C   1 
ATOM   7745  O O   . GLY F  1 158 ? 75.814 50.316 20.590  1.00 45.14  ? 185  GLY F O   1 
ATOM   7746  N N   . GLY F  1 159 ? 74.450 48.943 19.421  1.00 41.81  ? 186  GLY F N   1 
ATOM   7747  C CA  . GLY F  1 159 ? 73.860 50.025 18.662  1.00 38.40  ? 186  GLY F CA  1 
ATOM   7748  C C   . GLY F  1 159 ? 74.828 50.602 17.664  1.00 35.99  ? 186  GLY F C   1 
ATOM   7749  O O   . GLY F  1 159 ? 75.906 50.045 17.459  1.00 37.86  ? 186  GLY F O   1 
ATOM   7750  N N   . PRO F  1 160 ? 74.476 51.718 17.018  1.00 32.38  ? 187  PRO F N   1 
ATOM   7751  C CA  . PRO F  1 160 ? 75.380 52.318 16.039  1.00 31.40  ? 187  PRO F CA  1 
ATOM   7752  C C   . PRO F  1 160 ? 76.808 52.506 16.558  1.00 31.09  ? 187  PRO F C   1 
ATOM   7753  O O   . PRO F  1 160 ? 77.036 52.756 17.749  1.00 29.02  ? 187  PRO F O   1 
ATOM   7754  C CB  . PRO F  1 160 ? 74.687 53.630 15.704  1.00 29.97  ? 187  PRO F CB  1 
ATOM   7755  C CG  . PRO F  1 160 ? 73.259 53.237 15.766  1.00 28.61  ? 187  PRO F CG  1 
ATOM   7756  C CD  . PRO F  1 160 ? 73.186 52.419 17.031  1.00 29.26  ? 187  PRO F CD  1 
ATOM   7757  N N   . TRP F  1 161 ? 77.762 52.369 15.641  1.00 29.82  ? 188  TRP F N   1 
ATOM   7758  C CA  . TRP F  1 161 ? 79.181 52.504 15.953  1.00 28.81  ? 188  TRP F CA  1 
ATOM   7759  C C   . TRP F  1 161 ? 79.863 52.963 14.682  1.00 28.45  ? 188  TRP F C   1 
ATOM   7760  O O   . TRP F  1 161 ? 79.197 53.213 13.684  1.00 29.10  ? 188  TRP F O   1 
ATOM   7761  C CB  . TRP F  1 161 ? 79.759 51.149 16.352  1.00 28.20  ? 188  TRP F CB  1 
ATOM   7762  C CG  . TRP F  1 161 ? 79.558 50.111 15.286  1.00 26.22  ? 188  TRP F CG  1 
ATOM   7763  C CD1 . TRP F  1 161 ? 78.428 49.402 15.039  1.00 26.20  ? 188  TRP F CD1 1 
ATOM   7764  C CD2 . TRP F  1 161 ? 80.502 49.724 14.287  1.00 26.49  ? 188  TRP F CD2 1 
ATOM   7765  N NE1 . TRP F  1 161 ? 78.604 48.592 13.944  1.00 26.04  ? 188  TRP F NE1 1 
ATOM   7766  C CE2 . TRP F  1 161 ? 79.870 48.773 13.462  1.00 25.37  ? 188  TRP F CE2 1 
ATOM   7767  C CE3 . TRP F  1 161 ? 81.829 50.092 14.007  1.00 28.16  ? 188  TRP F CE3 1 
ATOM   7768  C CZ2 . TRP F  1 161 ? 80.510 48.183 12.377  1.00 26.79  ? 188  TRP F CZ2 1 
ATOM   7769  C CZ3 . TRP F  1 161 ? 82.470 49.506 12.929  1.00 27.79  ? 188  TRP F CZ3 1 
ATOM   7770  C CH2 . TRP F  1 161 ? 81.808 48.559 12.124  1.00 28.21  ? 188  TRP F CH2 1 
ATOM   7771  N N   . CYS F  1 162 ? 81.185 53.056 14.710  1.00 27.69  ? 189  CYS F N   1 
ATOM   7772  C CA  . CYS F  1 162 ? 81.934 53.459 13.526  1.00 28.73  ? 189  CYS F CA  1 
ATOM   7773  C C   . CYS F  1 162 ? 83.432 53.307 13.766  1.00 29.19  ? 189  CYS F C   1 
ATOM   7774  O O   . CYS F  1 162 ? 83.880 53.251 14.909  1.00 29.86  ? 189  CYS F O   1 
ATOM   7775  C CB  . CYS F  1 162 ? 81.633 54.912 13.178  1.00 27.55  ? 189  CYS F CB  1 
ATOM   7776  S SG  . CYS F  1 162 ? 82.515 56.078 14.250  1.00 29.67  ? 189  CYS F SG  1 
ATOM   7777  N N   . PHE F  1 163 ? 84.210 53.218 12.692  1.00 28.64  ? 190  PHE F N   1 
ATOM   7778  C CA  . PHE F  1 163 ? 85.654 53.132 12.849  1.00 26.20  ? 190  PHE F CA  1 
ATOM   7779  C C   . PHE F  1 163 ? 86.067 54.567 13.158  1.00 27.04  ? 190  PHE F C   1 
ATOM   7780  O O   . PHE F  1 163 ? 85.577 55.511 12.535  1.00 24.58  ? 190  PHE F O   1 
ATOM   7781  C CB  . PHE F  1 163 ? 86.304 52.613 11.568  1.00 23.55  ? 190  PHE F CB  1 
ATOM   7782  C CG  . PHE F  1 163 ? 85.970 51.175 11.272  1.00 22.27  ? 190  PHE F CG  1 
ATOM   7783  C CD1 . PHE F  1 163 ? 86.516 50.150 12.038  1.00 20.91  ? 190  PHE F CD1 1 
ATOM   7784  C CD2 . PHE F  1 163 ? 85.052 50.849 10.280  1.00 21.63  ? 190  PHE F CD2 1 
ATOM   7785  C CE1 . PHE F  1 163 ? 86.147 48.819 11.825  1.00 21.45  ? 190  PHE F CE1 1 
ATOM   7786  C CE2 . PHE F  1 163 ? 84.672 49.521 10.054  1.00 21.73  ? 190  PHE F CE2 1 
ATOM   7787  C CZ  . PHE F  1 163 ? 85.220 48.506 10.830  1.00 22.32  ? 190  PHE F CZ  1 
ATOM   7788  N N   . THR F  1 164 ? 86.933 54.734 14.153  1.00 28.19  ? 191  THR F N   1 
ATOM   7789  C CA  . THR F  1 164 ? 87.371 56.067 14.554  1.00 28.90  ? 191  THR F CA  1 
ATOM   7790  C C   . THR F  1 164 ? 88.567 56.565 13.751  1.00 30.38  ? 191  THR F C   1 
ATOM   7791  O O   . THR F  1 164 ? 89.355 55.772 13.230  1.00 31.00  ? 191  THR F O   1 
ATOM   7792  C CB  . THR F  1 164 ? 87.747 56.104 16.036  1.00 28.24  ? 191  THR F CB  1 
ATOM   7793  O OG1 . THR F  1 164 ? 89.170 56.019 16.159  1.00 27.84  ? 191  THR F OG1 1 
ATOM   7794  C CG2 . THR F  1 164 ? 87.092 54.942 16.778  1.00 28.67  ? 191  THR F CG2 1 
ATOM   7795  N N   . SER F  1 165 ? 88.696 57.883 13.649  1.00 30.66  ? 192  SER F N   1 
ATOM   7796  C CA  . SER F  1 165 ? 89.797 58.471 12.909  1.00 30.62  ? 192  SER F CA  1 
ATOM   7797  C C   . SER F  1 165 ? 91.062 58.439 13.764  1.00 30.58  ? 192  SER F C   1 
ATOM   7798  O O   . SER F  1 165 ? 92.115 58.911 13.350  1.00 30.17  ? 192  SER F O   1 
ATOM   7799  C CB  . SER F  1 165 ? 89.445 59.900 12.499  1.00 30.46  ? 192  SER F CB  1 
ATOM   7800  O OG  . SER F  1 165 ? 89.023 60.647 13.618  1.00 33.03  ? 192  SER F OG  1 
ATOM   7801  N N   . ASN F  1 166 ? 90.943 57.875 14.962  1.00 31.17  ? 193  ASN F N   1 
ATOM   7802  C CA  . ASN F  1 166 ? 92.074 57.744 15.868  1.00 33.37  ? 193  ASN F CA  1 
ATOM   7803  C C   . ASN F  1 166 ? 92.728 56.395 15.605  1.00 34.25  ? 193  ASN F C   1 
ATOM   7804  O O   . ASN F  1 166 ? 92.142 55.350 15.896  1.00 34.40  ? 193  ASN F O   1 
ATOM   7805  C CB  . ASN F  1 166 ? 91.615 57.791 17.324  1.00 35.50  ? 193  ASN F CB  1 
ATOM   7806  C CG  . ASN F  1 166 ? 92.777 57.759 18.304  1.00 36.61  ? 193  ASN F CG  1 
ATOM   7807  O OD1 . ASN F  1 166 ? 93.696 56.947 18.177  1.00 37.95  ? 193  ASN F OD1 1 
ATOM   7808  N ND2 . ASN F  1 166 ? 92.735 58.644 19.290  1.00 37.07  ? 193  ASN F ND2 1 
ATOM   7809  N N   . PRO F  1 167 ? 93.955 56.399 15.058  1.00 34.72  ? 194  PRO F N   1 
ATOM   7810  C CA  . PRO F  1 167 ? 94.692 55.172 14.751  1.00 34.56  ? 194  PRO F CA  1 
ATOM   7811  C C   . PRO F  1 167 ? 94.737 54.224 15.935  1.00 35.29  ? 194  PRO F C   1 
ATOM   7812  O O   . PRO F  1 167 ? 94.613 53.009 15.793  1.00 34.66  ? 194  PRO F O   1 
ATOM   7813  C CB  . PRO F  1 167 ? 96.066 55.696 14.386  1.00 34.49  ? 194  PRO F CB  1 
ATOM   7814  C CG  . PRO F  1 167 ? 95.758 57.011 13.744  1.00 33.91  ? 194  PRO F CG  1 
ATOM   7815  C CD  . PRO F  1 167 ? 94.752 57.584 14.692  1.00 34.68  ? 194  PRO F CD  1 
ATOM   7816  N N   . GLU F  1 168 ? 94.893 54.793 17.115  1.00 36.45  ? 195  GLU F N   1 
ATOM   7817  C CA  . GLU F  1 168 ? 94.971 53.981 18.300  1.00 39.57  ? 195  GLU F CA  1 
ATOM   7818  C C   . GLU F  1 168 ? 93.631 53.435 18.766  1.00 39.57  ? 195  GLU F C   1 
ATOM   7819  O O   . GLU F  1 168 ? 93.568 52.686 19.746  1.00 40.82  ? 195  GLU F O   1 
ATOM   7820  C CB  . GLU F  1 168 ? 95.687 54.763 19.404  1.00 43.38  ? 195  GLU F CB  1 
ATOM   7821  C CG  . GLU F  1 168 ? 97.173 54.394 19.501  1.00 50.50  ? 195  GLU F CG  1 
ATOM   7822  C CD  . GLU F  1 168 ? 98.081 55.571 19.839  1.00 54.72  ? 195  GLU F CD  1 
ATOM   7823  O OE1 . GLU F  1 168 ? 97.796 56.283 20.831  1.00 58.47  ? 195  GLU F OE1 1 
ATOM   7824  O OE2 . GLU F  1 168 ? 99.088 55.776 19.116  1.00 56.34  ? 195  GLU F OE2 1 
ATOM   7825  N N   . VAL F  1 169 ? 92.561 53.791 18.059  1.00 38.42  ? 196  VAL F N   1 
ATOM   7826  C CA  . VAL F  1 169 ? 91.222 53.302 18.400  1.00 36.30  ? 196  VAL F CA  1 
ATOM   7827  C C   . VAL F  1 169 ? 90.492 52.864 17.124  1.00 35.99  ? 196  VAL F C   1 
ATOM   7828  O O   . VAL F  1 169 ? 89.933 53.688 16.407  1.00 35.96  ? 196  VAL F O   1 
ATOM   7829  C CB  . VAL F  1 169 ? 90.386 54.391 19.094  1.00 35.68  ? 196  VAL F CB  1 
ATOM   7830  C CG1 . VAL F  1 169 ? 89.234 53.755 19.838  1.00 34.43  ? 196  VAL F CG1 1 
ATOM   7831  C CG2 . VAL F  1 169 ? 91.261 55.218 20.019  1.00 33.68  ? 196  VAL F CG2 1 
ATOM   7832  N N   . ARG F  1 170 ? 90.498 51.564 16.847  1.00 35.12  ? 197  ARG F N   1 
ATOM   7833  C CA  . ARG F  1 170 ? 89.858 51.045 15.646  1.00 34.11  ? 197  ARG F CA  1 
ATOM   7834  C C   . ARG F  1 170 ? 88.393 51.451 15.527  1.00 35.56  ? 197  ARG F C   1 
ATOM   7835  O O   . ARG F  1 170 ? 88.024 52.167 14.607  1.00 35.89  ? 197  ARG F O   1 
ATOM   7836  C CB  . ARG F  1 170 ? 89.994 49.524 15.594  1.00 30.70  ? 197  ARG F CB  1 
ATOM   7837  C CG  . ARG F  1 170 ? 89.510 48.898 14.302  1.00 27.73  ? 197  ARG F CG  1 
ATOM   7838  C CD  . ARG F  1 170 ? 89.715 47.391 14.314  1.00 24.66  ? 197  ARG F CD  1 
ATOM   7839  N NE  . ARG F  1 170 ? 89.070 46.734 13.179  1.00 22.40  ? 197  ARG F NE  1 
ATOM   7840  C CZ  . ARG F  1 170 ? 89.496 46.807 11.926  1.00 20.52  ? 197  ARG F CZ  1 
ATOM   7841  N NH1 . ARG F  1 170 ? 90.584 47.512 11.653  1.00 22.27  ? 197  ARG F NH1 1 
ATOM   7842  N NH2 . ARG F  1 170 ? 88.828 46.195 10.953  1.00 16.12  ? 197  ARG F NH2 1 
ATOM   7843  N N   . TYR F  1 171 ? 87.559 51.004 16.457  1.00 37.71  ? 198  TYR F N   1 
ATOM   7844  C CA  . TYR F  1 171 ? 86.128 51.334 16.434  1.00 40.28  ? 198  TYR F CA  1 
ATOM   7845  C C   . TYR F  1 171 ? 85.586 51.656 17.818  1.00 40.67  ? 198  TYR F C   1 
ATOM   7846  O O   . TYR F  1 171 ? 86.203 51.345 18.833  1.00 42.10  ? 198  TYR F O   1 
ATOM   7847  C CB  . TYR F  1 171 ? 85.314 50.165 15.879  1.00 42.40  ? 198  TYR F CB  1 
ATOM   7848  C CG  . TYR F  1 171 ? 85.675 48.844 16.530  1.00 45.37  ? 198  TYR F CG  1 
ATOM   7849  C CD1 . TYR F  1 171 ? 85.706 48.715 17.914  1.00 44.88  ? 198  TYR F CD1 1 
ATOM   7850  C CD2 . TYR F  1 171 ? 86.052 47.741 15.760  1.00 46.77  ? 198  TYR F CD2 1 
ATOM   7851  C CE1 . TYR F  1 171 ? 86.110 47.538 18.517  1.00 46.39  ? 198  TYR F CE1 1 
ATOM   7852  C CE2 . TYR F  1 171 ? 86.459 46.551 16.359  1.00 46.68  ? 198  TYR F CE2 1 
ATOM   7853  C CZ  . TYR F  1 171 ? 86.492 46.459 17.738  1.00 46.97  ? 198  TYR F CZ  1 
ATOM   7854  O OH  . TYR F  1 171 ? 86.962 45.307 18.339  1.00 48.08  ? 198  TYR F OH  1 
ATOM   7855  N N   . GLU F  1 172 ? 84.408 52.262 17.848  1.00 40.43  ? 199  GLU F N   1 
ATOM   7856  C CA  . GLU F  1 172 ? 83.746 52.613 19.096  1.00 38.87  ? 199  GLU F CA  1 
ATOM   7857  C C   . GLU F  1 172 ? 82.275 52.900 18.824  1.00 37.01  ? 199  GLU F C   1 
ATOM   7858  O O   . GLU F  1 172 ? 81.904 53.328 17.736  1.00 37.31  ? 199  GLU F O   1 
ATOM   7859  C CB  . GLU F  1 172 ? 84.408 53.832 19.740  1.00 39.52  ? 199  GLU F CB  1 
ATOM   7860  C CG  . GLU F  1 172 ? 83.662 54.340 20.955  1.00 41.88  ? 199  GLU F CG  1 
ATOM   7861  C CD  . GLU F  1 172 ? 84.462 55.328 21.798  1.00 42.69  ? 199  GLU F CD  1 
ATOM   7862  O OE1 . GLU F  1 172 ? 84.976 56.337 21.240  1.00 42.95  ? 199  GLU F OE1 1 
ATOM   7863  O OE2 . GLU F  1 172 ? 84.558 55.088 23.028  1.00 41.23  ? 199  GLU F OE2 1 
ATOM   7864  N N   . VAL F  1 173 ? 81.433 52.642 19.814  1.00 35.49  ? 200  VAL F N   1 
ATOM   7865  C CA  . VAL F  1 173 ? 80.010 52.880 19.665  1.00 33.02  ? 200  VAL F CA  1 
ATOM   7866  C C   . VAL F  1 173 ? 79.758 54.364 19.750  1.00 34.86  ? 200  VAL F C   1 
ATOM   7867  O O   . VAL F  1 173 ? 80.596 55.117 20.249  1.00 33.90  ? 200  VAL F O   1 
ATOM   7868  C CB  . VAL F  1 173 ? 79.214 52.198 20.765  1.00 29.58  ? 200  VAL F CB  1 
ATOM   7869  C CG1 . VAL F  1 173 ? 79.128 50.714 20.504  1.00 27.83  ? 200  VAL F CG1 1 
ATOM   7870  C CG2 . VAL F  1 173 ? 79.873 52.461 22.080  1.00 25.79  ? 200  VAL F CG2 1 
ATOM   7871  N N   . CYS F  1 174 ? 78.604 54.787 19.246  1.00 36.43  ? 201  CYS F N   1 
ATOM   7872  C CA  . CYS F  1 174 ? 78.250 56.192 19.280  1.00 37.54  ? 201  CYS F CA  1 
ATOM   7873  C C   . CYS F  1 174 ? 77.151 56.365 20.295  1.00 39.87  ? 201  CYS F C   1 
ATOM   7874  O O   . CYS F  1 174 ? 76.372 55.440 20.555  1.00 40.20  ? 201  CYS F O   1 
ATOM   7875  C CB  . CYS F  1 174 ? 77.783 56.662 17.911  1.00 35.55  ? 201  CYS F CB  1 
ATOM   7876  S SG  . CYS F  1 174 ? 78.981 56.348 16.571  1.00 33.91  ? 201  CYS F SG  1 
ATOM   7877  N N   . ASP F  1 175 ? 77.102 57.564 20.859  1.00 42.97  ? 202  ASP F N   1 
ATOM   7878  C CA  . ASP F  1 175 ? 76.124 57.922 21.879  1.00 44.78  ? 202  ASP F CA  1 
ATOM   7879  C C   . ASP F  1 175 ? 74.791 58.332 21.265  1.00 43.86  ? 202  ASP F C   1 
ATOM   7880  O O   . ASP F  1 175 ? 74.475 59.509 21.241  1.00 45.62  ? 202  ASP F O   1 
ATOM   7881  C CB  . ASP F  1 175 ? 76.689 59.080 22.694  1.00 48.30  ? 202  ASP F CB  1 
ATOM   7882  C CG  . ASP F  1 175 ? 76.447 58.910 24.161  1.00 52.24  ? 202  ASP F CG  1 
ATOM   7883  O OD1 . ASP F  1 175 ? 75.987 57.802 24.539  1.00 52.65  ? 202  ASP F OD1 1 
ATOM   7884  O OD2 . ASP F  1 175 ? 76.724 59.871 24.923  1.00 54.17  ? 202  ASP F OD2 1 
ATOM   7885  N N   . ILE F  1 176 ? 73.996 57.382 20.788  1.00 42.34  ? 203  ILE F N   1 
ATOM   7886  C CA  . ILE F  1 176 ? 72.746 57.750 20.152  1.00 41.42  ? 203  ILE F CA  1 
ATOM   7887  C C   . ILE F  1 176 ? 71.503 57.357 20.922  1.00 41.74  ? 203  ILE F C   1 
ATOM   7888  O O   . ILE F  1 176 ? 71.191 56.183 21.061  1.00 40.97  ? 203  ILE F O   1 
ATOM   7889  C CB  . ILE F  1 176 ? 72.713 57.203 18.718  1.00 40.87  ? 203  ILE F CB  1 
ATOM   7890  C CG1 . ILE F  1 176 ? 73.739 57.978 17.893  1.00 40.07  ? 203  ILE F CG1 1 
ATOM   7891  C CG2 . ILE F  1 176 ? 71.322 57.333 18.112  1.00 42.09  ? 203  ILE F CG2 1 
ATOM   7892  C CD1 . ILE F  1 176 ? 73.686 57.714 16.426  1.00 39.18  ? 203  ILE F CD1 1 
ATOM   7893  N N   . PRO F  1 177 ? 70.757 58.363 21.408  1.00 42.99  ? 204  PRO F N   1 
ATOM   7894  C CA  . PRO F  1 177 ? 69.524 58.256 22.192  1.00 43.60  ? 204  PRO F CA  1 
ATOM   7895  C C   . PRO F  1 177 ? 68.405 57.366 21.676  1.00 43.79  ? 204  PRO F C   1 
ATOM   7896  O O   . PRO F  1 177 ? 68.145 57.282 20.479  1.00 42.28  ? 204  PRO F O   1 
ATOM   7897  C CB  . PRO F  1 177 ? 69.083 59.714 22.335  1.00 43.66  ? 204  PRO F CB  1 
ATOM   7898  C CG  . PRO F  1 177 ? 69.599 60.342 21.084  1.00 43.30  ? 204  PRO F CG  1 
ATOM   7899  C CD  . PRO F  1 177 ? 70.979 59.765 21.004  1.00 43.38  ? 204  PRO F CD  1 
ATOM   7900  N N   . GLN F  1 178 ? 67.753 56.701 22.620  1.00 44.80  ? 205  GLN F N   1 
ATOM   7901  C CA  . GLN F  1 178 ? 66.629 55.832 22.335  1.00 47.07  ? 205  GLN F CA  1 
ATOM   7902  C C   . GLN F  1 178 ? 65.406 56.729 22.171  1.00 50.45  ? 205  GLN F C   1 
ATOM   7903  O O   . GLN F  1 178 ? 65.267 57.721 22.889  1.00 51.60  ? 205  GLN F O   1 
ATOM   7904  C CB  . GLN F  1 178 ? 66.387 54.892 23.513  1.00 45.63  ? 205  GLN F CB  1 
ATOM   7905  C CG  . GLN F  1 178 ? 67.427 53.813 23.713  1.00 43.65  ? 205  GLN F CG  1 
ATOM   7906  C CD  . GLN F  1 178 ? 67.317 52.705 22.682  1.00 41.99  ? 205  GLN F CD  1 
ATOM   7907  O OE1 . GLN F  1 178 ? 66.230 52.198 22.408  1.00 39.77  ? 205  GLN F OE1 1 
ATOM   7908  N NE2 . GLN F  1 178 ? 68.449 52.318 22.112  1.00 42.20  ? 205  GLN F NE2 1 
ATOM   7909  N N   . CYS F  1 179 ? 64.515 56.389 21.244  1.00 53.66  ? 206  CYS F N   1 
ATOM   7910  C CA  . CYS F  1 179 ? 63.315 57.194 21.046  1.00 55.94  ? 206  CYS F CA  1 
ATOM   7911  C C   . CYS F  1 179 ? 62.434 57.149 22.281  1.00 59.28  ? 206  CYS F C   1 
ATOM   7912  O O   . CYS F  1 179 ? 61.660 58.067 22.525  1.00 59.49  ? 206  CYS F O   1 
ATOM   7913  C CB  . CYS F  1 179 ? 62.520 56.699 19.852  1.00 53.34  ? 206  CYS F CB  1 
ATOM   7914  S SG  . CYS F  1 179 ? 63.355 56.967 18.265  1.00 51.41  ? 206  CYS F SG  1 
ATOM   7915  N N   . SER F  1 180 ? 62.550 56.073 23.053  1.00 63.86  ? 207  SER F N   1 
ATOM   7916  C CA  . SER F  1 180 ? 61.775 55.920 24.273  1.00 68.31  ? 207  SER F CA  1 
ATOM   7917  C C   . SER F  1 180 ? 62.616 56.347 25.478  1.00 72.26  ? 207  SER F C   1 
ATOM   7918  O O   . SER F  1 180 ? 63.191 55.517 26.186  1.00 73.01  ? 207  SER F O   1 
ATOM   7919  C CB  . SER F  1 180 ? 61.334 54.472 24.433  1.00 68.15  ? 207  SER F CB  1 
ATOM   7920  O OG  . SER F  1 180 ? 62.464 53.630 24.552  1.00 70.12  ? 207  SER F OG  1 
ATOM   7921  N N   . GLU F  1 181 ? 62.679 57.658 25.690  1.00 76.73  ? 208  GLU F N   1 
ATOM   7922  C CA  . GLU F  1 181 ? 63.428 58.268 26.786  1.00 81.01  ? 208  GLU F CA  1 
ATOM   7923  C C   . GLU F  1 181 ? 62.878 59.663 27.052  1.00 83.01  ? 208  GLU F C   1 
ATOM   7924  O O   . GLU F  1 181 ? 63.337 60.649 26.453  1.00 83.24  ? 208  GLU F O   1 
ATOM   7925  C CB  . GLU F  1 181 ? 64.904 58.399 26.432  1.00 82.27  ? 208  GLU F CB  1 
ATOM   7926  C CG  . GLU F  1 181 ? 65.708 57.151 26.592  1.00 86.62  ? 208  GLU F CG  1 
ATOM   7927  C CD  . GLU F  1 181 ? 67.176 57.421 26.349  1.00 89.79  ? 208  GLU F CD  1 
ATOM   7928  O OE1 . GLU F  1 181 ? 67.734 58.299 27.052  1.00 90.96  ? 208  GLU F OE1 1 
ATOM   7929  O OE2 . GLU F  1 181 ? 67.764 56.765 25.454  1.00 91.29  ? 208  GLU F OE2 1 
ATOM   7930  N N   . VAL F  1 182 ? 61.899 59.744 27.950  1.00 84.78  ? 209  VAL F N   1 
ATOM   7931  C CA  . VAL F  1 182 ? 61.285 61.023 28.290  1.00 85.78  ? 209  VAL F CA  1 
ATOM   7932  C C   . VAL F  1 182 ? 61.471 61.316 29.776  1.00 85.54  ? 209  VAL F C   1 
ATOM   7933  O O   . VAL F  1 182 ? 60.545 61.886 30.391  1.00 85.64  ? 209  VAL F O   1 
ATOM   7934  C CB  . VAL F  1 182 ? 59.772 61.017 27.961  1.00 86.65  ? 209  VAL F CB  1 
ATOM   7935  C CG1 . VAL F  1 182 ? 59.354 62.378 27.391  1.00 86.19  ? 209  VAL F CG1 1 
ATOM   7936  C CG2 . VAL F  1 182 ? 59.456 59.882 26.985  1.00 86.78  ? 209  VAL F CG2 1 
ATOM   7937  N N   . GLU F  1 183 ? 62.556 60.986 30.299  1.00 85.26  ? 210  GLU F N   1 
ATOM   7938  N N   . THR G  1 11  ? 8.303  75.881 39.382  1.00 93.01  ? 38   THR G N   1 
ATOM   7939  C CA  . THR G  1 11  ? 9.521  75.070 39.702  1.00 92.97  ? 38   THR G CA  1 
ATOM   7940  C C   . THR G  1 11  ? 9.268  74.080 40.835  1.00 92.82  ? 38   THR G C   1 
ATOM   7941  O O   . THR G  1 11  ? 10.095 73.202 41.111  1.00 93.20  ? 38   THR G O   1 
ATOM   7942  C CB  . THR G  1 11  ? 10.714 75.972 40.110  1.00 92.80  ? 38   THR G CB  1 
ATOM   7943  O OG1 . THR G  1 11  ? 10.343 76.796 41.226  1.00 92.27  ? 38   THR G OG1 1 
ATOM   7944  C CG2 . THR G  1 11  ? 11.132 76.847 38.949  1.00 92.70  ? 38   THR G CG2 1 
ATOM   7945  N N   . ILE G  1 12  ? 8.121  74.221 41.489  1.00 92.16  ? 39   ILE G N   1 
ATOM   7946  C CA  . ILE G  1 12  ? 7.775  73.349 42.598  1.00 90.93  ? 39   ILE G CA  1 
ATOM   7947  C C   . ILE G  1 12  ? 7.702  71.906 42.125  1.00 90.49  ? 39   ILE G C   1 
ATOM   7948  O O   . ILE G  1 12  ? 7.740  70.986 42.932  1.00 90.83  ? 39   ILE G O   1 
ATOM   7949  C CB  . ILE G  1 12  ? 6.429  73.754 43.226  1.00 90.30  ? 39   ILE G CB  1 
ATOM   7950  C CG1 . ILE G  1 12  ? 6.295  73.131 44.612  1.00 90.14  ? 39   ILE G CG1 1 
ATOM   7951  C CG2 . ILE G  1 12  ? 5.290  73.314 42.334  1.00 90.40  ? 39   ILE G CG2 1 
ATOM   7952  C CD1 . ILE G  1 12  ? 4.998  73.474 45.305  1.00 90.32  ? 39   ILE G CD1 1 
ATOM   7953  N N   . HIS G  1 13  ? 7.605  71.709 40.814  1.00 90.37  ? 40   HIS G N   1 
ATOM   7954  C CA  . HIS G  1 13  ? 7.539  70.362 40.255  1.00 90.30  ? 40   HIS G CA  1 
ATOM   7955  C C   . HIS G  1 13  ? 8.929  69.789 40.073  1.00 89.05  ? 40   HIS G C   1 
ATOM   7956  O O   . HIS G  1 13  ? 9.105  68.662 39.614  1.00 88.31  ? 40   HIS G O   1 
ATOM   7957  C CB  . HIS G  1 13  ? 6.801  70.375 38.919  1.00 91.70  ? 40   HIS G CB  1 
ATOM   7958  C CG  . HIS G  1 13  ? 5.365  70.777 39.039  1.00 93.87  ? 40   HIS G CG  1 
ATOM   7959  N ND1 . HIS G  1 13  ? 4.582  70.412 40.113  1.00 94.24  ? 40   HIS G ND1 1 
ATOM   7960  C CD2 . HIS G  1 13  ? 4.562  71.491 38.214  1.00 94.86  ? 40   HIS G CD2 1 
ATOM   7961  C CE1 . HIS G  1 13  ? 3.359  70.883 39.946  1.00 95.07  ? 40   HIS G CE1 1 
ATOM   7962  N NE2 . HIS G  1 13  ? 3.320  71.542 38.801  1.00 95.28  ? 40   HIS G NE2 1 
ATOM   7963  N N   . GLU G  1 14  ? 9.919  70.579 40.453  1.00 88.21  ? 41   GLU G N   1 
ATOM   7964  C CA  . GLU G  1 14  ? 11.297 70.161 40.332  1.00 87.84  ? 41   GLU G CA  1 
ATOM   7965  C C   . GLU G  1 14  ? 11.802 69.679 41.681  1.00 86.63  ? 41   GLU G C   1 
ATOM   7966  O O   . GLU G  1 14  ? 13.005 69.510 41.893  1.00 87.02  ? 41   GLU G O   1 
ATOM   7967  C CB  . GLU G  1 14  ? 12.130 71.327 39.809  1.00 88.77  ? 41   GLU G CB  1 
ATOM   7968  C CG  . GLU G  1 14  ? 11.640 71.820 38.457  1.00 89.20  ? 41   GLU G CG  1 
ATOM   7969  C CD  . GLU G  1 14  ? 12.412 73.013 37.952  1.00 89.46  ? 41   GLU G CD  1 
ATOM   7970  O OE1 . GLU G  1 14  ? 13.642 72.885 37.771  1.00 89.49  ? 41   GLU G OE1 1 
ATOM   7971  O OE2 . GLU G  1 14  ? 11.786 74.074 37.735  1.00 89.03  ? 41   GLU G OE2 1 
ATOM   7972  N N   . PHE G  1 15  ? 10.863 69.457 42.593  1.00 84.70  ? 42   PHE G N   1 
ATOM   7973  C CA  . PHE G  1 15  ? 11.190 68.969 43.926  1.00 83.45  ? 42   PHE G CA  1 
ATOM   7974  C C   . PHE G  1 15  ? 10.441 67.669 44.186  1.00 82.64  ? 42   PHE G C   1 
ATOM   7975  O O   . PHE G  1 15  ? 9.486  67.343 43.482  1.00 82.98  ? 42   PHE G O   1 
ATOM   7976  C CB  . PHE G  1 15  ? 10.790 69.984 45.000  1.00 82.86  ? 42   PHE G CB  1 
ATOM   7977  C CG  . PHE G  1 15  ? 11.525 71.287 44.918  1.00 82.39  ? 42   PHE G CG  1 
ATOM   7978  C CD1 . PHE G  1 15  ? 11.119 72.278 44.027  1.00 82.44  ? 42   PHE G CD1 1 
ATOM   7979  C CD2 . PHE G  1 15  ? 12.617 71.534 45.745  1.00 82.07  ? 42   PHE G CD2 1 
ATOM   7980  C CE1 . PHE G  1 15  ? 11.790 73.499 43.966  1.00 81.90  ? 42   PHE G CE1 1 
ATOM   7981  C CE2 . PHE G  1 15  ? 13.296 72.749 45.693  1.00 81.64  ? 42   PHE G CE2 1 
ATOM   7982  C CZ  . PHE G  1 15  ? 12.882 73.734 44.803  1.00 81.86  ? 42   PHE G CZ  1 
ATOM   7983  N N   . LYS G  1 16  ? 10.883 66.934 45.200  1.00 81.06  ? 43   LYS G N   1 
ATOM   7984  C CA  . LYS G  1 16  ? 10.259 65.675 45.590  1.00 79.47  ? 43   LYS G CA  1 
ATOM   7985  C C   . LYS G  1 16  ? 9.437  65.966 46.846  1.00 79.01  ? 43   LYS G C   1 
ATOM   7986  O O   . LYS G  1 16  ? 9.990  66.178 47.923  1.00 78.89  ? 43   LYS G O   1 
ATOM   7987  C CB  . LYS G  1 16  ? 11.353 64.650 45.879  1.00 78.72  ? 43   LYS G CB  1 
ATOM   7988  C CG  . LYS G  1 16  ? 10.896 63.341 46.481  1.00 77.19  ? 43   LYS G CG  1 
ATOM   7989  C CD  . LYS G  1 16  ? 12.120 62.559 46.916  1.00 75.59  ? 43   LYS G CD  1 
ATOM   7990  C CE  . LYS G  1 16  ? 11.772 61.344 47.740  1.00 75.00  ? 43   LYS G CE  1 
ATOM   7991  N NZ  . LYS G  1 16  ? 13.000 60.764 48.344  1.00 74.54  ? 43   LYS G NZ  1 
ATOM   7992  N N   . LYS G  1 17  ? 8.117  65.991 46.704  1.00 78.60  ? 44   LYS G N   1 
ATOM   7993  C CA  . LYS G  1 17  ? 7.254  66.298 47.836  1.00 78.81  ? 44   LYS G CA  1 
ATOM   7994  C C   . LYS G  1 17  ? 7.040  65.128 48.791  1.00 79.54  ? 44   LYS G C   1 
ATOM   7995  O O   . LYS G  1 17  ? 6.886  63.980 48.367  1.00 79.82  ? 44   LYS G O   1 
ATOM   7996  C CB  . LYS G  1 17  ? 5.897  66.815 47.341  1.00 78.41  ? 44   LYS G CB  1 
ATOM   7997  C CG  . LYS G  1 17  ? 4.951  67.274 48.468  1.00 78.08  ? 44   LYS G CG  1 
ATOM   7998  C CD  . LYS G  1 17  ? 3.552  67.651 47.953  1.00 75.42  ? 44   LYS G CD  1 
ATOM   7999  C CE  . LYS G  1 17  ? 2.591  67.959 49.096  1.00 73.60  ? 44   LYS G CE  1 
ATOM   8000  N NZ  . LYS G  1 17  ? 1.189  68.049 48.617  1.00 72.25  ? 44   LYS G NZ  1 
ATOM   8001  N N   . SER G  1 18  ? 7.026  65.440 50.086  1.00 80.19  ? 45   SER G N   1 
ATOM   8002  C CA  . SER G  1 18  ? 6.823  64.453 51.149  1.00 81.07  ? 45   SER G CA  1 
ATOM   8003  C C   . SER G  1 18  ? 5.773  64.979 52.138  1.00 81.38  ? 45   SER G C   1 
ATOM   8004  O O   . SER G  1 18  ? 6.100  65.583 53.163  1.00 80.17  ? 45   SER G O   1 
ATOM   8005  C CB  . SER G  1 18  ? 8.144  64.182 51.874  1.00 80.99  ? 45   SER G CB  1 
ATOM   8006  O OG  . SER G  1 18  ? 9.066  63.542 51.011  1.00 80.31  ? 45   SER G OG  1 
ATOM   8007  N N   . ALA G  1 19  ? 4.512  64.725 51.805  1.00 82.57  ? 46   ALA G N   1 
ATOM   8008  C CA  . ALA G  1 19  ? 3.371  65.167 52.584  1.00 83.88  ? 46   ALA G CA  1 
ATOM   8009  C C   . ALA G  1 19  ? 3.516  64.989 54.083  1.00 84.98  ? 46   ALA G C   1 
ATOM   8010  O O   . ALA G  1 19  ? 4.244  64.130 54.560  1.00 85.02  ? 46   ALA G O   1 
ATOM   8011  C CB  . ALA G  1 19  ? 2.116  64.460 52.099  1.00 82.62  ? 46   ALA G CB  1 
ATOM   8012  N N   . LYS G  1 20  ? 2.792  65.830 54.813  1.00 86.77  ? 47   LYS G N   1 
ATOM   8013  C CA  . LYS G  1 20  ? 2.766  65.829 56.272  1.00 88.36  ? 47   LYS G CA  1 
ATOM   8014  C C   . LYS G  1 20  ? 4.141  65.561 56.907  1.00 89.80  ? 47   LYS G C   1 
ATOM   8015  O O   . LYS G  1 20  ? 4.249  64.785 57.871  1.00 90.15  ? 47   LYS G O   1 
ATOM   8016  C CB  . LYS G  1 20  ? 1.744  64.807 56.751  1.00 87.72  ? 47   LYS G CB  1 
ATOM   8017  N N   . THR G  1 21  ? 5.178  66.232 56.399  1.00 90.49  ? 48   THR G N   1 
ATOM   8018  C CA  . THR G  1 21  ? 6.530  66.044 56.930  1.00 91.41  ? 48   THR G CA  1 
ATOM   8019  C C   . THR G  1 21  ? 7.292  67.359 57.096  1.00 91.36  ? 48   THR G C   1 
ATOM   8020  O O   . THR G  1 21  ? 6.926  68.379 56.528  1.00 91.06  ? 48   THR G O   1 
ATOM   8021  C CB  . THR G  1 21  ? 7.371  65.128 56.019  1.00 91.51  ? 48   THR G CB  1 
ATOM   8022  O OG1 . THR G  1 21  ? 6.618  63.950 55.711  1.00 92.56  ? 48   THR G OG1 1 
ATOM   8023  C CG2 . THR G  1 21  ? 8.668  64.723 56.723  1.00 91.77  ? 48   THR G CG2 1 
ATOM   8024  N N   . THR G  1 22  ? 8.370  67.305 57.870  1.00 92.18  ? 49   THR G N   1 
ATOM   8025  C CA  . THR G  1 22  ? 9.240  68.445 58.122  1.00 93.15  ? 49   THR G CA  1 
ATOM   8026  C C   . THR G  1 22  ? 10.551 67.901 58.697  1.00 93.99  ? 49   THR G C   1 
ATOM   8027  O O   . THR G  1 22  ? 10.641 66.711 59.001  1.00 93.73  ? 49   THR G O   1 
ATOM   8028  C CB  . THR G  1 22  ? 8.608  69.432 59.119  1.00 93.34  ? 49   THR G CB  1 
ATOM   8029  O OG1 . THR G  1 22  ? 9.458  70.578 59.262  1.00 92.84  ? 49   THR G OG1 1 
ATOM   8030  C CG2 . THR G  1 22  ? 8.422  68.773 60.476  1.00 93.45  ? 49   THR G CG2 1 
ATOM   8031  N N   . LEU G  1 23  ? 11.564 68.758 58.847  1.00 95.37  ? 50   LEU G N   1 
ATOM   8032  C CA  . LEU G  1 23  ? 12.868 68.327 59.383  1.00 96.49  ? 50   LEU G CA  1 
ATOM   8033  C C   . LEU G  1 23  ? 13.279 69.088 60.647  1.00 96.62  ? 50   LEU G C   1 
ATOM   8034  O O   . LEU G  1 23  ? 12.804 70.193 60.905  1.00 96.13  ? 50   LEU G O   1 
ATOM   8035  C CB  . LEU G  1 23  ? 13.973 68.491 58.323  1.00 97.26  ? 50   LEU G CB  1 
ATOM   8036  C CG  . LEU G  1 23  ? 13.753 67.998 56.883  1.00 98.13  ? 50   LEU G CG  1 
ATOM   8037  C CD1 . LEU G  1 23  ? 14.999 68.287 56.060  1.00 98.08  ? 50   LEU G CD1 1 
ATOM   8038  C CD2 . LEU G  1 23  ? 13.437 66.510 56.862  1.00 98.21  ? 50   LEU G CD2 1 
ATOM   8039  N N   . LYS G  1 31  ? 22.447 76.301 60.213  1.00 102.56 ? 58   LYS G N   1 
ATOM   8040  C CA  . LYS G  1 31  ? 21.662 77.506 59.955  1.00 103.16 ? 58   LYS G CA  1 
ATOM   8041  C C   . LYS G  1 31  ? 20.342 77.172 59.267  1.00 103.28 ? 58   LYS G C   1 
ATOM   8042  O O   . LYS G  1 31  ? 20.134 76.051 58.809  1.00 103.53 ? 58   LYS G O   1 
ATOM   8043  C CB  . LYS G  1 31  ? 22.460 78.480 59.094  1.00 103.70 ? 58   LYS G CB  1 
ATOM   8044  N N   . ILE G  1 32  ? 19.462 78.164 59.199  1.00 103.11 ? 59   ILE G N   1 
ATOM   8045  C CA  . ILE G  1 32  ? 18.150 78.034 58.582  1.00 103.06 ? 59   ILE G CA  1 
ATOM   8046  C C   . ILE G  1 32  ? 17.673 79.439 58.214  1.00 102.53 ? 59   ILE G C   1 
ATOM   8047  O O   . ILE G  1 32  ? 18.297 80.427 58.587  1.00 102.75 ? 59   ILE G O   1 
ATOM   8048  C CB  . ILE G  1 32  ? 17.129 77.383 59.567  1.00 103.63 ? 59   ILE G CB  1 
ATOM   8049  C CG1 . ILE G  1 32  ? 17.504 75.925 59.830  1.00 104.46 ? 59   ILE G CG1 1 
ATOM   8050  C CG2 . ILE G  1 32  ? 15.711 77.452 59.007  1.00 103.21 ? 59   ILE G CG2 1 
ATOM   8051  C CD1 . ILE G  1 32  ? 16.535 75.181 60.734  1.00 105.20 ? 59   ILE G CD1 1 
ATOM   8052  N N   . LYS G  1 33  ? 16.586 79.514 57.455  1.00 101.70 ? 60   LYS G N   1 
ATOM   8053  C CA  . LYS G  1 33  ? 15.997 80.780 57.046  1.00 100.92 ? 60   LYS G CA  1 
ATOM   8054  C C   . LYS G  1 33  ? 14.495 80.565 56.884  1.00 100.64 ? 60   LYS G C   1 
ATOM   8055  O O   . LYS G  1 33  ? 14.060 79.482 56.483  1.00 100.48 ? 60   LYS G O   1 
ATOM   8056  C CB  . LYS G  1 33  ? 16.625 81.263 55.726  1.00 100.84 ? 60   LYS G CB  1 
ATOM   8057  N N   . THR G  1 34  ? 13.707 81.588 57.210  1.00 100.00 ? 61   THR G N   1 
ATOM   8058  C CA  . THR G  1 34  ? 12.256 81.502 57.085  1.00 99.14  ? 61   THR G CA  1 
ATOM   8059  C C   . THR G  1 34  ? 11.625 82.820 56.675  1.00 98.32  ? 61   THR G C   1 
ATOM   8060  O O   . THR G  1 34  ? 12.277 83.868 56.653  1.00 98.49  ? 61   THR G O   1 
ATOM   8061  C CB  . THR G  1 34  ? 11.595 81.087 58.401  1.00 99.49  ? 61   THR G CB  1 
ATOM   8062  O OG1 . THR G  1 34  ? 11.778 82.127 59.366  1.00 99.32  ? 61   THR G OG1 1 
ATOM   8063  C CG2 . THR G  1 34  ? 12.199 79.794 58.923  1.00 99.66  ? 61   THR G CG2 1 
ATOM   8064  N N   . LYS G  1 35  ? 10.332 82.750 56.395  1.00 97.48  ? 62   LYS G N   1 
ATOM   8065  C CA  . LYS G  1 35  ? 9.551  83.908 55.998  1.00 97.00  ? 62   LYS G CA  1 
ATOM   8066  C C   . LYS G  1 35  ? 8.120  83.424 55.818  1.00 96.88  ? 62   LYS G C   1 
ATOM   8067  O O   . LYS G  1 35  ? 7.881  82.234 55.608  1.00 96.68  ? 62   LYS G O   1 
ATOM   8068  C CB  . LYS G  1 35  ? 10.084 84.491 54.690  1.00 96.96  ? 62   LYS G CB  1 
ATOM   8069  N N   . LYS G  1 36  ? 7.175  84.351 55.908  1.00 96.42  ? 63   LYS G N   1 
ATOM   8070  C CA  . LYS G  1 36  ? 5.768  84.037 55.747  1.00 95.54  ? 63   LYS G CA  1 
ATOM   8071  C C   . LYS G  1 36  ? 5.360  84.479 54.346  1.00 95.06  ? 63   LYS G C   1 
ATOM   8072  O O   . LYS G  1 36  ? 5.578  85.629 53.985  1.00 94.53  ? 63   LYS G O   1 
ATOM   8073  C CB  . LYS G  1 36  ? 4.952  84.777 56.807  1.00 95.10  ? 63   LYS G CB  1 
ATOM   8074  N N   . VAL G  1 37  ? 4.792  83.565 53.556  1.00 95.15  ? 64   VAL G N   1 
ATOM   8075  C CA  . VAL G  1 37  ? 4.356  83.882 52.193  1.00 95.60  ? 64   VAL G CA  1 
ATOM   8076  C C   . VAL G  1 37  ? 2.913  83.438 51.944  1.00 95.54  ? 64   VAL G C   1 
ATOM   8077  O O   . VAL G  1 37  ? 2.173  83.180 52.887  1.00 94.84  ? 64   VAL G O   1 
ATOM   8078  C CB  . VAL G  1 37  ? 5.274  83.216 51.141  1.00 95.78  ? 64   VAL G CB  1 
ATOM   8079  C CG1 . VAL G  1 37  ? 6.731  83.477 51.494  1.00 95.13  ? 64   VAL G CG1 1 
ATOM   8080  C CG2 . VAL G  1 37  ? 4.994  81.726 51.064  1.00 95.64  ? 64   VAL G CG2 1 
ATOM   8081  N N   . ASN G  1 38  ? 2.514  83.330 50.682  1.00 96.10  ? 65   ASN G N   1 
ATOM   8082  C CA  . ASN G  1 38  ? 1.143  82.930 50.365  1.00 97.00  ? 65   ASN G CA  1 
ATOM   8083  C C   . ASN G  1 38  ? 1.077  81.493 49.896  1.00 97.06  ? 65   ASN G C   1 
ATOM   8084  O O   . ASN G  1 38  ? 0.339  80.672 50.447  1.00 97.21  ? 65   ASN G O   1 
ATOM   8085  C CB  . ASN G  1 38  ? 0.574  83.832 49.274  1.00 97.46  ? 65   ASN G CB  1 
ATOM   8086  C CG  . ASN G  1 38  ? 0.829  85.288 49.553  1.00 98.31  ? 65   ASN G CG  1 
ATOM   8087  O OD1 . ASN G  1 38  ? 0.958  86.097 48.634  1.00 98.73  ? 65   ASN G OD1 1 
ATOM   8088  N ND2 . ASN G  1 38  ? 0.905  85.637 50.832  1.00 98.39  ? 65   ASN G ND2 1 
ATOM   8089  N N   . THR G  1 39  ? 1.852  81.185 48.870  1.00 96.67  ? 66   THR G N   1 
ATOM   8090  C CA  . THR G  1 39  ? 1.831  79.833 48.357  1.00 96.22  ? 66   THR G CA  1 
ATOM   8091  C C   . THR G  1 39  ? 3.172  79.139 48.505  1.00 95.74  ? 66   THR G C   1 
ATOM   8092  O O   . THR G  1 39  ? 4.213  79.790 48.619  1.00 96.05  ? 66   THR G O   1 
ATOM   8093  C CB  . THR G  1 39  ? 1.422  79.828 46.887  1.00 96.26  ? 66   THR G CB  1 
ATOM   8094  O OG1 . THR G  1 39  ? 2.413  80.510 46.111  1.00 96.02  ? 66   THR G OG1 1 
ATOM   8095  C CG2 . THR G  1 39  ? 0.080  80.530 46.719  1.00 96.13  ? 66   THR G CG2 1 
ATOM   8096  N N   . ALA G  1 40  ? 3.139  77.810 48.515  1.00 94.59  ? 67   ALA G N   1 
ATOM   8097  C CA  . ALA G  1 40  ? 4.359  77.028 48.635  1.00 92.83  ? 67   ALA G CA  1 
ATOM   8098  C C   . ALA G  1 40  ? 5.229  77.316 47.410  1.00 91.21  ? 67   ALA G C   1 
ATOM   8099  O O   . ALA G  1 40  ? 6.456  77.247 47.479  1.00 90.19  ? 67   ALA G O   1 
ATOM   8100  C CB  . ALA G  1 40  ? 4.019  75.545 48.719  1.00 92.59  ? 67   ALA G CB  1 
ATOM   8101  N N   . ASP G  1 41  ? 4.578  77.649 46.298  1.00 89.88  ? 68   ASP G N   1 
ATOM   8102  C CA  . ASP G  1 41  ? 5.268  77.964 45.052  1.00 89.01  ? 68   ASP G CA  1 
ATOM   8103  C C   . ASP G  1 41  ? 6.336  79.022 45.302  1.00 88.74  ? 68   ASP G C   1 
ATOM   8104  O O   . ASP G  1 41  ? 7.439  78.942 44.764  1.00 88.67  ? 68   ASP G O   1 
ATOM   8105  C CB  . ASP G  1 41  ? 4.274  78.493 44.023  1.00 88.25  ? 68   ASP G CB  1 
ATOM   8106  C CG  . ASP G  1 41  ? 3.056  77.611 43.890  1.00 87.55  ? 68   ASP G CG  1 
ATOM   8107  O OD1 . ASP G  1 41  ? 3.183  76.493 43.350  1.00 87.76  ? 68   ASP G OD1 1 
ATOM   8108  O OD2 . ASP G  1 41  ? 1.971  78.032 44.334  1.00 86.22  ? 68   ASP G OD2 1 
ATOM   8109  N N   . GLN G  1 42  ? 5.998  80.020 46.113  1.00 88.70  ? 69   GLN G N   1 
ATOM   8110  C CA  . GLN G  1 42  ? 6.939  81.089 46.438  1.00 88.45  ? 69   GLN G CA  1 
ATOM   8111  C C   . GLN G  1 42  ? 8.187  80.480 47.086  1.00 88.14  ? 69   GLN G C   1 
ATOM   8112  O O   . GLN G  1 42  ? 9.315  80.833 46.728  1.00 88.36  ? 69   GLN G O   1 
ATOM   8113  C CB  . GLN G  1 42  ? 6.285  82.104 47.386  1.00 88.40  ? 69   GLN G CB  1 
ATOM   8114  N N   . CYS G  1 43  ? 7.976  79.565 48.035  1.00 86.55  ? 70   CYS G N   1 
ATOM   8115  C CA  . CYS G  1 43  ? 9.083  78.901 48.715  1.00 83.62  ? 70   CYS G CA  1 
ATOM   8116  C C   . CYS G  1 43  ? 9.956  78.218 47.670  1.00 81.90  ? 70   CYS G C   1 
ATOM   8117  O O   . CYS G  1 43  ? 11.180 78.300 47.720  1.00 81.63  ? 70   CYS G O   1 
ATOM   8118  C CB  . CYS G  1 43  ? 8.564  77.838 49.684  1.00 83.62  ? 70   CYS G CB  1 
ATOM   8119  S SG  . CYS G  1 43  ? 7.343  78.381 50.923  1.00 82.21  ? 70   CYS G SG  1 
ATOM   8120  N N   . ALA G  1 44  ? 9.303  77.543 46.728  1.00 79.73  ? 71   ALA G N   1 
ATOM   8121  C CA  . ALA G  1 44  ? 9.983  76.824 45.663  1.00 78.00  ? 71   ALA G CA  1 
ATOM   8122  C C   . ALA G  1 44  ? 10.868 77.729 44.824  1.00 77.29  ? 71   ALA G C   1 
ATOM   8123  O O   . ALA G  1 44  ? 12.078 77.526 44.760  1.00 77.77  ? 71   ALA G O   1 
ATOM   8124  C CB  . ALA G  1 44  ? 8.966  76.129 44.778  1.00 77.92  ? 71   ALA G CB  1 
ATOM   8125  N N   . ASP G  1 45  ? 10.278 78.726 44.173  1.00 76.04  ? 72   ASP G N   1 
ATOM   8126  C CA  . ASP G  1 45  ? 11.067 79.636 43.343  1.00 74.18  ? 72   ASP G CA  1 
ATOM   8127  C C   . ASP G  1 45  ? 12.308 80.122 44.091  1.00 73.14  ? 72   ASP G C   1 
ATOM   8128  O O   . ASP G  1 45  ? 13.427 79.799 43.707  1.00 72.48  ? 72   ASP G O   1 
ATOM   8129  C CB  . ASP G  1 45  ? 10.222 80.822 42.906  1.00 73.74  ? 72   ASP G CB  1 
ATOM   8130  N N   . ARG G  1 46  ? 12.102 80.877 45.167  1.00 72.64  ? 73   ARG G N   1 
ATOM   8131  C CA  . ARG G  1 46  ? 13.206 81.412 45.970  1.00 72.90  ? 73   ARG G CA  1 
ATOM   8132  C C   . ARG G  1 46  ? 14.261 80.366 46.321  1.00 72.79  ? 73   ARG G C   1 
ATOM   8133  O O   . ARG G  1 46  ? 15.418 80.702 46.578  1.00 73.11  ? 73   ARG G O   1 
ATOM   8134  C CB  . ARG G  1 46  ? 12.678 82.051 47.266  1.00 73.25  ? 73   ARG G CB  1 
ATOM   8135  C CG  . ARG G  1 46  ? 13.769 82.655 48.153  1.00 73.83  ? 73   ARG G CG  1 
ATOM   8136  C CD  . ARG G  1 46  ? 13.192 83.432 49.329  1.00 75.05  ? 73   ARG G CD  1 
ATOM   8137  N NE  . ARG G  1 46  ? 14.215 84.153 50.095  1.00 76.48  ? 73   ARG G NE  1 
ATOM   8138  C CZ  . ARG G  1 46  ? 13.959 84.954 51.134  1.00 77.20  ? 73   ARG G CZ  1 
ATOM   8139  N NH1 . ARG G  1 46  ? 12.710 85.142 51.547  1.00 76.76  ? 73   ARG G NH1 1 
ATOM   8140  N NH2 . ARG G  1 46  ? 14.949 85.585 51.758  1.00 77.17  ? 73   ARG G NH2 1 
ATOM   8141  N N   . CYS G  1 47  ? 13.869 79.097 46.352  1.00 72.18  ? 74   CYS G N   1 
ATOM   8142  C CA  . CYS G  1 47  ? 14.832 78.048 46.661  1.00 70.87  ? 74   CYS G CA  1 
ATOM   8143  C C   . CYS G  1 47  ? 15.558 77.680 45.372  1.00 69.90  ? 74   CYS G C   1 
ATOM   8144  O O   . CYS G  1 47  ? 16.785 77.564 45.352  1.00 68.71  ? 74   CYS G O   1 
ATOM   8145  C CB  . CYS G  1 47  ? 14.124 76.825 47.247  1.00 71.06  ? 74   CYS G CB  1 
ATOM   8146  S SG  . CYS G  1 47  ? 15.190 75.393 47.633  1.00 71.03  ? 74   CYS G SG  1 
ATOM   8147  N N   . THR G  1 48  ? 14.796 77.516 44.293  1.00 68.90  ? 75   THR G N   1 
ATOM   8148  C CA  . THR G  1 48  ? 15.384 77.175 43.010  1.00 69.44  ? 75   THR G CA  1 
ATOM   8149  C C   . THR G  1 48  ? 16.411 78.238 42.633  1.00 68.85  ? 75   THR G C   1 
ATOM   8150  O O   . THR G  1 48  ? 17.538 77.921 42.260  1.00 69.03  ? 75   THR G O   1 
ATOM   8151  C CB  . THR G  1 48  ? 14.324 77.103 41.907  1.00 69.94  ? 75   THR G CB  1 
ATOM   8152  O OG1 . THR G  1 48  ? 13.173 76.404 42.393  1.00 70.71  ? 75   THR G OG1 1 
ATOM   8153  C CG2 . THR G  1 48  ? 14.874 76.351 40.706  1.00 71.34  ? 75   THR G CG2 1 
ATOM   8154  N N   . ARG G  1 49  ? 16.008 79.502 42.735  1.00 68.43  ? 76   ARG G N   1 
ATOM   8155  C CA  . ARG G  1 49  ? 16.885 80.632 42.431  1.00 67.43  ? 76   ARG G CA  1 
ATOM   8156  C C   . ARG G  1 49  ? 17.819 80.925 43.605  1.00 65.87  ? 76   ARG G C   1 
ATOM   8157  O O   . ARG G  1 49  ? 18.558 81.897 43.581  1.00 65.45  ? 76   ARG G O   1 
ATOM   8158  C CB  . ARG G  1 49  ? 16.057 81.891 42.114  1.00 68.46  ? 76   ARG G CB  1 
ATOM   8159  C CG  . ARG G  1 49  ? 15.364 81.877 40.754  1.00 68.94  ? 76   ARG G CG  1 
ATOM   8160  C CD  . ARG G  1 49  ? 14.784 83.245 40.379  1.00 70.72  ? 76   ARG G CD  1 
ATOM   8161  N NE  . ARG G  1 49  ? 13.354 83.368 40.662  1.00 72.95  ? 76   ARG G NE  1 
ATOM   8162  C CZ  . ARG G  1 49  ? 12.837 83.941 41.749  1.00 73.68  ? 76   ARG G CZ  1 
ATOM   8163  N NH1 . ARG G  1 49  ? 13.634 84.463 42.674  1.00 73.99  ? 76   ARG G NH1 1 
ATOM   8164  N NH2 . ARG G  1 49  ? 11.518 83.988 41.915  1.00 73.10  ? 76   ARG G NH2 1 
ATOM   8165  N N   . ASN G  1 50  ? 17.772 80.081 44.629  1.00 65.01  ? 77   ASN G N   1 
ATOM   8166  C CA  . ASN G  1 50  ? 18.609 80.237 45.813  1.00 65.04  ? 77   ASN G CA  1 
ATOM   8167  C C   . ASN G  1 50  ? 18.796 81.707 46.201  1.00 65.62  ? 77   ASN G C   1 
ATOM   8168  O O   . ASN G  1 50  ? 19.856 82.105 46.692  1.00 64.89  ? 77   ASN G O   1 
ATOM   8169  C CB  . ASN G  1 50  ? 19.972 79.578 45.580  1.00 63.75  ? 77   ASN G CB  1 
ATOM   8170  C CG  . ASN G  1 50  ? 20.679 79.218 46.881  1.00 63.46  ? 77   ASN G CG  1 
ATOM   8171  O OD1 . ASN G  1 50  ? 20.727 78.051 47.284  1.00 63.97  ? 77   ASN G OD1 1 
ATOM   8172  N ND2 . ASN G  1 50  ? 21.221 80.221 47.549  1.00 62.43  ? 77   ASN G ND2 1 
ATOM   8173  N N   . LYS G  1 51  ? 17.744 82.498 45.990  1.00 66.65  ? 78   LYS G N   1 
ATOM   8174  C CA  . LYS G  1 51  ? 17.750 83.928 46.303  1.00 68.36  ? 78   LYS G CA  1 
ATOM   8175  C C   . LYS G  1 51  ? 17.694 84.260 47.806  1.00 69.32  ? 78   LYS G C   1 
ATOM   8176  O O   . LYS G  1 51  ? 16.859 83.732 48.548  1.00 70.06  ? 78   LYS G O   1 
ATOM   8177  C CB  . LYS G  1 51  ? 16.578 84.625 45.578  1.00 67.56  ? 78   LYS G CB  1 
ATOM   8178  N N   . GLY G  1 52  ? 18.597 85.133 48.250  1.00 69.78  ? 79   GLY G N   1 
ATOM   8179  C CA  . GLY G  1 52  ? 18.599 85.552 49.644  1.00 69.68  ? 79   GLY G CA  1 
ATOM   8180  C C   . GLY G  1 52  ? 18.869 84.497 50.702  1.00 69.40  ? 79   GLY G C   1 
ATOM   8181  O O   . GLY G  1 52  ? 18.509 84.666 51.867  1.00 69.11  ? 79   GLY G O   1 
ATOM   8182  N N   . LEU G  1 53  ? 19.521 83.413 50.317  1.00 69.34  ? 80   LEU G N   1 
ATOM   8183  C CA  . LEU G  1 53  ? 19.809 82.358 51.272  1.00 69.21  ? 80   LEU G CA  1 
ATOM   8184  C C   . LEU G  1 53  ? 21.313 82.183 51.450  1.00 69.91  ? 80   LEU G C   1 
ATOM   8185  O O   . LEU G  1 53  ? 22.019 81.782 50.525  1.00 70.83  ? 80   LEU G O   1 
ATOM   8186  C CB  . LEU G  1 53  ? 19.174 81.056 50.790  1.00 67.77  ? 80   LEU G CB  1 
ATOM   8187  C CG  . LEU G  1 53  ? 17.709 81.198 50.374  1.00 65.79  ? 80   LEU G CG  1 
ATOM   8188  C CD1 . LEU G  1 53  ? 17.206 79.899 49.774  1.00 64.40  ? 80   LEU G CD1 1 
ATOM   8189  C CD2 . LEU G  1 53  ? 16.890 81.596 51.585  1.00 66.42  ? 80   LEU G CD2 1 
ATOM   8190  N N   . PRO G  1 54  ? 21.822 82.490 52.650  1.00 70.23  ? 81   PRO G N   1 
ATOM   8191  C CA  . PRO G  1 54  ? 23.244 82.381 52.994  1.00 70.36  ? 81   PRO G CA  1 
ATOM   8192  C C   . PRO G  1 54  ? 23.775 80.953 52.959  1.00 70.33  ? 81   PRO G C   1 
ATOM   8193  O O   . PRO G  1 54  ? 24.678 80.601 53.722  1.00 69.53  ? 81   PRO G O   1 
ATOM   8194  C CB  . PRO G  1 54  ? 23.305 82.982 54.393  1.00 70.90  ? 81   PRO G CB  1 
ATOM   8195  C CG  . PRO G  1 54  ? 21.964 82.640 54.956  1.00 70.80  ? 81   PRO G CG  1 
ATOM   8196  C CD  . PRO G  1 54  ? 21.044 82.965 53.804  1.00 70.64  ? 81   PRO G CD  1 
ATOM   8197  N N   . PHE G  1 55  ? 23.202 80.144 52.070  1.00 70.37  ? 82   PHE G N   1 
ATOM   8198  C CA  . PHE G  1 55  ? 23.593 78.750 51.895  1.00 70.30  ? 82   PHE G CA  1 
ATOM   8199  C C   . PHE G  1 55  ? 22.891 78.187 50.667  1.00 70.18  ? 82   PHE G C   1 
ATOM   8200  O O   . PHE G  1 55  ? 22.068 78.865 50.047  1.00 69.89  ? 82   PHE G O   1 
ATOM   8201  C CB  . PHE G  1 55  ? 23.219 77.924 53.136  1.00 71.58  ? 82   PHE G CB  1 
ATOM   8202  C CG  . PHE G  1 55  ? 21.769 78.045 53.545  1.00 72.52  ? 82   PHE G CG  1 
ATOM   8203  C CD1 . PHE G  1 55  ? 20.754 77.498 52.758  1.00 72.57  ? 82   PHE G CD1 1 
ATOM   8204  C CD2 . PHE G  1 55  ? 21.419 78.729 54.709  1.00 72.39  ? 82   PHE G CD2 1 
ATOM   8205  C CE1 . PHE G  1 55  ? 19.416 77.631 53.122  1.00 72.14  ? 82   PHE G CE1 1 
ATOM   8206  C CE2 . PHE G  1 55  ? 20.084 78.869 55.082  1.00 72.00  ? 82   PHE G CE2 1 
ATOM   8207  C CZ  . PHE G  1 55  ? 19.081 78.319 54.286  1.00 72.39  ? 82   PHE G CZ  1 
ATOM   8208  N N   . THR G  1 56  ? 23.222 76.951 50.311  1.00 69.93  ? 83   THR G N   1 
ATOM   8209  C CA  . THR G  1 56  ? 22.593 76.313 49.161  1.00 69.48  ? 83   THR G CA  1 
ATOM   8210  C C   . THR G  1 56  ? 21.274 75.726 49.648  1.00 68.99  ? 83   THR G C   1 
ATOM   8211  O O   . THR G  1 56  ? 21.258 74.913 50.573  1.00 67.86  ? 83   THR G O   1 
ATOM   8212  C CB  . THR G  1 56  ? 23.459 75.162 48.596  1.00 69.81  ? 83   THR G CB  1 
ATOM   8213  O OG1 . THR G  1 56  ? 24.816 75.599 48.454  1.00 69.92  ? 83   THR G OG1 1 
ATOM   8214  C CG2 . THR G  1 56  ? 22.939 74.728 47.242  1.00 68.97  ? 83   THR G CG2 1 
ATOM   8215  N N   . CYS G  1 57  ? 20.169 76.140 49.038  1.00 69.23  ? 84   CYS G N   1 
ATOM   8216  C CA  . CYS G  1 57  ? 18.865 75.626 49.434  1.00 69.44  ? 84   CYS G CA  1 
ATOM   8217  C C   . CYS G  1 57  ? 18.664 74.214 48.900  1.00 69.14  ? 84   CYS G C   1 
ATOM   8218  O O   . CYS G  1 57  ? 18.260 74.030 47.753  1.00 68.81  ? 84   CYS G O   1 
ATOM   8219  C CB  . CYS G  1 57  ? 17.743 76.527 48.915  1.00 70.32  ? 84   CYS G CB  1 
ATOM   8220  S SG  . CYS G  1 57  ? 16.108 75.889 49.382  1.00 73.14  ? 84   CYS G SG  1 
ATOM   8221  N N   . LYS G  1 58  ? 18.943 73.222 49.741  1.00 69.23  ? 85   LYS G N   1 
ATOM   8222  C CA  . LYS G  1 58  ? 18.804 71.821 49.357  1.00 69.63  ? 85   LYS G CA  1 
ATOM   8223  C C   . LYS G  1 58  ? 17.379 71.293 49.537  1.00 70.87  ? 85   LYS G C   1 
ATOM   8224  O O   . LYS G  1 58  ? 16.965 70.326 48.881  1.00 69.85  ? 85   LYS G O   1 
ATOM   8225  C CB  . LYS G  1 58  ? 19.771 70.967 50.173  1.00 68.17  ? 85   LYS G CB  1 
ATOM   8226  C CG  . LYS G  1 58  ? 21.202 71.412 50.056  1.00 66.26  ? 85   LYS G CG  1 
ATOM   8227  C CD  . LYS G  1 58  ? 22.131 70.422 50.713  1.00 66.26  ? 85   LYS G CD  1 
ATOM   8228  C CE  . LYS G  1 58  ? 23.577 70.886 50.629  1.00 66.09  ? 85   LYS G CE  1 
ATOM   8229  N NZ  . LYS G  1 58  ? 24.519 69.901 51.228  1.00 64.77  ? 85   LYS G NZ  1 
ATOM   8230  N N   . ALA G  1 59  ? 16.634 71.929 50.434  1.00 72.64  ? 86   ALA G N   1 
ATOM   8231  C CA  . ALA G  1 59  ? 15.259 71.527 50.709  1.00 74.11  ? 86   ALA G CA  1 
ATOM   8232  C C   . ALA G  1 59  ? 14.508 72.626 51.444  1.00 74.68  ? 86   ALA G C   1 
ATOM   8233  O O   . ALA G  1 59  ? 15.107 73.501 52.066  1.00 73.19  ? 86   ALA G O   1 
ATOM   8234  C CB  . ALA G  1 59  ? 15.243 70.247 51.540  1.00 73.68  ? 86   ALA G CB  1 
ATOM   8235  N N   . PHE G  1 60  ? 13.186 72.575 51.360  1.00 77.03  ? 87   PHE G N   1 
ATOM   8236  C CA  . PHE G  1 60  ? 12.353 73.558 52.028  1.00 79.01  ? 87   PHE G CA  1 
ATOM   8237  C C   . PHE G  1 60  ? 11.028 72.936 52.450  1.00 80.29  ? 87   PHE G C   1 
ATOM   8238  O O   . PHE G  1 60  ? 10.510 72.022 51.803  1.00 79.72  ? 87   PHE G O   1 
ATOM   8239  C CB  . PHE G  1 60  ? 12.109 74.764 51.111  1.00 78.76  ? 87   PHE G CB  1 
ATOM   8240  C CG  . PHE G  1 60  ? 11.045 74.542 50.065  1.00 79.34  ? 87   PHE G CG  1 
ATOM   8241  C CD1 . PHE G  1 60  ? 9.696  74.582 50.405  1.00 79.82  ? 87   PHE G CD1 1 
ATOM   8242  C CD2 . PHE G  1 60  ? 11.389 74.319 48.733  1.00 79.16  ? 87   PHE G CD2 1 
ATOM   8243  C CE1 . PHE G  1 60  ? 8.705  74.407 49.434  1.00 79.99  ? 87   PHE G CE1 1 
ATOM   8244  C CE2 . PHE G  1 60  ? 10.406 74.144 47.758  1.00 78.94  ? 87   PHE G CE2 1 
ATOM   8245  C CZ  . PHE G  1 60  ? 9.064  74.189 48.109  1.00 79.41  ? 87   PHE G CZ  1 
ATOM   8246  N N   . VAL G  1 61  ? 10.494 73.438 53.553  1.00 82.12  ? 88   VAL G N   1 
ATOM   8247  C CA  . VAL G  1 61  ? 9.220  72.964 54.070  1.00 84.13  ? 88   VAL G CA  1 
ATOM   8248  C C   . VAL G  1 61  ? 8.220  74.107 54.018  1.00 85.48  ? 88   VAL G C   1 
ATOM   8249  O O   . VAL G  1 61  ? 8.583  75.271 54.182  1.00 86.21  ? 88   VAL G O   1 
ATOM   8250  C CB  . VAL G  1 61  ? 9.339  72.507 55.534  1.00 83.58  ? 88   VAL G CB  1 
ATOM   8251  C CG1 . VAL G  1 61  ? 7.967  72.196 56.087  1.00 83.60  ? 88   VAL G CG1 1 
ATOM   8252  C CG2 . VAL G  1 61  ? 10.235 71.288 55.630  1.00 84.37  ? 88   VAL G CG2 1 
ATOM   8253  N N   . PHE G  1 62  ? 6.961  73.785 53.766  1.00 86.86  ? 89   PHE G N   1 
ATOM   8254  C CA  . PHE G  1 62  ? 5.941  74.819 53.743  1.00 88.16  ? 89   PHE G CA  1 
ATOM   8255  C C   . PHE G  1 62  ? 4.935  74.524 54.852  1.00 88.83  ? 89   PHE G C   1 
ATOM   8256  O O   . PHE G  1 62  ? 4.383  73.422 54.926  1.00 89.58  ? 89   PHE G O   1 
ATOM   8257  C CB  . PHE G  1 62  ? 5.224  74.871 52.397  1.00 88.35  ? 89   PHE G CB  1 
ATOM   8258  C CG  . PHE G  1 62  ? 4.158  75.921 52.338  1.00 89.03  ? 89   PHE G CG  1 
ATOM   8259  C CD1 . PHE G  1 62  ? 4.476  77.258 52.545  1.00 88.59  ? 89   PHE G CD1 1 
ATOM   8260  C CD2 . PHE G  1 62  ? 2.830  75.577 52.106  1.00 89.85  ? 89   PHE G CD2 1 
ATOM   8261  C CE1 . PHE G  1 62  ? 3.492  78.236 52.524  1.00 88.72  ? 89   PHE G CE1 1 
ATOM   8262  C CE2 . PHE G  1 62  ? 1.836  76.550 52.083  1.00 89.50  ? 89   PHE G CE2 1 
ATOM   8263  C CZ  . PHE G  1 62  ? 2.169  77.883 52.293  1.00 89.03  ? 89   PHE G CZ  1 
ATOM   8264  N N   . ASP G  1 63  ? 4.700  75.521 55.704  1.00 88.72  ? 90   ASP G N   1 
ATOM   8265  C CA  . ASP G  1 63  ? 3.782  75.397 56.833  1.00 87.97  ? 90   ASP G CA  1 
ATOM   8266  C C   . ASP G  1 63  ? 2.377  75.893 56.480  1.00 87.64  ? 90   ASP G C   1 
ATOM   8267  O O   . ASP G  1 63  ? 2.013  77.022 56.809  1.00 87.97  ? 90   ASP G O   1 
ATOM   8268  C CB  . ASP G  1 63  ? 4.325  76.206 58.011  1.00 87.74  ? 90   ASP G CB  1 
ATOM   8269  C CG  . ASP G  1 63  ? 3.864  75.676 59.343  1.00 87.35  ? 90   ASP G CG  1 
ATOM   8270  O OD1 . ASP G  1 63  ? 2.670  75.321 59.465  1.00 87.11  ? 90   ASP G OD1 1 
ATOM   8271  O OD2 . ASP G  1 63  ? 4.702  75.627 60.269  1.00 86.45  ? 90   ASP G OD2 1 
ATOM   8272  N N   . LYS G  1 64  ? 1.592  75.045 55.820  1.00 86.83  ? 91   LYS G N   1 
ATOM   8273  C CA  . LYS G  1 64  ? 0.235  75.398 55.416  1.00 86.30  ? 91   LYS G CA  1 
ATOM   8274  C C   . LYS G  1 64  ? -0.554 76.123 56.517  1.00 86.48  ? 91   LYS G C   1 
ATOM   8275  O O   . LYS G  1 64  ? -1.520 76.830 56.232  1.00 85.10  ? 91   LYS G O   1 
ATOM   8276  C CB  . LYS G  1 64  ? -0.508 74.141 54.972  1.00 85.31  ? 91   LYS G CB  1 
ATOM   8277  N N   . ALA G  1 65  ? -0.130 75.950 57.767  1.00 87.57  ? 92   ALA G N   1 
ATOM   8278  C CA  . ALA G  1 65  ? -0.785 76.575 58.912  1.00 89.05  ? 92   ALA G CA  1 
ATOM   8279  C C   . ALA G  1 65  ? -0.449 78.061 59.007  1.00 90.30  ? 92   ALA G C   1 
ATOM   8280  O O   . ALA G  1 65  ? -1.323 78.918 58.843  1.00 91.26  ? 92   ALA G O   1 
ATOM   8281  C CB  . ALA G  1 65  ? -0.369 75.866 60.197  1.00 88.72  ? 92   ALA G CB  1 
ATOM   8282  N N   . ARG G  1 66  ? 0.823  78.359 59.267  1.00 90.76  ? 93   ARG G N   1 
ATOM   8283  C CA  . ARG G  1 66  ? 1.288  79.739 59.399  1.00 90.98  ? 93   ARG G CA  1 
ATOM   8284  C C   . ARG G  1 66  ? 1.759  80.337 58.066  1.00 91.49  ? 93   ARG G C   1 
ATOM   8285  O O   . ARG G  1 66  ? 2.356  81.423 58.040  1.00 91.49  ? 93   ARG G O   1 
ATOM   8286  C CB  . ARG G  1 66  ? 2.413  79.805 60.434  1.00 90.01  ? 93   ARG G CB  1 
ATOM   8287  N N   . LYS G  1 67  ? 1.474  79.633 56.969  1.00 91.84  ? 94   LYS G N   1 
ATOM   8288  C CA  . LYS G  1 67  ? 1.867  80.061 55.622  1.00 91.63  ? 94   LYS G CA  1 
ATOM   8289  C C   . LYS G  1 67  ? 3.299  80.618 55.654  1.00 90.98  ? 94   LYS G C   1 
ATOM   8290  O O   . LYS G  1 67  ? 3.538  81.777 55.308  1.00 91.23  ? 94   LYS G O   1 
ATOM   8291  C CB  . LYS G  1 67  ? 0.877  81.118 55.090  1.00 90.95  ? 94   LYS G CB  1 
ATOM   8292  N N   . GLN G  1 68  ? 4.240  79.765 56.062  1.00 89.96  ? 95   GLN G N   1 
ATOM   8293  C CA  . GLN G  1 68  ? 5.648  80.131 56.197  1.00 89.46  ? 95   GLN G CA  1 
ATOM   8294  C C   . GLN G  1 68  ? 6.584  79.103 55.547  1.00 88.56  ? 95   GLN G C   1 
ATOM   8295  O O   . GLN G  1 68  ? 6.326  77.898 55.611  1.00 88.55  ? 95   GLN G O   1 
ATOM   8296  C CB  . GLN G  1 68  ? 5.965  80.265 57.692  1.00 89.95  ? 95   GLN G CB  1 
ATOM   8297  C CG  . GLN G  1 68  ? 7.431  80.250 58.074  1.00 90.99  ? 95   GLN G CG  1 
ATOM   8298  C CD  . GLN G  1 68  ? 7.615  79.953 59.549  1.00 91.92  ? 95   GLN G CD  1 
ATOM   8299  O OE1 . GLN G  1 68  ? 7.145  78.929 60.044  1.00 93.57  ? 95   GLN G OE1 1 
ATOM   8300  N NE2 . GLN G  1 68  ? 8.296  80.845 60.259  1.00 92.91  ? 95   GLN G NE2 1 
ATOM   8301  N N   . CYS G  1 69  ? 7.663  79.581 54.921  1.00 86.99  ? 96   CYS G N   1 
ATOM   8302  C CA  . CYS G  1 69  ? 8.634  78.689 54.287  1.00 84.84  ? 96   CYS G CA  1 
ATOM   8303  C C   . CYS G  1 69  ? 9.738  78.391 55.283  1.00 83.97  ? 96   CYS G C   1 
ATOM   8304  O O   . CYS G  1 69  ? 9.923  79.120 56.256  1.00 83.27  ? 96   CYS G O   1 
ATOM   8305  C CB  . CYS G  1 69  ? 9.288  79.334 53.068  1.00 83.98  ? 96   CYS G CB  1 
ATOM   8306  S SG  . CYS G  1 69  ? 8.206  80.006 51.770  1.00 83.81  ? 96   CYS G SG  1 
ATOM   8307  N N   . LEU G  1 70  ? 10.469 77.312 55.031  1.00 83.72  ? 97   LEU G N   1 
ATOM   8308  C CA  . LEU G  1 70  ? 11.590 76.912 55.878  1.00 83.11  ? 97   LEU G CA  1 
ATOM   8309  C C   . LEU G  1 70  ? 12.682 76.313 54.996  1.00 81.69  ? 97   LEU G C   1 
ATOM   8310  O O   . LEU G  1 70  ? 12.709 75.106 54.730  1.00 81.55  ? 97   LEU G O   1 
ATOM   8311  C CB  . LEU G  1 70  ? 11.152 75.893 56.937  1.00 83.76  ? 97   LEU G CB  1 
ATOM   8312  C CG  . LEU G  1 70  ? 10.343 76.414 58.128  1.00 84.09  ? 97   LEU G CG  1 
ATOM   8313  C CD1 . LEU G  1 70  ? 8.920  76.752 57.704  1.00 83.59  ? 97   LEU G CD1 1 
ATOM   8314  C CD2 . LEU G  1 70  ? 10.329 75.351 59.213  1.00 83.78  ? 97   LEU G CD2 1 
ATOM   8315  N N   . TRP G  1 71  ? 13.572 77.183 54.535  1.00 79.54  ? 98   TRP G N   1 
ATOM   8316  C CA  . TRP G  1 71  ? 14.673 76.785 53.675  1.00 77.55  ? 98   TRP G CA  1 
ATOM   8317  C C   . TRP G  1 71  ? 15.820 76.209 54.511  1.00 76.85  ? 98   TRP G C   1 
ATOM   8318  O O   . TRP G  1 71  ? 16.230 76.799 55.511  1.00 76.48  ? 98   TRP G O   1 
ATOM   8319  C CB  . TRP G  1 71  ? 15.132 78.003 52.867  1.00 76.45  ? 98   TRP G CB  1 
ATOM   8320  C CG  . TRP G  1 71  ? 14.056 78.565 51.966  1.00 75.64  ? 98   TRP G CG  1 
ATOM   8321  C CD1 . TRP G  1 71  ? 13.564 77.994 50.824  1.00 75.35  ? 98   TRP G CD1 1 
ATOM   8322  C CD2 . TRP G  1 71  ? 13.332 79.793 52.143  1.00 75.66  ? 98   TRP G CD2 1 
ATOM   8323  N NE1 . TRP G  1 71  ? 12.585 78.790 50.275  1.00 75.05  ? 98   TRP G NE1 1 
ATOM   8324  C CE2 . TRP G  1 71  ? 12.425 79.903 51.059  1.00 75.75  ? 98   TRP G CE2 1 
ATOM   8325  C CE3 . TRP G  1 71  ? 13.369 80.818 53.103  1.00 75.43  ? 98   TRP G CE3 1 
ATOM   8326  C CZ2 . TRP G  1 71  ? 11.547 80.992 50.917  1.00 76.17  ? 98   TRP G CZ2 1 
ATOM   8327  C CZ3 . TRP G  1 71  ? 12.497 81.903 52.962  1.00 75.88  ? 98   TRP G CZ3 1 
ATOM   8328  C CH2 . TRP G  1 71  ? 11.603 81.982 51.871  1.00 76.19  ? 98   TRP G CH2 1 
ATOM   8329  N N   . PHE G  1 72  ? 16.330 75.050 54.102  1.00 76.39  ? 99   PHE G N   1 
ATOM   8330  C CA  . PHE G  1 72  ? 17.418 74.397 54.828  1.00 75.76  ? 99   PHE G CA  1 
ATOM   8331  C C   . PHE G  1 72  ? 18.589 74.058 53.924  1.00 74.52  ? 99   PHE G C   1 
ATOM   8332  O O   . PHE G  1 72  ? 18.407 73.750 52.750  1.00 74.45  ? 99   PHE G O   1 
ATOM   8333  C CB  . PHE G  1 72  ? 16.952 73.076 55.450  1.00 76.82  ? 99   PHE G CB  1 
ATOM   8334  C CG  . PHE G  1 72  ? 15.601 73.140 56.098  1.00 76.29  ? 99   PHE G CG  1 
ATOM   8335  C CD1 . PHE G  1 72  ? 15.416 73.822 57.295  1.00 75.61  ? 99   PHE G CD1 1 
ATOM   8336  C CD2 . PHE G  1 72  ? 14.509 72.512 55.502  1.00 75.63  ? 99   PHE G CD2 1 
ATOM   8337  C CE1 . PHE G  1 72  ? 14.162 73.877 57.888  1.00 74.55  ? 99   PHE G CE1 1 
ATOM   8338  C CE2 . PHE G  1 72  ? 13.254 72.561 56.085  1.00 74.62  ? 99   PHE G CE2 1 
ATOM   8339  C CZ  . PHE G  1 72  ? 13.080 73.245 57.281  1.00 74.51  ? 99   PHE G CZ  1 
ATOM   8340  N N   . PRO G  1 73  ? 19.809 74.087 54.476  1.00 73.82  ? 100  PRO G N   1 
ATOM   8341  C CA  . PRO G  1 73  ? 21.033 73.773 53.743  1.00 73.85  ? 100  PRO G CA  1 
ATOM   8342  C C   . PRO G  1 73  ? 21.260 72.264 53.875  1.00 74.31  ? 100  PRO G C   1 
ATOM   8343  O O   . PRO G  1 73  ? 22.399 71.790 53.910  1.00 74.30  ? 100  PRO G O   1 
ATOM   8344  C CB  . PRO G  1 73  ? 22.079 74.573 54.497  1.00 73.20  ? 100  PRO G CB  1 
ATOM   8345  C CG  . PRO G  1 73  ? 21.639 74.373 55.902  1.00 72.90  ? 100  PRO G CG  1 
ATOM   8346  C CD  . PRO G  1 73  ? 20.140 74.614 55.813  1.00 73.62  ? 100  PRO G CD  1 
ATOM   8347  N N   . PHE G  1 74  ? 20.158 71.524 53.966  1.00 74.74  ? 101  PHE G N   1 
ATOM   8348  C CA  . PHE G  1 74  ? 20.197 70.072 54.118  1.00 74.76  ? 101  PHE G CA  1 
ATOM   8349  C C   . PHE G  1 74  ? 18.854 69.489 53.710  1.00 74.25  ? 101  PHE G C   1 
ATOM   8350  O O   . PHE G  1 74  ? 17.915 70.227 53.398  1.00 73.91  ? 101  PHE G O   1 
ATOM   8351  C CB  . PHE G  1 74  ? 20.487 69.708 55.580  1.00 75.27  ? 101  PHE G CB  1 
ATOM   8352  C CG  . PHE G  1 74  ? 19.528 70.334 56.560  1.00 77.21  ? 101  PHE G CG  1 
ATOM   8353  C CD1 . PHE G  1 74  ? 18.204 69.900 56.638  1.00 77.59  ? 101  PHE G CD1 1 
ATOM   8354  C CD2 . PHE G  1 74  ? 19.931 71.396 57.371  1.00 77.91  ? 101  PHE G CD2 1 
ATOM   8355  C CE1 . PHE G  1 74  ? 17.297 70.514 57.503  1.00 77.80  ? 101  PHE G CE1 1 
ATOM   8356  C CE2 . PHE G  1 74  ? 19.029 72.018 58.239  1.00 77.92  ? 101  PHE G CE2 1 
ATOM   8357  C CZ  . PHE G  1 74  ? 17.712 71.577 58.304  1.00 77.73  ? 101  PHE G CZ  1 
ATOM   8358  N N   . ASN G  1 75  ? 18.770 68.163 53.712  1.00 74.02  ? 102  ASN G N   1 
ATOM   8359  C CA  . ASN G  1 75  ? 17.536 67.472 53.365  1.00 74.79  ? 102  ASN G CA  1 
ATOM   8360  C C   . ASN G  1 75  ? 17.373 66.257 54.260  1.00 75.43  ? 102  ASN G C   1 
ATOM   8361  O O   . ASN G  1 75  ? 18.123 66.089 55.217  1.00 75.82  ? 102  ASN G O   1 
ATOM   8362  C CB  . ASN G  1 75  ? 17.539 67.035 51.896  1.00 74.10  ? 102  ASN G CB  1 
ATOM   8363  C CG  . ASN G  1 75  ? 18.632 66.026 51.580  1.00 73.77  ? 102  ASN G CG  1 
ATOM   8364  O OD1 . ASN G  1 75  ? 19.190 65.390 52.472  1.00 73.93  ? 102  ASN G OD1 1 
ATOM   8365  N ND2 . ASN G  1 75  ? 18.926 65.863 50.297  1.00 72.91  ? 102  ASN G ND2 1 
ATOM   8366  N N   . SER G  1 76  ? 16.412 65.397 53.934  1.00 76.67  ? 103  SER G N   1 
ATOM   8367  C CA  . SER G  1 76  ? 16.161 64.205 54.738  1.00 77.74  ? 103  SER G CA  1 
ATOM   8368  C C   . SER G  1 76  ? 17.398 63.333 54.992  1.00 78.63  ? 103  SER G C   1 
ATOM   8369  O O   . SER G  1 76  ? 17.751 63.098 56.147  1.00 79.24  ? 103  SER G O   1 
ATOM   8370  C CB  . SER G  1 76  ? 15.029 63.361 54.123  1.00 77.08  ? 103  SER G CB  1 
ATOM   8371  O OG  . SER G  1 76  ? 15.320 62.937 52.804  1.00 76.79  ? 103  SER G OG  1 
ATOM   8372  N N   . MET G  1 77  ? 18.066 62.863 53.939  1.00 79.36  ? 104  MET G N   1 
ATOM   8373  C CA  . MET G  1 77  ? 19.243 62.015 54.132  1.00 80.22  ? 104  MET G CA  1 
ATOM   8374  C C   . MET G  1 77  ? 20.384 62.714 54.863  1.00 81.49  ? 104  MET G C   1 
ATOM   8375  O O   . MET G  1 77  ? 21.282 62.061 55.394  1.00 81.65  ? 104  MET G O   1 
ATOM   8376  C CB  . MET G  1 77  ? 19.753 61.475 52.797  1.00 79.21  ? 104  MET G CB  1 
ATOM   8377  C CG  . MET G  1 77  ? 18.772 60.564 52.098  1.00 78.91  ? 104  MET G CG  1 
ATOM   8378  S SD  . MET G  1 77  ? 17.458 61.516 51.336  1.00 80.85  ? 104  MET G SD  1 
ATOM   8379  C CE  . MET G  1 77  ? 16.738 60.313 50.243  1.00 78.89  ? 104  MET G CE  1 
ATOM   8380  N N   . SER G  1 78  ? 20.353 64.040 54.896  1.00 83.08  ? 105  SER G N   1 
ATOM   8381  C CA  . SER G  1 78  ? 21.397 64.791 55.582  1.00 84.80  ? 105  SER G CA  1 
ATOM   8382  C C   . SER G  1 78  ? 21.567 64.268 57.011  1.00 85.89  ? 105  SER G C   1 
ATOM   8383  O O   . SER G  1 78  ? 20.600 63.827 57.641  1.00 86.37  ? 105  SER G O   1 
ATOM   8384  C CB  . SER G  1 78  ? 21.034 66.280 55.632  1.00 84.90  ? 105  SER G CB  1 
ATOM   8385  O OG  . SER G  1 78  ? 20.661 66.765 54.354  1.00 84.43  ? 105  SER G OG  1 
ATOM   8386  N N   . SER G  1 79  ? 22.797 64.307 57.515  1.00 86.61  ? 106  SER G N   1 
ATOM   8387  C CA  . SER G  1 79  ? 23.078 63.863 58.877  1.00 87.09  ? 106  SER G CA  1 
ATOM   8388  C C   . SER G  1 79  ? 22.940 65.092 59.770  1.00 87.57  ? 106  SER G C   1 
ATOM   8389  O O   . SER G  1 79  ? 23.251 66.205 59.340  1.00 88.35  ? 106  SER G O   1 
ATOM   8390  C CB  . SER G  1 79  ? 24.499 63.313 58.978  1.00 86.55  ? 106  SER G CB  1 
ATOM   8391  O OG  . SER G  1 79  ? 25.449 64.343 58.782  1.00 86.82  ? 106  SER G OG  1 
ATOM   8392  N N   . GLY G  1 80  ? 22.478 64.898 61.003  1.00 87.87  ? 107  GLY G N   1 
ATOM   8393  C CA  . GLY G  1 80  ? 22.306 66.024 61.907  1.00 88.24  ? 107  GLY G CA  1 
ATOM   8394  C C   . GLY G  1 80  ? 20.921 66.610 61.719  1.00 88.21  ? 107  GLY G C   1 
ATOM   8395  O O   . GLY G  1 80  ? 20.629 67.736 62.133  1.00 88.24  ? 107  GLY G O   1 
ATOM   8396  N N   . VAL G  1 81  ? 20.068 65.821 61.076  1.00 88.74  ? 108  VAL G N   1 
ATOM   8397  C CA  . VAL G  1 81  ? 18.694 66.205 60.793  1.00 90.41  ? 108  VAL G CA  1 
ATOM   8398  C C   . VAL G  1 81  ? 17.811 64.983 61.000  1.00 88.53  ? 108  VAL G C   1 
ATOM   8399  O O   . VAL G  1 81  ? 18.285 63.844 60.938  1.00 89.47  ? 108  VAL G O   1 
ATOM   8400  C CB  . VAL G  1 81  ? 18.546 66.698 59.331  1.00 90.25  ? 108  VAL G CB  1 
ATOM   8401  C CG1 . VAL G  1 81  ? 17.087 66.998 59.016  1.00 90.47  ? 108  VAL G CG1 1 
ATOM   8402  C CG2 . VAL G  1 81  ? 19.397 67.943 59.120  1.00 90.75  ? 108  VAL G CG2 1 
ATOM   8403  N N   . LYS G  1 82  ? 16.528 65.226 61.249  1.00 87.65  ? 109  LYS G N   1 
ATOM   8404  C CA  . LYS G  1 82  ? 15.569 64.150 61.470  1.00 86.25  ? 109  LYS G CA  1 
ATOM   8405  C C   . LYS G  1 82  ? 14.189 64.566 60.987  1.00 85.22  ? 109  LYS G C   1 
ATOM   8406  O O   . LYS G  1 82  ? 13.753 65.702 61.203  1.00 85.50  ? 109  LYS G O   1 
ATOM   8407  C CB  . LYS G  1 82  ? 15.515 63.799 62.961  1.00 84.84  ? 109  LYS G CB  1 
ATOM   8408  C CG  . LYS G  1 82  ? 16.861 63.373 63.505  1.00 85.53  ? 109  LYS G CG  1 
ATOM   8409  C CD  . LYS G  1 82  ? 16.942 63.528 64.993  1.00 84.39  ? 109  LYS G CD  1 
ATOM   8410  C CE  . LYS G  1 82  ? 18.337 63.192 65.480  1.00 83.76  ? 109  LYS G CE  1 
ATOM   8411  N NZ  . LYS G  1 82  ? 18.467 63.457 66.935  1.00 85.03  ? 109  LYS G NZ  1 
ATOM   8412  N N   . LYS G  1 83  ? 13.517 63.640 60.311  1.00 84.71  ? 110  LYS G N   1 
ATOM   8413  C CA  . LYS G  1 83  ? 12.169 63.874 59.810  1.00 83.93  ? 110  LYS G CA  1 
ATOM   8414  C C   . LYS G  1 83  ? 11.232 64.022 61.003  1.00 83.58  ? 110  LYS G C   1 
ATOM   8415  O O   . LYS G  1 83  ? 11.606 63.771 62.151  1.00 83.49  ? 110  LYS G O   1 
ATOM   8416  C CB  . LYS G  1 83  ? 11.677 62.685 58.976  1.00 83.56  ? 110  LYS G CB  1 
ATOM   8417  C CG  . LYS G  1 83  ? 12.198 62.569 57.560  1.00 82.32  ? 110  LYS G CG  1 
ATOM   8418  C CD  . LYS G  1 83  ? 11.448 61.446 56.848  1.00 82.59  ? 110  LYS G CD  1 
ATOM   8419  C CE  . LYS G  1 83  ? 11.696 61.441 55.346  1.00 84.04  ? 110  LYS G CE  1 
ATOM   8420  N NZ  . LYS G  1 83  ? 10.866 60.423 54.632  1.00 84.41  ? 110  LYS G NZ  1 
ATOM   8421  N N   . GLU G  1 84  ? 10.001 64.415 60.723  1.00 82.76  ? 111  GLU G N   1 
ATOM   8422  C CA  . GLU G  1 84  ? 9.023  64.565 61.778  1.00 82.40  ? 111  GLU G CA  1 
ATOM   8423  C C   . GLU G  1 84  ? 7.648  64.740 61.161  1.00 82.12  ? 111  GLU G C   1 
ATOM   8424  O O   . GLU G  1 84  ? 7.491  65.445 60.167  1.00 82.20  ? 111  GLU G O   1 
ATOM   8425  C CB  . GLU G  1 84  ? 9.376  65.760 62.656  1.00 81.53  ? 111  GLU G CB  1 
ATOM   8426  N N   . PHE G  1 85  ? 6.651  64.080 61.739  1.00 82.24  ? 112  PHE G N   1 
ATOM   8427  C CA  . PHE G  1 85  ? 5.300  64.199 61.223  1.00 81.95  ? 112  PHE G CA  1 
ATOM   8428  C C   . PHE G  1 85  ? 4.638  65.500 61.672  1.00 81.18  ? 112  PHE G C   1 
ATOM   8429  O O   . PHE G  1 85  ? 4.935  66.034 62.741  1.00 80.82  ? 112  PHE G O   1 
ATOM   8430  C CB  . PHE G  1 85  ? 4.433  63.031 61.675  1.00 82.27  ? 112  PHE G CB  1 
ATOM   8431  C CG  . PHE G  1 85  ? 3.047  63.079 61.107  1.00 83.47  ? 112  PHE G CG  1 
ATOM   8432  C CD1 . PHE G  1 85  ? 2.822  62.758 59.769  1.00 84.06  ? 112  PHE G CD1 1 
ATOM   8433  C CD2 . PHE G  1 85  ? 1.974  63.515 61.883  1.00 83.38  ? 112  PHE G CD2 1 
ATOM   8434  C CE1 . PHE G  1 85  ? 1.550  62.875 59.208  1.00 84.15  ? 112  PHE G CE1 1 
ATOM   8435  C CE2 . PHE G  1 85  ? 0.699  63.637 61.332  1.00 83.56  ? 112  PHE G CE2 1 
ATOM   8436  C CZ  . PHE G  1 85  ? 0.487  63.317 59.991  1.00 84.20  ? 112  PHE G CZ  1 
ATOM   8437  N N   . GLY G  1 86  ? 3.728  66.000 60.845  1.00 81.15  ? 113  GLY G N   1 
ATOM   8438  C CA  . GLY G  1 86  ? 3.029  67.230 61.158  1.00 81.38  ? 113  GLY G CA  1 
ATOM   8439  C C   . GLY G  1 86  ? 2.115  67.587 60.006  1.00 81.60  ? 113  GLY G C   1 
ATOM   8440  O O   . GLY G  1 86  ? 2.574  68.073 58.977  1.00 81.57  ? 113  GLY G O   1 
ATOM   8441  N N   . HIS G  1 87  ? 0.821  67.344 60.181  1.00 82.24  ? 114  HIS G N   1 
ATOM   8442  C CA  . HIS G  1 87  ? -0.172 67.613 59.146  1.00 82.45  ? 114  HIS G CA  1 
ATOM   8443  C C   . HIS G  1 87  ? -0.017 68.964 58.459  1.00 82.72  ? 114  HIS G C   1 
ATOM   8444  O O   . HIS G  1 87  ? -0.230 69.072 57.248  1.00 82.45  ? 114  HIS G O   1 
ATOM   8445  C CB  . HIS G  1 87  ? -1.574 67.485 59.734  1.00 83.12  ? 114  HIS G CB  1 
ATOM   8446  N N   . GLU G  1 88  ? 0.356  69.992 59.219  1.00 83.02  ? 115  GLU G N   1 
ATOM   8447  C CA  . GLU G  1 88  ? 0.511  71.324 58.633  1.00 84.05  ? 115  GLU G CA  1 
ATOM   8448  C C   . GLU G  1 88  ? 1.767  71.498 57.759  1.00 83.96  ? 115  GLU G C   1 
ATOM   8449  O O   . GLU G  1 88  ? 1.949  72.535 57.117  1.00 84.03  ? 115  GLU G O   1 
ATOM   8450  C CB  . GLU G  1 88  ? 0.497  72.406 59.730  1.00 83.92  ? 115  GLU G CB  1 
ATOM   8451  C CG  . GLU G  1 88  ? 1.786  72.541 60.543  1.00 83.78  ? 115  GLU G CG  1 
ATOM   8452  C CD  . GLU G  1 88  ? 1.944  71.473 61.606  1.00 83.41  ? 115  GLU G CD  1 
ATOM   8453  O OE1 . GLU G  1 88  ? 1.743  70.284 61.291  1.00 84.16  ? 115  GLU G OE1 1 
ATOM   8454  O OE2 . GLU G  1 88  ? 2.283  71.824 62.756  1.00 83.06  ? 115  GLU G OE2 1 
ATOM   8455  N N   . PHE G  1 89  ? 2.620  70.486 57.706  1.00 83.14  ? 116  PHE G N   1 
ATOM   8456  C CA  . PHE G  1 89  ? 3.827  70.616 56.915  1.00 81.87  ? 116  PHE G CA  1 
ATOM   8457  C C   . PHE G  1 89  ? 3.820  69.828 55.611  1.00 81.62  ? 116  PHE G C   1 
ATOM   8458  O O   . PHE G  1 89  ? 2.964  68.973 55.367  1.00 81.76  ? 116  PHE G O   1 
ATOM   8459  C CB  . PHE G  1 89  ? 5.034  70.194 57.747  1.00 81.73  ? 116  PHE G CB  1 
ATOM   8460  C CG  . PHE G  1 89  ? 5.123  70.879 59.071  1.00 81.65  ? 116  PHE G CG  1 
ATOM   8461  C CD1 . PHE G  1 89  ? 5.183  72.262 59.144  1.00 82.14  ? 116  PHE G CD1 1 
ATOM   8462  C CD2 . PHE G  1 89  ? 5.149  70.142 60.248  1.00 81.78  ? 116  PHE G CD2 1 
ATOM   8463  C CE1 . PHE G  1 89  ? 5.270  72.905 60.372  1.00 82.80  ? 116  PHE G CE1 1 
ATOM   8464  C CE2 . PHE G  1 89  ? 5.236  70.772 61.483  1.00 82.39  ? 116  PHE G CE2 1 
ATOM   8465  C CZ  . PHE G  1 89  ? 5.296  72.157 61.546  1.00 83.05  ? 116  PHE G CZ  1 
ATOM   8466  N N   . ASP G  1 90  ? 4.795  70.159 54.774  1.00 80.78  ? 117  ASP G N   1 
ATOM   8467  C CA  . ASP G  1 90  ? 5.026  69.514 53.489  1.00 78.83  ? 117  ASP G CA  1 
ATOM   8468  C C   . ASP G  1 90  ? 6.511  69.671 53.164  1.00 76.81  ? 117  ASP G C   1 
ATOM   8469  O O   . ASP G  1 90  ? 7.034  70.790 53.126  1.00 75.91  ? 117  ASP G O   1 
ATOM   8470  C CB  . ASP G  1 90  ? 4.186  70.155 52.382  1.00 79.95  ? 117  ASP G CB  1 
ATOM   8471  C CG  . ASP G  1 90  ? 2.820  69.515 52.239  1.00 80.94  ? 117  ASP G CG  1 
ATOM   8472  O OD1 . ASP G  1 90  ? 2.590  68.449 52.848  1.00 80.58  ? 117  ASP G OD1 1 
ATOM   8473  O OD2 . ASP G  1 90  ? 1.976  70.074 51.505  1.00 82.64  ? 117  ASP G OD2 1 
ATOM   8474  N N   . LEU G  1 91  ? 7.189  68.545 52.948  1.00 74.54  ? 118  LEU G N   1 
ATOM   8475  C CA  . LEU G  1 91  ? 8.611  68.566 52.621  1.00 71.59  ? 118  LEU G CA  1 
ATOM   8476  C C   . LEU G  1 91  ? 8.853  68.532 51.114  1.00 69.98  ? 118  LEU G C   1 
ATOM   8477  O O   . LEU G  1 91  ? 8.279  67.700 50.403  1.00 68.57  ? 118  LEU G O   1 
ATOM   8478  C CB  . LEU G  1 91  ? 9.333  67.390 53.276  1.00 71.29  ? 118  LEU G CB  1 
ATOM   8479  C CG  . LEU G  1 91  ? 10.848 67.351 53.051  1.00 70.04  ? 118  LEU G CG  1 
ATOM   8480  C CD1 . LEU G  1 91  ? 11.431 68.745 53.257  1.00 70.60  ? 118  LEU G CD1 1 
ATOM   8481  C CD2 . LEU G  1 91  ? 11.488 66.361 54.009  1.00 68.48  ? 118  LEU G CD2 1 
ATOM   8482  N N   . TYR G  1 92  ? 9.698  69.460 50.647  1.00 68.15  ? 119  TYR G N   1 
ATOM   8483  C CA  . TYR G  1 92  ? 10.074 69.602 49.234  1.00 65.66  ? 119  TYR G CA  1 
ATOM   8484  C C   . TYR G  1 92  ? 11.601 69.590 49.101  1.00 64.35  ? 119  TYR G C   1 
ATOM   8485  O O   . TYR G  1 92  ? 12.264 70.605 49.337  1.00 63.66  ? 119  TYR G O   1 
ATOM   8486  C CB  . TYR G  1 92  ? 9.544  70.922 48.656  1.00 65.39  ? 119  TYR G CB  1 
ATOM   8487  C CG  . TYR G  1 92  ? 8.054  71.116 48.799  1.00 66.08  ? 119  TYR G CG  1 
ATOM   8488  C CD1 . TYR G  1 92  ? 7.482  71.336 50.050  1.00 66.34  ? 119  TYR G CD1 1 
ATOM   8489  C CD2 . TYR G  1 92  ? 7.210  71.044 47.688  1.00 66.96  ? 119  TYR G CD2 1 
ATOM   8490  C CE1 . TYR G  1 92  ? 6.110  71.472 50.203  1.00 67.01  ? 119  TYR G CE1 1 
ATOM   8491  C CE2 . TYR G  1 92  ? 5.826  71.177 47.826  1.00 67.84  ? 119  TYR G CE2 1 
ATOM   8492  C CZ  . TYR G  1 92  ? 5.282  71.388 49.093  1.00 68.18  ? 119  TYR G CZ  1 
ATOM   8493  O OH  . TYR G  1 92  ? 3.914  71.482 49.261  1.00 67.96  ? 119  TYR G OH  1 
ATOM   8494  N N   . GLU G  1 93  ? 12.156 68.444 48.716  1.00 63.00  ? 120  GLU G N   1 
ATOM   8495  C CA  . GLU G  1 93  ? 13.599 68.310 48.564  1.00 61.38  ? 120  GLU G CA  1 
ATOM   8496  C C   . GLU G  1 93  ? 14.063 68.564 47.125  1.00 61.12  ? 120  GLU G C   1 
ATOM   8497  O O   . GLU G  1 93  ? 13.408 68.141 46.164  1.00 60.82  ? 120  GLU G O   1 
ATOM   8498  C CB  . GLU G  1 93  ? 14.029 66.917 49.019  1.00 60.56  ? 120  GLU G CB  1 
ATOM   8499  C CG  . GLU G  1 93  ? 13.697 66.637 50.474  1.00 60.72  ? 120  GLU G CG  1 
ATOM   8500  C CD  . GLU G  1 93  ? 13.955 65.197 50.871  1.00 61.21  ? 120  GLU G CD  1 
ATOM   8501  O OE1 . GLU G  1 93  ? 13.315 64.299 50.284  1.00 62.50  ? 120  GLU G OE1 1 
ATOM   8502  O OE2 . GLU G  1 93  ? 14.795 64.965 51.768  1.00 60.12  ? 120  GLU G OE2 1 
ATOM   8503  N N   . ASN G  1 94  ? 15.194 69.263 46.996  1.00 60.01  ? 121  ASN G N   1 
ATOM   8504  C CA  . ASN G  1 94  ? 15.791 69.597 45.699  1.00 59.00  ? 121  ASN G CA  1 
ATOM   8505  C C   . ASN G  1 94  ? 16.385 68.324 45.114  1.00 58.72  ? 121  ASN G C   1 
ATOM   8506  O O   . ASN G  1 94  ? 17.254 67.706 45.726  1.00 58.81  ? 121  ASN G O   1 
ATOM   8507  C CB  . ASN G  1 94  ? 16.900 70.639 45.901  1.00 59.51  ? 121  ASN G CB  1 
ATOM   8508  C CG  . ASN G  1 94  ? 17.588 71.049 44.603  1.00 59.30  ? 121  ASN G CG  1 
ATOM   8509  O OD1 . ASN G  1 94  ? 17.718 70.260 43.667  1.00 59.39  ? 121  ASN G OD1 1 
ATOM   8510  N ND2 . ASN G  1 94  ? 18.059 72.291 44.560  1.00 59.86  ? 121  ASN G ND2 1 
ATOM   8511  N N   . LYS G  1 95  ? 15.926 67.933 43.931  1.00 57.94  ? 122  LYS G N   1 
ATOM   8512  C CA  . LYS G  1 95  ? 16.423 66.716 43.303  1.00 57.63  ? 122  LYS G CA  1 
ATOM   8513  C C   . LYS G  1 95  ? 17.934 66.651 43.070  1.00 57.63  ? 122  LYS G C   1 
ATOM   8514  O O   . LYS G  1 95  ? 18.498 65.561 42.999  1.00 57.57  ? 122  LYS G O   1 
ATOM   8515  C CB  . LYS G  1 95  ? 15.698 66.470 41.978  1.00 58.45  ? 122  LYS G CB  1 
ATOM   8516  C CG  . LYS G  1 95  ? 14.250 66.056 42.139  1.00 59.81  ? 122  LYS G CG  1 
ATOM   8517  C CD  . LYS G  1 95  ? 13.581 65.778 40.798  1.00 62.65  ? 122  LYS G CD  1 
ATOM   8518  C CE  . LYS G  1 95  ? 12.079 65.540 40.986  1.00 64.23  ? 122  LYS G CE  1 
ATOM   8519  N NZ  . LYS G  1 95  ? 11.344 65.298 39.705  1.00 65.84  ? 122  LYS G NZ  1 
ATOM   8520  N N   . ASP G  1 96  ? 18.604 67.791 42.950  1.00 56.84  ? 123  ASP G N   1 
ATOM   8521  C CA  . ASP G  1 96  ? 20.045 67.765 42.708  1.00 55.60  ? 123  ASP G CA  1 
ATOM   8522  C C   . ASP G  1 96  ? 20.839 67.292 43.908  1.00 53.87  ? 123  ASP G C   1 
ATOM   8523  O O   . ASP G  1 96  ? 22.046 67.047 43.814  1.00 53.77  ? 123  ASP G O   1 
ATOM   8524  C CB  . ASP G  1 96  ? 20.548 69.142 42.289  1.00 57.02  ? 123  ASP G CB  1 
ATOM   8525  C CG  . ASP G  1 96  ? 20.085 69.527 40.906  1.00 57.99  ? 123  ASP G CG  1 
ATOM   8526  O OD1 . ASP G  1 96  ? 20.169 68.678 39.991  1.00 56.78  ? 123  ASP G OD1 1 
ATOM   8527  O OD2 . ASP G  1 96  ? 19.647 70.684 40.739  1.00 60.05  ? 123  ASP G OD2 1 
ATOM   8528  N N   . TYR G  1 97  ? 20.167 67.165 45.043  1.00 51.53  ? 124  TYR G N   1 
ATOM   8529  C CA  . TYR G  1 97  ? 20.853 66.716 46.240  1.00 49.01  ? 124  TYR G CA  1 
ATOM   8530  C C   . TYR G  1 97  ? 20.359 65.375 46.744  1.00 46.89  ? 124  TYR G C   1 
ATOM   8531  O O   . TYR G  1 97  ? 20.663 64.971 47.859  1.00 46.72  ? 124  TYR G O   1 
ATOM   8532  C CB  . TYR G  1 97  ? 20.741 67.780 47.317  1.00 49.07  ? 124  TYR G CB  1 
ATOM   8533  C CG  . TYR G  1 97  ? 21.420 69.052 46.890  1.00 50.34  ? 124  TYR G CG  1 
ATOM   8534  C CD1 . TYR G  1 97  ? 22.795 69.212 47.039  1.00 50.24  ? 124  TYR G CD1 1 
ATOM   8535  C CD2 . TYR G  1 97  ? 20.699 70.070 46.274  1.00 49.85  ? 124  TYR G CD2 1 
ATOM   8536  C CE1 . TYR G  1 97  ? 23.436 70.356 46.582  1.00 51.74  ? 124  TYR G CE1 1 
ATOM   8537  C CE2 . TYR G  1 97  ? 21.328 71.214 45.812  1.00 51.64  ? 124  TYR G CE2 1 
ATOM   8538  C CZ  . TYR G  1 97  ? 22.703 71.352 45.968  1.00 52.23  ? 124  TYR G CZ  1 
ATOM   8539  O OH  . TYR G  1 97  ? 23.354 72.472 45.497  1.00 53.82  ? 124  TYR G OH  1 
ATOM   8540  N N   . ILE G  1 98  ? 19.589 64.689 45.912  1.00 44.69  ? 125  ILE G N   1 
ATOM   8541  C CA  . ILE G  1 98  ? 19.092 63.372 46.253  1.00 43.43  ? 125  ILE G CA  1 
ATOM   8542  C C   . ILE G  1 98  ? 19.790 62.451 45.273  1.00 43.64  ? 125  ILE G C   1 
ATOM   8543  O O   . ILE G  1 98  ? 19.469 62.428 44.078  1.00 43.13  ? 125  ILE G O   1 
ATOM   8544  C CB  . ILE G  1 98  ? 17.573 63.284 46.083  1.00 43.73  ? 125  ILE G CB  1 
ATOM   8545  C CG1 . ILE G  1 98  ? 16.894 64.208 47.098  1.00 43.60  ? 125  ILE G CG1 1 
ATOM   8546  C CG2 . ILE G  1 98  ? 17.106 61.856 46.276  1.00 42.28  ? 125  ILE G CG2 1 
ATOM   8547  C CD1 . ILE G  1 98  ? 15.393 64.328 46.920  1.00 42.68  ? 125  ILE G CD1 1 
ATOM   8548  N N   . ARG G  1 99  ? 20.767 61.712 45.792  1.00 43.79  ? 126  ARG G N   1 
ATOM   8549  C CA  . ARG G  1 99  ? 21.567 60.806 44.987  1.00 44.20  ? 126  ARG G CA  1 
ATOM   8550  C C   . ARG G  1 99  ? 20.750 60.177 43.876  1.00 45.42  ? 126  ARG G C   1 
ATOM   8551  O O   . ARG G  1 99  ? 19.691 59.625 44.125  1.00 46.22  ? 126  ARG G O   1 
ATOM   8552  C CB  . ARG G  1 99  ? 22.172 59.710 45.859  1.00 42.92  ? 126  ARG G CB  1 
ATOM   8553  C CG  . ARG G  1 99  ? 23.318 58.978 45.172  1.00 42.85  ? 126  ARG G CG  1 
ATOM   8554  C CD  . ARG G  1 99  ? 23.780 57.762 45.951  1.00 41.51  ? 126  ARG G CD  1 
ATOM   8555  N NE  . ARG G  1 99  ? 24.064 58.065 47.352  1.00 40.59  ? 126  ARG G NE  1 
ATOM   8556  C CZ  . ARG G  1 99  ? 23.353 57.609 48.382  1.00 40.94  ? 126  ARG G CZ  1 
ATOM   8557  N NH1 . ARG G  1 99  ? 22.300 56.823 48.183  1.00 42.30  ? 126  ARG G NH1 1 
ATOM   8558  N NH2 . ARG G  1 99  ? 23.710 57.920 49.618  1.00 40.07  ? 126  ARG G NH2 1 
ATOM   8559  N N   . ASN G  1 100 ? 21.241 60.266 42.647  1.00 47.07  ? 127  ASN G N   1 
ATOM   8560  C CA  . ASN G  1 100 ? 20.524 59.690 41.528  1.00 48.64  ? 127  ASN G CA  1 
ATOM   8561  C C   . ASN G  1 100 ? 21.203 58.467 40.940  1.00 48.71  ? 127  ASN G C   1 
ATOM   8562  O O   . ASN G  1 100 ? 21.008 58.167 39.774  1.00 48.95  ? 127  ASN G O   1 
ATOM   8563  C CB  . ASN G  1 100 ? 20.296 60.735 40.425  1.00 50.48  ? 127  ASN G CB  1 
ATOM   8564  C CG  . ASN G  1 100 ? 21.572 61.430 40.004  1.00 51.51  ? 127  ASN G CG  1 
ATOM   8565  O OD1 . ASN G  1 100 ? 22.661 60.888 40.153  1.00 51.96  ? 127  ASN G OD1 1 
ATOM   8566  N ND2 . ASN G  1 100 ? 21.441 62.632 39.464  1.00 52.57  ? 127  ASN G ND2 1 
ATOM   8567  N N   . CYS G  1 101 ? 22.003 57.767 41.739  1.00 50.65  ? 128  CYS G N   1 
ATOM   8568  C CA  . CYS G  1 101 ? 22.688 56.536 41.315  1.00 53.17  ? 128  CYS G CA  1 
ATOM   8569  C C   . CYS G  1 101 ? 22.632 55.616 42.527  1.00 53.52  ? 128  CYS G C   1 
ATOM   8570  O O   . CYS G  1 101 ? 22.381 56.074 43.644  1.00 52.35  ? 128  CYS G O   1 
ATOM   8571  C CB  . CYS G  1 101 ? 24.157 56.784 40.901  1.00 54.37  ? 128  CYS G CB  1 
ATOM   8572  S SG  . CYS G  1 101 ? 25.209 57.600 42.143  1.00 59.46  ? 128  CYS G SG  1 
ATOM   8573  N N   . ILE G  1 102 ? 22.845 54.324 42.320  1.00 55.04  ? 129  ILE G N   1 
ATOM   8574  C CA  . ILE G  1 102 ? 22.792 53.391 43.440  1.00 57.40  ? 129  ILE G CA  1 
ATOM   8575  C C   . ILE G  1 102 ? 24.120 52.708 43.722  1.00 57.64  ? 129  ILE G C   1 
ATOM   8576  O O   . ILE G  1 102 ? 24.967 52.571 42.838  1.00 56.37  ? 129  ILE G O   1 
ATOM   8577  C CB  . ILE G  1 102 ? 21.750 52.283 43.197  1.00 58.60  ? 129  ILE G CB  1 
ATOM   8578  C CG1 . ILE G  1 102 ? 22.087 51.535 41.902  1.00 59.39  ? 129  ILE G CG1 1 
ATOM   8579  C CG2 . ILE G  1 102 ? 20.363 52.884 43.101  1.00 59.55  ? 129  ILE G CG2 1 
ATOM   8580  C CD1 . ILE G  1 102 ? 21.220 50.323 41.648  1.00 58.89  ? 129  ILE G CD1 1 
ATOM   8581  N N   . ILE G  1 103 ? 24.292 52.286 44.970  1.00 59.13  ? 130  ILE G N   1 
ATOM   8582  C CA  . ILE G  1 103 ? 25.499 51.575 45.372  1.00 60.15  ? 130  ILE G CA  1 
ATOM   8583  C C   . ILE G  1 103 ? 25.093 50.111 45.547  1.00 60.34  ? 130  ILE G C   1 
ATOM   8584  O O   . ILE G  1 103 ? 24.416 49.749 46.509  1.00 60.07  ? 130  ILE G O   1 
ATOM   8585  C CB  . ILE G  1 103 ? 26.059 52.091 46.713  1.00 60.88  ? 130  ILE G CB  1 
ATOM   8586  C CG1 . ILE G  1 103 ? 26.145 53.621 46.711  1.00 62.48  ? 130  ILE G CG1 1 
ATOM   8587  C CG2 . ILE G  1 103 ? 27.432 51.495 46.944  1.00 59.27  ? 130  ILE G CG2 1 
ATOM   8588  C CD1 . ILE G  1 103 ? 27.138 54.184 45.708  1.00 64.82  ? 130  ILE G CD1 1 
ATOM   8589  N N   . GLY G  1 104 ? 25.472 49.276 44.591  1.00 60.84  ? 131  GLY G N   1 
ATOM   8590  C CA  . GLY G  1 104 ? 25.139 47.868 44.684  1.00 61.66  ? 131  GLY G CA  1 
ATOM   8591  C C   . GLY G  1 104 ? 23.710 47.482 44.343  1.00 62.89  ? 131  GLY G C   1 
ATOM   8592  O O   . GLY G  1 104 ? 23.331 47.449 43.171  1.00 63.19  ? 131  GLY G O   1 
ATOM   8593  N N   . LYS G  1 105 ? 22.906 47.184 45.359  1.00 63.27  ? 132  LYS G N   1 
ATOM   8594  C CA  . LYS G  1 105 ? 21.523 46.768 45.131  1.00 62.15  ? 132  LYS G CA  1 
ATOM   8595  C C   . LYS G  1 105 ? 20.557 47.941 45.108  1.00 61.64  ? 132  LYS G C   1 
ATOM   8596  O O   . LYS G  1 105 ? 19.589 47.935 44.353  1.00 60.87  ? 132  LYS G O   1 
ATOM   8597  C CB  . LYS G  1 105 ? 21.092 45.757 46.199  1.00 61.99  ? 132  LYS G CB  1 
ATOM   8598  C CG  . LYS G  1 105 ? 22.209 44.856 46.667  1.00 61.18  ? 132  LYS G CG  1 
ATOM   8599  C CD  . LYS G  1 105 ? 23.119 45.639 47.591  1.00 61.09  ? 132  LYS G CD  1 
ATOM   8600  C CE  . LYS G  1 105 ? 24.524 45.107 47.568  1.00 61.24  ? 132  LYS G CE  1 
ATOM   8601  N NZ  . LYS G  1 105 ? 25.424 46.108 48.189  1.00 62.15  ? 132  LYS G NZ  1 
ATOM   8602  N N   . GLY G  1 106 ? 20.820 48.946 45.937  1.00 62.02  ? 133  GLY G N   1 
ATOM   8603  C CA  . GLY G  1 106 ? 19.952 50.107 45.964  1.00 62.74  ? 133  GLY G CA  1 
ATOM   8604  C C   . GLY G  1 106 ? 18.969 50.128 47.111  1.00 62.68  ? 133  GLY G C   1 
ATOM   8605  O O   . GLY G  1 106 ? 17.981 50.854 47.070  1.00 62.53  ? 133  GLY G O   1 
ATOM   8606  N N   . ARG G  1 107 ? 19.240 49.338 48.140  1.00 63.03  ? 134  ARG G N   1 
ATOM   8607  C CA  . ARG G  1 107 ? 18.356 49.283 49.294  1.00 62.96  ? 134  ARG G CA  1 
ATOM   8608  C C   . ARG G  1 107 ? 17.969 50.685 49.787  1.00 63.02  ? 134  ARG G C   1 
ATOM   8609  O O   . ARG G  1 107 ? 16.883 50.877 50.342  1.00 62.56  ? 134  ARG G O   1 
ATOM   8610  C CB  . ARG G  1 107 ? 19.024 48.488 50.420  1.00 62.90  ? 134  ARG G CB  1 
ATOM   8611  N N   . SER G  1 108 ? 18.840 51.669 49.569  1.00 62.97  ? 135  SER G N   1 
ATOM   8612  C CA  . SER G  1 108 ? 18.551 53.025 50.030  1.00 62.28  ? 135  SER G CA  1 
ATOM   8613  C C   . SER G  1 108 ? 18.255 54.044 48.934  1.00 60.17  ? 135  SER G C   1 
ATOM   8614  O O   . SER G  1 108 ? 18.155 55.243 49.211  1.00 60.30  ? 135  SER G O   1 
ATOM   8615  C CB  . SER G  1 108 ? 19.700 53.542 50.905  1.00 64.25  ? 135  SER G CB  1 
ATOM   8616  O OG  . SER G  1 108 ? 20.890 53.715 50.142  1.00 67.56  ? 135  SER G OG  1 
ATOM   8617  N N   . TYR G  1 109 ? 18.117 53.586 47.696  1.00 57.20  ? 136  TYR G N   1 
ATOM   8618  C CA  . TYR G  1 109 ? 17.806 54.507 46.606  1.00 55.24  ? 136  TYR G CA  1 
ATOM   8619  C C   . TYR G  1 109 ? 16.512 55.282 46.883  1.00 53.44  ? 136  TYR G C   1 
ATOM   8620  O O   . TYR G  1 109 ? 15.454 54.690 47.029  1.00 52.79  ? 136  TYR G O   1 
ATOM   8621  C CB  . TYR G  1 109 ? 17.630 53.757 45.288  1.00 53.21  ? 136  TYR G CB  1 
ATOM   8622  C CG  . TYR G  1 109 ? 17.027 54.626 44.216  1.00 51.98  ? 136  TYR G CG  1 
ATOM   8623  C CD1 . TYR G  1 109 ? 17.787 55.600 43.576  1.00 51.79  ? 136  TYR G CD1 1 
ATOM   8624  C CD2 . TYR G  1 109 ? 15.687 54.494 43.856  1.00 52.35  ? 136  TYR G CD2 1 
ATOM   8625  C CE1 . TYR G  1 109 ? 17.232 56.419 42.597  1.00 53.08  ? 136  TYR G CE1 1 
ATOM   8626  C CE2 . TYR G  1 109 ? 15.119 55.315 42.878  1.00 52.70  ? 136  TYR G CE2 1 
ATOM   8627  C CZ  . TYR G  1 109 ? 15.899 56.275 42.251  1.00 52.19  ? 136  TYR G CZ  1 
ATOM   8628  O OH  . TYR G  1 109 ? 15.357 57.088 41.285  1.00 50.57  ? 136  TYR G OH  1 
ATOM   8629  N N   . LYS G  1 110 ? 16.583 56.601 46.941  1.00 51.83  ? 137  LYS G N   1 
ATOM   8630  C CA  . LYS G  1 110 ? 15.376 57.356 47.178  1.00 51.16  ? 137  LYS G CA  1 
ATOM   8631  C C   . LYS G  1 110 ? 15.155 58.412 46.106  1.00 51.13  ? 137  LYS G C   1 
ATOM   8632  O O   . LYS G  1 110 ? 14.480 59.415 46.329  1.00 50.36  ? 137  LYS G O   1 
ATOM   8633  C CB  . LYS G  1 110 ? 15.414 57.951 48.585  1.00 52.47  ? 137  LYS G CB  1 
ATOM   8634  C CG  . LYS G  1 110 ? 15.300 56.854 49.642  1.00 53.92  ? 137  LYS G CG  1 
ATOM   8635  C CD  . LYS G  1 110 ? 15.586 57.287 51.073  1.00 53.59  ? 137  LYS G CD  1 
ATOM   8636  C CE  . LYS G  1 110 ? 15.563 56.056 51.993  1.00 53.74  ? 137  LYS G CE  1 
ATOM   8637  N NZ  . LYS G  1 110 ? 16.126 56.300 53.354  1.00 54.26  ? 137  LYS G NZ  1 
ATOM   8638  N N   . GLY G  1 111 ? 15.722 58.158 44.928  1.00 51.09  ? 138  GLY G N   1 
ATOM   8639  C CA  . GLY G  1 111 ? 15.573 59.068 43.810  1.00 51.54  ? 138  GLY G CA  1 
ATOM   8640  C C   . GLY G  1 111 ? 14.131 59.073 43.355  1.00 52.83  ? 138  GLY G C   1 
ATOM   8641  O O   . GLY G  1 111 ? 13.301 58.406 43.958  1.00 53.51  ? 138  GLY G O   1 
ATOM   8642  N N   . THR G  1 112 ? 13.823 59.795 42.283  1.00 54.09  ? 139  THR G N   1 
ATOM   8643  C CA  . THR G  1 112 ? 12.447 59.873 41.823  1.00 55.23  ? 139  THR G CA  1 
ATOM   8644  C C   . THR G  1 112 ? 12.131 59.254 40.478  1.00 55.98  ? 139  THR G C   1 
ATOM   8645  O O   . THR G  1 112 ? 11.134 59.620 39.857  1.00 57.73  ? 139  THR G O   1 
ATOM   8646  C CB  . THR G  1 112 ? 11.966 61.318 41.783  1.00 55.37  ? 139  THR G CB  1 
ATOM   8647  O OG1 . THR G  1 112 ? 12.755 62.053 40.839  1.00 57.60  ? 139  THR G OG1 1 
ATOM   8648  C CG2 . THR G  1 112 ? 12.093 61.950 43.150  1.00 56.08  ? 139  THR G CG2 1 
ATOM   8649  N N   . VAL G  1 113 ? 12.963 58.330 40.013  1.00 56.51  ? 140  VAL G N   1 
ATOM   8650  C CA  . VAL G  1 113 ? 12.677 57.669 38.744  1.00 58.06  ? 140  VAL G CA  1 
ATOM   8651  C C   . VAL G  1 113 ? 11.419 56.812 38.928  1.00 59.54  ? 140  VAL G C   1 
ATOM   8652  O O   . VAL G  1 113 ? 11.266 56.118 39.934  1.00 59.11  ? 140  VAL G O   1 
ATOM   8653  C CB  . VAL G  1 113 ? 13.835 56.763 38.302  1.00 57.30  ? 140  VAL G CB  1 
ATOM   8654  C CG1 . VAL G  1 113 ? 13.393 55.896 37.137  1.00 56.75  ? 140  VAL G CG1 1 
ATOM   8655  C CG2 . VAL G  1 113 ? 15.030 57.605 37.912  1.00 57.11  ? 140  VAL G CG2 1 
ATOM   8656  N N   . SER G  1 114 ? 10.517 56.859 37.957  1.00 61.30  ? 141  SER G N   1 
ATOM   8657  C CA  . SER G  1 114 ? 9.282  56.094 38.052  1.00 62.62  ? 141  SER G CA  1 
ATOM   8658  C C   . SER G  1 114 ? 8.939  55.427 36.732  1.00 62.35  ? 141  SER G C   1 
ATOM   8659  O O   . SER G  1 114 ? 7.777  55.404 36.324  1.00 62.03  ? 141  SER G O   1 
ATOM   8660  C CB  . SER G  1 114 ? 8.141  57.016 38.491  1.00 64.43  ? 141  SER G CB  1 
ATOM   8661  O OG  . SER G  1 114 ? 8.069  58.173 37.671  1.00 67.20  ? 141  SER G OG  1 
ATOM   8662  N N   . ILE G  1 115 ? 9.963  54.899 36.067  1.00 62.72  ? 142  ILE G N   1 
ATOM   8663  C CA  . ILE G  1 115 ? 9.799  54.223 34.786  1.00 63.54  ? 142  ILE G CA  1 
ATOM   8664  C C   . ILE G  1 115 ? 10.610 52.937 34.746  1.00 64.65  ? 142  ILE G C   1 
ATOM   8665  O O   . ILE G  1 115 ? 11.797 52.931 35.096  1.00 64.99  ? 142  ILE G O   1 
ATOM   8666  C CB  . ILE G  1 115 ? 10.243 55.130 33.595  1.00 62.84  ? 142  ILE G CB  1 
ATOM   8667  C CG1 . ILE G  1 115 ? 9.084  56.032 33.150  1.00 61.91  ? 142  ILE G CG1 1 
ATOM   8668  C CG2 . ILE G  1 115 ? 10.725 54.277 32.422  1.00 62.04  ? 142  ILE G CG2 1 
ATOM   8669  C CD1 . ILE G  1 115 ? 8.747  57.136 34.121  1.00 61.52  ? 142  ILE G CD1 1 
ATOM   8670  N N   . THR G  1 116 ? 9.966  51.854 34.313  1.00 65.72  ? 143  THR G N   1 
ATOM   8671  C CA  . THR G  1 116 ? 10.624 50.552 34.208  1.00 67.17  ? 143  THR G CA  1 
ATOM   8672  C C   . THR G  1 116 ? 11.607 50.618 33.041  1.00 67.67  ? 143  THR G C   1 
ATOM   8673  O O   . THR G  1 116 ? 11.449 51.453 32.147  1.00 67.60  ? 143  THR G O   1 
ATOM   8674  C CB  . THR G  1 116 ? 9.603  49.436 33.951  1.00 67.10  ? 143  THR G CB  1 
ATOM   8675  O OG1 . THR G  1 116 ? 8.898  49.707 32.732  1.00 68.03  ? 143  THR G OG1 1 
ATOM   8676  C CG2 . THR G  1 116 ? 8.612  49.358 35.093  1.00 67.21  ? 143  THR G CG2 1 
ATOM   8677  N N   . LYS G  1 117 ? 12.614 49.748 33.034  1.00 67.84  ? 144  LYS G N   1 
ATOM   8678  C CA  . LYS G  1 117 ? 13.591 49.795 31.959  1.00 67.63  ? 144  LYS G CA  1 
ATOM   8679  C C   . LYS G  1 117 ? 12.978 49.519 30.596  1.00 67.02  ? 144  LYS G C   1 
ATOM   8680  O O   . LYS G  1 117 ? 13.650 49.644 29.574  1.00 67.23  ? 144  LYS G O   1 
ATOM   8681  C CB  . LYS G  1 117 ? 14.764 48.848 32.239  1.00 69.10  ? 144  LYS G CB  1 
ATOM   8682  C CG  . LYS G  1 117 ? 14.532 47.378 31.966  1.00 71.40  ? 144  LYS G CG  1 
ATOM   8683  C CD  . LYS G  1 117 ? 15.852 46.624 32.126  1.00 72.70  ? 144  LYS G CD  1 
ATOM   8684  C CE  . LYS G  1 117 ? 15.703 45.131 31.867  1.00 74.00  ? 144  LYS G CE  1 
ATOM   8685  N NZ  . LYS G  1 117 ? 16.973 44.402 32.178  1.00 75.58  ? 144  LYS G NZ  1 
ATOM   8686  N N   . SER G  1 118 ? 11.699 49.157 30.584  1.00 66.61  ? 145  SER G N   1 
ATOM   8687  C CA  . SER G  1 118 ? 10.990 48.911 29.334  1.00 67.27  ? 145  SER G CA  1 
ATOM   8688  C C   . SER G  1 118 ? 10.123 50.112 29.008  1.00 67.66  ? 145  SER G C   1 
ATOM   8689  O O   . SER G  1 118 ? 9.327  50.081 28.070  1.00 68.05  ? 145  SER G O   1 
ATOM   8690  C CB  . SER G  1 118 ? 10.110 47.676 29.434  1.00 66.95  ? 145  SER G CB  1 
ATOM   8691  O OG  . SER G  1 118 ? 10.905 46.513 29.460  1.00 68.56  ? 145  SER G OG  1 
ATOM   8692  N N   . GLY G  1 119 ? 10.268 51.162 29.809  1.00 67.78  ? 146  GLY G N   1 
ATOM   8693  C CA  . GLY G  1 119 ? 9.516  52.378 29.579  1.00 67.44  ? 146  GLY G CA  1 
ATOM   8694  C C   . GLY G  1 119 ? 8.101  52.392 30.104  1.00 67.38  ? 146  GLY G C   1 
ATOM   8695  O O   . GLY G  1 119 ? 7.300  53.211 29.674  1.00 67.65  ? 146  GLY G O   1 
ATOM   8696  N N   . ILE G  1 120 ? 7.777  51.494 31.023  1.00 67.37  ? 147  ILE G N   1 
ATOM   8697  C CA  . ILE G  1 120 ? 6.434  51.475 31.579  1.00 67.55  ? 147  ILE G CA  1 
ATOM   8698  C C   . ILE G  1 120 ? 6.376  52.409 32.779  1.00 67.26  ? 147  ILE G C   1 
ATOM   8699  O O   . ILE G  1 120 ? 7.297  52.439 33.601  1.00 67.25  ? 147  ILE G O   1 
ATOM   8700  C CB  . ILE G  1 120 ? 6.027  50.070 32.061  1.00 68.04  ? 147  ILE G CB  1 
ATOM   8701  C CG1 . ILE G  1 120 ? 6.191  49.057 30.923  1.00 68.88  ? 147  ILE G CG1 1 
ATOM   8702  C CG2 . ILE G  1 120 ? 4.579  50.096 32.567  1.00 67.04  ? 147  ILE G CG2 1 
ATOM   8703  C CD1 . ILE G  1 120 ? 5.914  47.613 31.334  1.00 68.54  ? 147  ILE G CD1 1 
ATOM   8704  N N   . LYS G  1 121 ? 5.298  53.179 32.872  1.00 66.59  ? 148  LYS G N   1 
ATOM   8705  C CA  . LYS G  1 121 ? 5.114  54.083 33.998  1.00 65.40  ? 148  LYS G CA  1 
ATOM   8706  C C   . LYS G  1 121 ? 4.810  53.222 35.229  1.00 64.37  ? 148  LYS G C   1 
ATOM   8707  O O   . LYS G  1 121 ? 4.078  52.234 35.139  1.00 64.69  ? 148  LYS G O   1 
ATOM   8708  C CB  . LYS G  1 121 ? 3.949  55.040 33.726  1.00 65.51  ? 148  LYS G CB  1 
ATOM   8709  C CG  . LYS G  1 121 ? 3.669  55.996 34.866  1.00 65.34  ? 148  LYS G CG  1 
ATOM   8710  C CD  . LYS G  1 121 ? 2.578  56.987 34.517  1.00 65.35  ? 148  LYS G CD  1 
ATOM   8711  C CE  . LYS G  1 121 ? 2.463  58.048 35.604  1.00 65.93  ? 148  LYS G CE  1 
ATOM   8712  N NZ  . LYS G  1 121 ? 1.540  59.167 35.243  1.00 67.42  ? 148  LYS G NZ  1 
ATOM   8713  N N   . CYS G  1 122 ? 5.374  53.588 36.373  1.00 62.75  ? 149  CYS G N   1 
ATOM   8714  C CA  . CYS G  1 122 ? 5.149  52.828 37.590  1.00 61.05  ? 149  CYS G CA  1 
ATOM   8715  C C   . CYS G  1 122 ? 3.757  53.037 38.177  1.00 60.50  ? 149  CYS G C   1 
ATOM   8716  O O   . CYS G  1 122 ? 3.084  54.032 37.893  1.00 61.25  ? 149  CYS G O   1 
ATOM   8717  C CB  . CYS G  1 122 ? 6.188  53.200 38.644  1.00 60.91  ? 149  CYS G CB  1 
ATOM   8718  S SG  . CYS G  1 122 ? 7.886  52.636 38.308  1.00 60.92  ? 149  CYS G SG  1 
ATOM   8719  N N   . GLN G  1 123 ? 3.337  52.078 38.999  1.00 59.33  ? 150  GLN G N   1 
ATOM   8720  C CA  . GLN G  1 123 ? 2.045  52.119 39.676  1.00 56.80  ? 150  GLN G CA  1 
ATOM   8721  C C   . GLN G  1 123 ? 2.292  52.639 41.070  1.00 56.62  ? 150  GLN G C   1 
ATOM   8722  O O   . GLN G  1 123 ? 3.260  52.253 41.712  1.00 57.72  ? 150  GLN G O   1 
ATOM   8723  C CB  . GLN G  1 123 ? 1.449  50.718 39.799  1.00 55.13  ? 150  GLN G CB  1 
ATOM   8724  C CG  . GLN G  1 123 ? 0.230  50.640 40.720  1.00 51.55  ? 150  GLN G CG  1 
ATOM   8725  C CD  . GLN G  1 123 ? -0.211 49.209 41.004  1.00 49.28  ? 150  GLN G CD  1 
ATOM   8726  O OE1 . GLN G  1 123 ? -0.184 48.347 40.124  1.00 47.83  ? 150  GLN G OE1 1 
ATOM   8727  N NE2 . GLN G  1 123 ? -0.636 48.957 42.233  1.00 47.11  ? 150  GLN G NE2 1 
ATOM   8728  N N   . PRO G  1 124 ? 1.425  53.526 41.562  1.00 56.97  ? 151  PRO G N   1 
ATOM   8729  C CA  . PRO G  1 124 ? 1.616  54.057 42.916  1.00 57.00  ? 151  PRO G CA  1 
ATOM   8730  C C   . PRO G  1 124 ? 1.662  52.891 43.898  1.00 56.55  ? 151  PRO G C   1 
ATOM   8731  O O   . PRO G  1 124 ? 0.915  51.927 43.759  1.00 55.80  ? 151  PRO G O   1 
ATOM   8732  C CB  . PRO G  1 124 ? 0.375  54.920 43.128  1.00 57.16  ? 151  PRO G CB  1 
ATOM   8733  C CG  . PRO G  1 124 ? 0.038  55.377 41.748  1.00 56.97  ? 151  PRO G CG  1 
ATOM   8734  C CD  . PRO G  1 124 ? 0.253  54.135 40.913  1.00 56.95  ? 151  PRO G CD  1 
ATOM   8735  N N   . TRP G  1 125 ? 2.535  52.964 44.887  1.00 56.94  ? 152  TRP G N   1 
ATOM   8736  C CA  . TRP G  1 125 ? 2.603  51.879 45.846  1.00 57.93  ? 152  TRP G CA  1 
ATOM   8737  C C   . TRP G  1 125 ? 1.305  51.813 46.642  1.00 58.87  ? 152  TRP G C   1 
ATOM   8738  O O   . TRP G  1 125 ? 0.807  50.736 46.970  1.00 58.20  ? 152  TRP G O   1 
ATOM   8739  C CB  . TRP G  1 125 ? 3.795  52.081 46.783  1.00 57.74  ? 152  TRP G CB  1 
ATOM   8740  C CG  . TRP G  1 125 ? 5.111  52.043 46.065  1.00 57.38  ? 152  TRP G CG  1 
ATOM   8741  C CD1 . TRP G  1 125 ? 5.810  53.106 45.575  1.00 56.63  ? 152  TRP G CD1 1 
ATOM   8742  C CD2 . TRP G  1 125 ? 5.858  50.872 45.708  1.00 56.75  ? 152  TRP G CD2 1 
ATOM   8743  N NE1 . TRP G  1 125 ? 6.945  52.672 44.935  1.00 56.04  ? 152  TRP G NE1 1 
ATOM   8744  C CE2 . TRP G  1 125 ? 6.997  51.305 45.001  1.00 56.16  ? 152  TRP G CE2 1 
ATOM   8745  C CE3 . TRP G  1 125 ? 5.671  49.497 45.917  1.00 56.65  ? 152  TRP G CE3 1 
ATOM   8746  C CZ2 . TRP G  1 125 ? 7.948  50.417 44.502  1.00 56.69  ? 152  TRP G CZ2 1 
ATOM   8747  C CZ3 . TRP G  1 125 ? 6.619  48.614 45.421  1.00 57.58  ? 152  TRP G CZ3 1 
ATOM   8748  C CH2 . TRP G  1 125 ? 7.745  49.078 44.721  1.00 57.01  ? 152  TRP G CH2 1 
ATOM   8749  N N   . SER G  1 126 ? 0.750  52.980 46.942  1.00 60.48  ? 153  SER G N   1 
ATOM   8750  C CA  . SER G  1 126 ? -0.488 53.045 47.701  1.00 61.60  ? 153  SER G CA  1 
ATOM   8751  C C   . SER G  1 126 ? -1.664 52.426 46.938  1.00 62.37  ? 153  SER G C   1 
ATOM   8752  O O   . SER G  1 126 ? -2.659 52.030 47.546  1.00 63.36  ? 153  SER G O   1 
ATOM   8753  C CB  . SER G  1 126 ? -0.810 54.495 48.050  1.00 61.22  ? 153  SER G CB  1 
ATOM   8754  O OG  . SER G  1 126 ? -1.065 55.241 46.872  1.00 62.36  ? 153  SER G OG  1 
ATOM   8755  N N   . SER G  1 127 ? -1.557 52.332 45.614  1.00 62.28  ? 154  SER G N   1 
ATOM   8756  C CA  . SER G  1 127 ? -2.640 51.758 44.820  1.00 61.41  ? 154  SER G CA  1 
ATOM   8757  C C   . SER G  1 127 ? -2.610 50.238 44.730  1.00 61.28  ? 154  SER G C   1 
ATOM   8758  O O   . SER G  1 127 ? -1.581 49.602 44.972  1.00 60.27  ? 154  SER G O   1 
ATOM   8759  C CB  . SER G  1 127 ? -2.630 52.325 43.405  1.00 61.49  ? 154  SER G CB  1 
ATOM   8760  O OG  . SER G  1 127 ? -3.527 51.594 42.581  1.00 62.35  ? 154  SER G OG  1 
ATOM   8761  N N   . MET G  1 128 ? -3.761 49.667 44.378  1.00 61.19  ? 155  MET G N   1 
ATOM   8762  C CA  . MET G  1 128 ? -3.911 48.226 44.226  1.00 61.09  ? 155  MET G CA  1 
ATOM   8763  C C   . MET G  1 128 ? -4.301 47.970 42.785  1.00 62.42  ? 155  MET G C   1 
ATOM   8764  O O   . MET G  1 128 ? -4.631 46.849 42.399  1.00 63.80  ? 155  MET G O   1 
ATOM   8765  C CB  . MET G  1 128 ? -5.009 47.697 45.147  1.00 57.85  ? 155  MET G CB  1 
ATOM   8766  C CG  . MET G  1 128 ? -4.672 47.733 46.617  1.00 56.40  ? 155  MET G CG  1 
ATOM   8767  S SD  . MET G  1 128 ? -3.240 46.717 47.049  1.00 56.55  ? 155  MET G SD  1 
ATOM   8768  C CE  . MET G  1 128 ? -2.344 47.806 48.110  1.00 53.88  ? 155  MET G CE  1 
ATOM   8769  N N   . ILE G  1 129 ? -4.262 49.027 41.988  1.00 63.82  ? 156  ILE G N   1 
ATOM   8770  C CA  . ILE G  1 129 ? -4.626 48.926 40.588  1.00 65.55  ? 156  ILE G CA  1 
ATOM   8771  C C   . ILE G  1 129 ? -3.489 49.379 39.679  1.00 65.42  ? 156  ILE G C   1 
ATOM   8772  O O   . ILE G  1 129 ? -2.860 50.409 39.930  1.00 65.62  ? 156  ILE G O   1 
ATOM   8773  C CB  . ILE G  1 129 ? -5.861 49.785 40.304  1.00 67.10  ? 156  ILE G CB  1 
ATOM   8774  C CG1 . ILE G  1 129 ? -6.982 49.377 41.265  1.00 67.46  ? 156  ILE G CG1 1 
ATOM   8775  C CG2 . ILE G  1 129 ? -6.284 49.622 38.843  1.00 67.22  ? 156  ILE G CG2 1 
ATOM   8776  C CD1 . ILE G  1 129 ? -8.210 50.237 41.173  1.00 68.63  ? 156  ILE G CD1 1 
ATOM   8777  N N   . PRO G  1 130 ? -3.207 48.606 38.609  1.00 64.94  ? 157  PRO G N   1 
ATOM   8778  C CA  . PRO G  1 130 ? -3.905 47.373 38.233  1.00 64.01  ? 157  PRO G CA  1 
ATOM   8779  C C   . PRO G  1 130 ? -3.361 46.137 38.955  1.00 63.32  ? 157  PRO G C   1 
ATOM   8780  O O   . PRO G  1 130 ? -3.682 45.008 38.588  1.00 63.33  ? 157  PRO G O   1 
ATOM   8781  C CB  . PRO G  1 130 ? -3.665 47.303 36.731  1.00 64.11  ? 157  PRO G CB  1 
ATOM   8782  C CG  . PRO G  1 130 ? -2.273 47.787 36.625  1.00 63.34  ? 157  PRO G CG  1 
ATOM   8783  C CD  . PRO G  1 130 ? -2.274 49.006 37.540  1.00 64.51  ? 157  PRO G CD  1 
ATOM   8784  N N   . HIS G  1 131 ? -2.541 46.342 39.978  1.00 61.75  ? 158  HIS G N   1 
ATOM   8785  C CA  . HIS G  1 131 ? -1.986 45.205 40.688  1.00 60.18  ? 158  HIS G CA  1 
ATOM   8786  C C   . HIS G  1 131 ? -2.123 45.309 42.198  1.00 59.15  ? 158  HIS G C   1 
ATOM   8787  O O   . HIS G  1 131 ? -1.656 46.270 42.807  1.00 59.50  ? 158  HIS G O   1 
ATOM   8788  C CB  . HIS G  1 131 ? -0.511 45.026 40.321  1.00 60.47  ? 158  HIS G CB  1 
ATOM   8789  C CG  . HIS G  1 131 ? -0.269 44.827 38.856  1.00 59.68  ? 158  HIS G CG  1 
ATOM   8790  N ND1 . HIS G  1 131 ? -0.012 45.873 37.994  1.00 59.12  ? 158  HIS G ND1 1 
ATOM   8791  C CD2 . HIS G  1 131 ? -0.250 43.703 38.101  1.00 58.67  ? 158  HIS G CD2 1 
ATOM   8792  C CE1 . HIS G  1 131 ? 0.159  45.400 36.771  1.00 58.29  ? 158  HIS G CE1 1 
ATOM   8793  N NE2 . HIS G  1 131 ? 0.019  44.087 36.809  1.00 57.95  ? 158  HIS G NE2 1 
ATOM   8794  N N   . GLU G  1 132 ? -2.784 44.325 42.803  1.00 57.46  ? 159  GLU G N   1 
ATOM   8795  C CA  . GLU G  1 132 ? -2.940 44.307 44.250  1.00 55.36  ? 159  GLU G CA  1 
ATOM   8796  C C   . GLU G  1 132 ? -1.625 43.748 44.759  1.00 55.81  ? 159  GLU G C   1 
ATOM   8797  O O   . GLU G  1 132 ? -1.059 42.824 44.167  1.00 56.23  ? 159  GLU G O   1 
ATOM   8798  C CB  . GLU G  1 132 ? -4.110 43.409 44.670  1.00 53.48  ? 159  GLU G CB  1 
ATOM   8799  C CG  . GLU G  1 132 ? -4.453 43.476 46.154  1.00 49.53  ? 159  GLU G CG  1 
ATOM   8800  C CD  . GLU G  1 132 ? -3.864 42.342 46.949  1.00 47.08  ? 159  GLU G CD  1 
ATOM   8801  O OE1 . GLU G  1 132 ? -2.751 41.906 46.632  1.00 46.07  ? 159  GLU G OE1 1 
ATOM   8802  O OE2 . GLU G  1 132 ? -4.509 41.889 47.907  1.00 46.93  ? 159  GLU G OE2 1 
ATOM   8803  N N   . HIS G  1 133 ? -1.125 44.318 45.845  1.00 55.43  ? 160  HIS G N   1 
ATOM   8804  C CA  . HIS G  1 133 ? 0.144  43.879 46.400  1.00 55.11  ? 160  HIS G CA  1 
ATOM   8805  C C   . HIS G  1 133 ? 0.227  44.176 47.886  1.00 54.19  ? 160  HIS G C   1 
ATOM   8806  O O   . HIS G  1 133 ? -0.600 44.898 48.431  1.00 53.20  ? 160  HIS G O   1 
ATOM   8807  C CB  . HIS G  1 133 ? 1.294  44.589 45.687  1.00 55.78  ? 160  HIS G CB  1 
ATOM   8808  C CG  . HIS G  1 133 ? 1.361  46.051 45.984  1.00 55.53  ? 160  HIS G CG  1 
ATOM   8809  N ND1 . HIS G  1 133 ? 0.538  46.971 45.373  1.00 54.96  ? 160  HIS G ND1 1 
ATOM   8810  C CD2 . HIS G  1 133 ? 2.088  46.740 46.895  1.00 55.55  ? 160  HIS G CD2 1 
ATOM   8811  C CE1 . HIS G  1 133 ? 0.752  48.163 45.901  1.00 56.27  ? 160  HIS G CE1 1 
ATOM   8812  N NE2 . HIS G  1 133 ? 1.688  48.051 46.828  1.00 55.73  ? 160  HIS G NE2 1 
ATOM   8813  N N   . SER G  1 134 ? 1.263  43.636 48.518  1.00 55.41  ? 161  SER G N   1 
ATOM   8814  C CA  . SER G  1 134 ? 1.506  43.791 49.954  1.00 58.35  ? 161  SER G CA  1 
ATOM   8815  C C   . SER G  1 134 ? 2.534  44.862 50.338  1.00 59.49  ? 161  SER G C   1 
ATOM   8816  O O   . SER G  1 134 ? 2.887  44.992 51.516  1.00 59.67  ? 161  SER G O   1 
ATOM   8817  C CB  . SER G  1 134 ? 1.963  42.449 50.546  1.00 58.79  ? 161  SER G CB  1 
ATOM   8818  O OG  . SER G  1 134 ? 3.082  41.916 49.844  1.00 58.19  ? 161  SER G OG  1 
ATOM   8819  N N   . PHE G  1 135 ? 3.006  45.620 49.350  1.00 60.48  ? 162  PHE G N   1 
ATOM   8820  C CA  . PHE G  1 135 ? 4.009  46.658 49.563  1.00 60.33  ? 162  PHE G CA  1 
ATOM   8821  C C   . PHE G  1 135 ? 3.464  48.046 49.879  1.00 61.12  ? 162  PHE G C   1 
ATOM   8822  O O   . PHE G  1 135 ? 3.554  48.969 49.073  1.00 59.66  ? 162  PHE G O   1 
ATOM   8823  C CB  . PHE G  1 135 ? 4.914  46.712 48.344  1.00 59.85  ? 162  PHE G CB  1 
ATOM   8824  C CG  . PHE G  1 135 ? 5.804  45.521 48.217  1.00 60.14  ? 162  PHE G CG  1 
ATOM   8825  C CD1 . PHE G  1 135 ? 7.011  45.466 48.911  1.00 60.69  ? 162  PHE G CD1 1 
ATOM   8826  C CD2 . PHE G  1 135 ? 5.432  44.440 47.427  1.00 60.36  ? 162  PHE G CD2 1 
ATOM   8827  C CE1 . PHE G  1 135 ? 7.843  44.349 48.825  1.00 61.26  ? 162  PHE G CE1 1 
ATOM   8828  C CE2 . PHE G  1 135 ? 6.252  43.314 47.328  1.00 61.47  ? 162  PHE G CE2 1 
ATOM   8829  C CZ  . PHE G  1 135 ? 7.464  43.268 48.031  1.00 61.96  ? 162  PHE G CZ  1 
ATOM   8830  N N   . LEU G  1 136 ? 2.894  48.179 51.068  1.00 62.79  ? 163  LEU G N   1 
ATOM   8831  C CA  . LEU G  1 136 ? 2.350  49.449 51.514  1.00 64.87  ? 163  LEU G CA  1 
ATOM   8832  C C   . LEU G  1 136 ? 3.443  50.239 52.200  1.00 66.72  ? 163  LEU G C   1 
ATOM   8833  O O   . LEU G  1 136 ? 4.353  49.673 52.808  1.00 67.32  ? 163  LEU G O   1 
ATOM   8834  C CB  . LEU G  1 136 ? 1.221  49.246 52.524  1.00 64.88  ? 163  LEU G CB  1 
ATOM   8835  C CG  . LEU G  1 136 ? -0.188 48.916 52.048  1.00 65.04  ? 163  LEU G CG  1 
ATOM   8836  C CD1 . LEU G  1 136 ? -1.131 48.902 53.264  1.00 64.51  ? 163  LEU G CD1 1 
ATOM   8837  C CD2 . LEU G  1 136 ? -0.633 49.951 51.012  1.00 64.10  ? 163  LEU G CD2 1 
ATOM   8838  N N   . PRO G  1 137 ? 3.363  51.569 52.126  1.00 68.05  ? 164  PRO G N   1 
ATOM   8839  C CA  . PRO G  1 137 ? 4.399  52.363 52.786  1.00 68.62  ? 164  PRO G CA  1 
ATOM   8840  C C   . PRO G  1 137 ? 4.455  51.946 54.253  1.00 69.43  ? 164  PRO G C   1 
ATOM   8841  O O   . PRO G  1 137 ? 5.494  51.524 54.750  1.00 69.02  ? 164  PRO G O   1 
ATOM   8842  C CB  . PRO G  1 137 ? 3.898  53.795 52.614  1.00 68.08  ? 164  PRO G CB  1 
ATOM   8843  C CG  . PRO G  1 137 ? 3.108  53.731 51.338  1.00 68.43  ? 164  PRO G CG  1 
ATOM   8844  C CD  . PRO G  1 137 ? 2.357  52.428 51.479  1.00 68.34  ? 164  PRO G CD  1 
ATOM   8845  N N   . SER G  1 138 ? 3.305  52.051 54.917  1.00 70.81  ? 165  SER G N   1 
ATOM   8846  C CA  . SER G  1 138 ? 3.146  51.720 56.333  1.00 71.77  ? 165  SER G CA  1 
ATOM   8847  C C   . SER G  1 138 ? 3.896  50.477 56.825  1.00 72.43  ? 165  SER G C   1 
ATOM   8848  O O   . SER G  1 138 ? 4.540  50.516 57.878  1.00 73.37  ? 165  SER G O   1 
ATOM   8849  C CB  . SER G  1 138 ? 1.655  51.593 56.659  1.00 71.23  ? 165  SER G CB  1 
ATOM   8850  O OG  . SER G  1 138 ? 1.004  50.747 55.730  1.00 71.94  ? 165  SER G OG  1 
ATOM   8851  N N   . SER G  1 139 ? 3.822  49.380 56.080  1.00 72.05  ? 166  SER G N   1 
ATOM   8852  C CA  . SER G  1 139 ? 4.521  48.167 56.488  1.00 71.82  ? 166  SER G CA  1 
ATOM   8853  C C   . SER G  1 139 ? 6.018  48.254 56.166  1.00 71.67  ? 166  SER G C   1 
ATOM   8854  O O   . SER G  1 139 ? 6.818  47.452 56.646  1.00 71.01  ? 166  SER G O   1 
ATOM   8855  C CB  . SER G  1 139 ? 3.899  46.948 55.800  1.00 72.15  ? 166  SER G CB  1 
ATOM   8856  O OG  . SER G  1 139 ? 3.909  47.099 54.393  1.00 72.37  ? 166  SER G OG  1 
ATOM   8857  N N   . TYR G  1 140 ? 6.386  49.238 55.350  1.00 71.98  ? 167  TYR G N   1 
ATOM   8858  C CA  . TYR G  1 140 ? 7.778  49.445 54.957  1.00 72.01  ? 167  TYR G CA  1 
ATOM   8859  C C   . TYR G  1 140 ? 8.231  50.885 55.209  1.00 72.36  ? 167  TYR G C   1 
ATOM   8860  O O   . TYR G  1 140 ? 9.050  51.413 54.457  1.00 72.84  ? 167  TYR G O   1 
ATOM   8861  C CB  . TYR G  1 140 ? 7.972  49.123 53.472  1.00 70.90  ? 167  TYR G CB  1 
ATOM   8862  C CG  . TYR G  1 140 ? 7.949  47.657 53.130  1.00 71.32  ? 167  TYR G CG  1 
ATOM   8863  C CD1 . TYR G  1 140 ? 8.998  46.817 53.498  1.00 71.67  ? 167  TYR G CD1 1 
ATOM   8864  C CD2 . TYR G  1 140 ? 6.890  47.111 52.407  1.00 72.21  ? 167  TYR G CD2 1 
ATOM   8865  C CE1 . TYR G  1 140 ? 8.999  45.462 53.146  1.00 72.73  ? 167  TYR G CE1 1 
ATOM   8866  C CE2 . TYR G  1 140 ? 6.874  45.761 52.053  1.00 73.15  ? 167  TYR G CE2 1 
ATOM   8867  C CZ  . TYR G  1 140 ? 7.933  44.942 52.421  1.00 73.24  ? 167  TYR G CZ  1 
ATOM   8868  O OH  . TYR G  1 140 ? 7.923  43.617 52.041  1.00 73.21  ? 167  TYR G OH  1 
ATOM   8869  N N   . ARG G  1 141 ? 7.700  51.520 56.253  1.00 71.96  ? 168  ARG G N   1 
ATOM   8870  C CA  . ARG G  1 141 ? 8.084  52.895 56.567  1.00 71.20  ? 168  ARG G CA  1 
ATOM   8871  C C   . ARG G  1 141 ? 9.605  52.976 56.582  1.00 70.27  ? 168  ARG G C   1 
ATOM   8872  O O   . ARG G  1 141 ? 10.288 52.088 57.106  1.00 69.56  ? 168  ARG G O   1 
ATOM   8873  C CB  . ARG G  1 141 ? 7.513  53.317 57.917  1.00 71.75  ? 168  ARG G CB  1 
ATOM   8874  N N   . GLY G  1 142 ? 10.127 54.048 56.002  1.00 69.20  ? 169  GLY G N   1 
ATOM   8875  C CA  . GLY G  1 142 ? 11.565 54.220 55.910  1.00 68.72  ? 169  GLY G CA  1 
ATOM   8876  C C   . GLY G  1 142 ? 12.111 53.799 54.548  1.00 67.97  ? 169  GLY G C   1 
ATOM   8877  O O   . GLY G  1 142 ? 13.180 54.252 54.148  1.00 68.28  ? 169  GLY G O   1 
ATOM   8878  N N   . LYS G  1 143 ? 11.395 52.925 53.836  1.00 67.10  ? 170  LYS G N   1 
ATOM   8879  C CA  . LYS G  1 143 ? 11.816 52.464 52.504  1.00 64.74  ? 170  LYS G CA  1 
ATOM   8880  C C   . LYS G  1 143 ? 11.287 53.445 51.469  1.00 63.79  ? 170  LYS G C   1 
ATOM   8881  O O   . LYS G  1 143 ? 11.398 53.216 50.260  1.00 63.42  ? 170  LYS G O   1 
ATOM   8882  C CB  . LYS G  1 143 ? 11.269 51.064 52.216  1.00 63.69  ? 170  LYS G CB  1 
ATOM   8883  N N   . ASP G  1 144 ? 10.700 54.530 51.977  1.00 62.44  ? 171  ASP G N   1 
ATOM   8884  C CA  . ASP G  1 144 ? 10.133 55.603 51.168  1.00 60.68  ? 171  ASP G CA  1 
ATOM   8885  C C   . ASP G  1 144 ? 9.308  55.135 49.974  1.00 59.77  ? 171  ASP G C   1 
ATOM   8886  O O   . ASP G  1 144 ? 9.508  55.587 48.849  1.00 60.29  ? 171  ASP G O   1 
ATOM   8887  C CB  . ASP G  1 144 ? 11.253 56.543 50.707  1.00 60.74  ? 171  ASP G CB  1 
ATOM   8888  C CG  . ASP G  1 144 ? 10.731 57.771 49.968  1.00 60.88  ? 171  ASP G CG  1 
ATOM   8889  O OD1 . ASP G  1 144 ? 9.634  58.284 50.307  1.00 59.99  ? 171  ASP G OD1 1 
ATOM   8890  O OD2 . ASP G  1 144 ? 11.438 58.239 49.051  1.00 59.76  ? 171  ASP G OD2 1 
ATOM   8891  N N   . LEU G  1 145 ? 8.373  54.227 50.219  1.00 58.85  ? 172  LEU G N   1 
ATOM   8892  C CA  . LEU G  1 145 ? 7.518  53.738 49.149  1.00 57.63  ? 172  LEU G CA  1 
ATOM   8893  C C   . LEU G  1 145 ? 6.428  54.764 48.890  1.00 57.65  ? 172  LEU G C   1 
ATOM   8894  O O   . LEU G  1 145 ? 5.248  54.458 48.999  1.00 57.72  ? 172  LEU G O   1 
ATOM   8895  C CB  . LEU G  1 145 ? 6.890  52.401 49.539  1.00 56.46  ? 172  LEU G CB  1 
ATOM   8896  C CG  . LEU G  1 145 ? 7.869  51.235 49.681  1.00 55.73  ? 172  LEU G CG  1 
ATOM   8897  C CD1 . LEU G  1 145 ? 7.119  49.981 50.070  1.00 55.15  ? 172  LEU G CD1 1 
ATOM   8898  C CD2 . LEU G  1 145 ? 8.603  51.021 48.371  1.00 54.78  ? 172  LEU G CD2 1 
ATOM   8899  N N   . GLN G  1 146 ? 6.826  55.997 48.592  1.00 58.33  ? 173  GLN G N   1 
ATOM   8900  C CA  . GLN G  1 146 ? 5.865  57.063 48.314  1.00 58.47  ? 173  GLN G CA  1 
ATOM   8901  C C   . GLN G  1 146 ? 5.722  57.190 46.795  1.00 59.41  ? 173  GLN G C   1 
ATOM   8902  O O   . GLN G  1 146 ? 6.559  56.679 46.041  1.00 60.48  ? 173  GLN G O   1 
ATOM   8903  C CB  . GLN G  1 146 ? 6.345  58.377 48.920  1.00 57.63  ? 173  GLN G CB  1 
ATOM   8904  N N   . GLU G  1 147 ? 4.671  57.868 46.344  1.00 59.22  ? 174  GLU G N   1 
ATOM   8905  C CA  . GLU G  1 147 ? 4.421  58.025 44.909  1.00 58.69  ? 174  GLU G CA  1 
ATOM   8906  C C   . GLU G  1 147 ? 4.513  56.703 44.161  1.00 59.25  ? 174  GLU G C   1 
ATOM   8907  O O   . GLU G  1 147 ? 4.004  55.670 44.615  1.00 59.54  ? 174  GLU G O   1 
ATOM   8908  C CB  . GLU G  1 147 ? 5.400  59.020 44.289  1.00 57.21  ? 174  GLU G CB  1 
ATOM   8909  C CG  . GLU G  1 147 ? 5.018  60.447 44.559  1.00 56.63  ? 174  GLU G CG  1 
ATOM   8910  C CD  . GLU G  1 147 ? 3.559  60.697 44.250  1.00 55.78  ? 174  GLU G CD  1 
ATOM   8911  O OE1 . GLU G  1 147 ? 3.126  60.410 43.113  1.00 56.71  ? 174  GLU G OE1 1 
ATOM   8912  O OE2 . GLU G  1 147 ? 2.838  61.177 45.144  1.00 54.40  ? 174  GLU G OE2 1 
ATOM   8913  N N   . ASN G  1 148 ? 5.145  56.746 42.996  1.00 59.17  ? 175  ASN G N   1 
ATOM   8914  C CA  . ASN G  1 148 ? 5.315  55.538 42.211  1.00 59.57  ? 175  ASN G CA  1 
ATOM   8915  C C   . ASN G  1 148 ? 6.781  55.418 41.831  1.00 59.23  ? 175  ASN G C   1 
ATOM   8916  O O   . ASN G  1 148 ? 7.121  54.932 40.758  1.00 59.02  ? 175  ASN G O   1 
ATOM   8917  C CB  . ASN G  1 148 ? 4.432  55.582 40.962  1.00 61.02  ? 175  ASN G CB  1 
ATOM   8918  C CG  . ASN G  1 148 ? 4.881  56.632 39.963  1.00 62.72  ? 175  ASN G CG  1 
ATOM   8919  O OD1 . ASN G  1 148 ? 5.234  57.751 40.343  1.00 63.54  ? 175  ASN G OD1 1 
ATOM   8920  N ND2 . ASN G  1 148 ? 4.860  56.283 38.674  1.00 62.34  ? 175  ASN G ND2 1 
ATOM   8921  N N   . TYR G  1 149 ? 7.650  55.865 42.733  1.00 59.43  ? 176  TYR G N   1 
ATOM   8922  C CA  . TYR G  1 149 ? 9.089  55.821 42.506  1.00 58.59  ? 176  TYR G CA  1 
ATOM   8923  C C   . TYR G  1 149 ? 9.644  54.412 42.641  1.00 58.23  ? 176  TYR G C   1 
ATOM   8924  O O   . TYR G  1 149 ? 9.253  53.659 43.539  1.00 58.01  ? 176  TYR G O   1 
ATOM   8925  C CB  . TYR G  1 149 ? 9.825  56.694 43.515  1.00 58.81  ? 176  TYR G CB  1 
ATOM   8926  C CG  . TYR G  1 149 ? 9.290  58.086 43.680  1.00 59.91  ? 176  TYR G CG  1 
ATOM   8927  C CD1 . TYR G  1 149 ? 9.130  58.929 42.586  1.00 60.57  ? 176  TYR G CD1 1 
ATOM   8928  C CD2 . TYR G  1 149 ? 9.003  58.586 44.949  1.00 60.56  ? 176  TYR G CD2 1 
ATOM   8929  C CE1 . TYR G  1 149 ? 8.700  60.243 42.754  1.00 62.02  ? 176  TYR G CE1 1 
ATOM   8930  C CE2 . TYR G  1 149 ? 8.576  59.892 45.130  1.00 61.60  ? 176  TYR G CE2 1 
ATOM   8931  C CZ  . TYR G  1 149 ? 8.426  60.716 44.035  1.00 62.14  ? 176  TYR G CZ  1 
ATOM   8932  O OH  . TYR G  1 149 ? 8.011  62.013 44.237  1.00 63.89  ? 176  TYR G OH  1 
ATOM   8933  N N   . CYS G  1 150 ? 10.572 54.066 41.754  1.00 57.53  ? 177  CYS G N   1 
ATOM   8934  C CA  . CYS G  1 150 ? 11.214 52.764 41.799  1.00 56.31  ? 177  CYS G CA  1 
ATOM   8935  C C   . CYS G  1 150 ? 11.920 52.649 43.140  1.00 55.71  ? 177  CYS G C   1 
ATOM   8936  O O   . CYS G  1 150 ? 12.599 53.573 43.588  1.00 53.70  ? 177  CYS G O   1 
ATOM   8937  C CB  . CYS G  1 150 ? 12.240 52.647 40.692  1.00 55.53  ? 177  CYS G CB  1 
ATOM   8938  S SG  . CYS G  1 150 ? 11.547 52.881 39.042  1.00 55.90  ? 177  CYS G SG  1 
ATOM   8939  N N   . ARG G  1 151 ? 11.761 51.505 43.778  1.00 55.58  ? 178  ARG G N   1 
ATOM   8940  C CA  . ARG G  1 151 ? 12.371 51.295 45.065  1.00 57.42  ? 178  ARG G CA  1 
ATOM   8941  C C   . ARG G  1 151 ? 12.797 49.845 45.136  1.00 59.48  ? 178  ARG G C   1 
ATOM   8942  O O   . ARG G  1 151 ? 12.557 49.081 44.208  1.00 60.01  ? 178  ARG G O   1 
ATOM   8943  C CB  . ARG G  1 151 ? 11.352 51.618 46.165  1.00 56.91  ? 178  ARG G CB  1 
ATOM   8944  C CG  . ARG G  1 151 ? 10.963 53.088 46.257  1.00 55.69  ? 178  ARG G CG  1 
ATOM   8945  C CD  . ARG G  1 151 ? 11.964 53.833 47.121  1.00 56.31  ? 178  ARG G CD  1 
ATOM   8946  N NE  . ARG G  1 151 ? 11.695 55.265 47.237  1.00 55.95  ? 178  ARG G NE  1 
ATOM   8947  C CZ  . ARG G  1 151 ? 12.026 56.176 46.325  1.00 56.49  ? 178  ARG G CZ  1 
ATOM   8948  N NH1 . ARG G  1 151 ? 12.648 55.811 45.206  1.00 56.68  ? 178  ARG G NH1 1 
ATOM   8949  N NH2 . ARG G  1 151 ? 11.744 57.458 46.540  1.00 56.11  ? 178  ARG G NH2 1 
ATOM   8950  N N   . ASN G  1 152 ? 13.451 49.479 46.229  1.00 62.32  ? 179  ASN G N   1 
ATOM   8951  C CA  . ASN G  1 152 ? 13.884 48.107 46.446  1.00 65.68  ? 179  ASN G CA  1 
ATOM   8952  C C   . ASN G  1 152 ? 13.797 47.900 47.954  1.00 66.98  ? 179  ASN G C   1 
ATOM   8953  O O   . ASN G  1 152 ? 14.812 47.738 48.632  1.00 67.44  ? 179  ASN G O   1 
ATOM   8954  C CB  . ASN G  1 152 ? 15.315 47.911 45.947  1.00 67.22  ? 179  ASN G CB  1 
ATOM   8955  C CG  . ASN G  1 152 ? 15.784 46.476 46.078  1.00 68.91  ? 179  ASN G CG  1 
ATOM   8956  O OD1 . ASN G  1 152 ? 15.003 45.577 46.405  1.00 69.96  ? 179  ASN G OD1 1 
ATOM   8957  N ND2 . ASN G  1 152 ? 17.065 46.252 45.817  1.00 69.95  ? 179  ASN G ND2 1 
ATOM   8958  N N   . PRO G  1 153 ? 12.564 47.899 48.492  1.00 67.82  ? 180  PRO G N   1 
ATOM   8959  C CA  . PRO G  1 153 ? 12.281 47.730 49.916  1.00 69.24  ? 180  PRO G CA  1 
ATOM   8960  C C   . PRO G  1 153 ? 12.774 46.434 50.539  1.00 71.90  ? 180  PRO G C   1 
ATOM   8961  O O   . PRO G  1 153 ? 12.830 46.313 51.766  1.00 72.94  ? 180  PRO G O   1 
ATOM   8962  C CB  . PRO G  1 153 ? 10.764 47.871 49.976  1.00 67.66  ? 180  PRO G CB  1 
ATOM   8963  C CG  . PRO G  1 153 ? 10.336 47.276 48.696  1.00 66.94  ? 180  PRO G CG  1 
ATOM   8964  C CD  . PRO G  1 153 ? 11.309 47.876 47.718  1.00 67.21  ? 180  PRO G CD  1 
ATOM   8965  N N   . ARG G  1 154 ? 13.123 45.465 49.699  1.00 74.03  ? 181  ARG G N   1 
ATOM   8966  C CA  . ARG G  1 154 ? 13.600 44.186 50.203  1.00 76.42  ? 181  ARG G CA  1 
ATOM   8967  C C   . ARG G  1 154 ? 15.042 43.954 49.765  1.00 76.60  ? 181  ARG G C   1 
ATOM   8968  O O   . ARG G  1 154 ? 15.504 42.813 49.709  1.00 76.85  ? 181  ARG G O   1 
ATOM   8969  C CB  . ARG G  1 154 ? 12.710 43.032 49.705  1.00 78.65  ? 181  ARG G CB  1 
ATOM   8970  C CG  . ARG G  1 154 ? 11.211 43.353 49.602  1.00 82.01  ? 181  ARG G CG  1 
ATOM   8971  C CD  . ARG G  1 154 ? 10.365 42.092 49.697  1.00 84.21  ? 181  ARG G CD  1 
ATOM   8972  N NE  . ARG G  1 154 ? 10.346 41.606 51.073  1.00 87.88  ? 181  ARG G NE  1 
ATOM   8973  C CZ  . ARG G  1 154 ? 9.883  40.419 51.455  1.00 89.37  ? 181  ARG G CZ  1 
ATOM   8974  N NH1 . ARG G  1 154 ? 9.395  39.571 50.558  1.00 90.21  ? 181  ARG G NH1 1 
ATOM   8975  N NH2 . ARG G  1 154 ? 9.906  40.082 52.742  1.00 90.26  ? 181  ARG G NH2 1 
ATOM   8976  N N   . GLY G  1 155 ? 15.740 45.046 49.456  1.00 76.53  ? 182  GLY G N   1 
ATOM   8977  C CA  . GLY G  1 155 ? 17.129 44.964 49.035  1.00 76.29  ? 182  GLY G CA  1 
ATOM   8978  C C   . GLY G  1 155 ? 17.469 43.679 48.304  1.00 75.61  ? 182  GLY G C   1 
ATOM   8979  O O   . GLY G  1 155 ? 18.504 43.062 48.554  1.00 76.51  ? 182  GLY G O   1 
ATOM   8980  N N   . GLU G  1 156 ? 16.590 43.272 47.398  1.00 74.06  ? 183  GLU G N   1 
ATOM   8981  C CA  . GLU G  1 156 ? 16.798 42.053 46.641  1.00 73.72  ? 183  GLU G CA  1 
ATOM   8982  C C   . GLU G  1 156 ? 17.705 42.355 45.472  1.00 72.61  ? 183  GLU G C   1 
ATOM   8983  O O   . GLU G  1 156 ? 17.801 43.499 45.043  1.00 73.18  ? 183  GLU G O   1 
ATOM   8984  C CB  . GLU G  1 156 ? 15.465 41.541 46.108  1.00 75.94  ? 183  GLU G CB  1 
ATOM   8985  C CG  . GLU G  1 156 ? 14.337 41.547 47.126  1.00 79.37  ? 183  GLU G CG  1 
ATOM   8986  C CD  . GLU G  1 156 ? 12.987 41.197 46.512  1.00 81.68  ? 183  GLU G CD  1 
ATOM   8987  O OE1 . GLU G  1 156 ? 12.829 40.051 46.034  1.00 82.81  ? 183  GLU G OE1 1 
ATOM   8988  O OE2 . GLU G  1 156 ? 12.084 42.068 46.505  1.00 82.94  ? 183  GLU G OE2 1 
ATOM   8989  N N   . GLU G  1 157 ? 18.373 41.337 44.946  1.00 71.61  ? 184  GLU G N   1 
ATOM   8990  C CA  . GLU G  1 157 ? 19.225 41.568 43.792  1.00 70.58  ? 184  GLU G CA  1 
ATOM   8991  C C   . GLU G  1 157 ? 18.252 42.115 42.769  1.00 69.59  ? 184  GLU G C   1 
ATOM   8992  O O   . GLU G  1 157 ? 17.042 41.986 42.928  1.00 69.73  ? 184  GLU G O   1 
ATOM   8993  C CB  . GLU G  1 157 ? 19.841 40.263 43.294  1.00 70.93  ? 184  GLU G CB  1 
ATOM   8994  N N   . GLY G  1 158 ? 18.763 42.738 41.725  1.00 68.86  ? 185  GLY G N   1 
ATOM   8995  C CA  . GLY G  1 158 ? 17.860 43.280 40.734  1.00 68.03  ? 185  GLY G CA  1 
ATOM   8996  C C   . GLY G  1 158 ? 17.639 44.755 40.996  1.00 67.69  ? 185  GLY G C   1 
ATOM   8997  O O   . GLY G  1 158 ? 17.116 45.475 40.144  1.00 67.61  ? 185  GLY G O   1 
ATOM   8998  N N   . GLY G  1 159 ? 18.038 45.202 42.184  1.00 66.42  ? 186  GLY G N   1 
ATOM   8999  C CA  . GLY G  1 159 ? 17.897 46.599 42.541  1.00 64.88  ? 186  GLY G CA  1 
ATOM   9000  C C   . GLY G  1 159 ? 16.479 47.120 42.464  1.00 63.59  ? 186  GLY G C   1 
ATOM   9001  O O   . GLY G  1 159 ? 15.533 46.339 42.429  1.00 63.84  ? 186  GLY G O   1 
ATOM   9002  N N   . PRO G  1 160 ? 16.306 48.449 42.436  1.00 62.34  ? 187  PRO G N   1 
ATOM   9003  C CA  . PRO G  1 160 ? 15.010 49.124 42.364  1.00 61.35  ? 187  PRO G CA  1 
ATOM   9004  C C   . PRO G  1 160 ? 14.066 48.613 41.283  1.00 60.54  ? 187  PRO G C   1 
ATOM   9005  O O   . PRO G  1 160 ? 14.463 48.345 40.145  1.00 60.62  ? 187  PRO G O   1 
ATOM   9006  C CB  . PRO G  1 160 ? 15.402 50.581 42.155  1.00 61.86  ? 187  PRO G CB  1 
ATOM   9007  C CG  . PRO G  1 160 ? 16.646 50.680 42.972  1.00 61.91  ? 187  PRO G CG  1 
ATOM   9008  C CD  . PRO G  1 160 ? 17.393 49.436 42.556  1.00 61.78  ? 187  PRO G CD  1 
ATOM   9009  N N   . TRP G  1 161 ? 12.802 48.492 41.665  1.00 59.48  ? 188  TRP G N   1 
ATOM   9010  C CA  . TRP G  1 161 ? 11.754 48.022 40.776  1.00 58.41  ? 188  TRP G CA  1 
ATOM   9011  C C   . TRP G  1 161 ? 10.461 48.733 41.160  1.00 58.07  ? 188  TRP G C   1 
ATOM   9012  O O   . TRP G  1 161 ? 10.461 49.619 42.016  1.00 57.26  ? 188  TRP G O   1 
ATOM   9013  C CB  . TRP G  1 161 ? 11.570 46.518 40.941  1.00 57.06  ? 188  TRP G CB  1 
ATOM   9014  C CG  . TRP G  1 161 ? 11.254 46.133 42.350  1.00 55.56  ? 188  TRP G CG  1 
ATOM   9015  C CD1 . TRP G  1 161 ? 12.139 45.991 43.378  1.00 54.77  ? 188  TRP G CD1 1 
ATOM   9016  C CD2 . TRP G  1 161 ? 9.955  45.885 42.901  1.00 54.90  ? 188  TRP G CD2 1 
ATOM   9017  N NE1 . TRP G  1 161 ? 11.475 45.668 44.538  1.00 54.09  ? 188  TRP G NE1 1 
ATOM   9018  C CE2 . TRP G  1 161 ? 10.132 45.597 44.275  1.00 55.15  ? 188  TRP G CE2 1 
ATOM   9019  C CE3 . TRP G  1 161 ? 8.659  45.881 42.369  1.00 53.31  ? 188  TRP G CE3 1 
ATOM   9020  C CZ2 . TRP G  1 161 ? 9.057  45.306 45.127  1.00 55.48  ? 188  TRP G CZ2 1 
ATOM   9021  C CZ3 . TRP G  1 161 ? 7.590  45.592 43.218  1.00 55.20  ? 188  TRP G CZ3 1 
ATOM   9022  C CH2 . TRP G  1 161 ? 7.797  45.307 44.583  1.00 54.49  ? 188  TRP G CH2 1 
ATOM   9023  N N   . CYS G  1 162 ? 9.362  48.336 40.532  1.00 58.27  ? 189  CYS G N   1 
ATOM   9024  C CA  . CYS G  1 162 ? 8.078  48.935 40.832  1.00 58.59  ? 189  CYS G CA  1 
ATOM   9025  C C   . CYS G  1 162 ? 6.989  48.164 40.116  1.00 59.03  ? 189  CYS G C   1 
ATOM   9026  O O   . CYS G  1 162 ? 7.259  47.439 39.154  1.00 58.55  ? 189  CYS G O   1 
ATOM   9027  C CB  . CYS G  1 162 ? 8.056  50.396 40.373  1.00 59.35  ? 189  CYS G CB  1 
ATOM   9028  S SG  . CYS G  1 162 ? 7.772  50.628 38.583  1.00 59.73  ? 189  CYS G SG  1 
ATOM   9029  N N   . PHE G  1 163 ? 5.758  48.306 40.597  1.00 59.93  ? 190  PHE G N   1 
ATOM   9030  C CA  . PHE G  1 163 ? 4.626  47.646 39.953  1.00 60.85  ? 190  PHE G CA  1 
ATOM   9031  C C   . PHE G  1 163 ? 4.291  48.518 38.754  1.00 60.77  ? 190  PHE G C   1 
ATOM   9032  O O   . PHE G  1 163 ? 4.106  49.719 38.900  1.00 60.27  ? 190  PHE G O   1 
ATOM   9033  C CB  . PHE G  1 163 ? 3.437  47.555 40.915  1.00 61.12  ? 190  PHE G CB  1 
ATOM   9034  C CG  . PHE G  1 163 ? 3.615  46.517 41.997  1.00 61.51  ? 190  PHE G CG  1 
ATOM   9035  C CD1 . PHE G  1 163 ? 3.558  45.159 41.691  1.00 60.42  ? 190  PHE G CD1 1 
ATOM   9036  C CD2 . PHE G  1 163 ? 3.897  46.892 43.308  1.00 61.30  ? 190  PHE G CD2 1 
ATOM   9037  C CE1 . PHE G  1 163 ? 3.787  44.196 42.672  1.00 59.28  ? 190  PHE G CE1 1 
ATOM   9038  C CE2 . PHE G  1 163 ? 4.127  45.927 44.293  1.00 60.33  ? 190  PHE G CE2 1 
ATOM   9039  C CZ  . PHE G  1 163 ? 4.072  44.581 43.970  1.00 58.52  ? 190  PHE G CZ  1 
ATOM   9040  N N   . THR G  1 164 ? 4.237  47.923 37.567  1.00 61.51  ? 191  THR G N   1 
ATOM   9041  C CA  . THR G  1 164 ? 3.953  48.697 36.363  1.00 62.09  ? 191  THR G CA  1 
ATOM   9042  C C   . THR G  1 164 ? 2.462  48.956 36.141  1.00 62.54  ? 191  THR G C   1 
ATOM   9043  O O   . THR G  1 164 ? 1.609  48.138 36.494  1.00 63.40  ? 191  THR G O   1 
ATOM   9044  C CB  . THR G  1 164 ? 4.540  48.011 35.102  1.00 61.71  ? 191  THR G CB  1 
ATOM   9045  O OG1 . THR G  1 164 ? 3.487  47.418 34.334  1.00 61.81  ? 191  THR G OG1 1 
ATOM   9046  C CG2 . THR G  1 164 ? 5.534  46.935 35.502  1.00 62.33  ? 191  THR G CG2 1 
ATOM   9047  N N   . SER G  1 165 ? 2.158  50.109 35.554  1.00 62.74  ? 192  SER G N   1 
ATOM   9048  C CA  . SER G  1 165 ? 0.780  50.491 35.269  1.00 62.55  ? 192  SER G CA  1 
ATOM   9049  C C   . SER G  1 165 ? 0.164  49.645 34.149  1.00 62.77  ? 192  SER G C   1 
ATOM   9050  O O   . SER G  1 165 ? -1.015 49.803 33.810  1.00 61.83  ? 192  SER G O   1 
ATOM   9051  C CB  . SER G  1 165 ? 0.720  51.974 34.900  1.00 62.14  ? 192  SER G CB  1 
ATOM   9052  O OG  . SER G  1 165 ? 1.704  52.304 33.939  1.00 59.87  ? 192  SER G OG  1 
ATOM   9053  N N   . ASN G  1 166 ? 0.970  48.751 33.578  1.00 63.40  ? 193  ASN G N   1 
ATOM   9054  C CA  . ASN G  1 166 ? 0.510  47.866 32.512  1.00 63.31  ? 193  ASN G CA  1 
ATOM   9055  C C   . ASN G  1 166 ? -0.044 46.596 33.148  1.00 62.80  ? 193  ASN G C   1 
ATOM   9056  O O   . ASN G  1 166 ? 0.697  45.824 33.770  1.00 62.47  ? 193  ASN G O   1 
ATOM   9057  C CB  . ASN G  1 166 ? 1.662  47.493 31.574  1.00 63.79  ? 193  ASN G CB  1 
ATOM   9058  C CG  . ASN G  1 166 ? 1.215  46.592 30.427  1.00 64.25  ? 193  ASN G CG  1 
ATOM   9059  O OD1 . ASN G  1 166 ? 0.288  45.797 30.570  1.00 63.97  ? 193  ASN G OD1 1 
ATOM   9060  N ND2 . ASN G  1 166 ? 1.884  46.707 29.287  1.00 63.72  ? 193  ASN G ND2 1 
ATOM   9061  N N   . PRO G  1 167 ? -1.357 46.360 32.999  1.00 61.57  ? 194  PRO G N   1 
ATOM   9062  C CA  . PRO G  1 167 ? -1.975 45.165 33.576  1.00 60.17  ? 194  PRO G CA  1 
ATOM   9063  C C   . PRO G  1 167 ? -1.272 43.879 33.149  1.00 60.12  ? 194  PRO G C   1 
ATOM   9064  O O   . PRO G  1 167 ? -1.234 42.914 33.905  1.00 59.55  ? 194  PRO G O   1 
ATOM   9065  C CB  . PRO G  1 167 ? -3.404 45.247 33.068  1.00 59.36  ? 194  PRO G CB  1 
ATOM   9066  C CG  . PRO G  1 167 ? -3.635 46.726 32.998  1.00 59.91  ? 194  PRO G CG  1 
ATOM   9067  C CD  . PRO G  1 167 ? -2.367 47.206 32.343  1.00 60.48  ? 194  PRO G CD  1 
ATOM   9068  N N   . GLU G  1 168 ? -0.710 43.873 31.943  1.00 60.43  ? 195  GLU G N   1 
ATOM   9069  C CA  . GLU G  1 168 ? -0.014 42.700 31.424  1.00 61.58  ? 195  GLU G CA  1 
ATOM   9070  C C   . GLU G  1 168 ? 1.329  42.462 32.115  1.00 62.76  ? 195  GLU G C   1 
ATOM   9071  O O   . GLU G  1 168 ? 1.824  41.335 32.139  1.00 63.14  ? 195  GLU G O   1 
ATOM   9072  C CB  . GLU G  1 168 ? 0.193  42.837 29.916  1.00 61.44  ? 195  GLU G CB  1 
ATOM   9073  N N   . VAL G  1 169 ? 1.919  43.517 32.674  1.00 63.61  ? 196  VAL G N   1 
ATOM   9074  C CA  . VAL G  1 169 ? 3.204  43.400 33.360  1.00 64.12  ? 196  VAL G CA  1 
ATOM   9075  C C   . VAL G  1 169 ? 3.014  43.778 34.826  1.00 65.21  ? 196  VAL G C   1 
ATOM   9076  O O   . VAL G  1 169 ? 2.827  44.953 35.146  1.00 65.40  ? 196  VAL G O   1 
ATOM   9077  C CB  . VAL G  1 169 ? 4.250  44.346 32.739  1.00 63.41  ? 196  VAL G CB  1 
ATOM   9078  C CG1 . VAL G  1 169 ? 5.642  43.980 33.235  1.00 63.27  ? 196  VAL G CG1 1 
ATOM   9079  C CG2 . VAL G  1 169 ? 4.168  44.288 31.231  1.00 61.91  ? 196  VAL G CG2 1 
ATOM   9080  N N   . ARG G  1 170 ? 3.063  42.790 35.716  1.00 65.99  ? 197  ARG G N   1 
ATOM   9081  C CA  . ARG G  1 170 ? 2.875  43.065 37.140  1.00 67.43  ? 197  ARG G CA  1 
ATOM   9082  C C   . ARG G  1 170 ? 3.963  43.960 37.718  1.00 68.60  ? 197  ARG G C   1 
ATOM   9083  O O   . ARG G  1 170 ? 3.674  44.949 38.396  1.00 68.32  ? 197  ARG G O   1 
ATOM   9084  C CB  . ARG G  1 170 ? 2.811  41.759 37.940  1.00 66.21  ? 197  ARG G CB  1 
ATOM   9085  C CG  . ARG G  1 170 ? 2.561  41.958 39.440  1.00 63.77  ? 197  ARG G CG  1 
ATOM   9086  C CD  . ARG G  1 170 ? 2.450  40.625 40.171  1.00 62.02  ? 197  ARG G CD  1 
ATOM   9087  N NE  . ARG G  1 170 ? 2.438  40.789 41.623  1.00 61.17  ? 197  ARG G NE  1 
ATOM   9088  C CZ  . ARG G  1 170 ? 1.412  41.260 42.326  1.00 60.58  ? 197  ARG G CZ  1 
ATOM   9089  N NH1 . ARG G  1 170 ? 0.293  41.614 41.712  1.00 61.42  ? 197  ARG G NH1 1 
ATOM   9090  N NH2 . ARG G  1 170 ? 1.511  41.395 43.644  1.00 58.98  ? 197  ARG G NH2 1 
ATOM   9091  N N   . TYR G  1 171 ? 5.214  43.602 37.454  1.00 70.59  ? 198  TYR G N   1 
ATOM   9092  C CA  . TYR G  1 171 ? 6.341  44.379 37.942  1.00 72.78  ? 198  TYR G CA  1 
ATOM   9093  C C   . TYR G  1 171 ? 7.562  44.235 37.046  1.00 72.52  ? 198  TYR G C   1 
ATOM   9094  O O   . TYR G  1 171 ? 7.675  43.294 36.257  1.00 72.07  ? 198  TYR G O   1 
ATOM   9095  C CB  . TYR G  1 171 ? 6.710  43.962 39.375  1.00 75.65  ? 198  TYR G CB  1 
ATOM   9096  C CG  . TYR G  1 171 ? 7.116  42.506 39.532  1.00 79.56  ? 198  TYR G CG  1 
ATOM   9097  C CD1 . TYR G  1 171 ? 6.166  41.524 39.831  1.00 80.81  ? 198  TYR G CD1 1 
ATOM   9098  C CD2 . TYR G  1 171 ? 8.451  42.106 39.369  1.00 80.39  ? 198  TYR G CD2 1 
ATOM   9099  C CE1 . TYR G  1 171 ? 6.529  40.177 39.965  1.00 82.02  ? 198  TYR G CE1 1 
ATOM   9100  C CE2 . TYR G  1 171 ? 8.825  40.761 39.503  1.00 81.79  ? 198  TYR G CE2 1 
ATOM   9101  C CZ  . TYR G  1 171 ? 7.856  39.801 39.800  1.00 82.67  ? 198  TYR G CZ  1 
ATOM   9102  O OH  . TYR G  1 171 ? 8.196  38.465 39.925  1.00 83.61  ? 198  TYR G OH  1 
ATOM   9103  N N   . GLU G  1 172 ? 8.473  45.189 37.178  1.00 72.29  ? 199  GLU G N   1 
ATOM   9104  C CA  . GLU G  1 172 ? 9.699  45.188 36.408  1.00 72.43  ? 199  GLU G CA  1 
ATOM   9105  C C   . GLU G  1 172 ? 10.722 46.105 37.060  1.00 71.80  ? 199  GLU G C   1 
ATOM   9106  O O   . GLU G  1 172 ? 10.368 47.034 37.787  1.00 71.47  ? 199  GLU G O   1 
ATOM   9107  C CB  . GLU G  1 172 ? 9.434  45.644 34.974  1.00 73.38  ? 199  GLU G CB  1 
ATOM   9108  C CG  . GLU G  1 172 ? 10.694 46.073 34.246  1.00 75.39  ? 199  GLU G CG  1 
ATOM   9109  C CD  . GLU G  1 172 ? 10.481 46.262 32.765  1.00 76.95  ? 199  GLU G CD  1 
ATOM   9110  O OE1 . GLU G  1 172 ? 9.447  46.847 32.379  1.00 77.31  ? 199  GLU G OE1 1 
ATOM   9111  O OE2 . GLU G  1 172 ? 11.358 45.831 31.984  1.00 78.95  ? 199  GLU G OE2 1 
ATOM   9112  N N   . VAL G  1 173 ? 11.995 45.834 36.799  1.00 71.00  ? 200  VAL G N   1 
ATOM   9113  C CA  . VAL G  1 173 ? 13.073 46.630 37.358  1.00 69.79  ? 200  VAL G CA  1 
ATOM   9114  C C   . VAL G  1 173 ? 13.234 47.927 36.575  1.00 69.68  ? 200  VAL G C   1 
ATOM   9115  O O   . VAL G  1 173 ? 12.781 48.038 35.425  1.00 69.38  ? 200  VAL G O   1 
ATOM   9116  C CB  . VAL G  1 173 ? 14.399 45.863 37.308  1.00 69.64  ? 200  VAL G CB  1 
ATOM   9117  C CG1 . VAL G  1 173 ? 14.346 44.671 38.248  1.00 68.95  ? 200  VAL G CG1 1 
ATOM   9118  C CG2 . VAL G  1 173 ? 14.674 45.413 35.881  1.00 68.73  ? 200  VAL G CG2 1 
ATOM   9119  N N   . CYS G  1 174 ? 13.882 48.905 37.202  1.00 67.96  ? 201  CYS G N   1 
ATOM   9120  C CA  . CYS G  1 174 ? 14.101 50.193 36.566  1.00 65.51  ? 201  CYS G CA  1 
ATOM   9121  C C   . CYS G  1 174 ? 15.573 50.342 36.253  1.00 66.08  ? 201  CYS G C   1 
ATOM   9122  O O   . CYS G  1 174 ? 16.426 49.836 36.982  1.00 66.25  ? 201  CYS G O   1 
ATOM   9123  C CB  . CYS G  1 174 ? 13.651 51.321 37.490  1.00 63.23  ? 201  CYS G CB  1 
ATOM   9124  S SG  . CYS G  1 174 ? 11.956 51.119 38.133  1.00 58.12  ? 201  CYS G SG  1 
ATOM   9125  N N   . ASP G  1 175 ? 15.854 51.042 35.162  1.00 66.75  ? 202  ASP G N   1 
ATOM   9126  C CA  . ASP G  1 175 ? 17.217 51.295 34.692  1.00 66.52  ? 202  ASP G CA  1 
ATOM   9127  C C   . ASP G  1 175 ? 17.888 52.386 35.541  1.00 65.31  ? 202  ASP G C   1 
ATOM   9128  O O   . ASP G  1 175 ? 17.938 53.548 35.137  1.00 65.45  ? 202  ASP G O   1 
ATOM   9129  C CB  . ASP G  1 175 ? 17.161 51.764 33.235  1.00 67.91  ? 202  ASP G CB  1 
ATOM   9130  C CG  . ASP G  1 175 ? 18.372 51.344 32.431  1.00 69.99  ? 202  ASP G CG  1 
ATOM   9131  O OD1 . ASP G  1 175 ? 19.466 51.168 33.021  1.00 70.05  ? 202  ASP G OD1 1 
ATOM   9132  O OD2 . ASP G  1 175 ? 18.218 51.205 31.195  1.00 71.19  ? 202  ASP G OD2 1 
ATOM   9133  N N   . ILE G  1 176 ? 18.393 52.032 36.715  1.00 63.10  ? 203  ILE G N   1 
ATOM   9134  C CA  . ILE G  1 176 ? 19.043 53.028 37.549  1.00 61.60  ? 203  ILE G CA  1 
ATOM   9135  C C   . ILE G  1 176 ? 20.521 52.704 37.676  1.00 62.35  ? 203  ILE G C   1 
ATOM   9136  O O   . ILE G  1 176 ? 20.906 51.701 38.273  1.00 62.45  ? 203  ILE G O   1 
ATOM   9137  C CB  . ILE G  1 176 ? 18.353 53.129 38.932  1.00 61.04  ? 203  ILE G CB  1 
ATOM   9138  C CG1 . ILE G  1 176 ? 17.014 53.851 38.760  1.00 59.86  ? 203  ILE G CG1 1 
ATOM   9139  C CG2 . ILE G  1 176 ? 19.233 53.866 39.933  1.00 59.70  ? 203  ILE G CG2 1 
ATOM   9140  C CD1 . ILE G  1 176 ? 16.254 54.035 40.028  1.00 58.16  ? 203  ILE G CD1 1 
ATOM   9141  N N   . PRO G  1 177 ? 21.373 53.569 37.105  1.00 63.06  ? 204  PRO G N   1 
ATOM   9142  C CA  . PRO G  1 177 ? 22.830 53.460 37.086  1.00 63.48  ? 204  PRO G CA  1 
ATOM   9143  C C   . PRO G  1 177 ? 23.534 53.340 38.425  1.00 64.52  ? 204  PRO G C   1 
ATOM   9144  O O   . PRO G  1 177 ? 23.040 53.778 39.470  1.00 64.38  ? 204  PRO G O   1 
ATOM   9145  C CB  . PRO G  1 177 ? 23.253 54.714 36.330  1.00 62.78  ? 204  PRO G CB  1 
ATOM   9146  C CG  . PRO G  1 177 ? 22.226 55.692 36.744  1.00 62.96  ? 204  PRO G CG  1 
ATOM   9147  C CD  . PRO G  1 177 ? 20.962 54.890 36.598  1.00 63.72  ? 204  PRO G CD  1 
ATOM   9148  N N   . GLN G  1 178 ? 24.703 52.723 38.368  1.00 65.65  ? 205  GLN G N   1 
ATOM   9149  C CA  . GLN G  1 178 ? 25.537 52.544 39.539  1.00 67.34  ? 205  GLN G CA  1 
ATOM   9150  C C   . GLN G  1 178 ? 26.348 53.829 39.680  1.00 67.67  ? 205  GLN G C   1 
ATOM   9151  O O   . GLN G  1 178 ? 26.562 54.537 38.697  1.00 68.04  ? 205  GLN G O   1 
ATOM   9152  C CB  . GLN G  1 178 ? 26.489 51.365 39.322  1.00 68.12  ? 205  GLN G CB  1 
ATOM   9153  C CG  . GLN G  1 178 ? 25.804 50.031 39.113  1.00 68.27  ? 205  GLN G CG  1 
ATOM   9154  C CD  . GLN G  1 178 ? 24.997 49.621 40.318  1.00 68.76  ? 205  GLN G CD  1 
ATOM   9155  O OE1 . GLN G  1 178 ? 25.521 49.564 41.435  1.00 69.30  ? 205  GLN G OE1 1 
ATOM   9156  N NE2 . GLN G  1 178 ? 23.713 49.337 40.107  1.00 68.01  ? 205  GLN G NE2 1 
ATOM   9157  N N   . CYS G  1 179 ? 26.783 54.147 40.892  1.00 67.68  ? 206  CYS G N   1 
ATOM   9158  C CA  . CYS G  1 179 ? 27.598 55.333 41.078  1.00 67.87  ? 206  CYS G CA  1 
ATOM   9159  C C   . CYS G  1 179 ? 29.005 54.988 40.617  1.00 69.70  ? 206  CYS G C   1 
ATOM   9160  O O   . CYS G  1 179 ? 29.769 55.855 40.202  1.00 68.81  ? 206  CYS G O   1 
ATOM   9161  C CB  . CYS G  1 179 ? 27.633 55.745 42.539  1.00 65.17  ? 206  CYS G CB  1 
ATOM   9162  S SG  . CYS G  1 179 ? 26.016 56.118 43.282  1.00 63.67  ? 206  CYS G SG  1 
ATOM   9163  N N   . SER G  1 180 ? 29.330 53.702 40.689  1.00 72.82  ? 207  SER G N   1 
ATOM   9164  C CA  . SER G  1 180 ? 30.637 53.188 40.287  1.00 75.73  ? 207  SER G CA  1 
ATOM   9165  C C   . SER G  1 180 ? 31.113 53.506 38.857  1.00 77.72  ? 207  SER G C   1 
ATOM   9166  O O   . SER G  1 180 ? 32.163 54.088 38.705  1.00 78.87  ? 207  SER G O   1 
ATOM   9167  C CB  . SER G  1 180 ? 30.676 51.678 40.447  1.00 75.68  ? 207  SER G CB  1 
ATOM   9168  O OG  . SER G  1 180 ? 29.936 51.082 39.395  1.00 77.85  ? 207  SER G OG  1 
ATOM   9169  N N   . GLU G  1 181 ? 30.435 53.075 37.793  1.00 79.36  ? 208  GLU G N   1 
ATOM   9170  C CA  . GLU G  1 181 ? 30.958 53.383 36.438  1.00 81.05  ? 208  GLU G CA  1 
ATOM   9171  C C   . GLU G  1 181 ? 30.449 52.464 35.332  1.00 81.89  ? 208  GLU G C   1 
ATOM   9172  O O   . GLU G  1 181 ? 31.211 51.539 34.965  1.00 82.61  ? 208  GLU G O   1 
ATOM   9173  C CB  . GLU G  1 181 ? 32.502 53.330 36.419  1.00 81.05  ? 208  GLU G CB  1 
ATOM   9174  C CG  . GLU G  1 181 ? 33.189 53.921 35.172  1.00 81.25  ? 208  GLU G CG  1 
ATOM   9175  C CD  . GLU G  1 181 ? 32.919 55.415 34.972  1.00 81.55  ? 208  GLU G CD  1 
ATOM   9176  O OE1 . GLU G  1 181 ? 33.133 56.207 35.916  1.00 80.91  ? 208  GLU G OE1 1 
ATOM   9177  O OE2 . GLU G  1 181 ? 32.499 55.799 33.859  1.00 81.50  ? 208  GLU G OE2 1 
ATOM   9178  N N   . VAL G  1 182 ? 29.315 52.681 34.847  1.00 82.35  ? 209  VAL G N   1 
ATOM   9179  N N   . THR H  1 11  ? 8.877  70.971 30.382  1.00 87.23  ? 38   THR H N   1 
ATOM   9180  C CA  . THR H  1 11  ? 9.816  70.286 31.319  1.00 86.98  ? 38   THR H CA  1 
ATOM   9181  C C   . THR H  1 11  ? 11.251 70.329 30.805  1.00 87.04  ? 38   THR H C   1 
ATOM   9182  O O   . THR H  1 11  ? 12.106 69.576 31.266  1.00 87.45  ? 38   THR H O   1 
ATOM   9183  C CB  . THR H  1 11  ? 9.432  68.818 31.507  1.00 86.63  ? 38   THR H CB  1 
ATOM   9184  O OG1 . THR H  1 11  ? 9.833  68.068 30.355  1.00 86.50  ? 38   THR H OG1 1 
ATOM   9185  C CG2 . THR H  1 11  ? 7.932  68.692 31.680  1.00 86.63  ? 38   THR H CG2 1 
ATOM   9186  N N   . ILE H  1 12  ? 11.502 71.205 29.840  1.00 87.03  ? 39   ILE H N   1 
ATOM   9187  C CA  . ILE H  1 12  ? 12.827 71.372 29.247  1.00 87.58  ? 39   ILE H CA  1 
ATOM   9188  C C   . ILE H  1 12  ? 13.860 71.923 30.232  1.00 87.81  ? 39   ILE H C   1 
ATOM   9189  O O   . ILE H  1 12  ? 15.071 71.762 30.026  1.00 87.72  ? 39   ILE H O   1 
ATOM   9190  C CB  . ILE H  1 12  ? 12.760 72.327 28.050  1.00 87.84  ? 39   ILE H CB  1 
ATOM   9191  C CG1 . ILE H  1 12  ? 11.672 73.374 28.311  1.00 87.83  ? 39   ILE H CG1 1 
ATOM   9192  C CG2 . ILE H  1 12  ? 12.535 71.548 26.767  1.00 87.13  ? 39   ILE H CG2 1 
ATOM   9193  C CD1 . ILE H  1 12  ? 11.570 74.434 27.254  1.00 87.73  ? 39   ILE H CD1 1 
ATOM   9194  N N   . HIS H  1 13  ? 13.370 72.573 31.291  1.00 87.63  ? 40   HIS H N   1 
ATOM   9195  C CA  . HIS H  1 13  ? 14.225 73.163 32.322  1.00 87.18  ? 40   HIS H CA  1 
ATOM   9196  C C   . HIS H  1 13  ? 14.707 72.170 33.357  1.00 85.67  ? 40   HIS H C   1 
ATOM   9197  O O   . HIS H  1 13  ? 15.287 72.555 34.369  1.00 86.31  ? 40   HIS H O   1 
ATOM   9198  C CB  . HIS H  1 13  ? 13.512 74.299 33.046  1.00 89.07  ? 40   HIS H CB  1 
ATOM   9199  C CG  . HIS H  1 13  ? 13.399 75.550 32.237  1.00 91.94  ? 40   HIS H CG  1 
ATOM   9200  N ND1 . HIS H  1 13  ? 13.097 76.773 32.796  1.00 92.71  ? 40   HIS H ND1 1 
ATOM   9201  C CD2 . HIS H  1 13  ? 13.544 75.765 30.907  1.00 92.88  ? 40   HIS H CD2 1 
ATOM   9202  C CE1 . HIS H  1 13  ? 13.061 77.690 31.843  1.00 93.62  ? 40   HIS H CE1 1 
ATOM   9203  N NE2 . HIS H  1 13  ? 13.328 77.105 30.689  1.00 93.71  ? 40   HIS H NE2 1 
ATOM   9204  N N   . GLU H  1 14  ? 14.438 70.897 33.123  1.00 83.02  ? 41   GLU H N   1 
ATOM   9205  C CA  . GLU H  1 14  ? 14.890 69.854 34.023  1.00 80.98  ? 41   GLU H CA  1 
ATOM   9206  C C   . GLU H  1 14  ? 15.987 69.075 33.310  1.00 78.79  ? 41   GLU H C   1 
ATOM   9207  O O   . GLU H  1 14  ? 16.514 68.093 33.835  1.00 78.52  ? 41   GLU H O   1 
ATOM   9208  C CB  . GLU H  1 14  ? 13.724 68.946 34.394  1.00 82.42  ? 41   GLU H CB  1 
ATOM   9209  C CG  . GLU H  1 14  ? 12.742 69.612 35.353  1.00 84.63  ? 41   GLU H CG  1 
ATOM   9210  C CD  . GLU H  1 14  ? 11.345 69.016 35.284  1.00 85.24  ? 41   GLU H CD  1 
ATOM   9211  O OE1 . GLU H  1 14  ? 11.206 67.777 35.416  1.00 85.32  ? 41   GLU H OE1 1 
ATOM   9212  O OE2 . GLU H  1 14  ? 10.385 69.799 35.100  1.00 85.45  ? 41   GLU H OE2 1 
ATOM   9213  N N   . PHE H  1 15  ? 16.327 69.534 32.107  1.00 75.66  ? 42   PHE H N   1 
ATOM   9214  C CA  . PHE H  1 15  ? 17.368 68.904 31.308  1.00 72.13  ? 42   PHE H CA  1 
ATOM   9215  C C   . PHE H  1 15  ? 18.584 69.799 31.245  1.00 71.14  ? 42   PHE H C   1 
ATOM   9216  O O   . PHE H  1 15  ? 18.468 71.023 31.190  1.00 71.05  ? 42   PHE H O   1 
ATOM   9217  C CB  . PHE H  1 15  ? 16.895 68.653 29.878  1.00 70.22  ? 42   PHE H CB  1 
ATOM   9218  C CG  . PHE H  1 15  ? 15.805 67.634 29.764  1.00 68.94  ? 42   PHE H CG  1 
ATOM   9219  C CD1 . PHE H  1 15  ? 14.493 67.957 30.089  1.00 67.95  ? 42   PHE H CD1 1 
ATOM   9220  C CD2 . PHE H  1 15  ? 16.088 66.345 29.324  1.00 67.90  ? 42   PHE H CD2 1 
ATOM   9221  C CE1 . PHE H  1 15  ? 13.480 67.013 29.974  1.00 66.85  ? 42   PHE H CE1 1 
ATOM   9222  C CE2 . PHE H  1 15  ? 15.082 65.396 29.206  1.00 66.49  ? 42   PHE H CE2 1 
ATOM   9223  C CZ  . PHE H  1 15  ? 13.777 65.729 29.532  1.00 66.73  ? 42   PHE H CZ  1 
ATOM   9224  N N   . LYS H  1 16  ? 19.754 69.179 31.256  1.00 69.55  ? 43   LYS H N   1 
ATOM   9225  C CA  . LYS H  1 16  ? 21.000 69.914 31.164  1.00 68.54  ? 43   LYS H CA  1 
ATOM   9226  C C   . LYS H  1 16  ? 21.276 70.094 29.678  1.00 69.47  ? 43   LYS H C   1 
ATOM   9227  O O   . LYS H  1 16  ? 21.701 69.158 29.000  1.00 69.70  ? 43   LYS H O   1 
ATOM   9228  C CB  . LYS H  1 16  ? 22.133 69.118 31.806  1.00 66.40  ? 43   LYS H CB  1 
ATOM   9229  C CG  . LYS H  1 16  ? 23.514 69.695 31.576  1.00 62.25  ? 43   LYS H CG  1 
ATOM   9230  C CD  . LYS H  1 16  ? 24.555 68.763 32.135  1.00 60.27  ? 43   LYS H CD  1 
ATOM   9231  C CE  . LYS H  1 16  ? 25.944 69.278 31.873  1.00 59.69  ? 43   LYS H CE  1 
ATOM   9232  N NZ  . LYS H  1 16  ? 26.973 68.339 32.384  1.00 58.28  ? 43   LYS H NZ  1 
ATOM   9233  N N   . LYS H  1 17  ? 21.025 71.298 29.177  1.00 70.17  ? 44   LYS H N   1 
ATOM   9234  C CA  . LYS H  1 17  ? 21.233 71.602 27.767  1.00 70.73  ? 44   LYS H CA  1 
ATOM   9235  C C   . LYS H  1 17  ? 22.688 71.801 27.364  1.00 71.34  ? 44   LYS H C   1 
ATOM   9236  O O   . LYS H  1 17  ? 23.500 72.342 28.119  1.00 71.21  ? 44   LYS H O   1 
ATOM   9237  C CB  . LYS H  1 17  ? 20.428 72.841 27.382  1.00 70.42  ? 44   LYS H CB  1 
ATOM   9238  N N   . SER H  1 18  ? 22.996 71.340 26.157  1.00 72.50  ? 45   SER H N   1 
ATOM   9239  C CA  . SER H  1 18  ? 24.315 71.483 25.557  1.00 73.94  ? 45   SER H CA  1 
ATOM   9240  C C   . SER H  1 18  ? 24.079 71.932 24.118  1.00 76.02  ? 45   SER H C   1 
ATOM   9241  O O   . SER H  1 18  ? 23.958 71.107 23.211  1.00 76.26  ? 45   SER H O   1 
ATOM   9242  C CB  . SER H  1 18  ? 25.083 70.161 25.573  1.00 72.50  ? 45   SER H CB  1 
ATOM   9243  O OG  . SER H  1 18  ? 25.708 69.954 26.824  1.00 71.02  ? 45   SER H OG  1 
ATOM   9244  N N   . ALA H  1 19  ? 24.003 73.249 23.926  1.00 78.45  ? 46   ALA H N   1 
ATOM   9245  C CA  . ALA H  1 19  ? 23.761 73.848 22.618  1.00 80.86  ? 46   ALA H CA  1 
ATOM   9246  C C   . ALA H  1 19  ? 24.699 73.342 21.530  1.00 82.73  ? 46   ALA H C   1 
ATOM   9247  O O   . ALA H  1 19  ? 25.858 73.010 21.785  1.00 82.87  ? 46   ALA H O   1 
ATOM   9248  C CB  . ALA H  1 19  ? 23.863 75.360 22.721  1.00 80.65  ? 46   ALA H CB  1 
ATOM   9249  N N   . LYS H  1 20  ? 24.191 73.296 20.307  1.00 84.55  ? 47   LYS H N   1 
ATOM   9250  C CA  . LYS H  1 20  ? 24.995 72.843 19.186  1.00 87.08  ? 47   LYS H CA  1 
ATOM   9251  C C   . LYS H  1 20  ? 25.732 71.557 19.522  1.00 89.13  ? 47   LYS H C   1 
ATOM   9252  O O   . LYS H  1 20  ? 26.962 71.499 19.438  1.00 89.64  ? 47   LYS H O   1 
ATOM   9253  C CB  . LYS H  1 20  ? 26.016 73.915 18.791  1.00 86.53  ? 47   LYS H CB  1 
ATOM   9254  C CG  . LYS H  1 20  ? 25.420 75.187 18.203  1.00 86.58  ? 47   LYS H CG  1 
ATOM   9255  C CD  . LYS H  1 20  ? 24.703 76.038 19.241  1.00 85.82  ? 47   LYS H CD  1 
ATOM   9256  C CE  . LYS H  1 20  ? 24.109 77.274 18.589  1.00 85.50  ? 47   LYS H CE  1 
ATOM   9257  N NZ  . LYS H  1 20  ? 23.476 78.181 19.579  1.00 85.91  ? 47   LYS H NZ  1 
ATOM   9258  N N   . THR H  1 21  ? 24.986 70.529 19.910  1.00 91.24  ? 48   THR H N   1 
ATOM   9259  C CA  . THR H  1 21  ? 25.603 69.252 20.235  1.00 93.61  ? 48   THR H CA  1 
ATOM   9260  C C   . THR H  1 21  ? 24.656 68.114 19.888  1.00 95.05  ? 48   THR H C   1 
ATOM   9261  O O   . THR H  1 21  ? 23.461 68.329 19.696  1.00 94.43  ? 48   THR H O   1 
ATOM   9262  C CB  . THR H  1 21  ? 25.966 69.168 21.731  1.00 93.76  ? 48   THR H CB  1 
ATOM   9263  O OG1 . THR H  1 21  ? 26.637 70.370 22.128  1.00 94.44  ? 48   THR H OG1 1 
ATOM   9264  C CG2 . THR H  1 21  ? 26.893 67.980 21.987  1.00 94.32  ? 48   THR H CG2 1 
ATOM   9265  N N   . THR H  1 22  ? 25.199 66.906 19.798  1.00 97.64  ? 49   THR H N   1 
ATOM   9266  C CA  . THR H  1 22  ? 24.407 65.721 19.484  1.00 100.17 ? 49   THR H CA  1 
ATOM   9267  C C   . THR H  1 22  ? 25.254 64.472 19.732  1.00 102.40 ? 49   THR H C   1 
ATOM   9268  O O   . THR H  1 22  ? 26.481 64.538 19.686  1.00 102.96 ? 49   THR H O   1 
ATOM   9269  C CB  . THR H  1 22  ? 23.930 65.745 18.020  1.00 99.83  ? 49   THR H CB  1 
ATOM   9270  O OG1 . THR H  1 22  ? 23.136 64.581 17.759  1.00 99.05  ? 49   THR H OG1 1 
ATOM   9271  C CG2 . THR H  1 22  ? 25.119 65.780 17.069  1.00 100.34 ? 49   THR H CG2 1 
ATOM   9272  N N   . LEU H  1 23  ? 24.609 63.342 20.021  1.00 105.18 ? 50   LEU H N   1 
ATOM   9273  C CA  . LEU H  1 23  ? 25.338 62.095 20.286  1.00 107.81 ? 50   LEU H CA  1 
ATOM   9274  C C   . LEU H  1 23  ? 25.204 61.064 19.153  1.00 109.70 ? 50   LEU H C   1 
ATOM   9275  O O   . LEU H  1 23  ? 24.118 60.876 18.598  1.00 109.76 ? 50   LEU H O   1 
ATOM   9276  C CB  . LEU H  1 23  ? 24.864 61.488 21.613  1.00 107.23 ? 50   LEU H CB  1 
ATOM   9277  N N   . ILE H  1 24  ? 26.313 60.400 18.822  1.00 111.77 ? 51   ILE H N   1 
ATOM   9278  C CA  . ILE H  1 24  ? 26.337 59.393 17.756  1.00 114.04 ? 51   ILE H CA  1 
ATOM   9279  C C   . ILE H  1 24  ? 26.286 57.955 18.296  1.00 115.58 ? 51   ILE H C   1 
ATOM   9280  O O   . ILE H  1 24  ? 27.098 57.568 19.140  1.00 115.60 ? 51   ILE H O   1 
ATOM   9281  C CB  . ILE H  1 24  ? 27.581 59.589 16.889  1.00 113.54 ? 51   ILE H CB  1 
ATOM   9282  N N   . LYS H  1 25  ? 25.335 57.170 17.789  1.00 117.40 ? 52   LYS H N   1 
ATOM   9283  C CA  . LYS H  1 25  ? 25.142 55.783 18.219  1.00 119.24 ? 52   LYS H CA  1 
ATOM   9284  C C   . LYS H  1 25  ? 26.020 54.778 17.479  1.00 120.62 ? 52   LYS H C   1 
ATOM   9285  O O   . LYS H  1 25  ? 25.529 54.005 16.657  1.00 121.02 ? 52   LYS H O   1 
ATOM   9286  C CB  . LYS H  1 25  ? 23.666 55.391 18.062  1.00 118.74 ? 52   LYS H CB  1 
ATOM   9287  N N   . ILE H  1 26  ? 27.313 54.778 17.788  1.00 122.26 ? 53   ILE H N   1 
ATOM   9288  C CA  . ILE H  1 26  ? 28.254 53.862 17.153  1.00 123.99 ? 53   ILE H CA  1 
ATOM   9289  C C   . ILE H  1 26  ? 28.196 52.456 17.762  1.00 125.09 ? 53   ILE H C   1 
ATOM   9290  O O   . ILE H  1 26  ? 29.205 51.940 18.249  1.00 125.46 ? 53   ILE H O   1 
ATOM   9291  C CB  . ILE H  1 26  ? 29.677 54.421 17.256  1.00 123.88 ? 53   ILE H CB  1 
ATOM   9292  N N   . ASP H  1 27  ? 27.011 51.848 17.738  1.00 126.27 ? 54   ASP H N   1 
ATOM   9293  C CA  . ASP H  1 27  ? 26.809 50.498 18.268  1.00 127.23 ? 54   ASP H CA  1 
ATOM   9294  C C   . ASP H  1 27  ? 25.363 50.033 18.128  1.00 127.82 ? 54   ASP H C   1 
ATOM   9295  O O   . ASP H  1 27  ? 24.495 50.399 18.921  1.00 127.88 ? 54   ASP H O   1 
ATOM   9296  C CB  . ASP H  1 27  ? 27.212 50.411 19.742  1.00 127.41 ? 54   ASP H CB  1 
ATOM   9297  C CG  . ASP H  1 27  ? 27.056 49.004 20.306  1.00 127.50 ? 54   ASP H CG  1 
ATOM   9298  O OD1 . ASP H  1 27  ? 25.922 48.473 20.317  1.00 126.62 ? 54   ASP H OD1 1 
ATOM   9299  O OD2 . ASP H  1 27  ? 28.076 48.426 20.738  1.00 127.91 ? 54   ASP H OD2 1 
ATOM   9300  N N   . PRO H  1 28  ? 25.090 49.216 17.105  1.00 128.35 ? 55   PRO H N   1 
ATOM   9301  C CA  . PRO H  1 28  ? 23.746 48.687 16.848  1.00 128.75 ? 55   PRO H CA  1 
ATOM   9302  C C   . PRO H  1 28  ? 23.274 47.740 17.959  1.00 128.81 ? 55   PRO H C   1 
ATOM   9303  O O   . PRO H  1 28  ? 23.423 46.521 17.856  1.00 128.96 ? 55   PRO H O   1 
ATOM   9304  C CB  . PRO H  1 28  ? 23.913 47.971 15.507  1.00 128.82 ? 55   PRO H CB  1 
ATOM   9305  C CG  . PRO H  1 28  ? 25.009 48.756 14.839  1.00 128.62 ? 55   PRO H CG  1 
ATOM   9306  C CD  . PRO H  1 28  ? 25.986 48.944 15.968  1.00 128.42 ? 55   PRO H CD  1 
ATOM   9307  N N   . ALA H  1 29  ? 22.706 48.301 19.019  1.00 128.63 ? 56   ALA H N   1 
ATOM   9308  C CA  . ALA H  1 29  ? 22.222 47.490 20.130  1.00 128.54 ? 56   ALA H CA  1 
ATOM   9309  C C   . ALA H  1 29  ? 21.162 48.246 20.925  1.00 128.36 ? 56   ALA H C   1 
ATOM   9310  O O   . ALA H  1 29  ? 20.181 47.663 21.392  1.00 128.49 ? 56   ALA H O   1 
ATOM   9311  C CB  . ALA H  1 29  ? 23.388 47.101 21.035  1.00 128.78 ? 56   ALA H CB  1 
ATOM   9312  N N   . LEU H  1 30  ? 21.370 49.548 21.082  1.00 127.96 ? 57   LEU H N   1 
ATOM   9313  C CA  . LEU H  1 30  ? 20.426 50.390 21.804  1.00 127.10 ? 57   LEU H CA  1 
ATOM   9314  C C   . LEU H  1 30  ? 19.498 51.022 20.772  1.00 126.09 ? 57   LEU H C   1 
ATOM   9315  O O   . LEU H  1 30  ? 19.916 51.300 19.645  1.00 125.63 ? 57   LEU H O   1 
ATOM   9316  C CB  . LEU H  1 30  ? 21.174 51.475 22.590  1.00 127.35 ? 57   LEU H CB  1 
ATOM   9317  N N   . LYS H  1 31  ? 18.242 51.238 21.156  1.00 124.84 ? 58   LYS H N   1 
ATOM   9318  C CA  . LYS H  1 31  ? 17.259 51.829 20.254  1.00 123.68 ? 58   LYS H CA  1 
ATOM   9319  C C   . LYS H  1 31  ? 17.191 53.356 20.347  1.00 122.61 ? 58   LYS H C   1 
ATOM   9320  O O   . LYS H  1 31  ? 17.380 53.937 21.417  1.00 122.50 ? 58   LYS H O   1 
ATOM   9321  C CB  . LYS H  1 31  ? 15.887 51.229 20.527  1.00 123.82 ? 58   LYS H CB  1 
ATOM   9322  N N   . ILE H  1 32  ? 16.922 53.997 19.211  1.00 121.15 ? 59   ILE H N   1 
ATOM   9323  C CA  . ILE H  1 32  ? 16.816 55.449 19.143  1.00 119.65 ? 59   ILE H CA  1 
ATOM   9324  C C   . ILE H  1 32  ? 15.527 55.810 18.423  1.00 118.70 ? 59   ILE H C   1 
ATOM   9325  O O   . ILE H  1 32  ? 15.455 55.764 17.194  1.00 118.51 ? 59   ILE H O   1 
ATOM   9326  C CB  . ILE H  1 32  ? 18.013 56.035 18.403  1.00 119.61 ? 59   ILE H CB  1 
ATOM   9327  N N   . LYS H  1 33  ? 14.510 56.164 19.201  1.00 117.54 ? 60   LYS H N   1 
ATOM   9328  C CA  . LYS H  1 33  ? 13.209 56.535 18.657  1.00 116.34 ? 60   LYS H CA  1 
ATOM   9329  C C   . LYS H  1 33  ? 13.167 58.003 18.227  1.00 115.27 ? 60   LYS H C   1 
ATOM   9330  O O   . LYS H  1 33  ? 13.342 58.905 19.046  1.00 115.49 ? 60   LYS H O   1 
ATOM   9331  C CB  . LYS H  1 33  ? 12.118 56.260 19.694  1.00 116.39 ? 60   LYS H CB  1 
ATOM   9332  N N   . THR H  1 34  ? 12.931 58.235 16.939  1.00 113.90 ? 61   THR H N   1 
ATOM   9333  C CA  . THR H  1 34  ? 12.859 59.587 16.398  1.00 112.51 ? 61   THR H CA  1 
ATOM   9334  C C   . THR H  1 34  ? 11.468 59.879 15.850  1.00 111.60 ? 61   THR H C   1 
ATOM   9335  O O   . THR H  1 34  ? 10.686 58.969 15.580  1.00 111.20 ? 61   THR H O   1 
ATOM   9336  C CB  . THR H  1 34  ? 13.874 59.786 15.263  1.00 112.37 ? 61   THR H CB  1 
ATOM   9337  O OG1 . THR H  1 34  ? 13.592 58.860 14.207  1.00 112.69 ? 61   THR H OG1 1 
ATOM   9338  C CG2 . THR H  1 34  ? 15.289 59.558 15.769  1.00 111.90 ? 61   THR H CG2 1 
ATOM   9339  N N   . LYS H  1 35  ? 11.163 61.159 15.684  1.00 110.60 ? 62   LYS H N   1 
ATOM   9340  C CA  . LYS H  1 35  ? 9.867  61.564 15.165  1.00 109.83 ? 62   LYS H CA  1 
ATOM   9341  C C   . LYS H  1 35  ? 9.810  63.077 15.041  1.00 109.26 ? 62   LYS H C   1 
ATOM   9342  O O   . LYS H  1 35  ? 10.137 63.794 15.984  1.00 108.87 ? 62   LYS H O   1 
ATOM   9343  C CB  . LYS H  1 35  ? 8.753  61.068 16.086  1.00 109.45 ? 62   LYS H CB  1 
ATOM   9344  N N   . LYS H  1 36  ? 9.403  63.555 13.868  1.00 108.89 ? 63   LYS H N   1 
ATOM   9345  C CA  . LYS H  1 36  ? 9.285  64.985 13.613  1.00 108.33 ? 63   LYS H CA  1 
ATOM   9346  C C   . LYS H  1 36  ? 8.371  65.607 14.667  1.00 107.88 ? 63   LYS H C   1 
ATOM   9347  O O   . LYS H  1 36  ? 7.525  64.926 15.245  1.00 108.50 ? 63   LYS H O   1 
ATOM   9348  C CB  . LYS H  1 36  ? 8.719  65.222 12.212  1.00 108.15 ? 63   LYS H CB  1 
ATOM   9349  N N   . VAL H  1 37  ? 8.550  66.900 14.914  1.00 106.60 ? 64   VAL H N   1 
ATOM   9350  C CA  . VAL H  1 37  ? 7.753  67.628 15.899  1.00 105.45 ? 64   VAL H CA  1 
ATOM   9351  C C   . VAL H  1 37  ? 7.889  69.141 15.674  1.00 105.11 ? 64   VAL H C   1 
ATOM   9352  O O   . VAL H  1 37  ? 8.741  69.590 14.903  1.00 104.46 ? 64   VAL H O   1 
ATOM   9353  C CB  . VAL H  1 37  ? 8.204  67.249 17.345  1.00 105.18 ? 64   VAL H CB  1 
ATOM   9354  C CG1 . VAL H  1 37  ? 7.861  68.343 18.323  1.00 105.64 ? 64   VAL H CG1 1 
ATOM   9355  C CG2 . VAL H  1 37  ? 7.522  65.964 17.780  1.00 104.67 ? 64   VAL H CG2 1 
ATOM   9356  N N   . ASN H  1 38  ? 7.032  69.920 16.334  1.00 104.74 ? 65   ASN H N   1 
ATOM   9357  C CA  . ASN H  1 38  ? 7.055  71.380 16.228  1.00 104.59 ? 65   ASN H CA  1 
ATOM   9358  C C   . ASN H  1 38  ? 8.167  71.995 17.078  1.00 104.24 ? 65   ASN H C   1 
ATOM   9359  O O   . ASN H  1 38  ? 9.154  72.508 16.544  1.00 104.49 ? 65   ASN H O   1 
ATOM   9360  C CB  . ASN H  1 38  ? 5.703  71.965 16.666  1.00 104.76 ? 65   ASN H CB  1 
ATOM   9361  C CG  . ASN H  1 38  ? 5.708  73.497 16.741  1.00 105.07 ? 65   ASN H CG  1 
ATOM   9362  O OD1 . ASN H  1 38  ? 6.703  74.157 16.420  1.00 104.37 ? 65   ASN H OD1 1 
ATOM   9363  N ND2 . ASN H  1 38  ? 4.582  74.066 17.168  1.00 104.66 ? 65   ASN H ND2 1 
ATOM   9364  N N   . THR H  1 39  ? 8.000  71.941 18.399  1.00 103.35 ? 66   THR H N   1 
ATOM   9365  C CA  . THR H  1 39  ? 8.980  72.508 19.323  1.00 102.06 ? 66   THR H CA  1 
ATOM   9366  C C   . THR H  1 39  ? 9.778  71.457 20.100  1.00 100.82 ? 66   THR H C   1 
ATOM   9367  O O   . THR H  1 39  ? 9.391  70.290 20.185  1.00 100.16 ? 66   THR H O   1 
ATOM   9368  C CB  . THR H  1 39  ? 8.296  73.441 20.343  1.00 102.42 ? 66   THR H CB  1 
ATOM   9369  O OG1 . THR H  1 39  ? 7.417  72.675 21.177  1.00 103.10 ? 66   THR H OG1 1 
ATOM   9370  C CG2 . THR H  1 39  ? 7.495  74.516 19.627  1.00 102.53 ? 66   THR H CG2 1 
ATOM   9371  N N   . ALA H  1 40  ? 10.899 71.886 20.668  1.00 99.52  ? 67   ALA H N   1 
ATOM   9372  C CA  . ALA H  1 40  ? 11.744 70.996 21.446  1.00 98.27  ? 67   ALA H CA  1 
ATOM   9373  C C   . ALA H  1 40  ? 10.990 70.561 22.696  1.00 97.25  ? 67   ALA H C   1 
ATOM   9374  O O   . ALA H  1 40  ? 11.179 69.456 23.192  1.00 97.45  ? 67   ALA H O   1 
ATOM   9375  C CB  . ALA H  1 40  ? 13.034 71.704 21.831  1.00 98.18  ? 67   ALA H CB  1 
ATOM   9376  N N   . ASP H  1 41  ? 10.130 71.440 23.196  1.00 95.85  ? 68   ASP H N   1 
ATOM   9377  C CA  . ASP H  1 41  ? 9.341  71.156 24.385  1.00 94.91  ? 68   ASP H CA  1 
ATOM   9378  C C   . ASP H  1 41  ? 8.625  69.818 24.293  1.00 94.45  ? 68   ASP H C   1 
ATOM   9379  O O   . ASP H  1 41  ? 8.574  69.060 25.260  1.00 94.27  ? 68   ASP H O   1 
ATOM   9380  C CB  . ASP H  1 41  ? 8.323  72.268 24.604  1.00 94.41  ? 68   ASP H CB  1 
ATOM   9381  C CG  . ASP H  1 41  ? 8.978  73.602 24.852  1.00 94.07  ? 68   ASP H CG  1 
ATOM   9382  O OD1 . ASP H  1 41  ? 9.693  74.086 23.948  1.00 93.30  ? 68   ASP H OD1 1 
ATOM   9383  O OD2 . ASP H  1 41  ? 8.784  74.158 25.954  1.00 94.49  ? 68   ASP H OD2 1 
ATOM   9384  N N   . GLN H  1 42  ? 8.059  69.534 23.131  1.00 94.26  ? 69   GLN H N   1 
ATOM   9385  C CA  . GLN H  1 42  ? 7.363  68.273 22.938  1.00 94.23  ? 69   GLN H CA  1 
ATOM   9386  C C   . GLN H  1 42  ? 8.315  67.123 23.221  1.00 93.95  ? 69   GLN H C   1 
ATOM   9387  O O   . GLN H  1 42  ? 7.937  66.134 23.852  1.00 94.33  ? 69   GLN H O   1 
ATOM   9388  C CB  . GLN H  1 42  ? 6.845  68.168 21.509  1.00 94.61  ? 69   GLN H CB  1 
ATOM   9389  C CG  . GLN H  1 42  ? 5.621  69.000 21.220  1.00 94.16  ? 69   GLN H CG  1 
ATOM   9390  C CD  . GLN H  1 42  ? 5.218  68.898 19.773  1.00 94.58  ? 69   GLN H CD  1 
ATOM   9391  O OE1 . GLN H  1 42  ? 5.590  69.742 18.954  1.00 94.37  ? 69   GLN H OE1 1 
ATOM   9392  N NE2 . GLN H  1 42  ? 4.474  67.846 19.438  1.00 94.66  ? 69   GLN H NE2 1 
ATOM   9393  N N   . CYS H  1 43  ? 9.549  67.259 22.741  1.00 93.48  ? 70   CYS H N   1 
ATOM   9394  C CA  . CYS H  1 43  ? 10.571 66.239 22.950  1.00 92.57  ? 70   CYS H CA  1 
ATOM   9395  C C   . CYS H  1 43  ? 10.731 66.009 24.444  1.00 91.97  ? 70   CYS H C   1 
ATOM   9396  O O   . CYS H  1 43  ? 10.688 64.877 24.921  1.00 91.17  ? 70   CYS H O   1 
ATOM   9397  C CB  . CYS H  1 43  ? 11.915 66.699 22.390  1.00 92.33  ? 70   CYS H CB  1 
ATOM   9398  S SG  . CYS H  1 43  ? 11.928 67.228 20.648  1.00 92.82  ? 70   CYS H SG  1 
ATOM   9399  N N   . ALA H  1 44  ? 10.926 67.108 25.167  1.00 91.91  ? 71   ALA H N   1 
ATOM   9400  C CA  . ALA H  1 44  ? 11.105 67.084 26.610  1.00 91.91  ? 71   ALA H CA  1 
ATOM   9401  C C   . ALA H  1 44  ? 9.985  66.312 27.294  1.00 92.34  ? 71   ALA H C   1 
ATOM   9402  O O   . ALA H  1 44  ? 10.241 65.332 27.998  1.00 92.37  ? 71   ALA H O   1 
ATOM   9403  C CB  . ALA H  1 44  ? 11.167 68.514 27.150  1.00 90.88  ? 71   ALA H CB  1 
ATOM   9404  N N   . ASP H  1 45  ? 8.748  66.755 27.084  1.00 92.46  ? 72   ASP H N   1 
ATOM   9405  C CA  . ASP H  1 45  ? 7.595  66.098 27.686  1.00 92.27  ? 72   ASP H CA  1 
ATOM   9406  C C   . ASP H  1 45  ? 7.582  64.607 27.388  1.00 91.69  ? 72   ASP H C   1 
ATOM   9407  O O   . ASP H  1 45  ? 7.447  63.796 28.297  1.00 92.78  ? 72   ASP H O   1 
ATOM   9408  C CB  . ASP H  1 45  ? 6.302  66.741 27.193  1.00 92.65  ? 72   ASP H CB  1 
ATOM   9409  C CG  . ASP H  1 45  ? 6.153  68.172 27.667  1.00 93.69  ? 72   ASP H CG  1 
ATOM   9410  O OD1 . ASP H  1 45  ? 6.998  69.029 27.384  1.00 93.64  ? 72   ASP H OD1 1 
ATOM   9411  O OD2 . ASP H  1 45  ? 5.076  68.441 28.394  1.00 94.09  ? 72   ASP H OD2 1 
ATOM   9412  N N   . ARG H  1 46  ? 7.726  64.236 26.122  1.00 90.77  ? 73   ARG H N   1 
ATOM   9413  C CA  . ARG H  1 46  ? 7.731  62.822 25.757  1.00 90.46  ? 73   ARG H CA  1 
ATOM   9414  C C   . ARG H  1 46  ? 8.868  62.090 26.473  1.00 90.06  ? 73   ARG H C   1 
ATOM   9415  O O   . ARG H  1 46  ? 8.758  60.909 26.816  1.00 89.60  ? 73   ARG H O   1 
ATOM   9416  C CB  . ARG H  1 46  ? 7.873  62.669 24.242  1.00 90.83  ? 73   ARG H CB  1 
ATOM   9417  N N   . CYS H  1 47  ? 9.967  62.799 26.697  1.00 89.49  ? 74   CYS H N   1 
ATOM   9418  C CA  . CYS H  1 47  ? 11.102 62.207 27.377  1.00 89.30  ? 74   CYS H CA  1 
ATOM   9419  C C   . CYS H  1 47  ? 10.860 62.159 28.879  1.00 89.05  ? 74   CYS H C   1 
ATOM   9420  O O   . CYS H  1 47  ? 11.185 61.167 29.530  1.00 89.81  ? 74   CYS H O   1 
ATOM   9421  C CB  . CYS H  1 47  ? 12.362 63.004 27.079  1.00 89.67  ? 74   CYS H CB  1 
ATOM   9422  S SG  . CYS H  1 47  ? 13.888 62.303 27.773  1.00 91.15  ? 74   CYS H SG  1 
ATOM   9423  N N   . THR H  1 48  ? 10.290 63.229 29.427  1.00 88.17  ? 75   THR H N   1 
ATOM   9424  C CA  . THR H  1 48  ? 10.003 63.287 30.859  1.00 87.31  ? 75   THR H CA  1 
ATOM   9425  C C   . THR H  1 48  ? 8.999  62.203 31.248  1.00 87.68  ? 75   THR H C   1 
ATOM   9426  O O   . THR H  1 48  ? 9.287  61.355 32.090  1.00 88.17  ? 75   THR H O   1 
ATOM   9427  C CB  . THR H  1 48  ? 9.433  64.662 31.272  1.00 86.32  ? 75   THR H CB  1 
ATOM   9428  O OG1 . THR H  1 48  ? 10.418 65.676 31.041  1.00 85.28  ? 75   THR H OG1 1 
ATOM   9429  C CG2 . THR H  1 48  ? 9.051  64.665 32.742  1.00 85.15  ? 75   THR H CG2 1 
ATOM   9430  N N   . ARG H  1 49  ? 7.821  62.231 30.635  1.00 87.83  ? 76   ARG H N   1 
ATOM   9431  C CA  . ARG H  1 49  ? 6.787  61.246 30.925  1.00 87.99  ? 76   ARG H CA  1 
ATOM   9432  C C   . ARG H  1 49  ? 7.131  59.904 30.290  1.00 87.73  ? 76   ARG H C   1 
ATOM   9433  O O   . ARG H  1 49  ? 6.439  58.912 30.503  1.00 87.98  ? 76   ARG H O   1 
ATOM   9434  C CB  . ARG H  1 49  ? 5.437  61.748 30.416  1.00 88.92  ? 76   ARG H CB  1 
ATOM   9435  C CG  . ARG H  1 49  ? 5.047  63.089 31.007  1.00 91.41  ? 76   ARG H CG  1 
ATOM   9436  C CD  . ARG H  1 49  ? 3.880  63.699 30.266  1.00 93.59  ? 76   ARG H CD  1 
ATOM   9437  N NE  . ARG H  1 49  ? 3.637  65.078 30.677  1.00 95.35  ? 76   ARG H NE  1 
ATOM   9438  C CZ  . ARG H  1 49  ? 2.758  65.885 30.088  1.00 96.48  ? 76   ARG H CZ  1 
ATOM   9439  N NH1 . ARG H  1 49  ? 2.037  65.452 29.060  1.00 96.54  ? 76   ARG H NH1 1 
ATOM   9440  N NH2 . ARG H  1 49  ? 2.593  67.127 30.528  1.00 96.96  ? 76   ARG H NH2 1 
ATOM   9441  N N   . ASN H  1 50  ? 8.203  59.883 29.506  1.00 87.32  ? 77   ASN H N   1 
ATOM   9442  C CA  . ASN H  1 50  ? 8.662  58.662 28.859  1.00 86.99  ? 77   ASN H CA  1 
ATOM   9443  C C   . ASN H  1 50  ? 7.524  57.939 28.137  1.00 86.88  ? 77   ASN H C   1 
ATOM   9444  O O   . ASN H  1 50  ? 7.433  56.710 28.182  1.00 86.73  ? 77   ASN H O   1 
ATOM   9445  C CB  . ASN H  1 50  ? 9.281  57.740 29.911  1.00 87.22  ? 77   ASN H CB  1 
ATOM   9446  C CG  . ASN H  1 50  ? 10.319 56.815 29.334  1.00 88.09  ? 77   ASN H CG  1 
ATOM   9447  O OD1 . ASN H  1 50  ? 11.508 56.952 29.617  1.00 88.90  ? 77   ASN H OD1 1 
ATOM   9448  N ND2 . ASN H  1 50  ? 9.880  55.868 28.511  1.00 88.89  ? 77   ASN H ND2 1 
ATOM   9449  N N   . LYS H  1 51  ? 6.667  58.708 27.464  1.00 86.59  ? 78   LYS H N   1 
ATOM   9450  C CA  . LYS H  1 51  ? 5.521  58.155 26.730  1.00 85.91  ? 78   LYS H CA  1 
ATOM   9451  C C   . LYS H  1 51  ? 5.879  57.593 25.353  1.00 85.81  ? 78   LYS H C   1 
ATOM   9452  O O   . LYS H  1 51  ? 6.576  58.233 24.557  1.00 84.96  ? 78   LYS H O   1 
ATOM   9453  C CB  . LYS H  1 51  ? 4.428  59.214 26.589  1.00 84.57  ? 78   LYS H CB  1 
ATOM   9454  N N   . GLY H  1 52  ? 5.387  56.388 25.083  1.00 86.43  ? 79   GLY H N   1 
ATOM   9455  C CA  . GLY H  1 52  ? 5.654  55.743 23.811  1.00 87.66  ? 79   GLY H CA  1 
ATOM   9456  C C   . GLY H  1 52  ? 7.131  55.547 23.530  1.00 88.61  ? 79   GLY H C   1 
ATOM   9457  O O   . GLY H  1 52  ? 7.595  55.760 22.408  1.00 89.21  ? 79   GLY H O   1 
ATOM   9458  N N   . LEU H  1 53  ? 7.873  55.138 24.552  1.00 88.82  ? 80   LEU H N   1 
ATOM   9459  C CA  . LEU H  1 53  ? 9.302  54.903 24.418  1.00 88.70  ? 80   LEU H CA  1 
ATOM   9460  C C   . LEU H  1 53  ? 9.627  53.547 25.024  1.00 88.22  ? 80   LEU H C   1 
ATOM   9461  O O   . LEU H  1 53  ? 9.357  53.304 26.199  1.00 87.56  ? 80   LEU H O   1 
ATOM   9462  C CB  . LEU H  1 53  ? 10.077 56.012 25.128  1.00 90.11  ? 80   LEU H CB  1 
ATOM   9463  C CG  . LEU H  1 53  ? 9.987  57.387 24.456  1.00 91.44  ? 80   LEU H CG  1 
ATOM   9464  C CD1 . LEU H  1 53  ? 10.505 58.469 25.397  1.00 91.81  ? 80   LEU H CD1 1 
ATOM   9465  C CD2 . LEU H  1 53  ? 10.789 57.360 23.154  1.00 92.08  ? 80   LEU H CD2 1 
ATOM   9466  N N   . PRO H  1 54  ? 10.208 52.642 24.222  1.00 88.03  ? 81   PRO H N   1 
ATOM   9467  C CA  . PRO H  1 54  ? 10.582 51.286 24.641  1.00 88.08  ? 81   PRO H CA  1 
ATOM   9468  C C   . PRO H  1 54  ? 11.814 51.228 25.535  1.00 88.15  ? 81   PRO H C   1 
ATOM   9469  O O   . PRO H  1 54  ? 12.491 50.207 25.607  1.00 88.23  ? 81   PRO H O   1 
ATOM   9470  C CB  . PRO H  1 54  ? 10.813 50.578 23.313  1.00 88.01  ? 81   PRO H CB  1 
ATOM   9471  C CG  . PRO H  1 54  ? 11.446 51.659 22.503  1.00 88.19  ? 81   PRO H CG  1 
ATOM   9472  C CD  . PRO H  1 54  ? 10.569 52.866 22.811  1.00 87.91  ? 81   PRO H CD  1 
ATOM   9473  N N   . PHE H  1 55  ? 12.101 52.323 26.220  1.00 88.54  ? 82   PHE H N   1 
ATOM   9474  C CA  . PHE H  1 55  ? 13.264 52.374 27.088  1.00 88.82  ? 82   PHE H CA  1 
ATOM   9475  C C   . PHE H  1 55  ? 13.224 53.609 27.973  1.00 89.30  ? 82   PHE H C   1 
ATOM   9476  O O   . PHE H  1 55  ? 12.291 54.410 27.912  1.00 88.81  ? 82   PHE H O   1 
ATOM   9477  C CB  . PHE H  1 55  ? 14.542 52.392 26.245  1.00 88.96  ? 82   PHE H CB  1 
ATOM   9478  C CG  . PHE H  1 55  ? 14.531 53.430 25.158  1.00 89.69  ? 82   PHE H CG  1 
ATOM   9479  C CD1 . PHE H  1 55  ? 14.534 54.790 25.469  1.00 89.25  ? 82   PHE H CD1 1 
ATOM   9480  C CD2 . PHE H  1 55  ? 14.464 53.049 23.821  1.00 90.13  ? 82   PHE H CD2 1 
ATOM   9481  C CE1 . PHE H  1 55  ? 14.464 55.749 24.468  1.00 89.44  ? 82   PHE H CE1 1 
ATOM   9482  C CE2 . PHE H  1 55  ? 14.392 54.003 22.811  1.00 90.14  ? 82   PHE H CE2 1 
ATOM   9483  C CZ  . PHE H  1 55  ? 14.392 55.356 23.134  1.00 90.15  ? 82   PHE H CZ  1 
ATOM   9484  N N   . THR H  1 56  ? 14.258 53.752 28.790  1.00 89.82  ? 83   THR H N   1 
ATOM   9485  C CA  . THR H  1 56  ? 14.376 54.881 29.698  1.00 89.72  ? 83   THR H CA  1 
ATOM   9486  C C   . THR H  1 56  ? 15.002 56.042 28.921  1.00 89.70  ? 83   THR H C   1 
ATOM   9487  O O   . THR H  1 56  ? 16.147 55.940 28.483  1.00 89.59  ? 83   THR H O   1 
ATOM   9488  C CB  . THR H  1 56  ? 15.285 54.513 30.896  1.00 89.53  ? 83   THR H CB  1 
ATOM   9489  O OG1 . THR H  1 56  ? 14.925 53.217 31.396  1.00 89.32  ? 83   THR H OG1 1 
ATOM   9490  C CG2 . THR H  1 56  ? 15.136 55.529 32.008  1.00 89.04  ? 83   THR H CG2 1 
ATOM   9491  N N   . CYS H  1 57  ? 14.256 57.131 28.733  1.00 89.50  ? 84   CYS H N   1 
ATOM   9492  C CA  . CYS H  1 57  ? 14.781 58.289 28.009  1.00 89.13  ? 84   CYS H CA  1 
ATOM   9493  C C   . CYS H  1 57  ? 15.768 59.054 28.888  1.00 88.17  ? 84   CYS H C   1 
ATOM   9494  O O   . CYS H  1 57  ? 15.364 59.795 29.781  1.00 87.85  ? 84   CYS H O   1 
ATOM   9495  C CB  . CYS H  1 57  ? 13.648 59.230 27.568  1.00 89.97  ? 84   CYS H CB  1 
ATOM   9496  S SG  . CYS H  1 57  ? 14.283 60.664 26.629  1.00 92.26  ? 84   CYS H SG  1 
ATOM   9497  N N   . LYS H  1 58  ? 17.061 58.875 28.626  1.00 87.23  ? 85   LYS H N   1 
ATOM   9498  C CA  . LYS H  1 58  ? 18.099 59.534 29.412  1.00 86.70  ? 85   LYS H CA  1 
ATOM   9499  C C   . LYS H  1 58  ? 18.576 60.846 28.812  1.00 87.14  ? 85   LYS H C   1 
ATOM   9500  O O   . LYS H  1 58  ? 19.219 61.653 29.486  1.00 86.74  ? 85   LYS H O   1 
ATOM   9501  C CB  . LYS H  1 58  ? 19.284 58.589 29.593  1.00 85.41  ? 85   LYS H CB  1 
ATOM   9502  C CG  . LYS H  1 58  ? 18.904 57.327 30.326  1.00 83.36  ? 85   LYS H CG  1 
ATOM   9503  C CD  . LYS H  1 58  ? 20.067 56.381 30.480  1.00 81.35  ? 85   LYS H CD  1 
ATOM   9504  C CE  . LYS H  1 58  ? 19.617 55.124 31.192  1.00 79.51  ? 85   LYS H CE  1 
ATOM   9505  N NZ  . LYS H  1 58  ? 20.720 54.154 31.363  1.00 79.18  ? 85   LYS H NZ  1 
ATOM   9506  N N   . ALA H  1 59  ? 18.259 61.054 27.541  1.00 87.75  ? 86   ALA H N   1 
ATOM   9507  C CA  . ALA H  1 59  ? 18.652 62.272 26.858  1.00 88.41  ? 86   ALA H CA  1 
ATOM   9508  C C   . ALA H  1 59  ? 17.929 62.348 25.528  1.00 89.11  ? 86   ALA H C   1 
ATOM   9509  O O   . ALA H  1 59  ? 17.451 61.337 25.012  1.00 88.39  ? 86   ALA H O   1 
ATOM   9510  C CB  . ALA H  1 59  ? 20.157 62.286 26.638  1.00 87.98  ? 86   ALA H CB  1 
ATOM   9511  N N   . PHE H  1 60  ? 17.836 63.555 24.985  1.00 90.69  ? 87   PHE H N   1 
ATOM   9512  C CA  . PHE H  1 60  ? 17.185 63.753 23.699  1.00 92.09  ? 87   PHE H CA  1 
ATOM   9513  C C   . PHE H  1 60  ? 17.796 64.953 22.985  1.00 92.65  ? 87   PHE H C   1 
ATOM   9514  O O   . PHE H  1 60  ? 18.118 65.965 23.606  1.00 92.98  ? 87   PHE H O   1 
ATOM   9515  C CB  . PHE H  1 60  ? 15.667 63.935 23.880  1.00 92.42  ? 87   PHE H CB  1 
ATOM   9516  C CG  . PHE H  1 60  ? 15.251 65.319 24.312  1.00 92.94  ? 87   PHE H CG  1 
ATOM   9517  C CD1 . PHE H  1 60  ? 15.184 66.364 23.392  1.00 92.73  ? 87   PHE H CD1 1 
ATOM   9518  C CD2 . PHE H  1 60  ? 14.908 65.574 25.638  1.00 93.32  ? 87   PHE H CD2 1 
ATOM   9519  C CE1 . PHE H  1 60  ? 14.779 67.638 23.787  1.00 92.81  ? 87   PHE H CE1 1 
ATOM   9520  C CE2 . PHE H  1 60  ? 14.501 66.846 26.041  1.00 92.96  ? 87   PHE H CE2 1 
ATOM   9521  C CZ  . PHE H  1 60  ? 14.436 67.879 25.115  1.00 92.68  ? 87   PHE H CZ  1 
ATOM   9522  N N   . VAL H  1 61  ? 17.969 64.822 21.676  1.00 93.12  ? 88   VAL H N   1 
ATOM   9523  C CA  . VAL H  1 61  ? 18.534 65.890 20.873  1.00 93.33  ? 88   VAL H CA  1 
ATOM   9524  C C   . VAL H  1 61  ? 17.443 66.458 19.982  1.00 93.82  ? 88   VAL H C   1 
ATOM   9525  O O   . VAL H  1 61  ? 16.679 65.711 19.375  1.00 93.93  ? 88   VAL H O   1 
ATOM   9526  C CB  . VAL H  1 61  ? 19.682 65.366 19.982  1.00 93.22  ? 88   VAL H CB  1 
ATOM   9527  C CG1 . VAL H  1 61  ? 20.166 66.473 19.060  1.00 94.02  ? 88   VAL H CG1 1 
ATOM   9528  C CG2 . VAL H  1 61  ? 20.829 64.857 20.845  1.00 92.62  ? 88   VAL H CG2 1 
ATOM   9529  N N   . PHE H  1 62  ? 17.351 67.780 19.916  1.00 94.82  ? 89   PHE H N   1 
ATOM   9530  C CA  . PHE H  1 62  ? 16.349 68.398 19.062  1.00 96.22  ? 89   PHE H CA  1 
ATOM   9531  C C   . PHE H  1 62  ? 17.000 68.935 17.795  1.00 96.93  ? 89   PHE H C   1 
ATOM   9532  O O   . PHE H  1 62  ? 17.889 69.788 17.846  1.00 97.24  ? 89   PHE H O   1 
ATOM   9533  C CB  . PHE H  1 62  ? 15.621 69.531 19.788  1.00 96.03  ? 89   PHE H CB  1 
ATOM   9534  C CG  . PHE H  1 62  ? 14.581 70.217 18.942  1.00 96.74  ? 89   PHE H CG  1 
ATOM   9535  C CD1 . PHE H  1 62  ? 13.575 69.477 18.322  1.00 97.13  ? 89   PHE H CD1 1 
ATOM   9536  C CD2 . PHE H  1 62  ? 14.610 71.597 18.753  1.00 96.51  ? 89   PHE H CD2 1 
ATOM   9537  C CE1 . PHE H  1 62  ? 12.615 70.102 17.523  1.00 97.30  ? 89   PHE H CE1 1 
ATOM   9538  C CE2 . PHE H  1 62  ? 13.655 72.232 17.957  1.00 96.47  ? 89   PHE H CE2 1 
ATOM   9539  C CZ  . PHE H  1 62  ? 12.656 71.483 17.341  1.00 96.93  ? 89   PHE H CZ  1 
ATOM   9540  N N   . ASP H  1 63  ? 16.574 68.392 16.660  1.00 97.51  ? 90   ASP H N   1 
ATOM   9541  C CA  . ASP H  1 63  ? 17.087 68.817 15.368  1.00 98.45  ? 90   ASP H CA  1 
ATOM   9542  C C   . ASP H  1 63  ? 16.288 70.062 14.968  1.00 99.75  ? 90   ASP H C   1 
ATOM   9543  O O   . ASP H  1 63  ? 15.213 69.955 14.378  1.00 100.05 ? 90   ASP H O   1 
ATOM   9544  C CB  . ASP H  1 63  ? 16.903 67.685 14.346  1.00 97.16  ? 90   ASP H CB  1 
ATOM   9545  C CG  . ASP H  1 63  ? 17.602 67.959 13.032  1.00 96.03  ? 90   ASP H CG  1 
ATOM   9546  O OD1 . ASP H  1 63  ? 18.498 68.824 13.009  1.00 95.39  ? 90   ASP H OD1 1 
ATOM   9547  O OD2 . ASP H  1 63  ? 17.263 67.298 12.027  1.00 95.16  ? 90   ASP H OD2 1 
ATOM   9548  N N   . LYS H  1 64  ? 16.811 71.238 15.314  1.00 101.00 ? 91   LYS H N   1 
ATOM   9549  C CA  . LYS H  1 64  ? 16.153 72.515 15.018  1.00 101.73 ? 91   LYS H CA  1 
ATOM   9550  C C   . LYS H  1 64  ? 15.775 72.682 13.537  1.00 102.08 ? 91   LYS H C   1 
ATOM   9551  O O   . LYS H  1 64  ? 14.740 73.276 13.214  1.00 102.18 ? 91   LYS H O   1 
ATOM   9552  C CB  . LYS H  1 64  ? 17.051 73.672 15.470  1.00 101.76 ? 91   LYS H CB  1 
ATOM   9553  N N   . ALA H  1 65  ? 16.625 72.165 12.650  1.00 101.81 ? 92   ALA H N   1 
ATOM   9554  C CA  . ALA H  1 65  ? 16.411 72.216 11.205  1.00 101.39 ? 92   ALA H CA  1 
ATOM   9555  C C   . ALA H  1 65  ? 15.218 71.344 10.794  1.00 100.95 ? 92   ALA H C   1 
ATOM   9556  O O   . ALA H  1 65  ? 14.132 71.855 10.499  1.00 100.37 ? 92   ALA H O   1 
ATOM   9557  C CB  . ALA H  1 65  ? 17.672 71.741 10.487  1.00 101.34 ? 92   ALA H CB  1 
ATOM   9558  N N   . ARG H  1 66  ? 15.441 70.029 10.777  1.00 100.53 ? 93   ARG H N   1 
ATOM   9559  C CA  . ARG H  1 66  ? 14.416 69.049 10.414  1.00 100.30 ? 93   ARG H CA  1 
ATOM   9560  C C   . ARG H  1 66  ? 13.445 68.800 11.574  1.00 100.16 ? 93   ARG H C   1 
ATOM   9561  O O   . ARG H  1 66  ? 12.837 67.728 11.671  1.00 100.18 ? 93   ARG H O   1 
ATOM   9562  C CB  . ARG H  1 66  ? 15.081 67.732 9.993   1.00 100.08 ? 93   ARG H CB  1 
ATOM   9563  N N   . LYS H  1 67  ? 13.317 69.803 12.444  1.00 99.84  ? 94   LYS H N   1 
ATOM   9564  C CA  . LYS H  1 67  ? 12.445 69.775 13.623  1.00 99.20  ? 94   LYS H CA  1 
ATOM   9565  C C   . LYS H  1 67  ? 11.898 68.414 14.059  1.00 98.97  ? 94   LYS H C   1 
ATOM   9566  O O   . LYS H  1 67  ? 10.683 68.187 14.071  1.00 98.71  ? 94   LYS H O   1 
ATOM   9567  C CB  . LYS H  1 67  ? 11.293 70.759 13.422  1.00 98.32  ? 94   LYS H CB  1 
ATOM   9568  C CG  . LYS H  1 67  ? 11.749 72.203 13.423  1.00 97.41  ? 94   LYS H CG  1 
ATOM   9569  C CD  . LYS H  1 67  ? 10.716 73.109 12.802  1.00 97.49  ? 94   LYS H CD  1 
ATOM   9570  C CE  . LYS H  1 67  ? 9.383  72.990 13.506  1.00 97.86  ? 94   LYS H CE  1 
ATOM   9571  N NZ  . LYS H  1 67  ? 8.393  73.925 12.913  1.00 98.01  ? 94   LYS H NZ  1 
ATOM   9572  N N   . GLN H  1 68  ? 12.806 67.515 14.425  1.00 98.13  ? 95   GLN H N   1 
ATOM   9573  C CA  . GLN H  1 68  ? 12.415 66.194 14.882  1.00 97.49  ? 95   GLN H CA  1 
ATOM   9574  C C   . GLN H  1 68  ? 13.224 65.819 16.120  1.00 97.00  ? 95   GLN H C   1 
ATOM   9575  O O   . GLN H  1 68  ? 14.416 66.124 16.219  1.00 96.64  ? 95   GLN H O   1 
ATOM   9576  C CB  . GLN H  1 68  ? 12.627 65.145 13.784  1.00 97.72  ? 95   GLN H CB  1 
ATOM   9577  C CG  . GLN H  1 68  ? 14.027 64.549 13.732  1.00 98.47  ? 95   GLN H CG  1 
ATOM   9578  C CD  . GLN H  1 68  ? 14.057 63.188 13.048  1.00 98.59  ? 95   GLN H CD  1 
ATOM   9579  O OE1 . GLN H  1 68  ? 13.278 62.290 13.389  1.00 98.49  ? 95   GLN H OE1 1 
ATOM   9580  N NE2 . GLN H  1 68  ? 14.964 63.025 12.088  1.00 97.84  ? 95   GLN H NE2 1 
ATOM   9581  N N   . CYS H  1 69  ? 12.561 65.156 17.063  1.00 96.57  ? 96   CYS H N   1 
ATOM   9582  C CA  . CYS H  1 69  ? 13.194 64.727 18.304  1.00 94.86  ? 96   CYS H CA  1 
ATOM   9583  C C   . CYS H  1 69  ? 13.996 63.443 18.115  1.00 93.94  ? 96   CYS H C   1 
ATOM   9584  O O   . CYS H  1 69  ? 13.679 62.611 17.261  1.00 93.44  ? 96   CYS H O   1 
ATOM   9585  C CB  . CYS H  1 69  ? 12.141 64.468 19.384  1.00 94.73  ? 96   CYS H CB  1 
ATOM   9586  S SG  . CYS H  1 69  ? 10.888 65.763 19.702  1.00 93.47  ? 96   CYS H SG  1 
ATOM   9587  N N   . LEU H  1 70  ? 15.035 63.295 18.928  1.00 93.22  ? 97   LEU H N   1 
ATOM   9588  C CA  . LEU H  1 70  ? 15.882 62.109 18.904  1.00 92.72  ? 97   LEU H CA  1 
ATOM   9589  C C   . LEU H  1 70  ? 16.073 61.655 20.340  1.00 92.04  ? 97   LEU H C   1 
ATOM   9590  O O   . LEU H  1 70  ? 17.015 62.064 21.015  1.00 91.56  ? 97   LEU H O   1 
ATOM   9591  C CB  . LEU H  1 70  ? 17.246 62.406 18.268  1.00 93.07  ? 97   LEU H CB  1 
ATOM   9592  C CG  . LEU H  1 70  ? 17.309 62.566 16.745  1.00 92.53  ? 97   LEU H CG  1 
ATOM   9593  C CD1 . LEU H  1 70  ? 16.587 63.837 16.320  1.00 92.10  ? 97   LEU H CD1 1 
ATOM   9594  C CD2 . LEU H  1 70  ? 18.766 62.607 16.304  1.00 91.85  ? 97   LEU H CD2 1 
ATOM   9595  N N   . TRP H  1 71  ? 15.156 60.809 20.797  1.00 91.71  ? 98   TRP H N   1 
ATOM   9596  C CA  . TRP H  1 71  ? 15.172 60.275 22.154  1.00 91.52  ? 98   TRP H CA  1 
ATOM   9597  C C   . TRP H  1 71  ? 16.162 59.112 22.312  1.00 91.19  ? 98   TRP H C   1 
ATOM   9598  O O   . TRP H  1 71  ? 16.033 58.085 21.636  1.00 90.94  ? 98   TRP H O   1 
ATOM   9599  C CB  . TRP H  1 71  ? 13.754 59.823 22.523  1.00 91.68  ? 98   TRP H CB  1 
ATOM   9600  C CG  . TRP H  1 71  ? 12.747 60.951 22.537  1.00 91.70  ? 98   TRP H CG  1 
ATOM   9601  C CD1 . TRP H  1 71  ? 12.693 61.990 23.423  1.00 91.33  ? 98   TRP H CD1 1 
ATOM   9602  C CD2 . TRP H  1 71  ? 11.656 61.146 21.626  1.00 91.56  ? 98   TRP H CD2 1 
ATOM   9603  N NE1 . TRP H  1 71  ? 11.636 62.817 23.124  1.00 90.91  ? 98   TRP H NE1 1 
ATOM   9604  C CE2 . TRP H  1 71  ? 10.982 62.323 22.027  1.00 91.47  ? 98   TRP H CE2 1 
ATOM   9605  C CE3 . TRP H  1 71  ? 11.180 60.440 20.512  1.00 91.73  ? 98   TRP H CE3 1 
ATOM   9606  C CZ2 . TRP H  1 71  ? 9.858  62.811 21.351  1.00 91.84  ? 98   TRP H CZ2 1 
ATOM   9607  C CZ3 . TRP H  1 71  ? 10.063 60.925 19.840  1.00 91.62  ? 98   TRP H CZ3 1 
ATOM   9608  C CH2 . TRP H  1 71  ? 9.414  62.099 20.264  1.00 92.37  ? 98   TRP H CH2 1 
ATOM   9609  N N   . PHE H  1 72  ? 17.144 59.275 23.205  1.00 90.52  ? 99   PHE H N   1 
ATOM   9610  C CA  . PHE H  1 72  ? 18.158 58.238 23.440  1.00 89.97  ? 99   PHE H CA  1 
ATOM   9611  C C   . PHE H  1 72  ? 18.076 57.609 24.834  1.00 89.18  ? 99   PHE H C   1 
ATOM   9612  O O   . PHE H  1 72  ? 17.834 58.295 25.826  1.00 88.63  ? 99   PHE H O   1 
ATOM   9613  C CB  . PHE H  1 72  ? 19.582 58.800 23.260  1.00 90.05  ? 99   PHE H CB  1 
ATOM   9614  C CG  . PHE H  1 72  ? 19.780 59.599 22.000  1.00 90.26  ? 99   PHE H CG  1 
ATOM   9615  C CD1 . PHE H  1 72  ? 19.528 59.043 20.751  1.00 90.17  ? 99   PHE H CD1 1 
ATOM   9616  C CD2 . PHE H  1 72  ? 20.209 60.922 22.070  1.00 90.55  ? 99   PHE H CD2 1 
ATOM   9617  C CE1 . PHE H  1 72  ? 19.697 59.796 19.589  1.00 90.19  ? 99   PHE H CE1 1 
ATOM   9618  C CE2 . PHE H  1 72  ? 20.382 61.681 20.915  1.00 90.50  ? 99   PHE H CE2 1 
ATOM   9619  C CZ  . PHE H  1 72  ? 20.125 61.119 19.672  1.00 90.48  ? 99   PHE H CZ  1 
ATOM   9620  N N   . PRO H  1 73  ? 18.284 56.285 24.917  1.00 88.79  ? 100  PRO H N   1 
ATOM   9621  C CA  . PRO H  1 73  ? 18.252 55.527 26.168  1.00 89.07  ? 100  PRO H CA  1 
ATOM   9622  C C   . PRO H  1 73  ? 19.658 55.540 26.764  1.00 89.51  ? 100  PRO H C   1 
ATOM   9623  O O   . PRO H  1 73  ? 20.109 54.560 27.359  1.00 90.06  ? 100  PRO H O   1 
ATOM   9624  C CB  . PRO H  1 73  ? 17.848 54.141 25.700  1.00 88.70  ? 100  PRO H CB  1 
ATOM   9625  C CG  . PRO H  1 73  ? 18.617 54.024 24.431  1.00 88.70  ? 100  PRO H CG  1 
ATOM   9626  C CD  . PRO H  1 73  ? 18.366 55.367 23.767  1.00 89.00  ? 100  PRO H CD  1 
ATOM   9627  N N   . PHE H  1 74  ? 20.344 56.665 26.584  1.00 89.75  ? 101  PHE H N   1 
ATOM   9628  C CA  . PHE H  1 74  ? 21.715 56.844 27.061  1.00 89.50  ? 101  PHE H CA  1 
ATOM   9629  C C   . PHE H  1 74  ? 22.061 58.330 26.968  1.00 89.11  ? 101  PHE H C   1 
ATOM   9630  O O   . PHE H  1 74  ? 21.252 59.131 26.490  1.00 88.43  ? 101  PHE H O   1 
ATOM   9631  C CB  . PHE H  1 74  ? 22.677 56.035 26.177  1.00 89.12  ? 101  PHE H CB  1 
ATOM   9632  C CG  . PHE H  1 74  ? 22.552 56.353 24.710  1.00 88.56  ? 101  PHE H CG  1 
ATOM   9633  C CD1 . PHE H  1 74  ? 23.115 57.513 24.185  1.00 88.50  ? 101  PHE H CD1 1 
ATOM   9634  C CD2 . PHE H  1 74  ? 21.802 55.534 23.870  1.00 88.23  ? 101  PHE H CD2 1 
ATOM   9635  C CE1 . PHE H  1 74  ? 22.927 57.860 22.847  1.00 88.54  ? 101  PHE H CE1 1 
ATOM   9636  C CE2 . PHE H  1 74  ? 21.608 55.872 22.531  1.00 88.56  ? 101  PHE H CE2 1 
ATOM   9637  C CZ  . PHE H  1 74  ? 22.171 57.039 22.020  1.00 88.47  ? 101  PHE H CZ  1 
ATOM   9638  N N   . ASN H  1 75  ? 23.253 58.698 27.430  1.00 88.70  ? 102  ASN H N   1 
ATOM   9639  C CA  . ASN H  1 75  ? 23.690 60.087 27.356  1.00 88.43  ? 102  ASN H CA  1 
ATOM   9640  C C   . ASN H  1 75  ? 25.175 60.198 27.014  1.00 88.99  ? 102  ASN H C   1 
ATOM   9641  O O   . ASN H  1 75  ? 25.856 59.192 26.808  1.00 88.79  ? 102  ASN H O   1 
ATOM   9642  C CB  . ASN H  1 75  ? 23.390 60.848 28.658  1.00 86.91  ? 102  ASN H CB  1 
ATOM   9643  C CG  . ASN H  1 75  ? 24.156 60.316 29.848  1.00 86.26  ? 102  ASN H CG  1 
ATOM   9644  O OD1 . ASN H  1 75  ? 25.259 59.789 29.714  1.00 86.06  ? 102  ASN H OD1 1 
ATOM   9645  N ND2 . ASN H  1 75  ? 23.581 60.474 31.031  1.00 86.00  ? 102  ASN H ND2 1 
ATOM   9646  N N   . SER H  1 76  ? 25.665 61.430 26.956  1.00 89.49  ? 103  SER H N   1 
ATOM   9647  C CA  . SER H  1 76  ? 27.054 61.710 26.609  1.00 90.11  ? 103  SER H CA  1 
ATOM   9648  C C   . SER H  1 76  ? 28.106 60.910 27.373  1.00 90.89  ? 103  SER H C   1 
ATOM   9649  O O   . SER H  1 76  ? 29.188 60.658 26.861  1.00 90.73  ? 103  SER H O   1 
ATOM   9650  C CB  . SER H  1 76  ? 27.340 63.200 26.788  1.00 89.28  ? 103  SER H CB  1 
ATOM   9651  O OG  . SER H  1 76  ? 27.283 63.553 28.155  1.00 89.76  ? 103  SER H OG  1 
ATOM   9652  N N   . MET H  1 77  ? 27.817 60.514 28.600  1.00 92.09  ? 104  MET H N   1 
ATOM   9653  C CA  . MET H  1 77  ? 28.807 59.760 29.350  1.00 93.37  ? 104  MET H CA  1 
ATOM   9654  C C   . MET H  1 77  ? 28.637 58.258 29.128  1.00 94.94  ? 104  MET H C   1 
ATOM   9655  O O   . MET H  1 77  ? 29.457 57.452 29.587  1.00 94.54  ? 104  MET H O   1 
ATOM   9656  C CB  . MET H  1 77  ? 28.696 60.113 30.831  1.00 92.77  ? 104  MET H CB  1 
ATOM   9657  C CG  . MET H  1 77  ? 28.978 61.577 31.111  1.00 91.57  ? 104  MET H CG  1 
ATOM   9658  S SD  . MET H  1 77  ? 27.920 62.227 32.406  1.00 91.83  ? 104  MET H SD  1 
ATOM   9659  C CE  . MET H  1 77  ? 26.373 62.428 31.517  1.00 90.61  ? 104  MET H CE  1 
ATOM   9660  N N   . SER H  1 78  ? 27.579 57.891 28.403  1.00 96.62  ? 105  SER H N   1 
ATOM   9661  C CA  . SER H  1 78  ? 27.298 56.490 28.115  1.00 98.21  ? 105  SER H CA  1 
ATOM   9662  C C   . SER H  1 78  ? 28.369 55.881 27.216  1.00 99.95  ? 105  SER H C   1 
ATOM   9663  O O   . SER H  1 78  ? 28.583 56.329 26.083  1.00 99.90  ? 105  SER H O   1 
ATOM   9664  C CB  . SER H  1 78  ? 25.925 56.334 27.446  1.00 97.54  ? 105  SER H CB  1 
ATOM   9665  O OG  . SER H  1 78  ? 24.870 56.660 28.330  1.00 95.30  ? 105  SER H OG  1 
ATOM   9666  N N   . SER H  1 79  ? 29.045 54.862 27.737  1.00 101.66 ? 106  SER H N   1 
ATOM   9667  C CA  . SER H  1 79  ? 30.076 54.166 26.986  1.00 103.29 ? 106  SER H CA  1 
ATOM   9668  C C   . SER H  1 79  ? 29.421 53.584 25.738  1.00 104.98 ? 106  SER H C   1 
ATOM   9669  O O   . SER H  1 79  ? 28.524 52.741 25.832  1.00 105.36 ? 106  SER H O   1 
ATOM   9670  C CB  . SER H  1 79  ? 30.677 53.048 27.840  1.00 102.94 ? 106  SER H CB  1 
ATOM   9671  O OG  . SER H  1 79  ? 29.662 52.252 28.428  1.00 102.09 ? 106  SER H OG  1 
ATOM   9672  N N   . GLY H  1 80  ? 29.857 54.050 24.572  1.00 106.38 ? 107  GLY H N   1 
ATOM   9673  C CA  . GLY H  1 80  ? 29.287 53.562 23.331  1.00 107.78 ? 107  GLY H CA  1 
ATOM   9674  C C   . GLY H  1 80  ? 28.754 54.686 22.465  1.00 108.80 ? 107  GLY H C   1 
ATOM   9675  O O   . GLY H  1 80  ? 28.138 54.433 21.426  1.00 109.42 ? 107  GLY H O   1 
ATOM   9676  N N   . VAL H  1 81  ? 28.984 55.926 22.894  1.00 109.26 ? 108  VAL H N   1 
ATOM   9677  C CA  . VAL H  1 81  ? 28.533 57.095 22.147  1.00 109.94 ? 108  VAL H CA  1 
ATOM   9678  C C   . VAL H  1 81  ? 29.555 58.225 22.191  1.00 110.13 ? 108  VAL H C   1 
ATOM   9679  O O   . VAL H  1 81  ? 30.369 58.307 23.112  1.00 110.10 ? 108  VAL H O   1 
ATOM   9680  C CB  . VAL H  1 81  ? 27.180 57.625 22.674  1.00 110.15 ? 108  VAL H CB  1 
ATOM   9681  C CG1 . VAL H  1 81  ? 26.101 56.569 22.490  1.00 110.75 ? 108  VAL H CG1 1 
ATOM   9682  C CG2 . VAL H  1 81  ? 27.302 58.006 24.136  1.00 110.62 ? 108  VAL H CG2 1 
ATOM   9683  N N   . LYS H  1 82  ? 29.504 59.082 21.172  1.00 110.75 ? 109  LYS H N   1 
ATOM   9684  C CA  . LYS H  1 82  ? 30.412 60.221 21.031  1.00 110.95 ? 109  LYS H CA  1 
ATOM   9685  C C   . LYS H  1 82  ? 29.664 61.453 20.513  1.00 110.99 ? 109  LYS H C   1 
ATOM   9686  O O   . LYS H  1 82  ? 29.073 61.427 19.428  1.00 111.00 ? 109  LYS H O   1 
ATOM   9687  C CB  . LYS H  1 82  ? 31.549 59.863 20.074  1.00 110.85 ? 109  LYS H CB  1 
ATOM   9688  N N   . LYS H  1 83  ? 29.697 62.527 21.297  1.00 110.79 ? 110  LYS H N   1 
ATOM   9689  C CA  . LYS H  1 83  ? 29.023 63.769 20.935  1.00 110.47 ? 110  LYS H CA  1 
ATOM   9690  C C   . LYS H  1 83  ? 29.760 64.529 19.840  1.00 110.32 ? 110  LYS H C   1 
ATOM   9691  O O   . LYS H  1 83  ? 30.919 64.243 19.547  1.00 110.54 ? 110  LYS H O   1 
ATOM   9692  C CB  . LYS H  1 83  ? 28.865 64.668 22.171  1.00 110.06 ? 110  LYS H CB  1 
ATOM   9693  C CG  . LYS H  1 83  ? 30.106 64.753 23.057  1.00 109.37 ? 110  LYS H CG  1 
ATOM   9694  C CD  . LYS H  1 83  ? 30.068 65.961 23.994  1.00 108.40 ? 110  LYS H CD  1 
ATOM   9695  C CE  . LYS H  1 83  ? 28.894 65.925 24.957  1.00 108.00 ? 110  LYS H CE  1 
ATOM   9696  N NZ  . LYS H  1 83  ? 28.891 67.118 25.853  1.00 107.90 ? 110  LYS H NZ  1 
ATOM   9697  N N   . GLU H  1 84  ? 29.073 65.490 19.228  1.00 110.16 ? 111  GLU H N   1 
ATOM   9698  C CA  . GLU H  1 84  ? 29.669 66.304 18.177  1.00 110.55 ? 111  GLU H CA  1 
ATOM   9699  C C   . GLU H  1 84  ? 28.874 67.595 17.942  1.00 110.92 ? 111  GLU H C   1 
ATOM   9700  O O   . GLU H  1 84  ? 27.731 67.724 18.388  1.00 110.86 ? 111  GLU H O   1 
ATOM   9701  C CB  . GLU H  1 84  ? 29.807 65.492 16.881  1.00 110.55 ? 111  GLU H CB  1 
ATOM   9702  C CG  . GLU H  1 84  ? 28.514 64.928 16.311  1.00 110.94 ? 111  GLU H CG  1 
ATOM   9703  C CD  . GLU H  1 84  ? 28.744 64.108 15.044  1.00 111.24 ? 111  GLU H CD  1 
ATOM   9704  O OE1 . GLU H  1 84  ? 29.334 63.008 15.136  1.00 110.66 ? 111  GLU H OE1 1 
ATOM   9705  O OE2 . GLU H  1 84  ? 28.339 64.571 13.954  1.00 111.08 ? 111  GLU H OE2 1 
ATOM   9706  N N   . PHE H  1 85  ? 29.495 68.543 17.242  1.00 110.91 ? 112  PHE H N   1 
ATOM   9707  C CA  . PHE H  1 85  ? 28.903 69.854 16.960  1.00 110.71 ? 112  PHE H CA  1 
ATOM   9708  C C   . PHE H  1 85  ? 27.792 69.857 15.899  1.00 110.67 ? 112  PHE H C   1 
ATOM   9709  O O   . PHE H  1 85  ? 27.638 68.902 15.136  1.00 110.53 ? 112  PHE H O   1 
ATOM   9710  C CB  . PHE H  1 85  ? 30.029 70.820 16.559  1.00 110.74 ? 112  PHE H CB  1 
ATOM   9711  C CG  . PHE H  1 85  ? 29.634 72.275 16.571  1.00 111.24 ? 112  PHE H CG  1 
ATOM   9712  C CD1 . PHE H  1 85  ? 28.979 72.848 15.482  1.00 111.00 ? 112  PHE H CD1 1 
ATOM   9713  C CD2 . PHE H  1 85  ? 29.924 73.078 17.673  1.00 111.37 ? 112  PHE H CD2 1 
ATOM   9714  C CE1 . PHE H  1 85  ? 28.621 74.194 15.490  1.00 111.12 ? 112  PHE H CE1 1 
ATOM   9715  C CE2 . PHE H  1 85  ? 29.568 74.429 17.690  1.00 111.24 ? 112  PHE H CE2 1 
ATOM   9716  C CZ  . PHE H  1 85  ? 28.916 74.988 16.596  1.00 111.00 ? 112  PHE H CZ  1 
ATOM   9717  N N   . GLY H  1 86  ? 27.016 70.942 15.873  1.00 110.42 ? 113  GLY H N   1 
ATOM   9718  C CA  . GLY H  1 86  ? 25.933 71.091 14.914  1.00 109.77 ? 113  GLY H CA  1 
ATOM   9719  C C   . GLY H  1 86  ? 25.043 72.285 15.233  1.00 109.39 ? 113  GLY H C   1 
ATOM   9720  O O   . GLY H  1 86  ? 24.158 72.178 16.077  1.00 109.75 ? 113  GLY H O   1 
ATOM   9721  N N   . HIS H  1 87  ? 25.270 73.415 14.561  1.00 108.99 ? 114  HIS H N   1 
ATOM   9722  C CA  . HIS H  1 87  ? 24.493 74.646 14.776  1.00 108.11 ? 114  HIS H CA  1 
ATOM   9723  C C   . HIS H  1 87  ? 22.993 74.399 14.898  1.00 106.89 ? 114  HIS H C   1 
ATOM   9724  O O   . HIS H  1 87  ? 22.269 75.198 15.494  1.00 106.35 ? 114  HIS H O   1 
ATOM   9725  C CB  . HIS H  1 87  ? 24.709 75.626 13.620  1.00 109.27 ? 114  HIS H CB  1 
ATOM   9726  C CG  . HIS H  1 87  ? 26.147 75.901 13.307  1.00 110.60 ? 114  HIS H CG  1 
ATOM   9727  N ND1 . HIS H  1 87  ? 26.971 76.618 14.146  1.00 111.18 ? 114  HIS H ND1 1 
ATOM   9728  C CD2 . HIS H  1 87  ? 26.901 75.569 12.231  1.00 111.38 ? 114  HIS H CD2 1 
ATOM   9729  C CE1 . HIS H  1 87  ? 28.171 76.720 13.600  1.00 112.00 ? 114  HIS H CE1 1 
ATOM   9730  N NE2 . HIS H  1 87  ? 28.155 76.092 12.438  1.00 111.84 ? 114  HIS H NE2 1 
ATOM   9731  N N   . GLU H  1 88  ? 22.544 73.290 14.316  1.00 105.92 ? 115  GLU H N   1 
ATOM   9732  C CA  . GLU H  1 88  ? 21.135 72.896 14.300  1.00 104.92 ? 115  GLU H CA  1 
ATOM   9733  C C   . GLU H  1 88  ? 20.666 72.106 15.529  1.00 103.67 ? 115  GLU H C   1 
ATOM   9734  O O   . GLU H  1 88  ? 19.516 72.235 15.963  1.00 102.96 ? 115  GLU H O   1 
ATOM   9735  C CB  . GLU H  1 88  ? 20.873 72.052 13.056  1.00 105.65 ? 115  GLU H CB  1 
ATOM   9736  C CG  . GLU H  1 88  ? 21.676 70.763 13.055  1.00 106.62 ? 115  GLU H CG  1 
ATOM   9737  C CD  . GLU H  1 88  ? 21.356 69.866 11.882  1.00 107.52 ? 115  GLU H CD  1 
ATOM   9738  O OE1 . GLU H  1 88  ? 20.162 69.581 11.652  1.00 108.07 ? 115  GLU H OE1 1 
ATOM   9739  O OE2 . GLU H  1 88  ? 22.303 69.437 11.192  1.00 108.28 ? 115  GLU H OE2 1 
ATOM   9740  N N   . PHE H  1 89  ? 21.559 71.284 16.076  1.00 101.94 ? 116  PHE H N   1 
ATOM   9741  C CA  . PHE H  1 89  ? 21.244 70.449 17.233  1.00 99.84  ? 116  PHE H CA  1 
ATOM   9742  C C   . PHE H  1 89  ? 21.335 71.136 18.599  1.00 97.94  ? 116  PHE H C   1 
ATOM   9743  O O   . PHE H  1 89  ? 22.027 72.140 18.781  1.00 97.50  ? 116  PHE H O   1 
ATOM   9744  C CB  . PHE H  1 89  ? 22.162 69.223 17.264  1.00 101.08 ? 116  PHE H CB  1 
ATOM   9745  C CG  . PHE H  1 89  ? 22.078 68.356 16.039  1.00 102.09 ? 116  PHE H CG  1 
ATOM   9746  C CD1 . PHE H  1 89  ? 20.886 67.737 15.683  1.00 102.29 ? 116  PHE H CD1 1 
ATOM   9747  C CD2 . PHE H  1 89  ? 23.210 68.127 15.258  1.00 102.76 ? 116  PHE H CD2 1 
ATOM   9748  C CE1 . PHE H  1 89  ? 20.822 66.898 14.569  1.00 102.09 ? 116  PHE H CE1 1 
ATOM   9749  C CE2 . PHE H  1 89  ? 23.155 67.291 14.143  1.00 102.36 ? 116  PHE H CE2 1 
ATOM   9750  C CZ  . PHE H  1 89  ? 21.959 66.677 13.801  1.00 102.20 ? 116  PHE H CZ  1 
ATOM   9751  N N   . ASP H  1 90  ? 20.628 70.548 19.559  1.00 95.34  ? 117  ASP H N   1 
ATOM   9752  C CA  . ASP H  1 90  ? 20.590 71.009 20.941  1.00 91.73  ? 117  ASP H CA  1 
ATOM   9753  C C   . ASP H  1 90  ? 20.425 69.750 21.786  1.00 88.67  ? 117  ASP H C   1 
ATOM   9754  O O   . ASP H  1 90  ? 19.425 69.038 21.666  1.00 88.06  ? 117  ASP H O   1 
ATOM   9755  C CB  . ASP H  1 90  ? 19.408 71.961 21.162  1.00 93.02  ? 117  ASP H CB  1 
ATOM   9756  C CG  . ASP H  1 90  ? 19.842 73.412 21.337  1.00 94.33  ? 117  ASP H CG  1 
ATOM   9757  O OD1 . ASP H  1 90  ? 20.578 73.933 20.468  1.00 95.00  ? 117  ASP H OD1 1 
ATOM   9758  O OD2 . ASP H  1 90  ? 19.440 74.035 22.347  1.00 94.83  ? 117  ASP H OD2 1 
ATOM   9759  N N   . LEU H  1 91  ? 21.420 69.471 22.624  1.00 85.36  ? 118  LEU H N   1 
ATOM   9760  C CA  . LEU H  1 91  ? 21.409 68.290 23.481  1.00 81.60  ? 118  LEU H CA  1 
ATOM   9761  C C   . LEU H  1 91  ? 20.754 68.538 24.825  1.00 79.20  ? 118  LEU H C   1 
ATOM   9762  O O   . LEU H  1 91  ? 21.038 69.531 25.487  1.00 78.38  ? 118  LEU H O   1 
ATOM   9763  C CB  . LEU H  1 91  ? 22.833 67.794 23.722  1.00 81.16  ? 118  LEU H CB  1 
ATOM   9764  C CG  . LEU H  1 91  ? 22.932 66.557 24.609  1.00 81.20  ? 118  LEU H CG  1 
ATOM   9765  C CD1 . LEU H  1 91  ? 22.206 65.395 23.938  1.00 82.18  ? 118  LEU H CD1 1 
ATOM   9766  C CD2 . LEU H  1 91  ? 24.391 66.210 24.848  1.00 81.40  ? 118  LEU H CD2 1 
ATOM   9767  N N   . TYR H  1 92  ? 19.879 67.623 25.226  1.00 77.42  ? 119  TYR H N   1 
ATOM   9768  C CA  . TYR H  1 92  ? 19.200 67.736 26.513  1.00 75.18  ? 119  TYR H CA  1 
ATOM   9769  C C   . TYR H  1 92  ? 19.358 66.448 27.298  1.00 73.06  ? 119  TYR H C   1 
ATOM   9770  O O   . TYR H  1 92  ? 18.700 65.451 27.005  1.00 72.37  ? 119  TYR H O   1 
ATOM   9771  C CB  . TYR H  1 92  ? 17.713 68.014 26.325  1.00 75.43  ? 119  TYR H CB  1 
ATOM   9772  C CG  . TYR H  1 92  ? 17.399 69.317 25.630  1.00 75.49  ? 119  TYR H CG  1 
ATOM   9773  C CD1 . TYR H  1 92  ? 17.625 69.478 24.264  1.00 75.45  ? 119  TYR H CD1 1 
ATOM   9774  C CD2 . TYR H  1 92  ? 16.838 70.380 26.333  1.00 75.60  ? 119  TYR H CD2 1 
ATOM   9775  C CE1 . TYR H  1 92  ? 17.293 70.670 23.615  1.00 75.83  ? 119  TYR H CE1 1 
ATOM   9776  C CE2 . TYR H  1 92  ? 16.502 71.575 25.696  1.00 75.53  ? 119  TYR H CE2 1 
ATOM   9777  C CZ  . TYR H  1 92  ? 16.730 71.715 24.339  1.00 75.56  ? 119  TYR H CZ  1 
ATOM   9778  O OH  . TYR H  1 92  ? 16.387 72.893 23.710  1.00 74.48  ? 119  TYR H OH  1 
ATOM   9779  N N   . GLU H  1 93  ? 20.230 66.470 28.297  1.00 70.84  ? 120  GLU H N   1 
ATOM   9780  C CA  . GLU H  1 93  ? 20.456 65.285 29.104  1.00 69.29  ? 120  GLU H CA  1 
ATOM   9781  C C   . GLU H  1 93  ? 19.614 65.285 30.369  1.00 68.34  ? 120  GLU H C   1 
ATOM   9782  O O   . GLU H  1 93  ? 19.556 66.280 31.093  1.00 68.99  ? 120  GLU H O   1 
ATOM   9783  C CB  . GLU H  1 93  ? 21.928 65.176 29.456  1.00 69.48  ? 120  GLU H CB  1 
ATOM   9784  C CG  . GLU H  1 93  ? 22.811 65.055 28.238  1.00 70.38  ? 120  GLU H CG  1 
ATOM   9785  C CD  . GLU H  1 93  ? 24.276 65.008 28.596  1.00 71.86  ? 120  GLU H CD  1 
ATOM   9786  O OE1 . GLU H  1 93  ? 24.784 66.005 29.153  1.00 72.14  ? 120  GLU H OE1 1 
ATOM   9787  O OE2 . GLU H  1 93  ? 24.921 63.973 28.327  1.00 73.57  ? 120  GLU H OE2 1 
ATOM   9788  N N   . ASN H  1 94  ? 18.954 64.156 30.617  1.00 66.17  ? 121  ASN H N   1 
ATOM   9789  C CA  . ASN H  1 94  ? 18.111 63.991 31.783  1.00 63.51  ? 121  ASN H CA  1 
ATOM   9790  C C   . ASN H  1 94  ? 19.013 64.035 33.013  1.00 62.92  ? 121  ASN H C   1 
ATOM   9791  O O   . ASN H  1 94  ? 19.956 63.244 33.135  1.00 60.88  ? 121  ASN H O   1 
ATOM   9792  C CB  . ASN H  1 94  ? 17.387 62.654 31.706  1.00 63.08  ? 121  ASN H CB  1 
ATOM   9793  C CG  . ASN H  1 94  ? 16.245 62.561 32.687  1.00 64.02  ? 121  ASN H CG  1 
ATOM   9794  O OD1 . ASN H  1 94  ? 16.397 62.875 33.866  1.00 64.72  ? 121  ASN H OD1 1 
ATOM   9795  N ND2 . ASN H  1 94  ? 15.089 62.124 32.208  1.00 64.87  ? 121  ASN H ND2 1 
ATOM   9796  N N   . LYS H  1 95  ? 18.725 64.965 33.920  1.00 62.66  ? 122  LYS H N   1 
ATOM   9797  C CA  . LYS H  1 95  ? 19.527 65.114 35.121  1.00 62.73  ? 122  LYS H CA  1 
ATOM   9798  C C   . LYS H  1 95  ? 19.544 63.847 35.959  1.00 63.44  ? 122  LYS H C   1 
ATOM   9799  O O   . LYS H  1 95  ? 20.516 63.595 36.674  1.00 64.52  ? 122  LYS H O   1 
ATOM   9800  C CB  . LYS H  1 95  ? 19.042 66.306 35.950  1.00 61.08  ? 122  LYS H CB  1 
ATOM   9801  C CG  . LYS H  1 95  ? 19.186 67.616 35.213  1.00 61.09  ? 122  LYS H CG  1 
ATOM   9802  C CD  . LYS H  1 95  ? 19.465 68.776 36.143  1.00 62.04  ? 122  LYS H CD  1 
ATOM   9803  C CE  . LYS H  1 95  ? 18.283 69.076 37.047  1.00 65.26  ? 122  LYS H CE  1 
ATOM   9804  N NZ  . LYS H  1 95  ? 18.521 70.292 37.880  1.00 66.07  ? 122  LYS H NZ  1 
ATOM   9805  N N   . ASP H  1 96  ? 18.483 63.045 35.842  1.00 63.05  ? 123  ASP H N   1 
ATOM   9806  C CA  . ASP H  1 96  ? 18.368 61.780 36.571  1.00 62.40  ? 123  ASP H CA  1 
ATOM   9807  C C   . ASP H  1 96  ? 19.529 60.862 36.237  1.00 61.15  ? 123  ASP H C   1 
ATOM   9808  O O   . ASP H  1 96  ? 19.929 60.030 37.057  1.00 61.14  ? 123  ASP H O   1 
ATOM   9809  C CB  . ASP H  1 96  ? 17.068 61.056 36.209  1.00 63.52  ? 123  ASP H CB  1 
ATOM   9810  C CG  . ASP H  1 96  ? 15.851 61.734 36.772  1.00 64.73  ? 123  ASP H CG  1 
ATOM   9811  O OD1 . ASP H  1 96  ? 15.682 62.943 36.505  1.00 66.26  ? 123  ASP H OD1 1 
ATOM   9812  O OD2 . ASP H  1 96  ? 15.062 61.060 37.474  1.00 64.68  ? 123  ASP H OD2 1 
ATOM   9813  N N   . TYR H  1 97  ? 20.063 61.008 35.029  1.00 59.10  ? 124  TYR H N   1 
ATOM   9814  C CA  . TYR H  1 97  ? 21.167 60.172 34.620  1.00 57.63  ? 124  TYR H CA  1 
ATOM   9815  C C   . TYR H  1 97  ? 22.490 60.915 34.485  1.00 56.74  ? 124  TYR H C   1 
ATOM   9816  O O   . TYR H  1 97  ? 23.284 60.641 33.588  1.00 56.71  ? 124  TYR H O   1 
ATOM   9817  C CB  . TYR H  1 97  ? 20.792 59.427 33.344  1.00 58.07  ? 124  TYR H CB  1 
ATOM   9818  C CG  . TYR H  1 97  ? 19.544 58.607 33.558  1.00 59.52  ? 124  TYR H CG  1 
ATOM   9819  C CD1 . TYR H  1 97  ? 18.283 59.212 33.570  1.00 59.71  ? 124  TYR H CD1 1 
ATOM   9820  C CD2 . TYR H  1 97  ? 19.624 57.248 33.864  1.00 60.75  ? 124  TYR H CD2 1 
ATOM   9821  C CE1 . TYR H  1 97  ? 17.126 58.484 33.893  1.00 61.04  ? 124  TYR H CE1 1 
ATOM   9822  C CE2 . TYR H  1 97  ? 18.474 56.504 34.192  1.00 61.81  ? 124  TYR H CE2 1 
ATOM   9823  C CZ  . TYR H  1 97  ? 17.226 57.128 34.208  1.00 62.08  ? 124  TYR H CZ  1 
ATOM   9824  O OH  . TYR H  1 97  ? 16.098 56.403 34.561  1.00 60.88  ? 124  TYR H OH  1 
ATOM   9825  N N   . ILE H  1 98  ? 22.716 61.868 35.390  1.00 55.20  ? 125  ILE H N   1 
ATOM   9826  C CA  . ILE H  1 98  ? 23.966 62.617 35.441  1.00 53.03  ? 125  ILE H CA  1 
ATOM   9827  C C   . ILE H  1 98  ? 24.316 62.574 36.919  1.00 51.84  ? 125  ILE H C   1 
ATOM   9828  O O   . ILE H  1 98  ? 23.809 63.380 37.702  1.00 52.18  ? 125  ILE H O   1 
ATOM   9829  C CB  . ILE H  1 98  ? 23.794 64.084 34.997  1.00 52.83  ? 125  ILE H CB  1 
ATOM   9830  C CG1 . ILE H  1 98  ? 23.272 64.137 33.561  1.00 52.40  ? 125  ILE H CG1 1 
ATOM   9831  C CG2 . ILE H  1 98  ? 25.128 64.809 35.076  1.00 52.01  ? 125  ILE H CG2 1 
ATOM   9832  C CD1 . ILE H  1 98  ? 23.129 65.536 33.025  1.00 52.92  ? 125  ILE H CD1 1 
ATOM   9833  N N   . ARG H  1 99  ? 25.157 61.615 37.302  1.00 50.12  ? 126  ARG H N   1 
ATOM   9834  C CA  . ARG H  1 99  ? 25.524 61.453 38.702  1.00 48.63  ? 126  ARG H CA  1 
ATOM   9835  C C   . ARG H  1 99  ? 25.587 62.792 39.409  1.00 48.31  ? 126  ARG H C   1 
ATOM   9836  O O   . ARG H  1 99  ? 26.276 63.707 38.966  1.00 48.37  ? 126  ARG H O   1 
ATOM   9837  C CB  . ARG H  1 99  ? 26.864 60.742 38.849  1.00 47.59  ? 126  ARG H CB  1 
ATOM   9838  C CG  . ARG H  1 99  ? 27.072 60.239 40.261  1.00 46.71  ? 126  ARG H CG  1 
ATOM   9839  C CD  . ARG H  1 99  ? 28.442 59.672 40.450  1.00 46.06  ? 126  ARG H CD  1 
ATOM   9840  N NE  . ARG H  1 99  ? 28.853 58.880 39.300  1.00 44.52  ? 126  ARG H NE  1 
ATOM   9841  C CZ  . ARG H  1 99  ? 29.867 59.215 38.518  1.00 43.99  ? 126  ARG H CZ  1 
ATOM   9842  N NH1 . ARG H  1 99  ? 30.557 60.319 38.772  1.00 44.60  ? 126  ARG H NH1 1 
ATOM   9843  N NH2 . ARG H  1 99  ? 30.195 58.453 37.489  1.00 45.59  ? 126  ARG H NH2 1 
ATOM   9844  N N   . ASN H  1 100 ? 24.868 62.907 40.514  1.00 47.28  ? 127  ASN H N   1 
ATOM   9845  C CA  . ASN H  1 100 ? 24.843 64.155 41.235  1.00 47.93  ? 127  ASN H CA  1 
ATOM   9846  C C   . ASN H  1 100 ? 25.559 64.077 42.556  1.00 48.19  ? 127  ASN H C   1 
ATOM   9847  O O   . ASN H  1 100 ? 25.358 64.918 43.432  1.00 47.55  ? 127  ASN H O   1 
ATOM   9848  C CB  . ASN H  1 100 ? 23.409 64.599 41.462  1.00 48.42  ? 127  ASN H CB  1 
ATOM   9849  C CG  . ASN H  1 100 ? 22.651 63.660 42.353  1.00 48.66  ? 127  ASN H CG  1 
ATOM   9850  O OD1 . ASN H  1 100 ? 23.211 62.713 42.887  1.00 51.64  ? 127  ASN H OD1 1 
ATOM   9851  N ND2 . ASN H  1 100 ? 21.368 63.920 42.526  1.00 48.66  ? 127  ASN H ND2 1 
ATOM   9852  N N   . CYS H  1 101 ? 26.336 63.019 42.723  1.00 49.33  ? 128  CYS H N   1 
ATOM   9853  C CA  . CYS H  1 101 ? 27.124 62.888 43.933  1.00 53.29  ? 128  CYS H CA  1 
ATOM   9854  C C   . CYS H  1 101 ? 28.539 62.667 43.438  1.00 54.23  ? 128  CYS H C   1 
ATOM   9855  O O   . CYS H  1 101 ? 28.738 62.228 42.301  1.00 53.57  ? 128  CYS H O   1 
ATOM   9856  C CB  . CYS H  1 101 ? 26.653 61.726 44.822  1.00 54.36  ? 128  CYS H CB  1 
ATOM   9857  S SG  . CYS H  1 101 ? 26.549 60.096 44.026  1.00 56.53  ? 128  CYS H SG  1 
ATOM   9858  N N   . ILE H  1 102 ? 29.519 62.986 44.275  1.00 55.61  ? 129  ILE H N   1 
ATOM   9859  C CA  . ILE H  1 102 ? 30.911 62.848 43.876  1.00 58.59  ? 129  ILE H CA  1 
ATOM   9860  C C   . ILE H  1 102 ? 31.664 61.780 44.620  1.00 60.31  ? 129  ILE H C   1 
ATOM   9861  O O   . ILE H  1 102 ? 31.345 61.464 45.763  1.00 61.53  ? 129  ILE H O   1 
ATOM   9862  C CB  . ILE H  1 102 ? 31.698 64.155 44.087  1.00 59.02  ? 129  ILE H CB  1 
ATOM   9863  C CG1 . ILE H  1 102 ? 31.614 64.568 45.558  1.00 57.82  ? 129  ILE H CG1 1 
ATOM   9864  C CG2 . ILE H  1 102 ? 31.160 65.249 43.169  1.00 59.36  ? 129  ILE H CG2 1 
ATOM   9865  C CD1 . ILE H  1 102 ? 32.570 65.655 45.935  1.00 56.40  ? 129  ILE H CD1 1 
ATOM   9866  N N   . ILE H  1 103 ? 32.680 61.240 43.956  1.00 62.56  ? 130  ILE H N   1 
ATOM   9867  C CA  . ILE H  1 103 ? 33.531 60.221 44.552  1.00 64.83  ? 130  ILE H CA  1 
ATOM   9868  C C   . ILE H  1 103 ? 34.868 60.892 44.836  1.00 64.09  ? 130  ILE H C   1 
ATOM   9869  O O   . ILE H  1 103 ? 35.580 61.288 43.911  1.00 63.19  ? 130  ILE H O   1 
ATOM   9870  C CB  . ILE H  1 103 ? 33.802 59.045 43.595  1.00 66.61  ? 130  ILE H CB  1 
ATOM   9871  C CG1 . ILE H  1 103 ? 32.504 58.573 42.945  1.00 67.49  ? 130  ILE H CG1 1 
ATOM   9872  C CG2 . ILE H  1 103 ? 34.433 57.892 44.376  1.00 68.04  ? 130  ILE H CG2 1 
ATOM   9873  C CD1 . ILE H  1 103 ? 32.717 57.529 41.861  1.00 69.19  ? 130  ILE H CD1 1 
ATOM   9874  N N   . GLY H  1 104 ? 35.202 61.029 46.113  1.00 63.45  ? 131  GLY H N   1 
ATOM   9875  C CA  . GLY H  1 104 ? 36.462 61.653 46.461  1.00 62.89  ? 131  GLY H CA  1 
ATOM   9876  C C   . GLY H  1 104 ? 36.475 63.138 46.169  1.00 62.03  ? 131  GLY H C   1 
ATOM   9877  O O   . GLY H  1 104 ? 35.579 63.860 46.597  1.00 61.80  ? 131  GLY H O   1 
ATOM   9878  N N   . LYS H  1 105 ? 37.486 63.603 45.445  1.00 61.63  ? 132  LYS H N   1 
ATOM   9879  C CA  . LYS H  1 105 ? 37.580 65.025 45.130  1.00 62.45  ? 132  LYS H CA  1 
ATOM   9880  C C   . LYS H  1 105 ? 36.558 65.486 44.076  1.00 62.56  ? 132  LYS H C   1 
ATOM   9881  O O   . LYS H  1 105 ? 36.277 66.681 43.947  1.00 61.35  ? 132  LYS H O   1 
ATOM   9882  C CB  . LYS H  1 105 ? 39.008 65.357 44.698  1.00 62.84  ? 132  LYS H CB  1 
ATOM   9883  C CG  . LYS H  1 105 ? 40.011 65.232 45.840  1.00 64.40  ? 132  LYS H CG  1 
ATOM   9884  C CD  . LYS H  1 105 ? 41.454 65.154 45.340  1.00 66.29  ? 132  LYS H CD  1 
ATOM   9885  C CE  . LYS H  1 105 ? 42.423 64.815 46.477  1.00 66.92  ? 132  LYS H CE  1 
ATOM   9886  N NZ  . LYS H  1 105 ? 43.807 64.480 46.010  1.00 67.71  ? 132  LYS H NZ  1 
ATOM   9887  N N   . GLY H  1 106 ? 35.998 64.533 43.333  1.00 62.67  ? 133  GLY H N   1 
ATOM   9888  C CA  . GLY H  1 106 ? 34.999 64.866 42.330  1.00 61.60  ? 133  GLY H CA  1 
ATOM   9889  C C   . GLY H  1 106 ? 35.573 65.406 41.040  1.00 60.49  ? 133  GLY H C   1 
ATOM   9890  O O   . GLY H  1 106 ? 34.976 66.253 40.382  1.00 60.23  ? 133  GLY H O   1 
ATOM   9891  N N   . ARG H  1 107 ? 36.728 64.897 40.653  1.00 59.89  ? 134  ARG H N   1 
ATOM   9892  C CA  . ARG H  1 107 ? 37.371 65.370 39.443  1.00 59.15  ? 134  ARG H CA  1 
ATOM   9893  C C   . ARG H  1 107 ? 36.541 65.142 38.193  1.00 56.50  ? 134  ARG H C   1 
ATOM   9894  O O   . ARG H  1 107 ? 36.756 65.802 37.180  1.00 56.82  ? 134  ARG H O   1 
ATOM   9895  C CB  . ARG H  1 107 ? 38.734 64.703 39.284  1.00 62.61  ? 134  ARG H CB  1 
ATOM   9896  C CG  . ARG H  1 107 ? 39.468 64.506 40.610  1.00 65.73  ? 134  ARG H CG  1 
ATOM   9897  C CD  . ARG H  1 107 ? 38.961 63.274 41.339  1.00 66.52  ? 134  ARG H CD  1 
ATOM   9898  N NE  . ARG H  1 107 ? 39.562 63.131 42.658  1.00 67.64  ? 134  ARG H NE  1 
ATOM   9899  C CZ  . ARG H  1 107 ? 39.636 61.975 43.306  1.00 69.32  ? 134  ARG H CZ  1 
ATOM   9900  N NH1 . ARG H  1 107 ? 39.150 60.872 42.747  1.00 70.49  ? 134  ARG H NH1 1 
ATOM   9901  N NH2 . ARG H  1 107 ? 40.193 61.917 44.508  1.00 69.27  ? 134  ARG H NH2 1 
ATOM   9902  N N   . SER H  1 108 ? 35.598 64.212 38.247  1.00 53.04  ? 135  SER H N   1 
ATOM   9903  C CA  . SER H  1 108 ? 34.777 63.969 37.068  1.00 50.69  ? 135  SER H CA  1 
ATOM   9904  C C   . SER H  1 108 ? 33.335 64.437 37.223  1.00 47.81  ? 135  SER H C   1 
ATOM   9905  O O   . SER H  1 108 ? 32.488 64.145 36.375  1.00 46.87  ? 135  SER H O   1 
ATOM   9906  C CB  . SER H  1 108 ? 34.778 62.488 36.713  1.00 52.80  ? 135  SER H CB  1 
ATOM   9907  O OG  . SER H  1 108 ? 33.981 61.758 37.635  1.00 56.63  ? 135  SER H OG  1 
ATOM   9908  N N   . TYR H  1 109 ? 33.048 65.157 38.301  1.00 44.55  ? 136  TYR H N   1 
ATOM   9909  C CA  . TYR H  1 109 ? 31.696 65.650 38.515  1.00 41.31  ? 136  TYR H CA  1 
ATOM   9910  C C   . TYR H  1 109 ? 31.206 66.427 37.304  1.00 39.56  ? 136  TYR H C   1 
ATOM   9911  O O   . TYR H  1 109 ? 31.891 67.305 36.801  1.00 40.53  ? 136  TYR H O   1 
ATOM   9912  C CB  . TYR H  1 109 ? 31.645 66.558 39.729  1.00 40.56  ? 136  TYR H CB  1 
ATOM   9913  C CG  . TYR H  1 109 ? 30.300 67.215 39.906  1.00 40.51  ? 136  TYR H CG  1 
ATOM   9914  C CD1 . TYR H  1 109 ? 29.163 66.458 40.179  1.00 40.26  ? 136  TYR H CD1 1 
ATOM   9915  C CD2 . TYR H  1 109 ? 30.162 68.590 39.812  1.00 40.05  ? 136  TYR H CD2 1 
ATOM   9916  C CE1 . TYR H  1 109 ? 27.929 67.055 40.358  1.00 39.22  ? 136  TYR H CE1 1 
ATOM   9917  C CE2 . TYR H  1 109 ? 28.927 69.197 39.987  1.00 40.54  ? 136  TYR H CE2 1 
ATOM   9918  C CZ  . TYR H  1 109 ? 27.818 68.426 40.261  1.00 40.04  ? 136  TYR H CZ  1 
ATOM   9919  O OH  . TYR H  1 109 ? 26.602 69.038 40.439  1.00 41.72  ? 136  TYR H OH  1 
ATOM   9920  N N   . LYS H  1 110 ? 30.018 66.101 36.827  1.00 37.54  ? 137  LYS H N   1 
ATOM   9921  C CA  . LYS H  1 110 ? 29.472 66.793 35.678  1.00 35.53  ? 137  LYS H CA  1 
ATOM   9922  C C   . LYS H  1 110 ? 28.029 67.131 35.957  1.00 33.86  ? 137  LYS H C   1 
ATOM   9923  O O   . LYS H  1 110 ? 27.210 67.184 35.048  1.00 34.26  ? 137  LYS H O   1 
ATOM   9924  C CB  . LYS H  1 110 ? 29.574 65.919 34.430  1.00 36.30  ? 137  LYS H CB  1 
ATOM   9925  C CG  . LYS H  1 110 ? 30.977 65.455 34.145  1.00 36.74  ? 137  LYS H CG  1 
ATOM   9926  C CD  . LYS H  1 110 ? 31.070 64.801 32.791  1.00 39.32  ? 137  LYS H CD  1 
ATOM   9927  C CE  . LYS H  1 110 ? 32.483 64.307 32.544  1.00 43.56  ? 137  LYS H CE  1 
ATOM   9928  N NZ  . LYS H  1 110 ? 33.497 65.384 32.793  1.00 45.73  ? 137  LYS H NZ  1 
ATOM   9929  N N   . GLY H  1 111 ? 27.722 67.348 37.229  1.00 32.26  ? 138  GLY H N   1 
ATOM   9930  C CA  . GLY H  1 111 ? 26.370 67.693 37.605  1.00 30.59  ? 138  GLY H CA  1 
ATOM   9931  C C   . GLY H  1 111 ? 26.128 69.123 37.206  1.00 30.47  ? 138  GLY H C   1 
ATOM   9932  O O   . GLY H  1 111 ? 26.974 69.724 36.556  1.00 31.90  ? 138  GLY H O   1 
ATOM   9933  N N   . THR H  1 112 ? 24.993 69.686 37.604  1.00 30.14  ? 139  THR H N   1 
ATOM   9934  C CA  . THR H  1 112 ? 24.674 71.054 37.226  1.00 28.22  ? 139  THR H CA  1 
ATOM   9935  C C   . THR H  1 112 ? 24.549 72.020 38.387  1.00 28.25  ? 139  THR H C   1 
ATOM   9936  O O   . THR H  1 112 ? 23.992 73.097 38.239  1.00 28.57  ? 139  THR H O   1 
ATOM   9937  C CB  . THR H  1 112 ? 23.386 71.092 36.414  1.00 26.85  ? 139  THR H CB  1 
ATOM   9938  O OG1 . THR H  1 112 ? 22.293 70.646 37.228  1.00 27.18  ? 139  THR H OG1 1 
ATOM   9939  C CG2 . THR H  1 112 ? 23.507 70.177 35.218  1.00 26.22  ? 139  THR H CG2 1 
ATOM   9940  N N   . VAL H  1 113 ? 25.060 71.643 39.549  1.00 29.35  ? 140  VAL H N   1 
ATOM   9941  C CA  . VAL H  1 113 ? 25.001 72.548 40.684  1.00 30.25  ? 140  VAL H CA  1 
ATOM   9942  C C   . VAL H  1 113 ? 25.818 73.796 40.349  1.00 31.20  ? 140  VAL H C   1 
ATOM   9943  O O   . VAL H  1 113 ? 26.982 73.711 39.955  1.00 31.55  ? 140  VAL H O   1 
ATOM   9944  C CB  . VAL H  1 113 ? 25.572 71.902 41.955  1.00 30.52  ? 140  VAL H CB  1 
ATOM   9945  C CG1 . VAL H  1 113 ? 25.782 72.962 43.022  1.00 31.25  ? 140  VAL H CG1 1 
ATOM   9946  C CG2 . VAL H  1 113 ? 24.616 70.858 42.471  1.00 31.27  ? 140  VAL H CG2 1 
ATOM   9947  N N   . SER H  1 114 ? 25.212 74.961 40.510  1.00 32.15  ? 141  SER H N   1 
ATOM   9948  C CA  . SER H  1 114 ? 25.917 76.189 40.202  1.00 33.86  ? 141  SER H CA  1 
ATOM   9949  C C   . SER H  1 114 ? 25.851 77.216 41.324  1.00 34.85  ? 141  SER H C   1 
ATOM   9950  O O   . SER H  1 114 ? 25.800 78.419 41.069  1.00 34.36  ? 141  SER H O   1 
ATOM   9951  C CB  . SER H  1 114 ? 25.353 76.779 38.922  1.00 33.76  ? 141  SER H CB  1 
ATOM   9952  O OG  . SER H  1 114 ? 23.966 76.994 39.058  1.00 33.24  ? 141  SER H OG  1 
ATOM   9953  N N   . ILE H  1 115 ? 25.847 76.726 42.563  1.00 36.51  ? 142  ILE H N   1 
ATOM   9954  C CA  . ILE H  1 115 ? 25.794 77.583 43.747  1.00 38.34  ? 142  ILE H CA  1 
ATOM   9955  C C   . ILE H  1 115 ? 26.885 77.175 44.727  1.00 38.79  ? 142  ILE H C   1 
ATOM   9956  O O   . ILE H  1 115 ? 27.167 75.989 44.890  1.00 37.63  ? 142  ILE H O   1 
ATOM   9957  C CB  . ILE H  1 115 ? 24.398 77.494 44.473  1.00 39.16  ? 142  ILE H CB  1 
ATOM   9958  C CG1 . ILE H  1 115 ? 23.420 78.517 43.891  1.00 39.55  ? 142  ILE H CG1 1 
ATOM   9959  C CG2 . ILE H  1 115 ? 24.535 77.798 45.956  1.00 38.65  ? 142  ILE H CG2 1 
ATOM   9960  C CD1 . ILE H  1 115 ? 22.888 78.155 42.536  1.00 40.90  ? 142  ILE H CD1 1 
ATOM   9961  N N   . THR H  1 116 ? 27.496 78.164 45.370  1.00 40.32  ? 143  THR H N   1 
ATOM   9962  C CA  . THR H  1 116 ? 28.539 77.901 46.350  1.00 43.89  ? 143  THR H CA  1 
ATOM   9963  C C   . THR H  1 116 ? 27.935 77.497 47.703  1.00 46.69  ? 143  THR H C   1 
ATOM   9964  O O   . THR H  1 116 ? 26.717 77.611 47.918  1.00 47.89  ? 143  THR H O   1 
ATOM   9965  C CB  . THR H  1 116 ? 29.422 79.141 46.579  1.00 44.04  ? 143  THR H CB  1 
ATOM   9966  O OG1 . THR H  1 116 ? 28.613 80.236 47.029  1.00 42.12  ? 143  THR H OG1 1 
ATOM   9967  C CG2 . THR H  1 116 ? 30.129 79.529 45.297  1.00 45.99  ? 143  THR H CG2 1 
ATOM   9968  N N   . LYS H  1 117 ? 28.784 77.031 48.618  1.00 47.49  ? 144  LYS H N   1 
ATOM   9969  C CA  . LYS H  1 117 ? 28.320 76.635 49.939  1.00 47.93  ? 144  LYS H CA  1 
ATOM   9970  C C   . LYS H  1 117 ? 27.501 77.802 50.483  1.00 47.90  ? 144  LYS H C   1 
ATOM   9971  O O   . LYS H  1 117 ? 26.350 77.643 50.894  1.00 48.70  ? 144  LYS H O   1 
ATOM   9972  C CB  . LYS H  1 117 ? 29.518 76.365 50.856  1.00 48.51  ? 144  LYS H CB  1 
ATOM   9973  C CG  . LYS H  1 117 ? 29.179 75.640 52.156  1.00 50.32  ? 144  LYS H CG  1 
ATOM   9974  C CD  . LYS H  1 117 ? 30.455 75.151 52.856  1.00 53.16  ? 144  LYS H CD  1 
ATOM   9975  C CE  . LYS H  1 117 ? 30.184 74.009 53.852  1.00 55.05  ? 144  LYS H CE  1 
ATOM   9976  N NZ  . LYS H  1 117 ? 29.197 74.377 54.918  1.00 55.93  ? 144  LYS H NZ  1 
ATOM   9977  N N   . SER H  1 118 ? 28.094 78.987 50.422  1.00 47.36  ? 145  SER H N   1 
ATOM   9978  C CA  . SER H  1 118 ? 27.473 80.201 50.933  1.00 47.29  ? 145  SER H CA  1 
ATOM   9979  C C   . SER H  1 118 ? 26.236 80.658 50.180  1.00 47.85  ? 145  SER H C   1 
ATOM   9980  O O   . SER H  1 118 ? 25.672 81.708 50.499  1.00 47.50  ? 145  SER H O   1 
ATOM   9981  C CB  . SER H  1 118 ? 28.487 81.335 50.934  1.00 46.49  ? 145  SER H CB  1 
ATOM   9982  O OG  . SER H  1 118 ? 29.620 80.980 51.696  1.00 48.83  ? 145  SER H OG  1 
ATOM   9983  N N   . GLY H  1 119 ? 25.822 79.883 49.180  1.00 47.30  ? 146  GLY H N   1 
ATOM   9984  C CA  . GLY H  1 119 ? 24.649 80.243 48.410  1.00 47.48  ? 146  GLY H CA  1 
ATOM   9985  C C   . GLY H  1 119 ? 24.888 81.293 47.334  1.00 48.71  ? 146  GLY H C   1 
ATOM   9986  O O   . GLY H  1 119 ? 23.940 81.925 46.858  1.00 49.46  ? 146  GLY H O   1 
ATOM   9987  N N   . ILE H  1 120 ? 26.143 81.497 46.942  1.00 47.60  ? 147  ILE H N   1 
ATOM   9988  C CA  . ILE H  1 120 ? 26.441 82.478 45.908  1.00 45.76  ? 147  ILE H CA  1 
ATOM   9989  C C   . ILE H  1 120 ? 26.326 81.800 44.553  1.00 44.77  ? 147  ILE H C   1 
ATOM   9990  O O   . ILE H  1 120 ? 26.772 80.661 44.376  1.00 44.25  ? 147  ILE H O   1 
ATOM   9991  C CB  . ILE H  1 120 ? 27.871 83.029 46.038  1.00 46.99  ? 147  ILE H CB  1 
ATOM   9992  C CG1 . ILE H  1 120 ? 28.159 83.420 47.490  1.00 47.66  ? 147  ILE H CG1 1 
ATOM   9993  C CG2 . ILE H  1 120 ? 28.043 84.237 45.121  1.00 45.85  ? 147  ILE H CG2 1 
ATOM   9994  C CD1 . ILE H  1 120 ? 29.616 83.773 47.747  1.00 46.08  ? 147  ILE H CD1 1 
ATOM   9995  N N   . LYS H  1 121 ? 25.722 82.506 43.604  1.00 43.40  ? 148  LYS H N   1 
ATOM   9996  C CA  . LYS H  1 121 ? 25.552 82.001 42.250  1.00 42.02  ? 148  LYS H CA  1 
ATOM   9997  C C   . LYS H  1 121 ? 26.927 81.997 41.588  1.00 41.94  ? 148  LYS H C   1 
ATOM   9998  O O   . LYS H  1 121 ? 27.650 82.991 41.648  1.00 43.78  ? 148  LYS H O   1 
ATOM   9999  C CB  . LYS H  1 121 ? 24.609 82.913 41.481  1.00 40.73  ? 148  LYS H CB  1 
ATOM   10000 C CG  . LYS H  1 121 ? 24.259 82.425 40.102  1.00 41.98  ? 148  LYS H CG  1 
ATOM   10001 C CD  . LYS H  1 121 ? 23.374 83.426 39.379  1.00 42.11  ? 148  LYS H CD  1 
ATOM   10002 C CE  . LYS H  1 121 ? 22.905 82.861 38.049  1.00 43.35  ? 148  LYS H CE  1 
ATOM   10003 N NZ  . LYS H  1 121 ? 22.178 83.849 37.204  1.00 43.37  ? 148  LYS H NZ  1 
ATOM   10004 N N   . CYS H  1 122 ? 27.298 80.881 40.969  1.00 40.07  ? 149  CYS H N   1 
ATOM   10005 C CA  . CYS H  1 122 ? 28.596 80.789 40.321  1.00 37.64  ? 149  CYS H CA  1 
ATOM   10006 C C   . CYS H  1 122 ? 28.706 81.737 39.149  1.00 36.75  ? 149  CYS H C   1 
ATOM   10007 O O   . CYS H  1 122 ? 27.697 82.140 38.564  1.00 36.73  ? 149  CYS H O   1 
ATOM   10008 C CB  . CYS H  1 122 ? 28.842 79.376 39.805  1.00 38.30  ? 149  CYS H CB  1 
ATOM   10009 S SG  . CYS H  1 122 ? 29.155 78.099 41.057  1.00 37.19  ? 149  CYS H SG  1 
ATOM   10010 N N   . GLN H  1 123 ? 29.947 82.084 38.817  1.00 34.93  ? 150  GLN H N   1 
ATOM   10011 C CA  . GLN H  1 123 ? 30.248 82.948 37.678  1.00 32.86  ? 150  GLN H CA  1 
ATOM   10012 C C   . GLN H  1 123 ? 30.516 82.010 36.511  1.00 31.95  ? 150  GLN H C   1 
ATOM   10013 O O   . GLN H  1 123 ? 31.111 80.947 36.687  1.00 33.75  ? 150  GLN H O   1 
ATOM   10014 C CB  . GLN H  1 123 ? 31.509 83.787 37.926  1.00 30.50  ? 150  GLN H CB  1 
ATOM   10015 C CG  . GLN H  1 123 ? 32.042 84.488 36.660  1.00 27.77  ? 150  GLN H CG  1 
ATOM   10016 C CD  . GLN H  1 123 ? 33.441 85.081 36.827  1.00 24.59  ? 150  GLN H CD  1 
ATOM   10017 O OE1 . GLN H  1 123 ? 33.716 85.800 37.775  1.00 23.47  ? 150  GLN H OE1 1 
ATOM   10018 N NE2 . GLN H  1 123 ? 34.319 84.786 35.889  1.00 22.42  ? 150  GLN H NE2 1 
ATOM   10019 N N   . PRO H  1 124 ? 30.084 82.383 35.305  1.00 29.66  ? 151  PRO H N   1 
ATOM   10020 C CA  . PRO H  1 124 ? 30.323 81.514 34.151  1.00 29.03  ? 151  PRO H CA  1 
ATOM   10021 C C   . PRO H  1 124 ? 31.831 81.378 33.937  1.00 29.39  ? 151  PRO H C   1 
ATOM   10022 O O   . PRO H  1 124 ? 32.583 82.336 34.141  1.00 28.50  ? 151  PRO H O   1 
ATOM   10023 C CB  . PRO H  1 124 ? 29.660 82.268 33.014  1.00 27.81  ? 151  PRO H CB  1 
ATOM   10024 C CG  . PRO H  1 124 ? 28.624 83.082 33.705  1.00 27.11  ? 151  PRO H CG  1 
ATOM   10025 C CD  . PRO H  1 124 ? 29.335 83.581 34.914  1.00 27.65  ? 151  PRO H CD  1 
ATOM   10026 N N   . TRP H  1 125 ? 32.276 80.198 33.533  1.00 29.50  ? 152  TRP H N   1 
ATOM   10027 C CA  . TRP H  1 125 ? 33.700 79.979 33.313  1.00 30.16  ? 152  TRP H CA  1 
ATOM   10028 C C   . TRP H  1 125 ? 34.222 80.761 32.113  1.00 32.24  ? 152  TRP H C   1 
ATOM   10029 O O   . TRP H  1 125 ? 35.374 81.189 32.097  1.00 33.13  ? 152  TRP H O   1 
ATOM   10030 C CB  . TRP H  1 125 ? 33.990 78.492 33.100  1.00 26.06  ? 152  TRP H CB  1 
ATOM   10031 C CG  . TRP H  1 125 ? 33.661 77.647 34.261  1.00 22.02  ? 152  TRP H CG  1 
ATOM   10032 C CD1 . TRP H  1 125 ? 32.500 76.964 34.478  1.00 21.52  ? 152  TRP H CD1 1 
ATOM   10033 C CD2 . TRP H  1 125 ? 34.498 77.385 35.386  1.00 20.33  ? 152  TRP H CD2 1 
ATOM   10034 N NE1 . TRP H  1 125 ? 32.564 76.289 35.673  1.00 20.04  ? 152  TRP H NE1 1 
ATOM   10035 C CE2 . TRP H  1 125 ? 33.780 76.533 36.252  1.00 19.55  ? 152  TRP H CE2 1 
ATOM   10036 C CE3 . TRP H  1 125 ? 35.788 77.787 35.749  1.00 19.38  ? 152  TRP H CE3 1 
ATOM   10037 C CZ2 . TRP H  1 125 ? 34.310 76.072 37.456  1.00 21.02  ? 152  TRP H CZ2 1 
ATOM   10038 C CZ3 . TRP H  1 125 ? 36.320 77.326 36.951  1.00 20.76  ? 152  TRP H CZ3 1 
ATOM   10039 C CH2 . TRP H  1 125 ? 35.578 76.477 37.792  1.00 20.15  ? 152  TRP H CH2 1 
ATOM   10040 N N   . SER H  1 126 ? 33.373 80.935 31.106  1.00 33.45  ? 153  SER H N   1 
ATOM   10041 C CA  . SER H  1 126 ? 33.757 81.647 29.904  1.00 34.77  ? 153  SER H CA  1 
ATOM   10042 C C   . SER H  1 126 ? 33.884 83.127 30.181  1.00 35.97  ? 153  SER H C   1 
ATOM   10043 O O   . SER H  1 126 ? 34.469 83.844 29.386  1.00 38.34  ? 153  SER H O   1 
ATOM   10044 C CB  . SER H  1 126 ? 32.712 81.475 28.826  1.00 35.72  ? 153  SER H CB  1 
ATOM   10045 O OG  . SER H  1 126 ? 31.630 82.361 29.070  1.00 37.57  ? 153  SER H OG  1 
ATOM   10046 N N   . SER H  1 127 ? 33.318 83.593 31.289  1.00 37.11  ? 154  SER H N   1 
ATOM   10047 C CA  . SER H  1 127 ? 33.392 85.009 31.627  1.00 38.65  ? 154  SER H CA  1 
ATOM   10048 C C   . SER H  1 127 ? 34.645 85.379 32.411  1.00 39.66  ? 154  SER H C   1 
ATOM   10049 O O   . SER H  1 127 ? 35.200 84.548 33.135  1.00 39.84  ? 154  SER H O   1 
ATOM   10050 C CB  . SER H  1 127 ? 32.169 85.430 32.430  1.00 38.28  ? 154  SER H CB  1 
ATOM   10051 O OG  . SER H  1 127 ? 32.317 86.778 32.847  1.00 40.53  ? 154  SER H OG  1 
ATOM   10052 N N   . MET H  1 128 ? 35.086 86.627 32.258  1.00 40.03  ? 155  MET H N   1 
ATOM   10053 C CA  . MET H  1 128 ? 36.263 87.105 32.962  1.00 40.46  ? 155  MET H CA  1 
ATOM   10054 C C   . MET H  1 128 ? 35.840 88.115 33.999  1.00 41.81  ? 155  MET H C   1 
ATOM   10055 O O   . MET H  1 128 ? 36.675 88.744 34.632  1.00 43.24  ? 155  MET H O   1 
ATOM   10056 C CB  . MET H  1 128 ? 37.259 87.749 32.002  1.00 39.70  ? 155  MET H CB  1 
ATOM   10057 C CG  . MET H  1 128 ? 37.997 86.785 31.099  1.00 39.74  ? 155  MET H CG  1 
ATOM   10058 S SD  . MET H  1 128 ? 39.080 85.649 31.956  1.00 41.11  ? 155  MET H SD  1 
ATOM   10059 C CE  . MET H  1 128 ? 38.499 84.112 31.277  1.00 41.19  ? 155  MET H CE  1 
ATOM   10060 N N   . ILE H  1 129 ? 34.535 88.278 34.166  1.00 43.03  ? 156  ILE H N   1 
ATOM   10061 C CA  . ILE H  1 129 ? 34.020 89.212 35.158  1.00 44.37  ? 156  ILE H CA  1 
ATOM   10062 C C   . ILE H  1 129 ? 32.948 88.514 35.973  1.00 44.84  ? 156  ILE H C   1 
ATOM   10063 O O   . ILE H  1 129 ? 32.188 87.697 35.454  1.00 45.99  ? 156  ILE H O   1 
ATOM   10064 C CB  . ILE H  1 129 ? 33.403 90.462 34.504  1.00 44.80  ? 156  ILE H CB  1 
ATOM   10065 C CG1 . ILE H  1 129 ? 32.242 90.055 33.586  1.00 43.88  ? 156  ILE H CG1 1 
ATOM   10066 C CG2 . ILE H  1 129 ? 34.482 91.224 33.739  1.00 46.39  ? 156  ILE H CG2 1 
ATOM   10067 C CD1 . ILE H  1 129 ? 31.652 91.202 32.793  1.00 40.72  ? 156  ILE H CD1 1 
ATOM   10068 N N   . PRO H  1 130 ? 32.850 88.853 37.261  1.00 44.76  ? 157  PRO H N   1 
ATOM   10069 C CA  . PRO H  1 130 ? 33.702 89.845 37.914  1.00 44.51  ? 157  PRO H CA  1 
ATOM   10070 C C   . PRO H  1 130 ? 35.114 89.369 38.179  1.00 44.71  ? 157  PRO H C   1 
ATOM   10071 O O   . PRO H  1 130 ? 35.950 90.140 38.622  1.00 45.21  ? 157  PRO H O   1 
ATOM   10072 C CB  . PRO H  1 130 ? 32.953 90.116 39.208  1.00 43.71  ? 157  PRO H CB  1 
ATOM   10073 C CG  . PRO H  1 130 ? 32.451 88.767 39.553  1.00 43.41  ? 157  PRO H CG  1 
ATOM   10074 C CD  . PRO H  1 130 ? 31.901 88.273 38.227  1.00 43.63  ? 157  PRO H CD  1 
ATOM   10075 N N   . HIS H  1 131 ? 35.393 88.105 37.911  1.00 45.86  ? 158  HIS H N   1 
ATOM   10076 C CA  . HIS H  1 131 ? 36.724 87.596 38.195  1.00 47.62  ? 158  HIS H CA  1 
ATOM   10077 C C   . HIS H  1 131 ? 37.491 87.101 36.981  1.00 47.51  ? 158  HIS H C   1 
ATOM   10078 O O   . HIS H  1 131 ? 36.998 86.277 36.203  1.00 47.68  ? 158  HIS H O   1 
ATOM   10079 C CB  . HIS H  1 131 ? 36.621 86.497 39.244  1.00 50.19  ? 158  HIS H CB  1 
ATOM   10080 C CG  . HIS H  1 131 ? 35.865 86.915 40.467  1.00 53.55  ? 158  HIS H CG  1 
ATOM   10081 N ND1 . HIS H  1 131 ? 36.366 87.820 41.376  1.00 55.37  ? 158  HIS H ND1 1 
ATOM   10082 C CD2 . HIS H  1 131 ? 34.624 86.592 40.901  1.00 54.98  ? 158  HIS H CD2 1 
ATOM   10083 C CE1 . HIS H  1 131 ? 35.465 88.039 42.319  1.00 56.09  ? 158  HIS H CE1 1 
ATOM   10084 N NE2 . HIS H  1 131 ? 34.399 87.306 42.053  1.00 56.25  ? 158  HIS H NE2 1 
ATOM   10085 N N   . GLU H  1 132 ? 38.708 87.626 36.836  1.00 46.91  ? 159  GLU H N   1 
ATOM   10086 C CA  . GLU H  1 132 ? 39.607 87.286 35.733  1.00 46.06  ? 159  GLU H CA  1 
ATOM   10087 C C   . GLU H  1 132 ? 40.334 86.006 36.107  1.00 45.40  ? 159  GLU H C   1 
ATOM   10088 O O   . GLU H  1 132 ? 40.895 85.893 37.208  1.00 45.38  ? 159  GLU H O   1 
ATOM   10089 C CB  . GLU H  1 132 ? 40.613 88.422 35.492  1.00 46.44  ? 159  GLU H CB  1 
ATOM   10090 N N   . HIS H  1 133 ? 40.341 85.043 35.187  1.00 43.02  ? 160  HIS H N   1 
ATOM   10091 C CA  . HIS H  1 133 ? 40.968 83.766 35.489  1.00 40.10  ? 160  HIS H CA  1 
ATOM   10092 C C   . HIS H  1 133 ? 41.426 83.019 34.247  1.00 39.75  ? 160  HIS H C   1 
ATOM   10093 O O   . HIS H  1 133 ? 41.128 83.414 33.122  1.00 38.25  ? 160  HIS H O   1 
ATOM   10094 C CB  . HIS H  1 133 ? 39.974 82.907 36.256  1.00 37.56  ? 160  HIS H CB  1 
ATOM   10095 C CG  . HIS H  1 133 ? 38.782 82.517 35.445  1.00 35.60  ? 160  HIS H CG  1 
ATOM   10096 N ND1 . HIS H  1 133 ? 38.760 81.387 34.662  1.00 35.77  ? 160  HIS H ND1 1 
ATOM   10097 C CD2 . HIS H  1 133 ? 37.601 83.146 35.232  1.00 35.55  ? 160  HIS H CD2 1 
ATOM   10098 C CE1 . HIS H  1 133 ? 37.618 81.335 33.999  1.00 35.64  ? 160  HIS H CE1 1 
ATOM   10099 N NE2 . HIS H  1 133 ? 36.896 82.390 34.326  1.00 34.21  ? 160  HIS H NE2 1 
ATOM   10100 N N   . SER H  1 134 ? 42.107 81.900 34.474  1.00 39.95  ? 161  SER H N   1 
ATOM   10101 C CA  . SER H  1 134 ? 42.650 81.070 33.398  1.00 40.74  ? 161  SER H CA  1 
ATOM   10102 C C   . SER H  1 134 ? 41.952 79.719 33.182  1.00 41.16  ? 161  SER H C   1 
ATOM   10103 O O   . SER H  1 134 ? 42.451 78.863 32.436  1.00 41.64  ? 161  SER H O   1 
ATOM   10104 C CB  . SER H  1 134 ? 44.123 80.802 33.686  1.00 42.09  ? 161  SER H CB  1 
ATOM   10105 O OG  . SER H  1 134 ? 44.259 80.248 34.986  1.00 43.53  ? 161  SER H OG  1 
ATOM   10106 N N   . PHE H  1 135 ? 40.807 79.516 33.822  1.00 39.44  ? 162  PHE H N   1 
ATOM   10107 C CA  . PHE H  1 135 ? 40.126 78.245 33.689  1.00 36.79  ? 162  PHE H CA  1 
ATOM   10108 C C   . PHE H  1 135 ? 39.159 78.139 32.540  1.00 36.78  ? 162  PHE H C   1 
ATOM   10109 O O   . PHE H  1 135 ? 37.955 78.170 32.762  1.00 37.62  ? 162  PHE H O   1 
ATOM   10110 C CB  . PHE H  1 135 ? 39.403 77.911 34.985  1.00 35.50  ? 162  PHE H CB  1 
ATOM   10111 C CG  . PHE H  1 135 ? 40.324 77.560 36.108  1.00 34.07  ? 162  PHE H CG  1 
ATOM   10112 C CD1 . PHE H  1 135 ? 40.687 78.511 37.055  1.00 34.22  ? 162  PHE H CD1 1 
ATOM   10113 C CD2 . PHE H  1 135 ? 40.845 76.278 36.211  1.00 32.67  ? 162  PHE H CD2 1 
ATOM   10114 C CE1 . PHE H  1 135 ? 41.556 78.191 38.096  1.00 32.56  ? 162  PHE H CE1 1 
ATOM   10115 C CE2 . PHE H  1 135 ? 41.713 75.946 37.240  1.00 32.93  ? 162  PHE H CE2 1 
ATOM   10116 C CZ  . PHE H  1 135 ? 42.070 76.905 38.188  1.00 32.54  ? 162  PHE H CZ  1 
ATOM   10117 N N   . LEU H  1 136 ? 39.664 77.983 31.316  1.00 36.35  ? 163  LEU H N   1 
ATOM   10118 C CA  . LEU H  1 136 ? 38.772 77.862 30.155  1.00 36.54  ? 163  LEU H CA  1 
ATOM   10119 C C   . LEU H  1 136 ? 38.719 76.428 29.659  1.00 36.47  ? 163  LEU H C   1 
ATOM   10120 O O   . LEU H  1 136 ? 39.672 75.675 29.836  1.00 36.59  ? 163  LEU H O   1 
ATOM   10121 C CB  . LEU H  1 136 ? 39.245 78.769 29.021  1.00 36.40  ? 163  LEU H CB  1 
ATOM   10122 C CG  . LEU H  1 136 ? 39.553 80.203 29.465  1.00 37.41  ? 163  LEU H CG  1 
ATOM   10123 C CD1 . LEU H  1 136 ? 40.015 80.998 28.273  1.00 36.29  ? 163  LEU H CD1 1 
ATOM   10124 C CD2 . LEU H  1 136 ? 38.317 80.848 30.100  1.00 35.98  ? 163  LEU H CD2 1 
ATOM   10125 N N   . PRO H  1 137 ? 37.597 76.026 29.038  1.00 37.15  ? 164  PRO H N   1 
ATOM   10126 C CA  . PRO H  1 137 ? 37.437 74.662 28.515  1.00 37.39  ? 164  PRO H CA  1 
ATOM   10127 C C   . PRO H  1 137 ? 38.646 74.242 27.696  1.00 36.67  ? 164  PRO H C   1 
ATOM   10128 O O   . PRO H  1 137 ? 39.114 73.122 27.789  1.00 36.74  ? 164  PRO H O   1 
ATOM   10129 C CB  . PRO H  1 137 ? 36.168 74.758 27.674  1.00 36.32  ? 164  PRO H CB  1 
ATOM   10130 C CG  . PRO H  1 137 ? 35.354 75.711 28.445  1.00 36.94  ? 164  PRO H CG  1 
ATOM   10131 C CD  . PRO H  1 137 ? 36.361 76.800 28.844  1.00 37.88  ? 164  PRO H CD  1 
ATOM   10132 N N   . SER H  1 138 ? 39.146 75.169 26.899  1.00 38.18  ? 165  SER H N   1 
ATOM   10133 C CA  . SER H  1 138 ? 40.319 74.947 26.065  1.00 39.62  ? 165  SER H CA  1 
ATOM   10134 C C   . SER H  1 138 ? 41.465 74.303 26.860  1.00 39.40  ? 165  SER H C   1 
ATOM   10135 O O   . SER H  1 138 ? 41.992 73.252 26.483  1.00 40.19  ? 165  SER H O   1 
ATOM   10136 C CB  . SER H  1 138 ? 40.789 76.289 25.520  1.00 40.56  ? 165  SER H CB  1 
ATOM   10137 O OG  . SER H  1 138 ? 39.704 77.021 24.984  1.00 47.09  ? 165  SER H OG  1 
ATOM   10138 N N   . SER H  1 139 ? 41.857 74.942 27.956  1.00 36.94  ? 166  SER H N   1 
ATOM   10139 C CA  . SER H  1 139 ? 42.933 74.421 28.773  1.00 36.09  ? 166  SER H CA  1 
ATOM   10140 C C   . SER H  1 139 ? 42.577 73.131 29.515  1.00 36.25  ? 166  SER H C   1 
ATOM   10141 O O   . SER H  1 139 ? 43.454 72.331 29.836  1.00 37.32  ? 166  SER H O   1 
ATOM   10142 C CB  . SER H  1 139 ? 43.365 75.482 29.772  1.00 35.86  ? 166  SER H CB  1 
ATOM   10143 O OG  . SER H  1 139 ? 43.780 76.654 29.106  1.00 37.07  ? 166  SER H OG  1 
ATOM   10144 N N   . TYR H  1 140 ? 41.294 72.918 29.780  1.00 35.21  ? 167  TYR H N   1 
ATOM   10145 C CA  . TYR H  1 140 ? 40.869 71.731 30.503  1.00 33.39  ? 167  TYR H CA  1 
ATOM   10146 C C   . TYR H  1 140 ? 39.803 70.966 29.759  1.00 32.88  ? 167  TYR H C   1 
ATOM   10147 O O   . TYR H  1 140 ? 38.764 70.632 30.327  1.00 31.48  ? 167  TYR H O   1 
ATOM   10148 C CB  . TYR H  1 140 ? 40.343 72.115 31.877  1.00 33.13  ? 167  TYR H CB  1 
ATOM   10149 C CG  . TYR H  1 140 ? 41.343 72.861 32.723  1.00 33.82  ? 167  TYR H CG  1 
ATOM   10150 C CD1 . TYR H  1 140 ? 41.868 72.289 33.872  1.00 34.08  ? 167  TYR H CD1 1 
ATOM   10151 C CD2 . TYR H  1 140 ? 41.737 74.152 32.395  1.00 33.79  ? 167  TYR H CD2 1 
ATOM   10152 C CE1 . TYR H  1 140 ? 42.757 72.984 34.682  1.00 34.76  ? 167  TYR H CE1 1 
ATOM   10153 C CE2 . TYR H  1 140 ? 42.622 74.855 33.192  1.00 35.57  ? 167  TYR H CE2 1 
ATOM   10154 C CZ  . TYR H  1 140 ? 43.127 74.268 34.338  1.00 36.02  ? 167  TYR H CZ  1 
ATOM   10155 O OH  . TYR H  1 140 ? 43.978 74.981 35.157  1.00 39.18  ? 167  TYR H OH  1 
ATOM   10156 N N   . ARG H  1 141 ? 40.071 70.697 28.482  1.00 33.39  ? 168  ARG H N   1 
ATOM   10157 C CA  . ARG H  1 141 ? 39.153 69.942 27.627  1.00 33.73  ? 168  ARG H CA  1 
ATOM   10158 C C   . ARG H  1 141 ? 38.838 68.617 28.328  1.00 34.52  ? 168  ARG H C   1 
ATOM   10159 O O   . ARG H  1 141 ? 39.736 67.865 28.722  1.00 33.51  ? 168  ARG H O   1 
ATOM   10160 C CB  . ARG H  1 141 ? 39.787 69.689 26.236  1.00 29.92  ? 168  ARG H CB  1 
ATOM   10161 N N   . GLY H  1 142 ? 37.553 68.344 28.496  1.00 35.35  ? 169  GLY H N   1 
ATOM   10162 C CA  . GLY H  1 142 ? 37.156 67.126 29.169  1.00 36.89  ? 169  GLY H CA  1 
ATOM   10163 C C   . GLY H  1 142 ? 36.631 67.362 30.578  1.00 37.38  ? 169  GLY H C   1 
ATOM   10164 O O   . GLY H  1 142 ? 35.832 66.573 31.076  1.00 37.34  ? 169  GLY H O   1 
ATOM   10165 N N   . LYS H  1 143 ? 37.069 68.442 31.224  1.00 36.83  ? 170  LYS H N   1 
ATOM   10166 C CA  . LYS H  1 143 ? 36.611 68.739 32.575  1.00 36.41  ? 170  LYS H CA  1 
ATOM   10167 C C   . LYS H  1 143 ? 35.294 69.479 32.554  1.00 36.62  ? 170  LYS H C   1 
ATOM   10168 O O   . LYS H  1 143 ? 34.894 70.097 33.544  1.00 36.83  ? 170  LYS H O   1 
ATOM   10169 C CB  . LYS H  1 143 ? 37.647 69.554 33.347  1.00 37.88  ? 170  LYS H CB  1 
ATOM   10170 C CG  . LYS H  1 143 ? 38.533 68.725 34.280  1.00 39.71  ? 170  LYS H CG  1 
ATOM   10171 C CD  . LYS H  1 143 ? 39.685 68.018 33.549  1.00 42.25  ? 170  LYS H CD  1 
ATOM   10172 C CE  . LYS H  1 143 ? 39.203 67.061 32.451  1.00 43.32  ? 170  LYS H CE  1 
ATOM   10173 N NZ  . LYS H  1 143 ? 39.775 67.400 31.110  1.00 42.96  ? 170  LYS H NZ  1 
ATOM   10174 N N   . ASP H  1 144 ? 34.628 69.413 31.410  1.00 35.65  ? 171  ASP H N   1 
ATOM   10175 C CA  . ASP H  1 144 ? 33.334 70.045 31.229  1.00 34.25  ? 171  ASP H CA  1 
ATOM   10176 C C   . ASP H  1 144 ? 33.143 71.359 31.977  1.00 33.66  ? 171  ASP H C   1 
ATOM   10177 O O   . ASP H  1 144 ? 32.347 71.440 32.902  1.00 32.52  ? 171  ASP H O   1 
ATOM   10178 C CB  . ASP H  1 144 ? 32.244 69.054 31.626  1.00 35.74  ? 171  ASP H CB  1 
ATOM   10179 C CG  . ASP H  1 144 ? 30.846 69.613 31.436  1.00 37.61  ? 171  ASP H CG  1 
ATOM   10180 O OD1 . ASP H  1 144 ? 30.649 70.387 30.471  1.00 38.26  ? 171  ASP H OD1 1 
ATOM   10181 O OD2 . ASP H  1 144 ? 29.946 69.266 32.240  1.00 36.06  ? 171  ASP H OD2 1 
ATOM   10182 N N   . LEU H  1 145 ? 33.888 72.384 31.577  1.00 33.72  ? 172  LEU H N   1 
ATOM   10183 C CA  . LEU H  1 145 ? 33.776 73.697 32.196  1.00 32.96  ? 172  LEU H CA  1 
ATOM   10184 C C   . LEU H  1 145 ? 32.786 74.534 31.407  1.00 33.39  ? 172  LEU H C   1 
ATOM   10185 O O   . LEU H  1 145 ? 33.155 75.498 30.748  1.00 33.60  ? 172  LEU H O   1 
ATOM   10186 C CB  . LEU H  1 145 ? 35.132 74.397 32.233  1.00 31.34  ? 172  LEU H CB  1 
ATOM   10187 C CG  . LEU H  1 145 ? 36.100 73.858 33.276  1.00 30.69  ? 172  LEU H CG  1 
ATOM   10188 C CD1 . LEU H  1 145 ? 37.431 74.573 33.172  1.00 31.92  ? 172  LEU H CD1 1 
ATOM   10189 C CD2 . LEU H  1 145 ? 35.510 74.064 34.641  1.00 29.88  ? 172  LEU H CD2 1 
ATOM   10190 N N   . GLN H  1 146 ? 31.519 74.155 31.469  1.00 34.73  ? 173  GLN H N   1 
ATOM   10191 C CA  . GLN H  1 146 ? 30.474 74.894 30.769  1.00 36.40  ? 173  GLN H CA  1 
ATOM   10192 C C   . GLN H  1 146 ? 29.668 75.762 31.728  1.00 35.63  ? 173  GLN H C   1 
ATOM   10193 O O   . GLN H  1 146 ? 29.872 75.742 32.947  1.00 33.36  ? 173  GLN H O   1 
ATOM   10194 C CB  . GLN H  1 146 ? 29.524 73.933 30.043  1.00 39.37  ? 173  GLN H CB  1 
ATOM   10195 C CG  . GLN H  1 146 ? 30.221 73.016 29.054  1.00 43.18  ? 173  GLN H CG  1 
ATOM   10196 C CD  . GLN H  1 146 ? 31.155 73.784 28.143  1.00 45.91  ? 173  GLN H CD  1 
ATOM   10197 O OE1 . GLN H  1 146 ? 30.796 74.851 27.637  1.00 48.48  ? 173  GLN H OE1 1 
ATOM   10198 N NE2 . GLN H  1 146 ? 32.358 73.248 27.922  1.00 46.03  ? 173  GLN H NE2 1 
ATOM   10199 N N   . GLU H  1 147 ? 28.743 76.518 31.158  1.00 36.12  ? 174  GLU H N   1 
ATOM   10200 C CA  . GLU H  1 147 ? 27.896 77.398 31.938  1.00 38.03  ? 174  GLU H CA  1 
ATOM   10201 C C   . GLU H  1 147 ? 28.647 77.903 33.153  1.00 38.21  ? 174  GLU H C   1 
ATOM   10202 O O   . GLU H  1 147 ? 29.717 78.485 33.028  1.00 40.25  ? 174  GLU H O   1 
ATOM   10203 C CB  . GLU H  1 147 ? 26.637 76.660 32.388  1.00 40.45  ? 174  GLU H CB  1 
ATOM   10204 C CG  . GLU H  1 147 ? 25.767 76.186 31.244  1.00 43.66  ? 174  GLU H CG  1 
ATOM   10205 C CD  . GLU H  1 147 ? 25.450 77.301 30.272  1.00 44.98  ? 174  GLU H CD  1 
ATOM   10206 O OE1 . GLU H  1 147 ? 25.005 78.378 30.724  1.00 47.54  ? 174  GLU H OE1 1 
ATOM   10207 O OE2 . GLU H  1 147 ? 25.647 77.104 29.056  1.00 45.63  ? 174  GLU H OE2 1 
ATOM   10208 N N   . ASN H  1 148 ? 28.093 77.677 34.334  1.00 36.91  ? 175  ASN H N   1 
ATOM   10209 C CA  . ASN H  1 148 ? 28.739 78.121 35.555  1.00 35.12  ? 175  ASN H CA  1 
ATOM   10210 C C   . ASN H  1 148 ? 28.643 77.006 36.589  1.00 35.26  ? 175  ASN H C   1 
ATOM   10211 O O   . ASN H  1 148 ? 28.476 77.236 37.780  1.00 34.72  ? 175  ASN H O   1 
ATOM   10212 C CB  . ASN H  1 148 ? 28.079 79.411 36.053  1.00 33.26  ? 175  ASN H CB  1 
ATOM   10213 C CG  . ASN H  1 148 ? 26.650 79.200 36.542  1.00 32.26  ? 175  ASN H CG  1 
ATOM   10214 O OD1 . ASN H  1 148 ? 25.881 78.416 35.979  1.00 29.06  ? 175  ASN H OD1 1 
ATOM   10215 N ND2 . ASN H  1 148 ? 26.285 79.925 37.594  1.00 32.31  ? 175  ASN H ND2 1 
ATOM   10216 N N   . TYR H  1 149 ? 28.763 75.778 36.109  1.00 35.71  ? 176  TYR H N   1 
ATOM   10217 C CA  . TYR H  1 149 ? 28.692 74.620 36.976  1.00 35.66  ? 176  TYR H CA  1 
ATOM   10218 C C   . TYR H  1 149 ? 29.905 74.503 37.888  1.00 36.37  ? 176  TYR H C   1 
ATOM   10219 O O   . TYR H  1 149 ? 31.014 74.906 37.532  1.00 36.52  ? 176  TYR H O   1 
ATOM   10220 C CB  . TYR H  1 149 ? 28.592 73.355 36.136  1.00 34.36  ? 176  TYR H CB  1 
ATOM   10221 C CG  . TYR H  1 149 ? 27.451 73.365 35.160  1.00 35.55  ? 176  TYR H CG  1 
ATOM   10222 C CD1 . TYR H  1 149 ? 26.148 73.634 35.578  1.00 36.24  ? 176  TYR H CD1 1 
ATOM   10223 C CD2 . TYR H  1 149 ? 27.663 73.062 33.823  1.00 36.30  ? 176  TYR H CD2 1 
ATOM   10224 C CE1 . TYR H  1 149 ? 25.084 73.595 34.684  1.00 37.99  ? 176  TYR H CE1 1 
ATOM   10225 C CE2 . TYR H  1 149 ? 26.611 73.020 32.920  1.00 37.99  ? 176  TYR H CE2 1 
ATOM   10226 C CZ  . TYR H  1 149 ? 25.324 73.284 33.352  1.00 38.73  ? 176  TYR H CZ  1 
ATOM   10227 O OH  . TYR H  1 149 ? 24.280 73.228 32.450  1.00 40.32  ? 176  TYR H OH  1 
ATOM   10228 N N   . CYS H  1 150 ? 29.686 73.947 39.073  1.00 36.31  ? 177  CYS H N   1 
ATOM   10229 C CA  . CYS H  1 150 ? 30.769 73.737 40.013  1.00 35.35  ? 177  CYS H CA  1 
ATOM   10230 C C   . CYS H  1 150 ? 31.627 72.642 39.419  1.00 34.75  ? 177  CYS H C   1 
ATOM   10231 O O   . CYS H  1 150 ? 31.114 71.632 38.930  1.00 35.02  ? 177  CYS H O   1 
ATOM   10232 C CB  . CYS H  1 150 ? 30.212 73.270 41.339  1.00 35.53  ? 177  CYS H CB  1 
ATOM   10233 S SG  . CYS H  1 150 ? 29.160 74.484 42.174  1.00 38.21  ? 177  CYS H SG  1 
ATOM   10234 N N   . ARG H  1 151 ? 32.934 72.834 39.450  1.00 33.44  ? 178  ARG H N   1 
ATOM   10235 C CA  . ARG H  1 151 ? 33.825 71.827 38.904  1.00 33.32  ? 178  ARG H CA  1 
ATOM   10236 C C   . ARG H  1 151 ? 35.122 71.762 39.685  1.00 35.01  ? 178  ARG H C   1 
ATOM   10237 O O   . ARG H  1 151 ? 35.416 72.638 40.501  1.00 35.72  ? 178  ARG H O   1 
ATOM   10238 C CB  . ARG H  1 151 ? 34.114 72.143 37.447  1.00 30.49  ? 178  ARG H CB  1 
ATOM   10239 C CG  . ARG H  1 151 ? 32.906 72.026 36.554  1.00 27.32  ? 178  ARG H CG  1 
ATOM   10240 C CD  . ARG H  1 151 ? 32.589 70.575 36.269  1.00 24.55  ? 178  ARG H CD  1 
ATOM   10241 N NE  . ARG H  1 151 ? 31.517 70.419 35.293  1.00 22.57  ? 178  ARG H NE  1 
ATOM   10242 C CZ  . ARG H  1 151 ? 30.235 70.286 35.608  1.00 20.37  ? 178  ARG H CZ  1 
ATOM   10243 N NH1 . ARG H  1 151 ? 29.864 70.288 36.875  1.00 19.23  ? 178  ARG H NH1 1 
ATOM   10244 N NH2 . ARG H  1 151 ? 29.328 70.147 34.655  1.00 20.33  ? 178  ARG H NH2 1 
ATOM   10245 N N   . ASN H  1 152 ? 35.889 70.708 39.444  1.00 36.34  ? 179  ASN H N   1 
ATOM   10246 C CA  . ASN H  1 152 ? 37.176 70.528 40.103  1.00 38.34  ? 179  ASN H CA  1 
ATOM   10247 C C   . ASN H  1 152 ? 38.108 70.120 38.971  1.00 39.05  ? 179  ASN H C   1 
ATOM   10248 O O   . ASN H  1 152 ? 38.612 68.995 38.925  1.00 40.15  ? 179  ASN H O   1 
ATOM   10249 C CB  . ASN H  1 152 ? 37.104 69.415 41.147  1.00 38.69  ? 179  ASN H CB  1 
ATOM   10250 C CG  . ASN H  1 152 ? 38.289 69.428 42.088  1.00 39.64  ? 179  ASN H CG  1 
ATOM   10251 O OD1 . ASN H  1 152 ? 39.346 69.963 41.758  1.00 39.88  ? 179  ASN H OD1 1 
ATOM   10252 N ND2 . ASN H  1 152 ? 38.124 68.830 43.264  1.00 40.95  ? 179  ASN H ND2 1 
ATOM   10253 N N   . PRO H  1 153 ? 38.354 71.047 38.044  1.00 38.48  ? 180  PRO H N   1 
ATOM   10254 C CA  . PRO H  1 153 ? 39.208 70.835 36.879  1.00 39.12  ? 180  PRO H CA  1 
ATOM   10255 C C   . PRO H  1 153 ? 40.582 70.262 37.175  1.00 39.96  ? 180  PRO H C   1 
ATOM   10256 O O   . PRO H  1 153 ? 41.137 69.530 36.379  1.00 40.18  ? 180  PRO H O   1 
ATOM   10257 C CB  . PRO H  1 153 ? 39.264 72.217 36.256  1.00 39.40  ? 180  PRO H CB  1 
ATOM   10258 C CG  . PRO H  1 153 ? 39.201 73.106 37.463  1.00 37.93  ? 180  PRO H CG  1 
ATOM   10259 C CD  . PRO H  1 153 ? 38.107 72.480 38.257  1.00 37.64  ? 180  PRO H CD  1 
ATOM   10260 N N   . ARG H  1 154 ? 41.138 70.574 38.324  1.00 42.18  ? 181  ARG H N   1 
ATOM   10261 C CA  . ARG H  1 154 ? 42.459 70.058 38.629  1.00 44.89  ? 181  ARG H CA  1 
ATOM   10262 C C   . ARG H  1 154 ? 42.447 68.936 39.652  1.00 45.42  ? 181  ARG H C   1 
ATOM   10263 O O   . ARG H  1 154 ? 43.496 68.500 40.113  1.00 45.11  ? 181  ARG H O   1 
ATOM   10264 C CB  . ARG H  1 154 ? 43.345 71.190 39.137  1.00 47.71  ? 181  ARG H CB  1 
ATOM   10265 C CG  . ARG H  1 154 ? 43.869 72.114 38.062  1.00 50.05  ? 181  ARG H CG  1 
ATOM   10266 C CD  . ARG H  1 154 ? 44.822 73.082 38.702  1.00 53.65  ? 181  ARG H CD  1 
ATOM   10267 N NE  . ARG H  1 154 ? 45.895 73.476 37.803  1.00 57.05  ? 181  ARG H NE  1 
ATOM   10268 C CZ  . ARG H  1 154 ? 46.891 74.276 38.167  1.00 59.46  ? 181  ARG H CZ  1 
ATOM   10269 N NH1 . ARG H  1 154 ? 46.922 74.751 39.409  1.00 60.44  ? 181  ARG H NH1 1 
ATOM   10270 N NH2 . ARG H  1 154 ? 47.855 74.597 37.306  1.00 60.08  ? 181  ARG H NH2 1 
ATOM   10271 N N   . GLY H  1 155 ? 41.259 68.468 40.004  1.00 46.17  ? 182  GLY H N   1 
ATOM   10272 C CA  . GLY H  1 155 ? 41.152 67.420 41.001  1.00 46.07  ? 182  GLY H CA  1 
ATOM   10273 C C   . GLY H  1 155 ? 41.816 67.765 42.329  1.00 45.93  ? 182  GLY H C   1 
ATOM   10274 O O   . GLY H  1 155 ? 42.439 66.908 42.944  1.00 45.95  ? 182  GLY H O   1 
ATOM   10275 N N   . GLU H  1 156 ? 41.679 69.010 42.778  1.00 46.56  ? 183  GLU H N   1 
ATOM   10276 C CA  . GLU H  1 156 ? 42.262 69.467 44.042  1.00 48.21  ? 183  GLU H CA  1 
ATOM   10277 C C   . GLU H  1 156 ? 41.452 68.965 45.226  1.00 48.93  ? 183  GLU H C   1 
ATOM   10278 O O   . GLU H  1 156 ? 40.329 68.504 45.055  1.00 50.40  ? 183  GLU H O   1 
ATOM   10279 C CB  . GLU H  1 156 ? 42.288 70.998 44.094  1.00 49.58  ? 183  GLU H CB  1 
ATOM   10280 C CG  . GLU H  1 156 ? 43.168 71.654 43.026  1.00 52.47  ? 183  GLU H CG  1 
ATOM   10281 C CD  . GLU H  1 156 ? 42.975 73.170 42.917  1.00 52.14  ? 183  GLU H CD  1 
ATOM   10282 O OE1 . GLU H  1 156 ? 43.072 73.864 43.948  1.00 50.48  ? 183  GLU H OE1 1 
ATOM   10283 O OE2 . GLU H  1 156 ? 42.736 73.662 41.791  1.00 52.99  ? 183  GLU H OE2 1 
ATOM   10284 N N   . GLU H  1 157 ? 42.020 69.048 46.426  1.00 49.38  ? 184  GLU H N   1 
ATOM   10285 C CA  . GLU H  1 157 ? 41.307 68.628 47.634  1.00 49.77  ? 184  GLU H CA  1 
ATOM   10286 C C   . GLU H  1 157 ? 40.507 69.864 48.034  1.00 50.12  ? 184  GLU H C   1 
ATOM   10287 O O   . GLU H  1 157 ? 41.069 70.913 48.363  1.00 51.68  ? 184  GLU H O   1 
ATOM   10288 C CB  . GLU H  1 157 ? 42.293 68.229 48.750  1.00 49.26  ? 184  GLU H CB  1 
ATOM   10289 N N   . GLY H  1 158 ? 39.191 69.730 47.992  1.00 49.26  ? 185  GLY H N   1 
ATOM   10290 C CA  . GLY H  1 158 ? 38.292 70.828 48.295  1.00 48.60  ? 185  GLY H CA  1 
ATOM   10291 C C   . GLY H  1 158 ? 37.066 70.526 47.462  1.00 48.40  ? 185  GLY H C   1 
ATOM   10292 O O   . GLY H  1 158 ? 35.981 71.071 47.683  1.00 49.78  ? 185  GLY H O   1 
ATOM   10293 N N   . GLY H  1 159 ? 37.257 69.629 46.495  1.00 46.90  ? 186  GLY H N   1 
ATOM   10294 C CA  . GLY H  1 159 ? 36.172 69.212 45.629  1.00 44.92  ? 186  GLY H CA  1 
ATOM   10295 C C   . GLY H  1 159 ? 35.712 70.300 44.696  1.00 42.84  ? 186  GLY H C   1 
ATOM   10296 O O   . GLY H  1 159 ? 36.346 71.345 44.608  1.00 41.75  ? 186  GLY H O   1 
ATOM   10297 N N   . PRO H  1 160 ? 34.611 70.077 43.970  1.00 42.47  ? 187  PRO H N   1 
ATOM   10298 C CA  . PRO H  1 160 ? 34.122 71.100 43.052  1.00 42.80  ? 187  PRO H CA  1 
ATOM   10299 C C   . PRO H  1 160 ? 34.022 72.484 43.700  1.00 43.51  ? 187  PRO H C   1 
ATOM   10300 O O   . PRO H  1 160 ? 33.746 72.617 44.899  1.00 44.33  ? 187  PRO H O   1 
ATOM   10301 C CB  . PRO H  1 160 ? 32.771 70.541 42.620  1.00 41.96  ? 187  PRO H CB  1 
ATOM   10302 C CG  . PRO H  1 160 ? 33.051 69.075 42.564  1.00 40.58  ? 187  PRO H CG  1 
ATOM   10303 C CD  . PRO H  1 160 ? 33.811 68.845 43.851  1.00 41.50  ? 187  PRO H CD  1 
ATOM   10304 N N   . TRP H  1 161 ? 34.260 73.503 42.881  1.00 43.09  ? 188  TRP H N   1 
ATOM   10305 C CA  . TRP H  1 161 ? 34.220 74.895 43.298  1.00 41.86  ? 188  TRP H CA  1 
ATOM   10306 C C   . TRP H  1 161 ? 33.847 75.710 42.061  1.00 41.10  ? 188  TRP H C   1 
ATOM   10307 O O   . TRP H  1 161 ? 33.517 75.146 41.010  1.00 39.58  ? 188  TRP H O   1 
ATOM   10308 C CB  . TRP H  1 161 ? 35.601 75.330 43.787  1.00 42.48  ? 188  TRP H CB  1 
ATOM   10309 C CG  . TRP H  1 161 ? 36.652 75.128 42.746  1.00 44.15  ? 188  TRP H CG  1 
ATOM   10310 C CD1 . TRP H  1 161 ? 37.263 73.951 42.406  1.00 45.83  ? 188  TRP H CD1 1 
ATOM   10311 C CD2 . TRP H  1 161 ? 37.172 76.117 41.856  1.00 45.40  ? 188  TRP H CD2 1 
ATOM   10312 N NE1 . TRP H  1 161 ? 38.132 74.148 41.356  1.00 45.67  ? 188  TRP H NE1 1 
ATOM   10313 C CE2 . TRP H  1 161 ? 38.096 75.470 41.000  1.00 45.84  ? 188  TRP H CE2 1 
ATOM   10314 C CE3 . TRP H  1 161 ? 36.949 77.491 41.696  1.00 46.33  ? 188  TRP H CE3 1 
ATOM   10315 C CZ2 . TRP H  1 161 ? 38.793 76.150 40.001  1.00 45.64  ? 188  TRP H CZ2 1 
ATOM   10316 C CZ3 . TRP H  1 161 ? 37.644 78.169 40.699  1.00 46.81  ? 188  TRP H CZ3 1 
ATOM   10317 C CH2 . TRP H  1 161 ? 38.557 77.494 39.866  1.00 46.50  ? 188  TRP H CH2 1 
ATOM   10318 N N   . CYS H  1 162 ? 33.902 77.032 42.187  1.00 39.70  ? 189  CYS H N   1 
ATOM   10319 C CA  . CYS H  1 162 ? 33.602 77.901 41.062  1.00 38.52  ? 189  CYS H CA  1 
ATOM   10320 C C   . CYS H  1 162 ? 33.855 79.353 41.434  1.00 38.17  ? 189  CYS H C   1 
ATOM   10321 O O   . CYS H  1 162 ? 33.882 79.696 42.603  1.00 39.57  ? 189  CYS H O   1 
ATOM   10322 C CB  . CYS H  1 162 ? 32.148 77.730 40.658  1.00 38.85  ? 189  CYS H CB  1 
ATOM   10323 S SG  . CYS H  1 162 ? 30.997 78.598 41.763  1.00 39.32  ? 189  CYS H SG  1 
ATOM   10324 N N   . PHE H  1 163 ? 34.062 80.208 40.446  1.00 37.87  ? 190  PHE H N   1 
ATOM   10325 C CA  . PHE H  1 163 ? 34.261 81.617 40.734  1.00 36.81  ? 190  PHE H CA  1 
ATOM   10326 C C   . PHE H  1 163 ? 32.869 82.123 41.023  1.00 36.43  ? 190  PHE H C   1 
ATOM   10327 O O   . PHE H  1 163 ? 31.919 81.757 40.331  1.00 35.87  ? 190  PHE H O   1 
ATOM   10328 C CB  . PHE H  1 163 ? 34.882 82.319 39.524  1.00 38.29  ? 190  PHE H CB  1 
ATOM   10329 C CG  . PHE H  1 163 ? 36.292 81.888 39.252  1.00 38.84  ? 190  PHE H CG  1 
ATOM   10330 C CD1 . PHE H  1 163 ? 37.325 82.284 40.105  1.00 39.86  ? 190  PHE H CD1 1 
ATOM   10331 C CD2 . PHE H  1 163 ? 36.582 81.022 38.200  1.00 38.21  ? 190  PHE H CD2 1 
ATOM   10332 C CE1 . PHE H  1 163 ? 38.625 81.819 39.920  1.00 40.62  ? 190  PHE H CE1 1 
ATOM   10333 C CE2 . PHE H  1 163 ? 37.878 80.549 38.002  1.00 39.73  ? 190  PHE H CE2 1 
ATOM   10334 C CZ  . PHE H  1 163 ? 38.903 80.946 38.865  1.00 40.29  ? 190  PHE H CZ  1 
ATOM   10335 N N   . THR H  1 164 ? 32.735 82.938 42.061  1.00 37.37  ? 191  THR H N   1 
ATOM   10336 C CA  . THR H  1 164 ? 31.417 83.451 42.441  1.00 39.03  ? 191  THR H CA  1 
ATOM   10337 C C   . THR H  1 164 ? 31.031 84.743 41.724  1.00 38.57  ? 191  THR H C   1 
ATOM   10338 O O   . THR H  1 164 ? 31.893 85.512 41.303  1.00 37.41  ? 191  THR H O   1 
ATOM   10339 C CB  . THR H  1 164 ? 31.338 83.698 43.962  1.00 40.03  ? 191  THR H CB  1 
ATOM   10340 O OG1 . THR H  1 164 ? 31.512 85.097 44.231  1.00 40.86  ? 191  THR H OG1 1 
ATOM   10341 C CG2 . THR H  1 164 ? 32.421 82.897 44.683  1.00 39.07  ? 191  THR H CG2 1 
ATOM   10342 N N   . SER H  1 165 ? 29.730 84.971 41.585  1.00 38.71  ? 192  SER H N   1 
ATOM   10343 C CA  . SER H  1 165 ? 29.247 86.174 40.933  1.00 40.34  ? 192  SER H CA  1 
ATOM   10344 C C   . SER H  1 165 ? 29.346 87.366 41.893  1.00 42.33  ? 192  SER H C   1 
ATOM   10345 O O   . SER H  1 165 ? 28.987 88.496 41.554  1.00 42.05  ? 192  SER H O   1 
ATOM   10346 C CB  . SER H  1 165 ? 27.810 85.977 40.469  1.00 38.74  ? 192  SER H CB  1 
ATOM   10347 O OG  . SER H  1 165 ? 26.998 85.552 41.538  1.00 36.90  ? 192  SER H OG  1 
ATOM   10348 N N   . ASN H  1 166 ? 29.848 87.102 43.093  1.00 44.77  ? 193  ASN H N   1 
ATOM   10349 C CA  . ASN H  1 166 ? 30.029 88.144 44.092  1.00 46.36  ? 193  ASN H CA  1 
ATOM   10350 C C   . ASN H  1 166 ? 31.436 88.701 43.932  1.00 46.85  ? 193  ASN H C   1 
ATOM   10351 O O   . ASN H  1 166 ? 32.423 88.007 44.190  1.00 45.48  ? 193  ASN H O   1 
ATOM   10352 C CB  . ASN H  1 166 ? 29.881 87.577 45.503  1.00 47.81  ? 193  ASN H CB  1 
ATOM   10353 C CG  . ASN H  1 166 ? 29.954 88.653 46.565  1.00 48.62  ? 193  ASN H CG  1 
ATOM   10354 O OD1 . ASN H  1 166 ? 30.860 89.489 46.559  1.00 49.47  ? 193  ASN H OD1 1 
ATOM   10355 N ND2 . ASN H  1 166 ? 29.000 88.638 47.484  1.00 49.75  ? 193  ASN H ND2 1 
ATOM   10356 N N   . PRO H  1 167 ? 31.545 89.966 43.504  1.00 47.31  ? 194  PRO H N   1 
ATOM   10357 C CA  . PRO H  1 167 ? 32.839 90.620 43.305  1.00 47.72  ? 194  PRO H CA  1 
ATOM   10358 C C   . PRO H  1 167 ? 33.765 90.487 44.505  1.00 49.20  ? 194  PRO H C   1 
ATOM   10359 O O   . PRO H  1 167 ? 34.964 90.247 44.356  1.00 48.66  ? 194  PRO H O   1 
ATOM   10360 C CB  . PRO H  1 167 ? 32.445 92.058 43.027  1.00 46.43  ? 194  PRO H CB  1 
ATOM   10361 C CG  . PRO H  1 167 ? 31.153 91.897 42.293  1.00 47.11  ? 194  PRO H CG  1 
ATOM   10362 C CD  . PRO H  1 167 ? 30.442 90.867 43.137  1.00 46.50  ? 194  PRO H CD  1 
ATOM   10363 N N   . GLU H  1 168 ? 33.214 90.637 45.701  1.00 51.57  ? 195  GLU H N   1 
ATOM   10364 C CA  . GLU H  1 168 ? 34.037 90.528 46.894  1.00 54.18  ? 195  GLU H CA  1 
ATOM   10365 C C   . GLU H  1 168 ? 34.508 89.096 47.164  1.00 54.45  ? 195  GLU H C   1 
ATOM   10366 O O   . GLU H  1 168 ? 35.423 88.876 47.961  1.00 55.17  ? 195  GLU H O   1 
ATOM   10367 C CB  . GLU H  1 168 ? 33.288 91.078 48.114  1.00 56.44  ? 195  GLU H CB  1 
ATOM   10368 C CG  . GLU H  1 168 ? 33.597 92.548 48.399  1.00 60.40  ? 195  GLU H CG  1 
ATOM   10369 C CD  . GLU H  1 168 ? 33.135 92.998 49.781  1.00 63.21  ? 195  GLU H CD  1 
ATOM   10370 O OE1 . GLU H  1 168 ? 33.445 92.296 50.772  1.00 64.42  ? 195  GLU H OE1 1 
ATOM   10371 O OE2 . GLU H  1 168 ? 32.474 94.059 49.878  1.00 64.63  ? 195  GLU H OE2 1 
ATOM   10372 N N   . VAL H  1 169 ? 33.906 88.122 46.486  1.00 54.26  ? 196  VAL H N   1 
ATOM   10373 C CA  . VAL H  1 169 ? 34.278 86.722 46.695  1.00 52.20  ? 196  VAL H CA  1 
ATOM   10374 C C   . VAL H  1 169 ? 34.718 86.062 45.397  1.00 51.46  ? 196  VAL H C   1 
ATOM   10375 O O   . VAL H  1 169 ? 33.891 85.592 44.625  1.00 51.86  ? 196  VAL H O   1 
ATOM   10376 C CB  . VAL H  1 169 ? 33.093 85.916 47.269  1.00 51.67  ? 196  VAL H CB  1 
ATOM   10377 C CG1 . VAL H  1 169 ? 33.614 84.646 47.933  1.00 49.86  ? 196  VAL H CG1 1 
ATOM   10378 C CG2 . VAL H  1 169 ? 32.279 86.785 48.238  1.00 49.04  ? 196  VAL H CG2 1 
ATOM   10379 N N   . ARG H  1 170 ? 36.021 86.015 45.162  1.00 50.35  ? 197  ARG H N   1 
ATOM   10380 C CA  . ARG H  1 170 ? 36.533 85.415 43.939  1.00 50.04  ? 197  ARG H CA  1 
ATOM   10381 C C   . ARG H  1 170 ? 36.020 83.990 43.696  1.00 51.03  ? 197  ARG H C   1 
ATOM   10382 O O   . ARG H  1 170 ? 35.264 83.761 42.749  1.00 51.09  ? 197  ARG H O   1 
ATOM   10383 C CB  . ARG H  1 170 ? 38.065 85.426 43.948  1.00 48.37  ? 197  ARG H CB  1 
ATOM   10384 C CG  . ARG H  1 170 ? 38.703 84.980 42.644  1.00 45.81  ? 197  ARG H CG  1 
ATOM   10385 C CD  . ARG H  1 170 ? 40.218 85.037 42.733  1.00 44.65  ? 197  ARG H CD  1 
ATOM   10386 N NE  . ARG H  1 170 ? 40.877 84.456 41.564  1.00 43.74  ? 197  ARG H NE  1 
ATOM   10387 C CZ  . ARG H  1 170 ? 40.906 85.007 40.353  1.00 43.61  ? 197  ARG H CZ  1 
ATOM   10388 N NH1 . ARG H  1 170 ? 40.311 86.172 40.137  1.00 44.00  ? 197  ARG H NH1 1 
ATOM   10389 N NH2 . ARG H  1 170 ? 41.522 84.387 39.350  1.00 42.77  ? 197  ARG H NH2 1 
ATOM   10390 N N   . TYR H  1 171 ? 36.432 83.039 44.541  1.00 52.18  ? 198  TYR H N   1 
ATOM   10391 C CA  . TYR H  1 171 ? 36.032 81.627 44.399  1.00 53.62  ? 198  TYR H CA  1 
ATOM   10392 C C   . TYR H  1 171 ? 35.661 80.955 45.709  1.00 53.82  ? 198  TYR H C   1 
ATOM   10393 O O   . TYR H  1 171 ? 36.178 81.322 46.760  1.00 54.89  ? 198  TYR H O   1 
ATOM   10394 C CB  . TYR H  1 171 ? 37.163 80.806 43.795  1.00 54.92  ? 198  TYR H CB  1 
ATOM   10395 C CG  . TYR H  1 171 ? 38.308 80.608 44.753  1.00 56.90  ? 198  TYR H CG  1 
ATOM   10396 C CD1 . TYR H  1 171 ? 39.209 81.640 45.010  1.00 58.05  ? 198  TYR H CD1 1 
ATOM   10397 C CD2 . TYR H  1 171 ? 38.475 79.398 45.430  1.00 58.12  ? 198  TYR H CD2 1 
ATOM   10398 C CE1 . TYR H  1 171 ? 40.250 81.476 45.914  1.00 59.48  ? 198  TYR H CE1 1 
ATOM   10399 C CE2 . TYR H  1 171 ? 39.515 79.220 46.344  1.00 59.24  ? 198  TYR H CE2 1 
ATOM   10400 C CZ  . TYR H  1 171 ? 40.399 80.266 46.579  1.00 60.04  ? 198  TYR H CZ  1 
ATOM   10401 O OH  . TYR H  1 171 ? 41.435 80.110 47.473  1.00 60.81  ? 198  TYR H OH  1 
ATOM   10402 N N   . GLU H  1 172 ? 34.798 79.946 45.629  1.00 54.27  ? 199  GLU H N   1 
ATOM   10403 C CA  . GLU H  1 172 ? 34.351 79.197 46.802  1.00 55.44  ? 199  GLU H CA  1 
ATOM   10404 C C   . GLU H  1 172 ? 33.948 77.792 46.399  1.00 54.92  ? 199  GLU H C   1 
ATOM   10405 O O   . GLU H  1 172 ? 33.514 77.561 45.275  1.00 55.12  ? 199  GLU H O   1 
ATOM   10406 C CB  . GLU H  1 172 ? 33.163 79.892 47.464  1.00 56.89  ? 199  GLU H CB  1 
ATOM   10407 C CG  . GLU H  1 172 ? 32.533 79.089 48.576  1.00 60.60  ? 199  GLU H CG  1 
ATOM   10408 C CD  . GLU H  1 172 ? 31.576 79.904 49.439  1.00 62.69  ? 199  GLU H CD  1 
ATOM   10409 O OE1 . GLU H  1 172 ? 30.657 80.554 48.886  1.00 62.77  ? 199  GLU H OE1 1 
ATOM   10410 O OE2 . GLU H  1 172 ? 31.743 79.881 50.680  1.00 64.04  ? 199  GLU H OE2 1 
ATOM   10411 N N   . VAL H  1 173 ? 34.106 76.849 47.317  1.00 54.76  ? 200  VAL H N   1 
ATOM   10412 C CA  . VAL H  1 173 ? 33.749 75.466 47.037  1.00 54.00  ? 200  VAL H CA  1 
ATOM   10413 C C   . VAL H  1 173 ? 32.237 75.322 47.044  1.00 53.26  ? 200  VAL H C   1 
ATOM   10414 O O   . VAL H  1 173 ? 31.525 76.174 47.579  1.00 51.27  ? 200  VAL H O   1 
ATOM   10415 C CB  . VAL H  1 173 ? 34.330 74.507 48.091  1.00 53.80  ? 200  VAL H CB  1 
ATOM   10416 C CG1 . VAL H  1 173 ? 35.819 74.314 47.868  1.00 53.99  ? 200  VAL H CG1 1 
ATOM   10417 C CG2 . VAL H  1 173 ? 34.073 75.068 49.472  1.00 52.98  ? 200  VAL H CG2 1 
ATOM   10418 N N   . CYS H  1 174 ? 31.752 74.245 46.438  1.00 52.91  ? 201  CYS H N   1 
ATOM   10419 C CA  . CYS H  1 174 ? 30.324 73.992 46.400  1.00 53.17  ? 201  CYS H CA  1 
ATOM   10420 C C   . CYS H  1 174 ? 30.016 72.819 47.316  1.00 55.80  ? 201  CYS H C   1 
ATOM   10421 O O   . CYS H  1 174 ? 30.853 71.936 47.516  1.00 57.30  ? 201  CYS H O   1 
ATOM   10422 C CB  . CYS H  1 174 ? 29.877 73.677 44.982  1.00 49.73  ? 201  CYS H CB  1 
ATOM   10423 S SG  . CYS H  1 174 ? 30.286 74.981 43.785  1.00 43.97  ? 201  CYS H SG  1 
ATOM   10424 N N   . ASP H  1 175 ? 28.810 72.826 47.871  1.00 57.14  ? 202  ASP H N   1 
ATOM   10425 C CA  . ASP H  1 175 ? 28.342 71.797 48.792  1.00 58.41  ? 202  ASP H CA  1 
ATOM   10426 C C   . ASP H  1 175 ? 27.821 70.576 48.022  1.00 57.95  ? 202  ASP H C   1 
ATOM   10427 O O   . ASP H  1 175 ? 26.614 70.375 47.906  1.00 56.92  ? 202  ASP H O   1 
ATOM   10428 C CB  . ASP H  1 175 ? 27.217 72.405 49.639  1.00 62.67  ? 202  ASP H CB  1 
ATOM   10429 C CG  . ASP H  1 175 ? 27.464 72.292 51.137  1.00 65.43  ? 202  ASP H CG  1 
ATOM   10430 O OD1 . ASP H  1 175 ? 28.627 72.461 51.578  1.00 67.11  ? 202  ASP H OD1 1 
ATOM   10431 O OD2 . ASP H  1 175 ? 26.475 72.052 51.870  1.00 66.14  ? 202  ASP H OD2 1 
ATOM   10432 N N   . ILE H  1 176 ? 28.720 69.747 47.507  1.00 57.94  ? 203  ILE H N   1 
ATOM   10433 C CA  . ILE H  1 176 ? 28.280 68.590 46.736  1.00 57.56  ? 203  ILE H CA  1 
ATOM   10434 C C   . ILE H  1 176 ? 28.553 67.260 47.414  1.00 57.86  ? 203  ILE H C   1 
ATOM   10435 O O   . ILE H  1 176 ? 29.693 66.835 47.569  1.00 57.76  ? 203  ILE H O   1 
ATOM   10436 C CB  . ILE H  1 176 ? 28.887 68.626 45.314  1.00 57.26  ? 203  ILE H CB  1 
ATOM   10437 C CG1 . ILE H  1 176 ? 28.241 69.785 44.548  1.00 56.38  ? 203  ILE H CG1 1 
ATOM   10438 C CG2 . ILE H  1 176 ? 28.693 67.292 44.602  1.00 55.80  ? 203  ILE H CG2 1 
ATOM   10439 C CD1 . ILE H  1 176 ? 28.586 69.849 43.105  1.00 55.77  ? 203  ILE H CD1 1 
ATOM   10440 N N   . PRO H  1 177 ? 27.477 66.572 47.803  1.00 58.49  ? 204  PRO H N   1 
ATOM   10441 C CA  . PRO H  1 177 ? 27.450 65.277 48.483  1.00 59.02  ? 204  PRO H CA  1 
ATOM   10442 C C   . PRO H  1 177 ? 28.275 64.139 47.896  1.00 59.91  ? 204  PRO H C   1 
ATOM   10443 O O   . PRO H  1 177 ? 28.400 63.992 46.677  1.00 59.16  ? 204  PRO H O   1 
ATOM   10444 C CB  . PRO H  1 177 ? 25.957 64.947 48.528  1.00 58.04  ? 204  PRO H CB  1 
ATOM   10445 C CG  . PRO H  1 177 ? 25.440 65.606 47.307  1.00 58.53  ? 204  PRO H CG  1 
ATOM   10446 C CD  . PRO H  1 177 ? 26.122 66.942 47.357  1.00 58.75  ? 204  PRO H CD  1 
ATOM   10447 N N   . GLN H  1 178 ? 28.839 63.343 48.802  1.00 60.73  ? 205  GLN H N   1 
ATOM   10448 C CA  . GLN H  1 178 ? 29.637 62.178 48.452  1.00 61.77  ? 205  GLN H CA  1 
ATOM   10449 C C   . GLN H  1 178 ? 28.667 61.050 48.146  1.00 62.53  ? 205  GLN H C   1 
ATOM   10450 O O   . GLN H  1 178 ? 27.639 60.927 48.809  1.00 64.03  ? 205  GLN H O   1 
ATOM   10451 C CB  . GLN H  1 178 ? 30.499 61.767 49.638  1.00 62.50  ? 205  GLN H CB  1 
ATOM   10452 C CG  . GLN H  1 178 ? 31.636 62.707 49.966  1.00 65.15  ? 205  GLN H CG  1 
ATOM   10453 C CD  . GLN H  1 178 ? 32.779 62.601 48.975  1.00 66.58  ? 205  GLN H CD  1 
ATOM   10454 O OE1 . GLN H  1 178 ? 33.208 61.503 48.611  1.00 67.22  ? 205  GLN H OE1 1 
ATOM   10455 N NE2 . GLN H  1 178 ? 33.288 63.746 48.541  1.00 67.92  ? 205  GLN H NE2 1 
ATOM   10456 N N   . CYS H  1 179 ? 28.979 60.224 47.157  1.00 62.90  ? 206  CYS H N   1 
ATOM   10457 C CA  . CYS H  1 179 ? 28.093 59.118 46.838  1.00 65.48  ? 206  CYS H CA  1 
ATOM   10458 C C   . CYS H  1 179 ? 28.013 58.141 48.000  1.00 69.18  ? 206  CYS H C   1 
ATOM   10459 O O   . CYS H  1 179 ? 27.026 57.422 48.152  1.00 71.06  ? 206  CYS H O   1 
ATOM   10460 C CB  . CYS H  1 179 ? 28.568 58.376 45.601  1.00 62.60  ? 206  CYS H CB  1 
ATOM   10461 S SG  . CYS H  1 179 ? 28.449 59.349 44.071  1.00 60.71  ? 206  CYS H SG  1 
ATOM   10462 N N   . SER H  1 180 ? 29.057 58.115 48.818  1.00 72.70  ? 207  SER H N   1 
ATOM   10463 C CA  . SER H  1 180 ? 29.094 57.231 49.970  1.00 75.90  ? 207  SER H CA  1 
ATOM   10464 C C   . SER H  1 180 ? 28.692 57.984 51.237  1.00 79.07  ? 207  SER H C   1 
ATOM   10465 O O   . SER H  1 180 ? 29.548 58.407 52.018  1.00 80.03  ? 207  SER H O   1 
ATOM   10466 C CB  . SER H  1 180 ? 30.495 56.650 50.141  1.00 74.82  ? 207  SER H CB  1 
ATOM   10467 O OG  . SER H  1 180 ? 31.431 57.672 50.429  1.00 75.00  ? 207  SER H OG  1 
ATOM   10468 N N   . GLU H  1 181 ? 27.391 58.157 51.440  1.00 81.88  ? 208  GLU H N   1 
ATOM   10469 C CA  . GLU H  1 181 ? 26.912 58.838 52.634  1.00 84.72  ? 208  GLU H CA  1 
ATOM   10470 C C   . GLU H  1 181 ? 25.565 58.307 53.097  1.00 85.51  ? 208  GLU H C   1 
ATOM   10471 O O   . GLU H  1 181 ? 24.582 59.080 53.055  1.00 86.62  ? 208  GLU H O   1 
ATOM   10472 C CB  . GLU H  1 181 ? 26.833 60.349 52.399  1.00 86.00  ? 208  GLU H CB  1 
ATOM   10473 C CG  . GLU H  1 181 ? 28.188 61.056 52.451  1.00 88.53  ? 208  GLU H CG  1 
ATOM   10474 C CD  . GLU H  1 181 ? 29.025 60.658 53.672  1.00 89.93  ? 208  GLU H CD  1 
ATOM   10475 O OE1 . GLU H  1 181 ? 28.440 60.445 54.759  1.00 90.74  ? 208  GLU H OE1 1 
ATOM   10476 O OE2 . GLU H  1 181 ? 30.270 60.570 53.547  1.00 89.99  ? 208  GLU H OE2 1 
ATOM   10477 N N   . VAL H  1 182 ? 25.518 57.121 53.497  1.00 85.57  ? 209  VAL H N   1 
HETATM 10478 C C1  . IDS I  2 .   ? 0.980  15.205 20.965  1.00 122.39 ? 1    IDS I C1  1 
HETATM 10479 C C2  . IDS I  2 .   ? -0.380 15.531 21.628  1.00 122.05 ? 1    IDS I C2  1 
HETATM 10480 C C3  . IDS I  2 .   ? -1.167 14.292 22.147  1.00 121.67 ? 1    IDS I C3  1 
HETATM 10481 C C4  . IDS I  2 .   ? -0.259 13.267 22.861  1.00 121.98 ? 1    IDS I C4  1 
HETATM 10482 C C5  . IDS I  2 .   ? 0.996  12.998 21.999  1.00 122.91 ? 1    IDS I C5  1 
HETATM 10483 C C6  . IDS I  2 .   ? 1.974  11.988 22.609  1.00 123.47 ? 1    IDS I C6  1 
HETATM 10484 O O1  . IDS I  2 .   ? 0.766  14.775 19.646  1.00 122.12 ? 1    IDS I O1  1 
HETATM 10485 O O2  . IDS I  2 .   ? -0.121 16.406 22.721  1.00 122.17 ? 1    IDS I O2  1 
HETATM 10486 O O3  . IDS I  2 .   ? -1.791 13.637 21.057  1.00 121.57 ? 1    IDS I O3  1 
HETATM 10487 O O4  . IDS I  2 .   ? 0.017  13.777 24.166  1.00 121.43 ? 1    IDS I O4  1 
HETATM 10488 O O5  . IDS I  2 .   ? 1.681  14.244 21.753  1.00 123.10 ? 1    IDS I O5  1 
HETATM 10489 O O6A . IDS I  2 .   ? 2.994  12.345 23.179  1.00 123.93 ? 1    IDS I O6A 1 
HETATM 10490 O O6B . IDS I  2 .   ? 1.751  10.796 22.539  1.00 123.58 ? 1    IDS I O6B 1 
HETATM 10491 S S   . IDS I  2 .   ? -0.546 17.914 22.873  1.00 122.30 ? 1    IDS I S   1 
HETATM 10492 O O1S . IDS I  2 .   ? -1.973 17.911 23.031  1.00 122.52 ? 1    IDS I O1S 1 
HETATM 10493 O O2S . IDS I  2 .   ? 0.137  18.407 24.038  1.00 121.62 ? 1    IDS I O2S 1 
HETATM 10494 O O3S . IDS I  2 .   ? -0.120 18.582 21.681  1.00 122.60 ? 1    IDS I O3S 1 
HETATM 10495 C C1  . SGN I  2 .   ? -0.713 13.234 25.240  1.00 121.44 ? 2    SGN I C1  1 
HETATM 10496 C C2  . SGN I  2 .   ? -0.749 14.208 26.438  1.00 122.07 ? 2    SGN I C2  1 
HETATM 10497 C C3  . SGN I  2 .   ? 0.644  14.341 27.062  1.00 121.85 ? 2    SGN I C3  1 
HETATM 10498 C C4  . SGN I  2 .   ? 1.106  12.943 27.530  1.00 121.31 ? 2    SGN I C4  1 
HETATM 10499 C C5  . SGN I  2 .   ? 1.144  12.020 26.265  1.00 120.86 ? 2    SGN I C5  1 
HETATM 10500 C C6  . SGN I  2 .   ? 1.580  10.576 26.540  1.00 120.79 ? 2    SGN I C6  1 
HETATM 10501 N N2  . SGN I  2 .   ? -1.252 15.502 25.962  1.00 123.55 ? 2    SGN I N2  1 
HETATM 10502 O O3  . SGN I  2 .   ? 0.576  15.230 28.173  1.00 121.07 ? 2    SGN I O3  1 
HETATM 10503 O O4  . SGN I  2 .   ? 2.222  13.258 28.362  1.00 121.42 ? 2    SGN I O4  1 
HETATM 10504 O O5  . SGN I  2 .   ? -0.166 11.966 25.628  1.00 120.48 ? 2    SGN I O5  1 
HETATM 10505 O O6  . SGN I  2 .   ? 0.586  9.877  27.242  1.00 121.34 ? 2    SGN I O6  1 
HETATM 10506 S S1  . SGN I  2 .   ? -2.623 16.141 26.574  1.00 124.67 ? 2    SGN I S1  1 
HETATM 10507 O O1S . SGN I  2 .   ? -3.734 15.538 25.888  1.00 124.71 ? 2    SGN I O1S 1 
HETATM 10508 O O2S . SGN I  2 .   ? -2.595 15.859 27.988  1.00 124.85 ? 2    SGN I O2S 1 
HETATM 10509 O O3S . SGN I  2 .   ? -2.527 17.551 26.290  1.00 124.31 ? 2    SGN I O3S 1 
HETATM 10510 S S2  . SGN I  2 .   ? 0.621  8.359  27.609  1.00 121.75 ? 2    SGN I S2  1 
HETATM 10511 O O4S . SGN I  2 .   ? 1.919  8.080  28.153  1.00 121.38 ? 2    SGN I O4S 1 
HETATM 10512 O O5S . SGN I  2 .   ? -0.424 8.191  28.577  1.00 121.65 ? 2    SGN I O5S 1 
HETATM 10513 O O6S . SGN I  2 .   ? 0.360  7.652  26.383  1.00 121.08 ? 2    SGN I O6S 1 
HETATM 10514 C C1  . IDS I  2 .   ? 2.500  12.380 29.415  1.00 121.16 ? 3    IDS I C1  1 
HETATM 10515 C C2  . IDS I  2 .   ? 4.029  12.274 29.593  1.00 121.13 ? 3    IDS I C2  1 
HETATM 10516 C C3  . IDS I  2 .   ? 4.678  13.440 30.397  1.00 120.70 ? 3    IDS I C3  1 
HETATM 10517 C C4  . IDS I  2 .   ? 3.829  13.868 31.632  1.00 121.49 ? 3    IDS I C4  1 
HETATM 10518 C C5  . IDS I  2 .   ? 2.336  14.014 31.215  1.00 120.88 ? 3    IDS I C5  1 
HETATM 10519 C C6  . IDS I  2 .   ? 1.375  14.436 32.340  1.00 120.19 ? 3    IDS I C6  1 
HETATM 10520 O O2  . IDS I  2 .   ? 4.284  11.060 30.270  1.00 121.62 ? 3    IDS I O2  1 
HETATM 10521 O O3  . IDS I  2 .   ? 4.839  14.565 29.541  1.00 119.63 ? 3    IDS I O3  1 
HETATM 10522 O O4  . IDS I  2 .   ? 4.395  12.925 32.557  1.00 122.99 ? 3    IDS I O4  1 
HETATM 10523 O O5  . IDS I  2 .   ? 1.884  12.771 30.642  1.00 121.62 ? 3    IDS I O5  1 
HETATM 10524 O O6A . IDS I  2 .   ? 0.359  13.809 32.578  1.00 118.98 ? 3    IDS I O6A 1 
HETATM 10525 O O6B . IDS I  2 .   ? 1.603  15.417 33.021  1.00 119.38 ? 3    IDS I O6B 1 
HETATM 10526 S S   . IDS I  2 .   ? 4.866  9.723  29.703  1.00 122.25 ? 3    IDS I S   1 
HETATM 10527 O O1S . IDS I  2 .   ? 6.291  9.856  29.765  1.00 121.33 ? 3    IDS I O1S 1 
HETATM 10528 O O2S . IDS I  2 .   ? 4.366  8.704  30.581  1.00 122.49 ? 3    IDS I O2S 1 
HETATM 10529 O O3S . IDS I  2 .   ? 4.375  9.580  28.355  1.00 121.86 ? 3    IDS I O3S 1 
HETATM 10530 C C1  . SGN I  2 .   ? 5.014  13.422 33.731  1.00 123.71 ? 4    SGN I C1  1 
HETATM 10531 C C2  . SGN I  2 .   ? 5.826  12.300 34.447  1.00 124.74 ? 4    SGN I C2  1 
HETATM 10532 C C3  . SGN I  2 .   ? 4.855  11.203 34.930  1.00 124.43 ? 4    SGN I C3  1 
HETATM 10533 C C4  . SGN I  2 .   ? 3.870  11.850 35.919  1.00 124.96 ? 4    SGN I C4  1 
HETATM 10534 C C5  . SGN I  2 .   ? 3.103  12.994 35.177  1.00 124.73 ? 4    SGN I C5  1 
HETATM 10535 C C6  . SGN I  2 .   ? 2.108  13.785 36.042  1.00 125.73 ? 4    SGN I C6  1 
HETATM 10536 N N2  . SGN I  2 .   ? 6.820  11.761 33.503  1.00 126.11 ? 4    SGN I N2  1 
HETATM 10537 O O3  . SGN I  2 .   ? 5.575  10.178 35.592  1.00 123.77 ? 4    SGN I O3  1 
HETATM 10538 O O4  . SGN I  2 .   ? 3.156  10.649 36.270  1.00 126.54 ? 4    SGN I O4  1 
HETATM 10539 O O5  . SGN I  2 .   ? 4.024  13.956 34.609  1.00 123.75 ? 4    SGN I O5  1 
HETATM 10540 O O6  . SGN I  2 .   ? 2.786  14.389 37.131  1.00 127.34 ? 4    SGN I O6  1 
HETATM 10541 S S1  . SGN I  2 .   ? 8.376  12.311 33.547  1.00 126.89 ? 4    SGN I S1  1 
HETATM 10542 O O1S . SGN I  2 .   ? 8.387  13.687 33.120  1.00 125.92 ? 4    SGN I O1S 1 
HETATM 10543 O O2S . SGN I  2 .   ? 8.829  12.144 34.904  1.00 126.39 ? 4    SGN I O2S 1 
HETATM 10544 O O3S . SGN I  2 .   ? 9.088  11.461 32.626  1.00 126.37 ? 4    SGN I O3S 1 
HETATM 10545 S S2  . SGN I  2 .   ? 2.157  15.287 38.261  1.00 127.98 ? 4    SGN I S2  1 
HETATM 10546 O O4S . SGN I  2 .   ? 1.314  14.445 39.064  1.00 127.66 ? 4    SGN I O4S 1 
HETATM 10547 O O5S . SGN I  2 .   ? 3.285  15.803 38.991  1.00 127.38 ? 4    SGN I O5S 1 
HETATM 10548 O O6S . SGN I  2 .   ? 1.426  16.323 37.584  1.00 127.63 ? 4    SGN I O6S 1 
HETATM 10549 C C1  . IDS I  2 .   ? 2.384  10.683 37.442  1.00 126.91 ? 5    IDS I C1  1 
HETATM 10550 C C2  . IDS I  2 .   ? 1.800  9.272  37.727  1.00 127.95 ? 5    IDS I C2  1 
HETATM 10551 C C3  . IDS I  2 .   ? 1.738  9.035  39.261  1.00 127.77 ? 5    IDS I C3  1 
HETATM 10552 C C4  . IDS I  2 .   ? 3.153  9.164  39.930  1.00 128.31 ? 5    IDS I C4  1 
HETATM 10553 C C5  . IDS I  2 .   ? 4.026  10.212 39.139  1.00 126.27 ? 5    IDS I C5  1 
HETATM 10554 C C6  . IDS I  2 .   ? 5.097  10.980 39.915  1.00 126.09 ? 5    IDS I C6  1 
HETATM 10555 O O2  . IDS I  2 .   ? 0.461  9.153  37.179  1.00 129.46 ? 5    IDS I O2  1 
HETATM 10556 O O3  . IDS I  2 .   ? 1.219  7.742  39.516  1.00 128.04 ? 5    IDS I O3  1 
HETATM 10557 O O4  . IDS I  2 .   ? 3.989  8.616  40.966  1.00 131.79 ? 5    IDS I O4  1 
HETATM 10558 O O5  . IDS I  2 .   ? 3.153  11.161 38.536  1.00 126.29 ? 5    IDS I O5  1 
HETATM 10559 O O6A . IDS I  2 .   ? 5.271  10.810 41.098  1.00 126.09 ? 5    IDS I O6A 1 
HETATM 10560 O O6B . IDS I  2 .   ? 5.799  11.794 39.359  1.00 125.67 ? 5    IDS I O6B 1 
HETATM 10561 S S   . IDS I  2 .   ? -0.595 10.239 36.673  1.00 130.35 ? 5    IDS I S   1 
HETATM 10562 O O1S . IDS I  2 .   ? -0.124 10.709 35.389  1.00 130.26 ? 5    IDS I O1S 1 
HETATM 10563 O O2S . IDS I  2 .   ? -0.695 11.271 37.668  1.00 129.72 ? 5    IDS I O2S 1 
HETATM 10564 O O3S . IDS I  2 .   ? -1.821 9.501  36.555  1.00 130.54 ? 5    IDS I O3S 1 
HETATM 10565 C C1  . SGN I  2 .   ? 3.403  7.976  42.095  1.00 132.94 ? 6    SGN I C1  1 
HETATM 10566 C C2  . SGN I  2 .   ? 3.289  8.936  43.335  1.00 133.62 ? 6    SGN I C2  1 
HETATM 10567 C C3  . SGN I  2 .   ? 4.700  9.353  43.798  1.00 133.69 ? 6    SGN I C3  1 
HETATM 10568 C C4  . SGN I  2 .   ? 5.461  8.071  44.192  1.00 134.15 ? 6    SGN I C4  1 
HETATM 10569 C C5  . SGN I  2 .   ? 5.534  7.137  42.950  1.00 135.12 ? 6    SGN I C5  1 
HETATM 10570 C C6  . SGN I  2 .   ? 6.234  5.803  43.238  1.00 137.14 ? 6    SGN I C6  1 
HETATM 10571 N N2  . SGN I  2 .   ? 2.477  10.103 42.979  1.00 134.14 ? 6    SGN I N2  1 
HETATM 10572 O O3  . SGN I  2 .   ? 4.608  10.218 44.919  1.00 133.43 ? 6    SGN I O3  1 
HETATM 10573 O O5  . SGN I  2 .   ? 4.195  6.844  42.446  1.00 134.05 ? 6    SGN I O5  1 
HETATM 10574 O O6  . SGN I  2 .   ? 5.500  4.735  42.643  1.00 140.39 ? 6    SGN I O6  1 
HETATM 10575 S S1  . SGN I  2 .   ? 1.051  10.313 43.784  1.00 134.64 ? 6    SGN I S1  1 
HETATM 10576 O O1S . SGN I  2 .   ? 0.642  11.651 43.459  1.00 134.26 ? 6    SGN I O1S 1 
HETATM 10577 O O2S . SGN I  2 .   ? 0.115  9.338  43.299  1.00 134.53 ? 6    SGN I O2S 1 
HETATM 10578 O O3S . SGN I  2 .   ? 1.339  10.154 45.190  1.00 133.87 ? 6    SGN I O3S 1 
HETATM 10579 S S2  . SGN I  2 .   ? 5.755  3.179  42.775  1.00 142.23 ? 6    SGN I S2  1 
HETATM 10580 O O4S . SGN I  2 .   ? 5.705  2.644  41.441  1.00 141.45 ? 6    SGN I O4S 1 
HETATM 10581 O O5S . SGN I  2 .   ? 4.669  2.697  43.589  1.00 141.69 ? 6    SGN I O5S 1 
HETATM 10582 O O6S . SGN I  2 .   ? 7.039  2.996  43.399  1.00 142.30 ? 6    SGN I O6S 1 
HETATM 10583 C C1  . IDS J  3 .   ? 14.735 50.255 0.685   1.00 145.13 ? 1    IDS J C1  1 
HETATM 10584 C C2  . IDS J  3 .   ? 14.643 48.945 1.519   1.00 145.43 ? 1    IDS J C2  1 
HETATM 10585 C C3  . IDS J  3 .   ? 13.262 48.884 2.210   1.00 145.42 ? 1    IDS J C3  1 
HETATM 10586 C C4  . IDS J  3 .   ? 13.055 50.115 3.154   1.00 144.33 ? 1    IDS J C4  1 
HETATM 10587 C C5  . IDS J  3 .   ? 14.128 51.223 2.858   1.00 144.44 ? 1    IDS J C5  1 
HETATM 10588 C C6  . IDS J  3 .   ? 13.891 52.578 3.547   1.00 143.95 ? 1    IDS J C6  1 
HETATM 10589 O O1  . IDS J  3 .   ? 16.072 50.445 0.330   1.00 145.12 ? 1    IDS J O1  1 
HETATM 10590 O O2  . IDS J  3 .   ? 14.795 47.817 0.661   1.00 146.45 ? 1    IDS J O2  1 
HETATM 10591 O O3  . IDS J  3 .   ? 13.164 47.695 2.979   1.00 145.44 ? 1    IDS J O3  1 
HETATM 10592 O O4  . IDS J  3 .   ? 11.908 50.516 3.916   1.00 142.74 ? 1    IDS J O4  1 
HETATM 10593 O O5  . IDS J  3 .   ? 14.224 51.386 1.419   1.00 144.80 ? 1    IDS J O5  1 
HETATM 10594 O O6A . IDS J  3 .   ? 13.528 52.631 4.704   1.00 143.23 ? 1    IDS J O6A 1 
HETATM 10595 O O6B . IDS J  3 .   ? 14.068 53.627 2.971   1.00 144.00 ? 1    IDS J O6B 1 
HETATM 10596 S S   . IDS J  3 .   ? 15.481 46.428 0.961   1.00 146.69 ? 1    IDS J S   1 
HETATM 10597 O O1S . IDS J  3 .   ? 15.797 45.902 -0.335  1.00 146.86 ? 1    IDS J O1S 1 
HETATM 10598 O O2S . IDS J  3 .   ? 16.658 46.670 1.743   1.00 146.37 ? 1    IDS J O2S 1 
HETATM 10599 O O3S . IDS J  3 .   ? 14.493 45.650 1.638   1.00 146.02 ? 1    IDS J O3S 1 
HETATM 10600 C C1  . SGN J  3 .   ? 11.359 49.589 4.832   1.00 142.10 ? 2    SGN J C1  1 
HETATM 10601 C C2  . SGN J  3 .   ? 9.974  50.054 5.352   1.00 141.18 ? 2    SGN J C2  1 
HETATM 10602 C C3  . SGN J  3 .   ? 10.146 51.313 6.224   1.00 141.14 ? 2    SGN J C3  1 
HETATM 10603 C C4  . SGN J  3 .   ? 11.056 50.954 7.425   1.00 141.77 ? 2    SGN J C4  1 
HETATM 10604 C C5  . SGN J  3 .   ? 12.435 50.483 6.855   1.00 142.24 ? 2    SGN J C5  1 
HETATM 10605 C C6  . SGN J  3 .   ? 13.446 50.044 7.935   1.00 142.81 ? 2    SGN J C6  1 
HETATM 10606 N N2  . SGN J  3 .   ? 9.105  50.299 4.189   1.00 140.04 ? 2    SGN J N2  1 
HETATM 10607 O O3  . SGN J  3 .   ? 8.885  51.729 6.707   1.00 141.15 ? 2    SGN J O3  1 
HETATM 10608 O O4  . SGN J  3 .   ? 11.237 52.269 7.983   1.00 142.21 ? 2    SGN J O4  1 
HETATM 10609 O O5  . SGN J  3 .   ? 12.251 49.370 5.936   1.00 142.41 ? 2    SGN J O5  1 
HETATM 10610 O O6  . SGN J  3 .   ? 14.359 49.087 7.410   1.00 143.27 ? 2    SGN J O6  1 
HETATM 10611 S S1  . SGN J  3 .   ? 7.535  49.819 4.223   1.00 139.15 ? 2    SGN J S1  1 
HETATM 10612 O O1S . SGN J  3 .   ? 7.312  49.024 5.399   1.00 138.84 ? 2    SGN J O1S 1 
HETATM 10613 O O2S . SGN J  3 .   ? 6.762  51.026 4.206   1.00 139.11 ? 2    SGN J O2S 1 
HETATM 10614 O O3S . SGN J  3 .   ? 7.365  49.053 3.023   1.00 138.97 ? 2    SGN J O3S 1 
HETATM 10615 S S2  . SGN J  3 .   ? 14.853 47.767 8.106   1.00 143.65 ? 2    SGN J S2  1 
HETATM 10616 O O4S . SGN J  3 .   ? 13.794 46.803 7.991   1.00 143.38 ? 2    SGN J O4S 1 
HETATM 10617 O O5S . SGN J  3 .   ? 16.036 47.390 7.379   1.00 143.28 ? 2    SGN J O5S 1 
HETATM 10618 O O6S . SGN J  3 .   ? 15.148 48.114 9.468   1.00 143.54 ? 2    SGN J O6S 1 
HETATM 10619 C C1  . IDS J  3 .   ? 10.839 52.494 9.328   1.00 141.74 ? 3    IDS J C1  1 
HETATM 10620 C C2  . IDS J  3 .   ? 11.945 53.334 10.061  1.00 141.42 ? 3    IDS J C2  1 
HETATM 10621 C C3  . IDS J  3 .   ? 11.798 54.888 9.974   1.00 140.67 ? 3    IDS J C3  1 
HETATM 10622 C C4  . IDS J  3 .   ? 10.330 55.400 9.897   1.00 139.92 ? 3    IDS J C4  1 
HETATM 10623 C C5  . IDS J  3 .   ? 9.500  54.505 8.942   1.00 140.47 ? 3    IDS J C5  1 
HETATM 10624 C C6  . IDS J  3 .   ? 8.027  54.931 8.775   1.00 140.00 ? 3    IDS J C6  1 
HETATM 10625 O O2  . IDS J  3 .   ? 11.965 52.953 11.441  1.00 142.33 ? 3    IDS J O2  1 
HETATM 10626 O O3  . IDS J  3 .   ? 12.484 55.353 8.823   1.00 139.93 ? 3    IDS J O3  1 
HETATM 10627 O O4  . IDS J  3 .   ? 9.531  55.578 11.067  1.00 138.23 ? 3    IDS J O4  1 
HETATM 10628 O O5  . IDS J  3 .   ? 9.562  53.143 9.415   1.00 141.24 ? 3    IDS J O5  1 
HETATM 10629 O O6A . IDS J  3 .   ? 7.110  54.165 8.994   1.00 139.76 ? 3    IDS J O6A 1 
HETATM 10630 O O6B . IDS J  3 .   ? 7.745  56.056 8.416   1.00 139.51 ? 3    IDS J O6B 1 
HETATM 10631 S S   . IDS J  3 .   ? 12.918 51.920 12.169  1.00 142.87 ? 3    IDS J S   1 
HETATM 10632 O O1S . IDS J  3 .   ? 12.607 51.992 13.569  1.00 142.76 ? 3    IDS J O1S 1 
HETATM 10633 O O2S . IDS J  3 .   ? 12.594 50.642 11.599  1.00 142.95 ? 3    IDS J O2S 1 
HETATM 10634 O O3S . IDS J  3 .   ? 14.268 52.319 11.879  1.00 142.50 ? 3    IDS J O3S 1 
HETATM 10635 C C1  . SGN J  3 .   ? 9.752  56.722 11.864  1.00 137.71 ? 4    SGN J C1  1 
HETATM 10636 C C2  . SGN J  3 .   ? 9.492  56.383 13.350  1.00 137.46 ? 4    SGN J C2  1 
HETATM 10637 C C3  . SGN J  3 .   ? 8.002  56.049 13.551  1.00 137.19 ? 4    SGN J C3  1 
HETATM 10638 C C4  . SGN J  3 .   ? 7.185  57.302 13.162  1.00 137.16 ? 4    SGN J C4  1 
HETATM 10639 C C5  . SGN J  3 .   ? 7.481  57.627 11.666  1.00 136.44 ? 4    SGN J C5  1 
HETATM 10640 C C6  . SGN J  3 .   ? 6.777  58.882 11.128  1.00 135.48 ? 4    SGN J C6  1 
HETATM 10641 N N2  . SGN J  3 .   ? 10.354 55.261 13.714  1.00 137.76 ? 4    SGN J N2  1 
HETATM 10642 O O3  . SGN J  3 .   ? 7.766  55.740 14.912  1.00 137.23 ? 4    SGN J O3  1 
HETATM 10643 O O4  . SGN J  3 .   ? 5.892  56.769 13.461  1.00 138.82 ? 4    SGN J O4  1 
HETATM 10644 O O5  . SGN J  3 .   ? 8.908  57.806 11.449  1.00 136.94 ? 4    SGN J O5  1 
HETATM 10645 O O6  . SGN J  3 .   ? 7.108  59.985 11.953  1.00 134.32 ? 4    SGN J O6  1 
HETATM 10646 S S1  . SGN J  3 .   ? 11.638 55.554 14.681  1.00 138.10 ? 4    SGN J S1  1 
HETATM 10647 O O1S . SGN J  3 .   ? 11.255 56.535 15.644  1.00 138.11 ? 4    SGN J O1S 1 
HETATM 10648 O O2S . SGN J  3 .   ? 11.980 54.292 15.274  1.00 137.98 ? 4    SGN J O2S 1 
HETATM 10649 O O3S . SGN J  3 .   ? 12.664 56.045 13.796  1.00 137.73 ? 4    SGN J O3S 1 
HETATM 10650 S S2  . SGN J  3 .   ? 6.733  61.493 11.740  1.00 134.13 ? 4    SGN J S2  1 
HETATM 10651 O O4S . SGN J  3 .   ? 7.472  62.253 12.694  1.00 134.17 ? 4    SGN J O4S 1 
HETATM 10652 O O5S . SGN J  3 .   ? 7.120  61.779 10.388  1.00 134.37 ? 4    SGN J O5S 1 
HETATM 10653 O O6S . SGN J  3 .   ? 5.319  61.592 11.936  1.00 134.30 ? 4    SGN J O6S 1 
HETATM 10654 C C1  . IDS J  3 .   ? 4.900  57.661 13.907  1.00 139.87 ? 5    IDS J C1  1 
HETATM 10655 C C2  . IDS J  3 .   ? 3.497  56.988 13.758  1.00 140.55 ? 5    IDS J C2  1 
HETATM 10656 C C3  . IDS J  3 .   ? 3.125  56.016 14.917  1.00 140.86 ? 5    IDS J C3  1 
HETATM 10657 C C4  . IDS J  3 .   ? 3.525  56.565 16.320  1.00 141.83 ? 5    IDS J C4  1 
HETATM 10658 C C5  . IDS J  3 .   ? 4.992  57.088 16.284  1.00 140.65 ? 5    IDS J C5  1 
HETATM 10659 C C6  . IDS J  3 .   ? 5.511  57.659 17.612  1.00 140.44 ? 5    IDS J C6  1 
HETATM 10660 O O2  . IDS J  3 .   ? 2.517  58.018 13.714  1.00 140.75 ? 5    IDS J O2  1 
HETATM 10661 O O3  . IDS J  3 .   ? 3.783  54.777 14.716  1.00 141.15 ? 5    IDS J O3  1 
HETATM 10662 O O4  . IDS J  3 .   ? 2.519  57.574 16.496  1.00 144.33 ? 5    IDS J O4  1 
HETATM 10663 O O5  . IDS J  3 .   ? 5.117  58.091 15.257  1.00 140.26 ? 5    IDS J O5  1 
HETATM 10664 O O6A . IDS J  3 .   ? 5.792  58.834 17.737  1.00 139.68 ? 5    IDS J O6A 1 
HETATM 10665 O O6B . IDS J  3 .   ? 5.656  56.946 18.580  1.00 140.46 ? 5    IDS J O6B 1 
HETATM 10666 S S   . IDS J  3 .   ? 1.585  58.454 12.530  1.00 140.75 ? 5    IDS J S   1 
HETATM 10667 O O1S . IDS J  3 .   ? 0.677  57.365 12.300  1.00 140.77 ? 5    IDS J O1S 1 
HETATM 10668 O O2S . IDS J  3 .   ? 0.925  59.646 12.993  1.00 140.54 ? 5    IDS J O2S 1 
HETATM 10669 O O3S . IDS J  3 .   ? 2.445  58.708 11.415  1.00 140.73 ? 5    IDS J O3S 1 
HETATM 10670 C C1  . SGN J  3 .   ? 1.516  57.365 17.471  1.00 144.46 ? 6    SGN J C1  1 
HETATM 10671 C C2  . SGN J  3 .   ? 0.298  58.312 17.235  1.00 144.75 ? 6    SGN J C2  1 
HETATM 10672 C C3  . SGN J  3 .   ? 0.731  59.775 17.469  1.00 144.52 ? 6    SGN J C3  1 
HETATM 10673 C C4  . SGN J  3 .   ? 1.235  59.903 18.928  1.00 144.67 ? 6    SGN J C4  1 
HETATM 10674 C C5  . SGN J  3 .   ? 2.450  58.927 19.111  1.00 145.16 ? 6    SGN J C5  1 
HETATM 10675 C C6  . SGN J  3 .   ? 3.070  58.901 20.522  1.00 145.67 ? 6    SGN J C6  1 
HETATM 10676 N N2  . SGN J  3 .   ? -0.205 58.111 15.859  1.00 145.30 ? 6    SGN J N2  1 
HETATM 10677 O O3  . SGN J  3 .   ? -0.379 60.640 17.270  1.00 143.75 ? 6    SGN J O3  1 
HETATM 10678 O O4  . SGN J  3 .   ? 1.371  61.317 19.076  1.00 144.59 ? 6    SGN J O4  1 
HETATM 10679 O O5  . SGN J  3 .   ? 2.067  57.559 18.781  1.00 144.85 ? 6    SGN J O5  1 
HETATM 10680 O O6  . SGN J  3 .   ? 2.103  58.525 21.477  1.00 146.46 ? 6    SGN J O6  1 
HETATM 10681 S S1  . SGN J  3 .   ? -1.445 57.074 15.543  1.00 145.45 ? 6    SGN J S1  1 
HETATM 10682 O O1S . SGN J  3 .   ? -2.189 56.854 16.748  1.00 145.60 ? 6    SGN J O1S 1 
HETATM 10683 O O2S . SGN J  3 .   ? -2.220 57.706 14.513  1.00 145.61 ? 6    SGN J O2S 1 
HETATM 10684 O O3S . SGN J  3 .   ? -0.809 55.868 15.083  1.00 145.25 ? 6    SGN J O3S 1 
HETATM 10685 S S2  . SGN J  3 .   ? 2.368  57.965 22.913  1.00 146.86 ? 6    SGN J S2  1 
HETATM 10686 O O4S . SGN J  3 .   ? 1.090  57.753 23.526  1.00 147.11 ? 6    SGN J O4S 1 
HETATM 10687 O O5S . SGN J  3 .   ? 3.090  56.742 22.691  1.00 146.76 ? 6    SGN J O5S 1 
HETATM 10688 O O6S . SGN J  3 .   ? 3.158  58.954 23.592  1.00 146.64 ? 6    SGN J O6S 1 
HETATM 10689 C C1  . IDS J  3 .   ? 1.140  61.849 20.346  1.00 144.78 ? 7    IDS J C1  1 
HETATM 10690 C C2  . IDS J  3 .   ? 1.870  63.216 20.436  1.00 144.87 ? 7    IDS J C2  1 
HETATM 10691 C C3  . IDS J  3 .   ? 1.159  64.116 21.466  1.00 144.74 ? 7    IDS J C3  1 
HETATM 10692 C C4  . IDS J  3 .   ? -0.322 64.369 21.059  1.00 144.59 ? 7    IDS J C4  1 
HETATM 10693 C C5  . IDS J  3 .   ? -0.882 63.193 20.193  1.00 144.81 ? 7    IDS J C5  1 
HETATM 10694 C C6  . IDS J  3 .   ? -2.390 63.033 20.259  1.00 145.10 ? 7    IDS J C6  1 
HETATM 10695 O O2  . IDS J  3 .   ? 3.213  63.002 20.855  1.00 145.30 ? 7    IDS J O2  1 
HETATM 10696 O O3  . IDS J  3 .   ? 1.823  65.359 21.544  1.00 144.48 ? 7    IDS J O3  1 
HETATM 10697 O O5  . IDS J  3 .   ? -0.261 61.968 20.605  1.00 144.74 ? 7    IDS J O5  1 
HETATM 10698 O O6A . IDS J  3 .   ? -3.107 63.694 19.546  1.00 145.79 ? 7    IDS J O6A 1 
HETATM 10699 O O6B . IDS J  3 .   ? -2.913 62.242 21.014  1.00 145.22 ? 7    IDS J O6B 1 
HETATM 10700 S S   . IDS J  3 .   ? 4.539  63.135 20.027  1.00 145.56 ? 7    IDS J S   1 
HETATM 10701 O O1S . IDS J  3 .   ? 5.574  63.351 20.998  1.00 145.67 ? 7    IDS J O1S 1 
HETATM 10702 O O2S . IDS J  3 .   ? 4.381  64.231 19.110  1.00 145.21 ? 7    IDS J O2S 1 
HETATM 10703 O O3S . IDS J  3 .   ? 4.670  61.870 19.351  1.00 145.43 ? 7    IDS J O3S 1 
HETATM 10704 C C1  . IDS K  4 .   ? 40.538 26.144 -27.910 1.00 115.11 ? 1    IDS K C1  1 
HETATM 10705 C C2  . IDS K  4 .   ? 41.426 24.876 -28.035 1.00 115.40 ? 1    IDS K C2  1 
HETATM 10706 C C3  . IDS K  4 .   ? 41.084 23.860 -26.902 1.00 114.86 ? 1    IDS K C3  1 
HETATM 10707 C C4  . IDS K  4 .   ? 41.234 24.480 -25.467 1.00 112.20 ? 1    IDS K C4  1 
HETATM 10708 C C5  . IDS K  4 .   ? 40.730 25.983 -25.473 1.00 113.50 ? 1    IDS K C5  1 
HETATM 10709 C C6  . IDS K  4 .   ? 39.962 26.436 -24.219 1.00 113.29 ? 1    IDS K C6  1 
HETATM 10710 O O1  . IDS K  4 .   ? 41.381 27.246 -28.093 1.00 114.74 ? 1    IDS K O1  1 
HETATM 10711 O O2  . IDS K  4 .   ? 41.249 24.227 -29.353 1.00 117.34 ? 1    IDS K O2  1 
HETATM 10712 O O3  . IDS K  4 .   ? 41.931 22.731 -27.013 1.00 115.23 ? 1    IDS K O3  1 
HETATM 10713 O O4  . IDS K  4 .   ? 40.809 23.788 -24.263 1.00 106.55 ? 1    IDS K O4  1 
HETATM 10714 O O5  . IDS K  4 .   ? 39.891 26.208 -26.634 1.00 114.05 ? 1    IDS K O5  1 
HETATM 10715 O O6A . IDS K  4 .   ? 40.319 26.106 -23.111 1.00 112.65 ? 1    IDS K O6A 1 
HETATM 10716 O O6B . IDS K  4 .   ? 38.981 27.143 -24.299 1.00 113.62 ? 1    IDS K O6B 1 
HETATM 10717 S S   . IDS K  4 .   ? 40.065 24.197 -30.456 1.00 118.23 ? 1    IDS K S   1 
HETATM 10718 O O1S . IDS K  4 .   ? 40.445 23.148 -31.372 1.00 117.57 ? 1    IDS K O1S 1 
HETATM 10719 O O2S . IDS K  4 .   ? 38.832 23.883 -29.803 1.00 118.59 ? 1    IDS K O2S 1 
HETATM 10720 O O3S . IDS K  4 .   ? 40.056 25.486 -31.087 1.00 117.95 ? 1    IDS K O3S 1 
HETATM 10721 C C1  . SGN K  4 .   ? 41.661 22.822 -23.661 1.00 104.81 ? 2    SGN K C1  1 
HETATM 10722 C C2  . SGN K  4 .   ? 40.891 21.498 -23.372 1.00 103.68 ? 2    SGN K C2  1 
HETATM 10723 C C3  . SGN K  4 .   ? 39.808 21.737 -22.289 1.00 102.82 ? 2    SGN K C3  1 
HETATM 10724 C C4  . SGN K  4 .   ? 40.535 22.181 -21.002 1.00 101.00 ? 2    SGN K C4  1 
HETATM 10725 C C5  . SGN K  4 .   ? 41.328 23.490 -21.296 1.00 103.22 ? 2    SGN K C5  1 
HETATM 10726 C C6  . SGN K  4 .   ? 42.171 24.006 -20.102 1.00 103.12 ? 2    SGN K C6  1 
HETATM 10727 N N2  . SGN K  4 .   ? 40.315 21.025 -24.621 1.00 104.55 ? 2    SGN K N2  1 
HETATM 10728 O O3  . SGN K  4 .   ? 39.109 20.534 -22.022 1.00 101.08 ? 2    SGN K O3  1 
HETATM 10729 O O4  . SGN K  4 .   ? 39.463 22.457 -20.090 1.00 95.21  ? 2    SGN K O4  1 
HETATM 10730 O O5  . SGN K  4 .   ? 42.230 23.308 -22.430 1.00 103.94 ? 2    SGN K O5  1 
HETATM 10731 O O6  . SGN K  4 .   ? 42.801 22.868 -19.500 1.00 103.87 ? 2    SGN K O6  1 
HETATM 10732 S S1  . SGN K  4 .   ? 40.747 19.522 -25.111 1.00 104.88 ? 2    SGN K S1  1 
HETATM 10733 O O1S . SGN K  4 .   ? 42.181 19.459 -25.171 1.00 104.61 ? 2    SGN K O1S 1 
HETATM 10734 O O2S . SGN K  4 .   ? 40.194 18.609 -24.149 1.00 105.70 ? 2    SGN K O2S 1 
HETATM 10735 O O3S . SGN K  4 .   ? 40.141 19.378 -26.405 1.00 105.88 ? 2    SGN K O3S 1 
HETATM 10736 S S2  . SGN K  4 .   ? 44.005 22.787 -18.483 1.00 104.65 ? 2    SGN K S2  1 
HETATM 10737 O O4S . SGN K  4 .   ? 43.494 23.093 -17.179 1.00 103.96 ? 2    SGN K O4S 1 
HETATM 10738 O O5S . SGN K  4 .   ? 44.480 21.425 -18.584 1.00 103.45 ? 2    SGN K O5S 1 
HETATM 10739 O O6S . SGN K  4 .   ? 44.981 23.744 -18.932 1.00 104.93 ? 2    SGN K O6S 1 
HETATM 10740 C C1  . IDS K  4 .   ? 39.514 21.845 -18.824 1.00 93.11  ? 3    IDS K C1  1 
HETATM 10741 C C2  . IDS K  4 .   ? 38.793 22.756 -17.792 1.00 91.97  ? 3    IDS K C2  1 
HETATM 10742 C C3  . IDS K  4 .   ? 37.248 22.631 -17.794 1.00 90.71  ? 3    IDS K C3  1 
HETATM 10743 C C4  . IDS K  4 .   ? 36.780 21.162 -17.883 1.00 88.25  ? 3    IDS K C4  1 
HETATM 10744 C C5  . IDS K  4 .   ? 37.515 20.455 -19.045 1.00 90.53  ? 3    IDS K C5  1 
HETATM 10745 C C6  . IDS K  4 .   ? 37.110 18.993 -19.230 1.00 90.13  ? 3    IDS K C6  1 
HETATM 10746 O O2  . IDS K  4 .   ? 39.261 22.409 -16.502 1.00 92.29  ? 3    IDS K O2  1 
HETATM 10747 O O3  . IDS K  4 .   ? 36.727 23.331 -18.911 1.00 90.13  ? 3    IDS K O3  1 
HETATM 10748 O O4  . IDS K  4 .   ? 36.996 20.523 -16.618 1.00 82.20  ? 3    IDS K O4  1 
HETATM 10749 O O5  . IDS K  4 .   ? 38.938 20.534 -18.822 1.00 91.31  ? 3    IDS K O5  1 
HETATM 10750 O O6A . IDS K  4 .   ? 37.822 18.083 -18.855 1.00 89.29  ? 3    IDS K O6A 1 
HETATM 10751 O O6B . IDS K  4 .   ? 36.049 18.709 -19.752 1.00 90.33  ? 3    IDS K O6B 1 
HETATM 10752 S S   . IDS K  4 .   ? 39.758 23.360 -15.363 1.00 92.22  ? 3    IDS K S   1 
HETATM 10753 O O1S . IDS K  4 .   ? 38.631 24.168 -14.976 1.00 92.63  ? 3    IDS K O1S 1 
HETATM 10754 O O2S . IDS K  4 .   ? 40.214 22.464 -14.327 1.00 91.72  ? 3    IDS K O2S 1 
HETATM 10755 O O3S . IDS K  4 .   ? 40.820 24.147 -15.916 1.00 92.48  ? 3    IDS K O3S 1 
HETATM 10756 C C1  . SGN K  4 .   ? 35.855 20.271 -15.839 1.00 79.94  ? 4    SGN K C1  1 
HETATM 10757 C C2  . SGN K  4 .   ? 36.160 20.139 -14.332 1.00 77.89  ? 4    SGN K C2  1 
HETATM 10758 C C3  . SGN K  4 .   ? 36.885 18.825 -14.044 1.00 79.67  ? 4    SGN K C3  1 
HETATM 10759 C C4  . SGN K  4 .   ? 36.004 17.649 -14.513 1.00 82.09  ? 4    SGN K C4  1 
HETATM 10760 C C5  . SGN K  4 .   ? 35.778 17.825 -16.045 1.00 79.93  ? 4    SGN K C5  1 
HETATM 10761 C C6  . SGN K  4 .   ? 34.907 16.743 -16.713 1.00 79.84  ? 4    SGN K C6  1 
HETATM 10762 N N2  . SGN K  4 .   ? 36.952 21.310 -13.919 1.00 74.02  ? 4    SGN K N2  1 
HETATM 10763 O O3  . SGN K  4 .   ? 37.119 18.722 -12.650 1.00 80.83  ? 4    SGN K O3  1 
HETATM 10764 O O4  . SGN K  4 .   ? 36.764 16.505 -14.145 1.00 89.24  ? 4    SGN K O4  1 
HETATM 10765 O O5  . SGN K  4 .   ? 35.159 19.113 -16.324 1.00 80.16  ? 4    SGN K O5  1 
HETATM 10766 O O6  . SGN K  4 .   ? 33.575 16.812 -16.275 1.00 79.60  ? 4    SGN K O6  1 
HETATM 10767 S S1  . SGN K  4 .   ? 36.385 22.390 -12.849 1.00 70.34  ? 4    SGN K S1  1 
HETATM 10768 O O1S . SGN K  4 .   ? 35.494 23.278 -13.529 1.00 70.29  ? 4    SGN K O1S 1 
HETATM 10769 O O2S . SGN K  4 .   ? 35.765 21.596 -11.835 1.00 71.68  ? 4    SGN K O2S 1 
HETATM 10770 O O3S . SGN K  4 .   ? 37.541 23.101 -12.371 1.00 70.20  ? 4    SGN K O3S 1 
HETATM 10771 S S2  . SGN K  4 .   ? 32.350 16.119 -16.951 1.00 78.90  ? 4    SGN K S2  1 
HETATM 10772 O O4S . SGN K  4 .   ? 32.705 14.752 -17.195 1.00 78.98  ? 4    SGN K O4S 1 
HETATM 10773 O O5S . SGN K  4 .   ? 31.293 16.243 -16.007 1.00 79.70  ? 4    SGN K O5S 1 
HETATM 10774 O O6S . SGN K  4 .   ? 32.098 16.873 -18.140 1.00 79.36  ? 4    SGN K O6S 1 
HETATM 10775 C C1  . IDS K  4 .   ? 36.051 15.348 -13.832 1.00 93.60  ? 5    IDS K C1  1 
HETATM 10776 C C2  . IDS K  4 .   ? 36.933 14.109 -14.123 1.00 96.43  ? 5    IDS K C2  1 
HETATM 10777 C C3  . IDS K  4 .   ? 37.927 13.747 -12.995 1.00 96.74  ? 5    IDS K C3  1 
HETATM 10778 C C4  . IDS K  4 .   ? 37.322 13.907 -11.573 1.00 98.23  ? 5    IDS K C4  1 
HETATM 10779 C C5  . IDS K  4 .   ? 36.607 15.283 -11.481 1.00 96.66  ? 5    IDS K C5  1 
HETATM 10780 C C6  . IDS K  4 .   ? 35.965 15.616 -10.136 1.00 97.07  ? 5    IDS K C6  1 
HETATM 10781 O O2  . IDS K  4 .   ? 36.074 13.010 -14.341 1.00 99.38  ? 5    IDS K O2  1 
HETATM 10782 O O3  . IDS K  4 .   ? 39.041 14.607 -13.099 1.00 96.50  ? 5    IDS K O3  1 
HETATM 10783 O O4  . IDS K  4 .   ? 36.710 12.609 -11.490 1.00 102.41 ? 5    IDS K O4  1 
HETATM 10784 O O5  . IDS K  4 .   ? 35.597 15.346 -12.488 1.00 95.44  ? 5    IDS K O5  1 
HETATM 10785 O O6A . IDS K  4 .   ? 34.995 16.343 -10.068 1.00 96.41  ? 5    IDS K O6A 1 
HETATM 10786 O O6B . IDS K  4 .   ? 36.413 15.176 -9.101  1.00 97.45  ? 5    IDS K O6B 1 
HETATM 10787 S S   . IDS K  4 .   ? 35.627 12.389 -15.707 1.00 101.89 ? 5    IDS K S   1 
HETATM 10788 O O1S . IDS K  4 .   ? 36.609 11.388 -16.014 1.00 101.76 ? 5    IDS K O1S 1 
HETATM 10789 O O2S . IDS K  4 .   ? 34.316 11.838 -15.467 1.00 102.28 ? 5    IDS K O2S 1 
HETATM 10790 O O3S . IDS K  4 .   ? 35.594 13.459 -16.668 1.00 101.66 ? 5    IDS K O3S 1 
HETATM 10791 C C1  . SGN K  4 .   ? 37.091 11.764 -10.416 1.00 103.85 ? 6    SGN K C1  1 
HETATM 10792 C C2  . SGN K  4 .   ? 36.668 10.283 -10.657 1.00 105.24 ? 6    SGN K C2  1 
HETATM 10793 C C3  . SGN K  4 .   ? 35.132 10.165 -10.616 1.00 104.98 ? 6    SGN K C3  1 
HETATM 10794 C C4  . SGN K  4 .   ? 34.642 10.632 -9.221  1.00 105.45 ? 6    SGN K C4  1 
HETATM 10795 C C5  . SGN K  4 .   ? 35.099 12.120 -9.024  1.00 103.77 ? 6    SGN K C5  1 
HETATM 10796 C C6  . SGN K  4 .   ? 34.736 12.747 -7.663  1.00 102.21 ? 6    SGN K C6  1 
HETATM 10797 N N2  . SGN K  4 .   ? 37.218 9.840  -11.952 1.00 106.47 ? 6    SGN K N2  1 
HETATM 10798 O O3  . SGN K  4 .   ? 34.760 8.814  -10.825 1.00 104.70 ? 6    SGN K O3  1 
HETATM 10799 O O4  . SGN K  4 .   ? 33.253 10.264 -9.386  1.00 109.19 ? 6    SGN K O4  1 
HETATM 10800 O O5  . SGN K  4 .   ? 36.540 12.248 -9.181  1.00 103.91 ? 6    SGN K O5  1 
HETATM 10801 O O6  . SGN K  4 .   ? 35.321 12.021 -6.601  1.00 100.11 ? 6    SGN K O6  1 
HETATM 10802 S S1  . SGN K  4 .   ? 38.619 8.984  -12.000 1.00 107.35 ? 6    SGN K S1  1 
HETATM 10803 O O1S . SGN K  4 .   ? 39.681 9.840  -11.562 1.00 106.29 ? 6    SGN K O1S 1 
HETATM 10804 O O2S . SGN K  4 .   ? 38.418 7.837  -11.146 1.00 107.44 ? 6    SGN K O2S 1 
HETATM 10805 O O3S . SGN K  4 .   ? 38.768 8.613  -13.380 1.00 107.90 ? 6    SGN K O3S 1 
HETATM 10806 S S2  . SGN K  4 .   ? 35.097 12.248 -5.065  1.00 98.26  ? 6    SGN K S2  1 
HETATM 10807 O O4S . SGN K  4 .   ? 33.699 12.061 -4.797  1.00 98.17  ? 6    SGN K O4S 1 
HETATM 10808 O O5S . SGN K  4 .   ? 35.920 11.259 -4.432  1.00 98.02  ? 6    SGN K O5S 1 
HETATM 10809 O O6S . SGN K  4 .   ? 35.545 13.578 -4.799  1.00 97.72  ? 6    SGN K O6S 1 
HETATM 10810 C C1  . IDS K  4 .   ? 32.395 10.371 -8.278  1.00 110.25 ? 7    IDS K C1  1 
HETATM 10811 C C2  . IDS K  4 .   ? 30.942 10.013 -8.704  1.00 110.88 ? 7    IDS K C2  1 
HETATM 10812 C C3  . IDS K  4 .   ? 30.239 9.201  -7.576  1.00 112.14 ? 7    IDS K C3  1 
HETATM 10813 C C4  . IDS K  4 .   ? 31.027 7.886  -7.233  1.00 115.60 ? 7    IDS K C4  1 
HETATM 10814 C C5  . IDS K  4 .   ? 32.586 8.148  -7.386  1.00 113.60 ? 7    IDS K C5  1 
HETATM 10815 C C6  . IDS K  4 .   ? 33.559 7.390  -6.463  1.00 114.42 ? 7    IDS K C6  1 
HETATM 10816 O O2  . IDS K  4 .   ? 30.188 11.219 -8.961  1.00 108.63 ? 7    IDS K O2  1 
HETATM 10817 O O3  . IDS K  4 .   ? 28.919 8.863  -7.978  1.00 112.27 ? 7    IDS K O3  1 
HETATM 10818 O O4  . IDS K  4 .   ? 30.877 6.519  -6.800  1.00 123.14 ? 7    IDS K O4  1 
HETATM 10819 O O5  . IDS K  4 .   ? 32.834 9.545  -7.220  1.00 112.59 ? 7    IDS K O5  1 
HETATM 10820 O O6A . IDS K  4 .   ? 33.196 6.901  -5.419  1.00 114.07 ? 7    IDS K O6A 1 
HETATM 10821 O O6B . IDS K  4 .   ? 34.735 7.283  -6.748  1.00 115.06 ? 7    IDS K O6B 1 
HETATM 10822 S S   . IDS K  4 .   ? 30.366 12.699 -8.420  1.00 106.90 ? 7    IDS K S   1 
HETATM 10823 O O1S . IDS K  4 .   ? 29.124 13.332 -8.726  1.00 107.78 ? 7    IDS K O1S 1 
HETATM 10824 O O2S . IDS K  4 .   ? 30.592 12.641 -7.008  1.00 108.15 ? 7    IDS K O2S 1 
HETATM 10825 O O3S . IDS K  4 .   ? 31.459 13.271 -9.148  1.00 106.81 ? 7    IDS K O3S 1 
HETATM 10826 C C1  . SGN K  4 .   ? 29.738 6.127  -6.036  1.00 124.63 ? 8    SGN K C1  1 
HETATM 10827 C C2  . SGN K  4 .   ? 30.024 6.150  -4.493  1.00 125.99 ? 8    SGN K C2  1 
HETATM 10828 C C3  . SGN K  4 .   ? 31.094 5.085  -4.156  1.00 125.99 ? 8    SGN K C3  1 
HETATM 10829 C C4  . SGN K  4 .   ? 30.548 3.705  -4.571  1.00 126.46 ? 8    SGN K C4  1 
HETATM 10830 C C5  . SGN K  4 .   ? 30.258 3.722  -6.101  1.00 126.65 ? 8    SGN K C5  1 
HETATM 10831 C C6  . SGN K  4 .   ? 29.672 2.393  -6.613  1.00 127.71 ? 8    SGN K C6  1 
HETATM 10832 N N2  . SGN K  4 .   ? 30.465 7.500  -4.101  1.00 126.90 ? 8    SGN K N2  1 
HETATM 10833 O O3  . SGN K  4 .   ? 31.355 5.083  -2.763  1.00 125.15 ? 8    SGN K O3  1 
HETATM 10834 O O5  . SGN K  4 .   ? 29.324 4.803  -6.427  1.00 125.92 ? 8    SGN K O5  1 
HETATM 10835 O O6  . SGN K  4 .   ? 28.914 2.602  -7.793  1.00 129.09 ? 8    SGN K O6  1 
HETATM 10836 S S1  . SGN K  4 .   ? 29.539 8.378  -3.058  1.00 127.88 ? 8    SGN K S1  1 
HETATM 10837 O O1S . SGN K  4 .   ? 30.440 9.364  -2.524  1.00 127.66 ? 8    SGN K O1S 1 
HETATM 10838 O O2S . SGN K  4 .   ? 28.468 8.979  -3.801  1.00 127.72 ? 8    SGN K O2S 1 
HETATM 10839 O O3S . SGN K  4 .   ? 29.069 7.459  -2.050  1.00 127.69 ? 8    SGN K O3S 1 
HETATM 10840 S S2  . SGN K  4 .   ? 27.781 1.676  -8.361  1.00 129.89 ? 8    SGN K S2  1 
HETATM 10841 O O4S . SGN K  4 .   ? 27.767 1.880  -9.781  1.00 129.22 ? 8    SGN K O4S 1 
HETATM 10842 O O5S . SGN K  4 .   ? 26.579 2.151  -7.726  1.00 129.55 ? 8    SGN K O5S 1 
HETATM 10843 O O6S . SGN K  4 .   ? 28.106 0.324  -8.000  1.00 129.68 ? 8    SGN K O6S 1 
HETATM 10844 C C1  . SGN L  5 .   ? 63.797 40.657 0.588   1.00 113.95 ? 1    SGN L C1  1 
HETATM 10845 C C2  . SGN L  5 .   ? 64.175 39.382 1.391   1.00 115.13 ? 1    SGN L C2  1 
HETATM 10846 C C3  . SGN L  5 .   ? 65.020 39.760 2.629   1.00 113.72 ? 1    SGN L C3  1 
HETATM 10847 C C4  . SGN L  5 .   ? 66.305 40.458 2.133   1.00 110.99 ? 1    SGN L C4  1 
HETATM 10848 C C5  . SGN L  5 .   ? 65.893 41.738 1.329   1.00 111.80 ? 1    SGN L C5  1 
HETATM 10849 C C6  . SGN L  5 .   ? 67.049 42.573 0.698   1.00 110.03 ? 1    SGN L C6  1 
HETATM 10850 N N2  . SGN L  5 .   ? 62.923 38.687 1.753   1.00 119.55 ? 1    SGN L N2  1 
HETATM 10851 O O1  . SGN L  5 .   ? 62.883 41.477 1.279   1.00 112.85 ? 1    SGN L O1  1 
HETATM 10852 O O3  . SGN L  5 .   ? 65.377 38.587 3.349   1.00 112.67 ? 1    SGN L O3  1 
HETATM 10853 O O4  . SGN L  5 .   ? 66.462 40.964 3.464   1.00 107.09 ? 1    SGN L O4  1 
HETATM 10854 O O5  . SGN L  5 .   ? 64.975 41.400 0.243   1.00 113.01 ? 1    SGN L O5  1 
HETATM 10855 O O6  . SGN L  5 .   ? 68.324 41.956 0.858   1.00 107.78 ? 1    SGN L O6  1 
HETATM 10856 S S1  . SGN L  5 .   ? 62.747 37.080 1.438   1.00 122.69 ? 1    SGN L S1  1 
HETATM 10857 O O1S . SGN L  5 .   ? 63.922 36.612 0.736   1.00 121.87 ? 1    SGN L O1S 1 
HETATM 10858 O O2S . SGN L  5 .   ? 62.562 36.452 2.726   1.00 121.73 ? 1    SGN L O2S 1 
HETATM 10859 O O3S . SGN L  5 .   ? 61.564 37.001 0.613   1.00 122.15 ? 1    SGN L O3S 1 
HETATM 10860 S S2  . SGN L  5 .   ? 69.728 42.552 0.451   1.00 106.03 ? 1    SGN L S2  1 
HETATM 10861 O O4S . SGN L  5 .   ? 70.716 41.544 0.704   1.00 105.32 ? 1    SGN L O4S 1 
HETATM 10862 O O5S . SGN L  5 .   ? 69.596 42.865 -0.934  1.00 105.96 ? 1    SGN L O5S 1 
HETATM 10863 O O6S . SGN L  5 .   ? 69.918 43.729 1.237   1.00 105.79 ? 1    SGN L O6S 1 
HETATM 10864 C C1  . IDS L  5 .   ? 67.756 40.958 3.999   1.00 106.84 ? 2    IDS L C1  1 
HETATM 10865 C C2  . IDS L  5 .   ? 67.901 42.160 4.980   1.00 106.05 ? 2    IDS L C2  1 
HETATM 10866 C C3  . IDS L  5 .   ? 69.247 42.031 5.719   1.00 105.48 ? 2    IDS L C3  1 
HETATM 10867 C C4  . IDS L  5 .   ? 69.318 40.693 6.514   1.00 105.04 ? 2    IDS L C4  1 
HETATM 10868 C C5  . IDS L  5 .   ? 68.162 39.703 6.088   1.00 106.11 ? 2    IDS L C5  1 
HETATM 10869 C C6  . IDS L  5 .   ? 68.304 38.260 6.595   1.00 105.72 ? 2    IDS L C6  1 
HETATM 10870 O O2  . IDS L  5 .   ? 67.893 43.387 4.257   1.00 106.38 ? 2    IDS L O2  1 
HETATM 10871 O O3  . IDS L  5 .   ? 69.403 43.108 6.627   1.00 103.62 ? 2    IDS L O3  1 
HETATM 10872 O O4  . IDS L  5 .   ? 70.581 40.258 7.035   1.00 103.12 ? 2    IDS L O4  1 
HETATM 10873 O O5  . IDS L  5 .   ? 68.044 39.699 4.640   1.00 106.12 ? 2    IDS L O5  1 
HETATM 10874 O O6A . IDS L  5 .   ? 69.004 37.999 7.549   1.00 105.68 ? 2    IDS L O6A 1 
HETATM 10875 O O6B . IDS L  5 .   ? 67.714 37.342 6.066   1.00 105.70 ? 2    IDS L O6B 1 
HETATM 10876 S S   . IDS L  5 .   ? 67.572 44.840 4.765   1.00 106.10 ? 2    IDS L S   1 
HETATM 10877 O O1S . IDS L  5 .   ? 67.065 45.499 3.597   1.00 106.98 ? 2    IDS L O1S 1 
HETATM 10878 O O2S . IDS L  5 .   ? 66.586 44.749 5.800   1.00 106.24 ? 2    IDS L O2S 1 
HETATM 10879 O O3S . IDS L  5 .   ? 68.817 45.393 5.215   1.00 106.11 ? 2    IDS L O3S 1 
HETATM 10880 C C1  . SGN L  5 .   ? 71.200 41.010 8.069   1.00 102.56 ? 3    SGN L C1  1 
HETATM 10881 C C2  . SGN L  5 .   ? 72.490 40.302 8.549   1.00 101.71 ? 3    SGN L C2  1 
HETATM 10882 C C3  . SGN L  5 .   ? 72.124 38.949 9.176   1.00 101.45 ? 3    SGN L C3  1 
HETATM 10883 C C4  . SGN L  5 .   ? 71.234 39.251 10.403  1.00 100.19 ? 3    SGN L C4  1 
HETATM 10884 C C5  . SGN L  5 .   ? 69.955 39.995 9.925   1.00 103.37 ? 3    SGN L C5  1 
HETATM 10885 C C6  . SGN L  5 .   ? 68.974 40.421 11.047  1.00 104.75 ? 3    SGN L C6  1 
HETATM 10886 N N2  . SGN L  5 .   ? 73.377 40.143 7.414   1.00 101.67 ? 3    SGN L N2  1 
HETATM 10887 O O3  . SGN L  5 .   ? 73.296 38.292 9.604   1.00 101.05 ? 3    SGN L O3  1 
HETATM 10888 O O4  . SGN L  5 .   ? 71.167 37.994 11.072  1.00 94.29  ? 3    SGN L O4  1 
HETATM 10889 O O5  . SGN L  5 .   ? 70.305 41.185 9.170   1.00 102.80 ? 3    SGN L O5  1 
HETATM 10890 O O6  . SGN L  5 .   ? 69.436 41.616 11.684  1.00 105.92 ? 3    SGN L O6  1 
HETATM 10891 S S1  . SGN L  5 .   ? 74.888 40.763 7.577   1.00 101.51 ? 3    SGN L S1  1 
HETATM 10892 O O1S . SGN L  5 .   ? 74.928 41.601 8.739   1.00 101.70 ? 3    SGN L O1S 1 
HETATM 10893 O O2S . SGN L  5 .   ? 75.779 39.642 7.682   1.00 101.95 ? 3    SGN L O2S 1 
HETATM 10894 O O3S . SGN L  5 .   ? 75.089 41.516 6.372   1.00 102.22 ? 3    SGN L O3S 1 
HETATM 10895 S S2  . SGN L  5 .   ? 68.571 42.833 12.205  1.00 106.25 ? 3    SGN L S2  1 
HETATM 10896 O O4S . SGN L  5 .   ? 69.459 43.947 12.389  1.00 105.74 ? 3    SGN L O4S 1 
HETATM 10897 O O5S . SGN L  5 .   ? 67.604 43.057 11.164  1.00 105.63 ? 3    SGN L O5S 1 
HETATM 10898 O O6S . SGN L  5 .   ? 67.962 42.400 13.435  1.00 106.23 ? 3    SGN L O6S 1 
HETATM 10899 C C1  . IDS L  5 .   ? 71.790 37.902 12.335  1.00 91.60  ? 4    IDS L C1  1 
HETATM 10900 C C2  . IDS L  5 .   ? 70.841 37.134 13.300  1.00 88.93  ? 4    IDS L C2  1 
HETATM 10901 C C3  . IDS L  5 .   ? 70.900 35.586 13.172  1.00 87.36  ? 4    IDS L C3  1 
HETATM 10902 C C4  . IDS L  5 .   ? 72.328 35.043 12.914  1.00 82.95  ? 4    IDS L C4  1 
HETATM 10903 C C5  . IDS L  5 .   ? 73.029 35.883 11.829  1.00 87.28  ? 4    IDS L C5  1 
HETATM 10904 C C6  . IDS L  5 .   ? 74.443 35.422 11.508  1.00 86.92  ? 4    IDS L C6  1 
HETATM 10905 O O2  . IDS L  5 .   ? 71.150 37.518 14.643  1.00 88.92  ? 4    IDS L O2  1 
HETATM 10906 O O3  . IDS L  5 .   ? 70.079 35.186 12.089  1.00 87.45  ? 4    IDS L O3  1 
HETATM 10907 O O4  . IDS L  5 .   ? 73.252 34.835 13.971  1.00 71.12  ? 4    IDS L O4  1 
HETATM 10908 O O5  . IDS L  5 .   ? 73.061 37.255 12.253  1.00 89.26  ? 4    IDS L O5  1 
HETATM 10909 O O6A . IDS L  5 .   ? 75.404 36.064 11.867  1.00 87.68  ? 4    IDS L O6A 1 
HETATM 10910 O O6B . IDS L  5 .   ? 74.639 34.391 10.897  1.00 86.78  ? 4    IDS L O6B 1 
HETATM 10911 S S   . IDS L  5 .   ? 70.549 38.726 15.468  1.00 89.48  ? 4    IDS L S   1 
HETATM 10912 O O1S . IDS L  5 .   ? 70.935 38.531 16.836  1.00 89.03  ? 4    IDS L O1S 1 
HETATM 10913 O O2S . IDS L  5 .   ? 71.142 39.905 14.904  1.00 89.65  ? 4    IDS L O2S 1 
HETATM 10914 O O3S . IDS L  5 .   ? 69.120 38.687 15.275  1.00 87.98  ? 4    IDS L O3S 1 
HETATM 10915 C C1  . SGN L  5 .   ? 73.186 33.598 14.614  1.00 67.85  ? 5    SGN L C1  1 
HETATM 10916 C C2  . SGN L  5 .   ? 73.493 33.733 16.116  1.00 65.27  ? 5    SGN L C2  1 
HETATM 10917 C C3  . SGN L  5 .   ? 74.969 34.088 16.334  1.00 66.50  ? 5    SGN L C3  1 
HETATM 10918 C C4  . SGN L  5 .   ? 75.809 32.949 15.731  1.00 67.82  ? 5    SGN L C4  1 
HETATM 10919 C C5  . SGN L  5 .   ? 75.482 32.882 14.219  1.00 64.56  ? 5    SGN L C5  1 
HETATM 10920 C C6  . SGN L  5 .   ? 76.218 31.797 13.469  1.00 62.42  ? 5    SGN L C6  1 
HETATM 10921 N N2  . SGN L  5 .   ? 72.597 34.740 16.665  1.00 60.45  ? 5    SGN L N2  1 
HETATM 10922 O O3  . SGN L  5 .   ? 75.231 34.187 17.722  1.00 67.22  ? 5    SGN L O3  1 
HETATM 10923 O O4  . SGN L  5 .   ? 77.138 33.365 15.947  1.00 74.29  ? 5    SGN L O4  1 
HETATM 10924 O O5  . SGN L  5 .   ? 74.073 32.653 14.006  1.00 66.30  ? 5    SGN L O5  1 
HETATM 10925 O O6  . SGN L  5 .   ? 75.902 30.561 14.028  1.00 59.24  ? 5    SGN L O6  1 
HETATM 10926 S S1  . SGN L  5 .   ? 71.482 34.261 17.729  1.00 56.84  ? 5    SGN L S1  1 
HETATM 10927 O O1S . SGN L  5 .   ? 71.941 33.035 18.286  1.00 57.12  ? 5    SGN L O1S 1 
HETATM 10928 O O2S . SGN L  5 .   ? 71.377 35.320 18.686  1.00 56.50  ? 5    SGN L O2S 1 
HETATM 10929 O O3S . SGN L  5 .   ? 70.286 34.090 16.965  1.00 55.27  ? 5    SGN L O3S 1 
HETATM 10930 S S2  . SGN L  5 .   ? 75.967 29.197 13.292  1.00 59.66  ? 5    SGN L S2  1 
HETATM 10931 O O4S . SGN L  5 .   ? 75.118 28.294 13.981  1.00 61.43  ? 5    SGN L O4S 1 
HETATM 10932 O O5S . SGN L  5 .   ? 75.500 29.487 11.976  1.00 60.49  ? 5    SGN L O5S 1 
HETATM 10933 O O6S . SGN L  5 .   ? 77.341 28.780 13.307  1.00 59.25  ? 5    SGN L O6S 1 
HETATM 10934 C C1  . IDS L  5 .   ? 78.077 32.387 16.288  1.00 76.97  ? 6    IDS L C1  1 
HETATM 10935 C C2  . IDS L  5 .   ? 79.484 32.997 16.048  1.00 78.02  ? 6    IDS L C2  1 
HETATM 10936 C C3  . IDS L  5 .   ? 79.957 33.941 17.177  1.00 77.58  ? 6    IDS L C3  1 
HETATM 10937 C C4  . IDS L  5 .   ? 79.657 33.387 18.590  1.00 77.96  ? 6    IDS L C4  1 
HETATM 10938 C C5  . IDS L  5 .   ? 78.167 32.970 18.641  1.00 78.65  ? 6    IDS L C5  1 
HETATM 10939 C C6  . IDS L  5 .   ? 77.698 32.443 19.980  1.00 78.63  ? 6    IDS L C6  1 
HETATM 10940 O O2  . IDS L  5 .   ? 80.416 31.941 15.906  1.00 80.16  ? 6    IDS L O2  1 
HETATM 10941 O O3  . IDS L  5 .   ? 79.268 35.175 17.043  1.00 77.03  ? 6    IDS L O3  1 
HETATM 10942 O O4  . IDS L  5 .   ? 80.537 32.253 18.711  1.00 78.09  ? 6    IDS L O4  1 
HETATM 10943 O O5  . IDS L  5 .   ? 77.929 31.962 17.638  1.00 78.50  ? 6    IDS L O5  1 
HETATM 10944 O O6A . IDS L  5 .   ? 77.648 31.253 20.204  1.00 79.15  ? 6    IDS L O6A 1 
HETATM 10945 O O6B . IDS L  5 .   ? 77.358 33.213 20.856  1.00 77.90  ? 6    IDS L O6B 1 
HETATM 10946 S S   . IDS L  5 .   ? 81.146 31.479 14.594  1.00 82.40  ? 6    IDS L S   1 
HETATM 10947 O O1S . IDS L  5 .   ? 82.048 32.540 14.237  1.00 82.37  ? 6    IDS L O1S 1 
HETATM 10948 O O2S . IDS L  5 .   ? 81.828 30.264 14.954  1.00 81.85  ? 6    IDS L O2S 1 
HETATM 10949 O O3S . IDS L  5 .   ? 80.124 31.259 13.604  1.00 80.75  ? 6    IDS L O3S 1 
HETATM 10950 C C1  . SGN L  5 .   ? 81.551 32.352 19.672  1.00 78.62  ? 7    SGN L C1  1 
HETATM 10951 C C2  . SGN L  5 .   ? 82.799 31.479 19.385  1.00 79.47  ? 7    SGN L C2  1 
HETATM 10952 C C3  . SGN L  5 .   ? 82.515 30.000 19.652  1.00 79.55  ? 7    SGN L C3  1 
HETATM 10953 C C4  . SGN L  5 .   ? 82.071 29.826 21.116  1.00 81.76  ? 7    SGN L C4  1 
HETATM 10954 C C5  . SGN L  5 .   ? 80.777 30.682 21.286  1.00 79.13  ? 7    SGN L C5  1 
HETATM 10955 C C6  . SGN L  5 .   ? 80.155 30.655 22.685  1.00 79.14  ? 7    SGN L C6  1 
HETATM 10956 N N2  . SGN L  5 .   ? 83.229 31.715 17.991  1.00 79.98  ? 7    SGN L N2  1 
HETATM 10957 O O3  . SGN L  5 .   ? 83.696 29.256 19.412  1.00 80.00  ? 7    SGN L O3  1 
HETATM 10958 O O4  . SGN L  5 .   ? 82.119 28.405 21.208  1.00 89.51  ? 7    SGN L O4  1 
HETATM 10959 O O5  . SGN L  5 .   ? 81.032 32.083 20.975  1.00 78.17  ? 7    SGN L O5  1 
HETATM 10960 O O6  . SGN L  5 .   ? 81.133 30.650 23.686  1.00 77.18  ? 7    SGN L O6  1 
HETATM 10961 S S1  . SGN L  5 .   ? 84.469 32.707 17.601  1.00 80.32  ? 7    SGN L S1  1 
HETATM 10962 O O1S . SGN L  5 .   ? 85.306 32.900 18.749  1.00 79.05  ? 7    SGN L O1S 1 
HETATM 10963 O O2S . SGN L  5 .   ? 85.138 32.043 16.516  1.00 79.65  ? 7    SGN L O2S 1 
HETATM 10964 O O3S . SGN L  5 .   ? 83.831 33.938 17.194  1.00 79.07  ? 7    SGN L O3S 1 
HETATM 10965 S S2  . SGN L  5 .   ? 80.953 31.215 25.115  1.00 77.05  ? 7    SGN L S2  1 
HETATM 10966 O O4S . SGN L  5 .   ? 82.262 31.472 25.628  1.00 77.62  ? 7    SGN L O4S 1 
HETATM 10967 O O5S . SGN L  5 .   ? 80.176 32.417 24.937  1.00 75.03  ? 7    SGN L O5S 1 
HETATM 10968 O O6S . SGN L  5 .   ? 80.253 30.198 25.847  1.00 76.61  ? 7    SGN L O6S 1 
HETATM 10969 C C1  . IDS L  5 .   ? 82.199 27.809 22.472  1.00 92.54  ? 8    IDS L C1  1 
HETATM 10970 C C2  . IDS L  5 .   ? 81.382 26.482 22.397  1.00 95.26  ? 8    IDS L C2  1 
HETATM 10971 C C3  . IDS L  5 .   ? 81.936 25.448 23.402  1.00 96.56  ? 8    IDS L C3  1 
HETATM 10972 C C4  . IDS L  5 .   ? 83.440 25.143 23.119  1.00 101.34 ? 8    IDS L C4  1 
HETATM 10973 C C5  . IDS L  5 .   ? 84.084 26.323 22.313  1.00 97.01  ? 8    IDS L C5  1 
HETATM 10974 C C6  . IDS L  5 .   ? 85.602 26.366 22.309  1.00 97.59  ? 8    IDS L C6  1 
HETATM 10975 O O2  . IDS L  5 .   ? 80.011 26.745 22.698  1.00 94.34  ? 8    IDS L O2  1 
HETATM 10976 O O3  . IDS L  5 .   ? 81.189 24.248 23.300  1.00 96.73  ? 8    IDS L O3  1 
HETATM 10977 O O4  . IDS L  5 .   ? 84.042 25.130 24.418  1.00 114.06 ? 8    IDS L O4  1 
HETATM 10978 O O5  . IDS L  5 .   ? 83.554 27.560 22.824  1.00 95.03  ? 8    IDS L O5  1 
HETATM 10979 O O6A . IDS L  5 .   ? 86.235 25.496 21.755  1.00 96.75  ? 8    IDS L O6A 1 
HETATM 10980 O O6B . IDS L  5 .   ? 86.217 27.258 22.855  1.00 97.45  ? 8    IDS L O6B 1 
HETATM 10981 S S   . IDS L  5 .   ? 78.755 26.556 21.779  1.00 92.01  ? 8    IDS L S   1 
HETATM 10982 O O1S . IDS L  5 .   ? 78.731 27.736 20.950  1.00 90.92  ? 8    IDS L O1S 1 
HETATM 10983 O O2S . IDS L  5 .   ? 78.963 25.349 21.029  1.00 91.80  ? 8    IDS L O2S 1 
HETATM 10984 O O3S . IDS L  5 .   ? 77.636 26.484 22.666  1.00 91.70  ? 8    IDS L O3S 1 
HETATM 10985 C C1  . SGN L  5 .   ? 84.346 23.877 24.999  1.00 118.43 ? 9    SGN L C1  1 
HETATM 10986 C C2  . SGN L  5 .   ? 84.545 24.002 26.531  1.00 121.90 ? 9    SGN L C2  1 
HETATM 10987 C C3  . SGN L  5 .   ? 85.814 24.816 26.843  1.00 122.12 ? 9    SGN L C3  1 
HETATM 10988 C C4  . SGN L  5 .   ? 87.008 24.055 26.240  1.00 122.43 ? 9    SGN L C4  1 
HETATM 10989 C C5  . SGN L  5 .   ? 86.785 23.950 24.706  1.00 122.96 ? 9    SGN L C5  1 
HETATM 10990 C C6  . SGN L  5 .   ? 87.885 23.186 23.952  1.00 125.28 ? 9    SGN L C6  1 
HETATM 10991 N N2  . SGN L  5 .   ? 83.344 24.617 27.082  1.00 126.19 ? 9    SGN L N2  1 
HETATM 10992 O O3  . SGN L  5 .   ? 85.996 24.916 28.241  1.00 121.38 ? 9    SGN L O3  1 
HETATM 10993 O O5  . SGN L  5 .   ? 85.513 23.304 24.405  1.00 120.65 ? 9    SGN L O5  1 
HETATM 10994 O O6  . SGN L  5 .   ? 87.504 21.830 23.794  1.00 128.32 ? 9    SGN L O6  1 
HETATM 10995 S S1  . SGN L  5 .   ? 82.262 23.652 27.845  1.00 129.96 ? 9    SGN L S1  1 
HETATM 10996 O O1S . SGN L  5 .   ? 80.992 23.971 27.238  1.00 130.15 ? 9    SGN L O1S 1 
HETATM 10997 O O2S . SGN L  5 .   ? 82.628 22.279 27.617  1.00 129.85 ? 9    SGN L O2S 1 
HETATM 10998 O O3S . SGN L  5 .   ? 82.320 24.030 29.235  1.00 130.12 ? 9    SGN L O3S 1 
HETATM 10999 S S2  . SGN L  5 .   ? 87.929 20.848 22.646  1.00 130.23 ? 9    SGN L S2  1 
HETATM 11000 O O4S . SGN L  5 .   ? 89.365 20.919 22.575  1.00 130.17 ? 9    SGN L O4S 1 
HETATM 11001 O O5S . SGN L  5 .   ? 87.296 21.368 21.460  1.00 130.14 ? 9    SGN L O5S 1 
HETATM 11002 O O6S . SGN L  5 .   ? 87.449 19.544 23.000  1.00 130.15 ? 9    SGN L O6S 1 
HETATM 11003 C C1  . SGN M  6 .   ? 50.880 75.580 -20.815 1.00 150.22 ? 1    SGN M C1  1 
HETATM 11004 C C2  . SGN M  6 .   ? 52.038 76.611 -20.645 1.00 150.86 ? 1    SGN M C2  1 
HETATM 11005 C C3  . SGN M  6 .   ? 53.002 76.112 -19.539 1.00 150.07 ? 1    SGN M C3  1 
HETATM 11006 C C4  . SGN M  6 .   ? 52.195 76.011 -18.224 1.00 148.17 ? 1    SGN M C4  1 
HETATM 11007 C C5  . SGN M  6 .   ? 51.022 74.997 -18.433 1.00 149.69 ? 1    SGN M C5  1 
HETATM 11008 C C6  . SGN M  6 .   ? 50.077 74.827 -17.214 1.00 149.69 ? 1    SGN M C6  1 
HETATM 11009 N N2  . SGN M  6 .   ? 52.715 76.768 -21.949 1.00 153.45 ? 1    SGN M N2  1 
HETATM 11010 O O1  . SGN M  6 .   ? 51.352 74.346 -21.309 1.00 149.02 ? 1    SGN M O1  1 
HETATM 11011 O O3  . SGN M  6 .   ? 54.059 77.039 -19.360 1.00 149.09 ? 1    SGN M O3  1 
HETATM 11012 O O4  . SGN M  6 .   ? 53.161 75.403 -17.358 1.00 143.84 ? 1    SGN M O4  1 
HETATM 11013 O O5  . SGN M  6 .   ? 50.203 75.386 -19.567 1.00 149.60 ? 1    SGN M O5  1 
HETATM 11014 O O6  . SGN M  6 .   ? 49.632 76.113 -16.787 1.00 150.48 ? 1    SGN M O6  1 
HETATM 11015 S S1  . SGN M  6 .   ? 52.474 78.150 -22.827 1.00 155.41 ? 1    SGN M S1  1 
HETATM 11016 O O1S . SGN M  6 .   ? 51.067 78.282 -23.095 1.00 155.10 ? 1    SGN M O1S 1 
HETATM 11017 O O2S . SGN M  6 .   ? 52.996 79.232 -22.028 1.00 155.07 ? 1    SGN M O2S 1 
HETATM 11018 O O3S . SGN M  6 .   ? 53.227 77.950 -24.040 1.00 155.23 ? 1    SGN M O3S 1 
HETATM 11019 S S2  . SGN M  6 .   ? 48.889 76.514 -15.454 1.00 150.82 ? 1    SGN M S2  1 
HETATM 11020 O O4S . SGN M  6 .   ? 49.380 75.674 -14.405 1.00 150.53 ? 1    SGN M O4S 1 
HETATM 11021 O O5S . SGN M  6 .   ? 49.224 77.897 -15.254 1.00 150.57 ? 1    SGN M O5S 1 
HETATM 11022 O O6S . SGN M  6 .   ? 47.487 76.333 -15.708 1.00 150.98 ? 1    SGN M O6S 1 
HETATM 11023 C C1  . IDS M  6 .   ? 53.328 75.981 -16.090 1.00 142.67 ? 2    IDS M C1  1 
HETATM 11024 C C2  . IDS M  6 .   ? 53.790 74.894 -15.061 1.00 141.81 ? 2    IDS M C2  1 
HETATM 11025 C C3  . IDS M  6 .   ? 55.324 74.629 -15.019 1.00 140.49 ? 2    IDS M C3  1 
HETATM 11026 C C4  . IDS M  6 .   ? 56.179 75.908 -15.235 1.00 138.68 ? 2    IDS M C4  1 
HETATM 11027 C C5  . IDS M  6 .   ? 55.602 76.734 -16.416 1.00 140.52 ? 2    IDS M C5  1 
HETATM 11028 C C6  . IDS M  6 .   ? 56.366 78.021 -16.745 1.00 140.33 ? 2    IDS M C6  1 
HETATM 11029 O O2  . IDS M  6