data_1GRB
# 
_entry.id   1GRB 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1GRB         
WWPDB D_1000173669 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1GRB 
_pdbx_database_status.recvd_initial_deposition_date   1992-12-15 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    ? 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Karplus, P.A.' 1 
'Schulz, G.E.'  2 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;Substrate binding and catalysis by glutathione reductase as derived from refined enzyme: substrate crystal structures at 2 A resolution.
;
J.Mol.Biol.    210 163  180 1989 JMOBAK UK 0022-2836 0070 ? 2585516 '10.1016/0022-2836(89)90298-2' 
1       
;Inhibition of Human Glutathione Reductase by the Nitrosourea Drugs 1,3-Bis(2-Chloroethyl)-1-Nitrosourea and 1-(2-Chloroethyl)-3-(2-Hydroxyethyl)-1-Nitrosourea
;
Eur.J.Biochem. 171 193  ?   1988 EJBCAI IX 0014-2956 0262 ? ?       ?                              
2       'Refined Structure of Glutathione Reductase at 1.54 Angstroms Resolution' J.Mol.Biol.    195 701  ?   1987 JMOBAK UK 
0022-2836 0070 ? ?       ?                              
3       'Interaction of a Glutathione S-Conjugate with Glutathione Reductase. Kinetic and X-Ray Crystallographic Studies' 
Eur.J.Biochem. 138 373  ?   1984 EJBCAI IX 0014-2956 0262 ? ?       ?                              
4       
;Comparison of the Three-Dimensional Protein and Nucleotide Structure of the Fad-Binding Domain of P-Hydroxybenzoate Hydroxylase with the Fad-as Well as Nadph-Binding Domains of Glutathione Reductase
;
J.Mol.Biol.    167 725  ?   1983 JMOBAK UK 0022-2836 0070 ? ?       ?                              
5       'The Catalytic Mechanism of Glutathione Reductase as Derived from X-Ray Diffraction Analyses of Reaction Intermediates' 
J.Biol.Chem.   258 1752 ?   1983 JBCHA3 US 0021-9258 0071 ? ?       ?                              
6       'Fad-Binding Site of Glutathione Reductase' J.Mol.Biol.    160 287  ?   1982 JMOBAK UK 0022-2836 0070 ? ?       ? 
7       'Glutathione Reductase from Human Erythrocytes. The Sequences of the Nadph Domain and of the Interface Domain' 
Eur.J.Biochem. 121 259  ?   1982 EJBCAI IX 0014-2956 0262 ? ?       ?                              
8       'Three-Dimensional Structure of Glutathione Reductase at 2 Angstroms Resolution' J.Mol.Biol.    152 763  ?   1981 JMOBAK 
UK 0022-2836 0070 ? ?       ?                              
9       'Gene Duplication in Glutathione Reductase' J.Mol.Biol.    138 335  ?   1980 JMOBAK UK 0022-2836 0070 ? ?       ? 
10      'The C-Terminal Fragment of Human Glutathione Reductase Contains the Postulated Catalytic Histidine' 'FEBS Lett.'   105 
244  ?   1979 FEBLAL NE 0014-5793 0165 ? ?       ?                              
11      'The Structure of the Flavoenzyme Glutathione Reductase' Nature         273 120  ?   1978 NATUAS UK 0028-0836 0006 ? ? ? 
12      'Low Resolution Structure of Human Erythrocyte Glutathione Reductase' J.Mol.Biol.    113 141  ?   1977 JMOBAK UK 0022-2836 
0070 ? ?       ?                              
13      'Crystals of Human Erythrocyte Glutathione Reductase' 'FEBS Lett.'   54  86   ?   1975 FEBLAL NE 0014-5793 0165 ? ?       
?                              
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Karplus, P.A.'       1  
primary 'Schulz, G.E.'        2  
1       'Karplus, P.A.'       3  
1       'Krauth-Siegel, R.L.' 4  
1       'Schirmer, R.H.'      5  
1       'Schulz, G.E.'        6  
2       'Karplus, P.A.'       7  
2       'Schulz, G.E.'        8  
3       'Bilzer, M.'          9  
3       'Krauth-Siegel, R.L.' 10 
3       'Schirmer, R.H.'      11 
3       'Akerboom, T.P.M.'    12 
3       'Sies, H.'            13 
3       'Schulz, G.E.'        14 
4       'Wierenga, R.K.'      15 
4       'Drenth, J.'          16 
4       'Schulz, G.E.'        17 
5       'Pai, E.F.'           18 
5       'Schulz, G.E.'        19 
6       'Schulz, G.E.'        20 
6       'Schirmer, R.H.'      21 
6       'Pai, E.F.'           22 
7       'Krauth-Siegel, R.L.' 23 
7       'Blatterspiel, R.'    24 
7       'Saleh, M.'           25 
7       'Schiltz, E.'         26 
7       'Schirmer, R.H.'      27 
7       'Untucht-Grau, R.'    28 
8       'Thieme, R.'          29 
8       'Pai, E.F.'           30 
8       'Schirmer, R.H.'      31 
8       'Schulz, G.E.'        32 
9       'Schulz, G.E.'        33 
10      'Untucht-Grau, R.'    34 
10      'Schulz, G.E.'        35 
10      'Schirmer, R.H.'      36 
11      'Schulz, G.E.'        37 
11      'Schirmer, R.H.'      38 
11      'Sachsenheimer, W.'   39 
11      'Pai, E.F.'           40 
12      'Zappe, H.A.'         41 
12      'Krohne-Ehrich, G.'   42 
12      'Schulz, G.E.'        43 
13      'Schulz, G.E.'        44 
13      'Zappe, H.'           45 
13      'Worthington, D.J.'   46 
13      'Rosemeyer, M.A.'     47 
# 
_cell.entry_id           1GRB 
_cell.length_a           119.800 
_cell.length_b           84.500 
_cell.length_c           63.200 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        58.70 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1GRB 
_symmetry.space_group_name_H-M             'B 1 1 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'GLUTATHIONE REDUCTASE'                                     51636.242 1   1.6.4.2 ? ? ? 
2 non-polymer syn 'PHOSPHATE ION'                                             94.971    1   ?       ? ? ? 
3 non-polymer syn 'FLAVIN-ADENINE DINUCLEOTIDE'                               785.550   1   ?       ? ? ? 
4 non-polymer syn NICOTINAMIDE-ADENINE-DINUCLEOTIDE                           663.425   1   ?       ? ? ? 
5 non-polymer syn 'NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE' 745.421   1   ?       ? ? ? 
6 water       nat water                                                       18.015    527 ?       ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;ACRQEPQPQGPPPAAGAVASYDYLVIGGGSGGLASARRAAELGARAAVVESHKLGGTCVNVGCVPKKVMWNTAVHSEFMH
DHADYGFPSCEGKFNWRVIKEKRDAYVSRLNAIYQNNLTKSHIEIIRGHAAFTSDPKPTIEVSGKKYTAPHILIATGGMP
STPHESQIPGASLGITSDGFFQLEELPGRSVIVGAGYIAVEMAGILSALGSKTSLMIRHDKVLRSFDSMISTNCTEELEN
AGVEVLKFSQVKEVKKTLSGLEVSMVTAVPGRLPVMTMIPDVDCLLWAIGRVPNTKDLSLNKLGIQTDDKGHIIVDEFQN
TNVKGIYAVGDVCGKALLTPVAIAAGRKLAHRLFEYKEDSKLDYNNIPTVVFSHPPIGTVGLTEDEAIHKYGIENVKTYS
TSFTPMYHAVTKRKTKCVMKMVCANKEEKVVGIHMQGLGCDEMLQGFAVAVKMGATKADFDNTVAIHPTSSEELVTLR
;
_entity_poly.pdbx_seq_one_letter_code_can   
;ACRQEPQPQGPPPAAGAVASYDYLVIGGGSGGLASARRAAELGARAAVVESHKLGGTCVNVGCVPKKVMWNTAVHSEFMH
DHADYGFPSCEGKFNWRVIKEKRDAYVSRLNAIYQNNLTKSHIEIIRGHAAFTSDPKPTIEVSGKKYTAPHILIATGGMP
STPHESQIPGASLGITSDGFFQLEELPGRSVIVGAGYIAVEMAGILSALGSKTSLMIRHDKVLRSFDSMISTNCTEELEN
AGVEVLKFSQVKEVKKTLSGLEVSMVTAVPGRLPVMTMIPDVDCLLWAIGRVPNTKDLSLNKLGIQTDDKGHIIVDEFQN
TNVKGIYAVGDVCGKALLTPVAIAAGRKLAHRLFEYKEDSKLDYNNIPTVVFSHPPIGTVGLTEDEAIHKYGIENVKTYS
TSFTPMYHAVTKRKTKCVMKMVCANKEEKVVGIHMQGLGCDEMLQGFAVAVKMGATKADFDNTVAIHPTSSEELVTLR
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   CYS n 
1 3   ARG n 
1 4   GLN n 
1 5   GLU n 
1 6   PRO n 
1 7   GLN n 
1 8   PRO n 
1 9   GLN n 
1 10  GLY n 
1 11  PRO n 
1 12  PRO n 
1 13  PRO n 
1 14  ALA n 
1 15  ALA n 
1 16  GLY n 
1 17  ALA n 
1 18  VAL n 
1 19  ALA n 
1 20  SER n 
1 21  TYR n 
1 22  ASP n 
1 23  TYR n 
1 24  LEU n 
1 25  VAL n 
1 26  ILE n 
1 27  GLY n 
1 28  GLY n 
1 29  GLY n 
1 30  SER n 
1 31  GLY n 
1 32  GLY n 
1 33  LEU n 
1 34  ALA n 
1 35  SER n 
1 36  ALA n 
1 37  ARG n 
1 38  ARG n 
1 39  ALA n 
1 40  ALA n 
1 41  GLU n 
1 42  LEU n 
1 43  GLY n 
1 44  ALA n 
1 45  ARG n 
1 46  ALA n 
1 47  ALA n 
1 48  VAL n 
1 49  VAL n 
1 50  GLU n 
1 51  SER n 
1 52  HIS n 
1 53  LYS n 
1 54  LEU n 
1 55  GLY n 
1 56  GLY n 
1 57  THR n 
1 58  CYS n 
1 59  VAL n 
1 60  ASN n 
1 61  VAL n 
1 62  GLY n 
1 63  CYS n 
1 64  VAL n 
1 65  PRO n 
1 66  LYS n 
1 67  LYS n 
1 68  VAL n 
1 69  MET n 
1 70  TRP n 
1 71  ASN n 
1 72  THR n 
1 73  ALA n 
1 74  VAL n 
1 75  HIS n 
1 76  SER n 
1 77  GLU n 
1 78  PHE n 
1 79  MET n 
1 80  HIS n 
1 81  ASP n 
1 82  HIS n 
1 83  ALA n 
1 84  ASP n 
1 85  TYR n 
1 86  GLY n 
1 87  PHE n 
1 88  PRO n 
1 89  SER n 
1 90  CYS n 
1 91  GLU n 
1 92  GLY n 
1 93  LYS n 
1 94  PHE n 
1 95  ASN n 
1 96  TRP n 
1 97  ARG n 
1 98  VAL n 
1 99  ILE n 
1 100 LYS n 
1 101 GLU n 
1 102 LYS n 
1 103 ARG n 
1 104 ASP n 
1 105 ALA n 
1 106 TYR n 
1 107 VAL n 
1 108 SER n 
1 109 ARG n 
1 110 LEU n 
1 111 ASN n 
1 112 ALA n 
1 113 ILE n 
1 114 TYR n 
1 115 GLN n 
1 116 ASN n 
1 117 ASN n 
1 118 LEU n 
1 119 THR n 
1 120 LYS n 
1 121 SER n 
1 122 HIS n 
1 123 ILE n 
1 124 GLU n 
1 125 ILE n 
1 126 ILE n 
1 127 ARG n 
1 128 GLY n 
1 129 HIS n 
1 130 ALA n 
1 131 ALA n 
1 132 PHE n 
1 133 THR n 
1 134 SER n 
1 135 ASP n 
1 136 PRO n 
1 137 LYS n 
1 138 PRO n 
1 139 THR n 
1 140 ILE n 
1 141 GLU n 
1 142 VAL n 
1 143 SER n 
1 144 GLY n 
1 145 LYS n 
1 146 LYS n 
1 147 TYR n 
1 148 THR n 
1 149 ALA n 
1 150 PRO n 
1 151 HIS n 
1 152 ILE n 
1 153 LEU n 
1 154 ILE n 
1 155 ALA n 
1 156 THR n 
1 157 GLY n 
1 158 GLY n 
1 159 MET n 
1 160 PRO n 
1 161 SER n 
1 162 THR n 
1 163 PRO n 
1 164 HIS n 
1 165 GLU n 
1 166 SER n 
1 167 GLN n 
1 168 ILE n 
1 169 PRO n 
1 170 GLY n 
1 171 ALA n 
1 172 SER n 
1 173 LEU n 
1 174 GLY n 
1 175 ILE n 
1 176 THR n 
1 177 SER n 
1 178 ASP n 
1 179 GLY n 
1 180 PHE n 
1 181 PHE n 
1 182 GLN n 
1 183 LEU n 
1 184 GLU n 
1 185 GLU n 
1 186 LEU n 
1 187 PRO n 
1 188 GLY n 
1 189 ARG n 
1 190 SER n 
1 191 VAL n 
1 192 ILE n 
1 193 VAL n 
1 194 GLY n 
1 195 ALA n 
1 196 GLY n 
1 197 TYR n 
1 198 ILE n 
1 199 ALA n 
1 200 VAL n 
1 201 GLU n 
1 202 MET n 
1 203 ALA n 
1 204 GLY n 
1 205 ILE n 
1 206 LEU n 
1 207 SER n 
1 208 ALA n 
1 209 LEU n 
1 210 GLY n 
1 211 SER n 
1 212 LYS n 
1 213 THR n 
1 214 SER n 
1 215 LEU n 
1 216 MET n 
1 217 ILE n 
1 218 ARG n 
1 219 HIS n 
1 220 ASP n 
1 221 LYS n 
1 222 VAL n 
1 223 LEU n 
1 224 ARG n 
1 225 SER n 
1 226 PHE n 
1 227 ASP n 
1 228 SER n 
1 229 MET n 
1 230 ILE n 
1 231 SER n 
1 232 THR n 
1 233 ASN n 
1 234 CYS n 
1 235 THR n 
1 236 GLU n 
1 237 GLU n 
1 238 LEU n 
1 239 GLU n 
1 240 ASN n 
1 241 ALA n 
1 242 GLY n 
1 243 VAL n 
1 244 GLU n 
1 245 VAL n 
1 246 LEU n 
1 247 LYS n 
1 248 PHE n 
1 249 SER n 
1 250 GLN n 
1 251 VAL n 
1 252 LYS n 
1 253 GLU n 
1 254 VAL n 
1 255 LYS n 
1 256 LYS n 
1 257 THR n 
1 258 LEU n 
1 259 SER n 
1 260 GLY n 
1 261 LEU n 
1 262 GLU n 
1 263 VAL n 
1 264 SER n 
1 265 MET n 
1 266 VAL n 
1 267 THR n 
1 268 ALA n 
1 269 VAL n 
1 270 PRO n 
1 271 GLY n 
1 272 ARG n 
1 273 LEU n 
1 274 PRO n 
1 275 VAL n 
1 276 MET n 
1 277 THR n 
1 278 MET n 
1 279 ILE n 
1 280 PRO n 
1 281 ASP n 
1 282 VAL n 
1 283 ASP n 
1 284 CYS n 
1 285 LEU n 
1 286 LEU n 
1 287 TRP n 
1 288 ALA n 
1 289 ILE n 
1 290 GLY n 
1 291 ARG n 
1 292 VAL n 
1 293 PRO n 
1 294 ASN n 
1 295 THR n 
1 296 LYS n 
1 297 ASP n 
1 298 LEU n 
1 299 SER n 
1 300 LEU n 
1 301 ASN n 
1 302 LYS n 
1 303 LEU n 
1 304 GLY n 
1 305 ILE n 
1 306 GLN n 
1 307 THR n 
1 308 ASP n 
1 309 ASP n 
1 310 LYS n 
1 311 GLY n 
1 312 HIS n 
1 313 ILE n 
1 314 ILE n 
1 315 VAL n 
1 316 ASP n 
1 317 GLU n 
1 318 PHE n 
1 319 GLN n 
1 320 ASN n 
1 321 THR n 
1 322 ASN n 
1 323 VAL n 
1 324 LYS n 
1 325 GLY n 
1 326 ILE n 
1 327 TYR n 
1 328 ALA n 
1 329 VAL n 
1 330 GLY n 
1 331 ASP n 
1 332 VAL n 
1 333 CYS n 
1 334 GLY n 
1 335 LYS n 
1 336 ALA n 
1 337 LEU n 
1 338 LEU n 
1 339 THR n 
1 340 PRO n 
1 341 VAL n 
1 342 ALA n 
1 343 ILE n 
1 344 ALA n 
1 345 ALA n 
1 346 GLY n 
1 347 ARG n 
1 348 LYS n 
1 349 LEU n 
1 350 ALA n 
1 351 HIS n 
1 352 ARG n 
1 353 LEU n 
1 354 PHE n 
1 355 GLU n 
1 356 TYR n 
1 357 LYS n 
1 358 GLU n 
1 359 ASP n 
1 360 SER n 
1 361 LYS n 
1 362 LEU n 
1 363 ASP n 
1 364 TYR n 
1 365 ASN n 
1 366 ASN n 
1 367 ILE n 
1 368 PRO n 
1 369 THR n 
1 370 VAL n 
1 371 VAL n 
1 372 PHE n 
1 373 SER n 
1 374 HIS n 
1 375 PRO n 
1 376 PRO n 
1 377 ILE n 
1 378 GLY n 
1 379 THR n 
1 380 VAL n 
1 381 GLY n 
1 382 LEU n 
1 383 THR n 
1 384 GLU n 
1 385 ASP n 
1 386 GLU n 
1 387 ALA n 
1 388 ILE n 
1 389 HIS n 
1 390 LYS n 
1 391 TYR n 
1 392 GLY n 
1 393 ILE n 
1 394 GLU n 
1 395 ASN n 
1 396 VAL n 
1 397 LYS n 
1 398 THR n 
1 399 TYR n 
1 400 SER n 
1 401 THR n 
1 402 SER n 
1 403 PHE n 
1 404 THR n 
1 405 PRO n 
1 406 MET n 
1 407 TYR n 
1 408 HIS n 
1 409 ALA n 
1 410 VAL n 
1 411 THR n 
1 412 LYS n 
1 413 ARG n 
1 414 LYS n 
1 415 THR n 
1 416 LYS n 
1 417 CYS n 
1 418 VAL n 
1 419 MET n 
1 420 LYS n 
1 421 MET n 
1 422 VAL n 
1 423 CYS n 
1 424 ALA n 
1 425 ASN n 
1 426 LYS n 
1 427 GLU n 
1 428 GLU n 
1 429 LYS n 
1 430 VAL n 
1 431 VAL n 
1 432 GLY n 
1 433 ILE n 
1 434 HIS n 
1 435 MET n 
1 436 GLN n 
1 437 GLY n 
1 438 LEU n 
1 439 GLY n 
1 440 CYS n 
1 441 ASP n 
1 442 GLU n 
1 443 MET n 
1 444 LEU n 
1 445 GLN n 
1 446 GLY n 
1 447 PHE n 
1 448 ALA n 
1 449 VAL n 
1 450 ALA n 
1 451 VAL n 
1 452 LYS n 
1 453 MET n 
1 454 GLY n 
1 455 ALA n 
1 456 THR n 
1 457 LYS n 
1 458 ALA n 
1 459 ASP n 
1 460 PHE n 
1 461 ASP n 
1 462 ASN n 
1 463 THR n 
1 464 VAL n 
1 465 ALA n 
1 466 ILE n 
1 467 HIS n 
1 468 PRO n 
1 469 THR n 
1 470 SER n 
1 471 SER n 
1 472 GLU n 
1 473 GLU n 
1 474 LEU n 
1 475 VAL n 
1 476 THR n 
1 477 LEU n 
1 478 ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    GSHR_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P00390 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;ACRQEPQPQGPPPAAGAVASYDYLVIGGGSGGLASARRAAELGARAAVVESHKLGGTCVNVGCVPKKVMWNTAVHSEFMH
DHADYGFPSCEGKFNWRVIKEKRDAYVSRLNAIYQNNLTKSHIEIIRGHAAFTSDPKPTIEVSGKKYTAPHILIATGGMP
STPHESQIPGASLGITSDGFFQLEELPGRSVIVGAGYIAVEMAGILSALGSKTSLMIRHDKVLRSFDSMISTNCTEELEN
AGVEVLKFSQVKEVKKTLSGLEVSMVTAVPGRLPVMTMIPDVDCLLWAIGRVPNTKDLSLNKLGIQTDDKGHIIVDEFQN
TNVKGIYAVGDVCGKALLTPVAIAAGRKLAHRLFEYKEDSKLDYNNIPTVVFSHPPIGTVGLTEDEAIHKYGIENVKTYS
TSFTPMYHAVTKRKTKCVMKMVCANKEEKVVGIHMQGLGCDEMLQGFAVAVKMGATKADFDNTVAIHPTSSEELVTLR
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1GRB 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 478 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P00390 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  478 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       478 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                     ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                                    ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                  ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                             ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                                                    ? 'C3 H7 N O2 S'      121.158 
FAD non-polymer         . 'FLAVIN-ADENINE DINUCLEOTIDE'                               ? 'C27 H33 N9 O15 P2' 785.550 
GLN 'L-peptide linking' y GLUTAMINE                                                   ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                             ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                                     ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                                   ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                                       ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                  ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                                     ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                                      ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                                  ? 'C5 H11 N O2 S'     149.211 
NAD non-polymer         . NICOTINAMIDE-ADENINE-DINUCLEOTIDE                           ? 'C21 H27 N7 O14 P2' 663.425 
NDP non-polymer         . 'NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE' ? 'C21 H30 N7 O17 P3' 745.421 
PHE 'L-peptide linking' y PHENYLALANINE                                               ? 'C9 H11 N O2'       165.189 
PO4 non-polymer         . 'PHOSPHATE ION'                                             ? 'O4 P -3'           94.971  
PRO 'L-peptide linking' y PROLINE                                                     ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                                      ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                                   ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                  ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                                    ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                                      ? 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          1GRB 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.65 
_exptl_crystal.density_percent_sol   53.51 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_refine.entry_id                                 1GRB 
_refine.ls_number_reflns_obs                     38343 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             10. 
_refine.ls_d_res_high                            1.85 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.162 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  
;THE ENZYME CRYSTAL WAS SOAKED WITH NADH, DATA WERE
COLLECTED, AND THE STRUCTURE OF THE REDUCED ENZYME WITH
BOUND NADH WAS REFINED.

THE CRYSTAL STRUCTURE NAME IN THE PUBLICATION IS E2:NADH.
;
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3499 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         150 
_refine_hist.number_atoms_solvent             527 
_refine_hist.number_atoms_total               4176 
_refine_hist.d_res_high                       1.85 
_refine_hist.d_res_low                        10. 
# 
_struct.entry_id                  1GRB 
_struct.title                     
;SUBSTRATE BINDING AND CATALYSIS BY GLUTATHIONE REDUCTASE AS DERIVED FROM REFINED ENZYME: SUBSTRATE CRYSTAL STRUCTURES AT 2 ANGSTROMS RESOLUTION
;
_struct.pdbx_descriptor           'GLUTATHIONE REDUCTASE (E.C.1.6.4.2) (OXIDIZED) COMPLEX WITH NADH AND PHOSPHATE' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1GRB 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            'OXIDOREDUCTASE(FLAVOENZYME), OXIDOREDUCTASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  H1  GLY A 29  ? GLY A 43  ? GLY A 29  GLY A 43  1 'RES 43 IN 3/10 CONFORMATION'  15 
HELX_P HELX_P2  H2  GLY A 56  ? GLY A 86  ? GLY A 56  GLY A 86  1 'RES 80-86 3/10 CONFORMATION'  31 
HELX_P HELX_P3  H3  TRP A 96  ? HIS A 122 ? TRP A 96  HIS A 122 1 'RES 121-122 3/10 CONFORMATN'  27 
HELX_P HELX_P4  H4  GLY A 170 ? GLY A 174 ? GLY A 170 GLY A 174 5 ?                              5  
HELX_P HELX_P5  H5  SER A 177 ? LEU A 183 ? SER A 177 LEU A 183 5 ?                              7  
HELX_P HELX_P6  H6  GLY A 196 ? LEU A 209 ? GLY A 196 LEU A 209 1 ?                              14 
HELX_P HELX_P7  H7  ASP A 227 ? GLY A 242 ? ASP A 227 GLY A 242 1 'RES 242 IN 3/10 CONFORMATION' 16 
HELX_P HELX_P8  H8  SER A 299 ? GLY A 304 ? SER A 299 GLY A 304 5 ?                              6  
HELX_P HELX_P9  H9  GLY A 330 ? GLY A 334 ? GLY A 330 GLY A 334 5 ?                              5  
HELX_P HELX_P10 H10 LEU A 338 ? PHE A 354 ? LEU A 338 PHE A 354 1 ?                              17 
HELX_P HELX_P11 H11 THR A 383 ? GLY A 392 ? THR A 383 GLY A 392 1 ?                              10 
HELX_P HELX_P12 H12 PRO A 405 ? ALA A 409 ? PRO A 405 ALA A 409 5 ?                              5  
HELX_P HELX_P13 H13 LEU A 444 ? MET A 453 ? LEU A 444 MET A 453 1 ?                              10 
HELX_P HELX_P14 H14 THR A 456 ? ASN A 462 ? THR A 456 ASN A 462 1 ?                              7  
HELX_P HELX_P15 H15 SER A 470 ? THR A 476 ? SER A 470 THR A 476 5 ?                              7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 HIS 374 A . ? HIS 374 A PRO 375 A ? PRO 375 A 1 -3.49 
2 HIS 467 A . ? HIS 467 A PRO 468 A ? PRO 468 A 1 -1.89 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 8 ? 
B ? 4 ? 
C ? 5 ? 
D ? 4 ? 
E ? 5 ? 
F ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? anti-parallel 
A 6 7 ? anti-parallel 
A 7 8 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? parallel      
C 2 3 ? parallel      
C 3 4 ? parallel      
C 4 5 ? parallel      
D 1 2 ? parallel      
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
E 4 5 ? anti-parallel 
F 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLU A 124 ? GLY A 128 ? GLU A 124 GLY A 128 
A 2 ARG A 45  ? GLU A 50  ? ARG A 45  GLU A 50  
A 3 ASP A 22  ? GLY A 27  ? ASP A 22  GLY A 27  
A 4 HIS A 151 ? ALA A 155 ? HIS A 151 ALA A 155 
A 5 GLY A 325 ? VAL A 329 ? GLY A 325 VAL A 329 
A 6 GLN A 319 ? VAL A 323 ? GLN A 319 VAL A 323 
A 7 GLY A 311 ? ILE A 314 ? GLY A 311 ILE A 314 
A 8 GLN A 306 ? ASP A 308 ? GLN A 306 ASP A 308 
B 1 ALA A 19  ? TYR A 21  ? ALA A 19  TYR A 21  
B 2 LYS A 145 ? THR A 148 ? LYS A 145 THR A 148 
B 3 THR A 139 ? VAL A 142 ? THR A 139 VAL A 142 
B 4 ALA A 131 ? THR A 133 ? ALA A 131 THR A 133 
C 1 ILE A 175 ? ILE A 175 ? ILE A 175 ILE A 175 
C 2 ASP A 283 ? ALA A 288 ? ASP A 283 ALA A 288 
C 3 GLY A 188 ? GLY A 194 ? GLY A 188 GLY A 194 
C 4 LYS A 212 ? ILE A 217 ? LYS A 212 ILE A 217 
C 5 GLU A 244 ? SER A 249 ? GLU A 244 SER A 249 
D 1 PRO A 169 ? PRO A 169 ? PRO A 169 PRO A 169 
D 2 PHE A 248 ? THR A 257 ? PHE A 248 THR A 257 
D 3 GLY A 260 ? ALA A 268 ? GLY A 260 ALA A 268 
D 4 VAL A 275 ? VAL A 282 ? VAL A 275 VAL A 282 
E 1 THR A 369 ? VAL A 371 ? THR A 369 VAL A 371 
E 2 PRO A 376 ? LEU A 382 ? PRO A 376 LEU A 382 
E 3 GLU A 428 ? GLY A 437 ? GLU A 428 GLY A 437 
E 4 CYS A 417 ? ASN A 425 ? CYS A 417 ASN A 425 
E 5 ASN A 395 ? PHE A 403 ? ASN A 395 PHE A 403 
F 1 GLY A 157 ? SER A 161 ? GLY A 157 SER A 161 
F 2 GLY A 290 ? ASN A 294 ? GLY A 290 ASN A 294 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE PO4 A 481' 
AC2 Software ? ? ? ? 39 'BINDING SITE FOR RESIDUE FAD A 479' 
AC3 Software ? ? ? ? 28 'BINDING SITE FOR RESIDUE NAD A 480' 
AC4 Software ? ? ? ? 28 'BINDING SITE FOR RESIDUE NDP A 483' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 8  ARG A 218 ? ARG A 218  . ? 1_555 ? 
2   AC1 8  HIS A 219 ? HIS A 219  . ? 1_555 ? 
3   AC1 8  ARG A 224 ? ARG A 224  . ? 1_555 ? 
4   AC1 8  NAD D .   ? NAD A 480  . ? 1_555 ? 
5   AC1 8  NDP E .   ? NDP A 483  . ? 1_555 ? 
6   AC1 8  HOH F .   ? HOH A 503  . ? 1_555 ? 
7   AC1 8  HOH F .   ? HOH A 570  . ? 1_555 ? 
8   AC1 8  HOH F .   ? HOH A 594  . ? 1_555 ? 
9   AC2 39 GLY A 27  ? GLY A 27   . ? 1_555 ? 
10  AC2 39 GLY A 29  ? GLY A 29   . ? 1_555 ? 
11  AC2 39 SER A 30  ? SER A 30   . ? 1_555 ? 
12  AC2 39 GLY A 31  ? GLY A 31   . ? 1_555 ? 
13  AC2 39 GLU A 50  ? GLU A 50   . ? 1_555 ? 
14  AC2 39 SER A 51  ? SER A 51   . ? 1_555 ? 
15  AC2 39 HIS A 52  ? HIS A 52   . ? 1_555 ? 
16  AC2 39 GLY A 56  ? GLY A 56   . ? 1_555 ? 
17  AC2 39 THR A 57  ? THR A 57   . ? 1_555 ? 
18  AC2 39 CYS A 58  ? CYS A 58   . ? 1_555 ? 
19  AC2 39 VAL A 61  ? VAL A 61   . ? 1_555 ? 
20  AC2 39 GLY A 62  ? GLY A 62   . ? 1_555 ? 
21  AC2 39 CYS A 63  ? CYS A 63   . ? 1_555 ? 
22  AC2 39 LYS A 66  ? LYS A 66   . ? 1_555 ? 
23  AC2 39 GLY A 128 ? GLY A 128  . ? 1_555 ? 
24  AC2 39 HIS A 129 ? HIS A 129  . ? 1_555 ? 
25  AC2 39 ALA A 130 ? ALA A 130  . ? 1_555 ? 
26  AC2 39 ALA A 155 ? ALA A 155  . ? 1_555 ? 
27  AC2 39 THR A 156 ? THR A 156  . ? 1_555 ? 
28  AC2 39 GLY A 157 ? GLY A 157  . ? 1_555 ? 
29  AC2 39 ARG A 291 ? ARG A 291  . ? 1_555 ? 
30  AC2 39 GLY A 330 ? GLY A 330  . ? 1_555 ? 
31  AC2 39 ASP A 331 ? ASP A 331  . ? 1_555 ? 
32  AC2 39 LEU A 337 ? LEU A 337  . ? 1_555 ? 
33  AC2 39 LEU A 338 ? LEU A 338  . ? 1_555 ? 
34  AC2 39 THR A 339 ? THR A 339  . ? 1_555 ? 
35  AC2 39 PRO A 340 ? PRO A 340  . ? 1_555 ? 
36  AC2 39 HIS A 467 ? HIS A 467  . ? 2_665 ? 
37  AC2 39 PRO A 468 ? PRO A 468  . ? 2_665 ? 
38  AC2 39 NAD D .   ? NAD A 480  . ? 1_555 ? 
39  AC2 39 NDP E .   ? NDP A 483  . ? 1_555 ? 
40  AC2 39 HOH F .   ? HOH A 488  . ? 1_555 ? 
41  AC2 39 HOH F .   ? HOH A 490  . ? 1_555 ? 
42  AC2 39 HOH F .   ? HOH A 496  . ? 1_555 ? 
43  AC2 39 HOH F .   ? HOH A 501  . ? 1_555 ? 
44  AC2 39 HOH F .   ? HOH A 538  . ? 1_555 ? 
45  AC2 39 HOH F .   ? HOH A 796  . ? 1_555 ? 
46  AC2 39 HOH F .   ? HOH A 831  . ? 1_555 ? 
47  AC2 39 HOH F .   ? HOH A 982  . ? 1_555 ? 
48  AC3 28 LYS A 66  ? LYS A 66   . ? 1_555 ? 
49  AC3 28 ALA A 195 ? ALA A 195  . ? 1_555 ? 
50  AC3 28 GLY A 196 ? GLY A 196  . ? 1_555 ? 
51  AC3 28 TYR A 197 ? TYR A 197  . ? 1_555 ? 
52  AC3 28 ILE A 198 ? ILE A 198  . ? 1_555 ? 
53  AC3 28 GLU A 201 ? GLU A 201  . ? 1_555 ? 
54  AC3 28 ARG A 218 ? ARG A 218  . ? 1_555 ? 
55  AC3 28 ALA A 288 ? ALA A 288  . ? 1_555 ? 
56  AC3 28 ILE A 289 ? ILE A 289  . ? 1_555 ? 
57  AC3 28 GLY A 290 ? GLY A 290  . ? 1_555 ? 
58  AC3 28 ARG A 291 ? ARG A 291  . ? 1_555 ? 
59  AC3 28 LEU A 337 ? LEU A 337  . ? 1_555 ? 
60  AC3 28 LEU A 338 ? LEU A 338  . ? 1_555 ? 
61  AC3 28 VAL A 370 ? VAL A 370  . ? 1_555 ? 
62  AC3 28 FAD C .   ? FAD A 479  . ? 1_555 ? 
63  AC3 28 PO4 B .   ? PO4 A 481  . ? 1_555 ? 
64  AC3 28 NDP E .   ? NDP A 483  . ? 1_555 ? 
65  AC3 28 HOH F .   ? HOH A 500  . ? 1_555 ? 
66  AC3 28 HOH F .   ? HOH A 511  . ? 1_555 ? 
67  AC3 28 HOH F .   ? HOH A 514  . ? 1_555 ? 
68  AC3 28 HOH F .   ? HOH A 524  . ? 1_555 ? 
69  AC3 28 HOH F .   ? HOH A 594  . ? 1_555 ? 
70  AC3 28 HOH F .   ? HOH A 838  . ? 1_555 ? 
71  AC3 28 HOH F .   ? HOH A 851  . ? 1_555 ? 
72  AC3 28 HOH F .   ? HOH A 984  . ? 1_555 ? 
73  AC3 28 HOH F .   ? HOH A 1005 . ? 1_555 ? 
74  AC3 28 HOH F .   ? HOH A 1008 . ? 1_555 ? 
75  AC3 28 HOH F .   ? HOH A 1010 . ? 1_555 ? 
76  AC4 28 LYS A 66  ? LYS A 66   . ? 1_555 ? 
77  AC4 28 GLY A 194 ? GLY A 194  . ? 1_555 ? 
78  AC4 28 ALA A 195 ? ALA A 195  . ? 1_555 ? 
79  AC4 28 GLY A 196 ? GLY A 196  . ? 1_555 ? 
80  AC4 28 TYR A 197 ? TYR A 197  . ? 1_555 ? 
81  AC4 28 ILE A 198 ? ILE A 198  . ? 1_555 ? 
82  AC4 28 GLU A 201 ? GLU A 201  . ? 1_555 ? 
83  AC4 28 ARG A 218 ? ARG A 218  . ? 1_555 ? 
84  AC4 28 ARG A 224 ? ARG A 224  . ? 1_555 ? 
85  AC4 28 GLY A 290 ? GLY A 290  . ? 1_555 ? 
86  AC4 28 ARG A 291 ? ARG A 291  . ? 1_555 ? 
87  AC4 28 LEU A 337 ? LEU A 337  . ? 1_555 ? 
88  AC4 28 LEU A 338 ? LEU A 338  . ? 1_555 ? 
89  AC4 28 VAL A 370 ? VAL A 370  . ? 1_555 ? 
90  AC4 28 FAD C .   ? FAD A 479  . ? 1_555 ? 
91  AC4 28 NAD D .   ? NAD A 480  . ? 1_555 ? 
92  AC4 28 PO4 B .   ? PO4 A 481  . ? 1_555 ? 
93  AC4 28 HOH F .   ? HOH A 500  . ? 1_555 ? 
94  AC4 28 HOH F .   ? HOH A 503  . ? 1_555 ? 
95  AC4 28 HOH F .   ? HOH A 511  . ? 1_555 ? 
96  AC4 28 HOH F .   ? HOH A 514  . ? 1_555 ? 
97  AC4 28 HOH F .   ? HOH A 524  . ? 1_555 ? 
98  AC4 28 HOH F .   ? HOH A 594  . ? 1_555 ? 
99  AC4 28 HOH F .   ? HOH A 838  . ? 1_555 ? 
100 AC4 28 HOH F .   ? HOH A 984  . ? 1_555 ? 
101 AC4 28 HOH F .   ? HOH A 1005 . ? 1_555 ? 
102 AC4 28 HOH F .   ? HOH A 1008 . ? 1_555 ? 
103 AC4 28 HOH F .   ? HOH A 1010 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1GRB 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1GRB 
_atom_sites.fract_transf_matrix[1][1]   0.008347 
_atom_sites.fract_transf_matrix[1][2]   -0.005075 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013850 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.015823 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_sites_footnote.id 
_atom_sites_footnote.text 
1 'RESIDUES PRO 375 AND PRO 468 ARE CIS PROLINES.' 
2 
;MODEL OF NADPH BOUND TO GLUTATHIONE REDUCTASE AS COMPOSED OF NADH AND 2',5'-ADP ACCORDING TO KARPLUS & SCHULZ, J. MOL. BIOL. 210, 163-180 (1989)
;
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . VAL A 1 18  ? 33.088  51.016 30.119  1.00 41.49 ? 18   VAL A N     1 
ATOM   2    C CA    . VAL A 1 18  ? 34.511  51.008 30.512  1.00 41.47 ? 18   VAL A CA    1 
ATOM   3    C C     . VAL A 1 18  ? 34.943  49.584 30.843  1.00 34.04 ? 18   VAL A C     1 
ATOM   4    O O     . VAL A 1 18  ? 34.662  49.061 31.931  1.00 39.98 ? 18   VAL A O     1 
ATOM   5    C CB    . VAL A 1 18  ? 34.960  51.956 31.656  1.00 32.85 ? 18   VAL A CB    1 
ATOM   6    C CG1   . VAL A 1 18  ? 36.492  51.986 31.754  1.00 30.19 ? 18   VAL A CG1   1 
ATOM   7    C CG2   . VAL A 1 18  ? 34.477  53.405 31.520  1.00 34.89 ? 18   VAL A CG2   1 
ATOM   8    N N     . ALA A 1 19  ? 35.663  48.972 29.907  1.00 24.03 ? 19   ALA A N     1 
ATOM   9    C CA    . ALA A 1 19  ? 36.204  47.642 30.108  1.00 20.09 ? 19   ALA A CA    1 
ATOM   10   C C     . ALA A 1 19  ? 37.445  47.681 31.010  1.00 21.90 ? 19   ALA A C     1 
ATOM   11   O O     . ALA A 1 19  ? 38.404  48.434 30.813  1.00 21.46 ? 19   ALA A O     1 
ATOM   12   C CB    . ALA A 1 19  ? 36.507  47.022 28.753  1.00 21.00 ? 19   ALA A CB    1 
ATOM   13   N N     . SER A 1 20  ? 37.437  46.835 32.008  1.00 14.09 ? 20   SER A N     1 
ATOM   14   C CA    . SER A 1 20  ? 38.521  46.827 32.953  1.00 12.17 ? 20   SER A CA    1 
ATOM   15   C C     . SER A 1 20  ? 39.451  45.634 32.733  1.00 28.71 ? 20   SER A C     1 
ATOM   16   O O     . SER A 1 20  ? 39.007  44.568 32.311  1.00 25.40 ? 20   SER A O     1 
ATOM   17   C CB    . SER A 1 20  ? 37.895  46.900 34.331  1.00 13.28 ? 20   SER A CB    1 
ATOM   18   O OG    . SER A 1 20  ? 38.907  47.152 35.285  1.00 50.60 ? 20   SER A OG    1 
ATOM   19   N N     . TYR A 1 21  ? 40.754  45.852 32.954  1.00 20.42 ? 21   TYR A N     1 
ATOM   20   C CA    . TYR A 1 21  ? 41.767  44.808 32.848  1.00 20.17 ? 21   TYR A CA    1 
ATOM   21   C C     . TYR A 1 21  ? 42.654  44.878 34.055  1.00 13.68 ? 21   TYR A C     1 
ATOM   22   O O     . TYR A 1 21  ? 42.522  45.802 34.842  1.00 21.03 ? 21   TYR A O     1 
ATOM   23   C CB    . TYR A 1 21  ? 42.657  44.920 31.580  1.00 19.52 ? 21   TYR A CB    1 
ATOM   24   C CG    . TYR A 1 21  ? 41.927  44.689 30.295  1.00 12.18 ? 21   TYR A CG    1 
ATOM   25   C CD1   . TYR A 1 21  ? 41.183  45.712 29.708  1.00 17.70 ? 21   TYR A CD1   1 
ATOM   26   C CD2   . TYR A 1 21  ? 41.971  43.434 29.683  1.00 11.72 ? 21   TYR A CD2   1 
ATOM   27   C CE1   . TYR A 1 21  ? 40.465  45.491 28.530  1.00 32.17 ? 21   TYR A CE1   1 
ATOM   28   C CE2   . TYR A 1 21  ? 41.284  43.208 28.491  1.00 14.09 ? 21   TYR A CE2   1 
ATOM   29   C CZ    . TYR A 1 21  ? 40.533  44.238 27.926  1.00 22.78 ? 21   TYR A CZ    1 
ATOM   30   O OH    . TYR A 1 21  ? 39.873  44.028 26.732  1.00 28.77 ? 21   TYR A OH    1 
ATOM   31   N N     . ASP A 1 22  ? 43.565  43.907 34.194  1.00 16.55 ? 22   ASP A N     1 
ATOM   32   C CA    . ASP A 1 22  ? 44.545  43.967 35.276  1.00 17.33 ? 22   ASP A CA    1 
ATOM   33   C C     . ASP A 1 22  ? 45.700  44.845 34.851  1.00 22.70 ? 22   ASP A C     1 
ATOM   34   O O     . ASP A 1 22  ? 46.314  45.538 35.671  1.00 24.77 ? 22   ASP A O     1 
ATOM   35   C CB    . ASP A 1 22  ? 45.109  42.606 35.718  1.00 19.05 ? 22   ASP A CB    1 
ATOM   36   C CG    . ASP A 1 22  ? 44.029  41.730 36.290  1.00 38.97 ? 22   ASP A CG    1 
ATOM   37   O OD1   . ASP A 1 22  ? 43.104  42.403 36.944  1.00 45.95 ? 22   ASP A OD1   1 
ATOM   38   O OD2   . ASP A 1 22  ? 43.904  40.567 35.975  1.00 29.78 ? 22   ASP A OD2   1 
ATOM   39   N N     . TYR A 1 23  ? 45.979  44.785 33.559  1.00 16.05 ? 23   TYR A N     1 
ATOM   40   C CA    . TYR A 1 23  ? 47.125  45.514 33.026  1.00 10.67 ? 23   TYR A CA    1 
ATOM   41   C C     . TYR A 1 23  ? 46.778  45.986 31.631  1.00 12.00 ? 23   TYR A C     1 
ATOM   42   O O     . TYR A 1 23  ? 46.323  45.209 30.798  1.00 17.04 ? 23   TYR A O     1 
ATOM   43   C CB    . TYR A 1 23  ? 48.240  44.497 32.902  1.00 11.80 ? 23   TYR A CB    1 
ATOM   44   C CG    . TYR A 1 23  ? 49.624  45.077 32.833  1.00 13.67 ? 23   TYR A CG    1 
ATOM   45   C CD1   . TYR A 1 23  ? 49.948  46.269 33.483  1.00 19.80 ? 23   TYR A CD1   1 
ATOM   46   C CD2   . TYR A 1 23  ? 50.650  44.370 32.192  1.00 16.23 ? 23   TYR A CD2   1 
ATOM   47   C CE1   . TYR A 1 23  ? 51.249  46.785 33.490  1.00 18.08 ? 23   TYR A CE1   1 
ATOM   48   C CE2   . TYR A 1 23  ? 51.960  44.842 32.214  1.00 15.18 ? 23   TYR A CE2   1 
ATOM   49   C CZ    . TYR A 1 23  ? 52.238  46.065 32.833  1.00 15.07 ? 23   TYR A CZ    1 
ATOM   50   O OH    . TYR A 1 23  ? 53.521  46.530 32.839  1.00 16.01 ? 23   TYR A OH    1 
ATOM   51   N N     . LEU A 1 24  ? 46.999  47.277 31.381  1.00 10.74 ? 24   LEU A N     1 
ATOM   52   C CA    . LEU A 1 24  ? 46.769  47.889 30.092  1.00 8.86  ? 24   LEU A CA    1 
ATOM   53   C C     . LEU A 1 24  ? 48.131  48.406 29.668  1.00 15.37 ? 24   LEU A C     1 
ATOM   54   O O     . LEU A 1 24  ? 48.739  49.196 30.400  1.00 15.42 ? 24   LEU A O     1 
ATOM   55   C CB    . LEU A 1 24  ? 45.897  49.128 30.273  1.00 17.59 ? 24   LEU A CB    1 
ATOM   56   C CG    . LEU A 1 24  ? 44.531  49.025 29.636  1.00 31.66 ? 24   LEU A CG    1 
ATOM   57   C CD1   . LEU A 1 24  ? 43.804  50.349 29.846  1.00 27.87 ? 24   LEU A CD1   1 
ATOM   58   C CD2   . LEU A 1 24  ? 44.677  48.717 28.146  1.00 36.85 ? 24   LEU A CD2   1 
ATOM   59   N N     . VAL A 1 25  ? 48.552  48.027 28.475  1.00 11.50 ? 25   VAL A N     1 
ATOM   60   C CA    . VAL A 1 25  ? 49.849  48.395 27.924  1.00 14.74 ? 25   VAL A CA    1 
ATOM   61   C C     . VAL A 1 25  ? 49.582  49.242 26.668  1.00 17.43 ? 25   VAL A C     1 
ATOM   62   O O     . VAL A 1 25  ? 48.862  48.773 25.754  1.00 18.57 ? 25   VAL A O     1 
ATOM   63   C CB    . VAL A 1 25  ? 50.662  47.125 27.631  1.00 8.57  ? 25   VAL A CB    1 
ATOM   64   C CG1   . VAL A 1 25  ? 51.909  47.416 26.797  1.00 5.00  ? 25   VAL A CG1   1 
ATOM   65   C CG2   . VAL A 1 25  ? 51.037  46.428 28.927  1.00 13.59 ? 25   VAL A CG2   1 
ATOM   66   N N     . ILE A 1 26  ? 50.116  50.490 26.645  1.00 16.84 ? 26   ILE A N     1 
ATOM   67   C CA    . ILE A 1 26  ? 50.006  51.381 25.494  1.00 17.64 ? 26   ILE A CA    1 
ATOM   68   C C     . ILE A 1 26  ? 51.285  51.284 24.680  1.00 19.64 ? 26   ILE A C     1 
ATOM   69   O O     . ILE A 1 26  ? 52.351  51.704 25.128  1.00 16.76 ? 26   ILE A O     1 
ATOM   70   C CB    . ILE A 1 26  ? 49.682  52.842 25.839  1.00 21.41 ? 26   ILE A CB    1 
ATOM   71   C CG1   . ILE A 1 26  ? 48.445  52.891 26.729  1.00 19.88 ? 26   ILE A CG1   1 
ATOM   72   C CG2   . ILE A 1 26  ? 49.380  53.624 24.565  1.00 13.70 ? 26   ILE A CG2   1 
ATOM   73   C CD1   . ILE A 1 26  ? 48.294  54.245 27.407  1.00 23.68 ? 26   ILE A CD1   1 
ATOM   74   N N     . GLY A 1 27  ? 51.186  50.613 23.529  1.00 14.99 ? 27   GLY A N     1 
ATOM   75   C CA    . GLY A 1 27  ? 52.288  50.445 22.623  1.00 12.66 ? 27   GLY A CA    1 
ATOM   76   C C     . GLY A 1 27  ? 52.655  48.980 22.529  1.00 14.70 ? 27   GLY A C     1 
ATOM   77   O O     . GLY A 1 27  ? 52.986  48.359 23.527  1.00 14.14 ? 27   GLY A O     1 
ATOM   78   N N     . GLY A 1 28  ? 52.645  48.436 21.315  1.00 16.15 ? 28   GLY A N     1 
ATOM   79   C CA    . GLY A 1 28  ? 53.015  47.042 21.123  1.00 11.17 ? 28   GLY A CA    1 
ATOM   80   C C     . GLY A 1 28  ? 54.421  46.867 20.556  1.00 24.60 ? 28   GLY A C     1 
ATOM   81   O O     . GLY A 1 28  ? 54.590  46.099 19.601  1.00 18.39 ? 28   GLY A O     1 
ATOM   82   N N     . GLY A 1 29  ? 55.425  47.552 21.145  1.00 11.43 ? 29   GLY A N     1 
ATOM   83   C CA    . GLY A 1 29  ? 56.791  47.389 20.697  1.00 10.28 ? 29   GLY A CA    1 
ATOM   84   C C     . GLY A 1 29  ? 57.522  46.451 21.660  1.00 17.15 ? 29   GLY A C     1 
ATOM   85   O O     . GLY A 1 29  ? 56.889  45.689 22.397  1.00 16.23 ? 29   GLY A O     1 
ATOM   86   N N     . SER A 1 30  ? 58.848  46.506 21.673  1.00 9.51  ? 30   SER A N     1 
ATOM   87   C CA    . SER A 1 30  ? 59.616  45.589 22.510  1.00 9.63  ? 30   SER A CA    1 
ATOM   88   C C     . SER A 1 30  ? 59.259  45.600 23.969  1.00 10.18 ? 30   SER A C     1 
ATOM   89   O O     . SER A 1 30  ? 59.136  44.545 24.589  1.00 14.16 ? 30   SER A O     1 
ATOM   90   C CB    . SER A 1 30  ? 61.099  45.942 22.425  1.00 14.62 ? 30   SER A CB    1 
ATOM   91   O OG    . SER A 1 30  ? 61.521  45.615 21.130  1.00 24.99 ? 30   SER A OG    1 
ATOM   92   N N     . GLY A 1 31  ? 59.239  46.795 24.550  1.00 11.20 ? 31   GLY A N     1 
ATOM   93   C CA    . GLY A 1 31  ? 59.001  46.934 25.980  1.00 9.17  ? 31   GLY A CA    1 
ATOM   94   C C     . GLY A 1 31  ? 57.561  46.565 26.353  1.00 16.74 ? 31   GLY A C     1 
ATOM   95   O O     . GLY A 1 31  ? 57.342  45.945 27.383  1.00 14.86 ? 31   GLY A O     1 
ATOM   96   N N     . GLY A 1 32  ? 56.600  47.014 25.548  1.00 12.44 ? 32   GLY A N     1 
ATOM   97   C CA    . GLY A 1 32  ? 55.204  46.806 25.779  1.00 11.26 ? 32   GLY A CA    1 
ATOM   98   C C     . GLY A 1 32  ? 54.836  45.328 25.660  1.00 17.09 ? 32   GLY A C     1 
ATOM   99   O O     . GLY A 1 32  ? 54.173  44.772 26.521  1.00 14.18 ? 32   GLY A O     1 
ATOM   100  N N     . LEU A 1 33  ? 55.263  44.687 24.587  1.00 16.98 ? 33   LEU A N     1 
ATOM   101  C CA    . LEU A 1 33  ? 55.008  43.266 24.409  1.00 12.31 ? 33   LEU A CA    1 
ATOM   102  C C     . LEU A 1 33  ? 55.649  42.435 25.525  1.00 24.92 ? 33   LEU A C     1 
ATOM   103  O O     . LEU A 1 33  ? 54.998  41.536 26.093  1.00 19.38 ? 33   LEU A O     1 
ATOM   104  C CB    . LEU A 1 33  ? 55.544  42.767 23.050  1.00 12.35 ? 33   LEU A CB    1 
ATOM   105  C CG    . LEU A 1 33  ? 54.843  43.433 21.895  1.00 13.08 ? 33   LEU A CG    1 
ATOM   106  C CD1   . LEU A 1 33  ? 55.224  42.767 20.596  1.00 20.49 ? 33   LEU A CD1   1 
ATOM   107  C CD2   . LEU A 1 33  ? 53.336  43.361 22.162  1.00 16.02 ? 33   LEU A CD2   1 
ATOM   108  N N     . ALA A 1 34  ? 56.946  42.674 25.799  1.00 14.79 ? 34   ALA A N     1 
ATOM   109  C CA    . ALA A 1 34  ? 57.657  41.906 26.801  1.00 17.55 ? 34   ALA A CA    1 
ATOM   110  C C     . ALA A 1 34  ? 56.939  41.975 28.166  1.00 14.03 ? 34   ALA A C     1 
ATOM   111  O O     . ALA A 1 34  ? 56.848  40.960 28.881  1.00 15.25 ? 34   ALA A O     1 
ATOM   112  C CB    . ALA A 1 34  ? 59.111  42.352 26.903  1.00 12.88 ? 34   ALA A CB    1 
ATOM   113  N N     . SER A 1 35  ? 56.496  43.178 28.558  1.00 9.07  ? 35   SER A N     1 
ATOM   114  C CA    . SER A 1 35  ? 55.839  43.387 29.846  1.00 10.41 ? 35   SER A CA    1 
ATOM   115  C C     . SER A 1 35  ? 54.496  42.651 29.897  1.00 9.77  ? 35   SER A C     1 
ATOM   116  O O     . SER A 1 35  ? 54.228  41.913 30.867  1.00 15.26 ? 35   SER A O     1 
ATOM   117  C CB    . SER A 1 35  ? 55.672  44.867 30.169  1.00 7.48  ? 35   SER A CB    1 
ATOM   118  O OG    . SER A 1 35  ? 55.574  45.057 31.570  1.00 9.99  ? 35   SER A OG    1 
ATOM   119  N N     . ALA A 1 36  ? 53.667  42.862 28.868  1.00 10.24 ? 36   ALA A N     1 
ATOM   120  C CA    . ALA A 1 36  ? 52.359  42.206 28.746  1.00 12.23 ? 36   ALA A CA    1 
ATOM   121  C C     . ALA A 1 36  ? 52.464  40.684 28.814  1.00 11.26 ? 36   ALA A C     1 
ATOM   122  O O     . ALA A 1 36  ? 51.734  40.039 29.559  1.00 16.01 ? 36   ALA A O     1 
ATOM   123  C CB    . ALA A 1 36  ? 51.597  42.688 27.515  1.00 8.84  ? 36   ALA A CB    1 
ATOM   124  N N     . ARG A 1 37  ? 53.402  40.112 28.076  1.00 9.42  ? 37   ARG A N     1 
ATOM   125  C CA    . ARG A 1 37  ? 53.578  38.676 28.066  1.00 14.43 ? 37   ARG A CA    1 
ATOM   126  C C     . ARG A 1 37  ? 53.994  38.141 29.435  1.00 20.12 ? 37   ARG A C     1 
ATOM   127  O O     . ARG A 1 37  ? 53.579  37.071 29.824  1.00 16.06 ? 37   ARG A O     1 
ATOM   128  C CB    . ARG A 1 37  ? 54.565  38.266 26.962  1.00 12.54 ? 37   ARG A CB    1 
ATOM   129  C CG    . ARG A 1 37  ? 53.901  38.443 25.600  1.00 26.06 ? 37   ARG A CG    1 
ATOM   130  C CD    . ARG A 1 37  ? 54.801  38.151 24.421  1.00 35.18 ? 37   ARG A CD    1 
ATOM   131  N NE    . ARG A 1 37  ? 55.076  36.730 24.311  1.00 53.91 ? 37   ARG A NE    1 
ATOM   132  C CZ    . ARG A 1 37  ? 56.304  36.208 24.420  1.00 67.04 ? 37   ARG A CZ    1 
ATOM   133  N NH1   . ARG A 1 37  ? 57.350  37.024 24.631  1.00 66.66 ? 37   ARG A NH1   1 
ATOM   134  N NH2   . ARG A 1 37  ? 56.504  34.887 24.343  1.00 66.06 ? 37   ARG A NH2   1 
ATOM   135  N N     . ARG A 1 38  ? 54.861  38.833 30.160  1.00 11.08 ? 38   ARG A N     1 
ATOM   136  C CA    . ARG A 1 38  ? 55.283  38.307 31.443  1.00 13.83 ? 38   ARG A CA    1 
ATOM   137  C C     . ARG A 1 38  ? 54.137  38.482 32.418  1.00 9.86  ? 38   ARG A C     1 
ATOM   138  O O     . ARG A 1 38  ? 53.910  37.628 33.244  1.00 12.27 ? 38   ARG A O     1 
ATOM   139  C CB    . ARG A 1 38  ? 56.571  38.980 31.948  1.00 10.16 ? 38   ARG A CB    1 
ATOM   140  C CG    . ARG A 1 38  ? 57.117  38.420 33.251  1.00 15.02 ? 38   ARG A CG    1 
ATOM   141  C CD    . ARG A 1 38  ? 57.565  36.962 33.133  1.00 19.56 ? 38   ARG A CD    1 
ATOM   142  N NE    . ARG A 1 38  ? 58.298  36.677 31.907  1.00 23.12 ? 38   ARG A NE    1 
ATOM   143  C CZ    . ARG A 1 38  ? 59.622  36.596 31.856  1.00 31.70 ? 38   ARG A CZ    1 
ATOM   144  N NH1   . ARG A 1 38  ? 60.331  36.788 32.971  1.00 33.07 ? 38   ARG A NH1   1 
ATOM   145  N NH2   . ARG A 1 38  ? 60.282  36.377 30.724  1.00 20.23 ? 38   ARG A NH2   1 
ATOM   146  N N     . ALA A 1 39  ? 53.427  39.590 32.341  1.00 9.80  ? 39   ALA A N     1 
ATOM   147  C CA    . ALA A 1 39  ? 52.316  39.813 33.254  1.00 9.75  ? 39   ALA A CA    1 
ATOM   148  C C     . ALA A 1 39  ? 51.282  38.700 33.057  1.00 20.90 ? 39   ALA A C     1 
ATOM   149  O O     . ALA A 1 39  ? 50.728  38.173 34.016  1.00 15.68 ? 39   ALA A O     1 
ATOM   150  C CB    . ALA A 1 39  ? 51.620  41.127 32.947  1.00 9.76  ? 39   ALA A CB    1 
ATOM   151  N N     . ALA A 1 40  ? 50.927  38.421 31.805  1.00 14.87 ? 40   ALA A N     1 
ATOM   152  C CA    . ALA A 1 40  ? 49.963  37.363 31.513  1.00 12.80 ? 40   ALA A CA    1 
ATOM   153  C C     . ALA A 1 40  ? 50.434  36.016 32.077  1.00 22.22 ? 40   ALA A C     1 
ATOM   154  O O     . ALA A 1 40  ? 49.611  35.223 32.515  1.00 19.06 ? 40   ALA A O     1 
ATOM   155  C CB    . ALA A 1 40  ? 49.669  37.234 30.016  1.00 16.25 ? 40   ALA A CB    1 
ATOM   156  N N     . GLU A 1 41  ? 51.731  35.719 32.064  1.00 15.70 ? 41   GLU A N     1 
ATOM   157  C CA    . GLU A 1 41  ? 52.215  34.460 32.640  1.00 19.02 ? 41   GLU A CA    1 
ATOM   158  C C     . GLU A 1 41  ? 51.935  34.403 34.129  1.00 21.02 ? 41   GLU A C     1 
ATOM   159  O O     . GLU A 1 41  ? 51.845  33.328 34.707  1.00 19.70 ? 41   GLU A O     1 
ATOM   160  C CB    . GLU A 1 41  ? 53.733  34.258 32.536  1.00 14.99 ? 41   GLU A CB    1 
ATOM   161  C CG    . GLU A 1 41  ? 54.340  34.186 31.124  1.00 34.61 ? 41   GLU A CG    1 
ATOM   162  C CD    . GLU A 1 41  ? 55.830  33.982 31.239  1.00 43.63 ? 41   GLU A CD    1 
ATOM   163  O OE1   . GLU A 1 41  ? 56.375  33.530 32.245  1.00 42.89 ? 41   GLU A OE1   1 
ATOM   164  O OE2   . GLU A 1 41  ? 56.466  34.523 30.232  1.00 52.76 ? 41   GLU A OE2   1 
ATOM   165  N N     . LEU A 1 42  ? 51.894  35.571 34.751  1.00 16.12 ? 42   LEU A N     1 
ATOM   166  C CA    . LEU A 1 42  ? 51.707  35.684 36.182  1.00 16.78 ? 42   LEU A CA    1 
ATOM   167  C C     . LEU A 1 42  ? 50.220  35.697 36.545  1.00 20.32 ? 42   LEU A C     1 
ATOM   168  O O     . LEU A 1 42  ? 49.844  35.814 37.720  1.00 16.94 ? 42   LEU A O     1 
ATOM   169  C CB    . LEU A 1 42  ? 52.506  36.899 36.734  1.00 15.82 ? 42   LEU A CB    1 
ATOM   170  C CG    . LEU A 1 42  ? 54.019  36.731 36.538  1.00 12.27 ? 42   LEU A CG    1 
ATOM   171  C CD1   . LEU A 1 42  ? 54.725  38.000 37.011  1.00 11.15 ? 42   LEU A CD1   1 
ATOM   172  C CD2   . LEU A 1 42  ? 54.547  35.572 37.370  1.00 12.92 ? 42   LEU A CD2   1 
ATOM   173  N N     . GLY A 1 43  ? 49.361  35.597 35.530  1.00 9.82  ? 43   GLY A N     1 
ATOM   174  C CA    . GLY A 1 43  ? 47.915  35.497 35.748  1.00 18.91 ? 43   GLY A CA    1 
ATOM   175  C C     . GLY A 1 43  ? 47.169  36.771 35.421  1.00 16.03 ? 43   GLY A C     1 
ATOM   176  O O     . GLY A 1 43  ? 45.956  36.792 35.391  1.00 15.89 ? 43   GLY A O     1 
ATOM   177  N N     . ALA A 1 44  ? 47.875  37.853 35.122  1.00 16.17 ? 44   ALA A N     1 
ATOM   178  C CA    . ALA A 1 44  ? 47.180  39.102 34.793  1.00 9.14  ? 44   ALA A CA    1 
ATOM   179  C C     . ALA A 1 44  ? 46.347  39.001 33.535  1.00 13.66 ? 44   ALA A C     1 
ATOM   180  O O     . ALA A 1 44  ? 46.733  38.432 32.521  1.00 20.52 ? 44   ALA A O     1 
ATOM   181  C CB    . ALA A 1 44  ? 48.152  40.281 34.605  1.00 18.81 ? 44   ALA A CB    1 
ATOM   182  N N     . ARG A 1 45  ? 45.204  39.639 33.583  1.00 10.87 ? 45   ARG A N     1 
ATOM   183  C CA    . ARG A 1 45  ? 44.369  39.766 32.406  1.00 15.43 ? 45   ARG A CA    1 
ATOM   184  C C     . ARG A 1 45  ? 44.782  41.111 31.768  1.00 14.04 ? 45   ARG A C     1 
ATOM   185  O O     . ARG A 1 45  ? 44.487  42.197 32.291  1.00 20.05 ? 45   ARG A O     1 
ATOM   186  C CB    . ARG A 1 45  ? 42.898  39.746 32.827  1.00 22.36 ? 45   ARG A CB    1 
ATOM   187  C CG    . ARG A 1 45  ? 41.969  40.162 31.720  1.00 47.33 ? 45   ARG A CG    1 
ATOM   188  C CD    . ARG A 1 45  ? 41.861  39.070 30.672  1.00 64.50 ? 45   ARG A CD    1 
ATOM   189  N NE    . ARG A 1 45  ? 41.067  39.438 29.495  1.00 70.31 ? 45   ARG A NE    1 
ATOM   190  C CZ    . ARG A 1 45  ? 41.586  39.678 28.282  1.00 70.78 ? 45   ARG A CZ    1 
ATOM   191  N NH1   . ARG A 1 45  ? 42.932  39.652 28.093  1.00 37.91 ? 45   ARG A NH1   1 
ATOM   192  N NH2   . ARG A 1 45  ? 40.766  39.933 27.250  1.00 65.76 ? 45   ARG A NH2   1 
ATOM   193  N N     . ALA A 1 46  ? 45.542  41.006 30.682  1.00 20.65 ? 46   ALA A N     1 
ATOM   194  C CA    . ALA A 1 46  ? 46.167  42.130 29.999  1.00 16.65 ? 46   ALA A CA    1 
ATOM   195  C C     . ALA A 1 46  ? 45.658  42.380 28.590  1.00 22.03 ? 46   ALA A C     1 
ATOM   196  O O     . ALA A 1 46  ? 45.201  41.478 27.925  1.00 14.62 ? 46   ALA A O     1 
ATOM   197  C CB    . ALA A 1 46  ? 47.663  41.819 29.933  1.00 5.00  ? 46   ALA A CB    1 
ATOM   198  N N     . ALA A 1 47  ? 45.743  43.632 28.153  1.00 17.16 ? 47   ALA A N     1 
ATOM   199  C CA    . ALA A 1 47  ? 45.397  44.016 26.801  1.00 14.50 ? 47   ALA A CA    1 
ATOM   200  C C     . ALA A 1 47  ? 46.547  44.922 26.327  1.00 23.51 ? 47   ALA A C     1 
ATOM   201  O O     . ALA A 1 47  ? 47.168  45.616 27.145  1.00 19.90 ? 47   ALA A O     1 
ATOM   202  C CB    . ALA A 1 47  ? 44.123  44.832 26.792  1.00 9.47  ? 47   ALA A CB    1 
ATOM   203  N N     . VAL A 1 48  ? 46.878  44.866 25.034  1.00 17.03 ? 48   VAL A N     1 
ATOM   204  C CA    . VAL A 1 48  ? 47.931  45.696 24.446  1.00 14.12 ? 48   VAL A CA    1 
ATOM   205  C C     . VAL A 1 48  ? 47.265  46.619 23.419  1.00 15.83 ? 48   VAL A C     1 
ATOM   206  O O     . VAL A 1 48  ? 46.566  46.147 22.543  1.00 21.38 ? 48   VAL A O     1 
ATOM   207  C CB    . VAL A 1 48  ? 49.035  44.834 23.802  1.00 12.02 ? 48   VAL A CB    1 
ATOM   208  C CG1   . VAL A 1 48  ? 49.985  45.691 22.974  1.00 15.47 ? 48   VAL A CG1   1 
ATOM   209  C CG2   . VAL A 1 48  ? 49.831  44.073 24.846  1.00 16.84 ? 48   VAL A CG2   1 
ATOM   210  N N     . VAL A 1 49  ? 47.411  47.943 23.550  1.00 10.00 ? 49   VAL A N     1 
ATOM   211  C CA    . VAL A 1 49  ? 46.861  48.850 22.543  1.00 8.85  ? 49   VAL A CA    1 
ATOM   212  C C     . VAL A 1 49  ? 47.955  49.174 21.519  1.00 18.60 ? 49   VAL A C     1 
ATOM   213  O O     . VAL A 1 49  ? 49.065  49.535 21.892  1.00 21.62 ? 49   VAL A O     1 
ATOM   214  C CB    . VAL A 1 49  ? 46.416  50.160 23.174  1.00 13.09 ? 49   VAL A CB    1 
ATOM   215  C CG1   . VAL A 1 49  ? 45.629  50.990 22.165  1.00 21.61 ? 49   VAL A CG1   1 
ATOM   216  C CG2   . VAL A 1 49  ? 45.557  49.943 24.397  1.00 17.12 ? 49   VAL A CG2   1 
ATOM   217  N N     . GLU A 1 50  ? 47.711  49.000 20.230  1.00 12.34 ? 50   GLU A N     1 
ATOM   218  C CA    . GLU A 1 50  ? 48.722  49.262 19.222  1.00 11.89 ? 50   GLU A CA    1 
ATOM   219  C C     . GLU A 1 50  ? 48.086  49.904 18.023  1.00 10.44 ? 50   GLU A C     1 
ATOM   220  O O     . GLU A 1 50  ? 47.069  49.444 17.489  1.00 18.18 ? 50   GLU A O     1 
ATOM   221  C CB    . GLU A 1 50  ? 49.572  48.033 18.827  1.00 14.53 ? 50   GLU A CB    1 
ATOM   222  C CG    . GLU A 1 50  ? 50.438  48.278 17.570  1.00 20.50 ? 50   GLU A CG    1 
ATOM   223  C CD    . GLU A 1 50  ? 51.555  49.274 17.784  1.00 20.86 ? 50   GLU A CD    1 
ATOM   224  O OE1   . GLU A 1 50  ? 52.320  49.229 18.732  1.00 15.00 ? 50   GLU A OE1   1 
ATOM   225  O OE2   . GLU A 1 50  ? 51.558  50.239 16.892  1.00 13.01 ? 50   GLU A OE2   1 
ATOM   226  N N     . SER A 1 51  ? 48.652  51.023 17.623  1.00 14.91 ? 51   SER A N     1 
ATOM   227  C CA    . SER A 1 51  ? 48.030  51.763 16.556  1.00 22.22 ? 51   SER A CA    1 
ATOM   228  C C     . SER A 1 51  ? 48.626  51.424 15.210  1.00 30.16 ? 51   SER A C     1 
ATOM   229  O O     . SER A 1 51  ? 48.006  51.777 14.209  1.00 26.37 ? 51   SER A O     1 
ATOM   230  C CB    . SER A 1 51  ? 48.062  53.268 16.769  1.00 27.11 ? 51   SER A CB    1 
ATOM   231  O OG    . SER A 1 51  ? 49.409  53.709 16.815  1.00 23.22 ? 51   SER A OG    1 
ATOM   232  N N     . HIS A 1 52  ? 49.841  50.815 15.171  1.00 21.45 ? 52   HIS A N     1 
ATOM   233  C CA    . HIS A 1 52  ? 50.432  50.443 13.897  1.00 15.69 ? 52   HIS A CA    1 
ATOM   234  C C     . HIS A 1 52  ? 50.675  48.953 13.805  1.00 24.47 ? 52   HIS A C     1 
ATOM   235  O O     . HIS A 1 52  ? 49.731  48.151 13.849  1.00 26.91 ? 52   HIS A O     1 
ATOM   236  C CB    . HIS A 1 52  ? 51.712  51.211 13.578  1.00 32.04 ? 52   HIS A CB    1 
ATOM   237  C CG    . HIS A 1 52  ? 51.338  52.635 13.577  1.00 45.50 ? 52   HIS A CG    1 
ATOM   238  N ND1   . HIS A 1 52  ? 51.081  53.317 12.388  1.00 59.35 ? 52   HIS A ND1   1 
ATOM   239  C CD2   . HIS A 1 52  ? 51.052  53.461 14.623  1.00 49.99 ? 52   HIS A CD2   1 
ATOM   240  C CE1   . HIS A 1 52  ? 50.699  54.556 12.742  1.00 54.06 ? 52   HIS A CE1   1 
ATOM   241  N NE2   . HIS A 1 52  ? 50.659  54.669 14.075  1.00 52.24 ? 52   HIS A NE2   1 
ATOM   242  N N     . LYS A 1 53  ? 51.955  48.580 13.673  1.00 16.59 ? 53   LYS A N     1 
ATOM   243  C CA    . LYS A 1 53  ? 52.312  47.174 13.550  1.00 14.94 ? 53   LYS A CA    1 
ATOM   244  C C     . LYS A 1 53  ? 52.980  46.647 14.790  1.00 15.93 ? 53   LYS A C     1 
ATOM   245  O O     . LYS A 1 53  ? 53.847  47.286 15.379  1.00 23.77 ? 53   LYS A O     1 
ATOM   246  C CB    . LYS A 1 53  ? 53.240  46.923 12.373  1.00 25.89 ? 53   LYS A CB    1 
ATOM   247  C CG    . LYS A 1 53  ? 52.826  47.686 11.119  1.00 35.44 ? 53   LYS A CG    1 
ATOM   248  C CD    . LYS A 1 53  ? 53.054  46.902 9.833   1.00 45.20 ? 53   LYS A CD    1 
ATOM   249  C CE    . LYS A 1 53  ? 53.100  47.787 8.587   1.00 55.32 ? 53   LYS A CE    1 
ATOM   250  N NZ    . LYS A 1 53  ? 54.267  47.558 7.698   1.00 52.22 ? 53   LYS A NZ    1 
ATOM   251  N N     . LEU A 1 54  ? 52.610  45.437 15.169  1.00 15.59 ? 54   LEU A N     1 
ATOM   252  C CA    . LEU A 1 54  ? 53.247  44.875 16.322  1.00 21.52 ? 54   LEU A CA    1 
ATOM   253  C C     . LEU A 1 54  ? 54.731  44.665 16.057  1.00 18.43 ? 54   LEU A C     1 
ATOM   254  O O     . LEU A 1 54  ? 55.159  44.366 14.939  1.00 16.32 ? 54   LEU A O     1 
ATOM   255  C CB    . LEU A 1 54  ? 52.551  43.564 16.703  1.00 24.51 ? 54   LEU A CB    1 
ATOM   256  C CG    . LEU A 1 54  ? 51.088  43.767 17.060  1.00 27.58 ? 54   LEU A CG    1 
ATOM   257  C CD1   . LEU A 1 54  ? 50.365  42.422 16.955  1.00 35.70 ? 54   LEU A CD1   1 
ATOM   258  C CD2   . LEU A 1 54  ? 50.946  44.308 18.484  1.00 18.12 ? 54   LEU A CD2   1 
ATOM   259  N N     . GLY A 1 55  ? 55.514  44.704 17.122  1.00 11.30 ? 55   GLY A N     1 
ATOM   260  C CA    . GLY A 1 55  ? 56.932  44.478 16.960  1.00 13.06 ? 55   GLY A CA    1 
ATOM   261  C C     . GLY A 1 55  ? 57.563  45.847 17.081  1.00 14.85 ? 55   GLY A C     1 
ATOM   262  O O     . GLY A 1 55  ? 58.725  45.935 17.397  1.00 20.97 ? 55   GLY A O     1 
ATOM   263  N N     . GLY A 1 56  ? 56.777  46.886 16.826  1.00 10.63 ? 56   GLY A N     1 
ATOM   264  C CA    . GLY A 1 56  ? 57.155  48.293 16.963  1.00 12.30 ? 56   GLY A CA    1 
ATOM   265  C C     . GLY A 1 56  ? 58.406  48.645 16.148  1.00 22.83 ? 56   GLY A C     1 
ATOM   266  O O     . GLY A 1 56  ? 58.650  48.110 15.068  1.00 13.94 ? 56   GLY A O     1 
ATOM   267  N N     . THR A 1 57  ? 59.245  49.529 16.686  1.00 12.97 ? 57   THR A N     1 
ATOM   268  C CA    . THR A 1 57  ? 60.476  49.907 16.001  1.00 15.96 ? 57   THR A CA    1 
ATOM   269  C C     . THR A 1 57  ? 61.420  48.741 15.692  1.00 15.25 ? 57   THR A C     1 
ATOM   270  O O     . THR A 1 57  ? 61.944  48.667 14.581  1.00 11.64 ? 57   THR A O     1 
ATOM   271  C CB    . THR A 1 57  ? 61.189  51.102 16.683  1.00 16.36 ? 57   THR A CB    1 
ATOM   272  O OG1   . THR A 1 57  ? 60.304  52.195 16.739  1.00 13.83 ? 57   THR A OG1   1 
ATOM   273  C CG2   . THR A 1 57  ? 62.484  51.522 15.966  1.00 15.93 ? 57   THR A CG2   1 
ATOM   274  N N     . CYS A 1 58  ? 61.736  47.873 16.673  1.00 15.22 ? 58   CYS A N     1 
ATOM   275  C CA    . CYS A 1 58  ? 62.696  46.787 16.502  1.00 15.54 ? 58   CYS A CA    1 
ATOM   276  C C     . CYS A 1 58  ? 62.430  45.951 15.240  1.00 14.57 ? 58   CYS A C     1 
ATOM   277  O O     . CYS A 1 58  ? 63.308  45.686 14.408  1.00 16.75 ? 58   CYS A O     1 
ATOM   278  C CB    . CYS A 1 58  ? 62.709  45.912 17.779  1.00 15.67 ? 58   CYS A CB    1 
ATOM   279  S SG    . CYS A 1 58  ? 63.588  44.318 17.614  1.00 27.74 ? 58   CYS A SG    1 
ATOM   280  N N     . VAL A 1 59  ? 61.216  45.477 15.128  1.00 12.20 ? 59   VAL A N     1 
ATOM   281  C CA    . VAL A 1 59  ? 60.829  44.645 14.022  1.00 10.54 ? 59   VAL A CA    1 
ATOM   282  C C     . VAL A 1 59  ? 60.663  45.373 12.682  1.00 5.73  ? 59   VAL A C     1 
ATOM   283  O O     . VAL A 1 59  ? 61.139  44.905 11.656  1.00 16.80 ? 59   VAL A O     1 
ATOM   284  C CB    . VAL A 1 59  ? 59.528  43.927 14.398  1.00 17.79 ? 59   VAL A CB    1 
ATOM   285  C CG1   . VAL A 1 59  ? 59.080  43.038 13.238  1.00 15.49 ? 59   VAL A CG1   1 
ATOM   286  C CG2   . VAL A 1 59  ? 59.752  43.086 15.657  1.00 18.96 ? 59   VAL A CG2   1 
ATOM   287  N N     . ASN A 1 60  ? 59.930  46.478 12.668  1.00 10.83 ? 60   ASN A N     1 
ATOM   288  C CA    . ASN A 1 60  ? 59.518  47.206 11.491  1.00 5.00  ? 60   ASN A CA    1 
ATOM   289  C C     . ASN A 1 60  ? 60.527  48.134 10.848  1.00 23.70 ? 60   ASN A C     1 
ATOM   290  O O     . ASN A 1 60  ? 60.669  48.147 9.599   1.00 11.05 ? 60   ASN A O     1 
ATOM   291  C CB    . ASN A 1 60  ? 58.186  47.900 11.774  1.00 8.19  ? 60   ASN A CB    1 
ATOM   292  C CG    . ASN A 1 60  ? 57.190  46.816 12.175  1.00 12.64 ? 60   ASN A CG    1 
ATOM   293  O OD1   . ASN A 1 60  ? 56.858  45.952 11.339  1.00 19.36 ? 60   ASN A OD1   1 
ATOM   294  N ND2   . ASN A 1 60  ? 56.855  46.737 13.462  1.00 11.13 ? 60   ASN A ND2   1 
ATOM   295  N N     . VAL A 1 61  ? 61.176  48.967 11.671  1.00 14.01 ? 61   VAL A N     1 
ATOM   296  C CA    . VAL A 1 61  ? 62.091  49.945 11.141  1.00 10.06 ? 61   VAL A CA    1 
ATOM   297  C C     . VAL A 1 61  ? 63.361  50.075 11.987  1.00 11.00 ? 61   VAL A C     1 
ATOM   298  O O     . VAL A 1 61  ? 63.881  51.167 12.115  1.00 13.96 ? 61   VAL A O     1 
ATOM   299  C CB    . VAL A 1 61  ? 61.414  51.327 10.992  1.00 14.86 ? 61   VAL A CB    1 
ATOM   300  C CG1   . VAL A 1 61  ? 60.286  51.259 9.941   1.00 10.57 ? 61   VAL A CG1   1 
ATOM   301  C CG2   . VAL A 1 61  ? 60.784  51.873 12.271  1.00 12.82 ? 61   VAL A CG2   1 
ATOM   302  N N     . GLY A 1 62  ? 63.881  49.025 12.580  1.00 15.72 ? 62   GLY A N     1 
ATOM   303  C CA    . GLY A 1 62  ? 65.033  49.188 13.457  1.00 12.37 ? 62   GLY A CA    1 
ATOM   304  C C     . GLY A 1 62  ? 65.935  47.987 13.389  1.00 5.00  ? 62   GLY A C     1 
ATOM   305  O O     . GLY A 1 62  ? 66.405  47.608 12.318  1.00 12.60 ? 62   GLY A O     1 
ATOM   306  N N     . CYS A 1 63  ? 66.170  47.409 14.568  1.00 9.32  ? 63   CYS A N     1 
ATOM   307  C CA    . CYS A 1 63  ? 67.056  46.287 14.784  1.00 9.77  ? 63   CYS A CA    1 
ATOM   308  C C     . CYS A 1 63  ? 67.064  45.276 13.661  1.00 13.87 ? 63   CYS A C     1 
ATOM   309  O O     . CYS A 1 63  ? 68.089  45.011 13.052  1.00 9.58  ? 63   CYS A O     1 
ATOM   310  C CB    . CYS A 1 63  ? 66.798  45.582 16.137  1.00 10.46 ? 63   CYS A CB    1 
ATOM   311  S SG    . CYS A 1 63  ? 66.419  46.741 17.494  1.00 15.07 ? 63   CYS A SG    1 
ATOM   312  N N     . VAL A 1 64  ? 65.928  44.646 13.413  1.00 12.70 ? 64   VAL A N     1 
ATOM   313  C CA    . VAL A 1 64  ? 65.813  43.559 12.439  1.00 16.53 ? 64   VAL A CA    1 
ATOM   314  C C     . VAL A 1 64  ? 66.154  43.893 10.985  1.00 11.90 ? 64   VAL A C     1 
ATOM   315  O O     . VAL A 1 64  ? 67.102  43.296 10.456  1.00 11.12 ? 64   VAL A O     1 
ATOM   316  C CB    . VAL A 1 64  ? 64.536  42.736 12.569  1.00 14.22 ? 64   VAL A CB    1 
ATOM   317  C CG1   . VAL A 1 64  ? 64.566  41.606 11.538  1.00 8.81  ? 64   VAL A CG1   1 
ATOM   318  C CG2   . VAL A 1 64  ? 64.484  42.107 13.964  1.00 13.57 ? 64   VAL A CG2   1 
ATOM   319  N N     . PRO A 1 65  ? 65.384  44.766 10.310  1.00 12.01 ? 65   PRO A N     1 
ATOM   320  C CA    . PRO A 1 65  ? 65.703  45.158 8.947   1.00 9.76  ? 65   PRO A CA    1 
ATOM   321  C C     . PRO A 1 65  ? 67.131  45.730 8.842   1.00 8.91  ? 65   PRO A C     1 
ATOM   322  O O     . PRO A 1 65  ? 67.811  45.528 7.852   1.00 11.17 ? 65   PRO A O     1 
ATOM   323  C CB    . PRO A 1 65  ? 64.673  46.219 8.526   1.00 9.02  ? 65   PRO A CB    1 
ATOM   324  C CG    . PRO A 1 65  ? 63.963  46.671 9.787   1.00 6.97  ? 65   PRO A CG    1 
ATOM   325  C CD    . PRO A 1 65  ? 64.261  45.605 10.829  1.00 9.69  ? 65   PRO A CD    1 
ATOM   326  N N     . LYS A 1 66  ? 67.599  46.445 9.867   1.00 9.49  ? 66   LYS A N     1 
ATOM   327  C CA    . LYS A 1 66  ? 68.974  46.968 9.867   1.00 9.23  ? 66   LYS A CA    1 
ATOM   328  C C     . LYS A 1 66  ? 69.973  45.818 9.781   1.00 9.26  ? 66   LYS A C     1 
ATOM   329  O O     . LYS A 1 66  ? 70.912  45.859 8.975   1.00 9.36  ? 66   LYS A O     1 
ATOM   330  C CB    . LYS A 1 66  ? 69.252  47.877 11.088  1.00 7.29  ? 66   LYS A CB    1 
ATOM   331  C CG    . LYS A 1 66  ? 70.680  48.438 11.138  1.00 8.56  ? 66   LYS A CG    1 
ATOM   332  C CD    . LYS A 1 66  ? 71.695  47.491 11.820  1.00 11.12 ? 66   LYS A CD    1 
ATOM   333  C CE    . LYS A 1 66  ? 71.329  47.070 13.254  1.00 16.36 ? 66   LYS A CE    1 
ATOM   334  N NZ    . LYS A 1 66  ? 71.396  48.138 14.259  1.00 14.40 ? 66   LYS A NZ    1 
ATOM   335  N N     . LYS A 1 67  ? 69.837  44.810 10.652  1.00 7.32  ? 67   LYS A N     1 
ATOM   336  C CA    . LYS A 1 67  ? 70.791  43.709 10.717  1.00 5.00  ? 67   LYS A CA    1 
ATOM   337  C C     . LYS A 1 67  ? 70.838  42.966 9.396   1.00 17.15 ? 67   LYS A C     1 
ATOM   338  O O     . LYS A 1 67  ? 71.903  42.497 8.978   1.00 10.71 ? 67   LYS A O     1 
ATOM   339  C CB    . LYS A 1 67  ? 70.466  42.756 11.884  1.00 12.05 ? 67   LYS A CB    1 
ATOM   340  C CG    . LYS A 1 67  ? 71.462  41.636 12.208  1.00 12.37 ? 67   LYS A CG    1 
ATOM   341  C CD    . LYS A 1 67  ? 72.811  42.127 12.710  1.00 14.01 ? 67   LYS A CD    1 
ATOM   342  C CE    . LYS A 1 67  ? 73.888  41.055 12.834  1.00 9.08  ? 67   LYS A CE    1 
ATOM   343  N NZ    . LYS A 1 67  ? 73.612  40.061 13.905  1.00 11.73 ? 67   LYS A NZ    1 
ATOM   344  N N     . VAL A 1 68  ? 69.681  42.797 8.747   1.00 12.43 ? 68   VAL A N     1 
ATOM   345  C CA    . VAL A 1 68  ? 69.647  42.123 7.453   1.00 11.72 ? 68   VAL A CA    1 
ATOM   346  C C     . VAL A 1 68  ? 70.524  42.920 6.470   1.00 9.76  ? 68   VAL A C     1 
ATOM   347  O O     . VAL A 1 68  ? 71.296  42.323 5.694   1.00 11.48 ? 68   VAL A O     1 
ATOM   348  C CB    . VAL A 1 68  ? 68.221  42.013 6.880   1.00 12.05 ? 68   VAL A CB    1 
ATOM   349  C CG1   . VAL A 1 68  ? 68.261  41.411 5.474   1.00 6.74  ? 68   VAL A CG1   1 
ATOM   350  C CG2   . VAL A 1 68  ? 67.346  41.134 7.775   1.00 5.07  ? 68   VAL A CG2   1 
ATOM   351  N N     . MET A 1 69  ? 70.382  44.267 6.481   1.00 8.79  ? 69   MET A N     1 
ATOM   352  C CA    . MET A 1 69  ? 71.158  45.134 5.600   1.00 6.45  ? 69   MET A CA    1 
ATOM   353  C C     . MET A 1 69  ? 72.646  45.102 5.968   1.00 8.22  ? 69   MET A C     1 
ATOM   354  O O     . MET A 1 69  ? 73.526  45.158 5.110   1.00 11.63 ? 69   MET A O     1 
ATOM   355  C CB    . MET A 1 69  ? 70.590  46.575 5.655   1.00 11.18 ? 69   MET A CB    1 
ATOM   356  C CG    . MET A 1 69  ? 69.160  46.669 5.132   1.00 8.80  ? 69   MET A CG    1 
ATOM   357  S SD    . MET A 1 69  ? 69.024  45.967 3.470   1.00 15.38 ? 69   MET A SD    1 
ATOM   358  C CE    . MET A 1 69  ? 69.936  47.200 2.495   1.00 18.30 ? 69   MET A CE    1 
ATOM   359  N N     . TRP A 1 70  ? 72.951  44.999 7.260   1.00 5.56  ? 70   TRP A N     1 
ATOM   360  C CA    . TRP A 1 70  ? 74.318  44.858 7.692   1.00 10.28 ? 70   TRP A CA    1 
ATOM   361  C C     . TRP A 1 70  ? 74.931  43.556 7.140   1.00 11.90 ? 70   TRP A C     1 
ATOM   362  O O     . TRP A 1 70  ? 76.090  43.484 6.741   1.00 12.02 ? 70   TRP A O     1 
ATOM   363  C CB    . TRP A 1 70  ? 74.403  44.962 9.230   1.00 5.00  ? 70   TRP A CB    1 
ATOM   364  C CG    . TRP A 1 70  ? 75.817  44.955 9.797   1.00 14.62 ? 70   TRP A CG    1 
ATOM   365  C CD1   . TRP A 1 70  ? 76.639  46.035 9.939   1.00 9.92  ? 70   TRP A CD1   1 
ATOM   366  C CD2   . TRP A 1 70  ? 76.524  43.869 10.398  1.00 9.60  ? 70   TRP A CD2   1 
ATOM   367  N NE1   . TRP A 1 70  ? 77.843  45.663 10.509  1.00 9.49  ? 70   TRP A NE1   1 
ATOM   368  C CE2   . TRP A 1 70  ? 77.783  44.347 10.836  1.00 13.84 ? 70   TRP A CE2   1 
ATOM   369  C CE3   . TRP A 1 70  ? 76.243  42.512 10.552  1.00 11.59 ? 70   TRP A CE3   1 
ATOM   370  C CZ2   . TRP A 1 70  ? 78.734  43.534 11.447  1.00 13.26 ? 70   TRP A CZ2   1 
ATOM   371  C CZ3   . TRP A 1 70  ? 77.167  41.702 11.200  1.00 15.43 ? 70   TRP A CZ3   1 
ATOM   372  C CH2   . TRP A 1 70  ? 78.408  42.202 11.616  1.00 18.54 ? 70   TRP A CH2   1 
ATOM   373  N N     . ASN A 1 71  ? 74.192  42.444 7.220   1.00 8.48  ? 71   ASN A N     1 
ATOM   374  C CA    . ASN A 1 71  ? 74.711  41.171 6.754   1.00 6.21  ? 71   ASN A CA    1 
ATOM   375  C C     . ASN A 1 71  ? 75.000  41.273 5.272   1.00 8.15  ? 71   ASN A C     1 
ATOM   376  O O     . ASN A 1 71  ? 75.909  40.627 4.743   1.00 11.34 ? 71   ASN A O     1 
ATOM   377  C CB    . ASN A 1 71  ? 73.682  40.044 6.996   1.00 9.78  ? 71   ASN A CB    1 
ATOM   378  C CG    . ASN A 1 71  ? 73.647  39.570 8.461   1.00 16.26 ? 71   ASN A CG    1 
ATOM   379  O OD1   . ASN A 1 71  ? 74.698  39.520 9.112   1.00 16.06 ? 71   ASN A OD1   1 
ATOM   380  N ND2   . ASN A 1 71  ? 72.496  39.082 8.925   1.00 9.59  ? 71   ASN A ND2   1 
ATOM   381  N N     . THR A 1 72  ? 74.178  42.072 4.593   1.00 10.33 ? 72   THR A N     1 
ATOM   382  C CA    . THR A 1 72  ? 74.346  42.283 3.172   1.00 9.96  ? 72   THR A CA    1 
ATOM   383  C C     . THR A 1 72  ? 75.641  43.073 2.872   1.00 11.00 ? 72   THR A C     1 
ATOM   384  O O     . THR A 1 72  ? 76.424  42.730 1.982   1.00 8.52  ? 72   THR A O     1 
ATOM   385  C CB    . THR A 1 72  ? 73.117  42.998 2.606   1.00 10.82 ? 72   THR A CB    1 
ATOM   386  O OG1   . THR A 1 72  ? 71.910  42.282 2.941   1.00 11.00 ? 72   THR A OG1   1 
ATOM   387  C CG2   . THR A 1 72  ? 73.303  43.117 1.086   1.00 15.29 ? 72   THR A CG2   1 
ATOM   388  N N     . ALA A 1 73  ? 75.908  44.104 3.659   1.00 11.49 ? 73   ALA A N     1 
ATOM   389  C CA    . ALA A 1 73  ? 77.101  44.879 3.484   1.00 11.21 ? 73   ALA A CA    1 
ATOM   390  C C     . ALA A 1 73  ? 78.315  44.044 3.820   1.00 14.08 ? 73   ALA A C     1 
ATOM   391  O O     . ALA A 1 73  ? 79.354  44.106 3.121   1.00 17.01 ? 73   ALA A O     1 
ATOM   392  C CB    . ALA A 1 73  ? 77.034  46.125 4.367   1.00 9.68  ? 73   ALA A CB    1 
ATOM   393  N N     . VAL A 1 74  ? 78.146  43.180 4.811   1.00 13.96 ? 74   VAL A N     1 
ATOM   394  C CA    . VAL A 1 74  ? 79.214  42.260 5.194   1.00 10.45 ? 74   VAL A CA    1 
ATOM   395  C C     . VAL A 1 74  ? 79.614  41.354 4.037   1.00 15.80 ? 74   VAL A C     1 
ATOM   396  O O     . VAL A 1 74  ? 80.798  41.076 3.805   1.00 13.55 ? 74   VAL A O     1 
ATOM   397  C CB    . VAL A 1 74  ? 78.942  41.447 6.446   1.00 15.96 ? 74   VAL A CB    1 
ATOM   398  C CG1   . VAL A 1 74  ? 79.881  40.250 6.434   1.00 15.34 ? 74   VAL A CG1   1 
ATOM   399  C CG2   . VAL A 1 74  ? 79.195  42.302 7.680   1.00 9.35  ? 74   VAL A CG2   1 
ATOM   400  N N     . HIS A 1 75  ? 78.633  40.922 3.258   1.00 15.44 ? 75   HIS A N     1 
ATOM   401  C CA    . HIS A 1 75  ? 78.857  40.134 2.044   1.00 20.36 ? 75   HIS A CA    1 
ATOM   402  C C     . HIS A 1 75  ? 79.680  40.886 0.994   1.00 17.38 ? 75   HIS A C     1 
ATOM   403  O O     . HIS A 1 75  ? 80.509  40.288 0.304   1.00 22.98 ? 75   HIS A O     1 
ATOM   404  C CB    . HIS A 1 75  ? 77.532  39.781 1.344   1.00 28.75 ? 75   HIS A CB    1 
ATOM   405  C CG    . HIS A 1 75  ? 77.341  38.326 1.251   1.00 28.70 ? 75   HIS A CG    1 
ATOM   406  N ND1   . HIS A 1 75  ? 77.881  37.615 0.200   1.00 36.41 ? 75   HIS A ND1   1 
ATOM   407  C CD2   . HIS A 1 75  ? 76.751  37.459 2.131   1.00 30.09 ? 75   HIS A CD2   1 
ATOM   408  C CE1   . HIS A 1 75  ? 77.593  36.338 0.443   1.00 42.83 ? 75   HIS A CE1   1 
ATOM   409  N NE2   . HIS A 1 75  ? 76.911  36.205 1.582   1.00 39.26 ? 75   HIS A NE2   1 
ATOM   410  N N     . SER A 1 76  ? 79.371  42.177 0.823   1.00 15.15 ? 76   SER A N     1 
ATOM   411  C CA    . SER A 1 76  ? 80.071  43.065 -0.078  1.00 19.00 ? 76   SER A CA    1 
ATOM   412  C C     . SER A 1 76  ? 81.575  43.070 0.267   1.00 24.54 ? 76   SER A C     1 
ATOM   413  O O     . SER A 1 76  ? 82.425  42.918 -0.604  1.00 23.12 ? 76   SER A O     1 
ATOM   414  C CB    . SER A 1 76  ? 79.483  44.473 -0.029  1.00 21.12 ? 76   SER A CB    1 
ATOM   415  O OG    . SER A 1 76  ? 79.959  45.212 -1.131  1.00 40.17 ? 76   SER A OG    1 
ATOM   416  N N     . GLU A 1 77  ? 81.922  43.233 1.552   1.00 14.82 ? 77   GLU A N     1 
ATOM   417  C CA    . GLU A 1 77  ? 83.325  43.302 1.991   1.00 26.76 ? 77   GLU A CA    1 
ATOM   418  C C     . GLU A 1 77  ? 84.048  42.006 1.775   1.00 22.37 ? 77   GLU A C     1 
ATOM   419  O O     . GLU A 1 77  ? 85.212  41.934 1.376   1.00 28.82 ? 77   GLU A O     1 
ATOM   420  C CB    . GLU A 1 77  ? 83.480  43.563 3.497   1.00 25.59 ? 77   GLU A CB    1 
ATOM   421  C CG    . GLU A 1 77  ? 83.033  45.000 3.837   1.00 36.82 ? 77   GLU A CG    1 
ATOM   422  C CD    . GLU A 1 77  ? 82.845  45.261 5.325   1.00 60.63 ? 77   GLU A CD    1 
ATOM   423  O OE1   . GLU A 1 77  ? 83.437  44.377 6.130   1.00 57.21 ? 77   GLU A OE1   1 
ATOM   424  O OE2   . GLU A 1 77  ? 82.137  46.186 5.708   1.00 67.70 ? 77   GLU A OE2   1 
ATOM   425  N N     . PHE A 1 78  ? 83.405  40.941 2.182   1.00 22.28 ? 78   PHE A N     1 
ATOM   426  C CA    . PHE A 1 78  ? 84.020  39.663 2.049   1.00 30.91 ? 78   PHE A CA    1 
ATOM   427  C C     . PHE A 1 78  ? 84.362  39.398 0.603   1.00 34.75 ? 78   PHE A C     1 
ATOM   428  O O     . PHE A 1 78  ? 85.494  39.027 0.316   1.00 34.78 ? 78   PHE A O     1 
ATOM   429  C CB    . PHE A 1 78  ? 83.240  38.554 2.796   1.00 45.52 ? 78   PHE A CB    1 
ATOM   430  C CG    . PHE A 1 78  ? 83.523  38.697 4.286   1.00 52.99 ? 78   PHE A CG    1 
ATOM   431  C CD1   . PHE A 1 78  ? 84.781  39.153 4.709   1.00 54.70 ? 78   PHE A CD1   1 
ATOM   432  C CD2   . PHE A 1 78  ? 82.550  38.463 5.268   1.00 36.12 ? 78   PHE A CD2   1 
ATOM   433  C CE1   . PHE A 1 78  ? 85.092  39.347 6.071   1.00 48.45 ? 78   PHE A CE1   1 
ATOM   434  C CE2   . PHE A 1 78  ? 82.827  38.691 6.612   1.00 46.32 ? 78   PHE A CE2   1 
ATOM   435  C CZ    . PHE A 1 78  ? 84.100  39.114 7.020   1.00 51.16 ? 78   PHE A CZ    1 
ATOM   436  N N     . MET A 1 79  ? 83.407  39.677 -0.291  1.00 27.49 ? 79   MET A N     1 
ATOM   437  C CA    . MET A 1 79  ? 83.582  39.565 -1.731  1.00 15.78 ? 79   MET A CA    1 
ATOM   438  C C     . MET A 1 79  ? 84.775  40.387 -2.278  1.00 29.60 ? 79   MET A C     1 
ATOM   439  O O     . MET A 1 79  ? 85.280  40.082 -3.358  1.00 29.73 ? 79   MET A O     1 
ATOM   440  C CB    . MET A 1 79  ? 82.294  39.840 -2.539  1.00 34.88 ? 79   MET A CB    1 
ATOM   441  C CG    . MET A 1 79  ? 82.572  40.405 -3.931  1.00 51.57 ? 79   MET A CG    1 
ATOM   442  S SD    . MET A 1 79  ? 81.174  41.247 -4.755  1.00 79.95 ? 79   MET A SD    1 
ATOM   443  C CE    . MET A 1 79  ? 81.347  42.951 -4.135  1.00 67.51 ? 79   MET A CE    1 
ATOM   444  N N     . HIS A 1 80  ? 85.254  41.418 -1.564  1.00 21.06 ? 80   HIS A N     1 
ATOM   445  C CA    . HIS A 1 80  ? 86.445  42.154 -2.012  1.00 21.10 ? 80   HIS A CA    1 
ATOM   446  C C     . HIS A 1 80  ? 87.668  41.277 -1.792  1.00 27.11 ? 80   HIS A C     1 
ATOM   447  O O     . HIS A 1 80  ? 88.675  41.504 -2.455  1.00 25.79 ? 80   HIS A O     1 
ATOM   448  C CB    . HIS A 1 80  ? 86.764  43.484 -1.279  1.00 25.60 ? 80   HIS A CB    1 
ATOM   449  C CG    . HIS A 1 80  ? 85.764  44.552 -1.533  1.00 39.73 ? 80   HIS A CG    1 
ATOM   450  N ND1   . HIS A 1 80  ? 85.223  44.736 -2.802  1.00 47.68 ? 80   HIS A ND1   1 
ATOM   451  C CD2   . HIS A 1 80  ? 85.163  45.432 -0.668  1.00 41.24 ? 80   HIS A CD2   1 
ATOM   452  C CE1   . HIS A 1 80  ? 84.312  45.706 -2.687  1.00 43.99 ? 80   HIS A CE1   1 
ATOM   453  N NE2   . HIS A 1 80  ? 84.264  46.156 -1.428  1.00 42.36 ? 80   HIS A NE2   1 
ATOM   454  N N     . ASP A 1 81  ? 87.602  40.366 -0.795  1.00 19.02 ? 81   ASP A N     1 
ATOM   455  C CA    . ASP A 1 81  ? 88.696  39.491 -0.417  1.00 13.90 ? 81   ASP A CA    1 
ATOM   456  C C     . ASP A 1 81  ? 88.734  38.169 -1.200  1.00 14.06 ? 81   ASP A C     1 
ATOM   457  O O     . ASP A 1 81  ? 89.673  37.396 -1.084  1.00 11.48 ? 81   ASP A O     1 
ATOM   458  C CB    . ASP A 1 81  ? 88.693  39.187 1.094   1.00 19.66 ? 81   ASP A CB    1 
ATOM   459  C CG    . ASP A 1 81  ? 88.670  40.447 1.933   1.00 21.34 ? 81   ASP A CG    1 
ATOM   460  O OD1   . ASP A 1 81  ? 89.161  41.522 1.352   1.00 17.99 ? 81   ASP A OD1   1 
ATOM   461  O OD2   . ASP A 1 81  ? 88.369  40.419 3.092   1.00 18.85 ? 81   ASP A OD2   1 
ATOM   462  N N     . HIS A 1 82  ? 87.746  37.915 -2.033  1.00 13.97 ? 82   HIS A N     1 
ATOM   463  C CA    . HIS A 1 82  ? 87.598  36.674 -2.762  1.00 19.16 ? 82   HIS A CA    1 
ATOM   464  C C     . HIS A 1 82  ? 88.849  36.240 -3.513  1.00 15.62 ? 82   HIS A C     1 
ATOM   465  O O     . HIS A 1 82  ? 89.315  35.114 -3.399  1.00 17.44 ? 82   HIS A O     1 
ATOM   466  C CB    . HIS A 1 82  ? 86.353  36.753 -3.677  1.00 27.93 ? 82   HIS A CB    1 
ATOM   467  C CG    . HIS A 1 82  ? 85.642  35.459 -3.722  1.00 42.73 ? 82   HIS A CG    1 
ATOM   468  N ND1   . HIS A 1 82  ? 85.144  34.892 -2.546  1.00 44.09 ? 82   HIS A ND1   1 
ATOM   469  C CD2   . HIS A 1 82  ? 85.445  34.591 -4.773  1.00 48.48 ? 82   HIS A CD2   1 
ATOM   470  C CE1   . HIS A 1 82  ? 84.630  33.705 -2.927  1.00 53.82 ? 82   HIS A CE1   1 
ATOM   471  N NE2   . HIS A 1 82  ? 84.801  33.485 -4.241  1.00 46.79 ? 82   HIS A NE2   1 
ATOM   472  N N     . ALA A 1 83  ? 89.403  37.149 -4.282  1.00 19.64 ? 83   ALA A N     1 
ATOM   473  C CA    . ALA A 1 83  ? 90.549  36.797 -5.099  1.00 18.72 ? 83   ALA A CA    1 
ATOM   474  C C     . ALA A 1 83  ? 91.787  36.489 -4.265  1.00 17.28 ? 83   ALA A C     1 
ATOM   475  O O     . ALA A 1 83  ? 92.567  35.579 -4.582  1.00 17.85 ? 83   ALA A O     1 
ATOM   476  C CB    . ALA A 1 83  ? 90.808  37.874 -6.162  1.00 16.75 ? 83   ALA A CB    1 
ATOM   477  N N     . ASP A 1 84  ? 91.951  37.216 -3.161  1.00 13.60 ? 84   ASP A N     1 
ATOM   478  C CA    . ASP A 1 84  ? 93.089  37.007 -2.258  1.00 14.23 ? 84   ASP A CA    1 
ATOM   479  C C     . ASP A 1 84  ? 93.043  35.592 -1.670  1.00 26.43 ? 84   ASP A C     1 
ATOM   480  O O     . ASP A 1 84  ? 94.067  35.018 -1.280  1.00 19.62 ? 84   ASP A O     1 
ATOM   481  C CB    . ASP A 1 84  ? 93.017  37.984 -1.074  1.00 9.94  ? 84   ASP A CB    1 
ATOM   482  C CG    . ASP A 1 84  ? 93.488  39.367 -1.403  1.00 26.53 ? 84   ASP A CG    1 
ATOM   483  O OD1   . ASP A 1 84  ? 94.517  39.364 -2.221  1.00 32.32 ? 84   ASP A OD1   1 
ATOM   484  O OD2   . ASP A 1 84  ? 93.038  40.369 -0.874  1.00 28.17 ? 84   ASP A OD2   1 
ATOM   485  N N     . TYR A 1 85  ? 91.829  35.070 -1.542  1.00 20.15 ? 85   TYR A N     1 
ATOM   486  C CA    . TYR A 1 85  ? 91.642  33.793 -0.908  1.00 15.25 ? 85   TYR A CA    1 
ATOM   487  C C     . TYR A 1 85  ? 91.688  32.666 -1.919  1.00 24.35 ? 85   TYR A C     1 
ATOM   488  O O     . TYR A 1 85  ? 91.429  31.512 -1.596  1.00 28.15 ? 85   TYR A O     1 
ATOM   489  C CB    . TYR A 1 85  ? 90.380  33.785 -0.019  1.00 19.98 ? 85   TYR A CB    1 
ATOM   490  C CG    . TYR A 1 85  ? 90.701  34.114 1.421   1.00 13.14 ? 85   TYR A CG    1 
ATOM   491  C CD1   . TYR A 1 85  ? 91.236  33.149 2.268   1.00 12.21 ? 85   TYR A CD1   1 
ATOM   492  C CD2   . TYR A 1 85  ? 90.458  35.385 1.959   1.00 14.04 ? 85   TYR A CD2   1 
ATOM   493  C CE1   . TYR A 1 85  ? 91.533  33.440 3.603   1.00 5.00  ? 85   TYR A CE1   1 
ATOM   494  C CE2   . TYR A 1 85  ? 90.705  35.689 3.300   1.00 8.10  ? 85   TYR A CE2   1 
ATOM   495  C CZ    . TYR A 1 85  ? 91.268  34.704 4.115   1.00 10.29 ? 85   TYR A CZ    1 
ATOM   496  O OH    . TYR A 1 85  ? 91.561  34.943 5.423   1.00 14.25 ? 85   TYR A OH    1 
ATOM   497  N N     . GLY A 1 86  ? 92.022  32.984 -3.166  1.00 10.46 ? 86   GLY A N     1 
ATOM   498  C CA    . GLY A 1 86  ? 92.220  31.893 -4.092  1.00 11.90 ? 86   GLY A CA    1 
ATOM   499  C C     . GLY A 1 86  ? 91.032  31.631 -4.974  1.00 12.29 ? 86   GLY A C     1 
ATOM   500  O O     . GLY A 1 86  ? 90.972  30.685 -5.754  1.00 18.17 ? 86   GLY A O     1 
ATOM   501  N N     . PHE A 1 87  ? 90.133  32.536 -4.923  1.00 13.94 ? 87   PHE A N     1 
ATOM   502  C CA    . PHE A 1 87  ? 88.981  32.370 -5.732  1.00 19.94 ? 87   PHE A CA    1 
ATOM   503  C C     . PHE A 1 87  ? 89.061  33.333 -6.891  1.00 35.11 ? 87   PHE A C     1 
ATOM   504  O O     . PHE A 1 87  ? 89.886  34.243 -6.941  1.00 45.26 ? 87   PHE A O     1 
ATOM   505  C CB    . PHE A 1 87  ? 87.689  32.631 -4.914  1.00 26.44 ? 87   PHE A CB    1 
ATOM   506  C CG    . PHE A 1 87  ? 87.459  31.528 -3.915  1.00 24.41 ? 87   PHE A CG    1 
ATOM   507  C CD1   . PHE A 1 87  ? 86.800  30.358 -4.283  1.00 33.48 ? 87   PHE A CD1   1 
ATOM   508  C CD2   . PHE A 1 87  ? 88.003  31.616 -2.631  1.00 18.50 ? 87   PHE A CD2   1 
ATOM   509  C CE1   . PHE A 1 87  ? 86.611  29.334 -3.361  1.00 23.75 ? 87   PHE A CE1   1 
ATOM   510  C CE2   . PHE A 1 87  ? 87.812  30.614 -1.676  1.00 23.26 ? 87   PHE A CE2   1 
ATOM   511  C CZ    . PHE A 1 87  ? 87.115  29.466 -2.067  1.00 30.15 ? 87   PHE A CZ    1 
ATOM   512  N N     . PRO A 1 88  ? 88.139  33.155 -7.815  1.00 41.00 ? 88   PRO A N     1 
ATOM   513  C CA    . PRO A 1 88  ? 88.120  34.042 -8.940  1.00 44.96 ? 88   PRO A CA    1 
ATOM   514  C C     . PRO A 1 88  ? 87.286  35.250 -8.569  1.00 44.15 ? 88   PRO A C     1 
ATOM   515  O O     . PRO A 1 88  ? 86.331  35.169 -7.785  1.00 43.03 ? 88   PRO A O     1 
ATOM   516  C CB    . PRO A 1 88  ? 87.534  33.273 -10.133 1.00 49.96 ? 88   PRO A CB    1 
ATOM   517  C CG    . PRO A 1 88  ? 87.401  31.823 -9.677  1.00 53.78 ? 88   PRO A CG    1 
ATOM   518  C CD    . PRO A 1 88  ? 87.614  31.811 -8.165  1.00 41.58 ? 88   PRO A CD    1 
ATOM   519  N N     . SER A 1 89  ? 87.739  36.379 -9.112  1.00 50.02 ? 89   SER A N     1 
ATOM   520  C CA    . SER A 1 89  ? 87.130  37.666 -8.870  1.00 47.61 ? 89   SER A CA    1 
ATOM   521  C C     . SER A 1 89  ? 85.642  37.658 -9.198  1.00 55.91 ? 89   SER A C     1 
ATOM   522  O O     . SER A 1 89  ? 85.161  37.150 -10.236 1.00 51.96 ? 89   SER A O     1 
ATOM   523  C CB    . SER A 1 89  ? 87.863  38.830 -9.519  1.00 53.07 ? 89   SER A CB    1 
ATOM   524  O OG    . SER A 1 89  ? 87.737  39.956 -8.671  1.00 66.33 ? 89   SER A OG    1 
ATOM   525  N N     . CYS A 1 90  ? 84.926  38.214 -8.234  1.00 62.02 ? 90   CYS A N     1 
ATOM   526  C CA    . CYS A 1 90  ? 83.507  38.389 -8.342  1.00 57.09 ? 90   CYS A CA    1 
ATOM   527  C C     . CYS A 1 90  ? 83.326  39.774 -8.933  1.00 66.38 ? 90   CYS A C     1 
ATOM   528  O O     . CYS A 1 90  ? 83.896  40.776 -8.463  1.00 65.77 ? 90   CYS A O     1 
ATOM   529  C CB    . CYS A 1 90  ? 82.786  38.199 -6.990  1.00 65.89 ? 90   CYS A CB    1 
ATOM   530  S SG    . CYS A 1 90  ? 81.561  36.858 -7.040  1.00 79.92 ? 90   CYS A SG    1 
ATOM   531  N N     . GLU A 1 91  ? 82.538  39.788 -10.001 1.00 67.29 ? 91   GLU A N     1 
ATOM   532  C CA    . GLU A 1 91  ? 82.328  40.951 -10.832 1.00 67.70 ? 91   GLU A CA    1 
ATOM   533  C C     . GLU A 1 91  ? 81.381  42.085 -10.444 1.00 72.92 ? 91   GLU A C     1 
ATOM   534  O O     . GLU A 1 91  ? 81.560  43.167 -11.015 1.00 79.05 ? 91   GLU A O     1 
ATOM   535  C CB    . GLU A 1 91  ? 81.867  40.525 -12.210 1.00 61.16 ? 91   GLU A CB    1 
ATOM   536  C CG    . GLU A 1 91  ? 80.405  40.989 -12.343 1.00 61.07 ? 91   GLU A CG    1 
ATOM   537  C CD    . GLU A 1 91  ? 79.770  40.416 -13.567 1.00 72.53 ? 91   GLU A CD    1 
ATOM   538  O OE1   . GLU A 1 91  ? 80.254  40.560 -14.691 1.00 77.72 ? 91   GLU A OE1   1 
ATOM   539  O OE2   . GLU A 1 91  ? 78.755  39.625 -13.272 1.00 70.14 ? 91   GLU A OE2   1 
ATOM   540  N N     . GLY A 1 92  ? 80.301  41.983 -9.665  1.00 60.40 ? 92   GLY A N     1 
ATOM   541  C CA    . GLY A 1 92  ? 79.716  43.302 -9.749  1.00 54.26 ? 92   GLY A CA    1 
ATOM   542  C C     . GLY A 1 92  ? 78.544  43.763 -8.928  1.00 47.52 ? 92   GLY A C     1 
ATOM   543  O O     . GLY A 1 92  ? 78.514  43.725 -7.690  1.00 49.90 ? 92   GLY A O     1 
ATOM   544  N N     . LYS A 1 93  ? 77.642  44.327 -9.728  1.00 41.18 ? 93   LYS A N     1 
ATOM   545  C CA    . LYS A 1 93  ? 76.448  45.027 -9.319  1.00 43.45 ? 93   LYS A CA    1 
ATOM   546  C C     . LYS A 1 93  ? 75.501  44.336 -8.349  1.00 38.22 ? 93   LYS A C     1 
ATOM   547  O O     . LYS A 1 93  ? 74.851  43.322 -8.625  1.00 34.68 ? 93   LYS A O     1 
ATOM   548  C CB    . LYS A 1 93  ? 75.722  45.662 -10.486 1.00 38.56 ? 93   LYS A CB    1 
ATOM   549  C CG    . LYS A 1 93  ? 74.437  44.931 -10.834 1.00 55.65 ? 93   LYS A CG    1 
ATOM   550  C CD    . LYS A 1 93  ? 74.369  44.502 -12.292 1.00 64.24 ? 93   LYS A CD    1 
ATOM   551  C CE    . LYS A 1 93  ? 73.548  43.234 -12.520 1.00 69.14 ? 93   LYS A CE    1 
ATOM   552  N NZ    . LYS A 1 93  ? 73.863  42.141 -11.573 1.00 74.47 ? 93   LYS A NZ    1 
ATOM   553  N N     . PHE A 1 94  ? 75.400  44.995 -7.208  1.00 41.39 ? 94   PHE A N     1 
ATOM   554  C CA    . PHE A 1 94  ? 74.508  44.618 -6.164  1.00 32.87 ? 94   PHE A CA    1 
ATOM   555  C C     . PHE A 1 94  ? 73.106  45.012 -6.598  1.00 30.27 ? 94   PHE A C     1 
ATOM   556  O O     . PHE A 1 94  ? 72.853  46.061 -7.193  1.00 30.63 ? 94   PHE A O     1 
ATOM   557  C CB    . PHE A 1 94  ? 74.901  45.432 -4.940  1.00 24.58 ? 94   PHE A CB    1 
ATOM   558  C CG    . PHE A 1 94  ? 73.825  45.327 -3.901  1.00 16.81 ? 94   PHE A CG    1 
ATOM   559  C CD1   . PHE A 1 94  ? 73.493  44.111 -3.305  1.00 16.15 ? 94   PHE A CD1   1 
ATOM   560  C CD2   . PHE A 1 94  ? 73.109  46.473 -3.549  1.00 16.03 ? 94   PHE A CD2   1 
ATOM   561  C CE1   . PHE A 1 94  ? 72.504  44.049 -2.345  1.00 12.39 ? 94   PHE A CE1   1 
ATOM   562  C CE2   . PHE A 1 94  ? 72.092  46.424 -2.570  1.00 16.09 ? 94   PHE A CE2   1 
ATOM   563  C CZ    . PHE A 1 94  ? 71.799  45.195 -1.964  1.00 24.91 ? 94   PHE A CZ    1 
ATOM   564  N N     . ASN A 1 95  ? 72.149  44.180 -6.272  1.00 22.17 ? 95   ASN A N     1 
ATOM   565  C CA    . ASN A 1 95  ? 70.800  44.532 -6.661  1.00 17.38 ? 95   ASN A CA    1 
ATOM   566  C C     . ASN A 1 95  ? 69.952  44.782 -5.422  1.00 16.21 ? 95   ASN A C     1 
ATOM   567  O O     . ASN A 1 95  ? 69.549  43.878 -4.713  1.00 20.80 ? 95   ASN A O     1 
ATOM   568  C CB    . ASN A 1 95  ? 70.283  43.374 -7.534  1.00 18.45 ? 95   ASN A CB    1 
ATOM   569  C CG    . ASN A 1 95  ? 68.915  43.624 -8.116  1.00 37.78 ? 95   ASN A CG    1 
ATOM   570  O OD1   . ASN A 1 95  ? 68.192  44.563 -7.715  1.00 42.94 ? 95   ASN A OD1   1 
ATOM   571  N ND2   . ASN A 1 95  ? 68.544  42.722 -9.021  1.00 45.73 ? 95   ASN A ND2   1 
ATOM   572  N N     . TRP A 1 96  ? 69.681  46.034 -5.163  1.00 16.69 ? 96   TRP A N     1 
ATOM   573  C CA    . TRP A 1 96  ? 68.976  46.447 -3.984  1.00 14.71 ? 96   TRP A CA    1 
ATOM   574  C C     . TRP A 1 96  ? 67.591  45.820 -3.877  1.00 21.92 ? 96   TRP A C     1 
ATOM   575  O O     . TRP A 1 96  ? 67.135  45.433 -2.801  1.00 13.38 ? 96   TRP A O     1 
ATOM   576  C CB    . TRP A 1 96  ? 68.919  47.993 -3.945  1.00 12.05 ? 96   TRP A CB    1 
ATOM   577  C CG    . TRP A 1 96  ? 68.274  48.598 -2.725  1.00 17.12 ? 96   TRP A CG    1 
ATOM   578  C CD1   . TRP A 1 96  ? 66.940  48.724 -2.486  1.00 18.17 ? 96   TRP A CD1   1 
ATOM   579  C CD2   . TRP A 1 96  ? 68.933  49.237 -1.613  1.00 16.70 ? 96   TRP A CD2   1 
ATOM   580  N NE1   . TRP A 1 96  ? 66.717  49.376 -1.291  1.00 20.80 ? 96   TRP A NE1   1 
ATOM   581  C CE2   . TRP A 1 96  ? 67.925  49.700 -0.727  1.00 23.19 ? 96   TRP A CE2   1 
ATOM   582  C CE3   . TRP A 1 96  ? 70.265  49.509 -1.318  1.00 18.94 ? 96   TRP A CE3   1 
ATOM   583  C CZ2   . TRP A 1 96  ? 68.205  50.391 0.451   1.00 17.41 ? 96   TRP A CZ2   1 
ATOM   584  C CZ3   . TRP A 1 96  ? 70.554  50.179 -0.143  1.00 20.70 ? 96   TRP A CZ3   1 
ATOM   585  C CH2   . TRP A 1 96  ? 69.534  50.608 0.726   1.00 22.58 ? 96   TRP A CH2   1 
ATOM   586  N N     . ARG A 1 97  ? 66.867  45.761 -4.978  1.00 20.44 ? 97   ARG A N     1 
ATOM   587  C CA    . ARG A 1 97  ? 65.506  45.301 -4.895  1.00 20.66 ? 97   ARG A CA    1 
ATOM   588  C C     . ARG A 1 97  ? 65.252  43.865 -4.467  1.00 13.48 ? 97   ARG A C     1 
ATOM   589  O O     . ARG A 1 97  ? 64.250  43.505 -3.824  1.00 18.40 ? 97   ARG A O     1 
ATOM   590  C CB    . ARG A 1 97  ? 64.430  46.063 -5.647  1.00 38.55 ? 97   ARG A CB    1 
ATOM   591  C CG    . ARG A 1 97  ? 64.226  45.652 -7.095  1.00 46.93 ? 97   ARG A CG    1 
ATOM   592  C CD    . ARG A 1 97  ? 63.141  46.504 -7.767  1.00 56.21 ? 97   ARG A CD    1 
ATOM   593  N NE    . ARG A 1 97  ? 61.904  46.683 -6.975  1.00 66.50 ? 97   ARG A NE    1 
ATOM   594  C CZ    . ARG A 1 97  ? 60.813  45.886 -7.066  1.00 77.35 ? 97   ARG A CZ    1 
ATOM   595  N NH1   . ARG A 1 97  ? 60.857  44.823 -7.892  1.00 74.99 ? 97   ARG A NH1   1 
ATOM   596  N NH2   . ARG A 1 97  ? 59.687  46.089 -6.343  1.00 67.73 ? 97   ARG A NH2   1 
ATOM   597  N N     . VAL A 1 98  ? 66.232  43.047 -4.751  1.00 12.71 ? 98   VAL A N     1 
ATOM   598  C CA    . VAL A 1 98  ? 66.171  41.658 -4.390  1.00 14.06 ? 98   VAL A CA    1 
ATOM   599  C C     . VAL A 1 98  ? 66.197  41.506 -2.893  1.00 26.43 ? 98   VAL A C     1 
ATOM   600  O O     . VAL A 1 98  ? 65.421  40.726 -2.330  1.00 22.30 ? 98   VAL A O     1 
ATOM   601  C CB    . VAL A 1 98  ? 67.348  40.930 -4.993  1.00 22.02 ? 98   VAL A CB    1 
ATOM   602  C CG1   . VAL A 1 98  ? 67.490  39.520 -4.422  1.00 17.34 ? 98   VAL A CG1   1 
ATOM   603  C CG2   . VAL A 1 98  ? 67.078  40.839 -6.506  1.00 25.22 ? 98   VAL A CG2   1 
ATOM   604  N N     . ILE A 1 99  ? 67.155  42.193 -2.252  1.00 15.50 ? 99   ILE A N     1 
ATOM   605  C CA    . ILE A 1 99  ? 67.295  42.024 -0.830  1.00 12.05 ? 99   ILE A CA    1 
ATOM   606  C C     . ILE A 1 99  ? 66.199  42.830 -0.170  1.00 14.46 ? 99   ILE A C     1 
ATOM   607  O O     . ILE A 1 99  ? 65.642  42.454 0.856   1.00 14.41 ? 99   ILE A O     1 
ATOM   608  C CB    . ILE A 1 99  ? 68.707  42.344 -0.353  1.00 14.07 ? 99   ILE A CB    1 
ATOM   609  C CG1   . ILE A 1 99  ? 69.002  41.749 1.016   1.00 27.58 ? 99   ILE A CG1   1 
ATOM   610  C CG2   . ILE A 1 99  ? 68.866  43.845 -0.248  1.00 29.32 ? 99   ILE A CG2   1 
ATOM   611  C CD1   . ILE A 1 99  ? 68.993  40.214 1.024   1.00 28.66 ? 99   ILE A CD1   1 
ATOM   612  N N     . LYS A 1 100 ? 65.783  43.899 -0.816  1.00 11.90 ? 100  LYS A N     1 
ATOM   613  C CA    . LYS A 1 100 ? 64.752  44.637 -0.154  1.00 10.29 ? 100  LYS A CA    1 
ATOM   614  C C     . LYS A 1 100 ? 63.494  43.815 -0.053  1.00 15.09 ? 100  LYS A C     1 
ATOM   615  O O     . LYS A 1 100 ? 62.782  43.865 0.945   1.00 15.79 ? 100  LYS A O     1 
ATOM   616  C CB    . LYS A 1 100 ? 64.407  45.969 -0.753  1.00 19.27 ? 100  LYS A CB    1 
ATOM   617  C CG    . LYS A 1 100 ? 63.172  46.473 -0.015  1.00 21.60 ? 100  LYS A CG    1 
ATOM   618  C CD    . LYS A 1 100 ? 62.441  47.603 -0.669  1.00 21.57 ? 100  LYS A CD    1 
ATOM   619  C CE    . LYS A 1 100 ? 61.511  48.281 0.310   1.00 25.89 ? 100  LYS A CE    1 
ATOM   620  N NZ    . LYS A 1 100 ? 60.107  48.225 -0.130  1.00 16.97 ? 100  LYS A NZ    1 
ATOM   621  N N     . GLU A 1 101 ? 63.202  43.068 -1.090  1.00 20.13 ? 101  GLU A N     1 
ATOM   622  C CA    . GLU A 1 101 ? 61.962  42.317 -1.043  1.00 23.84 ? 101  GLU A CA    1 
ATOM   623  C C     . GLU A 1 101 ? 61.986  41.207 -0.014  1.00 22.50 ? 101  GLU A C     1 
ATOM   624  O O     . GLU A 1 101 ? 60.958  40.910 0.595   1.00 15.84 ? 101  GLU A O     1 
ATOM   625  C CB    . GLU A 1 101 ? 61.595  41.816 -2.435  1.00 23.76 ? 101  GLU A CB    1 
ATOM   626  C CG    . GLU A 1 101 ? 61.101  43.013 -3.259  1.00 36.48 ? 101  GLU A CG    1 
ATOM   627  C CD    . GLU A 1 101 ? 61.239  42.817 -4.750  1.00 59.41 ? 101  GLU A CD    1 
ATOM   628  O OE1   . GLU A 1 101 ? 61.929  41.941 -5.298  1.00 47.99 ? 101  GLU A OE1   1 
ATOM   629  O OE2   . GLU A 1 101 ? 60.470  43.681 -5.389  1.00 69.09 ? 101  GLU A OE2   1 
ATOM   630  N N     . LYS A 1 102 ? 63.150  40.569 0.124   1.00 10.11 ? 102  LYS A N     1 
ATOM   631  C CA    . LYS A 1 102 ? 63.316  39.471 1.057   1.00 12.54 ? 102  LYS A CA    1 
ATOM   632  C C     . LYS A 1 102 ? 63.335  39.980 2.478   1.00 17.55 ? 102  LYS A C     1 
ATOM   633  O O     . LYS A 1 102 ? 62.936  39.272 3.406   1.00 10.82 ? 102  LYS A O     1 
ATOM   634  C CB    . LYS A 1 102 ? 64.610  38.792 0.765   1.00 14.76 ? 102  LYS A CB    1 
ATOM   635  C CG    . LYS A 1 102 ? 64.618  38.076 -0.575  1.00 20.88 ? 102  LYS A CG    1 
ATOM   636  C CD    . LYS A 1 102 ? 65.836  37.176 -0.629  1.00 15.33 ? 102  LYS A CD    1 
ATOM   637  C CE    . LYS A 1 102 ? 66.274  36.904 -2.055  1.00 18.21 ? 102  LYS A CE    1 
ATOM   638  N NZ    . LYS A 1 102 ? 67.030  35.637 -2.110  1.00 27.14 ? 102  LYS A NZ    1 
ATOM   639  N N     . ARG A 1 103 ? 63.769  41.234 2.642   1.00 17.45 ? 103  ARG A N     1 
ATOM   640  C CA    . ARG A 1 103 ? 63.855  41.824 3.968   1.00 12.93 ? 103  ARG A CA    1 
ATOM   641  C C     . ARG A 1 103 ? 62.434  42.110 4.405   1.00 8.18  ? 103  ARG A C     1 
ATOM   642  O O     . ARG A 1 103 ? 62.017  41.819 5.525   1.00 10.55 ? 103  ARG A O     1 
ATOM   643  C CB    . ARG A 1 103 ? 64.678  43.117 3.877   1.00 9.57  ? 103  ARG A CB    1 
ATOM   644  C CG    . ARG A 1 103 ? 65.116  43.746 5.205   1.00 11.32 ? 103  ARG A CG    1 
ATOM   645  C CD    . ARG A 1 103 ? 65.684  45.157 4.964   1.00 7.90  ? 103  ARG A CD    1 
ATOM   646  N NE    . ARG A 1 103 ? 64.609  46.102 4.706   1.00 11.35 ? 103  ARG A NE    1 
ATOM   647  C CZ    . ARG A 1 103 ? 64.662  47.046 3.776   1.00 17.21 ? 103  ARG A CZ    1 
ATOM   648  N NH1   . ARG A 1 103 ? 65.772  47.162 3.041   1.00 13.39 ? 103  ARG A NH1   1 
ATOM   649  N NH2   . ARG A 1 103 ? 63.620  47.864 3.544   1.00 12.82 ? 103  ARG A NH2   1 
ATOM   650  N N     . ASP A 1 104 ? 61.648  42.728 3.532   1.00 8.08  ? 104  ASP A N     1 
ATOM   651  C CA    . ASP A 1 104 ? 60.272  43.050 3.863   1.00 10.03 ? 104  ASP A CA    1 
ATOM   652  C C     . ASP A 1 104 ? 59.448  41.799 4.225   1.00 16.55 ? 104  ASP A C     1 
ATOM   653  O O     . ASP A 1 104 ? 58.532  41.841 5.054   1.00 15.17 ? 104  ASP A O     1 
ATOM   654  C CB    . ASP A 1 104 ? 59.542  43.772 2.702   1.00 14.56 ? 104  ASP A CB    1 
ATOM   655  C CG    . ASP A 1 104 ? 59.948  45.221 2.506   1.00 27.82 ? 104  ASP A CG    1 
ATOM   656  O OD1   . ASP A 1 104 ? 60.459  45.941 3.363   1.00 25.42 ? 104  ASP A OD1   1 
ATOM   657  O OD2   . ASP A 1 104 ? 59.518  45.679 1.369   1.00 22.40 ? 104  ASP A OD2   1 
ATOM   658  N N     . ALA A 1 105 ? 59.698  40.719 3.507   1.00 14.62 ? 105  ALA A N     1 
ATOM   659  C CA    . ALA A 1 105 ? 58.975  39.482 3.734   1.00 14.81 ? 105  ALA A CA    1 
ATOM   660  C C     . ALA A 1 105 ? 59.295  38.946 5.117   1.00 14.59 ? 105  ALA A C     1 
ATOM   661  O O     . ALA A 1 105 ? 58.401  38.494 5.838   1.00 16.40 ? 105  ALA A O     1 
ATOM   662  C CB    . ALA A 1 105 ? 59.337  38.462 2.668   1.00 14.41 ? 105  ALA A CB    1 
ATOM   663  N N     . TYR A 1 106 ? 60.570  39.043 5.488   1.00 12.84 ? 106  TYR A N     1 
ATOM   664  C CA    . TYR A 1 106 ? 61.037  38.534 6.759   1.00 10.07 ? 106  TYR A CA    1 
ATOM   665  C C     . TYR A 1 106 ? 60.386  39.300 7.878   1.00 5.25  ? 106  TYR A C     1 
ATOM   666  O O     . TYR A 1 106 ? 59.997  38.733 8.886   1.00 15.38 ? 106  TYR A O     1 
ATOM   667  C CB    . TYR A 1 106 ? 62.569  38.562 6.821   1.00 10.03 ? 106  TYR A CB    1 
ATOM   668  C CG    . TYR A 1 106 ? 63.128  38.165 8.173   1.00 21.77 ? 106  TYR A CG    1 
ATOM   669  C CD1   . TYR A 1 106 ? 62.747  36.989 8.811   1.00 16.71 ? 106  TYR A CD1   1 
ATOM   670  C CD2   . TYR A 1 106 ? 64.120  38.950 8.773   1.00 14.99 ? 106  TYR A CD2   1 
ATOM   671  C CE1   . TYR A 1 106 ? 63.298  36.608 10.040  1.00 18.92 ? 106  TYR A CE1   1 
ATOM   672  C CE2   . TYR A 1 106 ? 64.707  38.558 9.967   1.00 17.10 ? 106  TYR A CE2   1 
ATOM   673  C CZ    . TYR A 1 106 ? 64.290  37.395 10.616  1.00 24.76 ? 106  TYR A CZ    1 
ATOM   674  O OH    . TYR A 1 106 ? 64.867  37.050 11.815  1.00 27.61 ? 106  TYR A OH    1 
ATOM   675  N N     . VAL A 1 107 ? 60.273  40.608 7.688   1.00 8.43  ? 107  VAL A N     1 
ATOM   676  C CA    . VAL A 1 107 ? 59.567  41.481 8.631   1.00 10.13 ? 107  VAL A CA    1 
ATOM   677  C C     . VAL A 1 107 ? 58.082  41.085 8.738   1.00 17.72 ? 107  VAL A C     1 
ATOM   678  O O     . VAL A 1 107 ? 57.509  41.101 9.822   1.00 13.46 ? 107  VAL A O     1 
ATOM   679  C CB    . VAL A 1 107 ? 59.738  42.937 8.229   1.00 10.58 ? 107  VAL A CB    1 
ATOM   680  C CG1   . VAL A 1 107 ? 58.759  43.832 8.957   1.00 9.66  ? 107  VAL A CG1   1 
ATOM   681  C CG2   . VAL A 1 107 ? 61.171  43.397 8.569   1.00 13.20 ? 107  VAL A CG2   1 
ATOM   682  N N     . SER A 1 108 ? 57.443  40.705 7.621   1.00 14.58 ? 108  SER A N     1 
ATOM   683  C CA    . SER A 1 108 ? 56.050  40.229 7.611   1.00 18.02 ? 108  SER A CA    1 
ATOM   684  C C     . SER A 1 108 ? 55.934  38.956 8.420   1.00 17.42 ? 108  SER A C     1 
ATOM   685  O O     . SER A 1 108 ? 54.957  38.798 9.118   1.00 14.41 ? 108  SER A O     1 
ATOM   686  C CB    . SER A 1 108 ? 55.626  39.918 6.210   1.00 10.59 ? 108  SER A CB    1 
ATOM   687  O OG    . SER A 1 108 ? 55.529  41.180 5.610   1.00 17.09 ? 108  SER A OG    1 
ATOM   688  N N     . ARG A 1 109 ? 56.938  38.070 8.306   1.00 13.56 ? 109  ARG A N     1 
ATOM   689  C CA    . ARG A 1 109 ? 56.955  36.846 9.073   1.00 14.44 ? 109  ARG A CA    1 
ATOM   690  C C     . ARG A 1 109 ? 56.964  37.163 10.561  1.00 18.71 ? 109  ARG A C     1 
ATOM   691  O O     . ARG A 1 109 ? 56.202  36.596 11.348  1.00 14.59 ? 109  ARG A O     1 
ATOM   692  C CB    . ARG A 1 109 ? 58.080  35.905 8.665   1.00 11.40 ? 109  ARG A CB    1 
ATOM   693  C CG    . ARG A 1 109 ? 57.814  35.358 7.257   1.00 8.10  ? 109  ARG A CG    1 
ATOM   694  C CD    . ARG A 1 109 ? 58.685  34.156 6.874   1.00 18.86 ? 109  ARG A CD    1 
ATOM   695  N NE    . ARG A 1 109 ? 60.157  34.320 7.013   1.00 19.17 ? 109  ARG A NE    1 
ATOM   696  C CZ    . ARG A 1 109 ? 61.011  34.850 6.105   1.00 28.57 ? 109  ARG A CZ    1 
ATOM   697  N NH1   . ARG A 1 109 ? 60.572  35.389 4.940   1.00 16.40 ? 109  ARG A NH1   1 
ATOM   698  N NH2   . ARG A 1 109 ? 62.318  34.913 6.361   1.00 27.09 ? 109  ARG A NH2   1 
ATOM   699  N N     . LEU A 1 110 ? 57.798  38.117 10.964  1.00 14.16 ? 110  LEU A N     1 
ATOM   700  C CA    . LEU A 1 110 ? 57.894  38.450 12.348  1.00 9.45  ? 110  LEU A CA    1 
ATOM   701  C C     . LEU A 1 110 ? 56.622  39.060 12.851  1.00 9.59  ? 110  LEU A C     1 
ATOM   702  O O     . LEU A 1 110 ? 56.219  38.808 13.977  1.00 17.64 ? 110  LEU A O     1 
ATOM   703  C CB    . LEU A 1 110 ? 59.086  39.369 12.581  1.00 13.31 ? 110  LEU A CB    1 
ATOM   704  C CG    . LEU A 1 110 ? 60.374  38.661 12.258  1.00 19.92 ? 110  LEU A CG    1 
ATOM   705  C CD1   . LEU A 1 110 ? 61.550  39.600 12.556  1.00 17.00 ? 110  LEU A CD1   1 
ATOM   706  C CD2   . LEU A 1 110 ? 60.471  37.444 13.141  1.00 18.06 ? 110  LEU A CD2   1 
ATOM   707  N N     . ASN A 1 111 ? 56.001  39.918 12.067  1.00 7.26  ? 111  ASN A N     1 
ATOM   708  C CA    . ASN A 1 111 ? 54.758  40.494 12.601  1.00 12.08 ? 111  ASN A CA    1 
ATOM   709  C C     . ASN A 1 111 ? 53.743  39.393 12.909  1.00 17.47 ? 111  ASN A C     1 
ATOM   710  O O     . ASN A 1 111 ? 53.090  39.444 13.930  1.00 22.90 ? 111  ASN A O     1 
ATOM   711  C CB    . ASN A 1 111 ? 54.080  41.488 11.655  1.00 11.09 ? 111  ASN A CB    1 
ATOM   712  C CG    . ASN A 1 111 ? 54.979  42.665 11.251  1.00 23.86 ? 111  ASN A CG    1 
ATOM   713  O OD1   . ASN A 1 111 ? 54.941  43.097 10.097  1.00 20.92 ? 111  ASN A OD1   1 
ATOM   714  N ND2   . ASN A 1 111 ? 55.583  43.332 12.219  1.00 26.68 ? 111  ASN A ND2   1 
ATOM   715  N N     . ALA A 1 112 ? 53.649  38.391 12.042  1.00 13.43 ? 112  ALA A N     1 
ATOM   716  C CA    . ALA A 1 112 ? 52.673  37.330 12.222  1.00 11.23 ? 112  ALA A CA    1 
ATOM   717  C C     . ALA A 1 112 ? 53.033  36.497 13.446  1.00 15.54 ? 112  ALA A C     1 
ATOM   718  O O     . ALA A 1 112 ? 52.177  36.095 14.226  1.00 13.71 ? 112  ALA A O     1 
ATOM   719  C CB    . ALA A 1 112 ? 52.706  36.460 10.968  1.00 11.74 ? 112  ALA A CB    1 
ATOM   720  N N     . ILE A 1 113 ? 54.317  36.300 13.676  1.00 16.60 ? 113  ILE A N     1 
ATOM   721  C CA    . ILE A 1 113 ? 54.781  35.564 14.848  1.00 19.12 ? 113  ILE A CA    1 
ATOM   722  C C     . ILE A 1 113 ? 54.444  36.234 16.182  1.00 18.90 ? 113  ILE A C     1 
ATOM   723  O O     . ILE A 1 113 ? 53.985  35.595 17.146  1.00 17.93 ? 113  ILE A O     1 
ATOM   724  C CB    . ILE A 1 113 ? 56.270  35.339 14.700  1.00 18.63 ? 113  ILE A CB    1 
ATOM   725  C CG1   . ILE A 1 113 ? 56.426  34.138 13.795  1.00 17.18 ? 113  ILE A CG1   1 
ATOM   726  C CG2   . ILE A 1 113 ? 56.911  35.032 16.031  1.00 15.44 ? 113  ILE A CG2   1 
ATOM   727  C CD1   . ILE A 1 113 ? 57.867  33.850 13.414  1.00 16.95 ? 113  ILE A CD1   1 
ATOM   728  N N     . TYR A 1 114 ? 54.649  37.533 16.242  1.00 15.53 ? 114  TYR A N     1 
ATOM   729  C CA    . TYR A 1 114 ? 54.394  38.333 17.417  1.00 16.98 ? 114  TYR A CA    1 
ATOM   730  C C     . TYR A 1 114 ? 52.944  38.376 17.754  1.00 14.09 ? 114  TYR A C     1 
ATOM   731  O O     . TYR A 1 114 ? 52.557  38.408 18.930  1.00 18.79 ? 114  TYR A O     1 
ATOM   732  C CB    . TYR A 1 114 ? 54.819  39.799 17.188  1.00 19.18 ? 114  TYR A CB    1 
ATOM   733  C CG    . TYR A 1 114 ? 56.310  39.822 17.359  1.00 22.13 ? 114  TYR A CG    1 
ATOM   734  C CD1   . TYR A 1 114 ? 57.135  39.037 16.568  1.00 29.65 ? 114  TYR A CD1   1 
ATOM   735  C CD2   . TYR A 1 114 ? 56.905  40.597 18.348  1.00 34.99 ? 114  TYR A CD2   1 
ATOM   736  C CE1   . TYR A 1 114 ? 58.536  39.014 16.682  1.00 28.43 ? 114  TYR A CE1   1 
ATOM   737  C CE2   . TYR A 1 114 ? 58.271  40.588 18.501  1.00 33.88 ? 114  TYR A CE2   1 
ATOM   738  C CZ    . TYR A 1 114 ? 59.081  39.787 17.699  1.00 27.04 ? 114  TYR A CZ    1 
ATOM   739  O OH    . TYR A 1 114 ? 60.435  39.801 18.003  1.00 40.94 ? 114  TYR A OH    1 
ATOM   740  N N     . GLN A 1 115 ? 52.129  38.484 16.717  1.00 15.08 ? 115  GLN A N     1 
ATOM   741  C CA    . GLN A 1 115 ? 50.704  38.486 16.928  1.00 17.74 ? 115  GLN A CA    1 
ATOM   742  C C     . GLN A 1 115 ? 50.322  37.126 17.513  1.00 17.41 ? 115  GLN A C     1 
ATOM   743  O O     . GLN A 1 115 ? 49.628  37.034 18.529  1.00 21.46 ? 115  GLN A O     1 
ATOM   744  C CB    . GLN A 1 115 ? 50.001  38.748 15.610  1.00 19.06 ? 115  GLN A CB    1 
ATOM   745  C CG    . GLN A 1 115 ? 48.497  38.952 15.833  1.00 24.70 ? 115  GLN A CG    1 
ATOM   746  C CD    . GLN A 1 115 ? 47.824  39.619 14.641  1.00 45.61 ? 115  GLN A CD    1 
ATOM   747  O OE1   . GLN A 1 115 ? 48.478  40.242 13.773  1.00 59.58 ? 115  GLN A OE1   1 
ATOM   748  N NE2   . GLN A 1 115 ? 46.499  39.516 14.618  1.00 50.93 ? 115  GLN A NE2   1 
ATOM   749  N N     . ASN A 1 116 ? 50.840  36.049 16.929  1.00 11.19 ? 116  ASN A N     1 
ATOM   750  C CA    . ASN A 1 116 ? 50.544  34.744 17.462  1.00 14.76 ? 116  ASN A CA    1 
ATOM   751  C C     . ASN A 1 116 ? 51.005  34.635 18.910  1.00 17.73 ? 116  ASN A C     1 
ATOM   752  O O     . ASN A 1 116 ? 50.346  33.972 19.713  1.00 18.72 ? 116  ASN A O     1 
ATOM   753  C CB    . ASN A 1 116 ? 51.131  33.627 16.573  1.00 17.54 ? 116  ASN A CB    1 
ATOM   754  C CG    . ASN A 1 116 ? 50.728  32.229 17.011  1.00 15.24 ? 116  ASN A CG    1 
ATOM   755  O OD1   . ASN A 1 116 ? 51.574  31.327 17.100  1.00 24.27 ? 116  ASN A OD1   1 
ATOM   756  N ND2   . ASN A 1 116 ? 49.422  32.017 17.081  1.00 19.23 ? 116  ASN A ND2   1 
ATOM   757  N N     . ASN A 1 117 ? 52.169  35.208 19.253  1.00 25.94 ? 117  ASN A N     1 
ATOM   758  C CA    . ASN A 1 117 ? 52.679  35.124 20.627  1.00 16.41 ? 117  ASN A CA    1 
ATOM   759  C C     . ASN A 1 117 ? 51.673  35.754 21.594  1.00 20.20 ? 117  ASN A C     1 
ATOM   760  O O     . ASN A 1 117 ? 51.517  35.316 22.739  1.00 24.45 ? 117  ASN A O     1 
ATOM   761  C CB    . ASN A 1 117 ? 54.046  35.780 20.822  1.00 15.23 ? 117  ASN A CB    1 
ATOM   762  C CG    . ASN A 1 117 ? 55.163  34.983 20.180  1.00 32.76 ? 117  ASN A CG    1 
ATOM   763  O OD1   . ASN A 1 117 ? 56.277  35.494 19.933  1.00 37.12 ? 117  ASN A OD1   1 
ATOM   764  N ND2   . ASN A 1 117 ? 54.915  33.700 20.001  1.00 24.33 ? 117  ASN A ND2   1 
ATOM   765  N N     . LEU A 1 118 ? 51.022  36.834 21.161  1.00 19.51 ? 118  LEU A N     1 
ATOM   766  C CA    . LEU A 1 118 ? 50.080  37.539 22.015  1.00 20.33 ? 118  LEU A CA    1 
ATOM   767  C C     . LEU A 1 118 ? 48.861  36.637 22.215  1.00 20.01 ? 118  LEU A C     1 
ATOM   768  O O     . LEU A 1 118 ? 48.453  36.367 23.349  1.00 21.40 ? 118  LEU A O     1 
ATOM   769  C CB    . LEU A 1 118 ? 49.647  38.898 21.415  1.00 16.68 ? 118  LEU A CB    1 
ATOM   770  C CG    . LEU A 1 118 ? 50.676  40.021 21.600  1.00 25.23 ? 118  LEU A CG    1 
ATOM   771  C CD1   . LEU A 1 118 ? 49.966  41.374 21.490  1.00 25.27 ? 118  LEU A CD1   1 
ATOM   772  C CD2   . LEU A 1 118 ? 51.374  39.916 22.947  1.00 20.57 ? 118  LEU A CD2   1 
ATOM   773  N N     . THR A 1 119 ? 48.310  36.124 21.118  1.00 18.30 ? 119  THR A N     1 
ATOM   774  C CA    . THR A 1 119 ? 47.117  35.300 21.214  1.00 31.61 ? 119  THR A CA    1 
ATOM   775  C C     . THR A 1 119 ? 47.296  34.063 22.077  1.00 26.25 ? 119  THR A C     1 
ATOM   776  O O     . THR A 1 119 ? 46.482  33.728 22.938  1.00 27.29 ? 119  THR A O     1 
ATOM   777  C CB    . THR A 1 119 ? 46.488  34.958 19.855  1.00 27.59 ? 119  THR A CB    1 
ATOM   778  O OG1   . THR A 1 119 ? 47.229  33.924 19.256  1.00 44.37 ? 119  THR A OG1   1 
ATOM   779  C CG2   . THR A 1 119 ? 46.520  36.164 18.935  1.00 20.26 ? 119  THR A CG2   1 
ATOM   780  N N     . LYS A 1 120 ? 48.402  33.389 21.906  1.00 20.44 ? 120  LYS A N     1 
ATOM   781  C CA    . LYS A 1 120 ? 48.663  32.208 22.714  1.00 21.81 ? 120  LYS A CA    1 
ATOM   782  C C     . LYS A 1 120 ? 48.737  32.531 24.210  1.00 39.82 ? 120  LYS A C     1 
ATOM   783  O O     . LYS A 1 120 ? 48.577  31.627 25.041  1.00 30.82 ? 120  LYS A O     1 
ATOM   784  C CB    . LYS A 1 120 ? 49.932  31.531 22.247  1.00 22.92 ? 120  LYS A CB    1 
ATOM   785  C CG    . LYS A 1 120 ? 49.683  30.668 21.014  1.00 37.98 ? 120  LYS A CG    1 
ATOM   786  C CD    . LYS A 1 120 ? 50.905  29.863 20.610  1.00 46.21 ? 120  LYS A CD    1 
ATOM   787  C CE    . LYS A 1 120 ? 52.205  30.519 21.052  1.00 54.56 ? 120  LYS A CE    1 
ATOM   788  N NZ    . LYS A 1 120 ? 53.401  29.851 20.496  1.00 65.87 ? 120  LYS A NZ    1 
ATOM   789  N N     . SER A 1 121 ? 49.047  33.806 24.541  1.00 31.86 ? 121  SER A N     1 
ATOM   790  C CA    . SER A 1 121 ? 49.192  34.219 25.922  1.00 18.95 ? 121  SER A CA    1 
ATOM   791  C C     . SER A 1 121 ? 47.868  34.737 26.447  1.00 16.86 ? 121  SER A C     1 
ATOM   792  O O     . SER A 1 121 ? 47.768  35.114 27.614  1.00 28.89 ? 121  SER A O     1 
ATOM   793  C CB    . SER A 1 121 ? 50.283  35.250 26.119  1.00 24.94 ? 121  SER A CB    1 
ATOM   794  O OG    . SER A 1 121 ? 51.558  34.628 26.057  1.00 40.58 ? 121  SER A OG    1 
ATOM   795  N N     . HIS A 1 122 ? 46.891  34.845 25.554  1.00 21.36 ? 122  HIS A N     1 
ATOM   796  C CA    . HIS A 1 122 ? 45.570  35.313 25.923  1.00 25.32 ? 122  HIS A CA    1 
ATOM   797  C C     . HIS A 1 122 ? 45.562  36.802 26.174  1.00 31.56 ? 122  HIS A C     1 
ATOM   798  O O     . HIS A 1 122 ? 44.814  37.309 27.013  1.00 29.50 ? 122  HIS A O     1 
ATOM   799  C CB    . HIS A 1 122 ? 45.056  34.549 27.157  1.00 31.55 ? 122  HIS A CB    1 
ATOM   800  C CG    . HIS A 1 122 ? 45.094  33.095 26.852  1.00 38.95 ? 122  HIS A CG    1 
ATOM   801  N ND1   . HIS A 1 122 ? 45.973  32.219 27.511  1.00 46.33 ? 122  HIS A ND1   1 
ATOM   802  C CD2   . HIS A 1 122 ? 44.415  32.400 25.885  1.00 38.44 ? 122  HIS A CD2   1 
ATOM   803  C CE1   . HIS A 1 122 ? 45.793  31.014 26.956  1.00 43.51 ? 122  HIS A CE1   1 
ATOM   804  N NE2   . HIS A 1 122 ? 44.885  31.098 25.971  1.00 45.33 ? 122  HIS A NE2   1 
ATOM   805  N N     . ILE A 1 123 ? 46.435  37.500 25.468  1.00 17.52 ? 123  ILE A N     1 
ATOM   806  C CA    . ILE A 1 123 ? 46.506  38.947 25.618  1.00 20.28 ? 123  ILE A CA    1 
ATOM   807  C C     . ILE A 1 123 ? 45.619  39.540 24.568  1.00 15.49 ? 123  ILE A C     1 
ATOM   808  O O     . ILE A 1 123 ? 45.718  39.212 23.400  1.00 19.48 ? 123  ILE A O     1 
ATOM   809  C CB    . ILE A 1 123 ? 47.945  39.491 25.478  1.00 11.90 ? 123  ILE A CB    1 
ATOM   810  C CG1   . ILE A 1 123 ? 48.758  39.050 26.706  1.00 13.98 ? 123  ILE A CG1   1 
ATOM   811  C CG2   . ILE A 1 123 ? 47.911  41.024 25.405  1.00 18.29 ? 123  ILE A CG2   1 
ATOM   812  C CD1   . ILE A 1 123 ? 50.227  38.769 26.441  1.00 17.89 ? 123  ILE A CD1   1 
ATOM   813  N N     . GLU A 1 124 ? 44.813  40.484 24.965  1.00 14.15 ? 124  GLU A N     1 
ATOM   814  C CA    . GLU A 1 124 ? 43.947  41.158 24.017  1.00 13.13 ? 124  GLU A CA    1 
ATOM   815  C C     . GLU A 1 124 ? 44.710  42.257 23.278  1.00 17.94 ? 124  GLU A C     1 
ATOM   816  O O     . GLU A 1 124 ? 45.565  42.917 23.857  1.00 25.11 ? 124  GLU A O     1 
ATOM   817  C CB    . GLU A 1 124 ? 42.757  41.722 24.807  1.00 26.79 ? 124  GLU A CB    1 
ATOM   818  C CG    . GLU A 1 124 ? 41.645  42.305 23.934  1.00 47.53 ? 124  GLU A CG    1 
ATOM   819  C CD    . GLU A 1 124 ? 40.254  41.972 24.410  1.00 52.62 ? 124  GLU A CD    1 
ATOM   820  O OE1   . GLU A 1 124 ? 40.159  41.610 25.679  1.00 41.84 ? 124  GLU A OE1   1 
ATOM   821  O OE2   . GLU A 1 124 ? 39.295  42.137 23.680  1.00 63.75 ? 124  GLU A OE2   1 
ATOM   822  N N     . ILE A 1 125 ? 44.465  42.399 21.967  1.00 22.67 ? 125  ILE A N     1 
ATOM   823  C CA    . ILE A 1 125 ? 45.150  43.416 21.165  1.00 21.77 ? 125  ILE A CA    1 
ATOM   824  C C     . ILE A 1 125 ? 44.090  44.420 20.775  1.00 22.11 ? 125  ILE A C     1 
ATOM   825  O O     . ILE A 1 125 ? 43.109  44.054 20.145  1.00 32.21 ? 125  ILE A O     1 
ATOM   826  C CB    . ILE A 1 125 ? 45.767  42.837 19.896  1.00 19.25 ? 125  ILE A CB    1 
ATOM   827  C CG1   . ILE A 1 125 ? 46.825  41.781 20.217  1.00 20.38 ? 125  ILE A CG1   1 
ATOM   828  C CG2   . ILE A 1 125 ? 46.335  43.960 19.037  1.00 13.23 ? 125  ILE A CG2   1 
ATOM   829  C CD1   . ILE A 1 125 ? 46.893  40.696 19.139  1.00 26.64 ? 125  ILE A CD1   1 
ATOM   830  N N     . ILE A 1 126 ? 44.198  45.644 21.270  1.00 18.02 ? 126  ILE A N     1 
ATOM   831  C CA    . ILE A 1 126 ? 43.258  46.705 20.948  1.00 19.91 ? 126  ILE A CA    1 
ATOM   832  C C     . ILE A 1 126 ? 43.960  47.525 19.907  1.00 19.18 ? 126  ILE A C     1 
ATOM   833  O O     . ILE A 1 126 ? 45.051  48.019 20.161  1.00 19.37 ? 126  ILE A O     1 
ATOM   834  C CB    . ILE A 1 126 ? 42.950  47.574 22.166  1.00 22.85 ? 126  ILE A CB    1 
ATOM   835  C CG1   . ILE A 1 126 ? 42.285  46.710 23.248  1.00 23.73 ? 126  ILE A CG1   1 
ATOM   836  C CG2   . ILE A 1 126 ? 42.017  48.700 21.765  1.00 22.76 ? 126  ILE A CG2   1 
ATOM   837  C CD1   . ILE A 1 126 ? 42.186  47.416 24.596  1.00 20.53 ? 126  ILE A CD1   1 
ATOM   838  N N     . ARG A 1 127 ? 43.394  47.551 18.712  1.00 23.46 ? 127  ARG A N     1 
ATOM   839  C CA    . ARG A 1 127 ? 44.009  48.227 17.582  1.00 21.11 ? 127  ARG A CA    1 
ATOM   840  C C     . ARG A 1 127 ? 43.559  49.689 17.514  1.00 27.12 ? 127  ARG A C     1 
ATOM   841  O O     . ARG A 1 127 ? 42.373  50.005 17.627  1.00 33.20 ? 127  ARG A O     1 
ATOM   842  C CB    . ARG A 1 127 ? 43.743  47.469 16.282  1.00 21.23 ? 127  ARG A CB    1 
ATOM   843  C CG    . ARG A 1 127 ? 44.929  46.645 15.748  1.00 43.43 ? 127  ARG A CG    1 
ATOM   844  C CD    . ARG A 1 127 ? 44.919  45.139 16.040  1.00 51.38 ? 127  ARG A CD    1 
ATOM   845  N NE    . ARG A 1 127 ? 43.682  44.429 15.665  1.00 71.41 ? 127  ARG A NE    1 
ATOM   846  C CZ    . ARG A 1 127 ? 43.497  43.090 15.688  1.00 73.77 ? 127  ARG A CZ    1 
ATOM   847  N NH1   . ARG A 1 127 ? 44.516  42.273 16.003  1.00 70.67 ? 127  ARG A NH1   1 
ATOM   848  N NH2   . ARG A 1 127 ? 42.310  42.543 15.371  1.00 74.07 ? 127  ARG A NH2   1 
ATOM   849  N N     . GLY A 1 128 ? 44.500  50.627 17.420  1.00 18.23 ? 128  GLY A N     1 
ATOM   850  C CA    . GLY A 1 128 ? 44.081  52.024 17.364  1.00 20.47 ? 128  GLY A CA    1 
ATOM   851  C C     . GLY A 1 128 ? 45.007  52.902 18.202  1.00 24.77 ? 128  GLY A C     1 
ATOM   852  O O     . GLY A 1 128 ? 45.943  52.403 18.808  1.00 21.36 ? 128  GLY A O     1 
ATOM   853  N N     . HIS A 1 129 ? 44.717  54.195 18.252  1.00 22.48 ? 129  HIS A N     1 
ATOM   854  C CA    . HIS A 1 129 ? 45.577  55.139 18.944  1.00 14.54 ? 129  HIS A CA    1 
ATOM   855  C C     . HIS A 1 129 ? 45.005  55.536 20.286  1.00 17.46 ? 129  HIS A C     1 
ATOM   856  O O     . HIS A 1 129 ? 43.888  56.050 20.353  1.00 32.26 ? 129  HIS A O     1 
ATOM   857  C CB    . HIS A 1 129 ? 45.738  56.365 18.035  1.00 19.47 ? 129  HIS A CB    1 
ATOM   858  C CG    . HIS A 1 129 ? 46.343  57.492 18.772  1.00 21.54 ? 129  HIS A CG    1 
ATOM   859  N ND1   . HIS A 1 129 ? 47.686  57.790 18.624  1.00 36.00 ? 129  HIS A ND1   1 
ATOM   860  C CD2   . HIS A 1 129 ? 45.790  58.347 19.681  1.00 34.82 ? 129  HIS A CD2   1 
ATOM   861  C CE1   . HIS A 1 129 ? 47.929  58.812 19.442  1.00 40.29 ? 129  HIS A CE1   1 
ATOM   862  N NE2   . HIS A 1 129 ? 46.810  59.178 20.089  1.00 32.45 ? 129  HIS A NE2   1 
ATOM   863  N N     . ALA A 1 130 ? 45.750  55.242 21.358  1.00 16.91 ? 130  ALA A N     1 
ATOM   864  C CA    . ALA A 1 130 ? 45.266  55.498 22.729  1.00 13.01 ? 130  ALA A CA    1 
ATOM   865  C C     . ALA A 1 130 ? 45.567  56.914 23.191  1.00 23.89 ? 130  ALA A C     1 
ATOM   866  O O     . ALA A 1 130 ? 46.582  57.485 22.849  1.00 24.33 ? 130  ALA A O     1 
ATOM   867  C CB    . ALA A 1 130 ? 45.875  54.522 23.738  1.00 10.64 ? 130  ALA A CB    1 
ATOM   868  N N     . ALA A 1 131 ? 44.700  57.473 24.025  1.00 21.87 ? 131  ALA A N     1 
ATOM   869  C CA    . ALA A 1 131 ? 44.936  58.777 24.628  1.00 24.97 ? 131  ALA A CA    1 
ATOM   870  C C     . ALA A 1 131 ? 44.246  58.731 25.970  1.00 24.37 ? 131  ALA A C     1 
ATOM   871  O O     . ALA A 1 131 ? 43.218  58.054 26.079  1.00 25.56 ? 131  ALA A O     1 
ATOM   872  C CB    . ALA A 1 131 ? 44.377  59.904 23.781  1.00 22.86 ? 131  ALA A CB    1 
ATOM   873  N N     . PHE A 1 132 ? 44.841  59.379 26.972  1.00 16.72 ? 132  PHE A N     1 
ATOM   874  C CA    . PHE A 1 132 ? 44.278  59.439 28.299  1.00 20.15 ? 132  PHE A CA    1 
ATOM   875  C C     . PHE A 1 132 ? 43.025  60.285 28.288  1.00 29.75 ? 132  PHE A C     1 
ATOM   876  O O     . PHE A 1 132 ? 42.877  61.163 27.445  1.00 28.53 ? 132  PHE A O     1 
ATOM   877  C CB    . PHE A 1 132 ? 45.251  60.031 29.318  1.00 18.09 ? 132  PHE A CB    1 
ATOM   878  C CG    . PHE A 1 132 ? 46.285  59.025 29.694  1.00 18.09 ? 132  PHE A CG    1 
ATOM   879  C CD1   . PHE A 1 132 ? 46.005  58.036 30.639  1.00 21.54 ? 132  PHE A CD1   1 
ATOM   880  C CD2   . PHE A 1 132 ? 47.517  59.033 29.052  1.00 24.69 ? 132  PHE A CD2   1 
ATOM   881  C CE1   . PHE A 1 132 ? 46.956  57.070 30.965  1.00 20.74 ? 132  PHE A CE1   1 
ATOM   882  C CE2   . PHE A 1 132 ? 48.483  58.084 29.377  1.00 27.26 ? 132  PHE A CE2   1 
ATOM   883  C CZ    . PHE A 1 132 ? 48.189  57.086 30.306  1.00 24.56 ? 132  PHE A CZ    1 
ATOM   884  N N     . THR A 1 133 ? 42.127  60.023 29.239  1.00 25.01 ? 133  THR A N     1 
ATOM   885  C CA    . THR A 1 133 ? 40.938  60.851 29.374  1.00 35.68 ? 133  THR A CA    1 
ATOM   886  C C     . THR A 1 133 ? 41.044  61.715 30.630  1.00 33.52 ? 133  THR A C     1 
ATOM   887  O O     . THR A 1 133 ? 41.897  61.543 31.530  1.00 31.71 ? 133  THR A O     1 
ATOM   888  C CB    . THR A 1 133 ? 39.596  60.098 29.433  1.00 27.57 ? 133  THR A CB    1 
ATOM   889  O OG1   . THR A 1 133 ? 39.587  59.273 30.593  1.00 32.05 ? 133  THR A OG1   1 
ATOM   890  C CG2   . THR A 1 133 ? 39.288  59.360 28.137  1.00 27.65 ? 133  THR A CG2   1 
ATOM   891  N N     . SER A 1 134 ? 40.052  62.599 30.689  1.00 43.04 ? 134  SER A N     1 
ATOM   892  C CA    . SER A 1 134 ? 39.851  63.590 31.725  1.00 41.41 ? 134  SER A CA    1 
ATOM   893  C C     . SER A 1 134 ? 39.420  62.901 32.995  1.00 50.87 ? 134  SER A C     1 
ATOM   894  O O     . SER A 1 134 ? 39.529  63.475 34.072  1.00 61.65 ? 134  SER A O     1 
ATOM   895  C CB    . SER A 1 134 ? 38.788  64.569 31.271  1.00 52.02 ? 134  SER A CB    1 
ATOM   896  O OG    . SER A 1 134 ? 38.081  64.003 30.163  1.00 60.23 ? 134  SER A OG    1 
ATOM   897  N N     . ASP A 1 135 ? 38.929  61.663 32.858  1.00 46.71 ? 135  ASP A N     1 
ATOM   898  C CA    . ASP A 1 135 ? 38.477  60.885 33.996  1.00 39.44 ? 135  ASP A CA    1 
ATOM   899  C C     . ASP A 1 135 ? 39.510  60.877 35.093  1.00 40.36 ? 135  ASP A C     1 
ATOM   900  O O     . ASP A 1 135 ? 40.730  60.813 34.917  1.00 48.07 ? 135  ASP A O     1 
ATOM   901  C CB    . ASP A 1 135 ? 38.043  59.449 33.676  1.00 37.37 ? 135  ASP A CB    1 
ATOM   902  C CG    . ASP A 1 135 ? 36.831  59.356 32.794  1.00 48.58 ? 135  ASP A CG    1 
ATOM   903  O OD1   . ASP A 1 135 ? 35.737  59.825 33.355  1.00 57.76 ? 135  ASP A OD1   1 
ATOM   904  O OD2   . ASP A 1 135 ? 36.850  58.790 31.712  1.00 51.56 ? 135  ASP A OD2   1 
ATOM   905  N N     . PRO A 1 136 ? 38.909  60.899 36.250  1.00 47.37 ? 136  PRO A N     1 
ATOM   906  C CA    . PRO A 1 136 ? 39.547  60.873 37.545  1.00 45.23 ? 136  PRO A CA    1 
ATOM   907  C C     . PRO A 1 136 ? 40.478  59.675 37.625  1.00 53.37 ? 136  PRO A C     1 
ATOM   908  O O     . PRO A 1 136 ? 41.697  59.855 37.610  1.00 61.67 ? 136  PRO A O     1 
ATOM   909  C CB    . PRO A 1 136 ? 38.399  60.767 38.553  1.00 49.10 ? 136  PRO A CB    1 
ATOM   910  C CG    . PRO A 1 136 ? 37.081  60.790 37.778  1.00 50.80 ? 136  PRO A CG    1 
ATOM   911  C CD    . PRO A 1 136 ? 37.428  60.823 36.300  1.00 45.57 ? 136  PRO A CD    1 
ATOM   912  N N     . LYS A 1 137 ? 39.912  58.461 37.722  1.00 57.98 ? 137  LYS A N     1 
ATOM   913  C CA    . LYS A 1 137 ? 40.766  57.286 37.704  1.00 46.58 ? 137  LYS A CA    1 
ATOM   914  C C     . LYS A 1 137 ? 41.314  57.143 36.274  1.00 36.48 ? 137  LYS A C     1 
ATOM   915  O O     . LYS A 1 137 ? 40.581  57.309 35.272  1.00 31.89 ? 137  LYS A O     1 
ATOM   916  C CB    . LYS A 1 137 ? 40.143  56.016 38.290  1.00 41.84 ? 137  LYS A CB    1 
ATOM   917  C CG    . LYS A 1 137 ? 39.202  55.239 37.371  1.00 39.07 ? 137  LYS A CG    1 
ATOM   918  C CD    . LYS A 1 137 ? 38.433  54.115 38.087  1.00 52.78 ? 137  LYS A CD    1 
ATOM   919  C CE    . LYS A 1 137 ? 37.824  53.057 37.157  1.00 57.95 ? 137  LYS A CE    1 
ATOM   920  N NZ    . LYS A 1 137 ? 36.605  53.497 36.443  1.00 62.25 ? 137  LYS A NZ    1 
ATOM   921  N N     . PRO A 1 138 ? 42.634  56.965 36.184  1.00 29.10 ? 138  PRO A N     1 
ATOM   922  C CA    . PRO A 1 138 ? 43.308  56.886 34.898  1.00 22.94 ? 138  PRO A CA    1 
ATOM   923  C C     . PRO A 1 138 ? 42.599  55.922 33.952  1.00 19.99 ? 138  PRO A C     1 
ATOM   924  O O     . PRO A 1 138 ? 42.442  54.725 34.220  1.00 21.90 ? 138  PRO A O     1 
ATOM   925  C CB    . PRO A 1 138 ? 44.748  56.472 35.188  1.00 29.53 ? 138  PRO A CB    1 
ATOM   926  C CG    . PRO A 1 138 ? 44.946  56.533 36.703  1.00 30.75 ? 138  PRO A CG    1 
ATOM   927  C CD    . PRO A 1 138 ? 43.557  56.672 37.318  1.00 28.76 ? 138  PRO A CD    1 
ATOM   928  N N     . THR A 1 139 ? 42.154  56.494 32.846  1.00 18.70 ? 139  THR A N     1 
ATOM   929  C CA    . THR A 1 139 ? 41.374  55.814 31.867  1.00 18.97 ? 139  THR A CA    1 
ATOM   930  C C     . THR A 1 139 ? 41.787  56.326 30.494  1.00 20.62 ? 139  THR A C     1 
ATOM   931  O O     . THR A 1 139 ? 41.972  57.523 30.329  1.00 25.68 ? 139  THR A O     1 
ATOM   932  C CB    . THR A 1 139 ? 39.886  56.170 32.156  1.00 27.62 ? 139  THR A CB    1 
ATOM   933  O OG1   . THR A 1 139 ? 39.476  55.668 33.413  1.00 29.12 ? 139  THR A OG1   1 
ATOM   934  C CG2   . THR A 1 139 ? 38.971  55.626 31.091  1.00 26.23 ? 139  THR A CG2   1 
ATOM   935  N N     . ILE A 1 140 ? 41.922  55.401 29.524  1.00 20.41 ? 140  ILE A N     1 
ATOM   936  C CA    . ILE A 1 140 ? 42.248  55.699 28.134  1.00 21.71 ? 140  ILE A CA    1 
ATOM   937  C C     . ILE A 1 140 ? 41.060  55.467 27.223  1.00 31.91 ? 140  ILE A C     1 
ATOM   938  O O     . ILE A 1 140 ? 40.155  54.664 27.505  1.00 24.87 ? 140  ILE A O     1 
ATOM   939  C CB    . ILE A 1 140 ? 43.494  54.970 27.598  1.00 20.18 ? 140  ILE A CB    1 
ATOM   940  C CG1   . ILE A 1 140 ? 43.167  53.476 27.335  1.00 21.81 ? 140  ILE A CG1   1 
ATOM   941  C CG2   . ILE A 1 140 ? 44.580  55.164 28.645  1.00 26.18 ? 140  ILE A CG2   1 
ATOM   942  C CD1   . ILE A 1 140 ? 44.258  52.558 26.725  1.00 5.00  ? 140  ILE A CD1   1 
ATOM   943  N N     . GLU A 1 141 ? 41.128  56.173 26.103  1.00 21.13 ? 141  GLU A N     1 
ATOM   944  C CA    . GLU A 1 141 ? 40.154  56.064 25.054  1.00 21.79 ? 141  GLU A CA    1 
ATOM   945  C C     . GLU A 1 141 ? 40.811  55.668 23.735  1.00 25.15 ? 141  GLU A C     1 
ATOM   946  O O     . GLU A 1 141 ? 41.757  56.295 23.297  1.00 27.59 ? 141  GLU A O     1 
ATOM   947  C CB    . GLU A 1 141 ? 39.408  57.396 24.899  1.00 29.05 ? 141  GLU A CB    1 
ATOM   948  C CG    . GLU A 1 141 ? 38.060  57.122 24.244  1.00 36.05 ? 141  GLU A CG    1 
ATOM   949  C CD    . GLU A 1 141 ? 37.278  58.369 24.028  1.00 55.16 ? 141  GLU A CD    1 
ATOM   950  O OE1   . GLU A 1 141 ? 36.483  58.819 24.841  1.00 62.32 ? 141  GLU A OE1   1 
ATOM   951  O OE2   . GLU A 1 141 ? 37.453  58.821 22.815  1.00 66.54 ? 141  GLU A OE2   1 
ATOM   952  N N     . VAL A 1 142 ? 40.262  54.654 23.074  1.00 22.64 ? 142  VAL A N     1 
ATOM   953  C CA    . VAL A 1 142 ? 40.750  54.190 21.786  1.00 21.80 ? 142  VAL A CA    1 
ATOM   954  C C     . VAL A 1 142 ? 39.566  54.001 20.872  1.00 33.43 ? 142  VAL A C     1 
ATOM   955  O O     . VAL A 1 142 ? 38.758  53.089 21.098  1.00 33.71 ? 142  VAL A O     1 
ATOM   956  C CB    . VAL A 1 142 ? 41.431  52.831 21.866  1.00 16.36 ? 142  VAL A CB    1 
ATOM   957  C CG1   . VAL A 1 142 ? 41.997  52.512 20.503  1.00 17.46 ? 142  VAL A CG1   1 
ATOM   958  C CG2   . VAL A 1 142 ? 42.461  52.728 22.999  1.00 19.26 ? 142  VAL A CG2   1 
ATOM   959  N N     . SER A 1 143 ? 39.415  54.887 19.889  1.00 34.63 ? 143  SER A N     1 
ATOM   960  C CA    . SER A 1 143 ? 38.340  54.758 18.918  1.00 34.70 ? 143  SER A CA    1 
ATOM   961  C C     . SER A 1 143 ? 36.957  54.865 19.555  1.00 38.96 ? 143  SER A C     1 
ATOM   962  O O     . SER A 1 143 ? 36.056  54.076 19.248  1.00 49.28 ? 143  SER A O     1 
ATOM   963  C CB    . SER A 1 143 ? 38.476  53.420 18.203  1.00 36.69 ? 143  SER A CB    1 
ATOM   964  O OG    . SER A 1 143 ? 39.417  53.533 17.149  1.00 51.34 ? 143  SER A OG    1 
ATOM   965  N N     . GLY A 1 144 ? 36.791  55.793 20.489  1.00 38.03 ? 144  GLY A N     1 
ATOM   966  C CA    . GLY A 1 144 ? 35.487  55.979 21.113  1.00 38.67 ? 144  GLY A CA    1 
ATOM   967  C C     . GLY A 1 144 ? 35.246  55.122 22.354  1.00 39.50 ? 144  GLY A C     1 
ATOM   968  O O     . GLY A 1 144 ? 34.407  55.483 23.175  1.00 51.85 ? 144  GLY A O     1 
ATOM   969  N N     . LYS A 1 145 ? 35.955  54.006 22.515  1.00 29.01 ? 145  LYS A N     1 
ATOM   970  C CA    . LYS A 1 145 ? 35.712  53.158 23.663  1.00 30.51 ? 145  LYS A CA    1 
ATOM   971  C C     . LYS A 1 145 ? 36.692  53.434 24.773  1.00 28.99 ? 145  LYS A C     1 
ATOM   972  O O     . LYS A 1 145 ? 37.856  53.712 24.516  1.00 23.25 ? 145  LYS A O     1 
ATOM   973  C CB    . LYS A 1 145 ? 35.819  51.686 23.313  1.00 31.31 ? 145  LYS A CB    1 
ATOM   974  C CG    . LYS A 1 145 ? 34.951  51.335 22.125  1.00 40.54 ? 145  LYS A CG    1 
ATOM   975  C CD    . LYS A 1 145 ? 33.977  50.209 22.423  1.00 52.27 ? 145  LYS A CD    1 
ATOM   976  C CE    . LYS A 1 145 ? 34.633  48.826 22.391  1.00 66.38 ? 145  LYS A CE    1 
ATOM   977  N NZ    . LYS A 1 145 ? 33.694  47.703 22.611  1.00 66.08 ? 145  LYS A NZ    1 
ATOM   978  N N     . LYS A 1 146 ? 36.225  53.252 26.002  1.00 20.15 ? 146  LYS A N     1 
ATOM   979  C CA    . LYS A 1 146 ? 37.061  53.470 27.152  1.00 23.31 ? 146  LYS A CA    1 
ATOM   980  C C     . LYS A 1 146 ? 37.569  52.148 27.717  1.00 35.12 ? 146  LYS A C     1 
ATOM   981  O O     . LYS A 1 146 ? 36.858  51.146 27.646  1.00 31.78 ? 146  LYS A O     1 
ATOM   982  C CB    . LYS A 1 146 ? 36.289  54.227 28.188  1.00 22.60 ? 146  LYS A CB    1 
ATOM   983  C CG    . LYS A 1 146 ? 35.931  55.630 27.719  1.00 26.49 ? 146  LYS A CG    1 
ATOM   984  C CD    . LYS A 1 146 ? 36.084  56.615 28.860  1.00 38.64 ? 146  LYS A CD    1 
ATOM   985  C CE    . LYS A 1 146 ? 34.842  57.444 29.133  1.00 55.87 ? 146  LYS A CE    1 
ATOM   986  N NZ    . LYS A 1 146 ? 35.103  58.897 29.175  1.00 58.22 ? 146  LYS A NZ    1 
ATOM   987  N N     . TYR A 1 147 ? 38.789  52.187 28.304  1.00 20.53 ? 147  TYR A N     1 
ATOM   988  C CA    . TYR A 1 147 ? 39.453  51.050 28.913  1.00 10.47 ? 147  TYR A CA    1 
ATOM   989  C C     . TYR A 1 147 ? 40.132  51.521 30.165  1.00 25.14 ? 147  TYR A C     1 
ATOM   990  O O     . TYR A 1 147 ? 40.662  52.630 30.161  1.00 29.41 ? 147  TYR A O     1 
ATOM   991  C CB    . TYR A 1 147 ? 40.533  50.517 28.012  1.00 14.80 ? 147  TYR A CB    1 
ATOM   992  C CG    . TYR A 1 147 ? 39.930  50.145 26.693  1.00 22.40 ? 147  TYR A CG    1 
ATOM   993  C CD1   . TYR A 1 147 ? 39.473  48.857 26.529  1.00 25.53 ? 147  TYR A CD1   1 
ATOM   994  C CD2   . TYR A 1 147 ? 39.851  51.055 25.624  1.00 17.58 ? 147  TYR A CD2   1 
ATOM   995  C CE1   . TYR A 1 147 ? 38.951  48.430 25.315  1.00 23.71 ? 147  TYR A CE1   1 
ATOM   996  C CE2   . TYR A 1 147 ? 39.331  50.638 24.395  1.00 11.32 ? 147  TYR A CE2   1 
ATOM   997  C CZ    . TYR A 1 147 ? 38.837  49.323 24.270  1.00 25.79 ? 147  TYR A CZ    1 
ATOM   998  O OH    . TYR A 1 147 ? 38.296  48.891 23.101  1.00 32.26 ? 147  TYR A OH    1 
ATOM   999  N N     . THR A 1 148 ? 40.228  50.683 31.204  1.00 16.33 ? 148  THR A N     1 
ATOM   1000 C CA    . THR A 1 148 ? 40.887  51.140 32.424  1.00 13.65 ? 148  THR A CA    1 
ATOM   1001 C C     . THR A 1 148 ? 41.578  49.962 33.070  1.00 20.41 ? 148  THR A C     1 
ATOM   1002 O O     . THR A 1 148 ? 41.363  48.832 32.628  1.00 22.47 ? 148  THR A O     1 
ATOM   1003 C CB    . THR A 1 148 ? 39.961  51.889 33.408  1.00 17.85 ? 148  THR A CB    1 
ATOM   1004 O OG1   . THR A 1 148 ? 40.726  52.341 34.514  1.00 17.71 ? 148  THR A OG1   1 
ATOM   1005 C CG2   . THR A 1 148 ? 38.901  50.941 33.977  1.00 21.72 ? 148  THR A CG2   1 
ATOM   1006 N N     . ALA A 1 149 ? 42.470  50.218 34.033  1.00 20.52 ? 149  ALA A N     1 
ATOM   1007 C CA    . ALA A 1 149 ? 43.190  49.164 34.737  1.00 8.45  ? 149  ALA A CA    1 
ATOM   1008 C C     . ALA A 1 149 ? 43.848  49.800 35.924  1.00 14.86 ? 149  ALA A C     1 
ATOM   1009 O O     . ALA A 1 149 ? 44.083  51.011 35.943  1.00 26.49 ? 149  ALA A O     1 
ATOM   1010 C CB    . ALA A 1 149 ? 44.199  48.447 33.832  1.00 8.53  ? 149  ALA A CB    1 
ATOM   1011 N N     . PRO A 1 150 ? 44.097  49.026 36.955  1.00 20.09 ? 150  PRO A N     1 
ATOM   1012 C CA    . PRO A 1 150 ? 44.764  49.601 38.099  1.00 16.80 ? 150  PRO A CA    1 
ATOM   1013 C C     . PRO A 1 150 ? 46.233  49.839 37.787  1.00 25.80 ? 150  PRO A C     1 
ATOM   1014 O O     . PRO A 1 150 ? 46.885  50.575 38.516  1.00 18.54 ? 150  PRO A O     1 
ATOM   1015 C CB    . PRO A 1 150 ? 44.698  48.554 39.207  1.00 13.09 ? 150  PRO A CB    1 
ATOM   1016 C CG    . PRO A 1 150 ? 44.137  47.288 38.567  1.00 22.49 ? 150  PRO A CG    1 
ATOM   1017 C CD    . PRO A 1 150 ? 43.470  47.717 37.284  1.00 19.17 ? 150  PRO A CD    1 
ATOM   1018 N N     . HIS A 1 151 ? 46.736  49.206 36.717  1.00 21.88 ? 151  HIS A N     1 
ATOM   1019 C CA    . HIS A 1 151 ? 48.128  49.361 36.289  1.00 13.19 ? 151  HIS A CA    1 
ATOM   1020 C C     . HIS A 1 151 ? 48.121  49.611 34.798  1.00 14.54 ? 151  HIS A C     1 
ATOM   1021 O O     . HIS A 1 151 ? 47.683  48.735 34.068  1.00 14.09 ? 151  HIS A O     1 
ATOM   1022 C CB    . HIS A 1 151 ? 48.928  48.088 36.521  1.00 11.44 ? 151  HIS A CB    1 
ATOM   1023 C CG    . HIS A 1 151 ? 48.875  47.665 37.943  1.00 18.38 ? 151  HIS A CG    1 
ATOM   1024 N ND1   . HIS A 1 151 ? 49.542  48.403 38.898  1.00 16.47 ? 151  HIS A ND1   1 
ATOM   1025 C CD2   . HIS A 1 151 ? 48.228  46.621 38.553  1.00 18.48 ? 151  HIS A CD2   1 
ATOM   1026 C CE1   . HIS A 1 151 ? 49.320  47.771 40.064  1.00 18.86 ? 151  HIS A CE1   1 
ATOM   1027 N NE2   . HIS A 1 151 ? 48.556  46.682 39.871  1.00 18.03 ? 151  HIS A NE2   1 
ATOM   1028 N N     . ILE A 1 152 ? 48.602  50.791 34.370  1.00 13.93 ? 152  ILE A N     1 
ATOM   1029 C CA    . ILE A 1 152 ? 48.681  51.181 32.970  1.00 11.15 ? 152  ILE A CA    1 
ATOM   1030 C C     . ILE A 1 152 ? 50.163  51.426 32.623  1.00 16.52 ? 152  ILE A C     1 
ATOM   1031 O O     . ILE A 1 152 ? 50.871  52.151 33.323  1.00 15.47 ? 152  ILE A O     1 
ATOM   1032 C CB    . ILE A 1 152 ? 47.838  52.429 32.715  1.00 13.78 ? 152  ILE A CB    1 
ATOM   1033 C CG1   . ILE A 1 152 ? 46.387  52.118 33.066  1.00 9.64  ? 152  ILE A CG1   1 
ATOM   1034 C CG2   . ILE A 1 152 ? 47.975  52.865 31.252  1.00 13.55 ? 152  ILE A CG2   1 
ATOM   1035 C CD1   . ILE A 1 152 ? 45.430  53.280 32.722  1.00 16.33 ? 152  ILE A CD1   1 
ATOM   1036 N N     . LEU A 1 153 ? 50.676  50.773 31.580  1.00 15.82 ? 153  LEU A N     1 
ATOM   1037 C CA    . LEU A 1 153 ? 52.065  50.963 31.151  1.00 15.08 ? 153  LEU A CA    1 
ATOM   1038 C C     . LEU A 1 153 ? 52.107  51.776 29.853  1.00 18.29 ? 153  LEU A C     1 
ATOM   1039 O O     . LEU A 1 153 ? 51.421  51.455 28.875  1.00 14.99 ? 153  LEU A O     1 
ATOM   1040 C CB    . LEU A 1 153 ? 52.851  49.639 31.012  1.00 10.63 ? 153  LEU A CB    1 
ATOM   1041 C CG    . LEU A 1 153 ? 54.187  49.795 30.328  1.00 13.85 ? 153  LEU A CG    1 
ATOM   1042 C CD1   . LEU A 1 153 ? 55.224  50.317 31.314  1.00 10.20 ? 153  LEU A CD1   1 
ATOM   1043 C CD2   . LEU A 1 153 ? 54.641  48.443 29.779  1.00 14.67 ? 153  LEU A CD2   1 
ATOM   1044 N N     . ILE A 1 154 ? 52.896  52.866 29.829  1.00 13.25 ? 154  ILE A N     1 
ATOM   1045 C CA    . ILE A 1 154 ? 53.040  53.643 28.607  1.00 13.58 ? 154  ILE A CA    1 
ATOM   1046 C C     . ILE A 1 154 ? 54.351  53.195 27.994  1.00 21.11 ? 154  ILE A C     1 
ATOM   1047 O O     . ILE A 1 154 ? 55.376  53.237 28.671  1.00 13.46 ? 154  ILE A O     1 
ATOM   1048 C CB    . ILE A 1 154 ? 53.097  55.159 28.858  1.00 21.28 ? 154  ILE A CB    1 
ATOM   1049 C CG1   . ILE A 1 154 ? 51.815  55.662 29.509  1.00 20.18 ? 154  ILE A CG1   1 
ATOM   1050 C CG2   . ILE A 1 154 ? 53.348  55.927 27.543  1.00 12.68 ? 154  ILE A CG2   1 
ATOM   1051 C CD1   . ILE A 1 154 ? 52.014  56.983 30.258  1.00 18.79 ? 154  ILE A CD1   1 
ATOM   1052 N N     . ALA A 1 155 ? 54.318  52.665 26.758  1.00 11.32 ? 155  ALA A N     1 
ATOM   1053 C CA    . ALA A 1 155 ? 55.558  52.181 26.131  1.00 18.01 ? 155  ALA A CA    1 
ATOM   1054 C C     . ALA A 1 155 ? 55.457  52.481 24.656  1.00 9.30  ? 155  ALA A C     1 
ATOM   1055 O O     . ALA A 1 155 ? 55.587  51.588 23.830  1.00 13.04 ? 155  ALA A O     1 
ATOM   1056 C CB    . ALA A 1 155 ? 55.778  50.669 26.359  1.00 12.25 ? 155  ALA A CB    1 
ATOM   1057 N N     . THR A 1 156 ? 55.167  53.746 24.370  1.00 10.80 ? 156  THR A N     1 
ATOM   1058 C CA    . THR A 1 156 ? 54.903  54.275 23.053  1.00 5.00  ? 156  THR A CA    1 
ATOM   1059 C C     . THR A 1 156 ? 56.137  54.605 22.208  1.00 12.23 ? 156  THR A C     1 
ATOM   1060 O O     . THR A 1 156 ? 55.998  55.066 21.093  1.00 15.28 ? 156  THR A O     1 
ATOM   1061 C CB    . THR A 1 156 ? 53.984  55.469 23.153  1.00 10.49 ? 156  THR A CB    1 
ATOM   1062 O OG1   . THR A 1 156 ? 54.577  56.343 24.086  1.00 15.89 ? 156  THR A OG1   1 
ATOM   1063 C CG2   . THR A 1 156 ? 52.597  55.039 23.653  1.00 8.62  ? 156  THR A CG2   1 
ATOM   1064 N N     . GLY A 1 157 ? 57.335  54.392 22.717  1.00 9.66  ? 157  GLY A N     1 
ATOM   1065 C CA    . GLY A 1 157 ? 58.573  54.538 21.974  1.00 6.85  ? 157  GLY A CA    1 
ATOM   1066 C C     . GLY A 1 157 ? 58.819  55.987 21.571  1.00 17.53 ? 157  GLY A C     1 
ATOM   1067 O O     . GLY A 1 157 ? 58.338  56.933 22.209  1.00 11.94 ? 157  GLY A O     1 
ATOM   1068 N N     . GLY A 1 158 ? 59.552  56.139 20.466  1.00 11.33 ? 158  GLY A N     1 
ATOM   1069 C CA    . GLY A 1 158 ? 59.875  57.454 19.928  1.00 13.70 ? 158  GLY A CA    1 
ATOM   1070 C C     . GLY A 1 158 ? 59.824  57.455 18.404  1.00 13.90 ? 158  GLY A C     1 
ATOM   1071 O O     . GLY A 1 158 ? 59.262  56.550 17.794  1.00 17.58 ? 158  GLY A O     1 
ATOM   1072 N N     . MET A 1 159 ? 60.344  58.536 17.803  1.00 14.49 ? 159  MET A N     1 
ATOM   1073 C CA    . MET A 1 159 ? 60.436  58.758 16.352  1.00 13.92 ? 159  MET A CA    1 
ATOM   1074 C C     . MET A 1 159 ? 61.712  59.514 16.058  1.00 13.91 ? 159  MET A C     1 
ATOM   1075 O O     . MET A 1 159 ? 62.303  60.185 16.902  1.00 15.65 ? 159  MET A O     1 
ATOM   1076 C CB    . MET A 1 159 ? 59.471  59.773 15.754  1.00 14.60 ? 159  MET A CB    1 
ATOM   1077 C CG    . MET A 1 159 ? 58.047  59.706 16.155  1.00 45.11 ? 159  MET A CG    1 
ATOM   1078 S SD    . MET A 1 159 ? 57.394  61.382 16.152  1.00 44.76 ? 159  MET A SD    1 
ATOM   1079 C CE    . MET A 1 159 ? 56.315  61.101 17.575  1.00 44.11 ? 159  MET A CE    1 
ATOM   1080 N N     . PRO A 1 160 ? 62.032  59.486 14.793  1.00 13.06 ? 160  PRO A N     1 
ATOM   1081 C CA    . PRO A 1 160 ? 63.203  60.173 14.329  1.00 19.66 ? 160  PRO A CA    1 
ATOM   1082 C C     . PRO A 1 160 ? 62.980  61.661 14.466  1.00 18.43 ? 160  PRO A C     1 
ATOM   1083 O O     . PRO A 1 160 ? 61.899  62.238 14.207  1.00 14.98 ? 160  PRO A O     1 
ATOM   1084 C CB    . PRO A 1 160 ? 63.379  59.802 12.852  1.00 19.98 ? 160  PRO A CB    1 
ATOM   1085 C CG    . PRO A 1 160 ? 62.478  58.601 12.607  1.00 17.27 ? 160  PRO A CG    1 
ATOM   1086 C CD    . PRO A 1 160 ? 61.405  58.709 13.669  1.00 9.10  ? 160  PRO A CD    1 
ATOM   1087 N N     . SER A 1 161 ? 64.059  62.293 14.839  1.00 17.91 ? 161  SER A N     1 
ATOM   1088 C CA    . SER A 1 161 ? 63.996  63.732 14.951  1.00 17.81 ? 161  SER A CA    1 
ATOM   1089 C C     . SER A 1 161 ? 64.410  64.324 13.589  1.00 29.79 ? 161  SER A C     1 
ATOM   1090 O O     . SER A 1 161 ? 65.294  63.775 12.904  1.00 22.59 ? 161  SER A O     1 
ATOM   1091 C CB    . SER A 1 161 ? 64.900  64.139 16.081  1.00 15.07 ? 161  SER A CB    1 
ATOM   1092 O OG    . SER A 1 161 ? 65.056  65.538 16.008  1.00 32.35 ? 161  SER A OG    1 
ATOM   1093 N N     . THR A 1 162 ? 63.737  65.403 13.155  1.00 21.25 ? 162  THR A N     1 
ATOM   1094 C CA    . THR A 1 162 ? 64.073  66.140 11.929  1.00 23.21 ? 162  THR A CA    1 
ATOM   1095 C C     . THR A 1 162 ? 64.137  67.644 12.225  1.00 40.27 ? 162  THR A C     1 
ATOM   1096 O O     . THR A 1 162 ? 63.472  68.125 13.159  1.00 29.79 ? 162  THR A O     1 
ATOM   1097 C CB    . THR A 1 162 ? 63.183  65.867 10.710  1.00 21.94 ? 162  THR A CB    1 
ATOM   1098 O OG1   . THR A 1 162 ? 61.877  66.298 10.966  1.00 40.19 ? 162  THR A OG1   1 
ATOM   1099 C CG2   . THR A 1 162 ? 63.206  64.374 10.419  1.00 24.91 ? 162  THR A CG2   1 
ATOM   1100 N N     . PRO A 1 163 ? 64.952  68.366 11.427  1.00 36.94 ? 163  PRO A N     1 
ATOM   1101 C CA    . PRO A 1 163 ? 65.074  69.802 11.552  1.00 31.53 ? 163  PRO A CA    1 
ATOM   1102 C C     . PRO A 1 163 ? 63.826  70.486 11.049  1.00 22.47 ? 163  PRO A C     1 
ATOM   1103 O O     . PRO A 1 163 ? 63.128  69.988 10.168  1.00 23.34 ? 163  PRO A O     1 
ATOM   1104 C CB    . PRO A 1 163 ? 66.242  70.258 10.665  1.00 29.55 ? 163  PRO A CB    1 
ATOM   1105 C CG    . PRO A 1 163 ? 66.836  69.005 10.044  1.00 31.34 ? 163  PRO A CG    1 
ATOM   1106 C CD    . PRO A 1 163 ? 66.057  67.829 10.585  1.00 17.34 ? 163  PRO A CD    1 
ATOM   1107 N N     . HIS A 1 164 ? 63.576  71.637 11.664  1.00 30.49 ? 164  HIS A N     1 
ATOM   1108 C CA    . HIS A 1 164 ? 62.481  72.490 11.253  1.00 31.23 ? 164  HIS A CA    1 
ATOM   1109 C C     . HIS A 1 164 ? 62.931  73.239 10.033  1.00 30.20 ? 164  HIS A C     1 
ATOM   1110 O O     . HIS A 1 164 ? 64.095  73.636 9.956   1.00 39.43 ? 164  HIS A O     1 
ATOM   1111 C CB    . HIS A 1 164 ? 62.235  73.521 12.340  1.00 38.24 ? 164  HIS A CB    1 
ATOM   1112 C CG    . HIS A 1 164 ? 61.429  72.924 13.414  1.00 49.86 ? 164  HIS A CG    1 
ATOM   1113 N ND1   . HIS A 1 164 ? 60.045  73.010 13.383  1.00 58.36 ? 164  HIS A ND1   1 
ATOM   1114 C CD2   . HIS A 1 164 ? 61.818  72.164 14.486  1.00 55.42 ? 164  HIS A CD2   1 
ATOM   1115 C CE1   . HIS A 1 164 ? 59.617  72.303 14.432  1.00 69.64 ? 164  HIS A CE1   1 
ATOM   1116 N NE2   . HIS A 1 164 ? 60.651  71.782 15.116  1.00 66.49 ? 164  HIS A NE2   1 
ATOM   1117 N N     . GLU A 1 165 ? 61.976  73.452 9.145   1.00 26.43 ? 165  GLU A N     1 
ATOM   1118 C CA    . GLU A 1 165 ? 62.147  74.240 7.955   1.00 24.70 ? 165  GLU A CA    1 
ATOM   1119 C C     . GLU A 1 165 ? 62.532  75.678 8.358   1.00 36.67 ? 165  GLU A C     1 
ATOM   1120 O O     . GLU A 1 165 ? 63.293  76.367 7.685   1.00 47.03 ? 165  GLU A O     1 
ATOM   1121 C CB    . GLU A 1 165 ? 60.840  74.229 7.147   1.00 26.92 ? 165  GLU A CB    1 
ATOM   1122 C CG    . GLU A 1 165 ? 61.126  74.152 5.633   1.00 42.42 ? 165  GLU A CG    1 
ATOM   1123 C CD    . GLU A 1 165 ? 61.313  72.743 5.154   1.00 39.74 ? 165  GLU A CD    1 
ATOM   1124 O OE1   . GLU A 1 165 ? 61.194  71.799 5.897   1.00 45.48 ? 165  GLU A OE1   1 
ATOM   1125 O OE2   . GLU A 1 165 ? 61.478  72.639 3.855   1.00 44.04 ? 165  GLU A OE2   1 
ATOM   1126 N N     . SER A 1 166 ? 62.078  76.127 9.520   1.00 35.40 ? 166  SER A N     1 
ATOM   1127 C CA    . SER A 1 166 ? 62.448  77.453 10.000  1.00 40.33 ? 166  SER A CA    1 
ATOM   1128 C C     . SER A 1 166 ? 63.945  77.589 10.261  1.00 47.16 ? 166  SER A C     1 
ATOM   1129 O O     . SER A 1 166 ? 64.486  78.669 10.041  1.00 56.41 ? 166  SER A O     1 
ATOM   1130 C CB    . SER A 1 166 ? 61.627  77.982 11.178  1.00 39.36 ? 166  SER A CB    1 
ATOM   1131 O OG    . SER A 1 166 ? 62.043  77.362 12.382  1.00 50.26 ? 166  SER A OG    1 
ATOM   1132 N N     . GLN A 1 167 ? 64.609  76.531 10.756  1.00 44.48 ? 167  GLN A N     1 
ATOM   1133 C CA    . GLN A 1 167 ? 66.046  76.580 11.003  1.00 40.46 ? 167  GLN A CA    1 
ATOM   1134 C C     . GLN A 1 167 ? 66.877  76.121 9.792   1.00 31.87 ? 167  GLN A C     1 
ATOM   1135 O O     . GLN A 1 167 ? 67.895  76.727 9.471   1.00 35.18 ? 167  GLN A O     1 
ATOM   1136 C CB    . GLN A 1 167 ? 66.515  76.041 12.383  1.00 47.76 ? 167  GLN A CB    1 
ATOM   1137 C CG    . GLN A 1 167 ? 66.886  74.533 12.403  1.00 60.96 ? 167  GLN A CG    1 
ATOM   1138 C CD    . GLN A 1 167 ? 68.146  74.132 13.197  1.00 65.87 ? 167  GLN A CD    1 
ATOM   1139 O OE1   . GLN A 1 167 ? 68.069  73.317 14.138  1.00 63.95 ? 167  GLN A OE1   1 
ATOM   1140 N NE2   . GLN A 1 167 ? 69.329  74.546 12.714  1.00 61.83 ? 167  GLN A NE2   1 
ATOM   1141 N N     . ILE A 1 168 ? 66.425  75.083 9.085   1.00 28.65 ? 168  ILE A N     1 
ATOM   1142 C CA    . ILE A 1 168 ? 67.120  74.588 7.915   1.00 17.25 ? 168  ILE A CA    1 
ATOM   1143 C C     . ILE A 1 168 ? 66.115  74.448 6.804   1.00 26.75 ? 168  ILE A C     1 
ATOM   1144 O O     . ILE A 1 168 ? 65.354  73.491 6.733   1.00 33.30 ? 168  ILE A O     1 
ATOM   1145 C CB    . ILE A 1 168 ? 67.782  73.244 8.148   1.00 23.38 ? 168  ILE A CB    1 
ATOM   1146 C CG1   . ILE A 1 168 ? 69.032  73.426 8.986   1.00 28.40 ? 168  ILE A CG1   1 
ATOM   1147 C CG2   . ILE A 1 168 ? 68.184  72.660 6.794   1.00 21.92 ? 168  ILE A CG2   1 
ATOM   1148 C CD1   . ILE A 1 168 ? 69.411  72.197 9.800   1.00 23.30 ? 168  ILE A CD1   1 
ATOM   1149 N N     . PRO A 1 169 ? 66.049  75.467 5.976   1.00 26.50 ? 169  PRO A N     1 
ATOM   1150 C CA    . PRO A 1 169 ? 65.099  75.453 4.891   1.00 22.81 ? 169  PRO A CA    1 
ATOM   1151 C C     . PRO A 1 169 ? 65.381  74.277 3.954   1.00 24.50 ? 169  PRO A C     1 
ATOM   1152 O O     . PRO A 1 169 ? 66.532  73.961 3.611   1.00 29.42 ? 169  PRO A O     1 
ATOM   1153 C CB    . PRO A 1 169 ? 65.267  76.790 4.171   1.00 27.06 ? 169  PRO A CB    1 
ATOM   1154 C CG    . PRO A 1 169 ? 66.217  77.649 4.989   1.00 24.54 ? 169  PRO A CG    1 
ATOM   1155 C CD    . PRO A 1 169 ? 66.786  76.761 6.086   1.00 26.51 ? 169  PRO A CD    1 
ATOM   1156 N N     . GLY A 1 170 ? 64.316  73.570 3.611   1.00 23.04 ? 170  GLY A N     1 
ATOM   1157 C CA    . GLY A 1 170 ? 64.416  72.391 2.773   1.00 20.02 ? 170  GLY A CA    1 
ATOM   1158 C C     . GLY A 1 170 ? 64.750  71.153 3.600   1.00 15.97 ? 170  GLY A C     1 
ATOM   1159 O O     . GLY A 1 170 ? 65.060  70.117 3.041   1.00 23.48 ? 170  GLY A O     1 
ATOM   1160 N N     . ALA A 1 171 ? 64.708  71.223 4.925   1.00 16.29 ? 171  ALA A N     1 
ATOM   1161 C CA    . ALA A 1 171 ? 65.124  70.048 5.708   1.00 17.49 ? 171  ALA A CA    1 
ATOM   1162 C C     . ALA A 1 171 ? 64.244  68.854 5.368   1.00 29.22 ? 171  ALA A C     1 
ATOM   1163 O O     . ALA A 1 171 ? 64.672  67.695 5.473   1.00 24.27 ? 171  ALA A O     1 
ATOM   1164 C CB    . ALA A 1 171 ? 64.990  70.284 7.201   1.00 16.75 ? 171  ALA A CB    1 
ATOM   1165 N N     . SER A 1 172 ? 62.994  69.158 5.016   1.00 30.32 ? 172  SER A N     1 
ATOM   1166 C CA    . SER A 1 172 ? 61.984  68.153 4.724   1.00 28.45 ? 172  SER A CA    1 
ATOM   1167 C C     . SER A 1 172 ? 62.207  67.374 3.426   1.00 28.33 ? 172  SER A C     1 
ATOM   1168 O O     . SER A 1 172 ? 61.419  66.459 3.147   1.00 39.44 ? 172  SER A O     1 
ATOM   1169 C CB    . SER A 1 172 ? 60.563  68.735 4.749   1.00 23.13 ? 172  SER A CB    1 
ATOM   1170 O OG    . SER A 1 172 ? 60.349  69.488 3.558   1.00 35.49 ? 172  SER A OG    1 
ATOM   1171 N N     . LEU A 1 173 ? 63.229  67.722 2.627   1.00 17.98 ? 173  LEU A N     1 
ATOM   1172 C CA    . LEU A 1 173 ? 63.614  67.003 1.421   1.00 22.45 ? 173  LEU A CA    1 
ATOM   1173 C C     . LEU A 1 173 ? 64.507  65.799 1.820   1.00 27.12 ? 173  LEU A C     1 
ATOM   1174 O O     . LEU A 1 173 ? 64.864  64.945 1.000   1.00 23.06 ? 173  LEU A O     1 
ATOM   1175 C CB    . LEU A 1 173 ? 64.351  67.919 0.391   1.00 23.17 ? 173  LEU A CB    1 
ATOM   1176 C CG    . LEU A 1 173 ? 63.461  68.994 -0.262  1.00 28.65 ? 173  LEU A CG    1 
ATOM   1177 C CD1   . LEU A 1 173 ? 64.324  70.069 -0.905  1.00 19.58 ? 173  LEU A CD1   1 
ATOM   1178 C CD2   . LEU A 1 173 ? 62.570  68.364 -1.335  1.00 20.94 ? 173  LEU A CD2   1 
ATOM   1179 N N     . GLY A 1 174 ? 64.943  65.778 3.084   1.00 18.03 ? 174  GLY A N     1 
ATOM   1180 C CA    . GLY A 1 174 ? 65.787  64.705 3.562   1.00 22.38 ? 174  GLY A CA    1 
ATOM   1181 C C     . GLY A 1 174 ? 64.896  63.631 4.166   1.00 25.62 ? 174  GLY A C     1 
ATOM   1182 O O     . GLY A 1 174 ? 63.730  63.889 4.520   1.00 21.61 ? 174  GLY A O     1 
ATOM   1183 N N     . ILE A 1 175 ? 65.473  62.445 4.318   1.00 17.80 ? 175  ILE A N     1 
ATOM   1184 C CA    . ILE A 1 175 ? 64.731  61.319 4.888   1.00 17.24 ? 175  ILE A CA    1 
ATOM   1185 C C     . ILE A 1 175 ? 65.304  60.981 6.264   1.00 16.89 ? 175  ILE A C     1 
ATOM   1186 O O     . ILE A 1 175 ? 66.341  61.538 6.632   1.00 17.86 ? 175  ILE A O     1 
ATOM   1187 C CB    . ILE A 1 175 ? 64.791  60.049 4.035   1.00 17.40 ? 175  ILE A CB    1 
ATOM   1188 C CG1   . ILE A 1 175 ? 66.223  59.577 3.856   1.00 20.09 ? 175  ILE A CG1   1 
ATOM   1189 C CG2   . ILE A 1 175 ? 64.075  60.226 2.695   1.00 16.47 ? 175  ILE A CG2   1 
ATOM   1190 C CD1   . ILE A 1 175 ? 66.279  58.103 3.431   1.00 21.48 ? 175  ILE A CD1   1 
ATOM   1191 N N     . THR A 1 176 ? 64.639  60.059 6.992   1.00 16.80 ? 176  THR A N     1 
ATOM   1192 C CA    . THR A 1 176 ? 65.138  59.563 8.268   1.00 12.71 ? 176  THR A CA    1 
ATOM   1193 C C     . THR A 1 176 ? 65.333  58.060 8.132   1.00 13.98 ? 176  THR A C     1 
ATOM   1194 O O     . THR A 1 176 ? 65.126  57.525 7.053   1.00 14.00 ? 176  THR A O     1 
ATOM   1195 C CB    . THR A 1 176 ? 64.169  59.803 9.433   1.00 19.15 ? 176  THR A CB    1 
ATOM   1196 O OG1   . THR A 1 176 ? 63.071  58.972 9.176   1.00 17.61 ? 176  THR A OG1   1 
ATOM   1197 C CG2   . THR A 1 176 ? 63.743  61.258 9.568   1.00 21.47 ? 176  THR A CG2   1 
ATOM   1198 N N     . SER A 1 177 ? 65.762  57.392 9.219   1.00 14.01 ? 177  SER A N     1 
ATOM   1199 C CA    . SER A 1 177 ? 65.950  55.957 9.189   1.00 11.54 ? 177  SER A CA    1 
ATOM   1200 C C     . SER A 1 177 ? 64.642  55.275 8.768   1.00 16.01 ? 177  SER A C     1 
ATOM   1201 O O     . SER A 1 177 ? 64.655  54.246 8.108   1.00 13.91 ? 177  SER A O     1 
ATOM   1202 C CB    . SER A 1 177 ? 66.440  55.434 10.526  1.00 9.69  ? 177  SER A CB    1 
ATOM   1203 O OG    . SER A 1 177 ? 65.536  55.893 11.513  1.00 12.38 ? 177  SER A OG    1 
ATOM   1204 N N     . ASP A 1 178 ? 63.492  55.886 9.046   1.00 12.82 ? 178  ASP A N     1 
ATOM   1205 C CA    . ASP A 1 178 ? 62.211  55.314 8.623   1.00 13.30 ? 178  ASP A CA    1 
ATOM   1206 C C     . ASP A 1 178 ? 62.140  55.257 7.114   1.00 14.23 ? 178  ASP A C     1 
ATOM   1207 O O     . ASP A 1 178 ? 61.719  54.266 6.527   1.00 19.11 ? 178  ASP A O     1 
ATOM   1208 C CB    . ASP A 1 178 ? 60.977  56.065 9.177   1.00 14.04 ? 178  ASP A CB    1 
ATOM   1209 C CG    . ASP A 1 178 ? 60.714  55.814 10.647  1.00 18.47 ? 178  ASP A CG    1 
ATOM   1210 O OD1   . ASP A 1 178 ? 61.457  55.136 11.345  1.00 27.01 ? 178  ASP A OD1   1 
ATOM   1211 O OD2   . ASP A 1 178 ? 59.723  56.522 11.126  1.00 24.82 ? 178  ASP A OD2   1 
ATOM   1212 N N     . GLY A 1 179 ? 62.558  56.368 6.493   1.00 17.84 ? 179  GLY A N     1 
ATOM   1213 C CA    . GLY A 1 179 ? 62.552  56.490 5.050   1.00 11.49 ? 179  GLY A CA    1 
ATOM   1214 C C     . GLY A 1 179 ? 63.625  55.622 4.423   1.00 13.68 ? 179  GLY A C     1 
ATOM   1215 O O     . GLY A 1 179 ? 63.465  55.159 3.298   1.00 16.51 ? 179  GLY A O     1 
ATOM   1216 N N     . PHE A 1 180 ? 64.693  55.322 5.157   1.00 11.26 ? 180  PHE A N     1 
ATOM   1217 C CA    . PHE A 1 180 ? 65.729  54.450 4.608   1.00 6.91  ? 180  PHE A CA    1 
ATOM   1218 C C     . PHE A 1 180 ? 65.149  53.063 4.260   1.00 15.52 ? 180  PHE A C     1 
ATOM   1219 O O     . PHE A 1 180 ? 65.533  52.390 3.288   1.00 12.74 ? 180  PHE A O     1 
ATOM   1220 C CB    . PHE A 1 180 ? 66.896  54.315 5.620   1.00 9.39  ? 180  PHE A CB    1 
ATOM   1221 C CG    . PHE A 1 180 ? 67.922  53.263 5.245   1.00 16.27 ? 180  PHE A CG    1 
ATOM   1222 C CD1   . PHE A 1 180 ? 67.795  51.946 5.672   1.00 20.60 ? 180  PHE A CD1   1 
ATOM   1223 C CD2   . PHE A 1 180 ? 69.034  53.587 4.474   1.00 17.88 ? 180  PHE A CD2   1 
ATOM   1224 C CE1   . PHE A 1 180 ? 68.762  50.988 5.330   1.00 15.70 ? 180  PHE A CE1   1 
ATOM   1225 C CE2   . PHE A 1 180 ? 69.995  52.653 4.106   1.00 17.71 ? 180  PHE A CE2   1 
ATOM   1226 C CZ    . PHE A 1 180 ? 69.873  51.341 4.567   1.00 16.56 ? 180  PHE A CZ    1 
ATOM   1227 N N     . PHE A 1 181 ? 64.231  52.619 5.118   1.00 19.06 ? 181  PHE A N     1 
ATOM   1228 C CA    . PHE A 1 181 ? 63.621  51.314 5.015   1.00 19.20 ? 181  PHE A CA    1 
ATOM   1229 C C     . PHE A 1 181 ? 62.573  51.260 3.947   1.00 20.31 ? 181  PHE A C     1 
ATOM   1230 O O     . PHE A 1 181 ? 62.094  50.171 3.649   1.00 14.82 ? 181  PHE A O     1 
ATOM   1231 C CB    . PHE A 1 181 ? 63.102  50.772 6.345   1.00 12.29 ? 181  PHE A CB    1 
ATOM   1232 C CG    . PHE A 1 181 ? 64.280  50.386 7.166   1.00 11.09 ? 181  PHE A CG    1 
ATOM   1233 C CD1   . PHE A 1 181 ? 65.189  49.472 6.694   1.00 14.54 ? 181  PHE A CD1   1 
ATOM   1234 C CD2   . PHE A 1 181 ? 64.517  51.017 8.389   1.00 15.46 ? 181  PHE A CD2   1 
ATOM   1235 C CE1   . PHE A 1 181 ? 66.304  49.128 7.477   1.00 19.42 ? 181  PHE A CE1   1 
ATOM   1236 C CE2   . PHE A 1 181 ? 65.600  50.693 9.182   1.00 12.35 ? 181  PHE A CE2   1 
ATOM   1237 C CZ    . PHE A 1 181 ? 66.508  49.730 8.711   1.00 17.39 ? 181  PHE A CZ    1 
ATOM   1238 N N     . GLN A 1 182 ? 62.274  52.426 3.350   1.00 15.58 ? 182  GLN A N     1 
ATOM   1239 C CA    . GLN A 1 182 ? 61.337  52.465 2.230   1.00 18.61 ? 182  GLN A CA    1 
ATOM   1240 C C     . GLN A 1 182 ? 62.035  52.572 0.878   1.00 18.20 ? 182  GLN A C     1 
ATOM   1241 O O     . GLN A 1 182 ? 61.402  52.424 -0.171  1.00 23.33 ? 182  GLN A O     1 
ATOM   1242 C CB    . GLN A 1 182 ? 60.261  53.559 2.349   1.00 14.45 ? 182  GLN A CB    1 
ATOM   1243 C CG    . GLN A 1 182 ? 59.404  53.422 3.619   1.00 30.56 ? 182  GLN A CG    1 
ATOM   1244 C CD    . GLN A 1 182 ? 57.995  53.879 3.336   1.00 63.76 ? 182  GLN A CD    1 
ATOM   1245 O OE1   . GLN A 1 182 ? 57.318  54.459 4.209   1.00 74.88 ? 182  GLN A OE1   1 
ATOM   1246 N NE2   . GLN A 1 182 ? 57.594  53.709 2.070   1.00 68.92 ? 182  GLN A NE2   1 
ATOM   1247 N N     . LEU A 1 183 ? 63.325  52.845 0.877   1.00 14.22 ? 183  LEU A N     1 
ATOM   1248 C CA    . LEU A 1 183 ? 64.037  53.026 -0.375  1.00 15.20 ? 183  LEU A CA    1 
ATOM   1249 C C     . LEU A 1 183 ? 63.884  51.772 -1.226  1.00 21.85 ? 183  LEU A C     1 
ATOM   1250 O O     . LEU A 1 183 ? 64.028  50.670 -0.702  1.00 24.46 ? 183  LEU A O     1 
ATOM   1251 C CB    . LEU A 1 183 ? 65.532  53.251 -0.118  1.00 17.49 ? 183  LEU A CB    1 
ATOM   1252 C CG    . LEU A 1 183 ? 65.813  54.606 0.508   1.00 17.65 ? 183  LEU A CG    1 
ATOM   1253 C CD1   . LEU A 1 183 ? 67.324  54.712 0.689   1.00 12.10 ? 183  LEU A CD1   1 
ATOM   1254 C CD2   . LEU A 1 183 ? 65.325  55.722 -0.398  1.00 17.42 ? 183  LEU A CD2   1 
ATOM   1255 N N     . GLU A 1 184 ? 63.717  51.932 -2.544  1.00 17.38 ? 184  GLU A N     1 
ATOM   1256 C CA    . GLU A 1 184 ? 63.589  50.775 -3.411  1.00 21.60 ? 184  GLU A CA    1 
ATOM   1257 C C     . GLU A 1 184 ? 64.808  50.554 -4.271  1.00 24.10 ? 184  GLU A C     1 
ATOM   1258 O O     . GLU A 1 184 ? 64.922  49.515 -4.924  1.00 25.57 ? 184  GLU A O     1 
ATOM   1259 C CB    . GLU A 1 184 ? 62.371  50.901 -4.315  1.00 28.36 ? 184  GLU A CB    1 
ATOM   1260 C CG    . GLU A 1 184 ? 61.158  51.356 -3.501  1.00 42.37 ? 184  GLU A CG    1 
ATOM   1261 C CD    . GLU A 1 184 ? 59.943  50.530 -3.783  1.00 49.91 ? 184  GLU A CD    1 
ATOM   1262 O OE1   . GLU A 1 184 ? 59.990  49.407 -4.247  1.00 55.08 ? 184  GLU A OE1   1 
ATOM   1263 O OE2   . GLU A 1 184 ? 58.842  51.174 -3.523  1.00 59.67 ? 184  GLU A OE2   1 
ATOM   1264 N N     . GLU A 1 185 ? 65.683  51.554 -4.349  1.00 19.06 ? 185  GLU A N     1 
ATOM   1265 C CA    . GLU A 1 185 ? 66.913  51.440 -5.126  1.00 21.52 ? 185  GLU A CA    1 
ATOM   1266 C C     . GLU A 1 185 ? 68.055  52.026 -4.304  1.00 18.26 ? 185  GLU A C     1 
ATOM   1267 O O     . GLU A 1 185 ? 67.893  52.888 -3.429  1.00 19.91 ? 185  GLU A O     1 
ATOM   1268 C CB    . GLU A 1 185 ? 66.841  52.074 -6.560  1.00 36.65 ? 185  GLU A CB    1 
ATOM   1269 C CG    . GLU A 1 185 ? 65.414  52.430 -7.104  1.00 62.04 ? 185  GLU A CG    1 
ATOM   1270 C CD    . GLU A 1 185 ? 64.849  51.574 -8.249  1.00 77.57 ? 185  GLU A CD    1 
ATOM   1271 O OE1   . GLU A 1 185 ? 65.778  50.937 -8.948  1.00 80.00 ? 185  GLU A OE1   1 
ATOM   1272 O OE2   . GLU A 1 185 ? 63.646  51.533 -8.538  1.00 76.47 ? 185  GLU A OE2   1 
ATOM   1273 N N     . LEU A 1 186 ? 69.242  51.569 -4.602  1.00 15.45 ? 186  LEU A N     1 
ATOM   1274 C CA    . LEU A 1 186 ? 70.405  52.094 -3.917  1.00 23.13 ? 186  LEU A CA    1 
ATOM   1275 C C     . LEU A 1 186 ? 70.648  53.507 -4.433  1.00 22.81 ? 186  LEU A C     1 
ATOM   1276 O O     . LEU A 1 186 ? 70.887  53.709 -5.625  1.00 23.27 ? 186  LEU A O     1 
ATOM   1277 C CB    . LEU A 1 186 ? 71.611  51.166 -4.179  1.00 19.73 ? 186  LEU A CB    1 
ATOM   1278 C CG    . LEU A 1 186 ? 72.961  51.715 -3.701  1.00 23.72 ? 186  LEU A CG    1 
ATOM   1279 C CD1   . LEU A 1 186 ? 73.145  51.545 -2.185  1.00 19.68 ? 186  LEU A CD1   1 
ATOM   1280 C CD2   . LEU A 1 186 ? 74.076  51.011 -4.440  1.00 21.31 ? 186  LEU A CD2   1 
ATOM   1281 N N     . PRO A 1 187 ? 70.631  54.494 -3.549  1.00 19.19 ? 187  PRO A N     1 
ATOM   1282 C CA    . PRO A 1 187 ? 70.927  55.870 -3.956  1.00 18.59 ? 187  PRO A CA    1 
ATOM   1283 C C     . PRO A 1 187 ? 72.378  55.972 -4.475  1.00 21.32 ? 187  PRO A C     1 
ATOM   1284 O O     . PRO A 1 187 ? 73.336  55.409 -3.901  1.00 25.65 ? 187  PRO A O     1 
ATOM   1285 C CB    . PRO A 1 187 ? 70.776  56.714 -2.673  1.00 18.95 ? 187  PRO A CB    1 
ATOM   1286 C CG    . PRO A 1 187 ? 70.582  55.733 -1.502  1.00 24.50 ? 187  PRO A CG    1 
ATOM   1287 C CD    . PRO A 1 187 ? 70.342  54.361 -2.096  1.00 15.10 ? 187  PRO A CD    1 
ATOM   1288 N N     . GLY A 1 188 ? 72.540  56.764 -5.553  1.00 18.09 ? 188  GLY A N     1 
ATOM   1289 C CA    . GLY A 1 188 ? 73.820  56.968 -6.211  1.00 11.19 ? 188  GLY A CA    1 
ATOM   1290 C C     . GLY A 1 188 ? 74.775  57.749 -5.313  1.00 15.38 ? 188  GLY A C     1 
ATOM   1291 O O     . GLY A 1 188 ? 75.926  57.336 -5.103  1.00 16.72 ? 188  GLY A O     1 
ATOM   1292 N N     . ARG A 1 189 ? 74.279  58.856 -4.780  1.00 20.80 ? 189  ARG A N     1 
ATOM   1293 C CA    . ARG A 1 189 ? 75.086  59.734 -3.967  1.00 24.68 ? 189  ARG A CA    1 
ATOM   1294 C C     . ARG A 1 189 ? 74.370  59.955 -2.651  1.00 10.54 ? 189  ARG A C     1 
ATOM   1295 O O     . ARG A 1 189 ? 73.216  60.338 -2.646  1.00 15.75 ? 189  ARG A O     1 
ATOM   1296 C CB    . ARG A 1 189 ? 75.247  61.067 -4.719  1.00 22.82 ? 189  ARG A CB    1 
ATOM   1297 C CG    . ARG A 1 189 ? 76.000  62.144 -3.953  1.00 17.12 ? 189  ARG A CG    1 
ATOM   1298 C CD    . ARG A 1 189 ? 77.465  61.773 -3.822  1.00 17.41 ? 189  ARG A CD    1 
ATOM   1299 N NE    . ARG A 1 189 ? 78.274  62.903 -3.308  1.00 19.13 ? 189  ARG A NE    1 
ATOM   1300 C CZ    . ARG A 1 189 ? 78.790  62.964 -2.078  1.00 25.13 ? 189  ARG A CZ    1 
ATOM   1301 N NH1   . ARG A 1 189 ? 78.611  61.929 -1.238  1.00 21.51 ? 189  ARG A NH1   1 
ATOM   1302 N NH2   . ARG A 1 189 ? 79.523  64.009 -1.699  1.00 32.67 ? 189  ARG A NH2   1 
ATOM   1303 N N     . SER A 1 190 ? 75.010  59.672 -1.528  1.00 10.38 ? 190  SER A N     1 
ATOM   1304 C CA    . SER A 1 190 ? 74.214  59.902 -0.341  1.00 14.91 ? 190  SER A CA    1 
ATOM   1305 C C     . SER A 1 190 ? 74.992  60.704 0.682   1.00 14.67 ? 190  SER A C     1 
ATOM   1306 O O     . SER A 1 190 ? 76.216  60.617 0.738   1.00 14.63 ? 190  SER A O     1 
ATOM   1307 C CB    . SER A 1 190 ? 73.638  58.582 0.202   1.00 22.25 ? 190  SER A CB    1 
ATOM   1308 O OG    . SER A 1 190 ? 74.679  57.658 0.271   1.00 40.42 ? 190  SER A OG    1 
ATOM   1309 N N     . VAL A 1 191 ? 74.261  61.522 1.431   1.00 14.43 ? 191  VAL A N     1 
ATOM   1310 C CA    . VAL A 1 191 ? 74.855  62.346 2.462   1.00 18.08 ? 191  VAL A CA    1 
ATOM   1311 C C     . VAL A 1 191 ? 74.112  62.079 3.762   1.00 18.40 ? 191  VAL A C     1 
ATOM   1312 O O     . VAL A 1 191 ? 72.892  62.205 3.833   1.00 15.95 ? 191  VAL A O     1 
ATOM   1313 C CB    . VAL A 1 191 ? 74.767  63.842 2.116   1.00 18.49 ? 191  VAL A CB    1 
ATOM   1314 C CG1   . VAL A 1 191 ? 75.128  64.692 3.332   1.00 13.63 ? 191  VAL A CG1   1 
ATOM   1315 C CG2   . VAL A 1 191 ? 75.718  64.139 0.964   1.00 18.33 ? 191  VAL A CG2   1 
ATOM   1316 N N     . ILE A 1 192 ? 74.891  61.714 4.776   1.00 15.22 ? 192  ILE A N     1 
ATOM   1317 C CA    . ILE A 1 192 ? 74.326  61.377 6.063   1.00 16.16 ? 192  ILE A CA    1 
ATOM   1318 C C     . ILE A 1 192 ? 74.719  62.431 7.087   1.00 9.65  ? 192  ILE A C     1 
ATOM   1319 O O     . ILE A 1 192 ? 75.879  62.780 7.192   1.00 19.58 ? 192  ILE A O     1 
ATOM   1320 C CB    . ILE A 1 192 ? 74.760  59.972 6.445   1.00 11.95 ? 192  ILE A CB    1 
ATOM   1321 C CG1   . ILE A 1 192 ? 74.218  58.974 5.428   1.00 19.18 ? 192  ILE A CG1   1 
ATOM   1322 C CG2   . ILE A 1 192 ? 74.264  59.625 7.851   1.00 11.22 ? 192  ILE A CG2   1 
ATOM   1323 C CD1   . ILE A 1 192 ? 75.194  57.870 5.151   1.00 30.09 ? 192  ILE A CD1   1 
ATOM   1324 N N     . VAL A 1 193 ? 73.735  62.952 7.812   1.00 10.50 ? 193  VAL A N     1 
ATOM   1325 C CA    . VAL A 1 193 ? 73.973  63.964 8.817   1.00 8.12  ? 193  VAL A CA    1 
ATOM   1326 C C     . VAL A 1 193 ? 73.815  63.401 10.227  1.00 16.02 ? 193  VAL A C     1 
ATOM   1327 O O     . VAL A 1 193 ? 72.760  62.878 10.578  1.00 13.20 ? 193  VAL A O     1 
ATOM   1328 C CB    . VAL A 1 193 ? 73.064  65.172 8.655   1.00 10.53 ? 193  VAL A CB    1 
ATOM   1329 C CG1   . VAL A 1 193 ? 73.483  66.202 9.686   1.00 5.00  ? 193  VAL A CG1   1 
ATOM   1330 C CG2   . VAL A 1 193 ? 73.236  65.779 7.262   1.00 10.53 ? 193  VAL A CG2   1 
ATOM   1331 N N     . GLY A 1 194 ? 74.877  63.517 11.044  1.00 13.10 ? 194  GLY A N     1 
ATOM   1332 C CA    . GLY A 1 194 ? 74.837  63.066 12.431  1.00 5.93  ? 194  GLY A CA    1 
ATOM   1333 C C     . GLY A 1 194 ? 76.062  62.234 12.754  1.00 7.45  ? 194  GLY A C     1 
ATOM   1334 O O     . GLY A 1 194 ? 76.808  61.772 11.892  1.00 15.72 ? 194  GLY A O     1 
ATOM   1335 N N     . ALA A 1 195 ? 76.337  62.038 14.030  1.00 7.36  ? 195  ALA A N     1 
ATOM   1336 C CA    . ALA A 1 195 ? 77.543  61.328 14.350  1.00 8.63  ? 195  ALA A CA    1 
ATOM   1337 C C     . ALA A 1 195 ? 77.298  60.226 15.382  1.00 15.40 ? 195  ALA A C     1 
ATOM   1338 O O     . ALA A 1 195 ? 78.201  59.947 16.194  1.00 13.07 ? 195  ALA A O     1 
ATOM   1339 C CB    . ALA A 1 195 ? 78.519  62.346 14.951  1.00 17.42 ? 195  ALA A CB    1 
ATOM   1340 N N     . GLY A 1 196 ? 76.072  59.683 15.433  1.00 10.71 ? 196  GLY A N     1 
ATOM   1341 C CA    . GLY A 1 196 ? 75.780  58.691 16.459  1.00 8.49  ? 196  GLY A CA    1 
ATOM   1342 C C     . GLY A 1 196 ? 75.639  57.314 15.835  1.00 15.61 ? 196  GLY A C     1 
ATOM   1343 O O     . GLY A 1 196 ? 76.198  57.021 14.783  1.00 11.92 ? 196  GLY A O     1 
ATOM   1344 N N     . TYR A 1 197 ? 74.875  56.460 16.491  1.00 8.20  ? 197  TYR A N     1 
ATOM   1345 C CA    . TYR A 1 197 ? 74.703  55.081 16.053  1.00 9.73  ? 197  TYR A CA    1 
ATOM   1346 C C     . TYR A 1 197 ? 74.188  54.943 14.636  1.00 7.07  ? 197  TYR A C     1 
ATOM   1347 O O     . TYR A 1 197 ? 74.776  54.249 13.824  1.00 9.53  ? 197  TYR A O     1 
ATOM   1348 C CB    . TYR A 1 197 ? 73.612  54.421 16.914  1.00 19.98 ? 197  TYR A CB    1 
ATOM   1349 C CG    . TYR A 1 197 ? 74.039  53.859 18.241  1.00 21.46 ? 197  TYR A CG    1 
ATOM   1350 C CD1   . TYR A 1 197 ? 74.171  54.674 19.364  1.00 13.02 ? 197  TYR A CD1   1 
ATOM   1351 C CD2   . TYR A 1 197 ? 74.251  52.492 18.390  1.00 16.61 ? 197  TYR A CD2   1 
ATOM   1352 C CE1   . TYR A 1 197 ? 74.475  54.149 20.621  1.00 12.55 ? 197  TYR A CE1   1 
ATOM   1353 C CE2   . TYR A 1 197 ? 74.544  51.948 19.638  1.00 8.20  ? 197  TYR A CE2   1 
ATOM   1354 C CZ    . TYR A 1 197 ? 74.650  52.771 20.754  1.00 12.66 ? 197  TYR A CZ    1 
ATOM   1355 O OH    . TYR A 1 197 ? 74.947  52.208 21.970  1.00 19.80 ? 197  TYR A OH    1 
ATOM   1356 N N     . ILE A 1 198 ? 73.027  55.552 14.372  1.00 6.82  ? 198  ILE A N     1 
ATOM   1357 C CA    . ILE A 1 198 ? 72.372  55.403 13.077  1.00 12.88 ? 198  ILE A CA    1 
ATOM   1358 C C     . ILE A 1 198 ? 73.218  55.969 11.933  1.00 23.73 ? 198  ILE A C     1 
ATOM   1359 O O     . ILE A 1 198 ? 73.360  55.348 10.867  1.00 17.56 ? 198  ILE A O     1 
ATOM   1360 C CB    . ILE A 1 198 ? 70.990  56.018 13.105  1.00 8.07  ? 198  ILE A CB    1 
ATOM   1361 C CG1   . ILE A 1 198 ? 70.106  55.221 14.071  1.00 19.67 ? 198  ILE A CG1   1 
ATOM   1362 C CG2   . ILE A 1 198 ? 70.407  56.050 11.681  1.00 8.73  ? 198  ILE A CG2   1 
ATOM   1363 C CD1   . ILE A 1 198 ? 68.679  55.787 14.209  1.00 9.70  ? 198  ILE A CD1   1 
ATOM   1364 N N     . ALA A 1 199 ? 73.876  57.112 12.185  1.00 15.79 ? 199  ALA A N     1 
ATOM   1365 C CA    . ALA A 1 199 ? 74.727  57.713 11.183  1.00 9.94  ? 199  ALA A CA    1 
ATOM   1366 C C     . ALA A 1 199 ? 75.845  56.752 10.810  1.00 5.00  ? 199  ALA A C     1 
ATOM   1367 O O     . ALA A 1 199 ? 76.115  56.474 9.624   1.00 12.06 ? 199  ALA A O     1 
ATOM   1368 C CB    . ALA A 1 199 ? 75.242  59.030 11.765  1.00 9.63  ? 199  ALA A CB    1 
ATOM   1369 N N     . VAL A 1 200 ? 76.506  56.213 11.823  1.00 7.92  ? 200  VAL A N     1 
ATOM   1370 C CA    . VAL A 1 200 ? 77.638  55.338 11.578  1.00 12.80 ? 200  VAL A CA    1 
ATOM   1371 C C     . VAL A 1 200 ? 77.177  54.060 10.873  1.00 17.87 ? 200  VAL A C     1 
ATOM   1372 O O     . VAL A 1 200 ? 77.815  53.570 9.933   1.00 12.46 ? 200  VAL A O     1 
ATOM   1373 C CB    . VAL A 1 200 ? 78.367  54.941 12.862  1.00 12.97 ? 200  VAL A CB    1 
ATOM   1374 C CG1   . VAL A 1 200 ? 79.321  53.777 12.583  1.00 7.97  ? 200  VAL A CG1   1 
ATOM   1375 C CG2   . VAL A 1 200 ? 79.108  56.136 13.448  1.00 10.97 ? 200  VAL A CG2   1 
ATOM   1376 N N     . GLU A 1 201 ? 76.029  53.540 11.313  1.00 11.21 ? 201  GLU A N     1 
ATOM   1377 C CA    . GLU A 1 201 ? 75.519  52.276 10.763  1.00 5.00  ? 201  GLU A CA    1 
ATOM   1378 C C     . GLU A 1 201 ? 75.098  52.441 9.323   1.00 5.00  ? 201  GLU A C     1 
ATOM   1379 O O     . GLU A 1 201 ? 75.448  51.615 8.473   1.00 7.78  ? 201  GLU A O     1 
ATOM   1380 C CB    . GLU A 1 201 ? 74.410  51.622 11.645  1.00 5.00  ? 201  GLU A CB    1 
ATOM   1381 C CG    . GLU A 1 201 ? 74.990  51.003 12.929  1.00 7.99  ? 201  GLU A CG    1 
ATOM   1382 C CD    . GLU A 1 201 ? 73.985  50.228 13.779  1.00 10.19 ? 201  GLU A CD    1 
ATOM   1383 O OE1   . GLU A 1 201 ? 72.760  50.356 13.345  1.00 10.55 ? 201  GLU A OE1   1 
ATOM   1384 O OE2   . GLU A 1 201 ? 74.263  49.775 14.877  1.00 11.52 ? 201  GLU A OE2   1 
ATOM   1385 N N     . MET A 1 202 ? 74.298  53.464 9.095   1.00 5.41  ? 202  MET A N     1 
ATOM   1386 C CA    . MET A 1 202 ? 73.791  53.665 7.770   1.00 6.01  ? 202  MET A CA    1 
ATOM   1387 C C     . MET A 1 202 ? 74.883  54.047 6.795   1.00 13.78 ? 202  MET A C     1 
ATOM   1388 O O     . MET A 1 202 ? 74.824  53.632 5.643   1.00 8.04  ? 202  MET A O     1 
ATOM   1389 C CB    . MET A 1 202 ? 72.695  54.720 7.722   1.00 14.30 ? 202  MET A CB    1 
ATOM   1390 C CG    . MET A 1 202 ? 71.637  54.521 8.783   1.00 25.86 ? 202  MET A CG    1 
ATOM   1391 S SD    . MET A 1 202 ? 70.459  53.288 8.218   1.00 39.81 ? 202  MET A SD    1 
ATOM   1392 C CE    . MET A 1 202 ? 71.520  51.857 8.341   1.00 25.27 ? 202  MET A CE    1 
ATOM   1393 N N     . ALA A 1 203 ? 75.830  54.886 7.208   1.00 11.07 ? 203  ALA A N     1 
ATOM   1394 C CA    . ALA A 1 203 ? 76.934  55.252 6.324   1.00 10.13 ? 203  ALA A CA    1 
ATOM   1395 C C     . ALA A 1 203 ? 77.688  54.005 5.941   1.00 10.78 ? 203  ALA A C     1 
ATOM   1396 O O     . ALA A 1 203 ? 78.092  53.855 4.786   1.00 13.96 ? 203  ALA A O     1 
ATOM   1397 C CB    . ALA A 1 203 ? 77.934  56.145 7.056   1.00 10.10 ? 203  ALA A CB    1 
ATOM   1398 N N     . GLY A 1 204 ? 77.962  53.117 6.913   1.00 12.90 ? 204  GLY A N     1 
ATOM   1399 C CA    . GLY A 1 204 ? 78.711  51.896 6.659   1.00 11.31 ? 204  GLY A CA    1 
ATOM   1400 C C     . GLY A 1 204 ? 77.993  50.943 5.665   1.00 23.32 ? 204  GLY A C     1 
ATOM   1401 O O     . GLY A 1 204 ? 78.644  50.273 4.841   1.00 16.51 ? 204  GLY A O     1 
ATOM   1402 N N     . ILE A 1 205 ? 76.653  50.831 5.775   1.00 18.40 ? 205  ILE A N     1 
ATOM   1403 C CA    . ILE A 1 205 ? 75.832  49.998 4.886   1.00 5.39  ? 205  ILE A CA    1 
ATOM   1404 C C     . ILE A 1 205 ? 75.777  50.583 3.467   1.00 10.43 ? 205  ILE A C     1 
ATOM   1405 O O     . ILE A 1 205 ? 76.092  49.883 2.495   1.00 19.38 ? 205  ILE A O     1 
ATOM   1406 C CB    . ILE A 1 205 ? 74.435  49.789 5.421   1.00 8.84  ? 205  ILE A CB    1 
ATOM   1407 C CG1   . ILE A 1 205 ? 74.403  48.869 6.649   1.00 13.22 ? 205  ILE A CG1   1 
ATOM   1408 C CG2   . ILE A 1 205 ? 73.589  49.162 4.330   1.00 18.73 ? 205  ILE A CG2   1 
ATOM   1409 C CD1   . ILE A 1 205 ? 73.115  49.109 7.447   1.00 9.71  ? 205  ILE A CD1   1 
ATOM   1410 N N     . LEU A 1 206 ? 75.432  51.873 3.324   1.00 13.66 ? 206  LEU A N     1 
ATOM   1411 C CA    . LEU A 1 206 ? 75.314  52.566 2.029   1.00 13.42 ? 206  LEU A CA    1 
ATOM   1412 C C     . LEU A 1 206 ? 76.633  52.501 1.257   1.00 16.19 ? 206  LEU A C     1 
ATOM   1413 O O     . LEU A 1 206 ? 76.721  52.065 0.094   1.00 11.68 ? 206  LEU A O     1 
ATOM   1414 C CB    . LEU A 1 206 ? 74.811  54.017 2.209   1.00 11.23 ? 206  LEU A CB    1 
ATOM   1415 C CG    . LEU A 1 206 ? 73.325  54.063 2.472   1.00 12.60 ? 206  LEU A CG    1 
ATOM   1416 C CD1   . LEU A 1 206 ? 72.856  55.436 2.960   1.00 14.09 ? 206  LEU A CD1   1 
ATOM   1417 C CD2   . LEU A 1 206 ? 72.530  53.650 1.246   1.00 22.74 ? 206  LEU A CD2   1 
ATOM   1418 N N     . SER A 1 207 ? 77.706  52.822 1.956   1.00 11.99 ? 207  SER A N     1 
ATOM   1419 C CA    . SER A 1 207 ? 79.032  52.765 1.383   1.00 11.56 ? 207  SER A CA    1 
ATOM   1420 C C     . SER A 1 207 ? 79.437  51.368 0.871   1.00 16.16 ? 207  SER A C     1 
ATOM   1421 O O     . SER A 1 207 ? 79.932  51.252 -0.258  1.00 14.80 ? 207  SER A O     1 
ATOM   1422 C CB    . SER A 1 207 ? 80.046  53.358 2.331   1.00 15.04 ? 207  SER A CB    1 
ATOM   1423 O OG    . SER A 1 207 ? 81.239  53.561 1.610   1.00 24.13 ? 207  SER A OG    1 
ATOM   1424 N N     . ALA A 1 208 ? 79.300  50.305 1.698   1.00 15.01 ? 208  ALA A N     1 
ATOM   1425 C CA    . ALA A 1 208 ? 79.683  48.954 1.315   1.00 13.88 ? 208  ALA A CA    1 
ATOM   1426 C C     . ALA A 1 208 ? 78.889  48.489 0.096   1.00 24.23 ? 208  ALA A C     1 
ATOM   1427 O O     . ALA A 1 208 ? 79.401  47.746 -0.738  1.00 19.01 ? 208  ALA A O     1 
ATOM   1428 C CB    . ALA A 1 208 ? 79.456  47.969 2.450   1.00 11.38 ? 208  ALA A CB    1 
ATOM   1429 N N     . LEU A 1 209 ? 77.642  48.948 -0.011  1.00 12.57 ? 209  LEU A N     1 
ATOM   1430 C CA    . LEU A 1 209 ? 76.758  48.591 -1.099  1.00 18.91 ? 209  LEU A CA    1 
ATOM   1431 C C     . LEU A 1 209 ? 76.974  49.407 -2.367  1.00 23.63 ? 209  LEU A C     1 
ATOM   1432 O O     . LEU A 1 209 ? 76.274  49.177 -3.345  1.00 29.90 ? 209  LEU A O     1 
ATOM   1433 C CB    . LEU A 1 209 ? 75.287  48.607 -0.664  1.00 10.22 ? 209  LEU A CB    1 
ATOM   1434 C CG    . LEU A 1 209 ? 75.124  47.681 0.554   1.00 23.69 ? 209  LEU A CG    1 
ATOM   1435 C CD1   . LEU A 1 209 ? 73.690  47.745 1.078   1.00 19.82 ? 209  LEU A CD1   1 
ATOM   1436 C CD2   . LEU A 1 209 ? 75.509  46.242 0.225   1.00 17.73 ? 209  LEU A CD2   1 
ATOM   1437 N N     . GLY A 1 210 ? 77.903  50.371 -2.367  1.00 21.73 ? 210  GLY A N     1 
ATOM   1438 C CA    . GLY A 1 210 ? 78.199  51.085 -3.582  1.00 16.27 ? 210  GLY A CA    1 
ATOM   1439 C C     . GLY A 1 210 ? 77.755  52.540 -3.674  1.00 22.76 ? 210  GLY A C     1 
ATOM   1440 O O     . GLY A 1 210 ? 78.024  53.185 -4.698  1.00 28.82 ? 210  GLY A O     1 
ATOM   1441 N N     . SER A 1 211 ? 77.056  53.074 -2.675  1.00 17.66 ? 211  SER A N     1 
ATOM   1442 C CA    . SER A 1 211 ? 76.633  54.461 -2.760  1.00 13.34 ? 211  SER A CA    1 
ATOM   1443 C C     . SER A 1 211 ? 77.845  55.340 -2.457  1.00 19.22 ? 211  SER A C     1 
ATOM   1444 O O     . SER A 1 211 ? 78.729  54.940 -1.706  1.00 15.19 ? 211  SER A O     1 
ATOM   1445 C CB    . SER A 1 211 ? 75.524  54.759 -1.775  1.00 12.10 ? 211  SER A CB    1 
ATOM   1446 O OG    . SER A 1 211 ? 75.074  56.071 -2.036  1.00 14.94 ? 211  SER A OG    1 
ATOM   1447 N N     . LYS A 1 212 ? 77.953  56.478 -3.140  1.00 21.16 ? 212  LYS A N     1 
ATOM   1448 C CA    . LYS A 1 212 ? 79.061  57.387 -2.871  1.00 13.42 ? 212  LYS A CA    1 
ATOM   1449 C C     . LYS A 1 212 ? 78.596  58.210 -1.686  1.00 8.03  ? 212  LYS A C     1 
ATOM   1450 O O     . LYS A 1 212 ? 77.792  59.097 -1.799  1.00 13.32 ? 212  LYS A O     1 
ATOM   1451 C CB    . LYS A 1 212 ? 79.381  58.223 -4.100  1.00 23.45 ? 212  LYS A CB    1 
ATOM   1452 C CG    . LYS A 1 212 ? 80.247  59.427 -3.772  1.00 41.34 ? 212  LYS A CG    1 
ATOM   1453 C CD    . LYS A 1 212 ? 81.555  59.465 -4.539  1.00 56.44 ? 212  LYS A CD    1 
ATOM   1454 C CE    . LYS A 1 212 ? 82.731  58.909 -3.736  1.00 61.87 ? 212  LYS A CE    1 
ATOM   1455 N NZ    . LYS A 1 212 ? 83.777  58.296 -4.578  1.00 67.86 ? 212  LYS A NZ    1 
ATOM   1456 N N     . THR A 1 213 ? 79.126  57.856 -0.528  1.00 20.19 ? 213  THR A N     1 
ATOM   1457 C CA    . THR A 1 213 ? 78.698  58.373 0.754   1.00 14.50 ? 213  THR A CA    1 
ATOM   1458 C C     . THR A 1 213 ? 79.593  59.372 1.473   1.00 11.39 ? 213  THR A C     1 
ATOM   1459 O O     . THR A 1 213 ? 80.781  59.175 1.615   1.00 21.53 ? 213  THR A O     1 
ATOM   1460 C CB    . THR A 1 213 ? 78.559  57.144 1.641   1.00 18.39 ? 213  THR A CB    1 
ATOM   1461 O OG1   . THR A 1 213 ? 77.761  56.192 0.968   1.00 12.89 ? 213  THR A OG1   1 
ATOM   1462 C CG2   . THR A 1 213 ? 77.902  57.564 2.950   1.00 16.23 ? 213  THR A CG2   1 
ATOM   1463 N N     . SER A 1 214 ? 78.943  60.403 1.997   1.00 18.72 ? 214  SER A N     1 
ATOM   1464 C CA    . SER A 1 214 ? 79.537  61.435 2.829   1.00 20.09 ? 214  SER A CA    1 
ATOM   1465 C C     . SER A 1 214 ? 78.813  61.404 4.164   1.00 17.14 ? 214  SER A C     1 
ATOM   1466 O O     . SER A 1 214 ? 77.594  61.330 4.247   1.00 15.71 ? 214  SER A O     1 
ATOM   1467 C CB    . SER A 1 214 ? 79.360  62.849 2.236   1.00 18.55 ? 214  SER A CB    1 
ATOM   1468 O OG    . SER A 1 214 ? 80.148  63.013 1.052   1.00 18.34 ? 214  SER A OG    1 
ATOM   1469 N N     . LEU A 1 215 ? 79.580  61.504 5.232   1.00 14.17 ? 215  LEU A N     1 
ATOM   1470 C CA    . LEU A 1 215 ? 79.048  61.589 6.593   1.00 17.12 ? 215  LEU A CA    1 
ATOM   1471 C C     . LEU A 1 215 ? 79.412  62.983 7.118   1.00 14.45 ? 215  LEU A C     1 
ATOM   1472 O O     . LEU A 1 215 ? 80.591  63.366 7.145   1.00 14.99 ? 215  LEU A O     1 
ATOM   1473 C CB    . LEU A 1 215 ? 79.688  60.462 7.422   1.00 14.70 ? 215  LEU A CB    1 
ATOM   1474 C CG    . LEU A 1 215 ? 79.208  60.299 8.864   1.00 16.02 ? 215  LEU A CG    1 
ATOM   1475 C CD1   . LEU A 1 215 ? 77.694  60.088 8.923   1.00 10.49 ? 215  LEU A CD1   1 
ATOM   1476 C CD2   . LEU A 1 215 ? 79.946  59.088 9.411   1.00 17.67 ? 215  LEU A CD2   1 
ATOM   1477 N N     . MET A 1 216 ? 78.399  63.771 7.427   1.00 11.53 ? 216  MET A N     1 
ATOM   1478 C CA    . MET A 1 216 ? 78.601  65.136 7.885   1.00 12.86 ? 216  MET A CA    1 
ATOM   1479 C C     . MET A 1 216 ? 78.423  65.249 9.424   1.00 17.31 ? 216  MET A C     1 
ATOM   1480 O O     . MET A 1 216 ? 77.329  65.060 9.958   1.00 14.22 ? 216  MET A O     1 
ATOM   1481 C CB    . MET A 1 216 ? 77.632  66.043 7.123   1.00 11.17 ? 216  MET A CB    1 
ATOM   1482 C CG    . MET A 1 216 ? 78.053  67.502 7.190   1.00 26.89 ? 216  MET A CG    1 
ATOM   1483 S SD    . MET A 1 216 ? 76.770  68.621 6.572   1.00 25.37 ? 216  MET A SD    1 
ATOM   1484 C CE    . MET A 1 216 ? 76.541  67.863 4.945   1.00 14.01 ? 216  MET A CE    1 
ATOM   1485 N N     . ILE A 1 217 ? 79.508  65.539 10.153  1.00 11.73 ? 217  ILE A N     1 
ATOM   1486 C CA    . ILE A 1 217 ? 79.529  65.550 11.604  1.00 7.75  ? 217  ILE A CA    1 
ATOM   1487 C C     . ILE A 1 217 ? 79.950  66.932 12.127  1.00 22.01 ? 217  ILE A C     1 
ATOM   1488 O O     . ILE A 1 217 ? 80.782  67.603 11.519  1.00 16.98 ? 217  ILE A O     1 
ATOM   1489 C CB    . ILE A 1 217 ? 80.450  64.432 12.112  1.00 12.08 ? 217  ILE A CB    1 
ATOM   1490 C CG1   . ILE A 1 217 ? 81.926  64.749 11.846  1.00 12.21 ? 217  ILE A CG1   1 
ATOM   1491 C CG2   . ILE A 1 217 ? 80.090  63.097 11.426  1.00 11.96 ? 217  ILE A CG2   1 
ATOM   1492 C CD1   . ILE A 1 217 ? 82.900  63.694 12.383  1.00 10.22 ? 217  ILE A CD1   1 
ATOM   1493 N N     . ARG A 1 218 ? 79.390  67.342 13.255  1.00 16.81 ? 218  ARG A N     1 
ATOM   1494 C CA    . ARG A 1 218 ? 79.619  68.659 13.814  1.00 16.77 ? 218  ARG A CA    1 
ATOM   1495 C C     . ARG A 1 218 ? 81.011  68.841 14.418  1.00 27.11 ? 218  ARG A C     1 
ATOM   1496 O O     . ARG A 1 218 ? 81.447  69.973 14.616  1.00 15.07 ? 218  ARG A O     1 
ATOM   1497 C CB    . ARG A 1 218 ? 78.594  68.967 14.872  1.00 14.40 ? 218  ARG A CB    1 
ATOM   1498 C CG    . ARG A 1 218 ? 77.231  69.174 14.228  1.00 21.18 ? 218  ARG A CG    1 
ATOM   1499 C CD    . ARG A 1 218 ? 76.263  69.753 15.234  1.00 26.06 ? 218  ARG A CD    1 
ATOM   1500 N NE    . ARG A 1 218 ? 76.179  68.879 16.393  1.00 38.55 ? 218  ARG A NE    1 
ATOM   1501 C CZ    . ARG A 1 218 ? 75.217  68.932 17.324  1.00 41.23 ? 218  ARG A CZ    1 
ATOM   1502 N NH1   . ARG A 1 218 ? 74.240  69.834 17.240  1.00 27.61 ? 218  ARG A NH1   1 
ATOM   1503 N NH2   . ARG A 1 218 ? 75.210  68.097 18.351  1.00 50.01 ? 218  ARG A NH2   1 
ATOM   1504 N N     . HIS A 1 219 ? 81.696  67.753 14.755  1.00 17.87 ? 219  HIS A N     1 
ATOM   1505 C CA    . HIS A 1 219 ? 83.033  67.873 15.278  1.00 5.00  ? 219  HIS A CA    1 
ATOM   1506 C C     . HIS A 1 219 ? 84.012  67.128 14.412  1.00 9.92  ? 219  HIS A C     1 
ATOM   1507 O O     . HIS A 1 219 ? 83.900  67.091 13.197  1.00 21.14 ? 219  HIS A O     1 
ATOM   1508 C CB    . HIS A 1 219 ? 83.199  67.520 16.774  1.00 11.30 ? 219  HIS A CB    1 
ATOM   1509 C CG    . HIS A 1 219 ? 82.392  68.407 17.666  0.00 0.00  ? 219  HIS A CG    1 
ATOM   1510 N ND1   . HIS A 1 219 ? 81.001  68.433 17.740  0.00 0.00  ? 219  HIS A ND1   1 
ATOM   1511 C CD2   . HIS A 1 219 ? 82.875  69.323 18.564  0.00 0.00  ? 219  HIS A CD2   1 
ATOM   1512 C CE1   . HIS A 1 219 ? 80.687  69.350 18.665  0.00 0.00  ? 219  HIS A CE1   1 
ATOM   1513 N NE2   . HIS A 1 219 ? 81.779  69.900 19.184  0.00 0.00  ? 219  HIS A NE2   1 
ATOM   1514 N N     . ASP A 1 220 ? 84.977  66.471 15.053  1.00 10.87 ? 220  ASP A N     1 
ATOM   1515 C CA    . ASP A 1 220 ? 86.000  65.782 14.284  1.00 13.01 ? 220  ASP A CA    1 
ATOM   1516 C C     . ASP A 1 220 ? 85.944  64.242 14.322  1.00 10.81 ? 220  ASP A C     1 
ATOM   1517 O O     . ASP A 1 220 ? 86.659  63.610 13.563  1.00 14.59 ? 220  ASP A O     1 
ATOM   1518 C CB    . ASP A 1 220 ? 87.384  66.274 14.749  1.00 20.02 ? 220  ASP A CB    1 
ATOM   1519 C CG    . ASP A 1 220 ? 87.599  66.024 16.220  1.00 23.72 ? 220  ASP A CG    1 
ATOM   1520 O OD1   . ASP A 1 220 ? 86.497  66.067 16.938  1.00 29.49 ? 220  ASP A OD1   1 
ATOM   1521 O OD2   . ASP A 1 220 ? 88.670  65.683 16.670  1.00 37.32 ? 220  ASP A OD2   1 
ATOM   1522 N N     . LYS A 1 221 ? 85.115  63.665 15.203  1.00 15.28 ? 221  LYS A N     1 
ATOM   1523 C CA    . LYS A 1 221 ? 85.002  62.220 15.385  1.00 16.78 ? 221  LYS A CA    1 
ATOM   1524 C C     . LYS A 1 221 ? 83.564  61.867 15.596  1.00 8.06  ? 221  LYS A C     1 
ATOM   1525 O O     . LYS A 1 221 ? 82.780  62.690 16.038  1.00 15.69 ? 221  LYS A O     1 
ATOM   1526 C CB    . LYS A 1 221 ? 85.766  61.731 16.602  1.00 12.57 ? 221  LYS A CB    1 
ATOM   1527 C CG    . LYS A 1 221 ? 87.254  61.836 16.373  1.00 21.88 ? 221  LYS A CG    1 
ATOM   1528 C CD    . LYS A 1 221 ? 88.020  61.958 17.676  1.00 29.52 ? 221  LYS A CD    1 
ATOM   1529 C CE    . LYS A 1 221 ? 89.519  61.808 17.427  1.00 34.62 ? 221  LYS A CE    1 
ATOM   1530 N NZ    . LYS A 1 221 ? 90.330  61.984 18.631  1.00 44.99 ? 221  LYS A NZ    1 
ATOM   1531 N N     . VAL A 1 222 ? 83.250  60.616 15.241  1.00 21.31 ? 222  VAL A N     1 
ATOM   1532 C CA    . VAL A 1 222 ? 81.927  60.028 15.463  1.00 12.61 ? 222  VAL A CA    1 
ATOM   1533 C C     . VAL A 1 222 ? 81.934  59.381 16.837  1.00 12.28 ? 222  VAL A C     1 
ATOM   1534 O O     . VAL A 1 222 ? 82.997  59.152 17.422  1.00 14.97 ? 222  VAL A O     1 
ATOM   1535 C CB    . VAL A 1 222 ? 81.590  58.959 14.425  1.00 10.36 ? 222  VAL A CB    1 
ATOM   1536 C CG1   . VAL A 1 222 ? 81.658  59.552 13.031  1.00 10.50 ? 222  VAL A CG1   1 
ATOM   1537 C CG2   . VAL A 1 222 ? 82.547  57.756 14.545  1.00 8.46  ? 222  VAL A CG2   1 
ATOM   1538 N N     . LEU A 1 223 ? 80.737  59.125 17.350  1.00 10.41 ? 223  LEU A N     1 
ATOM   1539 C CA    . LEU A 1 223 ? 80.589  58.417 18.597  1.00 5.00  ? 223  LEU A CA    1 
ATOM   1540 C C     . LEU A 1 223 ? 81.412  59.055 19.696  1.00 14.15 ? 223  LEU A C     1 
ATOM   1541 O O     . LEU A 1 223 ? 82.175  58.397 20.388  1.00 13.66 ? 223  LEU A O     1 
ATOM   1542 C CB    . LEU A 1 223 ? 80.963  56.923 18.413  1.00 15.71 ? 223  LEU A CB    1 
ATOM   1543 C CG    . LEU A 1 223 ? 80.129  56.200 17.335  1.00 12.14 ? 223  LEU A CG    1 
ATOM   1544 C CD1   . LEU A 1 223 ? 80.555  54.743 17.252  1.00 14.29 ? 223  LEU A CD1   1 
ATOM   1545 C CD2   . LEU A 1 223 ? 78.642  56.276 17.678  1.00 12.65 ? 223  LEU A CD2   1 
ATOM   1546 N N     . ARG A 1 224 ? 81.221  60.338 19.871  1.00 14.33 ? 224  ARG A N     1 
ATOM   1547 C CA    . ARG A 1 224 ? 82.037  61.087 20.820  1.00 18.52 ? 224  ARG A CA    1 
ATOM   1548 C C     . ARG A 1 224 ? 81.741  60.744 22.287  1.00 28.76 ? 224  ARG A C     1 
ATOM   1549 O O     . ARG A 1 224 ? 82.576  60.999 23.163  1.00 19.61 ? 224  ARG A O     1 
ATOM   1550 C CB    . ARG A 1 224 ? 81.934  62.595 20.488  1.00 15.42 ? 224  ARG A CB    1 
ATOM   1551 C CG    . ARG A 1 224 ? 82.709  62.849 19.169  1.00 28.01 ? 224  ARG A CG    1 
ATOM   1552 C CD    . ARG A 1 224 ? 82.811  64.325 18.789  1.00 32.25 ? 224  ARG A CD    1 
ATOM   1553 N NE    . ARG A 1 224 ? 81.822  65.109 19.489  1.00 29.79 ? 224  ARG A NE    1 
ATOM   1554 C CZ    . ARG A 1 224 ? 82.134  66.021 20.405  1.00 28.24 ? 224  ARG A CZ    1 
ATOM   1555 N NH1   . ARG A 1 224 ? 83.420  66.296 20.638  1.00 34.91 ? 224  ARG A NH1   1 
ATOM   1556 N NH2   . ARG A 1 224 ? 81.170  66.686 21.044  1.00 32.58 ? 224  ARG A NH2   1 
ATOM   1557 N N     . SER A 1 225 ? 80.615  60.052 22.557  1.00 23.14 ? 225  SER A N     1 
ATOM   1558 C CA    . SER A 1 225 ? 80.303  59.623 23.914  1.00 19.87 ? 225  SER A CA    1 
ATOM   1559 C C     . SER A 1 225 ? 80.864  58.241 24.295  1.00 15.62 ? 225  SER A C     1 
ATOM   1560 O O     . SER A 1 225 ? 80.774  57.819 25.448  1.00 25.15 ? 225  SER A O     1 
ATOM   1561 C CB    . SER A 1 225 ? 78.812  59.712 24.174  1.00 17.38 ? 225  SER A CB    1 
ATOM   1562 O OG    . SER A 1 225 ? 78.152  58.835 23.265  1.00 33.76 ? 225  SER A OG    1 
ATOM   1563 N N     . PHE A 1 226 ? 81.499  57.546 23.340  1.00 13.88 ? 226  PHE A N     1 
ATOM   1564 C CA    . PHE A 1 226 ? 82.134  56.253 23.562  1.00 9.36  ? 226  PHE A CA    1 
ATOM   1565 C C     . PHE A 1 226 ? 83.548  56.530 24.031  1.00 14.71 ? 226  PHE A C     1 
ATOM   1566 O O     . PHE A 1 226 ? 83.988  57.666 24.019  1.00 19.22 ? 226  PHE A O     1 
ATOM   1567 C CB    . PHE A 1 226 ? 82.215  55.442 22.274  1.00 9.32  ? 226  PHE A CB    1 
ATOM   1568 C CG    . PHE A 1 226 ? 80.877  54.846 21.929  1.00 11.88 ? 226  PHE A CG    1 
ATOM   1569 C CD1   . PHE A 1 226 ? 79.760  55.651 21.741  1.00 12.26 ? 226  PHE A CD1   1 
ATOM   1570 C CD2   . PHE A 1 226 ? 80.715  53.459 21.845  1.00 19.62 ? 226  PHE A CD2   1 
ATOM   1571 C CE1   . PHE A 1 226 ? 78.502  55.117 21.422  1.00 19.85 ? 226  PHE A CE1   1 
ATOM   1572 C CE2   . PHE A 1 226 ? 79.485  52.905 21.509  1.00 18.79 ? 226  PHE A CE2   1 
ATOM   1573 C CZ    . PHE A 1 226 ? 78.377  53.740 21.286  1.00 13.15 ? 226  PHE A CZ    1 
ATOM   1574 N N     . ASP A 1 227 ? 84.230  55.510 24.498  1.00 13.28 ? 227  ASP A N     1 
ATOM   1575 C CA    . ASP A 1 227 ? 85.574  55.678 24.931  1.00 7.76  ? 227  ASP A CA    1 
ATOM   1576 C C     . ASP A 1 227 ? 86.339  56.323 23.777  1.00 15.28 ? 227  ASP A C     1 
ATOM   1577 O O     . ASP A 1 227 ? 86.081  56.077 22.590  1.00 19.51 ? 227  ASP A O     1 
ATOM   1578 C CB    . ASP A 1 227 ? 86.185  54.346 25.328  1.00 10.89 ? 227  ASP A CB    1 
ATOM   1579 C CG    . ASP A 1 227 ? 87.510  54.502 26.004  1.00 12.78 ? 227  ASP A CG    1 
ATOM   1580 O OD1   . ASP A 1 227 ? 87.630  54.769 27.166  1.00 16.96 ? 227  ASP A OD1   1 
ATOM   1581 O OD2   . ASP A 1 227 ? 88.534  54.377 25.219  1.00 15.79 ? 227  ASP A OD2   1 
ATOM   1582 N N     . SER A 1 228 ? 87.260  57.208 24.089  1.00 15.44 ? 228  SER A N     1 
ATOM   1583 C CA    . SER A 1 228 ? 87.963  57.900 23.041  1.00 12.23 ? 228  SER A CA    1 
ATOM   1584 C C     . SER A 1 228 ? 88.743  56.987 22.089  1.00 5.00  ? 228  SER A C     1 
ATOM   1585 O O     . SER A 1 228 ? 88.936  57.291 20.915  1.00 11.92 ? 228  SER A O     1 
ATOM   1586 C CB    . SER A 1 228 ? 88.831  58.959 23.661  1.00 24.11 ? 228  SER A CB    1 
ATOM   1587 O OG    . SER A 1 228 ? 89.973  58.285 24.125  1.00 39.64 ? 228  SER A OG    1 
ATOM   1588 N N     . MET A 1 229 ? 89.158  55.808 22.548  1.00 18.05 ? 229  MET A N     1 
ATOM   1589 C CA    . MET A 1 229 ? 89.826  54.868 21.652  1.00 16.59 ? 229  MET A CA    1 
ATOM   1590 C C     . MET A 1 229 ? 88.889  54.433 20.524  1.00 17.02 ? 229  MET A C     1 
ATOM   1591 O O     . MET A 1 229 ? 89.296  54.241 19.363  1.00 14.14 ? 229  MET A O     1 
ATOM   1592 C CB    . MET A 1 229 ? 90.382  53.641 22.386  1.00 17.05 ? 229  MET A CB    1 
ATOM   1593 C CG    . MET A 1 229 ? 90.990  52.638 21.436  1.00 31.24 ? 229  MET A CG    1 
ATOM   1594 S SD    . MET A 1 229 ? 91.434  51.133 22.306  1.00 35.05 ? 229  MET A SD    1 
ATOM   1595 C CE    . MET A 1 229 ? 89.765  50.436 22.479  1.00 32.39 ? 229  MET A CE    1 
ATOM   1596 N N     . ILE A 1 230 ? 87.626  54.224 20.893  1.00 12.14 ? 230  ILE A N     1 
ATOM   1597 C CA    . ILE A 1 230 ? 86.610  53.819 19.952  1.00 10.95 ? 230  ILE A CA    1 
ATOM   1598 C C     . ILE A 1 230 ? 86.249  54.950 19.006  1.00 9.30  ? 230  ILE A C     1 
ATOM   1599 O O     . ILE A 1 230 ? 86.129  54.745 17.785  1.00 13.25 ? 230  ILE A O     1 
ATOM   1600 C CB    . ILE A 1 230 ? 85.368  53.281 20.684  1.00 17.71 ? 230  ILE A CB    1 
ATOM   1601 C CG1   . ILE A 1 230 ? 85.726  52.045 21.501  1.00 13.68 ? 230  ILE A CG1   1 
ATOM   1602 C CG2   . ILE A 1 230 ? 84.272  52.966 19.679  1.00 18.52 ? 230  ILE A CG2   1 
ATOM   1603 C CD1   . ILE A 1 230 ? 86.322  50.952 20.614  1.00 20.25 ? 230  ILE A CD1   1 
ATOM   1604 N N     . SER A 1 231 ? 86.052  56.153 19.529  1.00 12.37 ? 231  SER A N     1 
ATOM   1605 C CA    . SER A 1 231 ? 85.670  57.176 18.591  1.00 11.16 ? 231  SER A CA    1 
ATOM   1606 C C     . SER A 1 231 ? 86.750  57.460 17.587  1.00 15.71 ? 231  SER A C     1 
ATOM   1607 O O     . SER A 1 231 ? 86.471  57.664 16.411  1.00 15.89 ? 231  SER A O     1 
ATOM   1608 C CB    . SER A 1 231 ? 85.029  58.423 19.153  1.00 17.87 ? 231  SER A CB    1 
ATOM   1609 O OG    . SER A 1 231 ? 85.926  59.093 19.957  1.00 28.49 ? 231  SER A OG    1 
ATOM   1610 N N     . THR A 1 232 ? 87.993  57.400 18.025  1.00 14.38 ? 232  THR A N     1 
ATOM   1611 C CA    . THR A 1 232 ? 89.095  57.613 17.104  1.00 16.03 ? 232  THR A CA    1 
ATOM   1612 C C     . THR A 1 232 ? 89.172  56.501 16.079  1.00 19.69 ? 232  THR A C     1 
ATOM   1613 O O     . THR A 1 232 ? 89.220  56.763 14.877  1.00 13.65 ? 232  THR A O     1 
ATOM   1614 C CB    . THR A 1 232 ? 90.435  57.737 17.842  1.00 13.06 ? 232  THR A CB    1 
ATOM   1615 O OG1   . THR A 1 232 ? 90.313  58.814 18.748  1.00 19.80 ? 232  THR A OG1   1 
ATOM   1616 C CG2   . THR A 1 232 ? 91.569  57.969 16.848  1.00 21.31 ? 232  THR A CG2   1 
ATOM   1617 N N     . ASN A 1 233 ? 89.214  55.257 16.544  1.00 14.35 ? 233  ASN A N     1 
ATOM   1618 C CA    . ASN A 1 233 ? 89.363  54.135 15.637  1.00 15.16 ? 233  ASN A CA    1 
ATOM   1619 C C     . ASN A 1 233 ? 88.185  54.050 14.686  1.00 16.40 ? 233  ASN A C     1 
ATOM   1620 O O     . ASN A 1 233 ? 88.336  53.691 13.521  1.00 13.20 ? 233  ASN A O     1 
ATOM   1621 C CB    . ASN A 1 233 ? 89.490  52.827 16.438  1.00 17.29 ? 233  ASN A CB    1 
ATOM   1622 C CG    . ASN A 1 233 ? 89.821  51.639 15.578  1.00 19.21 ? 233  ASN A CG    1 
ATOM   1623 O OD1   . ASN A 1 233 ? 90.921  51.584 14.999  1.00 19.03 ? 233  ASN A OD1   1 
ATOM   1624 N ND2   . ASN A 1 233 ? 88.809  50.779 15.389  1.00 12.89 ? 233  ASN A ND2   1 
ATOM   1625 N N     . CYS A 1 234 ? 86.979  54.304 15.186  1.00 12.23 ? 234  CYS A N     1 
ATOM   1626 C CA    . CYS A 1 234 ? 85.821  54.167 14.339  1.00 5.42  ? 234  CYS A CA    1 
ATOM   1627 C C     . CYS A 1 234 ? 85.841  55.184 13.184  1.00 15.99 ? 234  CYS A C     1 
ATOM   1628 O O     . CYS A 1 234 ? 85.389  54.925 12.060  1.00 17.28 ? 234  CYS A O     1 
ATOM   1629 C CB    . CYS A 1 234 ? 84.526  54.336 15.140  1.00 10.50 ? 234  CYS A CB    1 
ATOM   1630 S SG    . CYS A 1 234 ? 83.075  53.962 14.122  1.00 14.97 ? 234  CYS A SG    1 
ATOM   1631 N N     . THR A 1 235 ? 86.285  56.405 13.472  1.00 14.31 ? 235  THR A N     1 
ATOM   1632 C CA    . THR A 1 235 ? 86.338  57.457 12.467  1.00 10.42 ? 235  THR A CA    1 
ATOM   1633 C C     . THR A 1 235 ? 87.338  57.102 11.394  1.00 10.24 ? 235  THR A C     1 
ATOM   1634 O O     . THR A 1 235 ? 87.097  57.252 10.204  1.00 10.34 ? 235  THR A O     1 
ATOM   1635 C CB    . THR A 1 235 ? 86.740  58.795 13.144  1.00 17.29 ? 235  THR A CB    1 
ATOM   1636 O OG1   . THR A 1 235 ? 85.854  59.086 14.230  1.00 13.01 ? 235  THR A OG1   1 
ATOM   1637 C CG2   . THR A 1 235 ? 86.708  59.902 12.103  1.00 15.93 ? 235  THR A CG2   1 
ATOM   1638 N N     . GLU A 1 236 ? 88.454  56.548 11.815  1.00 13.82 ? 236  GLU A N     1 
ATOM   1639 C CA    . GLU A 1 236 ? 89.450  56.133 10.842  1.00 11.89 ? 236  GLU A CA    1 
ATOM   1640 C C     . GLU A 1 236 ? 88.958  54.974 9.992   1.00 21.03 ? 236  GLU A C     1 
ATOM   1641 O O     . GLU A 1 236 ? 89.291  54.921 8.785   1.00 13.40 ? 236  GLU A O     1 
ATOM   1642 C CB    . GLU A 1 236 ? 90.756  55.691 11.504  1.00 16.05 ? 236  GLU A CB    1 
ATOM   1643 C CG    . GLU A 1 236 ? 91.313  56.754 12.464  1.00 34.01 ? 236  GLU A CG    1 
ATOM   1644 C CD    . GLU A 1 236 ? 92.738  56.517 12.892  1.00 44.58 ? 236  GLU A CD    1 
ATOM   1645 O OE1   . GLU A 1 236 ? 93.160  55.294 12.655  1.00 45.12 ? 236  GLU A OE1   1 
ATOM   1646 O OE2   . GLU A 1 236 ? 93.452  57.426 13.308  1.00 54.74 ? 236  GLU A OE2   1 
ATOM   1647 N N     . GLU A 1 237 ? 88.261  53.993 10.624  1.00 18.56 ? 237  GLU A N     1 
ATOM   1648 C CA    . GLU A 1 237 ? 87.801  52.825 9.880   1.00 12.80 ? 237  GLU A CA    1 
ATOM   1649 C C     . GLU A 1 237 ? 86.813  53.239 8.801   1.00 11.48 ? 237  GLU A C     1 
ATOM   1650 O O     . GLU A 1 237 ? 86.820  52.767 7.657   1.00 16.31 ? 237  GLU A O     1 
ATOM   1651 C CB    . GLU A 1 237 ? 87.281  51.695 10.822  1.00 5.89  ? 237  GLU A CB    1 
ATOM   1652 C CG    . GLU A 1 237 ? 88.430  50.870 11.497  1.00 16.52 ? 237  GLU A CG    1 
ATOM   1653 C CD    . GLU A 1 237 ? 89.191  49.812 10.681  1.00 18.04 ? 237  GLU A CD    1 
ATOM   1654 O OE1   . GLU A 1 237 ? 89.282  50.027 9.399   1.00 29.24 ? 237  GLU A OE1   1 
ATOM   1655 O OE2   . GLU A 1 237 ? 89.740  48.867 11.198  1.00 21.49 ? 237  GLU A OE2   1 
ATOM   1656 N N     . LEU A 1 238 ? 85.970  54.205 9.128   1.00 8.28  ? 238  LEU A N     1 
ATOM   1657 C CA    . LEU A 1 238 ? 85.032  54.719 8.130   1.00 13.69 ? 238  LEU A CA    1 
ATOM   1658 C C     . LEU A 1 238 ? 85.828  55.295 6.943   1.00 17.86 ? 238  LEU A C     1 
ATOM   1659 O O     . LEU A 1 238 ? 85.489  55.095 5.773   1.00 17.86 ? 238  LEU A O     1 
ATOM   1660 C CB    . LEU A 1 238 ? 84.126  55.820 8.742   1.00 12.05 ? 238  LEU A CB    1 
ATOM   1661 C CG    . LEU A 1 238 ? 82.946  55.331 9.618   1.00 16.64 ? 238  LEU A CG    1 
ATOM   1662 C CD1   . LEU A 1 238 ? 82.456  56.450 10.527  1.00 12.55 ? 238  LEU A CD1   1 
ATOM   1663 C CD2   . LEU A 1 238 ? 81.772  54.887 8.745   1.00 12.66 ? 238  LEU A CD2   1 
ATOM   1664 N N     . GLU A 1 239 ? 86.853  56.100 7.226   1.00 14.35 ? 239  GLU A N     1 
ATOM   1665 C CA    . GLU A 1 239 ? 87.616  56.708 6.129   1.00 10.30 ? 239  GLU A CA    1 
ATOM   1666 C C     . GLU A 1 239 ? 88.316  55.685 5.285   1.00 17.05 ? 239  GLU A C     1 
ATOM   1667 O O     . GLU A 1 239 ? 88.284  55.738 4.061   1.00 23.33 ? 239  GLU A O     1 
ATOM   1668 C CB    . GLU A 1 239 ? 88.646  57.730 6.625   1.00 14.43 ? 239  GLU A CB    1 
ATOM   1669 C CG    . GLU A 1 239 ? 87.915  58.945 7.203   1.00 26.68 ? 239  GLU A CG    1 
ATOM   1670 C CD    . GLU A 1 239 ? 88.786  60.026 7.793   1.00 45.46 ? 239  GLU A CD    1 
ATOM   1671 O OE1   . GLU A 1 239 ? 89.762  59.577 8.547   1.00 42.10 ? 239  GLU A OE1   1 
ATOM   1672 O OE2   . GLU A 1 239 ? 88.496  61.205 7.715   1.00 55.37 ? 239  GLU A OE2   1 
ATOM   1673 N N     . ASN A 1 240 ? 88.915  54.717 5.942   1.00 12.58 ? 240  ASN A N     1 
ATOM   1674 C CA    . ASN A 1 240 ? 89.562  53.633 5.247   1.00 16.56 ? 240  ASN A CA    1 
ATOM   1675 C C     . ASN A 1 240 ? 88.587  52.808 4.385   1.00 20.99 ? 240  ASN A C     1 
ATOM   1676 O O     . ASN A 1 240 ? 89.043  52.104 3.488   1.00 21.85 ? 240  ASN A O     1 
ATOM   1677 C CB    . ASN A 1 240 ? 90.295  52.696 6.248   1.00 17.67 ? 240  ASN A CB    1 
ATOM   1678 C CG    . ASN A 1 240 ? 91.386  53.443 6.998   1.00 44.92 ? 240  ASN A CG    1 
ATOM   1679 O OD1   . ASN A 1 240 ? 91.985  54.411 6.477   1.00 33.19 ? 240  ASN A OD1   1 
ATOM   1680 N ND2   . ASN A 1 240 ? 91.660  52.967 8.212   1.00 45.18 ? 240  ASN A ND2   1 
ATOM   1681 N N     . ALA A 1 241 ? 87.281  52.833 4.694   1.00 21.27 ? 241  ALA A N     1 
ATOM   1682 C CA    . ALA A 1 241 ? 86.285  52.039 3.977   1.00 22.88 ? 241  ALA A CA    1 
ATOM   1683 C C     . ALA A 1 241 ? 85.654  52.817 2.816   1.00 27.16 ? 241  ALA A C     1 
ATOM   1684 O O     . ALA A 1 241 ? 84.778  52.286 2.138   1.00 29.13 ? 241  ALA A O     1 
ATOM   1685 C CB    . ALA A 1 241 ? 85.195  51.518 4.914   1.00 17.24 ? 241  ALA A CB    1 
ATOM   1686 N N     . GLY A 1 242 ? 86.080  54.083 2.630   1.00 24.01 ? 242  GLY A N     1 
ATOM   1687 C CA    . GLY A 1 242 ? 85.652  54.935 1.518   1.00 22.28 ? 242  GLY A CA    1 
ATOM   1688 C C     . GLY A 1 242 ? 84.568  55.948 1.854   1.00 20.89 ? 242  GLY A C     1 
ATOM   1689 O O     . GLY A 1 242 ? 84.010  56.585 0.958   1.00 23.12 ? 242  GLY A O     1 
ATOM   1690 N N     . VAL A 1 243 ? 84.240  56.064 3.137   1.00 17.09 ? 243  VAL A N     1 
ATOM   1691 C CA    . VAL A 1 243 ? 83.246  57.037 3.565   1.00 19.90 ? 243  VAL A CA    1 
ATOM   1692 C C     . VAL A 1 243 ? 83.956  58.387 3.704   1.00 24.64 ? 243  VAL A C     1 
ATOM   1693 O O     . VAL A 1 243 ? 84.978  58.491 4.372   1.00 15.05 ? 243  VAL A O     1 
ATOM   1694 C CB    . VAL A 1 243 ? 82.611  56.668 4.921   1.00 17.01 ? 243  VAL A CB    1 
ATOM   1695 C CG1   . VAL A 1 243 ? 81.672  57.795 5.343   1.00 13.87 ? 243  VAL A CG1   1 
ATOM   1696 C CG2   . VAL A 1 243 ? 81.789  55.375 4.795   1.00 8.93  ? 243  VAL A CG2   1 
ATOM   1697 N N     . GLU A 1 244 ? 83.432  59.436 3.073   1.00 14.93 ? 244  GLU A N     1 
ATOM   1698 C CA    . GLU A 1 244 ? 84.020  60.753 3.245   1.00 18.54 ? 244  GLU A CA    1 
ATOM   1699 C C     . GLU A 1 244 ? 83.465  61.438 4.487   1.00 12.75 ? 244  GLU A C     1 
ATOM   1700 O O     . GLU A 1 244 ? 82.323  61.837 4.507   1.00 17.67 ? 244  GLU A O     1 
ATOM   1701 C CB    . GLU A 1 244 ? 83.680  61.592 1.995   1.00 19.76 ? 244  GLU A CB    1 
ATOM   1702 C CG    . GLU A 1 244 ? 83.957  63.093 2.184   1.00 30.60 ? 244  GLU A CG    1 
ATOM   1703 C CD    . GLU A 1 244 ? 83.582  63.832 0.933   1.00 35.14 ? 244  GLU A CD    1 
ATOM   1704 O OE1   . GLU A 1 244 ? 82.450  63.800 0.465   1.00 36.98 ? 244  GLU A OE1   1 
ATOM   1705 O OE2   . GLU A 1 244 ? 84.627  64.357 0.337   1.00 35.23 ? 244  GLU A OE2   1 
ATOM   1706 N N     . VAL A 1 245 ? 84.285  61.655 5.496   1.00 14.62 ? 245  VAL A N     1 
ATOM   1707 C CA    . VAL A 1 245 ? 83.804  62.294 6.716   1.00 14.74 ? 245  VAL A CA    1 
ATOM   1708 C C     . VAL A 1 245 ? 84.093  63.766 6.616   1.00 23.42 ? 245  VAL A C     1 
ATOM   1709 O O     . VAL A 1 245 ? 85.254  64.129 6.540   1.00 22.84 ? 245  VAL A O     1 
ATOM   1710 C CB    . VAL A 1 245 ? 84.545  61.761 7.930   1.00 13.50 ? 245  VAL A CB    1 
ATOM   1711 C CG1   . VAL A 1 245 ? 83.964  62.356 9.198   1.00 11.28 ? 245  VAL A CG1   1 
ATOM   1712 C CG2   . VAL A 1 245 ? 84.421  60.244 7.975   1.00 18.09 ? 245  VAL A CG2   1 
ATOM   1713 N N     . LEU A 1 246 ? 83.035  64.568 6.598   1.00 18.09 ? 246  LEU A N     1 
ATOM   1714 C CA    . LEU A 1 246 ? 83.072  66.023 6.549   1.00 14.55 ? 246  LEU A CA    1 
ATOM   1715 C C     . LEU A 1 246 ? 83.076  66.563 7.973   1.00 16.30 ? 246  LEU A C     1 
ATOM   1716 O O     . LEU A 1 246 ? 82.025  66.646 8.584   1.00 19.11 ? 246  LEU A O     1 
ATOM   1717 C CB    . LEU A 1 246 ? 81.818  66.560 5.815   1.00 9.41  ? 246  LEU A CB    1 
ATOM   1718 C CG    . LEU A 1 246 ? 81.692  65.992 4.392   1.00 17.70 ? 246  LEU A CG    1 
ATOM   1719 C CD1   . LEU A 1 246 ? 80.416  66.457 3.703   1.00 16.94 ? 246  LEU A CD1   1 
ATOM   1720 C CD2   . LEU A 1 246 ? 82.903  66.414 3.546   1.00 22.63 ? 246  LEU A CD2   1 
ATOM   1721 N N     . LYS A 1 247 ? 84.244  66.885 8.524   1.00 12.60 ? 247  LYS A N     1 
ATOM   1722 C CA    . LYS A 1 247 ? 84.315  67.374 9.906   1.00 11.92 ? 247  LYS A CA    1 
ATOM   1723 C C     . LYS A 1 247 ? 83.946  68.841 10.082  1.00 16.29 ? 247  LYS A C     1 
ATOM   1724 O O     . LYS A 1 247 ? 84.008  69.644 9.160   1.00 17.06 ? 247  LYS A O     1 
ATOM   1725 C CB    . LYS A 1 247 ? 85.677  67.101 10.519  1.00 13.84 ? 247  LYS A CB    1 
ATOM   1726 C CG    . LYS A 1 247 ? 86.043  65.669 10.249  1.00 12.51 ? 247  LYS A CG    1 
ATOM   1727 C CD    . LYS A 1 247 ? 87.444  65.304 10.656  1.00 18.33 ? 247  LYS A CD    1 
ATOM   1728 C CE    . LYS A 1 247 ? 87.720  63.858 10.281  1.00 27.34 ? 247  LYS A CE    1 
ATOM   1729 N NZ    . LYS A 1 247 ? 89.011  63.408 10.803  1.00 35.05 ? 247  LYS A NZ    1 
ATOM   1730 N N     . PHE A 1 248 ? 83.532  69.149 11.305  1.00 12.18 ? 248  PHE A N     1 
ATOM   1731 C CA    . PHE A 1 248 ? 83.141  70.495 11.671  1.00 10.94 ? 248  PHE A CA    1 
ATOM   1732 C C     . PHE A 1 248 ? 82.163  71.066 10.693  1.00 23.02 ? 248  PHE A C     1 
ATOM   1733 O O     . PHE A 1 248 ? 82.253  72.237 10.382  1.00 20.14 ? 248  PHE A O     1 
ATOM   1734 C CB    . PHE A 1 248 ? 84.365  71.418 11.758  1.00 14.31 ? 248  PHE A CB    1 
ATOM   1735 C CG    . PHE A 1 248 ? 85.207  70.977 12.916  1.00 8.44  ? 248  PHE A CG    1 
ATOM   1736 C CD1   . PHE A 1 248 ? 84.782  71.235 14.217  1.00 13.04 ? 248  PHE A CD1   1 
ATOM   1737 C CD2   . PHE A 1 248 ? 86.359  70.226 12.710  1.00 11.73 ? 248  PHE A CD2   1 
ATOM   1738 C CE1   . PHE A 1 248 ? 85.531  70.800 15.310  1.00 16.28 ? 248  PHE A CE1   1 
ATOM   1739 C CE2   . PHE A 1 248 ? 87.136  69.805 13.788  1.00 19.15 ? 248  PHE A CE2   1 
ATOM   1740 C CZ    . PHE A 1 248 ? 86.714  70.103 15.082  1.00 15.65 ? 248  PHE A CZ    1 
ATOM   1741 N N     . SER A 1 249 ? 81.233  70.248 10.200  1.00 12.78 ? 249  SER A N     1 
ATOM   1742 C CA    . SER A 1 249 ? 80.322  70.767 9.179   1.00 9.14  ? 249  SER A CA    1 
ATOM   1743 C C     . SER A 1 249 ? 78.883  70.570 9.551   1.00 19.45 ? 249  SER A C     1 
ATOM   1744 O O     . SER A 1 249 ? 78.581  69.638 10.285  1.00 29.63 ? 249  SER A O     1 
ATOM   1745 C CB    . SER A 1 249 ? 80.591  70.106 7.851   1.00 13.69 ? 249  SER A CB    1 
ATOM   1746 O OG    . SER A 1 249 ? 82.005  70.168 7.586   1.00 18.00 ? 249  SER A OG    1 
ATOM   1747 N N     . GLN A 1 250 ? 78.010  71.439 9.018   1.00 16.86 ? 250  GLN A N     1 
ATOM   1748 C CA    . GLN A 1 250 ? 76.571  71.340 9.216   1.00 19.16 ? 250  GLN A CA    1 
ATOM   1749 C C     . GLN A 1 250 ? 75.776  71.932 8.079   1.00 24.80 ? 250  GLN A C     1 
ATOM   1750 O O     . GLN A 1 250 ? 76.222  72.820 7.350   1.00 22.38 ? 250  GLN A O     1 
ATOM   1751 C CB    . GLN A 1 250 ? 76.035  71.745 10.592  1.00 33.16 ? 250  GLN A CB    1 
ATOM   1752 C CG    . GLN A 1 250 ? 76.096  73.247 10.884  1.00 38.39 ? 250  GLN A CG    1 
ATOM   1753 C CD    . GLN A 1 250 ? 75.982  73.515 12.388  1.00 56.73 ? 250  GLN A CD    1 
ATOM   1754 O OE1   . GLN A 1 250 ? 76.652  72.867 13.219  1.00 45.17 ? 250  GLN A OE1   1 
ATOM   1755 N NE2   . GLN A 1 250 ? 75.173  74.526 12.734  1.00 58.86 ? 250  GLN A NE2   1 
ATOM   1756 N N     . VAL A 1 251 ? 74.576  71.414 7.930   1.00 17.71 ? 251  VAL A N     1 
ATOM   1757 C CA    . VAL A 1 251 ? 73.730  71.810 6.838   1.00 19.56 ? 251  VAL A CA    1 
ATOM   1758 C C     . VAL A 1 251 ? 73.111  73.196 7.048   1.00 17.05 ? 251  VAL A C     1 
ATOM   1759 O O     . VAL A 1 251 ? 72.538  73.529 8.088   1.00 22.39 ? 251  VAL A O     1 
ATOM   1760 C CB    . VAL A 1 251 ? 72.695  70.722 6.538   1.00 26.49 ? 251  VAL A CB    1 
ATOM   1761 C CG1   . VAL A 1 251 ? 71.786  71.164 5.371   1.00 18.51 ? 251  VAL A CG1   1 
ATOM   1762 C CG2   . VAL A 1 251 ? 73.405  69.389 6.233   1.00 20.95 ? 251  VAL A CG2   1 
ATOM   1763 N N     . LYS A 1 252 ? 73.165  74.024 6.013   1.00 22.19 ? 252  LYS A N     1 
ATOM   1764 C CA    . LYS A 1 252 ? 72.637  75.356 6.129   1.00 22.50 ? 252  LYS A CA    1 
ATOM   1765 C C     . LYS A 1 252 ? 71.324  75.410 5.381   1.00 16.15 ? 252  LYS A C     1 
ATOM   1766 O O     . LYS A 1 252 ? 70.375  76.093 5.783   1.00 20.35 ? 252  LYS A O     1 
ATOM   1767 C CB    . LYS A 1 252 ? 73.649  76.320 5.569   1.00 25.74 ? 252  LYS A CB    1 
ATOM   1768 C CG    . LYS A 1 252 ? 73.356  77.779 5.855   1.00 49.39 ? 252  LYS A CG    1 
ATOM   1769 C CD    . LYS A 1 252 ? 74.028  78.690 4.811   1.00 61.14 ? 252  LYS A CD    1 
ATOM   1770 C CE    . LYS A 1 252 ? 73.217  79.906 4.317   1.00 60.92 ? 252  LYS A CE    1 
ATOM   1771 N NZ    . LYS A 1 252 ? 71.765  79.919 4.604   1.00 64.46 ? 252  LYS A NZ    1 
ATOM   1772 N N     . GLU A 1 253 ? 71.225  74.625 4.313   1.00 16.44 ? 253  GLU A N     1 
ATOM   1773 C CA    . GLU A 1 253 ? 69.982  74.604 3.580   1.00 17.54 ? 253  GLU A CA    1 
ATOM   1774 C C     . GLU A 1 253 ? 70.012  73.530 2.522   1.00 16.64 ? 253  GLU A C     1 
ATOM   1775 O O     . GLU A 1 253 ? 71.064  73.031 2.146   1.00 22.72 ? 253  GLU A O     1 
ATOM   1776 C CB    . GLU A 1 253 ? 69.618  75.989 3.006   1.00 34.30 ? 253  GLU A CB    1 
ATOM   1777 C CG    . GLU A 1 253 ? 69.591  76.066 1.466   1.00 43.76 ? 253  GLU A CG    1 
ATOM   1778 C CD    . GLU A 1 253 ? 69.379  77.481 0.947   1.00 50.69 ? 253  GLU A CD    1 
ATOM   1779 O OE1   . GLU A 1 253 ? 68.279  77.982 0.817   1.00 41.48 ? 253  GLU A OE1   1 
ATOM   1780 O OE2   . GLU A 1 253 ? 70.484  78.093 0.596   1.00 58.48 ? 253  GLU A OE2   1 
ATOM   1781 N N     . VAL A 1 254 ? 68.832  73.104 2.116   1.00 23.07 ? 254  VAL A N     1 
ATOM   1782 C CA    . VAL A 1 254 ? 68.730  72.048 1.136   1.00 23.63 ? 254  VAL A CA    1 
ATOM   1783 C C     . VAL A 1 254 ? 67.786  72.508 0.052   1.00 18.47 ? 254  VAL A C     1 
ATOM   1784 O O     . VAL A 1 254 ? 66.764  73.104 0.351   1.00 24.10 ? 254  VAL A O     1 
ATOM   1785 C CB    . VAL A 1 254 ? 68.164  70.767 1.749   1.00 22.58 ? 254  VAL A CB    1 
ATOM   1786 C CG1   . VAL A 1 254 ? 68.295  69.665 0.699   1.00 16.16 ? 254  VAL A CG1   1 
ATOM   1787 C CG2   . VAL A 1 254 ? 68.933  70.374 3.010   1.00 18.57 ? 254  VAL A CG2   1 
ATOM   1788 N N     . LYS A 1 255 ? 68.101  72.205 -1.200  1.00 22.02 ? 255  LYS A N     1 
ATOM   1789 C CA    . LYS A 1 255 ? 67.174  72.536 -2.271  1.00 29.46 ? 255  LYS A CA    1 
ATOM   1790 C C     . LYS A 1 255 ? 67.152  71.476 -3.372  1.00 15.27 ? 255  LYS A C     1 
ATOM   1791 O O     . LYS A 1 255 ? 68.118  70.730 -3.573  1.00 21.41 ? 255  LYS A O     1 
ATOM   1792 C CB    . LYS A 1 255 ? 67.207  74.000 -2.713  1.00 35.78 ? 255  LYS A CB    1 
ATOM   1793 C CG    . LYS A 1 255 ? 68.523  74.434 -3.331  1.00 47.71 ? 255  LYS A CG    1 
ATOM   1794 C CD    . LYS A 1 255 ? 68.428  75.734 -4.135  1.00 60.34 ? 255  LYS A CD    1 
ATOM   1795 C CE    . LYS A 1 255 ? 69.219  75.681 -5.451  1.00 66.96 ? 255  LYS A CE    1 
ATOM   1796 N NZ    . LYS A 1 255 ? 69.024  76.838 -6.355  1.00 70.00 ? 255  LYS A NZ    1 
ATOM   1797 N N     . LYS A 1 256 ? 65.982  71.372 -3.998  1.00 31.13 ? 256  LYS A N     1 
ATOM   1798 C CA    . LYS A 1 256 ? 65.642  70.405 -5.040  1.00 25.16 ? 256  LYS A CA    1 
ATOM   1799 C C     . LYS A 1 256 ? 66.046  70.985 -6.376  1.00 29.35 ? 256  LYS A C     1 
ATOM   1800 O O     . LYS A 1 256 ? 65.402  71.901 -6.836  1.00 44.90 ? 256  LYS A O     1 
ATOM   1801 C CB    . LYS A 1 256 ? 64.126  70.230 -5.010  1.00 35.31 ? 256  LYS A CB    1 
ATOM   1802 C CG    . LYS A 1 256 ? 63.522  69.270 -6.019  1.00 43.91 ? 256  LYS A CG    1 
ATOM   1803 C CD    . LYS A 1 256 ? 64.011  67.846 -5.856  1.00 51.03 ? 256  LYS A CD    1 
ATOM   1804 C CE    . LYS A 1 256 ? 64.207  67.125 -7.186  1.00 53.64 ? 256  LYS A CE    1 
ATOM   1805 N NZ    . LYS A 1 256 ? 65.477  66.379 -7.270  1.00 50.27 ? 256  LYS A NZ    1 
ATOM   1806 N N     . THR A 1 257 ? 67.168  70.538 -6.932  1.00 30.72 ? 257  THR A N     1 
ATOM   1807 C CA    . THR A 1 257 ? 67.663  71.021 -8.201  1.00 20.03 ? 257  THR A CA    1 
ATOM   1808 C C     . THR A 1 257 ? 67.083  70.111 -9.253  1.00 39.77 ? 257  THR A C     1 
ATOM   1809 O O     . THR A 1 257 ? 66.231  69.277 -8.947  1.00 38.84 ? 257  THR A O     1 
ATOM   1810 C CB    . THR A 1 257 ? 69.202  70.994 -8.332  1.00 27.82 ? 257  THR A CB    1 
ATOM   1811 O OG1   . THR A 1 257 ? 69.653  69.683 -8.606  1.00 34.72 ? 257  THR A OG1   1 
ATOM   1812 C CG2   . THR A 1 257 ? 69.873  71.482 -7.058  1.00 33.21 ? 257  THR A CG2   1 
ATOM   1813 N N     . LEU A 1 258 ? 67.581  70.270 -10.482 1.00 50.16 ? 258  LEU A N     1 
ATOM   1814 C CA    . LEU A 1 258 ? 67.107  69.570 -11.677 1.00 55.68 ? 258  LEU A CA    1 
ATOM   1815 C C     . LEU A 1 258 ? 67.253  68.050 -11.563 1.00 57.58 ? 258  LEU A C     1 
ATOM   1816 O O     . LEU A 1 258 ? 66.386  67.267 -12.005 1.00 46.87 ? 258  LEU A O     1 
ATOM   1817 C CB    . LEU A 1 258 ? 67.773  70.136 -12.959 1.00 32.73 ? 258  LEU A CB    1 
ATOM   1818 C CG    . LEU A 1 258 ? 66.966  71.290 -13.563 1.00 33.80 ? 258  LEU A CG    1 
ATOM   1819 C CD1   . LEU A 1 258 ? 67.645  71.827 -14.820 1.00 40.19 ? 258  LEU A CD1   1 
ATOM   1820 C CD2   . LEU A 1 258 ? 65.535  70.832 -13.875 1.00 34.79 ? 258  LEU A CD2   1 
ATOM   1821 N N     . SER A 1 259 ? 68.368  67.656 -10.945 1.00 57.73 ? 259  SER A N     1 
ATOM   1822 C CA    . SER A 1 259 ? 68.659  66.254 -10.783 1.00 66.18 ? 259  SER A CA    1 
ATOM   1823 C C     . SER A 1 259 ? 69.275  65.985 -9.421  1.00 59.28 ? 259  SER A C     1 
ATOM   1824 O O     . SER A 1 259 ? 70.496  65.863 -9.254  1.00 55.84 ? 259  SER A O     1 
ATOM   1825 C CB    . SER A 1 259 ? 69.457  65.686 -11.939 1.00 65.81 ? 259  SER A CB    1 
ATOM   1826 O OG    . SER A 1 259 ? 68.697  65.798 -13.132 1.00 69.62 ? 259  SER A OG    1 
ATOM   1827 N N     . GLY A 1 260 ? 68.367  65.894 -8.455  1.00 51.09 ? 260  GLY A N     1 
ATOM   1828 C CA    . GLY A 1 260 ? 68.717  65.581 -7.096  1.00 47.93 ? 260  GLY A CA    1 
ATOM   1829 C C     . GLY A 1 260 ? 68.657  66.807 -6.213  1.00 43.05 ? 260  GLY A C     1 
ATOM   1830 O O     . GLY A 1 260 ? 68.072  67.834 -6.545  1.00 49.07 ? 260  GLY A O     1 
ATOM   1831 N N     . LEU A 1 261 ? 69.288  66.673 -5.069  1.00 29.58 ? 261  LEU A N     1 
ATOM   1832 C CA    . LEU A 1 261 ? 69.286  67.706 -4.068  1.00 30.11 ? 261  LEU A CA    1 
ATOM   1833 C C     . LEU A 1 261 ? 70.635  68.371 -4.130  1.00 26.09 ? 261  LEU A C     1 
ATOM   1834 O O     . LEU A 1 261 ? 71.619  67.808 -4.633  1.00 28.19 ? 261  LEU A O     1 
ATOM   1835 C CB    . LEU A 1 261 ? 69.046  67.175 -2.624  1.00 22.63 ? 261  LEU A CB    1 
ATOM   1836 C CG    . LEU A 1 261 ? 67.833  66.273 -2.436  1.00 27.05 ? 261  LEU A CG    1 
ATOM   1837 C CD1   . LEU A 1 261 ? 67.867  65.584 -1.058  1.00 18.55 ? 261  LEU A CD1   1 
ATOM   1838 C CD2   . LEU A 1 261 ? 66.560  67.103 -2.577  1.00 26.89 ? 261  LEU A CD2   1 
ATOM   1839 N N     . GLU A 1 262 ? 70.643  69.572 -3.587  1.00 23.30 ? 262  GLU A N     1 
ATOM   1840 C CA    . GLU A 1 262 ? 71.871  70.321 -3.472  1.00 23.72 ? 262  GLU A CA    1 
ATOM   1841 C C     . GLU A 1 262 ? 71.960  70.801 -2.048  1.00 20.79 ? 262  GLU A C     1 
ATOM   1842 O O     . GLU A 1 262 ? 71.055  71.501 -1.579  1.00 24.16 ? 262  GLU A O     1 
ATOM   1843 C CB    . GLU A 1 262 ? 71.790  71.548 -4.332  1.00 25.88 ? 262  GLU A CB    1 
ATOM   1844 C CG    . GLU A 1 262 ? 72.972  72.455 -4.035  1.00 35.96 ? 262  GLU A CG    1 
ATOM   1845 C CD    . GLU A 1 262 ? 73.074  73.376 -5.199  1.00 59.48 ? 262  GLU A CD    1 
ATOM   1846 O OE1   . GLU A 1 262 ? 73.276  72.718 -6.333  1.00 63.59 ? 262  GLU A OE1   1 
ATOM   1847 O OE2   . GLU A 1 262 ? 72.720  74.540 -5.120  1.00 67.10 ? 262  GLU A OE2   1 
ATOM   1848 N N     . VAL A 1 263 ? 73.037  70.407 -1.384  1.00 15.53 ? 263  VAL A N     1 
ATOM   1849 C CA    . VAL A 1 263 ? 73.187  70.669 0.033   1.00 17.98 ? 263  VAL A CA    1 
ATOM   1850 C C     . VAL A 1 263 ? 74.178  71.782 0.258   1.00 16.26 ? 263  VAL A C     1 
ATOM   1851 O O     . VAL A 1 263 ? 75.308  71.742 -0.226  1.00 22.77 ? 263  VAL A O     1 
ATOM   1852 C CB    . VAL A 1 263 ? 73.645  69.395 0.748   1.00 21.82 ? 263  VAL A CB    1 
ATOM   1853 C CG1   . VAL A 1 263 ? 73.857  69.610 2.252   1.00 18.45 ? 263  VAL A CG1   1 
ATOM   1854 C CG2   . VAL A 1 263 ? 72.572  68.342 0.515   1.00 19.63 ? 263  VAL A CG2   1 
ATOM   1855 N N     . SER A 1 264 ? 73.726  72.783 0.985   1.00 18.58 ? 264  SER A N     1 
ATOM   1856 C CA    . SER A 1 264 ? 74.591  73.875 1.338   1.00 25.41 ? 264  SER A CA    1 
ATOM   1857 C C     . SER A 1 264 ? 75.112  73.582 2.709   1.00 15.17 ? 264  SER A C     1 
ATOM   1858 O O     . SER A 1 264 ? 74.343  73.446 3.633   1.00 22.17 ? 264  SER A O     1 
ATOM   1859 C CB    . SER A 1 264 ? 73.813  75.169 1.374   1.00 27.08 ? 264  SER A CB    1 
ATOM   1860 O OG    . SER A 1 264 ? 73.665  75.585 0.042   1.00 42.02 ? 264  SER A OG    1 
ATOM   1861 N N     . MET A 1 265 ? 76.416  73.564 2.845   1.00 16.00 ? 265  MET A N     1 
ATOM   1862 C CA    . MET A 1 265 ? 76.959  73.373 4.157   1.00 21.20 ? 265  MET A CA    1 
ATOM   1863 C C     . MET A 1 265 ? 77.998  74.428 4.521   1.00 33.79 ? 265  MET A C     1 
ATOM   1864 O O     . MET A 1 265 ? 78.624  75.060 3.669   1.00 21.47 ? 265  MET A O     1 
ATOM   1865 C CB    . MET A 1 265 ? 77.472  71.942 4.421   1.00 27.83 ? 265  MET A CB    1 
ATOM   1866 C CG    . MET A 1 265 ? 78.659  71.592 3.581   1.00 22.78 ? 265  MET A CG    1 
ATOM   1867 S SD    . MET A 1 265 ? 79.565  70.163 4.236   1.00 27.19 ? 265  MET A SD    1 
ATOM   1868 C CE    . MET A 1 265 ? 80.946  70.178 3.106   1.00 25.96 ? 265  MET A CE    1 
ATOM   1869 N N     . VAL A 1 266 ? 78.150  74.589 5.833   1.00 29.45 ? 266  VAL A N     1 
ATOM   1870 C CA    . VAL A 1 266 ? 79.135  75.468 6.411   1.00 19.38 ? 266  VAL A CA    1 
ATOM   1871 C C     . VAL A 1 266 ? 80.114  74.588 7.174   1.00 24.02 ? 266  VAL A C     1 
ATOM   1872 O O     . VAL A 1 266 ? 79.694  73.718 7.939   1.00 20.88 ? 266  VAL A O     1 
ATOM   1873 C CB    . VAL A 1 266 ? 78.492  76.446 7.386   1.00 16.43 ? 266  VAL A CB    1 
ATOM   1874 C CG1   . VAL A 1 266 ? 79.590  77.348 7.935   1.00 26.65 ? 266  VAL A CG1   1 
ATOM   1875 C CG2   . VAL A 1 266 ? 77.509  77.307 6.627   1.00 30.20 ? 266  VAL A CG2   1 
ATOM   1876 N N     . THR A 1 267 ? 81.409  74.760 6.896   1.00 11.90 ? 267  THR A N     1 
ATOM   1877 C CA    . THR A 1 267 ? 82.477  74.032 7.539   1.00 10.27 ? 267  THR A CA    1 
ATOM   1878 C C     . THR A 1 267 ? 83.241  75.042 8.406   1.00 25.47 ? 267  THR A C     1 
ATOM   1879 O O     . THR A 1 267 ? 83.704  76.074 7.896   1.00 27.87 ? 267  THR A O     1 
ATOM   1880 C CB    . THR A 1 267 ? 83.339  73.378 6.477   1.00 12.88 ? 267  THR A CB    1 
ATOM   1881 O OG1   . THR A 1 267 ? 82.560  72.417 5.733   1.00 18.26 ? 267  THR A OG1   1 
ATOM   1882 C CG2   . THR A 1 267 ? 84.497  72.691 7.143   1.00 14.31 ? 267  THR A CG2   1 
ATOM   1883 N N     . ALA A 1 268 ? 83.340  74.825 9.733   1.00 19.52 ? 268  ALA A N     1 
ATOM   1884 C CA    . ALA A 1 268 ? 83.984  75.789 10.624  1.00 18.26 ? 268  ALA A CA    1 
ATOM   1885 C C     . ALA A 1 268 ? 85.007  75.093 11.466  1.00 16.65 ? 268  ALA A C     1 
ATOM   1886 O O     . ALA A 1 268 ? 84.753  74.857 12.631  1.00 26.10 ? 268  ALA A O     1 
ATOM   1887 C CB    . ALA A 1 268 ? 82.965  76.458 11.558  1.00 13.91 ? 268  ALA A CB    1 
ATOM   1888 N N     . VAL A 1 269 ? 86.148  74.787 10.866  1.00 20.26 ? 269  VAL A N     1 
ATOM   1889 C CA    . VAL A 1 269 ? 87.230  74.163 11.595  1.00 12.36 ? 269  VAL A CA    1 
ATOM   1890 C C     . VAL A 1 269 ? 87.743  75.142 12.613  1.00 23.01 ? 269  VAL A C     1 
ATOM   1891 O O     . VAL A 1 269 ? 87.842  76.336 12.328  1.00 26.38 ? 269  VAL A O     1 
ATOM   1892 C CB    . VAL A 1 269 ? 88.351  73.797 10.688  1.00 14.49 ? 269  VAL A CB    1 
ATOM   1893 C CG1   . VAL A 1 269 ? 89.512  73.286 11.516  1.00 26.08 ? 269  VAL A CG1   1 
ATOM   1894 C CG2   . VAL A 1 269 ? 87.892  72.726 9.705   1.00 29.19 ? 269  VAL A CG2   1 
ATOM   1895 N N     . PRO A 1 270 ? 87.980  74.706 13.836  1.00 28.00 ? 270  PRO A N     1 
ATOM   1896 C CA    . PRO A 1 270 ? 88.416  75.711 14.766  1.00 33.18 ? 270  PRO A CA    1 
ATOM   1897 C C     . PRO A 1 270 ? 89.823  76.177 14.391  1.00 28.71 ? 270  PRO A C     1 
ATOM   1898 O O     . PRO A 1 270 ? 90.678  75.400 13.970  1.00 28.75 ? 270  PRO A O     1 
ATOM   1899 C CB    . PRO A 1 270 ? 88.275  75.137 16.180  1.00 37.78 ? 270  PRO A CB    1 
ATOM   1900 C CG    . PRO A 1 270 ? 87.372  73.927 16.047  1.00 36.13 ? 270  PRO A CG    1 
ATOM   1901 C CD    . PRO A 1 270 ? 87.380  73.558 14.569  1.00 36.03 ? 270  PRO A CD    1 
ATOM   1902 N N     . GLY A 1 271 ? 90.002  77.501 14.413  1.00 45.20 ? 271  GLY A N     1 
ATOM   1903 C CA    . GLY A 1 271 ? 91.277  78.116 14.061  1.00 38.29 ? 271  GLY A CA    1 
ATOM   1904 C C     . GLY A 1 271 ? 91.303  78.422 12.572  1.00 36.18 ? 271  GLY A C     1 
ATOM   1905 O O     . GLY A 1 271 ? 92.350  78.576 11.937  1.00 36.64 ? 271  GLY A O     1 
ATOM   1906 N N     . ARG A 1 272 ? 90.117  78.538 12.017  1.00 35.74 ? 272  ARG A N     1 
ATOM   1907 C CA    . ARG A 1 272 ? 90.047  78.757 10.607  1.00 20.08 ? 272  ARG A CA    1 
ATOM   1908 C C     . ARG A 1 272 ? 88.851  79.597 10.328  1.00 14.48 ? 272  ARG A C     1 
ATOM   1909 O O     . ARG A 1 272 ? 87.976  79.709 11.172  1.00 21.47 ? 272  ARG A O     1 
ATOM   1910 C CB    . ARG A 1 272 ? 89.795  77.398 10.016  1.00 30.96 ? 272  ARG A CB    1 
ATOM   1911 C CG    . ARG A 1 272 ? 90.576  77.265 8.760   1.00 38.06 ? 272  ARG A CG    1 
ATOM   1912 C CD    . ARG A 1 272 ? 91.316  75.951 8.660   1.00 44.43 ? 272  ARG A CD    1 
ATOM   1913 N NE    . ARG A 1 272 ? 91.863  75.931 7.315   1.00 63.30 ? 272  ARG A NE    1 
ATOM   1914 C CZ    . ARG A 1 272 ? 92.122  74.855 6.584   1.00 73.37 ? 272  ARG A CZ    1 
ATOM   1915 N NH1   . ARG A 1 272 ? 91.957  73.647 7.141   1.00 72.92 ? 272  ARG A NH1   1 
ATOM   1916 N NH2   . ARG A 1 272 ? 92.564  74.971 5.316   1.00 67.11 ? 272  ARG A NH2   1 
ATOM   1917 N N     . LEU A 1 273 ? 88.812  80.152 9.125   1.00 17.22 ? 273  LEU A N     1 
ATOM   1918 C CA    . LEU A 1 273 ? 87.618  80.883 8.774   1.00 24.54 ? 273  LEU A CA    1 
ATOM   1919 C C     . LEU A 1 273 ? 86.623  79.859 8.231   1.00 19.97 ? 273  LEU A C     1 
ATOM   1920 O O     . LEU A 1 273 ? 87.014  78.903 7.565   1.00 24.35 ? 273  LEU A O     1 
ATOM   1921 C CB    . LEU A 1 273 ? 87.862  82.026 7.757   1.00 15.94 ? 273  LEU A CB    1 
ATOM   1922 C CG    . LEU A 1 273 ? 88.765  83.118 8.313   1.00 18.21 ? 273  LEU A CG    1 
ATOM   1923 C CD1   . LEU A 1 273 ? 89.256  84.013 7.184   1.00 15.97 ? 273  LEU A CD1   1 
ATOM   1924 C CD2   . LEU A 1 273 ? 87.979  83.943 9.326   1.00 24.77 ? 273  LEU A CD2   1 
ATOM   1925 N N     . PRO A 1 274 ? 85.335  80.096 8.545   1.00 16.89 ? 274  PRO A N     1 
ATOM   1926 C CA    . PRO A 1 274 ? 84.239  79.285 8.075   1.00 18.10 ? 274  PRO A CA    1 
ATOM   1927 C C     . PRO A 1 274 ? 84.197  79.358 6.558   1.00 27.72 ? 274  PRO A C     1 
ATOM   1928 O O     . PRO A 1 274 ? 84.577  80.365 5.948   1.00 20.51 ? 274  PRO A O     1 
ATOM   1929 C CB    . PRO A 1 274 ? 82.940  79.854 8.652   1.00 21.61 ? 274  PRO A CB    1 
ATOM   1930 C CG    . PRO A 1 274 ? 83.325  81.172 9.331   1.00 23.58 ? 274  PRO A CG    1 
ATOM   1931 C CD    . PRO A 1 274 ? 84.834  81.189 9.425   1.00 14.27 ? 274  PRO A CD    1 
ATOM   1932 N N     . VAL A 1 275 ? 83.761  78.254 5.940   1.00 18.87 ? 275  VAL A N     1 
ATOM   1933 C CA    . VAL A 1 275 ? 83.670  78.196 4.508   1.00 21.45 ? 275  VAL A CA    1 
ATOM   1934 C C     . VAL A 1 275 ? 82.356  77.514 4.118   1.00 23.50 ? 275  VAL A C     1 
ATOM   1935 O O     . VAL A 1 275 ? 81.930  76.551 4.754   1.00 25.34 ? 275  VAL A O     1 
ATOM   1936 C CB    . VAL A 1 275 ? 84.936  77.596 3.904   1.00 19.10 ? 275  VAL A CB    1 
ATOM   1937 C CG1   . VAL A 1 275 ? 85.585  76.586 4.829   1.00 22.07 ? 275  VAL A CG1   1 
ATOM   1938 C CG2   . VAL A 1 275 ? 84.693  76.981 2.529   1.00 27.23 ? 275  VAL A CG2   1 
ATOM   1939 N N     . MET A 1 276 ? 81.672  78.067 3.129   1.00 18.04 ? 276  MET A N     1 
ATOM   1940 C CA    . MET A 1 276 ? 80.413  77.531 2.636   1.00 17.03 ? 276  MET A CA    1 
ATOM   1941 C C     . MET A 1 276 ? 80.680  76.700 1.383   1.00 26.01 ? 276  MET A C     1 
ATOM   1942 O O     . MET A 1 276 ? 81.475  77.085 0.531   1.00 24.15 ? 276  MET A O     1 
ATOM   1943 C CB    . MET A 1 276 ? 79.389  78.635 2.341   1.00 21.48 ? 276  MET A CB    1 
ATOM   1944 C CG    . MET A 1 276 ? 78.466  78.950 3.508   1.00 45.95 ? 276  MET A CG    1 
ATOM   1945 S SD    . MET A 1 276 ? 76.730  79.005 2.971   1.00 75.73 ? 276  MET A SD    1 
ATOM   1946 C CE    . MET A 1 276 ? 76.810  80.311 1.718   1.00 60.17 ? 276  MET A CE    1 
ATOM   1947 N N     . THR A 1 277 ? 80.077  75.507 1.316   1.00 21.82 ? 277  THR A N     1 
ATOM   1948 C CA    . THR A 1 277 ? 80.242  74.584 0.203   1.00 18.11 ? 277  THR A CA    1 
ATOM   1949 C C     . THR A 1 277 ? 78.881  74.074 -0.246  1.00 31.96 ? 277  THR A C     1 
ATOM   1950 O O     . THR A 1 277 ? 77.960  73.873 0.561   1.00 29.52 ? 277  THR A O     1 
ATOM   1951 C CB    . THR A 1 277 ? 80.993  73.351 0.674   1.00 21.76 ? 277  THR A CB    1 
ATOM   1952 O OG1   . THR A 1 277 ? 82.205  73.763 1.241   1.00 28.49 ? 277  THR A OG1   1 
ATOM   1953 C CG2   . THR A 1 277 ? 81.195  72.358 -0.480  1.00 28.18 ? 277  THR A CG2   1 
ATOM   1954 N N     . MET A 1 278 ? 78.759  73.798 -1.531  1.00 23.93 ? 278  MET A N     1 
ATOM   1955 C CA    . MET A 1 278 ? 77.514  73.239 -2.026  1.00 24.90 ? 278  MET A CA    1 
ATOM   1956 C C     . MET A 1 278 ? 77.829  71.809 -2.365  1.00 26.87 ? 278  MET A C     1 
ATOM   1957 O O     . MET A 1 278 ? 78.902  71.578 -2.914  1.00 29.76 ? 278  MET A O     1 
ATOM   1958 C CB    . MET A 1 278 ? 77.142  73.957 -3.319  1.00 39.57 ? 278  MET A CB    1 
ATOM   1959 C CG    . MET A 1 278 ? 75.807  74.649 -3.223  1.00 51.94 ? 278  MET A CG    1 
ATOM   1960 S SD    . MET A 1 278 ? 75.844  76.055 -2.096  1.00 79.38 ? 278  MET A SD    1 
ATOM   1961 C CE    . MET A 1 278 ? 77.303  76.927 -2.750  1.00 74.92 ? 278  MET A CE    1 
ATOM   1962 N N     . ILE A 1 279 ? 76.940  70.868 -2.017  1.00 21.75 ? 279  ILE A N     1 
ATOM   1963 C CA    . ILE A 1 279 ? 77.092  69.466 -2.412  1.00 21.86 ? 279  ILE A CA    1 
ATOM   1964 C C     . ILE A 1 279 ? 75.938  69.214 -3.379  1.00 15.56 ? 279  ILE A C     1 
ATOM   1965 O O     . ILE A 1 279 ? 74.753  69.332 -3.026  1.00 23.18 ? 279  ILE A O     1 
ATOM   1966 C CB    . ILE A 1 279 ? 77.090  68.414 -1.303  1.00 25.05 ? 279  ILE A CB    1 
ATOM   1967 C CG1   . ILE A 1 279 ? 78.183  68.683 -0.272  1.00 25.49 ? 279  ILE A CG1   1 
ATOM   1968 C CG2   . ILE A 1 279 ? 77.317  67.036 -1.912  1.00 18.56 ? 279  ILE A CG2   1 
ATOM   1969 C CD1   . ILE A 1 279 ? 78.094  67.710 0.900   1.00 24.79 ? 279  ILE A CD1   1 
ATOM   1970 N N     . PRO A 1 280 ? 76.310  68.995 -4.634  1.00 29.32 ? 280  PRO A N     1 
ATOM   1971 C CA    . PRO A 1 280 ? 75.364  68.847 -5.722  1.00 25.12 ? 280  PRO A CA    1 
ATOM   1972 C C     . PRO A 1 280 ? 75.097  67.387 -6.030  1.00 30.24 ? 280  PRO A C     1 
ATOM   1973 O O     . PRO A 1 280 ? 75.896  66.482 -5.713  1.00 26.97 ? 280  PRO A O     1 
ATOM   1974 C CB    . PRO A 1 280 ? 76.125  69.345 -6.938  1.00 25.57 ? 280  PRO A CB    1 
ATOM   1975 C CG    . PRO A 1 280 ? 77.595  69.060 -6.654  1.00 30.41 ? 280  PRO A CG    1 
ATOM   1976 C CD    . PRO A 1 280 ? 77.713  68.948 -5.139  1.00 25.81 ? 280  PRO A CD    1 
ATOM   1977 N N     . ASP A 1 281 ? 73.986  67.203 -6.726  1.00 26.35 ? 281  ASP A N     1 
ATOM   1978 C CA    . ASP A 1 281 ? 73.578  65.917 -7.247  1.00 27.12 ? 281  ASP A CA    1 
ATOM   1979 C C     . ASP A 1 281 ? 73.440  64.859 -6.165  1.00 31.03 ? 281  ASP A C     1 
ATOM   1980 O O     . ASP A 1 281 ? 73.866  63.708 -6.348  1.00 27.60 ? 281  ASP A O     1 
ATOM   1981 C CB    . ASP A 1 281 ? 74.564  65.432 -8.328  1.00 35.99 ? 281  ASP A CB    1 
ATOM   1982 C CG    . ASP A 1 281 ? 74.844  66.487 -9.379  1.00 45.12 ? 281  ASP A CG    1 
ATOM   1983 O OD1   . ASP A 1 281 ? 73.743  67.026 -9.895  1.00 38.85 ? 281  ASP A OD1   1 
ATOM   1984 O OD2   . ASP A 1 281 ? 75.984  66.781 -9.714  1.00 45.53 ? 281  ASP A OD2   1 
ATOM   1985 N N     . VAL A 1 282 ? 72.783  65.236 -5.071  1.00 20.87 ? 282  VAL A N     1 
ATOM   1986 C CA    . VAL A 1 282 ? 72.604  64.312 -3.980  1.00 22.03 ? 282  VAL A CA    1 
ATOM   1987 C C     . VAL A 1 282 ? 71.299  63.534 -4.154  1.00 22.43 ? 282  VAL A C     1 
ATOM   1988 O O     . VAL A 1 282 ? 70.238  64.085 -4.397  1.00 21.68 ? 282  VAL A O     1 
ATOM   1989 C CB    . VAL A 1 282 ? 72.757  65.016 -2.638  1.00 15.82 ? 282  VAL A CB    1 
ATOM   1990 C CG1   . VAL A 1 282 ? 72.325  64.116 -1.476  1.00 19.38 ? 282  VAL A CG1   1 
ATOM   1991 C CG2   . VAL A 1 282 ? 74.224  65.388 -2.467  1.00 14.16 ? 282  VAL A CG2   1 
ATOM   1992 N N     . ASP A 1 283 ? 71.387  62.210 -4.064  1.00 19.01 ? 283  ASP A N     1 
ATOM   1993 C CA    . ASP A 1 283 ? 70.220  61.386 -4.261  1.00 12.87 ? 283  ASP A CA    1 
ATOM   1994 C C     . ASP A 1 283 ? 69.484  61.216 -2.951  1.00 20.15 ? 283  ASP A C     1 
ATOM   1995 O O     . ASP A 1 283 ? 68.268  61.231 -2.907  1.00 23.11 ? 283  ASP A O     1 
ATOM   1996 C CB    . ASP A 1 283 ? 70.647  60.016 -4.816  1.00 24.46 ? 283  ASP A CB    1 
ATOM   1997 C CG    . ASP A 1 283 ? 71.321  60.160 -6.145  1.00 31.37 ? 283  ASP A CG    1 
ATOM   1998 O OD1   . ASP A 1 283 ? 70.649  60.953 -6.965  1.00 32.41 ? 283  ASP A OD1   1 
ATOM   1999 O OD2   . ASP A 1 283 ? 72.428  59.707 -6.378  1.00 24.67 ? 283  ASP A OD2   1 
ATOM   2000 N N     . CYS A 1 284 ? 70.260  61.016 -1.895  1.00 13.36 ? 284  CYS A N     1 
ATOM   2001 C CA    . CYS A 1 284 ? 69.689  60.748 -0.599  1.00 19.40 ? 284  CYS A CA    1 
ATOM   2002 C C     . CYS A 1 284 ? 70.311  61.628 0.491   1.00 15.28 ? 284  CYS A C     1 
ATOM   2003 O O     . CYS A 1 284 ? 71.527  61.590 0.729   1.00 21.92 ? 284  CYS A O     1 
ATOM   2004 C CB    . CYS A 1 284 ? 69.915  59.237 -0.290  1.00 13.51 ? 284  CYS A CB    1 
ATOM   2005 S SG    . CYS A 1 284 ? 69.316  58.753 1.343   1.00 26.95 ? 284  CYS A SG    1 
ATOM   2006 N N     . LEU A 1 285 ? 69.473  62.385 1.201   1.00 18.19 ? 285  LEU A N     1 
ATOM   2007 C CA    . LEU A 1 285 ? 69.923  63.156 2.342   1.00 17.68 ? 285  LEU A CA    1 
ATOM   2008 C C     . LEU A 1 285 ? 69.303  62.524 3.570   1.00 11.75 ? 285  LEU A C     1 
ATOM   2009 O O     . LEU A 1 285 ? 68.098  62.525 3.707   1.00 20.01 ? 285  LEU A O     1 
ATOM   2010 C CB    . LEU A 1 285 ? 69.505  64.617 2.254   1.00 20.24 ? 285  LEU A CB    1 
ATOM   2011 C CG    . LEU A 1 285 ? 69.802  65.433 3.503   1.00 24.47 ? 285  LEU A CG    1 
ATOM   2012 C CD1   . LEU A 1 285 ? 71.312  65.549 3.640   1.00 22.13 ? 285  LEU A CD1   1 
ATOM   2013 C CD2   . LEU A 1 285 ? 69.206  66.829 3.384   1.00 16.62 ? 285  LEU A CD2   1 
ATOM   2014 N N     . LEU A 1 286 ? 70.134  61.959 4.442   1.00 13.39 ? 286  LEU A N     1 
ATOM   2015 C CA    . LEU A 1 286 ? 69.629  61.216 5.586   1.00 18.57 ? 286  LEU A CA    1 
ATOM   2016 C C     . LEU A 1 286 ? 69.938  61.911 6.894   1.00 9.08  ? 286  LEU A C     1 
ATOM   2017 O O     . LEU A 1 286 ? 71.102  62.023 7.248   1.00 12.40 ? 286  LEU A O     1 
ATOM   2018 C CB    . LEU A 1 286 ? 70.196  59.764 5.565   1.00 14.06 ? 286  LEU A CB    1 
ATOM   2019 C CG    . LEU A 1 286 ? 69.300  58.766 6.312   1.00 21.93 ? 286  LEU A CG    1 
ATOM   2020 C CD1   . LEU A 1 286 ? 69.547  57.328 5.874   1.00 31.40 ? 286  LEU A CD1   1 
ATOM   2021 C CD2   . LEU A 1 286 ? 69.663  58.844 7.770   1.00 20.99 ? 286  LEU A CD2   1 
ATOM   2022 N N     . TRP A 1 287 ? 68.869  62.304 7.611   1.00 10.52 ? 287  TRP A N     1 
ATOM   2023 C CA    . TRP A 1 287 ? 68.968  62.951 8.929   1.00 9.31  ? 287  TRP A CA    1 
ATOM   2024 C C     . TRP A 1 287 ? 69.087  61.857 9.984   1.00 23.25 ? 287  TRP A C     1 
ATOM   2025 O O     . TRP A 1 287 ? 68.134  61.083 10.170  1.00 15.42 ? 287  TRP A O     1 
ATOM   2026 C CB    . TRP A 1 287 ? 67.766  63.856 9.271   1.00 15.35 ? 287  TRP A CB    1 
ATOM   2027 C CG    . TRP A 1 287 ? 67.587  65.033 8.346   1.00 20.21 ? 287  TRP A CG    1 
ATOM   2028 C CD1   . TRP A 1 287 ? 66.570  65.190 7.439   1.00 20.10 ? 287  TRP A CD1   1 
ATOM   2029 C CD2   . TRP A 1 287 ? 68.375  66.236 8.270   1.00 13.61 ? 287  TRP A CD2   1 
ATOM   2030 N NE1   . TRP A 1 287 ? 66.716  66.375 6.760   1.00 17.29 ? 287  TRP A NE1   1 
ATOM   2031 C CE2   . TRP A 1 287 ? 67.808  67.047 7.269   1.00 13.73 ? 287  TRP A CE2   1 
ATOM   2032 C CE3   . TRP A 1 287 ? 69.495  66.699 8.971   1.00 15.82 ? 287  TRP A CE3   1 
ATOM   2033 C CZ2   . TRP A 1 287 ? 68.351  68.274 6.927   1.00 11.21 ? 287  TRP A CZ2   1 
ATOM   2034 C CZ3   . TRP A 1 287 ? 70.037  67.942 8.658   1.00 14.25 ? 287  TRP A CZ3   1 
ATOM   2035 C CH2   . TRP A 1 287 ? 69.441  68.693 7.628   1.00 17.34 ? 287  TRP A CH2   1 
ATOM   2036 N N     . ALA A 1 288 ? 70.212  61.816 10.692  1.00 10.87 ? 288  ALA A N     1 
ATOM   2037 C CA    . ALA A 1 288 ? 70.448  60.834 11.741  1.00 13.13 ? 288  ALA A CA    1 
ATOM   2038 C C     . ALA A 1 288 ? 70.930  61.564 12.972  1.00 11.97 ? 288  ALA A C     1 
ATOM   2039 O O     . ALA A 1 288 ? 72.045  61.317 13.494  1.00 11.54 ? 288  ALA A O     1 
ATOM   2040 C CB    . ALA A 1 288 ? 71.431  59.768 11.294  1.00 9.05  ? 288  ALA A CB    1 
ATOM   2041 N N     . ILE A 1 289 ? 70.036  62.442 13.417  1.00 11.22 ? 289  ILE A N     1 
ATOM   2042 C CA    . ILE A 1 289 ? 70.309  63.364 14.503  1.00 11.51 ? 289  ILE A CA    1 
ATOM   2043 C C     . ILE A 1 289 ? 69.623  63.094 15.848  1.00 17.23 ? 289  ILE A C     1 
ATOM   2044 O O     . ILE A 1 289 ? 69.699  63.935 16.720  1.00 20.79 ? 289  ILE A O     1 
ATOM   2045 C CB    . ILE A 1 289 ? 70.107  64.803 14.022  1.00 15.28 ? 289  ILE A CB    1 
ATOM   2046 C CG1   . ILE A 1 289 ? 68.636  65.073 13.687  1.00 18.59 ? 289  ILE A CG1   1 
ATOM   2047 C CG2   . ILE A 1 289 ? 70.991  65.012 12.799  1.00 15.82 ? 289  ILE A CG2   1 
ATOM   2048 C CD1   . ILE A 1 289 ? 68.328  66.553 13.468  1.00 23.20 ? 289  ILE A CD1   1 
ATOM   2049 N N     . GLY A 1 290 ? 69.065  61.903 16.098  1.00 18.50 ? 290  GLY A N     1 
ATOM   2050 C CA    . GLY A 1 290 ? 68.466  61.566 17.386  1.00 10.78 ? 290  GLY A CA    1 
ATOM   2051 C C     . GLY A 1 290 ? 66.992  61.195 17.219  1.00 16.44 ? 290  GLY A C     1 
ATOM   2052 O O     . GLY A 1 290 ? 66.451  61.096 16.101  1.00 17.15 ? 290  GLY A O     1 
ATOM   2053 N N     . ARG A 1 291 ? 66.330  60.953 18.340  1.00 13.40 ? 291  ARG A N     1 
ATOM   2054 C CA    . ARG A 1 291 ? 64.939  60.555 18.293  1.00 19.07 ? 291  ARG A CA    1 
ATOM   2055 C C     . ARG A 1 291 ? 64.171  61.372 19.303  1.00 18.28 ? 291  ARG A C     1 
ATOM   2056 O O     . ARG A 1 291 ? 64.700  61.738 20.351  1.00 18.55 ? 291  ARG A O     1 
ATOM   2057 C CB    . ARG A 1 291 ? 64.720  59.094 18.642  1.00 22.85 ? 291  ARG A CB    1 
ATOM   2058 C CG    . ARG A 1 291 ? 65.787  58.179 18.082  1.00 21.82 ? 291  ARG A CG    1 
ATOM   2059 C CD    . ARG A 1 291 ? 65.210  57.328 16.986  1.00 18.98 ? 291  ARG A CD    1 
ATOM   2060 N NE    . ARG A 1 291 ? 64.030  56.607 17.470  1.00 16.69 ? 291  ARG A NE    1 
ATOM   2061 C CZ    . ARG A 1 291 ? 63.133  56.067 16.653  1.00 18.96 ? 291  ARG A CZ    1 
ATOM   2062 N NH1   . ARG A 1 291 ? 63.301  56.200 15.329  1.00 14.92 ? 291  ARG A NH1   1 
ATOM   2063 N NH2   . ARG A 1 291 ? 62.087  55.361 17.103  1.00 20.64 ? 291  ARG A NH2   1 
ATOM   2064 N N     . VAL A 1 292 ? 62.881  61.539 19.037  1.00 17.48 ? 292  VAL A N     1 
ATOM   2065 C CA    . VAL A 1 292 ? 62.040  62.265 19.955  1.00 26.30 ? 292  VAL A CA    1 
ATOM   2066 C C     . VAL A 1 292 ? 60.982  61.314 20.544  1.00 27.08 ? 292  VAL A C     1 
ATOM   2067 O O     . VAL A 1 292 ? 60.520  60.392 19.857  1.00 19.98 ? 292  VAL A O     1 
ATOM   2068 C CB    . VAL A 1 292 ? 61.425  63.431 19.200  1.00 26.45 ? 292  VAL A CB    1 
ATOM   2069 C CG1   . VAL A 1 292 ? 60.944  62.923 17.853  1.00 29.17 ? 292  VAL A CG1   1 
ATOM   2070 C CG2   . VAL A 1 292 ? 60.230  63.943 19.978  1.00 41.71 ? 292  VAL A CG2   1 
ATOM   2071 N N     . PRO A 1 293 ? 60.570  61.511 21.805  1.00 15.96 ? 293  PRO A N     1 
ATOM   2072 C CA    . PRO A 1 293 ? 59.627  60.577 22.416  1.00 17.49 ? 293  PRO A CA    1 
ATOM   2073 C C     . PRO A 1 293 ? 58.256  60.760 21.805  1.00 17.09 ? 293  PRO A C     1 
ATOM   2074 O O     . PRO A 1 293 ? 57.864  61.816 21.328  1.00 17.88 ? 293  PRO A O     1 
ATOM   2075 C CB    . PRO A 1 293 ? 59.576  60.879 23.914  1.00 19.50 ? 293  PRO A CB    1 
ATOM   2076 C CG    . PRO A 1 293 ? 60.284  62.219 24.087  1.00 21.56 ? 293  PRO A CG    1 
ATOM   2077 C CD    . PRO A 1 293 ? 60.965  62.561 22.770  1.00 14.19 ? 293  PRO A CD    1 
ATOM   2078 N N     . ASN A 1 294 ? 57.474  59.701 21.825  1.00 15.36 ? 294  ASN A N     1 
ATOM   2079 C CA    . ASN A 1 294 ? 56.171  59.770 21.215  1.00 8.27  ? 294  ASN A CA    1 
ATOM   2080 C C     . ASN A 1 294 ? 55.138  59.949 22.337  1.00 22.75 ? 294  ASN A C     1 
ATOM   2081 O O     . ASN A 1 294 ? 54.533  58.985 22.825  1.00 22.49 ? 294  ASN A O     1 
ATOM   2082 C CB    . ASN A 1 294 ? 56.020  58.398 20.587  1.00 16.31 ? 294  ASN A CB    1 
ATOM   2083 C CG    . ASN A 1 294 ? 55.340  58.448 19.284  1.00 25.80 ? 294  ASN A CG    1 
ATOM   2084 O OD1   . ASN A 1 294 ? 54.344  59.175 19.129  1.00 40.17 ? 294  ASN A OD1   1 
ATOM   2085 N ND2   . ASN A 1 294 ? 55.770  57.539 18.428  1.00 34.45 ? 294  ASN A ND2   1 
ATOM   2086 N N     . THR A 1 295 ? 54.959  61.175 22.818  1.00 18.21 ? 295  THR A N     1 
ATOM   2087 C CA    . THR A 1 295 ? 54.073  61.408 23.962  1.00 18.00 ? 295  THR A CA    1 
ATOM   2088 C C     . THR A 1 295 ? 53.105  62.559 23.655  1.00 21.16 ? 295  THR A C     1 
ATOM   2089 O O     . THR A 1 295 ? 52.137  62.885 24.366  1.00 28.14 ? 295  THR A O     1 
ATOM   2090 C CB    . THR A 1 295 ? 54.934  61.753 25.193  1.00 20.35 ? 295  THR A CB    1 
ATOM   2091 O OG1   . THR A 1 295 ? 55.762  62.872 24.858  1.00 23.72 ? 295  THR A OG1   1 
ATOM   2092 C CG2   . THR A 1 295 ? 55.742  60.543 25.688  1.00 11.88 ? 295  THR A CG2   1 
ATOM   2093 N N     . LYS A 1 296 ? 53.413  63.184 22.550  1.00 27.73 ? 296  LYS A N     1 
ATOM   2094 C CA    . LYS A 1 296 ? 52.712  64.334 22.052  1.00 39.73 ? 296  LYS A CA    1 
ATOM   2095 C C     . LYS A 1 296 ? 51.202  64.150 22.052  1.00 47.15 ? 296  LYS A C     1 
ATOM   2096 O O     . LYS A 1 296 ? 50.497  65.014 22.576  1.00 42.22 ? 296  LYS A O     1 
ATOM   2097 C CB    . LYS A 1 296 ? 53.219  64.626 20.654  1.00 52.62 ? 296  LYS A CB    1 
ATOM   2098 C CG    . LYS A 1 296 ? 53.077  66.083 20.290  1.00 62.36 ? 296  LYS A CG    1 
ATOM   2099 C CD    . LYS A 1 296 ? 51.857  66.321 19.399  1.00 67.82 ? 296  LYS A CD    1 
ATOM   2100 C CE    . LYS A 1 296 ? 52.129  67.127 18.128  1.00 68.21 ? 296  LYS A CE    1 
ATOM   2101 N NZ    . LYS A 1 296 ? 53.411  67.875 18.132  1.00 78.16 ? 296  LYS A NZ    1 
ATOM   2102 N N     . ASP A 1 297 ? 50.707  63.050 21.472  1.00 39.29 ? 297  ASP A N     1 
ATOM   2103 C CA    . ASP A 1 297 ? 49.271  62.870 21.339  1.00 35.34 ? 297  ASP A CA    1 
ATOM   2104 C C     . ASP A 1 297 ? 48.611  61.982 22.394  1.00 27.43 ? 297  ASP A C     1 
ATOM   2105 O O     . ASP A 1 297 ? 47.532  61.461 22.159  1.00 29.95 ? 297  ASP A O     1 
ATOM   2106 C CB    . ASP A 1 297 ? 48.938  62.397 19.922  1.00 33.85 ? 297  ASP A CB    1 
ATOM   2107 C CG    . ASP A 1 297 ? 49.095  63.527 18.951  1.00 47.01 ? 297  ASP A CG    1 
ATOM   2108 O OD1   . ASP A 1 297 ? 48.456  64.564 19.031  1.00 53.99 ? 297  ASP A OD1   1 
ATOM   2109 O OD2   . ASP A 1 297 ? 50.079  63.338 18.100  1.00 52.00 ? 297  ASP A OD2   1 
ATOM   2110 N N     . LEU A 1 298 ? 49.220  61.836 23.563  1.00 28.39 ? 298  LEU A N     1 
ATOM   2111 C CA    . LEU A 1 298 ? 48.736  60.962 24.627  1.00 28.41 ? 298  LEU A CA    1 
ATOM   2112 C C     . LEU A 1 298 ? 47.741  61.661 25.580  1.00 25.66 ? 298  LEU A C     1 
ATOM   2113 O O     . LEU A 1 298 ? 47.001  61.002 26.330  1.00 32.12 ? 298  LEU A O     1 
ATOM   2114 C CB    . LEU A 1 298 ? 49.948  60.434 25.441  1.00 21.44 ? 298  LEU A CB    1 
ATOM   2115 C CG    . LEU A 1 298 ? 50.619  59.205 24.865  1.00 28.00 ? 298  LEU A CG    1 
ATOM   2116 C CD1   . LEU A 1 298 ? 51.746  58.792 25.803  1.00 24.29 ? 298  LEU A CD1   1 
ATOM   2117 C CD2   . LEU A 1 298 ? 49.596  58.077 24.832  1.00 28.34 ? 298  LEU A CD2   1 
ATOM   2118 N N     . SER A 1 299 ? 47.737  62.990 25.583  1.00 22.23 ? 299  SER A N     1 
ATOM   2119 C CA    . SER A 1 299 ? 46.925  63.764 26.514  1.00 24.29 ? 299  SER A CA    1 
ATOM   2120 C C     . SER A 1 299 ? 47.414  63.573 27.938  1.00 26.42 ? 299  SER A C     1 
ATOM   2121 O O     . SER A 1 299 ? 46.613  63.511 28.862  1.00 24.00 ? 299  SER A O     1 
ATOM   2122 C CB    . SER A 1 299 ? 45.428  63.499 26.452  1.00 22.65 ? 299  SER A CB    1 
ATOM   2123 O OG    . SER A 1 299 ? 44.948  63.865 25.177  1.00 35.59 ? 299  SER A OG    1 
ATOM   2124 N N     . LEU A 1 300 ? 48.725  63.523 28.127  1.00 24.09 ? 300  LEU A N     1 
ATOM   2125 C CA    . LEU A 1 300 ? 49.338  63.281 29.426  1.00 26.73 ? 300  LEU A CA    1 
ATOM   2126 C C     . LEU A 1 300 ? 48.923  64.314 30.429  1.00 27.29 ? 300  LEU A C     1 
ATOM   2127 O O     . LEU A 1 300 ? 48.787  64.031 31.620  1.00 25.98 ? 300  LEU A O     1 
ATOM   2128 C CB    . LEU A 1 300 ? 50.874  63.304 29.356  1.00 16.40 ? 300  LEU A CB    1 
ATOM   2129 C CG    . LEU A 1 300 ? 51.412  62.157 28.518  1.00 22.46 ? 300  LEU A CG    1 
ATOM   2130 C CD1   . LEU A 1 300 ? 52.915  62.331 28.357  1.00 24.65 ? 300  LEU A CD1   1 
ATOM   2131 C CD2   . LEU A 1 300 ? 51.057  60.823 29.211  1.00 18.85 ? 300  LEU A CD2   1 
ATOM   2132 N N     . ASN A 1 301 ? 48.823  65.532 29.941  1.00 24.52 ? 301  ASN A N     1 
ATOM   2133 C CA    . ASN A 1 301 ? 48.530  66.670 30.777  1.00 34.57 ? 301  ASN A CA    1 
ATOM   2134 C C     . ASN A 1 301 ? 47.166  66.539 31.427  1.00 36.20 ? 301  ASN A C     1 
ATOM   2135 O O     . ASN A 1 301 ? 46.919  67.229 32.398  1.00 40.68 ? 301  ASN A O     1 
ATOM   2136 C CB    . ASN A 1 301 ? 48.573  67.936 29.916  1.00 34.42 ? 301  ASN A CB    1 
ATOM   2137 C CG    . ASN A 1 301 ? 47.651  67.753 28.726  1.00 50.43 ? 301  ASN A CG    1 
ATOM   2138 O OD1   . ASN A 1 301 ? 48.075  67.330 27.629  1.00 69.09 ? 301  ASN A OD1   1 
ATOM   2139 N ND2   . ASN A 1 301 ? 46.354  67.840 28.989  1.00 50.51 ? 301  ASN A ND2   1 
ATOM   2140 N N     . LYS A 1 302 ? 46.267  65.700 30.890  1.00 33.46 ? 302  LYS A N     1 
ATOM   2141 C CA    . LYS A 1 302 ? 44.944  65.526 31.496  1.00 26.65 ? 302  LYS A CA    1 
ATOM   2142 C C     . LYS A 1 302 ? 45.057  64.798 32.820  1.00 30.31 ? 302  LYS A C     1 
ATOM   2143 O O     . LYS A 1 302 ? 44.112  64.783 33.605  1.00 39.75 ? 302  LYS A O     1 
ATOM   2144 C CB    . LYS A 1 302 ? 43.991  64.730 30.644  1.00 27.80 ? 302  LYS A CB    1 
ATOM   2145 C CG    . LYS A 1 302 ? 43.415  65.481 29.460  1.00 26.51 ? 302  LYS A CG    1 
ATOM   2146 C CD    . LYS A 1 302 ? 42.595  64.498 28.647  1.00 36.93 ? 302  LYS A CD    1 
ATOM   2147 C CE    . LYS A 1 302 ? 42.026  65.045 27.356  1.00 45.49 ? 302  LYS A CE    1 
ATOM   2148 N NZ    . LYS A 1 302 ? 40.893  65.951 27.586  1.00 55.43 ? 302  LYS A NZ    1 
ATOM   2149 N N     . LEU A 1 303 ? 46.193  64.137 33.033  1.00 30.06 ? 303  LEU A N     1 
ATOM   2150 C CA    . LEU A 1 303 ? 46.455  63.431 34.283  1.00 28.42 ? 303  LEU A CA    1 
ATOM   2151 C C     . LEU A 1 303 ? 47.598  64.104 35.040  1.00 28.21 ? 303  LEU A C     1 
ATOM   2152 O O     . LEU A 1 303 ? 47.937  63.733 36.160  1.00 28.33 ? 303  LEU A O     1 
ATOM   2153 C CB    . LEU A 1 303 ? 46.697  61.904 34.088  1.00 35.15 ? 303  LEU A CB    1 
ATOM   2154 C CG    . LEU A 1 303 ? 45.418  61.109 33.765  1.00 35.72 ? 303  LEU A CG    1 
ATOM   2155 C CD1   . LEU A 1 303 ? 45.751  59.683 33.335  1.00 31.81 ? 303  LEU A CD1   1 
ATOM   2156 C CD2   . LEU A 1 303 ? 44.539  61.049 35.009  1.00 31.26 ? 303  LEU A CD2   1 
ATOM   2157 N N     . GLY A 1 304 ? 48.237  65.083 34.393  1.00 24.27 ? 304  GLY A N     1 
ATOM   2158 C CA    . GLY A 1 304 ? 49.360  65.788 35.005  1.00 19.09 ? 304  GLY A CA    1 
ATOM   2159 C C     . GLY A 1 304 ? 50.570  64.893 35.085  1.00 17.38 ? 304  GLY A C     1 
ATOM   2160 O O     . GLY A 1 304 ? 51.318  64.970 36.033  1.00 25.32 ? 304  GLY A O     1 
ATOM   2161 N N     . ILE A 1 305 ? 50.764  64.012 34.113  1.00 18.01 ? 305  ILE A N     1 
ATOM   2162 C CA    . ILE A 1 305 ? 51.930  63.145 34.135  1.00 24.42 ? 305  ILE A CA    1 
ATOM   2163 C C     . ILE A 1 305 ? 53.145  64.003 33.746  1.00 14.23 ? 305  ILE A C     1 
ATOM   2164 O O     . ILE A 1 305 ? 53.076  64.757 32.779  1.00 20.21 ? 305  ILE A O     1 
ATOM   2165 C CB    . ILE A 1 305 ? 51.695  61.997 33.153  1.00 20.23 ? 305  ILE A CB    1 
ATOM   2166 C CG1   . ILE A 1 305 ? 50.588  61.131 33.734  1.00 18.23 ? 305  ILE A CG1   1 
ATOM   2167 C CG2   . ILE A 1 305 ? 52.968  61.191 32.915  1.00 18.36 ? 305  ILE A CG2   1 
ATOM   2168 C CD1   . ILE A 1 305 ? 49.751  60.485 32.642  1.00 22.13 ? 305  ILE A CD1   1 
ATOM   2169 N N     . GLN A 1 306 ? 54.240  63.878 34.484  1.00 13.45 ? 306  GLN A N     1 
ATOM   2170 C CA    . GLN A 1 306 ? 55.454  64.698 34.280  1.00 15.73 ? 306  GLN A CA    1 
ATOM   2171 C C     . GLN A 1 306 ? 56.267  64.232 33.069  1.00 22.12 ? 306  GLN A C     1 
ATOM   2172 O O     . GLN A 1 306 ? 56.571  63.030 32.913  1.00 17.35 ? 306  GLN A O     1 
ATOM   2173 C CB    . GLN A 1 306 ? 56.394  64.508 35.480  1.00 22.54 ? 306  GLN A CB    1 
ATOM   2174 C CG    . GLN A 1 306 ? 56.275  65.532 36.604  1.00 29.14 ? 306  GLN A CG    1 
ATOM   2175 C CD    . GLN A 1 306 ? 57.435  65.368 37.581  1.00 31.20 ? 306  GLN A CD    1 
ATOM   2176 O OE1   . GLN A 1 306 ? 57.270  64.757 38.652  1.00 29.29 ? 306  GLN A OE1   1 
ATOM   2177 N NE2   . GLN A 1 306 ? 58.646  65.748 37.150  1.00 29.96 ? 306  GLN A NE2   1 
ATOM   2178 N N     . THR A 1 307 ? 56.737  65.195 32.277  1.00 18.04 ? 307  THR A N     1 
ATOM   2179 C CA    . THR A 1 307 ? 57.619  64.917 31.153  1.00 15.72 ? 307  THR A CA    1 
ATOM   2180 C C     . THR A 1 307 ? 58.772  65.938 31.234  1.00 22.97 ? 307  THR A C     1 
ATOM   2181 O O     . THR A 1 307 ? 58.674  66.927 31.965  1.00 20.53 ? 307  THR A O     1 
ATOM   2182 C CB    . THR A 1 307 ? 56.888  65.077 29.814  1.00 28.19 ? 307  THR A CB    1 
ATOM   2183 O OG1   . THR A 1 307 ? 56.338  66.371 29.811  1.00 27.26 ? 307  THR A OG1   1 
ATOM   2184 C CG2   . THR A 1 307 ? 55.743  64.057 29.628  1.00 14.73 ? 307  THR A CG2   1 
ATOM   2185 N N     . ASP A 1 308 ? 59.894  65.691 30.561  1.00 20.86 ? 308  ASP A N     1 
ATOM   2186 C CA    . ASP A 1 308 ? 60.969  66.665 30.586  1.00 23.56 ? 308  ASP A CA    1 
ATOM   2187 C C     . ASP A 1 308 ? 60.653  67.636 29.481  1.00 23.35 ? 308  ASP A C     1 
ATOM   2188 O O     . ASP A 1 308 ? 59.595  67.562 28.837  1.00 16.32 ? 308  ASP A O     1 
ATOM   2189 C CB    . ASP A 1 308 ? 62.386  66.065 30.411  1.00 13.47 ? 308  ASP A CB    1 
ATOM   2190 C CG    . ASP A 1 308 ? 62.538  65.380 29.080  1.00 14.38 ? 308  ASP A CG    1 
ATOM   2191 O OD1   . ASP A 1 308 ? 61.686  65.373 28.230  1.00 20.67 ? 308  ASP A OD1   1 
ATOM   2192 O OD2   . ASP A 1 308 ? 63.570  64.631 29.006  1.00 21.83 ? 308  ASP A OD2   1 
ATOM   2193 N N     . ASP A 1 309 ? 61.586  68.513 29.165  1.00 29.89 ? 309  ASP A N     1 
ATOM   2194 C CA    . ASP A 1 309 ? 61.238  69.423 28.089  1.00 31.43 ? 309  ASP A CA    1 
ATOM   2195 C C     . ASP A 1 309 ? 61.347  68.830 26.686  1.00 27.54 ? 309  ASP A C     1 
ATOM   2196 O O     . ASP A 1 309 ? 60.929  69.484 25.741  1.00 41.46 ? 309  ASP A O     1 
ATOM   2197 C CB    . ASP A 1 309 ? 61.844  70.825 28.202  1.00 40.06 ? 309  ASP A CB    1 
ATOM   2198 C CG    . ASP A 1 309 ? 63.340  70.762 28.139  1.00 51.43 ? 309  ASP A CG    1 
ATOM   2199 O OD1   . ASP A 1 309 ? 63.973  69.719 27.977  1.00 49.15 ? 309  ASP A OD1   1 
ATOM   2200 O OD2   . ASP A 1 309 ? 63.880  71.933 28.396  1.00 70.47 ? 309  ASP A OD2   1 
ATOM   2201 N N     . LYS A 1 310 ? 61.879  67.611 26.525  1.00 25.20 ? 310  LYS A N     1 
ATOM   2202 C CA    . LYS A 1 310 ? 61.872  66.998 25.200  1.00 25.87 ? 310  LYS A CA    1 
ATOM   2203 C C     . LYS A 1 310 ? 60.593  66.181 25.011  1.00 21.18 ? 310  LYS A C     1 
ATOM   2204 O O     . LYS A 1 310 ? 60.331  65.677 23.938  1.00 26.66 ? 310  LYS A O     1 
ATOM   2205 C CB    . LYS A 1 310 ? 63.074  66.138 24.876  1.00 30.84 ? 310  LYS A CB    1 
ATOM   2206 C CG    . LYS A 1 310 ? 64.384  66.732 25.368  1.00 46.98 ? 310  LYS A CG    1 
ATOM   2207 C CD    . LYS A 1 310 ? 64.650  68.088 24.765  1.00 48.94 ? 310  LYS A CD    1 
ATOM   2208 C CE    . LYS A 1 310 ? 65.987  68.167 24.038  1.00 62.31 ? 310  LYS A CE    1 
ATOM   2209 N NZ    . LYS A 1 310 ? 66.145  69.405 23.242  1.00 67.35 ? 310  LYS A NZ    1 
ATOM   2210 N N     . GLY A 1 311 ? 59.779  66.047 26.048  1.00 13.23 ? 311  GLY A N     1 
ATOM   2211 C CA    . GLY A 1 311 ? 58.575  65.256 25.928  1.00 11.71 ? 311  GLY A CA    1 
ATOM   2212 C C     . GLY A 1 311 ? 58.777  63.872 26.528  1.00 15.70 ? 311  GLY A C     1 
ATOM   2213 O O     . GLY A 1 311 ? 57.903  63.036 26.369  1.00 22.79 ? 311  GLY A O     1 
ATOM   2214 N N     . HIS A 1 312 ? 59.932  63.579 27.137  1.00 16.17 ? 312  HIS A N     1 
ATOM   2215 C CA    . HIS A 1 312 ? 60.120  62.257 27.730  1.00 13.63 ? 312  HIS A CA    1 
ATOM   2216 C C     . HIS A 1 312 ? 59.303  62.117 28.999  1.00 21.08 ? 312  HIS A C     1 
ATOM   2217 O O     . HIS A 1 312 ? 59.201  63.042 29.779  1.00 21.70 ? 312  HIS A O     1 
ATOM   2218 C CB    . HIS A 1 312 ? 61.581  61.940 28.149  1.00 18.69 ? 312  HIS A CB    1 
ATOM   2219 C CG    . HIS A 1 312 ? 62.517  61.855 26.995  1.00 15.54 ? 312  HIS A CG    1 
ATOM   2220 N ND1   . HIS A 1 312 ? 63.493  62.827 26.775  1.00 18.97 ? 312  HIS A ND1   1 
ATOM   2221 C CD2   . HIS A 1 312 ? 62.560  60.944 25.990  1.00 20.22 ? 312  HIS A CD2   1 
ATOM   2222 C CE1   . HIS A 1 312 ? 64.125  62.462 25.647  1.00 13.83 ? 312  HIS A CE1   1 
ATOM   2223 N NE2   . HIS A 1 312 ? 63.573  61.353 25.142  1.00 24.44 ? 312  HIS A NE2   1 
ATOM   2224 N N     . ILE A 1 313 ? 58.831  60.912 29.264  1.00 14.11 ? 313  ILE A N     1 
ATOM   2225 C CA    . ILE A 1 313 ? 58.131  60.682 30.502  1.00 11.84 ? 313  ILE A CA    1 
ATOM   2226 C C     . ILE A 1 313 ? 59.133  60.437 31.615  1.00 9.82  ? 313  ILE A C     1 
ATOM   2227 O O     . ILE A 1 313 ? 60.102  59.691 31.453  1.00 15.56 ? 313  ILE A O     1 
ATOM   2228 C CB    . ILE A 1 313 ? 57.132  59.543 30.357  1.00 11.91 ? 313  ILE A CB    1 
ATOM   2229 C CG1   . ILE A 1 313 ? 56.038  60.046 29.443  1.00 16.73 ? 313  ILE A CG1   1 
ATOM   2230 C CG2   . ILE A 1 313 ? 56.539  59.185 31.733  1.00 10.65 ? 313  ILE A CG2   1 
ATOM   2231 C CD1   . ILE A 1 313 ? 55.208  58.909 28.844  1.00 17.03 ? 313  ILE A CD1   1 
ATOM   2232 N N     . ILE A 1 314 ? 58.952  61.120 32.750  1.00 13.97 ? 314  ILE A N     1 
ATOM   2233 C CA    . ILE A 1 314 ? 59.843  60.995 33.905  1.00 9.54  ? 314  ILE A CA    1 
ATOM   2234 C C     . ILE A 1 314 ? 59.458  59.764 34.753  1.00 14.41 ? 314  ILE A C     1 
ATOM   2235 O O     . ILE A 1 314 ? 58.301  59.605 35.145  1.00 18.15 ? 314  ILE A O     1 
ATOM   2236 C CB    . ILE A 1 314 ? 59.779  62.281 34.764  1.00 9.76  ? 314  ILE A CB    1 
ATOM   2237 C CG1   . ILE A 1 314 ? 59.976  63.548 33.914  1.00 16.24 ? 314  ILE A CG1   1 
ATOM   2238 C CG2   . ILE A 1 314 ? 60.833  62.236 35.861  1.00 18.53 ? 314  ILE A CG2   1 
ATOM   2239 C CD1   . ILE A 1 314 ? 61.304  63.585 33.157  1.00 16.82 ? 314  ILE A CD1   1 
ATOM   2240 N N     . VAL A 1 315 ? 60.417  58.907 35.125  1.00 8.78  ? 315  VAL A N     1 
ATOM   2241 C CA    . VAL A 1 315 ? 60.072  57.759 35.940  1.00 10.64 ? 315  VAL A CA    1 
ATOM   2242 C C     . VAL A 1 315 ? 61.119  57.644 37.012  1.00 21.06 ? 315  VAL A C     1 
ATOM   2243 O O     . VAL A 1 315 ? 62.194  58.242 36.897  1.00 18.10 ? 315  VAL A O     1 
ATOM   2244 C CB    . VAL A 1 315 ? 60.096  56.457 35.145  1.00 12.47 ? 315  VAL A CB    1 
ATOM   2245 C CG1   . VAL A 1 315 ? 59.025  56.457 34.072  1.00 14.75 ? 315  VAL A CG1   1 
ATOM   2246 C CG2   . VAL A 1 315 ? 61.458  56.285 34.483  1.00 9.12  ? 315  VAL A CG2   1 
ATOM   2247 N N     . ASP A 1 316 ? 60.811  56.871 38.033  1.00 13.64 ? 316  ASP A N     1 
ATOM   2248 C CA    . ASP A 1 316 ? 61.769  56.558 39.075  1.00 14.35 ? 316  ASP A CA    1 
ATOM   2249 C C     . ASP A 1 316 ? 62.494  55.257 38.710  1.00 15.75 ? 316  ASP A C     1 
ATOM   2250 O O     . ASP A 1 316 ? 62.352  54.775 37.589  1.00 17.74 ? 316  ASP A O     1 
ATOM   2251 C CB    . ASP A 1 316 ? 61.195  56.550 40.531  1.00 12.75 ? 316  ASP A CB    1 
ATOM   2252 C CG    . ASP A 1 316 ? 60.151  55.480 40.801  1.00 15.94 ? 316  ASP A CG    1 
ATOM   2253 O OD1   . ASP A 1 316 ? 60.173  54.522 39.929  1.00 18.81 ? 316  ASP A OD1   1 
ATOM   2254 O OD2   . ASP A 1 316 ? 59.461  55.455 41.791  1.00 19.34 ? 316  ASP A OD2   1 
ATOM   2255 N N     . GLU A 1 317 ? 63.265  54.708 39.678  1.00 10.31 ? 317  GLU A N     1 
ATOM   2256 C CA    . GLU A 1 317 ? 64.099  53.521 39.492  1.00 16.73 ? 317  GLU A CA    1 
ATOM   2257 C C     . GLU A 1 317 ? 63.255  52.255 39.274  1.00 13.07 ? 317  GLU A C     1 
ATOM   2258 O O     . GLU A 1 317 ? 63.735  51.240 38.767  1.00 17.86 ? 317  GLU A O     1 
ATOM   2259 C CB    . GLU A 1 317 ? 65.162  53.348 40.615  1.00 11.74 ? 317  GLU A CB    1 
ATOM   2260 C CG    . GLU A 1 317 ? 64.511  52.857 41.925  1.00 27.63 ? 317  GLU A CG    1 
ATOM   2261 C CD    . GLU A 1 317 ? 64.980  53.556 43.180  1.00 59.80 ? 317  GLU A CD    1 
ATOM   2262 O OE1   . GLU A 1 317 ? 66.179  53.159 43.574  1.00 67.59 ? 317  GLU A OE1   1 
ATOM   2263 O OE2   . GLU A 1 317 ? 64.269  54.318 43.824  1.00 61.48 ? 317  GLU A OE2   1 
ATOM   2264 N N     . PHE A 1 318 ? 61.972  52.376 39.597  1.00 14.94 ? 318  PHE A N     1 
ATOM   2265 C CA    . PHE A 1 318 ? 61.008  51.283 39.424  1.00 11.86 ? 318  PHE A CA    1 
ATOM   2266 C C     . PHE A 1 318 ? 60.092  51.517 38.226  1.00 17.11 ? 318  PHE A C     1 
ATOM   2267 O O     . PHE A 1 318 ? 59.082  50.842 38.074  1.00 13.43 ? 318  PHE A O     1 
ATOM   2268 C CB    . PHE A 1 318 ? 60.129  51.160 40.677  1.00 16.48 ? 318  PHE A CB    1 
ATOM   2269 C CG    . PHE A 1 318 ? 60.926  50.771 41.884  1.00 19.12 ? 318  PHE A CG    1 
ATOM   2270 C CD1   . PHE A 1 318 ? 61.391  49.465 42.041  1.00 19.39 ? 318  PHE A CD1   1 
ATOM   2271 C CD2   . PHE A 1 318 ? 61.254  51.730 42.850  1.00 18.76 ? 318  PHE A CD2   1 
ATOM   2272 C CE1   . PHE A 1 318 ? 62.111  49.083 43.176  1.00 21.87 ? 318  PHE A CE1   1 
ATOM   2273 C CE2   . PHE A 1 318 ? 62.007  51.362 43.961  1.00 21.36 ? 318  PHE A CE2   1 
ATOM   2274 C CZ    . PHE A 1 318 ? 62.439  50.050 44.117  1.00 18.51 ? 318  PHE A CZ    1 
ATOM   2275 N N     . GLN A 1 319 ? 60.370  52.546 37.422  1.00 15.64 ? 319  GLN A N     1 
ATOM   2276 C CA    . GLN A 1 319 ? 59.559  52.829 36.242  1.00 14.66 ? 319  GLN A CA    1 
ATOM   2277 C C     . GLN A 1 319 ? 58.234  53.475 36.593  1.00 13.32 ? 319  GLN A C     1 
ATOM   2278 O O     . GLN A 1 319 ? 57.345  53.601 35.737  1.00 13.98 ? 319  GLN A O     1 
ATOM   2279 C CB    . GLN A 1 319 ? 59.369  51.603 35.317  1.00 12.60 ? 319  GLN A CB    1 
ATOM   2280 C CG    . GLN A 1 319 ? 60.686  50.821 35.002  1.00 14.66 ? 319  GLN A CG    1 
ATOM   2281 C CD    . GLN A 1 319 ? 61.756  51.541 34.172  1.00 9.32  ? 319  GLN A CD    1 
ATOM   2282 O OE1   . GLN A 1 319 ? 62.956  51.294 34.345  1.00 20.65 ? 319  GLN A OE1   1 
ATOM   2283 N NE2   . GLN A 1 319 ? 61.329  52.513 33.371  1.00 8.34  ? 319  GLN A NE2   1 
ATOM   2284 N N     . ASN A 1 320 ? 58.093  53.946 37.840  1.00 12.92 ? 320  ASN A N     1 
ATOM   2285 C CA    . ASN A 1 320 ? 56.886  54.664 38.201  1.00 11.59 ? 320  ASN A CA    1 
ATOM   2286 C C     . ASN A 1 320 ? 56.884  56.083 37.632  1.00 24.35 ? 320  ASN A C     1 
ATOM   2287 O O     . ASN A 1 320 ? 57.920  56.738 37.611  1.00 19.37 ? 320  ASN A O     1 
ATOM   2288 C CB    . ASN A 1 320 ? 56.722  54.834 39.711  1.00 9.58  ? 320  ASN A CB    1 
ATOM   2289 C CG    . ASN A 1 320 ? 56.590  53.515 40.433  1.00 5.00  ? 320  ASN A CG    1 
ATOM   2290 O OD1   . ASN A 1 320 ? 55.649  52.730 40.142  1.00 15.80 ? 320  ASN A OD1   1 
ATOM   2291 N ND2   . ASN A 1 320 ? 57.470  53.311 41.426  1.00 12.07 ? 320  ASN A ND2   1 
ATOM   2292 N N     . THR A 1 321 ? 55.720  56.580 37.205  1.00 17.62 ? 321  THR A N     1 
ATOM   2293 C CA    . THR A 1 321 ? 55.598  57.985 36.806  1.00 24.44 ? 321  THR A CA    1 
ATOM   2294 C C     . THR A 1 321 ? 55.250  58.696 38.113  1.00 14.48 ? 321  THR A C     1 
ATOM   2295 O O     . THR A 1 321 ? 55.290  58.044 39.164  1.00 17.69 ? 321  THR A O     1 
ATOM   2296 C CB    . THR A 1 321 ? 54.522  58.277 35.740  1.00 16.75 ? 321  THR A CB    1 
ATOM   2297 O OG1   . THR A 1 321 ? 53.238  58.031 36.287  1.00 18.50 ? 321  THR A OG1   1 
ATOM   2298 C CG2   . THR A 1 321 ? 54.789  57.487 34.452  1.00 14.13 ? 321  THR A CG2   1 
ATOM   2299 N N     . ASN A 1 322 ? 54.823  59.951 38.039  1.00 17.60 ? 322  ASN A N     1 
ATOM   2300 C CA    . ASN A 1 322 ? 54.478  60.704 39.252  1.00 22.76 ? 322  ASN A CA    1 
ATOM   2301 C C     . ASN A 1 322 ? 53.068  60.371 39.706  1.00 23.06 ? 322  ASN A C     1 
ATOM   2302 O O     . ASN A 1 322 ? 52.675  60.633 40.849  1.00 33.34 ? 322  ASN A O     1 
ATOM   2303 C CB    . ASN A 1 322 ? 54.627  62.236 39.094  1.00 23.93 ? 322  ASN A CB    1 
ATOM   2304 C CG    . ASN A 1 322 ? 53.824  62.787 37.938  1.00 20.16 ? 322  ASN A CG    1 
ATOM   2305 O OD1   . ASN A 1 322 ? 53.794  62.203 36.863  1.00 22.02 ? 322  ASN A OD1   1 
ATOM   2306 N ND2   . ASN A 1 322 ? 53.088  63.865 38.189  1.00 24.67 ? 322  ASN A ND2   1 
ATOM   2307 N N     . VAL A 1 323 ? 52.341  59.705 38.794  1.00 19.49 ? 323  VAL A N     1 
ATOM   2308 C CA    . VAL A 1 323 ? 50.958  59.327 39.026  1.00 13.94 ? 323  VAL A CA    1 
ATOM   2309 C C     . VAL A 1 323 ? 50.870  57.853 39.394  1.00 24.30 ? 323  VAL A C     1 
ATOM   2310 O O     . VAL A 1 323 ? 51.398  56.985 38.692  1.00 16.08 ? 323  VAL A O     1 
ATOM   2311 C CB    . VAL A 1 323 ? 50.162  59.628 37.783  1.00 14.74 ? 323  VAL A CB    1 
ATOM   2312 C CG1   . VAL A 1 323 ? 48.675  59.311 37.946  1.00 23.81 ? 323  VAL A CG1   1 
ATOM   2313 C CG2   . VAL A 1 323 ? 50.345  61.113 37.426  1.00 24.02 ? 323  VAL A CG2   1 
ATOM   2314 N N     . LYS A 1 324 ? 50.185  57.543 40.492  1.00 21.35 ? 324  LYS A N     1 
ATOM   2315 C CA    . LYS A 1 324 ? 50.003  56.169 40.937  1.00 25.58 ? 324  LYS A CA    1 
ATOM   2316 C C     . LYS A 1 324 ? 49.233  55.304 39.946  1.00 18.50 ? 324  LYS A C     1 
ATOM   2317 O O     . LYS A 1 324 ? 48.166  55.685 39.441  1.00 21.18 ? 324  LYS A O     1 
ATOM   2318 C CB    . LYS A 1 324 ? 49.401  56.104 42.335  1.00 43.70 ? 324  LYS A CB    1 
ATOM   2319 C CG    . LYS A 1 324 ? 50.480  56.353 43.391  1.00 67.51 ? 324  LYS A CG    1 
ATOM   2320 C CD    . LYS A 1 324 ? 49.986  56.403 44.835  1.00 65.41 ? 324  LYS A CD    1 
ATOM   2321 C CE    . LYS A 1 324 ? 50.891  57.223 45.759  1.00 61.63 ? 324  LYS A CE    1 
ATOM   2322 N NZ    . LYS A 1 324 ? 50.163  57.846 46.885  1.00 68.91 ? 324  LYS A NZ    1 
ATOM   2323 N N     . GLY A 1 325 ? 49.835  54.121 39.697  1.00 16.54 ? 325  GLY A N     1 
ATOM   2324 C CA    . GLY A 1 325 ? 49.273  53.109 38.797  1.00 18.33 ? 325  GLY A CA    1 
ATOM   2325 C C     . GLY A 1 325 ? 49.586  53.345 37.323  1.00 19.66 ? 325  GLY A C     1 
ATOM   2326 O O     . GLY A 1 325 ? 48.938  52.720 36.461  1.00 16.95 ? 325  GLY A O     1 
ATOM   2327 N N     . ILE A 1 326 ? 50.502  54.302 37.027  1.00 17.34 ? 326  ILE A N     1 
ATOM   2328 C CA    . ILE A 1 326 ? 50.931  54.594 35.654  1.00 13.11 ? 326  ILE A CA    1 
ATOM   2329 C C     . ILE A 1 326 ? 52.443  54.454 35.603  1.00 14.68 ? 326  ILE A C     1 
ATOM   2330 O O     . ILE A 1 326 ? 53.117  54.995 36.488  1.00 15.43 ? 326  ILE A O     1 
ATOM   2331 C CB    . ILE A 1 326 ? 50.478  55.964 35.174  1.00 14.79 ? 326  ILE A CB    1 
ATOM   2332 C CG1   . ILE A 1 326 ? 48.986  56.106 35.469  1.00 16.23 ? 326  ILE A CG1   1 
ATOM   2333 C CG2   . ILE A 1 326 ? 50.735  56.134 33.686  1.00 16.21 ? 326  ILE A CG2   1 
ATOM   2334 C CD1   . ILE A 1 326 ? 48.255  57.114 34.587  1.00 24.91 ? 326  ILE A CD1   1 
ATOM   2335 N N     . TYR A 1 327 ? 52.949  53.647 34.660  1.00 14.58 ? 327  TYR A N     1 
ATOM   2336 C CA    . TYR A 1 327 ? 54.366  53.355 34.524  1.00 20.93 ? 327  TYR A CA    1 
ATOM   2337 C C     . TYR A 1 327 ? 54.770  53.670 33.095  1.00 16.89 ? 327  TYR A C     1 
ATOM   2338 O O     . TYR A 1 327 ? 53.916  53.882 32.237  1.00 13.49 ? 327  TYR A O     1 
ATOM   2339 C CB    . TYR A 1 327 ? 54.655  51.860 34.836  1.00 9.85  ? 327  TYR A CB    1 
ATOM   2340 C CG    . TYR A 1 327 ? 53.794  51.418 35.984  1.00 14.82 ? 327  TYR A CG    1 
ATOM   2341 C CD1   . TYR A 1 327 ? 52.513  50.924 35.786  1.00 18.15 ? 327  TYR A CD1   1 
ATOM   2342 C CD2   . TYR A 1 327 ? 54.272  51.570 37.286  1.00 12.05 ? 327  TYR A CD2   1 
ATOM   2343 C CE1   . TYR A 1 327 ? 51.723  50.560 36.877  1.00 10.89 ? 327  TYR A CE1   1 
ATOM   2344 C CE2   . TYR A 1 327 ? 53.518  51.220 38.398  1.00 16.26 ? 327  TYR A CE2   1 
ATOM   2345 C CZ    . TYR A 1 327 ? 52.230  50.734 38.165  1.00 18.56 ? 327  TYR A CZ    1 
ATOM   2346 O OH    . TYR A 1 327 ? 51.471  50.412 39.232  1.00 18.64 ? 327  TYR A OH    1 
ATOM   2347 N N     . ALA A 1 328 ? 56.074  53.723 32.849  1.00 9.77  ? 328  ALA A N     1 
ATOM   2348 C CA    . ALA A 1 328 ? 56.578  53.952 31.504  1.00 11.36 ? 328  ALA A CA    1 
ATOM   2349 C C     . ALA A 1 328 ? 57.896  53.182 31.370  1.00 14.18 ? 328  ALA A C     1 
ATOM   2350 O O     . ALA A 1 328 ? 58.690  53.104 32.331  1.00 14.04 ? 328  ALA A O     1 
ATOM   2351 C CB    . ALA A 1 328 ? 56.764  55.437 31.202  1.00 9.57  ? 328  ALA A CB    1 
ATOM   2352 N N     . VAL A 1 329 ? 58.133  52.569 30.199  1.00 10.92 ? 329  VAL A N     1 
ATOM   2353 C CA    . VAL A 1 329 ? 59.400  51.886 29.980  1.00 10.26 ? 329  VAL A CA    1 
ATOM   2354 C C     . VAL A 1 329 ? 59.822  52.094 28.545  1.00 13.50 ? 329  VAL A C     1 
ATOM   2355 O O     . VAL A 1 329 ? 58.997  52.481 27.713  1.00 13.18 ? 329  VAL A O     1 
ATOM   2356 C CB    . VAL A 1 329 ? 59.409  50.377 30.223  1.00 15.24 ? 329  VAL A CB    1 
ATOM   2357 C CG1   . VAL A 1 329 ? 58.977  50.011 31.637  1.00 11.96 ? 329  VAL A CG1   1 
ATOM   2358 C CG2   . VAL A 1 329 ? 58.563  49.673 29.157  1.00 15.44 ? 329  VAL A CG2   1 
ATOM   2359 N N     . GLY A 1 330 ? 61.101  51.823 28.257  1.00 15.05 ? 330  GLY A N     1 
ATOM   2360 C CA    . GLY A 1 330 ? 61.557  51.889 26.875  1.00 13.00 ? 330  GLY A CA    1 
ATOM   2361 C C     . GLY A 1 330 ? 61.926  53.293 26.401  1.00 16.78 ? 330  GLY A C     1 
ATOM   2362 O O     . GLY A 1 330 ? 62.113  54.210 27.194  1.00 12.96 ? 330  GLY A O     1 
ATOM   2363 N N     . ASP A 1 331 ? 62.041  53.436 25.091  1.00 11.26 ? 331  ASP A N     1 
ATOM   2364 C CA    . ASP A 1 331 ? 62.511  54.665 24.475  1.00 13.38 ? 331  ASP A CA    1 
ATOM   2365 C C     . ASP A 1 331 ? 61.759  55.918 24.928  1.00 17.65 ? 331  ASP A C     1 
ATOM   2366 O O     . ASP A 1 331 ? 62.311  57.015 24.908  1.00 17.97 ? 331  ASP A O     1 
ATOM   2367 C CB    . ASP A 1 331 ? 62.449  54.574 22.938  1.00 9.67  ? 331  ASP A CB    1 
ATOM   2368 C CG    . ASP A 1 331 ? 63.491  53.725 22.248  1.00 7.49  ? 331  ASP A CG    1 
ATOM   2369 O OD1   . ASP A 1 331 ? 64.269  52.985 23.046  1.00 11.44 ? 331  ASP A OD1   1 
ATOM   2370 O OD2   . ASP A 1 331 ? 63.693  53.873 21.047  1.00 13.88 ? 331  ASP A OD2   1 
ATOM   2371 N N     . VAL A 1 332 ? 60.494  55.796 25.279  1.00 14.76 ? 332  VAL A N     1 
ATOM   2372 C CA    . VAL A 1 332 ? 59.727  56.961 25.664  1.00 14.23 ? 332  VAL A CA    1 
ATOM   2373 C C     . VAL A 1 332 ? 60.274  57.679 26.911  1.00 13.60 ? 332  VAL A C     1 
ATOM   2374 O O     . VAL A 1 332 ? 59.912  58.842 27.130  1.00 15.86 ? 332  VAL A O     1 
ATOM   2375 C CB    . VAL A 1 332 ? 58.232  56.618 25.813  1.00 12.67 ? 332  VAL A CB    1 
ATOM   2376 C CG1   . VAL A 1 332 ? 57.974  55.917 27.149  1.00 7.78  ? 332  VAL A CG1   1 
ATOM   2377 C CG2   . VAL A 1 332 ? 57.376  57.865 25.660  1.00 9.64  ? 332  VAL A CG2   1 
ATOM   2378 N N     . CYS A 1 333 ? 61.040  56.973 27.754  1.00 9.33  ? 333  CYS A N     1 
ATOM   2379 C CA    . CYS A 1 333 ? 61.650  57.491 28.981  1.00 10.24 ? 333  CYS A CA    1 
ATOM   2380 C C     . CYS A 1 333 ? 62.998  58.152 28.698  1.00 15.36 ? 333  CYS A C     1 
ATOM   2381 O O     . CYS A 1 333 ? 63.589  58.787 29.574  1.00 16.26 ? 333  CYS A O     1 
ATOM   2382 C CB    . CYS A 1 333 ? 61.845  56.408 30.061  1.00 15.89 ? 333  CYS A CB    1 
ATOM   2383 S SG    . CYS A 1 333 ? 60.216  55.776 30.570  1.00 17.94 ? 333  CYS A SG    1 
ATOM   2384 N N     . GLY A 1 334 ? 63.491  57.943 27.484  1.00 10.85 ? 334  GLY A N     1 
ATOM   2385 C CA    . GLY A 1 334 ? 64.709  58.556 26.973  1.00 19.62 ? 334  GLY A CA    1 
ATOM   2386 C C     . GLY A 1 334 ? 66.008  58.099 27.615  1.00 12.48 ? 334  GLY A C     1 
ATOM   2387 O O     . GLY A 1 334 ? 67.020  58.770 27.473  1.00 22.92 ? 334  GLY A O     1 
ATOM   2388 N N     . LYS A 1 335 ? 66.053  56.930 28.217  1.00 13.29 ? 335  LYS A N     1 
ATOM   2389 C CA    . LYS A 1 335 ? 67.285  56.481 28.797  1.00 14.54 ? 335  LYS A CA    1 
ATOM   2390 C C     . LYS A 1 335 ? 67.628  55.057 28.348  1.00 23.49 ? 335  LYS A C     1 
ATOM   2391 O O     . LYS A 1 335 ? 66.776  54.168 28.388  1.00 16.39 ? 335  LYS A O     1 
ATOM   2392 C CB    . LYS A 1 335 ? 67.340  56.725 30.296  1.00 22.13 ? 335  LYS A CB    1 
ATOM   2393 C CG    . LYS A 1 335 ? 67.103  55.511 31.153  1.00 34.49 ? 335  LYS A CG    1 
ATOM   2394 C CD    . LYS A 1 335 ? 67.959  55.511 32.425  1.00 45.22 ? 335  LYS A CD    1 
ATOM   2395 C CE    . LYS A 1 335 ? 67.155  55.294 33.703  1.00 54.63 ? 335  LYS A CE    1 
ATOM   2396 N NZ    . LYS A 1 335 ? 67.994  55.119 34.914  1.00 64.44 ? 335  LYS A NZ    1 
ATOM   2397 N N     . ALA A 1 336 ? 68.871  54.879 27.884  1.00 15.07 ? 336  ALA A N     1 
ATOM   2398 C CA    . ALA A 1 336 ? 69.352  53.629 27.328  1.00 14.59 ? 336  ALA A CA    1 
ATOM   2399 C C     . ALA A 1 336 ? 68.377  53.126 26.255  1.00 19.35 ? 336  ALA A C     1 
ATOM   2400 O O     . ALA A 1 336 ? 67.703  52.102 26.462  1.00 11.69 ? 336  ALA A O     1 
ATOM   2401 C CB    . ALA A 1 336 ? 69.497  52.628 28.457  1.00 14.16 ? 336  ALA A CB    1 
ATOM   2402 N N     . LEU A 1 337 ? 68.327  53.818 25.101  1.00 13.40 ? 337  LEU A N     1 
ATOM   2403 C CA    . LEU A 1 337 ? 67.391  53.510 24.029  1.00 15.04 ? 337  LEU A CA    1 
ATOM   2404 C C     . LEU A 1 337 ? 67.840  52.278 23.243  1.00 19.74 ? 337  LEU A C     1 
ATOM   2405 O O     . LEU A 1 337 ? 68.437  52.433 22.160  1.00 11.05 ? 337  LEU A O     1 
ATOM   2406 C CB    . LEU A 1 337 ? 67.126  54.678 23.056  1.00 6.87  ? 337  LEU A CB    1 
ATOM   2407 C CG    . LEU A 1 337 ? 66.732  56.048 23.650  1.00 19.13 ? 337  LEU A CG    1 
ATOM   2408 C CD1   . LEU A 1 337 ? 66.191  56.912 22.520  1.00 17.69 ? 337  LEU A CD1   1 
ATOM   2409 C CD2   . LEU A 1 337 ? 65.642  55.978 24.666  1.00 15.23 ? 337  LEU A CD2   1 
ATOM   2410 N N     . LEU A 1 338 ? 67.598  51.065 23.821  1.00 10.31 ? 338  LEU A N     1 
ATOM   2411 C CA    . LEU A 1 338 ? 67.981  49.778 23.222  1.00 5.00  ? 338  LEU A CA    1 
ATOM   2412 C C     . LEU A 1 338 ? 66.824  48.783 23.407  1.00 8.51  ? 338  LEU A C     1 
ATOM   2413 O O     . LEU A 1 338 ? 66.098  48.857 24.379  1.00 10.98 ? 338  LEU A O     1 
ATOM   2414 C CB    . LEU A 1 338 ? 69.229  49.176 23.898  1.00 7.84  ? 338  LEU A CB    1 
ATOM   2415 C CG    . LEU A 1 338 ? 70.415  50.091 23.759  1.00 10.45 ? 338  LEU A CG    1 
ATOM   2416 C CD1   . LEU A 1 338 ? 71.515  49.597 24.697  1.00 5.00  ? 338  LEU A CD1   1 
ATOM   2417 C CD2   . LEU A 1 338 ? 70.872  50.106 22.285  1.00 9.03  ? 338  LEU A CD2   1 
ATOM   2418 N N     . THR A 1 339 ? 66.642  47.867 22.470  1.00 16.41 ? 339  THR A N     1 
ATOM   2419 C CA    . THR A 1 339 ? 65.557  46.897 22.545  1.00 11.37 ? 339  THR A CA    1 
ATOM   2420 C C     . THR A 1 339 ? 65.671  46.065 23.808  1.00 12.32 ? 339  THR A C     1 
ATOM   2421 O O     . THR A 1 339 ? 64.711  45.946 24.565  1.00 14.41 ? 339  THR A O     1 
ATOM   2422 C CB    . THR A 1 339 ? 65.559  46.011 21.289  1.00 5.00  ? 339  THR A CB    1 
ATOM   2423 O OG1   . THR A 1 339 ? 64.901  46.750 20.317  1.00 11.57 ? 339  THR A OG1   1 
ATOM   2424 C CG2   . THR A 1 339 ? 64.838  44.702 21.556  1.00 7.97  ? 339  THR A CG2   1 
ATOM   2425 N N     . PRO A 1 340 ? 66.836  45.471 24.059  1.00 11.37 ? 340  PRO A N     1 
ATOM   2426 C CA    . PRO A 1 340 ? 66.908  44.603 25.195  1.00 7.42  ? 340  PRO A CA    1 
ATOM   2427 C C     . PRO A 1 340 ? 66.693  45.303 26.539  1.00 18.44 ? 340  PRO A C     1 
ATOM   2428 O O     . PRO A 1 340 ? 66.335  44.622 27.513  1.00 13.31 ? 340  PRO A O     1 
ATOM   2429 C CB    . PRO A 1 340 ? 68.254  43.858 25.151  1.00 8.87  ? 340  PRO A CB    1 
ATOM   2430 C CG    . PRO A 1 340 ? 68.745  44.079 23.727  1.00 12.73 ? 340  PRO A CG    1 
ATOM   2431 C CD    . PRO A 1 340 ? 68.095  45.371 23.294  1.00 10.06 ? 340  PRO A CD    1 
ATOM   2432 N N     . VAL A 1 341 ? 66.883  46.622 26.615  1.00 8.37  ? 341  VAL A N     1 
ATOM   2433 C CA    . VAL A 1 341 ? 66.648  47.421 27.820  1.00 11.56 ? 341  VAL A CA    1 
ATOM   2434 C C     . VAL A 1 341 ? 65.144  47.604 28.069  1.00 12.61 ? 341  VAL A C     1 
ATOM   2435 O O     . VAL A 1 341 ? 64.653  47.416 29.190  1.00 12.90 ? 341  VAL A O     1 
ATOM   2436 C CB    . VAL A 1 341 ? 67.385  48.795 27.782  1.00 9.50  ? 341  VAL A CB    1 
ATOM   2437 C CG1   . VAL A 1 341 ? 67.048  49.640 28.996  1.00 5.00  ? 341  VAL A CG1   1 
ATOM   2438 C CG2   . VAL A 1 341 ? 68.885  48.555 27.726  1.00 11.17 ? 341  VAL A CG2   1 
ATOM   2439 N N     . ALA A 1 342 ? 64.413  47.874 27.007  1.00 9.17  ? 342  ALA A N     1 
ATOM   2440 C CA    . ALA A 1 342 ? 62.972  48.036 27.079  1.00 5.55  ? 342  ALA A CA    1 
ATOM   2441 C C     . ALA A 1 342 ? 62.375  46.711 27.566  1.00 11.34 ? 342  ALA A C     1 
ATOM   2442 O O     . ALA A 1 342 ? 61.593  46.661 28.514  1.00 11.59 ? 342  ALA A O     1 
ATOM   2443 C CB    . ALA A 1 342 ? 62.404  48.449 25.722  1.00 9.12  ? 342  ALA A CB    1 
ATOM   2444 N N     . ILE A 1 343 ? 62.853  45.606 27.005  1.00 10.88 ? 343  ILE A N     1 
ATOM   2445 C CA    . ILE A 1 343 ? 62.377  44.265 27.350  1.00 13.65 ? 343  ILE A CA    1 
ATOM   2446 C C     . ILE A 1 343 ? 62.662  43.941 28.831  1.00 8.83  ? 343  ILE A C     1 
ATOM   2447 O O     . ILE A 1 343 ? 61.748  43.626 29.600  1.00 13.53 ? 343  ILE A O     1 
ATOM   2448 C CB    . ILE A 1 343 ? 63.004  43.244 26.397  1.00 15.41 ? 343  ILE A CB    1 
ATOM   2449 C CG1   . ILE A 1 343 ? 62.498  43.348 24.960  1.00 8.18  ? 343  ILE A CG1   1 
ATOM   2450 C CG2   . ILE A 1 343 ? 62.998  41.806 26.907  1.00 12.71 ? 343  ILE A CG2   1 
ATOM   2451 C CD1   . ILE A 1 343 ? 63.250  42.372 24.053  1.00 10.00 ? 343  ILE A CD1   1 
ATOM   2452 N N     . ALA A 1 344 ? 63.918  44.042 29.247  1.00 9.72  ? 344  ALA A N     1 
ATOM   2453 C CA    . ALA A 1 344 ? 64.309  43.790 30.645  1.00 7.87  ? 344  ALA A CA    1 
ATOM   2454 C C     . ALA A 1 344 ? 63.554  44.689 31.619  1.00 13.87 ? 344  ALA A C     1 
ATOM   2455 O O     . ALA A 1 344 ? 63.143  44.233 32.702  1.00 13.71 ? 344  ALA A O     1 
ATOM   2456 C CB    . ALA A 1 344 ? 65.815  43.879 30.902  1.00 6.83  ? 344  ALA A CB    1 
ATOM   2457 N N     . ALA A 1 345 ? 63.436  45.988 31.310  1.00 12.85 ? 345  ALA A N     1 
ATOM   2458 C CA    . ALA A 1 345 ? 62.695  46.876 32.206  1.00 14.13 ? 345  ALA A CA    1 
ATOM   2459 C C     . ALA A 1 345 ? 61.206  46.465 32.253  1.00 20.46 ? 345  ALA A C     1 
ATOM   2460 O O     . ALA A 1 345 ? 60.595  46.526 33.318  1.00 11.05 ? 345  ALA A O     1 
ATOM   2461 C CB    . ALA A 1 345 ? 62.860  48.360 31.879  1.00 7.29  ? 345  ALA A CB    1 
ATOM   2462 N N     . GLY A 1 346 ? 60.603  46.101 31.098  1.00 9.79  ? 346  GLY A N     1 
ATOM   2463 C CA    . GLY A 1 346 ? 59.191  45.716 31.053  1.00 5.99  ? 346  GLY A CA    1 
ATOM   2464 C C     . GLY A 1 346 ? 58.951  44.429 31.847  1.00 10.24 ? 346  GLY A C     1 
ATOM   2465 O O     . GLY A 1 346 ? 57.937  44.284 32.504  1.00 14.85 ? 346  GLY A O     1 
ATOM   2466 N N     . ARG A 1 347 ? 59.900  43.508 31.794  1.00 10.37 ? 347  ARG A N     1 
ATOM   2467 C CA    . ARG A 1 347 ? 59.788  42.239 32.491  1.00 10.54 ? 347  ARG A CA    1 
ATOM   2468 C C     . ARG A 1 347 ? 59.972  42.442 33.967  1.00 15.15 ? 347  ARG A C     1 
ATOM   2469 O O     . ARG A 1 347 ? 59.220  41.889 34.743  1.00 12.81 ? 347  ARG A O     1 
ATOM   2470 C CB    . ARG A 1 347 ? 60.769  41.159 32.035  1.00 11.49 ? 347  ARG A CB    1 
ATOM   2471 C CG    . ARG A 1 347 ? 60.405  40.592 30.667  1.00 13.43 ? 347  ARG A CG    1 
ATOM   2472 C CD    . ARG A 1 347 ? 61.497  39.639 30.163  1.00 16.68 ? 347  ARG A CD    1 
ATOM   2473 N NE    . ARG A 1 347 ? 61.099  38.944 28.934  1.00 22.35 ? 347  ARG A NE    1 
ATOM   2474 C CZ    . ARG A 1 347 ? 61.931  38.348 28.052  1.00 37.12 ? 347  ARG A CZ    1 
ATOM   2475 N NH1   . ARG A 1 347 ? 63.268  38.415 28.192  1.00 22.94 ? 347  ARG A NH1   1 
ATOM   2476 N NH2   . ARG A 1 347 ? 61.447  37.739 26.970  1.00 34.37 ? 347  ARG A NH2   1 
ATOM   2477 N N     . LYS A 1 348 ? 61.011  43.171 34.393  1.00 14.57 ? 348  LYS A N     1 
ATOM   2478 C CA    . LYS A 1 348 ? 61.174  43.367 35.832  1.00 14.47 ? 348  LYS A CA    1 
ATOM   2479 C C     . LYS A 1 348 ? 59.921  44.032 36.401  1.00 6.11  ? 348  LYS A C     1 
ATOM   2480 O O     . LYS A 1 348 ? 59.582  43.864 37.583  1.00 11.15 ? 348  LYS A O     1 
ATOM   2481 C CB    . LYS A 1 348 ? 62.408  44.213 36.144  1.00 12.73 ? 348  LYS A CB    1 
ATOM   2482 C CG    . LYS A 1 348 ? 63.712  43.538 35.762  1.00 14.10 ? 348  LYS A CG    1 
ATOM   2483 C CD    . LYS A 1 348 ? 64.050  42.481 36.769  1.00 17.88 ? 348  LYS A CD    1 
ATOM   2484 C CE    . LYS A 1 348 ? 65.518  42.086 36.779  1.00 30.12 ? 348  LYS A CE    1 
ATOM   2485 N NZ    . LYS A 1 348 ? 65.805  41.232 37.946  1.00 45.92 ? 348  LYS A NZ    1 
ATOM   2486 N N     . LEU A 1 349 ? 59.302  44.867 35.592  1.00 8.11  ? 349  LEU A N     1 
ATOM   2487 C CA    . LEU A 1 349 ? 58.142  45.592 36.045  1.00 10.84 ? 349  LEU A CA    1 
ATOM   2488 C C     . LEU A 1 349 ? 56.954  44.639 36.224  1.00 18.31 ? 349  LEU A C     1 
ATOM   2489 O O     . LEU A 1 349 ? 56.196  44.777 37.178  1.00 17.36 ? 349  LEU A O     1 
ATOM   2490 C CB    . LEU A 1 349 ? 57.753  46.785 35.139  1.00 9.90  ? 349  LEU A CB    1 
ATOM   2491 C CG    . LEU A 1 349 ? 56.429  47.481 35.522  1.00 14.69 ? 349  LEU A CG    1 
ATOM   2492 C CD1   . LEU A 1 349 ? 56.472  48.159 36.895  1.00 11.15 ? 349  LEU A CD1   1 
ATOM   2493 C CD2   . LEU A 1 349 ? 56.065  48.547 34.491  1.00 11.95 ? 349  LEU A CD2   1 
ATOM   2494 N N     . ALA A 1 350 ? 56.776  43.681 35.329  1.00 13.79 ? 350  ALA A N     1 
ATOM   2495 C CA    . ALA A 1 350 ? 55.703  42.699 35.490  1.00 8.84  ? 350  ALA A CA    1 
ATOM   2496 C C     . ALA A 1 350 ? 55.902  41.888 36.777  1.00 13.61 ? 350  ALA A C     1 
ATOM   2497 O O     . ALA A 1 350 ? 54.939  41.611 37.493  1.00 16.09 ? 350  ALA A O     1 
ATOM   2498 C CB    . ALA A 1 350 ? 55.710  41.757 34.288  1.00 9.20  ? 350  ALA A CB    1 
ATOM   2499 N N     . HIS A 1 351 ? 57.154  41.488 37.084  1.00 10.82 ? 351  HIS A N     1 
ATOM   2500 C CA    . HIS A 1 351 ? 57.391  40.744 38.312  1.00 14.35 ? 351  HIS A CA    1 
ATOM   2501 C C     . HIS A 1 351 ? 57.072  41.564 39.548  1.00 26.47 ? 351  HIS A C     1 
ATOM   2502 O O     . HIS A 1 351 ? 56.614  41.011 40.564  1.00 14.96 ? 351  HIS A O     1 
ATOM   2503 C CB    . HIS A 1 351 ? 58.827  40.273 38.398  1.00 17.15 ? 351  HIS A CB    1 
ATOM   2504 C CG    . HIS A 1 351 ? 59.063  39.138 37.474  1.00 27.10 ? 351  HIS A CG    1 
ATOM   2505 N ND1   . HIS A 1 351 ? 58.672  37.843 37.816  1.00 25.75 ? 351  HIS A ND1   1 
ATOM   2506 C CD2   . HIS A 1 351 ? 59.624  39.120 36.239  1.00 22.97 ? 351  HIS A CD2   1 
ATOM   2507 C CE1   . HIS A 1 351 ? 59.073  37.063 36.808  1.00 26.20 ? 351  HIS A CE1   1 
ATOM   2508 N NE2   . HIS A 1 351 ? 59.603  37.809 35.839  1.00 28.49 ? 351  HIS A NE2   1 
ATOM   2509 N N     . ARG A 1 352 ? 57.398  42.873 39.508  1.00 12.17 ? 352  ARG A N     1 
ATOM   2510 C CA    . ARG A 1 352 ? 57.114  43.715 40.656  1.00 14.07 ? 352  ARG A CA    1 
ATOM   2511 C C     . ARG A 1 352 ? 55.596  43.837 40.863  1.00 16.22 ? 352  ARG A C     1 
ATOM   2512 O O     . ARG A 1 352 ? 55.083  43.741 41.968  1.00 15.63 ? 352  ARG A O     1 
ATOM   2513 C CB    . ARG A 1 352 ? 57.770  45.111 40.485  1.00 12.08 ? 352  ARG A CB    1 
ATOM   2514 C CG    . ARG A 1 352 ? 57.464  46.015 41.685  1.00 13.44 ? 352  ARG A CG    1 
ATOM   2515 C CD    . ARG A 1 352 ? 58.260  47.336 41.710  1.00 9.20  ? 352  ARG A CD    1 
ATOM   2516 N NE    . ARG A 1 352 ? 57.942  48.267 40.607  1.00 12.70 ? 352  ARG A NE    1 
ATOM   2517 C CZ    . ARG A 1 352 ? 56.964  49.183 40.668  1.00 12.78 ? 352  ARG A CZ    1 
ATOM   2518 N NH1   . ARG A 1 352 ? 56.227  49.191 41.758  1.00 17.17 ? 352  ARG A NH1   1 
ATOM   2519 N NH2   . ARG A 1 352 ? 56.703  50.078 39.720  1.00 13.01 ? 352  ARG A NH2   1 
ATOM   2520 N N     . LEU A 1 353 ? 54.857  44.078 39.790  1.00 10.91 ? 353  LEU A N     1 
ATOM   2521 C CA    . LEU A 1 353 ? 53.431  44.305 39.871  1.00 9.46  ? 353  LEU A CA    1 
ATOM   2522 C C     . LEU A 1 353 ? 52.617  43.050 40.166  1.00 16.75 ? 353  LEU A C     1 
ATOM   2523 O O     . LEU A 1 353 ? 51.737  43.107 41.011  1.00 15.25 ? 353  LEU A O     1 
ATOM   2524 C CB    . LEU A 1 353 ? 52.839  45.005 38.636  1.00 18.96 ? 353  LEU A CB    1 
ATOM   2525 C CG    . LEU A 1 353 ? 53.459  46.361 38.286  1.00 19.72 ? 353  LEU A CG    1 
ATOM   2526 C CD1   . LEU A 1 353 ? 52.684  46.991 37.136  1.00 12.70 ? 353  LEU A CD1   1 
ATOM   2527 C CD2   . LEU A 1 353 ? 53.459  47.309 39.497  1.00 9.84  ? 353  LEU A CD2   1 
ATOM   2528 N N     . PHE A 1 354 ? 52.899  41.953 39.450  1.00 13.51 ? 354  PHE A N     1 
ATOM   2529 C CA    . PHE A 1 354 ? 52.109  40.730 39.527  1.00 15.38 ? 354  PHE A CA    1 
ATOM   2530 C C     . PHE A 1 354 ? 52.713  39.595 40.310  1.00 18.60 ? 354  PHE A C     1 
ATOM   2531 O O     . PHE A 1 354 ? 52.075  38.581 40.510  1.00 18.13 ? 354  PHE A O     1 
ATOM   2532 C CB    . PHE A 1 354 ? 51.711  40.312 38.114  1.00 13.28 ? 354  PHE A CB    1 
ATOM   2533 C CG    . PHE A 1 354 ? 50.938  41.442 37.500  1.00 12.16 ? 354  PHE A CG    1 
ATOM   2534 C CD1   . PHE A 1 354 ? 49.613  41.689 37.856  1.00 19.69 ? 354  PHE A CD1   1 
ATOM   2535 C CD2   . PHE A 1 354 ? 51.511  42.298 36.542  1.00 5.00  ? 354  PHE A CD2   1 
ATOM   2536 C CE1   . PHE A 1 354 ? 48.908  42.785 37.317  1.00 19.14 ? 354  PHE A CE1   1 
ATOM   2537 C CE2   . PHE A 1 354 ? 50.833  43.380 36.015  1.00 18.21 ? 354  PHE A CE2   1 
ATOM   2538 C CZ    . PHE A 1 354 ? 49.515  43.621 36.398  1.00 11.32 ? 354  PHE A CZ    1 
ATOM   2539 N N     . GLU A 1 355 ? 53.948  39.747 40.760  1.00 16.96 ? 355  GLU A N     1 
ATOM   2540 C CA    . GLU A 1 355 ? 54.505  38.725 41.589  1.00 15.86 ? 355  GLU A CA    1 
ATOM   2541 C C     . GLU A 1 355 ? 54.933  39.318 42.915  1.00 15.93 ? 355  GLU A C     1 
ATOM   2542 O O     . GLU A 1 355 ? 55.585  38.665 43.707  1.00 27.98 ? 355  GLU A O     1 
ATOM   2543 C CB    . GLU A 1 355 ? 55.624  37.951 40.907  1.00 14.99 ? 355  GLU A CB    1 
ATOM   2544 C CG    . GLU A 1 355 ? 55.962  36.686 41.695  1.00 26.22 ? 355  GLU A CG    1 
ATOM   2545 C CD    . GLU A 1 355 ? 56.937  35.799 40.987  1.00 35.66 ? 355  GLU A CD    1 
ATOM   2546 O OE1   . GLU A 1 355 ? 57.719  36.474 40.172  1.00 34.39 ? 355  GLU A OE1   1 
ATOM   2547 O OE2   . GLU A 1 355 ? 56.995  34.586 41.163  1.00 49.03 ? 355  GLU A OE2   1 
ATOM   2548 N N     . TYR A 1 356 ? 54.572  40.577 43.119  1.00 18.91 ? 356  TYR A N     1 
ATOM   2549 C CA    . TYR A 1 356 ? 54.808  41.289 44.368  1.00 21.61 ? 356  TYR A CA    1 
ATOM   2550 C C     . TYR A 1 356 ? 56.269  41.330 44.775  1.00 18.98 ? 356  TYR A C     1 
ATOM   2551 O O     . TYR A 1 356 ? 56.559  41.327 45.970  1.00 22.74 ? 356  TYR A O     1 
ATOM   2552 C CB    . TYR A 1 356 ? 53.909  40.723 45.494  1.00 17.36 ? 356  TYR A CB    1 
ATOM   2553 C CG    . TYR A 1 356 ? 52.502  40.690 44.964  1.00 17.17 ? 356  TYR A CG    1 
ATOM   2554 C CD1   . TYR A 1 356 ? 51.765  41.863 44.906  1.00 21.31 ? 356  TYR A CD1   1 
ATOM   2555 C CD2   . TYR A 1 356 ? 51.943  39.515 44.445  1.00 21.38 ? 356  TYR A CD2   1 
ATOM   2556 C CE1   . TYR A 1 356 ? 50.498  41.915 44.333  1.00 18.34 ? 356  TYR A CE1   1 
ATOM   2557 C CE2   . TYR A 1 356 ? 50.669  39.543 43.878  1.00 16.97 ? 356  TYR A CE2   1 
ATOM   2558 C CZ    . TYR A 1 356 ? 49.948  40.746 43.827  1.00 26.49 ? 356  TYR A CZ    1 
ATOM   2559 O OH    . TYR A 1 356 ? 48.694  40.792 43.264  1.00 26.17 ? 356  TYR A OH    1 
ATOM   2560 N N     . LYS A 1 357 ? 57.178  41.321 43.787  1.00 19.07 ? 357  LYS A N     1 
ATOM   2561 C CA    . LYS A 1 357 ? 58.612  41.441 44.069  1.00 25.90 ? 357  LYS A CA    1 
ATOM   2562 C C     . LYS A 1 357 ? 58.964  42.925 44.127  1.00 30.25 ? 357  LYS A C     1 
ATOM   2563 O O     . LYS A 1 357 ? 59.353  43.532 43.128  1.00 15.94 ? 357  LYS A O     1 
ATOM   2564 C CB    . LYS A 1 357 ? 59.507  40.727 43.070  1.00 20.65 ? 357  LYS A CB    1 
ATOM   2565 C CG    . LYS A 1 357 ? 59.133  39.271 42.982  1.00 32.15 ? 357  LYS A CG    1 
ATOM   2566 C CD    . LYS A 1 357 ? 60.345  38.375 42.872  1.00 45.25 ? 357  LYS A CD    1 
ATOM   2567 C CE    . LYS A 1 357 ? 59.973  36.910 42.748  1.00 59.34 ? 357  LYS A CE    1 
ATOM   2568 N NZ    . LYS A 1 357 ? 60.553  36.288 41.545  1.00 71.51 ? 357  LYS A NZ    1 
ATOM   2569 N N     . GLU A 1 358 ? 58.786  43.532 45.296  1.00 21.23 ? 358  GLU A N     1 
ATOM   2570 C CA    . GLU A 1 358 ? 58.992  44.961 45.427  1.00 27.99 ? 358  GLU A CA    1 
ATOM   2571 C C     . GLU A 1 358 ? 60.385  45.499 45.043  1.00 26.23 ? 358  GLU A C     1 
ATOM   2572 O O     . GLU A 1 358 ? 60.550  46.665 44.680  1.00 26.65 ? 358  GLU A O     1 
ATOM   2573 C CB    . GLU A 1 358 ? 58.388  45.525 46.734  1.00 49.80 ? 358  GLU A CB    1 
ATOM   2574 C CG    . GLU A 1 358 ? 59.002  45.042 48.073  1.00 62.51 ? 358  GLU A CG    1 
ATOM   2575 C CD    . GLU A 1 358 ? 58.885  46.073 49.194  1.00 77.34 ? 358  GLU A CD    1 
ATOM   2576 O OE1   . GLU A 1 358 ? 58.368  47.185 49.058  1.00 80.00 ? 358  GLU A OE1   1 
ATOM   2577 O OE2   . GLU A 1 358 ? 59.509  45.702 50.300  1.00 79.88 ? 358  GLU A OE2   1 
ATOM   2578 N N     . ASP A 1 359 ? 61.387  44.639 45.088  1.00 20.55 ? 359  ASP A N     1 
ATOM   2579 C CA    . ASP A 1 359 ? 62.749  45.013 44.781  1.00 23.38 ? 359  ASP A CA    1 
ATOM   2580 C C     . ASP A 1 359 ? 63.033  44.788 43.296  1.00 20.78 ? 359  ASP A C     1 
ATOM   2581 O O     . ASP A 1 359 ? 64.162  44.930 42.824  1.00 21.51 ? 359  ASP A O     1 
ATOM   2582 C CB    . ASP A 1 359 ? 63.738  44.209 45.675  1.00 41.55 ? 359  ASP A CB    1 
ATOM   2583 C CG    . ASP A 1 359 ? 63.762  42.705 45.411  1.00 62.59 ? 359  ASP A CG    1 
ATOM   2584 O OD1   . ASP A 1 359 ? 62.769  42.054 45.069  1.00 51.75 ? 359  ASP A OD1   1 
ATOM   2585 O OD2   . ASP A 1 359 ? 64.943  42.155 45.681  1.00 64.95 ? 359  ASP A OD2   1 
ATOM   2586 N N     . SER A 1 360 ? 62.012  44.366 42.565  1.00 19.00 ? 360  SER A N     1 
ATOM   2587 C CA    . SER A 1 360 ? 62.171  44.075 41.139  1.00 21.64 ? 360  SER A CA    1 
ATOM   2588 C C     . SER A 1 360 ? 62.308  45.335 40.297  1.00 17.49 ? 360  SER A C     1 
ATOM   2589 O O     . SER A 1 360 ? 61.349  46.088 40.085  1.00 17.26 ? 360  SER A O     1 
ATOM   2590 C CB    . SER A 1 360 ? 61.041  43.206 40.613  1.00 17.68 ? 360  SER A CB    1 
ATOM   2591 O OG    . SER A 1 360 ? 61.414  42.704 39.339  1.00 17.74 ? 360  SER A OG    1 
ATOM   2592 N N     . LYS A 1 361 ? 63.528  45.488 39.765  1.00 21.34 ? 361  LYS A N     1 
ATOM   2593 C CA    . LYS A 1 361 ? 63.855  46.592 38.875  1.00 21.05 ? 361  LYS A CA    1 
ATOM   2594 C C     . LYS A 1 361 ? 65.131  46.315 38.082  1.00 15.53 ? 361  LYS A C     1 
ATOM   2595 O O     . LYS A 1 361 ? 65.921  45.463 38.453  1.00 17.48 ? 361  LYS A O     1 
ATOM   2596 C CB    . LYS A 1 361 ? 64.022  47.887 39.650  1.00 18.27 ? 361  LYS A CB    1 
ATOM   2597 C CG    . LYS A 1 361 ? 65.132  47.829 40.666  1.00 18.73 ? 361  LYS A CG    1 
ATOM   2598 C CD    . LYS A 1 361 ? 65.295  49.129 41.417  1.00 28.98 ? 361  LYS A CD    1 
ATOM   2599 C CE    . LYS A 1 361 ? 66.273  49.003 42.568  1.00 30.15 ? 361  LYS A CE    1 
ATOM   2600 N NZ    . LYS A 1 361 ? 67.597  48.606 42.094  1.00 43.55 ? 361  LYS A NZ    1 
ATOM   2601 N N     . LEU A 1 362 ? 65.289  47.055 36.971  1.00 15.75 ? 362  LEU A N     1 
ATOM   2602 C CA    . LEU A 1 362 ? 66.444  46.920 36.089  1.00 13.60 ? 362  LEU A CA    1 
ATOM   2603 C C     . LEU A 1 362 ? 67.578  47.832 36.564  1.00 15.06 ? 362  LEU A C     1 
ATOM   2604 O O     . LEU A 1 362 ? 67.352  49.025 36.784  1.00 17.40 ? 362  LEU A O     1 
ATOM   2605 C CB    . LEU A 1 362 ? 66.047  47.346 34.665  1.00 15.90 ? 362  LEU A CB    1 
ATOM   2606 C CG    . LEU A 1 362 ? 67.243  47.314 33.731  1.00 19.06 ? 362  LEU A CG    1 
ATOM   2607 C CD1   . LEU A 1 362 ? 67.683  45.881 33.493  1.00 18.17 ? 362  LEU A CD1   1 
ATOM   2608 C CD2   . LEU A 1 362 ? 66.846  47.946 32.393  1.00 11.80 ? 362  LEU A CD2   1 
ATOM   2609 N N     . ASP A 1 363 ? 68.776  47.269 36.670  1.00 17.72 ? 363  ASP A N     1 
ATOM   2610 C CA    . ASP A 1 363 ? 69.996  48.014 36.970  1.00 20.07 ? 363  ASP A CA    1 
ATOM   2611 C C     . ASP A 1 363 ? 70.470  48.578 35.636  1.00 18.53 ? 363  ASP A C     1 
ATOM   2612 O O     . ASP A 1 363 ? 70.824  47.816 34.728  1.00 18.95 ? 363  ASP A O     1 
ATOM   2613 C CB    . ASP A 1 363 ? 71.102  47.065 37.487  1.00 24.39 ? 363  ASP A CB    1 
ATOM   2614 C CG    . ASP A 1 363 ? 72.392  47.788 37.842  1.00 33.20 ? 363  ASP A CG    1 
ATOM   2615 O OD1   . ASP A 1 363 ? 72.480  49.004 37.864  1.00 25.37 ? 363  ASP A OD1   1 
ATOM   2616 O OD2   . ASP A 1 363 ? 73.393  46.976 38.101  1.00 31.74 ? 363  ASP A OD2   1 
ATOM   2617 N N     . TYR A 1 364 ? 70.539  49.899 35.525  1.00 16.32 ? 364  TYR A N     1 
ATOM   2618 C CA    . TYR A 1 364 ? 70.980  50.542 34.299  1.00 10.76 ? 364  TYR A CA    1 
ATOM   2619 C C     . TYR A 1 364 ? 72.474  50.639 34.128  1.00 19.58 ? 364  TYR A C     1 
ATOM   2620 O O     . TYR A 1 364 ? 72.920  51.242 33.174  1.00 20.19 ? 364  TYR A O     1 
ATOM   2621 C CB    . TYR A 1 364 ? 70.317  51.866 33.967  1.00 9.32  ? 364  TYR A CB    1 
ATOM   2622 C CG    . TYR A 1 364 ? 68.848  51.744 33.607  1.00 16.66 ? 364  TYR A CG    1 
ATOM   2623 C CD1   . TYR A 1 364 ? 67.879  51.478 34.577  1.00 13.04 ? 364  TYR A CD1   1 
ATOM   2624 C CD2   . TYR A 1 364 ? 68.436  51.878 32.278  1.00 15.71 ? 364  TYR A CD2   1 
ATOM   2625 C CE1   . TYR A 1 364 ? 66.541  51.347 34.217  1.00 18.52 ? 364  TYR A CE1   1 
ATOM   2626 C CE2   . TYR A 1 364 ? 67.089  51.797 31.907  1.00 14.22 ? 364  TYR A CE2   1 
ATOM   2627 C CZ    . TYR A 1 364 ? 66.141  51.520 32.890  1.00 16.66 ? 364  TYR A CZ    1 
ATOM   2628 O OH    . TYR A 1 364 ? 64.827  51.414 32.526  1.00 14.92 ? 364  TYR A OH    1 
ATOM   2629 N N     . ASN A 1 365 ? 73.250  50.041 35.036  1.00 17.20 ? 365  ASN A N     1 
ATOM   2630 C CA    . ASN A 1 365 ? 74.694  50.008 34.906  1.00 23.01 ? 365  ASN A CA    1 
ATOM   2631 C C     . ASN A 1 365 ? 75.107  48.780 34.166  1.00 20.26 ? 365  ASN A C     1 
ATOM   2632 O O     . ASN A 1 365 ? 74.478  47.733 34.319  1.00 20.60 ? 365  ASN A O     1 
ATOM   2633 C CB    . ASN A 1 365 ? 75.439  50.018 36.241  1.00 22.19 ? 365  ASN A CB    1 
ATOM   2634 C CG    . ASN A 1 365 ? 75.077  51.255 37.017  1.00 35.24 ? 365  ASN A CG    1 
ATOM   2635 O OD1   . ASN A 1 365 ? 74.586  51.148 38.142  1.00 56.70 ? 365  ASN A OD1   1 
ATOM   2636 N ND2   . ASN A 1 365 ? 75.097  52.401 36.349  1.00 38.06 ? 365  ASN A ND2   1 
ATOM   2637 N N     . ASN A 1 366 ? 76.221  48.930 33.463  1.00 13.52 ? 366  ASN A N     1 
ATOM   2638 C CA    . ASN A 1 366 ? 76.828  47.829 32.743  1.00 17.71 ? 366  ASN A CA    1 
ATOM   2639 C C     . ASN A 1 366 ? 75.910  47.182 31.704  1.00 17.28 ? 366  ASN A C     1 
ATOM   2640 O O     . ASN A 1 366 ? 75.890  45.960 31.536  1.00 13.97 ? 366  ASN A O     1 
ATOM   2641 C CB    . ASN A 1 366 ? 77.445  46.794 33.684  1.00 17.06 ? 366  ASN A CB    1 
ATOM   2642 C CG    . ASN A 1 366 ? 78.470  47.403 34.605  1.00 13.77 ? 366  ASN A CG    1 
ATOM   2643 O OD1   . ASN A 1 366 ? 78.490  47.120 35.823  1.00 26.67 ? 366  ASN A OD1   1 
ATOM   2644 N ND2   . ASN A 1 366 ? 79.401  48.135 34.019  1.00 18.95 ? 366  ASN A ND2   1 
ATOM   2645 N N     . ILE A 1 367 ? 75.164  47.989 30.962  1.00 11.82 ? 367  ILE A N     1 
ATOM   2646 C CA    . ILE A 1 367 ? 74.350  47.486 29.865  1.00 11.90 ? 367  ILE A CA    1 
ATOM   2647 C C     . ILE A 1 367 ? 75.286  47.443 28.659  1.00 12.86 ? 367  ILE A C     1 
ATOM   2648 O O     . ILE A 1 367 ? 75.944  48.432 28.382  1.00 16.43 ? 367  ILE A O     1 
ATOM   2649 C CB    . ILE A 1 367 ? 73.206  48.479 29.627  1.00 13.32 ? 367  ILE A CB    1 
ATOM   2650 C CG1   . ILE A 1 367 ? 72.221  48.395 30.795  1.00 17.38 ? 367  ILE A CG1   1 
ATOM   2651 C CG2   . ILE A 1 367 ? 72.487  48.238 28.302  1.00 10.59 ? 367  ILE A CG2   1 
ATOM   2652 C CD1   . ILE A 1 367 ? 71.127  49.455 30.755  1.00 14.51 ? 367  ILE A CD1   1 
ATOM   2653 N N     . PRO A 1 368 ? 75.429  46.305 27.991  1.00 11.89 ? 368  PRO A N     1 
ATOM   2654 C CA    . PRO A 1 368 ? 76.318  46.198 26.873  1.00 12.39 ? 368  PRO A CA    1 
ATOM   2655 C C     . PRO A 1 368 ? 75.598  46.661 25.619  1.00 16.90 ? 368  PRO A C     1 
ATOM   2656 O O     . PRO A 1 368 ? 74.361  46.660 25.504  1.00 12.98 ? 368  PRO A O     1 
ATOM   2657 C CB    . PRO A 1 368 ? 76.684  44.704 26.777  1.00 7.79  ? 368  PRO A CB    1 
ATOM   2658 C CG    . PRO A 1 368 ? 75.489  43.976 27.395  1.00 17.30 ? 368  PRO A CG    1 
ATOM   2659 C CD    . PRO A 1 368 ? 74.791  44.991 28.266  1.00 13.13 ? 368  PRO A CD    1 
ATOM   2660 N N     . THR A 1 369 ? 76.410  47.086 24.644  1.00 11.19 ? 369  THR A N     1 
ATOM   2661 C CA    . THR A 1 369 ? 75.842  47.608 23.408  1.00 7.24  ? 369  THR A CA    1 
ATOM   2662 C C     . THR A 1 369 ? 76.792  47.330 22.272  1.00 6.81  ? 369  THR A C     1 
ATOM   2663 O O     . THR A 1 369 ? 78.001  47.270 22.442  1.00 11.50 ? 369  THR A O     1 
ATOM   2664 C CB    . THR A 1 369 ? 75.437  49.100 23.547  1.00 6.71  ? 369  THR A CB    1 
ATOM   2665 O OG1   . THR A 1 369 ? 74.760  49.451 22.353  1.00 13.51 ? 369  THR A OG1   1 
ATOM   2666 C CG2   . THR A 1 369 ? 76.703  49.941 23.703  1.00 10.60 ? 369  THR A CG2   1 
ATOM   2667 N N     . VAL A 1 370 ? 76.237  47.025 21.129  1.00 11.34 ? 370  VAL A N     1 
ATOM   2668 C CA    . VAL A 1 370 ? 77.066  46.774 19.924  1.00 5.33  ? 370  VAL A CA    1 
ATOM   2669 C C     . VAL A 1 370 ? 76.651  47.790 18.878  1.00 9.99  ? 370  VAL A C     1 
ATOM   2670 O O     . VAL A 1 370 ? 75.458  47.993 18.652  1.00 11.62 ? 370  VAL A O     1 
ATOM   2671 C CB    . VAL A 1 370 ? 76.846  45.356 19.343  1.00 10.93 ? 370  VAL A CB    1 
ATOM   2672 C CG1   . VAL A 1 370 ? 77.324  45.259 17.901  1.00 10.41 ? 370  VAL A CG1   1 
ATOM   2673 C CG2   . VAL A 1 370 ? 77.592  44.325 20.209  1.00 11.40 ? 370  VAL A CG2   1 
ATOM   2674 N N     . VAL A 1 371 ? 77.647  48.386 18.203  1.00 9.73  ? 371  VAL A N     1 
ATOM   2675 C CA    . VAL A 1 371 ? 77.382  49.273 17.083  1.00 5.40  ? 371  VAL A CA    1 
ATOM   2676 C C     . VAL A 1 371 ? 77.745  48.460 15.827  1.00 6.56  ? 371  VAL A C     1 
ATOM   2677 O O     . VAL A 1 371 ? 78.855  47.935 15.703  1.00 12.73 ? 371  VAL A O     1 
ATOM   2678 C CB    . VAL A 1 371 ? 78.168  50.577 17.136  1.00 9.20  ? 371  VAL A CB    1 
ATOM   2679 C CG1   . VAL A 1 371 ? 77.712  51.482 16.005  1.00 10.12 ? 371  VAL A CG1   1 
ATOM   2680 C CG2   . VAL A 1 371 ? 77.927  51.315 18.451  1.00 11.11 ? 371  VAL A CG2   1 
ATOM   2681 N N     . PHE A 1 372 ? 76.768  48.288 14.928  1.00 9.64  ? 372  PHE A N     1 
ATOM   2682 C CA    . PHE A 1 372 ? 76.945  47.484 13.729  1.00 7.97  ? 372  PHE A CA    1 
ATOM   2683 C C     . PHE A 1 372 ? 77.624  48.299 12.646  1.00 9.98  ? 372  PHE A C     1 
ATOM   2684 O O     . PHE A 1 372 ? 77.051  48.639 11.607  1.00 10.36 ? 372  PHE A O     1 
ATOM   2685 C CB    . PHE A 1 372 ? 75.592  46.873 13.269  1.00 7.93  ? 372  PHE A CB    1 
ATOM   2686 C CG    . PHE A 1 372 ? 75.223  45.790 14.252  1.00 10.85 ? 372  PHE A CG    1 
ATOM   2687 C CD1   . PHE A 1 372 ? 75.842  44.552 14.183  1.00 13.54 ? 372  PHE A CD1   1 
ATOM   2688 C CD2   . PHE A 1 372 ? 74.330  46.005 15.303  1.00 14.09 ? 372  PHE A CD2   1 
ATOM   2689 C CE1   . PHE A 1 372 ? 75.534  43.528 15.050  1.00 10.81 ? 372  PHE A CE1   1 
ATOM   2690 C CE2   . PHE A 1 372 ? 74.011  44.976 16.214  1.00 13.02 ? 372  PHE A CE2   1 
ATOM   2691 C CZ    . PHE A 1 372 ? 74.652  43.742 16.105  1.00 10.77 ? 372  PHE A CZ    1 
ATOM   2692 N N     . SER A 1 373 ? 78.872  48.624 12.951  1.00 6.43  ? 373  SER A N     1 
ATOM   2693 C CA    . SER A 1 373 ? 79.730  49.289 12.010  1.00 8.50  ? 373  SER A CA    1 
ATOM   2694 C C     . SER A 1 373 ? 80.550  48.217 11.344  1.00 13.32 ? 373  SER A C     1 
ATOM   2695 O O     . SER A 1 373 ? 80.255  47.036 11.506  1.00 11.61 ? 373  SER A O     1 
ATOM   2696 C CB    . SER A 1 373 ? 80.628  50.255 12.765  1.00 11.18 ? 373  SER A CB    1 
ATOM   2697 O OG    . SER A 1 373 ? 81.069  49.607 13.950  1.00 17.43 ? 373  SER A OG    1 
ATOM   2698 N N     . HIS A 1 374 ? 81.552  48.643 10.559  1.00 12.25 ? 374  HIS A N     1 
ATOM   2699 C CA    . HIS A 1 374 ? 82.461  47.723 9.917   1.00 11.40 ? 374  HIS A CA    1 
ATOM   2700 C C     . HIS A 1 374 ? 83.878  48.167 10.236  1.00 14.68 ? 374  HIS A C     1 
ATOM   2701 O O     . HIS A 1 374 ? 84.327  49.159 9.694   1.00 19.68 ? 374  HIS A O     1 
ATOM   2702 C CB    . HIS A 1 374 ? 82.298  47.710 8.371   1.00 19.15 ? 374  HIS A CB    1 
ATOM   2703 C CG    . HIS A 1 374 ? 80.902  47.400 7.930   1.00 27.99 ? 374  HIS A CG    1 
ATOM   2704 N ND1   . HIS A 1 374 ? 80.473  46.097 7.669   1.00 29.93 ? 374  HIS A ND1   1 
ATOM   2705 C CD2   . HIS A 1 374 ? 79.843  48.242 7.749   1.00 29.05 ? 374  HIS A CD2   1 
ATOM   2706 C CE1   . HIS A 1 374 ? 79.183  46.176 7.336   1.00 28.74 ? 374  HIS A CE1   1 
ATOM   2707 N NE2   . HIS A 1 374 ? 78.764  47.455 7.411   1.00 30.50 ? 374  HIS A NE2   1 
ATOM   2708 N N     . PRO A 1 375 ? 84.596  47.441 11.083  1.00 11.97 ? 375  PRO A N     1 
ATOM   2709 C CA    . PRO A 1 375 ? 84.080  46.286 11.779  1.00 6.94  ? 375  PRO A CA    1 
ATOM   2710 C C     . PRO A 1 375 ? 83.200  46.746 12.931  1.00 6.22  ? 375  PRO A C     1 
ATOM   2711 O O     . PRO A 1 375 ? 83.161  47.926 13.256  1.00 9.21  ? 375  PRO A O     1 
ATOM   2712 C CB    . PRO A 1 375 ? 85.288  45.530 12.292  1.00 11.50 ? 375  PRO A CB    1 
ATOM   2713 C CG    . PRO A 1 375 ? 86.524  46.301 11.847  1.00 16.65 ? 375  PRO A CG    1 
ATOM   2714 C CD    . PRO A 1 375 ? 86.051  47.556 11.189  1.00 10.31 ? 375  PRO A CD    1 
ATOM   2715 N N     . PRO A 1 376 ? 82.425  45.831 13.528  1.00 11.07 ? 376  PRO A N     1 
ATOM   2716 C CA    . PRO A 1 376 ? 81.485  46.180 14.585  1.00 5.40  ? 376  PRO A CA    1 
ATOM   2717 C C     . PRO A 1 376 ? 82.175  46.592 15.885  1.00 8.62  ? 376  PRO A C     1 
ATOM   2718 O O     . PRO A 1 376 ? 83.263  46.128 16.216  1.00 8.43  ? 376  PRO A O     1 
ATOM   2719 C CB    . PRO A 1 376 ? 80.697  44.889 14.861  1.00 5.00  ? 376  PRO A CB    1 
ATOM   2720 C CG    . PRO A 1 376 ? 81.456  43.746 14.202  1.00 5.00  ? 376  PRO A CG    1 
ATOM   2721 C CD    . PRO A 1 376 ? 82.450  44.367 13.233  1.00 9.14  ? 376  PRO A CD    1 
ATOM   2722 N N     . ILE A 1 377 ? 81.466  47.353 16.690  1.00 8.33  ? 377  ILE A N     1 
ATOM   2723 C CA    . ILE A 1 377 ? 81.941  47.841 17.985  1.00 11.89 ? 377  ILE A CA    1 
ATOM   2724 C C     . ILE A 1 377 ? 81.155  47.167 19.119  1.00 9.36  ? 377  ILE A C     1 
ATOM   2725 O O     . ILE A 1 377 ? 79.955  46.985 19.015  1.00 8.94  ? 377  ILE A O     1 
ATOM   2726 C CB    . ILE A 1 377 ? 81.703  49.366 18.108  1.00 9.91  ? 377  ILE A CB    1 
ATOM   2727 C CG1   . ILE A 1 377 ? 82.569  50.130 17.128  1.00 12.04 ? 377  ILE A CG1   1 
ATOM   2728 C CG2   . ILE A 1 377 ? 81.967  49.841 19.540  1.00 12.30 ? 377  ILE A CG2   1 
ATOM   2729 C CD1   . ILE A 1 377 ? 81.942  51.514 16.858  1.00 12.98 ? 377  ILE A CD1   1 
ATOM   2730 N N     . GLY A 1 378 ? 81.824  46.839 20.216  1.00 8.96  ? 378  GLY A N     1 
ATOM   2731 C CA    . GLY A 1 378 ? 81.143  46.290 21.375  1.00 11.47 ? 378  GLY A CA    1 
ATOM   2732 C C     . GLY A 1 378 ? 81.631  47.081 22.562  1.00 10.87 ? 378  GLY A C     1 
ATOM   2733 O O     . GLY A 1 378 ? 82.825  47.327 22.678  1.00 10.93 ? 378  GLY A O     1 
ATOM   2734 N N     . THR A 1 379 ? 80.729  47.474 23.451  1.00 10.75 ? 379  THR A N     1 
ATOM   2735 C CA    . THR A 1 379 ? 81.212  48.185 24.616  1.00 13.39 ? 379  THR A CA    1 
ATOM   2736 C C     . THR A 1 379 ? 80.360  47.878 25.863  1.00 18.10 ? 379  THR A C     1 
ATOM   2737 O O     . THR A 1 379 ? 79.152  47.685 25.753  1.00 11.98 ? 379  THR A O     1 
ATOM   2738 C CB    . THR A 1 379 ? 81.206  49.733 24.350  1.00 13.20 ? 379  THR A CB    1 
ATOM   2739 O OG1   . THR A 1 379 ? 81.581  50.340 25.552  1.00 21.80 ? 379  THR A OG1   1 
ATOM   2740 C CG2   . THR A 1 379 ? 79.792  50.207 24.074  1.00 8.45  ? 379  THR A CG2   1 
ATOM   2741 N N     . VAL A 1 380 ? 80.973  47.815 27.058  1.00 9.93  ? 380  VAL A N     1 
ATOM   2742 C CA    . VAL A 1 380 ? 80.165  47.629 28.254  1.00 11.66 ? 380  VAL A CA    1 
ATOM   2743 C C     . VAL A 1 380 ? 80.848  48.328 29.411  1.00 13.36 ? 380  VAL A C     1 
ATOM   2744 O O     . VAL A 1 380 ? 82.065  48.250 29.520  1.00 12.31 ? 380  VAL A O     1 
ATOM   2745 C CB    . VAL A 1 380 ? 79.887  46.161 28.618  1.00 9.23  ? 380  VAL A CB    1 
ATOM   2746 C CG1   . VAL A 1 380 ? 81.185  45.402 28.902  1.00 11.31 ? 380  VAL A CG1   1 
ATOM   2747 C CG2   . VAL A 1 380 ? 78.947  46.119 29.834  1.00 5.94  ? 380  VAL A CG2   1 
ATOM   2748 N N     . GLY A 1 381 ? 80.078  49.028 30.237  1.00 15.09 ? 381  GLY A N     1 
ATOM   2749 C CA    . GLY A 1 381 ? 80.649  49.675 31.421  1.00 16.10 ? 381  GLY A CA    1 
ATOM   2750 C C     . GLY A 1 381 ? 81.187  51.065 31.131  1.00 19.12 ? 381  GLY A C     1 
ATOM   2751 O O     . GLY A 1 381 ? 80.766  51.713 30.191  1.00 16.37 ? 381  GLY A O     1 
ATOM   2752 N N     . LEU A 1 382 ? 82.135  51.517 31.955  1.00 14.89 ? 382  LEU A N     1 
ATOM   2753 C CA    . LEU A 1 382 ? 82.696  52.881 31.929  1.00 15.41 ? 382  LEU A CA    1 
ATOM   2754 C C     . LEU A 1 382 ? 83.819  53.089 30.908  1.00 13.14 ? 382  LEU A C     1 
ATOM   2755 O O     . LEU A 1 382 ? 84.696  52.230 30.704  1.00 11.65 ? 382  LEU A O     1 
ATOM   2756 C CB    . LEU A 1 382 ? 83.276  53.244 33.307  1.00 18.89 ? 382  LEU A CB    1 
ATOM   2757 C CG    . LEU A 1 382 ? 82.325  53.103 34.497  1.00 22.36 ? 382  LEU A CG    1 
ATOM   2758 C CD1   . LEU A 1 382 ? 83.091  53.581 35.723  1.00 12.56 ? 382  LEU A CD1   1 
ATOM   2759 C CD2   . LEU A 1 382 ? 81.066  53.940 34.321  1.00 19.43 ? 382  LEU A CD2   1 
ATOM   2760 N N     . THR A 1 383 ? 83.822  54.282 30.282  1.00 12.47 ? 383  THR A N     1 
ATOM   2761 C CA    . THR A 1 383 ? 84.905  54.666 29.389  1.00 16.40 ? 383  THR A CA    1 
ATOM   2762 C C     . THR A 1 383 ? 86.053  55.076 30.315  1.00 17.37 ? 383  THR A C     1 
ATOM   2763 O O     . THR A 1 383 ? 85.863  55.218 31.524  1.00 16.62 ? 383  THR A O     1 
ATOM   2764 C CB    . THR A 1 383 ? 84.561  55.886 28.506  1.00 15.64 ? 383  THR A CB    1 
ATOM   2765 O OG1   . THR A 1 383 ? 84.407  56.964 29.385  1.00 16.78 ? 383  THR A OG1   1 
ATOM   2766 C CG2   . THR A 1 383 ? 83.224  55.673 27.808  1.00 12.88 ? 383  THR A CG2   1 
ATOM   2767 N N     . GLU A 1 384 ? 87.250  55.250 29.775  1.00 15.37 ? 384  GLU A N     1 
ATOM   2768 C CA    . GLU A 1 384 ? 88.386  55.634 30.601  1.00 17.77 ? 384  GLU A CA    1 
ATOM   2769 C C     . GLU A 1 384 ? 88.125  56.930 31.393  1.00 18.11 ? 384  GLU A C     1 
ATOM   2770 O O     . GLU A 1 384 ? 88.452  57.041 32.577  1.00 19.02 ? 384  GLU A O     1 
ATOM   2771 C CB    . GLU A 1 384 ? 89.676  55.704 29.753  1.00 20.14 ? 384  GLU A CB    1 
ATOM   2772 C CG    . GLU A 1 384 ? 90.923  55.958 30.614  1.00 23.73 ? 384  GLU A CG    1 
ATOM   2773 C CD    . GLU A 1 384 ? 92.207  56.064 29.840  1.00 28.48 ? 384  GLU A CD    1 
ATOM   2774 O OE1   . GLU A 1 384 ? 92.074  55.780 28.576  1.00 23.56 ? 384  GLU A OE1   1 
ATOM   2775 O OE2   . GLU A 1 384 ? 93.288  56.227 30.376  1.00 46.25 ? 384  GLU A OE2   1 
ATOM   2776 N N     . ASP A 1 385 ? 87.473  57.903 30.768  1.00 21.47 ? 385  ASP A N     1 
ATOM   2777 C CA    . ASP A 1 385 ? 87.231  59.183 31.415  1.00 21.28 ? 385  ASP A CA    1 
ATOM   2778 C C     . ASP A 1 385 ? 86.225  59.092 32.513  1.00 28.58 ? 385  ASP A C     1 
ATOM   2779 O O     . ASP A 1 385 ? 86.320  59.809 33.506  1.00 33.46 ? 385  ASP A O     1 
ATOM   2780 C CB    . ASP A 1 385 ? 86.779  60.236 30.414  1.00 24.39 ? 385  ASP A CB    1 
ATOM   2781 C CG    . ASP A 1 385 ? 87.942  60.611 29.528  1.00 45.18 ? 385  ASP A CG    1 
ATOM   2782 O OD1   . ASP A 1 385 ? 89.103  60.532 30.158  1.00 48.28 ? 385  ASP A OD1   1 
ATOM   2783 O OD2   . ASP A 1 385 ? 87.821  60.819 28.324  1.00 55.01 ? 385  ASP A OD2   1 
ATOM   2784 N N     . GLU A 1 386 ? 85.222  58.250 32.293  1.00 20.14 ? 386  GLU A N     1 
ATOM   2785 C CA    . GLU A 1 386 ? 84.192  58.033 33.284  1.00 21.71 ? 386  GLU A CA    1 
ATOM   2786 C C     . GLU A 1 386 ? 84.769  57.349 34.523  1.00 22.24 ? 386  GLU A C     1 
ATOM   2787 O O     . GLU A 1 386 ? 84.298  57.600 35.635  1.00 24.32 ? 386  GLU A O     1 
ATOM   2788 C CB    . GLU A 1 386 ? 82.998  57.212 32.761  1.00 16.87 ? 386  GLU A CB    1 
ATOM   2789 C CG    . GLU A 1 386 ? 82.114  57.968 31.764  1.00 24.32 ? 386  GLU A CG    1 
ATOM   2790 C CD    . GLU A 1 386 ? 81.143  57.087 30.995  1.00 31.68 ? 386  GLU A CD    1 
ATOM   2791 O OE1   . GLU A 1 386 ? 81.599  55.878 30.795  1.00 31.40 ? 386  GLU A OE1   1 
ATOM   2792 O OE2   . GLU A 1 386 ? 80.123  57.520 30.477  1.00 34.86 ? 386  GLU A OE2   1 
ATOM   2793 N N     . ALA A 1 387 ? 85.725  56.439 34.340  1.00 12.79 ? 387  ALA A N     1 
ATOM   2794 C CA    . ALA A 1 387 ? 86.273  55.730 35.466  1.00 17.05 ? 387  ALA A CA    1 
ATOM   2795 C C     . ALA A 1 387 ? 87.219  56.679 36.176  1.00 29.07 ? 387  ALA A C     1 
ATOM   2796 O O     . ALA A 1 387 ? 87.332  56.670 37.401  1.00 20.98 ? 387  ALA A O     1 
ATOM   2797 C CB    . ALA A 1 387 ? 87.047  54.486 35.027  1.00 19.80 ? 387  ALA A CB    1 
ATOM   2798 N N     . ILE A 1 388 ? 87.879  57.529 35.391  1.00 20.58 ? 388  ILE A N     1 
ATOM   2799 C CA    . ILE A 1 388 ? 88.763  58.493 35.995  1.00 25.95 ? 388  ILE A CA    1 
ATOM   2800 C C     . ILE A 1 388 ? 87.958  59.446 36.889  1.00 32.12 ? 388  ILE A C     1 
ATOM   2801 O O     . ILE A 1 388 ? 88.356  59.707 38.009  1.00 32.65 ? 388  ILE A O     1 
ATOM   2802 C CB    . ILE A 1 388 ? 89.592  59.209 34.946  1.00 30.44 ? 388  ILE A CB    1 
ATOM   2803 C CG1   . ILE A 1 388 ? 90.749  58.321 34.531  1.00 24.22 ? 388  ILE A CG1   1 
ATOM   2804 C CG2   . ILE A 1 388 ? 90.156  60.479 35.541  1.00 28.56 ? 388  ILE A CG2   1 
ATOM   2805 C CD1   . ILE A 1 388 ? 91.448  58.793 33.260  1.00 25.55 ? 388  ILE A CD1   1 
ATOM   2806 N N     . HIS A 1 389 ? 86.798  59.915 36.420  1.00 23.40 ? 389  HIS A N     1 
ATOM   2807 C CA    . HIS A 1 389 ? 85.914  60.781 37.188  1.00 27.28 ? 389  HIS A CA    1 
ATOM   2808 C C     . HIS A 1 389 ? 85.314  60.106 38.432  1.00 36.93 ? 389  HIS A C     1 
ATOM   2809 O O     . HIS A 1 389 ? 85.038  60.769 39.435  1.00 38.12 ? 389  HIS A O     1 
ATOM   2810 C CB    . HIS A 1 389 ? 84.798  61.432 36.328  1.00 31.71 ? 389  HIS A CB    1 
ATOM   2811 C CG    . HIS A 1 389 ? 83.740  62.167 37.129  1.00 57.19 ? 389  HIS A CG    1 
ATOM   2812 N ND1   . HIS A 1 389 ? 82.617  61.508 37.635  1.00 66.64 ? 389  HIS A ND1   1 
ATOM   2813 C CD2   . HIS A 1 389 ? 83.635  63.491 37.502  1.00 58.27 ? 389  HIS A CD2   1 
ATOM   2814 C CE1   . HIS A 1 389 ? 81.889  62.407 38.304  1.00 65.95 ? 389  HIS A CE1   1 
ATOM   2815 N NE2   . HIS A 1 389 ? 82.476  63.606 38.251  1.00 65.73 ? 389  HIS A NE2   1 
ATOM   2816 N N     . LYS A 1 390 ? 85.059  58.803 38.355  1.00 27.80 ? 390  LYS A N     1 
ATOM   2817 C CA    . LYS A 1 390 ? 84.418  58.060 39.409  1.00 20.87 ? 390  LYS A CA    1 
ATOM   2818 C C     . LYS A 1 390 ? 85.381  57.582 40.495  1.00 30.37 ? 390  LYS A C     1 
ATOM   2819 O O     . LYS A 1 390 ? 85.029  57.621 41.665  1.00 32.15 ? 390  LYS A O     1 
ATOM   2820 C CB    . LYS A 1 390 ? 83.587  56.908 38.848  1.00 20.52 ? 390  LYS A CB    1 
ATOM   2821 C CG    . LYS A 1 390 ? 82.965  56.026 39.925  1.00 30.56 ? 390  LYS A CG    1 
ATOM   2822 C CD    . LYS A 1 390 ? 81.645  55.426 39.466  1.00 49.36 ? 390  LYS A CD    1 
ATOM   2823 C CE    . LYS A 1 390 ? 80.869  54.704 40.561  1.00 54.86 ? 390  LYS A CE    1 
ATOM   2824 N NZ    . LYS A 1 390 ? 80.747  53.247 40.347  1.00 63.73 ? 390  LYS A NZ    1 
ATOM   2825 N N     . TYR A 1 391 ? 86.600  57.190 40.128  1.00 33.08 ? 391  TYR A N     1 
ATOM   2826 C CA    . TYR A 1 391 ? 87.555  56.639 41.072  1.00 24.69 ? 391  TYR A CA    1 
ATOM   2827 C C     . TYR A 1 391 ? 88.788  57.507 41.273  1.00 27.49 ? 391  TYR A C     1 
ATOM   2828 O O     . TYR A 1 391 ? 89.502  57.236 42.227  1.00 35.71 ? 391  TYR A O     1 
ATOM   2829 C CB    . TYR A 1 391 ? 88.057  55.239 40.652  1.00 24.15 ? 391  TYR A CB    1 
ATOM   2830 C CG    . TYR A 1 391 ? 86.933  54.270 40.427  1.00 25.97 ? 391  TYR A CG    1 
ATOM   2831 C CD1   . TYR A 1 391 ? 86.418  53.532 41.502  1.00 33.63 ? 391  TYR A CD1   1 
ATOM   2832 C CD2   . TYR A 1 391 ? 86.380  54.098 39.167  1.00 28.33 ? 391  TYR A CD2   1 
ATOM   2833 C CE1   . TYR A 1 391 ? 85.382  52.625 41.326  1.00 27.37 ? 391  TYR A CE1   1 
ATOM   2834 C CE2   . TYR A 1 391 ? 85.314  53.208 38.969  1.00 32.76 ? 391  TYR A CE2   1 
ATOM   2835 C CZ    . TYR A 1 391 ? 84.844  52.463 40.042  1.00 27.21 ? 391  TYR A CZ    1 
ATOM   2836 O OH    . TYR A 1 391 ? 83.817  51.592 39.882  1.00 35.92 ? 391  TYR A OH    1 
ATOM   2837 N N     . GLY A 1 392 ? 89.116  58.416 40.341  1.00 32.66 ? 392  GLY A N     1 
ATOM   2838 C CA    . GLY A 1 392 ? 90.310  59.247 40.437  1.00 21.07 ? 392  GLY A CA    1 
ATOM   2839 C C     . GLY A 1 392 ? 91.465  58.676 39.642  1.00 26.46 ? 392  GLY A C     1 
ATOM   2840 O O     . GLY A 1 392 ? 91.667  57.471 39.650  1.00 33.27 ? 392  GLY A O     1 
ATOM   2841 N N     . ILE A 1 393 ? 92.208  59.530 38.943  1.00 22.33 ? 393  ILE A N     1 
ATOM   2842 C CA    . ILE A 1 393 ? 93.282  59.096 38.069  1.00 27.76 ? 393  ILE A CA    1 
ATOM   2843 C C     . ILE A 1 393 ? 94.220  58.096 38.716  1.00 41.47 ? 393  ILE A C     1 
ATOM   2844 O O     . ILE A 1 393 ? 94.762  57.192 38.058  1.00 35.88 ? 393  ILE A O     1 
ATOM   2845 C CB    . ILE A 1 393 ? 94.140  60.236 37.525  1.00 37.59 ? 393  ILE A CB    1 
ATOM   2846 C CG1   . ILE A 1 393 ? 93.321  61.156 36.645  1.00 55.67 ? 393  ILE A CG1   1 
ATOM   2847 C CG2   . ILE A 1 393 ? 95.250  59.657 36.650  1.00 38.19 ? 393  ILE A CG2   1 
ATOM   2848 C CD1   . ILE A 1 393 ? 93.617  60.944 35.158  1.00 59.54 ? 393  ILE A CD1   1 
ATOM   2849 N N     . GLU A 1 394 ? 94.488  58.283 39.994  1.00 35.27 ? 394  GLU A N     1 
ATOM   2850 C CA    . GLU A 1 394 ? 95.461  57.427 40.624  1.00 41.31 ? 394  GLU A CA    1 
ATOM   2851 C C     . GLU A 1 394 ? 94.950  55.989 40.738  1.00 36.90 ? 394  GLU A C     1 
ATOM   2852 O O     . GLU A 1 394 ? 95.747  55.039 40.863  1.00 38.30 ? 394  GLU A O     1 
ATOM   2853 C CB    . GLU A 1 394 ? 95.820  57.994 42.006  1.00 44.20 ? 394  GLU A CB    1 
ATOM   2854 C CG    . GLU A 1 394 ? 94.639  57.770 42.961  1.00 53.55 ? 394  GLU A CG    1 
ATOM   2855 C CD    . GLU A 1 394 ? 94.216  58.999 43.708  1.00 65.50 ? 394  GLU A CD    1 
ATOM   2856 O OE1   . GLU A 1 394 ? 93.824  59.975 42.908  1.00 54.92 ? 394  GLU A OE1   1 
ATOM   2857 O OE2   . GLU A 1 394 ? 94.131  59.013 44.932  1.00 76.89 ? 394  GLU A OE2   1 
ATOM   2858 N N     . ASN A 1 395 ? 93.615  55.834 40.672  1.00 25.39 ? 395  ASN A N     1 
ATOM   2859 C CA    . ASN A 1 395 ? 92.979  54.538 40.870  1.00 33.25 ? 395  ASN A CA    1 
ATOM   2860 C C     . ASN A 1 395 ? 92.511  53.815 39.611  1.00 26.12 ? 395  ASN A C     1 
ATOM   2861 O O     . ASN A 1 395 ? 91.821  52.804 39.716  1.00 25.93 ? 395  ASN A O     1 
ATOM   2862 C CB    . ASN A 1 395 ? 91.772  54.655 41.807  1.00 25.52 ? 395  ASN A CB    1 
ATOM   2863 C CG    . ASN A 1 395 ? 92.172  55.169 43.176  1.00 42.09 ? 395  ASN A CG    1 
ATOM   2864 O OD1   . ASN A 1 395 ? 93.092  54.618 43.830  1.00 44.22 ? 395  ASN A OD1   1 
ATOM   2865 N ND2   . ASN A 1 395 ? 91.461  56.194 43.639  1.00 34.40 ? 395  ASN A ND2   1 
ATOM   2866 N N     . VAL A 1 396 ? 92.875  54.330 38.453  1.00 21.98 ? 396  VAL A N     1 
ATOM   2867 C CA    . VAL A 1 396 ? 92.408  53.777 37.197  1.00 23.37 ? 396  VAL A CA    1 
ATOM   2868 C C     . VAL A 1 396 ? 93.600  53.304 36.387  1.00 30.80 ? 396  VAL A C     1 
ATOM   2869 O O     . VAL A 1 396 ? 94.590  54.014 36.232  1.00 31.31 ? 396  VAL A O     1 
ATOM   2870 C CB    . VAL A 1 396 ? 91.528  54.724 36.368  1.00 21.76 ? 396  VAL A CB    1 
ATOM   2871 C CG1   . VAL A 1 396 ? 91.360  54.177 34.947  1.00 19.82 ? 396  VAL A CG1   1 
ATOM   2872 C CG2   . VAL A 1 396 ? 90.147  54.863 37.014  1.00 18.95 ? 396  VAL A CG2   1 
ATOM   2873 N N     . LYS A 1 397 ? 93.488  52.057 35.915  1.00 29.24 ? 397  LYS A N     1 
ATOM   2874 C CA    . LYS A 1 397 ? 94.516  51.452 35.117  1.00 21.84 ? 397  LYS A CA    1 
ATOM   2875 C C     . LYS A 1 397 ? 93.852  50.840 33.894  1.00 23.26 ? 397  LYS A C     1 
ATOM   2876 O O     . LYS A 1 397 ? 92.826  50.190 34.016  1.00 24.97 ? 397  LYS A O     1 
ATOM   2877 C CB    . LYS A 1 397 ? 95.219  50.413 35.962  1.00 25.08 ? 397  LYS A CB    1 
ATOM   2878 C CG    . LYS A 1 397 ? 96.135  49.510 35.158  1.00 43.14 ? 397  LYS A CG    1 
ATOM   2879 C CD    . LYS A 1 397 ? 97.613  49.742 35.400  1.00 54.25 ? 397  LYS A CD    1 
ATOM   2880 C CE    . LYS A 1 397 ? 98.438  49.670 34.113  1.00 55.26 ? 397  LYS A CE    1 
ATOM   2881 N NZ    . LYS A 1 397 ? 99.668  48.856 34.252  1.00 65.17 ? 397  LYS A NZ    1 
ATOM   2882 N N     . THR A 1 398 ? 94.398  51.069 32.709  1.00 22.08 ? 398  THR A N     1 
ATOM   2883 C CA    . THR A 1 398 ? 93.822  50.465 31.534  1.00 22.96 ? 398  THR A CA    1 
ATOM   2884 C C     . THR A 1 398 ? 94.853  49.569 30.888  1.00 25.47 ? 398  THR A C     1 
ATOM   2885 O O     . THR A 1 398 ? 96.074  49.711 31.077  1.00 27.83 ? 398  THR A O     1 
ATOM   2886 C CB    . THR A 1 398 ? 93.355  51.532 30.527  1.00 19.88 ? 398  THR A CB    1 
ATOM   2887 O OG1   . THR A 1 398 ? 94.487  52.169 29.967  1.00 39.12 ? 398  THR A OG1   1 
ATOM   2888 C CG2   . THR A 1 398 ? 92.478  52.538 31.240  1.00 13.67 ? 398  THR A CG2   1 
ATOM   2889 N N     . TYR A 1 399 ? 94.335  48.647 30.101  1.00 13.19 ? 399  TYR A N     1 
ATOM   2890 C CA    . TYR A 1 399 ? 95.175  47.783 29.316  1.00 8.00  ? 399  TYR A CA    1 
ATOM   2891 C C     . TYR A 1 399 ? 94.585  47.838 27.922  1.00 16.76 ? 399  TYR A C     1 
ATOM   2892 O O     . TYR A 1 399 ? 93.377  47.925 27.777  1.00 18.36 ? 399  TYR A O     1 
ATOM   2893 C CB    . TYR A 1 399 ? 94.985  46.365 29.808  1.00 16.15 ? 399  TYR A CB    1 
ATOM   2894 C CG    . TYR A 1 399 ? 95.553  46.197 31.161  1.00 18.14 ? 399  TYR A CG    1 
ATOM   2895 C CD1   . TYR A 1 399 ? 96.904  45.907 31.292  1.00 18.00 ? 399  TYR A CD1   1 
ATOM   2896 C CD2   . TYR A 1 399 ? 94.751  46.344 32.285  1.00 23.12 ? 399  TYR A CD2   1 
ATOM   2897 C CE1   . TYR A 1 399 ? 97.436  45.702 32.554  1.00 18.89 ? 399  TYR A CE1   1 
ATOM   2898 C CE2   . TYR A 1 399 ? 95.272  46.136 33.567  1.00 24.16 ? 399  TYR A CE2   1 
ATOM   2899 C CZ    . TYR A 1 399 ? 96.624  45.813 33.683  1.00 19.57 ? 399  TYR A CZ    1 
ATOM   2900 O OH    . TYR A 1 399 ? 97.165  45.575 34.915  1.00 28.70 ? 399  TYR A OH    1 
ATOM   2901 N N     . SER A 1 400 ? 95.413  47.754 26.881  1.00 12.98 ? 400  SER A N     1 
ATOM   2902 C CA    . SER A 1 400 ? 94.842  47.841 25.553  1.00 15.34 ? 400  SER A CA    1 
ATOM   2903 C C     . SER A 1 400 ? 95.726  47.078 24.596  1.00 23.06 ? 400  SER A C     1 
ATOM   2904 O O     . SER A 1 400 ? 96.858  46.693 24.931  1.00 22.33 ? 400  SER A O     1 
ATOM   2905 C CB    . SER A 1 400 ? 94.576  49.275 25.122  1.00 27.16 ? 400  SER A CB    1 
ATOM   2906 O OG    . SER A 1 400 ? 95.777  49.917 24.721  1.00 32.17 ? 400  SER A OG    1 
ATOM   2907 N N     . THR A 1 401 ? 95.172  46.784 23.421  1.00 17.54 ? 401  THR A N     1 
ATOM   2908 C CA    . THR A 1 401 ? 95.897  46.091 22.368  1.00 16.18 ? 401  THR A CA    1 
ATOM   2909 C C     . THR A 1 401 ? 95.327  46.535 21.035  1.00 18.88 ? 401  THR A C     1 
ATOM   2910 O O     . THR A 1 401 ? 94.197  47.021 20.956  1.00 15.64 ? 401  THR A O     1 
ATOM   2911 C CB    . THR A 1 401 ? 95.954  44.539 22.524  1.00 31.07 ? 401  THR A CB    1 
ATOM   2912 O OG1   . THR A 1 401 ? 96.865  44.037 21.555  1.00 24.21 ? 401  THR A OG1   1 
ATOM   2913 C CG2   . THR A 1 401 ? 94.599  43.869 22.312  1.00 16.23 ? 401  THR A CG2   1 
ATOM   2914 N N     . SER A 1 402 ? 96.169  46.439 20.007  1.00 14.64 ? 402  SER A N     1 
ATOM   2915 C CA    . SER A 1 402 ? 95.777  46.819 18.656  1.00 14.43 ? 402  SER A CA    1 
ATOM   2916 C C     . SER A 1 402 ? 96.521  45.820 17.783  1.00 16.14 ? 402  SER A C     1 
ATOM   2917 O O     . SER A 1 402 ? 97.694  45.572 17.987  1.00 23.55 ? 402  SER A O     1 
ATOM   2918 C CB    . SER A 1 402 ? 96.237  48.261 18.395  1.00 14.42 ? 402  SER A CB    1 
ATOM   2919 O OG    . SER A 1 402 ? 95.839  48.680 17.117  1.00 31.00 ? 402  SER A OG    1 
ATOM   2920 N N     . PHE A 1 403 ? 95.798  45.146 16.891  1.00 17.53 ? 403  PHE A N     1 
ATOM   2921 C CA    . PHE A 1 403 ? 96.411  44.143 16.046  1.00 13.39 ? 403  PHE A CA    1 
ATOM   2922 C C     . PHE A 1 403 ? 95.521  43.998 14.845  1.00 10.24 ? 403  PHE A C     1 
ATOM   2923 O O     . PHE A 1 403 ? 94.355  44.428 14.840  1.00 15.52 ? 403  PHE A O     1 
ATOM   2924 C CB    . PHE A 1 403 ? 96.582  42.776 16.755  1.00 21.13 ? 403  PHE A CB    1 
ATOM   2925 C CG    . PHE A 1 403 ? 95.279  42.153 17.240  1.00 15.60 ? 403  PHE A CG    1 
ATOM   2926 C CD1   . PHE A 1 403 ? 94.707  42.551 18.449  1.00 8.36  ? 403  PHE A CD1   1 
ATOM   2927 C CD2   . PHE A 1 403 ? 94.624  41.169 16.490  1.00 16.41 ? 403  PHE A CD2   1 
ATOM   2928 C CE1   . PHE A 1 403 ? 93.519  41.970 18.912  1.00 16.26 ? 403  PHE A CE1   1 
ATOM   2929 C CE2   . PHE A 1 403 ? 93.434  40.602 16.926  1.00 18.02 ? 403  PHE A CE2   1 
ATOM   2930 C CZ    . PHE A 1 403 ? 92.885  41.004 18.144  1.00 15.28 ? 403  PHE A CZ    1 
ATOM   2931 N N     . THR A 1 404 ? 96.093  43.342 13.843  1.00 12.21 ? 404  THR A N     1 
ATOM   2932 C CA    . THR A 1 404 ? 95.404  43.003 12.600  1.00 12.70 ? 404  THR A CA    1 
ATOM   2933 C C     . THR A 1 404 ? 94.950  41.559 12.675  1.00 15.88 ? 404  THR A C     1 
ATOM   2934 O O     . THR A 1 404 ? 95.783  40.667 12.721  1.00 15.90 ? 404  THR A O     1 
ATOM   2935 C CB    . THR A 1 404 ? 96.328  43.127 11.384  1.00 21.62 ? 404  THR A CB    1 
ATOM   2936 O OG1   . THR A 1 404 ? 96.790  44.464 11.274  1.00 15.49 ? 404  THR A OG1   1 
ATOM   2937 C CG2   . THR A 1 404 ? 95.532  42.761 10.127  1.00 21.05 ? 404  THR A CG2   1 
ATOM   2938 N N     . PRO A 1 405 ? 93.648  41.319 12.627  1.00 16.02 ? 405  PRO A N     1 
ATOM   2939 C CA    . PRO A 1 405 ? 93.164  39.940 12.693  1.00 16.69 ? 405  PRO A CA    1 
ATOM   2940 C C     . PRO A 1 405 ? 93.815  39.027 11.639  1.00 13.48 ? 405  PRO A C     1 
ATOM   2941 O O     . PRO A 1 405 ? 94.028  39.390 10.490  1.00 13.19 ? 405  PRO A O     1 
ATOM   2942 C CB    . PRO A 1 405 ? 91.640  39.993 12.477  1.00 18.04 ? 405  PRO A CB    1 
ATOM   2943 C CG    . PRO A 1 405 ? 91.266  41.422 12.855  1.00 5.00  ? 405  PRO A CG    1 
ATOM   2944 C CD    . PRO A 1 405 ? 92.513  42.263 12.637  1.00 9.29  ? 405  PRO A CD    1 
ATOM   2945 N N     . MET A 1 406 ? 94.156  37.833 12.075  1.00 16.90 ? 406  MET A N     1 
ATOM   2946 C CA    . MET A 1 406 ? 94.718  36.794 11.258  1.00 14.86 ? 406  MET A CA    1 
ATOM   2947 C C     . MET A 1 406 ? 93.928  36.577 9.953   1.00 16.57 ? 406  MET A C     1 
ATOM   2948 O O     . MET A 1 406 ? 94.496  36.142 8.969   1.00 17.37 ? 406  MET A O     1 
ATOM   2949 C CB    . MET A 1 406 ? 94.721  35.572 12.187  1.00 16.14 ? 406  MET A CB    1 
ATOM   2950 C CG    . MET A 1 406 ? 94.820  34.290 11.468  1.00 29.02 ? 406  MET A CG    1 
ATOM   2951 S SD    . MET A 1 406 ? 95.278  33.045 12.667  1.00 28.62 ? 406  MET A SD    1 
ATOM   2952 C CE    . MET A 1 406 ? 95.750  31.805 11.465  1.00 31.03 ? 406  MET A CE    1 
ATOM   2953 N N     . TYR A 1 407 ? 92.627  36.910 9.922   1.00 11.60 ? 407  TYR A N     1 
ATOM   2954 C CA    . TYR A 1 407 ? 91.811  36.859 8.706   1.00 13.83 ? 407  TYR A CA    1 
ATOM   2955 C C     . TYR A 1 407 ? 92.505  37.661 7.601   1.00 16.14 ? 407  TYR A C     1 
ATOM   2956 O O     . TYR A 1 407 ? 92.413  37.314 6.449   1.00 14.15 ? 407  TYR A O     1 
ATOM   2957 C CB    . TYR A 1 407 ? 90.385  37.418 8.921   1.00 5.18  ? 407  TYR A CB    1 
ATOM   2958 C CG    . TYR A 1 407 ? 89.644  37.564 7.604   1.00 13.58 ? 407  TYR A CG    1 
ATOM   2959 C CD1   . TYR A 1 407 ? 88.938  36.497 7.037   1.00 11.59 ? 407  TYR A CD1   1 
ATOM   2960 C CD2   . TYR A 1 407 ? 89.704  38.777 6.919   1.00 11.92 ? 407  TYR A CD2   1 
ATOM   2961 C CE1   . TYR A 1 407 ? 88.342  36.619 5.787   1.00 11.97 ? 407  TYR A CE1   1 
ATOM   2962 C CE2   . TYR A 1 407 ? 89.083  38.934 5.675   1.00 16.02 ? 407  TYR A CE2   1 
ATOM   2963 C CZ    . TYR A 1 407 ? 88.408  37.845 5.122   1.00 17.91 ? 407  TYR A CZ    1 
ATOM   2964 O OH    . TYR A 1 407 ? 87.818  38.022 3.913   1.00 20.90 ? 407  TYR A OH    1 
ATOM   2965 N N     . HIS A 1 408 ? 93.217  38.730 7.961   1.00 13.04 ? 408  HIS A N     1 
ATOM   2966 C CA    . HIS A 1 408 ? 93.821  39.614 6.949   1.00 11.68 ? 408  HIS A CA    1 
ATOM   2967 C C     . HIS A 1 408 ? 95.279  39.296 6.702   1.00 14.86 ? 408  HIS A C     1 
ATOM   2968 O O     . HIS A 1 408 ? 95.948  40.016 5.986   1.00 26.08 ? 408  HIS A O     1 
ATOM   2969 C CB    . HIS A 1 408 ? 93.714  41.079 7.360   1.00 11.87 ? 408  HIS A CB    1 
ATOM   2970 C CG    . HIS A 1 408 ? 92.311  41.617 7.449   1.00 5.00  ? 408  HIS A CG    1 
ATOM   2971 N ND1   . HIS A 1 408 ? 91.494  41.734 6.311   1.00 11.04 ? 408  HIS A ND1   1 
ATOM   2972 C CD2   . HIS A 1 408 ? 91.600  42.112 8.519   1.00 11.92 ? 408  HIS A CD2   1 
ATOM   2973 C CE1   . HIS A 1 408 ? 90.340  42.286 6.731   1.00 9.26  ? 408  HIS A CE1   1 
ATOM   2974 N NE2   . HIS A 1 408 ? 90.412  42.540 8.027   1.00 7.24  ? 408  HIS A NE2   1 
ATOM   2975 N N     . ALA A 1 409 ? 95.753  38.176 7.238   1.00 20.03 ? 409  ALA A N     1 
ATOM   2976 C CA    . ALA A 1 409 ? 97.126  37.765 7.020   1.00 19.70 ? 409  ALA A CA    1 
ATOM   2977 C C     . ALA A 1 409 ? 97.404  37.572 5.534   1.00 21.76 ? 409  ALA A C     1 
ATOM   2978 O O     . ALA A 1 409 ? 98.539  37.661 5.083   1.00 26.98 ? 409  ALA A O     1 
ATOM   2979 C CB    . ALA A 1 409 ? 97.372  36.471 7.774   1.00 16.37 ? 409  ALA A CB    1 
ATOM   2980 N N     . VAL A 1 410 ? 96.354  37.286 4.768   1.00 24.88 ? 410  VAL A N     1 
ATOM   2981 C CA    . VAL A 1 410 ? 96.457  36.992 3.353   1.00 17.70 ? 410  VAL A CA    1 
ATOM   2982 C C     . VAL A 1 410 ? 95.671  37.984 2.452   1.00 20.38 ? 410  VAL A C     1 
ATOM   2983 O O     . VAL A 1 410 ? 95.537  37.754 1.252   1.00 23.08 ? 410  VAL A O     1 
ATOM   2984 C CB    . VAL A 1 410 ? 96.076  35.523 3.080   1.00 23.70 ? 410  VAL A CB    1 
ATOM   2985 C CG1   . VAL A 1 410 ? 96.925  34.556 3.919   1.00 22.90 ? 410  VAL A CG1   1 
ATOM   2986 C CG2   . VAL A 1 410 ? 94.603  35.310 3.374   1.00 20.67 ? 410  VAL A CG2   1 
ATOM   2987 N N     . THR A 1 411 ? 95.147  39.094 2.977   1.00 15.44 ? 411  THR A N     1 
ATOM   2988 C CA    . THR A 1 411 ? 94.365  39.998 2.144   1.00 15.13 ? 411  THR A CA    1 
ATOM   2989 C C     . THR A 1 411 ? 95.112  41.333 1.948   1.00 19.23 ? 411  THR A C     1 
ATOM   2990 O O     . THR A 1 411 ? 95.944  41.718 2.769   1.00 16.60 ? 411  THR A O     1 
ATOM   2991 C CB    . THR A 1 411 ? 92.947  40.245 2.719   1.00 10.97 ? 411  THR A CB    1 
ATOM   2992 O OG1   . THR A 1 411 ? 93.114  40.838 3.983   1.00 13.81 ? 411  THR A OG1   1 
ATOM   2993 C CG2   . THR A 1 411 ? 92.216  38.932 2.910   1.00 15.64 ? 411  THR A CG2   1 
ATOM   2994 N N     . LYS A 1 412 ? 94.802  42.033 0.844   1.00 15.31 ? 412  LYS A N     1 
ATOM   2995 C CA    . LYS A 1 412 ? 95.404  43.333 0.578   1.00 11.18 ? 412  LYS A CA    1 
ATOM   2996 C C     . LYS A 1 412 ? 94.607  44.371 1.349   1.00 15.34 ? 412  LYS A C     1 
ATOM   2997 O O     . LYS A 1 412 ? 95.106  45.443 1.704   1.00 18.70 ? 412  LYS A O     1 
ATOM   2998 C CB    . LYS A 1 412 ? 95.323  43.686 -0.898  1.00 5.00  ? 412  LYS A CB    1 
ATOM   2999 C CG    . LYS A 1 412 ? 96.388  42.954 -1.687  1.00 12.34 ? 412  LYS A CG    1 
ATOM   3000 C CD    . LYS A 1 412 ? 96.163  43.154 -3.181  1.00 25.58 ? 412  LYS A CD    1 
ATOM   3001 C CE    . LYS A 1 412 ? 97.151  42.379 -4.028  1.00 39.28 ? 412  LYS A CE    1 
ATOM   3002 N NZ    . LYS A 1 412 ? 96.588  41.938 -5.316  1.00 60.05 ? 412  LYS A NZ    1 
ATOM   3003 N N     . ARG A 1 413 ? 93.318  44.092 1.530   1.00 12.42 ? 413  ARG A N     1 
ATOM   3004 C CA    . ARG A 1 413 ? 92.461  44.956 2.319   1.00 12.38 ? 413  ARG A CA    1 
ATOM   3005 C C     . ARG A 1 413 ? 92.706  44.605 3.798   1.00 16.90 ? 413  ARG A C     1 
ATOM   3006 O O     . ARG A 1 413 ? 92.923  43.447 4.151   1.00 18.86 ? 413  ARG A O     1 
ATOM   3007 C CB    . ARG A 1 413 ? 91.000  44.700 1.931   1.00 16.07 ? 413  ARG A CB    1 
ATOM   3008 C CG    . ARG A 1 413 ? 90.007  45.570 2.701   1.00 20.46 ? 413  ARG A CG    1 
ATOM   3009 C CD    . ARG A 1 413 ? 88.535  45.230 2.412   1.00 25.90 ? 413  ARG A CD    1 
ATOM   3010 N NE    . ARG A 1 413 ? 88.176  43.901 2.884   1.00 21.98 ? 413  ARG A NE    1 
ATOM   3011 C CZ    . ARG A 1 413 ? 87.492  43.702 4.008   1.00 23.51 ? 413  ARG A CZ    1 
ATOM   3012 N NH1   . ARG A 1 413 ? 87.060  44.745 4.693   1.00 16.47 ? 413  ARG A NH1   1 
ATOM   3013 N NH2   . ARG A 1 413 ? 87.224  42.486 4.466   1.00 15.32 ? 413  ARG A NH2   1 
ATOM   3014 N N     . LYS A 1 414 ? 92.735  45.610 4.670   1.00 12.61 ? 414  LYS A N     1 
ATOM   3015 C CA    . LYS A 1 414 ? 92.980  45.385 6.100   1.00 11.47 ? 414  LYS A CA    1 
ATOM   3016 C C     . LYS A 1 414 ? 92.003  46.164 6.984   1.00 18.03 ? 414  LYS A C     1 
ATOM   3017 O O     . LYS A 1 414 ? 91.494  47.229 6.633   1.00 18.11 ? 414  LYS A O     1 
ATOM   3018 C CB    . LYS A 1 414 ? 94.371  45.877 6.494   1.00 23.26 ? 414  LYS A CB    1 
ATOM   3019 C CG    . LYS A 1 414 ? 95.463  45.372 5.565   1.00 20.40 ? 414  LYS A CG    1 
ATOM   3020 C CD    . LYS A 1 414 ? 95.958  43.993 5.960   1.00 22.91 ? 414  LYS A CD    1 
ATOM   3021 C CE    . LYS A 1 414 ? 96.946  43.484 4.925   1.00 21.35 ? 414  LYS A CE    1 
ATOM   3022 N NZ    . LYS A 1 414 ? 97.546  42.187 5.237   1.00 22.03 ? 414  LYS A NZ    1 
ATOM   3023 N N     . THR A 1 415 ? 91.764  45.621 8.172   1.00 15.63 ? 415  THR A N     1 
ATOM   3024 C CA    . THR A 1 415 ? 90.985  46.284 9.191   1.00 10.63 ? 415  THR A CA    1 
ATOM   3025 C C     . THR A 1 415 ? 91.760  45.965 10.439  1.00 12.77 ? 415  THR A C     1 
ATOM   3026 O O     . THR A 1 415 ? 92.585  45.065 10.482  1.00 17.73 ? 415  THR A O     1 
ATOM   3027 C CB    . THR A 1 415 ? 89.506  45.826 9.329   1.00 16.68 ? 415  THR A CB    1 
ATOM   3028 O OG1   . THR A 1 415 ? 89.439  44.463 9.695   1.00 17.01 ? 415  THR A OG1   1 
ATOM   3029 C CG2   . THR A 1 415 ? 88.716  46.124 8.063   1.00 11.00 ? 415  THR A CG2   1 
ATOM   3030 N N     . LYS A 1 416 ? 91.497  46.733 11.466  1.00 10.64 ? 416  LYS A N     1 
ATOM   3031 C CA    . LYS A 1 416 ? 92.210  46.516 12.681  1.00 10.53 ? 416  LYS A CA    1 
ATOM   3032 C C     . LYS A 1 416 ? 91.286  45.989 13.756  1.00 10.19 ? 416  LYS A C     1 
ATOM   3033 O O     . LYS A 1 416 ? 90.092  46.107 13.615  1.00 11.56 ? 416  LYS A O     1 
ATOM   3034 C CB    . LYS A 1 416 ? 92.622  47.896 13.169  1.00 20.94 ? 416  LYS A CB    1 
ATOM   3035 C CG    . LYS A 1 416 ? 93.994  47.900 13.815  1.00 42.52 ? 416  LYS A CG    1 
ATOM   3036 C CD    . LYS A 1 416 ? 94.355  49.286 14.351  1.00 50.06 ? 416  LYS A CD    1 
ATOM   3037 C CE    . LYS A 1 416 ? 94.670  50.267 13.241  1.00 48.23 ? 416  LYS A CE    1 
ATOM   3038 N NZ    . LYS A 1 416 ? 95.106  51.574 13.743  1.00 57.90 ? 416  LYS A NZ    1 
ATOM   3039 N N     . CYS A 1 417 ? 91.864  45.514 14.846  1.00 11.98 ? 417  CYS A N     1 
ATOM   3040 C CA    . CYS A 1 417 ? 91.104  45.146 16.003  1.00 12.00 ? 417  CYS A CA    1 
ATOM   3041 C C     . CYS A 1 417 ? 91.702  45.906 17.194  1.00 14.34 ? 417  CYS A C     1 
ATOM   3042 O O     . CYS A 1 417 ? 92.899  45.837 17.426  1.00 16.66 ? 417  CYS A O     1 
ATOM   3043 C CB    . CYS A 1 417 ? 91.139  43.613 16.251  1.00 14.29 ? 417  CYS A CB    1 
ATOM   3044 S SG    . CYS A 1 417 ? 90.207  43.197 17.753  1.00 17.24 ? 417  CYS A SG    1 
ATOM   3045 N N     . VAL A 1 418 ? 90.902  46.703 17.899  1.00 11.96 ? 418  VAL A N     1 
ATOM   3046 C CA    . VAL A 1 418 ? 91.361  47.419 19.078  1.00 11.37 ? 418  VAL A CA    1 
ATOM   3047 C C     . VAL A 1 418 ? 90.515  46.987 20.276  1.00 14.55 ? 418  VAL A C     1 
ATOM   3048 O O     . VAL A 1 418 ? 89.285  46.879 20.232  1.00 13.71 ? 418  VAL A O     1 
ATOM   3049 C CB    . VAL A 1 418 ? 91.335  48.948 18.963  1.00 13.72 ? 418  VAL A CB    1 
ATOM   3050 C CG1   . VAL A 1 418 ? 92.180  49.439 17.785  1.00 14.50 ? 418  VAL A CG1   1 
ATOM   3051 C CG2   . VAL A 1 418 ? 89.907  49.387 18.695  1.00 13.07 ? 418  VAL A CG2   1 
ATOM   3052 N N     . MET A 1 419 ? 91.195  46.745 21.391  1.00 15.88 ? 419  MET A N     1 
ATOM   3053 C CA    . MET A 1 419 ? 90.576  46.348 22.638  1.00 7.97  ? 419  MET A CA    1 
ATOM   3054 C C     . MET A 1 419 ? 91.161  47.125 23.810  1.00 20.19 ? 419  MET A C     1 
ATOM   3055 O O     . MET A 1 419 ? 92.381  47.235 23.986  1.00 19.31 ? 419  MET A O     1 
ATOM   3056 C CB    . MET A 1 419 ? 90.794  44.867 22.938  1.00 8.82  ? 419  MET A CB    1 
ATOM   3057 C CG    . MET A 1 419 ? 90.154  43.953 21.938  1.00 13.29 ? 419  MET A CG    1 
ATOM   3058 S SD    . MET A 1 419 ? 90.704  42.248 22.206  1.00 19.28 ? 419  MET A SD    1 
ATOM   3059 C CE    . MET A 1 419 ? 89.628  41.501 20.963  1.00 21.28 ? 419  MET A CE    1 
ATOM   3060 N N     . LYS A 1 420 ? 90.293  47.541 24.707  1.00 14.43 ? 420  LYS A N     1 
ATOM   3061 C CA    . LYS A 1 420 ? 90.769  48.255 25.865  1.00 13.33 ? 420  LYS A CA    1 
ATOM   3062 C C     . LYS A 1 420 ? 89.986  47.781 27.045  1.00 20.71 ? 420  LYS A C     1 
ATOM   3063 O O     . LYS A 1 420 ? 88.763  47.649 26.996  1.00 14.90 ? 420  LYS A O     1 
ATOM   3064 C CB    . LYS A 1 420 ? 90.523  49.751 25.655  1.00 11.22 ? 420  LYS A CB    1 
ATOM   3065 C CG    . LYS A 1 420 ? 90.607  50.577 26.935  1.00 13.72 ? 420  LYS A CG    1 
ATOM   3066 C CD    . LYS A 1 420 ? 91.251  51.916 26.632  1.00 20.85 ? 420  LYS A CD    1 
ATOM   3067 C CE    . LYS A 1 420 ? 90.391  53.108 26.854  1.00 23.54 ? 420  LYS A CE    1 
ATOM   3068 N NZ    . LYS A 1 420 ? 90.995  54.308 26.219  1.00 15.24 ? 420  LYS A NZ    1 
ATOM   3069 N N     . MET A 1 421 ? 90.727  47.527 28.109  1.00 13.11 ? 421  MET A N     1 
ATOM   3070 C CA    . MET A 1 421 ? 90.136  47.122 29.382  1.00 8.73  ? 421  MET A CA    1 
ATOM   3071 C C     . MET A 1 421 ? 90.440  48.213 30.417  1.00 14.55 ? 421  MET A C     1 
ATOM   3072 O O     . MET A 1 421 ? 91.603  48.532 30.655  1.00 20.05 ? 421  MET A O     1 
ATOM   3073 C CB    . MET A 1 421 ? 90.689  45.756 29.866  1.00 12.28 ? 421  MET A CB    1 
ATOM   3074 C CG    . MET A 1 421 ? 90.277  45.346 31.285  1.00 25.39 ? 421  MET A CG    1 
ATOM   3075 S SD    . MET A 1 421 ? 91.129  43.844 31.891  1.00 25.27 ? 421  MET A SD    1 
ATOM   3076 C CE    . MET A 1 421 ? 90.546  42.629 30.672  1.00 20.63 ? 421  MET A CE    1 
ATOM   3077 N N     . VAL A 1 422 ? 89.380  48.711 31.058  1.00 13.98 ? 422  VAL A N     1 
ATOM   3078 C CA    . VAL A 1 422 ? 89.481  49.738 32.097  1.00 15.25 ? 422  VAL A CA    1 
ATOM   3079 C C     . VAL A 1 422 ? 89.311  49.089 33.476  1.00 18.42 ? 422  VAL A C     1 
ATOM   3080 O O     . VAL A 1 422 ? 88.273  48.500 33.753  1.00 17.86 ? 422  VAL A O     1 
ATOM   3081 C CB    . VAL A 1 422 ? 88.446  50.822 31.816  1.00 20.29 ? 422  VAL A CB    1 
ATOM   3082 C CG1   . VAL A 1 422 ? 88.550  51.975 32.808  1.00 14.11 ? 422  VAL A CG1   1 
ATOM   3083 C CG2   . VAL A 1 422 ? 88.646  51.315 30.387  1.00 14.49 ? 422  VAL A CG2   1 
ATOM   3084 N N     . CYS A 1 423 ? 90.331  49.141 34.338  1.00 15.90 ? 423  CYS A N     1 
ATOM   3085 C CA    . CYS A 1 423 ? 90.276  48.521 35.683  1.00 14.75 ? 423  CYS A CA    1 
ATOM   3086 C C     . CYS A 1 423 ? 90.312  49.587 36.789  1.00 18.99 ? 423  CYS A C     1 
ATOM   3087 O O     . CYS A 1 423 ? 90.900  50.650 36.600  1.00 18.96 ? 423  CYS A O     1 
ATOM   3088 C CB    . CYS A 1 423 ? 91.482  47.634 35.906  1.00 17.71 ? 423  CYS A CB    1 
ATOM   3089 S SG    . CYS A 1 423 ? 91.477  46.260 34.757  1.00 20.72 ? 423  CYS A SG    1 
ATOM   3090 N N     . ALA A 1 424 ? 89.760  49.283 37.964  1.00 15.00 ? 424  ALA A N     1 
ATOM   3091 C CA    . ALA A 1 424 ? 89.693  50.252 39.047  1.00 17.05 ? 424  ALA A CA    1 
ATOM   3092 C C     . ALA A 1 424 ? 90.200  49.652 40.341  1.00 28.18 ? 424  ALA A C     1 
ATOM   3093 O O     . ALA A 1 424 ? 89.982  48.476 40.648  1.00 27.71 ? 424  ALA A O     1 
ATOM   3094 C CB    . ALA A 1 424 ? 88.273  50.738 39.274  1.00 20.43 ? 424  ALA A CB    1 
ATOM   3095 N N     . ASN A 1 425 ? 90.824  50.512 41.144  1.00 34.92 ? 425  ASN A N     1 
ATOM   3096 C CA    . ASN A 1 425 ? 91.345  50.092 42.427  1.00 15.69 ? 425  ASN A CA    1 
ATOM   3097 C C     . ASN A 1 425 ? 92.439  49.053 42.276  1.00 23.18 ? 425  ASN A C     1 
ATOM   3098 O O     . ASN A 1 425 ? 92.826  48.705 41.167  1.00 37.77 ? 425  ASN A O     1 
ATOM   3099 C CB    . ASN A 1 425 ? 90.236  49.656 43.371  1.00 23.27 ? 425  ASN A CB    1 
ATOM   3100 C CG    . ASN A 1 425 ? 89.215  50.758 43.486  1.00 27.18 ? 425  ASN A CG    1 
ATOM   3101 O OD1   . ASN A 1 425 ? 88.012  50.497 43.645  1.00 42.56 ? 425  ASN A OD1   1 
ATOM   3102 N ND2   . ASN A 1 425 ? 89.692  51.998 43.430  1.00 27.28 ? 425  ASN A ND2   1 
ATOM   3103 N N     . LYS A 1 426 ? 92.961  48.604 43.425  1.00 35.37 ? 426  LYS A N     1 
ATOM   3104 C CA    . LYS A 1 426 ? 94.116  47.709 43.558  1.00 41.90 ? 426  LYS A CA    1 
ATOM   3105 C C     . LYS A 1 426 ? 93.865  46.278 43.072  1.00 22.76 ? 426  LYS A C     1 
ATOM   3106 O O     . LYS A 1 426 ? 94.720  45.584 42.512  1.00 33.71 ? 426  LYS A O     1 
ATOM   3107 C CB    . LYS A 1 426 ? 94.700  47.814 44.969  1.00 43.62 ? 426  LYS A CB    1 
ATOM   3108 C CG    . LYS A 1 426 ? 95.302  46.528 45.530  1.00 55.08 ? 426  LYS A CG    1 
ATOM   3109 C CD    . LYS A 1 426 ? 94.816  46.192 46.942  1.00 62.53 ? 426  LYS A CD    1 
ATOM   3110 C CE    . LYS A 1 426 ? 94.246  47.398 47.692  1.00 65.15 ? 426  LYS A CE    1 
ATOM   3111 N NZ    . LYS A 1 426 ? 93.122  47.094 48.602  1.00 63.57 ? 426  LYS A NZ    1 
ATOM   3112 N N     . GLU A 1 427 ? 92.622  45.900 43.274  1.00 20.38 ? 427  GLU A N     1 
ATOM   3113 C CA    . GLU A 1 427 ? 92.060  44.630 42.867  1.00 33.57 ? 427  GLU A CA    1 
ATOM   3114 C C     . GLU A 1 427 ? 91.942  44.606 41.335  1.00 23.89 ? 427  GLU A C     1 
ATOM   3115 O O     . GLU A 1 427 ? 91.910  43.556 40.733  1.00 27.18 ? 427  GLU A O     1 
ATOM   3116 C CB    . GLU A 1 427 ? 90.690  44.520 43.577  1.00 34.43 ? 427  GLU A CB    1 
ATOM   3117 C CG    . GLU A 1 427 ? 90.018  45.908 43.787  1.00 58.47 ? 427  GLU A CG    1 
ATOM   3118 C CD    . GLU A 1 427 ? 90.350  46.672 45.063  1.00 68.46 ? 427  GLU A CD    1 
ATOM   3119 O OE1   . GLU A 1 427 ? 91.630  46.749 45.354  1.00 73.52 ? 427  GLU A OE1   1 
ATOM   3120 O OE2   . GLU A 1 427 ? 89.511  47.301 45.690  1.00 80.00 ? 427  GLU A OE2   1 
ATOM   3121 N N     . GLU A 1 428 ? 91.937  45.779 40.706  1.00 22.52 ? 428  GLU A N     1 
ATOM   3122 C CA    . GLU A 1 428 ? 91.818  45.858 39.267  1.00 17.37 ? 428  GLU A CA    1 
ATOM   3123 C C     . GLU A 1 428 ? 90.512  45.256 38.841  1.00 22.32 ? 428  GLU A C     1 
ATOM   3124 O O     . GLU A 1 428 ? 90.453  44.374 37.997  1.00 20.53 ? 428  GLU A O     1 
ATOM   3125 C CB    . GLU A 1 428 ? 92.960  45.115 38.590  1.00 18.27 ? 428  GLU A CB    1 
ATOM   3126 C CG    . GLU A 1 428 ? 94.199  45.997 38.645  1.00 22.06 ? 428  GLU A CG    1 
ATOM   3127 C CD    . GLU A 1 428 ? 95.228  45.571 37.661  1.00 25.73 ? 428  GLU A CD    1 
ATOM   3128 O OE1   . GLU A 1 428 ? 95.283  44.278 37.459  1.00 43.17 ? 428  GLU A OE1   1 
ATOM   3129 O OE2   . GLU A 1 428 ? 95.965  46.359 37.138  1.00 41.72 ? 428  GLU A OE2   1 
ATOM   3130 N N     . LYS A 1 429 ? 89.457  45.775 39.439  1.00 15.76 ? 429  LYS A N     1 
ATOM   3131 C CA    . LYS A 1 429 ? 88.127  45.367 39.077  1.00 20.20 ? 429  LYS A CA    1 
ATOM   3132 C C     . LYS A 1 429 ? 87.861  45.821 37.656  1.00 21.13 ? 429  LYS A C     1 
ATOM   3133 O O     . LYS A 1 429 ? 88.113  46.971 37.328  1.00 19.37 ? 429  LYS A O     1 
ATOM   3134 C CB    . LYS A 1 429 ? 87.202  46.147 39.947  1.00 21.92 ? 429  LYS A CB    1 
ATOM   3135 C CG    . LYS A 1 429 ? 85.765  45.896 39.588  1.00 24.11 ? 429  LYS A CG    1 
ATOM   3136 C CD    . LYS A 1 429 ? 84.930  45.967 40.835  1.00 39.85 ? 429  LYS A CD    1 
ATOM   3137 C CE    . LYS A 1 429 ? 83.612  46.681 40.622  1.00 51.94 ? 429  LYS A CE    1 
ATOM   3138 N NZ    . LYS A 1 429 ? 82.838  46.796 41.876  1.00 58.64 ? 429  LYS A NZ    1 
ATOM   3139 N N     . VAL A 1 430 ? 87.324  44.933 36.816  1.00 15.14 ? 430  VAL A N     1 
ATOM   3140 C CA    . VAL A 1 430 ? 87.003  45.322 35.443  1.00 13.04 ? 430  VAL A CA    1 
ATOM   3141 C C     . VAL A 1 430 ? 85.759  46.218 35.370  1.00 20.27 ? 430  VAL A C     1 
ATOM   3142 O O     . VAL A 1 430 ? 84.642  45.720 35.525  1.00 20.96 ? 430  VAL A O     1 
ATOM   3143 C CB    . VAL A 1 430 ? 86.882  44.102 34.535  1.00 15.91 ? 430  VAL A CB    1 
ATOM   3144 C CG1   . VAL A 1 430 ? 86.671  44.512 33.061  1.00 15.68 ? 430  VAL A CG1   1 
ATOM   3145 C CG2   . VAL A 1 430 ? 88.201  43.351 34.643  1.00 16.95 ? 430  VAL A CG2   1 
ATOM   3146 N N     . VAL A 1 431 ? 85.923  47.551 35.106  1.00 13.06 ? 431  VAL A N     1 
ATOM   3147 C CA    . VAL A 1 431 ? 84.784  48.467 35.055  1.00 9.53  ? 431  VAL A CA    1 
ATOM   3148 C C     . VAL A 1 431 ? 84.379  48.877 33.650  1.00 13.81 ? 431  VAL A C     1 
ATOM   3149 O O     . VAL A 1 431 ? 83.347  49.522 33.481  1.00 13.09 ? 431  VAL A O     1 
ATOM   3150 C CB    . VAL A 1 431 ? 84.938  49.686 35.936  1.00 15.00 ? 431  VAL A CB    1 
ATOM   3151 C CG1   . VAL A 1 431 ? 85.140  49.154 37.340  1.00 17.08 ? 431  VAL A CG1   1 
ATOM   3152 C CG2   . VAL A 1 431 ? 86.176  50.476 35.539  1.00 13.51 ? 431  VAL A CG2   1 
ATOM   3153 N N     . GLY A 1 432 ? 85.152  48.473 32.630  1.00 11.98 ? 432  GLY A N     1 
ATOM   3154 C CA    . GLY A 1 432 ? 84.749  48.794 31.266  1.00 10.86 ? 432  GLY A CA    1 
ATOM   3155 C C     . GLY A 1 432 ? 85.568  47.984 30.265  1.00 17.55 ? 432  GLY A C     1 
ATOM   3156 O O     . GLY A 1 432 ? 86.772  47.761 30.464  1.00 14.08 ? 432  GLY A O     1 
ATOM   3157 N N     . ILE A 1 433 ? 84.872  47.548 29.188  1.00 13.25 ? 433  ILE A N     1 
ATOM   3158 C CA    . ILE A 1 433 ? 85.481  46.853 28.059  1.00 15.53 ? 433  ILE A CA    1 
ATOM   3159 C C     . ILE A 1 433 ? 85.043  47.546 26.777  1.00 8.76  ? 433  ILE A C     1 
ATOM   3160 O O     . ILE A 1 433 ? 83.868  47.818 26.635  1.00 11.86 ? 433  ILE A O     1 
ATOM   3161 C CB    . ILE A 1 433 ? 85.109  45.367 28.025  1.00 15.66 ? 433  ILE A CB    1 
ATOM   3162 C CG1   . ILE A 1 433 ? 85.723  44.723 29.259  1.00 11.49 ? 433  ILE A CG1   1 
ATOM   3163 C CG2   . ILE A 1 433 ? 85.750  44.736 26.803  1.00 15.25 ? 433  ILE A CG2   1 
ATOM   3164 C CD1   . ILE A 1 433 ? 85.386  43.258 29.391  1.00 29.28 ? 433  ILE A CD1   1 
ATOM   3165 N N     . HIS A 1 434 ? 86.002  47.842 25.879  1.00 9.50  ? 434  HIS A N     1 
ATOM   3166 C CA    . HIS A 1 434 ? 85.722  48.567 24.643  1.00 7.74  ? 434  HIS A CA    1 
ATOM   3167 C C     . HIS A 1 434 ? 86.511  47.909 23.539  1.00 5.00  ? 434  HIS A C     1 
ATOM   3168 O O     . HIS A 1 434 ? 87.704  47.668 23.682  1.00 14.27 ? 434  HIS A O     1 
ATOM   3169 C CB    . HIS A 1 434 ? 86.136  50.058 24.755  1.00 15.60 ? 434  HIS A CB    1 
ATOM   3170 C CG    . HIS A 1 434 ? 85.644  50.698 26.021  1.00 9.88  ? 434  HIS A CG    1 
ATOM   3171 N ND1   . HIS A 1 434 ? 84.331  51.081 26.207  1.00 10.91 ? 434  HIS A ND1   1 
ATOM   3172 C CD2   . HIS A 1 434 ? 86.312  50.972 27.172  1.00 13.98 ? 434  HIS A CD2   1 
ATOM   3173 C CE1   . HIS A 1 434 ? 84.208  51.528 27.436  1.00 11.64 ? 434  HIS A CE1   1 
ATOM   3174 N NE2   . HIS A 1 434 ? 85.403  51.500 28.051  1.00 18.27 ? 434  HIS A NE2   1 
ATOM   3175 N N     . MET A 1 435 ? 85.860  47.642 22.404  1.00 10.87 ? 435  MET A N     1 
ATOM   3176 C CA    . MET A 1 435 ? 86.578  46.969 21.343  1.00 12.41 ? 435  MET A CA    1 
ATOM   3177 C C     . MET A 1 435 ? 85.922  47.221 20.033  1.00 7.88  ? 435  MET A C     1 
ATOM   3178 O O     . MET A 1 435 ? 84.760  47.558 19.962  1.00 8.39  ? 435  MET A O     1 
ATOM   3179 C CB    . MET A 1 435 ? 86.613  45.446 21.587  1.00 15.42 ? 435  MET A CB    1 
ATOM   3180 C CG    . MET A 1 435 ? 85.276  44.808 21.932  1.00 17.72 ? 435  MET A CG    1 
ATOM   3181 S SD    . MET A 1 435 ? 85.537  43.085 22.541  1.00 26.05 ? 435  MET A SD    1 
ATOM   3182 C CE    . MET A 1 435 ? 83.833  42.551 22.715  1.00 21.76 ? 435  MET A CE    1 
ATOM   3183 N N     . GLN A 1 436 ? 86.689  47.089 18.983  1.00 7.07  ? 436  GLN A N     1 
ATOM   3184 C CA    . GLN A 1 436 ? 86.179  47.178 17.622  1.00 7.75  ? 436  GLN A CA    1 
ATOM   3185 C C     . GLN A 1 436 ? 86.995  46.163 16.830  1.00 8.59  ? 436  GLN A C     1 
ATOM   3186 O O     . GLN A 1 436 ? 88.191  45.997 17.024  1.00 10.81 ? 436  GLN A O     1 
ATOM   3187 C CB    . GLN A 1 436 ? 86.215  48.609 17.046  1.00 5.00  ? 436  GLN A CB    1 
ATOM   3188 C CG    . GLN A 1 436 ? 85.717  48.645 15.577  1.00 5.00  ? 436  GLN A CG    1 
ATOM   3189 C CD    . GLN A 1 436 ? 85.505  50.034 14.992  1.00 11.93 ? 436  GLN A CD    1 
ATOM   3190 O OE1   . GLN A 1 436 ? 85.977  51.011 15.581  1.00 14.37 ? 436  GLN A OE1   1 
ATOM   3191 N NE2   . GLN A 1 436 ? 84.732  50.166 13.900  1.00 8.63  ? 436  GLN A NE2   1 
ATOM   3192 N N     . GLY A 1 437 ? 86.341  45.394 15.993  1.00 6.33  ? 437  GLY A N     1 
ATOM   3193 C CA    . GLY A 1 437 ? 87.062  44.420 15.229  1.00 7.46  ? 437  GLY A CA    1 
ATOM   3194 C C     . GLY A 1 437 ? 86.099  43.328 14.734  1.00 13.40 ? 437  GLY A C     1 
ATOM   3195 O O     . GLY A 1 437 ? 84.957  43.223 15.205  1.00 11.07 ? 437  GLY A O     1 
ATOM   3196 N N     . LEU A 1 438 ? 86.572  42.524 13.779  1.00 9.92  ? 438  LEU A N     1 
ATOM   3197 C CA    . LEU A 1 438 ? 85.805  41.390 13.271  1.00 13.45 ? 438  LEU A CA    1 
ATOM   3198 C C     . LEU A 1 438 ? 85.452  40.446 14.413  1.00 15.88 ? 438  LEU A C     1 
ATOM   3199 O O     . LEU A 1 438 ? 86.318  40.066 15.226  1.00 10.87 ? 438  LEU A O     1 
ATOM   3200 C CB    . LEU A 1 438 ? 86.676  40.599 12.280  1.00 18.69 ? 438  LEU A CB    1 
ATOM   3201 C CG    . LEU A 1 438 ? 86.830  41.313 10.932  1.00 22.48 ? 438  LEU A CG    1 
ATOM   3202 C CD1   . LEU A 1 438 ? 87.793  40.497 10.083  1.00 21.52 ? 438  LEU A CD1   1 
ATOM   3203 C CD2   . LEU A 1 438 ? 85.446  41.448 10.276  1.00 16.41 ? 438  LEU A CD2   1 
ATOM   3204 N N     . GLY A 1 439 ? 84.179  40.050 14.478  1.00 13.51 ? 439  GLY A N     1 
ATOM   3205 C CA    . GLY A 1 439 ? 83.761  39.101 15.500  1.00 9.32  ? 439  GLY A CA    1 
ATOM   3206 C C     . GLY A 1 439 ? 83.319  39.780 16.787  1.00 15.15 ? 439  GLY A C     1 
ATOM   3207 O O     . GLY A 1 439 ? 82.742  39.130 17.649  1.00 13.91 ? 439  GLY A O     1 
ATOM   3208 N N     . CYS A 1 440 ? 83.585  41.094 16.922  1.00 10.27 ? 440  CYS A N     1 
ATOM   3209 C CA    . CYS A 1 440 ? 83.258  41.787 18.154  1.00 6.85  ? 440  CYS A CA    1 
ATOM   3210 C C     . CYS A 1 440 ? 81.758  41.831 18.456  1.00 9.18  ? 440  CYS A C     1 
ATOM   3211 O O     . CYS A 1 440 ? 81.395  41.982 19.620  1.00 10.28 ? 440  CYS A O     1 
ATOM   3212 C CB    . CYS A 1 440 ? 83.880  43.188 18.227  1.00 16.61 ? 440  CYS A CB    1 
ATOM   3213 S SG    . CYS A 1 440 ? 85.655  43.043 18.535  1.00 18.41 ? 440  CYS A SG    1 
ATOM   3214 N N     . ASP A 1 441 ? 80.886  41.678 17.453  1.00 7.92  ? 441  ASP A N     1 
ATOM   3215 C CA    . ASP A 1 441 ? 79.426  41.611 17.702  1.00 15.28 ? 441  ASP A CA    1 
ATOM   3216 C C     . ASP A 1 441 ? 78.993  40.366 18.540  1.00 8.14  ? 441  ASP A C     1 
ATOM   3217 O O     . ASP A 1 441 ? 78.101  40.433 19.399  1.00 11.41 ? 441  ASP A O     1 
ATOM   3218 C CB    . ASP A 1 441 ? 78.654  41.640 16.371  1.00 10.78 ? 441  ASP A CB    1 
ATOM   3219 C CG    . ASP A 1 441 ? 79.193  40.644 15.360  1.00 16.80 ? 441  ASP A CG    1 
ATOM   3220 O OD1   . ASP A 1 441 ? 80.379  40.364 15.247  1.00 11.82 ? 441  ASP A OD1   1 
ATOM   3221 O OD2   . ASP A 1 441 ? 78.228  40.073 14.660  1.00 15.87 ? 441  ASP A OD2   1 
ATOM   3222 N N     . GLU A 1 442 ? 79.677  39.224 18.322  1.00 7.81  ? 442  GLU A N     1 
ATOM   3223 C CA    . GLU A 1 442 ? 79.308  38.006 19.037  1.00 10.23 ? 442  GLU A CA    1 
ATOM   3224 C C     . GLU A 1 442 ? 80.203  37.751 20.249  1.00 13.30 ? 442  GLU A C     1 
ATOM   3225 O O     . GLU A 1 442 ? 79.960  36.834 21.043  1.00 12.85 ? 442  GLU A O     1 
ATOM   3226 C CB    . GLU A 1 442 ? 79.302  36.728 18.162  1.00 7.19  ? 442  GLU A CB    1 
ATOM   3227 C CG    . GLU A 1 442 ? 78.286  36.793 16.999  1.00 8.97  ? 442  GLU A CG    1 
ATOM   3228 C CD    . GLU A 1 442 ? 76.839  36.707 17.456  1.00 9.81  ? 442  GLU A CD    1 
ATOM   3229 O OE1   . GLU A 1 442 ? 76.689  36.543 18.737  1.00 8.95  ? 442  GLU A OE1   1 
ATOM   3230 O OE2   . GLU A 1 442 ? 75.903  36.728 16.680  1.00 11.62 ? 442  GLU A OE2   1 
ATOM   3231 N N     . MET A 1 443 ? 81.252  38.551 20.398  1.00 8.47  ? 443  MET A N     1 
ATOM   3232 C CA    . MET A 1 443 ? 82.221  38.319 21.457  1.00 5.00  ? 443  MET A CA    1 
ATOM   3233 C C     . MET A 1 443 ? 81.832  38.938 22.777  1.00 6.83  ? 443  MET A C     1 
ATOM   3234 O O     . MET A 1 443 ? 82.182  38.439 23.852  1.00 14.13 ? 443  MET A O     1 
ATOM   3235 C CB    . MET A 1 443 ? 83.528  38.966 20.970  1.00 10.08 ? 443  MET A CB    1 
ATOM   3236 C CG    . MET A 1 443 ? 84.791  38.535 21.667  1.00 19.75 ? 443  MET A CG    1 
ATOM   3237 S SD    . MET A 1 443 ? 86.129  39.636 21.109  1.00 16.75 ? 443  MET A SD    1 
ATOM   3238 C CE    . MET A 1 443 ? 86.238  39.299 19.367  1.00 8.97  ? 443  MET A CE    1 
ATOM   3239 N N     . LEU A 1 444 ? 81.115  40.058 22.699  1.00 9.27  ? 444  LEU A N     1 
ATOM   3240 C CA    . LEU A 1 444 ? 80.774  40.851 23.874  1.00 12.72 ? 444  LEU A CA    1 
ATOM   3241 C C     . LEU A 1 444 ? 79.904  40.208 24.953  1.00 22.05 ? 444  LEU A C     1 
ATOM   3242 O O     . LEU A 1 444 ? 80.174  40.404 26.156  1.00 11.37 ? 444  LEU A O     1 
ATOM   3243 C CB    . LEU A 1 444 ? 80.291  42.260 23.496  1.00 10.28 ? 444  LEU A CB    1 
ATOM   3244 C CG    . LEU A 1 444 ? 80.024  43.167 24.697  1.00 13.45 ? 444  LEU A CG    1 
ATOM   3245 C CD1   . LEU A 1 444 ? 81.346  43.609 25.329  1.00 15.61 ? 444  LEU A CD1   1 
ATOM   3246 C CD2   . LEU A 1 444 ? 79.238  44.386 24.193  1.00 11.44 ? 444  LEU A CD2   1 
ATOM   3247 N N     . GLN A 1 445 ? 78.827  39.529 24.562  1.00 10.42 ? 445  GLN A N     1 
ATOM   3248 C CA    . GLN A 1 445 ? 77.876  39.003 25.532  1.00 13.30 ? 445  GLN A CA    1 
ATOM   3249 C C     . GLN A 1 445 ? 78.464  38.324 26.771  1.00 9.72  ? 445  GLN A C     1 
ATOM   3250 O O     . GLN A 1 445 ? 78.130  38.686 27.893  1.00 14.29 ? 445  GLN A O     1 
ATOM   3251 C CB    . GLN A 1 445 ? 76.786  38.131 24.873  1.00 9.09  ? 445  GLN A CB    1 
ATOM   3252 C CG    . GLN A 1 445 ? 75.679  37.817 25.884  1.00 5.68  ? 445  GLN A CG    1 
ATOM   3253 C CD    . GLN A 1 445 ? 74.729  38.972 26.042  1.00 8.68  ? 445  GLN A CD    1 
ATOM   3254 O OE1   . GLN A 1 445 ? 73.895  39.202 25.172  1.00 10.68 ? 445  GLN A OE1   1 
ATOM   3255 N NE2   . GLN A 1 445 ? 74.849  39.722 27.142  1.00 10.20 ? 445  GLN A NE2   1 
ATOM   3256 N N     . GLY A 1 446 ? 79.334  37.350 26.594  1.00 10.87 ? 446  GLY A N     1 
ATOM   3257 C CA    . GLY A 1 446 ? 79.889  36.651 27.737  1.00 11.51 ? 446  GLY A CA    1 
ATOM   3258 C C     . GLY A 1 446 ? 80.786  37.556 28.589  1.00 14.64 ? 446  GLY A C     1 
ATOM   3259 O O     . GLY A 1 446 ? 80.810  37.427 29.813  1.00 13.40 ? 446  GLY A O     1 
ATOM   3260 N N     . PHE A 1 447 ? 81.585  38.449 27.989  1.00 10.03 ? 447  PHE A N     1 
ATOM   3261 C CA    . PHE A 1 447 ? 82.391  39.327 28.838  1.00 13.59 ? 447  PHE A CA    1 
ATOM   3262 C C     . PHE A 1 447 ? 81.478  40.255 29.655  1.00 10.88 ? 447  PHE A C     1 
ATOM   3263 O O     . PHE A 1 447 ? 81.764  40.603 30.797  1.00 17.56 ? 447  PHE A O     1 
ATOM   3264 C CB    . PHE A 1 447 ? 83.457  40.112 28.034  1.00 10.33 ? 447  PHE A CB    1 
ATOM   3265 C CG    . PHE A 1 447 ? 84.522  39.229 27.395  1.00 10.67 ? 447  PHE A CG    1 
ATOM   3266 C CD1   . PHE A 1 447 ? 85.525  38.627 28.149  1.00 16.66 ? 447  PHE A CD1   1 
ATOM   3267 C CD2   . PHE A 1 447 ? 84.614  39.120 26.006  1.00 5.00  ? 447  PHE A CD2   1 
ATOM   3268 C CE1   . PHE A 1 447 ? 86.534  37.845 27.586  1.00 13.47 ? 447  PHE A CE1   1 
ATOM   3269 C CE2   . PHE A 1 447 ? 85.605  38.345 25.408  1.00 5.00  ? 447  PHE A CE2   1 
ATOM   3270 C CZ    . PHE A 1 447 ? 86.558  37.691 26.203  1.00 14.84 ? 447  PHE A CZ    1 
ATOM   3271 N N     . ALA A 1 448 ? 80.325  40.579 29.104  1.00 10.80 ? 448  ALA A N     1 
ATOM   3272 C CA    . ALA A 1 448 ? 79.366  41.425 29.789  1.00 9.68  ? 448  ALA A CA    1 
ATOM   3273 C C     . ALA A 1 448 ? 78.806  40.727 31.020  1.00 19.81 ? 448  ALA A C     1 
ATOM   3274 O O     . ALA A 1 448 ? 78.489  41.390 32.008  1.00 16.83 ? 448  ALA A O     1 
ATOM   3275 C CB    . ALA A 1 448 ? 78.234  41.933 28.906  1.00 10.48 ? 448  ALA A CB    1 
ATOM   3276 N N     . VAL A 1 449 ? 78.678  39.388 30.964  1.00 16.28 ? 449  VAL A N     1 
ATOM   3277 C CA    . VAL A 1 449 ? 78.245  38.580 32.107  1.00 8.74  ? 449  VAL A CA    1 
ATOM   3278 C C     . VAL A 1 449 ? 79.303  38.685 33.203  1.00 16.42 ? 449  VAL A C     1 
ATOM   3279 O O     . VAL A 1 449 ? 78.960  38.933 34.361  1.00 17.98 ? 449  VAL A O     1 
ATOM   3280 C CB    . VAL A 1 449 ? 77.985  37.099 31.758  1.00 13.09 ? 449  VAL A CB    1 
ATOM   3281 C CG1   . VAL A 1 449 ? 77.645  36.336 33.042  1.00 16.49 ? 449  VAL A CG1   1 
ATOM   3282 C CG2   . VAL A 1 449 ? 76.849  36.915 30.745  1.00 12.04 ? 449  VAL A CG2   1 
ATOM   3283 N N     . ALA A 1 450 ? 80.593  38.536 32.808  1.00 17.72 ? 450  ALA A N     1 
ATOM   3284 C CA    . ALA A 1 450 ? 81.735  38.556 33.711  1.00 9.94  ? 450  ALA A CA    1 
ATOM   3285 C C     . ALA A 1 450 ? 81.841  39.950 34.335  1.00 21.50 ? 450  ALA A C     1 
ATOM   3286 O O     . ALA A 1 450 ? 82.046  40.066 35.568  1.00 19.07 ? 450  ALA A O     1 
ATOM   3287 C CB    . ALA A 1 450 ? 83.039  38.188 33.012  1.00 7.39  ? 450  ALA A CB    1 
ATOM   3288 N N     . VAL A 1 451 ? 81.609  40.991 33.539  1.00 13.11 ? 451  VAL A N     1 
ATOM   3289 C CA    . VAL A 1 451 ? 81.696  42.336 34.085  1.00 18.34 ? 451  VAL A CA    1 
ATOM   3290 C C     . VAL A 1 451 ? 80.564  42.603 35.094  1.00 30.44 ? 451  VAL A C     1 
ATOM   3291 O O     . VAL A 1 451 ? 80.763  43.192 36.176  1.00 22.71 ? 451  VAL A O     1 
ATOM   3292 C CB    . VAL A 1 451 ? 81.775  43.424 33.005  1.00 16.96 ? 451  VAL A CB    1 
ATOM   3293 C CG1   . VAL A 1 451 ? 81.537  44.810 33.604  1.00 15.09 ? 451  VAL A CG1   1 
ATOM   3294 C CG2   . VAL A 1 451 ? 83.124  43.411 32.338  1.00 15.13 ? 451  VAL A CG2   1 
ATOM   3295 N N     . LYS A 1 452 ? 79.380  42.098 34.775  1.00 16.57 ? 452  LYS A N     1 
ATOM   3296 C CA    . LYS A 1 452 ? 78.213  42.250 35.644  1.00 24.49 ? 452  LYS A CA    1 
ATOM   3297 C C     . LYS A 1 452 ? 78.424  41.568 37.003  1.00 24.93 ? 452  LYS A C     1 
ATOM   3298 O O     . LYS A 1 452 ? 77.899  42.028 38.020  1.00 28.17 ? 452  LYS A O     1 
ATOM   3299 C CB    . LYS A 1 452 ? 76.962  41.720 34.964  1.00 21.23 ? 452  LYS A CB    1 
ATOM   3300 C CG    . LYS A 1 452 ? 75.736  41.898 35.806  1.00 29.47 ? 452  LYS A CG    1 
ATOM   3301 C CD    . LYS A 1 452 ? 75.213  43.324 35.721  1.00 30.35 ? 452  LYS A CD    1 
ATOM   3302 C CE    . LYS A 1 452 ? 73.954  43.489 36.551  1.00 27.17 ? 452  LYS A CE    1 
ATOM   3303 N NZ    . LYS A 1 452 ? 72.750  43.681 35.731  1.00 37.04 ? 452  LYS A NZ    1 
ATOM   3304 N N     . MET A 1 453 ? 79.160  40.451 37.007  1.00 18.63 ? 453  MET A N     1 
ATOM   3305 C CA    . MET A 1 453 ? 79.431  39.691 38.207  1.00 14.96 ? 453  MET A CA    1 
ATOM   3306 C C     . MET A 1 453 ? 80.554  40.316 39.038  1.00 24.64 ? 453  MET A C     1 
ATOM   3307 O O     . MET A 1 453 ? 80.864  39.815 40.106  1.00 24.60 ? 453  MET A O     1 
ATOM   3308 C CB    . MET A 1 453 ? 79.882  38.277 37.866  1.00 18.48 ? 453  MET A CB    1 
ATOM   3309 C CG    . MET A 1 453 ? 78.777  37.341 37.423  1.00 22.95 ? 453  MET A CG    1 
ATOM   3310 S SD    . MET A 1 453 ? 79.501  35.751 36.984  1.00 28.57 ? 453  MET A SD    1 
ATOM   3311 C CE    . MET A 1 453 ? 80.220  35.215 38.553  1.00 26.74 ? 453  MET A CE    1 
ATOM   3312 N N     . GLY A 1 454 ? 81.213  41.354 38.529  1.00 20.75 ? 454  GLY A N     1 
ATOM   3313 C CA    . GLY A 1 454 ? 82.297  42.023 39.230  1.00 17.47 ? 454  GLY A CA    1 
ATOM   3314 C C     . GLY A 1 454 ? 83.654  41.354 39.044  1.00 27.01 ? 454  GLY A C     1 
ATOM   3315 O O     . GLY A 1 454 ? 84.432  41.317 39.997  1.00 24.50 ? 454  GLY A O     1 
ATOM   3316 N N     . ALA A 1 455 ? 83.974  40.868 37.839  1.00 19.63 ? 455  ALA A N     1 
ATOM   3317 C CA    . ALA A 1 455 ? 85.246  40.206 37.620  1.00 12.37 ? 455  ALA A CA    1 
ATOM   3318 C C     . ALA A 1 455 ? 86.356  41.210 37.797  1.00 19.21 ? 455  ALA A C     1 
ATOM   3319 O O     . ALA A 1 455 ? 86.163  42.406 37.628  1.00 19.18 ? 455  ALA A O     1 
ATOM   3320 C CB    . ALA A 1 455 ? 85.285  39.665 36.198  1.00 13.47 ? 455  ALA A CB    1 
ATOM   3321 N N     . THR A 1 456 ? 87.525  40.694 38.143  1.00 14.45 ? 456  THR A N     1 
ATOM   3322 C CA    . THR A 1 456 ? 88.709  41.497 38.273  1.00 14.57 ? 456  THR A CA    1 
ATOM   3323 C C     . THR A 1 456 ? 89.578  41.032 37.143  1.00 13.45 ? 456  THR A C     1 
ATOM   3324 O O     . THR A 1 456 ? 89.266  40.037 36.490  1.00 21.49 ? 456  THR A O     1 
ATOM   3325 C CB    . THR A 1 456 ? 89.485  41.252 39.587  1.00 27.42 ? 456  THR A CB    1 
ATOM   3326 O OG1   . THR A 1 456 ? 89.979  39.917 39.624  1.00 26.72 ? 456  THR A OG1   1 
ATOM   3327 C CG2   . THR A 1 456 ? 88.615  41.476 40.810  1.00 18.40 ? 456  THR A CG2   1 
ATOM   3328 N N     . LYS A 1 457 ? 90.711  41.684 36.962  1.00 24.29 ? 457  LYS A N     1 
ATOM   3329 C CA    . LYS A 1 457 ? 91.581  41.315 35.875  1.00 9.99  ? 457  LYS A CA    1 
ATOM   3330 C C     . LYS A 1 457 ? 92.143  39.912 36.098  1.00 19.77 ? 457  LYS A C     1 
ATOM   3331 O O     . LYS A 1 457 ? 92.363  39.164 35.140  1.00 17.90 ? 457  LYS A O     1 
ATOM   3332 C CB    . LYS A 1 457 ? 92.620  42.404 35.629  1.00 17.69 ? 457  LYS A CB    1 
ATOM   3333 C CG    . LYS A 1 457 ? 93.811  42.052 34.728  1.00 22.45 ? 457  LYS A CG    1 
ATOM   3334 C CD    . LYS A 1 457 ? 93.657  42.584 33.320  1.00 36.18 ? 457  LYS A CD    1 
ATOM   3335 C CE    . LYS A 1 457 ? 94.955  42.847 32.551  1.00 20.32 ? 457  LYS A CE    1 
ATOM   3336 N NZ    . LYS A 1 457 ? 95.844  41.680 32.554  1.00 23.42 ? 457  LYS A NZ    1 
ATOM   3337 N N     . ALA A 1 458 ? 92.349  39.517 37.367  1.00 18.74 ? 458  ALA A N     1 
ATOM   3338 C CA    . ALA A 1 458 ? 92.841  38.167 37.696  1.00 24.27 ? 458  ALA A CA    1 
ATOM   3339 C C     . ALA A 1 458 ? 91.863  37.077 37.200  1.00 19.96 ? 458  ALA A C     1 
ATOM   3340 O O     . ALA A 1 458 ? 92.265  36.014 36.687  1.00 20.14 ? 458  ALA A O     1 
ATOM   3341 C CB    . ALA A 1 458 ? 93.156  38.027 39.188  1.00 20.74 ? 458  ALA A CB    1 
ATOM   3342 N N     . ASP A 1 459 ? 90.560  37.374 37.273  1.00 14.48 ? 459  ASP A N     1 
ATOM   3343 C CA    . ASP A 1 459 ? 89.577  36.418 36.828  1.00 13.78 ? 459  ASP A CA    1 
ATOM   3344 C C     . ASP A 1 459 ? 89.731  36.173 35.326  1.00 31.78 ? 459  ASP A C     1 
ATOM   3345 O O     . ASP A 1 459 ? 89.699  35.013 34.871  1.00 30.01 ? 459  ASP A O     1 
ATOM   3346 C CB    . ASP A 1 459 ? 88.164  36.896 37.145  1.00 11.81 ? 459  ASP A CB    1 
ATOM   3347 C CG    . ASP A 1 459 ? 87.943  36.914 38.626  1.00 22.15 ? 459  ASP A CG    1 
ATOM   3348 O OD1   . ASP A 1 459 ? 88.167  35.948 39.323  1.00 28.06 ? 459  ASP A OD1   1 
ATOM   3349 O OD2   . ASP A 1 459 ? 87.359  38.006 39.039  1.00 20.97 ? 459  ASP A OD2   1 
ATOM   3350 N N     . PHE A 1 460 ? 89.927  37.266 34.567  1.00 20.36 ? 460  PHE A N     1 
ATOM   3351 C CA    . PHE A 1 460 ? 90.174  37.178 33.129  1.00 19.38 ? 460  PHE A CA    1 
ATOM   3352 C C     . PHE A 1 460 ? 91.459  36.410 32.877  1.00 15.28 ? 460  PHE A C     1 
ATOM   3353 O O     . PHE A 1 460 ? 91.523  35.470 32.090  1.00 17.95 ? 460  PHE A O     1 
ATOM   3354 C CB    . PHE A 1 460 ? 90.307  38.570 32.485  1.00 10.72 ? 460  PHE A CB    1 
ATOM   3355 C CG    . PHE A 1 460 ? 88.969  39.203 32.165  1.00 15.43 ? 460  PHE A CG    1 
ATOM   3356 C CD1   . PHE A 1 460 ? 88.020  39.456 33.152  1.00 17.56 ? 460  PHE A CD1   1 
ATOM   3357 C CD2   . PHE A 1 460 ? 88.668  39.629 30.862  1.00 17.22 ? 460  PHE A CD2   1 
ATOM   3358 C CE1   . PHE A 1 460 ? 86.782  40.047 32.866  1.00 18.59 ? 460  PHE A CE1   1 
ATOM   3359 C CE2   . PHE A 1 460 ? 87.449  40.224 30.562  1.00 16.13 ? 460  PHE A CE2   1 
ATOM   3360 C CZ    . PHE A 1 460 ? 86.491  40.426 31.565  1.00 17.92 ? 460  PHE A CZ    1 
ATOM   3361 N N     . ASP A 1 461 ? 92.500  36.850 33.543  1.00 12.54 ? 461  ASP A N     1 
ATOM   3362 C CA    . ASP A 1 461 ? 93.799  36.292 33.333  1.00 20.29 ? 461  ASP A CA    1 
ATOM   3363 C C     . ASP A 1 461 ? 93.890  34.799 33.671  1.00 21.86 ? 461  ASP A C     1 
ATOM   3364 O O     . ASP A 1 461 ? 94.774  34.098 33.164  1.00 19.47 ? 461  ASP A O     1 
ATOM   3365 C CB    . ASP A 1 461 ? 94.849  37.095 34.114  1.00 21.14 ? 461  ASP A CB    1 
ATOM   3366 C CG    . ASP A 1 461 ? 95.085  38.465 33.536  1.00 29.21 ? 461  ASP A CG    1 
ATOM   3367 O OD1   . ASP A 1 461 ? 94.711  38.811 32.412  1.00 26.35 ? 461  ASP A OD1   1 
ATOM   3368 O OD2   . ASP A 1 461 ? 95.914  39.155 34.277  1.00 28.88 ? 461  ASP A OD2   1 
ATOM   3369 N N     . ASN A 1 462 ? 93.026  34.358 34.574  1.00 17.32 ? 462  ASN A N     1 
ATOM   3370 C CA    . ASN A 1 462 ? 93.017  32.980 35.014  1.00 23.99 ? 462  ASN A CA    1 
ATOM   3371 C C     . ASN A 1 462 ? 92.139  32.061 34.164  1.00 25.01 ? 462  ASN A C     1 
ATOM   3372 O O     . ASN A 1 462 ? 91.991  30.896 34.483  1.00 25.24 ? 462  ASN A O     1 
ATOM   3373 C CB    . ASN A 1 462 ? 92.674  32.887 36.501  1.00 18.62 ? 462  ASN A CB    1 
ATOM   3374 C CG    . ASN A 1 462 ? 93.934  33.116 37.290  1.00 42.60 ? 462  ASN A CG    1 
ATOM   3375 O OD1   . ASN A 1 462 ? 95.035  32.667 36.896  1.00 51.07 ? 462  ASN A OD1   1 
ATOM   3376 N ND2   . ASN A 1 462 ? 93.812  33.999 38.273  1.00 52.49 ? 462  ASN A ND2   1 
ATOM   3377 N N     . THR A 1 463 ? 91.572  32.594 33.089  1.00 16.74 ? 463  THR A N     1 
ATOM   3378 C CA    . THR A 1 463 ? 90.778  31.835 32.152  1.00 11.88 ? 463  THR A CA    1 
ATOM   3379 C C     . THR A 1 463 ? 91.676  31.455 30.964  1.00 16.28 ? 463  THR A C     1 
ATOM   3380 O O     . THR A 1 463 ? 92.351  32.278 30.376  1.00 12.81 ? 463  THR A O     1 
ATOM   3381 C CB    . THR A 1 463 ? 89.537  32.638 31.731  1.00 10.97 ? 463  THR A CB    1 
ATOM   3382 O OG1   . THR A 1 463 ? 88.750  32.985 32.854  1.00 14.30 ? 463  THR A OG1   1 
ATOM   3383 C CG2   . THR A 1 463 ? 88.696  31.819 30.779  1.00 12.08 ? 463  THR A CG2   1 
ATOM   3384 N N     . VAL A 1 464 ? 91.768  30.164 30.672  1.00 13.98 ? 464  VAL A N     1 
ATOM   3385 C CA    . VAL A 1 464 ? 92.599  29.660 29.598  1.00 14.31 ? 464  VAL A CA    1 
ATOM   3386 C C     . VAL A 1 464 ? 92.027  30.201 28.300  1.00 17.87 ? 464  VAL A C     1 
ATOM   3387 O O     . VAL A 1 464 ? 90.812  30.323 28.182  1.00 12.52 ? 464  VAL A O     1 
ATOM   3388 C CB    . VAL A 1 464 ? 92.641  28.124 29.657  1.00 13.03 ? 464  VAL A CB    1 
ATOM   3389 C CG1   . VAL A 1 464 ? 93.251  27.483 28.422  1.00 12.82 ? 464  VAL A CG1   1 
ATOM   3390 C CG2   . VAL A 1 464 ? 93.420  27.666 30.899  1.00 11.49 ? 464  VAL A CG2   1 
ATOM   3391 N N     . ALA A 1 465 ? 92.910  30.629 27.399  1.00 10.71 ? 465  ALA A N     1 
ATOM   3392 C CA    . ALA A 1 465 ? 92.527  31.204 26.140  1.00 5.62  ? 465  ALA A CA    1 
ATOM   3393 C C     . ALA A 1 465 ? 92.062  30.137 25.163  1.00 8.71  ? 465  ALA A C     1 
ATOM   3394 O O     . ALA A 1 465 ? 92.302  28.946 25.330  1.00 13.47 ? 465  ALA A O     1 
ATOM   3395 C CB    . ALA A 1 465 ? 93.713  31.903 25.497  1.00 9.36  ? 465  ALA A CB    1 
ATOM   3396 N N     . ILE A 1 466 ? 91.350  30.624 24.125  1.00 10.74 ? 466  ILE A N     1 
ATOM   3397 C CA    . ILE A 1 466 ? 90.859  29.850 22.975  1.00 14.92 ? 466  ILE A CA    1 
ATOM   3398 C C     . ILE A 1 466 ? 91.640  30.331 21.768  1.00 10.00 ? 466  ILE A C     1 
ATOM   3399 O O     . ILE A 1 466 ? 91.455  31.507 21.397  1.00 5.00  ? 466  ILE A O     1 
ATOM   3400 C CB    . ILE A 1 466 ? 89.354  30.029 22.719  1.00 15.51 ? 466  ILE A CB    1 
ATOM   3401 C CG1   . ILE A 1 466 ? 88.551  29.562 23.941  1.00 11.06 ? 466  ILE A CG1   1 
ATOM   3402 C CG2   . ILE A 1 466 ? 88.986  29.173 21.503  1.00 10.62 ? 466  ILE A CG2   1 
ATOM   3403 C CD1   . ILE A 1 466 ? 87.155  30.167 23.988  1.00 18.70 ? 466  ILE A CD1   1 
ATOM   3404 N N     . HIS A 1 467 ? 92.451  29.433 21.171  1.00 13.81 ? 467  HIS A N     1 
ATOM   3405 C CA    . HIS A 1 467 ? 93.352  29.733 20.059  1.00 10.12 ? 467  HIS A CA    1 
ATOM   3406 C C     . HIS A 1 467 ? 93.005  28.959 18.808  1.00 15.10 ? 467  HIS A C     1 
ATOM   3407 O O     . HIS A 1 467 ? 92.672  27.777 18.870  1.00 13.51 ? 467  HIS A O     1 
ATOM   3408 C CB    . HIS A 1 467 ? 94.744  29.351 20.522  1.00 10.06 ? 467  HIS A CB    1 
ATOM   3409 C CG    . HIS A 1 467 ? 95.827  29.824 19.625  1.00 24.60 ? 467  HIS A CG    1 
ATOM   3410 N ND1   . HIS A 1 467 ? 95.990  31.173 19.395  1.00 15.58 ? 467  HIS A ND1   1 
ATOM   3411 C CD2   . HIS A 1 467 ? 96.744  29.127 18.879  1.00 10.70 ? 467  HIS A CD2   1 
ATOM   3412 C CE1   . HIS A 1 467 ? 96.989  31.268 18.525  1.00 21.26 ? 467  HIS A CE1   1 
ATOM   3413 N NE2   . HIS A 1 467 ? 97.475  30.063 18.196  1.00 15.90 ? 467  HIS A NE2   1 
ATOM   3414 N N     . PRO A 1 468 ? 93.088  29.587 17.656  1.00 14.61 ? 468  PRO A N     1 
ATOM   3415 C CA    . PRO A 1 468 ? 93.445  30.973 17.447  1.00 13.83 ? 468  PRO A CA    1 
ATOM   3416 C C     . PRO A 1 468 ? 92.170  31.780 17.242  1.00 12.07 ? 468  PRO A C     1 
ATOM   3417 O O     . PRO A 1 468 ? 91.375  31.492 16.344  1.00 14.88 ? 468  PRO A O     1 
ATOM   3418 C CB    . PRO A 1 468 ? 94.209  30.970 16.117  1.00 9.35  ? 468  PRO A CB    1 
ATOM   3419 C CG    . PRO A 1 468 ? 94.252  29.526 15.577  1.00 11.26 ? 468  PRO A CG    1 
ATOM   3420 C CD    . PRO A 1 468 ? 93.351  28.712 16.475  1.00 8.31  ? 468  PRO A CD    1 
ATOM   3421 N N     . THR A 1 469 ? 91.958  32.816 18.036  1.00 9.09  ? 469  THR A N     1 
ATOM   3422 C CA    . THR A 1 469 ? 90.762  33.621 17.902  1.00 9.53  ? 469  THR A CA    1 
ATOM   3423 C C     . THR A 1 469 ? 91.175  35.039 18.176  1.00 7.18  ? 469  THR A C     1 
ATOM   3424 O O     . THR A 1 469 ? 92.311  35.248 18.566  1.00 9.24  ? 469  THR A O     1 
ATOM   3425 C CB    . THR A 1 469 ? 89.638  33.205 18.880  1.00 10.17 ? 469  THR A CB    1 
ATOM   3426 O OG1   . THR A 1 469 ? 90.025  33.395 20.247  1.00 9.86  ? 469  THR A OG1   1 
ATOM   3427 C CG2   . THR A 1 469 ? 89.216  31.754 18.665  1.00 6.72  ? 469  THR A CG2   1 
ATOM   3428 N N     . SER A 1 470 ? 90.251  35.993 18.013  1.00 10.22 ? 470  SER A N     1 
ATOM   3429 C CA    . SER A 1 470 ? 90.492  37.379 18.374  1.00 11.18 ? 470  SER A CA    1 
ATOM   3430 C C     . SER A 1 470 ? 90.184  37.510 19.862  1.00 17.10 ? 470  SER A C     1 
ATOM   3431 O O     . SER A 1 470 ? 90.922  38.174 20.589  1.00 12.42 ? 470  SER A O     1 
ATOM   3432 C CB    . SER A 1 470 ? 89.663  38.384 17.604  1.00 10.04 ? 470  SER A CB    1 
ATOM   3433 O OG    . SER A 1 470 ? 90.290  38.582 16.341  1.00 10.66 ? 470  SER A OG    1 
ATOM   3434 N N     . SER A 1 471 ? 89.146  36.799 20.319  1.00 6.87  ? 471  SER A N     1 
ATOM   3435 C CA    . SER A 1 471 ? 88.688  36.878 21.692  1.00 10.04 ? 471  SER A CA    1 
ATOM   3436 C C     . SER A 1 471 ? 89.727  36.568 22.746  1.00 9.68  ? 471  SER A C     1 
ATOM   3437 O O     . SER A 1 471 ? 89.687  37.084 23.869  1.00 10.71 ? 471  SER A O     1 
ATOM   3438 C CB    . SER A 1 471 ? 87.432  36.047 21.908  1.00 10.11 ? 471  SER A CB    1 
ATOM   3439 O OG    . SER A 1 471 ? 87.766  34.697 21.681  1.00 13.18 ? 471  SER A OG    1 
ATOM   3440 N N     . GLU A 1 472 ? 90.666  35.710 22.394  1.00 8.40  ? 472  GLU A N     1 
ATOM   3441 C CA    . GLU A 1 472 ? 91.702  35.310 23.340  1.00 16.41 ? 472  GLU A CA    1 
ATOM   3442 C C     . GLU A 1 472 ? 92.526  36.525 23.804  1.00 16.78 ? 472  GLU A C     1 
ATOM   3443 O O     . GLU A 1 472 ? 93.152  36.421 24.831  1.00 15.11 ? 472  GLU A O     1 
ATOM   3444 C CB    . GLU A 1 472 ? 92.631  34.185 22.812  1.00 10.07 ? 472  GLU A CB    1 
ATOM   3445 C CG    . GLU A 1 472 ? 93.496  34.551 21.594  1.00 12.51 ? 472  GLU A CG    1 
ATOM   3446 C CD    . GLU A 1 472 ? 94.456  33.450 21.260  1.00 12.89 ? 472  GLU A CD    1 
ATOM   3447 O OE1   . GLU A 1 472 ? 95.087  32.871 22.114  1.00 20.56 ? 472  GLU A OE1   1 
ATOM   3448 O OE2   . GLU A 1 472 ? 94.452  33.079 20.006  1.00 11.16 ? 472  GLU A OE2   1 
ATOM   3449 N N     . GLU A 1 473 ? 92.558  37.624 23.040  1.00 12.66 ? 473  GLU A N     1 
ATOM   3450 C CA    . GLU A 1 473 ? 93.381  38.787 23.371  1.00 14.13 ? 473  GLU A CA    1 
ATOM   3451 C C     . GLU A 1 473 ? 92.946  39.423 24.669  1.00 20.54 ? 473  GLU A C     1 
ATOM   3452 O O     . GLU A 1 473 ? 93.743  40.043 25.374  1.00 20.06 ? 473  GLU A O     1 
ATOM   3453 C CB    . GLU A 1 473 ? 93.360  39.873 22.260  1.00 18.61 ? 473  GLU A CB    1 
ATOM   3454 C CG    . GLU A 1 473 ? 94.002  39.369 20.954  1.00 14.19 ? 473  GLU A CG    1 
ATOM   3455 C CD    . GLU A 1 473 ? 95.402  38.845 21.135  1.00 33.51 ? 473  GLU A CD    1 
ATOM   3456 O OE1   . GLU A 1 473 ? 96.214  39.378 21.879  1.00 37.43 ? 473  GLU A OE1   1 
ATOM   3457 O OE2   . GLU A 1 473 ? 95.651  37.744 20.455  1.00 39.09 ? 473  GLU A OE2   1 
ATOM   3458 N N     . LEU A 1 474 ? 91.652  39.344 24.932  1.00 14.40 ? 474  LEU A N     1 
ATOM   3459 C CA    . LEU A 1 474 ? 91.096  39.947 26.120  1.00 14.04 ? 474  LEU A CA    1 
ATOM   3460 C C     . LEU A 1 474 ? 91.523  39.223 27.373  1.00 15.27 ? 474  LEU A C     1 
ATOM   3461 O O     . LEU A 1 474 ? 91.379  39.762 28.471  1.00 16.69 ? 474  LEU A O     1 
ATOM   3462 C CB    . LEU A 1 474 ? 89.567  40.060 26.105  1.00 10.63 ? 474  LEU A CB    1 
ATOM   3463 C CG    . LEU A 1 474 ? 89.036  41.377 25.585  1.00 21.02 ? 474  LEU A CG    1 
ATOM   3464 C CD1   . LEU A 1 474 ? 87.539  41.489 25.914  1.00 32.87 ? 474  LEU A CD1   1 
ATOM   3465 C CD2   . LEU A 1 474 ? 89.740  42.527 26.303  1.00 20.37 ? 474  LEU A CD2   1 
ATOM   3466 N N     . VAL A 1 475 ? 91.955  37.982 27.248  1.00 11.02 ? 475  VAL A N     1 
ATOM   3467 C CA    . VAL A 1 475 ? 92.290  37.269 28.465  1.00 9.50  ? 475  VAL A CA    1 
ATOM   3468 C C     . VAL A 1 475 ? 93.801  37.175 28.583  1.00 24.10 ? 475  VAL A C     1 
ATOM   3469 O O     . VAL A 1 475 ? 94.291  36.575 29.523  1.00 23.47 ? 475  VAL A O     1 
ATOM   3470 C CB    . VAL A 1 475 ? 91.603  35.900 28.687  1.00 5.00  ? 475  VAL A CB    1 
ATOM   3471 C CG1   . VAL A 1 475 ? 90.070  35.999 28.781  1.00 9.31  ? 475  VAL A CG1   1 
ATOM   3472 C CG2   . VAL A 1 475 ? 91.985  34.891 27.603  1.00 13.58 ? 475  VAL A CG2   1 
ATOM   3473 N N     . THR A 1 476 ? 94.557  37.799 27.646  1.00 14.88 ? 476  THR A N     1 
ATOM   3474 C CA    . THR A 1 476 ? 96.014  37.758 27.721  1.00 9.77  ? 476  THR A CA    1 
ATOM   3475 C C     . THR A 1 476 ? 96.642  39.167 27.642  1.00 14.00 ? 476  THR A C     1 
ATOM   3476 O O     . THR A 1 476 ? 97.770  39.299 27.148  1.00 19.84 ? 476  THR A O     1 
ATOM   3477 C CB    . THR A 1 476 ? 96.659  36.847 26.663  1.00 19.55 ? 476  THR A CB    1 
ATOM   3478 O OG1   . THR A 1 476 ? 96.335  37.315 25.386  1.00 23.85 ? 476  THR A OG1   1 
ATOM   3479 C CG2   . THR A 1 476 ? 96.254  35.367 26.831  1.00 24.29 ? 476  THR A CG2   1 
ATOM   3480 N N     . LEU A 1 477 ? 95.901  40.189 28.089  1.00 13.12 ? 477  LEU A N     1 
ATOM   3481 C CA    . LEU A 1 477 ? 96.362  41.572 28.103  1.00 16.22 ? 477  LEU A CA    1 
ATOM   3482 C C     . LEU A 1 477 ? 97.448  41.733 29.158  1.00 25.93 ? 477  LEU A C     1 
ATOM   3483 O O     . LEU A 1 477 ? 97.345  41.221 30.272  1.00 20.22 ? 477  LEU A O     1 
ATOM   3484 C CB    . LEU A 1 477 ? 95.268  42.598 28.411  1.00 12.72 ? 477  LEU A CB    1 
ATOM   3485 C CG    . LEU A 1 477 ? 94.235  42.745 27.313  1.00 9.88  ? 477  LEU A CG    1 
ATOM   3486 C CD1   . LEU A 1 477 ? 93.141  43.648 27.833  1.00 16.36 ? 477  LEU A CD1   1 
ATOM   3487 C CD2   . LEU A 1 477 ? 94.828  43.385 26.070  1.00 18.04 ? 477  LEU A CD2   1 
ATOM   3488 N N     . ARG A 1 478 ? 98.501  42.445 28.801  1.00 30.21 ? 478  ARG A N     1 
ATOM   3489 C CA    . ARG A 1 478 ? 99.562  42.717 29.739  1.00 36.80 ? 478  ARG A CA    1 
ATOM   3490 C C     . ARG A 1 478 ? 100.001 44.162 29.677  1.00 33.06 ? 478  ARG A C     1 
ATOM   3491 O O     . ARG A 1 478 ? 100.448 44.582 30.777  1.00 40.75 ? 478  ARG A O     1 
ATOM   3492 C CB    . ARG A 1 478 ? 100.732 41.749 29.646  1.00 35.17 ? 478  ARG A CB    1 
ATOM   3493 C CG    . ARG A 1 478 ? 100.572 40.632 30.668  1.00 50.68 ? 478  ARG A CG    1 
ATOM   3494 C CD    . ARG A 1 478 ? 101.654 39.567 30.575  1.00 55.57 ? 478  ARG A CD    1 
ATOM   3495 N NE    . ARG A 1 478 ? 102.313 39.335 31.855  1.00 50.17 ? 478  ARG A NE    1 
ATOM   3496 C CZ    . ARG A 1 478 ? 103.639 39.273 31.998  1.00 46.54 ? 478  ARG A CZ    1 
ATOM   3497 N NH1   . ARG A 1 478 ? 104.419 39.418 30.916  1.00 32.74 ? 478  ARG A NH1   1 
ATOM   3498 N NH2   . ARG A 1 478 ? 104.195 39.007 33.185  1.00 48.47 ? 478  ARG A NH2   1 
ATOM   3499 O OXT   . ARG A 1 478 ? 99.752  44.790 28.615  1.00 45.43 ? 478  ARG A OXT   1 
HETATM 3500 P P     . PO4 B 2 .   ? 78.421  65.757 17.830  1.00 21.88 ? 481  PO4 A P     1 
HETATM 3501 O O1    . PO4 B 2 .   ? 78.061  66.757 18.850  1.00 30.66 ? 481  PO4 A O1    1 
HETATM 3502 O O2    . PO4 B 2 .   ? 77.310  65.798 16.835  1.00 31.60 ? 481  PO4 A O2    1 
HETATM 3503 O O3    . PO4 B 2 .   ? 79.690  66.029 17.044  1.00 34.84 ? 481  PO4 A O3    1 
HETATM 3504 O O4    . PO4 B 2 .   ? 78.488  64.490 18.608  1.00 38.04 ? 481  PO4 A O4    1 
HETATM 3505 P PA    . FAD C 3 .   ? 58.851  50.903 20.062  1.00 16.31 ? 479  FAD A PA    1 
HETATM 3506 O O1A   . FAD C 3 .   ? 58.952  52.116 19.236  1.00 14.01 ? 479  FAD A O1A   1 
HETATM 3507 O O2A   . FAD C 3 .   ? 59.405  49.556 19.676  1.00 20.80 ? 479  FAD A O2A   1 
HETATM 3508 O O5B   . FAD C 3 .   ? 57.264  50.624 20.336  1.00 12.83 ? 479  FAD A O5B   1 
HETATM 3509 C C5B   . FAD C 3 .   ? 56.364  51.852 20.491  1.00 18.67 ? 479  FAD A C5B   1 
HETATM 3510 C C4B   . FAD C 3 .   ? 55.091  51.292 19.856  1.00 11.48 ? 479  FAD A C4B   1 
HETATM 3511 O O4B   . FAD C 3 .   ? 53.985  52.084 20.381  1.00 12.89 ? 479  FAD A O4B   1 
HETATM 3512 C C3B   . FAD C 3 .   ? 54.974  51.335 18.327  1.00 15.11 ? 479  FAD A C3B   1 
HETATM 3513 O O3B   . FAD C 3 .   ? 54.623  50.142 17.692  1.00 14.94 ? 479  FAD A O3B   1 
HETATM 3514 C C2B   . FAD C 3 .   ? 53.987  52.479 18.083  1.00 14.06 ? 479  FAD A C2B   1 
HETATM 3515 O O2B   . FAD C 3 .   ? 53.282  52.216 16.871  1.00 15.69 ? 479  FAD A O2B   1 
HETATM 3516 C C1B   . FAD C 3 .   ? 53.044  52.282 19.253  1.00 14.29 ? 479  FAD A C1B   1 
HETATM 3517 N N9A   . FAD C 3 .   ? 52.336  53.498 19.691  1.00 11.79 ? 479  FAD A N9A   1 
HETATM 3518 C C8A   . FAD C 3 .   ? 52.887  54.761 19.958  1.00 17.03 ? 479  FAD A C8A   1 
HETATM 3519 N N7A   . FAD C 3 .   ? 51.973  55.606 20.436  1.00 20.45 ? 479  FAD A N7A   1 
HETATM 3520 C C5A   . FAD C 3 .   ? 50.827  54.884 20.522  1.00 15.96 ? 479  FAD A C5A   1 
HETATM 3521 C C6A   . FAD C 3 .   ? 49.489  55.230 20.962  1.00 17.19 ? 479  FAD A C6A   1 
HETATM 3522 N N6A   . FAD C 3 .   ? 49.158  56.393 21.424  1.00 15.06 ? 479  FAD A N6A   1 
HETATM 3523 N N1A   . FAD C 3 .   ? 48.564  54.235 20.889  1.00 15.94 ? 479  FAD A N1A   1 
HETATM 3524 C C2A   . FAD C 3 .   ? 48.866  53.003 20.415  1.00 17.25 ? 479  FAD A C2A   1 
HETATM 3525 N N3A   . FAD C 3 .   ? 50.053  52.598 20.009  1.00 21.22 ? 479  FAD A N3A   1 
HETATM 3526 C C4A   . FAD C 3 .   ? 50.994  53.566 20.059  1.00 17.83 ? 479  FAD A C4A   1 
HETATM 3527 N N1    . FAD C 3 .   ? 68.348  48.652 19.524  1.00 11.12 ? 479  FAD A N1    1 
HETATM 3528 C C2    . FAD C 3 .   ? 69.127  47.551 19.760  1.00 6.59  ? 479  FAD A C2    1 
HETATM 3529 O O2    . FAD C 3 .   ? 69.198  47.026 20.842  1.00 10.80 ? 479  FAD A O2    1 
HETATM 3530 N N3    . FAD C 3 .   ? 69.901  46.975 18.727  1.00 7.78  ? 479  FAD A N3    1 
HETATM 3531 C C4    . FAD C 3 .   ? 69.979  47.437 17.434  1.00 5.00  ? 479  FAD A C4    1 
HETATM 3532 O O4    . FAD C 3 .   ? 70.619  46.850 16.567  1.00 11.80 ? 479  FAD A O4    1 
HETATM 3533 C C4X   . FAD C 3 .   ? 69.129  48.626 17.165  1.00 8.68  ? 479  FAD A C4X   1 
HETATM 3534 N N5    . FAD C 3 .   ? 69.108  49.104 15.952  1.00 7.27  ? 479  FAD A N5    1 
HETATM 3535 C C5X   . FAD C 3 .   ? 68.263  50.157 15.732  1.00 7.02  ? 479  FAD A C5X   1 
HETATM 3536 C C6    . FAD C 3 .   ? 68.176  50.664 14.426  1.00 5.00  ? 479  FAD A C6    1 
HETATM 3537 C C7    . FAD C 3 .   ? 67.338  51.698 14.114  1.00 9.14  ? 479  FAD A C7    1 
HETATM 3538 C C7M   . FAD C 3 .   ? 67.300  52.258 12.713  1.00 6.28  ? 479  FAD A C7M   1 
HETATM 3539 C C8    . FAD C 3 .   ? 66.532  52.245 15.149  1.00 9.84  ? 479  FAD A C8    1 
HETATM 3540 C C8M   . FAD C 3 .   ? 65.604  53.390 14.916  1.00 11.03 ? 479  FAD A C8M   1 
HETATM 3541 C C9    . FAD C 3 .   ? 66.620  51.769 16.438  1.00 18.38 ? 479  FAD A C9    1 
HETATM 3542 C C9A   . FAD C 3 .   ? 67.473  50.728 16.745  1.00 11.51 ? 479  FAD A C9A   1 
HETATM 3543 N N10   . FAD C 3 .   ? 67.590  50.258 18.040  1.00 9.08  ? 479  FAD A N10   1 
HETATM 3544 C C10   . FAD C 3 .   ? 68.362  49.161 18.300  1.00 8.23  ? 479  FAD A C10   1 
HETATM 3545 C "C1'" . FAD C 3 .   ? 66.770  50.851 19.114  1.00 6.39  ? 479  FAD A "C1'" 1 
HETATM 3546 C "C2'" . FAD C 3 .   ? 65.555  49.951 19.458  1.00 10.80 ? 479  FAD A "C2'" 1 
HETATM 3547 O "O2'" . FAD C 3 .   ? 64.844  49.684 18.253  1.00 13.55 ? 479  FAD A "O2'" 1 
HETATM 3548 C "C3'" . FAD C 3 .   ? 64.613  50.707 20.369  1.00 15.75 ? 479  FAD A "C3'" 1 
HETATM 3549 O "O3'" . FAD C 3 .   ? 65.320  51.007 21.555  1.00 13.13 ? 479  FAD A "O3'" 1 
HETATM 3550 C "C4'" . FAD C 3 .   ? 63.439  49.864 20.764  1.00 14.94 ? 479  FAD A "C4'" 1 
HETATM 3551 O "O4'" . FAD C 3 .   ? 62.632  49.487 19.613  1.00 18.53 ? 479  FAD A "O4'" 1 
HETATM 3552 C "C5'" . FAD C 3 .   ? 62.588  50.787 21.698  1.00 14.93 ? 479  FAD A "C5'" 1 
HETATM 3553 O "O5'" . FAD C 3 .   ? 61.267  49.898 22.119  1.00 12.39 ? 479  FAD A "O5'" 1 
HETATM 3554 P P     . FAD C 3 .   ? 59.958  50.543 22.803  1.00 15.10 ? 479  FAD A P     1 
HETATM 3555 O O1P   . FAD C 3 .   ? 59.201  49.341 23.198  1.00 19.21 ? 479  FAD A O1P   1 
HETATM 3556 O O2P   . FAD C 3 .   ? 60.366  51.596 23.684  1.00 12.96 ? 479  FAD A O2P   1 
HETATM 3557 O O3P   . FAD C 3 .   ? 59.300  51.146 21.567  1.00 8.67  ? 479  FAD A O3P   1 
HETATM 3558 P PA    . NAD D 4 .   ? 72.253  59.362 18.726  1.00 19.27 ? 480  NAD A PA    1 
HETATM 3559 O O1A   . NAD D 4 .   ? 72.958  58.081 18.881  1.00 15.34 ? 480  NAD A O1A   1 
HETATM 3560 O O2A   . NAD D 4 .   ? 71.776  60.230 19.816  1.00 19.48 ? 480  NAD A O2A   1 
HETATM 3561 O O5B   . NAD D 4 .   ? 73.123  60.202 17.640  1.00 17.10 ? 480  NAD A O5B   1 
HETATM 3562 C C5B   . NAD D 4 .   ? 72.580  61.444 17.166  1.00 16.55 ? 480  NAD A C5B   1 
HETATM 3563 C C4B   . NAD D 4 .   ? 73.826  62.161 16.745  1.00 22.93 ? 480  NAD A C4B   1 
HETATM 3564 O O4B   . NAD D 4 .   ? 73.537  63.322 15.890  1.00 18.33 ? 480  NAD A O4B   1 
HETATM 3565 C C3B   . NAD D 4 .   ? 74.668  62.694 17.862  1.00 22.90 ? 480  NAD A C3B   1 
HETATM 3566 O O3B   . NAD D 4 .   ? 76.012  62.689 17.507  1.00 28.09 ? 480  NAD A O3B   1 
HETATM 3567 C C2B   . NAD D 4 .   ? 74.073  64.102 18.033  1.00 25.12 ? 480  NAD A C2B   1 
HETATM 3568 O O2B   . NAD D 4 .   ? 75.109  64.878 18.644  1.00 29.46 ? 480  NAD A O2B   1 
HETATM 3569 C C1B   . NAD D 4 .   ? 74.059  64.519 16.593  1.00 15.49 ? 480  NAD A C1B   1 
HETATM 3570 N N9A   . NAD D 4 .   ? 73.171  65.680 16.315  1.00 18.85 ? 480  NAD A N9A   1 
HETATM 3571 C C8A   . NAD D 4 .   ? 72.084  66.138 17.072  1.00 16.39 ? 480  NAD A C8A   1 
HETATM 3572 N N7A   . NAD D 4 .   ? 71.500  67.184 16.502  1.00 27.48 ? 480  NAD A N7A   1 
HETATM 3573 C C5A   . NAD D 4 .   ? 72.231  67.414 15.367  1.00 22.69 ? 480  NAD A C5A   1 
HETATM 3574 C C6A   . NAD D 4 .   ? 72.127  68.447 14.349  1.00 20.91 ? 480  NAD A C6A   1 
HETATM 3575 N N6A   . NAD D 4 .   ? 71.226  69.391 14.370  1.00 40.60 ? 480  NAD A N6A   1 
HETATM 3576 N N1A   . NAD D 4 .   ? 73.043  68.382 13.348  1.00 23.12 ? 480  NAD A N1A   1 
HETATM 3577 C C2A   . NAD D 4 .   ? 74.035  67.451 13.336  1.00 13.85 ? 480  NAD A C2A   1 
HETATM 3578 N N3A   . NAD D 4 .   ? 74.215  66.508 14.235  1.00 22.92 ? 480  NAD A N3A   1 
HETATM 3579 C C4A   . NAD D 4 .   ? 73.296  66.532 15.220  1.00 11.09 ? 480  NAD A C4A   1 
HETATM 3580 O O3    . NAD D 4 .   ? 70.925  59.068 17.841  1.00 17.40 ? 480  NAD A O3    1 
HETATM 3581 P PN    . NAD D 4 .   ? 70.563  58.117 16.572  1.00 15.61 ? 480  NAD A PN    1 
HETATM 3582 O O1N   . NAD D 4 .   ? 69.343  58.769 15.945  1.00 13.12 ? 480  NAD A O1N   1 
HETATM 3583 O O2N   . NAD D 4 .   ? 71.840  57.780 15.917  1.00 18.62 ? 480  NAD A O2N   1 
HETATM 3584 O O5D   . NAD D 4 .   ? 70.046  56.779 17.337  1.00 21.20 ? 480  NAD A O5D   1 
HETATM 3585 C C5D   . NAD D 4 .   ? 68.921  56.830 18.274  1.00 12.39 ? 480  NAD A C5D   1 
HETATM 3586 C C4D   . NAD D 4 .   ? 69.224  55.797 19.368  1.00 17.97 ? 480  NAD A C4D   1 
HETATM 3587 O O4D   . NAD D 4 .   ? 68.723  54.474 18.915  1.00 13.98 ? 480  NAD A O4D   1 
HETATM 3588 C C3D   . NAD D 4 .   ? 70.672  55.434 19.664  1.00 18.00 ? 480  NAD A C3D   1 
HETATM 3589 O O3D   . NAD D 4 .   ? 71.368  56.343 20.507  1.00 15.20 ? 480  NAD A O3D   1 
HETATM 3590 C C2D   . NAD D 4 .   ? 70.613  54.044 20.330  1.00 13.36 ? 480  NAD A C2D   1 
HETATM 3591 O O2D   . NAD D 4 .   ? 70.273  54.188 21.727  1.00 13.49 ? 480  NAD A O2D   1 
HETATM 3592 C C1D   . NAD D 4 .   ? 69.524  53.383 19.514  1.00 17.06 ? 480  NAD A C1D   1 
HETATM 3593 N N1N   . NAD D 4 .   ? 70.133  52.678 18.358  1.00 17.75 ? 480  NAD A N1N   1 
HETATM 3594 C C2N   . NAD D 4 .   ? 70.853  51.540 18.619  1.00 9.00  ? 480  NAD A C2N   1 
HETATM 3595 C C3N   . NAD D 4 .   ? 71.519  50.793 17.650  1.00 14.77 ? 480  NAD A C3N   1 
HETATM 3596 C C7N   . NAD D 4 .   ? 72.338  49.566 18.058  1.00 14.35 ? 480  NAD A C7N   1 
HETATM 3597 O O7N   . NAD D 4 .   ? 72.200  49.178 19.218  1.00 15.83 ? 480  NAD A O7N   1 
HETATM 3598 N N7N   . NAD D 4 .   ? 73.234  49.060 17.187  1.00 8.91  ? 480  NAD A N7N   1 
HETATM 3599 C C4N   . NAD D 4 .   ? 71.473  51.212 16.301  1.00 12.56 ? 480  NAD A C4N   1 
HETATM 3600 C C5N   . NAD D 4 .   ? 70.757  52.413 16.009  1.00 8.88  ? 480  NAD A C5N   1 
HETATM 3601 C C6N   . NAD D 4 .   ? 70.079  53.091 17.053  1.00 13.57 ? 480  NAD A C6N   1 
HETATM 3602 P PA    . NDP E 5 .   ? 72.253  59.362 18.726  1.00 19.27 ? 483  NDP A PA    1 
HETATM 3603 O O1A   . NDP E 5 .   ? 72.958  58.080 18.881  1.00 15.34 ? 483  NDP A O1A   1 
HETATM 3604 O O2A   . NDP E 5 .   ? 71.776  60.230 19.816  1.00 19.48 ? 483  NDP A O2A   1 
HETATM 3605 O O5B   . NDP E 5 .   ? 73.268  60.235 17.631  1.00 17.10 ? 483  NDP A O5B   1 
HETATM 3606 C C5B   . NDP E 5 .   ? 73.118  61.654 17.186  1.00 16.55 ? 483  NDP A C5B   1 
HETATM 3607 C C4B   . NDP E 5 .   ? 74.453  62.457 17.212  1.00 23.05 ? 483  NDP A C4B   1 
HETATM 3608 O O4B   . NDP E 5 .   ? 74.398  63.346 16.032  1.00 29.36 ? 483  NDP A O4B   1 
HETATM 3609 C C3B   . NDP E 5 .   ? 74.466  63.397 18.437  1.00 30.12 ? 483  NDP A C3B   1 
HETATM 3610 O O3B   . NDP E 5 .   ? 74.867  62.807 19.659  1.00 28.92 ? 483  NDP A O3B   1 
HETATM 3611 C C2B   . NDP E 5 .   ? 75.393  64.520 17.916  1.00 26.49 ? 483  NDP A C2B   1 
HETATM 3612 O O2B   . NDP E 5 .   ? 76.799  64.123 17.989  1.00 26.37 ? 483  NDP A O2B   1 
HETATM 3613 C C1B   . NDP E 5 .   ? 74.953  64.646 16.458  1.00 24.24 ? 483  NDP A C1B   1 
HETATM 3614 N N9A   . NDP E 5 .   ? 73.860  65.655 16.284  1.00 22.72 ? 483  NDP A N9A   1 
HETATM 3615 C C8A   . NDP E 5 .   ? 72.846  66.026 17.191  1.00 26.86 ? 483  NDP A C8A   1 
HETATM 3616 N N7A   . NDP E 5 .   ? 72.098  67.024 16.719  1.00 32.62 ? 483  NDP A N7A   1 
HETATM 3617 C C5A   . NDP E 5 .   ? 72.624  67.308 15.476  1.00 21.87 ? 483  NDP A C5A   1 
HETATM 3618 C C6A   . NDP E 5 .   ? 72.238  68.265 14.452  1.00 26.63 ? 483  NDP A C6A   1 
HETATM 3619 N N6A   . NDP E 5 .   ? 71.216  69.087 14.560  1.00 40.15 ? 483  NDP A N6A   1 
HETATM 3620 N N1A   . NDP E 5 .   ? 73.026  68.257 13.338  1.00 26.11 ? 483  NDP A N1A   1 
HETATM 3621 C C2A   . NDP E 5 .   ? 74.102  67.417 13.180  1.00 19.84 ? 483  NDP A C2A   1 
HETATM 3622 N N3A   . NDP E 5 .   ? 74.500  66.490 14.042  1.00 28.33 ? 483  NDP A N3A   1 
HETATM 3623 C C4A   . NDP E 5 .   ? 73.730  66.477 15.165  1.00 22.12 ? 483  NDP A C4A   1 
HETATM 3624 O O3    . NDP E 5 .   ? 70.925  59.067 17.841  1.00 17.40 ? 483  NDP A O3    1 
HETATM 3625 P PN    . NDP E 5 .   ? 70.563  58.117 16.572  1.00 15.61 ? 483  NDP A PN    1 
HETATM 3626 O O1N   . NDP E 5 .   ? 69.343  58.769 15.945  1.00 13.12 ? 483  NDP A O1N   1 
HETATM 3627 O O2N   . NDP E 5 .   ? 71.840  57.780 15.917  1.00 18.62 ? 483  NDP A O2N   1 
HETATM 3628 O O5D   . NDP E 5 .   ? 70.046  56.779 17.337  1.00 21.20 ? 483  NDP A O5D   1 
HETATM 3629 C C5D   . NDP E 5 .   ? 68.921  56.830 18.274  1.00 12.39 ? 483  NDP A C5D   1 
HETATM 3630 C C4D   . NDP E 5 .   ? 69.224  55.797 19.368  1.00 17.97 ? 483  NDP A C4D   1 
HETATM 3631 O O4D   . NDP E 5 .   ? 68.723  54.474 18.915  1.00 13.98 ? 483  NDP A O4D   1 
HETATM 3632 C C3D   . NDP E 5 .   ? 70.672  55.434 19.664  1.00 18.00 ? 483  NDP A C3D   1 
HETATM 3633 O O3D   . NDP E 5 .   ? 71.368  56.343 20.506  1.00 15.20 ? 483  NDP A O3D   1 
HETATM 3634 C C2D   . NDP E 5 .   ? 70.613  54.045 20.330  1.00 13.36 ? 483  NDP A C2D   1 
HETATM 3635 O O2D   . NDP E 5 .   ? 70.273  54.188 21.727  1.00 13.49 ? 483  NDP A O2D   1 
HETATM 3636 C C1D   . NDP E 5 .   ? 69.524  53.383 19.514  1.00 17.06 ? 483  NDP A C1D   1 
HETATM 3637 N N1N   . NDP E 5 .   ? 70.133  52.678 18.358  1.00 17.75 ? 483  NDP A N1N   1 
HETATM 3638 C C2N   . NDP E 5 .   ? 70.853  51.540 18.619  1.00 9.00  ? 483  NDP A C2N   1 
HETATM 3639 C C3N   . NDP E 5 .   ? 71.519  50.793 17.650  1.00 14.77 ? 483  NDP A C3N   1 
HETATM 3640 C C7N   . NDP E 5 .   ? 72.338  49.566 18.058  1.00 14.35 ? 483  NDP A C7N   1 
HETATM 3641 O O7N   . NDP E 5 .   ? 72.200  49.178 19.219  1.00 15.83 ? 483  NDP A O7N   1 
HETATM 3642 N N7N   . NDP E 5 .   ? 73.234  49.060 17.187  1.00 8.91  ? 483  NDP A N7N   1 
HETATM 3643 C C4N   . NDP E 5 .   ? 71.473  51.212 16.300  1.00 12.56 ? 483  NDP A C4N   1 
HETATM 3644 C C5N   . NDP E 5 .   ? 70.757  52.413 16.009  1.00 8.88  ? 483  NDP A C5N   1 
HETATM 3645 C C6N   . NDP E 5 .   ? 70.079  53.091 17.053  1.00 13.57 ? 483  NDP A C6N   1 
HETATM 3646 P P2B   . NDP E 5 .   ? 77.956  65.292 18.076  1.00 23.31 ? 483  NDP A P2B   1 
HETATM 3647 O O1X   . NDP E 5 .   ? 77.748  66.024 19.349  1.00 22.14 ? 483  NDP A O1X   1 
HETATM 3648 O O2X   . NDP E 5 .   ? 77.768  66.130 16.859  1.00 25.26 ? 483  NDP A O2X   1 
HETATM 3649 O O3X   . NDP E 5 .   ? 79.316  64.752 17.918  1.00 17.69 ? 483  NDP A O3X   1 
HETATM 3650 O O     . HOH F 6 .   ? 77.819  39.566 21.727  1.00 8.52  ? 487  HOH A O     1 
HETATM 3651 O O     . HOH F 6 .   ? 58.823  53.146 24.973  0.95 10.82 ? 488  HOH A O     1 
HETATM 3652 O O     . HOH F 6 .   ? 71.723  45.890 24.603  1.00 11.79 ? 489  HOH A O     1 
HETATM 3653 O O     . HOH F 6 .   ? 56.563  48.906 23.395  0.97 8.66  ? 490  HOH A O     1 
HETATM 3654 O O     . HOH F 6 .   ? 64.360  51.224 24.977  1.00 12.21 ? 491  HOH A O     1 
HETATM 3655 O O     . HOH F 6 .   ? 93.495  33.777 7.211   1.00 13.65 ? 492  HOH A O     1 
HETATM 3656 O O     . HOH F 6 .   ? 75.706  39.183 15.155  0.97 10.97 ? 493  HOH A O     1 
HETATM 3657 O O     . HOH F 6 .   ? 65.569  57.246 13.868  1.00 13.28 ? 494  HOH A O     1 
HETATM 3658 O O     . HOH F 6 .   ? 63.721  54.022 11.693  1.00 11.91 ? 495  HOH A O     1 
HETATM 3659 O O     . HOH F 6 .   ? 61.375  53.953 19.638  0.99 16.95 ? 496  HOH A O     1 
HETATM 3660 O O     . HOH F 6 .   ? 64.959  52.156 27.575  0.88 6.96  ? 497  HOH A O     1 
HETATM 3661 O O     . HOH F 6 .   ? 65.022  50.049 1.916   1.00 17.08 ? 498  HOH A O     1 
HETATM 3662 O O     . HOH F 6 .   ? 62.755  58.359 22.373  1.00 13.92 ? 499  HOH A O     1 
HETATM 3663 O O     . HOH F 6 .   ? 65.851  54.111 19.162  1.00 19.35 ? 500  HOH A O     1 
HETATM 3664 O O     . HOH F 6 .   ? 71.455  45.663 22.025  1.00 13.87 ? 501  HOH A O     1 
HETATM 3665 O O     . HOH F 6 .   ? 96.985  31.175 22.939  1.00 13.80 ? 502  HOH A O     1 
HETATM 3666 O O     . HOH F 6 .   ? 81.344  64.992 15.608  1.00 15.16 ? 503  HOH A O     1 
HETATM 3667 O O     . HOH F 6 .   ? 59.896  47.574 38.740  1.00 13.89 ? 504  HOH A O     1 
HETATM 3668 O O     . HOH F 6 .   ? 63.439  51.175 29.669  0.93 12.48 ? 505  HOH A O     1 
HETATM 3669 O O     . HOH F 6 .   ? 58.379  38.829 28.345  0.90 11.94 ? 506  HOH A O     1 
HETATM 3670 O O     . HOH F 6 .   ? 88.900  43.809 12.471  0.85 12.47 ? 507  HOH A O     1 
HETATM 3671 O O     . HOH F 6 .   ? 79.874  36.170 23.756  0.91 21.45 ? 508  HOH A O     1 
HETATM 3672 O O     . HOH F 6 .   ? 91.420  42.250 0.087   0.85 16.25 ? 509  HOH A O     1 
HETATM 3673 O O     . HOH F 6 .   ? 67.065  61.954 12.731  1.00 17.05 ? 510  HOH A O     1 
HETATM 3674 O O     . HOH F 6 .   ? 67.606  59.151 14.026  1.00 13.62 ? 511  HOH A O     1 
HETATM 3675 O O     . HOH F 6 .   ? 63.311  49.550 36.463  1.00 15.88 ? 512  HOH A O     1 
HETATM 3676 O O     . HOH F 6 .   ? 77.628  49.904 29.802  0.93 16.45 ? 513  HOH A O     1 
HETATM 3677 O O     . HOH F 6 .   ? 73.291  47.460 21.125  1.00 10.24 ? 514  HOH A O     1 
HETATM 3678 O O     . HOH F 6 .   ? 67.223  58.631 11.277  0.99 12.99 ? 515  HOH A O     1 
HETATM 3679 O O     . HOH F 6 .   ? 77.058  49.385 9.040   0.96 16.38 ? 516  HOH A O     1 
HETATM 3680 O O     . HOH F 6 .   ? 79.936  51.247 27.507  0.74 16.57 ? 517  HOH A O     1 
HETATM 3681 O O     . HOH F 6 .   ? 73.619  44.010 32.080  1.00 14.21 ? 518  HOH A O     1 
HETATM 3682 O O     . HOH F 6 .   ? 91.013  36.574 12.257  1.00 17.77 ? 519  HOH A O     1 
HETATM 3683 O O     . HOH F 6 .   ? 88.625  48.429 13.704  0.79 10.42 ? 520  HOH A O     1 
HETATM 3684 O O     . HOH F 6 .   ? 78.374  38.486 12.529  0.97 19.86 ? 521  HOH A O     1 
HETATM 3685 O O     . HOH F 6 .   ? 87.245  37.324 14.592  0.97 19.68 ? 522  HOH A O     1 
HETATM 3686 O O     . HOH F 6 .   ? 72.872  38.021 11.792  1.00 16.07 ? 523  HOH A O     1 
HETATM 3687 O O     . HOH F 6 .   ? 73.439  59.326 14.312  0.99 12.56 ? 524  HOH A O     1 
HETATM 3688 O O     . HOH F 6 .   ? 63.170  56.620 20.286  1.00 19.77 ? 525  HOH A O     1 
HETATM 3689 O O     . HOH F 6 .   ? 56.088  61.004 35.120  1.00 16.54 ? 526  HOH A O     1 
HETATM 3690 O O     . HOH F 6 .   ? 53.267  54.532 39.525  1.00 22.91 ? 527  HOH A O     1 
HETATM 3691 O O     . HOH F 6 .   ? 64.310  54.658 29.093  0.94 14.00 ? 528  HOH A O     1 
HETATM 3692 O O     . HOH F 6 .   ? 89.077  40.915 15.685  0.96 18.45 ? 529  HOH A O     1 
HETATM 3693 O O     . HOH F 6 .   ? 82.200  40.659 12.687  0.92 16.73 ? 530  HOH A O     1 
HETATM 3694 O O     . HOH F 6 .   ? 66.594  62.423 0.456   1.00 25.15 ? 531  HOH A O     1 
HETATM 3695 O O     . HOH F 6 .   ? 60.819  55.046 13.950  0.91 18.24 ? 532  HOH A O     1 
HETATM 3696 O O     . HOH F 6 .   ? 66.318  51.334 37.993  0.92 20.45 ? 533  HOH A O     1 
HETATM 3697 O O     . HOH F 6 .   ? 81.555  55.985 -0.316  1.00 21.61 ? 534  HOH A O     1 
HETATM 3698 O O     . HOH F 6 .   ? 64.761  60.387 22.693  0.80 16.19 ? 535  HOH A O     1 
HETATM 3699 O O     . HOH F 6 .   ? 61.449  59.583 5.847   0.99 23.31 ? 536  HOH A O     1 
HETATM 3700 O O     . HOH F 6 .   ? 62.174  46.151 5.336   0.91 18.74 ? 537  HOH A O     1 
HETATM 3701 O O     . HOH F 6 .   ? 54.705  49.992 14.806  1.00 18.68 ? 538  HOH A O     1 
HETATM 3702 O O     . HOH F 6 .   ? 48.238  38.517 41.720  0.59 7.36  ? 539  HOH A O     1 
HETATM 3703 O O     . HOH F 6 .   ? 72.445  45.950 33.836  1.00 18.75 ? 540  HOH A O     1 
HETATM 3704 O O     . HOH F 6 .   ? 59.392  41.743 23.107  0.74 18.01 ? 541  HOH A O     1 
HETATM 3705 O O     . HOH F 6 .   ? 93.782  40.063 30.397  1.00 17.87 ? 542  HOH A O     1 
HETATM 3706 O O     . HOH F 6 .   ? 97.602  31.677 25.461  1.00 21.14 ? 543  HOH A O     1 
HETATM 3707 O O     . HOH F 6 .   ? 83.941  33.243 10.190  0.90 22.60 ? 544  HOH A O     1 
HETATM 3708 O O     . HOH F 6 .   ? 75.738  38.062 11.413  1.00 26.16 ? 545  HOH A O     1 
HETATM 3709 O O     . HOH F 6 .   ? 46.024  35.663 31.280  1.00 28.56 ? 546  HOH A O     1 
HETATM 3710 O O     . HOH F 6 .   ? 86.672  76.132 8.135   1.00 19.18 ? 547  HOH A O     1 
HETATM 3711 O O     . HOH F 6 .   ? 70.399  51.651 37.942  0.93 24.99 ? 548  HOH A O     1 
HETATM 3712 O O     . HOH F 6 .   ? 49.492  37.972 39.683  0.88 16.73 ? 549  HOH A O     1 
HETATM 3713 O O     . HOH F 6 .   ? 92.033  36.964 14.880  0.86 12.03 ? 550  HOH A O     1 
HETATM 3714 O O     . HOH F 6 .   ? 84.863  36.462 13.343  0.72 11.97 ? 551  HOH A O     1 
HETATM 3715 O O     . HOH F 6 .   ? 58.876  48.947 45.004  1.00 33.13 ? 552  HOH A O     1 
HETATM 3716 O O     . HOH F 6 .   ? 100.215 30.679 17.201  0.66 19.79 ? 553  HOH A O     1 
HETATM 3717 O O     . HOH F 6 .   ? 62.218  57.017 1.129   0.98 27.29 ? 554  HOH A O     1 
HETATM 3718 O O     . HOH F 6 .   ? 79.734  51.822 9.512   0.74 17.10 ? 555  HOH A O     1 
HETATM 3719 O O     . HOH F 6 .   ? 81.418  50.205 4.965   0.98 26.69 ? 556  HOH A O     1 
HETATM 3720 O O     . HOH F 6 .   ? 63.237  59.799 34.057  0.87 22.10 ? 557  HOH A O     1 
HETATM 3721 O O     . HOH F 6 .   ? 61.399  47.690 36.085  0.73 11.39 ? 558  HOH A O     1 
HETATM 3722 O O     . HOH F 6 .   ? 81.309  49.157 35.338  1.00 23.49 ? 559  HOH A O     1 
HETATM 3723 O O     . HOH F 6 .   ? 96.412  40.546 24.218  0.75 17.57 ? 560  HOH A O     1 
HETATM 3724 O O     . HOH F 6 .   ? 97.774  41.842 20.575  1.00 36.17 ? 561  HOH A O     1 
HETATM 3725 O O     . HOH F 6 .   ? 92.252  34.320 14.714  0.74 15.33 ? 562  HOH A O     1 
HETATM 3726 O O     . HOH F 6 .   ? 96.338  30.125 27.947  0.86 21.21 ? 563  HOH A O     1 
HETATM 3727 O O     . HOH F 6 .   ? 99.316  42.679 14.115  0.64 27.66 ? 564  HOH A O     1 
HETATM 3728 O O     . HOH F 6 .   ? 101.199 35.738 3.353   0.79 14.86 ? 565  HOH A O     1 
HETATM 3729 O O     . HOH F 6 .   ? 82.917  53.247 24.734  0.76 12.33 ? 566  HOH A O     1 
HETATM 3730 O O     . HOH F 6 .   ? 46.174  38.251 29.520  0.86 24.51 ? 567  HOH A O     1 
HETATM 3731 O O     . HOH F 6 .   ? 40.319  46.415 18.162  1.00 40.12 ? 568  HOH A O     1 
HETATM 3732 O O     . HOH F 6 .   ? 70.769  51.935 12.230  0.83 15.67 ? 569  HOH A O     1 
HETATM 3733 O O     . HOH F 6 .   ? 78.979  61.576 18.406  0.91 31.25 ? 570  HOH A O     1 
HETATM 3734 O O     . HOH F 6 .   ? 83.744  51.888 11.294  0.87 27.24 ? 571  HOH A O     1 
HETATM 3735 O O     . HOH F 6 .   ? 82.152  51.616 7.198   0.83 26.13 ? 572  HOH A O     1 
HETATM 3736 O O     . HOH F 6 .   ? 64.388  53.953 35.639  0.99 23.05 ? 573  HOH A O     1 
HETATM 3737 O O     . HOH F 6 .   ? 70.529  55.642 24.662  0.54 13.76 ? 574  HOH A O     1 
HETATM 3738 O O     . HOH F 6 .   ? 63.533  54.155 31.512  0.89 20.92 ? 575  HOH A O     1 
HETATM 3739 O O     . HOH F 6 .   ? 75.214  51.004 31.326  0.68 17.18 ? 576  HOH A O     1 
HETATM 3740 O O     . HOH F 6 .   ? 69.288  44.255 36.640  1.00 24.29 ? 577  HOH A O     1 
HETATM 3741 O O     . HOH F 6 .   ? 81.756  41.463 10.341  1.00 26.19 ? 578  HOH A O     1 
HETATM 3742 O O     . HOH F 6 .   ? 50.545  41.239 12.924  0.71 20.77 ? 579  HOH A O     1 
HETATM 3743 O O     . HOH F 6 .   ? 81.551  35.863 -1.618  1.00 61.87 ? 580  HOH A O     1 
HETATM 3744 O O     . HOH F 6 .   ? 41.684  56.342 18.853  0.83 25.83 ? 581  HOH A O     1 
HETATM 3745 O O     . HOH F 6 .   ? 42.116  59.289 33.425  1.00 23.24 ? 582  HOH A O     1 
HETATM 3746 O O     . HOH F 6 .   ? 55.734  63.477 20.247  1.00 48.71 ? 583  HOH A O     1 
HETATM 3747 O O     . HOH F 6 .   ? 62.679  60.005 31.791  0.99 30.35 ? 584  HOH A O     1 
HETATM 3748 O O     . HOH F 6 .   ? 78.097  51.413 33.138  0.94 35.97 ? 585  HOH A O     1 
HETATM 3749 O O     . HOH F 6 .   ? 58.513  41.128 -0.377  0.83 27.45 ? 586  HOH A O     1 
HETATM 3750 O O     . HOH F 6 .   ? 87.806  50.075 7.260   0.96 22.40 ? 587  HOH A O     1 
HETATM 3751 O O     . HOH F 6 .   ? 56.791  50.681 13.378  0.90 31.88 ? 588  HOH A O     1 
HETATM 3752 O O     . HOH F 6 .   ? 85.215  60.494 22.847  0.98 28.22 ? 589  HOH A O     1 
HETATM 3753 O O     . HOH F 6 .   ? 82.201  73.731 3.858   0.86 24.29 ? 590  HOH A O     1 
HETATM 3754 O O     . HOH F 6 .   ? 65.058  63.761 33.500  0.89 28.60 ? 591  HOH A O     1 
HETATM 3755 O O     . HOH F 6 .   ? 55.928  47.839 44.165  0.77 32.92 ? 592  HOH A O     1 
HETATM 3756 O O     . HOH F 6 .   ? 99.317  41.573 0.582   1.00 21.64 ? 593  HOH A O     1 
HETATM 3757 O O     . HOH F 6 .   ? 77.076  65.555 14.324  0.82 13.55 ? 594  HOH A O     1 
HETATM 3758 O O     . HOH F 6 .   ? 69.406  50.244 -7.138  0.87 37.61 ? 595  HOH A O     1 
HETATM 3759 O O     . HOH F 6 .   ? 56.988  44.139 5.188   0.56 13.73 ? 596  HOH A O     1 
HETATM 3760 O O     . HOH F 6 .   ? 79.838  74.073 10.847  1.00 21.83 ? 597  HOH A O     1 
HETATM 3761 O O     . HOH F 6 .   ? 40.627  45.432 37.064  0.70 24.20 ? 598  HOH A O     1 
HETATM 3762 O O     . HOH F 6 .   ? 47.359  47.706 14.731  0.95 36.90 ? 599  HOH A O     1 
HETATM 3763 O O     . HOH F 6 .   ? 60.384  47.429 6.954   0.93 30.96 ? 600  HOH A O     1 
HETATM 3764 O O     . HOH F 6 .   ? 56.691  46.832 8.612   0.75 21.21 ? 601  HOH A O     1 
HETATM 3765 O O     . HOH F 6 .   ? 38.642  50.315 20.722  0.74 24.27 ? 602  HOH A O     1 
HETATM 3766 O O     . HOH F 6 .   ? 76.512  48.315 -6.182  0.58 16.31 ? 603  HOH A O     1 
HETATM 3767 O O     . HOH F 6 .   ? 87.418  57.950 27.157  0.81 18.24 ? 604  HOH A O     1 
HETATM 3768 O O     . HOH F 6 .   ? 82.649  51.154 2.213   0.46 14.80 ? 605  HOH A O     1 
HETATM 3769 O O     . HOH F 6 .   ? 92.367  48.427 3.595   0.88 25.08 ? 606  HOH A O     1 
HETATM 3770 O O     . HOH F 6 .   ? 70.247  57.077 -7.288  0.67 23.64 ? 607  HOH A O     1 
HETATM 3771 O O     . HOH F 6 .   ? 76.421  67.774 10.925  0.71 8.38  ? 608  HOH A O     1 
HETATM 3772 O O     . HOH F 6 .   ? 88.459  37.008 11.893  1.00 26.39 ? 609  HOH A O     1 
HETATM 3773 O O     . HOH F 6 .   ? 94.701  37.224 15.307  0.72 20.18 ? 610  HOH A O     1 
HETATM 3774 O O     . HOH F 6 .   ? 86.157  61.737 20.725  0.78 27.38 ? 611  HOH A O     1 
HETATM 3775 O O     . HOH F 6 .   ? 81.057  37.373 14.358  0.72 27.83 ? 612  HOH A O     1 
HETATM 3776 O O     . HOH F 6 .   ? 99.712  31.331 20.866  0.47 11.87 ? 613  HOH A O     1 
HETATM 3777 O O     . HOH F 6 .   ? 79.635  54.534 28.987  0.79 35.06 ? 614  HOH A O     1 
HETATM 3778 O O     . HOH F 6 .   ? 98.407  32.754 30.155  1.00 34.85 ? 615  HOH A O     1 
HETATM 3779 O O     . HOH F 6 .   ? 52.140  38.969 7.980   0.48 15.95 ? 616  HOH A O     1 
HETATM 3780 O O     . HOH F 6 .   ? 54.694  44.413 7.681   0.69 23.69 ? 617  HOH A O     1 
HETATM 3781 O O     . HOH F 6 .   ? 72.861  69.649 -7.965  1.00 42.95 ? 618  HOH A O     1 
HETATM 3782 O O     . HOH F 6 .   ? 65.829  59.547 -0.849  0.72 23.10 ? 619  HOH A O     1 
HETATM 3783 O O     . HOH F 6 .   ? 59.451  52.827 6.596   0.92 29.16 ? 620  HOH A O     1 
HETATM 3784 O O     . HOH F 6 .   ? 67.092  55.577 -3.844  0.62 19.65 ? 621  HOH A O     1 
HETATM 3785 O O     . HOH F 6 .   ? 73.738  69.639 10.307  0.59 19.48 ? 622  HOH A O     1 
HETATM 3786 O O     . HOH F 6 .   ? 94.727  33.486 29.950  0.71 24.04 ? 623  HOH A O     1 
HETATM 3787 O O     . HOH F 6 .   ? 92.899  55.735 24.096  0.88 34.55 ? 624  HOH A O     1 
HETATM 3788 O O     . HOH F 6 .   ? 67.257  60.648 23.285  0.51 23.32 ? 625  HOH A O     1 
HETATM 3789 O O     . HOH F 6 .   ? 97.163  38.476 14.525  0.66 29.57 ? 626  HOH A O     1 
HETATM 3790 O O     . HOH F 6 .   ? 86.546  33.790 8.720   0.64 13.15 ? 627  HOH A O     1 
HETATM 3791 O O     . HOH F 6 .   ? 85.869  38.489 41.513  0.64 27.72 ? 628  HOH A O     1 
HETATM 3792 O O     . HOH F 6 .   ? 88.171  33.009 38.618  0.59 17.45 ? 629  HOH A O     1 
HETATM 3793 O O     . HOH F 6 .   ? 57.939  51.354 43.694  0.57 16.08 ? 630  HOH A O     1 
HETATM 3794 O O     . HOH F 6 .   ? 54.042  51.183 42.333  0.78 32.66 ? 631  HOH A O     1 
HETATM 3795 O O     . HOH F 6 .   ? 82.426  43.946 8.989   0.84 28.81 ? 632  HOH A O     1 
HETATM 3796 O O     . HOH F 6 .   ? 54.200  45.285 44.096  0.62 23.40 ? 633  HOH A O     1 
HETATM 3797 O O     . HOH F 6 .   ? 84.021  84.878 9.200   0.84 36.38 ? 634  HOH A O     1 
HETATM 3798 O O     . HOH F 6 .   ? 56.990  55.353 18.455  0.48 10.08 ? 635  HOH A O     1 
HETATM 3799 O O     . HOH F 6 .   ? 50.439  64.322 25.820  0.49 13.61 ? 636  HOH A O     1 
HETATM 3800 O O     . HOH F 6 .   ? 46.650  51.256 41.007  0.64 19.74 ? 637  HOH A O     1 
HETATM 3801 O O     . HOH F 6 .   ? 87.159  61.634 4.599   0.60 11.54 ? 638  HOH A O     1 
HETATM 3802 O O     . HOH F 6 .   ? 71.181  56.728 27.819  0.53 23.70 ? 639  HOH A O     1 
HETATM 3803 O O     . HOH F 6 .   ? 104.788 46.505 19.184  0.36 32.69 ? 640  HOH A O     1 
HETATM 3804 O O     . HOH F 6 .   ? 98.891  45.091 37.943  0.68 33.75 ? 641  HOH A O     1 
HETATM 3805 O O     . HOH F 6 .   ? 91.175  43.845 -2.127  0.49 16.40 ? 642  HOH A O     1 
HETATM 3806 O O     . HOH F 6 .   ? 98.790  42.224 24.872  0.63 20.49 ? 643  HOH A O     1 
HETATM 3807 O O     . HOH F 6 .   ? 39.529  42.096 34.384  1.00 34.87 ? 644  HOH A O     1 
HETATM 3808 O O     . HOH F 6 .   ? 49.396  35.816 13.664  0.64 26.66 ? 645  HOH A O     1 
HETATM 3809 O O     . HOH F 6 .   ? 65.350  72.421 13.816  0.92 43.89 ? 646  HOH A O     1 
HETATM 3810 O O     . HOH F 6 .   ? 58.310  56.624 13.197  1.00 42.53 ? 647  HOH A O     1 
HETATM 3811 O O     . HOH F 6 .   ? 59.822  48.394 3.360   0.62 22.47 ? 648  HOH A O     1 
HETATM 3812 O O     . HOH F 6 .   ? 59.004  50.331 6.058   0.76 32.19 ? 649  HOH A O     1 
HETATM 3813 O O     . HOH F 6 .   ? 81.150  53.247 -2.077  0.50 17.55 ? 650  HOH A O     1 
HETATM 3814 O O     . HOH F 6 .   ? 93.032  53.398 16.095  0.65 22.96 ? 651  HOH A O     1 
HETATM 3815 O O     . HOH F 6 .   ? 94.656  36.467 18.359  0.72 28.46 ? 652  HOH A O     1 
HETATM 3816 O O     . HOH F 6 .   ? 99.755  34.195 24.981  0.54 22.98 ? 653  HOH A O     1 
HETATM 3817 O O     . HOH F 6 .   ? 63.221  54.717 -3.489  1.00 43.11 ? 654  HOH A O     1 
HETATM 3818 O O     . HOH F 6 .   ? 83.768  59.430 28.210  0.74 32.59 ? 655  HOH A O     1 
HETATM 3819 O O     . HOH F 6 .   ? 92.129  54.254 18.624  0.68 22.47 ? 656  HOH A O     1 
HETATM 3820 O O     . HOH F 6 .   ? 82.890  59.247 -0.865  0.74 29.11 ? 657  HOH A O     1 
HETATM 3821 O O     . HOH F 6 .   ? 90.566  31.990 38.561  0.71 37.94 ? 658  HOH A O     1 
HETATM 3822 O O     . HOH F 6 .   ? 97.122  38.304 31.120  0.69 23.94 ? 659  HOH A O     1 
HETATM 3823 O O     . HOH F 6 .   ? 89.113  63.013 13.223  0.58 26.07 ? 660  HOH A O     1 
HETATM 3824 O O     . HOH F 6 .   ? 80.304  72.322 13.528  0.76 28.04 ? 661  HOH A O     1 
HETATM 3825 O O     . HOH F 6 .   ? 50.438  44.330 13.118  0.63 30.29 ? 662  HOH A O     1 
HETATM 3826 O O     . HOH F 6 .   ? 87.554  39.599 -5.505  0.76 35.64 ? 663  HOH A O     1 
HETATM 3827 O O     . HOH F 6 .   ? 48.048  60.673 16.498  0.59 42.37 ? 664  HOH A O     1 
HETATM 3828 O O     . HOH F 6 .   ? 56.258  58.405 13.086  0.84 54.44 ? 665  HOH A O     1 
HETATM 3829 O O     . HOH F 6 .   ? 55.977  56.719 6.953   0.58 47.47 ? 666  HOH A O     1 
HETATM 3830 O O     . HOH F 6 .   ? 91.111  61.957 22.787  0.55 39.65 ? 667  HOH A O     1 
HETATM 3831 O O     . HOH F 6 .   ? 67.698  47.480 -7.918  0.67 34.66 ? 668  HOH A O     1 
HETATM 3832 O O     . HOH F 6 .   ? 63.878  41.375 -7.914  0.47 28.90 ? 669  HOH A O     1 
HETATM 3833 O O     . HOH F 6 .   ? 71.500  74.424 -1.484  0.91 30.86 ? 670  HOH A O     1 
HETATM 3834 O O     . HOH F 6 .   ? 45.826  53.241 36.501  0.60 12.50 ? 671  HOH A O     1 
HETATM 3835 O O     . HOH F 6 .   ? 91.867  50.277 46.192  0.78 38.73 ? 672  HOH A O     1 
HETATM 3836 O O     . HOH F 6 .   ? 64.266  73.364 -3.113  0.58 33.38 ? 673  HOH A O     1 
HETATM 3837 O O     . HOH F 6 .   ? 83.932  51.302 8.856   0.64 29.89 ? 674  HOH A O     1 
HETATM 3838 O O     . HOH F 6 .   ? 99.699  45.273 23.550  0.45 34.47 ? 675  HOH A O     1 
HETATM 3839 O O     . HOH F 6 .   ? 99.347  48.904 20.682  0.60 38.91 ? 676  HOH A O     1 
HETATM 3840 O O     . HOH F 6 .   ? 30.855  50.590 25.571  0.49 43.44 ? 677  HOH A O     1 
HETATM 3841 O O     . HOH F 6 .   ? 58.836  72.458 9.816   1.00 44.79 ? 678  HOH A O     1 
HETATM 3842 O O     . HOH F 6 .   ? 85.955  58.496 -6.853  0.30 38.96 ? 679  HOH A O     1 
HETATM 3843 O O     . HOH F 6 .   ? 85.800  58.615 -9.284  0.31 31.81 ? 680  HOH A O     1 
HETATM 3844 O O     . HOH F 6 .   ? 40.591  68.423 29.719  0.60 36.98 ? 681  HOH A O     1 
HETATM 3845 O O     . HOH F 6 .   ? 54.343  56.960 47.574  0.58 52.59 ? 682  HOH A O     1 
HETATM 3846 O O     . HOH F 6 .   ? 46.024  56.850 40.126  0.72 37.85 ? 683  HOH A O     1 
HETATM 3847 O O     . HOH F 6 .   ? 48.985  59.817 42.035  0.53 33.57 ? 684  HOH A O     1 
HETATM 3848 O O     . HOH F 6 .   ? 96.818  53.234 32.963  0.79 36.24 ? 685  HOH A O     1 
HETATM 3849 O O     . HOH F 6 .   ? 48.151  33.521 29.869  0.70 31.57 ? 686  HOH A O     1 
HETATM 3850 O O     . HOH F 6 .   ? 85.745  47.855 6.752   0.89 39.36 ? 687  HOH A O     1 
HETATM 3851 O O     . HOH F 6 .   ? 58.100  52.710 15.170  0.64 32.41 ? 688  HOH A O     1 
HETATM 3852 O O     . HOH F 6 .   ? 41.397  26.545 20.984  0.63 49.75 ? 689  HOH A O     1 
HETATM 3853 O O     . HOH F 6 .   ? 60.916  66.275 14.234  0.68 44.58 ? 690  HOH A O     1 
HETATM 3854 O O     . HOH F 6 .   ? 66.018  79.264 17.265  0.52 49.80 ? 691  HOH A O     1 
HETATM 3855 O O     . HOH F 6 .   ? 55.627  50.987 -0.005  0.66 50.44 ? 692  HOH A O     1 
HETATM 3856 O O     . HOH F 6 .   ? 57.211  49.184 -6.693  0.46 34.19 ? 693  HOH A O     1 
HETATM 3857 O O     . HOH F 6 .   ? 78.272  65.084 -5.548  0.54 23.31 ? 694  HOH A O     1 
HETATM 3858 O O     . HOH F 6 .   ? 92.427  57.671 22.257  0.60 34.17 ? 695  HOH A O     1 
HETATM 3859 O O     . HOH F 6 .   ? 90.206  60.042 13.956  1.00 50.90 ? 696  HOH A O     1 
HETATM 3860 O O     . HOH F 6 .   ? 82.578  74.424 14.073  0.68 32.34 ? 697  HOH A O     1 
HETATM 3861 O O     . HOH F 6 .   ? 85.856  78.240 12.153  0.73 27.84 ? 698  HOH A O     1 
HETATM 3862 O O     . HOH F 6 .   ? 88.214  71.885 6.164   0.41 18.14 ? 699  HOH A O     1 
HETATM 3863 O O     . HOH F 6 .   ? 54.483  33.926 43.358  0.43 26.12 ? 700  HOH A O     1 
HETATM 3864 O O     . HOH F 6 .   ? 81.258  47.846 37.606  0.88 36.67 ? 701  HOH A O     1 
HETATM 3865 O O     . HOH F 6 .   ? 77.185  51.161 27.293  0.65 27.12 ? 702  HOH A O     1 
HETATM 3866 O O     . HOH F 6 .   ? 39.587  49.297 18.815  0.44 14.76 ? 703  HOH A O     1 
HETATM 3867 O O     . HOH F 6 .   ? 63.085  59.058 -0.429  0.62 30.01 ? 704  HOH A O     1 
HETATM 3868 O O     . HOH F 6 .   ? 57.366  54.364 11.877  1.00 51.64 ? 705  HOH A O     1 
HETATM 3869 O O     . HOH F 6 .   ? 54.138  46.606 -7.516  0.47 40.41 ? 706  HOH A O     1 
HETATM 3870 O O     . HOH F 6 .   ? 73.855  48.650 -7.616  0.49 16.52 ? 707  HOH A O     1 
HETATM 3871 O O     . HOH F 6 .   ? 84.731  59.781 26.006  1.00 45.64 ? 708  HOH A O     1 
HETATM 3872 O O     . HOH F 6 .   ? 72.442  74.602 10.535  0.98 50.14 ? 709  HOH A O     1 
HETATM 3873 O O     . HOH F 6 .   ? 53.592  56.620 41.212  0.56 20.95 ? 710  HOH A O     1 
HETATM 3874 O O     . HOH F 6 .   ? 55.732  44.530 3.551   0.55 31.66 ? 711  HOH A O     1 
HETATM 3875 O O     . HOH F 6 .   ? 63.291  36.479 33.507  1.00 53.78 ? 712  HOH A O     1 
HETATM 3876 O O     . HOH F 6 .   ? 65.673  43.370 40.515  0.55 30.76 ? 713  HOH A O     1 
HETATM 3877 O O     . HOH F 6 .   ? 67.780  62.104 -7.451  0.67 41.96 ? 714  HOH A O     1 
HETATM 3878 O O     . HOH F 6 .   ? 71.524  62.860 -9.429  0.63 40.84 ? 715  HOH A O     1 
HETATM 3879 O O     . HOH F 6 .   ? 95.153  57.407 15.706  0.66 36.73 ? 716  HOH A O     1 
HETATM 3880 O O     . HOH F 6 .   ? 40.529  39.990 35.963  1.00 40.26 ? 717  HOH A O     1 
HETATM 3881 O O     . HOH F 6 .   ? 77.184  38.511 6.002   0.45 24.23 ? 718  HOH A O     1 
HETATM 3882 O O     . HOH F 6 .   ? 43.010  38.930 41.334  0.46 25.29 ? 719  HOH A O     1 
HETATM 3883 O O     . HOH F 6 .   ? 47.256  35.017 15.612  0.69 39.44 ? 720  HOH A O     1 
HETATM 3884 O O     . HOH F 6 .   ? 47.318  44.625 14.584  0.83 39.49 ? 721  HOH A O     1 
HETATM 3885 O O     . HOH F 6 .   ? 99.410  43.484 9.203   0.42 18.87 ? 722  HOH A O     1 
HETATM 3886 O O     . HOH F 6 .   ? 96.970  39.582 9.667   0.47 15.34 ? 723  HOH A O     1 
HETATM 3887 O O     . HOH F 6 .   ? 90.403  39.751 -3.597  0.48 18.62 ? 724  HOH A O     1 
HETATM 3888 O O     . HOH F 6 .   ? 42.599  55.215 16.601  0.57 36.44 ? 725  HOH A O     1 
HETATM 3889 O O     . HOH F 6 .   ? 86.713  67.748 21.671  0.36 24.82 ? 726  HOH A O     1 
HETATM 3890 O O     . HOH F 6 .   ? 100.503 39.152 8.315   0.67 37.18 ? 727  HOH A O     1 
HETATM 3891 O O     . HOH F 6 .   ? 78.052  55.655 25.353  1.00 55.82 ? 728  HOH A O     1 
HETATM 3892 O O     . HOH F 6 .   ? 77.853  54.761 -6.714  0.60 30.29 ? 729  HOH A O     1 
HETATM 3893 O O     . HOH F 6 .   ? 84.651  42.681 42.051  0.59 24.79 ? 730  HOH A O     1 
HETATM 3894 O O     . HOH F 6 .   ? 72.319  53.528 -7.885  0.87 40.56 ? 731  HOH A O     1 
HETATM 3895 O O     . HOH F 6 .   ? 50.232  32.936 29.460  0.72 27.49 ? 732  HOH A O     1 
HETATM 3896 O O     . HOH F 6 .   ? 94.721  39.233 -5.840  0.68 40.94 ? 733  HOH A O     1 
HETATM 3897 O O     . HOH F 6 .   ? 80.804  75.101 -3.340  0.69 36.05 ? 734  HOH A O     1 
HETATM 3898 O O     . HOH F 6 .   ? 91.492  43.739 47.819  0.67 51.92 ? 735  HOH A O     1 
HETATM 3899 O O     . HOH F 6 .   ? 68.418  51.091 39.640  0.61 25.12 ? 736  HOH A O     1 
HETATM 3900 O O     . HOH F 6 .   ? 40.659  50.895 37.540  0.38 18.12 ? 737  HOH A O     1 
HETATM 3901 O O     . HOH F 6 .   ? 57.990  46.374 6.197   0.59 19.80 ? 738  HOH A O     1 
HETATM 3902 O O     . HOH F 6 .   ? 64.371  56.213 42.287  0.58 22.76 ? 739  HOH A O     1 
HETATM 3903 O O     . HOH F 6 .   ? 94.034  41.535 44.629  0.54 38.63 ? 740  HOH A O     1 
HETATM 3904 O O     . HOH F 6 .   ? 70.987  57.981 25.104  0.25 25.14 ? 741  HOH A O     1 
HETATM 3905 O O     . HOH F 6 .   ? 70.984  59.019 30.545  0.28 21.74 ? 742  HOH A O     1 
HETATM 3906 O O     . HOH F 6 .   ? 81.565  58.515 36.013  0.82 27.66 ? 743  HOH A O     1 
HETATM 3907 O O     . HOH F 6 .   ? 99.441  48.094 11.722  0.43 36.11 ? 744  HOH A O     1 
HETATM 3908 O O     . HOH F 6 .   ? 63.301  67.643 -13.051 0.72 43.69 ? 745  HOH A O     1 
HETATM 3909 O O     . HOH F 6 .   ? 35.226  49.597 26.545  0.52 21.72 ? 746  HOH A O     1 
HETATM 3910 O O     . HOH F 6 .   ? 86.209  57.103 -4.600  0.29 31.62 ? 747  HOH A O     1 
HETATM 3911 O O     . HOH F 6 .   ? 51.428  55.509 47.954  0.33 44.56 ? 748  HOH A O     1 
HETATM 3912 O O     . HOH F 6 .   ? 77.922  51.548 40.192  0.73 47.61 ? 749  HOH A O     1 
HETATM 3913 O O     . HOH F 6 .   ? 97.896  57.070 44.810  0.47 46.00 ? 750  HOH A O     1 
HETATM 3914 O O     . HOH F 6 .   ? 95.747  38.902 37.014  0.70 37.62 ? 751  HOH A O     1 
HETATM 3915 O O     . HOH F 6 .   ? 55.976  38.821 21.886  0.70 42.93 ? 752  HOH A O     1 
HETATM 3916 O O     . HOH F 6 .   ? 63.882  35.034 35.166  0.44 48.54 ? 753  HOH A O     1 
HETATM 3917 O O     . HOH F 6 .   ? 48.536  31.925 34.276  0.60 30.16 ? 754  HOH A O     1 
HETATM 3918 O O     . HOH F 6 .   ? 51.675  50.898 10.099  0.62 47.53 ? 755  HOH A O     1 
HETATM 3919 O O     . HOH F 6 .   ? 60.836  39.136 21.798  0.51 41.06 ? 756  HOH A O     1 
HETATM 3920 O O     . HOH F 6 .   ? 104.507 29.170 19.629  0.66 46.56 ? 757  HOH A O     1 
HETATM 3921 O O     . HOH F 6 .   ? 67.221  69.641 15.415  0.75 43.05 ? 758  HOH A O     1 
HETATM 3922 O O     . HOH F 6 .   ? 51.346  51.130 7.027   0.43 36.22 ? 759  HOH A O     1 
HETATM 3923 O O     . HOH F 6 .   ? 58.417  51.121 -0.213  0.72 46.81 ? 760  HOH A O     1 
HETATM 3924 O O     . HOH F 6 .   ? 92.022  60.450 24.594  0.34 18.70 ? 761  HOH A O     1 
HETATM 3925 O O     . HOH F 6 .   ? 72.174  73.978 15.564  0.64 48.60 ? 762  HOH A O     1 
HETATM 3926 O O     . HOH F 6 .   ? 79.174  76.419 12.620  0.41 22.54 ? 763  HOH A O     1 
HETATM 3927 O O     . HOH F 6 .   ? 69.375  46.912 44.352  0.25 25.21 ? 764  HOH A O     1 
HETATM 3928 O O     . HOH F 6 .   ? 66.302  77.163 -0.422  0.69 39.04 ? 765  HOH A O     1 
HETATM 3929 O O     . HOH F 6 .   ? 87.831  74.704 6.343   0.96 32.65 ? 766  HOH A O     1 
HETATM 3930 O O     . HOH F 6 .   ? 87.430  62.390 33.589  0.72 32.05 ? 767  HOH A O     1 
HETATM 3931 O O     . HOH F 6 .   ? 58.998  35.520 27.092  0.89 48.81 ? 768  HOH A O     1 
HETATM 3932 O O     . HOH F 6 .   ? 99.704  43.812 18.012  0.41 38.18 ? 769  HOH A O     1 
HETATM 3933 O O     . HOH F 6 .   ? 89.171  48.812 5.194   0.65 36.17 ? 770  HOH A O     1 
HETATM 3934 O O     . HOH F 6 .   ? 53.686  51.436 10.207  0.65 37.06 ? 771  HOH A O     1 
HETATM 3935 O O     . HOH F 6 .   ? 54.408  49.680 -6.822  0.35 38.26 ? 772  HOH A O     1 
HETATM 3936 O O     . HOH F 6 .   ? 77.955  50.707 -7.601  0.38 41.74 ? 773  HOH A O     1 
HETATM 3937 O O     . HOH F 6 .   ? 82.529  64.730 24.038  0.44 29.74 ? 774  HOH A O     1 
HETATM 3938 O O     . HOH F 6 .   ? 93.730  54.973 21.735  0.53 38.41 ? 775  HOH A O     1 
HETATM 3939 O O     . HOH F 6 .   ? 92.104  47.161 -0.427  0.44 20.83 ? 776  HOH A O     1 
HETATM 3940 O O     . HOH F 6 .   ? 63.120  60.505 38.541  0.53 25.40 ? 777  HOH A O     1 
HETATM 3941 O O     . HOH F 6 .   ? 79.260  50.753 36.131  0.71 38.30 ? 778  HOH A O     1 
HETATM 3942 O O     . HOH F 6 .   ? 57.931  36.084 29.267  0.80 34.07 ? 779  HOH A O     1 
HETATM 3943 O O     . HOH F 6 .   ? 99.587  40.132 22.461  0.42 34.53 ? 780  HOH A O     1 
HETATM 3944 O O     . HOH F 6 .   ? 94.721  34.469 16.551  0.74 38.37 ? 781  HOH A O     1 
HETATM 3945 O O     . HOH F 6 .   ? 97.681  35.244 21.491  0.62 39.06 ? 782  HOH A O     1 
HETATM 3946 O O     . HOH F 6 .   ? 68.036  44.587 45.671  0.37 38.41 ? 783  HOH A O     1 
HETATM 3947 O O     . HOH F 6 .   ? 60.710  34.836 39.312  0.29 25.11 ? 784  HOH A O     1 
HETATM 3948 O O     . HOH F 6 .   ? 63.439  38.964 36.782  0.60 38.88 ? 785  HOH A O     1 
HETATM 3949 O O     . HOH F 6 .   ? 73.735  62.166 -8.134  0.62 36.84 ? 786  HOH A O     1 
HETATM 3950 O O     . HOH F 6 .   ? 47.109  58.609 16.210  0.48 36.03 ? 787  HOH A O     1 
HETATM 3951 O O     . HOH F 6 .   ? 48.312  57.418 14.549  0.65 55.47 ? 788  HOH A O     1 
HETATM 3952 O O     . HOH F 6 .   ? 52.247  48.152 43.145  0.38 19.04 ? 789  HOH A O     1 
HETATM 3953 O O     . HOH F 6 .   ? 86.701  36.686 9.821   0.75 34.76 ? 790  HOH A O     1 
HETATM 3954 O O     . HOH F 6 .   ? 91.996  50.495 4.617   0.83 49.34 ? 791  HOH A O     1 
HETATM 3955 O O     . HOH F 6 .   ? 98.130  41.032 7.762   0.33 15.16 ? 792  HOH A O     1 
HETATM 3956 O O     . HOH F 6 .   ? 92.735  46.616 -3.502  0.48 28.34 ? 793  HOH A O     1 
HETATM 3957 O O     . HOH F 6 .   ? 84.991  45.210 7.770   0.65 29.17 ? 794  HOH A O     1 
HETATM 3958 O O     . HOH F 6 .   ? 49.816  56.330 17.443  0.54 16.27 ? 795  HOH A O     1 
HETATM 3959 O O     . HOH F 6 .   ? 51.678  58.459 21.514  0.51 15.52 ? 796  HOH A O     1 
HETATM 3960 O O     . HOH F 6 .   ? 77.520  59.936 20.093  0.58 22.62 ? 797  HOH A O     1 
HETATM 3961 O O     . HOH F 6 .   ? 80.577  53.629 25.834  0.83 31.68 ? 798  HOH A O     1 
HETATM 3962 O O     . HOH F 6 .   ? 65.663  55.335 -7.667  0.83 47.38 ? 799  HOH A O     1 
HETATM 3963 O O     . HOH F 6 .   ? 70.761  48.068 -6.815  0.77 35.78 ? 800  HOH A O     1 
HETATM 3964 O O     . HOH F 6 .   ? 61.277  55.566 -1.762  0.62 36.22 ? 801  HOH A O     1 
HETATM 3965 O O     . HOH F 6 .   ? 63.484  38.906 -3.611  0.59 35.95 ? 802  HOH A O     1 
HETATM 3966 O O     . HOH F 6 .   ? 70.724  37.660 -7.078  0.65 35.58 ? 803  HOH A O     1 
HETATM 3967 O O     . HOH F 6 .   ? 52.759  34.857 28.324  0.46 17.35 ? 804  HOH A O     1 
HETATM 3968 O O     . HOH F 6 .   ? 50.919  30.601 31.278  0.48 34.12 ? 805  HOH A O     1 
HETATM 3969 O O     . HOH F 6 .   ? 83.321  81.784 -0.526  0.47 16.88 ? 806  HOH A O     1 
HETATM 3970 O O     . HOH F 6 .   ? 72.556  53.078 40.833  0.51 38.72 ? 807  HOH A O     1 
HETATM 3971 O O     . HOH F 6 .   ? 62.851  64.927 6.850   0.60 27.48 ? 808  HOH A O     1 
HETATM 3972 O O     . HOH F 6 .   ? 57.336  53.659 9.730   0.59 38.29 ? 809  HOH A O     1 
HETATM 3973 O O     . HOH F 6 .   ? 102.491 40.744 25.949  0.59 39.78 ? 810  HOH A O     1 
HETATM 3974 O O     . HOH F 6 .   ? 95.497  51.915 45.533  0.52 47.76 ? 811  HOH A O     1 
HETATM 3975 O O     . HOH F 6 .   ? 31.549  55.788 23.298  0.57 40.07 ? 812  HOH A O     1 
HETATM 3976 O O     . HOH F 6 .   ? 59.126  75.176 11.498  0.80 45.52 ? 813  HOH A O     1 
HETATM 3977 O O     . HOH F 6 .   ? 65.142  64.695 -5.437  0.39 22.94 ? 814  HOH A O     1 
HETATM 3978 O O     . HOH F 6 .   ? 97.747  54.005 35.831  0.70 43.65 ? 815  HOH A O     1 
HETATM 3979 O O     . HOH F 6 .   ? 97.991  48.000 15.013  0.45 25.39 ? 816  HOH A O     1 
HETATM 3980 O O     . HOH F 6 .   ? 92.979  41.411 39.618  0.45 7.49  ? 817  HOH A O     1 
HETATM 3981 O O     . HOH F 6 .   ? 95.197  41.815 38.634  0.44 26.26 ? 818  HOH A O     1 
HETATM 3982 O O     . HOH F 6 .   ? 71.014  63.935 19.418  0.16 22.81 ? 819  HOH A O     1 
HETATM 3983 O O     . HOH F 6 .   ? 82.832  47.912 4.326   0.61 26.70 ? 820  HOH A O     1 
HETATM 3984 O O     . HOH F 6 .   ? 37.471  39.610 24.800  0.57 36.07 ? 821  HOH A O     1 
HETATM 3985 O O     . HOH F 6 .   ? 50.398  55.585 50.117  0.14 39.79 ? 822  HOH A O     1 
HETATM 3986 O O     . HOH F 6 .   ? 45.047  53.975 38.914  0.70 42.95 ? 823  HOH A O     1 
HETATM 3987 O O     . HOH F 6 .   ? 91.012  59.981 44.244  0.60 38.09 ? 824  HOH A O     1 
HETATM 3988 O O     . HOH F 6 .   ? 95.243  56.689 48.691  0.66 49.01 ? 825  HOH A O     1 
HETATM 3989 O O     . HOH F 6 .   ? 94.508  50.369 21.224  0.70 38.77 ? 826  HOH A O     1 
HETATM 3990 O O     . HOH F 6 .   ? 44.619  38.179 21.332  0.48 34.16 ? 827  HOH A O     1 
HETATM 3991 O O     . HOH F 6 .   ? 42.615  40.488 20.511  0.37 23.26 ? 828  HOH A O     1 
HETATM 3992 O O     . HOH F 6 .   ? 47.202  33.724 31.859  0.70 38.29 ? 829  HOH A O     1 
HETATM 3993 O O     . HOH F 6 .   ? 41.268  40.962 38.340  0.33 27.79 ? 830  HOH A O     1 
HETATM 3994 O O     . HOH F 6 .   ? 54.474  53.798 15.339  0.96 51.39 ? 831  HOH A O     1 
HETATM 3995 O O     . HOH F 6 .   ? 64.285  77.869 14.533  0.53 41.09 ? 832  HOH A O     1 
HETATM 3996 O O     . HOH F 6 .   ? 63.843  77.477 17.401  0.29 36.36 ? 833  HOH A O     1 
HETATM 3997 O O     . HOH F 6 .   ? 59.797  59.665 10.020  0.44 27.03 ? 834  HOH A O     1 
HETATM 3998 O O     . HOH F 6 .   ? 56.914  47.698 -4.058  0.49 51.72 ? 835  HOH A O     1 
HETATM 3999 O O     . HOH F 6 .   ? 60.768  52.192 -7.983  0.43 36.17 ? 836  HOH A O     1 
HETATM 4000 O O     . HOH F 6 .   ? 82.115  49.728 -1.799  0.65 38.44 ? 837  HOH A O     1 
HETATM 4001 O O     . HOH F 6 .   ? 69.982  70.415 12.769  0.89 61.39 ? 838  HOH A O     1 
HETATM 4002 O O     . HOH F 6 .   ? 72.340  71.358 12.191  0.71 41.09 ? 839  HOH A O     1 
HETATM 4003 O O     . HOH F 6 .   ? 72.063  75.558 12.965  0.28 30.23 ? 840  HOH A O     1 
HETATM 4004 O O     . HOH F 6 .   ? 69.872  78.111 7.018   0.92 51.01 ? 841  HOH A O     1 
HETATM 4005 O O     . HOH F 6 .   ? 65.024  57.421 36.265  0.73 46.01 ? 842  HOH A O     1 
HETATM 4006 O O     . HOH F 6 .   ? 66.657  63.133 -4.779  0.47 31.44 ? 843  HOH A O     1 
HETATM 4007 O O     . HOH F 6 .   ? 77.139  37.037 41.063  0.36 13.51 ? 844  HOH A O     1 
HETATM 4008 O O     . HOH F 6 .   ? 99.655  34.177 20.186  0.46 34.66 ? 845  HOH A O     1 
HETATM 4009 O O     . HOH F 6 .   ? 98.642  34.052 15.224  0.78 55.00 ? 846  HOH A O     1 
HETATM 4010 O O     . HOH F 6 .   ? 56.426  46.385 1.160   0.27 22.46 ? 847  HOH A O     1 
HETATM 4011 O O     . HOH F 6 .   ? 58.562  44.030 -1.562  0.70 42.66 ? 848  HOH A O     1 
HETATM 4012 O O     . HOH F 6 .   ? 38.313  48.694 16.470  0.55 47.48 ? 849  HOH A O     1 
HETATM 4013 O O     . HOH F 6 .   ? 62.559  67.221 15.763  0.64 42.47 ? 850  HOH A O     1 
HETATM 4014 O O     . HOH F 6 .   ? 68.882  68.364 17.333  0.41 22.12 ? 851  HOH A O     1 
HETATM 4015 O O     . HOH F 6 .   ? 64.499  71.945 16.530  0.40 33.42 ? 852  HOH A O     1 
HETATM 4016 O O     . HOH F 6 .   ? 72.854  50.835 -8.987  0.34 29.98 ? 853  HOH A O     1 
HETATM 4017 O O     . HOH F 6 .   ? 97.542  34.749 16.858  0.58 41.74 ? 854  HOH A O     1 
HETATM 4018 O O     . HOH F 6 .   ? 97.814  39.298 17.872  0.40 40.57 ? 855  HOH A O     1 
HETATM 4019 O O     . HOH F 6 .   ? 66.848  45.611 43.312  0.34 19.26 ? 856  HOH A O     1 
HETATM 4020 O O     . HOH F 6 .   ? 62.467  40.295 39.376  0.56 44.90 ? 857  HOH A O     1 
HETATM 4021 O O     . HOH F 6 .   ? 75.910  60.199 -9.455  0.22 28.08 ? 858  HOH A O     1 
HETATM 4022 O O     . HOH F 6 .   ? 93.989  60.956 12.283  0.41 49.74 ? 859  HOH A O     1 
HETATM 4023 O O     . HOH F 6 .   ? 37.601  64.340 27.749  0.83 46.17 ? 860  HOH A O     1 
HETATM 4024 O O     . HOH F 6 .   ? 86.746  43.104 7.395   0.45 18.95 ? 861  HOH A O     1 
HETATM 4025 O O     . HOH F 6 .   ? 82.800  37.457 11.878  0.43 24.10 ? 862  HOH A O     1 
HETATM 4026 O O     . HOH F 6 .   ? 48.819  43.362 41.215  0.46 23.91 ? 863  HOH A O     1 
HETATM 4027 O O     . HOH F 6 .   ? 51.384  45.408 42.690  0.33 22.07 ? 864  HOH A O     1 
HETATM 4028 O O     . HOH F 6 .   ? 46.713  41.334 39.955  0.42 24.14 ? 865  HOH A O     1 
HETATM 4029 O O     . HOH F 6 .   ? 43.899  40.140 11.734  0.43 47.90 ? 866  HOH A O     1 
HETATM 4030 O O     . HOH F 6 .   ? 52.179  42.494 8.725   0.32 19.80 ? 867  HOH A O     1 
HETATM 4031 O O     . HOH F 6 .   ? 39.217  58.167 21.216  0.60 39.61 ? 868  HOH A O     1 
HETATM 4032 O O     . HOH F 6 .   ? 95.340  31.252 31.857  0.54 25.80 ? 869  HOH A O     1 
HETATM 4033 O O     . HOH F 6 .   ? 83.328  44.052 37.190  0.51 17.51 ? 870  HOH A O     1 
HETATM 4034 O O     . HOH F 6 .   ? 59.255  54.896 15.442  0.49 31.99 ? 871  HOH A O     1 
HETATM 4035 O O     . HOH F 6 .   ? 44.614  63.164 22.485  0.54 30.64 ? 872  HOH A O     1 
HETATM 4036 O O     . HOH F 6 .   ? 97.208  39.109 -1.331  0.66 45.14 ? 873  HOH A O     1 
HETATM 4037 O O     . HOH F 6 .   ? 60.972  36.160 -0.056  0.63 38.56 ? 874  HOH A O     1 
HETATM 4038 O O     . HOH F 6 .   ? 70.572  40.440 -8.794  0.38 26.35 ? 875  HOH A O     1 
HETATM 4039 O O     . HOH F 6 .   ? 86.948  64.884 4.309   0.53 35.87 ? 876  HOH A O     1 
HETATM 4040 O O     . HOH F 6 .   ? 98.766  31.686 32.349  0.51 25.09 ? 877  HOH A O     1 
HETATM 4041 O O     . HOH F 6 .   ? 56.651  49.580 8.438   0.58 26.19 ? 878  HOH A O     1 
HETATM 4042 O O     . HOH F 6 .   ? 57.472  49.754 3.928   0.56 36.99 ? 879  HOH A O     1 
HETATM 4043 O O     . HOH F 6 .   ? 52.209  50.144 41.714  0.41 28.38 ? 880  HOH A O     1 
HETATM 4044 O O     . HOH F 6 .   ? 61.389  55.121 44.026  0.47 41.92 ? 881  HOH A O     1 
HETATM 4045 O O     . HOH F 6 .   ? 92.525  40.282 42.016  0.32 25.30 ? 882  HOH A O     1 
HETATM 4046 O O     . HOH F 6 .   ? 97.880  42.480 35.405  0.75 42.64 ? 883  HOH A O     1 
HETATM 4047 O O     . HOH F 6 .   ? 94.223  52.316 43.956  0.71 35.73 ? 884  HOH A O     1 
HETATM 4048 O O     . HOH F 6 .   ? 87.594  58.798 2.339   0.74 40.59 ? 885  HOH A O     1 
HETATM 4049 O O     . HOH F 6 .   ? 100.681 32.351 16.453  0.46 39.53 ? 886  HOH A O     1 
HETATM 4050 O O     . HOH F 6 .   ? 80.940  60.364 34.240  0.53 44.94 ? 887  HOH A O     1 
HETATM 4051 O O     . HOH F 6 .   ? 98.939  55.575 39.252  0.36 35.77 ? 888  HOH A O     1 
HETATM 4052 O O     . HOH F 6 .   ? 94.365  55.488 32.607  0.33 16.83 ? 889  HOH A O     1 
HETATM 4053 O O     . HOH F 6 .   ? 99.089  46.014 13.584  0.55 52.46 ? 890  HOH A O     1 
HETATM 4054 O O     . HOH F 6 .   ? 63.338  55.743 -7.679  0.65 50.79 ? 891  HOH A O     1 
HETATM 4055 O O     . HOH F 6 .   ? 80.006  38.030 41.610  0.43 33.76 ? 892  HOH A O     1 
HETATM 4056 O O     . HOH F 6 .   ? 54.417  32.154 17.311  0.43 29.58 ? 893  HOH A O     1 
HETATM 4057 O O     . HOH F 6 .   ? 57.670  34.034 35.119  0.49 42.23 ? 894  HOH A O     1 
HETATM 4058 O O     . HOH F 6 .   ? 87.571  47.190 -1.100  0.22 29.19 ? 895  HOH A O     1 
HETATM 4059 O O     . HOH F 6 .   ? 46.512  25.067 24.485  0.28 27.12 ? 896  HOH A O     1 
HETATM 4060 O O     . HOH F 6 .   ? 44.154  29.037 20.544  0.25 35.29 ? 897  HOH A O     1 
HETATM 4061 O O     . HOH F 6 .   ? 50.285  28.263 24.714  0.49 40.04 ? 898  HOH A O     1 
HETATM 4062 O O     . HOH F 6 .   ? 39.351  60.817 24.878  0.68 43.11 ? 899  HOH A O     1 
HETATM 4063 O O     . HOH F 6 .   ? 58.189  53.616 7.888   0.35 33.05 ? 900  HOH A O     1 
HETATM 4064 O O     . HOH F 6 .   ? 54.447  53.382 11.533  0.33 36.49 ? 901  HOH A O     1 
HETATM 4065 O O     . HOH F 6 .   ? 57.923  56.403 0.839   0.40 32.69 ? 902  HOH A O     1 
HETATM 4066 O O     . HOH F 6 .   ? 72.541  71.008 -10.331 0.46 41.84 ? 903  HOH A O     1 
HETATM 4067 O O     . HOH F 6 .   ? 80.963  69.428 22.770  0.40 41.80 ? 904  HOH A O     1 
HETATM 4068 O O     . HOH F 6 .   ? 85.451  61.229 -1.249  0.56 45.45 ? 905  HOH A O     1 
HETATM 4069 O O     . HOH F 6 .   ? 73.768  76.904 12.352  0.27 42.89 ? 906  HOH A O     1 
HETATM 4070 O O     . HOH F 6 .   ? 85.416  76.641 15.229  0.76 45.83 ? 907  HOH A O     1 
HETATM 4071 O O     . HOH F 6 .   ? 87.897  81.622 12.720  0.52 39.47 ? 908  HOH A O     1 
HETATM 4072 O O     . HOH F 6 .   ? 64.456  62.337 36.102  0.28 15.45 ? 909  HOH A O     1 
HETATM 4073 O O     . HOH F 6 .   ? 106.649 42.549 30.024  0.47 51.01 ? 910  HOH A O     1 
HETATM 4074 O O     . HOH F 6 .   ? 63.332  35.984 31.209  0.63 41.96 ? 911  HOH A O     1 
HETATM 4075 O O     . HOH F 6 .   ? 64.085  73.822 14.571  0.56 51.19 ? 912  HOH A O     1 
HETATM 4076 O O     . HOH F 6 .   ? 60.233  62.112 12.073  0.48 33.79 ? 913  HOH A O     1 
HETATM 4077 O O     . HOH F 6 .   ? 57.730  57.198 8.989   0.28 29.31 ? 914  HOH A O     1 
HETATM 4078 O O     . HOH F 6 .   ? 81.220  54.200 -5.162  0.45 31.02 ? 915  HOH A O     1 
HETATM 4079 O O     . HOH F 6 .   ? 90.940  59.751 10.962  0.73 41.96 ? 916  HOH A O     1 
HETATM 4080 O O     . HOH F 6 .   ? 86.312  48.396 2.875   0.67 40.15 ? 917  HOH A O     1 
HETATM 4081 O O     . HOH F 6 .   ? 82.990  77.441 15.149  0.59 45.06 ? 918  HOH A O     1 
HETATM 4082 O O     . HOH F 6 .   ? 62.745  36.141 25.075  0.36 32.50 ? 919  HOH A O     1 
HETATM 4083 O O     . HOH F 6 .   ? 78.128  39.857 42.247  0.28 36.47 ? 920  HOH A O     1 
HETATM 4084 O O     . HOH F 6 .   ? 92.327  29.136 37.925  0.55 49.21 ? 921  HOH A O     1 
HETATM 4085 O O     . HOH F 6 .   ? 69.667  46.931 40.965  0.41 40.59 ? 922  HOH A O     1 
HETATM 4086 O O     . HOH F 6 .   ? 54.762  50.990 44.928  0.49 46.92 ? 923  HOH A O     1 
HETATM 4087 O O     . HOH F 6 .   ? 62.928  38.937 33.989  0.58 36.23 ? 924  HOH A O     1 
HETATM 4088 O O     . HOH F 6 .   ? 67.218  41.012 33.239  0.59 35.58 ? 925  HOH A O     1 
HETATM 4089 O O     . HOH F 6 .   ? 68.850  42.554 34.171  0.81 47.18 ? 926  HOH A O     1 
HETATM 4090 O O     . HOH F 6 .   ? 73.196  59.073 -8.440  0.39 36.24 ? 927  HOH A O     1 
HETATM 4091 O O     . HOH F 6 .   ? 93.859  61.183 16.862  0.50 30.81 ? 928  HOH A O     1 
HETATM 4092 O O     . HOH F 6 .   ? 90.516  66.764 18.802  0.24 36.02 ? 929  HOH A O     1 
HETATM 4093 O O     . HOH F 6 .   ? 56.425  54.826 16.250  0.40 30.55 ? 930  HOH A O     1 
HETATM 4094 O O     . HOH F 6 .   ? 41.555  32.484 26.007  0.61 48.68 ? 931  HOH A O     1 
HETATM 4095 O O     . HOH F 6 .   ? 79.206  36.412 5.875   0.53 35.72 ? 932  HOH A O     1 
HETATM 4096 O O     . HOH F 6 .   ? 85.124  43.381 -5.926  0.70 51.27 ? 933  HOH A O     1 
HETATM 4097 O O     . HOH F 6 .   ? 81.644  50.386 37.912  0.66 37.79 ? 934  HOH A O     1 
HETATM 4098 O O     . HOH F 6 .   ? 97.816  35.327 30.267  0.77 49.32 ? 935  HOH A O     1 
HETATM 4099 O O     . HOH F 6 .   ? 59.420  47.824 -2.467  0.52 31.24 ? 936  HOH A O     1 
HETATM 4100 O O     . HOH F 6 .   ? 46.972  28.769 24.609  0.46 43.94 ? 937  HOH A O     1 
HETATM 4101 O O     . HOH F 6 .   ? 41.814  29.694 23.396  0.36 30.12 ? 938  HOH A O     1 
HETATM 4102 O O     . HOH F 6 .   ? 81.464  79.083 -0.961  0.65 31.03 ? 939  HOH A O     1 
HETATM 4103 O O     . HOH F 6 .   ? 89.196  76.566 3.319   0.57 33.73 ? 940  HOH A O     1 
HETATM 4104 O O     . HOH F 6 .   ? 96.356  34.471 18.384  0.54 42.38 ? 941  HOH A O     1 
HETATM 4105 O O     . HOH F 6 .   ? 83.686  48.893 1.936   0.50 36.50 ? 942  HOH A O     1 
HETATM 4106 O O     . HOH F 6 .   ? 93.606  49.570 39.035  0.54 14.42 ? 943  HOH A O     1 
HETATM 4107 O O     . HOH F 6 .   ? 77.691  53.179 34.807  0.50 30.52 ? 944  HOH A O     1 
HETATM 4108 O O     . HOH F 6 .   ? 92.163  57.121 8.109   0.50 31.83 ? 945  HOH A O     1 
HETATM 4109 O O     . HOH F 6 .   ? 83.389  61.369 32.240  0.59 40.68 ? 946  HOH A O     1 
HETATM 4110 O O     . HOH F 6 .   ? 49.612  30.151 27.249  0.52 36.21 ? 947  HOH A O     1 
HETATM 4111 O O     . HOH F 6 .   ? 90.106  35.659 40.817  0.38 33.91 ? 948  HOH A O     1 
HETATM 4112 O O     . HOH F 6 .   ? 94.855  56.811 35.175  0.57 40.79 ? 949  HOH A O     1 
HETATM 4113 O O     . HOH F 6 .   ? 53.989  33.992 24.660  0.63 44.07 ? 950  HOH A O     1 
HETATM 4114 O O     . HOH F 6 .   ? 45.944  24.959 22.097  0.21 31.55 ? 951  HOH A O     1 
HETATM 4115 O O     . HOH F 6 .   ? 64.553  69.384 15.416  0.55 34.92 ? 952  HOH A O     1 
HETATM 4116 O O     . HOH F 6 .   ? 83.184  63.023 25.149  0.51 48.22 ? 953  HOH A O     1 
HETATM 4117 O O     . HOH F 6 .   ? 90.469  49.611 2.304   0.81 51.80 ? 954  HOH A O     1 
HETATM 4118 O O     . HOH F 6 .   ? 69.174  79.902 3.298   0.60 51.37 ? 955  HOH A O     1 
HETATM 4119 O O     . HOH F 6 .   ? 53.232  62.247 17.146  0.54 50.80 ? 956  HOH A O     1 
HETATM 4120 O O     . HOH F 6 .   ? 88.701  54.645 43.940  0.54 38.21 ? 957  HOH A O     1 
HETATM 4121 O O     . HOH F 6 .   ? 84.251  36.031 3.305   0.80 45.64 ? 958  HOH A O     1 
HETATM 4122 O O     . HOH F 6 .   ? 88.618  46.559 -1.323  0.26 29.52 ? 959  HOH A O     1 
HETATM 4123 O O     . HOH F 6 .   ? 72.735  78.067 8.900   0.33 39.40 ? 960  HOH A O     1 
HETATM 4124 O O     . HOH F 6 .   ? 86.761  72.859 3.819   0.41 34.52 ? 961  HOH A O     1 
HETATM 4125 O O     . HOH F 6 .   ? 89.293  62.353 32.707  0.64 48.10 ? 962  HOH A O     1 
HETATM 4126 O O     . HOH F 6 .   ? 97.461  38.076 11.634  0.43 31.51 ? 963  HOH A O     1 
HETATM 4127 O O     . HOH F 6 .   ? 59.189  33.197 25.832  0.49 47.97 ? 964  HOH A O     1 
HETATM 4128 O O     . HOH F 6 .   ? 60.785  35.055 23.382  0.43 50.58 ? 965  HOH A O     1 
HETATM 4129 O O     . HOH F 6 .   ? 80.348  37.554 43.838  0.17 40.05 ? 966  HOH A O     1 
HETATM 4130 O O     . HOH F 6 .   ? 96.407  31.968 30.053  0.52 41.90 ? 967  HOH A O     1 
HETATM 4131 O O     . HOH F 6 .   ? 54.069  44.409 46.566  0.32 22.51 ? 968  HOH A O     1 
HETATM 4132 O O     . HOH F 6 .   ? 68.743  42.943 39.016  0.55 41.68 ? 969  HOH A O     1 
HETATM 4133 O O     . HOH F 6 .   ? 85.266  64.733 20.769  0.66 44.46 ? 970  HOH A O     1 
HETATM 4134 O O     . HOH F 6 .   ? 72.812  53.664 30.303  0.30 25.93 ? 971  HOH A O     1 
HETATM 4135 O O     . HOH F 6 .   ? 87.418  33.308 35.936  0.49 28.83 ? 972  HOH A O     1 
HETATM 4136 O O     . HOH F 6 .   ? 80.064  45.558 38.382  0.61 42.56 ? 973  HOH A O     1 
HETATM 4137 O O     . HOH F 6 .   ? 61.219  38.016 -1.998  0.64 44.11 ? 974  HOH A O     1 
HETATM 4138 O O     . HOH F 6 .   ? 81.608  51.460 10.103  0.66 31.91 ? 975  HOH A O     1 
HETATM 4139 O O     . HOH F 6 .   ? 64.249  74.761 0.041   0.44 43.97 ? 976  HOH A O     1 
HETATM 4140 O O     . HOH F 6 .   ? 76.387  46.306 37.399  0.37 27.05 ? 977  HOH A O     1 
HETATM 4141 O O     . HOH F 6 .   ? 103.702 44.302 29.501  0.18 24.14 ? 978  HOH A O     1 
HETATM 4142 O O     . HOH F 6 .   ? 67.566  56.138 -6.513  0.43 40.41 ? 979  HOH A O     1 
HETATM 4143 O O     . HOH F 6 .   ? 43.232  53.285 36.607  0.42 26.84 ? 980  HOH A O     1 
HETATM 4144 O O     . HOH F 6 .   ? 95.315  35.923 37.313  0.43 31.19 ? 981  HOH A O     1 
HETATM 4145 O O     . HOH F 6 .   ? 60.704  47.650 19.500  1.00 24.20 ? 982  HOH A O     1 
HETATM 4146 O O     . HOH F 6 .   ? 74.843  51.047 27.022  1.00 34.91 ? 983  HOH A O     1 
HETATM 4147 O O     . HOH F 6 .   ? 75.350  57.959 20.046  0.83 22.05 ? 984  HOH A O     1 
HETATM 4148 O O     . HOH F 6 .   ? 64.429  34.705 13.089  1.00 42.81 ? 985  HOH A O     1 
HETATM 4149 O O     . HOH F 6 .   ? 74.325  72.188 15.627  0.69 29.02 ? 986  HOH A O     1 
HETATM 4150 O O     . HOH F 6 .   ? 100.645 47.207 31.323  1.00 44.08 ? 987  HOH A O     1 
HETATM 4151 O O     . HOH F 6 .   ? 90.574  58.197 27.424  1.00 39.18 ? 988  HOH A O     1 
HETATM 4152 O O     . HOH F 6 .   ? 33.425  52.361 26.244  1.00 38.88 ? 989  HOH A O     1 
HETATM 4153 O O     . HOH F 6 .   ? 98.265  47.820 27.846  1.00 39.63 ? 990  HOH A O     1 
HETATM 4154 O O     . HOH F 6 .   ? 68.374  60.410 20.486  1.00 41.37 ? 991  HOH A O     1 
HETATM 4155 O O     . HOH F 6 .   ? 86.419  66.930 6.740   1.00 40.68 ? 992  HOH A O     1 
HETATM 4156 O O     . HOH F 6 .   ? 47.694  65.187 23.682  0.37 29.12 ? 993  HOH A O     1 
HETATM 4157 O O     . HOH F 6 .   ? 96.773  51.065 27.697  1.00 44.99 ? 994  HOH A O     1 
HETATM 4158 O O     . HOH F 6 .   ? 73.404  53.581 24.291  1.00 40.81 ? 995  HOH A O     1 
HETATM 4159 O O     . HOH F 6 .   ? 85.843  70.218 19.003  1.00 45.30 ? 996  HOH A O     1 
HETATM 4160 O O     . HOH F 6 .   ? 61.469  69.360 8.655   1.00 42.40 ? 997  HOH A O     1 
HETATM 4161 O O     . HOH F 6 .   ? 72.658  52.628 26.536  1.00 42.65 ? 998  HOH A O     1 
HETATM 4162 O O     . HOH F 6 .   ? 86.731  69.659 7.819   1.00 43.08 ? 999  HOH A O     1 
HETATM 4163 O O     . HOH F 6 .   ? 82.346  71.608 21.441  1.00 43.96 ? 1000 HOH A O     1 
HETATM 4164 O O     . HOH F 6 .   ? 85.396  69.263 5.782   1.00 41.50 ? 1001 HOH A O     1 
HETATM 4165 O O     . HOH F 6 .   ? 81.904  45.534 37.076  1.00 38.79 ? 1002 HOH A O     1 
HETATM 4166 O O     . HOH F 6 .   ? 92.236  49.334 8.772   0.50 26.90 ? 1003 HOH A O     1 
HETATM 4167 O O     . HOH F 6 .   ? 72.834  78.525 1.172   1.00 42.88 ? 1004 HOH A O     1 
HETATM 4168 O O     . HOH F 6 .   ? 72.203  56.241 23.035  1.00 46.78 ? 1005 HOH A O     1 
HETATM 4169 O O     . HOH F 6 .   ? 83.376  46.802 1.709   1.00 43.73 ? 1006 HOH A O     1 
HETATM 4170 O O     . HOH F 6 .   ? 56.409  51.795 11.379  1.00 45.77 ? 1007 HOH A O     1 
HETATM 4171 O O     . HOH F 6 .   ? 69.892  58.358 21.803  1.00 43.51 ? 1008 HOH A O     1 
HETATM 4172 O O     . HOH F 6 .   ? 83.557  75.510 -0.698  1.00 41.23 ? 1009 HOH A O     1 
HETATM 4173 O O     . HOH F 6 .   ? 70.979  68.873 18.358  0.50 48.64 ? 1010 HOH A O     1 
HETATM 4174 O O     . HOH F 6 .   ? 102.292 29.001 20.386  1.00 48.02 ? 1011 HOH A O     1 
HETATM 4175 O O     . HOH F 6 .   ? 71.126  71.992 17.233  0.74 55.27 ? 1012 HOH A O     1 
HETATM 4176 O O     . HOH F 6 .   ? 76.578  43.754 31.716  1.00 41.32 ? 1013 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ALA 1   1   ?   ?   ?   A . n 
A 1 2   CYS 2   2   ?   ?   ?   A . n 
A 1 3   ARG 3   3   ?   ?   ?   A . n 
A 1 4   GLN 4   4   ?   ?   ?   A . n 
A 1 5   GLU 5   5   ?   ?   ?   A . n 
A 1 6   PRO 6   6   ?   ?   ?   A . n 
A 1 7   GLN 7   7   ?   ?   ?   A . n 
A 1 8   PRO 8   8   ?   ?   ?   A . n 
A 1 9   GLN 9   9   ?   ?   ?   A . n 
A 1 10  GLY 10  10  ?   ?   ?   A . n 
A 1 11  PRO 11  11  ?   ?   ?   A . n 
A 1 12  PRO 12  12  ?   ?   ?   A . n 
A 1 13  PRO 13  13  ?   ?   ?   A . n 
A 1 14  ALA 14  14  ?   ?   ?   A . n 
A 1 15  ALA 15  15  ?   ?   ?   A . n 
A 1 16  GLY 16  16  ?   ?   ?   A . n 
A 1 17  ALA 17  17  ?   ?   ?   A . n 
A 1 18  VAL 18  18  18  VAL VAL A . n 
A 1 19  ALA 19  19  19  ALA ALA A . n 
A 1 20  SER 20  20  20  SER SER A . n 
A 1 21  TYR 21  21  21  TYR TYR A . n 
A 1 22  ASP 22  22  22  ASP ASP A . n 
A 1 23  TYR 23  23  23  TYR TYR A . n 
A 1 24  LEU 24  24  24  LEU LEU A . n 
A 1 25  VAL 25  25  25  VAL VAL A . n 
A 1 26  ILE 26  26  26  ILE ILE A . n 
A 1 27  GLY 27  27  27  GLY GLY A . n 
A 1 28  GLY 28  28  28  GLY GLY A . n 
A 1 29  GLY 29  29  29  GLY GLY A . n 
A 1 30  SER 30  30  30  SER SER A . n 
A 1 31  GLY 31  31  31  GLY GLY A . n 
A 1 32  GLY 32  32  32  GLY GLY A . n 
A 1 33  LEU 33  33  33  LEU LEU A . n 
A 1 34  ALA 34  34  34  ALA ALA A . n 
A 1 35  SER 35  35  35  SER SER A . n 
A 1 36  ALA 36  36  36  ALA ALA A . n 
A 1 37  ARG 37  37  37  ARG ARG A . n 
A 1 38  ARG 38  38  38  ARG ARG A . n 
A 1 39  ALA 39  39  39  ALA ALA A . n 
A 1 40  ALA 40  40  40  ALA ALA A . n 
A 1 41  GLU 41  41  41  GLU GLU A . n 
A 1 42  LEU 42  42  42  LEU LEU A . n 
A 1 43  GLY 43  43  43  GLY GLY A . n 
A 1 44  ALA 44  44  44  ALA ALA A . n 
A 1 45  ARG 45  45  45  ARG ARG A . n 
A 1 46  ALA 46  46  46  ALA ALA A . n 
A 1 47  ALA 47  47  47  ALA ALA A . n 
A 1 48  VAL 48  48  48  VAL VAL A . n 
A 1 49  VAL 49  49  49  VAL VAL A . n 
A 1 50  GLU 50  50  50  GLU GLU A . n 
A 1 51  SER 51  51  51  SER SER A . n 
A 1 52  HIS 52  52  52  HIS HIS A . n 
A 1 53  LYS 53  53  53  LYS LYS A . n 
A 1 54  LEU 54  54  54  LEU LEU A . n 
A 1 55  GLY 55  55  55  GLY GLY A . n 
A 1 56  GLY 56  56  56  GLY GLY A . n 
A 1 57  THR 57  57  57  THR THR A . n 
A 1 58  CYS 58  58  58  CYS CYS A . n 
A 1 59  VAL 59  59  59  VAL VAL A . n 
A 1 60  ASN 60  60  60  ASN ASN A . n 
A 1 61  VAL 61  61  61  VAL VAL A . n 
A 1 62  GLY 62  62  62  GLY GLY A . n 
A 1 63  CYS 63  63  63  CYS CYS A . n 
A 1 64  VAL 64  64  64  VAL VAL A . n 
A 1 65  PRO 65  65  65  PRO PRO A . n 
A 1 66  LYS 66  66  66  LYS LYS A . n 
A 1 67  LYS 67  67  67  LYS LYS A . n 
A 1 68  VAL 68  68  68  VAL VAL A . n 
A 1 69  MET 69  69  69  MET MET A . n 
A 1 70  TRP 70  70  70  TRP TRP A . n 
A 1 71  ASN 71  71  71  ASN ASN A . n 
A 1 72  THR 72  72  72  THR THR A . n 
A 1 73  ALA 73  73  73  ALA ALA A . n 
A 1 74  VAL 74  74  74  VAL VAL A . n 
A 1 75  HIS 75  75  75  HIS HIS A . n 
A 1 76  SER 76  76  76  SER SER A . n 
A 1 77  GLU 77  77  77  GLU GLU A . n 
A 1 78  PHE 78  78  78  PHE PHE A . n 
A 1 79  MET 79  79  79  MET MET A . n 
A 1 80  HIS 80  80  80  HIS HIS A . n 
A 1 81  ASP 81  81  81  ASP ASP A . n 
A 1 82  HIS 82  82  82  HIS HIS A . n 
A 1 83  ALA 83  83  83  ALA ALA A . n 
A 1 84  ASP 84  84  84  ASP ASP A . n 
A 1 85  TYR 85  85  85  TYR TYR A . n 
A 1 86  GLY 86  86  86  GLY GLY A . n 
A 1 87  PHE 87  87  87  PHE PHE A . n 
A 1 88  PRO 88  88  88  PRO PRO A . n 
A 1 89  SER 89  89  89  SER SER A . n 
A 1 90  CYS 90  90  90  CYS CYS A . n 
A 1 91  GLU 91  91  91  GLU GLU A . n 
A 1 92  GLY 92  92  92  GLY GLY A . n 
A 1 93  LYS 93  93  93  LYS LYS A . n 
A 1 94  PHE 94  94  94  PHE PHE A . n 
A 1 95  ASN 95  95  95  ASN ASN A . n 
A 1 96  TRP 96  96  96  TRP TRP A . n 
A 1 97  ARG 97  97  97  ARG ARG A . n 
A 1 98  VAL 98  98  98  VAL VAL A . n 
A 1 99  ILE 99  99  99  ILE ILE A . n 
A 1 100 LYS 100 100 100 LYS LYS A . n 
A 1 101 GLU 101 101 101 GLU GLU A . n 
A 1 102 LYS 102 102 102 LYS LYS A . n 
A 1 103 ARG 103 103 103 ARG ARG A . n 
A 1 104 ASP 104 104 104 ASP ASP A . n 
A 1 105 ALA 105 105 105 ALA ALA A . n 
A 1 106 TYR 106 106 106 TYR TYR A . n 
A 1 107 VAL 107 107 107 VAL VAL A . n 
A 1 108 SER 108 108 108 SER SER A . n 
A 1 109 ARG 109 109 109 ARG ARG A . n 
A 1 110 LEU 110 110 110 LEU LEU A . n 
A 1 111 ASN 111 111 111 ASN ASN A . n 
A 1 112 ALA 112 112 112 ALA ALA A . n 
A 1 113 ILE 113 113 113 ILE ILE A . n 
A 1 114 TYR 114 114 114 TYR TYR A . n 
A 1 115 GLN 115 115 115 GLN GLN A . n 
A 1 116 ASN 116 116 116 ASN ASN A . n 
A 1 117 ASN 117 117 117 ASN ASN A . n 
A 1 118 LEU 118 118 118 LEU LEU A . n 
A 1 119 THR 119 119 119 THR THR A . n 
A 1 120 LYS 120 120 120 LYS LYS A . n 
A 1 121 SER 121 121 121 SER SER A . n 
A 1 122 HIS 122 122 122 HIS HIS A . n 
A 1 123 ILE 123 123 123 ILE ILE A . n 
A 1 124 GLU 124 124 124 GLU GLU A . n 
A 1 125 ILE 125 125 125 ILE ILE A . n 
A 1 126 ILE 126 126 126 ILE ILE A . n 
A 1 127 ARG 127 127 127 ARG ARG A . n 
A 1 128 GLY 128 128 128 GLY GLY A . n 
A 1 129 HIS 129 129 129 HIS HIS A . n 
A 1 130 ALA 130 130 130 ALA ALA A . n 
A 1 131 ALA 131 131 131 ALA ALA A . n 
A 1 132 PHE 132 132 132 PHE PHE A . n 
A 1 133 THR 133 133 133 THR THR A . n 
A 1 134 SER 134 134 134 SER SER A . n 
A 1 135 ASP 135 135 135 ASP ASP A . n 
A 1 136 PRO 136 136 136 PRO PRO A . n 
A 1 137 LYS 137 137 137 LYS LYS A . n 
A 1 138 PRO 138 138 138 PRO PRO A . n 
A 1 139 THR 139 139 139 THR THR A . n 
A 1 140 ILE 140 140 140 ILE ILE A . n 
A 1 141 GLU 141 141 141 GLU GLU A . n 
A 1 142 VAL 142 142 142 VAL VAL A . n 
A 1 143 SER 143 143 143 SER SER A . n 
A 1 144 GLY 144 144 144 GLY GLY A . n 
A 1 145 LYS 145 145 145 LYS LYS A . n 
A 1 146 LYS 146 146 146 LYS LYS A . n 
A 1 147 TYR 147 147 147 TYR TYR A . n 
A 1 148 THR 148 148 148 THR THR A . n 
A 1 149 ALA 149 149 149 ALA ALA A . n 
A 1 150 PRO 150 150 150 PRO PRO A . n 
A 1 151 HIS 151 151 151 HIS HIS A . n 
A 1 152 ILE 152 152 152 ILE ILE A . n 
A 1 153 LEU 153 153 153 LEU LEU A . n 
A 1 154 ILE 154 154 154 ILE ILE A . n 
A 1 155 ALA 155 155 155 ALA ALA A . n 
A 1 156 THR 156 156 156 THR THR A . n 
A 1 157 GLY 157 157 157 GLY GLY A . n 
A 1 158 GLY 158 158 158 GLY GLY A . n 
A 1 159 MET 159 159 159 MET MET A . n 
A 1 160 PRO 160 160 160 PRO PRO A . n 
A 1 161 SER 161 161 161 SER SER A . n 
A 1 162 THR 162 162 162 THR THR A . n 
A 1 163 PRO 163 163 163 PRO PRO A . n 
A 1 164 HIS 164 164 164 HIS HIS A . n 
A 1 165 GLU 165 165 165 GLU GLU A . n 
A 1 166 SER 166 166 166 SER SER A . n 
A 1 167 GLN 167 167 167 GLN GLN A . n 
A 1 168 ILE 168 168 168 ILE ILE A . n 
A 1 169 PRO 169 169 169 PRO PRO A . n 
A 1 170 GLY 170 170 170 GLY GLY A . n 
A 1 171 ALA 171 171 171 ALA ALA A . n 
A 1 172 SER 172 172 172 SER SER A . n 
A 1 173 LEU 173 173 173 LEU LEU A . n 
A 1 174 GLY 174 174 174 GLY GLY A . n 
A 1 175 ILE 175 175 175 ILE ILE A . n 
A 1 176 THR 176 176 176 THR THR A . n 
A 1 177 SER 177 177 177 SER SER A . n 
A 1 178 ASP 178 178 178 ASP ASP A . n 
A 1 179 GLY 179 179 179 GLY GLY A . n 
A 1 180 PHE 180 180 180 PHE PHE A . n 
A 1 181 PHE 181 181 181 PHE PHE A . n 
A 1 182 GLN 182 182 182 GLN GLN A . n 
A 1 183 LEU 183 183 183 LEU LEU A . n 
A 1 184 GLU 184 184 184 GLU GLU A . n 
A 1 185 GLU 185 185 185 GLU GLU A . n 
A 1 186 LEU 186 186 186 LEU LEU A . n 
A 1 187 PRO 187 187 187 PRO PRO A . n 
A 1 188 GLY 188 188 188 GLY GLY A . n 
A 1 189 ARG 189 189 189 ARG ARG A . n 
A 1 190 SER 190 190 190 SER SER A . n 
A 1 191 VAL 191 191 191 VAL VAL A . n 
A 1 192 ILE 192 192 192 ILE ILE A . n 
A 1 193 VAL 193 193 193 VAL VAL A . n 
A 1 194 GLY 194 194 194 GLY GLY A . n 
A 1 195 ALA 195 195 195 ALA ALA A . n 
A 1 196 GLY 196 196 196 GLY GLY A . n 
A 1 197 TYR 197 197 197 TYR TYR A . n 
A 1 198 ILE 198 198 198 ILE ILE A . n 
A 1 199 ALA 199 199 199 ALA ALA A . n 
A 1 200 VAL 200 200 200 VAL VAL A . n 
A 1 201 GLU 201 201 201 GLU GLU A . n 
A 1 202 MET 202 202 202 MET MET A . n 
A 1 203 ALA 203 203 203 ALA ALA A . n 
A 1 204 GLY 204 204 204 GLY GLY A . n 
A 1 205 ILE 205 205 205 ILE ILE A . n 
A 1 206 LEU 206 206 206 LEU LEU A . n 
A 1 207 SER 207 207 207 SER SER A . n 
A 1 208 ALA 208 208 208 ALA ALA A . n 
A 1 209 LEU 209 209 209 LEU LEU A . n 
A 1 210 GLY 210 210 210 GLY GLY A . n 
A 1 211 SER 211 211 211 SER SER A . n 
A 1 212 LYS 212 212 212 LYS LYS A . n 
A 1 213 THR 213 213 213 THR THR A . n 
A 1 214 SER 214 214 214 SER SER A . n 
A 1 215 LEU 215 215 215 LEU LEU A . n 
A 1 216 MET 216 216 216 MET MET A . n 
A 1 217 ILE 217 217 217 ILE ILE A . n 
A 1 218 ARG 218 218 218 ARG ARG A . n 
A 1 219 HIS 219 219 219 HIS HIS A . n 
A 1 220 ASP 220 220 220 ASP ASP A . n 
A 1 221 LYS 221 221 221 LYS LYS A . n 
A 1 222 VAL 222 222 222 VAL VAL A . n 
A 1 223 LEU 223 223 223 LEU LEU A . n 
A 1 224 ARG 224 224 224 ARG ARG A . n 
A 1 225 SER 225 225 225 SER SER A . n 
A 1 226 PHE 226 226 226 PHE PHE A . n 
A 1 227 ASP 227 227 227 ASP ASP A . n 
A 1 228 SER 228 228 228 SER SER A . n 
A 1 229 MET 229 229 229 MET MET A . n 
A 1 230 ILE 230 230 230 ILE ILE A . n 
A 1 231 SER 231 231 231 SER SER A . n 
A 1 232 THR 232 232 232 THR THR A . n 
A 1 233 ASN 233 233 233 ASN ASN A . n 
A 1 234 CYS 234 234 234 CYS CYS A . n 
A 1 235 THR 235 235 235 THR THR A . n 
A 1 236 GLU 236 236 236 GLU GLU A . n 
A 1 237 GLU 237 237 237 GLU GLU A . n 
A 1 238 LEU 238 238 238 LEU LEU A . n 
A 1 239 GLU 239 239 239 GLU GLU A . n 
A 1 240 ASN 240 240 240 ASN ASN A . n 
A 1 241 ALA 241 241 241 ALA ALA A . n 
A 1 242 GLY 242 242 242 GLY GLY A . n 
A 1 243 VAL 243 243 243 VAL VAL A . n 
A 1 244 GLU 244 244 244 GLU GLU A . n 
A 1 245 VAL 245 245 245 VAL VAL A . n 
A 1 246 LEU 246 246 246 LEU LEU A . n 
A 1 247 LYS 247 247 247 LYS LYS A . n 
A 1 248 PHE 248 248 248 PHE PHE A . n 
A 1 249 SER 249 249 249 SER SER A . n 
A 1 250 GLN 250 250 250 GLN GLN A . n 
A 1 251 VAL 251 251 251 VAL VAL A . n 
A 1 252 LYS 252 252 252 LYS LYS A . n 
A 1 253 GLU 253 253 253 GLU GLU A . n 
A 1 254 VAL 254 254 254 VAL VAL A . n 
A 1 255 LYS 255 255 255 LYS LYS A . n 
A 1 256 LYS 256 256 256 LYS LYS A . n 
A 1 257 THR 257 257 257 THR THR A . n 
A 1 258 LEU 258 258 258 LEU LEU A . n 
A 1 259 SER 259 259 259 SER SER A . n 
A 1 260 GLY 260 260 260 GLY GLY A . n 
A 1 261 LEU 261 261 261 LEU LEU A . n 
A 1 262 GLU 262 262 262 GLU GLU A . n 
A 1 263 VAL 263 263 263 VAL VAL A . n 
A 1 264 SER 264 264 264 SER SER A . n 
A 1 265 MET 265 265 265 MET MET A . n 
A 1 266 VAL 266 266 266 VAL VAL A . n 
A 1 267 THR 267 267 267 THR THR A . n 
A 1 268 ALA 268 268 268 ALA ALA A . n 
A 1 269 VAL 269 269 269 VAL VAL A . n 
A 1 270 PRO 270 270 270 PRO PRO A . n 
A 1 271 GLY 271 271 271 GLY GLY A . n 
A 1 272 ARG 272 272 272 ARG ARG A . n 
A 1 273 LEU 273 273 273 LEU LEU A . n 
A 1 274 PRO 274 274 274 PRO PRO A . n 
A 1 275 VAL 275 275 275 VAL VAL A . n 
A 1 276 MET 276 276 276 MET MET A . n 
A 1 277 THR 277 277 277 THR THR A . n 
A 1 278 MET 278 278 278 MET MET A . n 
A 1 279 ILE 279 279 279 ILE ILE A . n 
A 1 280 PRO 280 280 280 PRO PRO A . n 
A 1 281 ASP 281 281 281 ASP ASP A . n 
A 1 282 VAL 282 282 282 VAL VAL A . n 
A 1 283 ASP 283 283 283 ASP ASP A . n 
A 1 284 CYS 284 284 284 CYS CYS A . n 
A 1 285 LEU 285 285 285 LEU LEU A . n 
A 1 286 LEU 286 286 286 LEU LEU A . n 
A 1 287 TRP 287 287 287 TRP TRP A . n 
A 1 288 ALA 288 288 288 ALA ALA A . n 
A 1 289 ILE 289 289 289 ILE ILE A . n 
A 1 290 GLY 290 290 290 GLY GLY A . n 
A 1 291 ARG 291 291 291 ARG ARG A . n 
A 1 292 VAL 292 292 292 VAL VAL A . n 
A 1 293 PRO 293 293 293 PRO PRO A . n 
A 1 294 ASN 294 294 294 ASN ASN A . n 
A 1 295 THR 295 295 295 THR THR A . n 
A 1 296 LYS 296 296 296 LYS LYS A . n 
A 1 297 ASP 297 297 297 ASP ASP A . n 
A 1 298 LEU 298 298 298 LEU LEU A . n 
A 1 299 SER 299 299 299 SER SER A . n 
A 1 300 LEU 300 300 300 LEU LEU A . n 
A 1 301 ASN 301 301 301 ASN ASN A . n 
A 1 302 LYS 302 302 302 LYS LYS A . n 
A 1 303 LEU 303 303 303 LEU LEU A . n 
A 1 304 GLY 304 304 304 GLY GLY A . n 
A 1 305 ILE 305 305 305 ILE ILE A . n 
A 1 306 GLN 306 306 306 GLN GLN A . n 
A 1 307 THR 307 307 307 THR THR A . n 
A 1 308 ASP 308 308 308 ASP ASP A . n 
A 1 309 ASP 309 309 309 ASP ASP A . n 
A 1 310 LYS 310 310 310 LYS LYS A . n 
A 1 311 GLY 311 311 311 GLY GLY A . n 
A 1 312 HIS 312 312 312 HIS HIS A . n 
A 1 313 ILE 313 313 313 ILE ILE A . n 
A 1 314 ILE 314 314 314 ILE ILE A . n 
A 1 315 VAL 315 315 315 VAL VAL A . n 
A 1 316 ASP 316 316 316 ASP ASP A . n 
A 1 317 GLU 317 317 317 GLU GLU A . n 
A 1 318 PHE 318 318 318 PHE PHE A . n 
A 1 319 GLN 319 319 319 GLN GLN A . n 
A 1 320 ASN 320 320 320 ASN ASN A . n 
A 1 321 THR 321 321 321 THR THR A . n 
A 1 322 ASN 322 322 322 ASN ASN A . n 
A 1 323 VAL 323 323 323 VAL VAL A . n 
A 1 324 LYS 324 324 324 LYS LYS A . n 
A 1 325 GLY 325 325 325 GLY GLY A . n 
A 1 326 ILE 326 326 326 ILE ILE A . n 
A 1 327 TYR 327 327 327 TYR TYR A . n 
A 1 328 ALA 328 328 328 ALA ALA A . n 
A 1 329 VAL 329 329 329 VAL VAL A . n 
A 1 330 GLY 330 330 330 GLY GLY A . n 
A 1 331 ASP 331 331 331 ASP ASP A . n 
A 1 332 VAL 332 332 332 VAL VAL A . n 
A 1 333 CYS 333 333 333 CYS CYS A . n 
A 1 334 GLY 334 334 334 GLY GLY A . n 
A 1 335 LYS 335 335 335 LYS LYS A . n 
A 1 336 ALA 336 336 336 ALA ALA A . n 
A 1 337 LEU 337 337 337 LEU LEU A . n 
A 1 338 LEU 338 338 338 LEU LEU A . n 
A 1 339 THR 339 339 339 THR THR A . n 
A 1 340 PRO 340 340 340 PRO PRO A . n 
A 1 341 VAL 341 341 341 VAL VAL A . n 
A 1 342 ALA 342 342 342 ALA ALA A . n 
A 1 343 ILE 343 343 343 ILE ILE A . n 
A 1 344 ALA 344 344 344 ALA ALA A . n 
A 1 345 ALA 345 345 345 ALA ALA A . n 
A 1 346 GLY 346 346 346 GLY GLY A . n 
A 1 347 ARG 347 347 347 ARG ARG A . n 
A 1 348 LYS 348 348 348 LYS LYS A . n 
A 1 349 LEU 349 349 349 LEU LEU A . n 
A 1 350 ALA 350 350 350 ALA ALA A . n 
A 1 351 HIS 351 351 351 HIS HIS A . n 
A 1 352 ARG 352 352 352 ARG ARG A . n 
A 1 353 LEU 353 353 353 LEU LEU A . n 
A 1 354 PHE 354 354 354 PHE PHE A . n 
A 1 355 GLU 355 355 355 GLU GLU A . n 
A 1 356 TYR 356 356 356 TYR TYR A . n 
A 1 357 LYS 357 357 357 LYS LYS A . n 
A 1 358 GLU 358 358 358 GLU GLU A . n 
A 1 359 ASP 359 359 359 ASP ASP A . n 
A 1 360 SER 360 360 360 SER SER A . n 
A 1 361 LYS 361 361 361 LYS LYS A . n 
A 1 362 LEU 362 362 362 LEU LEU A . n 
A 1 363 ASP 363 363 363 ASP ASP A . n 
A 1 364 TYR 364 364 364 TYR TYR A . n 
A 1 365 ASN 365 365 365 ASN ASN A . n 
A 1 366 ASN 366 366 366 ASN ASN A . n 
A 1 367 ILE 367 367 367 ILE ILE A . n 
A 1 368 PRO 368 368 368 PRO PRO A . n 
A 1 369 THR 369 369 369 THR THR A . n 
A 1 370 VAL 370 370 370 VAL VAL A . n 
A 1 371 VAL 371 371 371 VAL VAL A . n 
A 1 372 PHE 372 372 372 PHE PHE A . n 
A 1 373 SER 373 373 373 SER SER A . n 
A 1 374 HIS 374 374 374 HIS HIS A . n 
A 1 375 PRO 375 375 375 PRO PRO A . n 
A 1 376 PRO 376 376 376 PRO PRO A . n 
A 1 377 ILE 377 377 377 ILE ILE A . n 
A 1 378 GLY 378 378 378 GLY GLY A . n 
A 1 379 THR 379 379 379 THR THR A . n 
A 1 380 VAL 380 380 380 VAL VAL A . n 
A 1 381 GLY 381 381 381 GLY GLY A . n 
A 1 382 LEU 382 382 382 LEU LEU A . n 
A 1 383 THR 383 383 383 THR THR A . n 
A 1 384 GLU 384 384 384 GLU GLU A . n 
A 1 385 ASP 385 385 385 ASP ASP A . n 
A 1 386 GLU 386 386 386 GLU GLU A . n 
A 1 387 ALA 387 387 387 ALA ALA A . n 
A 1 388 ILE 388 388 388 ILE ILE A . n 
A 1 389 HIS 389 389 389 HIS HIS A . n 
A 1 390 LYS 390 390 390 LYS LYS A . n 
A 1 391 TYR 391 391 391 TYR TYR A . n 
A 1 392 GLY 392 392 392 GLY GLY A . n 
A 1 393 ILE 393 393 393 ILE ILE A . n 
A 1 394 GLU 394 394 394 GLU GLU A . n 
A 1 395 ASN 395 395 395 ASN ASN A . n 
A 1 396 VAL 396 396 396 VAL VAL A . n 
A 1 397 LYS 397 397 397 LYS LYS A . n 
A 1 398 THR 398 398 398 THR THR A . n 
A 1 399 TYR 399 399 399 TYR TYR A . n 
A 1 400 SER 400 400 400 SER SER A . n 
A 1 401 THR 401 401 401 THR THR A . n 
A 1 402 SER 402 402 402 SER SER A . n 
A 1 403 PHE 403 403 403 PHE PHE A . n 
A 1 404 THR 404 404 404 THR THR A . n 
A 1 405 PRO 405 405 405 PRO PRO A . n 
A 1 406 MET 406 406 406 MET MET A . n 
A 1 407 TYR 407 407 407 TYR TYR A . n 
A 1 408 HIS 408 408 408 HIS HIS A . n 
A 1 409 ALA 409 409 409 ALA ALA A . n 
A 1 410 VAL 410 410 410 VAL VAL A . n 
A 1 411 THR 411 411 411 THR THR A . n 
A 1 412 LYS 412 412 412 LYS LYS A . n 
A 1 413 ARG 413 413 413 ARG ARG A . n 
A 1 414 LYS 414 414 414 LYS LYS A . n 
A 1 415 THR 415 415 415 THR THR A . n 
A 1 416 LYS 416 416 416 LYS LYS A . n 
A 1 417 CYS 417 417 417 CYS CYS A . n 
A 1 418 VAL 418 418 418 VAL VAL A . n 
A 1 419 MET 419 419 419 MET MET A . n 
A 1 420 LYS 420 420 420 LYS LYS A . n 
A 1 421 MET 421 421 421 MET MET A . n 
A 1 422 VAL 422 422 422 VAL VAL A . n 
A 1 423 CYS 423 423 423 CYS CYS A . n 
A 1 424 ALA 424 424 424 ALA ALA A . n 
A 1 425 ASN 425 425 425 ASN ASN A . n 
A 1 426 LYS 426 426 426 LYS LYS A . n 
A 1 427 GLU 427 427 427 GLU GLU A . n 
A 1 428 GLU 428 428 428 GLU GLU A . n 
A 1 429 LYS 429 429 429 LYS LYS A . n 
A 1 430 VAL 430 430 430 VAL VAL A . n 
A 1 431 VAL 431 431 431 VAL VAL A . n 
A 1 432 GLY 432 432 432 GLY GLY A . n 
A 1 433 ILE 433 433 433 ILE ILE A . n 
A 1 434 HIS 434 434 434 HIS HIS A . n 
A 1 435 MET 435 435 435 MET MET A . n 
A 1 436 GLN 436 436 436 GLN GLN A . n 
A 1 437 GLY 437 437 437 GLY GLY A . n 
A 1 438 LEU 438 438 438 LEU LEU A . n 
A 1 439 GLY 439 439 439 GLY GLY A . n 
A 1 440 CYS 440 440 440 CYS CYS A . n 
A 1 441 ASP 441 441 441 ASP ASP A . n 
A 1 442 GLU 442 442 442 GLU GLU A . n 
A 1 443 MET 443 443 443 MET MET A . n 
A 1 444 LEU 444 444 444 LEU LEU A . n 
A 1 445 GLN 445 445 445 GLN GLN A . n 
A 1 446 GLY 446 446 446 GLY GLY A . n 
A 1 447 PHE 447 447 447 PHE PHE A . n 
A 1 448 ALA 448 448 448 ALA ALA A . n 
A 1 449 VAL 449 449 449 VAL VAL A . n 
A 1 450 ALA 450 450 450 ALA ALA A . n 
A 1 451 VAL 451 451 451 VAL VAL A . n 
A 1 452 LYS 452 452 452 LYS LYS A . n 
A 1 453 MET 453 453 453 MET MET A . n 
A 1 454 GLY 454 454 454 GLY GLY A . n 
A 1 455 ALA 455 455 455 ALA ALA A . n 
A 1 456 THR 456 456 456 THR THR A . n 
A 1 457 LYS 457 457 457 LYS LYS A . n 
A 1 458 ALA 458 458 458 ALA ALA A . n 
A 1 459 ASP 459 459 459 ASP ASP A . n 
A 1 460 PHE 460 460 460 PHE PHE A . n 
A 1 461 ASP 461 461 461 ASP ASP A . n 
A 1 462 ASN 462 462 462 ASN ASN A . n 
A 1 463 THR 463 463 463 THR THR A . n 
A 1 464 VAL 464 464 464 VAL VAL A . n 
A 1 465 ALA 465 465 465 ALA ALA A . n 
A 1 466 ILE 466 466 466 ILE ILE A . n 
A 1 467 HIS 467 467 467 HIS HIS A . n 
A 1 468 PRO 468 468 468 PRO PRO A . n 
A 1 469 THR 469 469 469 THR THR A . n 
A 1 470 SER 470 470 470 SER SER A . n 
A 1 471 SER 471 471 471 SER SER A . n 
A 1 472 GLU 472 472 472 GLU GLU A . n 
A 1 473 GLU 473 473 473 GLU GLU A . n 
A 1 474 LEU 474 474 474 LEU LEU A . n 
A 1 475 VAL 475 475 475 VAL VAL A . n 
A 1 476 THR 476 476 476 THR THR A . n 
A 1 477 LEU 477 477 477 LEU LEU A . n 
A 1 478 ARG 478 478 478 ARG ARG A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 PO4 1   481  481  PO4 PO4 A . 
C 3 FAD 1   479  479  FAD FAD A . 
D 4 NAD 1   480  480  NAD NAD A . 
E 5 NDP 1   483  483  NDP NDP A . 
F 6 HOH 1   487  487  HOH HOH A . 
F 6 HOH 2   488  488  HOH HOH A . 
F 6 HOH 3   489  489  HOH HOH A . 
F 6 HOH 4   490  490  HOH HOH A . 
F 6 HOH 5   491  491  HOH HOH A . 
F 6 HOH 6   492  492  HOH HOH A . 
F 6 HOH 7   493  493  HOH HOH A . 
F 6 HOH 8   494  494  HOH HOH A . 
F 6 HOH 9   495  495  HOH HOH A . 
F 6 HOH 10  496  496  HOH HOH A . 
F 6 HOH 11  497  497  HOH HOH A . 
F 6 HOH 12  498  498  HOH HOH A . 
F 6 HOH 13  499  499  HOH HOH A . 
F 6 HOH 14  500  500  HOH HOH A . 
F 6 HOH 15  501  501  HOH HOH A . 
F 6 HOH 16  502  502  HOH HOH A . 
F 6 HOH 17  503  503  HOH HOH A . 
F 6 HOH 18  504  504  HOH HOH A . 
F 6 HOH 19  505  505  HOH HOH A . 
F 6 HOH 20  506  506  HOH HOH A . 
F 6 HOH 21  507  507  HOH HOH A . 
F 6 HOH 22  508  508  HOH HOH A . 
F 6 HOH 23  509  509  HOH HOH A . 
F 6 HOH 24  510  510  HOH HOH A . 
F 6 HOH 25  511  511  HOH HOH A . 
F 6 HOH 26  512  512  HOH HOH A . 
F 6 HOH 27  513  513  HOH HOH A . 
F 6 HOH 28  514  514  HOH HOH A . 
F 6 HOH 29  515  515  HOH HOH A . 
F 6 HOH 30  516  516  HOH HOH A . 
F 6 HOH 31  517  517  HOH HOH A . 
F 6 HOH 32  518  518  HOH HOH A . 
F 6 HOH 33  519  519  HOH HOH A . 
F 6 HOH 34  520  520  HOH HOH A . 
F 6 HOH 35  521  521  HOH HOH A . 
F 6 HOH 36  522  522  HOH HOH A . 
F 6 HOH 37  523  523  HOH HOH A . 
F 6 HOH 38  524  524  HOH HOH A . 
F 6 HOH 39  525  525  HOH HOH A . 
F 6 HOH 40  526  526  HOH HOH A . 
F 6 HOH 41  527  527  HOH HOH A . 
F 6 HOH 42  528  528  HOH HOH A . 
F 6 HOH 43  529  529  HOH HOH A . 
F 6 HOH 44  530  530  HOH HOH A . 
F 6 HOH 45  531  531  HOH HOH A . 
F 6 HOH 46  532  532  HOH HOH A . 
F 6 HOH 47  533  533  HOH HOH A . 
F 6 HOH 48  534  534  HOH HOH A . 
F 6 HOH 49  535  535  HOH HOH A . 
F 6 HOH 50  536  536  HOH HOH A . 
F 6 HOH 51  537  537  HOH HOH A . 
F 6 HOH 52  538  538  HOH HOH A . 
F 6 HOH 53  539  539  HOH HOH A . 
F 6 HOH 54  540  540  HOH HOH A . 
F 6 HOH 55  541  541  HOH HOH A . 
F 6 HOH 56  542  542  HOH HOH A . 
F 6 HOH 57  543  543  HOH HOH A . 
F 6 HOH 58  544  544  HOH HOH A . 
F 6 HOH 59  545  545  HOH HOH A . 
F 6 HOH 60  546  546  HOH HOH A . 
F 6 HOH 61  547  547  HOH HOH A . 
F 6 HOH 62  548  548  HOH HOH A . 
F 6 HOH 63  549  549  HOH HOH A . 
F 6 HOH 64  550  550  HOH HOH A . 
F 6 HOH 65  551  551  HOH HOH A . 
F 6 HOH 66  552  552  HOH HOH A . 
F 6 HOH 67  553  553  HOH HOH A . 
F 6 HOH 68  554  554  HOH HOH A . 
F 6 HOH 69  555  555  HOH HOH A . 
F 6 HOH 70  556  556  HOH HOH A . 
F 6 HOH 71  557  557  HOH HOH A . 
F 6 HOH 72  558  558  HOH HOH A . 
F 6 HOH 73  559  559  HOH HOH A . 
F 6 HOH 74  560  560  HOH HOH A . 
F 6 HOH 75  561  561  HOH HOH A . 
F 6 HOH 76  562  562  HOH HOH A . 
F 6 HOH 77  563  563  HOH HOH A . 
F 6 HOH 78  564  564  HOH HOH A . 
F 6 HOH 79  565  565  HOH HOH A . 
F 6 HOH 80  566  566  HOH HOH A . 
F 6 HOH 81  567  567  HOH HOH A . 
F 6 HOH 82  568  568  HOH HOH A . 
F 6 HOH 83  569  569  HOH HOH A . 
F 6 HOH 84  570  570  HOH HOH A . 
F 6 HOH 85  571  571  HOH HOH A . 
F 6 HOH 86  572  572  HOH HOH A . 
F 6 HOH 87  573  573  HOH HOH A . 
F 6 HOH 88  574  574  HOH HOH A . 
F 6 HOH 89  575  575  HOH HOH A . 
F 6 HOH 90  576  576  HOH HOH A . 
F 6 HOH 91  577  577  HOH HOH A . 
F 6 HOH 92  578  578  HOH HOH A . 
F 6 HOH 93  579  579  HOH HOH A . 
F 6 HOH 94  580  580  HOH HOH A . 
F 6 HOH 95  581  581  HOH HOH A . 
F 6 HOH 96  582  582  HOH HOH A . 
F 6 HOH 97  583  583  HOH HOH A . 
F 6 HOH 98  584  584  HOH HOH A . 
F 6 HOH 99  585  585  HOH HOH A . 
F 6 HOH 100 586  586  HOH HOH A . 
F 6 HOH 101 587  587  HOH HOH A . 
F 6 HOH 102 588  588  HOH HOH A . 
F 6 HOH 103 589  589  HOH HOH A . 
F 6 HOH 104 590  590  HOH HOH A . 
F 6 HOH 105 591  591  HOH HOH A . 
F 6 HOH 106 592  592  HOH HOH A . 
F 6 HOH 107 593  593  HOH HOH A . 
F 6 HOH 108 594  594  HOH HOH A . 
F 6 HOH 109 595  595  HOH HOH A . 
F 6 HOH 110 596  596  HOH HOH A . 
F 6 HOH 111 597  597  HOH HOH A . 
F 6 HOH 112 598  598  HOH HOH A . 
F 6 HOH 113 599  599  HOH HOH A . 
F 6 HOH 114 600  600  HOH HOH A . 
F 6 HOH 115 601  601  HOH HOH A . 
F 6 HOH 116 602  602  HOH HOH A . 
F 6 HOH 117 603  603  HOH HOH A . 
F 6 HOH 118 604  604  HOH HOH A . 
F 6 HOH 119 605  605  HOH HOH A . 
F 6 HOH 120 606  606  HOH HOH A . 
F 6 HOH 121 607  607  HOH HOH A . 
F 6 HOH 122 608  608  HOH HOH A . 
F 6 HOH 123 609  609  HOH HOH A . 
F 6 HOH 124 610  610  HOH HOH A . 
F 6 HOH 125 611  611  HOH HOH A . 
F 6 HOH 126 612  612  HOH HOH A . 
F 6 HOH 127 613  613  HOH HOH A . 
F 6 HOH 128 614  614  HOH HOH A . 
F 6 HOH 129 615  615  HOH HOH A . 
F 6 HOH 130 616  616  HOH HOH A . 
F 6 HOH 131 617  617  HOH HOH A . 
F 6 HOH 132 618  618  HOH HOH A . 
F 6 HOH 133 619  619  HOH HOH A . 
F 6 HOH 134 620  620  HOH HOH A . 
F 6 HOH 135 621  621  HOH HOH A . 
F 6 HOH 136 622  622  HOH HOH A . 
F 6 HOH 137 623  623  HOH HOH A . 
F 6 HOH 138 624  624  HOH HOH A . 
F 6 HOH 139 625  625  HOH HOH A . 
F 6 HOH 140 626  626  HOH HOH A . 
F 6 HOH 141 627  627  HOH HOH A . 
F 6 HOH 142 628  628  HOH HOH A . 
F 6 HOH 143 629  629  HOH HOH A . 
F 6 HOH 144 630  630  HOH HOH A . 
F 6 HOH 145 631  631  HOH HOH A . 
F 6 HOH 146 632  632  HOH HOH A . 
F 6 HOH 147 633  633  HOH HOH A . 
F 6 HOH 148 634  634  HOH HOH A . 
F 6 HOH 149 635  635  HOH HOH A . 
F 6 HOH 150 636  636  HOH HOH A . 
F 6 HOH 151 637  637  HOH HOH A . 
F 6 HOH 152 638  638  HOH HOH A . 
F 6 HOH 153 639  639  HOH HOH A . 
F 6 HOH 154 640  640  HOH HOH A . 
F 6 HOH 155 641  641  HOH HOH A . 
F 6 HOH 156 642  642  HOH HOH A . 
F 6 HOH 157 643  643  HOH HOH A . 
F 6 HOH 158 644  644  HOH HOH A . 
F 6 HOH 159 645  645  HOH HOH A . 
F 6 HOH 160 646  646  HOH HOH A . 
F 6 HOH 161 647  647  HOH HOH A . 
F 6 HOH 162 648  648  HOH HOH A . 
F 6 HOH 163 649  649  HOH HOH A . 
F 6 HOH 164 650  650  HOH HOH A . 
F 6 HOH 165 651  651  HOH HOH A . 
F 6 HOH 166 652  652  HOH HOH A . 
F 6 HOH 167 653  653  HOH HOH A . 
F 6 HOH 168 654  654  HOH HOH A . 
F 6 HOH 169 655  655  HOH HOH A . 
F 6 HOH 170 656  656  HOH HOH A . 
F 6 HOH 171 657  657  HOH HOH A . 
F 6 HOH 172 658  658  HOH HOH A . 
F 6 HOH 173 659  659  HOH HOH A . 
F 6 HOH 174 660  660  HOH HOH A . 
F 6 HOH 175 661  661  HOH HOH A . 
F 6 HOH 176 662  662  HOH HOH A . 
F 6 HOH 177 663  663  HOH HOH A . 
F 6 HOH 178 664  664  HOH HOH A . 
F 6 HOH 179 665  665  HOH HOH A . 
F 6 HOH 180 666  666  HOH HOH A . 
F 6 HOH 181 667  667  HOH HOH A . 
F 6 HOH 182 668  668  HOH HOH A . 
F 6 HOH 183 669  669  HOH HOH A . 
F 6 HOH 184 670  670  HOH HOH A . 
F 6 HOH 185 671  671  HOH HOH A . 
F 6 HOH 186 672  672  HOH HOH A . 
F 6 HOH 187 673  673  HOH HOH A . 
F 6 HOH 188 674  674  HOH HOH A . 
F 6 HOH 189 675  675  HOH HOH A . 
F 6 HOH 190 676  676  HOH HOH A . 
F 6 HOH 191 677  677  HOH HOH A . 
F 6 HOH 192 678  678  HOH HOH A . 
F 6 HOH 193 679  679  HOH HOH A . 
F 6 HOH 194 680  680  HOH HOH A . 
F 6 HOH 195 681  681  HOH HOH A . 
F 6 HOH 196 682  682  HOH HOH A . 
F 6 HOH 197 683  683  HOH HOH A . 
F 6 HOH 198 684  684  HOH HOH A . 
F 6 HOH 199 685  685  HOH HOH A . 
F 6 HOH 200 686  686  HOH HOH A . 
F 6 HOH 201 687  687  HOH HOH A . 
F 6 HOH 202 688  688  HOH HOH A . 
F 6 HOH 203 689  689  HOH HOH A . 
F 6 HOH 204 690  690  HOH HOH A . 
F 6 HOH 205 691  691  HOH HOH A . 
F 6 HOH 206 692  692  HOH HOH A . 
F 6 HOH 207 693  693  HOH HOH A . 
F 6 HOH 208 694  694  HOH HOH A . 
F 6 HOH 209 695  695  HOH HOH A . 
F 6 HOH 210 696  696  HOH HOH A . 
F 6 HOH 211 697  697  HOH HOH A . 
F 6 HOH 212 698  698  HOH HOH A . 
F 6 HOH 213 699  699  HOH HOH A . 
F 6 HOH 214 700  700  HOH HOH A . 
F 6 HOH 215 701  701  HOH HOH A . 
F 6 HOH 216 702  702  HOH HOH A . 
F 6 HOH 217 703  703  HOH HOH A . 
F 6 HOH 218 704  704  HOH HOH A . 
F 6 HOH 219 705  705  HOH HOH A . 
F 6 HOH 220 706  706  HOH HOH A . 
F 6 HOH 221 707  707  HOH HOH A . 
F 6 HOH 222 708  708  HOH HOH A . 
F 6 HOH 223 709  709  HOH HOH A . 
F 6 HOH 224 710  710  HOH HOH A . 
F 6 HOH 225 711  711  HOH HOH A . 
F 6 HOH 226 712  712  HOH HOH A . 
F 6 HOH 227 713  713  HOH HOH A . 
F 6 HOH 228 714  714  HOH HOH A . 
F 6 HOH 229 715  715  HOH HOH A . 
F 6 HOH 230 716  716  HOH HOH A . 
F 6 HOH 231 717  717  HOH HOH A . 
F 6 HOH 232 718  718  HOH HOH A . 
F 6 HOH 233 719  719  HOH HOH A . 
F 6 HOH 234 720  720  HOH HOH A . 
F 6 HOH 235 721  721  HOH HOH A . 
F 6 HOH 236 722  722  HOH HOH A . 
F 6 HOH 237 723  723  HOH HOH A . 
F 6 HOH 238 724  724  HOH HOH A . 
F 6 HOH 239 725  725  HOH HOH A . 
F 6 HOH 240 726  726  HOH HOH A . 
F 6 HOH 241 727  727  HOH HOH A . 
F 6 HOH 242 728  728  HOH HOH A . 
F 6 HOH 243 729  729  HOH HOH A . 
F 6 HOH 244 730  730  HOH HOH A . 
F 6 HOH 245 731  731  HOH HOH A . 
F 6 HOH 246 732  732  HOH HOH A . 
F 6 HOH 247 733  733  HOH HOH A . 
F 6 HOH 248 734  734  HOH HOH A . 
F 6 HOH 249 735  735  HOH HOH A . 
F 6 HOH 250 736  736  HOH HOH A . 
F 6 HOH 251 737  737  HOH HOH A . 
F 6 HOH 252 738  738  HOH HOH A . 
F 6 HOH 253 739  739  HOH HOH A . 
F 6 HOH 254 740  740  HOH HOH A . 
F 6 HOH 255 741  741  HOH HOH A . 
F 6 HOH 256 742  742  HOH HOH A . 
F 6 HOH 257 743  743  HOH HOH A . 
F 6 HOH 258 744  744  HOH HOH A . 
F 6 HOH 259 745  745  HOH HOH A . 
F 6 HOH 260 746  746  HOH HOH A . 
F 6 HOH 261 747  747  HOH HOH A . 
F 6 HOH 262 748  748  HOH HOH A . 
F 6 HOH 263 749  749  HOH HOH A . 
F 6 HOH 264 750  750  HOH HOH A . 
F 6 HOH 265 751  751  HOH HOH A . 
F 6 HOH 266 752  752  HOH HOH A . 
F 6 HOH 267 753  753  HOH HOH A . 
F 6 HOH 268 754  754  HOH HOH A . 
F 6 HOH 269 755  755  HOH HOH A . 
F 6 HOH 270 756  756  HOH HOH A . 
F 6 HOH 271 757  757  HOH HOH A . 
F 6 HOH 272 758  758  HOH HOH A . 
F 6 HOH 273 759  759  HOH HOH A . 
F 6 HOH 274 760  760  HOH HOH A . 
F 6 HOH 275 761  761  HOH HOH A . 
F 6 HOH 276 762  762  HOH HOH A . 
F 6 HOH 277 763  763  HOH HOH A . 
F 6 HOH 278 764  764  HOH HOH A . 
F 6 HOH 279 765  765  HOH HOH A . 
F 6 HOH 280 766  766  HOH HOH A . 
F 6 HOH 281 767  767  HOH HOH A . 
F 6 HOH 282 768  768  HOH HOH A . 
F 6 HOH 283 769  769  HOH HOH A . 
F 6 HOH 284 770  770  HOH HOH A . 
F 6 HOH 285 771  771  HOH HOH A . 
F 6 HOH 286 772  772  HOH HOH A . 
F 6 HOH 287 773  773  HOH HOH A . 
F 6 HOH 288 774  774  HOH HOH A . 
F 6 HOH 289 775  775  HOH HOH A . 
F 6 HOH 290 776  776  HOH HOH A . 
F 6 HOH 291 777  777  HOH HOH A . 
F 6 HOH 292 778  778  HOH HOH A . 
F 6 HOH 293 779  779  HOH HOH A . 
F 6 HOH 294 780  780  HOH HOH A . 
F 6 HOH 295 781  781  HOH HOH A . 
F 6 HOH 296 782  782  HOH HOH A . 
F 6 HOH 297 783  783  HOH HOH A . 
F 6 HOH 298 784  784  HOH HOH A . 
F 6 HOH 299 785  785  HOH HOH A . 
F 6 HOH 300 786  786  HOH HOH A . 
F 6 HOH 301 787  787  HOH HOH A . 
F 6 HOH 302 788  788  HOH HOH A . 
F 6 HOH 303 789  789  HOH HOH A . 
F 6 HOH 304 790  790  HOH HOH A . 
F 6 HOH 305 791  791  HOH HOH A . 
F 6 HOH 306 792  792  HOH HOH A . 
F 6 HOH 307 793  793  HOH HOH A . 
F 6 HOH 308 794  794  HOH HOH A . 
F 6 HOH 309 795  795  HOH HOH A . 
F 6 HOH 310 796  796  HOH HOH A . 
F 6 HOH 311 797  797  HOH HOH A . 
F 6 HOH 312 798  798  HOH HOH A . 
F 6 HOH 313 799  799  HOH HOH A . 
F 6 HOH 314 800  800  HOH HOH A . 
F 6 HOH 315 801  801  HOH HOH A . 
F 6 HOH 316 802  802  HOH HOH A . 
F 6 HOH 317 803  803  HOH HOH A . 
F 6 HOH 318 804  804  HOH HOH A . 
F 6 HOH 319 805  805  HOH HOH A . 
F 6 HOH 320 806  806  HOH HOH A . 
F 6 HOH 321 807  807  HOH HOH A . 
F 6 HOH 322 808  808  HOH HOH A . 
F 6 HOH 323 809  809  HOH HOH A . 
F 6 HOH 324 810  810  HOH HOH A . 
F 6 HOH 325 811  811  HOH HOH A . 
F 6 HOH 326 812  812  HOH HOH A . 
F 6 HOH 327 813  813  HOH HOH A . 
F 6 HOH 328 814  814  HOH HOH A . 
F 6 HOH 329 815  815  HOH HOH A . 
F 6 HOH 330 816  816  HOH HOH A . 
F 6 HOH 331 817  817  HOH HOH A . 
F 6 HOH 332 818  818  HOH HOH A . 
F 6 HOH 333 819  819  HOH HOH A . 
F 6 HOH 334 820  820  HOH HOH A . 
F 6 HOH 335 821  821  HOH HOH A . 
F 6 HOH 336 822  822  HOH HOH A . 
F 6 HOH 337 823  823  HOH HOH A . 
F 6 HOH 338 824  824  HOH HOH A . 
F 6 HOH 339 825  825  HOH HOH A . 
F 6 HOH 340 826  826  HOH HOH A . 
F 6 HOH 341 827  827  HOH HOH A . 
F 6 HOH 342 828  828  HOH HOH A . 
F 6 HOH 343 829  829  HOH HOH A . 
F 6 HOH 344 830  830  HOH HOH A . 
F 6 HOH 345 831  831  HOH HOH A . 
F 6 HOH 346 832  832  HOH HOH A . 
F 6 HOH 347 833  833  HOH HOH A . 
F 6 HOH 348 834  834  HOH HOH A . 
F 6 HOH 349 835  835  HOH HOH A . 
F 6 HOH 350 836  836  HOH HOH A . 
F 6 HOH 351 837  837  HOH HOH A . 
F 6 HOH 352 838  838  HOH HOH A . 
F 6 HOH 353 839  839  HOH HOH A . 
F 6 HOH 354 840  840  HOH HOH A . 
F 6 HOH 355 841  841  HOH HOH A . 
F 6 HOH 356 842  842  HOH HOH A . 
F 6 HOH 357 843  843  HOH HOH A . 
F 6 HOH 358 844  844  HOH HOH A . 
F 6 HOH 359 845  845  HOH HOH A . 
F 6 HOH 360 846  846  HOH HOH A . 
F 6 HOH 361 847  847  HOH HOH A . 
F 6 HOH 362 848  848  HOH HOH A . 
F 6 HOH 363 849  849  HOH HOH A . 
F 6 HOH 364 850  850  HOH HOH A . 
F 6 HOH 365 851  851  HOH HOH A . 
F 6 HOH 366 852  852  HOH HOH A . 
F 6 HOH 367 853  853  HOH HOH A . 
F 6 HOH 368 854  854  HOH HOH A . 
F 6 HOH 369 855  855  HOH HOH A . 
F 6 HOH 370 856  856  HOH HOH A . 
F 6 HOH 371 857  857  HOH HOH A . 
F 6 HOH 372 858  858  HOH HOH A . 
F 6 HOH 373 859  859  HOH HOH A . 
F 6 HOH 374 860  860  HOH HOH A . 
F 6 HOH 375 861  861  HOH HOH A . 
F 6 HOH 376 862  862  HOH HOH A . 
F 6 HOH 377 863  863  HOH HOH A . 
F 6 HOH 378 864  864  HOH HOH A . 
F 6 HOH 379 865  865  HOH HOH A . 
F 6 HOH 380 866  866  HOH HOH A . 
F 6 HOH 381 867  867  HOH HOH A . 
F 6 HOH 382 868  868  HOH HOH A . 
F 6 HOH 383 869  869  HOH HOH A . 
F 6 HOH 384 870  870  HOH HOH A . 
F 6 HOH 385 871  871  HOH HOH A . 
F 6 HOH 386 872  872  HOH HOH A . 
F 6 HOH 387 873  873  HOH HOH A . 
F 6 HOH 388 874  874  HOH HOH A . 
F 6 HOH 389 875  875  HOH HOH A . 
F 6 HOH 390 876  876  HOH HOH A . 
F 6 HOH 391 877  877  HOH HOH A . 
F 6 HOH 392 878  878  HOH HOH A . 
F 6 HOH 393 879  879  HOH HOH A . 
F 6 HOH 394 880  880  HOH HOH A . 
F 6 HOH 395 881  881  HOH HOH A . 
F 6 HOH 396 882  882  HOH HOH A . 
F 6 HOH 397 883  883  HOH HOH A . 
F 6 HOH 398 884  884  HOH HOH A . 
F 6 HOH 399 885  885  HOH HOH A . 
F 6 HOH 400 886  886  HOH HOH A . 
F 6 HOH 401 887  887  HOH HOH A . 
F 6 HOH 402 888  888  HOH HOH A . 
F 6 HOH 403 889  889  HOH HOH A . 
F 6 HOH 404 890  890  HOH HOH A . 
F 6 HOH 405 891  891  HOH HOH A . 
F 6 HOH 406 892  892  HOH HOH A . 
F 6 HOH 407 893  893  HOH HOH A . 
F 6 HOH 408 894  894  HOH HOH A . 
F 6 HOH 409 895  895  HOH HOH A . 
F 6 HOH 410 896  896  HOH HOH A . 
F 6 HOH 411 897  897  HOH HOH A . 
F 6 HOH 412 898  898  HOH HOH A . 
F 6 HOH 413 899  899  HOH HOH A . 
F 6 HOH 414 900  900  HOH HOH A . 
F 6 HOH 415 901  901  HOH HOH A . 
F 6 HOH 416 902  902  HOH HOH A . 
F 6 HOH 417 903  903  HOH HOH A . 
F 6 HOH 418 904  904  HOH HOH A . 
F 6 HOH 419 905  905  HOH HOH A . 
F 6 HOH 420 906  906  HOH HOH A . 
F 6 HOH 421 907  907  HOH HOH A . 
F 6 HOH 422 908  908  HOH HOH A . 
F 6 HOH 423 909  909  HOH HOH A . 
F 6 HOH 424 910  910  HOH HOH A . 
F 6 HOH 425 911  911  HOH HOH A . 
F 6 HOH 426 912  912  HOH HOH A . 
F 6 HOH 427 913  913  HOH HOH A . 
F 6 HOH 428 914  914  HOH HOH A . 
F 6 HOH 429 915  915  HOH HOH A . 
F 6 HOH 430 916  916  HOH HOH A . 
F 6 HOH 431 917  917  HOH HOH A . 
F 6 HOH 432 918  918  HOH HOH A . 
F 6 HOH 433 919  919  HOH HOH A . 
F 6 HOH 434 920  920  HOH HOH A . 
F 6 HOH 435 921  921  HOH HOH A . 
F 6 HOH 436 922  922  HOH HOH A . 
F 6 HOH 437 923  923  HOH HOH A . 
F 6 HOH 438 924  924  HOH HOH A . 
F 6 HOH 439 925  925  HOH HOH A . 
F 6 HOH 440 926  926  HOH HOH A . 
F 6 HOH 441 927  927  HOH HOH A . 
F 6 HOH 442 928  928  HOH HOH A . 
F 6 HOH 443 929  929  HOH HOH A . 
F 6 HOH 444 930  930  HOH HOH A . 
F 6 HOH 445 931  931  HOH HOH A . 
F 6 HOH 446 932  932  HOH HOH A . 
F 6 HOH 447 933  933  HOH HOH A . 
F 6 HOH 448 934  934  HOH HOH A . 
F 6 HOH 449 935  935  HOH HOH A . 
F 6 HOH 450 936  936  HOH HOH A . 
F 6 HOH 451 937  937  HOH HOH A . 
F 6 HOH 452 938  938  HOH HOH A . 
F 6 HOH 453 939  939  HOH HOH A . 
F 6 HOH 454 940  940  HOH HOH A . 
F 6 HOH 455 941  941  HOH HOH A . 
F 6 HOH 456 942  942  HOH HOH A . 
F 6 HOH 457 943  943  HOH HOH A . 
F 6 HOH 458 944  944  HOH HOH A . 
F 6 HOH 459 945  945  HOH HOH A . 
F 6 HOH 460 946  946  HOH HOH A . 
F 6 HOH 461 947  947  HOH HOH A . 
F 6 HOH 462 948  948  HOH HOH A . 
F 6 HOH 463 949  949  HOH HOH A . 
F 6 HOH 464 950  950  HOH HOH A . 
F 6 HOH 465 951  951  HOH HOH A . 
F 6 HOH 466 952  952  HOH HOH A . 
F 6 HOH 467 953  953  HOH HOH A . 
F 6 HOH 468 954  954  HOH HOH A . 
F 6 HOH 469 955  955  HOH HOH A . 
F 6 HOH 470 956  956  HOH HOH A . 
F 6 HOH 471 957  957  HOH HOH A . 
F 6 HOH 472 958  958  HOH HOH A . 
F 6 HOH 473 959  959  HOH HOH A . 
F 6 HOH 474 960  960  HOH HOH A . 
F 6 HOH 475 961  961  HOH HOH A . 
F 6 HOH 476 962  962  HOH HOH A . 
F 6 HOH 477 963  963  HOH HOH A . 
F 6 HOH 478 964  964  HOH HOH A . 
F 6 HOH 479 965  965  HOH HOH A . 
F 6 HOH 480 966  966  HOH HOH A . 
F 6 HOH 481 967  967  HOH HOH A . 
F 6 HOH 482 968  968  HOH HOH A . 
F 6 HOH 483 969  969  HOH HOH A . 
F 6 HOH 484 970  970  HOH HOH A . 
F 6 HOH 485 971  971  HOH HOH A . 
F 6 HOH 486 972  972  HOH HOH A . 
F 6 HOH 487 973  973  HOH HOH A . 
F 6 HOH 488 974  974  HOH HOH A . 
F 6 HOH 489 975  975  HOH HOH A . 
F 6 HOH 490 976  976  HOH HOH A . 
F 6 HOH 491 977  977  HOH HOH A . 
F 6 HOH 492 978  978  HOH HOH A . 
F 6 HOH 493 979  979  HOH HOH A . 
F 6 HOH 494 980  980  HOH HOH A . 
F 6 HOH 495 981  981  HOH HOH A . 
F 6 HOH 496 982  982  HOH HOH A . 
F 6 HOH 497 983  983  HOH HOH A . 
F 6 HOH 498 984  984  HOH HOH A . 
F 6 HOH 499 985  985  HOH HOH A . 
F 6 HOH 500 986  986  HOH HOH A . 
F 6 HOH 501 987  987  HOH HOH A . 
F 6 HOH 502 988  988  HOH HOH A . 
F 6 HOH 503 989  989  HOH HOH A . 
F 6 HOH 504 990  990  HOH HOH A . 
F 6 HOH 505 991  991  HOH HOH A . 
F 6 HOH 506 992  992  HOH HOH A . 
F 6 HOH 507 993  993  HOH HOH A . 
F 6 HOH 508 994  994  HOH HOH A . 
F 6 HOH 509 995  995  HOH HOH A . 
F 6 HOH 510 996  996  HOH HOH A . 
F 6 HOH 511 997  997  HOH HOH A . 
F 6 HOH 512 998  998  HOH HOH A . 
F 6 HOH 513 999  999  HOH HOH A . 
F 6 HOH 514 1000 1000 HOH HOH A . 
F 6 HOH 515 1001 1001 HOH HOH A . 
F 6 HOH 516 1002 1002 HOH HOH A . 
F 6 HOH 517 1003 1003 HOH HOH A . 
F 6 HOH 518 1004 1004 HOH HOH A . 
F 6 HOH 519 1005 1005 HOH HOH A . 
F 6 HOH 520 1006 1006 HOH HOH A . 
F 6 HOH 521 1007 1007 HOH HOH A . 
F 6 HOH 522 1008 1008 HOH HOH A . 
F 6 HOH 523 1009 1009 HOH HOH A . 
F 6 HOH 524 1010 1010 HOH HOH A . 
F 6 HOH 525 1011 1011 HOH HOH A . 
F 6 HOH 526 1012 1012 HOH HOH A . 
F 6 HOH 527 1013 1013 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA,PQS 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 15150 ? 
1 MORE         -96   ? 
1 'SSA (A^2)'  35460 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z       1.0000000000  0.0000000000 0.0000000000 0.0000000000   0.0000000000 1.0000000000  
0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 2_665 -x+1,-y+1,z -1.0000000000 0.0000000000 0.0000000000 163.6993649538 0.0000000000 -1.0000000000 
0.0000000000 72.2017711462 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1994-01-31 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Derived calculations'      
3 3 'Structure model' 'Version format compliance' 
# 
_software.name             TNT 
_software.classification   refinement 
_software.version          . 
_software.citation_id      ? 
_software.pdbx_ordinal     1 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1   1 PA  A NAD 480 ? ? PA  A NDP 483 ? ? 0.00 
2   1 O2A A NAD 480 ? ? O2A A NDP 483 ? ? 0.00 
3   1 PN  A NAD 480 ? ? PN  A NDP 483 ? ? 0.00 
4   1 O1N A NAD 480 ? ? O1N A NDP 483 ? ? 0.00 
5   1 O2N A NAD 480 ? ? O2N A NDP 483 ? ? 0.00 
6   1 O5D A NAD 480 ? ? O5D A NDP 483 ? ? 0.00 
7   1 C5D A NAD 480 ? ? C5D A NDP 483 ? ? 0.00 
8   1 C4D A NAD 480 ? ? C4D A NDP 483 ? ? 0.00 
9   1 O4D A NAD 480 ? ? O4D A NDP 483 ? ? 0.00 
10  1 C3D A NAD 480 ? ? C3D A NDP 483 ? ? 0.00 
11  1 O2D A NAD 480 ? ? O2D A NDP 483 ? ? 0.00 
12  1 C1D A NAD 480 ? ? C1D A NDP 483 ? ? 0.00 
13  1 N1N A NAD 480 ? ? N1N A NDP 483 ? ? 0.00 
14  1 C2N A NAD 480 ? ? C2N A NDP 483 ? ? 0.00 
15  1 C3N A NAD 480 ? ? C3N A NDP 483 ? ? 0.00 
16  1 C7N A NAD 480 ? ? C7N A NDP 483 ? ? 0.00 
17  1 N7N A NAD 480 ? ? N7N A NDP 483 ? ? 0.00 
18  1 C5N A NAD 480 ? ? C5N A NDP 483 ? ? 0.00 
19  1 C6N A NAD 480 ? ? C6N A NDP 483 ? ? 0.00 
20  1 O3D A NAD 480 ? ? O3D A NDP 483 ? ? 0.00 
21  1 O7N A NAD 480 ? ? O7N A NDP 483 ? ? 0.00 
22  1 C4N A NAD 480 ? ? C4N A NDP 483 ? ? 0.00 
23  1 O3  A NAD 480 ? ? O3  A NDP 483 ? ? 0.00 
24  1 O1A A NAD 480 ? ? O1A A NDP 483 ? ? 0.00 
25  1 C2D A NAD 480 ? ? C2D A NDP 483 ? ? 0.00 
26  1 N1A A NAD 480 ? ? N1A A NDP 483 ? ? 0.13 
27  1 O5B A NAD 480 ? ? O5B A NDP 483 ? ? 0.15 
28  1 C2A A NAD 480 ? ? C2A A NDP 483 ? ? 0.17 
29  1 C6A A NAD 480 ? ? C6A A NDP 483 ? ? 0.24 
30  1 N3A A NAD 480 ? ? N3A A NDP 483 ? ? 0.34 
31  1 N6A A NAD 480 ? ? N6A A NDP 483 ? ? 0.36 
32  1 C5A A NAD 480 ? ? C5A A NDP 483 ? ? 0.42 
33  1 C4A A NAD 480 ? ? C4A A NDP 483 ? ? 0.44 
34  1 O2  A PO4 481 ? ? O2X A NDP 483 ? ? 0.57 
35  1 C5B A NAD 480 ? ? C5B A NDP 483 ? ? 0.58 
36  1 N7A A NAD 480 ? ? N7A A NDP 483 ? ? 0.66 
37  1 N9A A NAD 480 ? ? N9A A NDP 483 ? ? 0.69 
38  1 P   A PO4 481 ? ? P2B A NDP 483 ? ? 0.70 
39  1 C3B A NAD 480 ? ? C4B A NDP 483 ? ? 0.72 
40  1 C8A A NAD 480 ? ? C8A A NDP 483 ? ? 0.78 
41  1 C4B A NAD 480 ? ? C4B A NDP 483 ? ? 0.84 
42  1 O2B A NAD 480 ? ? C2B A NDP 483 ? ? 0.86 
43  1 O4B A NAD 480 ? ? O4B A NDP 483 ? ? 0.87 
44  1 C2B A NAD 480 ? ? C3B A NDP 483 ? ? 0.90 
45  1 C1B A NAD 480 ? ? C1B A NDP 483 ? ? 0.91 
46  1 C3B A NAD 480 ? ? C3B A NDP 483 ? ? 0.93 
47  1 O1  A PO4 481 ? ? O1X A NDP 483 ? ? 0.94 
48  1 C8A A NAD 480 ? ? N7A A NDP 483 ? ? 0.95 
49  1 C4B A NAD 480 ? ? C5B A NDP 483 ? ? 0.98 
50  1 N9A A NAD 480 ? ? C8A A NDP 483 ? ? 1.00 
51  1 N3A A NAD 480 ? ? C4A A NDP 483 ? ? 1.05 
52  1 C4A A NAD 480 ? ? C5A A NDP 483 ? ? 1.06 
53  1 O4  A PO4 481 ? ? P2B A NDP 483 ? ? 1.10 
54  1 O4  A PO4 481 ? ? O3X A NDP 483 ? ? 1.11 
55  1 C6A A NAD 480 ? ? N6A A NDP 483 ? ? 1.13 
56  1 C1B A NAD 480 ? ? N9A A NDP 483 ? ? 1.19 
57  1 P   A PO4 481 ? ? O2X A NDP 483 ? ? 1.23 
58  1 O7N A NAD 480 ? ? C7N A NDP 483 ? ? 1.23 
59  1 C7N A NAD 480 ? ? O7N A NDP 483 ? ? 1.23 
60  1 C5A A NAD 480 ? ? C6A A NDP 483 ? ? 1.25 
61  1 C2A A NAD 480 ? ? N3A A NDP 483 ? ? 1.28 
62  1 C2A A NAD 480 ? ? N1A A NDP 483 ? ? 1.29 
63  1 C1B A NAD 480 ? ? O4B A NDP 483 ? ? 1.34 
64  1 C7N A NAD 480 ? ? N7N A NDP 483 ? ? 1.35 
65  1 N7N A NAD 480 ? ? C7N A NDP 483 ? ? 1.35 
66  1 P   A PO4 481 ? ? O3X A NDP 483 ? ? 1.35 
67  1 C6A A NAD 480 ? ? N1A A NDP 483 ? ? 1.37 
68  1 N1N A NAD 480 ? ? C6N A NDP 483 ? ? 1.37 
69  1 C6N A NAD 480 ? ? N1N A NDP 483 ? ? 1.37 
70  1 N1A A NAD 480 ? ? C6A A NDP 483 ? ? 1.37 
71  1 N1N A NAD 480 ? ? C2N A NDP 483 ? ? 1.37 
72  1 C2N A NAD 480 ? ? N1N A NDP 483 ? ? 1.37 
73  1 C2B A NAD 480 ? ? C2B A NDP 483 ? ? 1.39 
74  1 C2N A NAD 480 ? ? C3N A NDP 483 ? ? 1.39 
75  1 C3N A NAD 480 ? ? C2N A NDP 483 ? ? 1.39 
76  1 N3A A NAD 480 ? ? C2A A NDP 483 ? ? 1.40 
77  1 C4N A NAD 480 ? ? C3N A NDP 483 ? ? 1.41 
78  1 C5A A NAD 480 ? ? N7A A NDP 483 ? ? 1.41 
79  1 C3N A NAD 480 ? ? C4N A NDP 483 ? ? 1.41 
80  1 C5N A NAD 480 ? ? C6N A NDP 483 ? ? 1.42 
81  1 C6N A NAD 480 ? ? C5N A NDP 483 ? ? 1.42 
82  1 C3D A NAD 480 ? ? O3D A NDP 483 ? ? 1.42 
83  1 O3D A NAD 480 ? ? C3D A NDP 483 ? ? 1.42 
84  1 C5N A NAD 480 ? ? C4N A NDP 483 ? ? 1.43 
85  1 C4N A NAD 480 ? ? C5N A NDP 483 ? ? 1.43 
86  1 N1A A NAD 480 ? ? C2A A NDP 483 ? ? 1.44 
87  1 O2D A NAD 480 ? ? C2D A NDP 483 ? ? 1.44 
88  1 C2D A NAD 480 ? ? O2D A NDP 483 ? ? 1.44 
89  1 O5D A NAD 480 ? ? C5D A NDP 483 ? ? 1.46 
90  1 C5D A NAD 480 ? ? O5D A NDP 483 ? ? 1.46 
91  1 C5B A NAD 480 ? ? O5B A NDP 483 ? ? 1.47 
92  1 O1A A NAD 480 ? ? PA  A NDP 483 ? ? 1.47 
93  1 PA  A NAD 480 ? ? O1A A NDP 483 ? ? 1.47 
94  1 PA  A NAD 480 ? ? O2A A NDP 483 ? ? 1.47 
95  1 O2A A NAD 480 ? ? PA  A NDP 483 ? ? 1.47 
96  1 PN  A NAD 480 ? ? O2N A NDP 483 ? ? 1.47 
97  1 O2N A NAD 480 ? ? PN  A NDP 483 ? ? 1.47 
98  1 O4D A NAD 480 ? ? C1D A NDP 483 ? ? 1.48 
99  1 C1D A NAD 480 ? ? O4D A NDP 483 ? ? 1.48 
100 1 C1D A NAD 480 ? ? N1N A NDP 483 ? ? 1.48 
101 1 N1N A NAD 480 ? ? C1D A NDP 483 ? ? 1.48 
102 1 C4D A NAD 480 ? ? O4D A NDP 483 ? ? 1.49 
103 1 O4D A NAD 480 ? ? C4D A NDP 483 ? ? 1.49 
104 1 O2  A PO4 481 ? ? P2B A NDP 483 ? ? 1.49 
105 1 C4A A NAD 480 ? ? N9A A NDP 483 ? ? 1.49 
106 1 C4B A NAD 480 ? ? O4B A NDP 483 ? ? 1.50 
107 1 N9A A NAD 480 ? ? C4A A NDP 483 ? ? 1.51 
108 1 C2D A NAD 480 ? ? C1D A NDP 483 ? ? 1.51 
109 1 C1D A NAD 480 ? ? C2D A NDP 483 ? ? 1.51 
110 1 N6A A NAD 480 ? ? C6A A NDP 483 ? ? 1.52 
111 1 PN  A NAD 480 ? ? O1N A NDP 483 ? ? 1.52 
112 1 O1N A NAD 480 ? ? PN  A NDP 483 ? ? 1.52 
113 1 O5B A NAD 480 ? ? C5B A NDP 483 ? ? 1.52 
114 1 C4D A NAD 480 ? ? C3D A NDP 483 ? ? 1.52 
115 1 C3D A NAD 480 ? ? C4D A NDP 483 ? ? 1.52 
116 1 N7A A NAD 480 ? ? C5A A NDP 483 ? ? 1.53 
117 1 C3N A NAD 480 ? ? C7N A NDP 483 ? ? 1.53 
118 1 C7N A NAD 480 ? ? C3N A NDP 483 ? ? 1.53 
119 1 C5D A NAD 480 ? ? C4D A NDP 483 ? ? 1.53 
120 1 C4D A NAD 480 ? ? C5D A NDP 483 ? ? 1.53 
121 1 C3D A NAD 480 ? ? C2D A NDP 483 ? ? 1.54 
122 1 C2D A NAD 480 ? ? C3D A NDP 483 ? ? 1.54 
123 1 O3  A PO4 481 ? ? O3X A NDP 483 ? ? 1.59 
124 1 O3B A NAD 480 ? ? C4B A NDP 483 ? ? 1.60 
125 1 O3  A NAD 480 ? ? PA  A NDP 483 ? ? 1.62 
126 1 PA  A NAD 480 ? ? O3  A NDP 483 ? ? 1.62 
127 1 O5B A NAD 480 ? ? PA  A NDP 483 ? ? 1.63 
128 1 PN  A NAD 480 ? ? O5D A NDP 483 ? ? 1.63 
129 1 O5D A NAD 480 ? ? PN  A NDP 483 ? ? 1.63 
130 1 PN  A NAD 480 ? ? O3  A NDP 483 ? ? 1.63 
131 1 O3  A NAD 480 ? ? PN  A NDP 483 ? ? 1.63 
132 1 O2B A NAD 480 ? ? C3B A NDP 483 ? ? 1.63 
133 1 O1  A PO4 481 ? ? P2B A NDP 483 ? ? 1.66 
134 1 C6A A NAD 480 ? ? C5A A NDP 483 ? ? 1.68 
135 1 P   A PO4 481 ? ? O1X A NDP 483 ? ? 1.68 
136 1 C4A A NAD 480 ? ? N3A A NDP 483 ? ? 1.68 
137 1 O3B A NAD 480 ? ? O2B A NDP 483 ? ? 1.71 
138 1 PA  A NAD 480 ? ? O5B A NDP 483 ? ? 1.73 
139 1 N9A A NAD 480 ? ? N7A A NDP 483 ? ? 1.77 
140 1 C5A A NAD 480 ? ? C4A A NDP 483 ? ? 1.78 
141 1 C3B A NAD 480 ? ? O3B A NDP 483 ? ? 1.81 
142 1 O4B A NAD 480 ? ? C4B A NDP 483 ? ? 1.83 
143 1 O4  A PO4 481 ? ? O2B A NDP 483 ? ? 1.84 
144 1 O4  A PO4 481 ? ? O1X A NDP 483 ? ? 1.86 
145 1 C2B A NAD 480 ? ? C4B A NDP 483 ? ? 1.88 
146 1 C1B A NAD 480 ? ? C2B A NDP 483 ? ? 1.88 
147 1 C2B A NAD 480 ? ? C1B A NDP 483 ? ? 1.88 
148 1 N7A A NAD 480 ? ? C8A A NDP 483 ? ? 1.90 
149 1 N9A A NAD 480 ? ? C5A A NDP 483 ? ? 1.91 
150 1 O3  A PO4 481 ? ? O2X A NDP 483 ? ? 1.93 
151 1 O3B A NAD 480 ? ? C3B A NDP 483 ? ? 1.94 
152 1 C3B A NAD 480 ? ? O4B A NDP 483 ? ? 1.96 
153 1 O2B A NAD 480 ? ? O2B A NDP 483 ? ? 1.96 
154 1 C3B A NAD 480 ? ? C2B A NDP 483 ? ? 1.97 
155 1 O3B A NAD 480 ? ? C2B A NDP 483 ? ? 1.98 
156 1 C4A A NAD 480 ? ? N7A A NDP 483 ? ? 1.98 
157 1 C3B A NAD 480 ? ? C5B A NDP 483 ? ? 1.99 
158 1 C8A A NAD 480 ? ? N9A A NDP 483 ? ? 2.00 
159 1 O4B A NAD 480 ? ? C1B A NDP 483 ? ? 2.02 
160 1 C1B A NAD 480 ? ? C8A A NDP 483 ? ? 2.02 
161 1 C8A A NAD 480 ? ? C5A A NDP 483 ? ? 2.05 
162 1 N9A A NAD 480 ? ? C1B A NDP 483 ? ? 2.07 
163 1 C4A A NAD 480 ? ? C8A A NDP 483 ? ? 2.08 
164 1 C2A A NAD 480 ? ? C4A A NDP 483 ? ? 2.09 
165 1 O2  A PO4 481 ? ? O2B A NDP 483 ? ? 2.10 
166 1 O1  A PO4 481 ? ? O2X A NDP 483 ? ? 2.11 
167 1 C5A A NAD 480 ? ? N6A A NDP 483 ? ? 2.12 
168 1 C5B A NAD 480 ? ? C4B A NDP 483 ? ? 2.13 
169 1 O3  A PO4 481 ? ? P2B A NDP 483 ? ? 2.15 
170 1 O4B A NAD 480 ? ? C5B A NDP 483 ? ? 2.15 
171 1 C2B A NAD 480 ? ? O4B A NDP 483 ? ? 2.16 
172 1 N3A A NAD 480 ? ? C5A A NDP 483 ? ? 2.17 
173 1 C4A A NAD 480 ? ? C6A A NDP 483 ? ? 2.17 
174 1 C1B A NAD 480 ? ? C4B A NDP 483 ? ? 2.19 
175 1 C4B A NAD 480 ? ? C3B A NDP 483 ? ? 2.19 
176 1 C4B A NAD 480 ? ? O5B A NDP 483 ? ? 2.19 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 O  A HOH 580 ? ? 1_555 O  A HOH 580 ? ? 2_665 0.76 
2 1 SG A CYS 90  ? ? 1_555 SG A CYS 90  ? ? 2_665 1.62 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CD A GLU 77  ? ? OE1 A GLU 77  ? ? 1.334 1.252 0.082 0.011 N 
2 1 CD A GLU 91  ? ? OE2 A GLU 91  ? ? 1.320 1.252 0.068 0.011 N 
3 1 CD A GLU 101 ? ? OE2 A GLU 101 ? ? 1.321 1.252 0.069 0.011 N 
4 1 CD A GLU 124 ? ? OE1 A GLU 124 ? ? 1.323 1.252 0.071 0.011 N 
5 1 CD A GLU 185 ? ? OE1 A GLU 185 ? ? 1.326 1.252 0.074 0.011 N 
6 1 CD A GLU 262 ? ? OE1 A GLU 262 ? ? 1.327 1.252 0.075 0.011 N 
7 1 CD A GLU 317 ? ? OE1 A GLU 317 ? ? 1.323 1.252 0.071 0.011 N 
8 1 CD A GLU 358 ? ? OE2 A GLU 358 ? ? 1.323 1.252 0.071 0.011 N 
9 1 CD A GLU 394 ? ? OE1 A GLU 394 ? ? 1.321 1.252 0.069 0.011 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 CB A ASP 84  ? ? CG A ASP 84  ? ? OD1 A ASP 84  ? ? 112.38 118.30 -5.92  0.90 N 
2  1 C  A GLU 91  ? ? N  A GLY 92  ? ? CA  A GLY 92  ? ? 102.93 122.30 -19.37 2.10 Y 
3  1 CB A ASP 104 ? ? CG A ASP 104 ? ? OD1 A ASP 104 ? ? 125.44 118.30 7.14   0.90 N 
4  1 CB A ASP 104 ? ? CG A ASP 104 ? ? OD2 A ASP 104 ? ? 111.17 118.30 -7.13  0.90 N 
5  1 CB A MET 159 ? ? CA A MET 159 ? ? C   A MET 159 ? ? 97.19  110.40 -13.21 2.00 N 
6  1 CB A ASP 283 ? ? CG A ASP 283 ? ? OD1 A ASP 283 ? ? 112.27 118.30 -6.03  0.90 N 
7  1 CB A ASP 308 ? ? CG A ASP 308 ? ? OD1 A ASP 308 ? ? 123.77 118.30 5.47   0.90 N 
8  1 CB A ASP 309 ? ? CG A ASP 309 ? ? OD2 A ASP 309 ? ? 111.36 118.30 -6.94  0.90 N 
9  1 NE A ARG 352 ? ? CZ A ARG 352 ? ? NH1 A ARG 352 ? ? 116.76 120.30 -3.54  0.50 N 
10 1 NE A ARG 352 ? ? CZ A ARG 352 ? ? NH2 A ARG 352 ? ? 124.78 120.30 4.48   0.50 N 
11 1 CB A ASP 359 ? ? CG A ASP 359 ? ? OD2 A ASP 359 ? ? 112.70 118.30 -5.60  0.90 N 
12 1 CB A ASP 385 ? ? CG A ASP 385 ? ? OD1 A ASP 385 ? ? 112.44 118.30 -5.86  0.90 N 
13 1 CB A ASP 441 ? ? CG A ASP 441 ? ? OD1 A ASP 441 ? ? 123.76 118.30 5.46   0.90 N 
14 1 CB A ASP 441 ? ? CG A ASP 441 ? ? OD2 A ASP 441 ? ? 112.14 118.30 -6.16  0.90 N 
15 1 CB A ASP 459 ? ? CG A ASP 459 ? ? OD2 A ASP 459 ? ? 112.89 118.30 -5.41  0.90 N 
16 1 CB A ASP 461 ? ? CG A ASP 461 ? ? OD1 A ASP 461 ? ? 123.87 118.30 5.57   0.90 N 
17 1 CB A ASP 461 ? ? CG A ASP 461 ? ? OD2 A ASP 461 ? ? 111.21 118.30 -7.09  0.90 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 HIS A 52  ? ? -119.89 -117.43 
2 1 HIS A 122 ? ? 73.88   30.59   
3 1 PRO A 136 ? ? -54.12  -72.12  
4 1 ALA A 155 ? ? -144.57 52.66   
5 1 HIS A 219 ? ? -121.05 -140.75 
6 1 ALA A 336 ? ? 50.94   70.39   
7 1 ASN A 425 ? ? 63.46   -179.29 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 0 A HIS 219 ? CG  ? A HIS 219 CG  
2 1 Y 0 A HIS 219 ? ND1 ? A HIS 219 ND1 
3 1 Y 0 A HIS 219 ? CD2 ? A HIS 219 CD2 
4 1 Y 0 A HIS 219 ? CE1 ? A HIS 219 CE1 
5 1 Y 0 A HIS 219 ? NE2 ? A HIS 219 NE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A ALA 1  ? A ALA 1  
2  1 Y 1 A CYS 2  ? A CYS 2  
3  1 Y 1 A ARG 3  ? A ARG 3  
4  1 Y 1 A GLN 4  ? A GLN 4  
5  1 Y 1 A GLU 5  ? A GLU 5  
6  1 Y 1 A PRO 6  ? A PRO 6  
7  1 Y 1 A GLN 7  ? A GLN 7  
8  1 Y 1 A PRO 8  ? A PRO 8  
9  1 Y 1 A GLN 9  ? A GLN 9  
10 1 Y 1 A GLY 10 ? A GLY 10 
11 1 Y 1 A PRO 11 ? A PRO 11 
12 1 Y 1 A PRO 12 ? A PRO 12 
13 1 Y 1 A PRO 13 ? A PRO 13 
14 1 Y 1 A ALA 14 ? A ALA 14 
15 1 Y 1 A ALA 15 ? A ALA 15 
16 1 Y 1 A GLY 16 ? A GLY 16 
17 1 Y 1 A ALA 17 ? A ALA 17 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'PHOSPHATE ION'                                             PO4 
3 'FLAVIN-ADENINE DINUCLEOTIDE'                               FAD 
4 NICOTINAMIDE-ADENINE-DINUCLEOTIDE                           NAD 
5 'NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE' NDP 
6 water                                                       HOH 
#