data_1GUL
# 
_entry.id   1GUL 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1GUL         
RCSB  RCSB008094   
WWPDB D_1000008094 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1GUL 
_pdbx_database_status.recvd_initial_deposition_date   1998-06-10 
_pdbx_database_status.deposit_site                    BNL 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Bruns, C.M.'     1 
'Hubatsch, I.'    2 
'Ridderstrom, M.' 3 
'Mannervik, B.'   4 
'Tainer, J.A.'    5 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;Human glutathione transferase A4-4 crystal structures and mutagenesis reveal the basis of high catalytic efficiency with toxic lipid peroxidation products
;
J.Mol.Biol. 288 427 439 1999 JMOBAK UK 0022-2836 0070 ? 10329152 10.1006/jmbi.1999.2697 
1       
;Human Glutathione Transferase A4-4: An Alpha Class Enzyme with High Catalytic Efficiency in the Conjugation of 4-Hydroxynonenal and Other Genotoxic Products of Lipid Peroxidation
;
Biochem.J.  330 175 ?   1998 BIJOAK UK 0264-6021 0043 ? ?        ?                      
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Bruns, C.M.'     1 
primary 'Hubatsch, I.'    2 
primary 'Ridderstrom, M.' 3 
primary 'Mannervik, B.'   4 
primary 'Tainer, J.A.'    5 
1       'Hubatsch, I.'    6 
1       'Ridderstrom, M.' 7 
1       'Mannervik, B.'   8 
# 
_cell.entry_id           1GUL 
_cell.length_a           155.300 
_cell.length_b           156.100 
_cell.length_c           101.300 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              32 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1GUL 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'GLUTATHIONE TRANSFERASE A4-4' 25738.094 8   2.5.1.18 ? ? ? 
2 polymer syn 'S-(2-iodobenzyl) glutathione' 523.343   8   ?        ? ? ? 
3 water   nat water                          18.015    216 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'GLUTATHIONE S-TRANSFERASE, GST' 
# 
_entity_name_sys.entity_id   1 
_entity_name_sys.name        E.C.2.5.1.18 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no  
;MAARPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLYKLQDGNHLLFQQVPMVEIDGMKLVQTRSILHYIADKHN
LFGKNLKERTLIDMYVEGTLDLLELLIMHPFLKPDDQQKEVVNMAQKAIIRYFPVFEKILRGHGQSFLVGNQLSLADVIL
LQTILALEEKIPNILSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFRP
;
;MAARPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLYKLQDGNHLLFQQVPMVEIDGMKLVQTRSILHYIADKHN
LFGKNLKERTLIDMYVEGTLDLLELLIMHPFLKPDDQQKEVVNMAQKAIIRYFPVFEKILRGHGQSFLVGNQLSLADVIL
LQTILALEEKIPNILSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFRP
;
A,B,C,D,E,F,G,H ? 
2 'polypeptide(L)' no yes '(GGL)(ICY)G' EXG I,J,K,L,M,N,O,P ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   ALA n 
1 4   ARG n 
1 5   PRO n 
1 6   LYS n 
1 7   LEU n 
1 8   HIS n 
1 9   TYR n 
1 10  PRO n 
1 11  ASN n 
1 12  GLY n 
1 13  ARG n 
1 14  GLY n 
1 15  ARG n 
1 16  MET n 
1 17  GLU n 
1 18  SER n 
1 19  VAL n 
1 20  ARG n 
1 21  TRP n 
1 22  VAL n 
1 23  LEU n 
1 24  ALA n 
1 25  ALA n 
1 26  ALA n 
1 27  GLY n 
1 28  VAL n 
1 29  GLU n 
1 30  PHE n 
1 31  ASP n 
1 32  GLU n 
1 33  GLU n 
1 34  PHE n 
1 35  LEU n 
1 36  GLU n 
1 37  THR n 
1 38  LYS n 
1 39  GLU n 
1 40  GLN n 
1 41  LEU n 
1 42  TYR n 
1 43  LYS n 
1 44  LEU n 
1 45  GLN n 
1 46  ASP n 
1 47  GLY n 
1 48  ASN n 
1 49  HIS n 
1 50  LEU n 
1 51  LEU n 
1 52  PHE n 
1 53  GLN n 
1 54  GLN n 
1 55  VAL n 
1 56  PRO n 
1 57  MET n 
1 58  VAL n 
1 59  GLU n 
1 60  ILE n 
1 61  ASP n 
1 62  GLY n 
1 63  MET n 
1 64  LYS n 
1 65  LEU n 
1 66  VAL n 
1 67  GLN n 
1 68  THR n 
1 69  ARG n 
1 70  SER n 
1 71  ILE n 
1 72  LEU n 
1 73  HIS n 
1 74  TYR n 
1 75  ILE n 
1 76  ALA n 
1 77  ASP n 
1 78  LYS n 
1 79  HIS n 
1 80  ASN n 
1 81  LEU n 
1 82  PHE n 
1 83  GLY n 
1 84  LYS n 
1 85  ASN n 
1 86  LEU n 
1 87  LYS n 
1 88  GLU n 
1 89  ARG n 
1 90  THR n 
1 91  LEU n 
1 92  ILE n 
1 93  ASP n 
1 94  MET n 
1 95  TYR n 
1 96  VAL n 
1 97  GLU n 
1 98  GLY n 
1 99  THR n 
1 100 LEU n 
1 101 ASP n 
1 102 LEU n 
1 103 LEU n 
1 104 GLU n 
1 105 LEU n 
1 106 LEU n 
1 107 ILE n 
1 108 MET n 
1 109 HIS n 
1 110 PRO n 
1 111 PHE n 
1 112 LEU n 
1 113 LYS n 
1 114 PRO n 
1 115 ASP n 
1 116 ASP n 
1 117 GLN n 
1 118 GLN n 
1 119 LYS n 
1 120 GLU n 
1 121 VAL n 
1 122 VAL n 
1 123 ASN n 
1 124 MET n 
1 125 ALA n 
1 126 GLN n 
1 127 LYS n 
1 128 ALA n 
1 129 ILE n 
1 130 ILE n 
1 131 ARG n 
1 132 TYR n 
1 133 PHE n 
1 134 PRO n 
1 135 VAL n 
1 136 PHE n 
1 137 GLU n 
1 138 LYS n 
1 139 ILE n 
1 140 LEU n 
1 141 ARG n 
1 142 GLY n 
1 143 HIS n 
1 144 GLY n 
1 145 GLN n 
1 146 SER n 
1 147 PHE n 
1 148 LEU n 
1 149 VAL n 
1 150 GLY n 
1 151 ASN n 
1 152 GLN n 
1 153 LEU n 
1 154 SER n 
1 155 LEU n 
1 156 ALA n 
1 157 ASP n 
1 158 VAL n 
1 159 ILE n 
1 160 LEU n 
1 161 LEU n 
1 162 GLN n 
1 163 THR n 
1 164 ILE n 
1 165 LEU n 
1 166 ALA n 
1 167 LEU n 
1 168 GLU n 
1 169 GLU n 
1 170 LYS n 
1 171 ILE n 
1 172 PRO n 
1 173 ASN n 
1 174 ILE n 
1 175 LEU n 
1 176 SER n 
1 177 ALA n 
1 178 PHE n 
1 179 PRO n 
1 180 PHE n 
1 181 LEU n 
1 182 GLN n 
1 183 GLU n 
1 184 TYR n 
1 185 THR n 
1 186 VAL n 
1 187 LYS n 
1 188 LEU n 
1 189 SER n 
1 190 ASN n 
1 191 ILE n 
1 192 PRO n 
1 193 THR n 
1 194 ILE n 
1 195 LYS n 
1 196 ARG n 
1 197 PHE n 
1 198 LEU n 
1 199 GLU n 
1 200 PRO n 
1 201 GLY n 
1 202 SER n 
1 203 LYS n 
1 204 LYS n 
1 205 LYS n 
1 206 PRO n 
1 207 PRO n 
1 208 PRO n 
1 209 ASP n 
1 210 GLU n 
1 211 ILE n 
1 212 TYR n 
1 213 VAL n 
1 214 ARG n 
1 215 THR n 
1 216 VAL n 
1 217 TYR n 
1 218 ASN n 
1 219 ILE n 
1 220 PHE n 
1 221 ARG n 
1 222 PRO n 
2 1   GGL n 
2 2   ICY n 
2 3   GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    'SUBSTANTIA NIGRA' 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                BRAIN 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               JM109 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    CYTOPLASM 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               PKK-D 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP GTA4_HUMAN 1 ? ? O15217 ? 
2 PDB 1GUL       2 ? ? 1GUL   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 1GUL A 1 ? 222 ? O15217 1   ? 222 ? 1   222 
2  1 1GUL B 1 ? 222 ? O15217 1   ? 222 ? 1   222 
3  1 1GUL C 1 ? 222 ? O15217 1   ? 222 ? 1   222 
4  1 1GUL D 1 ? 222 ? O15217 1   ? 222 ? 1   222 
5  1 1GUL E 1 ? 222 ? O15217 1   ? 222 ? 1   222 
6  1 1GUL F 1 ? 222 ? O15217 1   ? 222 ? 1   222 
7  1 1GUL G 1 ? 222 ? O15217 1   ? 222 ? 1   222 
8  1 1GUL H 1 ? 222 ? O15217 1   ? 222 ? 1   222 
9  2 1GUL I 1 ? 3   ? 1GUL   231 ? 233 ? 231 233 
10 2 1GUL J 1 ? 3   ? 1GUL   231 ? 233 ? 231 233 
11 2 1GUL K 1 ? 3   ? 1GUL   231 ? 233 ? 231 233 
12 2 1GUL L 1 ? 3   ? 1GUL   231 ? 233 ? 231 233 
13 2 1GUL M 1 ? 3   ? 1GUL   231 ? 233 ? 231 233 
14 2 1GUL N 1 ? 3   ? 1GUL   231 ? 233 ? 231 233 
15 2 1GUL O 1 ? 3   ? 1GUL   231 ? 233 ? 231 233 
16 2 1GUL P 1 ? 3   ? 1GUL   231 ? 233 ? 231 233 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'                y ALANINE                       ?                 'C3 H7 N O2'       89.093  
ARG 'L-peptide linking'                y ARGININE                      ?                 'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking'                y ASPARAGINE                    ?                 'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking'                y 'ASPARTIC ACID'               ?                 'C4 H7 N O4'       133.103 
GGL 'L-gamma-peptide, C-delta linking' . 'GAMMA-L-GLUTAMIC ACID'       'L-GLUTAMIC ACID' 'C5 H9 N O4'       147.129 
GLN 'L-peptide linking'                y GLUTAMINE                     ?                 'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking'                y 'GLUTAMIC ACID'               ?                 'C5 H9 N O4'       147.129 
GLY 'peptide linking'                  y GLYCINE                       ?                 'C2 H5 N O2'       75.067  
HIS 'L-peptide linking'                y HISTIDINE                     ?                 'C6 H10 N3 O2 1'   156.162 
HOH non-polymer                        . WATER                         ?                 'H2 O'             18.015  
ICY 'L-peptide linking'                n 'S-(2-iodobenzyl)-L-cysteine' ?                 'C10 H12 I N O2 S' 337.177 
ILE 'L-peptide linking'                y ISOLEUCINE                    ?                 'C6 H13 N O2'      131.173 
LEU 'L-peptide linking'                y LEUCINE                       ?                 'C6 H13 N O2'      131.173 
LYS 'L-peptide linking'                y LYSINE                        ?                 'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking'                y METHIONINE                    ?                 'C5 H11 N O2 S'    149.211 
PHE 'L-peptide linking'                y PHENYLALANINE                 ?                 'C9 H11 N O2'      165.189 
PRO 'L-peptide linking'                y PROLINE                       ?                 'C5 H9 N O2'       115.130 
SER 'L-peptide linking'                y SERINE                        ?                 'C3 H7 N O3'       105.093 
THR 'L-peptide linking'                y THREONINE                     ?                 'C4 H9 N O3'       119.119 
TRP 'L-peptide linking'                y TRYPTOPHAN                    ?                 'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking'                y TYROSINE                      ?                 'C9 H11 N O3'      181.189 
VAL 'L-peptide linking'                y VALINE                        ?                 'C5 H11 N O2'      117.146 
# 
_exptl.entry_id          1GUL 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.0 
_exptl_crystal.density_percent_sol   55 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pdbx_details    
;CRYSTALLIZATION CONDITIONS: PROTEIN WAS CRYSTALLIZED FROM 20% PEG
4000, 100 MM PH 7.0, THEN SOAKED IN 1MM IODOBENZYL GLUTATHIONE
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           77 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1997-04-17 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9800 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRL BEAMLINE BL9-1' 
_diffrn_source.pdbx_synchrotron_site       SSRL 
_diffrn_source.pdbx_synchrotron_beamline   BL9-1 
_diffrn_source.pdbx_wavelength             0.9800 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1GUL 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             160.0 
_reflns.d_resolution_high            2.7 
_reflns.number_obs                   75834 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         86 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.11 
_reflns.pdbx_netI_over_sigmaI        12.9 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              8.7 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.7 
_reflns_shell.d_res_low              2.8 
_reflns_shell.percent_possible_all   99.8 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.41 
_reflns_shell.meanI_over_sigI_obs    3.5 
_reflns_shell.pdbx_redundancy        3.9 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1GUL 
_refine.ls_number_reflns_obs                     58800 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             160.0 
_refine.ls_d_res_high                            2.70 
_refine.ls_percent_reflns_obs                    0.86 
_refine.ls_R_factor_obs                          0.25 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.248 
_refine.ls_R_factor_R_free                       0.26 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  3294 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'BABINET SCALING' 
_refine.solvent_model_param_ksol                 1.02 
_refine.solvent_model_param_bsol                 565.9 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1GSE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             'TNT BCORREL V1.0' 
_refine.pdbx_stereochemistry_target_values       'TNT PROTGEO' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        14440 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             216 
_refine_hist.number_atoms_total               14656 
_refine_hist.d_res_high                       2.70 
_refine_hist.d_res_low                        160.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
t_bond_d           0.019 ? 0.8  1847 'X-RAY DIFFRACTION' ? 
t_angle_deg        2.77  ? 1.50 2478 'X-RAY DIFFRACTION' ? 
t_dihedral_angle_d 15.50 ? 0.50 1095 'X-RAY DIFFRACTION' ? 
t_incorr_chiral_ct 0     ? ?    ?    'X-RAY DIFFRACTION' ? 
t_pseud_angle      ?     ? ?    ?    'X-RAY DIFFRACTION' ? 
t_trig_c_planes    0.021 ? 1.00 50   'X-RAY DIFFRACTION' ? 
t_gen_planes       0.016 ? 4.00 256  'X-RAY DIFFRACTION' ? 
t_it               5.97  ? 2.00 1835 'X-RAY DIFFRACTION' ? 
t_nbd              0.030 ? 10.0 63   'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1GUL 
_struct.title                     'HUMAN GLUTATHIONE TRANSFERASE A4-4 COMPLEX WITH IODOBENZYL GLUTATHIONE' 
_struct.pdbx_descriptor           'GLUTATHIONE TRANSFERASE A4-4 (E.C.2.5.1.18)/IODOBENZYL-GLUTATHIONE INHIBITOR COMPLEX' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1GUL 
_struct_keywords.pdbx_keywords   'TRANSFERASE/TRANSFERASE INHIBITOR' 
_struct_keywords.text            'OXIDATIVE STRESS, ALKENAL DEGRADATION, TRANSFERASE-TRANSFERASE INHIBITOR COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 1 ? 
F N N 2 ? 
G N N 1 ? 
H N N 2 ? 
I N N 1 ? 
J N N 2 ? 
K N N 1 ? 
L N N 2 ? 
M N N 1 ? 
N N N 2 ? 
O N N 1 ? 
P N N 2 ? 
Q N N 3 ? 
R N N 3 ? 
S N N 3 ? 
T N N 3 ? 
U N N 3 ? 
V N N 3 ? 
W N N 3 ? 
X N N 3 ? 
# 
loop_
_struct_biol.id 
_struct_biol.pdbx_parent_biol_id 
_struct_biol.details 
1 ? ? 
2 ? ? 
3 ? ? 
4 ? ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  MET A 16  ? ALA A 25  ? MET A 16  ALA A 25  5 ? 10 
HELX_P HELX_P2  2  LYS A 38  ? ASP A 46  ? LYS A 38  ASP A 46  1 ? 9  
HELX_P HELX_P3  3  THR A 68  ? LYS A 78  ? THR A 68  LYS A 78  1 ? 11 
HELX_P HELX_P4  4  LEU A 86  ? PHE A 111 ? LEU A 86  PHE A 111 1 ? 26 
HELX_P HELX_P5  5  PRO A 114 ? ARG A 131 ? PRO A 114 ARG A 131 1 ? 18 
HELX_P HELX_P6  6  PHE A 133 ? HIS A 143 ? PHE A 133 HIS A 143 1 ? 11 
HELX_P HELX_P7  7  LEU A 155 ? LYS A 170 ? LEU A 155 LYS A 170 1 ? 16 
HELX_P HELX_P8  8  PRO A 179 ? ASN A 190 ? PRO A 179 ASN A 190 1 ? 12 
HELX_P HELX_P9  9  PRO A 192 ? LEU A 198 ? PRO A 192 LEU A 198 1 ? 7  
HELX_P HELX_P10 10 GLU A 210 ? ASN A 218 ? GLU A 210 ASN A 218 1 ? 9  
HELX_P HELX_P11 11 MET C 16  ? ALA C 25  ? MET B 16  ALA B 25  5 ? 10 
HELX_P HELX_P12 12 LYS C 38  ? ASP C 46  ? LYS B 38  ASP B 46  1 ? 9  
HELX_P HELX_P13 13 THR C 68  ? LYS C 78  ? THR B 68  LYS B 78  1 ? 11 
HELX_P HELX_P14 14 LEU C 86  ? PHE C 111 ? LEU B 86  PHE B 111 1 ? 26 
HELX_P HELX_P15 15 PRO C 114 ? ARG C 131 ? PRO B 114 ARG B 131 1 ? 18 
HELX_P HELX_P16 16 PHE C 133 ? HIS C 143 ? PHE B 133 HIS B 143 1 ? 11 
HELX_P HELX_P17 17 LEU C 155 ? LYS C 170 ? LEU B 155 LYS B 170 1 ? 16 
HELX_P HELX_P18 18 PRO C 179 ? ASN C 190 ? PRO B 179 ASN B 190 1 ? 12 
HELX_P HELX_P19 19 PRO C 192 ? LEU C 198 ? PRO B 192 LEU B 198 1 ? 7  
HELX_P HELX_P20 20 GLU C 210 ? ASN C 218 ? GLU B 210 ASN B 218 1 ? 9  
HELX_P HELX_P21 21 MET E 16  ? ALA E 25  ? MET C 16  ALA C 25  5 ? 10 
HELX_P HELX_P22 22 LYS E 38  ? ASP E 46  ? LYS C 38  ASP C 46  1 ? 9  
HELX_P HELX_P23 23 THR E 68  ? LYS E 78  ? THR C 68  LYS C 78  1 ? 11 
HELX_P HELX_P24 24 LEU E 86  ? PHE E 111 ? LEU C 86  PHE C 111 1 ? 26 
HELX_P HELX_P25 25 PRO E 114 ? ARG E 131 ? PRO C 114 ARG C 131 1 ? 18 
HELX_P HELX_P26 26 PHE E 133 ? HIS E 143 ? PHE C 133 HIS C 143 1 ? 11 
HELX_P HELX_P27 27 LEU E 155 ? LYS E 170 ? LEU C 155 LYS C 170 1 ? 16 
HELX_P HELX_P28 28 PRO E 179 ? ASN E 190 ? PRO C 179 ASN C 190 1 ? 12 
HELX_P HELX_P29 29 PRO E 192 ? LEU E 198 ? PRO C 192 LEU C 198 1 ? 7  
HELX_P HELX_P30 30 GLU E 210 ? ASN E 218 ? GLU C 210 ASN C 218 1 ? 9  
HELX_P HELX_P31 31 MET G 16  ? ALA G 25  ? MET D 16  ALA D 25  5 ? 10 
HELX_P HELX_P32 32 LYS G 38  ? ASP G 46  ? LYS D 38  ASP D 46  1 ? 9  
HELX_P HELX_P33 33 THR G 68  ? LYS G 78  ? THR D 68  LYS D 78  1 ? 11 
HELX_P HELX_P34 34 LEU G 86  ? PHE G 111 ? LEU D 86  PHE D 111 1 ? 26 
HELX_P HELX_P35 35 PRO G 114 ? ARG G 131 ? PRO D 114 ARG D 131 1 ? 18 
HELX_P HELX_P36 36 PHE G 133 ? HIS G 143 ? PHE D 133 HIS D 143 1 ? 11 
HELX_P HELX_P37 37 LEU G 155 ? LYS G 170 ? LEU D 155 LYS D 170 1 ? 16 
HELX_P HELX_P38 38 PRO G 179 ? ASN G 190 ? PRO D 179 ASN D 190 1 ? 12 
HELX_P HELX_P39 39 PRO G 192 ? LEU G 198 ? PRO D 192 LEU D 198 1 ? 7  
HELX_P HELX_P40 40 GLU G 210 ? ASN G 218 ? GLU D 210 ASN D 218 1 ? 9  
HELX_P HELX_P41 41 MET I 16  ? ALA I 25  ? MET E 16  ALA E 25  5 ? 10 
HELX_P HELX_P42 42 LYS I 38  ? ASP I 46  ? LYS E 38  ASP E 46  1 ? 9  
HELX_P HELX_P43 43 THR I 68  ? LYS I 78  ? THR E 68  LYS E 78  1 ? 11 
HELX_P HELX_P44 44 LEU I 86  ? PHE I 111 ? LEU E 86  PHE E 111 1 ? 26 
HELX_P HELX_P45 45 PRO I 114 ? ARG I 131 ? PRO E 114 ARG E 131 1 ? 18 
HELX_P HELX_P46 46 PHE I 133 ? HIS I 143 ? PHE E 133 HIS E 143 1 ? 11 
HELX_P HELX_P47 47 LEU I 155 ? LYS I 170 ? LEU E 155 LYS E 170 1 ? 16 
HELX_P HELX_P48 48 PRO I 179 ? ASN I 190 ? PRO E 179 ASN E 190 1 ? 12 
HELX_P HELX_P49 49 PRO I 192 ? LEU I 198 ? PRO E 192 LEU E 198 1 ? 7  
HELX_P HELX_P50 50 GLU I 210 ? ASN I 218 ? GLU E 210 ASN E 218 1 ? 9  
HELX_P HELX_P51 51 MET K 16  ? ALA K 25  ? MET F 16  ALA F 25  5 ? 10 
HELX_P HELX_P52 52 LYS K 38  ? ASP K 46  ? LYS F 38  ASP F 46  1 ? 9  
HELX_P HELX_P53 53 THR K 68  ? LYS K 78  ? THR F 68  LYS F 78  1 ? 11 
HELX_P HELX_P54 54 LEU K 86  ? PHE K 111 ? LEU F 86  PHE F 111 1 ? 26 
HELX_P HELX_P55 55 PRO K 114 ? ARG K 131 ? PRO F 114 ARG F 131 1 ? 18 
HELX_P HELX_P56 56 PHE K 133 ? HIS K 143 ? PHE F 133 HIS F 143 1 ? 11 
HELX_P HELX_P57 57 LEU K 155 ? LYS K 170 ? LEU F 155 LYS F 170 1 ? 16 
HELX_P HELX_P58 58 PRO K 179 ? ASN K 190 ? PRO F 179 ASN F 190 1 ? 12 
HELX_P HELX_P59 59 PRO K 192 ? LEU K 198 ? PRO F 192 LEU F 198 1 ? 7  
HELX_P HELX_P60 60 GLU K 210 ? ASN K 218 ? GLU F 210 ASN F 218 1 ? 9  
HELX_P HELX_P61 61 MET M 16  ? ALA M 25  ? MET G 16  ALA G 25  5 ? 10 
HELX_P HELX_P62 62 LYS M 38  ? ASP M 46  ? LYS G 38  ASP G 46  1 ? 9  
HELX_P HELX_P63 63 THR M 68  ? LYS M 78  ? THR G 68  LYS G 78  1 ? 11 
HELX_P HELX_P64 64 LEU M 86  ? PHE M 111 ? LEU G 86  PHE G 111 1 ? 26 
HELX_P HELX_P65 65 PRO M 114 ? ARG M 131 ? PRO G 114 ARG G 131 1 ? 18 
HELX_P HELX_P66 66 PHE M 133 ? HIS M 143 ? PHE G 133 HIS G 143 1 ? 11 
HELX_P HELX_P67 67 LEU M 155 ? LYS M 170 ? LEU G 155 LYS G 170 1 ? 16 
HELX_P HELX_P68 68 PRO M 179 ? ASN M 190 ? PRO G 179 ASN G 190 1 ? 12 
HELX_P HELX_P69 69 PRO M 192 ? LEU M 198 ? PRO G 192 LEU G 198 1 ? 7  
HELX_P HELX_P70 70 GLU M 210 ? ASN M 218 ? GLU G 210 ASN G 218 1 ? 9  
HELX_P HELX_P71 71 MET O 16  ? ALA O 25  ? MET H 16  ALA H 25  5 ? 10 
HELX_P HELX_P72 72 LYS O 38  ? ASP O 46  ? LYS H 38  ASP H 46  1 ? 9  
HELX_P HELX_P73 73 THR O 68  ? LYS O 78  ? THR H 68  LYS H 78  1 ? 11 
HELX_P HELX_P74 74 LEU O 86  ? PHE O 111 ? LEU H 86  PHE H 111 1 ? 26 
HELX_P HELX_P75 75 PRO O 114 ? ARG O 131 ? PRO H 114 ARG H 131 1 ? 18 
HELX_P HELX_P76 76 PHE O 133 ? HIS O 143 ? PHE H 133 HIS H 143 1 ? 11 
HELX_P HELX_P77 77 LEU O 155 ? LYS O 170 ? LEU H 155 LYS H 170 1 ? 16 
HELX_P HELX_P78 78 PRO O 179 ? ASN O 190 ? PRO H 179 ASN H 190 1 ? 12 
HELX_P HELX_P79 79 PRO O 192 ? LEU O 198 ? PRO H 192 LEU H 198 1 ? 7  
HELX_P HELX_P80 80 GLU O 210 ? ASN O 218 ? GLU H 210 ASN H 218 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? B GGL 1 CD ? ? ? 1_555 B ICY 2 N ? ? I GGL 231 I ICY 232 1_555 ? ? ? ? ? ? ? 1.319 ? 
covale2  covale ? ? B ICY 2 C  ? ? ? 1_555 B GLY 3 N ? ? I ICY 232 I GLY 233 1_555 ? ? ? ? ? ? ? 1.312 ? 
covale3  covale ? ? D GGL 1 CD ? ? ? 1_555 D ICY 2 N ? ? J GGL 231 J ICY 232 1_555 ? ? ? ? ? ? ? 1.319 ? 
covale4  covale ? ? D ICY 2 C  ? ? ? 1_555 D GLY 3 N ? ? J ICY 232 J GLY 233 1_555 ? ? ? ? ? ? ? 1.313 ? 
covale5  covale ? ? F GGL 1 CD ? ? ? 1_555 F ICY 2 N ? ? K GGL 231 K ICY 232 1_555 ? ? ? ? ? ? ? 1.319 ? 
covale6  covale ? ? F ICY 2 C  ? ? ? 1_555 F GLY 3 N ? ? K ICY 232 K GLY 233 1_555 ? ? ? ? ? ? ? 1.311 ? 
covale7  covale ? ? H GGL 1 CD ? ? ? 1_555 H ICY 2 N ? ? L GGL 231 L ICY 232 1_555 ? ? ? ? ? ? ? 1.319 ? 
covale8  covale ? ? H ICY 2 C  ? ? ? 1_555 H GLY 3 N ? ? L ICY 232 L GLY 233 1_555 ? ? ? ? ? ? ? 1.312 ? 
covale9  covale ? ? J GGL 1 CD ? ? ? 1_555 J ICY 2 N ? ? M GGL 231 M ICY 232 1_555 ? ? ? ? ? ? ? 1.319 ? 
covale10 covale ? ? J ICY 2 C  ? ? ? 1_555 J GLY 3 N ? ? M ICY 232 M GLY 233 1_555 ? ? ? ? ? ? ? 1.312 ? 
covale11 covale ? ? L GGL 1 CD ? ? ? 1_555 L ICY 2 N ? ? N GGL 231 N ICY 232 1_555 ? ? ? ? ? ? ? 1.319 ? 
covale12 covale ? ? L ICY 2 C  ? ? ? 1_555 L GLY 3 N ? ? N ICY 232 N GLY 233 1_555 ? ? ? ? ? ? ? 1.312 ? 
covale13 covale ? ? N GGL 1 CD ? ? ? 1_555 N ICY 2 N ? ? O GGL 231 O ICY 232 1_555 ? ? ? ? ? ? ? 1.319 ? 
covale14 covale ? ? N ICY 2 C  ? ? ? 1_555 N GLY 3 N ? ? O ICY 232 O GLY 233 1_555 ? ? ? ? ? ? ? 1.312 ? 
covale15 covale ? ? P GGL 1 CD ? ? ? 1_555 P ICY 2 N ? ? P GGL 231 P ICY 232 1_555 ? ? ? ? ? ? ? 1.319 ? 
covale16 covale ? ? P ICY 2 C  ? ? ? 1_555 P GLY 3 N ? ? P ICY 232 P GLY 233 1_555 ? ? ? ? ? ? ? 1.312 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 VAL 55 A . ? VAL 55 A PRO 56 A ? PRO 56 A 1 5.79 
2 VAL 55 C . ? VAL 55 B PRO 56 C ? PRO 56 B 1 5.78 
3 VAL 55 E . ? VAL 55 C PRO 56 E ? PRO 56 C 1 5.78 
4 VAL 55 G . ? VAL 55 D PRO 56 G ? PRO 56 D 1 5.80 
5 VAL 55 I . ? VAL 55 E PRO 56 I ? PRO 56 E 1 5.82 
6 VAL 55 K . ? VAL 55 F PRO 56 K ? PRO 56 F 1 5.73 
7 VAL 55 M . ? VAL 55 G PRO 56 M ? PRO 56 G 1 5.81 
8 VAL 55 O . ? VAL 55 H PRO 56 O ? PRO 56 H 1 5.72 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 4 ? 
C ? 4 ? 
D ? 4 ? 
E ? 4 ? 
F ? 4 ? 
G ? 4 ? 
H ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? parallel      
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? parallel      
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? parallel      
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? parallel      
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
G 1 2 ? parallel      
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
H 1 2 ? parallel      
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 30 ? LEU A 35 ? PHE A 30 LEU A 35 
A 2 PRO A 5  ? PRO A 10 ? PRO A 5  PRO A 10 
A 3 MET A 57 ? ILE A 60 ? MET A 57 ILE A 60 
A 4 MET A 63 ? VAL A 66 ? MET A 63 VAL A 66 
B 1 PHE C 30 ? LEU C 35 ? PHE B 30 LEU B 35 
B 2 PRO C 5  ? PRO C 10 ? PRO B 5  PRO B 10 
B 3 MET C 57 ? ILE C 60 ? MET B 57 ILE B 60 
B 4 MET C 63 ? VAL C 66 ? MET B 63 VAL B 66 
C 1 PHE E 30 ? LEU E 35 ? PHE C 30 LEU C 35 
C 2 PRO E 5  ? PRO E 10 ? PRO C 5  PRO C 10 
C 3 MET E 57 ? ILE E 60 ? MET C 57 ILE C 60 
C 4 MET E 63 ? VAL E 66 ? MET C 63 VAL C 66 
D 1 PHE G 30 ? LEU G 35 ? PHE D 30 LEU D 35 
D 2 PRO G 5  ? PRO G 10 ? PRO D 5  PRO D 10 
D 3 MET G 57 ? ILE G 60 ? MET D 57 ILE D 60 
D 4 MET G 63 ? VAL G 66 ? MET D 63 VAL D 66 
E 1 PHE I 30 ? LEU I 35 ? PHE E 30 LEU E 35 
E 2 PRO I 5  ? PRO I 10 ? PRO E 5  PRO E 10 
E 3 MET I 57 ? ILE I 60 ? MET E 57 ILE E 60 
E 4 MET I 63 ? VAL I 66 ? MET E 63 VAL E 66 
F 1 PHE K 30 ? LEU K 35 ? PHE F 30 LEU F 35 
F 2 PRO K 5  ? PRO K 10 ? PRO F 5  PRO F 10 
F 3 MET K 57 ? ILE K 60 ? MET F 57 ILE F 60 
F 4 MET K 63 ? VAL K 66 ? MET F 63 VAL F 66 
G 1 PHE M 30 ? LEU M 35 ? PHE G 30 LEU G 35 
G 2 PRO M 5  ? PRO M 10 ? PRO G 5  PRO G 10 
G 3 MET M 57 ? ILE M 60 ? MET G 57 ILE G 60 
G 4 MET M 63 ? VAL M 66 ? MET G 63 VAL G 66 
H 1 PHE O 30 ? LEU O 35 ? PHE H 30 LEU H 35 
H 2 PRO O 5  ? PRO O 10 ? PRO H 5  PRO H 10 
H 3 MET O 57 ? ILE O 60 ? MET H 57 ILE H 60 
H 4 MET O 63 ? VAL O 66 ? MET H 63 VAL H 66 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ASP A 31 ? O ASP A 31 N PRO A 5  ? N PRO A 5  
A 2 3 O LYS A 6  ? O LYS A 6  N GLU A 59 ? N GLU A 59 
A 3 4 O VAL A 58 ? O VAL A 58 N LEU A 65 ? N LEU A 65 
B 1 2 O ASP C 31 ? O ASP B 31 N PRO C 5  ? N PRO B 5  
B 2 3 O LYS C 6  ? O LYS B 6  N GLU C 59 ? N GLU B 59 
B 3 4 O VAL C 58 ? O VAL B 58 N LEU C 65 ? N LEU B 65 
C 1 2 O ASP E 31 ? O ASP C 31 N PRO E 5  ? N PRO C 5  
C 2 3 O LYS E 6  ? O LYS C 6  N GLU E 59 ? N GLU C 59 
C 3 4 O VAL E 58 ? O VAL C 58 N LEU E 65 ? N LEU C 65 
D 1 2 O ASP G 31 ? O ASP D 31 N PRO G 5  ? N PRO D 5  
D 2 3 O LYS G 6  ? O LYS D 6  N GLU G 59 ? N GLU D 59 
D 3 4 O VAL G 58 ? O VAL D 58 N LEU G 65 ? N LEU D 65 
E 1 2 O ASP I 31 ? O ASP E 31 N PRO I 5  ? N PRO E 5  
E 2 3 O LYS I 6  ? O LYS E 6  N GLU I 59 ? N GLU E 59 
E 3 4 O VAL I 58 ? O VAL E 58 N LEU I 65 ? N LEU E 65 
F 1 2 O ASP K 31 ? O ASP F 31 N PRO K 5  ? N PRO F 5  
F 2 3 O LYS K 6  ? O LYS F 6  N GLU K 59 ? N GLU F 59 
F 3 4 O VAL K 58 ? O VAL F 58 N LEU K 65 ? N LEU F 65 
G 1 2 O ASP M 31 ? O ASP G 31 N PRO M 5  ? N PRO G 5  
G 2 3 O LYS M 6  ? O LYS G 6  N GLU M 59 ? N GLU G 59 
G 3 4 O VAL M 58 ? O VAL G 58 N LEU M 65 ? N LEU G 65 
H 1 2 O ASP O 31 ? O ASP H 31 N PRO O 5  ? N PRO H 5  
H 2 3 O LYS O 6  ? O LYS H 6  N GLU O 59 ? N GLU H 59 
H 3 4 O VAL O 58 ? O VAL H 58 N LEU O 65 ? N LEU H 65 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
GTA Author ? ? ? ? 11 'GLUTATHIONE BINDING SITE.'             
HTA Author ? ? ? ? 8  'ELECTROPHILIC SUBSTRATE BINDING SITE.' 
GTB Author ? ? ? ? 11 'GLUTATHIONE BINDING SITE.'             
HTB Author ? ? ? ? 8  'ELECTROPHILIC SUBSTRATE BINDING SITE.' 
GTC Author ? ? ? ? 11 'GLUTATHIONE BINDING SITE.'             
HTC Author ? ? ? ? 8  'ELECTROPHILIC SUBSTRATE BINDING SITE.' 
GTD Author ? ? ? ? 11 'GLUTATHIONE BINDING SITE.'             
HTD Author ? ? ? ? 8  'ELECTROPHILIC SUBSTRATE BINDING SITE.' 
GTE Author ? ? ? ? 11 'GLUTATHIONE BINDING SITE.'             
HTE Author ? ? ? ? 8  'ELECTROPHILIC SUBSTRATE BINDING SITE.' 
GTF Author ? ? ? ? 11 'GLUTATHIONE BINDING SITE.'             
HTF Author ? ? ? ? 1  'ELECTROPHILIC SUBSTRATE BINDING SITE.' 
GTG Author ? ? ? ? 11 'GLUTATHIONE BINDING SITE.'             
HTG Author ? ? ? ? 8  'ELECTROPHILIC SUBSTRATE BINDING SITE.' 
GTH Author ? ? ? ? 11 'GLUTATHIONE BINDING SITE.'             
HTH Author ? ? ? ? 8  'ELECTROPHILIC SUBSTRATE BINDING SITE.' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   GTA 11 TYR A 9   ? TYR A 9   . ? 1_555 ? 
2   GTA 11 ARG A 15  ? ARG A 15  . ? 1_555 ? 
3   GTA 11 LEU A 41  ? LEU A 41  . ? 1_555 ? 
4   GTA 11 GLN A 45  ? GLN A 45  . ? 1_555 ? 
5   GTA 11 GLN A 54  ? GLN A 54  . ? 1_555 ? 
6   GTA 11 VAL A 55  ? VAL A 55  . ? 1_555 ? 
7   GTA 11 GLN A 67  ? GLN A 67  . ? 1_555 ? 
8   GTA 11 THR A 68  ? THR A 68  . ? 1_555 ? 
9   GTA 11 ASP A 101 ? ASP A 101 . ? 1_555 ? 
10  GTA 11 ARG A 131 ? ARG A 131 . ? 1_555 ? 
11  GTA 11 PHE A 220 ? PHE A 220 . ? 1_555 ? 
12  HTA 8  GLY A 14  ? GLY A 14  . ? 1_555 ? 
13  HTA 8  GLU A 104 ? GLU A 104 . ? 1_555 ? 
14  HTA 8  ILE A 107 ? ILE A 107 . ? 1_555 ? 
15  HTA 8  MET A 108 ? MET A 108 . ? 1_555 ? 
16  HTA 8  PHE A 111 ? PHE A 111 . ? 1_555 ? 
17  HTA 8  TYR A 212 ? TYR A 212 . ? 1_555 ? 
18  HTA 8  VAL A 216 ? VAL A 216 . ? 1_555 ? 
19  HTA 8  TYR A 217 ? TYR A 217 . ? 1_555 ? 
20  GTB 11 TYR C 9   ? TYR B 9   . ? 1_555 ? 
21  GTB 11 ARG C 15  ? ARG B 15  . ? 1_555 ? 
22  GTB 11 LEU C 41  ? LEU B 41  . ? 1_555 ? 
23  GTB 11 GLN C 45  ? GLN B 45  . ? 1_555 ? 
24  GTB 11 GLN C 54  ? GLN B 54  . ? 1_555 ? 
25  GTB 11 VAL C 55  ? VAL B 55  . ? 1_555 ? 
26  GTB 11 GLN C 67  ? GLN B 67  . ? 1_555 ? 
27  GTB 11 THR C 68  ? THR B 68  . ? 1_555 ? 
28  GTB 11 ASP C 101 ? ASP B 101 . ? 1_555 ? 
29  GTB 11 ARG C 131 ? ARG B 131 . ? 1_555 ? 
30  GTB 11 PHE C 220 ? PHE B 220 . ? 1_555 ? 
31  HTB 8  GLY C 14  ? GLY B 14  . ? 1_555 ? 
32  HTB 8  GLU C 104 ? GLU B 104 . ? 1_555 ? 
33  HTB 8  ILE C 107 ? ILE B 107 . ? 1_555 ? 
34  HTB 8  MET C 108 ? MET B 108 . ? 1_555 ? 
35  HTB 8  PHE C 111 ? PHE B 111 . ? 1_555 ? 
36  HTB 8  TYR C 212 ? TYR B 212 . ? 1_555 ? 
37  HTB 8  VAL C 216 ? VAL B 216 . ? 1_555 ? 
38  HTB 8  TYR C 217 ? TYR B 217 . ? 1_555 ? 
39  GTC 11 TYR E 9   ? TYR C 9   . ? 1_555 ? 
40  GTC 11 ARG E 15  ? ARG C 15  . ? 1_555 ? 
41  GTC 11 LEU E 41  ? LEU C 41  . ? 1_555 ? 
42  GTC 11 GLN E 45  ? GLN C 45  . ? 1_555 ? 
43  GTC 11 GLN E 54  ? GLN C 54  . ? 1_555 ? 
44  GTC 11 VAL E 55  ? VAL C 55  . ? 1_555 ? 
45  GTC 11 GLN E 67  ? GLN C 67  . ? 1_555 ? 
46  GTC 11 THR E 68  ? THR C 68  . ? 1_555 ? 
47  GTC 11 ASP E 101 ? ASP C 101 . ? 1_555 ? 
48  GTC 11 ARG E 131 ? ARG C 131 . ? 1_555 ? 
49  GTC 11 PHE E 220 ? PHE C 220 . ? 1_555 ? 
50  HTC 8  GLY E 14  ? GLY C 14  . ? 1_555 ? 
51  HTC 8  GLU E 104 ? GLU C 104 . ? 1_555 ? 
52  HTC 8  ILE E 107 ? ILE C 107 . ? 1_555 ? 
53  HTC 8  MET E 108 ? MET C 108 . ? 1_555 ? 
54  HTC 8  PHE E 111 ? PHE C 111 . ? 1_555 ? 
55  HTC 8  TYR E 212 ? TYR C 212 . ? 1_555 ? 
56  HTC 8  VAL E 216 ? VAL C 216 . ? 1_555 ? 
57  HTC 8  TYR E 217 ? TYR C 217 . ? 1_555 ? 
58  GTD 11 TYR G 9   ? TYR D 9   . ? 1_555 ? 
59  GTD 11 ARG G 15  ? ARG D 15  . ? 1_555 ? 
60  GTD 11 LEU G 41  ? LEU D 41  . ? 1_555 ? 
61  GTD 11 GLN G 45  ? GLN D 45  . ? 1_555 ? 
62  GTD 11 GLN G 54  ? GLN D 54  . ? 1_555 ? 
63  GTD 11 VAL G 55  ? VAL D 55  . ? 1_555 ? 
64  GTD 11 GLN G 67  ? GLN D 67  . ? 1_555 ? 
65  GTD 11 THR G 68  ? THR D 68  . ? 1_555 ? 
66  GTD 11 ASP G 101 ? ASP D 101 . ? 1_555 ? 
67  GTD 11 ARG G 131 ? ARG D 131 . ? 1_555 ? 
68  GTD 11 PHE G 220 ? PHE D 220 . ? 1_555 ? 
69  HTD 8  GLY G 14  ? GLY D 14  . ? 1_555 ? 
70  HTD 8  GLU G 104 ? GLU D 104 . ? 1_555 ? 
71  HTD 8  ILE G 107 ? ILE D 107 . ? 1_555 ? 
72  HTD 8  MET G 108 ? MET D 108 . ? 1_555 ? 
73  HTD 8  PHE G 111 ? PHE D 111 . ? 1_555 ? 
74  HTD 8  TYR G 212 ? TYR D 212 . ? 1_555 ? 
75  HTD 8  VAL G 216 ? VAL D 216 . ? 1_555 ? 
76  HTD 8  TYR G 217 ? TYR D 217 . ? 1_555 ? 
77  GTE 11 TYR I 9   ? TYR E 9   . ? 1_555 ? 
78  GTE 11 ARG I 15  ? ARG E 15  . ? 1_555 ? 
79  GTE 11 LEU I 41  ? LEU E 41  . ? 1_555 ? 
80  GTE 11 GLN I 45  ? GLN E 45  . ? 1_555 ? 
81  GTE 11 GLN I 54  ? GLN E 54  . ? 1_555 ? 
82  GTE 11 VAL I 55  ? VAL E 55  . ? 1_555 ? 
83  GTE 11 GLN I 67  ? GLN E 67  . ? 1_555 ? 
84  GTE 11 THR I 68  ? THR E 68  . ? 1_555 ? 
85  GTE 11 ASP I 101 ? ASP E 101 . ? 1_555 ? 
86  GTE 11 ARG I 131 ? ARG E 131 . ? 1_555 ? 
87  GTE 11 PHE I 220 ? PHE E 220 . ? 1_555 ? 
88  HTE 8  GLY I 14  ? GLY E 14  . ? 1_555 ? 
89  HTE 8  GLU I 104 ? GLU E 104 . ? 1_555 ? 
90  HTE 8  ILE I 107 ? ILE E 107 . ? 1_555 ? 
91  HTE 8  MET I 108 ? MET E 108 . ? 1_555 ? 
92  HTE 8  PHE I 111 ? PHE E 111 . ? 1_555 ? 
93  HTE 8  TYR I 212 ? TYR E 212 . ? 1_555 ? 
94  HTE 8  VAL I 216 ? VAL E 216 . ? 1_555 ? 
95  HTE 8  TYR I 217 ? TYR E 217 . ? 1_555 ? 
96  GTF 11 TYR K 9   ? TYR F 9   . ? 1_555 ? 
97  GTF 11 ARG K 15  ? ARG F 15  . ? 1_555 ? 
98  GTF 11 LEU K 41  ? LEU F 41  . ? 1_555 ? 
99  GTF 11 GLN K 45  ? GLN F 45  . ? 1_555 ? 
100 GTF 11 GLN K 54  ? GLN F 54  . ? 1_555 ? 
101 GTF 11 VAL K 55  ? VAL F 55  . ? 1_555 ? 
102 GTF 11 GLN K 67  ? GLN F 67  . ? 1_555 ? 
103 GTF 11 THR K 68  ? THR F 68  . ? 1_555 ? 
104 GTF 11 ASP K 101 ? ASP F 101 . ? 1_555 ? 
105 GTF 11 ARG K 131 ? ARG F 131 . ? 1_555 ? 
106 GTF 11 PHE K 220 ? PHE F 220 . ? 1_555 ? 
107 HTF 1  GLY K 14  ? GLY F 14  . ? 1_555 ? 
108 GTG 11 TYR M 9   ? TYR G 9   . ? 1_555 ? 
109 GTG 11 ARG M 15  ? ARG G 15  . ? 1_555 ? 
110 GTG 11 LEU M 41  ? LEU G 41  . ? 1_555 ? 
111 GTG 11 GLN M 45  ? GLN G 45  . ? 1_555 ? 
112 GTG 11 GLN M 54  ? GLN G 54  . ? 1_555 ? 
113 GTG 11 VAL M 55  ? VAL G 55  . ? 1_555 ? 
114 GTG 11 GLN M 67  ? GLN G 67  . ? 1_555 ? 
115 GTG 11 THR M 68  ? THR G 68  . ? 1_555 ? 
116 GTG 11 ASP M 101 ? ASP G 101 . ? 1_555 ? 
117 GTG 11 ARG M 131 ? ARG G 131 . ? 1_555 ? 
118 GTG 11 PHE M 220 ? PHE G 220 . ? 1_555 ? 
119 HTG 8  GLY M 14  ? GLY G 14  . ? 1_555 ? 
120 HTG 8  GLU M 104 ? GLU G 104 . ? 1_555 ? 
121 HTG 8  ILE M 107 ? ILE G 107 . ? 1_555 ? 
122 HTG 8  MET M 108 ? MET G 108 . ? 1_555 ? 
123 HTG 8  PHE M 111 ? PHE G 111 . ? 1_555 ? 
124 HTG 8  TYR M 212 ? TYR G 212 . ? 1_555 ? 
125 HTG 8  VAL M 216 ? VAL G 216 . ? 1_555 ? 
126 HTG 8  TYR M 217 ? TYR G 217 . ? 1_555 ? 
127 GTH 11 TYR O 9   ? TYR H 9   . ? 1_555 ? 
128 GTH 11 ARG O 15  ? ARG H 15  . ? 1_555 ? 
129 GTH 11 LEU O 41  ? LEU H 41  . ? 1_555 ? 
130 GTH 11 GLN O 45  ? GLN H 45  . ? 1_555 ? 
131 GTH 11 GLN O 54  ? GLN H 54  . ? 1_555 ? 
132 GTH 11 VAL O 55  ? VAL H 55  . ? 1_555 ? 
133 GTH 11 GLN O 67  ? GLN H 67  . ? 1_555 ? 
134 GTH 11 THR O 68  ? THR H 68  . ? 1_555 ? 
135 GTH 11 ASP O 101 ? ASP H 101 . ? 1_555 ? 
136 GTH 11 ARG O 131 ? ARG H 131 . ? 1_555 ? 
137 GTH 11 PHE O 220 ? PHE H 220 . ? 1_555 ? 
138 HTH 8  GLY O 14  ? GLY H 14  . ? 1_555 ? 
139 HTH 8  GLU O 104 ? GLU H 104 . ? 1_555 ? 
140 HTH 8  ILE O 107 ? ILE H 107 . ? 1_555 ? 
141 HTH 8  MET O 108 ? MET H 108 . ? 1_555 ? 
142 HTH 8  PHE O 111 ? PHE H 111 . ? 1_555 ? 
143 HTH 8  TYR O 212 ? TYR H 212 . ? 1_555 ? 
144 HTH 8  VAL O 216 ? VAL H 216 . ? 1_555 ? 
145 HTH 8  TYR O 217 ? TYR H 217 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1GUL 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1GUL 
_atom_sites.fract_transf_matrix[1][1]   0.006439 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006406 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009872 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
I 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . ARG A 1 4   ? -2.081  -25.676 -47.813 1.00 32.33  ? 4    ARG A N   1 
ATOM   2     C CA  . ARG A 1 4   ? -0.871  -26.502 -48.035 1.00 27.54  ? 4    ARG A CA  1 
ATOM   3     C C   . ARG A 1 4   ? 0.342   -25.615 -48.402 1.00 35.94  ? 4    ARG A C   1 
ATOM   4     O O   . ARG A 1 4   ? 0.336   -24.918 -49.424 1.00 45.21  ? 4    ARG A O   1 
ATOM   5     C CB  . ARG A 1 4   ? -1.254  -27.531 -49.099 1.00 27.89  ? 4    ARG A CB  1 
ATOM   6     C CG  . ARG A 1 4   ? -0.290  -28.578 -49.651 1.00 16.86  ? 4    ARG A CG  1 
ATOM   7     C CD  . ARG A 1 4   ? -1.046  -29.737 -50.400 1.00 21.30  ? 4    ARG A CD  1 
ATOM   8     N NE  . ARG A 1 4   ? -0.134  -30.804 -50.850 1.00 55.57  ? 4    ARG A NE  1 
ATOM   9     C CZ  . ARG A 1 4   ? -0.388  -32.089 -51.140 1.00 124.64 ? 4    ARG A CZ  1 
ATOM   10    N NH1 . ARG A 1 4   ? -1.614  -32.617 -51.076 1.00 187.32 ? 4    ARG A NH1 1 
ATOM   11    N NH2 . ARG A 1 4   ? 0.654   -32.855 -51.519 1.00 64.09  ? 4    ARG A NH2 1 
ATOM   12    N N   . PRO A 1 5   ? 1.400   -25.625 -47.562 1.00 19.55  ? 5    PRO A N   1 
ATOM   13    C CA  . PRO A 1 5   ? 2.537   -24.771 -47.795 1.00 10.62  ? 5    PRO A CA  1 
ATOM   14    C C   . PRO A 1 5   ? 3.188   -24.963 -49.088 1.00 13.02  ? 5    PRO A C   1 
ATOM   15    O O   . PRO A 1 5   ? 3.263   -26.080 -49.628 1.00 17.31  ? 5    PRO A O   1 
ATOM   16    C CB  . PRO A 1 5   ? 3.510   -25.054 -46.692 1.00 13.08  ? 5    PRO A CB  1 
ATOM   17    C CG  . PRO A 1 5   ? 2.667   -25.602 -45.562 1.00 14.67  ? 5    PRO A CG  1 
ATOM   18    C CD  . PRO A 1 5   ? 1.565   -26.335 -46.266 1.00 15.20  ? 5    PRO A CD  1 
ATOM   19    N N   . LYS A 1 6   ? 3.680   -23.830 -49.541 1.00 10.63  ? 6    LYS A N   1 
ATOM   20    C CA  . LYS A 1 6   ? 4.354   -23.795 -50.797 1.00 12.09  ? 6    LYS A CA  1 
ATOM   21    C C   . LYS A 1 6   ? 5.740   -23.232 -50.614 1.00 19.24  ? 6    LYS A C   1 
ATOM   22    O O   . LYS A 1 6   ? 5.963   -22.143 -50.083 1.00 23.36  ? 6    LYS A O   1 
ATOM   23    C CB  . LYS A 1 6   ? 3.544   -23.056 -51.824 1.00 12.50  ? 6    LYS A CB  1 
ATOM   24    C CG  . LYS A 1 6   ? 4.084   -23.186 -53.234 1.00 5.59   ? 6    LYS A CG  1 
ATOM   25    C CD  . LYS A 1 6   ? 3.156   -22.610 -54.281 1.00 22.77  ? 6    LYS A CD  1 
ATOM   26    C CE  . LYS A 1 6   ? 2.351   -23.649 -55.067 1.00 101.78 ? 6    LYS A CE  1 
ATOM   27    N NZ  . LYS A 1 6   ? 2.371   -23.445 -56.534 1.00 121.13 ? 6    LYS A NZ  1 
ATOM   28    N N   . LEU A 1 7   ? 6.652   -24.051 -51.058 1.00 10.70  ? 7    LEU A N   1 
ATOM   29    C CA  . LEU A 1 7   ? 8.045   -23.805 -50.964 1.00 7.75   ? 7    LEU A CA  1 
ATOM   30    C C   . LEU A 1 7   ? 8.670   -23.308 -52.221 1.00 15.45  ? 7    LEU A C   1 
ATOM   31    O O   . LEU A 1 7   ? 8.729   -24.026 -53.227 1.00 17.71  ? 7    LEU A O   1 
ATOM   32    C CB  . LEU A 1 7   ? 8.781   -25.102 -50.557 1.00 7.11   ? 7    LEU A CB  1 
ATOM   33    C CG  . LEU A 1 7   ? 8.735   -25.291 -49.045 1.00 7.44   ? 7    LEU A CG  1 
ATOM   34    C CD1 . LEU A 1 7   ? 7.305   -25.389 -48.544 1.00 1.06   ? 7    LEU A CD1 1 
ATOM   35    C CD2 . LEU A 1 7   ? 9.508   -26.492 -48.651 1.00 1.92   ? 7    LEU A CD2 1 
ATOM   36    N N   . HIS A 1 8   ? 9.285   -22.131 -52.100 1.00 10.78  ? 8    HIS A N   1 
ATOM   37    C CA  . HIS A 1 8   ? 9.990   -21.568 -53.232 1.00 10.93  ? 8    HIS A CA  1 
ATOM   38    C C   . HIS A 1 8   ? 11.447  -21.757 -53.121 1.00 15.06  ? 8    HIS A C   1 
ATOM   39    O O   . HIS A 1 8   ? 12.050  -21.225 -52.231 1.00 21.54  ? 8    HIS A O   1 
ATOM   40    C CB  . HIS A 1 8   ? 9.707   -20.082 -53.374 1.00 12.77  ? 8    HIS A CB  1 
ATOM   41    C CG  . HIS A 1 8   ? 8.246   -19.899 -53.629 1.00 12.97  ? 8    HIS A CG  1 
ATOM   42    N ND1 . HIS A 1 8   ? 7.750   -19.841 -54.934 1.00 9.21   ? 8    HIS A ND1 1 
ATOM   43    C CD2 . HIS A 1 8   ? 7.198   -19.840 -52.745 1.00 10.18  ? 8    HIS A CD2 1 
ATOM   44    C CE1 . HIS A 1 8   ? 6.433   -19.751 -54.803 1.00 4.88   ? 8    HIS A CE1 1 
ATOM   45    N NE2 . HIS A 1 8   ? 6.052   -19.747 -53.517 1.00 6.80   ? 8    HIS A NE2 1 
ATOM   46    N N   . TYR A 1 9   ? 12.017  -22.438 -54.067 1.00 14.76  ? 9    TYR A N   1 
ATOM   47    C CA  . TYR A 1 9   ? 13.420  -22.657 -54.012 1.00 9.55   ? 9    TYR A CA  1 
ATOM   48    C C   . TYR A 1 9   ? 13.751  -23.451 -55.216 1.00 13.90  ? 9    TYR A C   1 
ATOM   49    O O   . TYR A 1 9   ? 12.916  -24.079 -55.837 1.00 13.27  ? 9    TYR A O   1 
ATOM   50    C CB  . TYR A 1 9   ? 13.687  -23.571 -52.797 1.00 11.18  ? 9    TYR A CB  1 
ATOM   51    C CG  . TYR A 1 9   ? 15.071  -23.414 -52.202 1.00 11.92  ? 9    TYR A CG  1 
ATOM   52    C CD1 . TYR A 1 9   ? 15.380  -22.187 -51.635 1.00 17.29  ? 9    TYR A CD1 1 
ATOM   53    C CD2 . TYR A 1 9   ? 16.078  -24.383 -52.220 1.00 10.61  ? 9    TYR A CD2 1 
ATOM   54    C CE1 . TYR A 1 9   ? 16.619  -21.933 -51.061 1.00 8.41   ? 9    TYR A CE1 1 
ATOM   55    C CE2 . TYR A 1 9   ? 17.353  -24.145 -51.686 1.00 10.47  ? 9    TYR A CE2 1 
ATOM   56    C CZ  . TYR A 1 9   ? 17.609  -22.899 -51.106 1.00 8.46   ? 9    TYR A CZ  1 
ATOM   57    O OH  . TYR A 1 9   ? 18.784  -22.531 -50.529 1.00 9.58   ? 9    TYR A OH  1 
ATOM   58    N N   . PRO A 1 10  ? 15.008  -23.464 -55.489 1.00 12.04  ? 10   PRO A N   1 
ATOM   59    C CA  . PRO A 1 10  ? 15.547  -24.281 -56.518 1.00 6.12   ? 10   PRO A CA  1 
ATOM   60    C C   . PRO A 1 10  ? 15.261  -25.698 -56.125 1.00 17.79  ? 10   PRO A C   1 
ATOM   61    O O   . PRO A 1 10  ? 14.919  -25.994 -54.987 1.00 18.65  ? 10   PRO A O   1 
ATOM   62    C CB  . PRO A 1 10  ? 17.067  -24.111 -56.428 1.00 1.52   ? 10   PRO A CB  1 
ATOM   63    C CG  . PRO A 1 10  ? 17.314  -22.794 -55.728 1.00 1.37   ? 10   PRO A CG  1 
ATOM   64    C CD  . PRO A 1 10  ? 15.988  -22.459 -55.018 1.00 9.85   ? 10   PRO A CD  1 
ATOM   65    N N   . ASN A 1 11  ? 15.379  -26.593 -57.086 1.00 22.88  ? 11   ASN A N   1 
ATOM   66    C CA  . ASN A 1 11  ? 15.108  -27.971 -56.745 1.00 21.68  ? 11   ASN A CA  1 
ATOM   67    C C   . ASN A 1 11  ? 16.336  -28.663 -56.226 1.00 28.06  ? 11   ASN A C   1 
ATOM   68    O O   . ASN A 1 11  ? 17.036  -29.330 -57.000 1.00 29.83  ? 11   ASN A O   1 
ATOM   69    C CB  . ASN A 1 11  ? 14.576  -28.762 -57.930 1.00 27.41  ? 11   ASN A CB  1 
ATOM   70    C CG  . ASN A 1 11  ? 14.314  -30.218 -57.614 1.00 30.38  ? 11   ASN A CG  1 
ATOM   71    O OD1 . ASN A 1 11  ? 14.504  -30.751 -56.507 1.00 49.73  ? 11   ASN A OD1 1 
ATOM   72    N ND2 . ASN A 1 11  ? 13.790  -30.861 -58.599 1.00 31.51  ? 11   ASN A ND2 1 
ATOM   73    N N   . GLY A 1 12  ? 16.585  -28.514 -54.916 1.00 23.11  ? 12   GLY A N   1 
ATOM   74    C CA  . GLY A 1 12  ? 17.757  -29.083 -54.277 1.00 15.19  ? 12   GLY A CA  1 
ATOM   75    C C   . GLY A 1 12  ? 17.670  -28.737 -52.840 1.00 17.86  ? 12   GLY A C   1 
ATOM   76    O O   . GLY A 1 12  ? 16.745  -28.039 -52.425 1.00 19.68  ? 12   GLY A O   1 
ATOM   77    N N   . ARG A 1 13  ? 18.649  -29.199 -52.102 1.00 14.04  ? 13   ARG A N   1 
ATOM   78    C CA  . ARG A 1 13  ? 18.653  -29.020 -50.671 1.00 12.54  ? 13   ARG A CA  1 
ATOM   79    C C   . ARG A 1 13  ? 18.778  -27.588 -50.187 1.00 9.16   ? 13   ARG A C   1 
ATOM   80    O O   . ARG A 1 13  ? 17.877  -27.036 -49.522 1.00 15.29  ? 13   ARG A O   1 
ATOM   81    C CB  . ARG A 1 13  ? 19.740  -29.911 -50.036 1.00 7.69   ? 13   ARG A CB  1 
ATOM   82    C CG  . ARG A 1 13  ? 19.438  -31.385 -49.939 1.00 1.00   ? 13   ARG A CG  1 
ATOM   83    C CD  . ARG A 1 13  ? 20.587  -32.280 -49.477 1.00 1.00   ? 13   ARG A CD  1 
ATOM   84    N NE  . ARG A 1 13  ? 20.240  -33.702 -49.405 1.00 19.00  ? 13   ARG A NE  1 
ATOM   85    C CZ  . ARG A 1 13  ? 21.016  -34.687 -48.968 1.00 12.92  ? 13   ARG A CZ  1 
ATOM   86    N NH1 . ARG A 1 13  ? 22.212  -34.473 -48.481 1.00 18.59  ? 13   ARG A NH1 1 
ATOM   87    N NH2 . ARG A 1 13  ? 20.574  -35.927 -49.020 1.00 20.60  ? 13   ARG A NH2 1 
ATOM   88    N N   . GLY A 1 14  ? 19.989  -27.089 -50.406 1.00 1.00   ? 14   GLY A N   1 
ATOM   89    C CA  . GLY A 1 14  ? 20.419  -25.776 -49.994 1.00 1.00   ? 14   GLY A CA  1 
ATOM   90    C C   . GLY A 1 14  ? 20.001  -25.537 -48.591 1.00 9.54   ? 14   GLY A C   1 
ATOM   91    O O   . GLY A 1 14  ? 20.098  -26.450 -47.732 1.00 9.47   ? 14   GLY A O   1 
ATOM   92    N N   . ARG A 1 15  ? 19.450  -24.343 -48.388 1.00 9.02   ? 15   ARG A N   1 
ATOM   93    C CA  . ARG A 1 15  ? 18.959  -23.984 -47.084 1.00 5.35   ? 15   ARG A CA  1 
ATOM   94    C C   . ARG A 1 15  ? 17.547  -24.441 -46.788 1.00 14.90  ? 15   ARG A C   1 
ATOM   95    O O   . ARG A 1 15  ? 17.178  -24.479 -45.606 1.00 20.18  ? 15   ARG A O   1 
ATOM   96    C CB  . ARG A 1 15  ? 19.010  -22.516 -46.938 1.00 3.97   ? 15   ARG A CB  1 
ATOM   97    C CG  . ARG A 1 15  ? 20.382  -21.980 -47.170 1.00 5.24   ? 15   ARG A CG  1 
ATOM   98    C CD  . ARG A 1 15  ? 20.451  -20.502 -46.860 1.00 3.67   ? 15   ARG A CD  1 
ATOM   99    N NE  . ARG A 1 15  ? 21.795  -20.047 -47.162 1.00 14.51  ? 15   ARG A NE  1 
ATOM   100   C CZ  . ARG A 1 15  ? 22.708  -20.352 -46.261 1.00 9.50   ? 15   ARG A CZ  1 
ATOM   101   N NH1 . ARG A 1 15  ? 22.353  -20.995 -45.176 1.00 22.97  ? 15   ARG A NH1 1 
ATOM   102   N NH2 . ARG A 1 15  ? 23.963  -20.045 -46.438 1.00 12.46  ? 15   ARG A NH2 1 
ATOM   103   N N   . MET A 1 16  ? 16.804  -24.801 -47.836 1.00 6.25   ? 16   MET A N   1 
ATOM   104   C CA  . MET A 1 16  ? 15.400  -25.202 -47.692 1.00 7.96   ? 16   MET A CA  1 
ATOM   105   C C   . MET A 1 16  ? 15.143  -26.563 -47.051 1.00 16.37  ? 16   MET A C   1 
ATOM   106   O O   . MET A 1 16  ? 14.073  -26.865 -46.451 1.00 16.90  ? 16   MET A O   1 
ATOM   107   C CB  . MET A 1 16  ? 14.711  -25.007 -49.062 1.00 7.02   ? 16   MET A CB  1 
ATOM   108   C CG  . MET A 1 16  ? 13.263  -25.282 -49.040 1.00 7.94   ? 16   MET A CG  1 
ATOM   109   S SD  . MET A 1 16  ? 12.248  -24.087 -48.163 1.00 11.15  ? 16   MET A SD  1 
ATOM   110   C CE  . MET A 1 16  ? 12.069  -22.887 -49.438 1.00 5.61   ? 16   MET A CE  1 
ATOM   111   N N   . GLU A 1 17  ? 16.169  -27.389 -47.157 1.00 4.20   ? 17   GLU A N   1 
ATOM   112   C CA  . GLU A 1 17  ? 16.023  -28.719 -46.660 1.00 1.00   ? 17   GLU A CA  1 
ATOM   113   C C   . GLU A 1 17  ? 15.584  -28.854 -45.236 1.00 5.23   ? 17   GLU A C   1 
ATOM   114   O O   . GLU A 1 17  ? 14.824  -29.739 -44.876 1.00 11.87  ? 17   GLU A O   1 
ATOM   115   C CB  . GLU A 1 17  ? 17.230  -29.534 -47.016 1.00 1.00   ? 17   GLU A CB  1 
ATOM   116   C CG  . GLU A 1 17  ? 16.949  -31.049 -47.069 1.00 19.56  ? 17   GLU A CG  1 
ATOM   117   C CD  . GLU A 1 17  ? 16.240  -31.575 -48.282 1.00 7.78   ? 17   GLU A CD  1 
ATOM   118   O OE1 . GLU A 1 17  ? 15.844  -30.899 -49.199 1.00 31.51  ? 17   GLU A OE1 1 
ATOM   119   O OE2 . GLU A 1 17  ? 15.999  -32.856 -48.190 1.00 9.61   ? 17   GLU A OE2 1 
ATOM   120   N N   . SER A 1 18  ? 16.043  -27.962 -44.415 1.00 1.00   ? 18   SER A N   1 
ATOM   121   C CA  . SER A 1 18  ? 15.664  -28.015 -43.028 1.00 1.00   ? 18   SER A CA  1 
ATOM   122   C C   . SER A 1 18  ? 14.192  -27.857 -42.887 1.00 6.76   ? 18   SER A C   1 
ATOM   123   O O   . SER A 1 18  ? 13.495  -28.561 -42.143 1.00 9.68   ? 18   SER A O   1 
ATOM   124   C CB  . SER A 1 18  ? 16.452  -27.078 -42.148 1.00 1.00   ? 18   SER A CB  1 
ATOM   125   O OG  . SER A 1 18  ? 17.784  -27.071 -42.596 1.00 13.54  ? 18   SER A OG  1 
ATOM   126   N N   . VAL A 1 19  ? 13.691  -26.982 -43.702 1.00 7.37   ? 19   VAL A N   1 
ATOM   127   C CA  . VAL A 1 19  ? 12.261  -26.743 -43.733 1.00 8.08   ? 19   VAL A CA  1 
ATOM   128   C C   . VAL A 1 19  ? 11.514  -27.966 -44.203 1.00 9.25   ? 19   VAL A C   1 
ATOM   129   O O   . VAL A 1 19  ? 10.486  -28.310 -43.652 1.00 6.66   ? 19   VAL A O   1 
ATOM   130   C CB  . VAL A 1 19  ? 11.954  -25.633 -44.696 1.00 8.51   ? 19   VAL A CB  1 
ATOM   131   C CG1 . VAL A 1 19  ? 10.477  -25.374 -44.554 1.00 10.56  ? 19   VAL A CG1 1 
ATOM   132   C CG2 . VAL A 1 19  ? 12.731  -24.393 -44.292 1.00 1.00   ? 19   VAL A CG2 1 
ATOM   133   N N   . ARG A 1 20  ? 12.046  -28.623 -45.234 1.00 5.49   ? 20   ARG A N   1 
ATOM   134   C CA  . ARG A 1 20  ? 11.387  -29.858 -45.621 1.00 3.46   ? 20   ARG A CA  1 
ATOM   135   C C   . ARG A 1 20  ? 11.413  -30.814 -44.458 1.00 10.61  ? 20   ARG A C   1 
ATOM   136   O O   . ARG A 1 20  ? 10.381  -31.331 -44.083 1.00 13.96  ? 20   ARG A O   1 
ATOM   137   C CB  . ARG A 1 20  ? 11.976  -30.526 -46.828 1.00 1.00   ? 20   ARG A CB  1 
ATOM   138   C CG  . ARG A 1 20  ? 11.981  -29.521 -47.999 1.00 3.22   ? 20   ARG A CG  1 
ATOM   139   C CD  . ARG A 1 20  ? 12.791  -30.021 -49.211 1.00 7.99   ? 20   ARG A CD  1 
ATOM   140   N NE  . ARG A 1 20  ? 12.882  -29.069 -50.340 1.00 7.20   ? 20   ARG A NE  1 
ATOM   141   C CZ  . ARG A 1 20  ? 13.984  -28.478 -50.792 1.00 10.41  ? 20   ARG A CZ  1 
ATOM   142   N NH1 . ARG A 1 20  ? 15.143  -28.696 -50.211 1.00 15.20  ? 20   ARG A NH1 1 
ATOM   143   N NH2 . ARG A 1 20  ? 13.925  -27.618 -51.824 1.00 6.11   ? 20   ARG A NH2 1 
ATOM   144   N N   . TRP A 1 21  ? 12.565  -31.005 -43.849 1.00 7.37   ? 21   TRP A N   1 
ATOM   145   C CA  . TRP A 1 21  ? 12.614  -31.917 -42.730 1.00 7.08   ? 21   TRP A CA  1 
ATOM   146   C C   . TRP A 1 21  ? 11.589  -31.655 -41.683 1.00 15.16  ? 21   TRP A C   1 
ATOM   147   O O   . TRP A 1 21  ? 10.909  -32.548 -41.276 1.00 17.62  ? 21   TRP A O   1 
ATOM   148   C CB  . TRP A 1 21  ? 13.941  -31.827 -42.017 1.00 6.41   ? 21   TRP A CB  1 
ATOM   149   C CG  . TRP A 1 21  ? 14.899  -32.762 -42.596 1.00 10.05  ? 21   TRP A CG  1 
ATOM   150   C CD1 . TRP A 1 21  ? 15.762  -32.509 -43.599 1.00 13.65  ? 21   TRP A CD1 1 
ATOM   151   C CD2 . TRP A 1 21  ? 15.100  -34.122 -42.212 1.00 9.28   ? 21   TRP A CD2 1 
ATOM   152   N NE1 . TRP A 1 21  ? 16.521  -33.634 -43.863 1.00 8.11   ? 21   TRP A NE1 1 
ATOM   153   C CE2 . TRP A 1 21  ? 16.103  -34.646 -43.051 1.00 7.93   ? 21   TRP A CE2 1 
ATOM   154   C CE3 . TRP A 1 21  ? 14.541  -34.928 -41.220 1.00 8.18   ? 21   TRP A CE3 1 
ATOM   155   C CZ2 . TRP A 1 21  ? 16.556  -35.952 -42.911 1.00 5.43   ? 21   TRP A CZ2 1 
ATOM   156   C CZ3 . TRP A 1 21  ? 14.997  -36.198 -41.074 1.00 8.67   ? 21   TRP A CZ3 1 
ATOM   157   C CH2 . TRP A 1 21  ? 15.984  -36.709 -41.935 1.00 9.78   ? 21   TRP A CH2 1 
ATOM   158   N N   . VAL A 1 22  ? 11.446  -30.405 -41.310 1.00 13.45  ? 22   VAL A N   1 
ATOM   159   C CA  . VAL A 1 22  ? 10.546  -30.093 -40.252 1.00 9.94   ? 22   VAL A CA  1 
ATOM   160   C C   . VAL A 1 22  ? 9.134   -30.321 -40.611 1.00 12.54  ? 22   VAL A C   1 
ATOM   161   O O   . VAL A 1 22  ? 8.380   -30.876 -39.843 1.00 13.70  ? 22   VAL A O   1 
ATOM   162   C CB  . VAL A 1 22  ? 10.704  -28.663 -39.793 1.00 15.10  ? 22   VAL A CB  1 
ATOM   163   C CG1 . VAL A 1 22  ? 9.775   -28.446 -38.631 1.00 9.55   ? 22   VAL A CG1 1 
ATOM   164   C CG2 . VAL A 1 22  ? 12.101  -28.495 -39.224 1.00 16.50  ? 22   VAL A CG2 1 
ATOM   165   N N   . LEU A 1 23  ? 8.767   -29.817 -41.764 1.00 5.24   ? 23   LEU A N   1 
ATOM   166   C CA  . LEU A 1 23  ? 7.418   -30.005 -42.237 1.00 3.88   ? 23   LEU A CA  1 
ATOM   167   C C   . LEU A 1 23  ? 7.082   -31.473 -42.235 1.00 12.19  ? 23   LEU A C   1 
ATOM   168   O O   . LEU A 1 23  ? 6.121   -31.870 -41.609 1.00 12.38  ? 23   LEU A O   1 
ATOM   169   C CB  . LEU A 1 23  ? 7.270   -29.417 -43.643 1.00 3.09   ? 23   LEU A CB  1 
ATOM   170   C CG  . LEU A 1 23  ? 7.093   -27.902 -43.553 1.00 4.80   ? 23   LEU A CG  1 
ATOM   171   C CD1 . LEU A 1 23  ? 7.079   -27.320 -44.917 1.00 3.57   ? 23   LEU A CD1 1 
ATOM   172   C CD2 . LEU A 1 23  ? 5.734   -27.591 -42.974 1.00 2.17   ? 23   LEU A CD2 1 
ATOM   173   N N   . ALA A 1 24  ? 7.941   -32.268 -42.898 1.00 8.67   ? 24   ALA A N   1 
ATOM   174   C CA  . ALA A 1 24  ? 7.771   -33.726 -42.984 1.00 3.94   ? 24   ALA A CA  1 
ATOM   175   C C   . ALA A 1 24  ? 7.634   -34.348 -41.640 1.00 13.81  ? 24   ALA A C   1 
ATOM   176   O O   . ALA A 1 24  ? 6.760   -35.137 -41.424 1.00 20.36  ? 24   ALA A O   1 
ATOM   177   C CB  . ALA A 1 24  ? 8.850   -34.433 -43.747 1.00 1.00   ? 24   ALA A CB  1 
ATOM   178   N N   . ALA A 1 25  ? 8.524   -34.003 -40.759 1.00 13.24  ? 25   ALA A N   1 
ATOM   179   C CA  . ALA A 1 25  ? 8.471   -34.571 -39.449 1.00 9.76   ? 25   ALA A CA  1 
ATOM   180   C C   . ALA A 1 25  ? 7.188   -34.279 -38.752 1.00 16.53  ? 25   ALA A C   1 
ATOM   181   O O   . ALA A 1 25  ? 6.663   -35.104 -38.050 1.00 21.49  ? 25   ALA A O   1 
ATOM   182   C CB  . ALA A 1 25  ? 9.620   -34.123 -38.583 1.00 5.49   ? 25   ALA A CB  1 
ATOM   183   N N   . ALA A 1 26  ? 6.714   -33.065 -38.916 1.00 22.51  ? 26   ALA A N   1 
ATOM   184   C CA  . ALA A 1 26  ? 5.485   -32.601 -38.274 1.00 14.60  ? 26   ALA A CA  1 
ATOM   185   C C   . ALA A 1 26  ? 4.278   -33.218 -38.945 1.00 22.33  ? 26   ALA A C   1 
ATOM   186   O O   . ALA A 1 26  ? 3.149   -32.994 -38.593 1.00 28.32  ? 26   ALA A O   1 
ATOM   187   C CB  . ALA A 1 26  ? 5.425   -31.086 -38.320 1.00 8.69   ? 26   ALA A CB  1 
ATOM   188   N N   . GLY A 1 27  ? 4.543   -34.006 -39.941 1.00 20.41  ? 27   GLY A N   1 
ATOM   189   C CA  . GLY A 1 27  ? 3.512   -34.656 -40.681 1.00 17.35  ? 27   GLY A CA  1 
ATOM   190   C C   . GLY A 1 27  ? 2.766   -33.771 -41.661 1.00 24.13  ? 27   GLY A C   1 
ATOM   191   O O   . GLY A 1 27  ? 1.699   -34.155 -42.147 1.00 32.49  ? 27   GLY A O   1 
ATOM   192   N N   . VAL A 1 28  ? 3.322   -32.611 -41.998 1.00 17.82  ? 28   VAL A N   1 
ATOM   193   C CA  . VAL A 1 28  ? 2.672   -31.677 -42.919 1.00 8.87   ? 28   VAL A CA  1 
ATOM   194   C C   . VAL A 1 28  ? 3.059   -31.857 -44.368 1.00 18.14  ? 28   VAL A C   1 
ATOM   195   O O   . VAL A 1 28  ? 4.240   -31.959 -44.672 1.00 22.20  ? 28   VAL A O   1 
ATOM   196   C CB  . VAL A 1 28  ? 3.044   -30.295 -42.475 1.00 7.68   ? 28   VAL A CB  1 
ATOM   197   C CG1 . VAL A 1 28  ? 2.458   -29.278 -43.412 1.00 6.16   ? 28   VAL A CG1 1 
ATOM   198   C CG2 . VAL A 1 28  ? 2.626   -30.084 -41.033 1.00 1.00   ? 28   VAL A CG2 1 
ATOM   199   N N   . GLU A 1 29  ? 2.037   -31.939 -45.250 1.00 26.80  ? 29   GLU A N   1 
ATOM   200   C CA  . GLU A 1 29  ? 2.244   -32.101 -46.695 1.00 28.31  ? 29   GLU A CA  1 
ATOM   201   C C   . GLU A 1 29  ? 2.406   -30.727 -47.292 1.00 30.20  ? 29   GLU A C   1 
ATOM   202   O O   . GLU A 1 29  ? 1.800   -29.774 -46.789 1.00 38.03  ? 29   GLU A O   1 
ATOM   203   C CB  . GLU A 1 29  ? 1.125   -32.889 -47.422 1.00 32.26  ? 29   GLU A CB  1 
ATOM   204   C CG  . GLU A 1 29  ? 1.333   -34.421 -47.567 1.00 67.57  ? 29   GLU A CG  1 
ATOM   205   C CD  . GLU A 1 29  ? 0.192   -35.148 -48.243 1.00 160.28 ? 29   GLU A CD  1 
ATOM   206   O OE1 . GLU A 1 29  ? -0.879  -35.363 -47.704 1.00 195.37 ? 29   GLU A OE1 1 
ATOM   207   O OE2 . GLU A 1 29  ? 0.520   -35.533 -49.460 1.00 192.75 ? 29   GLU A OE2 1 
ATOM   208   N N   . PHE A 1 30  ? 3.214   -30.611 -48.349 1.00 13.23  ? 30   PHE A N   1 
ATOM   209   C CA  . PHE A 1 30  ? 3.386   -29.289 -48.865 1.00 8.69   ? 30   PHE A CA  1 
ATOM   210   C C   . PHE A 1 30  ? 3.753   -29.340 -50.283 1.00 14.26  ? 30   PHE A C   1 
ATOM   211   O O   . PHE A 1 30  ? 4.075   -30.408 -50.817 1.00 9.97   ? 30   PHE A O   1 
ATOM   212   C CB  . PHE A 1 30  ? 4.535   -28.602 -48.141 1.00 11.39  ? 30   PHE A CB  1 
ATOM   213   C CG  . PHE A 1 30  ? 5.841   -29.421 -48.174 1.00 9.08   ? 30   PHE A CG  1 
ATOM   214   C CD1 . PHE A 1 30  ? 6.741   -29.341 -49.236 1.00 8.84   ? 30   PHE A CD1 1 
ATOM   215   C CD2 . PHE A 1 30  ? 6.247   -30.224 -47.104 1.00 6.88   ? 30   PHE A CD2 1 
ATOM   216   C CE1 . PHE A 1 30  ? 7.956   -30.038 -49.266 1.00 5.28   ? 30   PHE A CE1 1 
ATOM   217   C CE2 . PHE A 1 30  ? 7.458   -30.935 -47.108 1.00 5.71   ? 30   PHE A CE2 1 
ATOM   218   C CZ  . PHE A 1 30  ? 8.319   -30.874 -48.208 1.00 1.00   ? 30   PHE A CZ  1 
ATOM   219   N N   . ASP A 1 31  ? 3.727   -28.163 -50.890 1.00 13.28  ? 31   ASP A N   1 
ATOM   220   C CA  . ASP A 1 31  ? 4.076   -28.136 -52.275 1.00 12.08  ? 31   ASP A CA  1 
ATOM   221   C C   . ASP A 1 31  ? 5.359   -27.416 -52.466 1.00 13.87  ? 31   ASP A C   1 
ATOM   222   O O   . ASP A 1 31  ? 5.838   -26.765 -51.567 1.00 21.44  ? 31   ASP A O   1 
ATOM   223   C CB  . ASP A 1 31  ? 2.964   -27.617 -53.218 1.00 15.48  ? 31   ASP A CB  1 
ATOM   224   C CG  . ASP A 1 31  ? 1.562   -28.089 -52.895 1.00 27.68  ? 31   ASP A CG  1 
ATOM   225   O OD1 . ASP A 1 31  ? 1.259   -29.260 -52.966 1.00 37.42  ? 31   ASP A OD1 1 
ATOM   226   O OD2 . ASP A 1 31  ? 0.719   -27.122 -52.529 1.00 34.74  ? 31   ASP A OD2 1 
ATOM   227   N N   . GLU A 1 32  ? 5.881   -27.535 -53.666 1.00 4.84   ? 32   GLU A N   1 
ATOM   228   C CA  . GLU A 1 32  ? 7.098   -26.897 -54.020 1.00 9.08   ? 32   GLU A CA  1 
ATOM   229   C C   . GLU A 1 32  ? 7.017   -26.200 -55.379 1.00 23.83  ? 32   GLU A C   1 
ATOM   230   O O   . GLU A 1 32  ? 6.509   -26.754 -56.314 1.00 34.10  ? 32   GLU A O   1 
ATOM   231   C CB  . GLU A 1 32  ? 8.263   -27.926 -54.078 1.00 10.48  ? 32   GLU A CB  1 
ATOM   232   C CG  . GLU A 1 32  ? 8.541   -28.647 -52.732 1.00 10.37  ? 32   GLU A CG  1 
ATOM   233   C CD  . GLU A 1 32  ? 9.839   -29.396 -52.773 1.00 18.46  ? 32   GLU A CD  1 
ATOM   234   O OE1 . GLU A 1 32  ? 9.951   -30.438 -53.376 1.00 28.62  ? 32   GLU A OE1 1 
ATOM   235   O OE2 . GLU A 1 32  ? 10.866  -28.692 -52.333 1.00 29.96  ? 32   GLU A OE2 1 
ATOM   236   N N   . GLU A 1 33  ? 7.599   -25.014 -55.508 1.00 17.07  ? 33   GLU A N   1 
ATOM   237   C CA  . GLU A 1 33  ? 7.642   -24.312 -56.737 1.00 10.34  ? 33   GLU A CA  1 
ATOM   238   C C   . GLU A 1 33  ? 9.073   -24.006 -57.074 1.00 14.02  ? 33   GLU A C   1 
ATOM   239   O O   . GLU A 1 33  ? 9.690   -23.096 -56.550 1.00 19.01  ? 33   GLU A O   1 
ATOM   240   C CB  . GLU A 1 33  ? 6.870   -23.041 -56.588 1.00 13.07  ? 33   GLU A CB  1 
ATOM   241   C CG  . GLU A 1 33  ? 6.545   -22.529 -58.000 1.00 25.16  ? 33   GLU A CG  1 
ATOM   242   C CD  . GLU A 1 33  ? 5.758   -21.255 -58.041 1.00 75.56  ? 33   GLU A CD  1 
ATOM   243   O OE1 . GLU A 1 33  ? 4.556   -21.221 -57.746 1.00 47.37  ? 33   GLU A OE1 1 
ATOM   244   O OE2 . GLU A 1 33  ? 6.495   -20.229 -58.484 1.00 39.17  ? 33   GLU A OE2 1 
ATOM   245   N N   . PHE A 1 34  ? 9.630   -24.800 -57.953 1.00 7.61   ? 34   PHE A N   1 
ATOM   246   C CA  . PHE A 1 34  ? 11.033  -24.664 -58.211 1.00 8.79   ? 34   PHE A CA  1 
ATOM   247   C C   . PHE A 1 34  ? 11.584  -23.555 -59.001 1.00 19.39  ? 34   PHE A C   1 
ATOM   248   O O   . PHE A 1 34  ? 11.138  -23.293 -60.091 1.00 24.13  ? 34   PHE A O   1 
ATOM   249   C CB  . PHE A 1 34  ? 11.582  -25.930 -58.815 1.00 10.39  ? 34   PHE A CB  1 
ATOM   250   C CG  . PHE A 1 34  ? 11.407  -27.051 -57.858 1.00 17.68  ? 34   PHE A CG  1 
ATOM   251   C CD1 . PHE A 1 34  ? 11.856  -26.906 -56.547 1.00 28.34  ? 34   PHE A CD1 1 
ATOM   252   C CD2 . PHE A 1 34  ? 10.791  -28.241 -58.238 1.00 16.81  ? 34   PHE A CD2 1 
ATOM   253   C CE1 . PHE A 1 34  ? 11.654  -27.932 -55.630 1.00 31.51  ? 34   PHE A CE1 1 
ATOM   254   C CE2 . PHE A 1 34  ? 10.579  -29.271 -57.327 1.00 16.09  ? 34   PHE A CE2 1 
ATOM   255   C CZ  . PHE A 1 34  ? 11.029  -29.116 -56.022 1.00 21.33  ? 34   PHE A CZ  1 
ATOM   256   N N   . LEU A 1 35  ? 12.681  -23.008 -58.514 1.00 17.76  ? 35   LEU A N   1 
ATOM   257   C CA  . LEU A 1 35  ? 13.353  -22.041 -59.337 1.00 10.55  ? 35   LEU A CA  1 
ATOM   258   C C   . LEU A 1 35  ? 14.367  -22.754 -60.186 1.00 19.28  ? 35   LEU A C   1 
ATOM   259   O O   . LEU A 1 35  ? 15.089  -23.622 -59.701 1.00 29.56  ? 35   LEU A O   1 
ATOM   260   C CB  . LEU A 1 35  ? 14.026  -20.861 -58.634 1.00 7.52   ? 35   LEU A CB  1 
ATOM   261   C CG  . LEU A 1 35  ? 13.071  -20.123 -57.720 1.00 13.89  ? 35   LEU A CG  1 
ATOM   262   C CD1 . LEU A 1 35  ? 13.827  -19.314 -56.683 1.00 9.47   ? 35   LEU A CD1 1 
ATOM   263   C CD2 . LEU A 1 35  ? 12.289  -19.163 -58.529 1.00 11.29  ? 35   LEU A CD2 1 
ATOM   264   N N   . GLU A 1 36  ? 14.363  -22.379 -61.475 1.00 21.93  ? 36   GLU A N   1 
ATOM   265   C CA  . GLU A 1 36  ? 15.292  -22.869 -62.483 1.00 23.68  ? 36   GLU A CA  1 
ATOM   266   C C   . GLU A 1 36  ? 16.176  -21.842 -63.171 1.00 31.22  ? 36   GLU A C   1 
ATOM   267   O O   . GLU A 1 36  ? 17.248  -22.225 -63.663 1.00 34.30  ? 36   GLU A O   1 
ATOM   268   C CB  . GLU A 1 36  ? 14.700  -23.866 -63.485 1.00 26.56  ? 36   GLU A CB  1 
ATOM   269   C CG  . GLU A 1 36  ? 13.793  -24.959 -62.860 1.00 46.80  ? 36   GLU A CG  1 
ATOM   270   C CD  . GLU A 1 36  ? 12.932  -25.694 -63.844 1.00 144.65 ? 36   GLU A CD  1 
ATOM   271   O OE1 . GLU A 1 36  ? 13.305  -26.060 -64.922 1.00 197.15 ? 36   GLU A OE1 1 
ATOM   272   O OE2 . GLU A 1 36  ? 11.718  -25.849 -63.396 1.00 116.08 ? 36   GLU A OE2 1 
ATOM   273   N N   . THR A 1 37  ? 15.751  -20.560 -63.169 1.00 31.21  ? 37   THR A N   1 
ATOM   274   C CA  . THR A 1 37  ? 16.434  -19.438 -63.824 1.00 29.82  ? 37   THR A CA  1 
ATOM   275   C C   . THR A 1 37  ? 16.396  -18.110 -63.070 1.00 35.09  ? 37   THR A C   1 
ATOM   276   O O   . THR A 1 37  ? 15.487  -17.846 -62.242 1.00 28.14  ? 37   THR A O   1 
ATOM   277   C CB  . THR A 1 37  ? 15.620  -19.132 -65.088 1.00 43.33  ? 37   THR A CB  1 
ATOM   278   O OG1 . THR A 1 37  ? 14.459  -18.380 -64.752 1.00 54.39  ? 37   THR A OG1 1 
ATOM   279   C CG2 . THR A 1 37  ? 15.187  -20.409 -65.753 1.00 18.64  ? 37   THR A CG2 1 
ATOM   280   N N   . LYS A 1 38  ? 17.317  -17.216 -63.504 1.00 29.25  ? 38   LYS A N   1 
ATOM   281   C CA  . LYS A 1 38  ? 17.368  -15.861 -62.934 1.00 27.02  ? 38   LYS A CA  1 
ATOM   282   C C   . LYS A 1 38  ? 15.990  -15.227 -63.031 1.00 32.21  ? 38   LYS A C   1 
ATOM   283   O O   . LYS A 1 38  ? 15.375  -14.669 -62.081 1.00 38.46  ? 38   LYS A O   1 
ATOM   284   C CB  . LYS A 1 38  ? 18.375  -14.950 -63.649 1.00 26.43  ? 38   LYS A CB  1 
ATOM   285   C CG  . LYS A 1 38  ? 19.319  -14.139 -62.743 1.00 60.64  ? 38   LYS A CG  1 
ATOM   286   C CD  . LYS A 1 38  ? 20.758  -14.680 -62.604 1.00 131.05 ? 38   LYS A CD  1 
ATOM   287   C CE  . LYS A 1 38  ? 21.696  -13.833 -61.721 1.00 170.26 ? 38   LYS A CE  1 
ATOM   288   N NZ  . LYS A 1 38  ? 23.125  -14.240 -61.727 1.00 174.30 ? 38   LYS A NZ  1 
ATOM   289   N N   . GLU A 1 39  ? 15.478  -15.386 -64.207 1.00 27.67  ? 39   GLU A N   1 
ATOM   290   C CA  . GLU A 1 39  ? 14.209  -14.832 -64.557 1.00 31.08  ? 39   GLU A CA  1 
ATOM   291   C C   . GLU A 1 39  ? 13.065  -15.216 -63.666 1.00 30.03  ? 39   GLU A C   1 
ATOM   292   O O   . GLU A 1 39  ? 12.292  -14.352 -63.211 1.00 35.32  ? 39   GLU A O   1 
ATOM   293   C CB  . GLU A 1 39  ? 13.925  -14.954 -66.050 1.00 37.81  ? 39   GLU A CB  1 
ATOM   294   C CG  . GLU A 1 39  ? 12.736  -14.090 -66.501 1.00 79.19  ? 39   GLU A CG  1 
ATOM   295   C CD  . GLU A 1 39  ? 11.758  -14.925 -67.282 1.00 193.64 ? 39   GLU A CD  1 
ATOM   296   O OE1 . GLU A 1 39  ? 11.772  -16.150 -67.294 1.00 232.66 ? 39   GLU A OE1 1 
ATOM   297   O OE2 . GLU A 1 39  ? 10.904  -14.195 -67.954 1.00 227.39 ? 39   GLU A OE2 1 
ATOM   298   N N   . GLN A 1 40  ? 12.947  -16.495 -63.359 1.00 21.77  ? 40   GLN A N   1 
ATOM   299   C CA  . GLN A 1 40  ? 11.877  -16.847 -62.441 1.00 20.26  ? 40   GLN A CA  1 
ATOM   300   C C   . GLN A 1 40  ? 12.074  -16.211 -61.085 1.00 27.16  ? 40   GLN A C   1 
ATOM   301   O O   . GLN A 1 40  ? 11.108  -15.852 -60.416 1.00 28.08  ? 40   GLN A O   1 
ATOM   302   C CB  . GLN A 1 40  ? 11.725  -18.324 -62.291 1.00 19.08  ? 40   GLN A CB  1 
ATOM   303   C CG  . GLN A 1 40  ? 11.961  -19.006 -63.626 1.00 31.96  ? 40   GLN A CG  1 
ATOM   304   C CD  . GLN A 1 40  ? 12.062  -20.488 -63.443 1.00 60.17  ? 40   GLN A CD  1 
ATOM   305   O OE1 . GLN A 1 40  ? 13.166  -21.014 -63.177 1.00 56.97  ? 40   GLN A OE1 1 
ATOM   306   N NE2 . GLN A 1 40  ? 10.891  -21.123 -63.416 1.00 30.70  ? 40   GLN A NE2 1 
ATOM   307   N N   . LEU A 1 41  ? 13.340  -16.046 -60.714 1.00 19.89  ? 41   LEU A N   1 
ATOM   308   C CA  . LEU A 1 41  ? 13.636  -15.411 -59.485 1.00 18.47  ? 41   LEU A CA  1 
ATOM   309   C C   . LEU A 1 41  ? 13.177  -13.984 -59.602 1.00 22.31  ? 41   LEU A C   1 
ATOM   310   O O   . LEU A 1 41  ? 12.425  -13.491 -58.752 1.00 20.50  ? 41   LEU A O   1 
ATOM   311   C CB  . LEU A 1 41  ? 15.119  -15.551 -59.201 1.00 19.14  ? 41   LEU A CB  1 
ATOM   312   C CG  . LEU A 1 41  ? 15.600  -14.742 -58.002 1.00 22.37  ? 41   LEU A CG  1 
ATOM   313   C CD1 . LEU A 1 41  ? 14.874  -15.110 -56.697 1.00 14.45  ? 41   LEU A CD1 1 
ATOM   314   C CD2 . LEU A 1 41  ? 17.095  -14.944 -57.859 1.00 6.97   ? 41   LEU A CD2 1 
ATOM   315   N N   . TYR A 1 42  ? 13.544  -13.336 -60.707 1.00 18.09  ? 42   TYR A N   1 
ATOM   316   C CA  . TYR A 1 42  ? 13.048  -11.963 -60.896 1.00 22.08  ? 42   TYR A CA  1 
ATOM   317   C C   . TYR A 1 42  ? 11.584  -11.795 -60.785 1.00 21.45  ? 42   TYR A C   1 
ATOM   318   O O   . TYR A 1 42  ? 11.086  -10.846 -60.207 1.00 23.96  ? 42   TYR A O   1 
ATOM   319   C CB  . TYR A 1 42  ? 13.338  -11.427 -62.240 1.00 34.68  ? 42   TYR A CB  1 
ATOM   320   C CG  . TYR A 1 42  ? 14.775  -11.048 -62.262 1.00 69.13  ? 42   TYR A CG  1 
ATOM   321   C CD1 . TYR A 1 42  ? 15.371  -10.539 -61.109 1.00 82.25  ? 42   TYR A CD1 1 
ATOM   322   C CD2 . TYR A 1 42  ? 15.559  -11.178 -63.410 1.00 76.28  ? 42   TYR A CD2 1 
ATOM   323   C CE1 . TYR A 1 42  ? 16.717  -10.159 -61.092 1.00 94.37  ? 42   TYR A CE1 1 
ATOM   324   C CE2 . TYR A 1 42  ? 16.907  -10.808 -63.408 1.00 79.12  ? 42   TYR A CE2 1 
ATOM   325   C CZ  . TYR A 1 42  ? 17.490  -10.293 -62.249 1.00 95.12  ? 42   TYR A CZ  1 
ATOM   326   O OH  . TYR A 1 42  ? 18.819  -9.912  -62.261 1.00 96.88  ? 42   TYR A OH  1 
ATOM   327   N N   . LYS A 1 43  ? 10.865  -12.711 -61.352 1.00 13.68  ? 43   LYS A N   1 
ATOM   328   C CA  . LYS A 1 43  ? 9.450   -12.514 -61.232 1.00 14.88  ? 43   LYS A CA  1 
ATOM   329   C C   . LYS A 1 43  ? 8.980   -12.601 -59.816 1.00 21.16  ? 43   LYS A C   1 
ATOM   330   O O   . LYS A 1 43  ? 8.060   -11.950 -59.350 1.00 31.70  ? 43   LYS A O   1 
ATOM   331   C CB  . LYS A 1 43  ? 8.658   -13.441 -62.151 1.00 21.00  ? 43   LYS A CB  1 
ATOM   332   C CG  . LYS A 1 43  ? 9.382   -13.624 -63.473 1.00 105.48 ? 43   LYS A CG  1 
ATOM   333   C CD  . LYS A 1 43  ? 8.883   -14.809 -64.286 1.00 165.45 ? 43   LYS A CD  1 
ATOM   334   C CE  . LYS A 1 43  ? 7.771   -14.448 -65.261 1.00 228.51 ? 43   LYS A CE  1 
ATOM   335   N NZ  . LYS A 1 43  ? 7.464   -15.526 -66.218 1.00 258.00 ? 43   LYS A NZ  1 
ATOM   336   N N   . LEU A 1 44  ? 9.630   -13.425 -59.102 1.00 13.95  ? 44   LEU A N   1 
ATOM   337   C CA  . LEU A 1 44  ? 9.211   -13.620 -57.743 1.00 12.63  ? 44   LEU A CA  1 
ATOM   338   C C   . LEU A 1 44  ? 9.479   -12.361 -56.967 1.00 15.33  ? 44   LEU A C   1 
ATOM   339   O O   . LEU A 1 44  ? 8.689   -11.863 -56.163 1.00 15.90  ? 44   LEU A O   1 
ATOM   340   C CB  . LEU A 1 44  ? 10.081  -14.803 -57.316 1.00 12.87  ? 44   LEU A CB  1 
ATOM   341   C CG  . LEU A 1 44  ? 9.568   -15.649 -56.174 1.00 16.69  ? 44   LEU A CG  1 
ATOM   342   C CD1 . LEU A 1 44  ? 8.114   -15.923 -56.308 1.00 12.70  ? 44   LEU A CD1 1 
ATOM   343   C CD2 . LEU A 1 44  ? 10.273  -16.996 -56.152 1.00 18.55  ? 44   LEU A CD2 1 
ATOM   344   N N   . GLN A 1 45  ? 10.628  -11.821 -57.299 1.00 10.39  ? 45   GLN A N   1 
ATOM   345   C CA  . GLN A 1 45  ? 11.107  -10.645 -56.662 1.00 8.91   ? 45   GLN A CA  1 
ATOM   346   C C   . GLN A 1 45  ? 10.261  -9.508  -57.042 1.00 24.32  ? 45   GLN A C   1 
ATOM   347   O O   . GLN A 1 45  ? 9.782   -8.768  -56.202 1.00 24.96  ? 45   GLN A O   1 
ATOM   348   C CB  . GLN A 1 45  ? 12.498  -10.374 -57.163 1.00 7.27   ? 45   GLN A CB  1 
ATOM   349   C CG  . GLN A 1 45  ? 13.470  -11.256 -56.429 1.00 23.17  ? 45   GLN A CG  1 
ATOM   350   C CD  . GLN A 1 45  ? 14.843  -11.057 -56.949 1.00 9.01   ? 45   GLN A CD  1 
ATOM   351   O OE1 . GLN A 1 45  ? 14.974  -10.668 -58.098 1.00 36.30  ? 45   GLN A OE1 1 
ATOM   352   N NE2 . GLN A 1 45  ? 15.854  -11.412 -56.138 1.00 19.47  ? 45   GLN A NE2 1 
ATOM   353   N N   . ASP A 1 46  ? 10.089  -9.423  -58.355 1.00 25.91  ? 46   ASP A N   1 
ATOM   354   C CA  . ASP A 1 46  ? 9.278   -8.384  -58.948 1.00 24.70  ? 46   ASP A CA  1 
ATOM   355   C C   . ASP A 1 46  ? 7.878   -8.309  -58.361 1.00 20.91  ? 46   ASP A C   1 
ATOM   356   O O   . ASP A 1 46  ? 7.346   -7.266  -58.120 1.00 23.96  ? 46   ASP A O   1 
ATOM   357   C CB  . ASP A 1 46  ? 9.186   -8.525  -60.463 1.00 28.86  ? 46   ASP A CB  1 
ATOM   358   C CG  . ASP A 1 46  ? 8.330   -7.458  -61.130 1.00 66.70  ? 46   ASP A CG  1 
ATOM   359   O OD1 . ASP A 1 46  ? 8.577   -6.270  -61.043 1.00 73.54  ? 46   ASP A OD1 1 
ATOM   360   O OD2 . ASP A 1 46  ? 7.258   -7.930  -61.758 1.00 88.27  ? 46   ASP A OD2 1 
ATOM   361   N N   . GLY A 1 47  ? 7.224   -9.409  -58.131 1.00 17.38  ? 47   GLY A N   1 
ATOM   362   C CA  . GLY A 1 47  ? 5.906   -9.281  -57.578 1.00 13.80  ? 47   GLY A CA  1 
ATOM   363   C C   . GLY A 1 47  ? 5.908   -9.018  -56.106 1.00 20.83  ? 47   GLY A C   1 
ATOM   364   O O   . GLY A 1 47  ? 4.855   -9.072  -55.478 1.00 26.10  ? 47   GLY A O   1 
ATOM   365   N N   . ASN A 1 48  ? 7.081   -8.768  -55.539 1.00 16.78  ? 48   ASN A N   1 
ATOM   366   C CA  . ASN A 1 48  ? 7.128   -8.487  -54.123 1.00 18.70  ? 48   ASN A CA  1 
ATOM   367   C C   . ASN A 1 48  ? 6.765   -9.679  -53.274 1.00 23.54  ? 48   ASN A C   1 
ATOM   368   O O   . ASN A 1 48  ? 6.074   -9.578  -52.274 1.00 28.81  ? 48   ASN A O   1 
ATOM   369   C CB  . ASN A 1 48  ? 6.337   -7.184  -53.768 1.00 19.59  ? 48   ASN A CB  1 
ATOM   370   C CG  . ASN A 1 48  ? 6.987   -6.021  -54.519 1.00 101.87 ? 48   ASN A CG  1 
ATOM   371   O OD1 . ASN A 1 48  ? 8.234   -5.929  -54.613 1.00 85.57  ? 48   ASN A OD1 1 
ATOM   372   N ND2 . ASN A 1 48  ? 6.164   -5.235  -55.218 1.00 131.65 ? 48   ASN A ND2 1 
ATOM   373   N N   . HIS A 1 49  ? 7.215   -10.845 -53.668 1.00 14.99  ? 49   HIS A N   1 
ATOM   374   C CA  . HIS A 1 49  ? 6.847   -11.956 -52.836 1.00 12.78  ? 49   HIS A CA  1 
ATOM   375   C C   . HIS A 1 49  ? 7.876   -12.315 -51.809 1.00 15.54  ? 49   HIS A C   1 
ATOM   376   O O   . HIS A 1 49  ? 7.561   -13.006 -50.864 1.00 16.83  ? 49   HIS A O   1 
ATOM   377   C CB  . HIS A 1 49  ? 6.783   -13.113 -53.732 1.00 16.79  ? 49   HIS A CB  1 
ATOM   378   C CG  . HIS A 1 49  ? 5.769   -12.884 -54.746 1.00 21.98  ? 49   HIS A CG  1 
ATOM   379   N ND1 . HIS A 1 49  ? 4.427   -12.852 -54.396 1.00 23.88  ? 49   HIS A ND1 1 
ATOM   380   C CD2 . HIS A 1 49  ? 5.894   -12.725 -56.077 1.00 25.84  ? 49   HIS A CD2 1 
ATOM   381   C CE1 . HIS A 1 49  ? 3.758   -12.708 -55.520 1.00 21.95  ? 49   HIS A CE1 1 
ATOM   382   N NE2 . HIS A 1 49  ? 4.603   -12.641 -56.547 1.00 24.18  ? 49   HIS A NE2 1 
ATOM   383   N N   . LEU A 1 50  ? 9.105   -11.882 -52.067 1.00 8.69   ? 50   LEU A N   1 
ATOM   384   C CA  . LEU A 1 50  ? 10.243  -12.093 -51.246 1.00 4.38   ? 50   LEU A CA  1 
ATOM   385   C C   . LEU A 1 50  ? 10.495  -10.850 -50.457 1.00 11.49  ? 50   LEU A C   1 
ATOM   386   O O   . LEU A 1 50  ? 11.000  -9.924  -51.017 1.00 9.66   ? 50   LEU A O   1 
ATOM   387   C CB  . LEU A 1 50  ? 11.464  -12.271 -52.153 1.00 1.64   ? 50   LEU A CB  1 
ATOM   388   C CG  . LEU A 1 50  ? 11.150  -13.361 -53.151 1.00 3.51   ? 50   LEU A CG  1 
ATOM   389   C CD1 . LEU A 1 50  ? 12.387  -13.761 -53.954 1.00 1.06   ? 50   LEU A CD1 1 
ATOM   390   C CD2 . LEU A 1 50  ? 10.477  -14.504 -52.425 1.00 1.00   ? 50   LEU A CD2 1 
ATOM   391   N N   . LEU A 1 51  ? 10.202  -10.880 -49.161 1.00 8.04   ? 51   LEU A N   1 
ATOM   392   C CA  . LEU A 1 51  ? 10.377  -9.739  -48.288 1.00 1.52   ? 51   LEU A CA  1 
ATOM   393   C C   . LEU A 1 51  ? 11.695  -9.091  -48.438 1.00 10.02  ? 51   LEU A C   1 
ATOM   394   O O   . LEU A 1 51  ? 11.776  -7.883  -48.444 1.00 21.73  ? 51   LEU A O   1 
ATOM   395   C CB  . LEU A 1 51  ? 10.177  -10.164 -46.833 1.00 1.31   ? 51   LEU A CB  1 
ATOM   396   C CG  . LEU A 1 51  ? 10.351  -9.056  -45.793 1.00 7.53   ? 51   LEU A CG  1 
ATOM   397   C CD1 . LEU A 1 51  ? 9.268   -8.009  -45.998 1.00 1.00   ? 51   LEU A CD1 1 
ATOM   398   C CD2 . LEU A 1 51  ? 10.237  -9.540  -44.337 1.00 1.00   ? 51   LEU A CD2 1 
ATOM   399   N N   . PHE A 1 52  ? 12.732  -9.907  -48.567 1.00 9.94   ? 52   PHE A N   1 
ATOM   400   C CA  . PHE A 1 52  ? 14.079  -9.362  -48.665 1.00 7.21   ? 52   PHE A CA  1 
ATOM   401   C C   . PHE A 1 52  ? 14.732  -9.776  -49.952 1.00 11.24  ? 52   PHE A C   1 
ATOM   402   O O   . PHE A 1 52  ? 15.941  -9.809  -50.024 1.00 6.58   ? 52   PHE A O   1 
ATOM   403   C CB  . PHE A 1 52  ? 15.000  -9.668  -47.466 1.00 1.00   ? 52   PHE A CB  1 
ATOM   404   C CG  . PHE A 1 52  ? 14.546  -9.068  -46.140 1.00 2.96   ? 52   PHE A CG  1 
ATOM   405   C CD1 . PHE A 1 52  ? 14.521  -7.694  -45.925 1.00 7.87   ? 52   PHE A CD1 1 
ATOM   406   C CD2 . PHE A 1 52  ? 14.157  -9.877  -45.069 1.00 6.49   ? 52   PHE A CD2 1 
ATOM   407   C CE1 . PHE A 1 52  ? 14.070  -7.136  -44.727 1.00 6.37   ? 52   PHE A CE1 1 
ATOM   408   C CE2 . PHE A 1 52  ? 13.716  -9.359  -43.853 1.00 6.34   ? 52   PHE A CE2 1 
ATOM   409   C CZ  . PHE A 1 52  ? 13.652  -7.974  -43.700 1.00 5.29   ? 52   PHE A CZ  1 
ATOM   410   N N   . GLN A 1 53  ? 13.918  -10.178 -50.918 1.00 5.74   ? 53   GLN A N   1 
ATOM   411   C CA  . GLN A 1 53  ? 14.454  -10.553 -52.201 1.00 5.09   ? 53   GLN A CA  1 
ATOM   412   C C   . GLN A 1 53  ? 15.181  -11.856 -52.247 1.00 13.57  ? 53   GLN A C   1 
ATOM   413   O O   . GLN A 1 53  ? 15.797  -12.170 -53.242 1.00 14.23  ? 53   GLN A O   1 
ATOM   414   C CB  . GLN A 1 53  ? 15.319  -9.437  -52.782 1.00 3.56   ? 53   GLN A CB  1 
ATOM   415   C CG  . GLN A 1 53  ? 14.630  -8.016  -52.793 1.00 13.24  ? 53   GLN A CG  1 
ATOM   416   C CD  . GLN A 1 53  ? 13.374  -7.900  -53.660 1.00 42.24  ? 53   GLN A CD  1 
ATOM   417   O OE1 . GLN A 1 53  ? 13.379  -7.185  -54.665 1.00 114.27 ? 53   GLN A OE1 1 
ATOM   418   N NE2 . GLN A 1 53  ? 12.298  -8.605  -53.328 1.00 50.32  ? 53   GLN A NE2 1 
ATOM   419   N N   . GLN A 1 54  ? 15.073  -12.632 -51.190 1.00 11.15  ? 54   GLN A N   1 
ATOM   420   C CA  . GLN A 1 54  ? 15.731  -13.890 -51.235 1.00 11.09  ? 54   GLN A CA  1 
ATOM   421   C C   . GLN A 1 54  ? 14.783  -14.960 -50.870 1.00 14.96  ? 54   GLN A C   1 
ATOM   422   O O   . GLN A 1 54  ? 13.713  -14.649 -50.343 1.00 10.27  ? 54   GLN A O   1 
ATOM   423   C CB  . GLN A 1 54  ? 16.681  -13.978 -50.070 1.00 9.52   ? 54   GLN A CB  1 
ATOM   424   C CG  . GLN A 1 54  ? 17.644  -12.818 -50.138 1.00 12.31  ? 54   GLN A CG  1 
ATOM   425   C CD  . GLN A 1 54  ? 18.414  -12.632 -48.868 1.00 1.00   ? 54   GLN A CD  1 
ATOM   426   O OE1 . GLN A 1 54  ? 17.864  -12.196 -47.829 1.00 45.37  ? 54   GLN A OE1 1 
ATOM   427   N NE2 . GLN A 1 54  ? 19.659  -13.075 -48.912 1.00 19.84  ? 54   GLN A NE2 1 
ATOM   428   N N   . VAL A 1 55  ? 15.259  -16.177 -51.144 1.00 10.42  ? 55   VAL A N   1 
ATOM   429   C CA  . VAL A 1 55  ? 14.678  -17.451 -50.780 1.00 9.57   ? 55   VAL A CA  1 
ATOM   430   C C   . VAL A 1 55  ? 15.681  -18.113 -49.800 1.00 14.69  ? 55   VAL A C   1 
ATOM   431   O O   . VAL A 1 55  ? 16.890  -17.823 -49.744 1.00 8.70   ? 55   VAL A O   1 
ATOM   432   C CB  . VAL A 1 55  ? 14.439  -18.378 -51.970 1.00 8.03   ? 55   VAL A CB  1 
ATOM   433   C CG1 . VAL A 1 55  ? 13.284  -17.863 -52.767 1.00 3.46   ? 55   VAL A CG1 1 
ATOM   434   C CG2 . VAL A 1 55  ? 15.673  -18.458 -52.857 1.00 4.29   ? 55   VAL A CG2 1 
ATOM   435   N N   . PRO A 1 56  ? 15.228  -19.015 -48.962 1.00 11.30  ? 56   PRO A N   1 
ATOM   436   C CA  . PRO A 1 56  ? 13.896  -19.553 -48.926 1.00 4.11   ? 56   PRO A CA  1 
ATOM   437   C C   . PRO A 1 56  ? 12.786  -18.628 -48.648 1.00 9.83   ? 56   PRO A C   1 
ATOM   438   O O   . PRO A 1 56  ? 12.859  -17.777 -47.777 1.00 19.45  ? 56   PRO A O   1 
ATOM   439   C CB  . PRO A 1 56  ? 13.926  -20.493 -47.694 1.00 1.00   ? 56   PRO A CB  1 
ATOM   440   C CG  . PRO A 1 56  ? 15.379  -20.782 -47.409 1.00 4.11   ? 56   PRO A CG  1 
ATOM   441   C CD  . PRO A 1 56  ? 16.242  -19.904 -48.295 1.00 3.84   ? 56   PRO A CD  1 
ATOM   442   N N   . MET A 1 57  ? 11.668  -18.926 -49.269 1.00 5.04   ? 57   MET A N   1 
ATOM   443   C CA  . MET A 1 57  ? 10.399  -18.270 -48.945 1.00 3.72   ? 57   MET A CA  1 
ATOM   444   C C   . MET A 1 57  ? 9.386   -19.403 -48.921 1.00 5.29   ? 57   MET A C   1 
ATOM   445   O O   . MET A 1 57  ? 9.422   -20.330 -49.727 1.00 10.86  ? 57   MET A O   1 
ATOM   446   C CB  . MET A 1 57  ? 9.931   -17.193 -49.926 1.00 5.14   ? 57   MET A CB  1 
ATOM   447   C CG  . MET A 1 57  ? 8.708   -16.507 -49.398 1.00 11.13  ? 57   MET A CG  1 
ATOM   448   S SD  . MET A 1 57  ? 7.136   -17.252 -49.881 1.00 16.68  ? 57   MET A SD  1 
ATOM   449   C CE  . MET A 1 57  ? 7.166   -16.670 -51.567 1.00 5.94   ? 57   MET A CE  1 
ATOM   450   N N   . VAL A 1 58  ? 8.525   -19.383 -47.971 1.00 2.32   ? 58   VAL A N   1 
ATOM   451   C CA  . VAL A 1 58  ? 7.519   -20.406 -47.856 1.00 2.31   ? 58   VAL A CA  1 
ATOM   452   C C   . VAL A 1 58  ? 6.192   -19.728 -47.611 1.00 12.78  ? 58   VAL A C   1 
ATOM   453   O O   . VAL A 1 58  ? 6.059   -18.830 -46.748 1.00 11.53  ? 58   VAL A O   1 
ATOM   454   C CB  . VAL A 1 58  ? 7.823   -21.242 -46.636 1.00 4.17   ? 58   VAL A CB  1 
ATOM   455   C CG1 . VAL A 1 58  ? 6.645   -22.136 -46.247 1.00 2.31   ? 58   VAL A CG1 1 
ATOM   456   C CG2 . VAL A 1 58  ? 9.038   -22.046 -46.963 1.00 5.34   ? 58   VAL A CG2 1 
ATOM   457   N N   . GLU A 1 59  ? 5.227   -20.152 -48.399 1.00 12.32  ? 59   GLU A N   1 
ATOM   458   C CA  . GLU A 1 59  ? 3.909   -19.591 -48.238 1.00 10.70  ? 59   GLU A CA  1 
ATOM   459   C C   . GLU A 1 59  ? 3.114   -20.478 -47.380 1.00 17.16  ? 59   GLU A C   1 
ATOM   460   O O   . GLU A 1 59  ? 2.797   -21.595 -47.758 1.00 22.45  ? 59   GLU A O   1 
ATOM   461   C CB  . GLU A 1 59  ? 3.110   -19.472 -49.496 1.00 9.62   ? 59   GLU A CB  1 
ATOM   462   C CG  . GLU A 1 59  ? 3.810   -18.765 -50.656 1.00 29.96  ? 59   GLU A CG  1 
ATOM   463   C CD  . GLU A 1 59  ? 2.846   -18.547 -51.814 1.00 5.94   ? 59   GLU A CD  1 
ATOM   464   O OE1 . GLU A 1 59  ? 1.786   -17.932 -51.695 1.00 138.83 ? 59   GLU A OE1 1 
ATOM   465   O OE2 . GLU A 1 59  ? 3.264   -19.121 -52.925 1.00 37.35  ? 59   GLU A OE2 1 
ATOM   466   N N   . ILE A 1 60  ? 2.778   -19.943 -46.250 1.00 10.44  ? 60   ILE A N   1 
ATOM   467   C CA  . ILE A 1 60  ? 2.055   -20.706 -45.302 1.00 7.52   ? 60   ILE A CA  1 
ATOM   468   C C   . ILE A 1 60  ? 1.142   -19.840 -44.449 1.00 12.99  ? 60   ILE A C   1 
ATOM   469   O O   . ILE A 1 60  ? 1.466   -18.729 -44.030 1.00 18.91  ? 60   ILE A O   1 
ATOM   470   C CB  . ILE A 1 60  ? 3.125   -21.280 -44.405 1.00 13.20  ? 60   ILE A CB  1 
ATOM   471   C CG1 . ILE A 1 60  ? 2.471   -22.122 -43.365 1.00 13.74  ? 60   ILE A CG1 1 
ATOM   472   C CG2 . ILE A 1 60  ? 3.862   -20.132 -43.707 1.00 13.67  ? 60   ILE A CG2 1 
ATOM   473   C CD1 . ILE A 1 60  ? 3.449   -23.012 -42.624 1.00 4.78   ? 60   ILE A CD1 1 
ATOM   474   N N   . ASP A 1 61  ? -0.024  -20.374 -44.182 1.00 13.05  ? 61   ASP A N   1 
ATOM   475   C CA  . ASP A 1 61  ? -1.022  -19.701 -43.345 1.00 8.47   ? 61   ASP A CA  1 
ATOM   476   C C   . ASP A 1 61  ? -1.285  -18.299 -43.757 1.00 16.67  ? 61   ASP A C   1 
ATOM   477   O O   . ASP A 1 61  ? -1.491  -17.394 -42.931 1.00 22.10  ? 61   ASP A O   1 
ATOM   478   C CB  . ASP A 1 61  ? -0.760  -19.828 -41.850 1.00 7.69   ? 61   ASP A CB  1 
ATOM   479   C CG  . ASP A 1 61  ? -0.870  -21.274 -41.499 1.00 29.36  ? 61   ASP A CG  1 
ATOM   480   O OD1 . ASP A 1 61  ? -1.272  -22.136 -42.293 1.00 47.71  ? 61   ASP A OD1 1 
ATOM   481   O OD2 . ASP A 1 61  ? -0.232  -21.538 -40.400 1.00 16.19  ? 61   ASP A OD2 1 
ATOM   482   N N   . GLY A 1 62  ? -1.256  -18.168 -45.072 1.00 16.28  ? 62   GLY A N   1 
ATOM   483   C CA  . GLY A 1 62  ? -1.500  -16.902 -45.724 1.00 16.33  ? 62   GLY A CA  1 
ATOM   484   C C   . GLY A 1 62  ? -0.360  -15.919 -45.710 1.00 27.86  ? 62   GLY A C   1 
ATOM   485   O O   . GLY A 1 62  ? -0.562  -14.781 -46.119 1.00 31.80  ? 62   GLY A O   1 
ATOM   486   N N   . MET A 1 63  ? 0.828   -16.345 -45.243 1.00 21.31  ? 63   MET A N   1 
ATOM   487   C CA  . MET A 1 63  ? 1.950   -15.468 -45.212 1.00 10.03  ? 63   MET A CA  1 
ATOM   488   C C   . MET A 1 63  ? 2.984   -15.982 -46.167 1.00 19.03  ? 63   MET A C   1 
ATOM   489   O O   . MET A 1 63  ? 2.902   -17.138 -46.603 1.00 21.46  ? 63   MET A O   1 
ATOM   490   C CB  . MET A 1 63  ? 2.526   -15.480 -43.812 1.00 9.48   ? 63   MET A CB  1 
ATOM   491   C CG  . MET A 1 63  ? 1.524   -15.061 -42.752 1.00 9.21   ? 63   MET A CG  1 
ATOM   492   S SD  . MET A 1 63  ? 1.815   -15.862 -41.172 1.00 21.16  ? 63   MET A SD  1 
ATOM   493   C CE  . MET A 1 63  ? 2.523   -14.492 -40.194 1.00 25.93  ? 63   MET A CE  1 
ATOM   494   N N   . LYS A 1 64  ? 3.940   -15.111 -46.450 1.00 11.90  ? 64   LYS A N   1 
ATOM   495   C CA  . LYS A 1 64  ? 5.067   -15.463 -47.235 1.00 11.35  ? 64   LYS A CA  1 
ATOM   496   C C   . LYS A 1 64  ? 6.285   -15.292 -46.350 1.00 16.18  ? 64   LYS A C   1 
ATOM   497   O O   . LYS A 1 64  ? 6.946   -14.266 -46.350 1.00 16.69  ? 64   LYS A O   1 
ATOM   498   C CB  . LYS A 1 64  ? 5.186   -14.584 -48.444 1.00 14.15  ? 64   LYS A CB  1 
ATOM   499   C CG  . LYS A 1 64  ? 3.934   -14.657 -49.284 1.00 5.89   ? 64   LYS A CG  1 
ATOM   500   C CD  . LYS A 1 64  ? 4.026   -13.838 -50.575 1.00 21.21  ? 64   LYS A CD  1 
ATOM   501   C CE  . LYS A 1 64  ? 2.778   -13.813 -51.505 1.00 17.64  ? 64   LYS A CE  1 
ATOM   502   N NZ  . LYS A 1 64  ? 2.579   -12.502 -52.220 1.00 57.04  ? 64   LYS A NZ  1 
ATOM   503   N N   . LEU A 1 65  ? 6.581   -16.289 -45.586 1.00 7.70   ? 65   LEU A N   1 
ATOM   504   C CA  . LEU A 1 65  ? 7.708   -16.194 -44.732 1.00 4.37   ? 65   LEU A CA  1 
ATOM   505   C C   . LEU A 1 65  ? 8.962   -16.455 -45.474 1.00 6.56   ? 65   LEU A C   1 
ATOM   506   O O   . LEU A 1 65  ? 8.963   -17.279 -46.380 1.00 12.20  ? 65   LEU A O   1 
ATOM   507   C CB  . LEU A 1 65  ? 7.603   -17.245 -43.649 1.00 6.69   ? 65   LEU A CB  1 
ATOM   508   C CG  . LEU A 1 65  ? 6.251   -17.216 -42.951 1.00 7.55   ? 65   LEU A CG  1 
ATOM   509   C CD1 . LEU A 1 65  ? 6.287   -18.135 -41.788 1.00 1.00   ? 65   LEU A CD1 1 
ATOM   510   C CD2 . LEU A 1 65  ? 5.975   -15.855 -42.379 1.00 1.40   ? 65   LEU A CD2 1 
ATOM   511   N N   . VAL A 1 66  ? 9.995   -15.734 -45.014 1.00 1.00   ? 66   VAL A N   1 
ATOM   512   C CA  . VAL A 1 66  ? 11.387  -15.703 -45.459 1.00 5.48   ? 66   VAL A CA  1 
ATOM   513   C C   . VAL A 1 66  ? 12.365  -15.831 -44.270 1.00 11.95  ? 66   VAL A C   1 
ATOM   514   O O   . VAL A 1 66  ? 11.982  -15.657 -43.126 1.00 3.67   ? 66   VAL A O   1 
ATOM   515   C CB  . VAL A 1 66  ? 11.707  -14.496 -46.345 1.00 9.76   ? 66   VAL A CB  1 
ATOM   516   C CG1 . VAL A 1 66  ? 10.702  -14.447 -47.478 1.00 15.83  ? 66   VAL A CG1 1 
ATOM   517   C CG2 . VAL A 1 66  ? 11.615  -13.206 -45.571 1.00 1.21   ? 66   VAL A CG2 1 
ATOM   518   N N   . GLN A 1 67  ? 13.642  -16.177 -44.528 1.00 11.12  ? 67   GLN A N   1 
ATOM   519   C CA  . GLN A 1 67  ? 14.634  -16.404 -43.468 1.00 3.11   ? 67   GLN A CA  1 
ATOM   520   C C   . GLN A 1 67  ? 14.393  -17.741 -42.891 1.00 10.31  ? 67   GLN A C   1 
ATOM   521   O O   . GLN A 1 67  ? 13.422  -17.946 -42.140 1.00 11.82  ? 67   GLN A O   1 
ATOM   522   C CB  . GLN A 1 67  ? 14.588  -15.374 -42.325 1.00 1.00   ? 67   GLN A CB  1 
ATOM   523   C CG  . GLN A 1 67  ? 14.879  -13.967 -42.880 1.00 1.00   ? 67   GLN A CG  1 
ATOM   524   C CD  . GLN A 1 67  ? 16.356  -13.753 -43.196 1.00 2.40   ? 67   GLN A CD  1 
ATOM   525   O OE1 . GLN A 1 67  ? 17.202  -14.514 -42.670 1.00 19.99  ? 67   GLN A OE1 1 
ATOM   526   N NE2 . GLN A 1 67  ? 16.663  -12.760 -44.053 1.00 14.45  ? 67   GLN A NE2 1 
ATOM   527   N N   . THR A 1 68  ? 15.276  -18.628 -43.262 1.00 7.66   ? 68   THR A N   1 
ATOM   528   C CA  . THR A 1 68  ? 15.193  -20.004 -42.793 1.00 5.71   ? 68   THR A CA  1 
ATOM   529   C C   . THR A 1 68  ? 14.900  -20.131 -41.336 1.00 12.38  ? 68   THR A C   1 
ATOM   530   O O   . THR A 1 68  ? 13.959  -20.792 -40.967 1.00 12.68  ? 68   THR A O   1 
ATOM   531   C CB  . THR A 1 68  ? 16.521  -20.665 -43.062 1.00 4.93   ? 68   THR A CB  1 
ATOM   532   O OG1 . THR A 1 68  ? 16.851  -20.413 -44.401 1.00 9.64   ? 68   THR A OG1 1 
ATOM   533   C CG2 . THR A 1 68  ? 16.475  -22.118 -42.791 1.00 1.00   ? 68   THR A CG2 1 
ATOM   534   N N   . ARG A 1 69  ? 15.660  -19.456 -40.485 1.00 12.11  ? 69   ARG A N   1 
ATOM   535   C CA  . ARG A 1 69  ? 15.358  -19.671 -39.077 1.00 11.05  ? 69   ARG A CA  1 
ATOM   536   C C   . ARG A 1 69  ? 13.991  -19.238 -38.626 1.00 13.17  ? 69   ARG A C   1 
ATOM   537   O O   . ARG A 1 69  ? 13.392  -19.794 -37.720 1.00 15.74  ? 69   ARG A O   1 
ATOM   538   C CB  . ARG A 1 69  ? 16.332  -18.951 -38.229 1.00 2.87   ? 69   ARG A CB  1 
ATOM   539   C CG  . ARG A 1 69  ? 17.761  -19.313 -38.554 1.00 2.19   ? 69   ARG A CG  1 
ATOM   540   C CD  . ARG A 1 69  ? 18.719  -18.303 -37.930 1.00 16.62  ? 69   ARG A CD  1 
ATOM   541   N NE  . ARG A 1 69  ? 20.034  -18.835 -37.657 1.00 10.38  ? 69   ARG A NE  1 
ATOM   542   C CZ  . ARG A 1 69  ? 20.810  -19.153 -38.672 1.00 32.64  ? 69   ARG A CZ  1 
ATOM   543   N NH1 . ARG A 1 69  ? 20.358  -18.942 -39.884 1.00 27.33  ? 69   ARG A NH1 1 
ATOM   544   N NH2 . ARG A 1 69  ? 21.981  -19.776 -38.508 1.00 22.95  ? 69   ARG A NH2 1 
ATOM   545   N N   . SER A 1 70  ? 13.532  -18.174 -39.219 1.00 7.66   ? 70   SER A N   1 
ATOM   546   C CA  . SER A 1 70  ? 12.261  -17.596 -38.845 1.00 3.53   ? 70   SER A CA  1 
ATOM   547   C C   . SER A 1 70  ? 11.136  -18.504 -39.270 1.00 9.97   ? 70   SER A C   1 
ATOM   548   O O   . SER A 1 70  ? 10.177  -18.760 -38.561 1.00 14.94  ? 70   SER A O   1 
ATOM   549   C CB  . SER A 1 70  ? 12.184  -16.231 -39.454 1.00 1.00   ? 70   SER A CB  1 
ATOM   550   O OG  . SER A 1 70  ? 13.323  -15.461 -39.062 1.00 15.34  ? 70   SER A OG  1 
ATOM   551   N N   . ILE A 1 71  ? 11.356  -19.072 -40.415 1.00 4.81   ? 71   ILE A N   1 
ATOM   552   C CA  . ILE A 1 71  ? 10.437  -20.021 -40.943 1.00 3.49   ? 71   ILE A CA  1 
ATOM   553   C C   . ILE A 1 71  ? 10.353  -21.244 -40.031 1.00 9.08   ? 71   ILE A C   1 
ATOM   554   O O   . ILE A 1 71  ? 9.288   -21.696 -39.644 1.00 13.77  ? 71   ILE A O   1 
ATOM   555   C CB  . ILE A 1 71  ? 10.874  -20.469 -42.312 1.00 2.60   ? 71   ILE A CB  1 
ATOM   556   C CG1 . ILE A 1 71  ? 10.797  -19.377 -43.412 1.00 2.12   ? 71   ILE A CG1 1 
ATOM   557   C CG2 . ILE A 1 71  ? 9.902   -21.525 -42.591 1.00 1.00   ? 71   ILE A CG2 1 
ATOM   558   C CD1 . ILE A 1 71  ? 11.571  -19.747 -44.684 1.00 1.00   ? 71   ILE A CD1 1 
ATOM   559   N N   . LEU A 1 72  ? 11.493  -21.769 -39.655 1.00 6.18   ? 72   LEU A N   1 
ATOM   560   C CA  . LEU A 1 72  ? 11.567  -22.937 -38.779 1.00 4.76   ? 72   LEU A CA  1 
ATOM   561   C C   . LEU A 1 72  ? 10.913  -22.655 -37.483 1.00 4.66   ? 72   LEU A C   1 
ATOM   562   O O   . LEU A 1 72  ? 10.159  -23.450 -36.998 1.00 11.07  ? 72   LEU A O   1 
ATOM   563   C CB  . LEU A 1 72  ? 13.014  -23.379 -38.500 1.00 7.63   ? 72   LEU A CB  1 
ATOM   564   C CG  . LEU A 1 72  ? 13.767  -23.859 -39.731 1.00 3.60   ? 72   LEU A CG  1 
ATOM   565   C CD1 . LEU A 1 72  ? 15.190  -24.244 -39.383 1.00 1.00   ? 72   LEU A CD1 1 
ATOM   566   C CD2 . LEU A 1 72  ? 13.045  -25.026 -40.334 1.00 1.00   ? 72   LEU A CD2 1 
ATOM   567   N N   . HIS A 1 73  ? 11.173  -21.520 -36.885 1.00 7.74   ? 73   HIS A N   1 
ATOM   568   C CA  . HIS A 1 73  ? 10.469  -21.223 -35.617 1.00 3.88   ? 73   HIS A CA  1 
ATOM   569   C C   . HIS A 1 73  ? 8.971   -21.184 -35.809 1.00 11.84  ? 73   HIS A C   1 
ATOM   570   O O   . HIS A 1 73  ? 8.200   -21.612 -34.957 1.00 12.42  ? 73   HIS A O   1 
ATOM   571   C CB  . HIS A 1 73  ? 10.806  -19.831 -35.142 1.00 1.00   ? 73   HIS A CB  1 
ATOM   572   C CG  . HIS A 1 73  ? 12.262  -19.669 -34.906 1.00 6.41   ? 73   HIS A CG  1 
ATOM   573   N ND1 . HIS A 1 73  ? 12.907  -18.465 -34.962 1.00 9.52   ? 73   HIS A ND1 1 
ATOM   574   C CD2 . HIS A 1 73  ? 13.174  -20.583 -34.577 1.00 12.04  ? 73   HIS A CD2 1 
ATOM   575   C CE1 . HIS A 1 73  ? 14.170  -18.665 -34.684 1.00 10.29  ? 73   HIS A CE1 1 
ATOM   576   N NE2 . HIS A 1 73  ? 14.363  -19.934 -34.433 1.00 12.17  ? 73   HIS A NE2 1 
ATOM   577   N N   . TYR A 1 74  ? 8.513   -20.601 -36.912 1.00 8.27   ? 74   TYR A N   1 
ATOM   578   C CA  . TYR A 1 74  ? 7.069   -20.545 -37.070 1.00 9.83   ? 74   TYR A CA  1 
ATOM   579   C C   . TYR A 1 74  ? 6.456   -21.942 -37.056 1.00 14.80  ? 74   TYR A C   1 
ATOM   580   O O   . TYR A 1 74  ? 5.532   -22.244 -36.292 1.00 13.02  ? 74   TYR A O   1 
ATOM   581   C CB  . TYR A 1 74  ? 6.654   -19.789 -38.352 1.00 9.69   ? 74   TYR A CB  1 
ATOM   582   C CG  . TYR A 1 74  ? 5.161   -19.769 -38.576 1.00 11.22  ? 74   TYR A CG  1 
ATOM   583   C CD1 . TYR A 1 74  ? 4.331   -18.952 -37.815 1.00 11.17  ? 74   TYR A CD1 1 
ATOM   584   C CD2 . TYR A 1 74  ? 4.549   -20.556 -39.556 1.00 12.41  ? 74   TYR A CD2 1 
ATOM   585   C CE1 . TYR A 1 74  ? 2.953   -18.940 -38.030 1.00 10.74  ? 74   TYR A CE1 1 
ATOM   586   C CE2 . TYR A 1 74  ? 3.165   -20.629 -39.722 1.00 9.64   ? 74   TYR A CE2 1 
ATOM   587   C CZ  . TYR A 1 74  ? 2.352   -19.792 -38.959 1.00 19.86  ? 74   TYR A CZ  1 
ATOM   588   O OH  . TYR A 1 74  ? 0.969   -19.777 -39.132 1.00 17.49  ? 74   TYR A OH  1 
ATOM   589   N N   . ILE A 1 75  ? 7.034   -22.809 -37.879 1.00 4.94   ? 75   ILE A N   1 
ATOM   590   C CA  . ILE A 1 75  ? 6.492   -24.130 -37.955 1.00 4.38   ? 75   ILE A CA  1 
ATOM   591   C C   . ILE A 1 75  ? 6.548   -24.838 -36.645 1.00 15.50  ? 75   ILE A C   1 
ATOM   592   O O   . ILE A 1 75  ? 5.615   -25.476 -36.258 1.00 18.12  ? 75   ILE A O   1 
ATOM   593   C CB  . ILE A 1 75  ? 7.231   -24.882 -39.010 1.00 7.14   ? 75   ILE A CB  1 
ATOM   594   C CG1 . ILE A 1 75  ? 7.061   -24.123 -40.331 1.00 8.39   ? 75   ILE A CG1 1 
ATOM   595   C CG2 . ILE A 1 75  ? 6.719   -26.298 -39.111 1.00 2.67   ? 75   ILE A CG2 1 
ATOM   596   C CD1 . ILE A 1 75  ? 8.004   -24.641 -41.417 1.00 9.74   ? 75   ILE A CD1 1 
ATOM   597   N N   . ALA A 1 76  ? 7.666   -24.714 -35.965 1.00 8.97   ? 76   ALA A N   1 
ATOM   598   C CA  . ALA A 1 76  ? 7.837   -25.382 -34.711 1.00 6.89   ? 76   ALA A CA  1 
ATOM   599   C C   . ALA A 1 76  ? 6.759   -24.965 -33.766 1.00 14.31  ? 76   ALA A C   1 
ATOM   600   O O   . ALA A 1 76  ? 6.143   -25.735 -33.097 1.00 16.32  ? 76   ALA A O   1 
ATOM   601   C CB  . ALA A 1 76  ? 9.197   -25.045 -34.110 1.00 7.25   ? 76   ALA A CB  1 
ATOM   602   N N   . ASP A 1 77  ? 6.552   -23.708 -33.717 1.00 12.04  ? 77   ASP A N   1 
ATOM   603   C CA  . ASP A 1 77  ? 5.564   -23.165 -32.840 1.00 8.15   ? 77   ASP A CA  1 
ATOM   604   C C   . ASP A 1 77  ? 4.166   -23.544 -33.269 1.00 20.17  ? 77   ASP A C   1 
ATOM   605   O O   . ASP A 1 77  ? 3.278   -23.613 -32.461 1.00 27.38  ? 77   ASP A O   1 
ATOM   606   C CB  . ASP A 1 77  ? 5.716   -21.641 -32.796 1.00 1.30   ? 77   ASP A CB  1 
ATOM   607   C CG  . ASP A 1 77  ? 6.483   -21.218 -31.575 1.00 15.64  ? 77   ASP A CG  1 
ATOM   608   O OD1 . ASP A 1 77  ? 6.687   -21.964 -30.607 1.00 25.53  ? 77   ASP A OD1 1 
ATOM   609   O OD2 . ASP A 1 77  ? 6.901   -19.975 -31.662 1.00 25.03  ? 77   ASP A OD2 1 
ATOM   610   N N   . LYS A 1 78  ? 3.932   -23.768 -34.536 1.00 13.84  ? 78   LYS A N   1 
ATOM   611   C CA  . LYS A 1 78  ? 2.603   -24.204 -34.897 1.00 8.75   ? 78   LYS A CA  1 
ATOM   612   C C   . LYS A 1 78  ? 2.521   -25.701 -34.638 1.00 21.37  ? 78   LYS A C   1 
ATOM   613   O O   . LYS A 1 78  ? 1.501   -26.304 -34.841 1.00 25.64  ? 78   LYS A O   1 
ATOM   614   C CB  . LYS A 1 78  ? 2.299   -24.079 -36.405 1.00 6.78   ? 78   LYS A CB  1 
ATOM   615   C CG  . LYS A 1 78  ? 2.256   -22.666 -36.878 1.00 40.33  ? 78   LYS A CG  1 
ATOM   616   C CD  . LYS A 1 78  ? 1.399   -21.824 -35.959 1.00 42.81  ? 78   LYS A CD  1 
ATOM   617   C CE  . LYS A 1 78  ? -0.101  -21.880 -36.275 1.00 47.35  ? 78   LYS A CE  1 
ATOM   618   N NZ  . LYS A 1 78  ? -0.960  -21.299 -35.218 1.00 69.76  ? 78   LYS A NZ  1 
ATOM   619   N N   . HIS A 1 79  ? 3.603   -26.379 -34.336 1.00 16.29  ? 79   HIS A N   1 
ATOM   620   C CA  . HIS A 1 79  ? 3.408   -27.800 -34.226 1.00 10.72  ? 79   HIS A CA  1 
ATOM   621   C C   . HIS A 1 79  ? 4.003   -28.475 -33.041 1.00 14.66  ? 79   HIS A C   1 
ATOM   622   O O   . HIS A 1 79  ? 4.459   -29.602 -33.183 1.00 6.93   ? 79   HIS A O   1 
ATOM   623   C CB  . HIS A 1 79  ? 3.960   -28.511 -35.417 1.00 10.30  ? 79   HIS A CB  1 
ATOM   624   C CG  . HIS A 1 79  ? 3.127   -28.278 -36.595 1.00 20.66  ? 79   HIS A CG  1 
ATOM   625   N ND1 . HIS A 1 79  ? 3.441   -27.293 -37.502 1.00 29.24  ? 79   HIS A ND1 1 
ATOM   626   C CD2 . HIS A 1 79  ? 2.021   -28.913 -37.039 1.00 21.04  ? 79   HIS A CD2 1 
ATOM   627   C CE1 . HIS A 1 79  ? 2.532   -27.342 -38.487 1.00 23.80  ? 79   HIS A CE1 1 
ATOM   628   N NE2 . HIS A 1 79  ? 1.681   -28.307 -38.225 1.00 19.97  ? 79   HIS A NE2 1 
ATOM   629   N N   . ASN A 1 80  ? 4.031   -27.790 -31.911 1.00 17.51  ? 80   ASN A N   1 
ATOM   630   C CA  . ASN A 1 80  ? 4.620   -28.405 -30.764 1.00 17.97  ? 80   ASN A CA  1 
ATOM   631   C C   . ASN A 1 80  ? 6.027   -28.934 -30.924 1.00 23.47  ? 80   ASN A C   1 
ATOM   632   O O   . ASN A 1 80  ? 6.381   -29.981 -30.360 1.00 33.09  ? 80   ASN A O   1 
ATOM   633   C CB  . ASN A 1 80  ? 3.717   -29.509 -30.245 1.00 22.81  ? 80   ASN A CB  1 
ATOM   634   C CG  . ASN A 1 80  ? 4.031   -29.923 -28.843 1.00 56.00  ? 80   ASN A CG  1 
ATOM   635   O OD1 . ASN A 1 80  ? 4.136   -31.130 -28.603 1.00 61.63  ? 80   ASN A OD1 1 
ATOM   636   N ND2 . ASN A 1 80  ? 4.095   -28.946 -27.925 1.00 50.44  ? 80   ASN A ND2 1 
ATOM   637   N N   . LEU A 1 81  ? 6.854   -28.214 -31.654 1.00 17.49  ? 81   LEU A N   1 
ATOM   638   C CA  . LEU A 1 81  ? 8.222   -28.676 -31.776 1.00 12.09  ? 81   LEU A CA  1 
ATOM   639   C C   . LEU A 1 81  ? 9.138   -27.696 -31.102 1.00 9.79   ? 81   LEU A C   1 
ATOM   640   O O   . LEU A 1 81  ? 10.333  -27.746 -31.318 1.00 9.64   ? 81   LEU A O   1 
ATOM   641   C CB  . LEU A 1 81  ? 8.671   -28.854 -33.206 1.00 6.52   ? 81   LEU A CB  1 
ATOM   642   C CG  . LEU A 1 81  ? 7.801   -29.828 -33.940 1.00 4.24   ? 81   LEU A CG  1 
ATOM   643   C CD1 . LEU A 1 81  ? 8.076   -29.674 -35.451 1.00 2.56   ? 81   LEU A CD1 1 
ATOM   644   C CD2 . LEU A 1 81  ? 8.322   -31.186 -33.591 1.00 1.00   ? 81   LEU A CD2 1 
ATOM   645   N N   . PHE A 1 82  ? 8.565   -26.834 -30.280 1.00 7.16   ? 82   PHE A N   1 
ATOM   646   C CA  . PHE A 1 82  ? 9.360   -25.770 -29.614 1.00 7.97   ? 82   PHE A CA  1 
ATOM   647   C C   . PHE A 1 82  ? 9.342   -25.773 -28.100 1.00 16.81  ? 82   PHE A C   1 
ATOM   648   O O   . PHE A 1 82  ? 9.516   -24.740 -27.433 1.00 19.23  ? 82   PHE A O   1 
ATOM   649   C CB  . PHE A 1 82  ? 9.006   -24.360 -30.109 1.00 4.68   ? 82   PHE A CB  1 
ATOM   650   C CG  . PHE A 1 82  ? 10.200  -23.534 -30.462 1.00 9.05   ? 82   PHE A CG  1 
ATOM   651   C CD1 . PHE A 1 82  ? 11.405  -23.646 -29.752 1.00 15.06  ? 82   PHE A CD1 1 
ATOM   652   C CD2 . PHE A 1 82  ? 10.125  -22.609 -31.505 1.00 10.50  ? 82   PHE A CD2 1 
ATOM   653   C CE1 . PHE A 1 82  ? 12.533  -22.867 -30.023 1.00 9.59   ? 82   PHE A CE1 1 
ATOM   654   C CE2 . PHE A 1 82  ? 11.232  -21.807 -31.779 1.00 11.51  ? 82   PHE A CE2 1 
ATOM   655   C CZ  . PHE A 1 82  ? 12.428  -21.934 -31.056 1.00 7.34   ? 82   PHE A CZ  1 
ATOM   656   N N   . GLY A 1 83  ? 9.140   -26.954 -27.549 1.00 16.51  ? 83   GLY A N   1 
ATOM   657   C CA  . GLY A 1 83  ? 9.137   -27.046 -26.121 1.00 18.16  ? 83   GLY A CA  1 
ATOM   658   C C   . GLY A 1 83  ? 7.789   -26.727 -25.533 1.00 19.47  ? 83   GLY A C   1 
ATOM   659   O O   . GLY A 1 83  ? 6.826   -26.582 -26.280 1.00 16.68  ? 83   GLY A O   1 
ATOM   660   N N   . LYS A 1 84  ? 7.779   -26.616 -24.206 1.00 16.34  ? 84   LYS A N   1 
ATOM   661   C CA  . LYS A 1 84  ? 6.585   -26.369 -23.415 1.00 15.03  ? 84   LYS A CA  1 
ATOM   662   C C   . LYS A 1 84  ? 6.789   -25.207 -22.476 1.00 25.33  ? 84   LYS A C   1 
ATOM   663   O O   . LYS A 1 84  ? 5.879   -24.718 -21.837 1.00 23.09  ? 84   LYS A O   1 
ATOM   664   C CB  . LYS A 1 84  ? 6.015   -27.646 -22.773 1.00 10.79  ? 84   LYS A CB  1 
ATOM   665   C CG  . LYS A 1 84  ? 5.541   -28.539 -23.931 1.00 32.78  ? 84   LYS A CG  1 
ATOM   666   C CD  . LYS A 1 84  ? 4.606   -29.700 -23.601 1.00 30.09  ? 84   LYS A CD  1 
ATOM   667   C CE  . LYS A 1 84  ? 3.655   -30.135 -24.731 1.00 51.57  ? 84   LYS A CE  1 
ATOM   668   N NZ  . LYS A 1 84  ? 3.001   -31.449 -24.480 1.00 126.63 ? 84   LYS A NZ  1 
ATOM   669   N N   . ASN A 1 85  ? 7.985   -24.652 -22.518 1.00 25.00  ? 85   ASN A N   1 
ATOM   670   C CA  . ASN A 1 85  ? 8.240   -23.493 -21.708 1.00 19.70  ? 85   ASN A CA  1 
ATOM   671   C C   . ASN A 1 85  ? 9.533   -22.774 -22.095 1.00 22.04  ? 85   ASN A C   1 
ATOM   672   O O   . ASN A 1 85  ? 10.370  -23.330 -22.805 1.00 31.75  ? 85   ASN A O   1 
ATOM   673   C CB  . ASN A 1 85  ? 8.179   -23.913 -20.236 1.00 10.80  ? 85   ASN A CB  1 
ATOM   674   C CG  . ASN A 1 85  ? 9.391   -24.706 -19.834 1.00 18.33  ? 85   ASN A CG  1 
ATOM   675   O OD1 . ASN A 1 85  ? 10.543  -24.278 -19.987 1.00 71.35  ? 85   ASN A OD1 1 
ATOM   676   N ND2 . ASN A 1 85  ? 9.138   -25.929 -19.498 1.00 19.54  ? 85   ASN A ND2 1 
ATOM   677   N N   . LEU A 1 86  ? 9.728   -21.562 -21.563 1.00 13.64  ? 86   LEU A N   1 
ATOM   678   C CA  . LEU A 1 86  ? 10.903  -20.763 -21.869 1.00 7.94   ? 86   LEU A CA  1 
ATOM   679   C C   . LEU A 1 86  ? 12.206  -21.506 -21.750 1.00 14.84  ? 86   LEU A C   1 
ATOM   680   O O   . LEU A 1 86  ? 13.106  -21.398 -22.594 1.00 20.25  ? 86   LEU A O   1 
ATOM   681   C CB  . LEU A 1 86  ? 10.984  -19.492 -21.029 1.00 4.53   ? 86   LEU A CB  1 
ATOM   682   C CG  . LEU A 1 86  ? 11.994  -18.498 -21.576 1.00 10.05  ? 86   LEU A CG  1 
ATOM   683   C CD1 . LEU A 1 86  ? 11.775  -18.329 -23.048 1.00 13.10  ? 86   LEU A CD1 1 
ATOM   684   C CD2 . LEU A 1 86  ? 11.774  -17.135 -20.994 1.00 8.38   ? 86   LEU A CD2 1 
ATOM   685   N N   . LYS A 1 87  ? 12.287  -22.266 -20.681 1.00 12.86  ? 87   LYS A N   1 
ATOM   686   C CA  . LYS A 1 87  ? 13.502  -23.014 -20.405 1.00 16.47  ? 87   LYS A CA  1 
ATOM   687   C C   . LYS A 1 87  ? 13.872  -23.931 -21.514 1.00 17.63  ? 87   LYS A C   1 
ATOM   688   O O   . LYS A 1 87  ? 14.996  -23.900 -21.979 1.00 27.41  ? 87   LYS A O   1 
ATOM   689   C CB  . LYS A 1 87  ? 13.578  -23.600 -19.001 1.00 18.47  ? 87   LYS A CB  1 
ATOM   690   C CG  . LYS A 1 87  ? 13.371  -22.481 -17.963 1.00 136.90 ? 87   LYS A CG  1 
ATOM   691   C CD  . LYS A 1 87  ? 14.052  -21.135 -18.320 1.00 174.68 ? 87   LYS A CD  1 
ATOM   692   C CE  . LYS A 1 87  ? 13.595  -19.914 -17.487 1.00 151.33 ? 87   LYS A CE  1 
ATOM   693   N NZ  . LYS A 1 87  ? 14.392  -18.663 -17.653 1.00 58.97  ? 87   LYS A NZ  1 
ATOM   694   N N   . GLU A 1 88  ? 12.882  -24.684 -21.921 1.00 8.70   ? 88   GLU A N   1 
ATOM   695   C CA  . GLU A 1 88  ? 12.990  -25.618 -23.003 1.00 11.62  ? 88   GLU A CA  1 
ATOM   696   C C   . GLU A 1 88  ? 13.275  -24.924 -24.290 1.00 18.30  ? 88   GLU A C   1 
ATOM   697   O O   . GLU A 1 88  ? 14.198  -25.257 -25.025 1.00 23.26  ? 88   GLU A O   1 
ATOM   698   C CB  . GLU A 1 88  ? 11.654  -26.369 -23.163 1.00 14.39  ? 88   GLU A CB  1 
ATOM   699   C CG  . GLU A 1 88  ? 11.412  -27.326 -21.980 1.00 5.07   ? 88   GLU A CG  1 
ATOM   700   C CD  . GLU A 1 88  ? 10.236  -28.288 -22.025 1.00 21.29  ? 88   GLU A CD  1 
ATOM   701   O OE1 . GLU A 1 88  ? 9.472   -28.530 -23.001 1.00 20.61  ? 88   GLU A OE1 1 
ATOM   702   O OE2 . GLU A 1 88  ? 10.265  -29.001 -20.913 1.00 24.75  ? 88   GLU A OE2 1 
ATOM   703   N N   . ARG A 1 89  ? 12.403  -23.994 -24.571 1.00 10.56  ? 89   ARG A N   1 
ATOM   704   C CA  . ARG A 1 89  ? 12.476  -23.207 -25.761 1.00 9.51   ? 89   ARG A CA  1 
ATOM   705   C C   . ARG A 1 89  ? 13.863  -22.651 -25.896 1.00 9.97   ? 89   ARG A C   1 
ATOM   706   O O   . ARG A 1 89  ? 14.534  -22.693 -26.935 1.00 10.78  ? 89   ARG A O   1 
ATOM   707   C CB  . ARG A 1 89  ? 11.598  -22.037 -25.547 1.00 3.43   ? 89   ARG A CB  1 
ATOM   708   C CG  . ARG A 1 89  ? 11.343  -21.440 -26.881 1.00 18.27  ? 89   ARG A CG  1 
ATOM   709   C CD  . ARG A 1 89  ? 10.297  -20.346 -26.789 1.00 6.77   ? 89   ARG A CD  1 
ATOM   710   N NE  . ARG A 1 89  ? 10.099  -19.730 -28.052 1.00 16.25  ? 89   ARG A NE  1 
ATOM   711   C CZ  . ARG A 1 89  ? 9.163   -20.034 -28.919 1.00 15.11  ? 89   ARG A CZ  1 
ATOM   712   N NH1 . ARG A 1 89  ? 8.232   -20.952 -28.654 1.00 14.64  ? 89   ARG A NH1 1 
ATOM   713   N NH2 . ARG A 1 89  ? 9.201   -19.381 -30.094 1.00 33.37  ? 89   ARG A NH2 1 
ATOM   714   N N   . THR A 1 90  ? 14.353  -22.204 -24.766 1.00 1.00   ? 90   THR A N   1 
ATOM   715   C CA  . THR A 1 90  ? 15.721  -21.665 -24.785 1.00 1.00   ? 90   THR A CA  1 
ATOM   716   C C   . THR A 1 90  ? 16.804  -22.674 -25.227 1.00 12.66  ? 90   THR A C   1 
ATOM   717   O O   . THR A 1 90  ? 17.676  -22.393 -26.064 1.00 12.11  ? 90   THR A O   1 
ATOM   718   C CB  . THR A 1 90  ? 16.019  -20.977 -23.468 1.00 11.57  ? 90   THR A CB  1 
ATOM   719   O OG1 . THR A 1 90  ? 15.048  -19.993 -23.157 1.00 20.47  ? 90   THR A OG1 1 
ATOM   720   C CG2 . THR A 1 90  ? 17.371  -20.381 -23.544 1.00 1.00   ? 90   THR A CG2 1 
ATOM   721   N N   . LEU A 1 91  ? 16.688  -23.909 -24.716 1.00 5.25   ? 91   LEU A N   1 
ATOM   722   C CA  . LEU A 1 91  ? 17.616  -24.958 -25.050 1.00 1.00   ? 91   LEU A CA  1 
ATOM   723   C C   . LEU A 1 91  ? 17.542  -25.348 -26.486 1.00 9.46   ? 91   LEU A C   1 
ATOM   724   O O   . LEU A 1 91  ? 18.540  -25.471 -27.178 1.00 13.34  ? 91   LEU A O   1 
ATOM   725   C CB  . LEU A 1 91  ? 17.276  -26.162 -24.202 1.00 2.65   ? 91   LEU A CB  1 
ATOM   726   C CG  . LEU A 1 91  ? 17.622  -25.878 -22.742 1.00 6.82   ? 91   LEU A CG  1 
ATOM   727   C CD1 . LEU A 1 91  ? 17.146  -26.969 -21.845 1.00 2.85   ? 91   LEU A CD1 1 
ATOM   728   C CD2 . LEU A 1 91  ? 19.105  -25.870 -22.545 1.00 1.00   ? 91   LEU A CD2 1 
ATOM   729   N N   . ILE A 1 92  ? 16.324  -25.540 -26.917 1.00 6.98   ? 92   ILE A N   1 
ATOM   730   C CA  . ILE A 1 92  ? 16.057  -25.950 -28.268 1.00 5.61   ? 92   ILE A CA  1 
ATOM   731   C C   . ILE A 1 92  ? 16.627  -24.936 -29.202 1.00 12.34  ? 92   ILE A C   1 
ATOM   732   O O   . ILE A 1 92  ? 17.258  -25.268 -30.197 1.00 16.34  ? 92   ILE A O   1 
ATOM   733   C CB  . ILE A 1 92  ? 14.553  -26.020 -28.404 1.00 9.15   ? 92   ILE A CB  1 
ATOM   734   C CG1 . ILE A 1 92  ? 14.075  -27.140 -27.504 1.00 9.09   ? 92   ILE A CG1 1 
ATOM   735   C CG2 . ILE A 1 92  ? 14.082  -26.216 -29.833 1.00 4.91   ? 92   ILE A CG2 1 
ATOM   736   C CD1 . ILE A 1 92  ? 12.614  -27.468 -27.647 1.00 7.16   ? 92   ILE A CD1 1 
ATOM   737   N N   . ASP A 1 93  ? 16.437  -23.678 -28.836 1.00 5.23   ? 93   ASP A N   1 
ATOM   738   C CA  . ASP A 1 93  ? 16.941  -22.615 -29.677 1.00 3.41   ? 93   ASP A CA  1 
ATOM   739   C C   . ASP A 1 93  ? 18.456  -22.684 -29.846 1.00 13.46  ? 93   ASP A C   1 
ATOM   740   O O   . ASP A 1 93  ? 19.013  -22.757 -30.965 1.00 8.81   ? 93   ASP A O   1 
ATOM   741   C CB  . ASP A 1 93  ? 16.465  -21.298 -29.085 1.00 3.72   ? 93   ASP A CB  1 
ATOM   742   C CG  . ASP A 1 93  ? 16.702  -20.015 -29.880 1.00 15.82  ? 93   ASP A CG  1 
ATOM   743   O OD1 . ASP A 1 93  ? 17.286  -19.971 -30.934 1.00 13.84  ? 93   ASP A OD1 1 
ATOM   744   O OD2 . ASP A 1 93  ? 16.153  -18.960 -29.303 1.00 24.47  ? 93   ASP A OD2 1 
ATOM   745   N N   . MET A 1 94  ? 19.119  -22.762 -28.714 1.00 7.44   ? 94   MET A N   1 
ATOM   746   C CA  . MET A 1 94  ? 20.534  -22.852 -28.792 1.00 1.95   ? 94   MET A CA  1 
ATOM   747   C C   . MET A 1 94  ? 21.026  -24.028 -29.546 1.00 4.64   ? 94   MET A C   1 
ATOM   748   O O   . MET A 1 94  ? 21.977  -23.933 -30.318 1.00 7.26   ? 94   MET A O   1 
ATOM   749   C CB  . MET A 1 94  ? 21.069  -22.933 -27.407 1.00 4.75   ? 94   MET A CB  1 
ATOM   750   C CG  . MET A 1 94  ? 20.880  -21.640 -26.595 1.00 9.41   ? 94   MET A CG  1 
ATOM   751   S SD  . MET A 1 94  ? 21.591  -21.808 -24.888 1.00 14.86  ? 94   MET A SD  1 
ATOM   752   C CE  . MET A 1 94  ? 22.994  -20.812 -25.398 1.00 13.63  ? 94   MET A CE  1 
ATOM   753   N N   . TYR A 1 95  ? 20.385  -25.157 -29.311 1.00 3.29   ? 95   TYR A N   1 
ATOM   754   C CA  . TYR A 1 95  ? 20.850  -26.364 -29.952 1.00 1.00   ? 95   TYR A CA  1 
ATOM   755   C C   . TYR A 1 95  ? 20.747  -26.208 -31.422 1.00 6.98   ? 95   TYR A C   1 
ATOM   756   O O   . TYR A 1 95  ? 21.614  -26.526 -32.219 1.00 7.33   ? 95   TYR A O   1 
ATOM   757   C CB  . TYR A 1 95  ? 19.978  -27.552 -29.573 1.00 2.91   ? 95   TYR A CB  1 
ATOM   758   C CG  . TYR A 1 95  ? 20.130  -27.856 -28.106 1.00 8.52   ? 95   TYR A CG  1 
ATOM   759   C CD1 . TYR A 1 95  ? 21.169  -27.248 -27.408 1.00 4.73   ? 95   TYR A CD1 1 
ATOM   760   C CD2 . TYR A 1 95  ? 19.305  -28.759 -27.411 1.00 10.51  ? 95   TYR A CD2 1 
ATOM   761   C CE1 . TYR A 1 95  ? 21.323  -27.511 -26.045 1.00 6.52   ? 95   TYR A CE1 1 
ATOM   762   C CE2 . TYR A 1 95  ? 19.466  -29.054 -26.048 1.00 4.52   ? 95   TYR A CE2 1 
ATOM   763   C CZ  . TYR A 1 95  ? 20.486  -28.399 -25.357 1.00 16.64  ? 95   TYR A CZ  1 
ATOM   764   O OH  . TYR A 1 95  ? 20.691  -28.603 -24.007 1.00 17.95  ? 95   TYR A OH  1 
ATOM   765   N N   . VAL A 1 96  ? 19.632  -25.687 -31.771 1.00 4.16   ? 96   VAL A N   1 
ATOM   766   C CA  . VAL A 1 96  ? 19.401  -25.471 -33.160 1.00 2.88   ? 96   VAL A CA  1 
ATOM   767   C C   . VAL A 1 96  ? 20.399  -24.536 -33.788 1.00 6.46   ? 96   VAL A C   1 
ATOM   768   O O   . VAL A 1 96  ? 20.932  -24.815 -34.847 1.00 6.51   ? 96   VAL A O   1 
ATOM   769   C CB  . VAL A 1 96  ? 18.041  -24.897 -33.330 1.00 3.29   ? 96   VAL A CB  1 
ATOM   770   C CG1 . VAL A 1 96  ? 17.943  -24.500 -34.761 1.00 1.56   ? 96   VAL A CG1 1 
ATOM   771   C CG2 . VAL A 1 96  ? 17.019  -25.967 -33.079 1.00 4.65   ? 96   VAL A CG2 1 
ATOM   772   N N   . GLU A 1 97  ? 20.641  -23.390 -33.165 1.00 1.62   ? 97   GLU A N   1 
ATOM   773   C CA  . GLU A 1 97  ? 21.612  -22.481 -33.782 1.00 2.81   ? 97   GLU A CA  1 
ATOM   774   C C   . GLU A 1 97  ? 22.983  -23.100 -33.905 1.00 9.85   ? 97   GLU A C   1 
ATOM   775   O O   . GLU A 1 97  ? 23.661  -22.977 -34.934 1.00 10.22  ? 97   GLU A O   1 
ATOM   776   C CB  . GLU A 1 97  ? 21.723  -21.142 -33.073 1.00 6.17   ? 97   GLU A CB  1 
ATOM   777   C CG  . GLU A 1 97  ? 20.379  -20.430 -32.969 1.00 3.05   ? 97   GLU A CG  1 
ATOM   778   C CD  . GLU A 1 97  ? 19.901  -19.945 -34.334 1.00 17.39  ? 97   GLU A CD  1 
ATOM   779   O OE1 . GLU A 1 97  ? 20.684  -19.604 -35.186 1.00 7.10   ? 97   GLU A OE1 1 
ATOM   780   O OE2 . GLU A 1 97  ? 18.573  -19.800 -34.448 1.00 19.34  ? 97   GLU A OE2 1 
ATOM   781   N N   . GLY A 1 98  ? 23.389  -23.780 -32.853 1.00 7.21   ? 98   GLY A N   1 
ATOM   782   C CA  . GLY A 1 98  ? 24.695  -24.422 -32.903 1.00 2.67   ? 98   GLY A CA  1 
ATOM   783   C C   . GLY A 1 98  ? 24.724  -25.404 -34.036 1.00 3.56   ? 98   GLY A C   1 
ATOM   784   O O   . GLY A 1 98  ? 25.612  -25.425 -34.874 1.00 5.22   ? 98   GLY A O   1 
ATOM   785   N N   . THR A 1 99  ? 23.686  -26.193 -34.107 1.00 2.16   ? 99   THR A N   1 
ATOM   786   C CA  . THR A 1 99  ? 23.610  -27.182 -35.176 1.00 2.83   ? 99   THR A CA  1 
ATOM   787   C C   . THR A 1 99  ? 23.650  -26.587 -36.572 1.00 12.76  ? 99   THR A C   1 
ATOM   788   O O   . THR A 1 99  ? 24.423  -27.044 -37.415 1.00 12.87  ? 99   THR A O   1 
ATOM   789   C CB  . THR A 1 99  ? 22.422  -28.102 -35.000 1.00 7.66   ? 99   THR A CB  1 
ATOM   790   O OG1 . THR A 1 99  ? 22.347  -28.522 -33.639 1.00 6.21   ? 99   THR A OG1 1 
ATOM   791   C CG2 . THR A 1 99  ? 22.554  -29.256 -35.976 1.00 2.99   ? 99   THR A CG2 1 
ATOM   792   N N   . LEU A 1 100 ? 22.881  -25.518 -36.792 1.00 6.88   ? 100  LEU A N   1 
ATOM   793   C CA  . LEU A 1 100 ? 22.910  -24.811 -38.084 1.00 3.94   ? 100  LEU A CA  1 
ATOM   794   C C   . LEU A 1 100 ? 24.316  -24.323 -38.437 1.00 8.49   ? 100  LEU A C   1 
ATOM   795   O O   . LEU A 1 100 ? 24.733  -24.212 -39.609 1.00 13.34  ? 100  LEU A O   1 
ATOM   796   C CB  . LEU A 1 100 ? 21.954  -23.633 -38.048 1.00 4.11   ? 100  LEU A CB  1 
ATOM   797   C CG  . LEU A 1 100 ? 20.469  -24.038 -38.045 1.00 8.88   ? 100  LEU A CG  1 
ATOM   798   C CD1 . LEU A 1 100 ? 19.616  -22.785 -38.188 1.00 2.21   ? 100  LEU A CD1 1 
ATOM   799   C CD2 . LEU A 1 100 ? 20.201  -24.925 -39.274 1.00 1.00   ? 100  LEU A CD2 1 
ATOM   800   N N   . ASP A 1 101 ? 25.094  -24.063 -37.418 1.00 1.00   ? 101  ASP A N   1 
ATOM   801   C CA  . ASP A 1 101 ? 26.446  -23.663 -37.723 1.00 2.36   ? 101  ASP A CA  1 
ATOM   802   C C   . ASP A 1 101 ? 27.284  -24.795 -38.287 1.00 8.45   ? 101  ASP A C   1 
ATOM   803   O O   . ASP A 1 101 ? 28.225  -24.617 -39.024 1.00 12.15  ? 101  ASP A O   1 
ATOM   804   C CB  . ASP A 1 101 ? 27.130  -23.150 -36.476 1.00 1.77   ? 101  ASP A CB  1 
ATOM   805   C CG  . ASP A 1 101 ? 26.775  -21.736 -36.060 1.00 3.77   ? 101  ASP A CG  1 
ATOM   806   O OD1 . ASP A 1 101 ? 26.018  -21.017 -36.693 1.00 14.68  ? 101  ASP A OD1 1 
ATOM   807   O OD2 . ASP A 1 101 ? 27.196  -21.495 -34.837 1.00 33.03  ? 101  ASP A OD2 1 
ATOM   808   N N   . LEU A 1 102 ? 26.941  -25.977 -37.908 1.00 8.68   ? 102  LEU A N   1 
ATOM   809   C CA  . LEU A 1 102 ? 27.621  -27.144 -38.384 1.00 4.32   ? 102  LEU A CA  1 
ATOM   810   C C   . LEU A 1 102 ? 27.117  -27.480 -39.752 1.00 10.80  ? 102  LEU A C   1 
ATOM   811   O O   . LEU A 1 102 ? 27.856  -27.698 -40.683 1.00 14.15  ? 102  LEU A O   1 
ATOM   812   C CB  . LEU A 1 102 ? 27.264  -28.286 -37.438 1.00 3.76   ? 102  LEU A CB  1 
ATOM   813   C CG  . LEU A 1 102 ? 27.921  -29.658 -37.725 1.00 10.55  ? 102  LEU A CG  1 
ATOM   814   C CD1 . LEU A 1 102 ? 29.413  -29.635 -37.993 1.00 3.28   ? 102  LEU A CD1 1 
ATOM   815   C CD2 . LEU A 1 102 ? 27.640  -30.630 -36.595 1.00 8.71   ? 102  LEU A CD2 1 
ATOM   816   N N   . LEU A 1 103 ? 25.820  -27.490 -39.876 1.00 6.51   ? 103  LEU A N   1 
ATOM   817   C CA  . LEU A 1 103 ? 25.187  -27.758 -41.132 1.00 1.50   ? 103  LEU A CA  1 
ATOM   818   C C   . LEU A 1 103 ? 25.659  -26.852 -42.238 1.00 3.09   ? 103  LEU A C   1 
ATOM   819   O O   . LEU A 1 103 ? 25.716  -27.209 -43.398 1.00 11.31  ? 103  LEU A O   1 
ATOM   820   C CB  . LEU A 1 103 ? 23.715  -27.534 -40.946 1.00 1.77   ? 103  LEU A CB  1 
ATOM   821   C CG  . LEU A 1 103 ? 22.866  -27.880 -42.172 1.00 6.67   ? 103  LEU A CG  1 
ATOM   822   C CD1 . LEU A 1 103 ? 22.927  -29.360 -42.516 1.00 1.00   ? 103  LEU A CD1 1 
ATOM   823   C CD2 . LEU A 1 103 ? 21.428  -27.599 -41.780 1.00 5.13   ? 103  LEU A CD2 1 
ATOM   824   N N   . GLU A 1 104 ? 26.014  -25.660 -41.888 1.00 3.47   ? 104  GLU A N   1 
ATOM   825   C CA  . GLU A 1 104 ? 26.488  -24.716 -42.869 1.00 3.16   ? 104  GLU A CA  1 
ATOM   826   C C   . GLU A 1 104 ? 27.635  -25.220 -43.682 1.00 10.60  ? 104  GLU A C   1 
ATOM   827   O O   . GLU A 1 104 ? 27.742  -25.014 -44.863 1.00 15.54  ? 104  GLU A O   1 
ATOM   828   C CB  . GLU A 1 104 ? 26.946  -23.486 -42.142 1.00 4.44   ? 104  GLU A CB  1 
ATOM   829   C CG  . GLU A 1 104 ? 27.130  -22.333 -43.101 1.00 1.00   ? 104  GLU A CG  1 
ATOM   830   C CD  . GLU A 1 104 ? 25.879  -21.873 -43.797 1.00 11.35  ? 104  GLU A CD  1 
ATOM   831   O OE1 . GLU A 1 104 ? 24.746  -22.234 -43.457 1.00 33.25  ? 104  GLU A OE1 1 
ATOM   832   O OE2 . GLU A 1 104 ? 26.169  -21.001 -44.753 1.00 12.49  ? 104  GLU A OE2 1 
ATOM   833   N N   . LEU A 1 105 ? 28.490  -25.924 -43.036 1.00 7.71   ? 105  LEU A N   1 
ATOM   834   C CA  . LEU A 1 105 ? 29.596  -26.526 -43.736 1.00 2.89   ? 105  LEU A CA  1 
ATOM   835   C C   . LEU A 1 105 ? 29.124  -27.409 -44.887 1.00 9.81   ? 105  LEU A C   1 
ATOM   836   O O   . LEU A 1 105 ? 29.695  -27.478 -45.990 1.00 13.77  ? 105  LEU A O   1 
ATOM   837   C CB  . LEU A 1 105 ? 30.374  -27.411 -42.753 1.00 3.27   ? 105  LEU A CB  1 
ATOM   838   C CG  . LEU A 1 105 ? 30.968  -26.658 -41.550 1.00 6.52   ? 105  LEU A CG  1 
ATOM   839   C CD1 . LEU A 1 105 ? 31.989  -27.463 -40.751 1.00 4.87   ? 105  LEU A CD1 1 
ATOM   840   C CD2 . LEU A 1 105 ? 31.563  -25.362 -41.987 1.00 1.00   ? 105  LEU A CD2 1 
ATOM   841   N N   . LEU A 1 106 ? 28.070  -28.114 -44.601 1.00 7.80   ? 106  LEU A N   1 
ATOM   842   C CA  . LEU A 1 106 ? 27.521  -28.982 -45.622 1.00 6.10   ? 106  LEU A CA  1 
ATOM   843   C C   . LEU A 1 106 ? 26.920  -28.154 -46.753 1.00 14.47  ? 106  LEU A C   1 
ATOM   844   O O   . LEU A 1 106 ? 27.101  -28.475 -47.955 1.00 13.94  ? 106  LEU A O   1 
ATOM   845   C CB  . LEU A 1 106 ? 26.390  -29.787 -45.026 1.00 1.05   ? 106  LEU A CB  1 
ATOM   846   C CG  . LEU A 1 106 ? 26.729  -31.150 -44.419 1.00 1.18   ? 106  LEU A CG  1 
ATOM   847   C CD1 . LEU A 1 106 ? 27.735  -31.921 -45.257 1.00 1.00   ? 106  LEU A CD1 1 
ATOM   848   C CD2 . LEU A 1 106 ? 27.177  -30.974 -43.005 1.00 6.50   ? 106  LEU A CD2 1 
ATOM   849   N N   . ILE A 1 107 ? 26.173  -27.099 -46.351 1.00 5.24   ? 107  ILE A N   1 
ATOM   850   C CA  . ILE A 1 107 ? 25.552  -26.159 -47.314 1.00 4.29   ? 107  ILE A CA  1 
ATOM   851   C C   . ILE A 1 107 ? 26.509  -25.476 -48.269 1.00 16.36  ? 107  ILE A C   1 
ATOM   852   O O   . ILE A 1 107 ? 26.199  -25.371 -49.483 1.00 26.57  ? 107  ILE A O   1 
ATOM   853   C CB  . ILE A 1 107 ? 24.710  -25.117 -46.661 1.00 7.23   ? 107  ILE A CB  1 
ATOM   854   C CG1 . ILE A 1 107 ? 23.597  -25.880 -46.014 1.00 2.25   ? 107  ILE A CG1 1 
ATOM   855   C CG2 . ILE A 1 107 ? 24.192  -24.073 -47.647 1.00 6.37   ? 107  ILE A CG2 1 
ATOM   856   C CD1 . ILE A 1 107 ? 22.771  -25.002 -45.178 1.00 1.00   ? 107  ILE A CD1 1 
ATOM   857   N N   . MET A 1 108 ? 27.642  -25.036 -47.709 1.00 6.24   ? 108  MET A N   1 
ATOM   858   C CA  . MET A 1 108 ? 28.662  -24.405 -48.517 1.00 11.25  ? 108  MET A CA  1 
ATOM   859   C C   . MET A 1 108 ? 29.468  -25.342 -49.379 1.00 14.93  ? 108  MET A C   1 
ATOM   860   O O   . MET A 1 108 ? 30.020  -24.947 -50.377 1.00 18.42  ? 108  MET A O   1 
ATOM   861   C CB  . MET A 1 108 ? 29.699  -23.633 -47.711 1.00 16.55  ? 108  MET A CB  1 
ATOM   862   C CG  . MET A 1 108 ? 29.132  -22.705 -46.634 1.00 34.20  ? 108  MET A CG  1 
ATOM   863   S SD  . MET A 1 108 ? 30.341  -21.996 -45.407 1.00 42.91  ? 108  MET A SD  1 
ATOM   864   C CE  . MET A 1 108 ? 31.677  -23.266 -45.389 1.00 38.79  ? 108  MET A CE  1 
ATOM   865   N N   . HIS A 1 109 ? 29.619  -26.554 -48.925 1.00 12.04  ? 109  HIS A N   1 
ATOM   866   C CA  . HIS A 1 109 ? 30.454  -27.527 -49.544 1.00 8.78   ? 109  HIS A CA  1 
ATOM   867   C C   . HIS A 1 109 ? 30.540  -27.587 -51.038 1.00 13.15  ? 109  HIS A C   1 
ATOM   868   O O   . HIS A 1 109 ? 31.584  -27.456 -51.610 1.00 19.76  ? 109  HIS A O   1 
ATOM   869   C CB  . HIS A 1 109 ? 30.156  -28.892 -48.995 1.00 13.77  ? 109  HIS A CB  1 
ATOM   870   C CG  . HIS A 1 109 ? 31.366  -29.736 -49.189 1.00 19.62  ? 109  HIS A CG  1 
ATOM   871   N ND1 . HIS A 1 109 ? 31.368  -30.796 -50.083 1.00 21.17  ? 109  HIS A ND1 1 
ATOM   872   C CD2 . HIS A 1 109 ? 32.609  -29.620 -48.621 1.00 19.59  ? 109  HIS A CD2 1 
ATOM   873   C CE1 . HIS A 1 109 ? 32.604  -31.315 -50.002 1.00 19.93  ? 109  HIS A CE1 1 
ATOM   874   N NE2 . HIS A 1 109 ? 33.375  -30.613 -49.160 1.00 19.10  ? 109  HIS A NE2 1 
ATOM   875   N N   . PRO A 1 110 ? 29.438  -27.797 -51.682 1.00 12.54  ? 110  PRO A N   1 
ATOM   876   C CA  . PRO A 1 110 ? 29.398  -27.880 -53.134 1.00 9.73   ? 110  PRO A CA  1 
ATOM   877   C C   . PRO A 1 110 ? 29.887  -26.668 -53.864 1.00 21.00  ? 110  PRO A C   1 
ATOM   878   O O   . PRO A 1 110 ? 30.234  -26.725 -55.038 1.00 31.35  ? 110  PRO A O   1 
ATOM   879   C CB  . PRO A 1 110 ? 27.941  -28.057 -53.525 1.00 7.40   ? 110  PRO A CB  1 
ATOM   880   C CG  . PRO A 1 110 ? 27.157  -28.194 -52.247 1.00 3.83   ? 110  PRO A CG  1 
ATOM   881   C CD  . PRO A 1 110 ? 28.075  -27.847 -51.076 1.00 9.25   ? 110  PRO A CD  1 
ATOM   882   N N   . PHE A 1 111 ? 29.933  -25.546 -53.216 1.00 15.41  ? 111  PHE A N   1 
ATOM   883   C CA  . PHE A 1 111 ? 30.399  -24.380 -53.937 1.00 9.17   ? 111  PHE A CA  1 
ATOM   884   C C   . PHE A 1 111 ? 31.868  -24.045 -53.735 1.00 23.69  ? 111  PHE A C   1 
ATOM   885   O O   . PHE A 1 111 ? 32.324  -22.954 -54.074 1.00 30.42  ? 111  PHE A O   1 
ATOM   886   C CB  . PHE A 1 111 ? 29.523  -23.214 -53.550 1.00 4.06   ? 111  PHE A CB  1 
ATOM   887   C CG  . PHE A 1 111 ? 28.096  -23.559 -53.792 1.00 7.88   ? 111  PHE A CG  1 
ATOM   888   C CD1 . PHE A 1 111 ? 27.539  -23.493 -55.074 1.00 8.51   ? 111  PHE A CD1 1 
ATOM   889   C CD2 . PHE A 1 111 ? 27.288  -23.973 -52.733 1.00 16.26  ? 111  PHE A CD2 1 
ATOM   890   C CE1 . PHE A 1 111 ? 26.205  -23.834 -55.317 1.00 11.45  ? 111  PHE A CE1 1 
ATOM   891   C CE2 . PHE A 1 111 ? 25.953  -24.306 -52.963 1.00 17.14  ? 111  PHE A CE2 1 
ATOM   892   C CZ  . PHE A 1 111 ? 25.408  -24.254 -54.248 1.00 8.93   ? 111  PHE A CZ  1 
ATOM   893   N N   . LEU A 1 112 ? 32.559  -24.952 -53.080 1.00 20.71  ? 112  LEU A N   1 
ATOM   894   C CA  . LEU A 1 112 ? 33.976  -24.851 -52.798 1.00 19.56  ? 112  LEU A CA  1 
ATOM   895   C C   . LEU A 1 112 ? 34.701  -25.279 -54.021 1.00 33.83  ? 112  LEU A C   1 
ATOM   896   O O   . LEU A 1 112 ? 34.136  -25.958 -54.874 1.00 37.60  ? 112  LEU A O   1 
ATOM   897   C CB  . LEU A 1 112 ? 34.408  -25.911 -51.747 1.00 16.48  ? 112  LEU A CB  1 
ATOM   898   C CG  . LEU A 1 112 ? 33.879  -25.505 -50.394 1.00 14.20  ? 112  LEU A CG  1 
ATOM   899   C CD1 . LEU A 1 112 ? 34.706  -26.115 -49.317 1.00 11.29  ? 112  LEU A CD1 1 
ATOM   900   C CD2 . LEU A 1 112 ? 34.055  -24.023 -50.328 1.00 1.49   ? 112  LEU A CD2 1 
ATOM   901   N N   . LYS A 1 113 ? 35.972  -24.919 -54.040 1.00 34.66  ? 113  LYS A N   1 
ATOM   902   C CA  . LYS A 1 113 ? 36.872  -25.332 -55.082 1.00 34.60  ? 113  LYS A CA  1 
ATOM   903   C C   . LYS A 1 113 ? 37.327  -26.699 -54.669 1.00 48.05  ? 113  LYS A C   1 
ATOM   904   O O   . LYS A 1 113 ? 37.933  -26.913 -53.618 1.00 57.59  ? 113  LYS A O   1 
ATOM   905   C CB  . LYS A 1 113 ? 38.089  -24.428 -55.251 1.00 37.42  ? 113  LYS A CB  1 
ATOM   906   C CG  . LYS A 1 113 ? 37.840  -22.917 -55.371 1.00 107.85 ? 113  LYS A CG  1 
ATOM   907   C CD  . LYS A 1 113 ? 36.866  -22.293 -54.364 1.00 141.69 ? 113  LYS A CD  1 
ATOM   908   C CE  . LYS A 1 113 ? 37.144  -22.597 -52.895 1.00 148.40 ? 113  LYS A CE  1 
ATOM   909   N NZ  . LYS A 1 113 ? 36.246  -21.864 -51.984 1.00 163.81 ? 113  LYS A NZ  1 
ATOM   910   N N   . PRO A 1 114 ? 36.951  -27.597 -55.498 1.00 47.13  ? 114  PRO A N   1 
ATOM   911   C CA  . PRO A 1 114 ? 37.225  -29.033 -55.459 1.00 50.56  ? 114  PRO A CA  1 
ATOM   912   C C   . PRO A 1 114 ? 38.441  -29.453 -54.624 1.00 62.15  ? 114  PRO A C   1 
ATOM   913   O O   . PRO A 1 114 ? 38.453  -30.470 -53.888 1.00 60.40  ? 114  PRO A O   1 
ATOM   914   C CB  . PRO A 1 114 ? 37.403  -29.390 -56.936 1.00 51.30  ? 114  PRO A CB  1 
ATOM   915   C CG  . PRO A 1 114 ? 37.093  -28.120 -57.764 1.00 51.76  ? 114  PRO A CG  1 
ATOM   916   C CD  . PRO A 1 114 ? 37.053  -26.936 -56.822 1.00 44.33  ? 114  PRO A CD  1 
ATOM   917   N N   . ASP A 1 115 ? 39.472  -28.639 -54.745 1.00 66.54  ? 115  ASP A N   1 
ATOM   918   C CA  . ASP A 1 115 ? 40.665  -28.853 -53.983 1.00 73.05  ? 115  ASP A CA  1 
ATOM   919   C C   . ASP A 1 115 ? 40.332  -28.685 -52.485 1.00 65.55  ? 115  ASP A C   1 
ATOM   920   O O   . ASP A 1 115 ? 40.637  -29.535 -51.617 1.00 71.35  ? 115  ASP A O   1 
ATOM   921   C CB  . ASP A 1 115 ? 41.735  -27.862 -54.496 1.00 84.19  ? 115  ASP A CB  1 
ATOM   922   C CG  . ASP A 1 115 ? 42.752  -27.411 -53.464 1.00 167.64 ? 115  ASP A CG  1 
ATOM   923   O OD1 . ASP A 1 115 ? 43.052  -28.050 -52.456 1.00 178.29 ? 115  ASP A OD1 1 
ATOM   924   O OD2 . ASP A 1 115 ? 43.311  -26.260 -53.785 1.00 197.05 ? 115  ASP A OD2 1 
ATOM   925   N N   . ASP A 1 116 ? 39.659  -27.573 -52.191 1.00 41.01  ? 116  ASP A N   1 
ATOM   926   C CA  . ASP A 1 116 ? 39.269  -27.257 -50.845 1.00 34.94  ? 116  ASP A CA  1 
ATOM   927   C C   . ASP A 1 116 ? 38.167  -28.128 -50.312 1.00 31.13  ? 116  ASP A C   1 
ATOM   928   O O   . ASP A 1 116 ? 37.873  -28.187 -49.109 1.00 30.98  ? 116  ASP A O   1 
ATOM   929   C CB  . ASP A 1 116 ? 38.803  -25.819 -50.789 1.00 39.70  ? 116  ASP A CB  1 
ATOM   930   C CG  . ASP A 1 116 ? 39.874  -24.836 -51.157 1.00 60.74  ? 116  ASP A CG  1 
ATOM   931   O OD1 . ASP A 1 116 ? 41.052  -25.132 -51.304 1.00 63.01  ? 116  ASP A OD1 1 
ATOM   932   O OD2 . ASP A 1 116 ? 39.406  -23.613 -51.198 1.00 66.45  ? 116  ASP A OD2 1 
ATOM   933   N N   . GLN A 1 117 ? 37.515  -28.791 -51.219 1.00 20.22  ? 117  GLN A N   1 
ATOM   934   C CA  . GLN A 1 117 ? 36.434  -29.588 -50.783 1.00 20.01  ? 117  GLN A CA  1 
ATOM   935   C C   . GLN A 1 117 ? 36.833  -30.659 -49.834 1.00 30.67  ? 117  GLN A C   1 
ATOM   936   O O   . GLN A 1 117 ? 36.166  -30.942 -48.846 1.00 36.77  ? 117  GLN A O   1 
ATOM   937   C CB  . GLN A 1 117 ? 35.692  -30.136 -51.975 1.00 22.50  ? 117  GLN A CB  1 
ATOM   938   C CG  . GLN A 1 117 ? 34.869  -29.032 -52.652 1.00 37.02  ? 117  GLN A CG  1 
ATOM   939   C CD  . GLN A 1 117 ? 33.919  -29.669 -53.618 1.00 29.68  ? 117  GLN A CD  1 
ATOM   940   O OE1 . GLN A 1 117 ? 34.265  -30.649 -54.271 1.00 64.54  ? 117  GLN A OE1 1 
ATOM   941   N NE2 . GLN A 1 117 ? 32.684  -29.213 -53.614 1.00 42.05  ? 117  GLN A NE2 1 
ATOM   942   N N   . GLN A 1 118 ? 37.961  -31.221 -50.131 1.00 33.21  ? 118  GLN A N   1 
ATOM   943   C CA  . GLN A 1 118 ? 38.458  -32.274 -49.308 1.00 34.93  ? 118  GLN A CA  1 
ATOM   944   C C   . GLN A 1 118 ? 38.944  -31.858 -47.947 1.00 32.72  ? 118  GLN A C   1 
ATOM   945   O O   . GLN A 1 118 ? 38.656  -32.516 -46.941 1.00 33.69  ? 118  GLN A O   1 
ATOM   946   C CB  . GLN A 1 118 ? 39.428  -33.159 -50.053 1.00 41.88  ? 118  GLN A CB  1 
ATOM   947   C CG  . GLN A 1 118 ? 39.388  -34.596 -49.485 1.00 157.13 ? 118  GLN A CG  1 
ATOM   948   C CD  . GLN A 1 118 ? 37.985  -35.183 -49.416 1.00 221.48 ? 118  GLN A CD  1 
ATOM   949   O OE1 . GLN A 1 118 ? 37.117  -34.867 -50.252 1.00 237.99 ? 118  GLN A OE1 1 
ATOM   950   N NE2 . GLN A 1 118 ? 37.748  -36.032 -48.412 1.00 199.58 ? 118  GLN A NE2 1 
ATOM   951   N N   . LYS A 1 119 ? 39.671  -30.759 -47.917 1.00 28.62  ? 119  LYS A N   1 
ATOM   952   C CA  . LYS A 1 119 ? 40.134  -30.262 -46.644 1.00 25.84  ? 119  LYS A CA  1 
ATOM   953   C C   . LYS A 1 119 ? 38.931  -30.043 -45.712 1.00 26.95  ? 119  LYS A C   1 
ATOM   954   O O   . LYS A 1 119 ? 38.889  -30.371 -44.540 1.00 33.39  ? 119  LYS A O   1 
ATOM   955   C CB  . LYS A 1 119 ? 41.048  -29.025 -46.763 1.00 28.01  ? 119  LYS A CB  1 
ATOM   956   C CG  . LYS A 1 119 ? 41.795  -28.779 -45.439 1.00 143.15 ? 119  LYS A CG  1 
ATOM   957   C CD  . LYS A 1 119 ? 40.904  -28.228 -44.317 1.00 172.67 ? 119  LYS A CD  1 
ATOM   958   C CE  . LYS A 1 119 ? 41.035  -28.894 -42.939 1.00 131.07 ? 119  LYS A CE  1 
ATOM   959   N NZ  . LYS A 1 119 ? 39.806  -28.690 -42.103 1.00 24.57  ? 119  LYS A NZ  1 
ATOM   960   N N   . GLU A 1 120 ? 37.888  -29.582 -46.321 1.00 19.79  ? 120  GLU A N   1 
ATOM   961   C CA  . GLU A 1 120 ? 36.643  -29.279 -45.695 1.00 17.74  ? 120  GLU A CA  1 
ATOM   962   C C   . GLU A 1 120 ? 35.900  -30.391 -45.047 1.00 19.67  ? 120  GLU A C   1 
ATOM   963   O O   . GLU A 1 120 ? 35.261  -30.214 -43.988 1.00 22.84  ? 120  GLU A O   1 
ATOM   964   C CB  . GLU A 1 120 ? 35.874  -28.592 -46.784 1.00 19.73  ? 120  GLU A CB  1 
ATOM   965   C CG  . GLU A 1 120 ? 36.619  -27.271 -46.762 1.00 25.31  ? 120  GLU A CG  1 
ATOM   966   C CD  . GLU A 1 120 ? 36.466  -26.754 -45.351 1.00 96.14  ? 120  GLU A CD  1 
ATOM   967   O OE1 . GLU A 1 120 ? 35.470  -26.988 -44.616 1.00 96.42  ? 120  GLU A OE1 1 
ATOM   968   O OE2 . GLU A 1 120 ? 37.519  -26.053 -45.015 1.00 45.20  ? 120  GLU A OE2 1 
ATOM   969   N N   . VAL A 1 121 ? 35.952  -31.517 -45.725 1.00 5.57   ? 121  VAL A N   1 
ATOM   970   C CA  . VAL A 1 121 ? 35.322  -32.649 -45.156 1.00 6.59   ? 121  VAL A CA  1 
ATOM   971   C C   . VAL A 1 121 ? 36.016  -33.009 -43.856 1.00 17.69  ? 121  VAL A C   1 
ATOM   972   O O   . VAL A 1 121 ? 35.405  -33.315 -42.826 1.00 24.97  ? 121  VAL A O   1 
ATOM   973   C CB  . VAL A 1 121 ? 35.499  -33.797 -46.064 1.00 6.74   ? 121  VAL A CB  1 
ATOM   974   C CG1 . VAL A 1 121 ? 34.984  -34.988 -45.309 1.00 4.65   ? 121  VAL A CG1 1 
ATOM   975   C CG2 . VAL A 1 121 ? 34.628  -33.556 -47.260 1.00 3.02   ? 121  VAL A CG2 1 
ATOM   976   N N   . VAL A 1 122 ? 37.313  -32.962 -43.913 1.00 9.06   ? 122  VAL A N   1 
ATOM   977   C CA  . VAL A 1 122 ? 38.080  -33.230 -42.724 1.00 13.35  ? 122  VAL A CA  1 
ATOM   978   C C   . VAL A 1 122 ? 37.671  -32.278 -41.631 1.00 18.92  ? 122  VAL A C   1 
ATOM   979   O O   . VAL A 1 122 ? 37.388  -32.668 -40.474 1.00 19.82  ? 122  VAL A O   1 
ATOM   980   C CB  . VAL A 1 122 ? 39.576  -33.077 -43.007 1.00 16.00  ? 122  VAL A CB  1 
ATOM   981   C CG1 . VAL A 1 122 ? 40.344  -33.235 -41.732 1.00 13.10  ? 122  VAL A CG1 1 
ATOM   982   C CG2 . VAL A 1 122 ? 40.015  -34.193 -43.902 1.00 11.75  ? 122  VAL A CG2 1 
ATOM   983   N N   . ASN A 1 123 ? 37.533  -31.018 -42.025 1.00 15.18  ? 123  ASN A N   1 
ATOM   984   C CA  . ASN A 1 123 ? 37.079  -30.080 -41.019 1.00 12.95  ? 123  ASN A CA  1 
ATOM   985   C C   . ASN A 1 123 ? 35.712  -30.362 -40.408 1.00 15.30  ? 123  ASN A C   1 
ATOM   986   O O   . ASN A 1 123 ? 35.544  -30.268 -39.179 1.00 18.14  ? 123  ASN A O   1 
ATOM   987   C CB  . ASN A 1 123 ? 37.111  -28.649 -41.401 1.00 20.55  ? 123  ASN A CB  1 
ATOM   988   C CG  . ASN A 1 123 ? 36.872  -27.770 -40.155 1.00 82.12  ? 123  ASN A CG  1 
ATOM   989   O OD1 . ASN A 1 123 ? 37.452  -28.012 -39.021 1.00 69.87  ? 123  ASN A OD1 1 
ATOM   990   N ND2 . ASN A 1 123 ? 35.985  -26.761 -40.348 1.00 34.52  ? 123  ASN A ND2 1 
ATOM   991   N N   . MET A 1 124 ? 34.722  -30.707 -41.227 1.00 5.42   ? 124  MET A N   1 
ATOM   992   C CA  . MET A 1 124 ? 33.415  -31.034 -40.666 1.00 2.66   ? 124  MET A CA  1 
ATOM   993   C C   . MET A 1 124 ? 33.575  -32.126 -39.697 1.00 12.04  ? 124  MET A C   1 
ATOM   994   O O   . MET A 1 124 ? 32.952  -32.111 -38.636 1.00 15.26  ? 124  MET A O   1 
ATOM   995   C CB  . MET A 1 124 ? 32.497  -31.713 -41.646 1.00 3.56   ? 124  MET A CB  1 
ATOM   996   C CG  . MET A 1 124 ? 32.544  -31.102 -43.014 1.00 11.59  ? 124  MET A CG  1 
ATOM   997   S SD  . MET A 1 124 ? 31.339  -31.934 -44.038 1.00 14.50  ? 124  MET A SD  1 
ATOM   998   C CE  . MET A 1 124 ? 31.469  -30.779 -45.396 1.00 8.18   ? 124  MET A CE  1 
ATOM   999   N N   . ALA A 1 125 ? 34.408  -33.092 -40.102 1.00 8.41   ? 125  ALA A N   1 
ATOM   1000  C CA  . ALA A 1 125 ? 34.588  -34.245 -39.207 1.00 8.92   ? 125  ALA A CA  1 
ATOM   1001  C C   . ALA A 1 125 ? 35.060  -33.761 -37.879 1.00 16.57  ? 125  ALA A C   1 
ATOM   1002  O O   . ALA A 1 125 ? 34.451  -34.033 -36.859 1.00 19.75  ? 125  ALA A O   1 
ATOM   1003  C CB  . ALA A 1 125 ? 35.608  -35.224 -39.737 1.00 6.67   ? 125  ALA A CB  1 
ATOM   1004  N N   . GLN A 1 126 ? 36.119  -32.965 -37.911 1.00 7.08   ? 126  GLN A N   1 
ATOM   1005  C CA  . GLN A 1 126 ? 36.622  -32.493 -36.638 1.00 3.18   ? 126  GLN A CA  1 
ATOM   1006  C C   . GLN A 1 126 ? 35.664  -31.677 -35.807 1.00 13.31  ? 126  GLN A C   1 
ATOM   1007  O O   . GLN A 1 126 ? 35.582  -31.837 -34.576 1.00 13.84  ? 126  GLN A O   1 
ATOM   1008  C CB  . GLN A 1 126 ? 37.865  -31.709 -36.867 1.00 6.18   ? 126  GLN A CB  1 
ATOM   1009  C CG  . GLN A 1 126 ? 39.044  -32.532 -37.507 1.00 22.38  ? 126  GLN A CG  1 
ATOM   1010  C CD  . GLN A 1 126 ? 40.349  -31.696 -37.600 1.00 27.21  ? 126  GLN A CD  1 
ATOM   1011  O OE1 . GLN A 1 126 ? 40.669  -31.196 -38.691 1.00 47.66  ? 126  GLN A OE1 1 
ATOM   1012  N NE2 . GLN A 1 126 ? 40.916  -31.271 -36.439 1.00 31.54  ? 126  GLN A NE2 1 
ATOM   1013  N N   . LYS A 1 127 ? 34.930  -30.776 -36.462 1.00 6.91   ? 127  LYS A N   1 
ATOM   1014  C CA  . LYS A 1 127 ? 34.042  -29.965 -35.702 1.00 7.02   ? 127  LYS A CA  1 
ATOM   1015  C C   . LYS A 1 127 ? 32.981  -30.791 -35.061 1.00 12.38  ? 127  LYS A C   1 
ATOM   1016  O O   . LYS A 1 127 ? 32.604  -30.581 -33.905 1.00 11.43  ? 127  LYS A O   1 
ATOM   1017  C CB  . LYS A 1 127 ? 33.343  -29.059 -36.651 1.00 19.18  ? 127  LYS A CB  1 
ATOM   1018  C CG  . LYS A 1 127 ? 34.182  -27.909 -37.144 1.00 13.43  ? 127  LYS A CG  1 
ATOM   1019  C CD  . LYS A 1 127 ? 34.181  -26.746 -36.156 1.00 6.89   ? 127  LYS A CD  1 
ATOM   1020  C CE  . LYS A 1 127 ? 35.531  -25.953 -36.116 1.00 6.90   ? 127  LYS A CE  1 
ATOM   1021  N NZ  . LYS A 1 127 ? 36.645  -26.733 -35.476 1.00 114.42 ? 127  LYS A NZ  1 
ATOM   1022  N N   . ALA A 1 128 ? 32.446  -31.708 -35.875 1.00 5.41   ? 128  ALA A N   1 
ATOM   1023  C CA  . ALA A 1 128 ? 31.378  -32.531 -35.411 1.00 1.00   ? 128  ALA A CA  1 
ATOM   1024  C C   . ALA A 1 128 ? 31.813  -33.267 -34.174 1.00 6.77   ? 128  ALA A C   1 
ATOM   1025  O O   . ALA A 1 128 ? 31.169  -33.277 -33.126 1.00 9.61   ? 128  ALA A O   1 
ATOM   1026  C CB  . ALA A 1 128 ? 30.997  -33.471 -36.487 1.00 1.00   ? 128  ALA A CB  1 
ATOM   1027  N N   . ILE A 1 129 ? 32.938  -33.910 -34.332 1.00 4.19   ? 129  ILE A N   1 
ATOM   1028  C CA  . ILE A 1 129 ? 33.504  -34.791 -33.324 1.00 8.94   ? 129  ILE A CA  1 
ATOM   1029  C C   . ILE A 1 129 ? 33.846  -34.077 -32.069 1.00 12.61  ? 129  ILE A C   1 
ATOM   1030  O O   . ILE A 1 129 ? 33.708  -34.548 -30.954 1.00 22.81  ? 129  ILE A O   1 
ATOM   1031  C CB  . ILE A 1 129 ? 34.866  -35.396 -33.706 1.00 20.48  ? 129  ILE A CB  1 
ATOM   1032  C CG1 . ILE A 1 129 ? 34.865  -36.331 -34.872 1.00 16.28  ? 129  ILE A CG1 1 
ATOM   1033  C CG2 . ILE A 1 129 ? 35.191  -36.274 -32.551 1.00 34.42  ? 129  ILE A CG2 1 
ATOM   1034  C CD1 . ILE A 1 129 ? 33.432  -36.741 -34.942 1.00 9.85   ? 129  ILE A CD1 1 
ATOM   1035  N N   . ILE A 1 130 ? 34.440  -32.967 -32.258 1.00 8.64   ? 130  ILE A N   1 
ATOM   1036  C CA  . ILE A 1 130 ? 34.901  -32.216 -31.116 1.00 10.81  ? 130  ILE A CA  1 
ATOM   1037  C C   . ILE A 1 130 ? 33.971  -31.181 -30.535 1.00 10.87  ? 130  ILE A C   1 
ATOM   1038  O O   . ILE A 1 130 ? 33.911  -31.012 -29.341 1.00 13.33  ? 130  ILE A O   1 
ATOM   1039  C CB  . ILE A 1 130 ? 36.079  -31.437 -31.592 1.00 15.81  ? 130  ILE A CB  1 
ATOM   1040  C CG1 . ILE A 1 130 ? 37.148  -32.412 -31.944 1.00 19.12  ? 130  ILE A CG1 1 
ATOM   1041  C CG2 . ILE A 1 130 ? 36.645  -30.617 -30.483 1.00 6.62   ? 130  ILE A CG2 1 
ATOM   1042  C CD1 . ILE A 1 130 ? 38.287  -31.650 -32.562 1.00 24.97  ? 130  ILE A CD1 1 
ATOM   1043  N N   . ARG A 1 131 ? 33.290  -30.461 -31.382 1.00 3.96   ? 131  ARG A N   1 
ATOM   1044  C CA  . ARG A 1 131 ? 32.504  -29.385 -30.906 1.00 1.93   ? 131  ARG A CA  1 
ATOM   1045  C C   . ARG A 1 131 ? 31.058  -29.643 -30.695 1.00 6.36   ? 131  ARG A C   1 
ATOM   1046  O O   . ARG A 1 131 ? 30.544  -29.124 -29.721 1.00 12.60  ? 131  ARG A O   1 
ATOM   1047  C CB  . ARG A 1 131 ? 32.889  -28.154 -31.748 1.00 4.26   ? 131  ARG A CB  1 
ATOM   1048  C CG  . ARG A 1 131 ? 32.104  -26.850 -31.655 1.00 23.64  ? 131  ARG A CG  1 
ATOM   1049  C CD  . ARG A 1 131 ? 33.017  -25.653 -32.017 1.00 14.16  ? 131  ARG A CD  1 
ATOM   1050  N NE  . ARG A 1 131 ? 34.319  -25.903 -31.372 1.00 66.89  ? 131  ARG A NE  1 
ATOM   1051  C CZ  . ARG A 1 131 ? 35.286  -25.004 -31.375 1.00 94.72  ? 131  ARG A CZ  1 
ATOM   1052  N NH1 . ARG A 1 131 ? 35.042  -23.840 -32.033 1.00 9.97   ? 131  ARG A NH1 1 
ATOM   1053  N NH2 . ARG A 1 131 ? 36.464  -25.282 -30.726 1.00 69.95  ? 131  ARG A NH2 1 
ATOM   1054  N N   . TYR A 1 132 ? 30.435  -30.479 -31.537 1.00 7.37   ? 132  TYR A N   1 
ATOM   1055  C CA  . TYR A 1 132 ? 29.001  -30.758 -31.436 1.00 3.84   ? 132  TYR A CA  1 
ATOM   1056  C C   . TYR A 1 132 ? 28.534  -32.067 -30.855 1.00 8.16   ? 132  TYR A C   1 
ATOM   1057  O O   . TYR A 1 132 ? 27.742  -32.109 -29.879 1.00 8.00   ? 132  TYR A O   1 
ATOM   1058  C CB  . TYR A 1 132 ? 28.366  -30.554 -32.821 1.00 7.62   ? 132  TYR A CB  1 
ATOM   1059  C CG  . TYR A 1 132 ? 28.539  -29.093 -33.227 1.00 9.15   ? 132  TYR A CG  1 
ATOM   1060  C CD1 . TYR A 1 132 ? 27.800  -28.078 -32.616 1.00 3.85   ? 132  TYR A CD1 1 
ATOM   1061  C CD2 . TYR A 1 132 ? 29.576  -28.701 -34.081 1.00 7.21   ? 132  TYR A CD2 1 
ATOM   1062  C CE1 . TYR A 1 132 ? 27.970  -26.735 -32.946 1.00 1.00   ? 132  TYR A CE1 1 
ATOM   1063  C CE2 . TYR A 1 132 ? 29.835  -27.349 -34.333 1.00 1.61   ? 132  TYR A CE2 1 
ATOM   1064  C CZ  . TYR A 1 132 ? 29.023  -26.357 -33.783 1.00 1.00   ? 132  TYR A CZ  1 
ATOM   1065  O OH  . TYR A 1 132 ? 29.227  -25.014 -34.049 1.00 21.40  ? 132  TYR A OH  1 
ATOM   1066  N N   . PHE A 1 133 ? 28.925  -33.149 -31.513 1.00 5.39   ? 133  PHE A N   1 
ATOM   1067  C CA  . PHE A 1 133 ? 28.483  -34.476 -31.083 1.00 2.99   ? 133  PHE A CA  1 
ATOM   1068  C C   . PHE A 1 133 ? 28.592  -34.727 -29.572 1.00 14.49  ? 133  PHE A C   1 
ATOM   1069  O O   . PHE A 1 133 ? 27.767  -35.336 -28.860 1.00 18.06  ? 133  PHE A O   1 
ATOM   1070  C CB  . PHE A 1 133 ? 29.202  -35.540 -31.897 1.00 3.33   ? 133  PHE A CB  1 
ATOM   1071  C CG  . PHE A 1 133 ? 28.643  -35.575 -33.296 1.00 7.26   ? 133  PHE A CG  1 
ATOM   1072  C CD1 . PHE A 1 133 ? 27.580  -34.742 -33.654 1.00 8.71   ? 133  PHE A CD1 1 
ATOM   1073  C CD2 . PHE A 1 133 ? 29.132  -36.460 -34.261 1.00 7.41   ? 133  PHE A CD2 1 
ATOM   1074  C CE1 . PHE A 1 133 ? 27.076  -34.745 -34.960 1.00 10.38  ? 133  PHE A CE1 1 
ATOM   1075  C CE2 . PHE A 1 133 ? 28.604  -36.516 -35.556 1.00 6.55   ? 133  PHE A CE2 1 
ATOM   1076  C CZ  . PHE A 1 133 ? 27.594  -35.621 -35.921 1.00 4.10   ? 133  PHE A CZ  1 
ATOM   1077  N N   . PRO A 1 134 ? 29.633  -34.202 -29.028 1.00 8.58   ? 134  PRO A N   1 
ATOM   1078  C CA  . PRO A 1 134 ? 29.852  -34.452 -27.619 1.00 2.15   ? 134  PRO A CA  1 
ATOM   1079  C C   . PRO A 1 134 ? 28.847  -33.855 -26.650 1.00 13.92  ? 134  PRO A C   1 
ATOM   1080  O O   . PRO A 1 134 ? 28.586  -34.388 -25.583 1.00 16.26  ? 134  PRO A O   1 
ATOM   1081  C CB  . PRO A 1 134 ? 31.275  -34.041 -27.378 1.00 1.00   ? 134  PRO A CB  1 
ATOM   1082  C CG  . PRO A 1 134 ? 32.004  -34.067 -28.700 1.00 1.00   ? 134  PRO A CG  1 
ATOM   1083  C CD  . PRO A 1 134 ? 30.913  -34.010 -29.770 1.00 6.64   ? 134  PRO A CD  1 
ATOM   1084  N N   . VAL A 1 135 ? 28.250  -32.765 -27.076 1.00 12.60  ? 135  VAL A N   1 
ATOM   1085  C CA  . VAL A 1 135 ? 27.313  -32.027 -26.305 1.00 3.53   ? 135  VAL A CA  1 
ATOM   1086  C C   . VAL A 1 135 ? 26.037  -32.805 -26.271 1.00 9.74   ? 135  VAL A C   1 
ATOM   1087  O O   . VAL A 1 135 ? 25.413  -33.007 -25.249 1.00 15.21  ? 135  VAL A O   1 
ATOM   1088  C CB  . VAL A 1 135 ? 27.150  -30.608 -26.923 1.00 1.00   ? 135  VAL A CB  1 
ATOM   1089  C CG1 . VAL A 1 135 ? 26.150  -29.727 -26.188 1.00 1.00   ? 135  VAL A CG1 1 
ATOM   1090  C CG2 . VAL A 1 135 ? 28.432  -29.832 -26.892 1.00 1.00   ? 135  VAL A CG2 1 
ATOM   1091  N N   . PHE A 1 136 ? 25.693  -33.251 -27.429 1.00 1.86   ? 136  PHE A N   1 
ATOM   1092  C CA  . PHE A 1 136 ? 24.462  -33.956 -27.535 1.00 1.00   ? 136  PHE A CA  1 
ATOM   1093  C C   . PHE A 1 136 ? 24.557  -35.297 -26.912 1.00 7.71   ? 136  PHE A C   1 
ATOM   1094  O O   . PHE A 1 136 ? 23.642  -35.699 -26.205 1.00 13.38  ? 136  PHE A O   1 
ATOM   1095  C CB  . PHE A 1 136 ? 24.085  -34.062 -29.008 1.00 2.78   ? 136  PHE A CB  1 
ATOM   1096  C CG  . PHE A 1 136 ? 23.951  -32.663 -29.554 1.00 6.31   ? 136  PHE A CG  1 
ATOM   1097  C CD1 . PHE A 1 136 ? 23.108  -31.752 -28.915 1.00 3.72   ? 136  PHE A CD1 1 
ATOM   1098  C CD2 . PHE A 1 136 ? 24.660  -32.208 -30.670 1.00 8.93   ? 136  PHE A CD2 1 
ATOM   1099  C CE1 . PHE A 1 136 ? 22.901  -30.471 -29.442 1.00 3.55   ? 136  PHE A CE1 1 
ATOM   1100  C CE2 . PHE A 1 136 ? 24.485  -30.914 -31.183 1.00 8.46   ? 136  PHE A CE2 1 
ATOM   1101  C CZ  . PHE A 1 136 ? 23.587  -30.032 -30.580 1.00 1.00   ? 136  PHE A CZ  1 
ATOM   1102  N N   . GLU A 1 137 ? 25.670  -35.986 -27.194 1.00 5.46   ? 137  GLU A N   1 
ATOM   1103  C CA  . GLU A 1 137 ? 25.880  -37.278 -26.598 1.00 8.33   ? 137  GLU A CA  1 
ATOM   1104  C C   . GLU A 1 137 ? 25.729  -37.198 -25.070 1.00 15.69  ? 137  GLU A C   1 
ATOM   1105  O O   . GLU A 1 137 ? 24.999  -37.920 -24.403 1.00 20.46  ? 137  GLU A O   1 
ATOM   1106  C CB  . GLU A 1 137 ? 27.242  -37.794 -26.964 1.00 9.05   ? 137  GLU A CB  1 
ATOM   1107  C CG  . GLU A 1 137 ? 27.466  -39.176 -26.378 1.00 4.06   ? 137  GLU A CG  1 
ATOM   1108  C CD  . GLU A 1 137 ? 27.083  -40.345 -27.247 1.00 26.79  ? 137  GLU A CD  1 
ATOM   1109  O OE1 . GLU A 1 137 ? 26.387  -40.274 -28.240 1.00 17.69  ? 137  GLU A OE1 1 
ATOM   1110  O OE2 . GLU A 1 137 ? 27.568  -41.465 -26.768 1.00 30.49  ? 137  GLU A OE2 1 
ATOM   1111  N N   . LYS A 1 138 ? 26.339  -36.221 -24.489 1.00 5.87   ? 138  LYS A N   1 
ATOM   1112  C CA  . LYS A 1 138 ? 26.209  -36.072 -23.072 1.00 1.66   ? 138  LYS A CA  1 
ATOM   1113  C C   . LYS A 1 138 ? 24.837  -35.697 -22.612 1.00 15.78  ? 138  LYS A C   1 
ATOM   1114  O O   . LYS A 1 138 ? 24.439  -36.027 -21.542 1.00 21.84  ? 138  LYS A O   1 
ATOM   1115  C CB  . LYS A 1 138 ? 27.229  -35.068 -22.600 1.00 1.00   ? 138  LYS A CB  1 
ATOM   1116  C CG  . LYS A 1 138 ? 26.950  -34.485 -21.233 1.00 28.85  ? 138  LYS A CG  1 
ATOM   1117  C CD  . LYS A 1 138 ? 28.177  -33.785 -20.583 1.00 12.27  ? 138  LYS A CD  1 
ATOM   1118  C CE  . LYS A 1 138 ? 27.833  -32.918 -19.356 1.00 131.11 ? 138  LYS A CE  1 
ATOM   1119  N NZ  . LYS A 1 138 ? 29.002  -32.311 -18.681 1.00 165.74 ? 138  LYS A NZ  1 
ATOM   1120  N N   . ILE A 1 139 ? 24.121  -34.940 -23.379 1.00 16.05  ? 139  ILE A N   1 
ATOM   1121  C CA  . ILE A 1 139 ? 22.802  -34.548 -22.951 1.00 11.73  ? 139  ILE A CA  1 
ATOM   1122  C C   . ILE A 1 139 ? 21.942  -35.750 -22.775 1.00 18.87  ? 139  ILE A C   1 
ATOM   1123  O O   . ILE A 1 139 ? 21.284  -35.926 -21.756 1.00 25.87  ? 139  ILE A O   1 
ATOM   1124  C CB  . ILE A 1 139 ? 22.205  -33.660 -24.022 1.00 10.22  ? 139  ILE A CB  1 
ATOM   1125  C CG1 . ILE A 1 139 ? 22.773  -32.302 -23.732 1.00 2.56   ? 139  ILE A CG1 1 
ATOM   1126  C CG2 . ILE A 1 139 ? 20.683  -33.588 -23.970 1.00 3.44   ? 139  ILE A CG2 1 
ATOM   1127  C CD1 . ILE A 1 139 ? 22.383  -31.264 -24.753 1.00 11.94  ? 139  ILE A CD1 1 
ATOM   1128  N N   . LEU A 1 140 ? 21.975  -36.526 -23.830 1.00 8.73   ? 140  LEU A N   1 
ATOM   1129  C CA  . LEU A 1 140 ? 21.224  -37.754 -23.974 1.00 9.66   ? 140  LEU A CA  1 
ATOM   1130  C C   . LEU A 1 140 ? 21.605  -38.762 -22.949 1.00 19.86  ? 140  LEU A C   1 
ATOM   1131  O O   . LEU A 1 140 ? 20.761  -39.526 -22.479 1.00 20.31  ? 140  LEU A O   1 
ATOM   1132  C CB  . LEU A 1 140 ? 21.597  -38.428 -25.303 1.00 7.37   ? 140  LEU A CB  1 
ATOM   1133  C CG  . LEU A 1 140 ? 21.006  -37.687 -26.483 1.00 12.43  ? 140  LEU A CG  1 
ATOM   1134  C CD1 . LEU A 1 140 ? 21.488  -38.332 -27.754 1.00 11.57  ? 140  LEU A CD1 1 
ATOM   1135  C CD2 . LEU A 1 140 ? 19.498  -37.807 -26.403 1.00 1.00   ? 140  LEU A CD2 1 
ATOM   1136  N N   . ARG A 1 141 ? 22.916  -38.853 -22.764 1.00 18.13  ? 141  ARG A N   1 
ATOM   1137  C CA  . ARG A 1 141 ? 23.457  -39.809 -21.836 1.00 15.20  ? 141  ARG A CA  1 
ATOM   1138  C C   . ARG A 1 141 ? 23.018  -39.338 -20.497 1.00 23.36  ? 141  ARG A C   1 
ATOM   1139  O O   . ARG A 1 141 ? 22.703  -40.049 -19.582 1.00 26.77  ? 141  ARG A O   1 
ATOM   1140  C CB  . ARG A 1 141 ? 24.978  -39.901 -21.909 1.00 12.08  ? 141  ARG A CB  1 
ATOM   1141  C CG  . ARG A 1 141 ? 25.688  -40.726 -20.811 1.00 15.77  ? 141  ARG A CG  1 
ATOM   1142  C CD  . ARG A 1 141 ? 27.043  -41.428 -21.238 1.00 39.51  ? 141  ARG A CD  1 
ATOM   1143  N NE  . ARG A 1 141 ? 27.899  -42.121 -20.190 1.00 24.05  ? 141  ARG A NE  1 
ATOM   1144  C CZ  . ARG A 1 141 ? 28.102  -41.696 -18.920 1.00 157.26 ? 141  ARG A CZ  1 
ATOM   1145  N NH1 . ARG A 1 141 ? 27.557  -40.566 -18.437 1.00 197.13 ? 141  ARG A NH1 1 
ATOM   1146  N NH2 . ARG A 1 141 ? 28.895  -42.415 -18.118 1.00 188.07 ? 141  ARG A NH2 1 
ATOM   1147  N N   . GLY A 1 142 ? 22.891  -38.079 -20.370 1.00 26.73  ? 142  GLY A N   1 
ATOM   1148  C CA  . GLY A 1 142 ? 22.512  -37.640 -19.070 1.00 22.08  ? 142  GLY A CA  1 
ATOM   1149  C C   . GLY A 1 142 ? 21.074  -37.829 -18.656 1.00 28.74  ? 142  GLY A C   1 
ATOM   1150  O O   . GLY A 1 142 ? 20.805  -37.775 -17.494 1.00 37.30  ? 142  GLY A O   1 
ATOM   1151  N N   . HIS A 1 143 ? 20.112  -37.974 -19.549 1.00 26.32  ? 143  HIS A N   1 
ATOM   1152  C CA  . HIS A 1 143 ? 18.720  -38.066 -19.084 1.00 15.58  ? 143  HIS A CA  1 
ATOM   1153  C C   . HIS A 1 143 ? 18.046  -39.349 -19.514 1.00 22.64  ? 143  HIS A C   1 
ATOM   1154  O O   . HIS A 1 143 ? 16.942  -39.681 -19.077 1.00 32.45  ? 143  HIS A O   1 
ATOM   1155  C CB  . HIS A 1 143 ? 17.866  -36.837 -19.511 1.00 12.14  ? 143  HIS A CB  1 
ATOM   1156  C CG  . HIS A 1 143 ? 17.804  -36.549 -21.007 1.00 16.77  ? 143  HIS A CG  1 
ATOM   1157  N ND1 . HIS A 1 143 ? 17.763  -37.556 -21.979 1.00 18.94  ? 143  HIS A ND1 1 
ATOM   1158  C CD2 . HIS A 1 143 ? 17.726  -35.354 -21.650 1.00 14.09  ? 143  HIS A CD2 1 
ATOM   1159  C CE1 . HIS A 1 143 ? 17.684  -36.959 -23.143 1.00 18.89  ? 143  HIS A CE1 1 
ATOM   1160  N NE2 . HIS A 1 143 ? 17.658  -35.631 -22.976 1.00 16.83  ? 143  HIS A NE2 1 
ATOM   1161  N N   . GLY A 1 144 ? 18.723  -40.040 -20.426 1.00 12.56  ? 144  GLY A N   1 
ATOM   1162  C CA  . GLY A 1 144 ? 18.273  -41.288 -20.951 1.00 11.41  ? 144  GLY A CA  1 
ATOM   1163  C C   . GLY A 1 144 ? 17.069  -41.207 -21.882 1.00 29.14  ? 144  GLY A C   1 
ATOM   1164  O O   . GLY A 1 144 ? 16.646  -42.273 -22.321 1.00 40.79  ? 144  GLY A O   1 
ATOM   1165  N N   . GLN A 1 145 ? 16.523  -39.993 -22.133 1.00 18.28  ? 145  GLN A N   1 
ATOM   1166  C CA  . GLN A 1 145 ? 15.364  -39.908 -23.026 1.00 11.15  ? 145  GLN A CA  1 
ATOM   1167  C C   . GLN A 1 145 ? 15.675  -39.991 -24.490 1.00 10.67  ? 145  GLN A C   1 
ATOM   1168  O O   . GLN A 1 145 ? 16.851  -40.027 -24.913 1.00 11.31  ? 145  GLN A O   1 
ATOM   1169  C CB  . GLN A 1 145 ? 14.412  -38.820 -22.642 1.00 10.79  ? 145  GLN A CB  1 
ATOM   1170  C CG  . GLN A 1 145 ? 14.466  -38.807 -21.116 1.00 13.73  ? 145  GLN A CG  1 
ATOM   1171  C CD  . GLN A 1 145 ? 13.664  -37.663 -20.605 1.00 15.92  ? 145  GLN A CD  1 
ATOM   1172  O OE1 . GLN A 1 145 ? 13.920  -36.493 -20.976 1.00 39.77  ? 145  GLN A OE1 1 
ATOM   1173  N NE2 . GLN A 1 145 ? 12.577  -37.993 -19.963 1.00 27.22  ? 145  GLN A NE2 1 
ATOM   1174  N N   . SER A 1 146 ? 14.630  -40.131 -25.269 1.00 7.31   ? 146  SER A N   1 
ATOM   1175  C CA  . SER A 1 146 ? 14.904  -40.264 -26.687 1.00 15.43  ? 146  SER A CA  1 
ATOM   1176  C C   . SER A 1 146 ? 14.933  -38.951 -27.449 1.00 19.58  ? 146  SER A C   1 
ATOM   1177  O O   . SER A 1 146 ? 15.180  -38.979 -28.633 1.00 20.76  ? 146  SER A O   1 
ATOM   1178  C CB  . SER A 1 146 ? 14.035  -41.263 -27.430 1.00 23.42  ? 146  SER A CB  1 
ATOM   1179  O OG  . SER A 1 146 ? 13.554  -42.290 -26.576 1.00 23.75  ? 146  SER A OG  1 
ATOM   1180  N N   . PHE A 1 147 ? 14.710  -37.859 -26.743 1.00 12.42  ? 147  PHE A N   1 
ATOM   1181  C CA  . PHE A 1 147 ? 14.698  -36.542 -27.272 1.00 12.85  ? 147  PHE A CA  1 
ATOM   1182  C C   . PHE A 1 147 ? 15.642  -35.701 -26.516 1.00 17.51  ? 147  PHE A C   1 
ATOM   1183  O O   . PHE A 1 147 ? 15.812  -35.940 -25.349 1.00 17.01  ? 147  PHE A O   1 
ATOM   1184  C CB  . PHE A 1 147 ? 13.341  -35.975 -26.973 1.00 16.68  ? 147  PHE A CB  1 
ATOM   1185  C CG  . PHE A 1 147 ? 12.380  -36.899 -27.617 1.00 15.38  ? 147  PHE A CG  1 
ATOM   1186  C CD1 . PHE A 1 147 ? 12.341  -36.977 -29.006 1.00 14.47  ? 147  PHE A CD1 1 
ATOM   1187  C CD2 . PHE A 1 147 ? 11.562  -37.739 -26.876 1.00 16.29  ? 147  PHE A CD2 1 
ATOM   1188  C CE1 . PHE A 1 147 ? 11.452  -37.796 -29.702 1.00 10.70  ? 147  PHE A CE1 1 
ATOM   1189  C CE2 . PHE A 1 147 ? 10.695  -38.596 -27.559 1.00 12.98  ? 147  PHE A CE2 1 
ATOM   1190  C CZ  . PHE A 1 147 ? 10.632  -38.634 -28.952 1.00 2.23   ? 147  PHE A CZ  1 
ATOM   1191  N N   . LEU A 1 148 ? 16.197  -34.700 -27.186 1.00 14.06  ? 148  LEU A N   1 
ATOM   1192  C CA  . LEU A 1 148 ? 17.160  -33.803 -26.575 1.00 7.29   ? 148  LEU A CA  1 
ATOM   1193  C C   . LEU A 1 148 ? 16.584  -32.998 -25.435 1.00 14.68  ? 148  LEU A C   1 
ATOM   1194  O O   . LEU A 1 148 ? 17.243  -32.715 -24.381 1.00 11.93  ? 148  LEU A O   1 
ATOM   1195  C CB  . LEU A 1 148 ? 17.660  -32.816 -27.609 1.00 1.53   ? 148  LEU A CB  1 
ATOM   1196  C CG  . LEU A 1 148 ? 18.662  -33.475 -28.506 1.00 8.09   ? 148  LEU A CG  1 
ATOM   1197  C CD1 . LEU A 1 148 ? 18.950  -32.454 -29.568 1.00 6.61   ? 148  LEU A CD1 1 
ATOM   1198  C CD2 . LEU A 1 148 ? 19.948  -33.775 -27.746 1.00 3.81   ? 148  LEU A CD2 1 
ATOM   1199  N N   . VAL A 1 149 ? 15.357  -32.586 -25.706 1.00 7.19   ? 149  VAL A N   1 
ATOM   1200  C CA  . VAL A 1 149 ? 14.653  -31.736 -24.789 1.00 8.20   ? 149  VAL A CA  1 
ATOM   1201  C C   . VAL A 1 149 ? 13.185  -32.115 -24.638 1.00 17.89  ? 149  VAL A C   1 
ATOM   1202  O O   . VAL A 1 149 ? 12.473  -32.440 -25.620 1.00 13.91  ? 149  VAL A O   1 
ATOM   1203  C CB  . VAL A 1 149 ? 14.743  -30.261 -25.210 1.00 8.40   ? 149  VAL A CB  1 
ATOM   1204  C CG1 . VAL A 1 149 ? 13.966  -29.313 -24.277 1.00 4.74   ? 149  VAL A CG1 1 
ATOM   1205  C CG2 . VAL A 1 149 ? 16.177  -29.778 -25.423 1.00 7.52   ? 149  VAL A CG2 1 
ATOM   1206  N N   . GLY A 1 150 ? 12.790  -32.052 -23.365 1.00 11.92  ? 150  GLY A N   1 
ATOM   1207  C CA  . GLY A 1 150 ? 11.440  -32.286 -22.887 1.00 14.38  ? 150  GLY A CA  1 
ATOM   1208  C C   . GLY A 1 150 ? 10.779  -33.634 -23.188 1.00 20.27  ? 150  GLY A C   1 
ATOM   1209  O O   . GLY A 1 150 ? 9.559   -33.770 -23.168 1.00 25.89  ? 150  GLY A O   1 
ATOM   1210  N N   . ASN A 1 151 ? 11.567  -34.602 -23.501 1.00 19.63  ? 151  ASN A N   1 
ATOM   1211  C CA  . ASN A 1 151 ? 11.018  -35.895 -23.772 1.00 19.72  ? 151  ASN A CA  1 
ATOM   1212  C C   . ASN A 1 151 ? 9.974   -35.921 -24.813 1.00 18.61  ? 151  ASN A C   1 
ATOM   1213  O O   . ASN A 1 151 ? 9.052   -36.690 -24.789 1.00 28.97  ? 151  ASN A O   1 
ATOM   1214  C CB  . ASN A 1 151 ? 10.559  -36.575 -22.509 1.00 14.88  ? 151  ASN A CB  1 
ATOM   1215  C CG  . ASN A 1 151 ? 10.685  -38.056 -22.597 1.00 30.62  ? 151  ASN A CG  1 
ATOM   1216  O OD1 . ASN A 1 151 ? 11.404  -38.684 -23.411 1.00 33.31  ? 151  ASN A OD1 1 
ATOM   1217  N ND2 . ASN A 1 151 ? 9.828   -38.610 -21.807 1.00 19.00  ? 151  ASN A ND2 1 
ATOM   1218  N N   . GLN A 1 152 ? 10.139  -35.022 -25.704 1.00 18.45  ? 152  GLN A N   1 
ATOM   1219  C CA  . GLN A 1 152 ? 9.317   -34.930 -26.872 1.00 16.11  ? 152  GLN A CA  1 
ATOM   1220  C C   . GLN A 1 152 ? 10.136  -34.375 -28.024 1.00 21.81  ? 152  GLN A C   1 
ATOM   1221  O O   . GLN A 1 152 ? 11.205  -33.749 -27.855 1.00 26.92  ? 152  GLN A O   1 
ATOM   1222  C CB  . GLN A 1 152 ? 7.997   -34.209 -26.662 1.00 11.65  ? 152  GLN A CB  1 
ATOM   1223  C CG  . GLN A 1 152 ? 8.118   -32.736 -26.274 1.00 50.81  ? 152  GLN A CG  1 
ATOM   1224  C CD  . GLN A 1 152 ? 6.831   -32.044 -26.645 1.00 60.65  ? 152  GLN A CD  1 
ATOM   1225  O OE1 . GLN A 1 152 ? 5.788   -32.627 -26.336 1.00 31.26  ? 152  GLN A OE1 1 
ATOM   1226  N NE2 . GLN A 1 152 ? 6.896   -30.904 -27.374 1.00 39.42  ? 152  GLN A NE2 1 
ATOM   1227  N N   . LEU A 1 153 ? 9.664   -34.675 -29.201 1.00 9.82   ? 153  LEU A N   1 
ATOM   1228  C CA  . LEU A 1 153 ? 10.347  -34.213 -30.370 1.00 8.50   ? 153  LEU A CA  1 
ATOM   1229  C C   . LEU A 1 153 ? 10.285  -32.695 -30.402 1.00 17.38  ? 153  LEU A C   1 
ATOM   1230  O O   . LEU A 1 153 ? 9.276   -32.087 -30.053 1.00 22.43  ? 153  LEU A O   1 
ATOM   1231  C CB  . LEU A 1 153 ? 9.708   -34.859 -31.601 1.00 7.95   ? 153  LEU A CB  1 
ATOM   1232  C CG  . LEU A 1 153 ? 10.396  -34.674 -32.941 1.00 9.93   ? 153  LEU A CG  1 
ATOM   1233  C CD1 . LEU A 1 153 ? 11.643  -35.530 -33.061 1.00 4.74   ? 153  LEU A CD1 1 
ATOM   1234  C CD2 . LEU A 1 153 ? 9.439   -35.079 -34.020 1.00 1.00   ? 153  LEU A CD2 1 
ATOM   1235  N N   . SER A 1 154 ? 11.401  -32.133 -30.813 1.00 9.75   ? 154  SER A N   1 
ATOM   1236  C CA  . SER A 1 154 ? 11.582  -30.738 -30.909 1.00 5.01   ? 154  SER A CA  1 
ATOM   1237  C C   . SER A 1 154 ? 12.282  -30.446 -32.192 1.00 12.22  ? 154  SER A C   1 
ATOM   1238  O O   . SER A 1 154 ? 12.775  -31.294 -32.941 1.00 13.00  ? 154  SER A O   1 
ATOM   1239  C CB  . SER A 1 154 ? 12.400  -30.221 -29.745 1.00 1.00   ? 154  SER A CB  1 
ATOM   1240  O OG  . SER A 1 154 ? 13.753  -30.540 -29.948 1.00 11.84  ? 154  SER A OG  1 
ATOM   1241  N N   . LEU A 1 155 ? 12.284  -29.190 -32.461 1.00 9.77   ? 155  LEU A N   1 
ATOM   1242  C CA  . LEU A 1 155 ? 12.960  -28.723 -33.631 1.00 7.09   ? 155  LEU A CA  1 
ATOM   1243  C C   . LEU A 1 155 ? 14.445  -29.095 -33.548 1.00 11.75  ? 155  LEU A C   1 
ATOM   1244  O O   . LEU A 1 155 ? 15.090  -29.386 -34.534 1.00 13.82  ? 155  LEU A O   1 
ATOM   1245  C CB  . LEU A 1 155 ? 12.753  -27.214 -33.655 1.00 5.55   ? 155  LEU A CB  1 
ATOM   1246  C CG  . LEU A 1 155 ? 13.540  -26.511 -34.734 1.00 7.79   ? 155  LEU A CG  1 
ATOM   1247  C CD1 . LEU A 1 155 ? 13.191  -27.047 -36.094 1.00 1.95   ? 155  LEU A CD1 1 
ATOM   1248  C CD2 . LEU A 1 155 ? 13.194  -25.041 -34.654 1.00 1.00   ? 155  LEU A CD2 1 
ATOM   1249  N N   . ALA A 1 156 ? 15.004  -29.108 -32.336 1.00 4.41   ? 156  ALA A N   1 
ATOM   1250  C CA  . ALA A 1 156 ? 16.394  -29.450 -32.171 1.00 1.00   ? 156  ALA A CA  1 
ATOM   1251  C C   . ALA A 1 156 ? 16.696  -30.870 -32.672 1.00 9.58   ? 156  ALA A C   1 
ATOM   1252  O O   . ALA A 1 156 ? 17.699  -31.136 -33.372 1.00 11.69  ? 156  ALA A O   1 
ATOM   1253  C CB  . ALA A 1 156 ? 16.768  -29.240 -30.734 1.00 1.21   ? 156  ALA A CB  1 
ATOM   1254  N N   . ASP A 1 157 ? 15.804  -31.808 -32.371 1.00 3.22   ? 157  ASP A N   1 
ATOM   1255  C CA  . ASP A 1 157 ? 16.050  -33.164 -32.818 1.00 1.00   ? 157  ASP A CA  1 
ATOM   1256  C C   . ASP A 1 157 ? 16.007  -33.271 -34.339 1.00 6.79   ? 157  ASP A C   1 
ATOM   1257  O O   . ASP A 1 157 ? 16.771  -33.985 -34.983 1.00 9.32   ? 157  ASP A O   1 
ATOM   1258  C CB  . ASP A 1 157 ? 15.004  -34.102 -32.225 1.00 1.62   ? 157  ASP A CB  1 
ATOM   1259  C CG  . ASP A 1 157 ? 14.878  -34.117 -30.728 1.00 7.39   ? 157  ASP A CG  1 
ATOM   1260  O OD1 . ASP A 1 157 ? 15.787  -34.341 -29.948 1.00 7.28   ? 157  ASP A OD1 1 
ATOM   1261  O OD2 . ASP A 1 157 ? 13.662  -33.885 -30.338 1.00 11.20  ? 157  ASP A OD2 1 
ATOM   1262  N N   . VAL A 1 158 ? 15.086  -32.595 -34.971 1.00 2.97   ? 158  VAL A N   1 
ATOM   1263  C CA  . VAL A 1 158 ? 15.053  -32.734 -36.431 1.00 3.11   ? 158  VAL A CA  1 
ATOM   1264  C C   . VAL A 1 158 ? 16.304  -32.210 -37.120 1.00 12.25  ? 158  VAL A C   1 
ATOM   1265  O O   . VAL A 1 158 ? 16.866  -32.829 -38.030 1.00 12.12  ? 158  VAL A O   1 
ATOM   1266  C CB  . VAL A 1 158 ? 13.838  -32.046 -37.057 1.00 6.13   ? 158  VAL A CB  1 
ATOM   1267  C CG1 . VAL A 1 158 ? 13.779  -32.287 -38.551 1.00 8.89   ? 158  VAL A CG1 1 
ATOM   1268  C CG2 . VAL A 1 158 ? 12.539  -32.395 -36.378 1.00 1.00   ? 158  VAL A CG2 1 
ATOM   1269  N N   . ILE A 1 159 ? 16.731  -31.013 -36.708 1.00 8.29   ? 159  ILE A N   1 
ATOM   1270  C CA  . ILE A 1 159 ? 17.896  -30.398 -37.328 1.00 4.76   ? 159  ILE A CA  1 
ATOM   1271  C C   . ILE A 1 159 ? 19.137  -31.216 -37.109 1.00 8.02   ? 159  ILE A C   1 
ATOM   1272  O O   . ILE A 1 159 ? 19.999  -31.347 -37.981 1.00 12.26  ? 159  ILE A O   1 
ATOM   1273  C CB  . ILE A 1 159 ? 18.098  -28.983 -36.811 1.00 7.13   ? 159  ILE A CB  1 
ATOM   1274  C CG1 . ILE A 1 159 ? 16.843  -28.165 -37.050 1.00 7.72   ? 159  ILE A CG1 1 
ATOM   1275  C CG2 . ILE A 1 159 ? 19.211  -28.326 -37.588 1.00 1.00   ? 159  ILE A CG2 1 
ATOM   1276  C CD1 . ILE A 1 159 ? 16.405  -28.241 -38.517 1.00 2.92   ? 159  ILE A CD1 1 
ATOM   1277  N N   . LEU A 1 160 ? 19.186  -31.788 -35.921 1.00 1.91   ? 160  LEU A N   1 
ATOM   1278  C CA  . LEU A 1 160 ? 20.310  -32.606 -35.552 1.00 3.04   ? 160  LEU A CA  1 
ATOM   1279  C C   . LEU A 1 160 ? 20.304  -33.850 -36.348 1.00 6.29   ? 160  LEU A C   1 
ATOM   1280  O O   . LEU A 1 160 ? 21.286  -34.187 -37.004 1.00 12.58  ? 160  LEU A O   1 
ATOM   1281  C CB  . LEU A 1 160 ? 20.349  -32.835 -34.055 1.00 4.78   ? 160  LEU A CB  1 
ATOM   1282  C CG  . LEU A 1 160 ? 21.494  -33.715 -33.656 1.00 5.70   ? 160  LEU A CG  1 
ATOM   1283  C CD1 . LEU A 1 160 ? 22.823  -33.167 -34.134 1.00 1.00   ? 160  LEU A CD1 1 
ATOM   1284  C CD2 . LEU A 1 160 ? 21.477  -33.740 -32.160 1.00 1.00   ? 160  LEU A CD2 1 
ATOM   1285  N N   . LEU A 1 161 ? 19.153  -34.474 -36.379 1.00 1.00   ? 161  LEU A N   1 
ATOM   1286  C CA  . LEU A 1 161 ? 19.029  -35.630 -37.222 1.00 2.24   ? 161  LEU A CA  1 
ATOM   1287  C C   . LEU A 1 161 ? 19.398  -35.333 -38.673 1.00 6.32   ? 161  LEU A C   1 
ATOM   1288  O O   . LEU A 1 161 ? 20.161  -36.032 -39.342 1.00 7.38   ? 161  LEU A O   1 
ATOM   1289  C CB  . LEU A 1 161 ? 17.589  -36.116 -37.225 1.00 4.61   ? 161  LEU A CB  1 
ATOM   1290  C CG  . LEU A 1 161 ? 17.403  -37.314 -38.175 1.00 11.13  ? 161  LEU A CG  1 
ATOM   1291  C CD1 . LEU A 1 161 ? 18.197  -38.533 -37.743 1.00 6.22   ? 161  LEU A CD1 1 
ATOM   1292  C CD2 . LEU A 1 161 ? 15.955  -37.728 -38.176 1.00 5.61   ? 161  LEU A CD2 1 
ATOM   1293  N N   . GLN A 1 162 ? 18.882  -34.244 -39.166 1.00 1.00   ? 162  GLN A N   1 
ATOM   1294  C CA  . GLN A 1 162 ? 19.179  -33.914 -40.542 1.00 2.60   ? 162  GLN A CA  1 
ATOM   1295  C C   . GLN A 1 162 ? 20.652  -33.789 -40.853 1.00 9.76   ? 162  GLN A C   1 
ATOM   1296  O O   . GLN A 1 162 ? 21.148  -34.291 -41.852 1.00 13.96  ? 162  GLN A O   1 
ATOM   1297  C CB  . GLN A 1 162 ? 18.491  -32.602 -40.919 1.00 5.01   ? 162  GLN A CB  1 
ATOM   1298  C CG  . GLN A 1 162 ? 19.344  -31.895 -41.965 1.00 1.00   ? 162  GLN A CG  1 
ATOM   1299  C CD  . GLN A 1 162 ? 18.778  -30.618 -42.599 1.00 7.99   ? 162  GLN A CD  1 
ATOM   1300  O OE1 . GLN A 1 162 ? 18.984  -30.414 -43.794 1.00 13.25  ? 162  GLN A OE1 1 
ATOM   1301  N NE2 . GLN A 1 162 ? 18.236  -29.665 -41.827 1.00 1.00   ? 162  GLN A NE2 1 
ATOM   1302  N N   . THR A 1 163 ? 21.316  -33.146 -39.910 1.00 8.32   ? 163  THR A N   1 
ATOM   1303  C CA  . THR A 1 163 ? 22.721  -32.843 -39.997 1.00 6.48   ? 163  THR A CA  1 
ATOM   1304  C C   . THR A 1 163 ? 23.601  -34.063 -39.881 1.00 10.48  ? 163  THR A C   1 
ATOM   1305  O O   . THR A 1 163 ? 24.529  -34.311 -40.647 1.00 9.86   ? 163  THR A O   1 
ATOM   1306  C CB  . THR A 1 163 ? 23.070  -31.796 -38.924 1.00 3.83   ? 163  THR A CB  1 
ATOM   1307  O OG1 . THR A 1 163 ? 22.247  -30.640 -39.014 1.00 7.93   ? 163  THR A OG1 1 
ATOM   1308  C CG2 . THR A 1 163 ? 24.522  -31.404 -39.000 1.00 1.00   ? 163  THR A CG2 1 
ATOM   1309  N N   . ILE A 1 164 ? 23.323  -34.832 -38.877 1.00 6.30   ? 164  ILE A N   1 
ATOM   1310  C CA  . ILE A 1 164 ? 24.070  -36.048 -38.686 1.00 5.83   ? 164  ILE A CA  1 
ATOM   1311  C C   . ILE A 1 164 ? 23.987  -36.930 -39.929 1.00 10.33  ? 164  ILE A C   1 
ATOM   1312  O O   . ILE A 1 164 ? 24.996  -37.404 -40.499 1.00 8.32   ? 164  ILE A O   1 
ATOM   1313  C CB  . ILE A 1 164 ? 23.355  -36.788 -37.599 1.00 8.52   ? 164  ILE A CB  1 
ATOM   1314  C CG1 . ILE A 1 164 ? 23.790  -36.293 -36.229 1.00 6.79   ? 164  ILE A CG1 1 
ATOM   1315  C CG2 . ILE A 1 164 ? 23.696  -38.232 -37.774 1.00 3.92   ? 164  ILE A CG2 1 
ATOM   1316  C CD1 . ILE A 1 164 ? 22.975  -36.911 -35.120 1.00 1.00   ? 164  ILE A CD1 1 
ATOM   1317  N N   . LEU A 1 165 ? 22.760  -37.112 -40.417 1.00 1.85   ? 165  LEU A N   1 
ATOM   1318  C CA  . LEU A 1 165 ? 22.657  -37.929 -41.609 1.00 1.15   ? 165  LEU A CA  1 
ATOM   1319  C C   . LEU A 1 165 ? 23.409  -37.404 -42.791 1.00 7.95   ? 165  LEU A C   1 
ATOM   1320  O O   . LEU A 1 165 ? 23.925  -38.149 -43.609 1.00 14.91  ? 165  LEU A O   1 
ATOM   1321  C CB  . LEU A 1 165 ? 21.226  -38.135 -42.033 1.00 3.68   ? 165  LEU A CB  1 
ATOM   1322  C CG  . LEU A 1 165 ? 20.347  -38.796 -40.982 1.00 9.64   ? 165  LEU A CG  1 
ATOM   1323  C CD1 . LEU A 1 165 ? 18.948  -38.998 -41.526 1.00 5.44   ? 165  LEU A CD1 1 
ATOM   1324  C CD2 . LEU A 1 165 ? 20.898  -40.134 -40.591 1.00 1.00   ? 165  LEU A CD2 1 
ATOM   1325  N N   . ALA A 1 166 ? 23.400  -36.105 -42.919 1.00 8.71   ? 166  ALA A N   1 
ATOM   1326  C CA  . ALA A 1 166 ? 24.105  -35.488 -44.018 1.00 1.59   ? 166  ALA A CA  1 
ATOM   1327  C C   . ALA A 1 166 ? 25.598  -35.684 -43.886 1.00 7.30   ? 166  ALA A C   1 
ATOM   1328  O O   . ALA A 1 166 ? 26.327  -35.875 -44.846 1.00 7.68   ? 166  ALA A O   1 
ATOM   1329  C CB  . ALA A 1 166 ? 23.812  -34.049 -43.910 1.00 1.00   ? 166  ALA A CB  1 
ATOM   1330  N N   . LEU A 1 167 ? 26.064  -35.646 -42.660 1.00 4.92   ? 167  LEU A N   1 
ATOM   1331  C CA  . LEU A 1 167 ? 27.458  -35.824 -42.430 1.00 4.32   ? 167  LEU A CA  1 
ATOM   1332  C C   . LEU A 1 167 ? 27.808  -37.241 -42.753 1.00 12.12  ? 167  LEU A C   1 
ATOM   1333  O O   . LEU A 1 167 ? 28.813  -37.529 -43.415 1.00 11.02  ? 167  LEU A O   1 
ATOM   1334  C CB  . LEU A 1 167 ? 27.717  -35.577 -40.947 1.00 4.79   ? 167  LEU A CB  1 
ATOM   1335  C CG  . LEU A 1 167 ? 27.845  -34.100 -40.662 1.00 9.14   ? 167  LEU A CG  1 
ATOM   1336  C CD1 . LEU A 1 167 ? 27.731  -33.807 -39.210 1.00 6.73   ? 167  LEU A CD1 1 
ATOM   1337  C CD2 . LEU A 1 167 ? 29.227  -33.664 -41.045 1.00 1.00   ? 167  LEU A CD2 1 
ATOM   1338  N N   . GLU A 1 168 ? 26.949  -38.138 -42.278 1.00 7.20   ? 168  GLU A N   1 
ATOM   1339  C CA  . GLU A 1 168 ? 27.227  -39.529 -42.554 1.00 5.64   ? 168  GLU A CA  1 
ATOM   1340  C C   . GLU A 1 168 ? 27.318  -39.832 -44.020 1.00 13.17  ? 168  GLU A C   1 
ATOM   1341  O O   . GLU A 1 168 ? 27.919  -40.810 -44.447 1.00 20.60  ? 168  GLU A O   1 
ATOM   1342  C CB  . GLU A 1 168 ? 26.241  -40.469 -41.975 1.00 1.00   ? 168  GLU A CB  1 
ATOM   1343  C CG  . GLU A 1 168 ? 26.319  -40.461 -40.470 1.00 11.55  ? 168  GLU A CG  1 
ATOM   1344  C CD  . GLU A 1 168 ? 25.395  -41.502 -39.897 1.00 4.97   ? 168  GLU A CD  1 
ATOM   1345  O OE1 . GLU A 1 168 ? 24.308  -41.801 -40.435 1.00 25.67  ? 168  GLU A OE1 1 
ATOM   1346  O OE2 . GLU A 1 168 ? 25.924  -42.133 -38.839 1.00 38.28  ? 168  GLU A OE2 1 
ATOM   1347  N N   . GLU A 1 169 ? 26.679  -39.035 -44.802 1.00 3.60   ? 169  GLU A N   1 
ATOM   1348  C CA  . GLU A 1 169 ? 26.813  -39.280 -46.195 1.00 3.76   ? 169  GLU A CA  1 
ATOM   1349  C C   . GLU A 1 169 ? 28.240  -39.065 -46.596 1.00 13.90  ? 169  GLU A C   1 
ATOM   1350  O O   . GLU A 1 169 ? 28.690  -39.701 -47.519 1.00 20.41  ? 169  GLU A O   1 
ATOM   1351  C CB  . GLU A 1 169 ? 25.933  -38.390 -47.093 1.00 5.62   ? 169  GLU A CB  1 
ATOM   1352  C CG  . GLU A 1 169 ? 24.424  -38.625 -46.968 1.00 3.86   ? 169  GLU A CG  1 
ATOM   1353  C CD  . GLU A 1 169 ? 23.647  -37.480 -47.556 1.00 20.25  ? 169  GLU A CD  1 
ATOM   1354  O OE1 . GLU A 1 169 ? 24.151  -36.423 -47.787 1.00 27.21  ? 169  GLU A OE1 1 
ATOM   1355  O OE2 . GLU A 1 169 ? 22.362  -37.669 -47.599 1.00 8.59   ? 169  GLU A OE2 1 
ATOM   1356  N N   . LYS A 1 170 ? 28.960  -38.160 -45.946 1.00 13.87  ? 170  LYS A N   1 
ATOM   1357  C CA  . LYS A 1 170 ? 30.344  -37.951 -46.333 1.00 10.02  ? 170  LYS A CA  1 
ATOM   1358  C C   . LYS A 1 170 ? 31.313  -38.723 -45.448 1.00 19.17  ? 170  LYS A C   1 
ATOM   1359  O O   . LYS A 1 170 ? 32.409  -39.076 -45.893 1.00 19.33  ? 170  LYS A O   1 
ATOM   1360  C CB  . LYS A 1 170 ? 30.726  -36.501 -46.240 1.00 8.99   ? 170  LYS A CB  1 
ATOM   1361  C CG  . LYS A 1 170 ? 29.740  -35.633 -46.938 1.00 9.35   ? 170  LYS A CG  1 
ATOM   1362  C CD  . LYS A 1 170 ? 30.290  -34.410 -47.685 1.00 10.16  ? 170  LYS A CD  1 
ATOM   1363  C CE  . LYS A 1 170 ? 29.254  -33.813 -48.642 1.00 32.81  ? 170  LYS A CE  1 
ATOM   1364  N NZ  . LYS A 1 170 ? 29.761  -32.943 -49.732 1.00 121.55 ? 170  LYS A NZ  1 
ATOM   1365  N N   . ILE A 1 171 ? 30.929  -38.933 -44.180 1.00 13.36  ? 171  ILE A N   1 
ATOM   1366  C CA  . ILE A 1 171 ? 31.778  -39.614 -43.193 1.00 7.24   ? 171  ILE A CA  1 
ATOM   1367  C C   . ILE A 1 171 ? 30.922  -40.514 -42.372 1.00 13.74  ? 171  ILE A C   1 
ATOM   1368  O O   . ILE A 1 171 ? 30.399  -40.204 -41.293 1.00 23.49  ? 171  ILE A O   1 
ATOM   1369  C CB  . ILE A 1 171 ? 32.395  -38.604 -42.264 1.00 8.56   ? 171  ILE A CB  1 
ATOM   1370  C CG1 . ILE A 1 171 ? 32.889  -37.407 -43.049 1.00 7.78   ? 171  ILE A CG1 1 
ATOM   1371  C CG2 . ILE A 1 171 ? 33.528  -39.256 -41.571 1.00 1.00   ? 171  ILE A CG2 1 
ATOM   1372  C CD1 . ILE A 1 171 ? 33.020  -36.177 -42.187 1.00 7.31   ? 171  ILE A CD1 1 
ATOM   1373  N N   . PRO A 1 172 ? 30.813  -41.621 -42.977 1.00 7.06   ? 172  PRO A N   1 
ATOM   1374  C CA  . PRO A 1 172 ? 29.972  -42.714 -42.649 1.00 9.45   ? 172  PRO A CA  1 
ATOM   1375  C C   . PRO A 1 172 ? 30.071  -43.245 -41.281 1.00 17.10  ? 172  PRO A C   1 
ATOM   1376  O O   . PRO A 1 172 ? 29.094  -43.789 -40.823 1.00 16.45  ? 172  PRO A O   1 
ATOM   1377  C CB  . PRO A 1 172 ? 30.189  -43.797 -43.714 1.00 4.38   ? 172  PRO A CB  1 
ATOM   1378  C CG  . PRO A 1 172 ? 30.921  -43.098 -44.835 1.00 3.83   ? 172  PRO A CG  1 
ATOM   1379  C CD  . PRO A 1 172 ? 31.493  -41.803 -44.265 1.00 6.07   ? 172  PRO A CD  1 
ATOM   1380  N N   . ASN A 1 173 ? 31.228  -43.091 -40.681 1.00 15.91  ? 173  ASN A N   1 
ATOM   1381  C CA  . ASN A 1 173 ? 31.501  -43.572 -39.345 1.00 14.15  ? 173  ASN A CA  1 
ATOM   1382  C C   . ASN A 1 173 ? 31.637  -42.424 -38.400 1.00 21.82  ? 173  ASN A C   1 
ATOM   1383  O O   . ASN A 1 173 ? 32.273  -42.513 -37.384 1.00 26.37  ? 173  ASN A O   1 
ATOM   1384  C CB  . ASN A 1 173 ? 32.875  -44.232 -39.376 1.00 8.39   ? 173  ASN A CB  1 
ATOM   1385  C CG  . ASN A 1 173 ? 33.968  -43.365 -39.988 1.00 42.06  ? 173  ASN A CG  1 
ATOM   1386  O OD1 . ASN A 1 173 ? 33.743  -42.686 -41.012 1.00 79.29  ? 173  ASN A OD1 1 
ATOM   1387  N ND2 . ASN A 1 173 ? 35.210  -43.566 -39.505 1.00 48.92  ? 173  ASN A ND2 1 
ATOM   1388  N N   . ILE A 1 174 ? 31.097  -41.304 -38.766 1.00 17.65  ? 174  ILE A N   1 
ATOM   1389  C CA  . ILE A 1 174 ? 31.273  -40.181 -37.927 1.00 10.65  ? 174  ILE A CA  1 
ATOM   1390  C C   . ILE A 1 174 ? 30.689  -40.363 -36.539 1.00 15.63  ? 174  ILE A C   1 
ATOM   1391  O O   . ILE A 1 174 ? 31.187  -39.828 -35.553 1.00 22.04  ? 174  ILE A O   1 
ATOM   1392  C CB  . ILE A 1 174 ? 30.807  -38.973 -38.660 1.00 10.88  ? 174  ILE A CB  1 
ATOM   1393  C CG1 . ILE A 1 174 ? 31.383  -37.821 -37.904 1.00 5.26   ? 174  ILE A CG1 1 
ATOM   1394  C CG2 . ILE A 1 174 ? 29.257  -38.979 -38.748 1.00 1.00   ? 174  ILE A CG2 1 
ATOM   1395  C CD1 . ILE A 1 174 ? 31.267  -36.646 -38.786 1.00 16.19  ? 174  ILE A CD1 1 
ATOM   1396  N N   . LEU A 1 175 ? 29.673  -41.222 -36.429 1.00 13.16  ? 175  LEU A N   1 
ATOM   1397  C CA  . LEU A 1 175 ? 29.023  -41.450 -35.136 1.00 10.15  ? 175  LEU A CA  1 
ATOM   1398  C C   . LEU A 1 175 ? 29.579  -42.579 -34.286 1.00 23.77  ? 175  LEU A C   1 
ATOM   1399  O O   . LEU A 1 175 ? 29.050  -42.869 -33.184 1.00 21.65  ? 175  LEU A O   1 
ATOM   1400  C CB  . LEU A 1 175 ? 27.569  -41.802 -35.321 1.00 5.76   ? 175  LEU A CB  1 
ATOM   1401  C CG  . LEU A 1 175 ? 26.616  -40.631 -35.467 1.00 9.61   ? 175  LEU A CG  1 
ATOM   1402  C CD1 . LEU A 1 175 ? 25.237  -41.186 -35.254 1.00 10.47  ? 175  LEU A CD1 1 
ATOM   1403  C CD2 . LEU A 1 175 ? 26.880  -39.483 -34.482 1.00 1.06   ? 175  LEU A CD2 1 
ATOM   1404  N N   . SER A 1 176 ? 30.582  -43.233 -34.866 1.00 22.38  ? 176  SER A N   1 
ATOM   1405  C CA  . SER A 1 176 ? 31.295  -44.358 -34.277 1.00 20.12  ? 176  SER A CA  1 
ATOM   1406  C C   . SER A 1 176 ? 31.473  -44.147 -32.799 1.00 19.57  ? 176  SER A C   1 
ATOM   1407  O O   . SER A 1 176 ? 31.041  -44.935 -32.003 1.00 36.15  ? 176  SER A O   1 
ATOM   1408  C CB  . SER A 1 176 ? 32.670  -44.558 -34.913 1.00 27.14  ? 176  SER A CB  1 
ATOM   1409  O OG  . SER A 1 176 ? 33.390  -43.310 -34.859 1.00 92.26  ? 176  SER A OG  1 
ATOM   1410  N N   . ALA A 1 177 ? 32.082  -43.070 -32.401 1.00 14.43  ? 177  ALA A N   1 
ATOM   1411  C CA  . ALA A 1 177 ? 32.277  -42.859 -30.985 1.00 7.83   ? 177  ALA A CA  1 
ATOM   1412  C C   . ALA A 1 177 ? 31.103  -42.313 -30.193 1.00 15.57  ? 177  ALA A C   1 
ATOM   1413  O O   . ALA A 1 177 ? 31.360  -41.984 -29.028 1.00 21.58  ? 177  ALA A O   1 
ATOM   1414  C CB  . ALA A 1 177 ? 33.426  -41.919 -30.787 1.00 5.96   ? 177  ALA A CB  1 
ATOM   1415  N N   . PHE A 1 178 ? 29.895  -42.208 -30.806 1.00 6.27   ? 178  PHE A N   1 
ATOM   1416  C CA  . PHE A 1 178 ? 28.716  -41.649 -30.175 1.00 9.20   ? 178  PHE A CA  1 
ATOM   1417  C C   . PHE A 1 178 ? 27.551  -42.573 -30.237 1.00 18.14  ? 178  PHE A C   1 
ATOM   1418  O O   . PHE A 1 178 ? 26.610  -42.431 -30.983 1.00 24.51  ? 178  PHE A O   1 
ATOM   1419  C CB  . PHE A 1 178 ? 28.364  -40.298 -30.812 1.00 10.48  ? 178  PHE A CB  1 
ATOM   1420  C CG  . PHE A 1 178 ? 29.600  -39.435 -30.823 1.00 6.36   ? 178  PHE A CG  1 
ATOM   1421  C CD1 . PHE A 1 178 ? 29.946  -38.670 -29.714 1.00 1.27   ? 178  PHE A CD1 1 
ATOM   1422  C CD2 . PHE A 1 178 ? 30.435  -39.381 -31.935 1.00 11.09  ? 178  PHE A CD2 1 
ATOM   1423  C CE1 . PHE A 1 178 ? 31.063  -37.827 -29.730 1.00 1.00   ? 178  PHE A CE1 1 
ATOM   1424  C CE2 . PHE A 1 178 ? 31.590  -38.596 -31.941 1.00 11.28  ? 178  PHE A CE2 1 
ATOM   1425  C CZ  . PHE A 1 178 ? 31.918  -37.822 -30.829 1.00 1.00   ? 178  PHE A CZ  1 
ATOM   1426  N N   . PRO A 1 179 ? 27.661  -43.519 -29.395 1.00 20.81  ? 179  PRO A N   1 
ATOM   1427  C CA  . PRO A 1 179 ? 26.742  -44.611 -29.193 1.00 19.51  ? 179  PRO A CA  1 
ATOM   1428  C C   . PRO A 1 179 ? 25.375  -44.108 -28.819 1.00 24.18  ? 179  PRO A C   1 
ATOM   1429  O O   . PRO A 1 179 ? 24.381  -44.605 -29.325 1.00 26.95  ? 179  PRO A O   1 
ATOM   1430  C CB  . PRO A 1 179 ? 27.320  -45.380 -28.032 1.00 15.42  ? 179  PRO A CB  1 
ATOM   1431  C CG  . PRO A 1 179 ? 28.597  -44.712 -27.607 1.00 15.39  ? 179  PRO A CG  1 
ATOM   1432  C CD  . PRO A 1 179 ? 28.904  -43.648 -28.635 1.00 16.82  ? 179  PRO A CD  1 
ATOM   1433  N N   . PHE A 1 180 ? 25.313  -43.101 -27.966 1.00 16.21  ? 180  PHE A N   1 
ATOM   1434  C CA  . PHE A 1 180 ? 24.003  -42.535 -27.667 1.00 14.12  ? 180  PHE A CA  1 
ATOM   1435  C C   . PHE A 1 180 ? 23.415  -41.895 -28.899 1.00 18.51  ? 180  PHE A C   1 
ATOM   1436  O O   . PHE A 1 180 ? 22.260  -42.135 -29.242 1.00 18.74  ? 180  PHE A O   1 
ATOM   1437  C CB  . PHE A 1 180 ? 24.108  -41.485 -26.591 1.00 16.34  ? 180  PHE A CB  1 
ATOM   1438  C CG  . PHE A 1 180 ? 24.157  -42.218 -25.272 1.00 21.04  ? 180  PHE A CG  1 
ATOM   1439  C CD1 . PHE A 1 180 ? 25.338  -42.783 -24.804 1.00 20.75  ? 180  PHE A CD1 1 
ATOM   1440  C CD2 . PHE A 1 180 ? 23.012  -42.440 -24.499 1.00 26.78  ? 180  PHE A CD2 1 
ATOM   1441  C CE1 . PHE A 1 180 ? 25.376  -43.464 -23.580 1.00 18.28  ? 180  PHE A CE1 1 
ATOM   1442  C CE2 . PHE A 1 180 ? 23.011  -43.138 -23.286 1.00 17.67  ? 180  PHE A CE2 1 
ATOM   1443  C CZ  . PHE A 1 180 ? 24.221  -43.644 -22.816 1.00 10.82  ? 180  PHE A CZ  1 
ATOM   1444  N N   . LEU A 1 181 ? 24.255  -41.107 -29.588 1.00 8.93   ? 181  LEU A N   1 
ATOM   1445  C CA  . LEU A 1 181 ? 23.801  -40.471 -30.780 1.00 9.86   ? 181  LEU A CA  1 
ATOM   1446  C C   . LEU A 1 181 ? 23.399  -41.519 -31.792 1.00 12.03  ? 181  LEU A C   1 
ATOM   1447  O O   . LEU A 1 181 ? 22.421  -41.366 -32.561 1.00 13.20  ? 181  LEU A O   1 
ATOM   1448  C CB  . LEU A 1 181 ? 24.849  -39.507 -31.368 1.00 13.77  ? 181  LEU A CB  1 
ATOM   1449  C CG  . LEU A 1 181 ? 24.982  -38.206 -30.613 1.00 13.05  ? 181  LEU A CG  1 
ATOM   1450  C CD1 . LEU A 1 181 ? 26.133  -37.366 -31.154 1.00 11.41  ? 181  LEU A CD1 1 
ATOM   1451  C CD2 . LEU A 1 181 ? 23.677  -37.499 -30.771 1.00 1.82   ? 181  LEU A CD2 1 
ATOM   1452  N N   . GLN A 1 182 ? 24.110  -42.636 -31.799 1.00 9.34   ? 182  GLN A N   1 
ATOM   1453  C CA  . GLN A 1 182 ? 23.687  -43.625 -32.792 1.00 8.76   ? 182  GLN A CA  1 
ATOM   1454  C C   . GLN A 1 182 ? 22.321  -44.156 -32.502 1.00 14.41  ? 182  GLN A C   1 
ATOM   1455  O O   . GLN A 1 182 ? 21.487  -44.293 -33.356 1.00 16.30  ? 182  GLN A O   1 
ATOM   1456  C CB  . GLN A 1 182 ? 24.559  -44.825 -32.879 1.00 6.64   ? 182  GLN A CB  1 
ATOM   1457  C CG  . GLN A 1 182 ? 25.934  -44.676 -33.519 1.00 35.10  ? 182  GLN A CG  1 
ATOM   1458  C CD  . GLN A 1 182 ? 26.791  -45.845 -33.055 1.00 18.09  ? 182  GLN A CD  1 
ATOM   1459  O OE1 . GLN A 1 182 ? 26.279  -46.937 -32.739 1.00 83.28  ? 182  GLN A OE1 1 
ATOM   1460  N NE2 . GLN A 1 182 ? 28.064  -45.593 -32.818 1.00 33.79  ? 182  GLN A NE2 1 
ATOM   1461  N N   . GLU A 1 183 ? 22.072  -44.460 -31.271 1.00 15.58  ? 183  GLU A N   1 
ATOM   1462  C CA  . GLU A 1 183 ? 20.787  -44.975 -30.978 1.00 18.74  ? 183  GLU A CA  1 
ATOM   1463  C C   . GLU A 1 183 ? 19.711  -43.991 -31.214 1.00 16.44  ? 183  GLU A C   1 
ATOM   1464  O O   . GLU A 1 183 ? 18.702  -44.299 -31.815 1.00 21.35  ? 183  GLU A O   1 
ATOM   1465  C CB  . GLU A 1 183 ? 20.690  -45.479 -29.568 1.00 23.36  ? 183  GLU A CB  1 
ATOM   1466  C CG  . GLU A 1 183 ? 19.661  -46.615 -29.356 1.00 90.45  ? 183  GLU A CG  1 
ATOM   1467  C CD  . GLU A 1 183 ? 19.547  -46.874 -27.909 1.00 240.06 ? 183  GLU A CD  1 
ATOM   1468  O OE1 . GLU A 1 183 ? 20.407  -46.617 -27.098 1.00 286.72 ? 183  GLU A OE1 1 
ATOM   1469  O OE2 . GLU A 1 183 ? 18.517  -47.617 -27.591 1.00 267.52 ? 183  GLU A OE2 1 
ATOM   1470  N N   . TYR A 1 184 ? 19.933  -42.803 -30.724 1.00 16.75  ? 184  TYR A N   1 
ATOM   1471  C CA  . TYR A 1 184 ? 18.977  -41.720 -30.870 1.00 15.59  ? 184  TYR A CA  1 
ATOM   1472  C C   . TYR A 1 184 ? 18.554  -41.554 -32.336 1.00 17.05  ? 184  TYR A C   1 
ATOM   1473  O O   . TYR A 1 184 ? 17.362  -41.479 -32.706 1.00 16.57  ? 184  TYR A O   1 
ATOM   1474  C CB  . TYR A 1 184 ? 19.763  -40.544 -30.394 1.00 10.91  ? 184  TYR A CB  1 
ATOM   1475  C CG  . TYR A 1 184 ? 19.170  -39.203 -30.622 1.00 13.32  ? 184  TYR A CG  1 
ATOM   1476  C CD1 . TYR A 1 184 ? 18.264  -38.597 -29.748 1.00 12.11  ? 184  TYR A CD1 1 
ATOM   1477  C CD2 . TYR A 1 184 ? 19.661  -38.436 -31.677 1.00 10.72  ? 184  TYR A CD2 1 
ATOM   1478  C CE1 . TYR A 1 184 ? 17.756  -37.324 -30.036 1.00 9.98   ? 184  TYR A CE1 1 
ATOM   1479  C CE2 . TYR A 1 184 ? 19.184  -37.152 -31.952 1.00 4.44   ? 184  TYR A CE2 1 
ATOM   1480  C CZ  . TYR A 1 184 ? 18.233  -36.573 -31.120 1.00 8.44   ? 184  TYR A CZ  1 
ATOM   1481  O OH  . TYR A 1 184 ? 17.815  -35.265 -31.369 1.00 17.51  ? 184  TYR A OH  1 
ATOM   1482  N N   . THR A 1 185 ? 19.559  -41.599 -33.194 1.00 2.92   ? 185  THR A N   1 
ATOM   1483  C CA  . THR A 1 185 ? 19.361  -41.443 -34.621 1.00 2.77   ? 185  THR A CA  1 
ATOM   1484  C C   . THR A 1 185 ? 18.489  -42.522 -35.159 1.00 13.26  ? 185  THR A C   1 
ATOM   1485  O O   . THR A 1 185 ? 17.586  -42.363 -35.975 1.00 13.17  ? 185  THR A O   1 
ATOM   1486  C CB  . THR A 1 185 ? 20.741  -41.577 -35.281 1.00 14.05  ? 185  THR A CB  1 
ATOM   1487  O OG1 . THR A 1 185 ? 21.468  -40.472 -34.938 1.00 9.91   ? 185  THR A OG1 1 
ATOM   1488  C CG2 . THR A 1 185 ? 20.668  -41.556 -36.778 1.00 3.34   ? 185  THR A CG2 1 
ATOM   1489  N N   . VAL A 1 186 ? 18.796  -43.675 -34.705 1.00 11.46  ? 186  VAL A N   1 
ATOM   1490  C CA  . VAL A 1 186 ? 18.035  -44.793 -35.148 1.00 14.52  ? 186  VAL A CA  1 
ATOM   1491  C C   . VAL A 1 186 ? 16.583  -44.691 -34.787 1.00 11.38  ? 186  VAL A C   1 
ATOM   1492  O O   . VAL A 1 186 ? 15.694  -44.821 -35.606 1.00 16.88  ? 186  VAL A O   1 
ATOM   1493  C CB  . VAL A 1 186 ? 18.578  -46.030 -34.488 1.00 19.24  ? 186  VAL A CB  1 
ATOM   1494  C CG1 . VAL A 1 186 ? 17.623  -47.123 -34.868 1.00 15.96  ? 186  VAL A CG1 1 
ATOM   1495  C CG2 . VAL A 1 186 ? 19.921  -46.345 -35.107 1.00 14.85  ? 186  VAL A CG2 1 
ATOM   1496  N N   . LYS A 1 187 ? 16.344  -44.469 -33.542 1.00 4.04   ? 187  LYS A N   1 
ATOM   1497  C CA  . LYS A 1 187 ? 14.975  -44.294 -33.146 1.00 8.37   ? 187  LYS A CA  1 
ATOM   1498  C C   . LYS A 1 187 ? 14.242  -43.184 -33.860 1.00 18.54  ? 187  LYS A C   1 
ATOM   1499  O O   . LYS A 1 187 ? 13.082  -43.327 -34.193 1.00 20.40  ? 187  LYS A O   1 
ATOM   1500  C CB  . LYS A 1 187 ? 14.899  -43.942 -31.692 1.00 7.10   ? 187  LYS A CB  1 
ATOM   1501  C CG  . LYS A 1 187 ? 15.615  -44.954 -30.839 1.00 17.97  ? 187  LYS A CG  1 
ATOM   1502  C CD  . LYS A 1 187 ? 15.016  -45.049 -29.439 1.00 38.64  ? 187  LYS A CD  1 
ATOM   1503  C CE  . LYS A 1 187 ? 16.029  -44.945 -28.274 1.00 92.14  ? 187  LYS A CE  1 
ATOM   1504  N NZ  . LYS A 1 187 ? 16.383  -43.566 -27.840 1.00 21.76  ? 187  LYS A NZ  1 
ATOM   1505  N N   . LEU A 1 188 ? 14.887  -42.035 -33.932 1.00 19.55  ? 188  LEU A N   1 
ATOM   1506  C CA  . LEU A 1 188 ? 14.248  -40.901 -34.525 1.00 15.53  ? 188  LEU A CA  1 
ATOM   1507  C C   . LEU A 1 188 ? 13.894  -41.291 -35.913 1.00 17.36  ? 188  LEU A C   1 
ATOM   1508  O O   . LEU A 1 188 ? 12.858  -40.911 -36.443 1.00 19.51  ? 188  LEU A O   1 
ATOM   1509  C CB  . LEU A 1 188 ? 15.242  -39.723 -34.645 1.00 11.05  ? 188  LEU A CB  1 
ATOM   1510  C CG  . LEU A 1 188 ? 15.512  -38.924 -33.387 1.00 12.13  ? 188  LEU A CG  1 
ATOM   1511  C CD1 . LEU A 1 188 ? 16.316  -37.689 -33.719 1.00 9.57   ? 188  LEU A CD1 1 
ATOM   1512  C CD2 . LEU A 1 188 ? 14.251  -38.479 -32.670 1.00 12.24  ? 188  LEU A CD2 1 
ATOM   1513  N N   . SER A 1 189 ? 14.814  -42.008 -36.526 1.00 6.09   ? 189  SER A N   1 
ATOM   1514  C CA  . SER A 1 189 ? 14.528  -42.297 -37.907 1.00 10.27  ? 189  SER A CA  1 
ATOM   1515  C C   . SER A 1 189 ? 13.391  -43.232 -38.076 1.00 18.63  ? 189  SER A C   1 
ATOM   1516  O O   . SER A 1 189 ? 12.981  -43.530 -39.197 1.00 20.89  ? 189  SER A O   1 
ATOM   1517  C CB  . SER A 1 189 ? 15.684  -42.805 -38.707 1.00 16.35  ? 189  SER A CB  1 
ATOM   1518  O OG  . SER A 1 189 ? 16.887  -42.292 -38.220 1.00 15.31  ? 189  SER A OG  1 
ATOM   1519  N N   . ASN A 1 190 ? 12.971  -43.786 -36.952 1.00 18.88  ? 190  ASN A N   1 
ATOM   1520  C CA  . ASN A 1 190 ? 11.850  -44.730 -37.000 1.00 20.58  ? 190  ASN A CA  1 
ATOM   1521  C C   . ASN A 1 190 ? 10.526  -44.093 -36.758 1.00 29.19  ? 190  ASN A C   1 
ATOM   1522  O O   . ASN A 1 190 ? 9.535   -44.750 -36.892 1.00 34.30  ? 190  ASN A O   1 
ATOM   1523  C CB  . ASN A 1 190 ? 11.984  -46.181 -36.467 1.00 18.59  ? 190  ASN A CB  1 
ATOM   1524  C CG  . ASN A 1 190 ? 12.970  -46.986 -37.253 1.00 101.46 ? 190  ASN A CG  1 
ATOM   1525  O OD1 . ASN A 1 190 ? 12.578  -47.535 -38.308 1.00 120.18 ? 190  ASN A OD1 1 
ATOM   1526  N ND2 . ASN A 1 190 ? 14.256  -46.942 -36.828 1.00 89.76  ? 190  ASN A ND2 1 
ATOM   1527  N N   . ILE A 1 191 ? 10.537  -42.806 -36.419 1.00 25.31  ? 191  ILE A N   1 
ATOM   1528  C CA  . ILE A 1 191 ? 9.323   -42.052 -36.306 1.00 17.82  ? 191  ILE A CA  1 
ATOM   1529  C C   . ILE A 1 191 ? 8.769   -42.029 -37.727 1.00 27.30  ? 191  ILE A C   1 
ATOM   1530  O O   . ILE A 1 191 ? 9.415   -41.845 -38.776 1.00 34.88  ? 191  ILE A O   1 
ATOM   1531  C CB  . ILE A 1 191 ? 9.604   -40.686 -35.757 1.00 21.12  ? 191  ILE A CB  1 
ATOM   1532  C CG1 . ILE A 1 191 ? 10.022  -40.875 -34.328 1.00 13.87  ? 191  ILE A CG1 1 
ATOM   1533  C CG2 . ILE A 1 191 ? 8.342   -39.859 -35.778 1.00 26.89  ? 191  ILE A CG2 1 
ATOM   1534  C CD1 . ILE A 1 191 ? 10.736  -39.645 -33.794 1.00 11.39  ? 191  ILE A CD1 1 
ATOM   1535  N N   . PRO A 1 192 ? 7.554   -42.369 -37.745 1.00 21.14  ? 192  PRO A N   1 
ATOM   1536  C CA  . PRO A 1 192 ? 6.816   -42.638 -38.941 1.00 17.83  ? 192  PRO A CA  1 
ATOM   1537  C C   . PRO A 1 192 ? 6.860   -41.614 -39.997 1.00 19.97  ? 192  PRO A C   1 
ATOM   1538  O O   . PRO A 1 192 ? 7.142   -41.968 -41.133 1.00 22.87  ? 192  PRO A O   1 
ATOM   1539  C CB  . PRO A 1 192 ? 5.441   -43.061 -38.501 1.00 17.55  ? 192  PRO A CB  1 
ATOM   1540  C CG  . PRO A 1 192 ? 5.540   -43.386 -37.012 1.00 16.14  ? 192  PRO A CG  1 
ATOM   1541  C CD  . PRO A 1 192 ? 6.858   -42.791 -36.513 1.00 18.64  ? 192  PRO A CD  1 
ATOM   1542  N N   . THR A 1 193 ? 6.638   -40.356 -39.621 1.00 14.39  ? 193  THR A N   1 
ATOM   1543  C CA  . THR A 1 193 ? 6.727   -39.260 -40.595 1.00 9.79   ? 193  THR A CA  1 
ATOM   1544  C C   . THR A 1 193 ? 8.120   -39.255 -41.142 1.00 16.14  ? 193  THR A C   1 
ATOM   1545  O O   . THR A 1 193 ? 8.350   -39.137 -42.346 1.00 22.19  ? 193  THR A O   1 
ATOM   1546  C CB  . THR A 1 193 ? 6.540   -37.954 -39.873 1.00 18.10  ? 193  THR A CB  1 
ATOM   1547  O OG1 . THR A 1 193 ? 7.360   -37.972 -38.722 1.00 32.46  ? 193  THR A OG1 1 
ATOM   1548  C CG2 . THR A 1 193 ? 5.125   -37.913 -39.378 1.00 1.00   ? 193  THR A CG2 1 
ATOM   1549  N N   . ILE A 1 194 ? 9.047   -39.424 -40.206 1.00 10.60  ? 194  ILE A N   1 
ATOM   1550  C CA  . ILE A 1 194 ? 10.458  -39.417 -40.543 1.00 10.39  ? 194  ILE A CA  1 
ATOM   1551  C C   . ILE A 1 194 ? 10.818  -40.614 -41.354 1.00 18.17  ? 194  ILE A C   1 
ATOM   1552  O O   . ILE A 1 194 ? 11.512  -40.529 -42.386 1.00 18.32  ? 194  ILE A O   1 
ATOM   1553  C CB  . ILE A 1 194 ? 11.305  -39.306 -39.304 1.00 10.11  ? 194  ILE A CB  1 
ATOM   1554  C CG1 . ILE A 1 194 ? 10.982  -37.961 -38.679 1.00 7.74   ? 194  ILE A CG1 1 
ATOM   1555  C CG2 . ILE A 1 194 ? 12.749  -39.357 -39.708 1.00 3.49   ? 194  ILE A CG2 1 
ATOM   1556  C CD1 . ILE A 1 194 ? 11.788  -37.769 -37.423 1.00 6.88   ? 194  ILE A CD1 1 
ATOM   1557  N N   . LYS A 1 195 ? 10.301  -41.737 -40.883 1.00 14.50  ? 195  LYS A N   1 
ATOM   1558  C CA  . LYS A 1 195 ? 10.547  -42.971 -41.585 1.00 16.16  ? 195  LYS A CA  1 
ATOM   1559  C C   . LYS A 1 195 ? 10.123  -42.828 -43.031 1.00 18.60  ? 195  LYS A C   1 
ATOM   1560  O O   . LYS A 1 195 ? 10.884  -43.169 -43.911 1.00 19.12  ? 195  LYS A O   1 
ATOM   1561  C CB  . LYS A 1 195 ? 9.870   -44.136 -40.914 1.00 14.73  ? 195  LYS A CB  1 
ATOM   1562  C CG  . LYS A 1 195 ? 10.119  -45.425 -41.669 1.00 22.53  ? 195  LYS A CG  1 
ATOM   1563  C CD  . LYS A 1 195 ? 9.510   -46.703 -41.032 1.00 45.07  ? 195  LYS A CD  1 
ATOM   1564  C CE  . LYS A 1 195 ? 10.037  -48.049 -41.578 1.00 63.04  ? 195  LYS A CE  1 
ATOM   1565  N NZ  . LYS A 1 195 ? 9.014   -49.115 -41.653 1.00 124.12 ? 195  LYS A NZ  1 
ATOM   1566  N N   . ARG A 1 196 ? 8.962   -42.192 -43.260 1.00 14.87  ? 196  ARG A N   1 
ATOM   1567  C CA  . ARG A 1 196 ? 8.487   -41.976 -44.618 1.00 14.76  ? 196  ARG A CA  1 
ATOM   1568  C C   . ARG A 1 196 ? 9.366   -41.034 -45.403 1.00 19.24  ? 196  ARG A C   1 
ATOM   1569  O O   . ARG A 1 196 ? 9.588   -41.213 -46.599 1.00 21.84  ? 196  ARG A O   1 
ATOM   1570  C CB  . ARG A 1 196 ? 7.050   -41.452 -44.706 1.00 10.93  ? 196  ARG A CB  1 
ATOM   1571  C CG  . ARG A 1 196 ? 5.943   -42.393 -44.248 1.00 84.94  ? 196  ARG A CG  1 
ATOM   1572  C CD  . ARG A 1 196 ? 4.627   -41.641 -44.062 1.00 131.16 ? 196  ARG A CD  1 
ATOM   1573  N NE  . ARG A 1 196 ? 3.913   -42.005 -42.841 1.00 172.78 ? 196  ARG A NE  1 
ATOM   1574  C CZ  . ARG A 1 196 ? 3.331   -41.097 -42.062 1.00 214.26 ? 196  ARG A CZ  1 
ATOM   1575  N NH1 . ARG A 1 196 ? 3.400   -39.794 -42.359 1.00 205.59 ? 196  ARG A NH1 1 
ATOM   1576  N NH2 . ARG A 1 196 ? 2.685   -41.496 -40.960 1.00 215.17 ? 196  ARG A NH2 1 
ATOM   1577  N N   . PHE A 1 197 ? 9.772   -39.971 -44.730 1.00 21.18  ? 197  PHE A N   1 
ATOM   1578  C CA  . PHE A 1 197 ? 10.573  -38.936 -45.367 1.00 19.20  ? 197  PHE A CA  1 
ATOM   1579  C C   . PHE A 1 197 ? 11.830  -39.570 -45.873 1.00 18.79  ? 197  PHE A C   1 
ATOM   1580  O O   . PHE A 1 197 ? 12.337  -39.254 -46.926 1.00 14.50  ? 197  PHE A O   1 
ATOM   1581  C CB  . PHE A 1 197 ? 10.888  -37.799 -44.360 1.00 16.60  ? 197  PHE A CB  1 
ATOM   1582  C CG  . PHE A 1 197 ? 11.568  -36.595 -44.980 1.00 16.51  ? 197  PHE A CG  1 
ATOM   1583  C CD1 . PHE A 1 197 ? 10.877  -35.769 -45.877 1.00 17.86  ? 197  PHE A CD1 1 
ATOM   1584  C CD2 . PHE A 1 197 ? 12.876  -36.244 -44.632 1.00 11.93  ? 197  PHE A CD2 1 
ATOM   1585  C CE1 . PHE A 1 197 ? 11.473  -34.660 -46.481 1.00 9.94   ? 197  PHE A CE1 1 
ATOM   1586  C CE2 . PHE A 1 197 ? 13.494  -35.144 -45.229 1.00 10.07  ? 197  PHE A CE2 1 
ATOM   1587  C CZ  . PHE A 1 197 ? 12.792  -34.359 -46.148 1.00 6.81   ? 197  PHE A CZ  1 
ATOM   1588  N N   . LEU A 1 198 ? 12.321  -40.484 -45.079 1.00 13.52  ? 198  LEU A N   1 
ATOM   1589  C CA  . LEU A 1 198 ? 13.511  -41.158 -45.464 1.00 17.31  ? 198  LEU A CA  1 
ATOM   1590  C C   . LEU A 1 198 ? 13.291  -42.145 -46.571 1.00 28.14  ? 198  LEU A C   1 
ATOM   1591  O O   . LEU A 1 198 ? 14.200  -42.436 -47.322 1.00 31.92  ? 198  LEU A O   1 
ATOM   1592  C CB  . LEU A 1 198 ? 14.131  -41.844 -44.270 1.00 17.25  ? 198  LEU A CB  1 
ATOM   1593  C CG  . LEU A 1 198 ? 14.581  -40.794 -43.306 1.00 16.15  ? 198  LEU A CG  1 
ATOM   1594  C CD1 . LEU A 1 198 ? 14.935  -41.437 -42.007 1.00 6.63   ? 198  LEU A CD1 1 
ATOM   1595  C CD2 . LEU A 1 198 ? 15.779  -40.087 -43.897 1.00 15.83  ? 198  LEU A CD2 1 
ATOM   1596  N N   . GLU A 1 199 ? 12.073  -42.629 -46.681 1.00 30.95  ? 199  GLU A N   1 
ATOM   1597  C CA  . GLU A 1 199 ? 11.726  -43.548 -47.749 1.00 31.65  ? 199  GLU A CA  1 
ATOM   1598  C C   . GLU A 1 199 ? 11.534  -42.832 -49.064 1.00 40.90  ? 199  GLU A C   1 
ATOM   1599  O O   . GLU A 1 199 ? 11.390  -41.625 -49.151 1.00 48.36  ? 199  GLU A O   1 
ATOM   1600  C CB  . GLU A 1 199 ? 10.465  -44.376 -47.445 1.00 33.09  ? 199  GLU A CB  1 
ATOM   1601  C CG  . GLU A 1 199 ? 10.712  -45.551 -46.488 1.00 16.15  ? 199  GLU A CG  1 
ATOM   1602  C CD  . GLU A 1 199 ? 9.519   -45.994 -45.687 1.00 54.57  ? 199  GLU A CD  1 
ATOM   1603  O OE1 . GLU A 1 199 ? 8.336   -45.677 -45.919 1.00 50.51  ? 199  GLU A OE1 1 
ATOM   1604  O OE2 . GLU A 1 199 ? 9.921   -46.820 -44.742 1.00 47.42  ? 199  GLU A OE2 1 
ATOM   1605  N N   . PRO A 1 200 ? 11.498  -43.622 -50.096 1.00 40.19  ? 200  PRO A N   1 
ATOM   1606  C CA  . PRO A 1 200 ? 11.339  -43.160 -51.444 1.00 38.67  ? 200  PRO A CA  1 
ATOM   1607  C C   . PRO A 1 200 ? 10.053  -42.446 -51.737 1.00 39.52  ? 200  PRO A C   1 
ATOM   1608  O O   . PRO A 1 200 ? 8.971   -42.728 -51.170 1.00 40.62  ? 200  PRO A O   1 
ATOM   1609  C CB  . PRO A 1 200 ? 11.489  -44.380 -52.326 1.00 40.92  ? 200  PRO A CB  1 
ATOM   1610  C CG  . PRO A 1 200 ? 12.296  -45.350 -51.498 1.00 47.45  ? 200  PRO A CG  1 
ATOM   1611  C CD  . PRO A 1 200 ? 12.208  -44.901 -50.050 1.00 43.09  ? 200  PRO A CD  1 
ATOM   1612  N N   . GLY A 1 201 ? 10.217  -41.484 -52.639 1.00 32.36  ? 201  GLY A N   1 
ATOM   1613  C CA  . GLY A 1 201 ? 9.090   -40.677 -53.039 1.00 29.94  ? 201  GLY A CA  1 
ATOM   1614  C C   . GLY A 1 201 ? 8.723   -39.529 -52.092 1.00 38.66  ? 201  GLY A C   1 
ATOM   1615  O O   . GLY A 1 201 ? 7.618   -39.005 -52.230 1.00 44.65  ? 201  GLY A O   1 
ATOM   1616  N N   . SER A 1 202 ? 9.641   -39.131 -51.149 1.00 26.51  ? 202  SER A N   1 
ATOM   1617  C CA  . SER A 1 202 ? 9.420   -38.041 -50.199 1.00 13.49  ? 202  SER A CA  1 
ATOM   1618  C C   . SER A 1 202 ? 9.860   -36.772 -50.894 1.00 20.44  ? 202  SER A C   1 
ATOM   1619  O O   . SER A 1 202 ? 10.397  -36.839 -52.033 1.00 27.79  ? 202  SER A O   1 
ATOM   1620  C CB  . SER A 1 202 ? 10.217  -38.250 -48.923 1.00 11.17  ? 202  SER A CB  1 
ATOM   1621  O OG  . SER A 1 202 ? 11.586  -38.363 -49.289 1.00 33.64  ? 202  SER A OG  1 
ATOM   1622  N N   . LYS A 1 203 ? 9.646   -35.612 -50.266 1.00 16.86  ? 203  LYS A N   1 
ATOM   1623  C CA  . LYS A 1 203 ? 10.156  -34.424 -50.941 1.00 12.34  ? 203  LYS A CA  1 
ATOM   1624  C C   . LYS A 1 203 ? 11.618  -34.143 -50.490 1.00 15.77  ? 203  LYS A C   1 
ATOM   1625  O O   . LYS A 1 203 ? 12.260  -33.213 -50.910 1.00 15.65  ? 203  LYS A O   1 
ATOM   1626  C CB  . LYS A 1 203 ? 9.215   -33.239 -50.940 1.00 12.78  ? 203  LYS A CB  1 
ATOM   1627  C CG  . LYS A 1 203 ? 7.921   -33.483 -51.753 1.00 11.84  ? 203  LYS A CG  1 
ATOM   1628  C CD  . LYS A 1 203 ? 6.911   -32.318 -51.792 1.00 32.90  ? 203  LYS A CD  1 
ATOM   1629  C CE  . LYS A 1 203 ? 5.476   -32.641 -52.246 1.00 4.97   ? 203  LYS A CE  1 
ATOM   1630  N NZ  . LYS A 1 203 ? 4.833   -33.716 -51.421 1.00 139.36 ? 203  LYS A NZ  1 
ATOM   1631  N N   . LYS A 1 204 ? 12.148  -35.065 -49.695 1.00 9.39   ? 204  LYS A N   1 
ATOM   1632  C CA  . LYS A 1 204 ? 13.493  -35.058 -49.247 1.00 10.47  ? 204  LYS A CA  1 
ATOM   1633  C C   . LYS A 1 204 ? 14.347  -35.013 -50.482 1.00 13.83  ? 204  LYS A C   1 
ATOM   1634  O O   . LYS A 1 204 ? 14.056  -35.676 -51.427 1.00 18.60  ? 204  LYS A O   1 
ATOM   1635  C CB  . LYS A 1 204 ? 13.738  -36.349 -48.488 1.00 12.59  ? 204  LYS A CB  1 
ATOM   1636  C CG  . LYS A 1 204 ? 15.200  -36.562 -48.192 1.00 1.00   ? 204  LYS A CG  1 
ATOM   1637  C CD  . LYS A 1 204 ? 15.457  -37.554 -47.061 1.00 12.50  ? 204  LYS A CD  1 
ATOM   1638  C CE  . LYS A 1 204 ? 16.874  -37.482 -46.486 1.00 1.00   ? 204  LYS A CE  1 
ATOM   1639  N NZ  . LYS A 1 204 ? 17.854  -37.021 -47.485 1.00 19.12  ? 204  LYS A NZ  1 
ATOM   1640  N N   . LYS A 1 205 ? 15.352  -34.166 -50.498 1.00 15.72  ? 205  LYS A N   1 
ATOM   1641  C CA  . LYS A 1 205 ? 16.220  -34.003 -51.651 1.00 12.07  ? 205  LYS A CA  1 
ATOM   1642  C C   . LYS A 1 205 ? 17.565  -34.675 -51.466 1.00 19.49  ? 205  LYS A C   1 
ATOM   1643  O O   . LYS A 1 205 ? 18.129  -34.852 -50.395 1.00 26.86  ? 205  LYS A O   1 
ATOM   1644  C CB  . LYS A 1 205 ? 16.450  -32.521 -51.952 1.00 8.61   ? 205  LYS A CB  1 
ATOM   1645  C CG  . LYS A 1 205 ? 15.156  -31.759 -52.084 1.00 17.48  ? 205  LYS A CG  1 
ATOM   1646  C CD  . LYS A 1 205 ? 14.677  -31.711 -53.523 1.00 9.28   ? 205  LYS A CD  1 
ATOM   1647  C CE  . LYS A 1 205 ? 13.312  -31.068 -53.702 1.00 1.00   ? 205  LYS A CE  1 
ATOM   1648  N NZ  . LYS A 1 205 ? 12.256  -31.918 -53.181 1.00 6.31   ? 205  LYS A NZ  1 
ATOM   1649  N N   . PRO A 1 206 ? 18.100  -35.000 -52.579 1.00 14.76  ? 206  PRO A N   1 
ATOM   1650  C CA  . PRO A 1 206 ? 19.390  -35.630 -52.751 1.00 11.27  ? 206  PRO A CA  1 
ATOM   1651  C C   . PRO A 1 206 ? 20.499  -34.659 -52.615 1.00 15.22  ? 206  PRO A C   1 
ATOM   1652  O O   . PRO A 1 206 ? 20.328  -33.451 -52.696 1.00 21.81  ? 206  PRO A O   1 
ATOM   1653  C CB  . PRO A 1 206 ? 19.462  -36.042 -54.181 1.00 7.94   ? 206  PRO A CB  1 
ATOM   1654  C CG  . PRO A 1 206 ? 18.386  -35.236 -54.886 1.00 14.45  ? 206  PRO A CG  1 
ATOM   1655  C CD  . PRO A 1 206 ? 17.478  -34.622 -53.832 1.00 14.12  ? 206  PRO A CD  1 
ATOM   1656  N N   . PRO A 1 207 ? 21.624  -35.230 -52.435 1.00 10.85  ? 207  PRO A N   1 
ATOM   1657  C CA  . PRO A 1 207 ? 22.800  -34.452 -52.261 1.00 11.11  ? 207  PRO A CA  1 
ATOM   1658  C C   . PRO A 1 207 ? 22.965  -33.867 -53.593 1.00 25.21  ? 207  PRO A C   1 
ATOM   1659  O O   . PRO A 1 207 ? 22.651  -34.500 -54.572 1.00 31.74  ? 207  PRO A O   1 
ATOM   1660  C CB  . PRO A 1 207 ? 23.905  -35.465 -51.956 1.00 7.59   ? 207  PRO A CB  1 
ATOM   1661  C CG  . PRO A 1 207 ? 23.201  -36.751 -51.534 1.00 8.00   ? 207  PRO A CG  1 
ATOM   1662  C CD  . PRO A 1 207 ? 21.816  -36.658 -52.135 1.00 7.14   ? 207  PRO A CD  1 
ATOM   1663  N N   . PRO A 1 208 ? 23.338  -32.642 -53.587 1.00 29.08  ? 208  PRO A N   1 
ATOM   1664  C CA  . PRO A 1 208 ? 23.574  -31.817 -54.743 1.00 30.67  ? 208  PRO A CA  1 
ATOM   1665  C C   . PRO A 1 208 ? 24.650  -32.317 -55.664 1.00 32.66  ? 208  PRO A C   1 
ATOM   1666  O O   . PRO A 1 208 ? 25.706  -32.702 -55.197 1.00 36.10  ? 208  PRO A O   1 
ATOM   1667  C CB  . PRO A 1 208 ? 24.113  -30.540 -54.162 1.00 31.72  ? 208  PRO A CB  1 
ATOM   1668  C CG  . PRO A 1 208 ? 24.590  -30.878 -52.768 1.00 35.02  ? 208  PRO A CG  1 
ATOM   1669  C CD  . PRO A 1 208 ? 23.947  -32.167 -52.363 1.00 26.22  ? 208  PRO A CD  1 
ATOM   1670  N N   . ASP A 1 209 ? 24.342  -32.203 -56.957 1.00 30.07  ? 209  ASP A N   1 
ATOM   1671  C CA  . ASP A 1 209 ? 25.136  -32.575 -58.117 1.00 30.10  ? 209  ASP A CA  1 
ATOM   1672  C C   . ASP A 1 209 ? 25.627  -31.363 -58.873 1.00 35.70  ? 209  ASP A C   1 
ATOM   1673  O O   . ASP A 1 209 ? 25.232  -30.204 -58.644 1.00 35.20  ? 209  ASP A O   1 
ATOM   1674  C CB  . ASP A 1 209 ? 24.294  -33.426 -59.110 1.00 33.91  ? 209  ASP A CB  1 
ATOM   1675  C CG  . ASP A 1 209 ? 22.907  -32.883 -59.282 1.00 69.22  ? 209  ASP A CG  1 
ATOM   1676  O OD1 . ASP A 1 209 ? 22.686  -31.759 -59.689 1.00 74.62  ? 209  ASP A OD1 1 
ATOM   1677  O OD2 . ASP A 1 209 ? 21.998  -33.634 -58.715 1.00 99.67  ? 209  ASP A OD2 1 
ATOM   1678  N N   . GLU A 1 210 ? 26.447  -31.690 -59.843 1.00 38.21  ? 210  GLU A N   1 
ATOM   1679  C CA  . GLU A 1 210 ? 27.020  -30.705 -60.712 1.00 46.01  ? 210  GLU A CA  1 
ATOM   1680  C C   . GLU A 1 210 ? 25.915  -29.857 -61.332 1.00 38.12  ? 210  GLU A C   1 
ATOM   1681  O O   . GLU A 1 210 ? 26.049  -28.661 -61.603 1.00 37.81  ? 210  GLU A O   1 
ATOM   1682  C CB  . GLU A 1 210 ? 27.877  -31.427 -61.776 1.00 55.83  ? 210  GLU A CB  1 
ATOM   1683  C CG  . GLU A 1 210 ? 28.715  -30.500 -62.697 1.00 125.54 ? 210  GLU A CG  1 
ATOM   1684  C CD  . GLU A 1 210 ? 27.940  -29.852 -63.833 1.00 218.62 ? 210  GLU A CD  1 
ATOM   1685  O OE1 . GLU A 1 210 ? 27.172  -30.455 -64.568 1.00 242.90 ? 210  GLU A OE1 1 
ATOM   1686  O OE2 . GLU A 1 210 ? 28.218  -28.576 -63.981 1.00 231.97 ? 210  GLU A OE2 1 
ATOM   1687  N N   . ILE A 1 211 ? 24.776  -30.459 -61.525 1.00 27.64  ? 211  ILE A N   1 
ATOM   1688  C CA  . ILE A 1 211 ? 23.711  -29.691 -62.111 1.00 30.80  ? 211  ILE A CA  1 
ATOM   1689  C C   . ILE A 1 211 ? 23.160  -28.635 -61.191 1.00 31.42  ? 211  ILE A C   1 
ATOM   1690  O O   . ILE A 1 211 ? 23.092  -27.478 -61.588 1.00 33.61  ? 211  ILE A O   1 
ATOM   1691  C CB  . ILE A 1 211 ? 22.559  -30.586 -62.511 1.00 40.88  ? 211  ILE A CB  1 
ATOM   1692  C CG1 . ILE A 1 211 ? 22.848  -31.375 -63.787 1.00 44.20  ? 211  ILE A CG1 1 
ATOM   1693  C CG2 . ILE A 1 211 ? 21.293  -29.755 -62.616 1.00 43.55  ? 211  ILE A CG2 1 
ATOM   1694  C CD1 . ILE A 1 211 ? 24.014  -32.356 -63.600 1.00 91.48  ? 211  ILE A CD1 1 
ATOM   1695  N N   . TYR A 1 212 ? 22.692  -29.093 -60.015 1.00 20.70  ? 212  TYR A N   1 
ATOM   1696  C CA  . TYR A 1 212 ? 22.150  -28.213 -59.029 1.00 19.94  ? 212  TYR A CA  1 
ATOM   1697  C C   . TYR A 1 212 ? 23.142  -27.060 -58.869 1.00 24.87  ? 212  TYR A C   1 
ATOM   1698  O O   . TYR A 1 212 ? 22.818  -25.846 -58.936 1.00 22.05  ? 212  TYR A O   1 
ATOM   1699  C CB  . TYR A 1 212 ? 21.985  -28.951 -57.695 1.00 18.24  ? 212  TYR A CB  1 
ATOM   1700  C CG  . TYR A 1 212 ? 21.690  -28.024 -56.537 1.00 23.41  ? 212  TYR A CG  1 
ATOM   1701  C CD1 . TYR A 1 212 ? 20.420  -27.456 -56.345 1.00 21.68  ? 212  TYR A CD1 1 
ATOM   1702  C CD2 . TYR A 1 212 ? 22.697  -27.724 -55.608 1.00 31.30  ? 212  TYR A CD2 1 
ATOM   1703  C CE1 . TYR A 1 212 ? 20.181  -26.604 -55.252 1.00 20.53  ? 212  TYR A CE1 1 
ATOM   1704  C CE2 . TYR A 1 212 ? 22.478  -26.876 -54.510 1.00 34.43  ? 212  TYR A CE2 1 
ATOM   1705  C CZ  . TYR A 1 212 ? 21.211  -26.304 -54.339 1.00 44.89  ? 212  TYR A CZ  1 
ATOM   1706  O OH  . TYR A 1 212 ? 21.015  -25.413 -53.293 1.00 44.17  ? 212  TYR A OH  1 
ATOM   1707  N N   . VAL A 1 213 ? 24.391  -27.470 -58.789 1.00 8.44   ? 213  VAL A N   1 
ATOM   1708  C CA  . VAL A 1 213 ? 25.371  -26.450 -58.620 1.00 8.96   ? 213  VAL A CA  1 
ATOM   1709  C C   . VAL A 1 213 ? 25.392  -25.431 -59.696 1.00 19.43  ? 213  VAL A C   1 
ATOM   1710  O O   . VAL A 1 213 ? 25.243  -24.248 -59.453 1.00 23.29  ? 213  VAL A O   1 
ATOM   1711  C CB  . VAL A 1 213 ? 26.713  -27.024 -58.384 1.00 8.72   ? 213  VAL A CB  1 
ATOM   1712  C CG1 . VAL A 1 213 ? 27.622  -25.825 -58.251 1.00 3.46   ? 213  VAL A CG1 1 
ATOM   1713  C CG2 . VAL A 1 213 ? 26.660  -27.849 -57.085 1.00 5.20   ? 213  VAL A CG2 1 
ATOM   1714  N N   . ARG A 1 214 ? 25.388  -25.931 -60.881 1.00 24.33  ? 214  ARG A N   1 
ATOM   1715  C CA  . ARG A 1 214 ? 25.323  -25.106 -62.058 1.00 26.47  ? 214  ARG A CA  1 
ATOM   1716  C C   . ARG A 1 214 ? 24.108  -24.221 -62.005 1.00 23.21  ? 214  ARG A C   1 
ATOM   1717  O O   . ARG A 1 214 ? 24.153  -23.018 -62.103 1.00 23.56  ? 214  ARG A O   1 
ATOM   1718  C CB  . ARG A 1 214 ? 25.118  -26.017 -63.249 1.00 47.19  ? 214  ARG A CB  1 
ATOM   1719  C CG  . ARG A 1 214 ? 25.693  -25.424 -64.522 1.00 121.11 ? 214  ARG A CG  1 
ATOM   1720  C CD  . ARG A 1 214 ? 26.935  -24.561 -64.276 1.00 191.70 ? 214  ARG A CD  1 
ATOM   1721  N NE  . ARG A 1 214 ? 27.325  -23.733 -65.424 1.00 254.17 ? 214  ARG A NE  1 
ATOM   1722  C CZ  . ARG A 1 214 ? 27.181  -24.058 -66.719 1.00 300.00 ? 214  ARG A CZ  1 
ATOM   1723  N NH1 . ARG A 1 214 ? 26.668  -25.220 -67.125 1.00 300.00 ? 214  ARG A NH1 1 
ATOM   1724  N NH2 . ARG A 1 214 ? 27.585  -23.190 -67.646 1.00 300.00 ? 214  ARG A NH2 1 
ATOM   1725  N N   . THR A 1 215 ? 22.992  -24.837 -61.807 1.00 15.52  ? 215  THR A N   1 
ATOM   1726  C CA  . THR A 1 215 ? 21.770  -24.104 -61.765 1.00 11.87  ? 215  THR A CA  1 
ATOM   1727  C C   . THR A 1 215 ? 21.749  -23.010 -60.743 1.00 23.89  ? 215  THR A C   1 
ATOM   1728  O O   . THR A 1 215 ? 21.191  -21.946 -61.007 1.00 25.01  ? 215  THR A O   1 
ATOM   1729  C CB  . THR A 1 215 ? 20.673  -25.044 -61.303 1.00 22.07  ? 215  THR A CB  1 
ATOM   1730  O OG1 . THR A 1 215 ? 20.360  -26.036 -62.237 1.00 34.28  ? 215  THR A OG1 1 
ATOM   1731  C CG2 . THR A 1 215 ? 19.481  -24.171 -61.044 1.00 13.80  ? 215  THR A CG2 1 
ATOM   1732  N N   . VAL A 1 216 ? 22.251  -23.310 -59.541 1.00 24.68  ? 216  VAL A N   1 
ATOM   1733  C CA  . VAL A 1 216 ? 22.156  -22.290 -58.542 1.00 23.39  ? 216  VAL A CA  1 
ATOM   1734  C C   . VAL A 1 216 ? 22.938  -21.122 -58.967 1.00 26.73  ? 216  VAL A C   1 
ATOM   1735  O O   . VAL A 1 216 ? 22.458  -19.998 -58.909 1.00 27.42  ? 216  VAL A O   1 
ATOM   1736  C CB  . VAL A 1 216 ? 22.258  -22.688 -57.084 1.00 27.02  ? 216  VAL A CB  1 
ATOM   1737  C CG1 . VAL A 1 216 ? 21.570  -24.008 -56.947 1.00 24.78  ? 216  VAL A CG1 1 
ATOM   1738  C CG2 . VAL A 1 216 ? 23.672  -22.821 -56.644 1.00 30.89  ? 216  VAL A CG2 1 
ATOM   1739  N N   . TYR A 1 217 ? 24.093  -21.413 -59.484 1.00 26.74  ? 217  TYR A N   1 
ATOM   1740  C CA  . TYR A 1 217 ? 24.894  -20.332 -60.005 1.00 31.47  ? 217  TYR A CA  1 
ATOM   1741  C C   . TYR A 1 217 ? 24.141  -19.589 -61.074 1.00 36.69  ? 217  TYR A C   1 
ATOM   1742  O O   . TYR A 1 217 ? 24.156  -18.392 -61.189 1.00 39.94  ? 217  TYR A O   1 
ATOM   1743  C CB  . TYR A 1 217 ? 26.151  -20.833 -60.672 1.00 37.04  ? 217  TYR A CB  1 
ATOM   1744  C CG  . TYR A 1 217 ? 27.234  -21.170 -59.708 1.00 57.37  ? 217  TYR A CG  1 
ATOM   1745  C CD1 . TYR A 1 217 ? 27.722  -20.251 -58.776 1.00 62.60  ? 217  TYR A CD1 1 
ATOM   1746  C CD2 . TYR A 1 217 ? 27.859  -22.414 -59.789 1.00 69.49  ? 217  TYR A CD2 1 
ATOM   1747  C CE1 . TYR A 1 217 ? 28.788  -20.584 -57.931 1.00 73.92  ? 217  TYR A CE1 1 
ATOM   1748  C CE2 . TYR A 1 217 ? 28.937  -22.756 -58.965 1.00 74.53  ? 217  TYR A CE2 1 
ATOM   1749  C CZ  . TYR A 1 217 ? 29.411  -21.837 -58.025 1.00 80.38  ? 217  TYR A CZ  1 
ATOM   1750  O OH  . TYR A 1 217 ? 30.501  -22.167 -57.220 1.00 63.60  ? 217  TYR A OH  1 
ATOM   1751  N N   . ASN A 1 218 ? 23.411  -20.303 -61.867 1.00 38.49  ? 218  ASN A N   1 
ATOM   1752  C CA  . ASN A 1 218 ? 22.716  -19.563 -62.873 1.00 38.84  ? 218  ASN A CA  1 
ATOM   1753  C C   . ASN A 1 218 ? 21.621  -18.680 -62.344 1.00 42.20  ? 218  ASN A C   1 
ATOM   1754  O O   . ASN A 1 218 ? 21.320  -17.679 -62.950 1.00 53.50  ? 218  ASN A O   1 
ATOM   1755  C CB  . ASN A 1 218 ? 22.334  -20.383 -64.121 1.00 38.59  ? 218  ASN A CB  1 
ATOM   1756  C CG  . ASN A 1 218 ? 23.580  -20.972 -64.760 1.00 97.21  ? 218  ASN A CG  1 
ATOM   1757  O OD1 . ASN A 1 218 ? 23.496  -21.979 -65.483 1.00 142.34 ? 218  ASN A OD1 1 
ATOM   1758  N ND2 . ASN A 1 218 ? 24.744  -20.374 -64.455 1.00 74.68  ? 218  ASN A ND2 1 
ATOM   1759  N N   . ILE A 1 219 ? 21.016  -19.023 -61.237 1.00 26.47  ? 219  ILE A N   1 
ATOM   1760  C CA  . ILE A 1 219 ? 19.950  -18.194 -60.777 1.00 21.54  ? 219  ILE A CA  1 
ATOM   1761  C C   . ILE A 1 219 ? 20.409  -17.068 -59.908 1.00 32.02  ? 219  ILE A C   1 
ATOM   1762  O O   . ILE A 1 219 ? 19.688  -16.107 -59.744 1.00 34.29  ? 219  ILE A O   1 
ATOM   1763  C CB  . ILE A 1 219 ? 19.092  -19.096 -59.973 1.00 23.46  ? 219  ILE A CB  1 
ATOM   1764  C CG1 . ILE A 1 219 ? 18.804  -20.308 -60.831 1.00 21.97  ? 219  ILE A CG1 1 
ATOM   1765  C CG2 . ILE A 1 219 ? 17.820  -18.420 -59.544 1.00 22.56  ? 219  ILE A CG2 1 
ATOM   1766  C CD1 . ILE A 1 219 ? 18.019  -21.329 -60.012 1.00 18.18  ? 219  ILE A CD1 1 
ATOM   1767  N N   . PHE A 1 220 ? 21.617  -17.156 -59.349 1.00 31.03  ? 220  PHE A N   1 
ATOM   1768  C CA  . PHE A 1 220 ? 22.093  -16.124 -58.409 1.00 29.59  ? 220  PHE A CA  1 
ATOM   1769  C C   . PHE A 1 220 ? 23.534  -15.532 -58.601 1.00 44.12  ? 220  PHE A C   1 
ATOM   1770  O O   . PHE A 1 220 ? 24.218  -15.477 -59.659 1.00 60.72  ? 220  PHE A O   1 
ATOM   1771  C CB  . PHE A 1 220 ? 22.058  -16.763 -57.005 1.00 33.70  ? 220  PHE A CB  1 
ATOM   1772  C CG  . PHE A 1 220 ? 20.816  -17.474 -56.463 1.00 34.38  ? 220  PHE A CG  1 
ATOM   1773  C CD1 . PHE A 1 220 ? 19.674  -16.755 -56.118 1.00 36.48  ? 220  PHE A CD1 1 
ATOM   1774  C CD2 . PHE A 1 220 ? 20.835  -18.820 -56.106 1.00 38.85  ? 220  PHE A CD2 1 
ATOM   1775  C CE1 . PHE A 1 220 ? 18.558  -17.359 -55.544 1.00 36.82  ? 220  PHE A CE1 1 
ATOM   1776  C CE2 . PHE A 1 220 ? 19.731  -19.451 -55.527 1.00 41.89  ? 220  PHE A CE2 1 
ATOM   1777  C CZ  . PHE A 1 220 ? 18.577  -18.722 -55.264 1.00 38.16  ? 220  PHE A CZ  1 
HETATM 1778  N N   . GGL B 2 1   ? 19.923  -15.876 -44.023 1.00 37.15  ? 231  GGL I N   1 
HETATM 1779  C CA  . GGL B 2 1   ? 18.988  -16.178 -45.102 1.00 7.63   ? 231  GGL I CA  1 
HETATM 1780  C C   . GGL B 2 1   ? 18.292  -17.527 -44.941 1.00 7.03   ? 231  GGL I C   1 
HETATM 1781  O O   . GGL B 2 1   ? 17.088  -17.572 -45.334 1.00 19.40  ? 231  GGL I O   1 
HETATM 1782  C CB  . GGL B 2 1   ? 19.668  -16.010 -46.443 1.00 6.19   ? 231  GGL I CB  1 
HETATM 1783  C CG  . GGL B 2 1   ? 18.944  -16.637 -47.625 1.00 24.61  ? 231  GGL I CG  1 
HETATM 1784  C CD  . GGL B 2 1   ? 19.806  -16.437 -48.855 1.00 18.75  ? 231  GGL I CD  1 
HETATM 1785  O OE1 . GGL B 2 1   ? 21.007  -16.189 -48.782 1.00 36.14  ? 231  GGL I OE1 1 
HETATM 1786  O OXT . GGL B 2 1   ? 18.897  -18.394 -44.239 1.00 43.52  ? 231  GGL I OXT 1 
HETATM 1787  C C   . ICY B 2 2   ? 18.911  -15.702 -52.248 1.00 29.74  ? 232  ICY I C   1 
HETATM 1788  N N   . ICY B 2 2   ? 19.179  -16.574 -50.007 1.00 39.29  ? 232  ICY I N   1 
HETATM 1789  O O   . ICY B 2 2   ? 17.662  -15.855 -52.242 1.00 26.16  ? 232  ICY I O   1 
HETATM 1790  C CA  . ICY B 2 2   ? 19.854  -16.391 -51.278 1.00 38.11  ? 232  ICY I CA  1 
HETATM 1791  C CB  . ICY B 2 2   ? 20.492  -17.696 -51.832 1.00 43.28  ? 232  ICY I CB  1 
HETATM 1792  S SG  . ICY B 2 2   ? 21.875  -18.352 -50.834 1.00 46.76  ? 232  ICY I SG  1 
HETATM 1793  I I   . ICY B 2 2   ? 22.359  -22.362 -51.461 1.00 90.26  ? 232  ICY I I   1 
HETATM 1794  C C0  . ICY B 2 2   ? 22.861  -19.250 -52.049 1.00 300.00 ? 232  ICY I C0  1 
HETATM 1795  C C1  . ICY B 2 2   ? 24.008  -19.830 -51.281 1.00 300.00 ? 232  ICY I C1  1 
HETATM 1796  C C2  . ICY B 2 2   ? 23.934  -21.142 -50.795 1.00 5.69   ? 232  ICY I C2  1 
HETATM 1797  C C3  . ICY B 2 2   ? 25.024  -21.594 -50.049 1.00 31.59  ? 232  ICY I C3  1 
HETATM 1798  C C4  . ICY B 2 2   ? 26.096  -20.745 -49.739 1.00 15.35  ? 232  ICY I C4  1 
HETATM 1799  C C5  . ICY B 2 2   ? 26.093  -19.409 -50.134 1.00 300.00 ? 232  ICY I C5  1 
HETATM 1800  C C6  . ICY B 2 2   ? 25.027  -18.953 -50.905 1.00 300.00 ? 232  ICY I C6  1 
ATOM   1801  N N   . GLY B 2 3   ? 19.497  -14.830 -53.034 1.00 27.44  ? 233  GLY I N   1 
ATOM   1802  C CA  . GLY B 2 3   ? 18.680  -14.069 -53.975 1.00 23.21  ? 233  GLY I CA  1 
ATOM   1803  C C   . GLY B 2 3   ? 19.334  -12.763 -54.335 1.00 26.89  ? 233  GLY I C   1 
ATOM   1804  O O   . GLY B 2 3   ? 18.973  -12.268 -55.438 1.00 47.64  ? 233  GLY I O   1 
ATOM   1805  O OXT . GLY B 2 3   ? 20.224  -12.377 -53.510 1.00 83.82  ? 233  GLY I OXT 1 
ATOM   1806  N N   . ARG C 1 4   ? 22.830  -9.665  -12.143 1.00 32.33  ? 4    ARG B N   1 
ATOM   1807  C CA  . ARG C 1 4   ? 23.353  -8.750  -13.185 1.00 27.54  ? 4    ARG B CA  1 
ATOM   1808  C C   . ARG C 1 4   ? 24.136  -9.534  -14.264 1.00 35.94  ? 4    ARG B C   1 
ATOM   1809  O O   . ARG C 1 4   ? 25.154  -10.174 -13.974 1.00 45.21  ? 4    ARG B O   1 
ATOM   1810  C CB  . ARG C 1 4   ? 24.172  -7.693  -12.443 1.00 27.89  ? 4    ARG B CB  1 
ATOM   1811  C CG  . ARG C 1 4   ? 24.917  -6.557  -13.139 1.00 16.86  ? 4    ARG B CG  1 
ATOM   1812  C CD  . ARG C 1 4   ? 25.314  -5.412  -12.135 1.00 21.30  ? 4    ARG B CD  1 
ATOM   1813  N NE  . ARG C 1 4   ? 25.945  -4.265  -12.812 1.00 55.57  ? 4    ARG B NE  1 
ATOM   1814  C CZ  . ARG C 1 4   ? 26.051  -2.986  -12.421 1.00 124.64 ? 4    ARG B CZ  1 
ATOM   1815  N NH1 . ARG C 1 4   ? 25.577  -2.545  -11.252 1.00 187.32 ? 4    ARG B NH1 1 
ATOM   1816  N NH2 . ARG C 1 4   ? 26.676  -2.134  -13.257 1.00 64.09  ? 4    ARG B NH2 1 
ATOM   1817  N N   . PRO C 1 5   ? 23.662  -9.498  -15.529 1.00 19.55  ? 5    PRO B N   1 
ATOM   1818  C CA  . PRO C 1 5   ? 24.292  -10.261 -16.576 1.00 10.62  ? 5    PRO B CA  1 
ATOM   1819  C C   . PRO C 1 5   ? 25.705  -9.958  -16.785 1.00 13.02  ? 5    PRO B C   1 
ATOM   1820  O O   . PRO C 1 5   ? 26.161  -8.812  -16.636 1.00 17.31  ? 5    PRO B O   1 
ATOM   1821  C CB  . PRO C 1 5   ? 23.523  -9.974  -17.829 1.00 13.08  ? 5    PRO B CB  1 
ATOM   1822  C CG  . PRO C 1 5   ? 22.153  -9.544  -17.353 1.00 14.67  ? 5    PRO B CG  1 
ATOM   1823  C CD  . PRO C 1 5   ? 22.432  -8.849  -16.054 1.00 15.20  ? 5    PRO B CD  1 
ATOM   1824  N N   . LYS C 1 6   ? 26.366  -11.030 -17.164 1.00 10.63  ? 6    LYS B N   1 
ATOM   1825  C CA  . LYS C 1 6   ? 27.768  -10.954 -17.417 1.00 12.09  ? 6    LYS B CA  1 
ATOM   1826  C C   . LYS C 1 6   ? 28.059  -11.433 -18.816 1.00 19.24  ? 6    LYS B C   1 
ATOM   1827  O O   . LYS C 1 6   ? 27.700  -12.531 -19.243 1.00 23.36  ? 6    LYS B O   1 
ATOM   1828  C CB  . LYS C 1 6   ? 28.547  -11.689 -16.364 1.00 12.50  ? 6    LYS B CB  1 
ATOM   1829  C CG  . LYS C 1 6   ? 30.042  -11.449 -16.433 1.00 5.59   ? 6    LYS B CG  1 
ATOM   1830  C CD  . LYS C 1 6   ? 30.792  -12.029 -15.254 1.00 22.77  ? 6    LYS B CD  1 
ATOM   1831  C CE  . LYS C 1 6   ? 31.218  -11.005 -14.198 1.00 101.78 ? 6    LYS B CE  1 
ATOM   1832  N NZ  . LYS C 1 6   ? 32.631  -11.129 -13.772 1.00 121.13 ? 6    LYS B NZ  1 
ATOM   1833  N N   . LEU C 1 7   ? 28.701  -10.533 -19.506 1.00 10.70  ? 7    LEU B N   1 
ATOM   1834  C CA  . LEU C 1 7   ? 29.056  -10.690 -20.869 1.00 7.75   ? 7    LEU B CA  1 
ATOM   1835  C C   . LEU C 1 7   ? 30.476  -11.077 -21.096 1.00 15.45  ? 7    LEU B C   1 
ATOM   1836  O O   . LEU C 1 7   ? 31.398  -10.304 -20.807 1.00 17.71  ? 7    LEU B O   1 
ATOM   1837  C CB  . LEU C 1 7   ? 28.803  -9.371  -21.634 1.00 7.11   ? 7    LEU B CB  1 
ATOM   1838  C CG  . LEU C 1 7   ? 27.341  -9.266  -22.050 1.00 7.44   ? 7    LEU B CG  1 
ATOM   1839  C CD1 . LEU C 1 7   ? 26.420  -9.290  -20.843 1.00 1.06   ? 7    LEU B CD1 1 
ATOM   1840  C CD2 . LEU C 1 7   ? 27.118  -8.039  -22.850 1.00 1.92   ? 7    LEU B CD2 1 
ATOM   1841  N N   . HIS C 1 8   ? 30.634  -12.216 -21.773 1.00 10.78  ? 8    HIS B N   1 
ATOM   1842  C CA  . HIS C 1 8   ? 31.964  -12.670 -22.118 1.00 10.93  ? 8    HIS B CA  1 
ATOM   1843  C C   . HIS C 1 8   ? 32.292  -12.391 -23.527 1.00 15.06  ? 8    HIS B C   1 
ATOM   1844  O O   . HIS C 1 8   ? 31.669  -12.928 -24.400 1.00 21.54  ? 8    HIS B O   1 
ATOM   1845  C CB  . HIS C 1 8   ? 32.118  -14.162 -21.874 1.00 12.77  ? 8    HIS B CB  1 
ATOM   1846  C CG  . HIS C 1 8   ? 31.925  -14.427 -20.416 1.00 12.97  ? 8    HIS B CG  1 
ATOM   1847  N ND1 . HIS C 1 8   ? 33.016  -14.448 -19.544 1.00 9.21   ? 8    HIS B ND1 1 
ATOM   1848  C CD2 . HIS C 1 8   ? 30.769  -14.602 -19.698 1.00 10.18  ? 8    HIS B CD2 1 
ATOM   1849  C CE1 . HIS C 1 8   ? 32.495  -14.632 -18.338 1.00 4.88   ? 8    HIS B CE1 1 
ATOM   1850  N NE2 . HIS C 1 8   ? 31.158  -14.730 -18.375 1.00 6.80   ? 8    HIS B NE2 1 
ATOM   1851  N N   . TYR C 1 9   ? 33.316  -11.624 -23.743 1.00 14.76  ? 9    TYR B N   1 
ATOM   1852  C CA  . TYR C 1 9   ? 33.678  -11.316 -25.082 1.00 9.55   ? 9    TYR B CA  1 
ATOM   1853  C C   . TYR C 1 9   ? 34.866  -10.439 -24.986 1.00 13.90  ? 9    TYR B C   1 
ATOM   1854  O O   . TYR C 1 9   ? 35.155  -9.835  -23.972 1.00 13.27  ? 9    TYR B O   1 
ATOM   1855  C CB  . TYR C 1 9   ? 32.542  -10.452 -25.670 1.00 11.18  ? 9    TYR B CB  1 
ATOM   1856  C CG  . TYR C 1 9   ? 32.412  -10.548 -27.176 1.00 11.92  ? 9    TYR B CG  1 
ATOM   1857  C CD1 . TYR C 1 9   ? 32.056  -11.781 -27.702 1.00 17.29  ? 9    TYR B CD1 1 
ATOM   1858  C CD2 . TYR C 1 9   ? 32.669  -9.515  -28.081 1.00 10.61  ? 9    TYR B CD2 1 
ATOM   1859  C CE1 . TYR C 1 9   ? 31.908  -11.982 -29.069 1.00 8.41   ? 9    TYR B CE1 1 
ATOM   1860  C CE2 . TYR C 1 9   ? 32.569  -9.696  -29.469 1.00 10.47  ? 9    TYR B CE2 1 
ATOM   1861  C CZ  . TYR C 1 9   ? 32.186  -10.952 -29.950 1.00 8.46   ? 9    TYR B CZ  1 
ATOM   1862  O OH  . TYR C 1 9   ? 32.024  -11.271 -31.261 1.00 9.58   ? 9    TYR B OH  1 
ATOM   1863  N N   . PRO C 1 10  ? 35.509  -10.328 -26.095 1.00 12.04  ? 10   PRO B N   1 
ATOM   1864  C CA  . PRO C 1 10  ? 36.593  -9.423  -26.250 1.00 6.12   ? 10   PRO B CA  1 
ATOM   1865  C C   . PRO C 1 10  ? 36.032  -8.051  -26.034 1.00 17.79  ? 10   PRO B C   1 
ATOM   1866  O O   . PRO C 1 10  ? 34.826  -7.840  -26.048 1.00 18.65  ? 10   PRO B O   1 
ATOM   1867  C CB  . PRO C 1 10  ? 36.985  -9.497  -27.729 1.00 1.52   ? 10   PRO B CB  1 
ATOM   1868  C CG  . PRO C 1 10  ? 36.490  -10.830 -28.242 1.00 1.37   ? 10   PRO B CG  1 
ATOM   1869  C CD  . PRO C 1 10  ? 35.434  -11.289 -27.218 1.00 9.85   ? 10   PRO B CD  1 
ATOM   1870  N N   . ASN C 1 11  ? 36.917  -7.101  -25.806 1.00 22.88  ? 11   ASN B N   1 
ATOM   1871  C CA  . ASN C 1 11  ? 36.412  -5.764  -25.590 1.00 21.68  ? 11   ASN B CA  1 
ATOM   1872  C C   . ASN C 1 11  ? 36.246  -5.021  -26.885 1.00 28.06  ? 11   ASN B C   1 
ATOM   1873  O O   . ASN C 1 11  ? 37.148  -4.268  -27.279 1.00 29.83  ? 11   ASN B O   1 
ATOM   1874  C CB  . ASN C 1 11  ? 37.318  -4.948  -24.681 1.00 27.41  ? 11   ASN B CB  1 
ATOM   1875  C CG  . ASN C 1 11  ? 36.834  -3.531  -24.462 1.00 30.38  ? 11   ASN B CG  1 
ATOM   1876  O OD1 . ASN C 1 11  ? 35.804  -3.047  -24.961 1.00 49.73  ? 11   ASN B OD1 1 
ATOM   1877  N ND2 . ASN C 1 11  ? 37.563  -2.873  -23.629 1.00 31.51  ? 11   ASN B ND2 1 
ATOM   1878  N N   . GLY C 1 12  ? 35.090  -5.222  -27.534 1.00 23.11  ? 12   GLY B N   1 
ATOM   1879  C CA  . GLY C 1 12  ? 34.802  -4.611  -28.819 1.00 15.19  ? 12   GLY B CA  1 
ATOM   1880  C C   . GLY C 1 12  ? 33.436  -5.038  -29.198 1.00 17.86  ? 12   GLY B C   1 
ATOM   1881  O O   . GLY C 1 12  ? 32.808  -5.817  -28.481 1.00 19.68  ? 12   GLY B O   1 
ATOM   1882  N N   . ARG C 1 13  ? 33.002  -4.552  -30.335 1.00 14.04  ? 13   ARG B N   1 
ATOM   1883  C CA  . ARG C 1 13  ? 31.658  -4.807  -30.790 1.00 12.54  ? 13   ARG B CA  1 
ATOM   1884  C C   . ARG C 1 13  ? 31.338  -6.251  -31.126 1.00 9.16   ? 13   ARG B C   1 
ATOM   1885  O O   . ARG C 1 13  ? 30.470  -6.896  -30.502 1.00 15.29  ? 13   ARG B O   1 
ATOM   1886  C CB  . ARG C 1 13  ? 31.325  -3.881  -31.978 1.00 7.69   ? 13   ARG B CB  1 
ATOM   1887  C CG  . ARG C 1 13  ? 31.035  -2.437  -31.652 1.00 1.00   ? 13   ARG B CG  1 
ATOM   1888  C CD  . ARG C 1 13  ? 30.885  -1.494  -32.845 1.00 1.00   ? 13   ARG B CD  1 
ATOM   1889  N NE  . ARG C 1 13  ? 30.610  -0.104  -32.471 1.00 19.00  ? 13   ARG B NE  1 
ATOM   1890  C CZ  . ARG C 1 13  ? 30.363  0.906   -33.298 1.00 12.92  ? 13   ARG B CZ  1 
ATOM   1891  N NH1 . ARG C 1 13  ? 30.282  0.746   -34.595 1.00 18.59  ? 13   ARG B NH1 1 
ATOM   1892  N NH2 . ARG C 1 13  ? 30.188  2.115   -32.804 1.00 20.60  ? 13   ARG B NH2 1 
ATOM   1893  N N   . GLY C 1 14  ? 31.953  -6.656  -32.231 1.00 1.00   ? 14   GLY B N   1 
ATOM   1894  C CA  . GLY C 1 14  ? 31.787  -7.958  -32.829 1.00 1.00   ? 14   GLY B CA  1 
ATOM   1895  C C   . GLY C 1 14  ? 30.344  -8.298  -32.878 1.00 9.54   ? 14   GLY B C   1 
ATOM   1896  O O   . GLY C 1 14  ? 29.493  -7.428  -33.193 1.00 9.47   ? 14   GLY B O   1 
ATOM   1897  N N   . ARG C 1 15  ? 30.067  -9.535  -32.473 1.00 9.02   ? 15   ARG B N   1 
ATOM   1898  C CA  . ARG C 1 15  ? 28.704  -9.995  -32.428 1.00 5.35   ? 15   ARG B CA  1 
ATOM   1899  C C   . ARG C 1 15  ? 27.958  -9.649  -31.157 1.00 14.90  ? 15   ARG B C   1 
ATOM   1900  O O   . ARG C 1 15  ? 26.720  -9.698  -31.172 1.00 20.18  ? 15   ARG B O   1 
ATOM   1901  C CB  . ARG C 1 15  ? 28.686  -11.462 -32.590 1.00 3.97   ? 15   ARG B CB  1 
ATOM   1902  C CG  . ARG C 1 15  ? 29.364  -11.893 -33.846 1.00 5.24   ? 15   ARG B CG  1 
ATOM   1903  C CD  . ARG C 1 15  ? 29.196  -13.377 -34.076 1.00 3.67   ? 15   ARG B CD  1 
ATOM   1904  N NE  . ARG C 1 15  ? 29.927  -13.725 -35.280 1.00 14.51  ? 15   ARG B NE  1 
ATOM   1905  C CZ  . ARG C 1 15  ? 29.330  -13.409 -36.412 1.00 9.50   ? 15   ARG B CZ  1 
ATOM   1906  N NH1 . ARG C 1 15  ? 28.145  -12.849 -36.381 1.00 22.97  ? 15   ARG B NH1 1 
ATOM   1907  N NH2 . ARG C 1 15  ? 29.904  -13.622 -37.563 1.00 12.46  ? 15   ARG B NH2 1 
ATOM   1908  N N   . MET C 1 16  ? 28.700  -9.284  -30.110 1.00 6.25   ? 16   MET B N   1 
ATOM   1909  C CA  . MET C 1 16  ? 28.105  -8.985  -28.803 1.00 7.96   ? 16   MET B CA  1 
ATOM   1910  C C   . MET C 1 16  ? 27.321  -7.680  -28.694 1.00 16.37  ? 16   MET B C   1 
ATOM   1911  O O   . MET C 1 16  ? 26.402  -7.482  -27.850 1.00 16.90  ? 16   MET B O   1 
ATOM   1912  C CB  . MET C 1 16  ? 29.208  -9.152  -27.733 1.00 7.02   ? 16   MET B CB  1 
ATOM   1913  C CG  . MET C 1 16  ? 28.724  -8.975  -26.352 1.00 7.94   ? 16   MET B CG  1 
ATOM   1914  S SD  . MET C 1 16  ? 27.665  -10.280 -25.716 1.00 11.15  ? 16   MET B SD  1 
ATOM   1915  C CE  . MET C 1 16  ? 28.906  -11.419 -25.206 1.00 5.61   ? 16   MET B CE  1 
ATOM   1916  N N   . GLU C 1 17  ? 27.677  -6.783  -29.597 1.00 4.20   ? 17   GLU B N   1 
ATOM   1917  C CA  . GLU C 1 17  ? 27.066  -5.494  -29.550 1.00 1.00   ? 17   GLU B CA  1 
ATOM   1918  C C   . GLU C 1 17  ? 25.570  -5.464  -29.569 1.00 5.23   ? 17   GLU B C   1 
ATOM   1919  O O   . GLU C 1 17  ? 24.933  -4.652  -28.917 1.00 11.87  ? 17   GLU B O   1 
ATOM   1920  C CB  . GLU C 1 17  ? 27.716  -4.583  -30.548 1.00 1.00   ? 17   GLU B CB  1 
ATOM   1921  C CG  . GLU C 1 17  ? 27.572  -3.089  -30.194 1.00 19.56  ? 17   GLU B CG  1 
ATOM   1922  C CD  . GLU C 1 17  ? 28.469  -2.548  -29.120 1.00 7.78   ? 17   GLU B CD  1 
ATOM   1923  O OE1 . GLU C 1 17  ? 29.266  -3.199  -28.492 1.00 31.51  ? 17   GLU B OE1 1 
ATOM   1924  O OE2 . GLU C 1 17  ? 28.217  -1.292  -28.860 1.00 9.61   ? 17   GLU B OE2 1 
ATOM   1925  N N   . SER C 1 18  ? 24.995  -6.366  -30.300 1.00 1.00   ? 18   SER B N   1 
ATOM   1926  C CA  . SER C 1 18  ? 23.558  -6.413  -30.368 1.00 1.00   ? 18   SER B CA  1 
ATOM   1927  C C   . SER C 1 18  ? 22.985  -6.675  -29.021 1.00 6.76   ? 18   SER B C   1 
ATOM   1928  O O   . SER C 1 18  ? 22.015  -6.059  -28.557 1.00 9.68   ? 18   SER B O   1 
ATOM   1929  C CB  . SER C 1 18  ? 23.031  -7.341  -31.433 1.00 1.00   ? 18   SER B CB  1 
ATOM   1930  O OG  . SER C 1 18  ? 23.865  -7.236  -32.559 1.00 13.54  ? 18   SER B OG  1 
ATOM   1931  N N   . VAL C 1 19  ? 23.667  -7.537  -28.334 1.00 7.37   ? 19   VAL B N   1 
ATOM   1932  C CA  . VAL C 1 19  ? 23.275  -7.868  -26.977 1.00 8.08   ? 19   VAL B CA  1 
ATOM   1933  C C   . VAL C 1 19  ? 23.406  -6.674  -26.065 1.00 9.25   ? 19   VAL B C   1 
ATOM   1934  O O   . VAL C 1 19  ? 22.543  -6.429  -25.244 1.00 6.66   ? 19   VAL B O   1 
ATOM   1935  C CB  . VAL C 1 19  ? 24.174  -8.943  -26.439 1.00 8.51   ? 19   VAL B CB  1 
ATOM   1936  C CG1 . VAL C 1 19  ? 23.605  -9.307  -25.093 1.00 10.56  ? 19   VAL B CG1 1 
ATOM   1937  C CG2 . VAL C 1 19  ? 24.117  -10.149 -27.360 1.00 1.00   ? 19   VAL B CG2 1 
ATOM   1938  N N   . ARG C 1 20  ? 24.501  -5.929  -26.220 1.00 5.49   ? 20   ARG B N   1 
ATOM   1939  C CA  . ARG C 1 20  ? 24.578  -4.722  -25.417 1.00 3.46   ? 20   ARG B CA  1 
ATOM   1940  C C   . ARG C 1 20  ? 23.414  -3.829  -25.757 1.00 10.61  ? 20   ARG B C   1 
ATOM   1941  O O   . ARG C 1 20  ? 22.706  -3.403  -24.870 1.00 13.96  ? 20   ARG B O   1 
ATOM   1942  C CB  . ARG C 1 20  ? 25.857  -3.953  -25.571 1.00 1.00   ? 20   ARG B CB  1 
ATOM   1943  C CG  . ARG C 1 20  ? 27.042  -4.892  -25.260 1.00 3.22   ? 20   ARG B CG  1 
ATOM   1944  C CD  . ARG C 1 20  ? 28.405  -4.275  -25.630 1.00 7.99   ? 20   ARG B CD  1 
ATOM   1945  N NE  . ARG C 1 20  ? 29.572  -5.158  -25.411 1.00 7.20   ? 20   ARG B NE  1 
ATOM   1946  C CZ  . ARG C 1 20  ? 30.381  -5.650  -26.344 1.00 10.41  ? 20   ARG B CZ  1 
ATOM   1947  N NH1 . ARG C 1 20  ? 30.169  -5.387  -27.615 1.00 15.20  ? 20   ARG B NH1 1 
ATOM   1948  N NH2 . ARG C 1 20  ? 31.403  -6.456  -26.009 1.00 6.11   ? 20   ARG B NH2 1 
ATOM   1949  N N   . TRP C 1 21  ? 23.176  -3.595  -27.031 1.00 7.37   ? 21   TRP B N   1 
ATOM   1950  C CA  . TRP C 1 21  ? 22.064  -2.743  -27.382 1.00 7.08   ? 21   TRP B CA  1 
ATOM   1951  C C   . TRP C 1 21  ? 20.774  -3.127  -26.746 1.00 15.16  ? 21   TRP B C   1 
ATOM   1952  O O   . TRP C 1 21  ? 20.116  -2.304  -26.184 1.00 17.62  ? 21   TRP B O   1 
ATOM   1953  C CB  . TRP C 1 21  ? 21.800  -2.782  -28.867 1.00 6.41   ? 21   TRP B CB  1 
ATOM   1954  C CG  . TRP C 1 21  ? 22.577  -1.756  -29.554 1.00 10.05  ? 21   TRP B CG  1 
ATOM   1955  C CD1 . TRP C 1 21  ? 23.811  -1.898  -30.075 1.00 13.65  ? 21   TRP B CD1 1 
ATOM   1956  C CD2 . TRP C 1 21  ? 22.177  -0.408  -29.801 1.00 9.28   ? 21   TRP B CD2 1 
ATOM   1957  N NE1 . TRP C 1 21  ? 24.214  -0.713  -30.661 1.00 8.11   ? 21   TRP B NE1 1 
ATOM   1958  C CE2 . TRP C 1 21  ? 23.243  0.225   -30.469 1.00 7.93   ? 21   TRP B CE2 1 
ATOM   1959  C CE3 . TRP C 1 21  ? 21.007  0.305   -29.540 1.00 8.18   ? 21   TRP B CE3 1 
ATOM   1960  C CZ2 . TRP C 1 21  ? 23.157  1.549   -30.881 1.00 5.43   ? 21   TRP B CZ2 1 
ATOM   1961  C CZ3 . TRP C 1 21  ? 20.918  1.593   -29.959 1.00 8.67   ? 21   TRP B CZ3 1 
ATOM   1962  C CH2 . TRP C 1 21  ? 22.001  2.213   -30.605 1.00 9.78   ? 21   TRP B CH2 1 
ATOM   1963  N N   . VAL C 1 22  ? 20.465  -4.402  -26.784 1.00 13.45  ? 22   VAL B N   1 
ATOM   1964  C CA  . VAL C 1 22  ? 19.207  -4.829  -26.272 1.00 9.94   ? 22   VAL B CA  1 
ATOM   1965  C C   . VAL C 1 22  ? 19.099  -4.676  -24.809 1.00 12.54  ? 22   VAL B C   1 
ATOM   1966  O O   . VAL C 1 22  ? 18.100  -4.214  -24.305 1.00 13.70  ? 22   VAL B O   1 
ATOM   1967  C CB  . VAL C 1 22  ? 18.922  -6.268  -26.631 1.00 15.10  ? 22   VAL B CB  1 
ATOM   1968  C CG1 . VAL C 1 22  ? 17.550  -6.607  -26.119 1.00 9.55   ? 22   VAL B CG1 1 
ATOM   1969  C CG2 . VAL C 1 22  ? 18.822  -6.373  -28.141 1.00 16.50  ? 22   VAL B CG2 1 
ATOM   1970  N N   . LEU C 1 23  ? 20.117  -5.141  -24.126 1.00 5.24   ? 23   LEU B N   1 
ATOM   1971  C CA  . LEU C 1 23  ? 20.140  -5.018  -22.690 1.00 3.88   ? 23   LEU B CA  1 
ATOM   1972  C C   . LEU C 1 23  ? 19.931  -3.578  -22.303 1.00 12.19  ? 23   LEU B C   1 
ATOM   1973  O O   . LEU C 1 23  ? 19.014  -3.279  -21.566 1.00 12.38  ? 23   LEU B O   1 
ATOM   1974  C CB  . LEU C 1 23  ? 21.471  -5.539  -22.141 1.00 3.09   ? 23   LEU B CB  1 
ATOM   1975  C CG  . LEU C 1 23  ? 21.439  -7.065  -22.072 1.00 4.80   ? 23   LEU B CG  1 
ATOM   1976  C CD1 . LEU C 1 23  ? 22.771  -7.574  -21.663 1.00 3.57   ? 23   LEU B CD1 1 
ATOM   1977  C CD2 . LEU C 1 23  ? 20.495  -7.496  -20.975 1.00 2.17   ? 23   LEU B CD2 1 
ATOM   1978  N N   . ALA C 1 24  ? 20.767  -2.694  -22.876 1.00 8.67   ? 24   ALA B N   1 
ATOM   1979  C CA  . ALA C 1 24  ? 20.693  -1.248  -22.620 1.00 3.94   ? 24   ALA B CA  1 
ATOM   1980  C C   . ALA C 1 24  ? 19.331  -0.709  -22.878 1.00 13.81  ? 24   ALA B C   1 
ATOM   1981  O O   . ALA C 1 24  ? 18.802  0.008   -22.078 1.00 20.36  ? 24   ALA B O   1 
ATOM   1982  C CB  . ALA C 1 24  ? 21.697  -0.431  -23.375 1.00 1.00   ? 24   ALA B CB  1 
ATOM   1983  N N   . ALA C 1 25  ? 18.791  -1.040  -24.012 1.00 13.24  ? 25   ALA B N   1 
ATOM   1984  C CA  . ALA C 1 25  ? 17.491  -0.547  -24.341 1.00 9.76   ? 25   ALA B CA  1 
ATOM   1985  C C   . ALA C 1 25  ? 16.457  -0.960  -23.353 1.00 16.53  ? 25   ALA B C   1 
ATOM   1986  O O   . ALA C 1 25  ? 15.572  -0.211  -23.033 1.00 21.49  ? 25   ALA B O   1 
ATOM   1987  C CB  . ALA C 1 25  ? 17.053  -0.964  -25.722 1.00 5.49   ? 25   ALA B CB  1 
ATOM   1988  N N   . ALA C 1 26  ? 16.554  -2.193  -22.908 1.00 22.51  ? 26   ALA B N   1 
ATOM   1989  C CA  . ALA C 1 26  ? 15.601  -2.771  -21.962 1.00 14.60  ? 26   ALA B CA  1 
ATOM   1990  C C   . ALA C 1 26  ? 15.824  -2.200  -20.579 1.00 22.33  ? 26   ALA B C   1 
ATOM   1991  O O   . ALA C 1 26  ? 15.160  -2.517  -19.626 1.00 28.32  ? 26   ALA B O   1 
ATOM   1992  C CB  . ALA C 1 26  ? 15.734  -4.282  -21.961 1.00 8.69   ? 26   ALA B CB  1 
ATOM   1993  N N   . GLY C 1 27  ? 16.795  -1.345  -20.485 1.00 20.41  ? 27   GLY B N   1 
ATOM   1994  C CA  . GLY C 1 27  ? 17.136  -0.726  -19.246 1.00 17.35  ? 27   GLY B CA  1 
ATOM   1995  C C   . GLY C 1 27  ? 17.900  -1.605  -18.275 1.00 24.13  ? 27   GLY B C   1 
ATOM   1996  O O   . GLY C 1 27  ? 18.007  -1.267  -17.094 1.00 32.49  ? 27   GLY B O   1 
ATOM   1997  N N   . VAL C 1 28  ? 18.473  -2.706  -18.753 1.00 17.82  ? 28   VAL B N   1 
ATOM   1998  C CA  . VAL C 1 28  ? 19.214  -3.631  -17.894 1.00 8.87   ? 28   VAL B CA  1 
ATOM   1999  C C   . VAL C 1 28  ? 20.695  -3.349  -17.804 1.00 18.14  ? 28   VAL B C   1 
ATOM   2000  O O   . VAL C 1 28  ? 21.339  -3.153  -18.826 1.00 22.20  ? 28   VAL B O   1 
ATOM   2001  C CB  . VAL C 1 28  ? 19.005  -5.007  -18.449 1.00 7.68   ? 28   VAL B CB  1 
ATOM   2002  C CG1 . VAL C 1 28  ? 19.787  -6.009  -17.650 1.00 6.16   ? 28   VAL B CG1 1 
ATOM   2003  C CG2 . VAL C 1 28  ? 17.523  -5.321  -18.509 1.00 1.00   ? 28   VAL B CG2 1 
ATOM   2004  N N   . GLU C 1 29  ? 21.214  -3.288  -16.556 1.00 26.80  ? 29   GLU B N   1 
ATOM   2005  C CA  . GLU C 1 29  ? 22.637  -3.036  -16.297 1.00 28.31  ? 29   GLU B CA  1 
ATOM   2006  C C   . GLU C 1 29  ? 23.351  -4.362  -16.330 1.00 30.20  ? 29   GLU B C   1 
ATOM   2007  O O   . GLU C 1 29  ? 22.756  -5.379  -15.955 1.00 38.03  ? 29   GLU B O   1 
ATOM   2008  C CB  . GLU C 1 29  ? 22.929  -2.286  -14.972 1.00 32.26  ? 29   GLU B CB  1 
ATOM   2009  C CG  . GLU C 1 29  ? 23.021  -0.738  -15.054 1.00 67.57  ? 29   GLU B CG  1 
ATOM   2010  C CD  . GLU C 1 29  ? 23.262  -0.054  -13.727 1.00 160.28 ? 29   GLU B CD  1 
ATOM   2011  O OE1 . GLU C 1 29  ? 22.407  0.061   -12.867 1.00 195.37 ? 29   GLU B OE1 1 
ATOM   2012  O OE2 . GLU C 1 29  ? 24.490  0.416   -13.643 1.00 192.75 ? 29   GLU B OE2 1 
ATOM   2013  N N   . PHE C 1 30  ? 24.610  -4.368  -16.775 1.00 13.23  ? 30   PHE B N   1 
ATOM   2014  C CA  . PHE C 1 30  ? 25.247  -5.647  -16.840 1.00 8.69   ? 30   PHE B CA  1 
ATOM   2015  C C   . PHE C 1 30  ? 26.702  -5.496  -16.747 1.00 14.26  ? 30   PHE B C   1 
ATOM   2016  O O   . PHE C 1 30  ? 27.231  -4.382  -16.837 1.00 9.97   ? 30   PHE B O   1 
ATOM   2017  C CB  . PHE C 1 30  ? 24.960  -6.293  -18.188 1.00 11.39  ? 30   PHE B CB  1 
ATOM   2018  C CG  . PHE C 1 30  ? 25.334  -5.389  -19.379 1.00 9.08   ? 30   PHE B CG  1 
ATOM   2019  C CD1 . PHE C 1 30  ? 26.623  -5.353  -19.909 1.00 8.84   ? 30   PHE B CD1 1 
ATOM   2020  C CD2 . PHE C 1 30  ? 24.385  -4.619  -20.059 1.00 6.88   ? 30   PHE B CD2 1 
ATOM   2021  C CE1 . PHE C 1 30  ? 26.974  -4.576  -21.021 1.00 5.28   ? 30   PHE B CE1 1 
ATOM   2022  C CE2 . PHE C 1 30  ? 24.710  -3.830  -21.175 1.00 5.71   ? 30   PHE B CE2 1 
ATOM   2023  C CZ  . PHE C 1 30  ? 26.022  -3.775  -21.654 1.00 1.00   ? 30   PHE B CZ  1 
ATOM   2024  N N   . ASP C 1 31  ? 27.354  -6.638  -16.589 1.00 13.28  ? 31   ASP B N   1 
ATOM   2025  C CA  . ASP C 1 31  ? 28.777  -6.568  -16.492 1.00 12.08  ? 31   ASP B CA  1 
ATOM   2026  C C   . ASP C 1 31  ? 29.403  -7.191  -17.685 1.00 13.87  ? 31   ASP B C   1 
ATOM   2027  O O   . ASP C 1 31  ? 28.742  -7.855  -18.449 1.00 21.44  ? 31   ASP B O   1 
ATOM   2028  C CB  . ASP C 1 31  ? 29.369  -7.109  -15.168 1.00 15.48  ? 31   ASP B CB  1 
ATOM   2029  C CG  . ASP C 1 31  ? 28.599  -6.749  -13.915 1.00 27.68  ? 31   ASP B CG  1 
ATOM   2030  O OD1 . ASP C 1 31  ? 28.490  -5.598  -13.550 1.00 37.42  ? 31   ASP B OD1 1 
ATOM   2031  O OD2 . ASP C 1 31  ? 28.062  -7.788  -13.273 1.00 34.74  ? 31   ASP B OD2 1 
ATOM   2032  N N   . GLU C 1 32  ? 30.693  -6.974  -17.803 1.00 4.84   ? 32   GLU B N   1 
ATOM   2033  C CA  . GLU C 1 32  ? 31.448  -7.510  -18.879 1.00 9.08   ? 32   GLU B CA  1 
ATOM   2034  C C   . GLU C 1 32  ? 32.762  -8.137  -18.413 1.00 23.83  ? 32   GLU B C   1 
ATOM   2035  O O   . GLU C 1 32  ? 33.455  -7.569  -17.615 1.00 34.10  ? 32   GLU B O   1 
ATOM   2036  C CB  . GLU C 1 32  ? 31.786  -6.404  -19.919 1.00 10.48  ? 32   GLU B CB  1 
ATOM   2037  C CG  . GLU C 1 32  ? 30.543  -5.739  -20.567 1.00 10.37  ? 32   GLU B CG  1 
ATOM   2038  C CD  . GLU C 1 32  ? 30.926  -4.904  -21.752 1.00 18.46  ? 32   GLU B CD  1 
ATOM   2039  O OE1 . GLU C 1 32  ? 31.459  -3.827  -21.622 1.00 28.62  ? 32   GLU B OE1 1 
ATOM   2040  O OE2 . GLU C 1 32  ? 30.873  -5.561  -22.896 1.00 29.96  ? 32   GLU B OE2 1 
ATOM   2041  N N   . GLU C 1 33  ? 33.147  -9.274  -18.981 1.00 17.07  ? 33   GLU B N   1 
ATOM   2042  C CA  . GLU C 1 33  ? 34.377  -9.905  -18.674 1.00 10.34  ? 33   GLU B CA  1 
ATOM   2043  C C   . GLU C 1 33  ? 35.157  -10.097 -19.942 1.00 14.02  ? 33   GLU B C   1 
ATOM   2044  O O   . GLU C 1 33  ? 34.913  -10.991 -20.733 1.00 19.01  ? 33   GLU B O   1 
ATOM   2045  C CB  . GLU C 1 33  ? 34.089  -11.230 -18.046 1.00 13.07  ? 33   GLU B CB  1 
ATOM   2046  C CG  . GLU C 1 33  ? 35.366  -11.687 -17.324 1.00 25.16  ? 33   GLU B CG  1 
ATOM   2047  C CD  . GLU C 1 33  ? 35.255  -13.006 -16.623 1.00 75.56  ? 33   GLU B CD  1 
ATOM   2048  O OE1 . GLU C 1 33  ? 34.609  -13.136 -15.575 1.00 47.37  ? 33   GLU B OE1 1 
ATOM   2049  O OE2 . GLU C 1 33  ? 35.974  -13.956 -17.233 1.00 39.17  ? 33   GLU B OE2 1 
ATOM   2050  N N   . PHE C 1 34  ? 36.106  -9.222  -20.162 1.00 7.61   ? 34   PHE B N   1 
ATOM   2051  C CA  . PHE C 1 34  ? 36.790  -9.251  -21.420 1.00 8.79   ? 34   PHE B CA  1 
ATOM   2052  C C   . PHE C 1 34  ? 37.788  -10.277 -21.750 1.00 19.39  ? 34   PHE B C   1 
ATOM   2053  O O   . PHE C 1 34  ? 38.704  -10.510 -21.001 1.00 24.13  ? 34   PHE B O   1 
ATOM   2054  C CB  . PHE C 1 34  ? 37.442  -7.921  -21.695 1.00 10.39  ? 34   PHE B CB  1 
ATOM   2055  C CG  . PHE C 1 34  ? 36.400  -6.867  -21.774 1.00 17.68  ? 34   PHE B CG  1 
ATOM   2056  C CD1 . PHE C 1 34  ? 35.303  -7.051  -22.613 1.00 28.34  ? 34   PHE B CD1 1 
ATOM   2057  C CD2 . PHE C 1 34  ? 36.487  -5.702  -21.015 1.00 16.81  ? 34   PHE B CD2 1 
ATOM   2058  C CE1 . PHE C 1 34  ? 34.298  -6.091  -22.658 1.00 31.51  ? 34   PHE B CE1 1 
ATOM   2059  C CE2 . PHE C 1 34  ? 35.485  -4.738  -21.048 1.00 16.09  ? 34   PHE B CE2 1 
ATOM   2060  C CZ  . PHE C 1 34  ? 34.395  -4.932  -21.887 1.00 21.33  ? 34   PHE B CZ  1 
ATOM   2061  N N   . LEU C 1 35  ? 37.700  -10.776 -22.969 1.00 17.76  ? 35   LEU B N   1 
ATOM   2062  C CA  . LEU C 1 35  ? 38.756  -11.651 -23.397 1.00 10.55  ? 35   LEU B CA  1 
ATOM   2063  C C   . LEU C 1 35  ? 39.822  -10.828 -24.063 1.00 19.28  ? 35   LEU B C   1 
ATOM   2064  O O   . LEU C 1 35  ? 39.521  -9.941  -24.859 1.00 29.56  ? 35   LEU B O   1 
ATOM   2065  C CB  . LEU C 1 35  ? 38.379  -12.819 -24.309 1.00 7.52   ? 35   LEU B CB  1 
ATOM   2066  C CG  . LEU C 1 35  ? 37.271  -13.667 -23.720 1.00 13.89  ? 35   LEU B CG  1 
ATOM   2067  C CD1 . LEU C 1 35  ? 36.576  -14.478 -24.797 1.00 9.47   ? 35   LEU B CD1 1 
ATOM   2068  C CD2 . LEU C 1 35  ? 37.868  -14.632 -22.771 1.00 11.29  ? 35   LEU B CD2 1 
ATOM   2069  N N   . GLU C 1 36  ? 41.071  -11.133 -23.677 1.00 21.93  ? 36   GLU B N   1 
ATOM   2070  C CA  . GLU C 1 36  ? 42.278  -10.530 -24.224 1.00 23.68  ? 36   GLU B CA  1 
ATOM   2071  C C   . GLU C 1 36  ? 43.275  -11.458 -24.898 1.00 31.22  ? 36   GLU B C   1 
ATOM   2072  O O   . GLU C 1 36  ? 44.043  -10.979 -25.746 1.00 34.30  ? 36   GLU B O   1 
ATOM   2073  C CB  . GLU C 1 36  ? 42.977  -9.523  -23.305 1.00 26.56  ? 36   GLU B CB  1 
ATOM   2074  C CG  . GLU C 1 36  ? 42.028  -8.527  -22.586 1.00 46.80  ? 36   GLU B CG  1 
ATOM   2075  C CD  . GLU C 1 36  ? 42.646  -7.799  -21.430 1.00 144.65 ? 36   GLU B CD  1 
ATOM   2076  O OE1 . GLU C 1 36  ? 43.757  -7.353  -21.433 1.00 197.15 ? 36   GLU B OE1 1 
ATOM   2077  O OE2 . GLU C 1 36  ? 41.838  -7.749  -20.408 1.00 116.08 ? 36   GLU B OE2 1 
ATOM   2078  N N   . THR C 1 37  ? 43.233  -12.764 -24.555 1.00 31.21  ? 37   THR B N   1 
ATOM   2079  C CA  . THR C 1 37  ? 44.144  -13.802 -25.053 1.00 29.82  ? 37   THR B CA  1 
ATOM   2080  C C   . THR C 1 37  ? 43.511  -15.167 -25.313 1.00 35.09  ? 37   THR B C   1 
ATOM   2081  O O   . THR C 1 37  ? 42.465  -15.535 -24.718 1.00 28.14  ? 37   THR B O   1 
ATOM   2082  C CB  . THR C 1 37  ? 45.116  -14.093 -23.902 1.00 43.33  ? 37   THR B CB  1 
ATOM   2083  O OG1 . THR C 1 37  ? 44.495  -14.937 -22.939 1.00 54.39  ? 37   THR B OG1 1 
ATOM   2084  C CG2 . THR C 1 37  ? 45.524  -12.814 -23.226 1.00 18.64  ? 37   THR B CG2 1 
ATOM   2085  N N   . LYS C 1 38  ? 44.269  -15.974 -26.094 1.00 29.25  ? 38   LYS B N   1 
ATOM   2086  C CA  . LYS C 1 38  ? 43.840  -17.351 -26.383 1.00 27.02  ? 38   LYS B CA  1 
ATOM   2087  C C   . LYS C 1 38  ? 43.555  -18.069 -25.074 1.00 32.21  ? 38   LYS B C   1 
ATOM   2088  O O   . LYS C 1 38  ? 42.504  -18.716 -24.810 1.00 38.46  ? 38   LYS B O   1 
ATOM   2089  C CB  . LYS C 1 38  ? 44.892  -18.154 -27.160 1.00 26.43  ? 38   LYS B CB  1 
ATOM   2090  C CG  . LYS C 1 38  ? 44.378  -18.948 -28.375 1.00 60.64  ? 38   LYS B CG  1 
ATOM   2091  C CD  . LYS C 1 38  ? 44.649  -18.321 -29.759 1.00 131.05 ? 38   LYS B CD  1 
ATOM   2092  C CE  . LYS C 1 38  ? 44.158  -19.149 -30.963 1.00 170.26 ? 38   LYS B CE  1 
ATOM   2093  N NZ  . LYS C 1 38  ? 44.573  -18.649 -32.299 1.00 174.30 ? 38   LYS B NZ  1 
ATOM   2094  N N   . GLU C 1 39  ? 44.503  -17.882 -24.215 1.00 27.67  ? 39   GLU B N   1 
ATOM   2095  C CA  . GLU C 1 39  ? 44.486  -18.500 -22.928 1.00 31.08  ? 39   GLU B CA  1 
ATOM   2096  C C   . GLU C 1 39  ? 43.262  -18.240 -22.100 1.00 30.03  ? 39   GLU B C   1 
ATOM   2097  O O   . GLU C 1 39  ? 42.655  -19.176 -21.547 1.00 35.32  ? 39   GLU B O   1 
ATOM   2098  C CB  . GLU C 1 39  ? 45.807  -18.317 -22.190 1.00 37.81  ? 39   GLU B CB  1 
ATOM   2099  C CG  . GLU C 1 39  ? 45.932  -19.233 -20.961 1.00 79.19  ? 39   GLU B CG  1 
ATOM   2100  C CD  . GLU C 1 39  ? 46.315  -18.424 -19.751 1.00 193.64 ? 39   GLU B CD  1 
ATOM   2101  O OE1 . GLU C 1 39  ? 46.243  -17.202 -19.704 1.00 232.66 ? 39   GLU B OE1 1 
ATOM   2102  O OE2 . GLU C 1 39  ? 46.743  -19.173 -18.766 1.00 227.39 ? 39   GLU B OE2 1 
ATOM   2103  N N   . GLN C 1 40  ? 42.844  -16.990 -22.023 1.00 21.77  ? 40   GLN B N   1 
ATOM   2104  C CA  . GLN C 1 40  ? 41.619  -16.759 -21.275 1.00 20.26  ? 40   GLN B CA  1 
ATOM   2105  C C   . GLN C 1 40  ? 40.438  -17.452 -21.912 1.00 27.16  ? 40   GLN B C   1 
ATOM   2106  O O   . GLN C 1 40  ? 39.532  -17.909 -21.219 1.00 28.08  ? 40   GLN B O   1 
ATOM   2107  C CB  . GLN C 1 40  ? 41.325  -15.305 -21.108 1.00 19.08  ? 40   GLN B CB  1 
ATOM   2108  C CG  . GLN C 1 40  ? 42.617  -14.539 -20.887 1.00 31.96  ? 40   GLN B CG  1 
ATOM   2109  C CD  . GLN C 1 40  ? 42.368  -13.066 -20.970 1.00 60.17  ? 40   GLN B CD  1 
ATOM   2110  O OE1 . GLN C 1 40  ? 42.417  -12.482 -22.077 1.00 56.97  ? 40   GLN B OE1 1 
ATOM   2111  N NE2 . GLN C 1 40  ? 41.939  -12.512 -19.837 1.00 30.70  ? 40   GLN B NE2 1 
ATOM   2112  N N   . LEU C 1 41  ? 40.485  -17.552 -23.237 1.00 19.89  ? 41   LEU B N   1 
ATOM   2113  C CA  . LEU C 1 41  ? 39.454  -18.230 -23.929 1.00 18.47  ? 41   LEU B CA  1 
ATOM   2114  C C   . LEU C 1 41  ? 39.526  -19.676 -23.523 1.00 22.31  ? 41   LEU B C   1 
ATOM   2115  O O   . LEU C 1 41  ? 38.524  -20.263 -23.096 1.00 20.50  ? 41   LEU B O   1 
ATOM   2116  C CB  . LEU C 1 41  ? 39.629  -18.008 -25.419 1.00 19.14  ? 41   LEU B CB  1 
ATOM   2117  C CG  . LEU C 1 41  ? 38.696  -18.846 -26.285 1.00 22.37  ? 41   LEU B CG  1 
ATOM   2118  C CD1 . LEU C 1 41  ? 37.208  -18.596 -25.983 1.00 14.45  ? 41   LEU B CD1 1 
ATOM   2119  C CD2 . LEU C 1 41  ? 39.004  -18.553 -27.739 1.00 6.97   ? 41   LEU B CD2 1 
ATOM   2120  N N   . TYR C 1 42  ? 40.733  -20.239 -23.559 1.00 18.09  ? 42   TYR B N   1 
ATOM   2121  C CA  . TYR C 1 42  ? 40.858  -21.630 -23.094 1.00 22.08  ? 42   TYR B CA  1 
ATOM   2122  C C   . TYR C 1 42  ? 40.316  -21.900 -21.746 1.00 21.45  ? 42   TYR B C   1 
ATOM   2123  O O   . TYR C 1 42  ? 39.683  -22.909 -21.496 1.00 23.96  ? 42   TYR B O   1 
ATOM   2124  C CB  . TYR C 1 42  ? 42.261  -22.073 -22.978 1.00 34.68  ? 42   TYR B CB  1 
ATOM   2125  C CG  . TYR C 1 42  ? 42.749  -22.354 -24.353 1.00 69.13  ? 42   TYR B CG  1 
ATOM   2126  C CD1 . TYR C 1 42  ? 41.874  -22.883 -25.300 1.00 82.25  ? 42   TYR B CD1 1 
ATOM   2127  C CD2 . TYR C 1 42  ? 44.070  -22.112 -24.736 1.00 76.28  ? 42   TYR B CD2 1 
ATOM   2128  C CE1 . TYR C 1 42  ? 42.297  -23.174 -26.601 1.00 94.37  ? 42   TYR B CE1 1 
ATOM   2129  C CE2 . TYR C 1 42  ? 44.507  -22.391 -26.034 1.00 79.12  ? 42   TYR B CE2 1 
ATOM   2130  C CZ  . TYR C 1 42  ? 43.622  -22.927 -26.970 1.00 95.12  ? 42   TYR B CZ  1 
ATOM   2131  O OH  . TYR C 1 42  ? 44.068  -23.218 -28.247 1.00 96.88  ? 42   TYR B OH  1 
ATOM   2132  N N   . LYS C 1 43  ? 40.569  -21.005 -20.845 1.00 13.68  ? 43   LYS B N   1 
ATOM   2133  C CA  . LYS C 1 43  ? 40.036  -21.301 -19.547 1.00 14.88  ? 43   LYS B CA  1 
ATOM   2134  C C   . LYS C 1 43  ? 38.542  -21.321 -19.536 1.00 21.16  ? 43   LYS B C   1 
ATOM   2135  O O   . LYS C 1 43  ? 37.864  -22.056 -18.837 1.00 31.70  ? 43   LYS B O   1 
ATOM   2136  C CB  . LYS C 1 43  ? 40.600  -20.381 -18.467 1.00 21.00  ? 43   LYS B CB  1 
ATOM   2137  C CG  . LYS C 1 43  ? 42.064  -20.081 -18.736 1.00 105.48 ? 43   LYS B CG  1 
ATOM   2138  C CD  . LYS C 1 43  ? 42.598  -18.890 -17.955 1.00 165.45 ? 43   LYS B CD  1 
ATOM   2139  C CE  . LYS C 1 43  ? 43.209  -19.271 -16.614 1.00 228.51 ? 43   LYS B CE  1 
ATOM   2140  N NZ  . LYS C 1 43  ? 43.946  -18.167 -15.975 1.00 258.00 ? 43   LYS B NZ  1 
ATOM   2141  N N   . LEU C 1 44  ? 38.004  -20.495 -20.336 1.00 13.95  ? 44   LEU B N   1 
ATOM   2142  C CA  . LEU C 1 44  ? 36.572  -20.401 -20.350 1.00 12.63  ? 44   LEU B CA  1 
ATOM   2143  C C   . LEU C 1 44  ? 36.007  -21.679 -20.904 1.00 15.33  ? 44   LEU B C   1 
ATOM   2144  O O   . LEU C 1 44  ? 35.037  -22.270 -20.426 1.00 15.90  ? 44   LEU B O   1 
ATOM   2145  C CB  . LEU C 1 44  ? 36.349  -19.187 -21.254 1.00 12.87  ? 44   LEU B CB  1 
ATOM   2146  C CG  . LEU C 1 44  ? 35.048  -18.439 -21.081 1.00 16.69  ? 44   LEU B CG  1 
ATOM   2147  C CD1 . LEU C 1 44  ? 34.710  -18.255 -19.646 1.00 12.70  ? 44   LEU B CD1 1 
ATOM   2148  C CD2 . LEU C 1 44  ? 35.147  -17.051 -21.695 1.00 18.55  ? 44   LEU B CD2 1 
ATOM   2149  N N   . GLN C 1 45  ? 36.713  -22.123 -21.917 1.00 10.39  ? 45   GLN B N   1 
ATOM   2150  C CA  . GLN C 1 45  ? 36.338  -23.297 -22.625 1.00 8.91   ? 45   GLN B CA  1 
ATOM   2151  C C   . GLN C 1 45  ? 36.521  -24.466 -21.756 1.00 24.32  ? 45   GLN B C   1 
ATOM   2152  O O   . GLN C 1 45  ? 35.629  -25.279 -21.596 1.00 24.96  ? 45   GLN B O   1 
ATOM   2153  C CB  . GLN C 1 45  ? 37.259  -23.448 -23.803 1.00 7.27   ? 45   GLN B CB  1 
ATOM   2154  C CG  . GLN C 1 45  ? 36.798  -22.544 -24.912 1.00 23.17  ? 45   GLN B CG  1 
ATOM   2155  C CD  . GLN C 1 45  ? 37.726  -22.623 -26.064 1.00 9.01   ? 45   GLN B CD  1 
ATOM   2156  O OE1 . GLN C 1 45  ? 38.884  -22.941 -25.850 1.00 36.30  ? 45   GLN B OE1 1 
ATOM   2157  N NE2 . GLN C 1 45  ? 37.241  -22.246 -27.259 1.00 19.47  ? 45   GLN B NE2 1 
ATOM   2158  N N   . ASP C 1 46  ? 37.720  -24.492 -21.190 1.00 25.91  ? 46   ASP B N   1 
ATOM   2159  C CA  . ASP C 1 46  ? 38.109  -25.549 -20.285 1.00 24.70  ? 46   ASP B CA  1 
ATOM   2160  C C   . ASP C 1 46  ? 37.128  -25.748 -19.141 1.00 20.91  ? 46   ASP B C   1 
ATOM   2161  O O   . ASP C 1 46  ? 36.810  -26.835 -18.759 1.00 23.96  ? 46   ASP B O   1 
ATOM   2162  C CB  . ASP C 1 46  ? 39.508  -25.334 -19.721 1.00 28.86  ? 46   ASP B CB  1 
ATOM   2163  C CG  . ASP C 1 46  ? 39.955  -26.419 -18.751 1.00 66.70  ? 46   ASP B CG  1 
ATOM   2164  O OD1 . ASP C 1 46  ? 40.033  -27.591 -19.068 1.00 73.54  ? 46   ASP B OD1 1 
ATOM   2165  O OD2 . ASP C 1 46  ? 40.189  -25.986 -17.517 1.00 88.27  ? 46   ASP B OD2 1 
ATOM   2166  N N   . GLY C 1 47  ? 36.631  -24.708 -18.540 1.00 17.38  ? 47   GLY B N   1 
ATOM   2167  C CA  . GLY C 1 47  ? 35.711  -24.952 -17.465 1.00 13.80  ? 47   GLY B CA  1 
ATOM   2168  C C   . GLY C 1 47  ? 34.333  -25.292 -17.936 1.00 20.83  ? 47   GLY B C   1 
ATOM   2169  O O   . GLY C 1 47  ? 33.411  -25.341 -17.128 1.00 26.10  ? 47   GLY B O   1 
ATOM   2170  N N   . ASN C 1 48  ? 34.172  -25.494 -19.237 1.00 16.78  ? 48   ASN B N   1 
ATOM   2171  C CA  . ASN C 1 48  ? 32.862  -25.846 -19.734 1.00 18.70  ? 48   ASN B CA  1 
ATOM   2172  C C   . ASN C 1 48  ? 31.861  -24.727 -19.597 1.00 23.54  ? 48   ASN B C   1 
ATOM   2173  O O   . ASN C 1 48  ? 30.707  -24.927 -19.255 1.00 28.81  ? 48   ASN B O   1 
ATOM   2174  C CB  . ASN C 1 48  ? 32.376  -27.215 -19.153 1.00 19.59  ? 48   ASN B CB  1 
ATOM   2175  C CG  . ASN C 1 48  ? 33.370  -28.291 -19.592 1.00 101.87 ? 48   ASN B CG  1 
ATOM   2176  O OD1 . ASN C 1 48  ? 33.848  -28.295 -20.751 1.00 85.57  ? 48   ASN B OD1 1 
ATOM   2177  N ND2 . ASN C 1 48  ? 33.837  -29.092 -18.631 1.00 131.65 ? 48   ASN B ND2 1 
ATOM   2178  N N   . HIS C 1 49  ? 32.290  -23.515 -19.847 1.00 14.99  ? 49   HIS B N   1 
ATOM   2179  C CA  . HIS C 1 49  ? 31.308  -22.476 -19.704 1.00 12.78  ? 49   HIS B CA  1 
ATOM   2180  C C   . HIS C 1 49  ? 30.623  -22.105 -20.983 1.00 15.54  ? 49   HIS B C   1 
ATOM   2181  O O   . HIS C 1 49  ? 29.580  -21.488 -20.944 1.00 16.83  ? 49   HIS B O   1 
ATOM   2182  C CB  . HIS C 1 49  ? 32.057  -21.280 -19.312 1.00 16.79  ? 49   HIS B CB  1 
ATOM   2183  C CG  . HIS C 1 49  ? 32.725  -21.522 -18.045 1.00 21.98  ? 49   HIS B CG  1 
ATOM   2184  N ND1 . HIS C 1 49  ? 31.984  -21.661 -16.881 1.00 23.88  ? 49   HIS B ND1 1 
ATOM   2185  C CD2 . HIS C 1 49  ? 34.038  -21.601 -17.759 1.00 25.84  ? 49   HIS B CD2 1 
ATOM   2186  C CE1 . HIS C 1 49  ? 32.856  -21.789 -15.904 1.00 21.95  ? 49   HIS B CE1 1 
ATOM   2187  N NE2 . HIS C 1 49  ? 34.095  -21.745 -16.391 1.00 24.18  ? 49   HIS B NE2 1 
ATOM   2188  N N   . LEU C 1 50  ? 31.275  -22.441 -22.090 1.00 8.69   ? 50   LEU B N   1 
ATOM   2189  C CA  . LEU C 1 50  ? 30.830  -22.199 -23.415 1.00 4.38   ? 50   LEU B CA  1 
ATOM   2190  C C   . LEU C 1 50  ? 30.246  -23.463 -23.957 1.00 11.49  ? 50   LEU B C   1 
ATOM   2191  O O   . LEU C 1 50  ? 30.998  -24.322 -24.306 1.00 9.66   ? 50   LEU B O   1 
ATOM   2192  C CB  . LEU C 1 50  ? 32.052  -21.893 -24.285 1.00 1.64   ? 50   LEU B CB  1 
ATOM   2193  C CG  . LEU C 1 50  ? 32.826  -20.774 -23.627 1.00 3.51   ? 50   LEU B CG  1 
ATOM   2194  C CD1 . LEU C 1 50  ? 33.938  -20.251 -24.534 1.00 1.06   ? 50   LEU B CD1 1 
ATOM   2195  C CD2 . LEU C 1 50  ? 31.849  -19.719 -23.160 1.00 1.00   ? 50   LEU B CD2 1 
ATOM   2196  N N   . LEU C 1 51  ? 28.924  -23.521 -24.079 1.00 8.04   ? 51   LEU B N   1 
ATOM   2197  C CA  . LEU C 1 51  ? 28.230  -24.693 -24.569 1.00 1.52   ? 51   LEU B CA  1 
ATOM   2198  C C   . LEU C 1 51  ? 28.822  -25.243 -25.805 1.00 10.02  ? 51   LEU B C   1 
ATOM   2199  O O   . LEU C 1 51  ? 28.938  -26.441 -25.936 1.00 21.73  ? 51   LEU B O   1 
ATOM   2200  C CB  . LEU C 1 51  ? 26.757  -24.360 -24.811 1.00 1.31   ? 51   LEU B CB  1 
ATOM   2201  C CG  . LEU C 1 51  ? 25.902  -25.508 -25.350 1.00 7.53   ? 51   LEU B CG  1 
ATOM   2202  C CD1 . LEU C 1 51  ? 25.839  -26.612 -24.307 1.00 1.00   ? 51   LEU B CD1 1 
ATOM   2203  C CD2 . LEU C 1 51  ? 24.451  -25.111 -25.670 1.00 1.00   ? 51   LEU B CD2 1 
ATOM   2204  N N   . PHE C 1 52  ? 29.204  -24.355 -26.711 1.00 9.94   ? 52   PHE B N   1 
ATOM   2205  C CA  . PHE C 1 52  ? 29.749  -24.803 -27.985 1.00 7.21   ? 52   PHE B CA  1 
ATOM   2206  C C   . PHE C 1 52  ? 31.141  -24.279 -28.187 1.00 11.24  ? 52   PHE B C   1 
ATOM   2207  O O   . PHE C 1 52  ? 31.577  -24.162 -29.312 1.00 6.58   ? 52   PHE B O   1 
ATOM   2208  C CB  . PHE C 1 52  ? 28.871  -24.501 -29.217 1.00 1.00   ? 52   PHE B CB  1 
ATOM   2209  C CG  . PHE C 1 52  ? 27.516  -25.200 -29.225 1.00 2.96   ? 52   PHE B CG  1 
ATOM   2210  C CD1 . PHE C 1 52  ? 27.402  -26.582 -29.332 1.00 7.87   ? 52   PHE B CD1 1 
ATOM   2211  C CD2 . PHE C 1 52  ? 26.323  -24.476 -29.150 1.00 6.49   ? 52   PHE B CD2 1 
ATOM   2212  C CE1 . PHE C 1 52  ? 26.166  -27.231 -29.301 1.00 6.37   ? 52   PHE B CE1 1 
ATOM   2213  C CE2 . PHE C 1 52  ? 25.070  -25.086 -29.132 1.00 6.34   ? 52   PHE B CE2 1 
ATOM   2214  C CZ  . PHE C 1 52  ? 25.003  -26.479 -29.184 1.00 5.29   ? 52   PHE B CZ  1 
ATOM   2215  N N   . GLN C 1 53  ? 31.780  -23.881 -27.096 1.00 5.74   ? 53   GLN B N   1 
ATOM   2216  C CA  . GLN C 1 53  ? 33.136  -23.404 -27.190 1.00 5.09   ? 53   GLN B CA  1 
ATOM   2217  C C   . GLN C 1 53  ? 33.309  -22.055 -27.805 1.00 13.57  ? 53   GLN B C   1 
ATOM   2218  O O   . GLN C 1 53  ? 34.420  -21.648 -28.067 1.00 14.23  ? 53   GLN B O   1 
ATOM   2219  C CB  . GLN C 1 53  ? 34.031  -24.428 -27.883 1.00 3.56   ? 53   GLN B CB  1 
ATOM   2220  C CG  . GLN C 1 53  ? 33.932  -25.888 -27.292 1.00 13.24  ? 53   GLN B CG  1 
ATOM   2221  C CD  . GLN C 1 53  ? 34.378  -26.041 -25.836 1.00 42.24  ? 53   GLN B CD  1 
ATOM   2222  O OE1 . GLN C 1 53  ? 35.384  -26.700 -25.562 1.00 114.27 ? 53   GLN B OE1 1 
ATOM   2223  N NE2 . GLN C 1 53  ? 33.683  -25.428 -24.884 1.00 50.32  ? 53   GLN B NE2 1 
ATOM   2224  N N   . GLN C 1 54  ? 32.218  -21.345 -27.994 1.00 11.15  ? 54   GLN B N   1 
ATOM   2225  C CA  . GLN C 1 54  ? 32.373  -20.046 -28.546 1.00 11.09  ? 54   GLN B CA  1 
ATOM   2226  C C   . GLN C 1 54  ? 31.660  -19.062 -27.709 1.00 14.96  ? 54   GLN B C   1 
ATOM   2227  O O   . GLN C 1 54  ? 30.854  -19.471 -26.871 1.00 10.27  ? 54   GLN B O   1 
ATOM   2228  C CB  . GLN C 1 54  ? 31.552  -19.957 -29.806 1.00 9.52   ? 54   GLN B CB  1 
ATOM   2229  C CG  . GLN C 1 54  ? 31.994  -21.045 -30.753 1.00 12.31  ? 54   GLN B CG  1 
ATOM   2230  C CD  . GLN C 1 54  ? 31.037  -21.247 -31.887 1.00 1.00   ? 54   GLN B CD  1 
ATOM   2231  O OE1 . GLN C 1 54  ? 29.913  -21.773 -31.707 1.00 45.37  ? 54   GLN B OE1 1 
ATOM   2232  N NE2 . GLN C 1 54  ? 31.429  -20.721 -33.035 1.00 19.84  ? 54   GLN B NE2 1 
ATOM   2233  N N   . VAL C 1 55  ? 31.979  -17.803 -28.020 1.00 10.42  ? 55   VAL B N   1 
ATOM   2234  C CA  . VAL C 1 55  ? 31.365  -16.591 -27.521 1.00 9.57   ? 55   VAL B CA  1 
ATOM   2235  C C   . VAL C 1 55  ? 30.695  -15.917 -28.747 1.00 14.69  ? 55   VAL B C   1 
ATOM   2236  O O   . VAL C 1 55  ? 31.033  -16.129 -29.926 1.00 8.70   ? 55   VAL B O   1 
ATOM   2237  C CB  . VAL C 1 55  ? 32.356  -15.620 -26.882 1.00 8.03   ? 55   VAL B CB  1 
ATOM   2238  C CG1 . VAL C 1 55  ? 32.795  -16.168 -25.563 1.00 3.46   ? 55   VAL B CG1 1 
ATOM   2239  C CG2 . VAL C 1 55  ? 33.570  -15.412 -27.776 1.00 4.29   ? 55   VAL B CG2 1 
ATOM   2240  N N   . PRO C 1 56  ? 29.697  -15.093 -28.534 1.00 11.30  ? 56   PRO B N   1 
ATOM   2241  C CA  . PRO C 1 56  ? 29.216  -14.647 -27.256 1.00 4.11   ? 56   PRO B CA  1 
ATOM   2242  C C   . PRO C 1 56  ? 28.678  -15.657 -26.331 1.00 9.83   ? 56   PRO B C   1 
ATOM   2243  O O   . PRO C 1 56  ? 27.934  -16.547 -26.710 1.00 19.45  ? 56   PRO B O   1 
ATOM   2244  C CB  . PRO C 1 56  ? 27.989  -13.774 -27.622 1.00 1.00   ? 56   PRO B CB  1 
ATOM   2245  C CG  . PRO C 1 56  ? 28.143  -13.405 -29.077 1.00 4.11   ? 56   PRO B CG  1 
ATOM   2246  C CD  . PRO C 1 56  ? 29.311  -14.176 -29.663 1.00 3.84   ? 56   PRO B CD  1 
ATOM   2247  N N   . MET C 1 57  ? 28.904  -15.402 -25.063 1.00 5.04   ? 57   MET B N   1 
ATOM   2248  C CA  . MET C 1 57  ? 28.254  -16.157 -23.989 1.00 3.72   ? 57   MET B CA  1 
ATOM   2249  C C   . MET C 1 57  ? 27.841  -15.096 -22.981 1.00 5.29   ? 57   MET B C   1 
ATOM   2250  O O   . MET C 1 57  ? 28.551  -14.127 -22.722 1.00 10.86  ? 57   MET B O   1 
ATOM   2251  C CB  . MET C 1 57  ? 29.119  -17.209 -23.290 1.00 5.14   ? 57   MET B CB  1 
ATOM   2252  C CG  . MET C 1 57  ? 28.291  -18.001 -22.325 1.00 11.13  ? 57   MET B CG  1 
ATOM   2253  S SD  . MET C 1 57  ? 28.215  -17.337 -20.648 1.00 16.68  ? 57   MET B SD  1 
ATOM   2254  C CE  . MET C 1 57  ? 29.866  -17.826 -20.181 1.00 5.94   ? 57   MET B CE  1 
ATOM   2255  N N   . VAL C 1 58  ? 26.676  -15.224 -22.459 1.00 2.32   ? 58   VAL B N   1 
ATOM   2256  C CA  . VAL C 1 58  ? 26.186  -14.277 -21.492 1.00 2.31   ? 58   VAL B CA  1 
ATOM   2257  C C   . VAL C 1 58  ? 25.595  -15.054 -20.339 1.00 12.78  ? 58   VAL B C   1 
ATOM   2258  O O   . VAL C 1 58  ? 24.799  -16.003 -20.522 1.00 11.53  ? 58   VAL B O   1 
ATOM   2259  C CB  . VAL C 1 58  ? 25.062  -13.489 -22.120 1.00 4.17   ? 58   VAL B CB  1 
ATOM   2260  C CG1 . VAL C 1 58  ? 24.268  -12.697 -21.080 1.00 2.31   ? 58   VAL B CG1 1 
ATOM   2261  C CG2 . VAL C 1 58  ? 25.688  -12.590 -23.135 1.00 5.34   ? 58   VAL B CG2 1 
ATOM   2262  N N   . GLU C 1 59  ? 26.018  -14.653 -19.159 1.00 12.32  ? 59   GLU B N   1 
ATOM   2263  C CA  . GLU C 1 59  ? 25.501  -15.308 -17.983 1.00 10.70  ? 59   GLU B CA  1 
ATOM   2264  C C   . GLU C 1 59  ? 24.380  -14.523 -17.453 1.00 17.16  ? 59   GLU B C   1 
ATOM   2265  O O   . GLU C 1 59  ? 24.562  -13.411 -16.983 1.00 22.45  ? 59   GLU B O   1 
ATOM   2266  C CB  . GLU C 1 59  ? 26.459  -15.413 -16.840 1.00 9.62   ? 59   GLU B CB  1 
ATOM   2267  C CG  . GLU C 1 59  ? 27.825  -16.009 -17.178 1.00 29.96  ? 59   GLU B CG  1 
ATOM   2268  C CD  . GLU C 1 59  ? 28.644  -16.229 -15.914 1.00 5.94   ? 59   GLU B CD  1 
ATOM   2269  O OE1 . GLU C 1 59  ? 28.250  -16.918 -14.973 1.00 138.83 ? 59   GLU B OE1 1 
ATOM   2270  O OE2 . GLU C 1 59  ? 29.786  -15.570 -15.940 1.00 37.35  ? 59   GLU B OE2 1 
ATOM   2271  N N   . ILE C 1 60  ? 23.242  -15.138 -17.509 1.00 10.44  ? 60   ILE B N   1 
ATOM   2272  C CA  . ILE C 1 60  ? 22.067  -14.476 -17.081 1.00 7.52   ? 60   ILE B CA  1 
ATOM   2273  C C   . ILE C 1 60  ? 21.039  -15.445 -16.519 1.00 12.99  ? 60   ILE B C   1 
ATOM   2274  O O   . ILE C 1 60  ? 20.819  -16.553 -17.008 1.00 18.91  ? 60   ILE B O   1 
ATOM   2275  C CB  . ILE C 1 60  ? 21.502  -13.881 -18.348 1.00 13.20  ? 60   ILE B CB  1 
ATOM   2276  C CG1 . ILE C 1 60  ? 20.255  -13.141 -18.010 1.00 13.74  ? 60   ILE B CG1 1 
ATOM   2277  C CG2 . ILE C 1 60  ? 21.147  -15.013 -19.318 1.00 13.67  ? 60   ILE B CG2 1 
ATOM   2278  C CD1 . ILE C 1 60  ? 19.788  -12.229 -19.127 1.00 4.78   ? 60   ILE B CD1 1 
ATOM   2279  N N   . ASP C 1 61  ? 20.390  -15.004 -15.469 1.00 13.05  ? 61   ASP B N   1 
ATOM   2280  C CA  . ASP C 1 61  ? 19.338  -15.786 -14.812 1.00 8.47   ? 61   ASP B CA  1 
ATOM   2281  C C   . ASP C 1 61  ? 19.748  -17.178 -14.500 1.00 16.67  ? 61   ASP B C   1 
ATOM   2282  O O   . ASP C 1 61  ? 18.965  -18.137 -14.603 1.00 22.10  ? 61   ASP B O   1 
ATOM   2283  C CB  . ASP C 1 61  ? 17.990  -15.721 -15.519 1.00 7.69   ? 61   ASP B CB  1 
ATOM   2284  C CG  . ASP C 1 61  ? 17.520  -14.306 -15.456 1.00 29.36  ? 61   ASP B CG  1 
ATOM   2285  O OD1 . ASP C 1 61  ? 18.089  -13.432 -14.788 1.00 47.71  ? 61   ASP B OD1 1 
ATOM   2286  O OD2 . ASP C 1 61  ? 16.654  -14.060 -16.390 1.00 16.19  ? 61   ASP B OD2 1 
ATOM   2287  N N   . GLY C 1 62  ? 21.014  -17.237 -14.126 1.00 16.28  ? 62   GLY B N   1 
ATOM   2288  C CA  . GLY C 1 62  ? 21.648  -18.480 -13.752 1.00 16.33  ? 62   GLY B CA  1 
ATOM   2289  C C   . GLY C 1 62  ? 22.054  -19.384 -14.884 1.00 27.86  ? 62   GLY B C   1 
ATOM   2290  O O   . GLY C 1 62  ? 22.461  -20.510 -14.619 1.00 31.80  ? 62   GLY B O   1 
ATOM   2291  N N   . MET C 1 63  ? 21.945  -18.906 -16.137 1.00 21.31  ? 63   MET B N   1 
ATOM   2292  C CA  . MET C 1 63  ? 22.321  -19.707 -17.253 1.00 10.03  ? 63   MET B CA  1 
ATOM   2293  C C   . MET C 1 63  ? 23.508  -19.076 -17.915 1.00 19.03  ? 63   MET B C   1 
ATOM   2294  O O   . MET C 1 63  ? 23.815  -17.906 -17.648 1.00 21.46  ? 63   MET B O   1 
ATOM   2295  C CB  . MET C 1 63  ? 21.168  -19.731 -18.234 1.00 9.48   ? 63   MET B CB  1 
ATOM   2296  C CG  . MET C 1 63  ? 19.884  -20.272 -17.630 1.00 9.21   ? 63   MET B CG  1 
ATOM   2297  S SD  . MET C 1 63  ? 18.417  -19.538 -18.359 1.00 21.16  ? 63   MET B SD  1 
ATOM   2298  C CE  . MET C 1 63  ? 17.803  -20.908 -19.398 1.00 25.93  ? 63   MET B CE  1 
ATOM   2299  N N   . LYS C 1 64  ? 24.131  -19.865 -18.776 1.00 11.90  ? 64   LYS B N   1 
ATOM   2300  C CA  . LYS C 1 64  ? 25.197  -19.398 -19.586 1.00 11.35  ? 64   LYS B CA  1 
ATOM   2301  C C   . LYS C 1 64  ? 24.742  -19.535 -21.025 1.00 16.18  ? 64   LYS B C   1 
ATOM   2302  O O   . LYS C 1 64  ? 25.017  -20.513 -21.701 1.00 16.69  ? 64   LYS B O   1 
ATOM   2303  C CB  . LYS C 1 64  ? 26.443  -20.202 -19.366 1.00 14.15  ? 64   LYS B CB  1 
ATOM   2304  C CG  . LYS C 1 64  ? 26.852  -20.167 -17.913 1.00 5.89   ? 64   LYS B CG  1 
ATOM   2305  C CD  . LYS C 1 64  ? 28.164  -20.908 -17.638 1.00 21.21  ? 64   LYS B CD  1 
ATOM   2306  C CE  . LYS C 1 64  ? 28.666  -20.967 -16.166 1.00 17.64  ? 64   LYS B CE  1 
ATOM   2307  N NZ  . LYS C 1 64  ? 29.377  -22.248 -15.817 1.00 57.04  ? 64   LYS B NZ  1 
ATOM   2308  N N   . LEU C 1 65  ? 24.037  -18.562 -21.497 1.00 7.70   ? 65   LEU B N   1 
ATOM   2309  C CA  . LEU C 1 65  ? 23.578  -18.628 -22.836 1.00 4.37   ? 65   LEU B CA  1 
ATOM   2310  C C   . LEU C 1 65  ? 24.648  -18.245 -23.785 1.00 6.56   ? 65   LEU B C   1 
ATOM   2311  O O   . LEU C 1 65  ? 25.450  -17.376 -23.466 1.00 12.20  ? 65   LEU B O   1 
ATOM   2312  C CB  . LEU C 1 65  ? 22.443  -17.645 -23.023 1.00 6.69   ? 65   LEU B CB  1 
ATOM   2313  C CG  . LEU C 1 65  ? 21.368  -17.801 -21.957 1.00 7.55   ? 65   LEU B CG  1 
ATOM   2314  C CD1 . LEU C 1 65  ? 20.210  -16.944 -22.309 1.00 1.00   ? 65   LEU B CD1 1 
ATOM   2315  C CD2 . LEU C 1 65  ? 20.838  -19.205 -21.936 1.00 1.40   ? 65   LEU B CD2 1 
ATOM   2316  N N   . VAL C 1 66  ? 24.579  -18.919 -24.942 1.00 1.00   ? 66   VAL B N   1 
ATOM   2317  C CA  . VAL C 1 66  ? 25.430  -18.834 -26.127 1.00 5.48   ? 66   VAL B CA  1 
ATOM   2318  C C   . VAL C 1 66  ? 24.592  -18.705 -27.419 1.00 11.95  ? 66   VAL B C   1 
ATOM   2319  O O   . VAL C 1 66  ? 23.401  -18.965 -27.418 1.00 3.67   ? 66   VAL B O   1 
ATOM   2320  C CB  . VAL C 1 66  ? 26.455  -19.969 -26.213 1.00 9.76   ? 66   VAL B CB  1 
ATOM   2321  C CG1 . VAL C 1 66  ? 27.226  -20.024 -24.909 1.00 15.83  ? 66   VAL B CG1 1 
ATOM   2322  C CG2 . VAL C 1 66  ? 25.784  -21.301 -26.425 1.00 1.21   ? 66   VAL B CG2 1 
ATOM   2323  N N   . GLN C 1 67  ? 25.204  -18.262 -28.535 1.00 11.12  ? 67   GLN B N   1 
ATOM   2324  C CA  . GLN C 1 67  ? 24.485  -18.026 -29.795 1.00 3.11   ? 67   GLN B CA  1 
ATOM   2325  C C   . GLN C 1 67  ? 23.769  -16.741 -29.683 1.00 10.31  ? 67   GLN B C   1 
ATOM   2326  O O   . GLN C 1 67  ? 22.744  -16.641 -28.984 1.00 11.82  ? 67   GLN B O   1 
ATOM   2327  C CB  . GLN C 1 67  ? 23.459  -19.116 -30.154 1.00 1.00   ? 67   GLN B CB  1 
ATOM   2328  C CG  . GLN C 1 67  ? 24.175  -20.470 -30.324 1.00 1.00   ? 67   GLN B CG  1 
ATOM   2329  C CD  . GLN C 1 67  ? 24.943  -20.568 -31.638 1.00 2.40   ? 67   GLN B CD  1 
ATOM   2330  O OE1 . GLN C 1 67  ? 24.649  -19.782 -32.569 1.00 19.99  ? 67   GLN B OE1 1 
ATOM   2331  N NE2 . GLN C 1 67  ? 25.921  -21.492 -31.710 1.00 14.45  ? 67   GLN B NE2 1 
ATOM   2332  N N   . THR C 1 68  ? 24.328  -15.779 -30.365 1.00 7.66   ? 68   THR B N   1 
ATOM   2333  C CA  . THR C 1 68  ? 23.760  -14.438 -30.367 1.00 5.71   ? 68   THR B CA  1 
ATOM   2334  C C   . THR C 1 68  ? 22.278  -14.409 -30.535 1.00 12.38  ? 68   THR B C   1 
ATOM   2335  O O   . THR C 1 68  ? 21.593  -13.832 -29.725 1.00 12.68  ? 68   THR B O   1 
ATOM   2336  C CB  . THR C 1 68  ? 24.375  -13.677 -31.514 1.00 4.93   ? 68   THR B CB  1 
ATOM   2337  O OG1 . THR C 1 68  ? 25.765  -13.835 -31.424 1.00 9.64   ? 68   THR B OG1 1 
ATOM   2338  C CG2 . THR C 1 68  ? 24.001  -12.247 -31.487 1.00 1.00   ? 68   THR B CG2 1 
ATOM   2339  N N   . ARG C 1 69  ? 21.751  -15.076 -31.552 1.00 12.11  ? 69   ARG B N   1 
ATOM   2340  C CA  . ARG C 1 69  ? 20.307  -14.957 -31.691 1.00 11.05  ? 69   ARG B CA  1 
ATOM   2341  C C   . ARG C 1 69  ? 19.491  -15.503 -30.553 1.00 13.17  ? 69   ARG B C   1 
ATOM   2342  O O   . ARG C 1 69  ? 18.408  -15.037 -30.239 1.00 15.74  ? 69   ARG B O   1 
ATOM   2343  C CB  . ARG C 1 69  ? 19.851  -15.655 -32.913 1.00 2.87   ? 69   ARG B CB  1 
ATOM   2344  C CG  . ARG C 1 69  ? 20.572  -15.182 -34.152 1.00 2.19   ? 69   ARG B CG  1 
ATOM   2345  C CD  . ARG C 1 69  ? 20.345  -16.158 -35.302 1.00 16.62  ? 69   ARG B CD  1 
ATOM   2346  N NE  . ARG C 1 69  ? 20.451  -15.555 -36.611 1.00 10.38  ? 69   ARG B NE  1 
ATOM   2347  C CZ  . ARG C 1 69  ? 21.629  -15.133 -37.018 1.00 32.64  ? 69   ARG B CZ  1 
ATOM   2348  N NH1 . ARG C 1 69  ? 22.656  -15.309 -36.223 1.00 27.33  ? 69   ARG B NH1 1 
ATOM   2349  N NH2 . ARG C 1 69  ? 21.788  -14.443 -38.152 1.00 22.95  ? 69   ARG B NH2 1 
ATOM   2350  N N   . SER C 1 70  ? 19.988  -16.562 -29.983 1.00 7.66   ? 70   SER B N   1 
ATOM   2351  C CA  . SER C 1 70  ? 19.285  -17.242 -28.919 1.00 3.53   ? 70   SER B CA  1 
ATOM   2352  C C   . SER C 1 70  ? 19.279  -16.389 -27.677 1.00 9.97   ? 70   SER B C   1 
ATOM   2353  O O   . SER C 1 70  ? 18.294  -16.235 -26.974 1.00 14.94  ? 70   SER B O   1 
ATOM   2354  C CB  . SER C 1 70  ? 19.937  -18.575 -28.721 1.00 1.00   ? 70   SER B CB  1 
ATOM   2355  O OG  . SER C 1 70  ? 19.968  -19.287 -29.960 1.00 15.34  ? 70   SER B OG  1 
ATOM   2356  N N   . ILE C 1 71  ? 20.393  -15.748 -27.504 1.00 4.81   ? 71   ILE B N   1 
ATOM   2357  C CA  . ILE C 1 71  ? 20.546  -14.835 -26.424 1.00 3.49   ? 71   ILE B CA  1 
ATOM   2358  C C   . ILE C 1 71  ? 19.567  -13.670 -26.569 1.00 9.08   ? 71   ILE B C   1 
ATOM   2359  O O   . ILE C 1 71  ? 18.841  -13.311 -25.657 1.00 13.77  ? 71   ILE B O   1 
ATOM   2360  C CB  . ILE C 1 71  ? 21.947  -14.287 -26.393 1.00 2.60   ? 71   ILE B CB  1 
ATOM   2361  C CG1 . ILE C 1 71  ? 23.045  -15.321 -26.030 1.00 2.12   ? 71   ILE B CG1 1 
ATOM   2362  C CG2 . ILE C 1 71  ? 21.839  -13.284 -25.335 1.00 1.00   ? 71   ILE B CG2 1 
ATOM   2363  C CD1 . ILE C 1 71  ? 24.464  -14.834 -26.354 1.00 1.00   ? 71   ILE B CD1 1 
ATOM   2364  N N   . LEU C 1 72  ? 19.522  -13.092 -27.744 1.00 6.18   ? 72   LEU B N   1 
ATOM   2365  C CA  . LEU C 1 72  ? 18.630  -11.970 -28.031 1.00 4.76   ? 72   LEU B CA  1 
ATOM   2366  C C   . LEU C 1 72  ? 17.220  -12.363 -27.825 1.00 4.66   ? 72   LEU B C   1 
ATOM   2367  O O   . LEU C 1 72  ? 16.472  -11.647 -27.223 1.00 11.07  ? 72   LEU B O   1 
ATOM   2368  C CB  . LEU C 1 72  ? 18.777  -11.448 -29.471 1.00 7.63   ? 72   LEU B CB  1 
ATOM   2369  C CG  . LEU C 1 72  ? 20.143  -10.855 -29.782 1.00 3.60   ? 72   LEU B CG  1 
ATOM   2370  C CD1 . LEU C 1 72  ? 20.221  -10.395 -31.224 1.00 1.00   ? 72   LEU B CD1 1 
ATOM   2371  C CD2 . LEU C 1 72  ? 20.411  -9.708  -28.855 1.00 1.00   ? 72   LEU B CD2 1 
ATOM   2372  N N   . HIS C 1 73  ? 16.812  -13.508 -28.310 1.00 7.74   ? 73   HIS B N   1 
ATOM   2373  C CA  . HIS C 1 73  ? 15.414  -13.918 -28.049 1.00 3.88   ? 73   HIS B CA  1 
ATOM   2374  C C   . HIS C 1 73  ? 15.140  -14.046 -26.569 1.00 11.84  ? 73   HIS B C   1 
ATOM   2375  O O   . HIS C 1 73  ? 14.065  -13.716 -26.081 1.00 12.42  ? 73   HIS B O   1 
ATOM   2376  C CB  . HIS C 1 73  ? 15.165  -15.308 -28.581 1.00 1.00   ? 73   HIS B CB  1 
ATOM   2377  C CG  . HIS C 1 73  ? 15.399  -15.386 -30.044 1.00 6.41   ? 73   HIS B CG  1 
ATOM   2378  N ND1 . HIS C 1 73  ? 15.735  -16.540 -30.696 1.00 9.52   ? 73   HIS B ND1 1 
ATOM   2379  C CD2 . HIS C 1 73  ? 15.301  -14.432 -30.970 1.00 12.04  ? 73   HIS B CD2 1 
ATOM   2380  C CE1 . HIS C 1 73  ? 15.844  -16.271 -31.972 1.00 10.29  ? 73   HIS B CE1 1 
ATOM   2381  N NE2 . HIS C 1 73  ? 15.575  -15.008 -32.174 1.00 12.17  ? 73   HIS B NE2 1 
ATOM   2382  N N   . TYR C 1 74  ? 16.088  -14.599 -25.819 1.00 8.27   ? 74   TYR B N   1 
ATOM   2383  C CA  . TYR C 1 74  ? 15.800  -14.742 -24.401 1.00 9.83   ? 74   TYR B CA  1 
ATOM   2384  C C   . TYR C 1 74  ? 15.500  -13.391 -23.758 1.00 14.80  ? 74   TYR B C   1 
ATOM   2385  O O   . TYR C 1 74  ? 14.470  -13.192 -23.104 1.00 13.02  ? 74   TYR B O   1 
ATOM   2386  C CB  . TYR C 1 74  ? 16.943  -15.455 -23.645 1.00 9.69   ? 74   TYR B CB  1 
ATOM   2387  C CG  . TYR C 1 74  ? 16.700  -15.562 -22.159 1.00 11.22  ? 74   TYR B CG  1 
ATOM   2388  C CD1 . TYR C 1 74  ? 15.781  -16.471 -21.645 1.00 11.17  ? 74   TYR B CD1 1 
ATOM   2389  C CD2 . TYR C 1 74  ? 17.387  -14.766 -21.237 1.00 12.41  ? 74   TYR B CD2 1 
ATOM   2390  C CE1 . TYR C 1 74  ? 15.564  -16.563 -20.270 1.00 10.74  ? 74   TYR B CE1 1 
ATOM   2391  C CE2 . TYR C 1 74  ? 17.115  -14.776 -19.868 1.00 9.64   ? 74   TYR B CE2 1 
ATOM   2392  C CZ  . TYR C 1 74  ? 16.201  -15.705 -19.372 1.00 19.86  ? 74   TYR B CZ  1 
ATOM   2393  O OH  . TYR C 1 74  ? 15.943  -15.802 -18.005 1.00 17.49  ? 74   TYR B OH  1 
ATOM   2394  N N   . ILE C 1 75  ? 16.396  -12.446 -24.012 1.00 4.94   ? 75   ILE B N   1 
ATOM   2395  C CA  . ILE C 1 75  ? 16.209  -11.161 -23.412 1.00 4.38   ? 75   ILE B CA  1 
ATOM   2396  C C   . ILE C 1 75  ? 14.932  -10.522 -23.838 1.00 15.50  ? 75   ILE B C   1 
ATOM   2397  O O   . ILE C 1 75  ? 14.233  -9.968  -23.042 1.00 18.12  ? 75   ILE B O   1 
ATOM   2398  C CB  . ILE C 1 75  ? 17.383  -10.307 -23.752 1.00 7.14   ? 75   ILE B CB  1 
ATOM   2399  C CG1 . ILE C 1 75  ? 18.639  -11.004 -23.216 1.00 8.39   ? 75   ILE B CG1 1 
ATOM   2400  C CG2 . ILE C 1 75  ? 17.221  -8.925  -23.168 1.00 2.67   ? 75   ILE B CG2 1 
ATOM   2401  C CD1 . ILE C 1 75  ? 19.922  -10.368 -23.751 1.00 9.74   ? 75   ILE B CD1 1 
ATOM   2402  N N   . ALA C 1 76  ? 14.638  -10.607 -25.116 1.00 8.97   ? 76   ALA B N   1 
ATOM   2403  C CA  . ALA C 1 76  ? 13.452  -9.997  -25.636 1.00 6.89   ? 76   ALA B CA  1 
ATOM   2404  C C   . ALA C 1 76  ? 12.255  -10.534 -24.925 1.00 14.31  ? 76   ALA B C   1 
ATOM   2405  O O   . ALA C 1 76  ? 11.376  -9.843  -24.512 1.00 16.32  ? 76   ALA B O   1 
ATOM   2406  C CB  . ALA C 1 76  ? 13.322  -10.275 -27.130 1.00 7.25   ? 76   ALA B CB  1 
ATOM   2407  N N   . ASP C 1 77  ? 12.234  -11.803 -24.802 1.00 12.04  ? 77   ASP B N   1 
ATOM   2408  C CA  . ASP C 1 77  ? 11.137  -12.456 -24.161 1.00 8.15   ? 77   ASP B CA  1 
ATOM   2409  C C   . ASP C 1 77  ? 11.089  -12.148 -22.683 1.00 20.17  ? 77   ASP B C   1 
ATOM   2410  O O   . ASP C 1 77  ? 10.045  -12.182 -22.087 1.00 27.38  ? 77   ASP B O   1 
ATOM   2411  C CB  . ASP C 1 77  ? 11.250  -13.967 -24.390 1.00 1.30   ? 77   ASP B CB  1 
ATOM   2412  C CG  . ASP C 1 77  ? 10.356  -14.403 -25.517 1.00 15.64  ? 77   ASP B CG  1 
ATOM   2413  O OD1 . ASP C 1 77  ? 9.447   -13.697 -25.976 1.00 25.53  ? 77   ASP B OD1 1 
ATOM   2414  O OD2 . ASP C 1 77  ? 10.655  -15.609 -25.945 1.00 25.03  ? 77   ASP B OD2 1 
ATOM   2415  N N   . LYS C 1 78  ? 12.204  -11.873 -22.058 1.00 13.84  ? 78   LYS B N   1 
ATOM   2416  C CA  . LYS C 1 78  ? 12.109  -11.508 -20.663 1.00 8.75   ? 78   LYS B CA  1 
ATOM   2417  C C   . LYS C 1 78  ? 11.732  -10.035 -20.596 1.00 21.37  ? 78   LYS B C   1 
ATOM   2418  O O   . LYS C 1 78  ? 11.569  -9.491  -19.536 1.00 25.64  ? 78   LYS B O   1 
ATOM   2419  C CB  . LYS C 1 78  ? 13.456  -11.572 -19.913 1.00 6.78   ? 78   LYS B CB  1 
ATOM   2420  C CG  . LYS C 1 78  ? 13.992  -12.958 -19.792 1.00 40.33  ? 78   LYS B CG  1 
ATOM   2421  C CD  . LYS C 1 78  ? 12.917  -13.903 -19.302 1.00 42.81  ? 78   LYS B CD  1 
ATOM   2422  C CE  . LYS C 1 78  ? 12.754  -13.929 -17.777 1.00 47.35  ? 78   LYS B CE  1 
ATOM   2423  N NZ  . LYS C 1 78  ? 11.529  -14.621 -17.316 1.00 69.76  ? 78   LYS B NZ  1 
ATOM   2424  N N   . HIS C 1 79  ? 11.728  -9.304  -21.685 1.00 16.29  ? 79   HIS B N   1 
ATOM   2425  C CA  . HIS C 1 79  ? 11.463  -7.907  -21.468 1.00 10.72  ? 79   HIS B CA  1 
ATOM   2426  C C   . HIS C 1 79  ? 10.473  -7.258  -22.369 1.00 14.66  ? 79   HIS B C   1 
ATOM   2427  O O   . HIS C 1 79  ? 10.667  -6.098  -22.705 1.00 6.93   ? 79   HIS B O   1 
ATOM   2428  C CB  . HIS C 1 79  ? 12.712  -7.099  -21.590 1.00 10.30  ? 79   HIS B CB  1 
ATOM   2429  C CG  . HIS C 1 79  ? 13.592  -7.324  -20.445 1.00 20.66  ? 79   HIS B CG  1 
ATOM   2430  N ND1 . HIS C 1 79  ? 14.619  -8.236  -20.508 1.00 29.24  ? 79   HIS B ND1 1 
ATOM   2431  C CD2 . HIS C 1 79  ? 13.630  -6.741  -19.227 1.00 21.04  ? 79   HIS B CD2 1 
ATOM   2432  C CE1 . HIS C 1 79  ? 15.272  -8.195  -19.337 1.00 23.80  ? 79   HIS B CE1 1 
ATOM   2433  N NE2 . HIS C 1 79  ? 14.694  -7.304  -18.565 1.00 19.97  ? 79   HIS B NE2 1 
ATOM   2434  N N   . ASN C 1 80  ? 9.457   -7.999  -22.778 1.00 17.51  ? 80   ASN B N   1 
ATOM   2435  C CA  . ASN C 1 80  ? 8.505   -7.408  -23.664 1.00 17.97  ? 80   ASN B CA  1 
ATOM   2436  C C   . ASN C 1 80  ? 9.051   -6.779  -24.926 1.00 23.47  ? 80   ASN B C   1 
ATOM   2437  O O   . ASN C 1 80  ? 8.549   -5.743  -25.388 1.00 33.09  ? 80   ASN B O   1 
ATOM   2438  C CB  . ASN C 1 80  ? 7.658   -6.396  -22.916 1.00 22.81  ? 80   ASN B CB  1 
ATOM   2439  C CG  . ASN C 1 80  ? 6.393   -6.037  -23.629 1.00 56.00  ? 80   ASN B CG  1 
ATOM   2440  O OD1 . ASN C 1 80  ? 6.112   -4.840  -23.747 1.00 61.63  ? 80   ASN B OD1 1 
ATOM   2441  N ND2 . ASN C 1 80  ? 5.611   -7.055  -24.020 1.00 50.44  ? 80   ASN B ND2 1 
ATOM   2442  N N   . LEU C 1 81  ? 10.048  -7.403  -25.518 1.00 17.49  ? 81   LEU B N   1 
ATOM   2443  C CA  . LEU C 1 81  ? 10.550  -6.846  -26.758 1.00 12.09  ? 81   LEU B CA  1 
ATOM   2444  C C   . LEU C 1 81  ? 10.261  -7.797  -27.883 1.00 9.79   ? 81   LEU B C   1 
ATOM   2445  O O   . LEU C 1 81  ? 10.828  -7.657  -28.948 1.00 9.64   ? 81   LEU B O   1 
ATOM   2446  C CB  . LEU C 1 81  ? 12.033  -6.562  -26.733 1.00 6.52   ? 81   LEU B CB  1 
ATOM   2447  C CG  . LEU C 1 81  ? 12.394  -5.611  -25.634 1.00 4.24   ? 81   LEU B CG  1 
ATOM   2448  C CD1 . LEU C 1 81  ? 13.923  -5.665  -25.434 1.00 2.56   ? 81   LEU B CD1 1 
ATOM   2449  C CD2 . LEU C 1 81  ? 12.125  -4.241  -26.173 1.00 1.00   ? 81   LEU B CD2 1 
ATOM   2450  N N   . PHE C 1 82  ? 9.366   -8.738  -27.633 1.00 7.16   ? 82   PHE B N   1 
ATOM   2451  C CA  . PHE C 1 82  ? 9.053   -9.781  -28.644 1.00 7.97   ? 82   PHE B CA  1 
ATOM   2452  C C   . PHE C 1 82  ? 7.610   -9.859  -29.097 1.00 16.81  ? 82   PHE B C   1 
ATOM   2453  O O   . PHE C 1 82  ? 7.104   -10.912 -29.517 1.00 19.23  ? 82   PHE B O   1 
ATOM   2454  C CB  . PHE C 1 82  ? 9.515   -11.183 -28.221 1.00 4.68   ? 82   PHE B CB  1 
ATOM   2455  C CG  . PHE C 1 82  ? 10.274  -11.908 -29.284 1.00 9.05   ? 82   PHE B CG  1 
ATOM   2456  C CD1 . PHE C 1 82  ? 9.961   -11.754 -30.643 1.00 15.06  ? 82   PHE B CD1 1 
ATOM   2457  C CD2 . PHE C 1 82  ? 11.307  -12.779 -28.932 1.00 10.50  ? 82   PHE B CD2 1 
ATOM   2458  C CE1 . PHE C 1 82  ? 10.620  -12.441 -31.666 1.00 9.59   ? 82   PHE B CE1 1 
ATOM   2459  C CE2 . PHE C 1 82  ? 11.963  -13.490 -29.936 1.00 11.51  ? 82   PHE B CE2 1 
ATOM   2460  C CZ  . PHE C 1 82  ? 11.634  -13.323 -31.290 1.00 7.34   ? 82   PHE B CZ  1 
ATOM   2461  N N   . GLY C 1 83  ? 6.941   -8.725  -29.020 1.00 16.51  ? 83   GLY B N   1 
ATOM   2462  C CA  . GLY C 1 83  ? 5.578   -8.710  -29.456 1.00 18.16  ? 83   GLY B CA  1 
ATOM   2463  C C   . GLY C 1 83  ? 4.630   -9.148  -28.373 1.00 19.47  ? 83   GLY B C   1 
ATOM   2464  O O   . GLY C 1 83  ? 5.054   -9.317  -27.234 1.00 16.68  ? 83   GLY B O   1 
ATOM   2465  N N   . LYS C 1 84  ? 3.375   -9.330  -28.780 1.00 16.34  ? 84   LYS B N   1 
ATOM   2466  C CA  . LYS C 1 84  ? 2.276   -9.697  -27.903 1.00 15.03  ? 84   LYS B CA  1 
ATOM   2467  C C   . LYS C 1 84  ? 1.530   -10.891 -28.442 1.00 25.33  ? 84   LYS B C   1 
ATOM   2468  O O   . LYS C 1 84  ? 0.679   -11.473 -27.799 1.00 23.09  ? 84   LYS B O   1 
ATOM   2469  C CB  . LYS C 1 84  ? 1.401   -8.497  -27.501 1.00 10.79  ? 84   LYS B CB  1 
ATOM   2470  C CG  . LYS C 1 84  ? 2.292   -7.577  -26.650 1.00 32.78  ? 84   LYS B CG  1 
ATOM   2471  C CD  . LYS C 1 84  ? 1.609   -6.500  -25.811 1.00 30.09  ? 84   LYS B CD  1 
ATOM   2472  C CE  . LYS C 1 84  ? 2.360   -6.069  -24.537 1.00 51.57  ? 84   LYS B CE  1 
ATOM   2473  N NZ  . LYS C 1 84  ? 1.828   -4.817  -23.932 1.00 126.63 ? 84   LYS B NZ  1 
ATOM   2474  N N   . ASN C 1 85  ? 1.975   -11.363 -29.590 1.00 25.00  ? 85   ASN B N   1 
ATOM   2475  C CA  . ASN C 1 85  ? 1.367   -12.544 -30.138 1.00 19.70  ? 85   ASN B CA  1 
ATOM   2476  C C   . ASN C 1 85  ? 2.181   -13.154 -31.279 1.00 22.04  ? 85   ASN B C   1 
ATOM   2477  O O   . ASN C 1 85  ? 3.072   -12.507 -31.828 1.00 31.75  ? 85   ASN B O   1 
ATOM   2478  C CB  . ASN C 1 85  ? -0.079  -12.208 -30.516 1.00 10.80  ? 85   ASN B CB  1 
ATOM   2479  C CG  . ASN C 1 85  ? -0.146  -11.359 -31.755 1.00 18.33  ? 85   ASN B CG  1 
ATOM   2480  O OD1 . ASN C 1 85  ? 0.383   -11.701 -32.822 1.00 71.35  ? 85   ASN B OD1 1 
ATOM   2481  N ND2 . ASN C 1 85  ? -0.629  -10.175 -31.562 1.00 19.54  ? 85   ASN B ND2 1 
ATOM   2482  N N   . LEU C 1 86  ? 1.822   -14.377 -31.686 1.00 13.64  ? 86   LEU B N   1 
ATOM   2483  C CA  . LEU C 1 86  ? 2.529   -15.079 -32.744 1.00 7.94   ? 86   LEU B CA  1 
ATOM   2484  C C   . LEU C 1 86  ? 2.763   -14.259 -33.983 1.00 14.84  ? 86   LEU B C   1 
ATOM   2485  O O   . LEU C 1 86  ? 3.848   -14.262 -34.582 1.00 20.25  ? 86   LEU B O   1 
ATOM   2486  C CB  . LEU C 1 86  ? 1.847   -16.385 -33.140 1.00 4.53   ? 86   LEU B CB  1 
ATOM   2487  C CG  . LEU C 1 86  ? 2.746   -17.279 -33.976 1.00 10.05  ? 86   LEU B CG  1 
ATOM   2488  C CD1 . LEU C 1 86  ? 4.089   -17.384 -33.320 1.00 13.10  ? 86   LEU B CD1 1 
ATOM   2489  C CD2 . LEU C 1 86  ? 2.223   -18.683 -34.011 1.00 8.38   ? 86   LEU B CD2 1 
ATOM   2490  N N   . LYS C 1 87  ? 1.719   -13.553 -34.356 1.00 12.86  ? 87   LYS B N   1 
ATOM   2491  C CA  . LYS C 1 87  ? 1.776   -12.742 -35.561 1.00 16.47  ? 87   LYS B CA  1 
ATOM   2492  C C   . LYS C 1 87  ? 2.877   -11.744 -35.526 1.00 17.63  ? 87   LYS B C   1 
ATOM   2493  O O   . LYS C 1 87  ? 3.665   -11.676 -36.450 1.00 27.41  ? 87   LYS B O   1 
ATOM   2494  C CB  . LYS C 1 87  ? 0.425   -12.227 -36.041 1.00 18.47  ? 87   LYS B CB  1 
ATOM   2495  C CG  . LYS C 1 87  ? -0.544  -13.411 -36.218 1.00 136.90 ? 87   LYS B CG  1 
ATOM   2496  C CD  . LYS C 1 87  ? 0.099   -14.688 -36.817 1.00 174.68 ? 87   LYS B CD  1 
ATOM   2497  C CE  . LYS C 1 87  ? -0.745  -15.979 -36.698 1.00 151.33 ? 87   LYS B CE  1 
ATOM   2498  N NZ  . LYS C 1 87  ? -0.254  -17.164 -37.462 1.00 58.97  ? 87   LYS B NZ  1 
ATOM   2499  N N   . GLU C 1 88  ? 2.907   -11.038 -34.424 1.00 8.70   ? 88   GLU B N   1 
ATOM   2500  C CA  . GLU C 1 88  ? 3.900   -10.043 -34.148 1.00 11.62  ? 88   GLU B CA  1 
ATOM   2501  C C   . GLU C 1 88  ? 5.259   -10.647 -34.052 1.00 18.30  ? 88   GLU B C   1 
ATOM   2502  O O   . GLU C 1 88  ? 6.216   -10.215 -34.685 1.00 23.26  ? 88   GLU B O   1 
ATOM   2503  C CB  . GLU C 1 88  ? 3.590   -9.375  -32.795 1.00 14.39  ? 88   GLU B CB  1 
ATOM   2504  C CG  . GLU C 1 88  ? 2.325   -8.500  -32.887 1.00 5.07   ? 88   GLU B CG  1 
ATOM   2505  C CD  . GLU C 1 88  ? 1.939   -7.617  -31.711 1.00 21.29  ? 88   GLU B CD  1 
ATOM   2506  O OE1 . GLU C 1 88  ? 2.614   -7.375  -30.672 1.00 20.61  ? 88   GLU B OE1 1 
ATOM   2507  O OE2 . GLU C 1 88  ? 0.841   -6.964  -32.050 1.00 24.75  ? 88   GLU B OE2 1 
ATOM   2508  N N   . ARG C 1 89  ? 5.324   -11.617 -33.180 1.00 10.56  ? 89   ARG B N   1 
ATOM   2509  C CA  . ARG C 1 89  ? 6.532   -12.333 -32.917 1.00 9.51   ? 89   ARG B CA  1 
ATOM   2510  C C   . ARG C 1 89  ? 7.125   -12.787 -34.218 1.00 9.97   ? 89   ARG B C   1 
ATOM   2511  O O   . ARG C 1 89  ? 8.314   -12.646 -34.532 1.00 10.78  ? 89   ARG B O   1 
ATOM   2512  C CB  . ARG C 1 89  ? 6.143   -13.568 -32.204 1.00 3.43   ? 89   ARG B CB  1 
ATOM   2513  C CG  . ARG C 1 89  ? 7.374   -14.109 -31.577 1.00 18.27  ? 89   ARG B CG  1 
ATOM   2514  C CD  . ARG C 1 89  ? 7.044   -15.273 -30.663 1.00 6.77   ? 89   ARG B CD  1 
ATOM   2515  N NE  . ARG C 1 89  ? 8.226   -15.833 -30.112 1.00 16.25  ? 89   ARG B NE  1 
ATOM   2516  C CZ  . ARG C 1 89  ? 8.740   -15.546 -28.940 1.00 15.11  ? 89   ARG B CZ  1 
ATOM   2517  N NH1 . ARG C 1 89  ? 8.138   -14.707 -28.096 1.00 14.64  ? 89   ARG B NH1 1 
ATOM   2518  N NH2 . ARG C 1 89  ? 9.914   -16.131 -28.643 1.00 33.37  ? 89   ARG B NH2 1 
ATOM   2519  N N   . THR C 1 90  ? 6.234   -13.260 -35.055 1.00 1.00   ? 90   THR B N   1 
ATOM   2520  C CA  . THR C 1 90  ? 6.710   -13.706 -36.373 1.00 1.00   ? 90   THR B CA  1 
ATOM   2521  C C   . THR C 1 90  ? 7.389   -12.605 -37.218 1.00 12.66  ? 90   THR B C   1 
ATOM   2522  O O   . THR C 1 90  ? 8.471   -12.783 -37.799 1.00 12.11  ? 90   THR B O   1 
ATOM   2523  C CB  . THR C 1 90  ? 5.600   -14.442 -37.096 1.00 11.57  ? 90   THR B CB  1 
ATOM   2524  O OG1 . THR C 1 90  ? 5.077   -15.503 -36.317 1.00 20.47  ? 90   THR B OG1 1 
ATOM   2525  C CG2 . THR C 1 90  ? 6.128   -14.942 -38.385 1.00 1.00   ? 90   THR B CG2 1 
ATOM   2526  N N   . LEU C 1 91  ? 6.781   -11.409 -37.208 1.00 5.25   ? 91   LEU B N   1 
ATOM   2527  C CA  . LEU C 1 91  ? 7.308   -10.285 -37.937 1.00 1.00   ? 91   LEU B CA  1 
ATOM   2528  C C   . LEU C 1 91  ? 8.620   -9.825  -37.403 1.00 9.46   ? 91   LEU B C   1 
ATOM   2529  O O   . LEU C 1 91  ? 9.574   -9.599  -38.131 1.00 13.34  ? 91   LEU B O   1 
ATOM   2530  C CB  . LEU C 1 91  ? 6.313   -9.153  -37.821 1.00 2.65   ? 91   LEU B CB  1 
ATOM   2531  C CG  . LEU C 1 91  ? 5.053   -9.491  -38.615 1.00 6.82   ? 91   LEU B CG  1 
ATOM   2532  C CD1 . LEU C 1 91  ? 3.978   -8.483  -38.390 1.00 2.85   ? 91   LEU B CD1 1 
ATOM   2533  C CD2 . LEU C 1 91  ? 5.321   -9.411  -40.085 1.00 1.00   ? 91   LEU B CD2 1 
ATOM   2534  N N   . ILE C 1 92  ? 8.643   -9.691  -36.104 1.00 6.98   ? 92   ILE B N   1 
ATOM   2535  C CA  . ILE C 1 92  ? 9.814   -9.229  -35.413 1.00 5.61   ? 92   ILE B CA  1 
ATOM   2536  C C   . ILE C 1 92  ? 10.948  -10.152 -35.712 1.00 12.34  ? 92   ILE B C   1 
ATOM   2537  O O   . ILE C 1 92  ? 12.062  -9.726  -35.987 1.00 16.34  ? 92   ILE B O   1 
ATOM   2538  C CB  . ILE C 1 92  ? 9.478   -9.252  -33.939 1.00 9.15   ? 92   ILE B CB  1 
ATOM   2539  C CG1 . ILE C 1 92  ? 8.397   -8.215  -33.712 1.00 9.09   ? 92   ILE B CG1 1 
ATOM   2540  C CG2 . ILE C 1 92  ? 10.676  -9.011  -33.040 1.00 4.91   ? 92   ILE B CG2 1 
ATOM   2541  C CD1 . ILE C 1 92  ? 8.062   -7.978  -32.265 1.00 7.16   ? 92   ILE B CD1 1 
ATOM   2542  N N   . ASP C 1 93  ? 10.631  -11.437 -35.703 1.00 5.23   ? 93   ASP B N   1 
ATOM   2543  C CA  . ASP C 1 93  ? 11.660  -12.418 -35.971 1.00 3.41   ? 93   ASP B CA  1 
ATOM   2544  C C   . ASP C 1 93  ? 12.279  -12.240 -37.354 1.00 13.46  ? 93   ASP B C   1 
ATOM   2545  O O   . ASP C 1 93  ? 13.507  -12.071 -37.533 1.00 8.81   ? 93   ASP B O   1 
ATOM   2546  C CB  . ASP C 1 93  ? 11.045  -13.794 -35.764 1.00 3.72   ? 93   ASP B CB  1 
ATOM   2547  C CG  . ASP C 1 93  ? 11.964  -15.014 -35.802 1.00 15.82  ? 93   ASP B CG  1 
ATOM   2548  O OD1 . ASP C 1 93  ? 13.146  -14.963 -36.032 1.00 13.84  ? 93   ASP B OD1 1 
ATOM   2549  O OD2 . ASP C 1 93  ? 11.323  -16.132 -35.509 1.00 24.47  ? 93   ASP B OD2 1 
ATOM   2550  N N   . MET C 1 94  ? 11.402  -12.179 -38.331 1.00 7.44   ? 94   MET B N   1 
ATOM   2551  C CA  . MET C 1 94  ? 11.903  -11.991 -39.646 1.00 1.95   ? 94   MET B CA  1 
ATOM   2552  C C   . MET C 1 94  ? 12.686  -10.747 -39.825 1.00 4.64   ? 94   MET B C   1 
ATOM   2553  O O   . MET C 1 94  ? 13.717  -10.737 -40.493 1.00 7.26   ? 94   MET B O   1 
ATOM   2554  C CB  . MET C 1 94  ? 10.747  -11.948 -40.580 1.00 4.75   ? 94   MET B CB  1 
ATOM   2555  C CG  . MET C 1 94  ? 10.010  -13.292 -40.712 1.00 9.41   ? 94   MET B CG  1 
ATOM   2556  S SD  . MET C 1 94  ? 8.596   -13.169 -41.909 1.00 14.86  ? 94   MET B SD  1 
ATOM   2557  C CE  . MET C 1 94  ? 9.580   -14.041 -43.129 1.00 13.63  ? 94   MET B CE  1 
ATOM   2558  N N   . TYR C 1 95  ? 12.187  -9.677  -39.236 1.00 3.29   ? 95   TYR B N   1 
ATOM   2559  C CA  . TYR C 1 95  ? 12.852  -8.409  -39.423 1.00 1.00   ? 95   TYR B CA  1 
ATOM   2560  C C   . TYR C 1 95  ? 14.227  -8.493  -38.877 1.00 6.98   ? 95   TYR B C   1 
ATOM   2561  O O   . TYR C 1 95  ? 15.226  -8.076  -39.438 1.00 7.33   ? 95   TYR B O   1 
ATOM   2562  C CB  . TYR C 1 95  ? 12.141  -7.303  -38.657 1.00 2.91   ? 95   TYR B CB  1 
ATOM   2563  C CG  . TYR C 1 95  ? 10.773  -7.068  -39.242 1.00 8.52   ? 95   TYR B CG  1 
ATOM   2564  C CD1 . TYR C 1 95  ? 10.472  -7.642  -40.473 1.00 4.73   ? 95   TYR B CD1 1 
ATOM   2565  C CD2 . TYR C 1 95  ? 9.796   -6.260  -38.632 1.00 10.51  ? 95   TYR B CD2 1 
ATOM   2566  C CE1 . TYR C 1 95  ? 9.207   -7.443  -41.030 1.00 6.52   ? 95   TYR B CE1 1 
ATOM   2567  C CE2 . TYR C 1 95  ? 8.531   -6.028  -39.193 1.00 4.52   ? 95   TYR B CE2 1 
ATOM   2568  C CZ  . TYR C 1 95  ? 8.234   -6.650  -40.407 1.00 16.64  ? 95   TYR B CZ  1 
ATOM   2569  O OH  . TYR C 1 95  ? 7.001   -6.505  -41.010 1.00 17.95  ? 95   TYR B OH  1 
ATOM   2570  N N   . VAL C 1 96  ? 14.254  -9.068  -37.734 1.00 4.16   ? 96   VAL B N   1 
ATOM   2571  C CA  . VAL C 1 96  ? 15.517  -9.224  -37.094 1.00 2.88   ? 96   VAL B CA  1 
ATOM   2572  C C   . VAL C 1 96  ? 16.485  -10.056 -37.891 1.00 6.46   ? 96   VAL B C   1 
ATOM   2573  O O   . VAL C 1 96  ? 17.634  -9.687  -38.056 1.00 6.51   ? 96   VAL B O   1 
ATOM   2574  C CB  . VAL C 1 96  ? 15.302  -9.877  -35.777 1.00 3.29   ? 96   VAL B CB  1 
ATOM   2575  C CG1 . VAL C 1 96  ? 16.659  -10.203 -35.259 1.00 1.56   ? 96   VAL B CG1 1 
ATOM   2576  C CG2 . VAL C 1 96  ? 14.675  -8.892  -34.834 1.00 4.65   ? 96   VAL B CG2 1 
ATOM   2577  N N   . GLU C 1 97  ? 16.049  -11.215 -38.367 1.00 1.62   ? 97   GLU B N   1 
ATOM   2578  C CA  . GLU C 1 97  ? 16.997  -12.024 -39.140 1.00 2.81   ? 97   GLU B CA  1 
ATOM   2579  C C   . GLU C 1 97  ? 17.490  -11.310 -40.375 1.00 9.85   ? 97   GLU B C   1 
ATOM   2580  O O   . GLU C 1 97  ? 18.683  -11.333 -40.706 1.00 10.22  ? 97   GLU B O   1 
ATOM   2581  C CB  . GLU C 1 97  ? 16.453  -13.388 -39.528 1.00 6.17   ? 97   GLU B CB  1 
ATOM   2582  C CG  . GLU C 1 97  ? 15.993  -14.192 -38.317 1.00 3.05   ? 97   GLU B CG  1 
ATOM   2583  C CD  . GLU C 1 97  ? 17.177  -14.635 -37.463 1.00 17.39  ? 97   GLU B CD  1 
ATOM   2584  O OE1 . GLU C 1 97  ? 18.250  -14.877 -37.958 1.00 7.10   ? 97   GLU B OE1 1 
ATOM   2585  O OE2 . GLU C 1 97  ? 16.888  -14.861 -36.173 1.00 19.34  ? 97   GLU B OE2 1 
ATOM   2586  N N   . GLY C 1 98  ? 16.567  -10.661 -41.055 1.00 7.21   ? 98   GLY B N   1 
ATOM   2587  C CA  . GLY C 1 98  ? 16.969  -9.932  -42.250 1.00 2.67   ? 98   GLY B CA  1 
ATOM   2588  C C   . GLY C 1 98  ? 17.984  -8.892  -41.880 1.00 3.56   ? 98   GLY B C   1 
ATOM   2589  O O   . GLY C 1 98  ? 19.050  -8.767  -42.463 1.00 5.22   ? 98   GLY B O   1 
ATOM   2590  N N   . THR C 1 99  ? 17.677  -8.171  -40.836 1.00 2.16   ? 99   THR B N   1 
ATOM   2591  C CA  . THR C 1 99  ? 18.598  -7.133  -40.386 1.00 2.83   ? 99   THR B CA  1 
ATOM   2592  C C   . THR C 1 99  ? 19.978  -7.649  -40.019 1.00 12.76  ? 99   THR B C   1 
ATOM   2593  O O   . THR C 1 99  ? 20.983  -7.098  -40.471 1.00 12.87  ? 99   THR B O   1 
ATOM   2594  C CB  . THR C 1 99  ? 18.002  -6.305  -39.270 1.00 7.66   ? 99   THR B CB  1 
ATOM   2595  O OG1 . THR C 1 99  ? 16.657  -5.964  -39.601 1.00 6.21   ? 99   THR B OG1 1 
ATOM   2596  C CG2 . THR C 1 99  ? 18.887  -5.094  -39.039 1.00 2.99   ? 99   THR B CG2 1 
ATOM   2597  N N   . LEU C 1 100 ? 20.027  -8.754  -39.271 1.00 6.88   ? 100  LEU B N   1 
ATOM   2598  C CA  . LEU C 1 100 ? 21.313  -9.387  -38.931 1.00 3.94   ? 100  LEU B CA  1 
ATOM   2599  C C   . LEU C 1 100 ? 22.113  -9.762  -40.179 1.00 8.49   ? 100  LEU B C   1 
ATOM   2600  O O   . LEU C 1 100 ? 23.361  -9.782  -40.217 1.00 13.34  ? 100  LEU B O   1 
ATOM   2601  C CB  . LEU C 1 100 ? 21.069  -10.627 -38.089 1.00 4.11   ? 100  LEU B CB  1 
ATOM   2602  C CG  . LEU C 1 100 ? 20.583  -10.322 -36.661 1.00 8.88   ? 100  LEU B CG  1 
ATOM   2603  C CD1 . LEU C 1 100 ? 20.546  -11.619 -35.865 1.00 2.21   ? 100  LEU B CD1 1 
ATOM   2604  C CD2 . LEU C 1 100 ? 21.604  -9.390  -35.984 1.00 1.00   ? 100  LEU B CD2 1 
ATOM   2605  N N   . ASP C 1 101 ? 21.403  -10.023 -41.246 1.00 1.00   ? 101  ASP B N   1 
ATOM   2606  C CA  . ASP C 1 101 ? 22.135  -10.316 -42.454 1.00 2.36   ? 101  ASP B CA  1 
ATOM   2607  C C   . ASP C 1 101 ? 22.847  -9.103  -43.022 1.00 8.45   ? 101  ASP B C   1 
ATOM   2608  O O   . ASP C 1 101 ? 23.847  -9.178  -43.696 1.00 12.15  ? 101  ASP B O   1 
ATOM   2609  C CB  . ASP C 1 101 ? 21.197  -10.848 -43.514 1.00 1.77   ? 101  ASP B CB  1 
ATOM   2610  C CG  . ASP C 1 101 ? 20.794  -12.303 -43.372 1.00 3.77   ? 101  ASP B CG  1 
ATOM   2611  O OD1 . ASP C 1 101 ? 21.214  -13.036 -42.490 1.00 14.68  ? 101  ASP B OD1 1 
ATOM   2612  O OD2 . ASP C 1 101 ? 19.779  -12.580 -44.162 1.00 33.03  ? 101  ASP B OD2 1 
ATOM   2613  N N   . LEU C 1 102 ? 22.298  -7.968  -42.759 1.00 8.68   ? 102  LEU B N   1 
ATOM   2614  C CA  . LEU C 1 102 ? 22.875  -6.735  -43.203 1.00 4.32   ? 102  LEU B CA  1 
ATOM   2615  C C   . LEU C 1 102 ? 23.995  -6.361  -42.284 1.00 10.80  ? 102  LEU B C   1 
ATOM   2616  O O   . LEU C 1 102 ? 25.090  -6.045  -42.687 1.00 14.15  ? 102  LEU B O   1 
ATOM   2617  C CB  . LEU C 1 102 ? 21.787  -5.671  -43.104 1.00 3.76   ? 102  LEU B CB  1 
ATOM   2618  C CG  . LEU C 1 102 ? 22.163  -4.245  -43.574 1.00 10.55  ? 102  LEU B CG  1 
ATOM   2619  C CD1 . LEU C 1 102 ? 22.876  -4.155  -44.909 1.00 3.28   ? 102  LEU B CD1 1 
ATOM   2620  C CD2 . LEU C 1 102 ? 20.935  -3.355  -43.613 1.00 8.71   ? 102  LEU B CD2 1 
ATOM   2621  N N   . LEU C 1 103 ? 23.715  -6.430  -41.014 1.00 6.51   ? 103  LEU B N   1 
ATOM   2622  C CA  . LEU C 1 103 ? 24.694  -6.138  -40.011 1.00 1.50   ? 103  LEU B CA  1 
ATOM   2623  C C   . LEU C 1 103 ? 25.953  -6.951  -40.158 1.00 3.09   ? 103  LEU B C   1 
ATOM   2624  O O   . LEU C 1 103 ? 27.046  -6.530  -39.836 1.00 11.31  ? 103  LEU B O   1 
ATOM   2625  C CB  . LEU C 1 103 ? 24.083  -6.469  -38.681 1.00 1.77   ? 103  LEU B CB  1 
ATOM   2626  C CG  . LEU C 1 103 ? 24.962  -6.115  -37.479 1.00 6.67   ? 103  LEU B CG  1 
ATOM   2627  C CD1 . LEU C 1 103 ? 25.202  -4.618  -37.361 1.00 1.00   ? 103  LEU B CD1 1 
ATOM   2628  C CD2 . LEU C 1 103 ? 24.169  -6.511  -36.248 1.00 5.13   ? 103  LEU B CD2 1 
ATOM   2629  N N   . GLU C 1 104 ? 25.814  -8.134  -40.660 1.00 3.47   ? 104  GLU B N   1 
ATOM   2630  C CA  . GLU C 1 104 ? 26.958  -8.991  -40.850 1.00 3.16   ? 104  GLU B CA  1 
ATOM   2631  C C   . GLU C 1 104 ? 28.045  -8.369  -41.663 1.00 10.60  ? 104  GLU B C   1 
ATOM   2632  O O   . GLU C 1 104 ? 29.214  -8.504  -41.408 1.00 15.54  ? 104  GLU B O   1 
ATOM   2633  C CB  . GLU C 1 104 ? 26.495  -10.224 -41.567 1.00 4.44   ? 104  GLU B CB  1 
ATOM   2634  C CG  . GLU C 1 104 ? 27.544  -11.310 -41.499 1.00 1.00   ? 104  GLU B CG  1 
ATOM   2635  C CD  . GLU C 1 104 ? 27.854  -11.814 -40.116 1.00 11.35  ? 104  GLU B CD  1 
ATOM   2636  O OE1 . GLU C 1 104 ? 27.159  -11.548 -39.129 1.00 33.25  ? 104  GLU B OE1 1 
ATOM   2637  O OE2 . GLU C 1 104 ? 28.912  -12.613 -40.136 1.00 12.49  ? 104  GLU B OE2 1 
ATOM   2638  N N   . LEU C 1 105 ? 27.644  -7.645  -42.643 1.00 7.71   ? 105  LEU B N   1 
ATOM   2639  C CA  . LEU C 1 105 ? 28.604  -6.935  -43.448 1.00 2.89   ? 105  LEU B CA  1 
ATOM   2640  C C   . LEU C 1 105 ? 29.490  -6.025  -42.602 1.00 9.81   ? 105  LEU B C   1 
ATOM   2641  O O   . LEU C 1 105 ? 30.707  -5.860  -42.799 1.00 13.77  ? 105  LEU B O   1 
ATOM   2642  C CB  . LEU C 1 105 ? 27.847  -6.054  -44.450 1.00 3.27   ? 105  LEU B CB  1 
ATOM   2643  C CG  . LEU C 1 105 ? 26.940  -6.829  -45.422 1.00 6.52   ? 105  LEU B CG  1 
ATOM   2644  C CD1 . LEU C 1 105 ? 26.438  -6.001  -46.602 1.00 4.87   ? 105  LEU B CD1 1 
ATOM   2645  C CD2 . LEU C 1 105 ? 27.630  -8.057  -45.912 1.00 1.00   ? 105  LEU B CD2 1 
ATOM   2646  N N   . LEU C 1 106 ? 28.845  -5.408  -41.657 1.00 7.80   ? 106  LEU B N   1 
ATOM   2647  C CA  . LEU C 1 106 ? 29.585  -4.525  -40.778 1.00 6.10   ? 106  LEU B CA  1 
ATOM   2648  C C   . LEU C 1 106 ? 30.533  -5.330  -39.896 1.00 14.47  ? 106  LEU B C   1 
ATOM   2649  O O   . LEU C 1 106 ? 31.707  -4.934  -39.680 1.00 13.94  ? 106  LEU B O   1 
ATOM   2650  C CB  . LEU C 1 106 ? 28.615  -3.830  -39.851 1.00 1.05   ? 106  LEU B CB  1 
ATOM   2651  C CG  . LEU C 1 106 ? 28.046  -2.481  -40.298 1.00 1.18   ? 106  LEU B CG  1 
ATOM   2652  C CD1 . LEU C 1 106 ? 29.095  -1.602  -40.958 1.00 1.00   ? 106  LEU B CD1 1 
ATOM   2653  C CD2 . LEU C 1 106 ? 26.853  -2.702  -41.170 1.00 6.50   ? 106  LEU B CD2 1 
ATOM   2654  N N   . ILE C 1 107 ? 29.997  -6.452  -39.360 1.00 5.24   ? 107  ILE B N   1 
ATOM   2655  C CA  . ILE C 1 107 ? 30.788  -7.378  -38.516 1.00 4.29   ? 107  ILE B CA  1 
ATOM   2656  C C   . ILE C 1 107 ? 32.036  -7.945  -39.160 1.00 16.36  ? 107  ILE B C   1 
ATOM   2657  O O   . ILE C 1 107 ? 33.101  -8.005  -38.494 1.00 26.57  ? 107  ILE B O   1 
ATOM   2658  C CB  . ILE C 1 107 ? 29.984  -8.507  -37.967 1.00 7.23   ? 107  ILE B CB  1 
ATOM   2659  C CG1 . ILE C 1 107 ? 28.975  -7.855  -37.075 1.00 2.25   ? 107  ILE B CG1 1 
ATOM   2660  C CG2 . ILE C 1 107 ? 30.836  -9.529  -37.218 1.00 6.37   ? 107  ILE B CG2 1 
ATOM   2661  C CD1 . ILE C 1 107 ? 27.991  -8.829  -36.591 1.00 1.00   ? 107  ILE B CD1 1 
ATOM   2662  N N   . MET C 1 108 ? 31.883  -8.338  -40.430 1.00 6.24   ? 108  MET B N   1 
ATOM   2663  C CA  . MET C 1 108 ? 33.007  -8.856  -41.178 1.00 11.25  ? 108  MET B CA  1 
ATOM   2664  C C   . MET C 1 108 ? 34.006  -7.823  -41.632 1.00 14.93  ? 108  MET B C   1 
ATOM   2665  O O   . MET C 1 108 ? 35.151  -8.127  -41.866 1.00 18.42  ? 108  MET B O   1 
ATOM   2666  C CB  . MET C 1 108 ? 32.615  -9.599  -42.448 1.00 16.55  ? 108  MET B CB  1 
ATOM   2667  C CG  . MET C 1 108 ? 31.485  -10.619 -42.287 1.00 34.20  ? 108  MET B CG  1 
ATOM   2668  S SD  . MET C 1 108 ? 30.741  -11.310 -43.849 1.00 42.91  ? 108  MET B SD  1 
ATOM   2669  C CE  . MET C 1 108 ? 31.043  -9.957  -45.064 1.00 38.79  ? 108  MET B CE  1 
ATOM   2670  N N   . HIS C 1 109 ? 33.535  -6.630  -41.860 1.00 12.04  ? 109  HIS B N   1 
ATOM   2671  C CA  . HIS C 1 109 ? 34.310  -5.572  -42.416 1.00 8.78   ? 109  HIS B CA  1 
ATOM   2672  C C   . HIS C 1 109 ? 35.750  -5.427  -42.031 1.00 13.15  ? 109  HIS B C   1 
ATOM   2673  O O   . HIS C 1 109 ? 36.622  -5.458  -42.852 1.00 19.76  ? 109  HIS B O   1 
ATOM   2674  C CB  . HIS C 1 109 ? 33.600  -4.261  -42.239 1.00 13.77  ? 109  HIS B CB  1 
ATOM   2675  C CG  . HIS C 1 109 ? 34.095  -3.329  -43.289 1.00 19.62  ? 109  HIS B CG  1 
ATOM   2676  N ND1 . HIS C 1 109 ? 34.869  -2.225  -42.964 1.00 21.17  ? 109  HIS B ND1 1 
ATOM   2677  C CD2 . HIS C 1 109 ? 33.945  -3.393  -44.650 1.00 19.59  ? 109  HIS B CD2 1 
ATOM   2678  C CE1 . HIS C 1 109 ? 35.134  -1.631  -44.139 1.00 19.93  ? 109  HIS B CE1 1 
ATOM   2679  N NE2 . HIS C 1 109 ? 34.621  -2.324  -45.164 1.00 19.10  ? 109  HIS B NE2 1 
ATOM   2680  N N   . PRO C 1 110 ? 36.009  -5.256  -40.775 1.00 12.54  ? 110  PRO B N   1 
ATOM   2681  C CA  . PRO C 1 110 ? 37.369  -5.099  -40.284 1.00 9.73   ? 110  PRO B CA  1 
ATOM   2682  C C   . PRO C 1 110 ? 38.298  -6.236  -40.578 1.00 21.00  ? 110  PRO B C   1 
ATOM   2683  O O   . PRO C 1 110 ? 39.514  -6.093  -40.541 1.00 31.35  ? 110  PRO B O   1 
ATOM   2684  C CB  . PRO C 1 110 ? 37.281  -4.999  -38.771 1.00 7.40   ? 110  PRO B CB  1 
ATOM   2685  C CG  . PRO C 1 110 ? 35.818  -4.982  -38.416 1.00 3.83   ? 110  PRO B CG  1 
ATOM   2686  C CD  . PRO C 1 110 ? 35.012  -5.329  -39.667 1.00 9.25   ? 110  PRO B CD  1 
ATOM   2687  N N   . PHE C 1 111 ? 37.776  -7.385  -40.875 1.00 15.41  ? 111  PHE B N   1 
ATOM   2688  C CA  . PHE C 1 111 ? 38.686  -8.478  -41.148 1.00 9.17   ? 111  PHE B CA  1 
ATOM   2689  C C   . PHE C 1 111 ? 38.968  -8.725  -42.622 1.00 23.69  ? 111  PHE B C   1 
ATOM   2690  O O   . PHE C 1 111 ? 39.507  -9.763  -43.000 1.00 30.42  ? 111  PHE B O   1 
ATOM   2691  C CB  . PHE C 1 111 ? 38.133  -9.718  -40.491 1.00 4.06   ? 111  PHE B CB  1 
ATOM   2692  C CG  . PHE C 1 111 ? 37.901  -9.456  -39.045 1.00 7.88   ? 111  PHE B CG  1 
ATOM   2693  C CD1 . PHE C 1 111 ? 38.952  -9.490  -38.121 1.00 8.51   ? 111  PHE B CD1 1 
ATOM   2694  C CD2 . PHE C 1 111 ? 36.619  -9.153  -38.586 1.00 16.26  ? 111  PHE B CD2 1 
ATOM   2695  C CE1 . PHE C 1 111 ? 38.750  -9.226  -36.763 1.00 11.45  ? 111  PHE B CE1 1 
ATOM   2696  C CE2 . PHE C 1 111 ? 36.405  -8.898  -37.232 1.00 17.14  ? 111  PHE B CE2 1 
ATOM   2697  C CZ  . PHE C 1 111 ? 37.461  -8.917  -36.318 1.00 8.93   ? 111  PHE B CZ  1 
ATOM   2698  N N   . LEU C 1 112 ? 38.494  -7.810  -43.439 1.00 20.71  ? 112  LEU B N   1 
ATOM   2699  C CA  . LEU C 1 112 ? 38.668  -7.832  -44.876 1.00 19.56  ? 112  LEU B CA  1 
ATOM   2700  C C   . LEU C 1 112 ? 40.020  -7.292  -45.166 1.00 33.83  ? 112  LEU B C   1 
ATOM   2701  O O   . LEU C 1 112 ? 40.609  -6.608  -44.333 1.00 37.60  ? 112  LEU B O   1 
ATOM   2702  C CB  . LEU C 1 112 ? 37.727  -6.803  -45.563 1.00 16.48  ? 112  LEU B CB  1 
ATOM   2703  C CG  . LEU C 1 112 ? 36.309  -7.314  -45.499 1.00 14.20  ? 112  LEU B CG  1 
ATOM   2704  C CD1 . LEU C 1 112 ? 35.497  -6.709  -46.590 1.00 11.29  ? 112  LEU B CD1 1 
ATOM   2705  C CD2 . LEU C 1 112 ? 36.406  -8.783  -45.755 1.00 1.49   ? 112  LEU B CD2 1 
ATOM   2706  N N   . LYS C 1 113 ? 40.453  -7.566  -46.383 1.00 34.66  ? 113  LYS B N   1 
ATOM   2707  C CA  . LYS C 1 113 ? 41.689  -7.039  -46.896 1.00 34.60  ? 113  LYS B CA  1 
ATOM   2708  C C   . LYS C 1 113 ? 41.339  -5.669  -47.392 1.00 48.05  ? 113  LYS B C   1 
ATOM   2709  O O   . LYS C 1 113 ? 40.512  -5.471  -48.283 1.00 57.59  ? 113  LYS B O   1 
ATOM   2710  C CB  . LYS C 1 113 ? 42.286  -7.850  -48.041 1.00 37.42  ? 113  LYS B CB  1 
ATOM   2711  C CG  . LYS C 1 113 ? 42.431  -9.366  -47.838 1.00 107.85 ? 113  LYS B CG  1 
ATOM   2712  C CD  . LYS C 1 113 ? 41.221  -10.106 -47.254 1.00 141.69 ? 113  LYS B CD  1 
ATOM   2713  C CE  . LYS C 1 113 ? 39.890  -9.862  -47.960 1.00 148.40 ? 113  LYS B CE  1 
ATOM   2714  N NZ  . LYS C 1 113 ? 38.803  -10.701 -47.423 1.00 163.81 ? 113  LYS B NZ  1 
ATOM   2715  N N   . PRO C 1 114 ? 41.947  -4.755  -46.736 1.00 47.13  ? 114  PRO B N   1 
ATOM   2716  C CA  . PRO C 1 114 ? 41.892  -3.308  -46.942 1.00 50.56  ? 114  PRO B CA  1 
ATOM   2717  C C   . PRO C 1 114 ? 41.442  -2.853  -48.336 1.00 62.15  ? 114  PRO B C   1 
ATOM   2718  O O   . PRO C 1 114 ? 40.675  -1.878  -48.528 1.00 60.40  ? 114  PRO B O   1 
ATOM   2719  C CB  . PRO C 1 114 ? 43.323  -2.862  -46.636 1.00 51.30  ? 114  PRO B CB  1 
ATOM   2720  C CG  . PRO C 1 114 ? 44.104  -4.104  -46.144 1.00 51.76  ? 114  PRO B CG  1 
ATOM   2721  C CD  . PRO C 1 114 ? 43.282  -5.336  -46.454 1.00 44.33  ? 114  PRO B CD  1 
ATOM   2722  N N   . ASP C 1 115 ? 41.930  -3.590  -49.315 1.00 66.54  ? 115  ASP B N   1 
ATOM   2723  C CA  . ASP C 1 115 ? 41.557  -3.338  -50.674 1.00 73.05  ? 115  ASP B CA  1 
ATOM   2724  C C   . ASP C 1 115 ? 40.045  -3.607  -50.830 1.00 65.55  ? 115  ASP B C   1 
ATOM   2725  O O   . ASP C 1 115 ? 39.254  -2.786  -51.349 1.00 71.35  ? 115  ASP B O   1 
ATOM   2726  C CB  . ASP C 1 115 ? 42.443  -4.227  -51.577 1.00 84.19  ? 115  ASP B CB  1 
ATOM   2727  C CG  . ASP C 1 115 ? 41.807  -4.664  -52.884 1.00 167.64 ? 115  ASP B CG  1 
ATOM   2728  O OD1 . ASP C 1 115 ? 40.896  -4.061  -53.452 1.00 178.29 ? 115  ASP B OD1 1 
ATOM   2729  O OD2 . ASP C 1 115 ? 42.364  -5.756  -53.369 1.00 197.05 ? 115  ASP B OD2 1 
ATOM   2730  N N   . ASP C 1 116 ? 39.639  -4.775  -50.334 1.00 41.01  ? 116  ASP B N   1 
ATOM   2731  C CA  . ASP C 1 116 ? 38.264  -5.187  -50.396 1.00 34.94  ? 116  ASP B CA  1 
ATOM   2732  C C   . ASP C 1 116 ? 37.359  -4.421  -49.474 1.00 31.13  ? 116  ASP B C   1 
ATOM   2733  O O   . ASP C 1 116 ? 36.123  -4.446  -49.565 1.00 30.98  ? 116  ASP B O   1 
ATOM   2734  C CB  . ASP C 1 116 ? 38.171  -6.654  -50.038 1.00 39.70  ? 116  ASP B CB  1 
ATOM   2735  C CG  . ASP C 1 116 ? 38.918  -7.543  -50.986 1.00 60.74  ? 116  ASP B CG  1 
ATOM   2736  O OD1 . ASP C 1 116 ? 39.397  -7.162  -52.046 1.00 63.01  ? 116  ASP B OD1 1 
ATOM   2737  O OD2 . ASP C 1 116 ? 38.900  -8.790  -50.586 1.00 66.45  ? 116  ASP B OD2 1 
ATOM   2738  N N   . GLN C 1 117 ? 37.973  -3.755  -48.543 1.00 20.22  ? 117  GLN B N   1 
ATOM   2739  C CA  . GLN C 1 117 ? 37.171  -3.056  -47.614 1.00 20.01  ? 117  GLN B CA  1 
ATOM   2740  C C   . GLN C 1 117 ? 36.317  -2.013  -48.237 1.00 30.67  ? 117  GLN B C   1 
ATOM   2741  O O   . GLN C 1 117 ? 35.154  -1.828  -47.897 1.00 36.77  ? 117  GLN B O   1 
ATOM   2742  C CB  . GLN C 1 117 ? 38.037  -2.496  -46.514 1.00 22.50  ? 117  GLN B CB  1 
ATOM   2743  C CG  . GLN C 1 117 ? 38.506  -3.614  -45.575 1.00 37.02  ? 117  GLN B CG  1 
ATOM   2744  C CD  . GLN C 1 117 ? 39.086  -2.991  -44.343 1.00 29.68  ? 117  GLN B CD  1 
ATOM   2745  O OE1 . GLN C 1 117 ? 39.742  -1.957  -44.424 1.00 64.54  ? 117  GLN B OE1 1 
ATOM   2746  N NE2 . GLN C 1 117 ? 38.736  -3.528  -43.193 1.00 42.05  ? 117  GLN B NE2 1 
ATOM   2747  N N   . GLN C 1 118 ? 36.904  -1.362  -49.190 1.00 33.21  ? 118  GLN B N   1 
ATOM   2748  C CA  . GLN C 1 118 ? 36.200  -0.324  -49.868 1.00 34.93  ? 118  GLN B CA  1 
ATOM   2749  C C   . GLN C 1 118 ? 35.087  -0.779  -50.771 1.00 32.72  ? 118  GLN B C   1 
ATOM   2750  O O   . GLN C 1 118 ? 33.997  -0.196  -50.778 1.00 33.69  ? 118  GLN B O   1 
ATOM   2751  C CB  . GLN C 1 118 ? 37.142  0.662   -50.517 1.00 41.88  ? 118  GLN B CB  1 
ATOM   2752  C CG  . GLN C 1 118 ? 36.488  2.061   -50.588 1.00 157.13 ? 118  GLN B CG  1 
ATOM   2753  C CD  . GLN C 1 118 ? 35.951  2.549   -49.250 1.00 221.48 ? 118  GLN B CD  1 
ATOM   2754  O OE1 . GLN C 1 118 ? 36.502  2.221   -48.181 1.00 237.99 ? 118  GLN B OE1 1 
ATOM   2755  N NE2 . GLN C 1 118 ? 34.865  3.326   -49.296 1.00 199.58 ? 118  GLN B NE2 1 
ATOM   2756  N N   . LYS C 1 119 ? 35.359  -1.827  -51.522 1.00 28.62  ? 119  LYS B N   1 
ATOM   2757  C CA  . LYS C 1 119 ? 34.328  -2.359  -52.379 1.00 25.84  ? 119  LYS B CA  1 
ATOM   2758  C C   . LYS C 1 119 ? 33.090  -2.707  -51.536 1.00 26.95  ? 119  LYS B C   1 
ATOM   2759  O O   . LYS C 1 119 ? 31.942  -2.445  -51.844 1.00 33.39  ? 119  LYS B O   1 
ATOM   2760  C CB  . LYS C 1 119 ? 34.809  -3.525  -53.268 1.00 28.01  ? 119  LYS B CB  1 
ATOM   2761  C CG  . LYS C 1 119 ? 33.798  -3.791  -54.399 1.00 143.15 ? 119  LYS B CG  1 
ATOM   2762  C CD  . LYS C 1 119 ? 32.500  -4.459  -53.926 1.00 172.67 ? 119  LYS B CD  1 
ATOM   2763  C CE  . LYS C 1 119 ? 31.184  -3.860  -54.447 1.00 131.07 ? 119  LYS B CE  1 
ATOM   2764  N NZ  . LYS C 1 119 ? 30.029  -4.189  -53.549 1.00 24.57  ? 119  LYS B NZ  1 
ATOM   2765  N N   . GLU C 1 120 ? 33.382  -3.203  -50.378 1.00 19.79  ? 120  GLU B N   1 
ATOM   2766  C CA  . GLU C 1 120 ? 32.428  -3.621  -49.404 1.00 17.74  ? 120  GLU B CA  1 
ATOM   2767  C C   . GLU C 1 120 ? 31.506  -2.596  -48.848 1.00 19.67  ? 120  GLU B C   1 
ATOM   2768  O O   . GLU C 1 120 ? 30.317  -2.871  -48.577 1.00 22.84  ? 120  GLU B O   1 
ATOM   2769  C CB  . GLU C 1 120 ? 33.274  -4.298  -48.368 1.00 19.73  ? 120  GLU B CB  1 
ATOM   2770  C CG  . GLU C 1 120 ? 33.576  -5.566  -49.144 1.00 25.31  ? 120  GLU B CG  1 
ATOM   2771  C CD  . GLU C 1 120 ? 32.226  -6.166  -49.460 1.00 96.14  ? 120  GLU B CD  1 
ATOM   2772  O OE1 . GLU C 1 120 ? 31.207  -6.038  -48.731 1.00 96.42  ? 120  GLU B OE1 1 
ATOM   2773  O OE2 . GLU C 1 120 ? 32.280  -6.813  -50.597 1.00 45.20  ? 120  GLU B OE2 1 
ATOM   2774  N N   . VAL C 1 121 ? 32.085  -1.435  -48.634 1.00 5.57   ? 121  VAL B N   1 
ATOM   2775  C CA  . VAL C 1 121 ? 31.272  -0.379  -48.160 1.00 6.59   ? 121  VAL B CA  1 
ATOM   2776  C C   . VAL C 1 121 ? 30.225  -0.043  -49.205 1.00 17.69  ? 121  VAL B C   1 
ATOM   2777  O O   . VAL C 1 121 ? 29.038  0.166   -48.930 1.00 24.97  ? 121  VAL B O   1 
ATOM   2778  C CB  . VAL C 1 121 ? 32.106  0.825   -47.993 1.00 6.74   ? 121  VAL B CB  1 
ATOM   2779  C CG1 . VAL C 1 121 ? 31.147  1.937   -47.682 1.00 4.65   ? 121  VAL B CG1 1 
ATOM   2780  C CG2 . VAL C 1 121 ? 32.992  0.591   -46.806 1.00 3.02   ? 121  VAL B CG2 1 
ATOM   2781  N N   . VAL C 1 122 ? 30.680  -0.001  -50.421 1.00 9.06   ? 122  VAL B N   1 
ATOM   2782  C CA  . VAL C 1 122 ? 29.767  0.253   -51.505 1.00 13.35  ? 122  VAL B CA  1 
ATOM   2783  C C   . VAL C 1 122 ? 28.672  -0.780  -51.500 1.00 18.92  ? 122  VAL B C   1 
ATOM   2784  O O   . VAL C 1 122 ? 27.459  -0.472  -51.572 1.00 19.82  ? 122  VAL B O   1 
ATOM   2785  C CB  . VAL C 1 122 ? 30.505  0.215   -52.845 1.00 16.00  ? 122  VAL B CB  1 
ATOM   2786  C CG1 . VAL C 1 122 ? 29.518  0.356   -53.962 1.00 13.10  ? 122  VAL B CG1 1 
ATOM   2787  C CG2 . VAL C 1 122 ? 31.409  1.404   -52.933 1.00 11.75  ? 122  VAL B CG2 1 
ATOM   2788  N N   . ASN C 1 123 ? 29.093  -2.024  -51.306 1.00 15.18  ? 123  ASN B N   1 
ATOM   2789  C CA  . ASN C 1 123 ? 28.065  -3.042  -51.230 1.00 12.95  ? 123  ASN B CA  1 
ATOM   2790  C C   . ASN C 1 123 ? 27.047  -2.884  -50.108 1.00 15.30  ? 123  ASN B C   1 
ATOM   2791  O O   . ASN C 1 123 ? 25.835  -3.055  -50.334 1.00 18.14  ? 123  ASN B O   1 
ATOM   2792  C CB  . ASN C 1 123 ? 28.540  -4.446  -51.209 1.00 20.55  ? 123  ASN B CB  1 
ATOM   2793  C CG  . ASN C 1 123 ? 27.346  -5.404  -51.409 1.00 82.12  ? 123  ASN B CG  1 
ATOM   2794  O OD1 . ASN C 1 123 ? 26.430  -5.184  -52.300 1.00 69.87  ? 123  ASN B OD1 1 
ATOM   2795  N ND2 . ASN C 1 123 ? 27.329  -6.457  -50.554 1.00 34.52  ? 123  ASN B ND2 1 
ATOM   2796  N N   . MET C 1 124 ? 27.496  -2.563  -48.898 1.00 5.42   ? 124  MET B N   1 
ATOM   2797  C CA  . MET C 1 124 ? 26.540  -2.353  -47.816 1.00 2.66   ? 124  MET B CA  1 
ATOM   2798  C C   . MET C 1 124 ? 25.592  -1.306  -48.217 1.00 12.04  ? 124  MET B C   1 
ATOM   2799  O O   . MET C 1 124 ? 24.395  -1.419  -47.955 1.00 15.26  ? 124  MET B O   1 
ATOM   2800  C CB  . MET C 1 124 ? 27.141  -1.686  -46.609 1.00 3.56   ? 124  MET B CB  1 
ATOM   2801  C CG  . MET C 1 124 ? 28.497  -2.218  -46.258 1.00 11.59  ? 124  MET B CG  1 
ATOM   2802  S SD  . MET C 1 124 ? 29.041  -1.415  -44.757 1.00 14.50  ? 124  MET B SD  1 
ATOM   2803  C CE  . MET C 1 124 ? 30.452  -2.485  -44.514 1.00 8.18   ? 124  MET B CE  1 
ATOM   2804  N N   . ALA C 1 125 ? 26.163  -0.267  -48.838 1.00 8.41   ? 125  ALA B N   1 
ATOM   2805  C CA  . ALA C 1 125 ? 25.286  0.846   -49.232 1.00 8.92   ? 125  ALA B CA  1 
ATOM   2806  C C   . ALA C 1 125 ? 24.205  0.325   -50.115 1.00 16.57  ? 125  ALA B C   1 
ATOM   2807  O O   . ALA C 1 125 ? 23.031  0.501   -49.840 1.00 19.75  ? 125  ALA B O   1 
ATOM   2808  C CB  . ALA C 1 125 ? 26.032  1.917   -49.991 1.00 6.67   ? 125  ALA B CB  1 
ATOM   2809  N N   . GLN C 1 126 ? 24.616  -0.397  -51.147 1.00 7.08   ? 126  GLN B N   1 
ATOM   2810  C CA  . GLN C 1 126 ? 23.595  -0.901  -52.042 1.00 3.18   ? 126  GLN B CA  1 
ATOM   2811  C C   . GLN C 1 126 ? 22.571  -1.822  -51.428 1.00 13.31  ? 126  GLN B C   1 
ATOM   2812  O O   . GLN C 1 126 ? 21.366  -1.733  -51.724 1.00 13.84  ? 126  GLN B O   1 
ATOM   2813  C CB  . GLN C 1 126 ? 24.249  -1.588  -53.188 1.00 6.18   ? 126  GLN B CB  1 
ATOM   2814  C CG  . GLN C 1 126 ? 25.160  -0.656  -54.070 1.00 22.38  ? 126  GLN B CG  1 
ATOM   2815  C CD  . GLN C 1 126 ? 25.707  -1.397  -55.320 1.00 27.21  ? 126  GLN B CD  1 
ATOM   2816  O OE1 . GLN C 1 126 ? 26.876  -1.816  -55.309 1.00 47.66  ? 126  GLN B OE1 1 
ATOM   2817  N NE2 . GLN C 1 126 ? 24.809  -1.845  -56.238 1.00 31.54  ? 126  GLN B NE2 1 
ATOM   2818  N N   . LYS C 1 127 ? 23.032  -2.734  -50.570 1.00 6.91   ? 127  LYS B N   1 
ATOM   2819  C CA  . LYS C 1 127 ? 22.096  -3.641  -50.000 1.00 7.02   ? 127  LYS B CA  1 
ATOM   2820  C C   . LYS C 1 127 ? 21.104  -2.922  -49.152 1.00 12.38  ? 127  LYS B C   1 
ATOM   2821  O O   . LYS C 1 127 ? 19.906  -3.218  -49.163 1.00 11.43  ? 127  LYS B O   1 
ATOM   2822  C CB  . LYS C 1 127 ? 22.847  -4.539  -49.084 1.00 19.18  ? 127  LYS B CB  1 
ATOM   2823  C CG  . LYS C 1 127 ? 23.654  -5.603  -49.782 1.00 13.43  ? 127  LYS B CG  1 
ATOM   2824  C CD  . LYS C 1 127 ? 22.798  -6.815  -50.141 1.00 6.89   ? 127  LYS B CD  1 
ATOM   2825  C CE  . LYS C 1 127 ? 23.230  -7.518  -51.472 1.00 6.90   ? 127  LYS B CE  1 
ATOM   2826  N NZ  . LYS C 1 127 ? 22.909  -6.701  -52.692 1.00 114.42 ? 127  LYS B NZ  1 
ATOM   2827  N N   . ALA C 1 128 ? 21.647  -2.001  -48.349 1.00 5.41   ? 128  ALA B N   1 
ATOM   2828  C CA  . ALA C 1 128 ? 20.821  -1.276  -47.441 1.00 1.00   ? 128  ALA B CA  1 
ATOM   2829  C C   . ALA C 1 128 ? 19.728  -0.580  -48.203 1.00 6.77   ? 128  ALA B C   1 
ATOM   2830  O O   . ALA C 1 128 ? 18.535  -0.668  -47.916 1.00 9.61   ? 128  ALA B O   1 
ATOM   2831  C CB  . ALA C 1 128 ? 21.659  -0.308  -46.701 1.00 1.00   ? 128  ALA B CB  1 
ATOM   2832  N N   . ILE C 1 129 ? 20.177  0.144   -49.192 1.00 4.19   ? 129  ILE B N   1 
ATOM   2833  C CA  . ILE C 1 129 ? 19.331  1.006   -50.001 1.00 8.94   ? 129  ILE B CA  1 
ATOM   2834  C C   . ILE C 1 129 ? 18.295  0.250   -50.748 1.00 12.61  ? 129  ILE B C   1 
ATOM   2835  O O   . ILE C 1 129 ? 17.161  0.651   -50.941 1.00 22.81  ? 129  ILE B O   1 
ATOM   2836  C CB  . ILE C 1 129 ? 20.068  1.719   -51.148 1.00 20.48  ? 129  ILE B CB  1 
ATOM   2837  C CG1 . ILE C 1 129 ? 21.108  2.713   -50.742 1.00 16.28  ? 129  ILE B CG1 1 
ATOM   2838  C CG2 . ILE C 1 129 ? 19.009  2.554   -51.773 1.00 34.42  ? 129  ILE B CG2 1 
ATOM   2839  C CD1 . ILE C 1 129 ? 20.706  3.030   -49.340 1.00 9.85   ? 129  ILE B CD1 1 
ATOM   2840  N N   . ILE C 1 130 ? 18.735  -0.806  -51.305 1.00 8.64   ? 130  ILE B N   1 
ATOM   2841  C CA  . ILE C 1 130 ? 17.846  -1.585  -52.132 1.00 10.81  ? 130  ILE B CA  1 
ATOM   2842  C C   . ILE C 1 130 ? 17.083  -2.709  -51.477 1.00 10.87  ? 130  ILE B C   1 
ATOM   2843  O O   . ILE C 1 130 ? 15.943  -2.945  -51.798 1.00 13.33  ? 130  ILE B O   1 
ATOM   2844  C CB  . ILE C 1 130 ? 18.714  -2.258  -53.139 1.00 15.81  ? 130  ILE B CB  1 
ATOM   2845  C CG1 . ILE C 1 130 ? 19.306  -1.197  -54.000 1.00 19.12  ? 130  ILE B CG1 1 
ATOM   2846  C CG2 . ILE C 1 130 ? 17.893  -3.096  -54.059 1.00 6.62   ? 130  ILE B CG2 1 
ATOM   2847  C CD1 . ILE C 1 130 ? 20.296  -1.848  -54.926 1.00 24.97  ? 130  ILE B CD1 1 
ATOM   2848  N N   . ARG C 1 131 ? 17.730  -3.426  -50.602 1.00 3.96   ? 131  ARG B N   1 
ATOM   2849  C CA  . ARG C 1 131 ? 17.113  -4.576  -50.053 1.00 1.93   ? 131  ARG B CA  1 
ATOM   2850  C C   . ARG C 1 131 ? 16.452  -4.426  -48.733 1.00 6.36   ? 131  ARG B C   1 
ATOM   2851  O O   . ARG C 1 131 ? 15.407  -5.029  -48.571 1.00 12.60  ? 131  ARG B O   1 
ATOM   2852  C CB  . ARG C 1 131 ? 18.118  -5.732  -50.215 1.00 4.26   ? 131  ARG B CB  1 
ATOM   2853  C CG  . ARG C 1 131 ? 17.882  -7.088  -49.559 1.00 23.64  ? 131  ARG B CG  1 
ATOM   2854  C CD  . ARG C 1 131 ? 18.590  -8.201  -50.370 1.00 14.16  ? 131  ARG B CD  1 
ATOM   2855  N NE  . ARG C 1 131 ? 18.359  -7.900  -51.794 1.00 66.89  ? 131  ARG B NE  1 
ATOM   2856  C CZ  . ARG C 1 131 ? 18.722  -8.732  -52.754 1.00 94.72  ? 131  ARG B CZ  1 
ATOM   2857  N NH1 . ARG C 1 131 ? 19.355  -9.873  -52.372 1.00 9.97   ? 131  ARG B NH1 1 
ATOM   2858  N NH2 . ARG C 1 131 ? 18.447  -8.411  -54.060 1.00 69.95  ? 131  ARG B NH2 1 
ATOM   2859  N N   . TYR C 1 132 ? 17.001  -3.589  -47.842 1.00 7.37   ? 132  TYR B N   1 
ATOM   2860  C CA  . TYR C 1 132 ? 16.446  -3.412  -46.498 1.00 3.84   ? 132  TYR B CA  1 
ATOM   2861  C C   . TYR C 1 132 ? 15.658  -2.169  -46.174 1.00 8.16   ? 132  TYR B C   1 
ATOM   2862  O O   . TYR C 1 132 ? 14.486  -2.232  -45.722 1.00 8.00   ? 132  TYR B O   1 
ATOM   2863  C CB  . TYR C 1 132 ? 17.580  -3.583  -45.475 1.00 7.62   ? 132  TYR B CB  1 
ATOM   2864  C CG  . TYR C 1 132 ? 18.123  -5.006  -45.582 1.00 9.15   ? 132  TYR B CG  1 
ATOM   2865  C CD1 . TYR C 1 132 ? 17.388  -6.099  -45.117 1.00 3.85   ? 132  TYR B CD1 1 
ATOM   2866  C CD2 . TYR C 1 132 ? 19.279  -5.283  -46.320 1.00 7.21   ? 132  TYR B CD2 1 
ATOM   2867  C CE1 . TYR C 1 132 ? 17.849  -7.408  -45.239 1.00 1.00   ? 132  TYR B CE1 1 
ATOM   2868  C CE2 . TYR C 1 132 ? 19.693  -6.599  -46.551 1.00 1.61   ? 132  TYR B CE2 1 
ATOM   2869  C CZ  . TYR C 1 132 ? 18.993  -7.671  -45.997 1.00 1.00   ? 132  TYR B CZ  1 
ATOM   2870  O OH  . TYR C 1 132 ? 19.403  -8.981  -46.171 1.00 21.40  ? 132  TYR B OH  1 
ATOM   2871  N N   . PHE C 1 133 ? 16.326  -1.030  -46.291 1.00 5.39   ? 133  PHE B N   1 
ATOM   2872  C CA  . PHE C 1 133 ? 15.688  0.240   -45.942 1.00 2.99   ? 133  PHE B CA  1 
ATOM   2873  C C   . PHE C 1 133 ? 14.269  0.417   -46.502 1.00 14.49  ? 133  PHE B C   1 
ATOM   2874  O O   . PHE C 1 133 ? 13.297  0.931   -45.911 1.00 18.06  ? 133  PHE B O   1 
ATOM   2875  C CB  . PHE C 1 133 ? 16.605  1.391   -46.323 1.00 3.33   ? 133  PHE B CB  1 
ATOM   2876  C CG  . PHE C 1 133 ? 17.759  1.463   -45.357 1.00 7.26   ? 133  PHE B CG  1 
ATOM   2877  C CD1 . PHE C 1 133 ? 17.833  0.582   -44.275 1.00 8.71   ? 133  PHE B CD1 1 
ATOM   2878  C CD2 . PHE C 1 133 ? 18.762  2.429   -45.481 1.00 7.41   ? 133  PHE B CD2 1 
ATOM   2879  C CE1 . PHE C 1 133 ? 18.918  0.621   -43.392 1.00 10.38  ? 133  PHE B CE1 1 
ATOM   2880  C CE2 . PHE C 1 133 ? 19.826  2.518   -44.576 1.00 6.55   ? 133  PHE B CE2 1 
ATOM   2881  C CZ  . PHE C 1 133 ? 19.927  1.579   -43.545 1.00 4.10   ? 133  PHE B CZ  1 
ATOM   2882  N N   . PRO C 1 134 ? 14.109  -0.066  -47.684 1.00 8.58   ? 134  PRO B N   1 
ATOM   2883  C CA  . PRO C 1 134 ? 12.821  0.122   -48.317 1.00 2.15   ? 134  PRO B CA  1 
ATOM   2884  C C   . PRO C 1 134 ? 11.635  -0.591  -47.691 1.00 13.92  ? 134  PRO B C   1 
ATOM   2885  O O   . PRO C 1 134 ? 10.505  -0.134  -47.749 1.00 16.26  ? 134  PRO B O   1 
ATOM   2886  C CB  . PRO C 1 134 ? 13.057  -0.206  -49.762 1.00 1.00   ? 134  PRO B CB  1 
ATOM   2887  C CG  . PRO C 1 134 ? 14.533  -0.061  -50.044 1.00 1.00   ? 134  PRO B CG  1 
ATOM   2888  C CD  . PRO C 1 134 ? 15.219  -0.133  -48.679 1.00 6.64   ? 134  PRO B CD  1 
ATOM   2889  N N   . VAL C 1 135 ? 11.934  -1.694  -47.043 1.00 12.60  ? 135  VAL B N   1 
ATOM   2890  C CA  . VAL C 1 135 ? 10.968  -2.532  -46.427 1.00 3.53   ? 135  VAL B CA  1 
ATOM   2891  C C   . VAL C 1 135 ? 10.489  -1.843  -45.189 1.00 9.74   ? 135  VAL B C   1 
ATOM   2892  O O   . VAL C 1 135 ? 9.314   -1.738  -44.904 1.00 15.21  ? 135  VAL B O   1 
ATOM   2893  C CB  . VAL C 1 135 ? 11.605  -3.924  -46.146 1.00 1.00   ? 135  VAL B CB  1 
ATOM   2894  C CG1 . VAL C 1 135 ? 10.664  -4.907  -45.466 1.00 1.00   ? 135  VAL B CG1 1 
ATOM   2895  C CG2 . VAL C 1 135 ? 12.024  -4.614  -47.410 1.00 1.00   ? 135  VAL B CG2 1 
ATOM   2896  N N   . PHE C 1 136 ? 11.451  -1.360  -44.483 1.00 1.86   ? 136  PHE B N   1 
ATOM   2897  C CA  . PHE C 1 136 ? 11.125  -0.734  -43.248 1.00 1.00   ? 136  PHE B CA  1 
ATOM   2898  C C   . PHE C 1 136 ? 10.467  0.576   -43.469 1.00 7.71   ? 136  PHE B C   1 
ATOM   2899  O O   . PHE C 1 136 ? 9.487   0.878   -42.800 1.00 13.38  ? 136  PHE B O   1 
ATOM   2900  C CB  . PHE C 1 136 ? 12.400  -0.575  -42.428 1.00 2.78   ? 136  PHE B CB  1 
ATOM   2901  C CG  . PHE C 1 136 ? 12.977  -1.948  -42.197 1.00 6.31   ? 136  PHE B CG  1 
ATOM   2902  C CD1 . PHE C 1 136 ? 12.177  -2.946  -41.637 1.00 3.72   ? 136  PHE B CD1 1 
ATOM   2903  C CD2 . PHE C 1 136 ? 14.286  -2.295  -42.546 1.00 8.93   ? 136  PHE B CD2 1 
ATOM   2904  C CE1 . PHE C 1 136 ? 12.704  -4.208  -41.337 1.00 3.55   ? 136  PHE B CE1 1 
ATOM   2905  C CE2 . PHE C 1 136 ? 14.811  -3.569  -42.281 1.00 8.46   ? 136  PHE B CE2 1 
ATOM   2906  C CZ  . PHE C 1 136 ? 14.026  -4.540  -41.656 1.00 1.00   ? 136  PHE B CZ  1 
ATOM   2907  N N   . GLU C 1 137 ? 11.027  1.351   -44.406 1.00 5.46   ? 137  GLU B N   1 
ATOM   2908  C CA  . GLU C 1 137 ? 10.434  2.621   -44.730 1.00 8.33   ? 137  GLU B CA  1 
ATOM   2909  C C   . GLU C 1 137 ? 8.943   2.450   -45.064 1.00 15.69  ? 137  GLU B C   1 
ATOM   2910  O O   . GLU C 1 137 ? 8.035   3.085   -44.544 1.00 20.46  ? 137  GLU B O   1 
ATOM   2911  C CB  . GLU C 1 137 ? 11.162  3.244   -45.886 1.00 9.05   ? 137  GLU B CB  1 
ATOM   2912  C CG  . GLU C 1 137 ? 10.576  4.605   -46.216 1.00 4.06   ? 137  GLU B CG  1 
ATOM   2913  C CD  . GLU C 1 137 ? 11.201  5.791   -45.528 1.00 26.79  ? 137  GLU B CD  1 
ATOM   2914  O OE1 . GLU C 1 137 ? 11.935  5.727   -44.563 1.00 17.69  ? 137  GLU B OE1 1 
ATOM   2915  O OE2 . GLU C 1 137 ? 10.815  6.913   -46.085 1.00 30.49  ? 137  GLU B OE2 1 
ATOM   2916  N N   . LYS C 1 138 ? 8.648   1.486   -45.869 1.00 5.87   ? 138  LYS B N   1 
ATOM   2917  C CA  . LYS C 1 138 ? 7.273   1.253   -46.192 1.00 1.66   ? 138  LYS B CA  1 
ATOM   2918  C C   . LYS C 1 138 ? 6.443   0.764   -45.049 1.00 15.78  ? 138  LYS B C   1 
ATOM   2919  O O   . LYS C 1 138 ? 5.282   1.010   -44.987 1.00 21.84  ? 138  LYS B O   1 
ATOM   2920  C CB  . LYS C 1 138 ? 7.209   0.295   -47.353 1.00 1.00   ? 138  LYS B CB  1 
ATOM   2921  C CG  . LYS C 1 138 ? 5.867   -0.377  -47.539 1.00 28.85  ? 138  LYS B CG  1 
ATOM   2922  C CD  . LYS C 1 138 ? 5.676   -1.027  -48.939 1.00 12.27  ? 138  LYS B CD  1 
ATOM   2923  C CE  . LYS C 1 138 ? 4.467   -1.979  -49.033 1.00 131.11 ? 138  LYS B CE  1 
ATOM   2924  N NZ  . LYS C 1 138 ? 4.228   -2.543  -50.380 1.00 165.74 ? 138  LYS B NZ  1 
ATOM   2925  N N   . ILE C 1 139 ? 7.005   0.003   -44.167 1.00 16.05  ? 139  ILE B N   1 
ATOM   2926  C CA  . ILE C 1 139 ? 6.223   -0.498  -43.065 1.00 11.73  ? 139  ILE B CA  1 
ATOM   2927  C C   . ILE C 1 139 ? 5.707   0.634   -42.247 1.00 18.87  ? 139  ILE B C   1 
ATOM   2928  O O   . ILE C 1 139 ? 4.525   0.711   -41.930 1.00 25.87  ? 139  ILE B O   1 
ATOM   2929  C CB  . ILE C 1 139 ? 7.120   -1.365  -42.207 1.00 10.22  ? 139  ILE B CB  1 
ATOM   2930  C CG1 . ILE C 1 139 ? 7.115   -2.696  -42.900 1.00 2.56   ? 139  ILE B CG1 1 
ATOM   2931  C CG2 . ILE C 1 139 ? 6.609   -1.540  -40.782 1.00 3.44   ? 139  ILE B CG2 1 
ATOM   2932  C CD1 . ILE C 1 139 ? 8.038   -3.702  -42.262 1.00 11.94  ? 139  ILE B CD1 1 
ATOM   2933  N N   . LEU C 1 140 ? 6.663   1.465   -41.915 1.00 8.73   ? 140  LEU B N   1 
ATOM   2934  C CA  . LEU C 1 140 ? 6.483   2.647   -41.100 1.00 9.66   ? 140  LEU B CA  1 
ATOM   2935  C C   . LEU C 1 140 ? 5.555   3.622   -41.732 1.00 19.86  ? 140  LEU B C   1 
ATOM   2936  O O   . LEU C 1 140 ? 4.796   4.302   -41.041 1.00 20.31  ? 140  LEU B O   1 
ATOM   2937  C CB  . LEU C 1 140 ? 7.811   3.414   -41.011 1.00 7.37   ? 140  LEU B CB  1 
ATOM   2938  C CG  . LEU C 1 140 ? 8.802   2.699   -40.118 1.00 12.43  ? 140  LEU B CG  1 
ATOM   2939  C CD1 . LEU C 1 140 ? 10.111  3.441   -40.152 1.00 11.57  ? 140  LEU B CD1 1 
ATOM   2940  C CD2 . LEU C 1 140 ? 8.256   2.714   -38.705 1.00 1.00   ? 140  LEU B CD2 1 
ATOM   2941  N N   . ARG C 1 141 ? 5.774   3.790   -43.030 1.00 18.13  ? 141  ARG B N   1 
ATOM   2942  C CA  . ARG C 1 141 ? 4.991   4.729   -43.787 1.00 15.20  ? 141  ARG B CA  1 
ATOM   2943  C C   . ARG C 1 141 ? 3.619   4.159   -43.807 1.00 23.36  ? 141  ARG B C   1 
ATOM   2944  O O   . ARG C 1 141 ? 2.604   4.798   -43.759 1.00 26.77  ? 141  ARG B O   1 
ATOM   2945  C CB  . ARG C 1 141 ? 5.520   4.925   -45.205 1.00 12.08  ? 141  ARG B CB  1 
ATOM   2946  C CG  . ARG C 1 141 ? 4.637   5.736   -46.181 1.00 15.77  ? 141  ARG B CG  1 
ATOM   2947  C CD  . ARG C 1 141 ? 5.407   6.548   -47.302 1.00 39.51  ? 141  ARG B CD  1 
ATOM   2948  N NE  . ARG C 1 141 ? 4.625   7.239   -48.408 1.00 24.05  ? 141  ARG B NE  1 
ATOM   2949  C CZ  . ARG C 1 141 ? 3.512   6.762   -49.014 1.00 157.26 ? 141  ARG B CZ  1 
ATOM   2950  N NH1 . ARG C 1 141 ? 2.967   5.574   -48.699 1.00 197.13 ? 141  ARG B NH1 1 
ATOM   2951  N NH2 . ARG C 1 141 ? 2.943   7.488   -49.982 1.00 188.07 ? 141  ARG B NH2 1 
ATOM   2952  N N   . GLY C 1 142 ? 3.549   2.889   -43.785 1.00 26.73  ? 142  GLY B N   1 
ATOM   2953  C CA  . GLY C 1 142 ? 2.230   2.358   -43.848 1.00 22.08  ? 142  GLY B CA  1 
ATOM   2954  C C   . GLY C 1 142 ? 1.383   2.429   -42.602 1.00 28.74  ? 142  GLY B C   1 
ATOM   2955  O O   . GLY C 1 142 ? 0.202   2.295   -42.710 1.00 37.30  ? 142  GLY B O   1 
ATOM   2956  N N   . HIS C 1 143 ? 1.926   2.557   -41.405 1.00 26.32  ? 143  HIS B N   1 
ATOM   2957  C CA  . HIS C 1 143 ? 1.051   2.532   -40.223 1.00 15.58  ? 143  HIS B CA  1 
ATOM   2958  C C   . HIS C 1 143 ? 1.162   3.788   -39.390 1.00 22.64  ? 143  HIS B C   1 
ATOM   2959  O O   . HIS C 1 143 ? 0.385   4.022   -38.462 1.00 32.45  ? 143  HIS B O   1 
ATOM   2960  C CB  . HIS C 1 143 ? 1.282   1.273   -39.337 1.00 12.14  ? 143  HIS B CB  1 
ATOM   2961  C CG  . HIS C 1 143 ? 2.704   1.062   -38.828 1.00 16.77  ? 143  HIS B CG  1 
ATOM   2962  N ND1 . HIS C 1 143 ? 3.543   2.114   -38.441 1.00 18.94  ? 143  HIS B ND1 1 
ATOM   2963  C CD2 . HIS C 1 143 ? 3.375   -0.100  -38.610 1.00 14.09  ? 143  HIS B CD2 1 
ATOM   2964  C CE1 . HIS C 1 143 ? 4.666   1.576   -38.033 1.00 18.89  ? 143  HIS B CE1 1 
ATOM   2965  N NE2 . HIS C 1 143 ? 4.594   0.242   -38.122 1.00 16.83  ? 143  HIS B NE2 1 
ATOM   2966  N N   . GLY C 1 144 ? 2.186   4.570   -39.718 1.00 12.56  ? 144  GLY B N   1 
ATOM   2967  C CA  . GLY C 1 144 ? 2.458   5.812   -39.070 1.00 11.41  ? 144  GLY B CA  1 
ATOM   2968  C C   . GLY C 1 144 ? 2.979   5.701   -37.642 1.00 29.14  ? 144  GLY B C   1 
ATOM   2969  O O   . GLY C 1 144 ? 3.190   6.758   -37.054 1.00 40.79  ? 144  GLY B O   1 
ATOM   2970  N N   . GLN C 1 145 ? 3.136   4.468   -37.102 1.00 18.28  ? 145  GLN B N   1 
ATOM   2971  C CA  . GLN C 1 145 ? 3.634   4.354   -35.729 1.00 11.15  ? 145  GLN B CA  1 
ATOM   2972  C C   . GLN C 1 145 ? 5.113   4.535   -35.566 1.00 10.67  ? 145  GLN B C   1 
ATOM   2973  O O   . GLN C 1 145 ? 5.873   4.671   -36.550 1.00 11.31  ? 145  GLN B O   1 
ATOM   2974  C CB  . GLN C 1 145 ? 3.056   3.186   -34.994 1.00 10.79  ? 145  GLN B CB  1 
ATOM   2975  C CG  . GLN C 1 145 ? 1.624   3.096   -35.519 1.00 13.73  ? 145  GLN B CG  1 
ATOM   2976  C CD  . GLN C 1 145 ? 0.975   1.876   -34.969 1.00 15.92  ? 145  GLN B CD  1 
ATOM   2977  O OE1 . GLN C 1 145 ? 1.489   0.747   -35.152 1.00 39.77  ? 145  GLN B OE1 1 
ATOM   2978  N NE2 . GLN C 1 145 ? 0.009   2.098   -34.121 1.00 27.22  ? 145  GLN B NE2 1 
ATOM   2979  N N   . SER C 1 146 ? 5.523   4.647   -34.326 1.00 7.31   ? 146  SER B N   1 
ATOM   2980  C CA  . SER C 1 146 ? 6.943   4.873   -34.140 1.00 15.43  ? 146  SER B CA  1 
ATOM   2981  C C   . SER C 1 146 ? 7.769   3.607   -33.993 1.00 19.58  ? 146  SER B C   1 
ATOM   2982  O O   . SER C 1 146 ? 8.967   3.714   -33.859 1.00 20.76  ? 146  SER B O   1 
ATOM   2983  C CB  . SER C 1 146 ? 7.311   5.850   -33.038 1.00 23.42  ? 146  SER B CB  1 
ATOM   2984  O OG  . SER C 1 146 ? 6.281   6.796   -32.798 1.00 23.75  ? 146  SER B OG  1 
ATOM   2985  N N   . PHE C 1 147 ? 7.108   2.467   -34.051 1.00 12.42  ? 147  PHE B N   1 
ATOM   2986  C CA  . PHE C 1 147 ? 7.700   1.182   -33.937 1.00 12.85  ? 147  PHE B CA  1 
ATOM   2987  C C   . PHE C 1 147 ? 7.331   0.366   -35.107 1.00 17.51  ? 147  PHE B C   1 
ATOM   2988  O O   . PHE C 1 147 ? 6.259   0.554   -35.619 1.00 17.01  ? 147  PHE B O   1 
ATOM   2989  C CB  . PHE C 1 147 ? 7.041   0.511   -32.768 1.00 16.68  ? 147  PHE B CB  1 
ATOM   2990  C CG  . PHE C 1 147 ? 7.292   1.402   -31.612 1.00 15.38  ? 147  PHE B CG  1 
ATOM   2991  C CD1 . PHE C 1 147 ? 8.593   1.551   -31.141 1.00 14.47  ? 147  PHE B CD1 1 
ATOM   2992  C CD2 . PHE C 1 147 ? 6.278   2.146   -31.026 1.00 16.29  ? 147  PHE B CD2 1 
ATOM   2993  C CE1 . PHE C 1 147 ? 8.923   2.345   -30.043 1.00 10.70  ? 147  PHE B CE1 1 
ATOM   2994  C CE2 . PHE C 1 147 ? 6.600   2.978   -29.951 1.00 12.98  ? 147  PHE B CE2 1 
ATOM   2995  C CZ  . PHE C 1 147 ? 7.900   3.086   -29.458 1.00 2.23   ? 147  PHE B CZ  1 
ATOM   2996  N N   . LEU C 1 148 ? 8.209   -0.559  -35.473 1.00 14.06  ? 148  LEU B N   1 
ATOM   2997  C CA  . LEU C 1 148 ? 7.987   -1.421  -36.619 1.00 7.29   ? 148  LEU B CA  1 
ATOM   2998  C C   . LEU C 1 148 ? 6.786   -2.322  -36.463 1.00 14.68  ? 148  LEU B C   1 
ATOM   2999  O O   . LEU C 1 148 ? 6.007   -2.616  -37.428 1.00 11.93  ? 148  LEU B O   1 
ATOM   3000  C CB  . LEU C 1 148 ? 9.192   -2.316  -36.819 1.00 1.53   ? 148  LEU B CB  1 
ATOM   3001  C CG  . LEU C 1 148 ? 10.304  -1.546  -37.462 1.00 8.09   ? 148  LEU B CG  1 
ATOM   3002  C CD1 . LEU C 1 148 ? 11.473  -2.487  -37.454 1.00 6.61   ? 148  LEU B CD1 1 
ATOM   3003  C CD2 . LEU C 1 148 ? 9.955   -1.202  -38.905 1.00 3.81   ? 148  LEU B CD2 1 
ATOM   3004  N N   . VAL C 1 149 ? 6.696   -2.799  -35.233 1.00 7.19   ? 149  VAL B N   1 
ATOM   3005  C CA  . VAL C 1 149 ? 5.671   -3.742  -34.888 1.00 8.20   ? 149  VAL B CA  1 
ATOM   3006  C C   . VAL C 1 149 ? 5.051   -3.470  -33.523 1.00 17.89  ? 149  VAL B C   1 
ATOM   3007  O O   . VAL C 1 149 ? 5.742   -3.141  -32.528 1.00 13.91  ? 149  VAL B O   1 
ATOM   3008  C CB  . VAL C 1 149 ? 6.203   -5.183  -34.912 1.00 8.40   ? 149  VAL B CB  1 
ATOM   3009  C CG1 . VAL C 1 149 ? 5.146   -6.229  -34.507 1.00 4.74   ? 149  VAL B CG1 1 
ATOM   3010  C CG2 . VAL C 1 149 ? 6.878   -5.558  -36.230 1.00 7.52   ? 149  VAL B CG2 1 
ATOM   3011  N N   . GLY C 1 150 ? 3.726   -3.626  -33.546 1.00 11.92  ? 150  GLY B N   1 
ATOM   3012  C CA  . GLY C 1 150 ? 2.842   -3.508  -32.401 1.00 14.38  ? 150  GLY B CA  1 
ATOM   3013  C C   . GLY C 1 150 ? 2.829   -2.193  -31.617 1.00 20.27  ? 150  GLY B C   1 
ATOM   3014  O O   . GLY C 1 150 ? 2.427   -2.139  -30.458 1.00 25.89  ? 150  GLY B O   1 
ATOM   3015  N N   . ASN C 1 151 ? 3.299   -1.159  -32.223 1.00 19.63  ? 151  ASN B N   1 
ATOM   3016  C CA  . ASN C 1 151 ? 3.296   0.107   -31.558 1.00 19.72  ? 151  ASN B CA  1 
ATOM   3017  C C   . ASN C 1 151 ? 3.963   0.119   -30.242 1.00 18.61  ? 151  ASN B C   1 
ATOM   3018  O O   . ASN C 1 151 ? 3.603   0.823   -29.338 1.00 28.97  ? 151  ASN B O   1 
ATOM   3019  C CB  . ASN C 1 151 ? 1.908   0.687   -31.481 1.00 14.88  ? 151  ASN B CB  1 
ATOM   3020  C CG  . ASN C 1 151 ? 1.925   2.176   -31.505 1.00 30.62  ? 151  ASN B CG  1 
ATOM   3021  O OD1 . ASN C 1 151 ? 2.874   2.892   -31.906 1.00 33.31  ? 151  ASN B OD1 1 
ATOM   3022  N ND2 . ASN C 1 151 ? 0.873   2.629   -30.910 1.00 19.00  ? 151  ASN B ND2 1 
ATOM   3023  N N   . GLN C 1 152 ? 4.923   -0.718  -30.165 1.00 18.45  ? 152  GLN B N   1 
ATOM   3024  C CA  . GLN C 1 152 ? 5.786   -0.802  -29.026 1.00 16.11  ? 152  GLN B CA  1 
ATOM   3025  C C   . GLN C 1 152 ? 7.170   -1.240  -29.473 1.00 21.81  ? 152  GLN B C   1 
ATOM   3026  O O   . GLN C 1 152 ? 7.382   -1.802  -30.570 1.00 26.92  ? 152  GLN B O   1 
ATOM   3027  C CB  . GLN C 1 152 ? 5.234   -1.619  -27.872 1.00 11.65  ? 152  GLN B CB  1 
ATOM   3028  C CG  . GLN C 1 152 ? 5.007   -3.100  -28.175 1.00 50.81  ? 152  GLN B CG  1 
ATOM   3029  C CD  . GLN C 1 152 ? 5.014   -3.855  -26.871 1.00 60.65  ? 152  GLN B CD  1 
ATOM   3030  O OE1 . GLN C 1 152 ? 4.360   -3.359  -25.949 1.00 31.26  ? 152  GLN B OE1 1 
ATOM   3031  N NE2 . GLN C 1 152 ? 5.807   -4.948  -26.760 1.00 39.42  ? 152  GLN B NE2 1 
ATOM   3032  N N   . LEU C 1 153 ? 8.121   -0.910  -28.646 1.00 9.82   ? 153  LEU B N   1 
ATOM   3033  C CA  . LEU C 1 153 ? 9.473   -1.262  -28.954 1.00 8.50   ? 153  LEU B CA  1 
ATOM   3034  C C   . LEU C 1 153 ? 9.592   -2.777  -28.956 1.00 17.38  ? 153  LEU B C   1 
ATOM   3035  O O   . LEU C 1 153 ? 8.995   -3.469  -28.134 1.00 22.43  ? 153  LEU B O   1 
ATOM   3036  C CB  . LEU C 1 153 ? 10.400  -0.596  -27.935 1.00 7.95   ? 153  LEU B CB  1 
ATOM   3037  C CG  . LEU C 1 153 ? 11.896  -0.663  -28.182 1.00 9.93   ? 153  LEU B CG  1 
ATOM   3038  C CD1 . LEU C 1 153 ? 12.331  0.279   -29.289 1.00 4.74   ? 153  LEU B CD1 1 
ATOM   3039  C CD2 . LEU C 1 153 ? 12.598  -0.266  -26.920 1.00 1.00   ? 153  LEU B CD2 1 
ATOM   3040  N N   . SER C 1 154 ? 10.364  -3.242  -29.914 1.00 9.75   ? 154  SER B N   1 
ATOM   3041  C CA  . SER C 1 154 ? 10.610  -4.614  -30.121 1.00 5.01   ? 154  SER B CA  1 
ATOM   3042  C C   . SER C 1 154 ? 12.063  -4.791  -30.402 1.00 12.22  ? 154  SER B C   1 
ATOM   3043  O O   . SER C 1 154 ? 12.865  -3.873  -30.598 1.00 13.00  ? 154  SER B O   1 
ATOM   3044  C CB  . SER C 1 154 ? 9.793   -5.137  -31.283 1.00 1.00   ? 154  SER B CB  1 
ATOM   3045  O OG  . SER C 1 154 ? 10.377  -4.719  -32.490 1.00 11.84  ? 154  SER B OG  1 
ATOM   3046  N N   . LEU C 1 155 ? 12.408  -6.028  -30.379 1.00 9.77   ? 155  LEU B N   1 
ATOM   3047  C CA  . LEU C 1 155 ? 13.759  -6.386  -30.680 1.00 7.09   ? 155  LEU B CA  1 
ATOM   3048  C C   . LEU C 1 155 ? 14.109  -5.921  -32.099 1.00 11.75  ? 155  LEU B C   1 
ATOM   3049  O O   . LEU C 1 155 ? 15.222  -5.536  -32.392 1.00 13.82  ? 155  LEU B O   1 
ATOM   3050  C CB  . LEU C 1 155 ? 13.826  -7.902  -30.546 1.00 5.55   ? 155  LEU B CB  1 
ATOM   3051  C CG  . LEU C 1 155 ? 15.141  -8.493  -30.992 1.00 7.79   ? 155  LEU B CG  1 
ATOM   3052  C CD1 . LEU C 1 155 ? 16.287  -7.910  -30.214 1.00 1.95   ? 155  LEU B CD1 1 
ATOM   3053  C CD2 . LEU C 1 155 ? 15.064  -9.985  -30.757 1.00 1.00   ? 155  LEU B CD2 1 
ATOM   3054  N N   . ALA C 1 156 ? 13.129  -5.936  -33.005 1.00 4.41   ? 156  ALA B N   1 
ATOM   3055  C CA  . ALA C 1 156 ? 13.374  -5.512  -34.360 1.00 1.00   ? 156  ALA B CA  1 
ATOM   3056  C C   . ALA C 1 156 ? 13.841  -4.050  -34.425 1.00 9.58   ? 156  ALA B C   1 
ATOM   3057  O O   . ALA C 1 156 ? 14.794  -3.681  -35.148 1.00 11.69  ? 156  ALA B O   1 
ATOM   3058  C CB  . ALA C 1 156 ? 12.139  -5.772  -35.170 1.00 1.21   ? 156  ALA B CB  1 
ATOM   3059  N N   . ASP C 1 157 ? 13.215  -3.191  -33.627 1.00 3.22   ? 157  ASP B N   1 
ATOM   3060  C CA  . ASP C 1 157 ? 13.619  -1.799  -33.659 1.00 1.00   ? 157  ASP B CA  1 
ATOM   3061  C C   . ASP C 1 157 ? 15.042  -1.615  -33.142 1.00 6.79   ? 157  ASP B C   1 
ATOM   3062  O O   . ASP C 1 157 ? 15.837  -0.819  -33.635 1.00 9.32   ? 157  ASP B O   1 
ATOM   3063  C CB  . ASP C 1 157 ? 12.669  -0.966  -32.806 1.00 1.62   ? 157  ASP B CB  1 
ATOM   3064  C CG  . ASP C 1 157 ? 11.208  -1.039  -33.150 1.00 7.39   ? 157  ASP B CG  1 
ATOM   3065  O OD1 . ASP C 1 157 ? 10.730  -0.797  -34.244 1.00 7.28   ? 157  ASP B OD1 1 
ATOM   3066  O OD2 . ASP C 1 157 ? 10.482  -1.371  -32.127 1.00 11.20  ? 157  ASP B OD2 1 
ATOM   3067  N N   . VAL C 1 158 ? 15.408  -2.316  -32.103 1.00 2.97   ? 158  VAL B N   1 
ATOM   3068  C CA  . VAL C 1 158 ? 16.774  -2.102  -31.613 1.00 3.11   ? 158  VAL B CA  1 
ATOM   3069  C C   . VAL C 1 158 ? 17.848  -2.504  -32.611 1.00 12.25  ? 158  VAL B C   1 
ATOM   3070  O O   . VAL C 1 158 ? 18.840  -1.802  -32.834 1.00 12.12  ? 158  VAL B O   1 
ATOM   3071  C CB  . VAL C 1 158 ? 17.044  -2.835  -30.297 1.00 6.13   ? 158  VAL B CB  1 
ATOM   3072  C CG1 . VAL C 1 158 ? 18.427  -2.519  -29.767 1.00 8.89   ? 158  VAL B CG1 1 
ATOM   3073  C CG2 . VAL C 1 158 ? 15.977  -2.609  -29.258 1.00 1.00   ? 158  VAL B CG2 1 
ATOM   3074  N N   . ILE C 1 159 ? 17.673  -3.691  -33.200 1.00 8.29   ? 159  ILE B N   1 
ATOM   3075  C CA  . ILE C 1 159 ? 18.662  -4.193  -34.143 1.00 4.76   ? 159  ILE B CA  1 
ATOM   3076  C C   . ILE C 1 159 ? 18.776  -3.308  -35.351 1.00 8.02   ? 159  ILE B C   1 
ATOM   3077  O O   . ILE C 1 159 ? 19.859  -3.074  -35.894 1.00 12.26  ? 159  ILE B O   1 
ATOM   3078  C CB  . ILE C 1 159 ? 18.334  -5.617  -34.561 1.00 7.13   ? 159  ILE B CB  1 
ATOM   3079  C CG1 . ILE C 1 159 ? 18.234  -6.503  -33.334 1.00 7.72   ? 159  ILE B CG1 1 
ATOM   3080  C CG2 . ILE C 1 159 ? 19.459  -6.157  -35.408 1.00 1.00   ? 159  ILE B CG2 1 
ATOM   3081  C CD1 . ILE C 1 159 ? 19.487  -6.378  -32.459 1.00 2.92   ? 159  ILE B CD1 1 
ATOM   3082  N N   . LEU C 1 160 ? 17.623  -2.798  -35.740 1.00 1.91   ? 160  LEU B N   1 
ATOM   3083  C CA  . LEU C 1 160 ? 17.559  -1.928  -36.883 1.00 3.04   ? 160  LEU B CA  1 
ATOM   3084  C C   . LEU C 1 160 ? 18.224  -0.646  -36.573 1.00 6.29   ? 160  LEU B C   1 
ATOM   3085  O O   . LEU C 1 160 ? 19.124  -0.210  -37.286 1.00 12.58  ? 160  LEU B O   1 
ATOM   3086  C CB  . LEU C 1 160 ? 16.133  -1.777  -37.374 1.00 4.78   ? 160  LEU B CB  1 
ATOM   3087  C CG  . LEU C 1 160 ? 16.043  -0.845  -38.543 1.00 5.70   ? 160  LEU B CG  1 
ATOM   3088  C CD1 . LEU C 1 160 ? 16.943  -1.278  -39.683 1.00 1.00   ? 160  LEU B CD1 1 
ATOM   3089  C CD2 . LEU C 1 160 ? 14.616  -0.901  -38.990 1.00 1.00   ? 160  LEU B CD2 1 
ATOM   3090  N N   . LEU C 1 161 ? 17.857  -0.099  -35.441 1.00 1.00   ? 161  LEU B N   1 
ATOM   3091  C CA  . LEU C 1 161 ? 18.537  1.089   -35.008 1.00 2.24   ? 161  LEU B CA  1 
ATOM   3092  C C   . LEU C 1 161 ? 20.048  0.895   -34.923 1.00 6.32   ? 161  LEU B C   1 
ATOM   3093  O O   . LEU C 1 161 ? 20.868  1.678   -35.407 1.00 7.38   ? 161  LEU B O   1 
ATOM   3094  C CB  . LEU C 1 161 ? 18.064  1.478   -33.617 1.00 4.61   ? 161  LEU B CB  1 
ATOM   3095  C CG  . LEU C 1 161 ? 18.824  2.710   -33.090 1.00 11.13  ? 161  LEU B CG  1 
ATOM   3096  C CD1 . LEU C 1 161 ? 18.570  3.954   -33.921 1.00 6.22   ? 161  LEU B CD1 1 
ATOM   3097  C CD2 . LEU C 1 161 ? 18.352  3.027   -31.695 1.00 5.61   ? 161  LEU B CD2 1 
ATOM   3098  N N   . GLN C 1 162 ? 20.436  -0.198  -34.330 1.00 1.00   ? 162  GLN B N   1 
ATOM   3099  C CA  . GLN C 1 162 ? 21.856  -0.434  -34.201 1.00 2.60   ? 162  GLN B CA  1 
ATOM   3100  C C   . GLN C 1 162 ? 22.612  -0.444  -35.510 1.00 9.76   ? 162  GLN B C   1 
ATOM   3101  O O   . GLN C 1 162 ? 23.676  0.142   -35.647 1.00 13.96  ? 162  GLN B O   1 
ATOM   3102  C CB  . GLN C 1 162 ? 22.097  -1.767  -33.492 1.00 5.01   ? 162  GLN B CB  1 
ATOM   3103  C CG  . GLN C 1 162 ? 23.401  -2.359  -34.011 1.00 1.00   ? 162  GLN B CG  1 
ATOM   3104  C CD  . GLN C 1 162 ? 23.920  -3.635  -33.337 1.00 7.99   ? 162  GLN B CD  1 
ATOM   3105  O OE1 . GLN C 1 162 ? 25.132  -3.761  -33.171 1.00 13.25  ? 162  GLN B OE1 1 
ATOM   3106  N NE2 . GLN C 1 162 ? 23.089  -4.662  -33.106 1.00 1.00   ? 162  GLN B NE2 1 
ATOM   3107  N N   . THR C 1 163 ? 21.966  -1.091  -36.462 1.00 8.32   ? 163  THR B N   1 
ATOM   3108  C CA  . THR C 1 163 ? 22.500  -1.295  -37.784 1.00 6.48   ? 163  THR B CA  1 
ATOM   3109  C C   . THR C 1 163 ? 22.573  -0.028  -38.598 1.00 10.48  ? 163  THR B C   1 
ATOM   3110  O O   . THR C 1 163 ? 23.567  0.322   -39.231 1.00 9.86   ? 163  THR B O   1 
ATOM   3111  C CB  . THR C 1 163 ? 21.663  -2.372  -38.497 1.00 3.83   ? 163  THR B CB  1 
ATOM   3112  O OG1 . THR C 1 163 ? 21.578  -3.574  -37.741 1.00 7.93   ? 163  THR B OG1 1 
ATOM   3113  C CG2 . THR C 1 163 ? 22.208  -2.663  -39.870 1.00 1.00   ? 163  THR B CG2 1 
ATOM   3114  N N   . ILE C 1 164 ? 21.480  0.667   -38.610 1.00 6.30   ? 164  ILE B N   1 
ATOM   3115  C CA  . ILE C 1 164 ? 21.441  1.918   -39.322 1.00 5.83   ? 164  ILE B CA  1 
ATOM   3116  C C   . ILE C 1 164 ? 22.533  2.857   -38.816 1.00 10.33  ? 164  ILE B C   1 
ATOM   3117  O O   . ILE C 1 164 ? 23.350  3.427   -39.576 1.00 8.32   ? 164  ILE B O   1 
ATOM   3118  C CB  . ILE C 1 164 ? 20.138  2.550   -38.945 1.00 8.52   ? 164  ILE B CB  1 
ATOM   3119  C CG1 . ILE C 1 164 ? 19.006  2.013   -39.806 1.00 6.79   ? 164  ILE B CG1 1 
ATOM   3120  C CG2 . ILE C 1 164 ? 20.306  4.021   -39.147 1.00 3.92   ? 164  ILE B CG2 1 
ATOM   3121  C CD1 . ILE C 1 164 ? 17.659  2.515   -39.347 1.00 1.00   ? 164  ILE B CD1 1 
ATOM   3122  N N   . LEU C 1 165 ? 22.607  2.983   -37.492 1.00 1.85   ? 165  LEU B N   1 
ATOM   3123  C CA  . LEU C 1 165 ? 23.649  3.854   -36.986 1.00 1.15   ? 165  LEU B CA  1 
ATOM   3124  C C   . LEU C 1 165 ? 25.039  3.443   -37.358 1.00 7.95   ? 165  LEU B C   1 
ATOM   3125  O O   . LEU C 1 165 ? 25.921  4.263   -37.560 1.00 14.91  ? 165  LEU B O   1 
ATOM   3126  C CB  . LEU C 1 165 ? 23.599  3.987   -35.486 1.00 3.68   ? 165  LEU B CB  1 
ATOM   3127  C CG  . LEU C 1 165 ? 22.285  4.531   -34.946 1.00 9.64   ? 165  LEU B CG  1 
ATOM   3128  C CD1 . LEU C 1 165 ? 22.358  4.669   -33.440 1.00 5.44   ? 165  LEU B CD1 1 
ATOM   3129  C CD2 . LEU C 1 165 ? 21.988  5.880   -35.528 1.00 1.00   ? 165  LEU B CD2 1 
ATOM   3130  N N   . ALA C 1 166 ? 25.250  2.155   -37.371 1.00 8.71   ? 166  ALA B N   1 
ATOM   3131  C CA  . ALA C 1 166 ? 26.553  1.646   -37.728 1.00 1.59   ? 166  ALA B CA  1 
ATOM   3132  C C   . ALA C 1 166 ? 26.871  1.933   -39.178 1.00 7.30   ? 166  ALA B C   1 
ATOM   3133  O O   . ALA C 1 166 ? 27.992  2.223   -39.564 1.00 7.68   ? 166  ALA B O   1 
ATOM   3134  C CB  . ALA C 1 166 ? 26.463  0.187   -37.551 1.00 1.00   ? 166  ALA B CB  1 
ATOM   3135  N N   . LEU C 1 167 ? 25.853  1.861   -40.002 1.00 4.92   ? 167  LEU B N   1 
ATOM   3136  C CA  . LEU C 1 167 ? 26.049  2.118   -41.389 1.00 4.32   ? 167  LEU B CA  1 
ATOM   3137  C C   . LEU C 1 167 ? 26.362  3.571   -41.555 1.00 12.12  ? 167  LEU B C   1 
ATOM   3138  O O   . LEU C 1 167 ? 27.278  3.959   -42.291 1.00 11.02  ? 167  LEU B O   1 
ATOM   3139  C CB  . LEU C 1 167 ? 24.738  1.810   -42.106 1.00 4.79   ? 167  LEU B CB  1 
ATOM   3140  C CG  . LEU C 1 167 ? 24.612  0.332   -42.385 1.00 9.14   ? 167  LEU B CG  1 
ATOM   3141  C CD1 . LEU C 1 167 ? 23.220  -0.045  -42.740 1.00 6.73   ? 167  LEU B CD1 1 
ATOM   3142  C CD2 . LEU C 1 167 ? 25.430  0.010   -43.599 1.00 1.00   ? 167  LEU B CD2 1 
ATOM   3143  N N   . GLU C 1 168 ? 25.585  4.382   -40.845 1.00 7.20   ? 168  GLU B N   1 
ATOM   3144  C CA  . GLU C 1 168 ? 25.833  5.801   -40.958 1.00 5.64   ? 168  GLU B CA  1 
ATOM   3145  C C   . GLU C 1 168 ? 27.231  6.187   -40.576 1.00 13.17  ? 168  GLU B C   1 
ATOM   3146  O O   . GLU C 1 168 ? 27.751  7.224   -40.969 1.00 20.60  ? 168  GLU B O   1 
ATOM   3147  C CB  . GLU C 1 168 ? 24.914  6.642   -40.158 1.00 1.00   ? 168  GLU B CB  1 
ATOM   3148  C CG  . GLU C 1 168 ? 23.510  6.559   -40.699 1.00 11.55  ? 168  GLU B CG  1 
ATOM   3149  C CD  . GLU C 1 168 ? 22.609  7.504   -39.950 1.00 4.97   ? 168  GLU B CD  1 
ATOM   3150  O OE1 . GLU C 1 168 ? 22.766  7.759   -38.737 1.00 25.67  ? 168  GLU B OE1 1 
ATOM   3151  O OE2 . GLU C 1 168 ? 21.722  8.112   -40.751 1.00 38.28  ? 168  GLU B OE2 1 
ATOM   3152  N N   . GLU C 1 169 ? 27.834  5.392   -39.764 1.00 3.60   ? 169  GLU B N   1 
ATOM   3153  C CA  . GLU C 1 169 ? 29.180  5.719   -39.448 1.00 3.76   ? 169  GLU B CA  1 
ATOM   3154  C C   . GLU C 1 169 ? 30.013  5.621   -40.689 1.00 13.90  ? 169  GLU B C   1 
ATOM   3155  O O   . GLU C 1 169 ? 30.982  6.333   -40.800 1.00 20.41  ? 169  GLU B O   1 
ATOM   3156  C CB  . GLU C 1 169 ? 29.826  4.822   -38.376 1.00 5.62   ? 169  GLU B CB  1 
ATOM   3157  C CG  . GLU C 1 169 ? 29.228  4.949   -36.970 1.00 3.86   ? 169  GLU B CG  1 
ATOM   3158  C CD  . GLU C 1 169 ? 29.630  3.788   -36.104 1.00 20.25  ? 169  GLU B CD  1 
ATOM   3159  O OE1 . GLU C 1 169 ? 30.079  2.781   -36.560 1.00 27.21  ? 169  GLU B OE1 1 
ATOM   3160  O OE2 . GLU C 1 169 ? 29.264  3.894   -34.861 1.00 8.59   ? 169  GLU B OE2 1 
ATOM   3161  N N   . LYS C 1 170 ? 29.681  4.732   -41.616 1.00 13.87  ? 170  LYS B N   1 
ATOM   3162  C CA  . LYS C 1 170 ? 30.487  4.636   -42.820 1.00 10.02  ? 170  LYS B CA  1 
ATOM   3163  C C   . LYS C 1 170 ? 29.889  5.423   -43.979 1.00 19.17  ? 170  LYS B C   1 
ATOM   3164  O O   . LYS C 1 170 ? 30.622  5.871   -44.865 1.00 19.33  ? 170  LYS B O   1 
ATOM   3165  C CB  . LYS C 1 170 ? 30.619  3.212   -43.280 1.00 8.99   ? 170  LYS B CB  1 
ATOM   3166  C CG  . LYS C 1 170 ? 31.041  2.319   -42.167 1.00 9.35   ? 170  LYS B CG  1 
ATOM   3167  C CD  . LYS C 1 170 ? 32.006  1.177   -42.515 1.00 10.16  ? 170  LYS B CD  1 
ATOM   3168  C CE  . LYS C 1 170 ? 32.639  0.564   -41.263 1.00 32.81  ? 170  LYS B CE  1 
ATOM   3169  N NZ  . LYS C 1 170 ? 33.891  -0.211  -41.447 1.00 121.55 ? 170  LYS B NZ  1 
ATOM   3170  N N   . ILE C 1 171 ? 28.553  5.539   -43.997 1.00 13.36  ? 171  ILE B N   1 
ATOM   3171  C CA  . ILE C 1 171 ? 27.828  6.221   -45.078 1.00 7.24   ? 171  ILE B CA  1 
ATOM   3172  C C   . ILE C 1 171 ? 26.722  7.018   -44.478 1.00 13.74  ? 171  ILE B C   1 
ATOM   3173  O O   . ILE C 1 171 ? 25.560  6.617   -44.330 1.00 23.49  ? 171  ILE B O   1 
ATOM   3174  C CB  . ILE C 1 171 ? 27.207  5.207   -45.999 1.00 8.56   ? 171  ILE B CB  1 
ATOM   3175  C CG1 . ILE C 1 171 ? 28.188  4.088   -46.280 1.00 7.78   ? 171  ILE B CG1 1 
ATOM   3176  C CG2 . ILE C 1 171 ? 26.850  5.895   -47.259 1.00 1.00   ? 171  ILE B CG2 1 
ATOM   3177  C CD1 . ILE C 1 171 ? 27.497  2.826   -46.729 1.00 7.31   ? 171  ILE B CD1 1 
ATOM   3178  N N   . PRO C 1 172 ? 27.184  8.146   -44.135 1.00 7.06   ? 172  PRO B N   1 
ATOM   3179  C CA  . PRO C 1 172 ? 26.538  9.162   -43.387 1.00 9.45   ? 172  PRO B CA  1 
ATOM   3180  C C   . PRO C 1 172 ? 25.232  9.625   -43.880 1.00 17.10  ? 172  PRO B C   1 
ATOM   3181  O O   . PRO C 1 172 ? 24.459  10.077  -43.069 1.00 16.45  ? 172  PRO B O   1 
ATOM   3182  C CB  . PRO C 1 172 ? 27.538  10.312  -43.212 1.00 4.38   ? 172  PRO B CB  1 
ATOM   3183  C CG  . PRO C 1 172 ? 28.876  9.723   -43.593 1.00 3.83   ? 172  PRO B CG  1 
ATOM   3184  C CD  . PRO C 1 172 ? 28.603  8.441   -44.373 1.00 6.07   ? 172  PRO B CD  1 
ATOM   3185  N N   . ASN C 1 173 ? 25.028  9.516   -45.172 1.00 15.91  ? 173  ASN B N   1 
ATOM   3186  C CA  . ASN C 1 173 ? 23.809  9.942   -45.823 1.00 14.15  ? 173  ASN B CA  1 
ATOM   3187  C C   . ASN C 1 173 ? 23.035  8.757   -46.299 1.00 21.82  ? 173  ASN B C   1 
ATOM   3188  O O   . ASN C 1 173 ? 22.259  8.834   -47.213 1.00 26.37  ? 173  ASN B O   1 
ATOM   3189  C CB  . ASN C 1 173 ? 24.212  10.693  -47.087 1.00 8.39   ? 173  ASN B CB  1 
ATOM   3190  C CG  . ASN C 1 173 ? 25.190  9.934   -47.976 1.00 42.06  ? 173  ASN B CG  1 
ATOM   3191  O OD1 . ASN C 1 173 ? 26.141  9.297   -47.477 1.00 79.29  ? 173  ASN B OD1 1 
ATOM   3192  N ND2 . ASN C 1 173 ? 25.098  10.191  -49.296 1.00 48.92  ? 173  ASN B ND2 1 
ATOM   3193  N N   . ILE C 1 174 ? 23.297  7.625   -45.725 1.00 17.65  ? 174  ILE B N   1 
ATOM   3194  C CA  . ILE C 1 174 ? 22.634  6.473   -46.204 1.00 10.65  ? 174  ILE B CA  1 
ATOM   3195  C C   . ILE C 1 174 ? 21.125  6.542   -46.071 1.00 15.63  ? 174  ILE B C   1 
ATOM   3196  O O   . ILE C 1 174 ? 20.379  5.989   -46.875 1.00 22.04  ? 174  ILE B O   1 
ATOM   3197  C CB  . ILE C 1 174 ? 23.273  5.277   -45.591 1.00 10.88  ? 174  ILE B CB  1 
ATOM   3198  C CG1 . ILE C 1 174 ? 22.813  4.128   -46.426 1.00 5.26   ? 174  ILE B CG1 1 
ATOM   3199  C CG2 . ILE C 1 174 ? 22.881  5.185   -44.091 1.00 1.00   ? 174  ILE B CG2 1 
ATOM   3200  C CD1 . ILE C 1 174 ? 23.699  2.996   -46.097 1.00 16.19  ? 174  ILE B CD1 1 
ATOM   3201  N N   . LEU C 1 175 ? 20.648  7.324   -45.101 1.00 13.16  ? 175  LEU B N   1 
ATOM   3202  C CA  . LEU C 1 175 ? 19.205  7.440   -44.874 1.00 10.15  ? 175  LEU B CA  1 
ATOM   3203  C C   . LEU C 1 175 ? 18.488  8.556   -45.612 1.00 23.77  ? 175  LEU B C   1 
ATOM   3204  O O   . LEU C 1 175 ? 17.260  8.752   -45.438 1.00 21.65  ? 175  LEU B O   1 
ATOM   3205  C CB  . LEU C 1 175 ? 18.910  7.704   -43.419 1.00 5.76   ? 175  LEU B CB  1 
ATOM   3206  C CG  . LEU C 1 175 ? 18.840  6.482   -42.523 1.00 9.61   ? 175  LEU B CG  1 
ATOM   3207  C CD1 . LEU C 1 175 ? 18.176  6.932   -41.254 1.00 10.47  ? 175  LEU B CD1 1 
ATOM   3208  C CD2 . LEU C 1 175 ? 18.067  5.303   -43.133 1.00 1.06   ? 175  LEU B CD2 1 
ATOM   3209  N N   . SER C 1 176 ? 19.300  9.305   -46.355 1.00 22.38  ? 176  SER B N   1 
ATOM   3210  C CA  . SER C 1 176 ? 18.879  10.442  -47.162 1.00 20.12  ? 176  SER B CA  1 
ATOM   3211  C C   . SER C 1 176 ? 17.546  10.165  -47.799 1.00 19.57  ? 176  SER B C   1 
ATOM   3212  O O   . SER C 1 176 ? 16.602  10.879  -47.598 1.00 36.15  ? 176  SER B O   1 
ATOM   3213  C CB  . SER C 1 176 ? 19.890  10.766  -48.261 1.00 27.14  ? 176  SER B CB  1 
ATOM   3214  O OG  . SER C 1 176 ? 20.148  9.568   -49.020 1.00 92.26  ? 176  SER B OG  1 
ATOM   3215  N N   . ALA C 1 177 ? 17.431  9.111   -48.551 1.00 14.43  ? 177  ALA B N   1 
ATOM   3216  C CA  . ALA C 1 177 ? 16.162  8.839   -49.185 1.00 7.83   ? 177  ALA B CA  1 
ATOM   3217  C C   . ALA C 1 177 ? 15.089  8.175   -48.341 1.00 15.57  ? 177  ALA B C   1 
ATOM   3218  O O   . ALA C 1 177 ? 14.085  7.802   -48.961 1.00 21.58  ? 177  ALA B O   1 
ATOM   3219  C CB  . ALA C 1 177 ? 16.392  7.968   -50.381 1.00 5.96   ? 177  ALA B CB  1 
ATOM   3220  N N   . PHE C 1 178 ? 15.308  8.023   -47.008 1.00 6.27   ? 178  PHE B N   1 
ATOM   3221  C CA  . PHE C 1 178 ? 14.388  7.354   -46.111 1.00 9.20   ? 178  PHE B CA  1 
ATOM   3222  C C   . PHE C 1 178 ? 14.024  8.201   -44.942 1.00 18.14  ? 178  PHE B C   1 
ATOM   3223  O O   . PHE C 1 178 ? 14.454  8.036   -43.824 1.00 24.51  ? 178  PHE B O   1 
ATOM   3224  C CB  . PHE C 1 178 ? 14.980  6.018   -45.642 1.00 10.48  ? 178  PHE B CB  1 
ATOM   3225  C CG  . PHE C 1 178 ? 15.431  5.241   -46.852 1.00 6.36   ? 178  PHE B CG  1 
ATOM   3226  C CD1 . PHE C 1 178 ? 14.539  4.443   -47.560 1.00 1.27   ? 178  PHE B CD1 1 
ATOM   3227  C CD2 . PHE C 1 178 ? 16.746  5.302   -47.303 1.00 11.09  ? 178  PHE B CD2 1 
ATOM   3228  C CE1 . PHE C 1 178 ? 14.956  3.678   -48.655 1.00 1.00   ? 178  PHE B CE1 1 
ATOM   3229  C CE2 . PHE C 1 178 ? 17.161  4.596   -48.435 1.00 11.28  ? 178  PHE B CE2 1 
ATOM   3230  C CZ  . PHE C 1 178 ? 16.261  3.788   -49.127 1.00 1.00   ? 178  PHE B CZ  1 
ATOM   3231  N N   . PRO C 1 179 ? 13.191  9.106   -45.263 1.00 20.81  ? 179  PRO B N   1 
ATOM   3232  C CA  . PRO C 1 179 ? 12.640  10.122  -44.402 1.00 19.51  ? 179  PRO B CA  1 
ATOM   3233  C C   . PRO C 1 179 ? 11.902  9.510   -43.244 1.00 24.18  ? 179  PRO B C   1 
ATOM   3234  O O   . PRO C 1 179 ? 12.043  9.967   -42.120 1.00 26.95  ? 179  PRO B O   1 
ATOM   3235  C CB  . PRO C 1 179 ? 11.661  10.865  -45.275 1.00 15.42  ? 179  PRO B CB  1 
ATOM   3236  C CG  . PRO C 1 179 ? 11.696  10.261  -46.651 1.00 15.39  ? 179  PRO B CG  1 
ATOM   3237  C CD  . PRO C 1 179 ? 12.841  9.276   -46.673 1.00 16.82  ? 179  PRO B CD  1 
ATOM   3238  N N   . PHE C 1 180 ? 11.145  8.458   -43.496 1.00 16.21  ? 180  PHE B N   1 
ATOM   3239  C CA  . PHE C 1 180 ? 10.500  7.791   -42.371 1.00 14.12  ? 180  PHE B CA  1 
ATOM   3240  C C   . PHE C 1 180 ? 11.535  7.180   -41.461 1.00 18.51  ? 180  PHE B C   1 
ATOM   3241  O O   . PHE C 1 180 ? 11.490  7.361   -40.246 1.00 18.74  ? 180  PHE B O   1 
ATOM   3242  C CB  . PHE C 1 180 ? 9.585   6.694   -42.853 1.00 16.34  ? 180  PHE B CB  1 
ATOM   3243  C CG  . PHE C 1 180 ? 8.296   7.358   -43.275 1.00 21.04  ? 180  PHE B CG  1 
ATOM   3244  C CD1 . PHE C 1 180 ? 8.174   7.974   -44.515 1.00 20.75  ? 180  PHE B CD1 1 
ATOM   3245  C CD2 . PHE C 1 180 ? 7.196   7.462   -42.417 1.00 26.78  ? 180  PHE B CD2 1 
ATOM   3246  C CE1 . PHE C 1 180 ? 6.975   8.590   -44.898 1.00 18.28  ? 180  PHE B CE1 1 
ATOM   3247  C CE2 . PHE C 1 180 ? 5.995   8.093   -42.759 1.00 17.67  ? 180  PHE B CE2 1 
ATOM   3248  C CZ  . PHE C 1 180 ? 5.883   8.652   -44.030 1.00 10.82  ? 180  PHE B CZ  1 
ATOM   3249  N N   . LEU C 1 181 ? 12.502  6.487   -42.082 1.00 8.93   ? 181  LEU B N   1 
ATOM   3250  C CA  . LEU C 1 181 ? 13.540  5.887   -41.311 1.00 9.86   ? 181  LEU B CA  1 
ATOM   3251  C C   . LEU C 1 181 ? 14.303  6.958   -40.566 1.00 12.03  ? 181  LEU B C   1 
ATOM   3252  O O   . LEU C 1 181 ? 14.744  6.782   -39.406 1.00 13.20  ? 181  LEU B O   1 
ATOM   3253  C CB  . LEU C 1 181 ? 14.488  5.027   -42.168 1.00 13.77  ? 181  LEU B CB  1 
ATOM   3254  C CG  . LEU C 1 181 ? 13.904  3.699   -42.589 1.00 13.05  ? 181  LEU B CG  1 
ATOM   3255  C CD1 . LEU C 1 181 ? 14.830  2.967   -43.554 1.00 11.41  ? 181  LEU B CD1 1 
ATOM   3256  C CD2 . LEU C 1 181 ? 13.704  2.917   -41.334 1.00 1.82   ? 181  LEU B CD2 1 
ATOM   3257  N N   . GLN C 1 182 ? 14.448  8.118   -41.187 1.00 9.34   ? 182  GLN B N   1 
ATOM   3258  C CA  . GLN C 1 182 ? 15.191  9.129   -40.432 1.00 8.76   ? 182  GLN B CA  1 
ATOM   3259  C C   . GLN C 1 182 ? 14.459  9.552   -39.200 1.00 14.41  ? 182  GLN B C   1 
ATOM   3260  O O   . GLN C 1 182 ? 15.005  9.678   -38.137 1.00 16.30  ? 182  GLN B O   1 
ATOM   3261  C CB  . GLN C 1 182 ? 15.455  10.387  -41.177 1.00 6.64   ? 182  GLN B CB  1 
ATOM   3262  C CG  . GLN C 1 182 ? 16.495  10.363  -42.291 1.00 35.10  ? 182  GLN B CG  1 
ATOM   3263  C CD  . GLN C 1 182 ? 16.234  11.560  -43.194 1.00 18.09  ? 182  GLN B CD  1 
ATOM   3264  O OE1 . GLN C 1 182 ? 15.699  12.598  -42.755 1.00 83.28  ? 182  GLN B OE1 1 
ATOM   3265  N NE2 . GLN C 1 182 ? 16.417  11.381  -44.488 1.00 33.79  ? 182  GLN B NE2 1 
ATOM   3266  N N   . GLU C 1 183 ? 13.193  9.773   -39.331 1.00 15.58  ? 183  GLU B N   1 
ATOM   3267  C CA  . GLU C 1 183 ? 12.484  10.185  -38.177 1.00 18.74  ? 183  GLU B CA  1 
ATOM   3268  C C   . GLU C 1 183 ? 12.449  9.146   -37.128 1.00 16.44  ? 183  GLU B C   1 
ATOM   3269  O O   . GLU C 1 183 ? 12.688  9.418   -35.969 1.00 21.35  ? 183  GLU B O   1 
ATOM   3270  C CB  . GLU C 1 183 ? 11.080  10.606  -38.499 1.00 23.36  ? 183  GLU B CB  1 
ATOM   3271  C CG  . GLU C 1 183 ? 10.483  11.658  -37.534 1.00 90.45  ? 183  GLU B CG  1 
ATOM   3272  C CD  . GLU C 1 183 ? 9.056   11.832  -37.862 1.00 240.06 ? 183  GLU B CD  1 
ATOM   3273  O OE1 . GLU C 1 183 ? 8.568   11.590  -38.942 1.00 286.72 ? 183  GLU B OE1 1 
ATOM   3274  O OE2 . GLU C 1 183 ? 8.386   12.487  -36.948 1.00 267.52 ? 183  GLU B OE2 1 
ATOM   3275  N N   . TYR C 1 184 ? 12.136  7.951   -37.546 1.00 16.75  ? 184  TYR B N   1 
ATOM   3276  C CA  . TYR C 1 184 ? 12.059  6.816   -36.644 1.00 15.59  ? 184  TYR B CA  1 
ATOM   3277  C C   . TYR C 1 184 ? 13.332  6.701   -35.795 1.00 17.05  ? 184  TYR B C   1 
ATOM   3278  O O   . TYR C 1 184 ? 13.324  6.566   -34.552 1.00 16.57  ? 184  TYR B O   1 
ATOM   3279  C CB  . TYR C 1 184 ? 11.931  5.671   -37.592 1.00 10.91  ? 184  TYR B CB  1 
ATOM   3280  C CG  . TYR C 1 184 ? 12.061  4.308   -37.021 1.00 13.32  ? 184  TYR B CG  1 
ATOM   3281  C CD1 . TYR C 1 184 ? 10.997  3.597   -36.460 1.00 12.11  ? 184  TYR B CD1 1 
ATOM   3282  C CD2 . TYR C 1 184 ? 13.267  3.632   -37.196 1.00 10.72  ? 184  TYR B CD2 1 
ATOM   3283  C CE1 . TYR C 1 184 ? 11.205  2.311   -35.948 1.00 9.98   ? 184  TYR B CE1 1 
ATOM   3284  C CE2 . TYR C 1 184 ? 13.474  2.336   -36.718 1.00 4.44   ? 184  TYR B CE2 1 
ATOM   3285  C CZ  . TYR C 1 184 ? 12.434  1.652   -36.100 1.00 8.44   ? 184  TYR B CZ  1 
ATOM   3286  O OH  . TYR C 1 184 ? 12.635  0.334   -35.687 1.00 17.51  ? 184  TYR B OH  1 
ATOM   3287  N N   . THR C 1 185 ? 14.452  6.858   -36.482 1.00 2.92   ? 185  THR B N   1 
ATOM   3288  C CA  . THR C 1 185 ? 15.757  6.765   -35.858 1.00 2.77   ? 185  THR B CA  1 
ATOM   3289  C C   . THR C 1 185 ? 15.923  7.811   -34.813 1.00 13.26  ? 185  THR B C   1 
ATOM   3290  O O   . THR C 1 185 ? 16.433  7.636   -33.710 1.00 13.17  ? 185  THR B O   1 
ATOM   3291  C CB  . THR C 1 185 ? 16.796  7.025   -36.958 1.00 14.05  ? 185  THR B CB  1 
ATOM   3292  O OG1 . THR C 1 185 ? 16.772  5.954   -37.806 1.00 9.91   ? 185  THR B OG1 1 
ATOM   3293  C CG2 . THR C 1 185 ? 18.197  7.079   -36.426 1.00 3.34   ? 185  THR B CG2 1 
ATOM   3294  N N   . VAL C 1 186 ? 15.505  8.956   -35.192 1.00 11.46  ? 186  VAL B N   1 
ATOM   3295  C CA  . VAL C 1 186 ? 15.613  10.043  -34.280 1.00 14.52  ? 186  VAL B CA  1 
ATOM   3296  C C   . VAL C 1 186 ? 14.832  9.826   -33.018 1.00 11.38  ? 186  VAL B C   1 
ATOM   3297  O O   . VAL C 1 186 ? 15.328  9.940   -31.913 1.00 16.88  ? 186  VAL B O   1 
ATOM   3298  C CB  . VAL C 1 186 ? 15.065  11.276  -34.942 1.00 19.24  ? 186  VAL B CB  1 
ATOM   3299  C CG1 . VAL C 1 186 ? 15.055  12.322  -33.867 1.00 15.96  ? 186  VAL B CG1 1 
ATOM   3300  C CG2 . VAL C 1 186 ? 16.041  11.712  -36.011 1.00 14.85  ? 186  VAL B CG2 1 
ATOM   3301  N N   . LYS C 1 187 ? 13.593  9.523   -33.187 1.00 4.04   ? 187  LYS B N   1 
ATOM   3302  C CA  . LYS C 1 187 ? 12.810  9.236   -32.018 1.00 8.37   ? 187  LYS B CA  1 
ATOM   3303  C C   . LYS C 1 187 ? 13.342  8.120   -31.152 1.00 18.54  ? 187  LYS B C   1 
ATOM   3304  O O   . LYS C 1 187 ? 13.293  8.203   -29.941 1.00 20.40  ? 187  LYS B O   1 
ATOM   3305  C CB  . LYS C 1 187 ? 11.432  8.803   -32.413 1.00 7.10   ? 187  LYS B CB  1 
ATOM   3306  C CG  . LYS C 1 187 ? 10.769  9.814   -33.310 1.00 17.97  ? 187  LYS B CG  1 
ATOM   3307  C CD  . LYS C 1 187 ? 9.250   9.794   -33.171 1.00 38.64  ? 187  LYS B CD  1 
ATOM   3308  C CE  . LYS C 1 187 ? 8.462   9.696   -34.498 1.00 92.14  ? 187  LYS B CE  1 
ATOM   3309  N NZ  . LYS C 1 187 ? 8.256   8.322   -35.033 1.00 21.76  ? 187  LYS B NZ  1 
ATOM   3310  N N   . LEU C 1 188 ? 13.690  7.022   -31.796 1.00 19.55  ? 188  LEU B N   1 
ATOM   3311  C CA  . LEU C 1 188 ? 14.137  5.881   -31.058 1.00 15.53  ? 188  LEU B CA  1 
ATOM   3312  C C   . LEU C 1 188 ? 15.319  6.320   -30.274 1.00 17.36  ? 188  LEU B C   1 
ATOM   3313  O O   . LEU C 1 188 ? 15.532  5.901   -29.143 1.00 19.51  ? 188  LEU B O   1 
ATOM   3314  C CB  . LEU C 1 188 ? 14.640  4.779   -32.020 1.00 11.05  ? 188  LEU B CB  1 
ATOM   3315  C CG  . LEU C 1 188 ? 13.585  3.934   -32.703 1.00 12.13  ? 188  LEU B CG  1 
ATOM   3316  C CD1 . LEU C 1 188 ? 14.234  2.775   -33.422 1.00 9.57   ? 188  LEU B CD1 1 
ATOM   3317  C CD2 . LEU C 1 188 ? 12.550  3.369   -31.749 1.00 12.24  ? 188  LEU B CD2 1 
ATOM   3318  N N   . SER C 1 189 ? 16.132  7.128   -30.924 1.00 6.09   ? 189  SER B N   1 
ATOM   3319  C CA  . SER C 1 189 ? 17.334  7.470   -30.211 1.00 10.27  ? 189  SER B CA  1 
ATOM   3320  C C   . SER C 1 189 ? 17.080  8.335   -29.035 1.00 18.63  ? 189  SER B C   1 
ATOM   3321  O O   . SER C 1 189 ? 17.997  8.665   -28.284 1.00 20.89  ? 189  SER B O   1 
ATOM   3322  C CB  . SER C 1 189 ? 18.412  8.096   -31.037 1.00 16.35  ? 189  SER B CB  1 
ATOM   3323  O OG  . SER C 1 189 ? 18.355  7.638   -32.354 1.00 15.31  ? 189  SER B OG  1 
ATOM   3324  N N   . ASN C 1 190 ? 15.845  8.800   -28.959 1.00 18.88  ? 190  ASN B N   1 
ATOM   3325  C CA  . ASN C 1 190 ? 15.480  9.669   -27.835 1.00 20.58  ? 190  ASN B CA  1 
ATOM   3326  C C   . ASN C 1 190 ? 14.890  8.933   -26.683 1.00 29.19  ? 190  ASN B C   1 
ATOM   3327  O O   . ASN C 1 190 ? 14.667  9.529   -25.670 1.00 34.30  ? 190  ASN B O   1 
ATOM   3328  C CB  . ASN C 1 190 ? 14.912  11.095  -28.060 1.00 18.59  ? 190  ASN B CB  1 
ATOM   3329  C CG  . ASN C 1 190 ? 15.903  12.004  -28.715 1.00 101.46 ? 190  ASN B CG  1 
ATOM   3330  O OD1 . ASN C 1 190 ? 16.746  12.581  -27.990 1.00 120.18 ? 190  ASN B OD1 1 
ATOM   3331  N ND2 . ASN C 1 190 ? 15.897  12.023  -30.070 1.00 89.76  ? 190  ASN B ND2 1 
ATOM   3332  N N   . ILE C 1 191 ? 14.663  7.634   -26.858 1.00 25.31  ? 191  ILE B N   1 
ATOM   3333  C CA  . ILE C 1 191 ? 14.237  6.796   -25.776 1.00 17.82  ? 191  ILE B CA  1 
ATOM   3334  C C   . ILE C 1 191 ? 15.418  6.812   -24.810 1.00 27.30  ? 191  ILE B C   1 
ATOM   3335  O O   . ILE C 1 191 ? 16.625  6.727   -25.107 1.00 34.88  ? 191  ILE B O   1 
ATOM   3336  C CB  . ILE C 1 191 ? 13.899  5.424   -26.276 1.00 21.12  ? 191  ILE B CB  1 
ATOM   3337  C CG1 . ILE C 1 191 ? 12.658  5.564   -27.107 1.00 13.87  ? 191  ILE B CG1 1 
ATOM   3338  C CG2 . ILE C 1 191 ? 13.591  4.518   -25.110 1.00 26.89  ? 191  ILE B CG2 1 
ATOM   3339  C CD1 . ILE C 1 191 ? 12.457  4.358   -28.008 1.00 11.39  ? 191  ILE B CD1 1 
ATOM   3340  N N   . PRO C 1 192 ? 15.039  7.071   -23.635 1.00 21.14  ? 192  PRO B N   1 
ATOM   3341  C CA  . PRO C 1 192 ? 15.929  7.354   -22.551 1.00 17.83  ? 192  PRO B CA  1 
ATOM   3342  C C   . PRO C 1 192 ? 17.018  6.393   -22.313 1.00 19.97  ? 192  PRO B C   1 
ATOM   3343  O O   . PRO C 1 192 ? 18.157  6.824   -22.212 1.00 22.87  ? 192  PRO B O   1 
ATOM   3344  C CB  . PRO C 1 192 ? 15.060  7.661   -21.362 1.00 17.55  ? 192  PRO B CB  1 
ATOM   3345  C CG  . PRO C 1 192 ? 13.654  7.912   -21.902 1.00 16.14  ? 192  PRO B CG  1 
ATOM   3346  C CD  . PRO C 1 192 ? 13.626  7.380   -23.336 1.00 18.64  ? 192  PRO B CD  1 
ATOM   3347  N N   . THR C 1 193 ? 16.682  5.104   -22.278 1.00 14.39  ? 193  THR B N   1 
ATOM   3348  C CA  . THR C 1 193 ? 17.712  4.070   -22.111 1.00 9.79   ? 193  THR B CA  1 
ATOM   3349  C C   . THR C 1 193 ? 18.658  4.186   -23.265 1.00 16.14  ? 193  THR B C   1 
ATOM   3350  O O   . THR C 1 193 ? 19.880  4.148   -23.115 1.00 22.19  ? 193  THR B O   1 
ATOM   3351  C CB  . THR C 1 193 ? 17.062  2.718   -22.218 1.00 18.10  ? 193  THR B CB  1 
ATOM   3352  O OG1 . THR C 1 193 ? 16.219  2.729   -23.353 1.00 32.46  ? 193  THR B OG1 1 
ATOM   3353  C CG2 . THR C 1 193 ? 16.161  2.557   -21.030 1.00 1.00   ? 193  THR B CG2 1 
ATOM   3354  N N   . ILE C 1 194 ? 18.042  4.367   -24.427 1.00 10.60  ? 194  ILE B N   1 
ATOM   3355  C CA  . ILE C 1 194 ? 18.794  4.471   -25.663 1.00 10.39  ? 194  ILE B CA  1 
ATOM   3356  C C   . ILE C 1 194 ? 19.589  5.731   -25.698 1.00 18.17  ? 194  ILE B C   1 
ATOM   3357  O O   . ILE C 1 194 ? 20.788  5.747   -26.041 1.00 18.32  ? 194  ILE B O   1 
ATOM   3358  C CB  . ILE C 1 194 ? 17.886  4.351   -26.857 1.00 10.11  ? 194  ILE B CB  1 
ATOM   3359  C CG1 . ILE C 1 194 ? 17.289  2.956   -26.806 1.00 7.74   ? 194  ILE B CG1 1 
ATOM   3360  C CG2 . ILE C 1 194 ? 18.708  4.519   -28.100 1.00 3.49   ? 194  ILE B CG2 1 
ATOM   3361  C CD1 . ILE C 1 194 ? 16.357  2.751   -27.970 1.00 6.88   ? 194  ILE B CD1 1 
ATOM   3362  N N   . LYS C 1 195 ? 18.904  6.790   -25.300 1.00 14.50  ? 195  LYS B N   1 
ATOM   3363  C CA  . LYS C 1 195 ? 19.558  8.073   -25.259 1.00 16.16  ? 195  LYS B CA  1 
ATOM   3364  C C   . LYS C 1 195 ? 20.811  7.980   -24.415 1.00 18.60  ? 195  LYS B C   1 
ATOM   3365  O O   . LYS C 1 195 ? 21.855  8.417   -24.849 1.00 19.12  ? 195  LYS B O   1 
ATOM   3366  C CB  . LYS C 1 195 ? 18.631  9.154   -24.770 1.00 14.73  ? 195  LYS B CB  1 
ATOM   3367  C CG  . LYS C 1 195 ? 19.333  10.495  -24.712 1.00 22.53  ? 195  LYS B CG  1 
ATOM   3368  C CD  . LYS C 1 195 ? 18.450  11.694  -24.271 1.00 45.07  ? 195  LYS B CD  1 
ATOM   3369  C CE  . LYS C 1 195 ? 19.035  13.099  -24.540 1.00 63.04  ? 195  LYS B CE  1 
ATOM   3370  N NZ  . LYS C 1 195 ? 18.717  14.097  -23.495 1.00 124.12 ? 195  LYS B NZ  1 
ATOM   3371  N N   . ARG C 1 196 ? 20.718  7.281   -23.271 1.00 14.87  ? 196  ARG B N   1 
ATOM   3372  C CA  . ARG C 1 196 ? 21.877  7.107   -22.409 1.00 14.76  ? 196  ARG B CA  1 
ATOM   3373  C C   . ARG C 1 196 ? 22.958  6.268   -23.044 1.00 19.24  ? 196  ARG B C   1 
ATOM   3374  O O   . ARG C 1 196 ? 24.149  6.525   -22.876 1.00 21.84  ? 196  ARG B O   1 
ATOM   3375  C CB  . ARG C 1 196 ? 21.557  6.494   -21.041 1.00 10.93  ? 196  ARG B CB  1 
ATOM   3376  C CG  . ARG C 1 196 ? 20.717  7.334   -20.088 1.00 84.94  ? 196  ARG B CG  1 
ATOM   3377  C CD  . ARG C 1 196 ? 20.190  6.488   -18.931 1.00 131.16 ? 196  ARG B CD  1 
ATOM   3378  N NE  . ARG C 1 196 ? 18.787  6.738   -18.615 1.00 172.78 ? 196  ARG B NE  1 
ATOM   3379  C CZ  . ARG C 1 196 ? 17.933  5.753   -18.346 1.00 214.26 ? 196  ARG B CZ  1 
ATOM   3380  N NH1 . ARG C 1 196 ? 18.329  4.475   -18.380 1.00 205.59 ? 196  ARG B NH1 1 
ATOM   3381  N NH2 . ARG C 1 196 ? 16.661  6.049   -18.056 1.00 215.17 ? 196  ARG B NH2 1 
ATOM   3382  N N   . PHE C 1 197 ? 22.519  5.200   -23.688 1.00 21.18  ? 197  PHE B N   1 
ATOM   3383  C CA  . PHE C 1 197 ? 23.443  4.256   -24.299 1.00 19.20  ? 197  PHE B CA  1 
ATOM   3384  C C   . PHE C 1 197 ? 24.263  4.998   -25.307 1.00 18.79  ? 197  PHE B C   1 
ATOM   3385  O O   . PHE C 1 197 ? 25.441  4.773   -25.476 1.00 14.50  ? 197  PHE B O   1 
ATOM   3386  C CB  . PHE C 1 197 ? 22.664  3.090   -24.964 1.00 16.60  ? 197  PHE B CB  1 
ATOM   3387  C CG  . PHE C 1 197 ? 23.547  1.969   -25.473 1.00 16.51  ? 197  PHE B CG  1 
ATOM   3388  C CD1 . PHE C 1 197 ? 24.245  1.148   -24.578 1.00 17.86  ? 197  PHE B CD1 1 
ATOM   3389  C CD2 . PHE C 1 197 ? 23.642  1.687   -26.840 1.00 11.93  ? 197  PHE B CD2 1 
ATOM   3390  C CE1 . PHE C 1 197 ? 25.080  0.114   -25.008 1.00 9.94   ? 197  PHE B CE1 1 
ATOM   3391  C CE2 . PHE C 1 197 ? 24.476  0.664   -27.293 1.00 10.07  ? 197  PHE B CE2 1 
ATOM   3392  C CZ  . PHE C 1 197 ? 25.189  -0.116  -26.378 1.00 6.81   ? 197  PHE B CZ  1 
ATOM   3393  N N   . LEU C 1 198 ? 23.595  5.899   -25.976 1.00 13.52  ? 198  LEU B N   1 
ATOM   3394  C CA  . LEU C 1 198 ? 24.277  6.670   -26.956 1.00 17.31  ? 198  LEU B CA  1 
ATOM   3395  C C   . LEU C 1 198 ? 25.191  7.697   -26.357 1.00 28.14  ? 198  LEU B C   1 
ATOM   3396  O O   . LEU C 1 198 ? 26.161  8.088   -26.974 1.00 31.92  ? 198  LEU B O   1 
ATOM   3397  C CB  . LEU C 1 198 ? 23.285  7.331   -27.882 1.00 17.25  ? 198  LEU B CB  1 
ATOM   3398  C CG  . LEU C 1 198 ? 22.582  6.263   -28.658 1.00 16.15  ? 198  LEU B CG  1 
ATOM   3399  C CD1 . LEU C 1 198 ? 21.412  6.858   -29.366 1.00 6.63   ? 198  LEU B CD1 1 
ATOM   3400  C CD2 . LEU C 1 198 ? 23.561  5.670   -29.645 1.00 15.83  ? 198  LEU B CD2 1 
ATOM   3401  N N   . GLU C 1 199 ? 24.887  8.105   -25.144 1.00 30.95  ? 199  GLU B N   1 
ATOM   3402  C CA  . GLU C 1 199 ? 25.730  9.054   -24.441 1.00 31.65  ? 199  GLU B CA  1 
ATOM   3403  C C   . GLU C 1 199 ? 26.970  8.398   -23.884 1.00 40.90  ? 199  GLU B C   1 
ATOM   3404  O O   . GLU C 1 199 ? 27.094  7.191   -23.777 1.00 48.36  ? 199  GLU B O   1 
ATOM   3405  C CB  . GLU C 1 199 ? 24.996  9.780   -23.299 1.00 33.09  ? 199  GLU B CB  1 
ATOM   3406  C CG  . GLU C 1 199 ? 24.080  10.916  -23.775 1.00 16.15  ? 199  GLU B CG  1 
ATOM   3407  C CD  . GLU C 1 199 ? 22.922  11.236  -22.870 1.00 54.57  ? 199  GLU B CD  1 
ATOM   3408  O OE1 . GLU C 1 199 ? 22.803  10.854  -21.690 1.00 50.51  ? 199  GLU B OE1 1 
ATOM   3409  O OE2 . GLU C 1 199 ? 22.090  12.035  -23.506 1.00 47.42  ? 199  GLU B OE2 1 
ATOM   3410  N N   . PRO C 1 200 ? 27.882  9.238   -23.493 1.00 40.19  ? 200  PRO B N   1 
ATOM   3411  C CA  . PRO C 1 200 ? 29.146  8.839   -22.946 1.00 38.67  ? 200  PRO B CA  1 
ATOM   3412  C C   . PRO C 1 200 ? 29.081  8.057   -21.667 1.00 39.52  ? 200  PRO B C   1 
ATOM   3413  O O   . PRO C 1 200 ? 28.191  8.237   -20.802 1.00 40.62  ? 200  PRO B O   1 
ATOM   3414  C CB  . PRO C 1 200 ? 29.943  10.111  -22.758 1.00 40.92  ? 200  PRO B CB  1 
ATOM   3415  C CG  . PRO C 1 200 ? 29.335  11.087  -23.736 1.00 47.45  ? 200  PRO B CG  1 
ATOM   3416  C CD  . PRO C 1 200 ? 27.965  10.557  -24.122 1.00 43.09  ? 200  PRO B CD  1 
ATOM   3417  N N   . GLY C 1 201 ? 30.056  7.158   -21.588 1.00 32.36  ? 201  GLY B N   1 
ATOM   3418  C CA  . GLY C 1 201 ? 30.148  6.300   -20.432 1.00 29.94  ? 201  GLY B CA  1 
ATOM   3419  C C   . GLY C 1 201 ? 29.218  5.082   -20.430 1.00 38.66  ? 201  GLY B C   1 
ATOM   3420  O O   . GLY C 1 201 ? 29.047  4.494   -19.363 1.00 44.65  ? 201  GLY B O   1 
ATOM   3421  N N   . SER C 1 202 ? 28.632  4.696   -21.613 1.00 26.51  ? 202  SER B N   1 
ATOM   3422  C CA  . SER C 1 202 ? 27.740  3.545   -21.748 1.00 13.49  ? 202  SER B CA  1 
ATOM   3423  C C   . SER C 1 202 ? 28.625  2.346   -22.010 1.00 20.44  ? 202  SER B C   1 
ATOM   3424  O O   . SER C 1 202 ? 29.866  2.509   -22.164 1.00 27.79  ? 202  SER B O   1 
ATOM   3425  C CB  . SER C 1 202 ? 26.758  3.738   -22.891 1.00 11.17  ? 202  SER B CB  1 
ATOM   3426  O OG  . SER C 1 202 ? 27.517  3.961   -24.072 1.00 33.64  ? 202  SER B OG  1 
ATOM   3427  N N   . LYS C 1 203 ? 28.046  1.143   -22.055 1.00 16.86  ? 203  LYS B N   1 
ATOM   3428  C CA  . LYS C 1 203 ? 28.927  0.029   -22.386 1.00 12.34  ? 203  LYS B CA  1 
ATOM   3429  C C   . LYS C 1 203 ? 28.967  -0.178  -23.927 1.00 15.77  ? 203  LYS B C   1 
ATOM   3430  O O   . LYS C 1 203 ? 29.628  -1.040  -24.450 1.00 15.65  ? 203  LYS B O   1 
ATOM   3431  C CB  . LYS C 1 203 ? 28.722  -1.214  -21.548 1.00 12.78  ? 203  LYS B CB  1 
ATOM   3432  C CG  . LYS C 1 203 ? 29.080  -1.014  -20.056 1.00 11.84  ? 203  LYS B CG  1 
ATOM   3433  C CD  . LYS C 1 203 ? 28.890  -2.239  -19.139 1.00 32.90  ? 203  LYS B CD  1 
ATOM   3434  C CE  . LYS C 1 203 ? 28.859  -1.988  -17.620 1.00 4.97   ? 203  LYS B CE  1 
ATOM   3435  N NZ  . LYS C 1 203 ? 27.802  -1.004  -17.215 1.00 139.36 ? 203  LYS B NZ  1 
ATOM   3436  N N   . LYS C 1 204 ? 28.309  0.733   -24.634 1.00 9.39   ? 204  LYS B N   1 
ATOM   3437  C CA  . LYS C 1 204 ? 28.296  0.792   -26.050 1.00 10.47  ? 204  LYS B CA  1 
ATOM   3438  C C   . LYS C 1 204 ? 29.733  0.869   -26.481 1.00 13.83  ? 204  LYS B C   1 
ATOM   3439  O O   . LYS C 1 204 ? 30.494  1.561   -25.880 1.00 18.60  ? 204  LYS B O   1 
ATOM   3440  C CB  . LYS C 1 204 ? 27.559  2.054   -26.458 1.00 12.59  ? 204  LYS B CB  1 
ATOM   3441  C CG  . LYS C 1 204 ? 27.711  2.347   -27.928 1.00 1.00   ? 204  LYS B CG  1 
ATOM   3442  C CD  . LYS C 1 204 ? 26.646  3.293   -28.477 1.00 12.50  ? 204  LYS B CD  1 
ATOM   3443  C CE  . LYS C 1 204 ? 26.539  3.284   -30.004 1.00 1.00   ? 204  LYS B CE  1 
ATOM   3444  N NZ  . LYS C 1 204 ? 27.820  2.943   -30.646 1.00 19.12  ? 204  LYS B NZ  1 
ATOM   3445  N N   . LYS C 1 205 ? 30.117  0.093   -27.469 1.00 15.72  ? 205  LYS B N   1 
ATOM   3446  C CA  . LYS C 1 205 ? 31.489  0.049   -27.944 1.00 12.07  ? 205  LYS B CA  1 
ATOM   3447  C C   . LYS C 1 205 ? 31.677  0.798   -29.247 1.00 19.49  ? 205  LYS B C   1 
ATOM   3448  O O   . LYS C 1 205 ? 30.821  0.955   -30.106 1.00 26.86  ? 205  LYS B O   1 
ATOM   3449  C CB  . LYS C 1 205 ? 31.950  -1.396  -28.138 1.00 8.61   ? 205  LYS B CB  1 
ATOM   3450  C CG  . LYS C 1 205 ? 31.733  -2.234  -26.904 1.00 17.48  ? 205  LYS B CG  1 
ATOM   3451  C CD  . LYS C 1 205 ? 32.956  -2.237  -26.005 1.00 9.28   ? 205  LYS B CD  1 
ATOM   3452  C CE  . LYS C 1 205 ? 32.753  -2.959  -24.684 1.00 1.00   ? 205  LYS B CE  1 
ATOM   3453  N NZ  . LYS C 1 205 ? 31.875  -2.210  -23.803 1.00 6.31   ? 205  LYS B NZ  1 
ATOM   3454  N N   . PRO C 1 206 ? 32.875  1.217   -29.395 1.00 14.76  ? 206  PRO B N   1 
ATOM   3455  C CA  . PRO C 1 206 ? 33.388  1.939   -30.537 1.00 11.27  ? 206  PRO B CA  1 
ATOM   3456  C C   . PRO C 1 206 ? 33.668  1.038   -31.678 1.00 15.22  ? 206  PRO B C   1 
ATOM   3457  O O   . PRO C 1 206 ? 33.778  -0.173  -31.547 1.00 21.81  ? 206  PRO B O   1 
ATOM   3458  C CB  . PRO C 1 206 ? 34.739  2.430   -30.143 1.00 7.94   ? 206  PRO B CB  1 
ATOM   3459  C CG  . PRO C 1 206 ? 35.135  1.593   -28.940 1.00 14.45  ? 206  PRO B CG  1 
ATOM   3460  C CD  . PRO C 1 206 ? 33.900  0.865   -28.434 1.00 14.12  ? 206  PRO B CD  1 
ATOM   3461  N N   . PRO C 1 207 ? 33.801  1.672   -32.775 1.00 10.85  ? 207  PRO B N   1 
ATOM   3462  C CA  . PRO C 1 207 ? 34.052  0.965   -33.982 1.00 11.11  ? 207  PRO B CA  1 
ATOM   3463  C C   . PRO C 1 207 ? 35.408  0.464   -33.753 1.00 25.21  ? 207  PRO B C   1 
ATOM   3464  O O   . PRO C 1 207 ? 36.196  1.126   -33.122 1.00 31.74  ? 207  PRO B O   1 
ATOM   3465  C CB  . PRO C 1 207 ? 34.029  2.032   -35.079 1.00 7.59   ? 207  PRO B CB  1 
ATOM   3466  C CG  . PRO C 1 207 ? 33.321  3.244   -34.481 1.00 8.00   ? 207  PRO B CG  1 
ATOM   3467  C CD  . PRO C 1 207 ? 33.474  3.091   -32.984 1.00 7.14   ? 207  PRO B CD  1 
ATOM   3468  N N   . PRO C 1 208 ? 35.604  -0.732  -34.166 1.00 29.08  ? 208  PRO B N   1 
ATOM   3469  C CA  . PRO C 1 208 ? 36.832  -1.477  -34.071 1.00 30.67  ? 208  PRO B CA  1 
ATOM   3470  C C   . PRO C 1 208 ? 38.001  -0.859  -34.784 1.00 32.66  ? 208  PRO B C   1 
ATOM   3471  O O   . PRO C 1 208 ? 37.853  -0.430  -35.913 1.00 36.10  ? 208  PRO B O   1 
ATOM   3472  C CB  . PRO C 1 208 ? 36.536  -2.745  -34.822 1.00 31.72  ? 208  PRO B CB  1 
ATOM   3473  C CG  . PRO C 1 208 ? 35.335  -2.450  -35.692 1.00 35.02  ? 208  PRO B CG  1 
ATOM   3474  C CD  . PRO C 1 208 ? 34.662  -1.230  -35.146 1.00 26.22  ? 208  PRO B CD  1 
ATOM   3475  N N   . ASP C 1 209 ? 39.142  -0.924  -34.096 1.00 30.07  ? 209  ASP B N   1 
ATOM   3476  C CA  . ASP C 1 209 ? 40.460  -0.439  -34.473 1.00 30.10  ? 209  ASP B CA  1 
ATOM   3477  C C   . ASP C 1 209 ? 41.414  -1.574  -34.761 1.00 35.70  ? 209  ASP B C   1 
ATOM   3478  O O   . ASP C 1 209 ? 41.158  -2.767  -34.511 1.00 35.20  ? 209  ASP B O   1 
ATOM   3479  C CB  . ASP C 1 209 ? 41.084  0.406   -33.326 1.00 33.91  ? 209  ASP B CB  1 
ATOM   3480  C CG  . ASP C 1 209 ? 40.861  -0.218  -31.981 1.00 69.22  ? 209  ASP B CG  1 
ATOM   3481  O OD1 . ASP C 1 209 ? 41.259  -1.331  -31.697 1.00 74.62  ? 209  ASP B OD1 1 
ATOM   3482  O OD2 . ASP C 1 209 ? 39.991  0.440   -31.258 1.00 99.67  ? 209  ASP B OD2 1 
ATOM   3483  N N   . GLU C 1 210 ? 42.563  -1.142  -35.224 1.00 38.21  ? 210  GLU B N   1 
ATOM   3484  C CA  . GLU C 1 210 ? 43.633  -2.039  -35.545 1.00 46.01  ? 210  GLU B CA  1 
ATOM   3485  C C   . GLU C 1 210 ? 43.943  -2.924  -34.343 1.00 38.12  ? 210  GLU B C   1 
ATOM   3486  O O   . GLU C 1 210 ? 44.326  -4.093  -34.442 1.00 37.81  ? 210  GLU B O   1 
ATOM   3487  C CB  . GLU C 1 210 ? 44.854  -1.206  -35.995 1.00 55.83  ? 210  GLU B CB  1 
ATOM   3488  C CG  . GLU C 1 210 ? 46.051  -2.025  -36.549 1.00 125.54 ? 210  GLU B CG  1 
ATOM   3489  C CD  . GLU C 1 210 ? 46.938  -2.662  -35.491 1.00 218.62 ? 210  GLU B CD  1 
ATOM   3490  O OE1 . GLU C 1 210 ? 47.358  -2.073  -34.505 1.00 242.90 ? 210  GLU B OE1 1 
ATOM   3491  O OE2 . GLU C 1 210 ? 47.254  -3.907  -35.768 1.00 231.97 ? 210  GLU B OE2 1 
ATOM   3492  N N   . ILE C 1 211 ? 43.735  -2.390  -33.173 1.00 27.64  ? 211  ILE B N   1 
ATOM   3493  C CA  . ILE C 1 211 ? 44.019  -3.194  -32.016 1.00 30.80  ? 211  ILE B CA  1 
ATOM   3494  C C   . ILE C 1 211 ? 43.052  -4.332  -31.827 1.00 31.42  ? 211  ILE B C   1 
ATOM   3495  O O   . ILE C 1 211 ? 43.490  -5.468  -31.694 1.00 33.61  ? 211  ILE B O   1 
ATOM   3496  C CB  . ILE C 1 211 ? 43.982  -2.358  -30.756 1.00 40.88  ? 211  ILE B CB  1 
ATOM   3497  C CG1 . ILE C 1 211 ? 45.226  -1.485  -30.599 1.00 44.20  ? 211  ILE B CG1 1 
ATOM   3498  C CG2 . ILE C 1 211 ? 43.753  -3.264  -29.560 1.00 43.55  ? 211  ILE B CG2 1 
ATOM   3499  C CD1 . ILE C 1 211 ? 45.336  -0.440  -31.718 1.00 91.48  ? 211  ILE B CD1 1 
ATOM   3500  N N   . TYR C 1 212 ? 41.760  -3.969  -31.726 1.00 20.70  ? 212  TYR B N   1 
ATOM   3501  C CA  . TYR C 1 212 ? 40.720  -4.934  -31.558 1.00 19.94  ? 212  TYR B CA  1 
ATOM   3502  C C   . TYR C 1 212 ? 40.954  -6.026  -32.603 1.00 24.87  ? 212  TYR B C   1 
ATOM   3503  O O   . TYR C 1 212 ? 41.005  -7.254  -32.332 1.00 22.05  ? 212  TYR B O   1 
ATOM   3504  C CB  . TYR C 1 212 ? 39.351  -4.281  -31.780 1.00 18.24  ? 212  TYR B CB  1 
ATOM   3505  C CG  . TYR C 1 212 ? 38.227  -5.286  -31.902 1.00 23.41  ? 212  TYR B CG  1 
ATOM   3506  C CD1 . TYR C 1 212 ? 37.696  -5.946  -30.782 1.00 21.68  ? 212  TYR B CD1 1 
ATOM   3507  C CD2 . TYR C 1 212 ? 37.675  -5.567  -33.161 1.00 31.30  ? 212  TYR B CD2 1 
ATOM   3508  C CE1 . TYR C 1 212 ? 36.646  -6.869  -30.934 1.00 20.53  ? 212  TYR B CE1 1 
ATOM   3509  C CE2 . TYR C 1 212 ? 36.626  -6.485  -33.333 1.00 34.43  ? 212  TYR B CE2 1 
ATOM   3510  C CZ  . TYR C 1 212 ? 36.116  -7.148  -32.209 1.00 44.89  ? 212  TYR B CZ  1 
ATOM   3511  O OH  . TYR C 1 212 ? 35.127  -8.105  -32.389 1.00 44.17  ? 212  TYR B OH  1 
ATOM   3512  N N   . VAL C 1 213 ? 41.232  -5.539  -33.795 1.00 8.44   ? 213  VAL B N   1 
ATOM   3513  C CA  . VAL C 1 213 ? 41.444  -6.499  -34.826 1.00 8.96   ? 213  VAL B CA  1 
ATOM   3514  C C   . VAL C 1 213 ? 42.544  -7.456  -34.560 1.00 19.43  ? 213  VAL B C   1 
ATOM   3515  O O   . VAL C 1 213 ? 42.352  -8.658  -34.549 1.00 23.29  ? 213  VAL B O   1 
ATOM   3516  C CB  . VAL C 1 213 ? 41.591  -5.851  -36.146 1.00 8.72   ? 213  VAL B CB  1 
ATOM   3517  C CG1 . VAL C 1 213 ? 41.828  -6.992  -37.107 1.00 3.46   ? 213  VAL B CG1 1 
ATOM   3518  C CG2 . VAL C 1 213 ? 40.283  -5.102  -36.460 1.00 5.20   ? 213  VAL B CG2 1 
ATOM   3519  N N   . ARG C 1 214 ? 43.633  -6.895  -34.165 1.00 24.33  ? 214  ARG B N   1 
ATOM   3520  C CA  . ARG C 1 214 ? 44.789  -7.659  -33.777 1.00 26.47  ? 214  ARG B CA  1 
ATOM   3521  C C   . ARG C 1 214 ? 44.429  -8.624  -32.681 1.00 23.21  ? 214  ARG B C   1 
ATOM   3522  O O   . ARG C 1 214 ? 44.621  -9.814  -32.749 1.00 23.56  ? 214  ARG B O   1 
ATOM   3523  C CB  . ARG C 1 214 ? 45.792  -6.701  -33.171 1.00 47.19  ? 214  ARG B CB  1 
ATOM   3524  C CG  . ARG C 1 214 ? 47.218  -7.186  -33.350 1.00 121.11 ? 214  ARG B CG  1 
ATOM   3525  C CD  . ARG C 1 214 ? 47.427  -7.977  -34.646 1.00 191.70 ? 214  ARG B CD  1 
ATOM   3526  N NE  . ARG C 1 214 ? 48.695  -8.715  -34.699 1.00 254.17 ? 214  ARG B NE  1 
ATOM   3527  C CZ  . ARG C 1 214 ? 49.857  -8.332  -34.146 1.00 300.00 ? 214  ARG B CZ  1 
ATOM   3528  N NH1 . ARG C 1 214 ? 50.002  -7.187  -33.478 1.00 300.00 ? 214  ARG B NH1 1 
ATOM   3529  N NH2 . ARG C 1 214 ? 50.922  -9.121  -34.282 1.00 300.00 ? 214  ARG B NH2 1 
ATOM   3530  N N   . THR C 1 215 ? 43.855  -8.095  -31.654 1.00 15.52  ? 215  THR B N   1 
ATOM   3531  C CA  . THR C 1 215 ? 43.493  -8.908  -30.541 1.00 11.87  ? 215  THR B CA  1 
ATOM   3532  C C   . THR C 1 215 ? 42.594  -10.054 -30.889 1.00 23.89  ? 215  THR B C   1 
ATOM   3533  O O   . THR C 1 215 ? 42.749  -11.137 -30.326 1.00 25.01  ? 215  THR B O   1 
ATOM   3534  C CB  . THR C 1 215 ? 42.652  -8.069  -29.598 1.00 22.07  ? 215  THR B CB  1 
ATOM   3535  O OG1 . THR C 1 215 ? 43.372  -7.052  -28.965 1.00 34.28  ? 215  THR B OG1 1 
ATOM   3536  C CG2 . THR C 1 215 ? 42.103  -9.032  -28.587 1.00 13.80  ? 215  THR B CG2 1 
ATOM   3537  N N   . VAL C 1 216 ? 41.586  -9.786  -31.724 1.00 24.68  ? 216  VAL B N   1 
ATOM   3538  C CA  . VAL C 1 216 ? 40.681  -10.862 -31.991 1.00 23.39  ? 216  VAL B CA  1 
ATOM   3539  C C   . VAL C 1 216 ? 41.407  -11.951 -32.656 1.00 26.73  ? 216  VAL B C   1 
ATOM   3540  O O   . VAL C 1 216 ? 41.284  -13.106 -32.271 1.00 27.42  ? 216  VAL B O   1 
ATOM   3541  C CB  . VAL C 1 216 ? 39.300  -10.536 -32.521 1.00 27.02  ? 216  VAL B CB  1 
ATOM   3542  C CG1 . VAL C 1 216 ? 38.865  -9.273  -31.849 1.00 24.78  ? 216  VAL B CG1 1 
ATOM   3543  C CG2 . VAL C 1 216 ? 39.306  -10.333 -33.994 1.00 30.89  ? 216  VAL B CG2 1 
ATOM   3544  N N   . TYR C 1 217 ? 42.231  -11.557 -33.579 1.00 26.74  ? 217  TYR B N   1 
ATOM   3545  C CA  . TYR C 1 217 ? 43.047  -12.553 -34.229 1.00 31.47  ? 217  TYR B CA  1 
ATOM   3546  C C   . TYR C 1 217 ? 43.884  -13.287 -33.217 1.00 36.69  ? 217  TYR B C   1 
ATOM   3547  O O   . TYR C 1 217 ? 44.083  -14.472 -33.251 1.00 39.94  ? 217  TYR B O   1 
ATOM   3548  C CB  . TYR C 1 217 ? 44.030  -11.935 -35.192 1.00 37.04  ? 217  TYR B CB  1 
ATOM   3549  C CG  . TYR C 1 217 ? 43.423  -11.579 -36.504 1.00 57.37  ? 217  TYR B CG  1 
ATOM   3550  C CD1 . TYR C 1 217 ? 42.753  -12.512 -37.299 1.00 62.60  ? 217  TYR B CD1 1 
ATOM   3551  C CD2 . TYR C 1 217 ? 43.603  -10.294 -37.014 1.00 69.49  ? 217  TYR B CD2 1 
ATOM   3552  C CE1 . TYR C 1 217 ? 42.254  -12.154 -38.558 1.00 73.92  ? 217  TYR B CE1 1 
ATOM   3553  C CE2 . TYR C 1 217 ? 43.127  -9.925  -38.277 1.00 74.53  ? 217  TYR B CE2 1 
ATOM   3554  C CZ  . TYR C 1 217 ? 42.445  -10.859 -39.062 1.00 80.38  ? 217  TYR B CZ  1 
ATOM   3555  O OH  . TYR C 1 217 ? 41.991  -10.501 -40.331 1.00 63.60  ? 217  TYR B OH  1 
ATOM   3556  N N   . ASN C 1 218 ? 44.363  -12.581 -32.245 1.00 38.49  ? 218  ASN B N   1 
ATOM   3557  C CA  . ASN C 1 218 ? 45.157  -13.311 -31.307 1.00 38.84  ? 218  ASN B CA  1 
ATOM   3558  C C   . ASN C 1 218 ? 44.382  -14.292 -30.473 1.00 42.20  ? 218  ASN B C   1 
ATOM   3559  O O   . ASN C 1 218 ? 44.936  -15.277 -30.046 1.00 53.50  ? 218  ASN B O   1 
ATOM   3560  C CB  . ASN C 1 218 ? 46.167  -12.453 -30.520 1.00 38.59  ? 218  ASN B CB  1 
ATOM   3561  C CG  . ASN C 1 218 ? 47.113  -11.750 -31.477 1.00 97.21  ? 218  ASN B CG  1 
ATOM   3562  O OD1 . ASN C 1 218 ? 47.702  -10.713 -31.126 1.00 142.34 ? 218  ASN B OD1 1 
ATOM   3563  N ND2 . ASN C 1 218 ? 47.223  -12.285 -32.705 1.00 74.68  ? 218  ASN B ND2 1 
ATOM   3564  N N   . ILE C 1 219 ? 43.122  -14.049 -30.225 1.00 26.47  ? 219  ILE B N   1 
ATOM   3565  C CA  . ILE C 1 219 ? 42.417  -14.970 -29.394 1.00 21.54  ? 219  ILE B CA  1 
ATOM   3566  C C   . ILE C 1 219 ? 41.813  -16.108 -30.152 1.00 32.02  ? 219  ILE B C   1 
ATOM   3567  O O   . ILE C 1 219 ? 41.505  -17.122 -29.563 1.00 34.29  ? 219  ILE B O   1 
ATOM   3568  C CB  . ILE C 1 219 ? 41.327  -14.171 -28.787 1.00 23.46  ? 219  ILE B CB  1 
ATOM   3569  C CG1 . ILE C 1 219 ? 41.967  -12.937 -28.191 1.00 21.97  ? 219  ILE B CG1 1 
ATOM   3570  C CG2 . ILE C 1 219 ? 40.578  -14.952 -27.743 1.00 22.56  ? 219  ILE B CG2 1 
ATOM   3571  C CD1 . ILE C 1 219 ? 40.877  -12.015 -27.652 1.00 18.18  ? 219  ILE B CD1 1 
ATOM   3572  N N   . PHE C 1 220 ? 41.646  -15.970 -31.468 1.00 31.03  ? 220  PHE B N   1 
ATOM   3573  C CA  . PHE C 1 220 ? 40.973  -17.016 -32.260 1.00 29.59  ? 220  PHE B CA  1 
ATOM   3574  C C   . PHE C 1 220 ? 41.639  -17.501 -33.596 1.00 44.12  ? 220  PHE B C   1 
ATOM   3575  O O   . PHE C 1 220 ? 42.857  -17.454 -33.920 1.00 60.72  ? 220  PHE B O   1 
ATOM   3576  C CB  . PHE C 1 220 ? 39.584  -16.457 -32.632 1.00 33.70  ? 220  PHE B CB  1 
ATOM   3577  C CG  . PHE C 1 220 ? 38.639  -15.859 -31.587 1.00 34.38  ? 220  PHE B CG  1 
ATOM   3578  C CD1 . PHE C 1 220 ? 38.012  -16.670 -30.643 1.00 36.48  ? 220  PHE B CD1 1 
ATOM   3579  C CD2 . PHE C 1 220 ? 38.210  -14.536 -31.653 1.00 38.85  ? 220  PHE B CD2 1 
ATOM   3580  C CE1 . PHE C 1 220 ? 37.083  -16.173 -29.733 1.00 36.82  ? 220  PHE B CE1 1 
ATOM   3581  C CE2 . PHE C 1 220 ? 37.277  -14.011 -30.755 1.00 41.89  ? 220  PHE B CE2 1 
ATOM   3582  C CZ  . PHE C 1 220 ? 36.726  -14.828 -29.775 1.00 38.16  ? 220  PHE B CZ  1 
HETATM 3583  N N   . GGL D 2 1   ? 26.670  -18.172 -34.670 1.00 37.15  ? 231  GGL J N   1 
HETATM 3584  C CA  . GGL D 2 1   ? 27.386  -17.876 -33.434 1.00 7.63   ? 231  GGL J CA  1 
HETATM 3585  C C   . GGL D 2 1   ? 26.924  -16.587 -32.760 1.00 7.03   ? 231  GGL J C   1 
HETATM 3586  O O   . GGL D 2 1   ? 26.925  -16.601 -31.492 1.00 19.40  ? 231  GGL J O   1 
HETATM 3587  C CB  . GGL D 2 1   ? 28.880  -17.927 -33.672 1.00 6.19   ? 231  GGL J CB  1 
HETATM 3588  C CG  . GGL D 2 1   ? 29.735  -17.287 -32.588 1.00 24.61  ? 231  GGL J CG  1 
HETATM 3589  C CD  . GGL D 2 1   ? 31.181  -17.364 -33.035 1.00 18.75  ? 231  GGL J CD  1 
HETATM 3590  O OE1 . GGL D 2 1   ? 31.497  -17.536 -34.210 1.00 36.14  ? 231  GGL J OE1 1 
HETATM 3591  O OXT . GGL D 2 1   ? 26.382  -15.720 -33.511 1.00 43.52  ? 231  GGL J OXT 1 
HETATM 3592  C C   . ICY D 2 2   ? 34.180  -17.975 -31.168 1.00 29.74  ? 232  ICY J C   1 
HETATM 3593  N N   . ICY D 2 2   ? 32.073  -17.208 -32.076 1.00 39.29  ? 232  ICY J N   1 
HETATM 3594  O O   . ICY D 2 2   ? 33.781  -17.906 -29.976 1.00 26.16  ? 232  ICY J O   1 
HETATM 3595  C CA  . ICY D 2 2   ? 33.499  -17.278 -32.332 1.00 38.11  ? 232  ICY J CA  1 
HETATM 3596  C CB  . ICY D 2 2   ? 34.128  -15.906 -32.705 1.00 43.28  ? 232  ICY J CB  1 
HETATM 3597  S SG  . ICY D 2 2   ? 33.557  -15.214 -34.297 1.00 46.76  ? 232  ICY J SG  1 
HETATM 3598  I I   . ICY D 2 2   ? 34.016  -11.153 -34.375 1.00 90.26  ? 232  ICY J I   1 
HETATM 3599  C C0  . ICY D 2 2   ? 34.949  -14.189 -34.815 1.00 300.00 ? 232  ICY J C0  1 
HETATM 3600  C C1  . ICY D 2 2   ? 34.530  -13.576 -36.115 1.00 300.00 ? 232  ICY J C1  1 
HETATM 3601  C C2  . ICY D 2 2   ? 33.953  -12.299 -36.134 1.00 5.69   ? 232  ICY J C2  1 
HETATM 3602  C C3  . ICY D 2 2   ? 33.547  -11.816 -37.379 1.00 31.59  ? 232  ICY J C3  1 
HETATM 3603  C C4  . ICY D 2 2   ? 33.641  -12.608 -38.533 1.00 15.35  ? 232  ICY J C4  1 
HETATM 3604  C C5  . ICY D 2 2   ? 34.110  -13.918 -38.470 1.00 300.00 ? 232  ICY J C5  1 
HETATM 3605  C C6  . ICY D 2 2   ? 34.548  -14.402 -37.240 1.00 300.00 ? 232  ICY J C6  1 
ATOM   3606  N N   . GLY D 2 3   ? 35.168  -18.764 -31.521 1.00 27.44  ? 233  GLY J N   1 
ATOM   3607  C CA  . GLY D 2 3   ? 35.865  -19.526 -30.489 1.00 23.21  ? 233  GLY J CA  1 
ATOM   3608  C C   . GLY D 2 3   ? 36.499  -20.765 -31.059 1.00 26.89  ? 233  GLY J C   1 
ATOM   3609  O O   . GLY D 2 3   ? 37.471  -21.223 -30.398 1.00 47.64  ? 233  GLY J O   1 
ATOM   3610  O OXT . GLY D 2 3   ? 36.016  -21.134 -32.178 1.00 83.82  ? 233  GLY J OXT 1 
ATOM   3611  N N   . ARG E 1 4   ? 35.368  15.384  8.935   1.00 32.33  ? 4    ARG C N   1 
ATOM   3612  C CA  . ARG E 1 4   ? 35.579  14.484  10.093  1.00 27.54  ? 4    ARG C CA  1 
ATOM   3613  C C   . ARG E 1 4   ? 35.912  15.295  11.367  1.00 35.94  ? 4    ARG C C   1 
ATOM   3614  O O   . ARG E 1 4   ? 36.925  16.003  11.425  1.00 45.21  ? 4    ARG C O   1 
ATOM   3615  C CB  . ARG E 1 4   ? 36.663  13.494  9.665   1.00 27.89  ? 4    ARG C CB  1 
ATOM   3616  C CG  . ARG E 1 4   ? 37.211  12.394  10.570  1.00 16.86  ? 4    ARG C CG  1 
ATOM   3617  C CD  . ARG E 1 4   ? 37.988  11.295  9.755   1.00 21.30  ? 4    ARG C CD  1 
ATOM   3618  N NE  . ARG E 1 4   ? 38.435  10.177  10.605  1.00 55.57  ? 4    ARG C NE  1 
ATOM   3619  C CZ  . ARG E 1 4   ? 38.746  8.914   10.274  1.00 124.64 ? 4    ARG C CZ  1 
ATOM   3620  N NH1 . ARG E 1 4   ? 38.711  8.466   9.016   1.00 187.32 ? 4    ARG C NH1 1 
ATOM   3621  N NH2 . ARG E 1 4   ? 39.117  8.087   11.271  1.00 64.09  ? 4    ARG C NH2 1 
ATOM   3622  N N   . PRO E 1 5   ? 35.054  15.207  12.407  1.00 19.55  ? 5    PRO C N   1 
ATOM   3623  C CA  . PRO E 1 5   ? 35.255  15.988  13.600  1.00 10.62  ? 5    PRO C CA  1 
ATOM   3624  C C   . PRO E 1 5   ? 36.539  15.770  14.262  1.00 13.02  ? 5    PRO C C   1 
ATOM   3625  O O   . PRO E 1 5   ? 37.092  14.657  14.275  1.00 17.31  ? 5    PRO C O   1 
ATOM   3626  C CB  . PRO E 1 5   ? 34.139  15.630  14.532  1.00 13.08  ? 5    PRO C CB  1 
ATOM   3627  C CG  . PRO E 1 5   ? 33.031  15.125  13.635  1.00 14.67  ? 5    PRO C CG  1 
ATOM   3628  C CD  . PRO E 1 5   ? 33.764  14.473  12.501  1.00 15.20  ? 5    PRO C CD  1 
ATOM   3629  N N   . LYS E 1 6   ? 36.968  16.874  14.834  1.00 10.63  ? 6    LYS C N   1 
ATOM   3630  C CA  . LYS E 1 6   ? 38.211  16.880  15.532  1.00 12.09  ? 6    LYS C CA  1 
ATOM   3631  C C   . LYS E 1 6   ? 37.996  17.351  16.948  1.00 19.24  ? 6    LYS C C   1 
ATOM   3632  O O   . LYS E 1 6   ? 37.447  18.417  17.230  1.00 23.36  ? 6    LYS C O   1 
ATOM   3633  C CB  . LYS E 1 6   ? 39.243  17.682  14.791  1.00 12.50  ? 6    LYS C CB  1 
ATOM   3634  C CG  . LYS E 1 6   ? 40.645  17.534  15.348  1.00 5.59   ? 6    LYS C CG  1 
ATOM   3635  C CD  . LYS E 1 6   ? 41.701  18.181  14.478  1.00 22.77  ? 6    LYS C CD  1 
ATOM   3636  C CE  . LYS E 1 6   ? 42.514  17.205  13.623  1.00 101.78 ? 6    LYS C CE  1 
ATOM   3637  N NZ  . LYS E 1 6   ? 43.978  17.425  13.683  1.00 121.13 ? 6    LYS C NZ  1 
ATOM   3638  N N   . LEU E 1 7   ? 38.435  16.480  17.813  1.00 10.70  ? 7    LEU C N   1 
ATOM   3639  C CA  . LEU E 1 7   ? 38.312  16.634  19.217  1.00 7.75   ? 7    LEU C CA  1 
ATOM   3640  C C   . LEU E 1 7   ? 39.552  17.105  19.896  1.00 15.45  ? 7    LEU C C   1 
ATOM   3641  O O   . LEU E 1 7   ? 40.566  16.396  19.928  1.00 17.71  ? 7    LEU C O   1 
ATOM   3642  C CB  . LEU E 1 7   ? 37.909  15.288  19.861  1.00 7.11   ? 7    LEU C CB  1 
ATOM   3643  C CG  . LEU E 1 7   ? 36.401  15.084  19.774  1.00 7.44   ? 7    LEU C CG  1 
ATOM   3644  C CD1 . LEU E 1 7   ? 35.927  15.073  18.332  1.00 1.06   ? 7    LEU C CD1 1 
ATOM   3645  C CD2 . LEU E 1 7   ? 36.009  13.831  20.461  1.00 1.92   ? 7    LEU C CD2 1 
ATOM   3646  N N   . HIS E 1 8   ? 39.404  18.238  20.583  1.00 10.78  ? 8    HIS C N   1 
ATOM   3647  C CA  . HIS E 1 8   ? 40.516  18.768  21.344  1.00 10.93  ? 8    HIS C CA  1 
ATOM   3648  C C   . HIS E 1 8   ? 40.382  18.484  22.784  1.00 15.06  ? 8    HIS C C   1 
ATOM   3649  O O   . HIS E 1 8   ? 39.474  18.965  23.403  1.00 21.54  ? 8    HIS C O   1 
ATOM   3650  C CB  . HIS E 1 8   ? 40.644  20.270  21.160  1.00 12.77  ? 8    HIS C CB  1 
ATOM   3651  C CG  . HIS E 1 8   ? 40.923  20.550  19.719  1.00 12.97  ? 8    HIS C CG  1 
ATOM   3652  N ND1 . HIS E 1 8   ? 42.236  20.655  19.252  1.00 9.21   ? 8    HIS C ND1 1 
ATOM   3653  C CD2 . HIS E 1 8   ? 40.057  20.666  18.661  1.00 10.18  ? 8    HIS C CD2 1 
ATOM   3654  C CE1 . HIS E 1 8   ? 42.127  20.829  17.941  1.00 4.88   ? 8    HIS C CE1 1 
ATOM   3655  N NE2 . HIS E 1 8   ? 40.848  20.842  17.538  1.00 6.80   ? 8    HIS C NE2 1 
ATOM   3656  N N   . TYR E 1 9   ? 41.326  17.778  23.326  1.00 14.76  ? 9    TYR C N   1 
ATOM   3657  C CA  . TYR E 1 9   ? 41.249  17.469  24.711  1.00 9.55   ? 9    TYR C CA  1 
ATOM   3658  C C   . TYR E 1 9   ? 42.457  16.669  25.013  1.00 13.90  ? 9    TYR C C   1 
ATOM   3659  O O   . TYR E 1 9   ? 43.101  16.104  24.151  1.00 13.27  ? 9    TYR C O   1 
ATOM   3660  C CB  . TYR E 1 9   ? 40.041  16.525  24.896  1.00 11.18  ? 9    TYR C CB  1 
ATOM   3661  C CG  . TYR E 1 9   ? 39.419  16.586  26.276  1.00 11.92  ? 9    TYR C CG  1 
ATOM   3662  C CD1 . TYR E 1 9   ? 38.831  17.783  26.652  1.00 17.29  ? 9    TYR C CD1 1 
ATOM   3663  C CD2 . TYR E 1 9   ? 39.432  15.554  27.219  1.00 10.61  ? 9    TYR C CD2 1 
ATOM   3664  C CE1 . TYR E 1 9   ? 38.232  17.950  27.894  1.00 8.41   ? 9    TYR C CE1 1 
ATOM   3665  C CE2 . TYR E 1 9   ? 38.872  15.703  28.496  1.00 10.47  ? 9    TYR C CE2 1 
ATOM   3666  C CZ  . TYR E 1 9   ? 38.271  16.923  28.821  1.00 8.46   ? 9    TYR C CZ  1 
ATOM   3667  O OH  . TYR E 1 9   ? 37.669  17.207  30.006  1.00 9.58   ? 9    TYR C OH  1 
ATOM   3668  N N   . PRO E 1 10  ? 42.707  16.578  26.271  1.00 12.04  ? 10   PRO C N   1 
ATOM   3669  C CA  . PRO E 1 10  ? 43.737  15.740  26.776  1.00 6.12   ? 10   PRO C CA  1 
ATOM   3670  C C   . PRO E 1 10  ? 43.367  14.340  26.392  1.00 17.79  ? 10   PRO C C   1 
ATOM   3671  O O   . PRO E 1 10  ? 42.240  14.054  26.010  1.00 18.65  ? 10   PRO C O   1 
ATOM   3672  C CB  . PRO E 1 10  ? 43.618  15.811  28.302  1.00 1.52   ? 10   PRO C CB  1 
ATOM   3673  C CG  . PRO E 1 10  ? 42.896  17.101  28.620  1.00 1.37   ? 10   PRO C CG  1 
ATOM   3674  C CD  . PRO E 1 10  ? 42.206  17.512  27.305  1.00 9.85   ? 10   PRO C CD  1 
ATOM   3675  N N   . ASN E 1 11  ? 44.338  13.451  26.470  1.00 22.88  ? 11   ASN C N   1 
ATOM   3676  C CA  . ASN E 1 11  ? 44.019  12.089  26.105  1.00 21.68  ? 11   ASN C CA  1 
ATOM   3677  C C   . ASN E 1 11  ? 43.488  11.313  27.276  1.00 28.06  ? 11   ASN C C   1 
ATOM   3678  O O   . ASN E 1 11  ? 44.257  10.612  27.946  1.00 29.83  ? 11   ASN C O   1 
ATOM   3679  C CB  . ASN E 1 11  ? 45.224  11.348  25.545  1.00 27.41  ? 11   ASN C CB  1 
ATOM   3680  C CG  . ASN E 1 11  ? 44.931  9.909   25.184  1.00 30.38  ? 11   ASN C CG  1 
ATOM   3681  O OD1 . ASN E 1 11  ? 43.828  9.351   25.319  1.00 49.73  ? 11   ASN C OD1 1 
ATOM   3682  N ND2 . ASN E 1 11  ? 45.934  9.312   24.639  1.00 31.51  ? 11   ASN C ND2 1 
ATOM   3683  N N   . GLY E 1 12  ? 42.171  11.431  27.509  1.00 23.11  ? 12   GLY C N   1 
ATOM   3684  C CA  . GLY E 1 12  ? 41.519  10.780  28.630  1.00 15.19  ? 12   GLY C CA  1 
ATOM   3685  C C   . GLY E 1 12  ? 40.079  11.114  28.539  1.00 17.86  ? 12   GLY C C   1 
ATOM   3686  O O   . GLY E 1 12  ? 39.672  11.865  27.653  1.00 19.68  ? 12   GLY C O   1 
ATOM   3687  N N   . ARG E 1 13  ? 39.330  10.581  29.472  1.00 14.04  ? 13   ARG C N   1 
ATOM   3688  C CA  . ARG E 1 13  ? 37.897  10.743  29.461  1.00 12.54  ? 13   ARG C CA  1 
ATOM   3689  C C   . ARG E 1 13  ? 37.392  12.158  29.669  1.00 9.16   ? 13   ARG C C   1 
ATOM   3690  O O   . ARG E 1 13  ? 36.737  12.759  28.793  1.00 15.29  ? 13   ARG C O   1 
ATOM   3691  C CB  . ARG E 1 13  ? 37.254  9.776   30.476  1.00 7.69   ? 13   ARG C CB  1 
ATOM   3692  C CG  . ARG E 1 13  ? 37.182  8.323   30.078  1.00 1.00   ? 13   ARG C CG  1 
ATOM   3693  C CD  . ARG E 1 13  ? 36.711  7.351   31.158  1.00 1.00   ? 13   ARG C CD  1 
ATOM   3694  N NE  . ARG E 1 13  ? 36.663  5.953   30.719  1.00 19.00  ? 13   ARG C NE  1 
ATOM   3695  C CZ  . ARG E 1 13  ? 36.225  4.915   31.422  1.00 12.92  ? 13   ARG C CZ  1 
ATOM   3696  N NH1 . ARG E 1 13  ? 35.714  5.046   32.620  1.00 18.59  ? 13   ARG C NH1 1 
ATOM   3697  N NH2 . ARG E 1 13  ? 36.301  3.707   30.902  1.00 20.60  ? 13   ARG C NH2 1 
ATOM   3698  N N   . GLY E 1 14  ? 37.583  12.580  30.913  1.00 1.00   ? 14   GLY C N   1 
ATOM   3699  C CA  . GLY E 1 14  ? 37.147  13.858  31.419  1.00 1.00   ? 14   GLY C CA  1 
ATOM   3700  C C   . GLY E 1 14  ? 35.748  14.107  30.991  1.00 9.54   ? 14   GLY C C   1 
ATOM   3701  O O   . GLY E 1 14  ? 34.900  13.179  31.013  1.00 9.47   ? 14   GLY C O   1 
ATOM   3702  N N   . ARG E 1 15  ? 35.540  15.331  30.514  1.00 9.02   ? 15   ARG C N   1 
ATOM   3703  C CA  . ARG E 1 15  ? 34.240  15.706  30.023  1.00 5.35   ? 15   ARG C CA  1 
ATOM   3704  C C   . ARG E 1 15  ? 33.976  15.337  28.579  1.00 14.90  ? 15   ARG C C   1 
ATOM   3705  O O   . ARG E 1 15  ? 32.801  15.309  28.186  1.00 20.18  ? 15   ARG C O   1 
ATOM   3706  C CB  . ARG E 1 15  ? 34.074  17.166  30.165  1.00 3.97   ? 15   ARG C CB  1 
ATOM   3707  C CG  . ARG E 1 15  ? 34.275  17.615  31.573  1.00 5.24   ? 15   ARG C CG  1 
ATOM   3708  C CD  . ARG E 1 15  ? 33.945  19.081  31.731  1.00 3.67   ? 15   ARG C CD  1 
ATOM   3709  N NE  . ARG E 1 15  ? 34.217  19.452  33.107  1.00 14.51  ? 15   ARG C NE  1 
ATOM   3710  C CZ  . ARG E 1 15  ? 33.303  19.078  33.982  1.00 9.50   ? 15   ARG C CZ  1 
ATOM   3711  N NH1 . ARG E 1 15  ? 32.233  18.447  33.566  1.00 22.97  ? 15   ARG C NH1 1 
ATOM   3712  N NH2 . ARG E 1 15  ? 33.454  19.306  35.257  1.00 12.46  ? 15   ARG C NH2 1 
ATOM   3713  N N   . MET E 1 16  ? 35.041  15.038  27.834  1.00 6.25   ? 16   MET C N   1 
ATOM   3714  C CA  . MET E 1 16  ? 34.928  14.727  26.405  1.00 7.96   ? 16   MET C CA  1 
ATOM   3715  C C   . MET E 1 16  ? 34.309  13.378  26.049  1.00 16.37  ? 16   MET C C   1 
ATOM   3716  O O   . MET E 1 16  ? 33.732  13.139  24.951  1.00 16.90  ? 16   MET C O   1 
ATOM   3717  C CB  . MET E 1 16  ? 36.307  14.982  25.756  1.00 7.02   ? 16   MET C CB  1 
ATOM   3718  C CG  . MET E 1 16  ? 36.315  14.801  24.293  1.00 7.94   ? 16   MET C CG  1 
ATOM   3719  S SD  . MET E 1 16  ? 35.441  16.049  23.340  1.00 11.15  ? 16   MET C SD  1 
ATOM   3720  C CE  . MET E 1 16  ? 36.703  17.273  23.263  1.00 5.61   ? 16   MET C CE  1 
ATOM   3721  N N   . GLU E 1 17  ? 34.407  12.489  27.021  1.00 4.20   ? 17   GLU C N   1 
ATOM   3722  C CA  . GLU E 1 17  ? 33.930  11.165  26.781  1.00 1.00   ? 17   GLU C CA  1 
ATOM   3723  C C   . GLU E 1 17  ? 32.516  11.042  26.308  1.00 5.23   ? 17   GLU C C   1 
ATOM   3724  O O   . GLU E 1 17  ? 32.181  10.204  25.486  1.00 11.87  ? 17   GLU C O   1 
ATOM   3725  C CB  . GLU E 1 17  ? 34.275  10.279  27.940  1.00 1.00   ? 17   GLU C CB  1 
ATOM   3726  C CG  . GLU E 1 17  ? 34.353  8.786   27.563  1.00 19.56  ? 17   GLU C CG  1 
ATOM   3727  C CD  . GLU E 1 17  ? 35.585  8.321   26.844  1.00 7.78   ? 17   GLU C CD  1 
ATOM   3728  O OE1 . GLU E 1 17  ? 36.500  9.032   26.510  1.00 31.51  ? 17   GLU C OE1 1 
ATOM   3729  O OE2 . GLU E 1 17  ? 35.514  7.057   26.520  1.00 9.61   ? 17   GLU C OE2 1 
ATOM   3730  N N   . SER E 1 18  ? 31.676  11.893  26.808  1.00 1.00   ? 18   SER C N   1 
ATOM   3731  C CA  . SER E 1 18  ? 30.296  11.848  26.400  1.00 1.00   ? 18   SER C CA  1 
ATOM   3732  C C   . SER E 1 18  ? 30.180  12.099  24.939  1.00 6.76   ? 18   SER C C   1 
ATOM   3733  O O   . SER E 1 18  ? 29.457  11.433  24.184  1.00 9.68   ? 18   SER C O   1 
ATOM   3734  C CB  . SER E 1 18  ? 29.390  12.722  27.230  1.00 1.00   ? 18   SER C CB  1 
ATOM   3735  O OG  . SER E 1 18  ? 29.814  12.649  28.568  1.00 13.54  ? 18   SER C OG  1 
ATOM   3736  N N   . VAL E 1 19  ? 30.992  13.014  24.511  1.00 7.37   ? 19   VAL C N   1 
ATOM   3737  C CA  . VAL E 1 19  ? 31.046  13.346  23.100  1.00 8.08   ? 19   VAL C CA  1 
ATOM   3738  C C   . VAL E 1 19  ? 31.545  12.179  22.285  1.00 9.25   ? 19   VAL C C   1 
ATOM   3739  O O   . VAL E 1 19  ? 31.017  11.896  21.226  1.00 6.66   ? 19   VAL C O   1 
ATOM   3740  C CB  . VAL E 1 19  ? 32.000  14.484  22.883  1.00 8.51   ? 19   VAL C CB  1 
ATOM   3741  C CG1 . VAL E 1 19  ? 31.881  14.836  21.423  1.00 10.56  ? 19   VAL C CG1 1 
ATOM   3742  C CG2 . VAL E 1 19  ? 31.566  15.667  23.730  1.00 1.00   ? 19   VAL C CG2 1 
ATOM   3743  N N   . ARG E 1 20  ? 32.574  11.501  22.792  1.00 5.49   ? 20   ARG C N   1 
ATOM   3744  C CA  . ARG E 1 20  ? 32.989  10.316  22.063  1.00 3.46   ? 20   ARG C CA  1 
ATOM   3745  C C   . ARG E 1 20  ? 31.838  9.347   22.005  1.00 10.61  ? 20   ARG C C   1 
ATOM   3746  O O   . ARG E 1 20  ? 31.489  8.893   20.936  1.00 13.96  ? 20   ARG C O   1 
ATOM   3747  C CB  . ARG E 1 20  ? 34.194  9.625   22.630  1.00 1.00   ? 20   ARG C CB  1 
ATOM   3748  C CG  . ARG E 1 20  ? 35.352  10.642  22.722  1.00 3.22   ? 20   ARG C CG  1 
ATOM   3749  C CD  . ARG E 1 20  ? 36.555  10.105  23.520  1.00 7.99   ? 20   ARG C CD  1 
ATOM   3750  N NE  . ARG E 1 20  ? 37.670  11.062  23.693  1.00 7.20   ? 20   ARG C NE  1 
ATOM   3751  C CZ  . ARG E 1 20  ? 38.095  11.586  24.839  1.00 10.41  ? 20   ARG C CZ  1 
ATOM   3752  N NH1 . ARG E 1 20  ? 37.496  11.287  25.971  1.00 15.20  ? 20   ARG C NH1 1 
ATOM   3753  N NH2 . ARG E 1 20  ? 39.116  12.460  24.855  1.00 6.11   ? 20   ARG C NH2 1 
ATOM   3754  N N   . TRP E 1 21  ? 31.211  9.075   23.131  1.00 7.37   ? 21   TRP C N   1 
ATOM   3755  C CA  . TRP E 1 21  ? 30.103  8.148   23.101  1.00 7.08   ? 21   TRP C CA  1 
ATOM   3756  C C   . TRP E 1 21  ? 29.072  8.463   22.075  1.00 15.16  ? 21   TRP C C   1 
ATOM   3757  O O   . TRP E 1 21  ? 28.689  7.612   21.332  1.00 17.62  ? 21   TRP C O   1 
ATOM   3758  C CB  . TRP E 1 21  ? 29.366  8.144   24.417  1.00 6.41   ? 21   TRP C CB  1 
ATOM   3759  C CG  . TRP E 1 21  ? 29.940  7.156   25.324  1.00 10.05  ? 21   TRP C CG  1 
ATOM   3760  C CD1 . TRP E 1 21  ? 30.924  7.365   26.220  1.00 13.65  ? 21   TRP C CD1 1 
ATOM   3761  C CD2 . TRP E 1 21  ? 29.570  5.781   25.430  1.00 9.28   ? 21   TRP C CD2 1 
ATOM   3762  N NE1 . TRP E 1 21  ? 31.188  6.196   26.910  1.00 8.11   ? 21   TRP C NE1 1 
ATOM   3763  C CE2 . TRP E 1 21  ? 30.397  5.204   26.412  1.00 7.93   ? 21   TRP C CE2 1 
ATOM   3764  C CE3 . TRP E 1 21  ? 28.598  5.002   24.801  1.00 8.18   ? 21   TRP C CE3 1 
ATOM   3765  C CZ2 . TRP E 1 21  ? 30.266  3.870   26.778  1.00 5.43   ? 21   TRP C CZ2 1 
ATOM   3766  C CZ3 . TRP E 1 21  ? 28.461  3.703   25.172  1.00 8.67   ? 21   TRP C CZ3 1 
ATOM   3767  C CH2 . TRP E 1 21  ? 29.310  3.140   26.140  1.00 9.78   ? 21   TRP C CH2 1 
ATOM   3768  N N   . VAL E 1 22  ? 28.685  9.716   22.006  1.00 13.45  ? 22   VAL C N   1 
ATOM   3769  C CA  . VAL E 1 22  ? 27.640  10.073  21.108  1.00 9.94   ? 22   VAL C CA  1 
ATOM   3770  C C   . VAL E 1 22  ? 28.027  9.940   19.691  1.00 12.54  ? 22   VAL C C   1 
ATOM   3771  O O   . VAL E 1 22  ? 27.280  9.426   18.889  1.00 13.70  ? 22   VAL C O   1 
ATOM   3772  C CB  . VAL E 1 22  ? 27.159  11.484  21.349  1.00 15.10  ? 22   VAL C CB  1 
ATOM   3773  C CG1 . VAL E 1 22  ? 26.011  11.747  20.414  1.00 9.55   ? 22   VAL C CG1 1 
ATOM   3774  C CG2 . VAL E 1 22  ? 26.563  11.555  22.743  1.00 16.50  ? 22   VAL C CG2 1 
ATOM   3775  N N   . LEU E 1 23  ? 29.179  10.481  19.379  1.00 5.24   ? 23   LEU C N   1 
ATOM   3776  C CA  . LEU E 1 23  ? 29.679  10.386  18.030  1.00 3.88   ? 23   LEU C CA  1 
ATOM   3777  C C   . LEU E 1 23  ? 29.702  8.942   17.600  1.00 12.19  ? 23   LEU C C   1 
ATOM   3778  O O   . LEU E 1 23  ? 29.098  8.601   16.604  1.00 12.38  ? 23   LEU C O   1 
ATOM   3779  C CB  . LEU E 1 23  ? 31.080  10.998  17.946  1.00 3.09   ? 23   LEU C CB  1 
ATOM   3780  C CG  . LEU E 1 23  ? 30.973  12.520  17.865  1.00 4.80   ? 23   LEU C CG  1 
ATOM   3781  C CD1 . LEU E 1 23  ? 32.330  13.118  17.914  1.00 3.57   ? 23   LEU C CD1 1 
ATOM   3782  C CD2 . LEU E 1 23  ? 30.415  12.912  16.519  1.00 2.17   ? 23   LEU C CD2 1 
ATOM   3783  N N   . ALA E 1 24  ? 30.360  8.101   18.419  1.00 8.67   ? 24   ALA C N   1 
ATOM   3784  C CA  . ALA E 1 24  ? 30.467  6.659   18.157  1.00 3.94   ? 24   ALA C CA  1 
ATOM   3785  C C   . ALA E 1 24  ? 29.134  6.031   17.955  1.00 13.81  ? 24   ALA C C   1 
ATOM   3786  O O   . ALA E 1 24  ? 28.944  5.298   17.028  1.00 20.36  ? 24   ALA C O   1 
ATOM   3787  C CB  . ALA E 1 24  ? 31.220  5.892   19.202  1.00 1.00   ? 24   ALA C CB  1 
ATOM   3788  N N   . ALA E 1 25  ? 28.233  6.307   18.849  1.00 13.24  ? 25   ALA C N   1 
ATOM   3789  C CA  . ALA E 1 25  ? 26.932  5.729   18.735  1.00 9.76   ? 25   ALA C CA  1 
ATOM   3790  C C   . ALA E 1 25  ? 26.254  6.095   17.460  1.00 16.53  ? 25   ALA C C   1 
ATOM   3791  O O   . ALA E 1 25  ? 25.572  5.297   16.870  1.00 21.49  ? 25   ALA C O   1 
ATOM   3792  C CB  . ALA E 1 25  ? 26.040  6.091   19.894  1.00 5.49   ? 25   ALA C CB  1 
ATOM   3793  N N   . ALA E 1 26  ? 26.411  7.339   17.069  1.00 22.51  ? 26   ALA C N   1 
ATOM   3794  C CA  . ALA E 1 26  ? 25.785  7.873   15.860  1.00 14.60  ? 26   ALA C CA  1 
ATOM   3795  C C   . ALA E 1 26  ? 26.485  7.343   14.629  1.00 22.33  ? 26   ALA C C   1 
ATOM   3796  O O   . ALA E 1 26  ? 26.151  7.636   13.510  1.00 28.32  ? 26   ALA C O   1 
ATOM   3797  C CB  . ALA E 1 26  ? 25.813  9.390   15.899  1.00 8.69   ? 26   ALA C CB  1 
ATOM   3798  N N   . GLY E 1 27  ? 27.487  6.552   14.861  1.00 20.41  ? 27   GLY C N   1 
ATOM   3799  C CA  . GLY E 1 27  ? 28.253  5.978   13.805  1.00 17.35  ? 27   GLY C CA  1 
ATOM   3800  C C   . GLY E 1 27  ? 29.235  6.921   13.135  1.00 24.13  ? 27   GLY C C   1 
ATOM   3801  O O   . GLY E 1 27  ? 29.745  6.612   12.055  1.00 32.49  ? 27   GLY C O   1 
ATOM   3802  N N   . VAL E 1 28  ? 29.547  8.047   13.771  1.00 17.82  ? 28   VAL C N   1 
ATOM   3803  C CA  . VAL E 1 28  ? 30.467  9.031   13.200  1.00 8.87   ? 28   VAL C CA  1 
ATOM   3804  C C   . VAL E 1 28  ? 31.911  8.844   13.601  1.00 18.14  ? 28   VAL C C   1 
ATOM   3805  O O   . VAL E 1 28  ? 32.195  8.669   14.779  1.00 22.20  ? 28   VAL C O   1 
ATOM   3806  C CB  . VAL E 1 28  ? 29.999  10.381  13.652  1.00 7.68   ? 28   VAL C CB  1 
ATOM   3807  C CG1 . VAL E 1 28  ? 30.933  11.445  13.150  1.00 6.16   ? 28   VAL C CG1 1 
ATOM   3808  C CG2 . VAL E 1 28  ? 28.562  10.602  13.221  1.00 1.00   ? 28   VAL C CG2 1 
ATOM   3809  N N   . GLU E 1 29  ? 32.813  8.838   12.593  1.00 26.80  ? 29   GLU C N   1 
ATOM   3810  C CA  . GLU E 1 29  ? 34.256  8.680   12.816  1.00 28.31  ? 29   GLU C CA  1 
ATOM   3811  C C   . GLU E 1 29  ? 34.832  10.048  13.077  1.00 30.20  ? 29   GLU C C   1 
ATOM   3812  O O   . GLU E 1 29  ? 34.327  11.032  12.525  1.00 38.03  ? 29   GLU C O   1 
ATOM   3813  C CB  . GLU E 1 29  ? 35.013  7.975   11.663  1.00 32.26  ? 29   GLU C CB  1 
ATOM   3814  C CG  . GLU E 1 29  ? 35.174  6.434   11.774  1.00 67.57  ? 29   GLU C CG  1 
ATOM   3815  C CD  . GLU E 1 29  ? 35.879  5.790   10.602  1.00 160.28 ? 29   GLU C CD  1 
ATOM   3816  O OE1 . GLU E 1 29  ? 35.362  5.639   9.509   1.00 195.37 ? 29   GLU C OE1 1 
ATOM   3817  O OE2 . GLU E 1 29  ? 37.095  5.399   10.927  1.00 192.75 ? 29   GLU C OE2 1 
ATOM   3818  N N   . PHE E 1 30  ? 35.873  10.124  13.911  1.00 13.23  ? 30   PHE C N   1 
ATOM   3819  C CA  . PHE E 1 30  ? 36.368  11.438  14.177  1.00 8.69   ? 30   PHE C CA  1 
ATOM   3820  C C   . PHE E 1 30  ? 37.780  11.380  14.566  1.00 14.26  ? 30   PHE C C   1 
ATOM   3821  O O   . PHE E 1 30  ? 38.322  10.300  14.829  1.00 9.97   ? 30   PHE C O   1 
ATOM   3822  C CB  . PHE E 1 30  ? 35.615  12.041  15.354  1.00 11.39  ? 30   PHE C CB  1 
ATOM   3823  C CG  . PHE E 1 30  ? 35.635  11.140  16.605  1.00 9.08   ? 30   PHE C CG  1 
ATOM   3824  C CD1 . PHE E 1 30  ? 36.680  11.174  17.528  1.00 8.84   ? 30   PHE C CD1 1 
ATOM   3825  C CD2 . PHE E 1 30  ? 34.569  10.300  16.938  1.00 6.88   ? 30   PHE C CD2 1 
ATOM   3826  C CE1 . PHE E 1 30  ? 36.697  10.400  18.696  1.00 5.28   ? 30   PHE C CE1 1 
ATOM   3827  C CE2 . PHE E 1 30  ? 34.560  9.512   18.101  1.00 5.71   ? 30   PHE C CE2 1 
ATOM   3828  C CZ  . PHE E 1 30  ? 35.644  9.530   18.985  1.00 1.00   ? 30   PHE C CZ  1 
ATOM   3829  N N   . ASP E 1 31  ? 38.372  12.563  14.627  1.00 13.28  ? 31   ASP C N   1 
ATOM   3830  C CA  . ASP E 1 31  ? 39.750  12.584  15.003  1.00 12.08  ? 31   ASP C CA  1 
ATOM   3831  C C   . ASP E 1 31  ? 39.909  13.222  16.333  1.00 13.87  ? 31   ASP C C   1 
ATOM   3832  O O   . ASP E 1 31  ? 38.993  13.830  16.836  1.00 21.44  ? 31   ASP C O   1 
ATOM   3833  C CB  . ASP E 1 31  ? 40.706  13.185  13.945  1.00 15.48  ? 31   ASP C CB  1 
ATOM   3834  C CG  . ASP E 1 31  ? 40.414  12.800  12.510  1.00 27.68  ? 31   ASP C CG  1 
ATOM   3835  O OD1 . ASP E 1 31  ? 40.506  11.652  12.133  1.00 37.42  ? 31   ASP C OD1 1 
ATOM   3836  O OD2 . ASP E 1 31  ? 40.051  13.815  11.724  1.00 34.74  ? 31   ASP C OD2 1 
ATOM   3837  N N   . GLU E 1 32  ? 41.101  13.084  16.869  1.00 4.84   ? 32   GLU C N   1 
ATOM   3838  C CA  . GLU E 1 32  ? 41.425  13.646  18.131  1.00 9.08   ? 32   GLU C CA  1 
ATOM   3839  C C   . GLU E 1 32  ? 42.776  14.363  18.120  1.00 23.83  ? 32   GLU C C   1 
ATOM   3840  O O   . GLU E 1 32  ? 43.727  13.853  17.595  1.00 34.10  ? 32   GLU C O   1 
ATOM   3841  C CB  . GLU E 1 32  ? 41.475  12.545  19.228  1.00 10.48  ? 32   GLU C CB  1 
ATOM   3842  C CG  . GLU E 1 32  ? 40.134  11.791  19.434  1.00 10.37  ? 32   GLU C CG  1 
ATOM   3843  C CD  . GLU E 1 32  ? 40.161  10.961  20.682  1.00 18.46  ? 32   GLU C CD  1 
ATOM   3844  O OE1 . GLU E 1 32  ? 40.775  9.921   20.738  1.00 28.62  ? 32   GLU C OE1 1 
ATOM   3845  O OE2 . GLU E 1 32  ? 39.694  11.592  21.743  1.00 29.96  ? 32   GLU C OE2 1 
ATOM   3846  N N   . GLU E 1 33  ? 42.879  15.510  18.780  1.00 17.07  ? 33   GLU C N   1 
ATOM   3847  C CA  . GLU E 1 33  ? 44.098  16.222  18.891  1.00 10.34  ? 33   GLU C CA  1 
ATOM   3848  C C   . GLU E 1 33  ? 44.405  16.439  20.344  1.00 14.02  ? 33   GLU C C   1 
ATOM   3849  O O   . GLU E 1 33  ? 43.859  17.301  21.009  1.00 19.01  ? 33   GLU C O   1 
ATOM   3850  C CB  . GLU E 1 33  ? 43.946  17.538  18.199  1.00 13.07  ? 33   GLU C CB  1 
ATOM   3851  C CG  . GLU E 1 33  ? 45.357  18.087  17.934  1.00 25.16  ? 33   GLU C CG  1 
ATOM   3852  C CD  . GLU E 1 33  ? 45.396  19.409  17.232  1.00 75.56  ? 33   GLU C CD  1 
ATOM   3853  O OE1 . GLU E 1 33  ? 45.122  19.517  16.029  1.00 47.37  ? 33   GLU C OE1 1 
ATOM   3854  O OE2 . GLU E 1 33  ? 45.812  20.391  18.041  1.00 39.17  ? 33   GLU C OE2 1 
ATOM   3855  N N   . PHE E 1 34  ? 45.284  15.621  20.866  1.00 7.61   ? 34   PHE C N   1 
ATOM   3856  C CA  . PHE E 1 34  ? 45.515  15.669  22.279  1.00 8.79   ? 34   PHE C CA  1 
ATOM   3857  C C   . PHE E 1 34  ? 46.281  16.750  22.915  1.00 19.39  ? 34   PHE C C   1 
ATOM   3858  O O   . PHE E 1 34  ? 47.375  17.053  22.507  1.00 24.13  ? 34   PHE C O   1 
ATOM   3859  C CB  . PHE E 1 34  ? 46.126  14.378  22.757  1.00 10.39  ? 34   PHE C CB  1 
ATOM   3860  C CG  . PHE E 1 34  ? 45.187  13.259  22.492  1.00 17.68  ? 34   PHE C CG  1 
ATOM   3861  C CD1 . PHE E 1 34  ? 43.866  13.360  22.925  1.00 28.34  ? 34   PHE C CD1 1 
ATOM   3862  C CD2 . PHE E 1 34  ? 45.593  12.116  21.808  1.00 16.81  ? 34   PHE C CD2 1 
ATOM   3863  C CE1 . PHE E 1 34  ? 42.966  12.338  22.640  1.00 31.51  ? 34   PHE C CE1 1 
ATOM   3864  C CE2 . PHE E 1 34  ? 44.699  11.091  21.513  1.00 16.09  ? 34   PHE C CE2 1 
ATOM   3865  C CZ  . PHE E 1 34  ? 43.384  11.201  21.948  1.00 21.33  ? 34   PHE C CZ  1 
ATOM   3866  N N   . LEU E 1 35  ? 45.767  17.219  24.035  1.00 17.76  ? 35   LEU C N   1 
ATOM   3867  C CA  . LEU E 1 35  ? 46.566  18.150  24.783  1.00 10.55  ? 35   LEU C CA  1 
ATOM   3868  C C   . LEU E 1 35  ? 47.405  17.383  25.765  1.00 19.28  ? 35   LEU C C   1 
ATOM   3869  O O   . LEU E 1 35  ? 46.919  16.465  26.421  1.00 29.56  ? 35   LEU C O   1 
ATOM   3870  C CB  . LEU E 1 35  ? 45.835  19.276  25.518  1.00 7.52   ? 35   LEU C CB  1 
ATOM   3871  C CG  . LEU E 1 35  ? 44.929  20.063  24.595  1.00 13.89  ? 35   LEU C CG  1 
ATOM   3872  C CD1 . LEU E 1 35  ? 43.869  20.810  25.382  1.00 9.47   ? 35   LEU C CD1 1 
ATOM   3873  C CD2 . LEU E 1 35  ? 45.740  21.081  23.892  1.00 11.29  ? 35   LEU C CD2 1 
ATOM   3874  N N   . GLU E 1 36  ? 48.689  17.773  25.809  1.00 21.93  ? 36   GLU C N   1 
ATOM   3875  C CA  . GLU E 1 36  ? 49.687  17.236  26.724  1.00 23.68  ? 36   GLU C CA  1 
ATOM   3876  C C   . GLU E 1 36  ? 50.346  18.212  27.685  1.00 31.22  ? 36   GLU C C   1 
ATOM   3877  O O   . GLU E 1 36  ? 50.823  17.766  28.739  1.00 34.30  ? 36   GLU C O   1 
ATOM   3878  C CB  . GLU E 1 36  ? 50.712  16.291  26.088  1.00 26.56  ? 36   GLU C CB  1 
ATOM   3879  C CG  . GLU E 1 36  ? 50.118  15.251  25.101  1.00 46.80  ? 36   GLU C CG  1 
ATOM   3880  C CD  . GLU E 1 36  ? 51.126  14.585  24.213  1.00 144.65 ? 36   GLU C CD  1 
ATOM   3881  O OE1 . GLU E 1 36  ? 52.202  14.209  24.582  1.00 197.15 ? 36   GLU C OE1 1 
ATOM   3882  O OE2 . GLU E 1 36  ? 50.702  14.504  22.983  1.00 116.08 ? 36   GLU C OE2 1 
ATOM   3883  N N   . THR E 1 37  ? 50.335  19.518  27.343  1.00 31.21  ? 37   THR C N   1 
ATOM   3884  C CA  . THR E 1 37  ? 50.963  20.601  28.109  1.00 29.82  ? 37   THR C CA  1 
ATOM   3885  C C   . THR E 1 37  ? 50.192  21.920  28.142  1.00 35.09  ? 37   THR C C   1 
ATOM   3886  O O   . THR E 1 37  ? 49.377  22.233  27.237  1.00 28.14  ? 37   THR C O   1 
ATOM   3887  C CB  . THR E 1 37  ? 52.237  20.974  27.340  1.00 43.33  ? 37   THR C CB  1 
ATOM   3888  O OG1 . THR E 1 37  ? 51.912  21.796  26.224  1.00 54.39  ? 37   THR C OG1 1 
ATOM   3889  C CG2 . THR E 1 37  ? 52.926  19.736  26.838  1.00 18.64  ? 37   THR C CG2 1 
ATOM   3890  N N   . LYS E 1 38  ? 50.598  22.758  29.127  1.00 29.25  ? 38   LYS C N   1 
ATOM   3891  C CA  . LYS E 1 38  ? 50.010  24.100  29.254  1.00 27.02  ? 38   LYS C CA  1 
ATOM   3892  C C   . LYS E 1 38  ? 50.123  24.823  27.922  1.00 32.21  ? 38   LYS C C   1 
ATOM   3893  O O   . LYS E 1 38  ? 49.177  25.408  27.326  1.00 38.46  ? 38   LYS C O   1 
ATOM   3894  C CB  . LYS E 1 38  ? 50.695  24.952  30.331  1.00 26.43  ? 38   LYS C CB  1 
ATOM   3895  C CG  . LYS E 1 38  ? 49.762  25.690  31.308  1.00 60.64  ? 38   LYS C CG  1 
ATOM   3896  C CD  . LYS E 1 38  ? 49.604  25.056  32.706  1.00 131.05 ? 38   LYS C CD  1 
ATOM   3897  C CE  . LYS E 1 38  ? 48.694  25.830  33.680  1.00 170.26 ? 38   LYS C CE  1 
ATOM   3898  N NZ  . LYS E 1 38  ? 48.679  25.332  35.080  1.00 174.30 ? 38   LYS C NZ  1 
ATOM   3899  N N   . GLU E 1 39  ? 51.310  24.711  27.423  1.00 27.67  ? 39   GLU C N   1 
ATOM   3900  C CA  . GLU E 1 39  ? 51.676  25.350  26.199  1.00 31.08  ? 39   GLU C CA  1 
ATOM   3901  C C   . GLU E 1 39  ? 50.811  25.030  25.016  1.00 30.03  ? 39   GLU C C   1 
ATOM   3902  O O   . GLU E 1 39  ? 50.358  25.937  24.292  1.00 35.32  ? 39   GLU C O   1 
ATOM   3903  C CB  . GLU E 1 39  ? 53.175  25.264  25.935  1.00 37.81  ? 39   GLU C CB  1 
ATOM   3904  C CG  . GLU E 1 39  ? 53.636  26.208  24.813  1.00 79.19  ? 39   GLU C CG  1 
ATOM   3905  C CD  . GLU E 1 39  ? 54.445  25.447  23.798  1.00 193.64 ? 39   GLU C CD  1 
ATOM   3906  O OE1 . GLU E 1 39  ? 54.473  24.224  23.734  1.00 232.66 ? 39   GLU C OE1 1 
ATOM   3907  O OE2 . GLU E 1 39  ? 55.123  26.238  23.006  1.00 227.39 ? 39   GLU C OE2 1 
ATOM   3908  N N   . GLN E 1 40  ? 50.522  23.758  24.810  1.00 21.77  ? 40   GLN C N   1 
ATOM   3909  C CA  . GLN E 1 40  ? 49.628  23.465  23.703  1.00 20.26  ? 40   GLN C CA  1 
ATOM   3910  C C   . GLN E 1 40  ? 48.261  24.071  23.915  1.00 27.16  ? 40   GLN C C   1 
ATOM   3911  O O   . GLN E 1 40  ? 47.605  24.483  22.962  1.00 28.08  ? 40   GLN C O   1 
ATOM   3912  C CB  . GLN E 1 40  ? 49.500  21.999  23.453  1.00 19.08  ? 40   GLN C CB  1 
ATOM   3913  C CG  . GLN E 1 40  ? 50.839  21.319  23.670  1.00 31.96  ? 40   GLN C CG  1 
ATOM   3914  C CD  . GLN E 1 40  ? 50.674  19.831  23.672  1.00 60.17  ? 40   GLN C CD  1 
ATOM   3915  O OE1 . GLN E 1 40  ? 50.395  19.232  24.735  1.00 56.97  ? 40   GLN C OE1 1 
ATOM   3916  N NE2 . GLN E 1 40  ? 50.676  19.273  22.462  1.00 30.70  ? 40   GLN C NE2 1 
ATOM   3917  N N   . LEU E 1 41  ? 47.865  24.149  25.182  1.00 19.89  ? 41   LEU C N   1 
ATOM   3918  C CA  . LEU E 1 41  ? 46.623  24.749  25.495  1.00 18.47  ? 41   LEU C CA  1 
ATOM   3919  C C   . LEU E 1 41  ? 46.730  26.204  25.131  1.00 22.31  ? 41   LEU C C   1 
ATOM   3920  O O   . LEU E 1 41  ? 45.887  26.735  24.396  1.00 20.50  ? 41   LEU C O   1 
ATOM   3921  C CB  . LEU E 1 41  ? 46.314  24.511  26.960  1.00 19.14  ? 41   LEU C CB  1 
ATOM   3922  C CG  . LEU E 1 41  ? 45.096  25.273  27.470  1.00 22.37  ? 41   LEU C CG  1 
ATOM   3923  C CD1 . LEU E 1 41  ? 43.809  24.937  26.697  1.00 14.45  ? 41   LEU C CD1 1 
ATOM   3924  C CD2 . LEU E 1 41  ? 44.929  24.973  28.946  1.00 6.97   ? 41   LEU C CD2 1 
ATOM   3925  N N   . TYR E 1 42  ? 47.819  26.840  25.559  1.00 18.09  ? 42   TYR C N   1 
ATOM   3926  C CA  . TYR E 1 42  ? 47.999  28.244  25.156  1.00 22.08  ? 42   TYR C CA  1 
ATOM   3927  C C   . TYR E 1 42  ? 47.913  28.505  23.704  1.00 21.45  ? 42   TYR C C   1 
ATOM   3928  O O   . TYR E 1 42  ? 47.331  29.478  23.258  1.00 23.96  ? 42   TYR C O   1 
ATOM   3929  C CB  . TYR E 1 42  ? 49.331  28.776  25.505  1.00 34.68  ? 42   TYR C CB  1 
ATOM   3930  C CG  . TYR E 1 42  ? 49.322  29.062  26.964  1.00 69.13  ? 42   TYR C CG  1 
ATOM   3931  C CD1 . TYR E 1 42  ? 48.152  29.518  27.570  1.00 82.25  ? 42   TYR C CD1 1 
ATOM   3932  C CD2 . TYR E 1 42  ? 50.458  28.895  27.759  1.00 76.28  ? 42   TYR C CD2 1 
ATOM   3933  C CE1 . TYR E 1 42  ? 48.106  29.810  28.937  1.00 94.37  ? 42   TYR C CE1 1 
ATOM   3934  C CE2 . TYR E 1 42  ? 50.427  29.177  29.128  1.00 79.12  ? 42   TYR C CE2 1 
ATOM   3935  C CZ  . TYR E 1 42  ? 49.251  29.640  29.721  1.00 95.12  ? 42   TYR C CZ  1 
ATOM   3936  O OH  . TYR E 1 42  ? 49.234  29.935  31.072  1.00 96.88  ? 42   TYR C OH  1 
ATOM   3937  N N   . LYS E 1 43  ? 48.504  27.644  22.939  1.00 13.68  ? 43   LYS C N   1 
ATOM   3938  C CA  . LYS E 1 43  ? 48.407  27.931  21.537  1.00 14.88  ? 43   LYS C CA  1 
ATOM   3939  C C   . LYS E 1 43  ? 47.001  27.858  21.036  1.00 21.16  ? 43   LYS C C   1 
ATOM   3940  O O   . LYS E 1 43  ? 46.543  28.561  20.151  1.00 31.70  ? 43   LYS C O   1 
ATOM   3941  C CB  . LYS E 1 43  ? 49.352  27.068  20.705  1.00 21.00  ? 43   LYS C CB  1 
ATOM   3942  C CG  . LYS E 1 43  ? 50.663  26.854  21.440  1.00 105.48 ? 43   LYS C CG  1 
ATOM   3943  C CD  . LYS E 1 43  ? 51.500  25.713  20.881  1.00 165.45 ? 43   LYS C CD  1 
ATOM   3944  C CE  . LYS E 1 43  ? 52.490  26.157  19.813  1.00 228.51 ? 43   LYS C CE  1 
ATOM   3945  N NZ  . LYS E 1 43  ? 53.466  25.112  19.455  1.00 258.00 ? 43   LYS C NZ  1 
ATOM   3946  N N   . LEU E 1 44  ? 46.286  26.985  21.618  1.00 13.95  ? 44   LEU C N   1 
ATOM   3947  C CA  . LEU E 1 44  ? 44.937  26.802  21.162  1.00 12.63  ? 44   LEU C CA  1 
ATOM   3948  C C   . LEU E 1 44  ? 44.140  28.032  21.496  1.00 15.33  ? 44   LEU C C   1 
ATOM   3949  O O   . LEU E 1 44  ? 43.344  28.570  20.725  1.00 15.90  ? 44   LEU C O   1 
ATOM   3950  C CB  . LEU E 1 44  ? 44.510  25.560  21.946  1.00 12.87  ? 44   LEU C CB  1 
ATOM   3951  C CG  . LEU E 1 44  ? 43.389  24.736  21.359  1.00 16.69  ? 44   LEU C CG  1 
ATOM   3952  C CD1 . LEU E 1 44  ? 43.552  24.558  19.893  1.00 12.70  ? 44   LEU C CD1 1 
ATOM   3953  C CD2 . LEU E 1 44  ? 43.371  23.346  21.975  1.00 18.55  ? 44   LEU C CD2 1 
ATOM   3954  N N   . GLN E 1 45  ? 44.445  28.500  22.684  1.00 10.39  ? 45   GLN C N   1 
ATOM   3955  C CA  . GLN E 1 45  ? 43.784  29.635  23.225  1.00 8.91   ? 45   GLN C CA  1 
ATOM   3956  C C   . GLN E 1 45  ? 44.165  30.829  22.461  1.00 24.32  ? 45   GLN C C   1 
ATOM   3957  O O   . GLN E 1 45  ? 43.324  31.588  22.015  1.00 24.96  ? 45   GLN C O   1 
ATOM   3958  C CB  . GLN E 1 45  ? 44.257  29.822  24.640  1.00 7.27   ? 45   GLN C CB  1 
ATOM   3959  C CG  . GLN E 1 45  ? 43.517  28.870  25.539  1.00 23.17  ? 45   GLN C CG  1 
ATOM   3960  C CD  . GLN E 1 45  ? 44.010  28.986  26.932  1.00 9.01   ? 45   GLN C CD  1 
ATOM   3961  O OE1 . GLN E 1 45  ? 45.151  29.380  27.109  1.00 36.30  ? 45   GLN C OE1 1 
ATOM   3962  N NE2 . GLN E 1 45  ? 43.185  28.557  27.902  1.00 19.47  ? 45   GLN C NE2 1 
ATOM   3963  N N   . ASP E 1 46  ? 45.479  30.940  22.320  1.00 25.91  ? 46   ASP C N   1 
ATOM   3964  C CA  . ASP E 1 46  ? 46.073  32.036  21.588  1.00 24.70  ? 46   ASP C CA  1 
ATOM   3965  C C   . ASP E 1 46  ? 45.510  32.194  20.185  1.00 20.91  ? 46   ASP C C   1 
ATOM   3966  O O   . ASP E 1 46  ? 45.266  33.267  19.717  1.00 23.96  ? 46   ASP C O   1 
ATOM   3967  C CB  . ASP E 1 46  ? 47.591  31.919  21.516  1.00 28.86  ? 46   ASP C CB  1 
ATOM   3968  C CG  . ASP E 1 46  ? 48.260  33.047  20.743  1.00 66.70  ? 46   ASP C CG  1 
ATOM   3969  O OD1 . ASP E 1 46  ? 48.153  34.215  21.064  1.00 73.54  ? 46   ASP C OD1 1 
ATOM   3970  O OD2 . ASP E 1 46  ? 48.913  32.653  19.655  1.00 88.27  ? 46   ASP C OD2 1 
ATOM   3971  N N   . GLY E 1 47  ? 45.306  31.136  19.458  1.00 17.38  ? 47   GLY C N   1 
ATOM   3972  C CA  . GLY E 1 47  ? 44.776  31.343  18.141  1.00 13.80  ? 47   GLY C CA  1 
ATOM   3973  C C   . GLY E 1 47  ? 43.300  31.588  18.132  1.00 20.83  ? 47   GLY C C   1 
ATOM   3974  O O   . GLY E 1 47  ? 42.692  31.594  17.066  1.00 26.10  ? 47   GLY C O   1 
ATOM   3975  N N   . ASN E 1 48  ? 42.709  31.755  19.308  1.00 16.78  ? 48   ASN C N   1 
ATOM   3976  C CA  . ASN E 1 48  ? 41.289  32.015  19.346  1.00 18.70  ? 48   ASN C CA  1 
ATOM   3977  C C   . ASN E 1 48  ? 40.462  30.839  18.892  1.00 23.54  ? 48   ASN C C   1 
ATOM   3978  O O   . ASN E 1 48  ? 39.474  30.973  18.190  1.00 28.81  ? 48   ASN C O   1 
ATOM   3979  C CB  . ASN E 1 48  ? 40.932  33.363  18.634  1.00 19.59  ? 48   ASN C CB  1 
ATOM   3980  C CG  . ASN E 1 48  ? 41.656  34.490  19.372  1.00 101.87 ? 48   ASN C CG  1 
ATOM   3981  O OD1 . ASN E 1 48  ? 41.726  34.502  20.624  1.00 85.57  ? 48   ASN C OD1 1 
ATOM   3982  N ND2 . ASN E 1 48  ? 42.359  35.336  18.614  1.00 131.65 ? 48   ASN C ND2 1 
ATOM   3983  N N   . HIS E 1 49  ? 40.863  29.652  19.273  1.00 14.99  ? 49   HIS C N   1 
ATOM   3984  C CA  . HIS E 1 49  ? 40.052  28.557  18.819  1.00 12.78  ? 49   HIS C CA  1 
ATOM   3985  C C   . HIS E 1 49  ? 39.012  28.120  19.803  1.00 15.54  ? 49   HIS C C   1 
ATOM   3986  O O   . HIS E 1 49  ? 38.082  27.440  19.427  1.00 16.83  ? 49   HIS C O   1 
ATOM   3987  C CB  . HIS E 1 49  ? 40.964  27.417  18.697  1.00 16.79  ? 49   HIS C CB  1 
ATOM   3988  C CG  . HIS E 1 49  ? 41.993  27.723  17.719  1.00 21.98  ? 49   HIS C CG  1 
ATOM   3989  N ND1 . HIS E 1 49  ? 41.667  27.837  16.376  1.00 23.88  ? 49   HIS C ND1 1 
ATOM   3990  C CD2 . HIS E 1 49  ? 43.320  27.889  17.879  1.00 25.84  ? 49   HIS C CD2 1 
ATOM   3991  C CE1 . HIS E 1 49  ? 42.801  28.037  15.739  1.00 21.95  ? 49   HIS C CE1 1 
ATOM   3992  N NE2 . HIS E 1 49  ? 43.812  28.062  16.605  1.00 24.18  ? 49   HIS C NE2 1 
ATOM   3993  N N   . LEU E 1 50  ? 39.242  28.476  21.062  1.00 8.69   ? 50   LEU C N   1 
ATOM   3994  C CA  . LEU E 1 50  ? 38.404  28.182  22.169  1.00 4.38   ? 50   LEU C CA  1 
ATOM   3995  C C   . LEU E 1 50  ? 37.594  29.397  22.485  1.00 11.49  ? 50   LEU C C   1 
ATOM   3996  O O   . LEU E 1 50  ? 38.133  30.295  23.059  1.00 9.66   ? 50   LEU C O   1 
ATOM   3997  C CB  . LEU E 1 50  ? 39.291  27.937  23.393  1.00 1.64   ? 50   LEU C CB  1 
ATOM   3998  C CG  . LEU E 1 50  ? 40.308  26.881  23.028  1.00 3.51   ? 50   LEU C CG  1 
ATOM   3999  C CD1 . LEU E 1 50  ? 41.094  26.412  24.251  1.00 1.06   ? 50   LEU C CD1 1 
ATOM   4000  C CD2 . LEU E 1 50  ? 39.609  25.775  22.269  1.00 1.00   ? 50   LEU C CD2 1 
ATOM   4001  N N   . LEU E 1 51  ? 36.304  29.371  22.167  1.00 8.04   ? 51   LEU C N   1 
ATOM   4002  C CA  . LEU E 1 51  ? 35.414  30.488  22.399  1.00 1.52   ? 51   LEU C CA  1 
ATOM   4003  C C   . LEU E 1 51  ? 35.532  31.051  23.758  1.00 10.02  ? 51   LEU C C   1 
ATOM   4004  O O   . LEU E 1 51  ? 35.521  32.252  23.917  1.00 21.73  ? 51   LEU C O   1 
ATOM   4005  C CB  . LEU E 1 51  ? 33.968  30.060  22.144  1.00 1.31   ? 51   LEU C CB  1 
ATOM   4006  C CG  . LEU E 1 51  ? 32.911  31.142  22.370  1.00 7.53   ? 51   LEU C CG  1 
ATOM   4007  C CD1 . LEU E 1 51  ? 33.122  32.259  21.360  1.00 1.00   ? 51   LEU C CD1 1 
ATOM   4008  C CD2 . LEU E 1 51  ? 31.464  30.649  22.198  1.00 1.00   ? 51   LEU C CD2 1 
ATOM   4009  N N   . PHE E 1 52  ? 35.653  30.172  24.743  1.00 9.94   ? 52   PHE C N   1 
ATOM   4010  C CA  . PHE E 1 52  ? 35.719  30.630  26.124  1.00 7.21   ? 52   PHE C CA  1 
ATOM   4011  C C   . PHE E 1 52  ? 37.000  30.190  26.772  1.00 11.24  ? 52   PHE C C   1 
ATOM   4012  O O   . PHE E 1 52  ? 37.051  30.080  27.978  1.00 6.58   ? 52   PHE C O   1 
ATOM   4013  C CB  . PHE E 1 52  ? 34.508  30.251  27.000  1.00 1.00   ? 52   PHE C CB  1 
ATOM   4014  C CG  . PHE E 1 52  ? 33.183  30.863  26.561  1.00 2.96   ? 52   PHE C CG  1 
ATOM   4015  C CD1 . PHE E 1 52  ? 32.951  32.234  26.621  1.00 7.87   ? 52   PHE C CD1 1 
ATOM   4016  C CD2 . PHE E 1 52  ? 32.130  30.069  26.101  1.00 6.49   ? 52   PHE C CD2 1 
ATOM   4017  C CE1 . PHE E 1 52  ? 31.754  32.805  26.184  1.00 6.37   ? 52   PHE C CE1 1 
ATOM   4018  C CE2 . PHE E 1 52  ? 30.915  30.600  25.672  1.00 6.34   ? 52   PHE C CE2 1 
ATOM   4019  C CZ  . PHE E 1 52  ? 30.745  31.984  25.694  1.00 5.29   ? 52   PHE C CZ  1 
ATOM   4020  N N   . GLN E 1 53  ? 37.985  29.852  25.953  1.00 5.74   ? 53   GLN C N   1 
ATOM   4021  C CA  . GLN E 1 53  ? 39.263  29.459  26.487  1.00 5.09   ? 53   GLN C CA  1 
ATOM   4022  C C   . GLN E 1 53  ? 39.313  28.112  27.130  1.00 13.57  ? 53   GLN C C   1 
ATOM   4023  O O   . GLN E 1 53  ? 40.301  27.771  27.743  1.00 14.23  ? 53   GLN C O   1 
ATOM   4024  C CB  . GLN E 1 53  ? 39.814  30.523  27.433  1.00 3.56   ? 53   GLN C CB  1 
ATOM   4025  C CG  . GLN E 1 53  ? 39.819  31.986  26.837  1.00 13.24  ? 53   GLN C CG  1 
ATOM   4026  C CD  . GLN E 1 53  ? 40.707  32.193  25.608  1.00 42.24  ? 53   GLN C CD  1 
ATOM   4027  O OE1 . GLN E 1 53  ? 41.702  32.918  25.677  1.00 114.27 ? 53   GLN C OE1 1 
ATOM   4028  N NE2 . GLN E 1 53  ? 40.403  31.555  24.482  1.00 50.32  ? 53   GLN C NE2 1 
ATOM   4029  N N   . GLN E 1 54  ? 38.268  27.332  26.952  1.00 11.15  ? 54   GLN C N   1 
ATOM   4030  C CA  . GLN E 1 54  ? 38.318  26.035  27.529  1.00 11.09  ? 54   GLN C CA  1 
ATOM   4031  C C   . GLN E 1 54  ? 37.984  25.024  26.507  1.00 14.96  ? 54   GLN C C   1 
ATOM   4032  O O   . GLN E 1 54  ? 37.472  25.397  25.450  1.00 10.27  ? 54   GLN C O   1 
ATOM   4033  C CB  . GLN E 1 54  ? 37.137  25.872  28.449  1.00 9.52   ? 54   GLN C CB  1 
ATOM   4034  C CG  . GLN E 1 54  ? 37.173  26.968  29.486  1.00 12.31  ? 54   GLN C CG  1 
ATOM   4035  C CD  . GLN E 1 54  ? 35.887  27.089  30.242  1.00 1.00   ? 54   GLN C CD  1 
ATOM   4036  O OE1 . GLN E 1 54  ? 34.852  27.548  29.702  1.00 45.37  ? 54   GLN C OE1 1 
ATOM   4037  N NE2 . GLN E 1 54  ? 35.914  26.568  31.457  1.00 19.84  ? 54   GLN C NE2 1 
ATOM   4038  N N   . VAL E 1 55  ? 38.265  23.782  26.909  1.00 10.42  ? 55   VAL C N   1 
ATOM   4039  C CA  . VAL E 1 55  ? 37.928  22.544  26.241  1.00 9.57   ? 55   VAL C CA  1 
ATOM   4040  C C   . VAL E 1 55  ? 36.939  21.808  27.180  1.00 14.69  ? 55   VAL C C   1 
ATOM   4041  O O   . VAL E 1 55  ? 36.857  22.018  28.404  1.00 8.70   ? 55   VAL C O   1 
ATOM   4042  C CB  . VAL E 1 55  ? 39.134  21.649  25.965  1.00 8.03   ? 55   VAL C CB  1 
ATOM   4043  C CG1 . VAL E 1 55  ? 39.944  22.247  24.860  1.00 3.46   ? 55   VAL C CG1 1 
ATOM   4044  C CG2 . VAL E 1 55  ? 39.999  21.500  27.207  1.00 4.29   ? 55   VAL C CG2 1 
ATOM   4045  N N   . PRO E 1 56  ? 36.120  20.927  26.655  1.00 11.30  ? 56   PRO C N   1 
ATOM   4046  C CA  . PRO E 1 56  ? 36.115  20.476  25.291  1.00 4.11   ? 56   PRO C CA  1 
ATOM   4047  C C   . PRO E 1 56  ? 35.845  21.467  24.237  1.00 9.83   ? 56   PRO C C   1 
ATOM   4048  O O   . PRO E 1 56  ? 34.962  22.301  24.349  1.00 19.45  ? 56   PRO C O   1 
ATOM   4049  C CB  . PRO E 1 56  ? 34.895  19.521  25.237  1.00 1.00   ? 56   PRO C CB  1 
ATOM   4050  C CG  . PRO E 1 56  ? 34.588  19.136  26.663  1.00 4.11   ? 56   PRO C CG  1 
ATOM   4051  C CD  . PRO E 1 56  ? 35.447  19.967  27.597  1.00 3.84   ? 56   PRO C CD  1 
ATOM   4052  N N   . MET E 1 57  ? 36.490  21.249  23.114  1.00 5.04   ? 57   MET C N   1 
ATOM   4053  C CA  . MET E 1 57  ? 36.180  21.982  21.884  1.00 3.72   ? 57   MET C CA  1 
ATOM   4054  C C   . MET E 1 57  ? 36.189  20.916  20.800  1.00 5.29   ? 57   MET C C   1 
ATOM   4055  O O   . MET E 1 57  ? 37.006  19.998  20.792  1.00 10.86  ? 57   MET C O   1 
ATOM   4056  C CB  . MET E 1 57  ? 37.156  23.098  21.505  1.00 5.14   ? 57   MET C CB  1 
ATOM   4057  C CG  . MET E 1 57  ? 36.641  23.855  20.319  1.00 11.13  ? 57   MET C CG  1 
ATOM   4058  S SD  . MET E 1 57  ? 37.161  23.219  18.712  1.00 16.68  ? 57   MET C SD  1 
ATOM   4059  C CE  . MET E 1 57  ? 38.839  23.818  18.810  1.00 5.94   ? 57   MET C CE  1 
ATOM   4060  N N   . VAL E 1 58  ? 35.254  20.981  19.925  1.00 2.32   ? 58   VAL C N   1 
ATOM   4061  C CA  . VAL E 1 58  ? 35.171  20.023  18.853  1.00 2.31   ? 58   VAL C CA  1 
ATOM   4062  C C   . VAL E 1 58  ? 34.941  20.783  17.568  1.00 12.78  ? 58   VAL C C   1 
ATOM   4063  O O   . VAL E 1 58  ? 34.069  21.677  17.477  1.00 11.53  ? 58   VAL C O   1 
ATOM   4064  C CB  . VAL E 1 58  ? 33.956  19.155  19.080  1.00 4.17   ? 58   VAL C CB  1 
ATOM   4065  C CG1 . VAL E 1 58  ? 33.600  18.335  17.840  1.00 2.31   ? 58   VAL C CG1 1 
ATOM   4066  C CG2 . VAL E 1 58  ? 34.272  18.278  20.246  1.00 5.34   ? 58   VAL C CG2 1 
ATOM   4067  N N   . GLU E 1 59  ? 35.751  20.431  16.593  1.00 12.32  ? 59   GLU C N   1 
ATOM   4068  C CA  . GLU E 1 59  ? 35.607  21.074  15.311  1.00 10.70  ? 59   GLU C CA  1 
ATOM   4069  C C   . GLU E 1 59  ? 34.775  20.230  14.444  1.00 17.16  ? 59   GLU C C   1 
ATOM   4070  O O   . GLU E 1 59  ? 35.173  19.140  14.063  1.00 22.45  ? 59   GLU C O   1 
ATOM   4071  C CB  . GLU E 1 59  ? 36.877  21.259  14.545  1.00 9.62   ? 59   GLU C CB  1 
ATOM   4072  C CG  . GLU E 1 59  ? 38.015  21.933  15.310  1.00 29.96  ? 59   GLU C CG  1 
ATOM   4073  C CD  . GLU E 1 59  ? 39.187  22.226  14.384  1.00 5.94   ? 59   GLU C CD  1 
ATOM   4074  O OE1 . GLU E 1 59  ? 39.079  22.907  13.364  1.00 138.83 ? 59   GLU C OE1 1 
ATOM   4075  O OE2 . GLU E 1 59  ? 40.298  21.640  14.785  1.00 37.35  ? 59   GLU C OE2 1 
ATOM   4076  N N   . ILE E 1 60  ? 33.644  20.772  14.122  1.00 10.44  ? 60   ILE C N   1 
ATOM   4077  C CA  . ILE E 1 60  ? 32.719  20.047  13.334  1.00 7.52   ? 60   ILE C CA  1 
ATOM   4078  C C   . ILE E 1 60  ? 31.871  20.960  12.463  1.00 12.99  ? 60   ILE C C   1 
ATOM   4079  O O   . ILE E 1 60  ? 31.432  22.042  12.850  1.00 18.91  ? 60   ILE C O   1 
ATOM   4080  C CB  . ILE E 1 60  ? 31.811  19.394  14.348  1.00 13.20  ? 60   ILE C CB  1 
ATOM   4081  C CG1 . ILE E 1 60  ? 30.793  18.584  13.622  1.00 13.74  ? 60   ILE C CG1 1 
ATOM   4082  C CG2 . ILE E 1 60  ? 31.085  20.484  15.144  1.00 13.67  ? 60   ILE C CG2 1 
ATOM   4083  C CD1 . ILE E 1 60  ? 30.047  17.624  14.527  1.00 4.78   ? 60   ILE C CD1 1 
ATOM   4084  N N   . ASP E 1 61  ? 31.632  20.499  11.260  1.00 13.05  ? 61   ASP C N   1 
ATOM   4085  C CA  . ASP E 1 61  ? 30.805  21.225  10.292  1.00 8.47   ? 61   ASP C CA  1 
ATOM   4086  C C   . ASP E 1 61  ? 31.203  22.646  10.128  1.00 16.67  ? 61   ASP C C   1 
ATOM   4087  O O   . ASP E 1 61  ? 30.369  23.552  9.965   1.00 22.10  ? 61   ASP C O   1 
ATOM   4088  C CB  . ASP E 1 61  ? 29.307  21.064  10.517  1.00 7.69   ? 61   ASP C CB  1 
ATOM   4089  C CG  . ASP E 1 61  ? 28.977  19.624  10.308  1.00 29.36  ? 61   ASP C CG  1 
ATOM   4090  O OD1 . ASP E 1 61  ? 29.789  18.799  9.866   1.00 47.71  ? 61   ASP C OD1 1 
ATOM   4091  O OD2 . ASP E 1 61  ? 27.870  19.306  10.907  1.00 16.19  ? 61   ASP C OD2 1 
ATOM   4092  N N   . GLY E 1 62  ? 32.516  22.790  10.190  1.00 16.28  ? 62   GLY C N   1 
ATOM   4093  C CA  . GLY E 1 62  ? 33.155  24.077  10.040  1.00 16.33  ? 62   GLY C CA  1 
ATOM   4094  C C   . GLY E 1 62  ? 33.108  24.984  11.240  1.00 27.86  ? 62   GLY C C   1 
ATOM   4095  O O   . GLY E 1 62  ? 33.506  26.137  11.119  1.00 31.80  ? 62   GLY C O   1 
ATOM   4096  N N   . MET E 1 63  ? 32.626  24.477  12.389  1.00 21.31  ? 63   MET C N   1 
ATOM   4097  C CA  . MET E 1 63  ? 32.563  25.279  13.565  1.00 10.03  ? 63   MET C CA  1 
ATOM   4098  C C   . MET E 1 63  ? 33.506  24.711  14.581  1.00 19.03  ? 63   MET C C   1 
ATOM   4099  O O   . MET E 1 63  ? 33.958  23.568  14.433  1.00 21.46  ? 63   MET C O   1 
ATOM   4100  C CB  . MET E 1 63  ? 31.153  25.213  14.112  1.00 9.48   ? 63   MET C CB  1 
ATOM   4101  C CG  . MET E 1 63  ? 30.106  25.684  13.120  1.00 9.21   ? 63   MET C CG  1 
ATOM   4102  S SD  . MET E 1 63  ? 28.532  24.847  13.329  1.00 21.16  ? 63   MET C SD  1 
ATOM   4103  C CE  . MET E 1 63  ? 27.524  26.157  14.105  1.00 25.93  ? 63   MET C CE  1 
ATOM   4104  N N   . LYS E 1 64  ? 33.761  25.521  15.596  1.00 11.90  ? 64   LYS C N   1 
ATOM   4105  C CA  . LYS E 1 64  ? 34.530  25.107  16.713  1.00 11.35  ? 64   LYS C CA  1 
ATOM   4106  C C   . LYS E 1 64  ? 33.621  25.188  17.922  1.00 16.18  ? 64   LYS C C   1 
ATOM   4107  O O   . LYS E 1 64  ? 33.596  26.169  18.648  1.00 16.69  ? 64   LYS C O   1 
ATOM   4108  C CB  . LYS E 1 64  ? 35.725  25.990  16.911  1.00 14.15  ? 64   LYS C CB  1 
ATOM   4109  C CG  . LYS E 1 64  ? 36.588  26.008  15.672  1.00 5.89   ? 64   LYS C CG  1 
ATOM   4110  C CD  . LYS E 1 64  ? 37.867  26.835  15.841  1.00 21.21  ? 64   LYS C CD  1 
ATOM   4111  C CE  . LYS E 1 64  ? 38.819  26.951  14.615  1.00 17.64  ? 64   LYS C CE  1 
ATOM   4112  N NZ  . LYS E 1 64  ? 39.520  28.280  14.514  1.00 57.04  ? 64   LYS C NZ  1 
ATOM   4113  N N   . LEU E 1 65  ? 32.865  24.165  18.139  1.00 7.70   ? 65   LEU C N   1 
ATOM   4114  C CA  . LEU E 1 65  ? 31.990  24.177  19.254  1.00 4.37   ? 65   LEU C CA  1 
ATOM   4115  C C   . LEU E 1 65  ? 32.712  23.845  20.502  1.00 6.56   ? 65   LEU C C   1 
ATOM   4116  O O   . LEU E 1 65  ? 33.629  23.033  20.467  1.00 12.20  ? 65   LEU C O   1 
ATOM   4117  C CB  . LEU E 1 65  ? 30.922  23.123  19.061  1.00 6.69   ? 65   LEU C CB  1 
ATOM   4118  C CG  . LEU E 1 65  ? 30.248  23.231  17.701  1.00 7.55   ? 65   LEU C CG  1 
ATOM   4119  C CD1 . LEU E 1 65  ? 29.097  22.298  17.656  1.00 1.00   ? 65   LEU C CD1 1 
ATOM   4120  C CD2 . LEU E 1 65  ? 29.664  24.600  17.503  1.00 1.40   ? 65   LEU C CD2 1 
ATOM   4121  N N   . VAL E 1 66  ? 32.225  24.492  21.571  1.00 1.00   ? 66   VAL C N   1 
ATOM   4122  C CA  . VAL E 1 66  ? 32.644  24.438  22.970  1.00 5.48   ? 66   VAL C CA  1 
ATOM   4123  C C   . VAL E 1 66  ? 31.440  24.234  23.915  1.00 11.95  ? 66   VAL C C   1 
ATOM   4124  O O   . VAL E 1 66  ? 30.301  24.419  23.523  1.00 3.67   ? 66   VAL C O   1 
ATOM   4125  C CB  . VAL E 1 66  ? 33.509  25.633  23.383  1.00 9.76   ? 66   VAL C CB  1 
ATOM   4126  C CG1 . VAL E 1 66  ? 34.659  25.760  22.405  1.00 15.83  ? 66   VAL C CG1 1 
ATOM   4127  C CG2 . VAL E 1 66  ? 32.720  26.917  23.360  1.00 1.21   ? 66   VAL C CG2 1 
ATOM   4128  N N   . GLN E 1 67  ? 31.679  23.809  25.172  1.00 11.12  ? 67   GLN C N   1 
ATOM   4129  C CA  . GLN E 1 67  ? 30.605  23.506  26.127  1.00 3.11   ? 67   GLN C CA  1 
ATOM   4130  C C   . GLN E 1 67  ? 30.049  22.181  25.790  1.00 10.31  ? 67   GLN C C   1 
ATOM   4131  O O   . GLN E 1 67  ? 29.319  22.030  24.794  1.00 11.82  ? 67   GLN C O   1 
ATOM   4132  C CB  . GLN E 1 67  ? 29.450  24.523  26.126  1.00 1.00   ? 67   GLN C CB  1 
ATOM   4133  C CG  . GLN E 1 67  ? 29.981  25.915  26.517  1.00 1.00   ? 67   GLN C CG  1 
ATOM   4134  C CD  . GLN E 1 67  ? 30.268  26.037  28.011  1.00 2.40   ? 67   GLN C CD  1 
ATOM   4135  O OE1 . GLN E 1 67  ? 29.737  25.217  28.796  1.00 19.99  ? 67   GLN C OE1 1 
ATOM   4136  N NE2 . GLN E 1 67  ? 31.106  27.018  28.397  1.00 14.45  ? 67   GLN C NE2 1 
ATOM   4137  N N   . THR E 1 68  ? 30.416  21.243  26.621  1.00 7.66   ? 68   THR C N   1 
ATOM   4138  C CA  . THR E 1 68  ? 29.966  19.870  26.441  1.00 5.71   ? 68   THR C CA  1 
ATOM   4139  C C   . THR E 1 68  ? 28.517  19.745  26.113  1.00 12.38  ? 68   THR C C   1 
ATOM   4140  O O   . THR E 1 68  ? 28.173  19.142  25.125  1.00 12.68  ? 68   THR C O   1 
ATOM   4141  C CB  . THR E 1 68  ? 30.220  19.128  27.728  1.00 4.93   ? 68   THR C CB  1 
ATOM   4142  O OG1 . THR E 1 68  ? 31.550  19.374  28.099  1.00 9.64   ? 68   THR C OG1 1 
ATOM   4143  C CG2 . THR E 1 68  ? 29.969  17.678  27.584  1.00 1.00   ? 68   THR C CG2 1 
ATOM   4144  N N   . ARG E 1 69  ? 27.644  20.359  26.899  1.00 12.11  ? 69   ARG C N   1 
ATOM   4145  C CA  . ARG E 1 69  ? 26.244  20.148  26.557  1.00 11.05  ? 69   ARG C CA  1 
ATOM   4146  C C   . ARG E 1 69  ? 25.812  20.663  25.213  1.00 13.17  ? 69   ARG C C   1 
ATOM   4147  O O   . ARG E 1 69  ? 24.924  20.136  24.563  1.00 15.74  ? 69   ARG C O   1 
ATOM   4148  C CB  . ARG E 1 69  ? 25.369  20.794  27.560  1.00 2.87   ? 69   ARG C CB  1 
ATOM   4149  C CG  . ARG E 1 69  ? 25.674  20.344  28.968  1.00 2.19   ? 69   ARG C CG  1 
ATOM   4150  C CD  . ARG E 1 69  ? 25.019  21.283  29.977  1.00 16.62  ? 69   ARG C CD  1 
ATOM   4151  N NE  . ARG E 1 69  ? 24.730  20.664  31.250  1.00 10.38  ? 69   ARG C NE  1 
ATOM   4152  C CZ  . ARG E 1 69  ? 25.735  20.308  32.023  1.00 32.64  ? 69   ARG C CZ  1 
ATOM   4153  N NH1 . ARG E 1 69  ? 26.952  20.562  31.608  1.00 27.33  ? 69   ARG C NH1 1 
ATOM   4154  N NH2 . ARG E 1 69  ? 25.558  19.609  33.148  1.00 22.95  ? 69   ARG C NH2 1 
ATOM   4155  N N   . SER E 1 70  ? 26.399  21.761  24.834  1.00 7.66   ? 70   SER C N   1 
ATOM   4156  C CA  . SER E 1 70  ? 26.041  22.416  23.597  1.00 3.53   ? 70   SER C CA  1 
ATOM   4157  C C   . SER E 1 70  ? 26.498  21.587  22.424  1.00 9.97   ? 70   SER C C   1 
ATOM   4158  O O   . SER E 1 70  ? 25.809  21.385  21.437  1.00 14.94  ? 70   SER C O   1 
ATOM   4159  C CB  . SER E 1 70  ? 26.633  23.790  23.619  1.00 1.00   ? 70   SER C CB  1 
ATOM   4160  O OG  . SER E 1 70  ? 26.211  24.480  24.797  1.00 15.34  ? 70   SER C OG  1 
ATOM   4161  N N   . ILE E 1 71  ? 27.646  21.020  22.628  1.00 4.81   ? 71   ILE C N   1 
ATOM   4162  C CA  . ILE E 1 71  ? 28.202  20.138  21.660  1.00 3.49   ? 71   ILE C CA  1 
ATOM   4163  C C   . ILE E 1 71  ? 27.308  18.912  21.480  1.00 9.08   ? 71   ILE C C   1 
ATOM   4164  O O   . ILE E 1 71  ? 26.946  18.526  20.382  1.00 13.77  ? 71   ILE C O   1 
ATOM   4165  C CB  . ILE E 1 71  ? 29.569  19.679  22.093  1.00 2.60   ? 71   ILE C CB  1 
ATOM   4166  C CG1 . ILE E 1 71  ? 30.656  20.786  22.107  1.00 2.12   ? 71   ILE C CG1 1 
ATOM   4167  C CG2 . ILE E 1 71  ? 29.879  18.691  21.060  1.00 1.00   ? 71   ILE C CG2 1 
ATOM   4168  C CD1 . ILE E 1 71  ? 31.918  20.382  22.879  1.00 1.00   ? 71   ILE C CD1 1 
ATOM   4169  N N   . LEU E 1 72  ? 26.918  18.311  22.577  1.00 6.18   ? 72   LEU C N   1 
ATOM   4170  C CA  . LEU E 1 72  ? 26.056  17.130  22.559  1.00 4.76   ? 72   LEU C CA  1 
ATOM   4171  C C   . LEU E 1 72  ? 24.769  17.438  21.901  1.00 4.66   ? 72   LEU C C   1 
ATOM   4172  O O   . LEU E 1 72  ? 24.307  16.688  21.088  1.00 11.07  ? 72   LEU C O   1 
ATOM   4173  C CB  . LEU E 1 72  ? 25.757  16.592  23.970  1.00 7.63   ? 72   LEU C CB  1 
ATOM   4174  C CG  . LEU E 1 72  ? 26.980  16.079  24.713  1.00 3.60   ? 72   LEU C CG  1 
ATOM   4175  C CD1 . LEU E 1 72  ? 26.612  15.599  26.102  1.00 1.00   ? 72   LEU C CD1 1 
ATOM   4176  C CD2 . LEU E 1 72  ? 27.611  14.968  23.929  1.00 1.00   ? 72   LEU C CD2 1 
ATOM   4177  N N   . HIS E 1 73  ? 24.151  18.547  22.222  1.00 7.74   ? 73   HIS C N   1 
ATOM   4178  C CA  . HIS E 1 73  ? 22.892  18.874  21.515  1.00 3.88   ? 73   HIS C CA  1 
ATOM   4179  C C   . HIS E 1 73  ? 23.111  19.012  20.026  1.00 11.84  ? 73   HIS C C   1 
ATOM   4180  O O   . HIS E 1 73  ? 22.278  18.625  19.214  1.00 12.42  ? 73   HIS C O   1 
ATOM   4181  C CB  . HIS E 1 73  ? 22.394  20.236  21.932  1.00 1.00   ? 73   HIS C CB  1 
ATOM   4182  C CG  . HIS E 1 73  ? 22.129  20.301  23.391  1.00 6.41   ? 73   HIS C CG  1 
ATOM   4183  N ND1 . HIS E 1 73  ? 22.158  21.461  24.113  1.00 9.52   ? 73   HIS C ND1 1 
ATOM   4184  C CD2 . HIS E 1 73  ? 21.796  19.326  24.236  1.00 12.04  ? 73   HIS C CD2 1 
ATOM   4185  C CE1 . HIS E 1 73  ? 21.860  21.177  25.355  1.00 10.29  ? 73   HIS C CE1 1 
ATOM   4186  N NE2 . HIS E 1 73  ? 21.622  19.895  25.461  1.00 12.17  ? 73   HIS C NE2 1 
ATOM   4187  N N   . TYR E 1 74  ? 24.214  19.636  19.628  1.00 8.27   ? 74   TYR C N   1 
ATOM   4188  C CA  . TYR E 1 74  ? 24.397  19.787  18.193  1.00 9.83   ? 74   TYR C CA  1 
ATOM   4189  C C   . TYR E 1 74  ? 24.412  18.432  17.492  1.00 14.80  ? 74   TYR C C   1 
ATOM   4190  O O   . TYR E 1 74  ? 23.669  18.182  16.536  1.00 13.02  ? 74   TYR C O   1 
ATOM   4191  C CB  . TYR E 1 74  ? 25.677  20.583  17.852  1.00 9.69   ? 74   TYR C CB  1 
ATOM   4192  C CG  . TYR E 1 74  ? 25.927  20.702  16.368  1.00 11.22  ? 74   TYR C CG  1 
ATOM   4193  C CD1 . TYR E 1 74  ? 25.170  21.562  15.578  1.00 11.17  ? 74   TYR C CD1 1 
ATOM   4194  C CD2 . TYR E 1 74  ? 26.928  19.968  15.725  1.00 12.41  ? 74   TYR C CD2 1 
ATOM   4195  C CE1 . TYR E 1 74  ? 25.410  21.665  14.208  1.00 10.74  ? 74   TYR C CE1 1 
ATOM   4196  C CE2 . TYR E 1 74  ? 27.120  19.986  14.342  1.00 9.64   ? 74   TYR C CE2 1 
ATOM   4197  C CZ  . TYR E 1 74  ? 26.360  20.865  13.571  1.00 19.86  ? 74   TYR C CZ  1 
ATOM   4198  O OH  . TYR E 1 74  ? 26.558  20.971  12.195  1.00 17.49  ? 74   TYR C OH  1 
ATOM   4199  N N   . ILE E 1 75  ? 25.236  17.540  18.028  1.00 4.94   ? 75   ILE C N   1 
ATOM   4200  C CA  . ILE E 1 75  ? 25.339  16.257  17.404  1.00 4.38   ? 75   ILE C CA  1 
ATOM   4201  C C   . ILE E 1 75  ? 24.037  15.532  17.390  1.00 15.50  ? 75   ILE C C   1 
ATOM   4202  O O   . ILE E 1 75  ? 23.675  14.951  16.410  1.00 18.12  ? 75   ILE C O   1 
ATOM   4203  C CB  . ILE E 1 75  ? 26.390  15.472  18.112  1.00 7.14   ? 75   ILE C CB  1 
ATOM   4204  C CG1 . ILE E 1 75  ? 27.704  16.256  18.016  1.00 8.39   ? 75   ILE C CG1 1 
ATOM   4205  C CG2 . ILE E 1 75  ? 26.518  14.093  17.512  1.00 2.67   ? 75   ILE C CG2 1 
ATOM   4206  C CD1 . ILE E 1 75  ? 28.779  15.691  18.944  1.00 9.74   ? 75   ILE C CD1 1 
ATOM   4207  N N   . ALA E 1 76  ? 23.336  15.576  18.500  1.00 8.97   ? 76   ALA C N   1 
ATOM   4208  C CA  . ALA E 1 76  ? 22.088  14.883  18.605  1.00 6.89   ? 76   ALA C CA  1 
ATOM   4209  C C   . ALA E 1 76  ? 21.157  15.358  17.538  1.00 14.31  ? 76   ALA C C   1 
ATOM   4210  O O   . ALA E 1 76  ? 20.509  14.621  16.861  1.00 16.32  ? 76   ALA C O   1 
ATOM   4211  C CB  . ALA E 1 76  ? 21.458  15.125  19.972  1.00 7.25   ? 76   ALA C CB  1 
ATOM   4212  N N   . ASP E 1 77  ? 21.095  16.625  17.411  1.00 12.04  ? 77   ASP C N   1 
ATOM   4213  C CA  . ASP E 1 77  ? 20.229  17.220  16.444  1.00 8.15   ? 77   ASP C CA  1 
ATOM   4214  C C   . ASP E 1 77  ? 20.688  16.937  15.033  1.00 20.17  ? 77   ASP C C   1 
ATOM   4215  O O   . ASP E 1 77  ? 19.897  16.916  14.127  1.00 27.38  ? 77   ASP C O   1 
ATOM   4216  C CB  . ASP E 1 77  ? 20.163  18.731  16.693  1.00 1.30   ? 77   ASP C CB  1 
ATOM   4217  C CG  . ASP E 1 77  ? 18.923  19.089  17.463  1.00 15.64  ? 77   ASP C CG  1 
ATOM   4218  O OD1 . ASP E 1 77  ? 17.961  18.320  17.600  1.00 25.53  ? 77   ASP C OD1 1 
ATOM   4219  O OD2 . ASP E 1 77  ? 18.986  20.303  17.961  1.00 25.03  ? 77   ASP C OD2 1 
ATOM   4220  N N   . LYS E 1 78  ? 21.962  16.744  14.809  1.00 13.84  ? 78   LYS C N   1 
ATOM   4221  C CA  . LYS E 1 78  ? 22.352  16.399  13.461  1.00 8.75   ? 78   LYS C CA  1 
ATOM   4222  C C   . LYS E 1 78  ? 22.114  14.907  13.279  1.00 21.37  ? 78   LYS C C   1 
ATOM   4223  O O   . LYS E 1 78  ? 22.343  14.374  12.226  1.00 25.64  ? 78   LYS C O   1 
ATOM   4224  C CB  . LYS E 1 78  ? 23.863  16.561  13.194  1.00 6.78   ? 78   LYS C CB  1 
ATOM   4225  C CG  . LYS E 1 78  ? 24.319  17.979  13.251  1.00 40.33  ? 78   LYS C CG  1 
ATOM   4226  C CD  . LYS E 1 78  ? 23.405  18.864  12.433  1.00 42.81  ? 78   LYS C CD  1 
ATOM   4227  C CE  . LYS E 1 78  ? 23.748  18.908  10.939  1.00 47.35  ? 78   LYS C CE  1 
ATOM   4228  N NZ  . LYS E 1 78  ? 22.699  19.531  10.099  1.00 69.76  ? 78   LYS C NZ  1 
ATOM   4229  N N   . HIS E 1 79  ? 21.801  14.157  14.309  1.00 16.29  ? 79   HIS C N   1 
ATOM   4230  C CA  . HIS E 1 79  ? 21.713  12.751  14.021  1.00 10.72  ? 79   HIS C CA  1 
ATOM   4231  C C   . HIS E 1 79  ? 20.527  12.025  14.549  1.00 14.66  ? 79   HIS C C   1 
ATOM   4232  O O   . HIS E 1 79  ? 20.675  10.872  14.934  1.00 6.93   ? 79   HIS C O   1 
ATOM   4233  C CB  . HIS E 1 79  ? 22.903  12.019  14.548  1.00 10.30  ? 79   HIS C CB  1 
ATOM   4234  C CG  . HIS E 1 79  ? 24.093  12.319  13.754  1.00 20.66  ? 79   HIS C CG  1 
ATOM   4235  N ND1 . HIS E 1 79  ? 24.981  13.293  14.148  1.00 29.24  ? 79   HIS C ND1 1 
ATOM   4236  C CD2 . HIS E 1 79  ? 24.565  11.762  12.618  1.00 21.04  ? 79   HIS C CD2 1 
ATOM   4237  C CE1 . HIS E 1 79  ? 25.983  13.314  13.256  1.00 23.80  ? 79   HIS C CE1 1 
ATOM   4238  N NE2 . HIS E 1 79  ? 25.749  12.403  12.340  1.00 19.97  ? 79   HIS C NE2 1 
ATOM   4239  N N   . ASN E 1 80  ? 19.387  12.693  14.600  1.00 17.51  ? 80   ASN C N   1 
ATOM   4240  C CA  . ASN E 1 80  ? 18.238  12.028  15.127  1.00 17.97  ? 80   ASN C CA  1 
ATOM   4241  C C   . ASN E 1 80  ? 18.380  11.411  16.499  1.00 23.47  ? 80   ASN C C   1 
ATOM   4242  O O   . ASN E 1 80  ? 17.823  10.337  16.775  1.00 33.09  ? 80   ASN C O   1 
ATOM   4243  C CB  . ASN E 1 80  ? 17.750  10.979  14.145  1.00 22.81  ? 80   ASN C CB  1 
ATOM   4244  C CG  . ASN E 1 80  ? 16.348  10.529  14.405  1.00 56.00  ? 80   ASN C CG  1 
ATOM   4245  O OD1 . ASN E 1 80  ? 16.122  9.315   14.428  1.00 61.63  ? 80   ASN C OD1 1 
ATOM   4246  N ND2 . ASN E 1 80  ? 15.416  11.489  14.515  1.00 50.44  ? 80   ASN C ND2 1 
ATOM   4247  N N   . LEU E 1 81  ? 19.085  12.085  17.384  1.00 17.49  ? 81   LEU C N   1 
ATOM   4248  C CA  . LEU E 1 81  ? 19.189  11.537  18.722  1.00 12.09  ? 81   LEU C CA  1 
ATOM   4249  C C   . LEU E 1 81  ? 18.486  12.448  19.686  1.00 9.79   ? 81   LEU C C   1 
ATOM   4250  O O   . LEU E 1 81  ? 18.681  12.323  20.879  1.00 9.64   ? 81   LEU C O   1 
ATOM   4251  C CB  . LEU E 1 81  ? 20.613  11.347  19.185  1.00 6.52   ? 81   LEU C CB  1 
ATOM   4252  C CG  . LEU E 1 81  ? 21.375  10.440  18.268  1.00 4.24   ? 81   LEU C CG  1 
ATOM   4253  C CD1 . LEU E 1 81  ? 22.879  10.594  18.581  1.00 2.56   ? 81   LEU C CD1 1 
ATOM   4254  C CD2 . LEU E 1 81  ? 21.034  9.047   18.694  1.00 1.00   ? 81   LEU C CD2 1 
ATOM   4255  N N   . PHE E 1 82  ? 17.663  13.335  19.155  1.00 7.16   ? 82   PHE C N   1 
ATOM   4256  C CA  . PHE E 1 82  ? 16.970  14.338  20.004  1.00 7.97   ? 82   PHE C CA  1 
ATOM   4257  C C   . PHE E 1 82  ? 15.456  14.318  19.957  1.00 16.81  ? 82   PHE C C   1 
ATOM   4258  O O   . PHE E 1 82  ? 14.773  15.330  20.185  1.00 19.23  ? 82   PHE C O   1 
ATOM   4259  C CB  . PHE E 1 82  ? 17.453  15.774  19.751  1.00 4.68   ? 82   PHE C CB  1 
ATOM   4260  C CG  . PHE E 1 82  ? 17.773  16.525  21.002  1.00 9.05   ? 82   PHE C CG  1 
ATOM   4261  C CD1 . PHE E 1 82  ? 17.043  16.327  22.183  1.00 15.06  ? 82   PHE C CD1 1 
ATOM   4262  C CD2 . PHE E 1 82  ? 18.806  17.465  21.006  1.00 10.50  ? 82   PHE C CD2 1 
ATOM   4263  C CE1 . PHE E 1 82  ? 17.284  17.035  23.364  1.00 9.59   ? 82   PHE C CE1 1 
ATOM   4264  C CE2 . PHE E 1 82  ? 19.049  18.197  22.167  1.00 11.51  ? 82   PHE C CE2 1 
ATOM   4265  C CZ  . PHE E 1 82  ? 18.307  17.985  23.339  1.00 7.34   ? 82   PHE C CZ  1 
ATOM   4266  N N   . GLY E 1 83  ? 14.924  13.146  19.670  1.00 16.51  ? 83   GLY C N   1 
ATOM   4267  C CA  . GLY E 1 83  ? 13.498  13.038  19.634  1.00 18.16  ? 83   GLY C CA  1 
ATOM   4268  C C   . GLY E 1 83  ? 12.930  13.436  18.299  1.00 19.47  ? 83   GLY C C   1 
ATOM   4269  O O   . GLY E 1 83  ? 13.692  13.652  17.361  1.00 16.68  ? 83   GLY C O   1 
ATOM   4270  N N   . LYS E 1 84  ? 11.602  13.532  18.271  1.00 16.34  ? 84   LYS C N   1 
ATOM   4271  C CA  . LYS E 1 84  ? 10.829  13.847  17.081  1.00 15.03  ? 84   LYS C CA  1 
ATOM   4272  C C   . LYS E 1 84  ? 9.872   14.982  17.341  1.00 25.33  ? 84   LYS C C   1 
ATOM   4273  O O   . LYS E 1 84  ? 9.243   15.521  16.453  1.00 23.09  ? 84   LYS C O   1 
ATOM   4274  C CB  . LYS E 1 84  ? 10.214  12.602  16.418  1.00 10.79  ? 84   LYS C CB  1 
ATOM   4275  C CG  . LYS E 1 84  ? 11.392  11.755  15.909  1.00 32.78  ? 84   LYS C CG  1 
ATOM   4276  C CD  . LYS E 1 84  ? 11.094  10.653  14.895  1.00 30.09  ? 84   LYS C CD  1 
ATOM   4277  C CE  . LYS E 1 84  ? 12.246  10.293  13.940  1.00 51.57  ? 84   LYS C CE  1 
ATOM   4278  N NZ  . LYS E 1 84  ? 12.024  9.021   13.198  1.00 126.63 ? 84   LYS C NZ  1 
ATOM   4279  N N   . ASN E 1 85  ? 9.885   15.459  18.571  1.00 25.00  ? 85   ASN C N   1 
ATOM   4280  C CA  . ASN E 1 85  ? 9.056   16.590  18.885  1.00 19.70  ? 85   ASN C CA  1 
ATOM   4281  C C   . ASN E 1 85  ? 9.411   17.228  20.228  1.00 22.04  ? 85   ASN C C   1 
ATOM   4282  O O   . ASN E 1 85  ? 10.113  16.628  21.041  1.00 31.75  ? 85   ASN C O   1 
ATOM   4283  C CB  . ASN E 1 85  ? 7.591   16.157  18.770  1.00 10.80  ? 85   ASN C CB  1 
ATOM   4284  C CG  . ASN E 1 85  ? 7.178   15.283  19.920  1.00 18.33  ? 85   ASN C CG  1 
ATOM   4285  O OD1 . ASN E 1 85  ? 7.304   15.637  21.100  1.00 71.35  ? 85   ASN C OD1 1 
ATOM   4286  N ND2 . ASN E 1 85  ? 6.862   14.075  19.583  1.00 19.54  ? 85   ASN C ND2 1 
ATOM   4287  N N   . LEU E 1 86  ? 8.860   18.419  20.491  1.00 13.64  ? 86   LEU C N   1 
ATOM   4288  C CA  . LEU E 1 86  ? 9.134   19.144  21.720  1.00 7.94   ? 86   LEU C CA  1 
ATOM   4289  C C   . LEU E 1 86  ? 9.001   18.317  22.971  1.00 14.84  ? 86   LEU C C   1 
ATOM   4290  O O   . LEU E 1 86  ? 9.828   18.376  23.891  1.00 20.25  ? 86   LEU C O   1 
ATOM   4291  C CB  . LEU E 1 86  ? 8.276   20.397  21.867  1.00 4.53   ? 86   LEU C CB  1 
ATOM   4292  C CG  . LEU E 1 86  ? 8.792   21.330  22.949  1.00 10.05  ? 86   LEU C CG  1 
ATOM   4293  C CD1 . LEU E 1 86  ? 10.266  21.530  22.769  1.00 13.10  ? 86   LEU C CD1 1 
ATOM   4294  C CD2 . LEU E 1 86  ? 8.197   22.697  22.806  1.00 8.38   ? 86   LEU C CD2 1 
ATOM   4295  N N   . LYS E 1 87  ? 7.941   17.541  22.983  1.00 12.86  ? 87   LYS C N   1 
ATOM   4296  C CA  . LYS E 1 87  ? 7.653   16.713  24.142  1.00 16.47  ? 87   LYS C CA  1 
ATOM   4297  C C   . LYS E 1 87  ? 8.767   15.787  24.472  1.00 17.63  ? 87   LYS C C   1 
ATOM   4298  O O   . LYS E 1 87  ? 9.211   15.751  25.605  1.00 27.41  ? 87   LYS C O   1 
ATOM   4299  C CB  . LYS E 1 87  ? 6.256   16.107  24.153  1.00 18.47  ? 87   LYS C CB  1 
ATOM   4300  C CG  . LYS E 1 87  ? 5.207   17.224  23.999  1.00 136.90 ? 87   LYS C CG  1 
ATOM   4301  C CD  . LYS E 1 87  ? 5.534   18.528  24.772  1.00 174.68 ? 87   LYS C CD  1 
ATOM   4302  C CE  . LYS E 1 87  ? 4.694   19.766  24.379  1.00 151.33 ? 87   LYS C CE  1 
ATOM   4303  N NZ  . LYS E 1 87  ? 4.830   20.965  25.258  1.00 58.97  ? 87   LYS C NZ  1 
ATOM   4304  N N   . GLU E 1 88  ? 9.201   15.104  23.444  1.00 8.70   ? 88   GLU C N   1 
ATOM   4305  C CA  . GLU E 1 88  ? 10.293  14.178  23.512  1.00 11.62  ? 88   GLU C CA  1 
ATOM   4306  C C   . GLU E 1 88  ? 11.566  14.867  23.865  1.00 18.30  ? 88   GLU C C   1 
ATOM   4307  O O   . GLU E 1 88  ? 12.288  14.484  24.778  1.00 23.26  ? 88   GLU C O   1 
ATOM   4308  C CB  . GLU E 1 88  ? 10.487  13.517  22.134  1.00 14.39  ? 88   GLU C CB  1 
ATOM   4309  C CG  . GLU E 1 88  ? 9.321   12.563  21.808  1.00 5.07   ? 88   GLU C CG  1 
ATOM   4310  C CD  . GLU E 1 88  ? 9.399   11.680  20.574  1.00 21.29  ? 88   GLU C CD  1 
ATOM   4311  O OE1 . GLU E 1 88  ? 10.392  11.499  19.814  1.00 20.61  ? 88   GLU C OE1 1 
ATOM   4312  O OE2 . GLU E 1 88  ? 8.296   10.953  20.536  1.00 24.75  ? 88   GLU C OE2 1 
ATOM   4313  N N   . ARG E 1 89  ? 11.850  15.855  23.060  1.00 10.56  ? 89   ARG C N   1 
ATOM   4314  C CA  . ARG E 1 89  ? 13.029  16.649  23.206  1.00 9.51   ? 89   ARG C CA  1 
ATOM   4315  C C   . ARG E 1 89  ? 13.132  17.116  24.628  1.00 9.97   ? 89   ARG C C   1 
ATOM   4316  O O   . ARG E 1 89  ? 14.159  17.043  25.314  1.00 10.78  ? 89   ARG C O   1 
ATOM   4317  C CB  . ARG E 1 89  ? 12.815  17.871  22.401  1.00 3.43   ? 89   ARG C CB  1 
ATOM   4318  C CG  . ARG E 1 89  ? 14.146  18.499  22.210  1.00 18.27  ? 89   ARG C CG  1 
ATOM   4319  C CD  . ARG E 1 89  ? 14.058  19.657  21.235  1.00 6.77   ? 89   ARG C CD  1 
ATOM   4320  N NE  . ARG E 1 89  ? 15.317  20.299  21.100  1.00 16.25  ? 89   ARG C NE  1 
ATOM   4321  C CZ  . ARG E 1 89  ? 16.204  20.066  20.163  1.00 15.11  ? 89   ARG C CZ  1 
ATOM   4322  N NH1 . ARG E 1 89  ? 15.968  19.207  19.170  1.00 14.64  ? 89   ARG C NH1 1 
ATOM   4323  N NH2 . ARG E 1 89  ? 17.370  20.729  20.265  1.00 33.37  ? 89   ARG C NH2 1 
ATOM   4324  N N   . THR E 1 90  ? 11.987  17.517  25.124  1.00 1.00   ? 90   THR C N   1 
ATOM   4325  C CA  . THR E 1 90  ? 11.975  17.967  26.524  1.00 1.00   ? 90   THR C CA  1 
ATOM   4326  C C   . THR E 1 90  ? 12.410  16.895  27.548  1.00 12.66  ? 90   THR C C   1 
ATOM   4327  O O   . THR E 1 90  ? 13.228  17.129  28.452  1.00 12.11  ? 90   THR C O   1 
ATOM   4328  C CB  . THR E 1 90  ? 10.644  18.619  26.841  1.00 11.57  ? 90   THR C CB  1 
ATOM   4329  O OG1 . THR E 1 90  ? 10.338  19.660  25.930  1.00 20.47  ? 90   THR C OG1 1 
ATOM   4330  C CG2 . THR E 1 90  ? 10.688  19.127  28.230  1.00 1.00   ? 90   THR C CG2 1 
ATOM   4331  N N   . LEU E 1 91  ? 11.917  15.665  27.343  1.00 5.25   ? 91   LEU C N   1 
ATOM   4332  C CA  . LEU E 1 91  ? 12.248  14.562  28.208  1.00 1.00   ? 91   LEU C CA  1 
ATOM   4333  C C   . LEU E 1 91  ? 13.690  14.194  28.136  1.00 9.46   ? 91   LEU C C   1 
ATOM   4334  O O   . LEU E 1 91  ? 14.366  14.015  29.137  1.00 13.34  ? 91   LEU C O   1 
ATOM   4335  C CB  . LEU E 1 91  ? 11.422  13.373  27.776  1.00 2.65   ? 91   LEU C CB  1 
ATOM   4336  C CG  . LEU E 1 91  ? 9.953   13.616  28.112  1.00 6.82   ? 91   LEU C CG  1 
ATOM   4337  C CD1 . LEU E 1 91  ? 9.078   12.548  27.550  1.00 2.85   ? 91   LEU C CD1 1 
ATOM   4338  C CD2 . LEU E 1 91  ? 9.729   13.526  29.588  1.00 1.00   ? 91   LEU C CD2 1 
ATOM   4339  N N   . ILE E 1 92  ? 14.146  14.086  26.917  1.00 6.98   ? 92   ILE C N   1 
ATOM   4340  C CA  . ILE E 1 92  ? 15.506  13.710  26.649  1.00 5.61   ? 92   ILE C CA  1 
ATOM   4341  C C   . ILE E 1 92  ? 16.417  14.696  27.300  1.00 12.34  ? 92   ILE C C   1 
ATOM   4342  O O   . ILE E 1 92  ? 17.404  14.336  27.927  1.00 16.34  ? 92   ILE C O   1 
ATOM   4343  C CB  . ILE E 1 92  ? 15.670  13.739  25.146  1.00 9.15   ? 92   ILE C CB  1 
ATOM   4344  C CG1 . ILE E 1 92  ? 14.793  12.642  24.581  1.00 9.09   ? 92   ILE C CG1 1 
ATOM   4345  C CG2 . ILE E 1 92  ? 17.110  13.591  24.691  1.00 4.91   ? 92   ILE C CG2 1 
ATOM   4346  C CD1 . ILE E 1 92  ? 14.967  12.411  23.105  1.00 7.16   ? 92   ILE C CD1 1 
ATOM   4347  N N   . ASP E 1 93  ? 16.038  15.960  27.185  1.00 5.23   ? 93   ASP C N   1 
ATOM   4348  C CA  . ASP E 1 93  ? 16.856  16.998  27.772  1.00 3.41   ? 93   ASP C CA  1 
ATOM   4349  C C   . ASP E 1 93  ? 16.999  16.833  29.282  1.00 13.46  ? 93   ASP C C   1 
ATOM   4350  O O   . ASP E 1 93  ? 18.108  16.737  29.854  1.00 8.81   ? 93   ASP C O   1 
ATOM   4351  C CB  . ASP E 1 93  ? 16.256  18.336  27.371  1.00 3.72   ? 93   ASP C CB  1 
ATOM   4352  C CG  . ASP E 1 93  ? 17.030  19.610  27.704  1.00 15.82  ? 93   ASP C CG  1 
ATOM   4353  O OD1 . ASP E 1 93  ? 18.072  19.629  28.310  1.00 13.84  ? 93   ASP C OD1 1 
ATOM   4354  O OD2 . ASP E 1 93  ? 16.449  20.691  27.214  1.00 24.47  ? 93   ASP C OD2 1 
ATOM   4355  N N   . MET E 1 94  ? 15.856  16.699  29.918  1.00 7.44   ? 94   MET C N   1 
ATOM   4356  C CA  . MET E 1 94  ? 15.910  16.519  31.325  1.00 1.95   ? 94   MET C CA  1 
ATOM   4357  C C   . MET E 1 94  ? 16.670  15.323  31.754  1.00 4.64   ? 94   MET C C   1 
ATOM   4358  O O   . MET E 1 94  ? 17.424  15.365  32.724  1.00 7.26   ? 94   MET C O   1 
ATOM   4359  C CB  . MET E 1 94  ? 14.517  16.387  31.828  1.00 4.75   ? 94   MET C CB  1 
ATOM   4360  C CG  . MET E 1 94  ? 13.692  17.680  31.707  1.00 9.41   ? 94   MET C CG  1 
ATOM   4361  S SD  . MET E 1 94  ? 11.974  17.447  32.374  1.00 14.86  ? 94   MET C SD  1 
ATOM   4362  C CE  . MET E 1 94  ? 12.446  18.356  33.847  1.00 13.63  ? 94   MET C CE  1 
ATOM   4363  N N   . TYR E 1 95  ? 16.461  14.235  31.038  1.00 3.29   ? 95   TYR C N   1 
ATOM   4364  C CA  . TYR E 1 95  ? 17.109  13.008  31.436  1.00 1.00   ? 95   TYR C CA  1 
ATOM   4365  C C   . TYR E 1 95  ? 18.579  13.187  31.371  1.00 6.98   ? 95   TYR C C   1 
ATOM   4366  O O   . TYR E 1 95  ? 19.364  12.823  32.230  1.00 7.33   ? 95   TYR C O   1 
ATOM   4367  C CB  . TYR E 1 95  ? 16.761  11.874  30.483  1.00 2.91   ? 95   TYR C CB  1 
ATOM   4368  C CG  . TYR E 1 95  ? 15.296  11.544  30.587  1.00 8.52   ? 95   TYR C CG  1 
ATOM   4369  C CD1 . TYR E 1 95  ? 14.572  12.075  31.650  1.00 4.73   ? 95   TYR C CD1 1 
ATOM   4370  C CD2 . TYR E 1 95  ? 14.628  10.688  29.693  1.00 10.51  ? 95   TYR C CD2 1 
ATOM   4371  C CE1 . TYR E 1 95  ? 13.210  11.787  31.761  1.00 6.52   ? 95   TYR C CE1 1 
ATOM   4372  C CE2 . TYR E 1 95  ? 13.266  10.367  29.809  1.00 4.52   ? 95   TYR C CE2 1 
ATOM   4373  C CZ  . TYR E 1 95  ? 12.548  10.947  30.856  1.00 16.64  ? 95   TYR C CZ  1 
ATOM   4374  O OH  . TYR E 1 95  ? 11.198  10.714  31.022  1.00 17.95  ? 95   TYR C OH  1 
ATOM   4375  N N   . VAL E 1 96  ? 18.941  13.783  30.298  1.00 4.16   ? 96   VAL C N   1 
ATOM   4376  C CA  . VAL E 1 96  ? 20.331  14.030  30.108  1.00 2.88   ? 96   VAL C CA  1 
ATOM   4377  C C   . VAL E 1 96  ? 20.929  14.906  31.175  1.00 6.46   ? 96   VAL C C   1 
ATOM   4378  O O   . VAL E 1 96  ? 21.982  14.606  31.709  1.00 6.51   ? 96   VAL C O   1 
ATOM   4379  C CB  . VAL E 1 96  ? 20.518  14.693  28.791  1.00 3.29   ? 96   VAL C CB  1 
ATOM   4380  C CG1 . VAL E 1 96  ? 21.945  15.112  28.745  1.00 1.56   ? 96   VAL C CG1 1 
ATOM   4381  C CG2 . VAL E 1 96  ? 20.299  13.688  27.698  1.00 4.65   ? 96   VAL C CG2 1 
ATOM   4382  N N   . GLU E 1 97  ? 20.287  16.027  31.479  1.00 1.62   ? 97   GLU C N   1 
ATOM   4383  C CA  . GLU E 1 97  ? 20.875  16.878  32.518  1.00 2.81   ? 97   GLU C CA  1 
ATOM   4384  C C   . GLU E 1 97  ? 20.981  16.174  33.848  1.00 9.85   ? 97   GLU C C   1 
ATOM   4385  O O   . GLU E 1 97  ? 21.996  16.265  34.552  1.00 10.22  ? 97   GLU C O   1 
ATOM   4386  C CB  . GLU E 1 97  ? 20.147  18.199  32.701  1.00 6.17   ? 97   GLU C CB  1 
ATOM   4387  C CG  . GLU E 1 97  ? 20.057  18.995  31.404  1.00 3.05   ? 97   GLU C CG  1 
ATOM   4388  C CD  . GLU E 1 97  ? 21.424  19.526  30.984  1.00 17.39  ? 97   GLU C CD  1 
ATOM   4389  O OE1 . GLU E 1 97  ? 22.258  19.825  31.803  1.00 7.10   ? 97   GLU C OE1 1 
ATOM   4390  O OE2 . GLU E 1 97  ? 21.560  19.757  29.670  1.00 19.34  ? 97   GLU C OE2 1 
ATOM   4391  N N   . GLY E 1 98  ? 19.931  15.456  34.190  1.00 7.21   ? 98   GLY C N   1 
ATOM   4392  C CA  . GLY E 1 98  ? 19.966  14.732  35.453  1.00 2.67   ? 98   GLY C CA  1 
ATOM   4393  C C   . GLY E 1 98  ? 21.111  13.764  35.440  1.00 3.56   ? 98   GLY C C   1 
ATOM   4394  O O   . GLY E 1 98  ? 21.933  13.695  36.340  1.00 5.22   ? 98   GLY C O   1 
ATOM   4395  N N   . THR E 1 99  ? 21.210  13.044  34.354  1.00 2.16   ? 99   THR C N   1 
ATOM   4396  C CA  . THR E 1 99  ? 22.293  12.075  34.235  1.00 2.83   ? 99   THR C CA  1 
ATOM   4397  C C   . THR E 1 99  ? 23.681  12.682  34.339  1.00 12.76  ? 99   THR C C   1 
ATOM   4398  O O   . THR E 1 99  ? 24.515  12.186  35.097  1.00 12.87  ? 99   THR C O   1 
ATOM   4399  C CB  . THR E 1 99  ? 22.150  11.231  32.987  1.00 7.66   ? 99   THR C CB  1 
ATOM   4400  O OG1 . THR E 1 99  ? 20.797  10.801  32.860  1.00 6.21   ? 99   THR C OG1 1 
ATOM   4401  C CG2 . THR E 1 99  ? 23.139  10.083  33.063  1.00 2.99   ? 99   THR C CG2 1 
ATOM   4402  N N   . LEU E 1 100 ? 23.900  13.801  33.645  1.00 6.88   ? 100  LEU C N   1 
ATOM   4403  C CA  . LEU E 1 100 ? 25.182  14.520  33.743  1.00 3.94   ? 100  LEU C CA  1 
ATOM   4404  C C   . LEU E 1 100 ? 25.504  14.920  35.184  1.00 8.49   ? 100  LEU C C   1 
ATOM   4405  O O   . LEU E 1 100 ? 26.667  15.018  35.629  1.00 13.34  ? 100  LEU C O   1 
ATOM   4406  C CB  . LEU E 1 100 ? 25.148  15.757  32.865  1.00 4.11   ? 100  LEU C CB  1 
ATOM   4407  C CG  . LEU E 1 100 ? 25.177  15.448  31.357  1.00 8.88   ? 100  LEU C CG  1 
ATOM   4408  C CD1 . LEU E 1 100 ? 25.319  16.755  30.589  1.00 2.21   ? 100  LEU C CD1 1 
ATOM   4409  C CD2 . LEU E 1 100 ? 26.422  14.595  31.055  1.00 1.00   ? 100  LEU C CD2 1 
ATOM   4410  N N   . ASP E 1 101 ? 24.468  15.118  35.958  1.00 1.00   ? 101  ASP C N   1 
ATOM   4411  C CA  . ASP E 1 101 ? 24.743  15.433  37.339  1.00 2.36   ? 101  ASP C CA  1 
ATOM   4412  C C   . ASP E 1 101 ? 25.307  14.256  38.112  1.00 8.45   ? 101  ASP C C   1 
ATOM   4413  O O   . ASP E 1 101 ? 26.025  14.382  39.077  1.00 12.15  ? 101  ASP C O   1 
ATOM   4414  C CB  . ASP E 1 101 ? 23.478  15.886  38.031  1.00 1.77   ? 101  ASP C CB  1 
ATOM   4415  C CG  . ASP E 1 101 ? 23.050  17.315  37.760  1.00 3.77   ? 101  ASP C CG  1 
ATOM   4416  O OD1 . ASP E 1 101 ? 23.687  18.089  37.062  1.00 14.68  ? 101  ASP C OD1 1 
ATOM   4417  O OD2 . ASP E 1 101 ? 21.817  17.514  38.172  1.00 33.03  ? 101  ASP C OD2 1 
ATOM   4418  N N   . LEU E 1 102 ? 24.949  13.094  37.687  1.00 8.68   ? 102  LEU C N   1 
ATOM   4419  C CA  . LEU E 1 102 ? 25.428  11.892  38.299  1.00 4.32   ? 102  LEU C CA  1 
ATOM   4420  C C   . LEU E 1 102 ? 26.809  11.605  37.801  1.00 10.80  ? 102  LEU C C   1 
ATOM   4421  O O   . LEU E 1 102 ? 27.730  11.351  38.541  1.00 14.15  ? 102  LEU C O   1 
ATOM   4422  C CB  . LEU E 1 102 ? 24.504  10.764  37.852  1.00 3.76   ? 102  LEU C CB  1 
ATOM   4423  C CG  . LEU E 1 102 ? 24.796  9.356   38.425  1.00 10.55  ? 102  LEU C CG  1 
ATOM   4424  C CD1 . LEU E 1 102 ? 25.037  9.286   39.920  1.00 3.28   ? 102  LEU C CD1 1 
ATOM   4425  C CD2 . LEU E 1 102 ? 23.684  8.391   38.061  1.00 8.71   ? 102  LEU C CD2 1 
ATOM   4426  N N   . LEU E 1 103 ? 26.957  11.680  36.508  1.00 6.51   ? 103  LEU C N   1 
ATOM   4427  C CA  . LEU E 1 103 ? 28.227  11.468  35.883  1.00 1.50   ? 103  LEU C CA  1 
ATOM   4428  C C   . LEU E 1 103 ? 29.313  12.355  36.433  1.00 3.09   ? 103  LEU C C   1 
ATOM   4429  O O   . LEU E 1 103 ? 30.476  12.009  36.488  1.00 11.31  ? 103  LEU C O   1 
ATOM   4430  C CB  . LEU E 1 103 ? 28.065  11.785  34.425  1.00 1.77   ? 103  LEU C CB  1 
ATOM   4431  C CG  . LEU E 1 103 ? 29.310  11.508  33.579  1.00 6.67   ? 103  LEU C CG  1 
ATOM   4432  C CD1 . LEU E 1 103 ? 29.672  10.032  33.551  1.00 1.00   ? 103  LEU C CD1 1 
ATOM   4433  C CD2 . LEU E 1 103 ? 28.940  11.877  32.155  1.00 5.13   ? 103  LEU C CD2 1 
ATOM   4434  N N   . GLU E 1 104 ? 28.941  13.517  36.857  1.00 3.47   ? 104  GLU C N   1 
ATOM   4435  C CA  . GLU E 1 104 ? 29.901  14.440  37.409  1.00 3.16   ? 104  GLU C CA  1 
ATOM   4436  C C   . GLU E 1 104 ? 30.700  13.873  38.536  1.00 10.60  ? 104  GLU C C   1 
ATOM   4437  O O   . GLU E 1 104 ? 31.876  14.085  38.678  1.00 15.54  ? 104  GLU C O   1 
ATOM   4438  C CB  . GLU E 1 104 ? 29.150  15.629  37.931  1.00 4.44   ? 104  GLU C CB  1 
ATOM   4439  C CG  . GLU E 1 104 ? 30.091  16.779  38.207  1.00 1.00   ? 104  GLU C CG  1 
ATOM   4440  C CD  . GLU E 1 104 ? 30.803  17.327  37.002  1.00 11.35  ? 104  GLU C CD  1 
ATOM   4441  O OE1 . GLU E 1 104 ? 30.488  17.036  35.842  1.00 33.25  ? 104  GLU C OE1 1 
ATOM   4442  O OE2 . GLU E 1 104 ? 31.742  18.190  37.365  1.00 12.49  ? 104  GLU C OE2 1 
ATOM   4443  N N   . LEU E 1 105 ? 30.048  13.107  39.332  1.00 7.71   ? 105  LEU C N   1 
ATOM   4444  C CA  . LEU E 1 105 ? 30.736  12.444  40.410  1.00 2.89   ? 105  LEU C CA  1 
ATOM   4445  C C   . LEU E 1 105 ? 31.906  11.607  39.904  1.00 9.81   ? 105  LEU C C   1 
ATOM   4446  O O   . LEU E 1 105 ? 32.999  11.514  40.490  1.00 13.77  ? 105  LEU C O   1 
ATOM   4447  C CB  . LEU E 1 105 ? 29.750  11.499  41.111  1.00 3.27   ? 105  LEU C CB  1 
ATOM   4448  C CG  . LEU E 1 105 ? 28.527  12.198  41.729  1.00 6.52   ? 105  LEU C CG  1 
ATOM   4449  C CD1 . LEU E 1 105 ? 27.721  11.319  42.681  1.00 4.87   ? 105  LEU C CD1 1 
ATOM   4450  C CD2 . LEU E 1 105 ? 28.937  13.458  42.415  1.00 1.00   ? 105  LEU C CD2 1 
ATOM   4451  N N   . LEU E 1 106 ? 31.648  10.968  38.801  1.00 7.80   ? 106  LEU C N   1 
ATOM   4452  C CA  . LEU E 1 106 ? 32.690  10.149  38.217  1.00 6.10   ? 106  LEU C CA  1 
ATOM   4453  C C   . LEU E 1 106 ? 33.821  11.027  37.692  1.00 14.47  ? 106  LEU C C   1 
ATOM   4454  O O   . LEU E 1 106 ? 35.023  10.709  37.874  1.00 13.94  ? 106  LEU C O   1 
ATOM   4455  C CB  . LEU E 1 106 ? 32.125  9.412   37.026  1.00 1.05   ? 106  LEU C CB  1 
ATOM   4456  C CG  . LEU E 1 106 ? 31.529  8.023   37.265  1.00 1.18   ? 106  LEU C CG  1 
ATOM   4457  C CD1 . LEU E 1 106 ? 32.359  7.198   38.235  1.00 1.00   ? 106  LEU C CD1 1 
ATOM   4458  C CD2 . LEU E 1 106 ? 30.105  8.153   37.697  1.00 6.50   ? 106  LEU C CD2 1 
ATOM   4459  N N   . ILE E 1 107 ? 33.419  12.123  37.007  1.00 5.24   ? 107  ILE C N   1 
ATOM   4460  C CA  . ILE E 1 107 ? 34.380  13.113  36.465  1.00 4.29   ? 107  ILE C CA  1 
ATOM   4461  C C   . ILE E 1 107 ? 35.309  13.744  37.482  1.00 16.36  ? 107  ILE C C   1 
ATOM   4462  O O   . ILE E 1 107 ? 36.527  13.883  37.202  1.00 26.57  ? 107  ILE C O   1 
ATOM   4463  C CB  . ILE E 1 107 ? 33.729  14.199  35.680  1.00 7.23   ? 107  ILE C CB  1 
ATOM   4464  C CG1 . ILE E 1 107 ? 33.112  13.502  34.508  1.00 2.25   ? 107  ILE C CG1 1 
ATOM   4465  C CG2 . ILE E 1 107 ? 34.711  15.286  35.249  1.00 6.37   ? 107  ILE C CG2 1 
ATOM   4466  C CD1 . ILE E 1 107 ? 32.280  14.422  33.725  1.00 1.00   ? 107  ILE C CD1 1 
ATOM   4467  N N   . MET E 1 108 ? 34.723  14.103  38.630  1.00 6.24   ? 108  MET C N   1 
ATOM   4468  C CA  . MET E 1 108 ? 35.505  14.676  39.704  1.00 11.25  ? 108  MET C CA  1 
ATOM   4469  C C   . MET E 1 108 ? 36.364  13.700  40.464  1.00 14.93  ? 108  MET C C   1 
ATOM   4470  O O   . MET E 1 108 ? 37.347  14.070  41.059  1.00 18.42  ? 108  MET C O   1 
ATOM   4471  C CB  . MET E 1 108 ? 34.670  15.370  40.773  1.00 16.55  ? 108  MET C CB  1 
ATOM   4472  C CG  . MET E 1 108 ? 33.592  16.320  40.247  1.00 34.20  ? 108  MET C CG  1 
ATOM   4473  S SD  . MET E 1 108 ? 32.334  16.935  41.476  1.00 42.91  ? 108  MET C SD  1 
ATOM   4474  C CE  . MET E 1 108 ? 32.309  15.582  42.727  1.00 38.79  ? 108  MET C CE  1 
ATOM   4475  N N   . HIS E 1 109 ? 35.923  12.475  40.528  1.00 12.04  ? 109  HIS C N   1 
ATOM   4476  C CA  . HIS E 1 109 ? 36.540  11.458  41.310  1.00 8.78   ? 109  HIS C CA  1 
ATOM   4477  C C   . HIS E 1 109 ? 38.033  11.410  41.420  1.00 13.15  ? 109  HIS C C   1 
ATOM   4478  O O   . HIS E 1 109 ? 38.584  11.480  42.481  1.00 19.76  ? 109  HIS C O   1 
ATOM   4479  C CB  . HIS E 1 109 ? 36.014  10.108  40.915  1.00 13.77  ? 109  HIS C CB  1 
ATOM   4480  C CG  . HIS E 1 109 ? 36.197  9.190   42.071  1.00 19.62  ? 109  HIS C CG  1 
ATOM   4481  N ND1 . HIS E 1 109 ? 37.104  8.143   42.022  1.00 21.17  ? 109  HIS C ND1 1 
ATOM   4482  C CD2 . HIS E 1 109 ? 35.605  9.219   43.309  1.00 19.59  ? 109  HIS C CD2 1 
ATOM   4483  C CE1 . HIS E 1 109 ? 37.008  7.544   43.220  1.00 19.93  ? 109  HIS C CE1 1 
ATOM   4484  N NE2 . HIS E 1 109 ? 36.143  8.185   44.019  1.00 19.10  ? 109  HIS C NE2 1 
ATOM   4485  N N   . PRO E 1 110 ? 38.699  11.279  40.319  1.00 12.54  ? 110  PRO C N   1 
ATOM   4486  C CA  . PRO E 1 110 ? 40.152  11.216  40.301  1.00 9.73   ? 110  PRO C CA  1 
ATOM   4487  C C   . PRO E 1 110 ? 40.858  12.402  40.880  1.00 21.00  ? 110  PRO C C   1 
ATOM   4488  O O   . PRO E 1 110 ? 42.026  12.337  41.245  1.00 31.35  ? 110  PRO C O   1 
ATOM   4489  C CB  . PRO E 1 110 ? 40.572  11.138  38.843  1.00 7.40   ? 110  PRO C CB  1 
ATOM   4490  C CG  . PRO E 1 110 ? 39.310  11.037  38.028  1.00 3.83   ? 110  PRO C CG  1 
ATOM   4491  C CD  . PRO E 1 110 ? 38.118  11.310  38.945  1.00 9.25   ? 110  PRO C CD  1 
ATOM   4492  N N   . PHE E 1 111 ? 40.195  13.511  40.986  1.00 15.41  ? 111  PHE C N   1 
ATOM   4493  C CA  . PHE E 1 111 ? 40.892  14.653  41.540  1.00 9.17   ? 111  PHE C CA  1 
ATOM   4494  C C   . PHE E 1 111 ? 40.659  14.890  43.023  1.00 23.69  ? 111  PHE C C   1 
ATOM   4495  O O   . PHE E 1 111 ? 40.976  15.953  43.555  1.00 30.42  ? 111  PHE C O   1 
ATOM   4496  C CB  . PHE E 1 111 ? 40.506  15.868  40.734  1.00 4.06   ? 111  PHE C CB  1 
ATOM   4497  C CG  . PHE E 1 111 ? 40.778  15.619  39.292  1.00 7.88   ? 111  PHE C CG  1 
ATOM   4498  C CD1 . PHE E 1 111 ? 42.068  15.736  38.765  1.00 8.51   ? 111  PHE C CD1 1 
ATOM   4499  C CD2 . PHE E 1 111 ? 39.739  15.246  38.439  1.00 16.26  ? 111  PHE C CD2 1 
ATOM   4500  C CE1 . PHE E 1 111 ? 42.340  15.485  37.416  1.00 11.45  ? 111  PHE C CE1 1 
ATOM   4501  C CE2 . PHE E 1 111 ? 39.997  15.002  37.090  1.00 17.14  ? 111  PHE C CE2 1 
ATOM   4502  C CZ  . PHE E 1 111 ? 41.291  15.104  36.574  1.00 8.93   ? 111  PHE C CZ  1 
ATOM   4503  N N   . LEU E 1 112 ? 40.004  13.933  43.642  1.00 20.71  ? 112  LEU C N   1 
ATOM   4504  C CA  . LEU E 1 112 ? 39.695  13.939  45.057  1.00 19.56  ? 112  LEU C CA  1 
ATOM   4505  C C   . LEU E 1 112 ? 40.910  13.479  45.776  1.00 33.83  ? 112  LEU C C   1 
ATOM   4506  O O   . LEU E 1 112 ? 41.782  12.848  45.184  1.00 37.60  ? 112  LEU C O   1 
ATOM   4507  C CB  . LEU E 1 112 ? 38.650  12.841  45.400  1.00 16.48  ? 112  LEU C CB  1 
ATOM   4508  C CG  . LEU E 1 112 ? 37.302  13.264  44.873  1.00 14.20  ? 112  LEU C CG  1 
ATOM   4509  C CD1 . LEU E 1 112 ? 36.218  12.590  45.639  1.00 11.29  ? 112  LEU C CD1 1 
ATOM   4510  C CD2 . LEU E 1 112 ? 37.214  14.731  45.143  1.00 1.49   ? 112  LEU C CD2 1 
ATOM   4511  N N   . LYS E 1 113 ? 40.902  13.757  47.068  1.00 34.66  ? 113  LYS C N   1 
ATOM   4512  C CA  . LYS E 1 113 ? 41.933  13.299  47.958  1.00 34.60  ? 113  LYS C CA  1 
ATOM   4513  C C   . LYS E 1 113 ? 41.530  11.901  48.317  1.00 48.05  ? 113  LYS C C   1 
ATOM   4514  O O   . LYS E 1 113 ? 40.471  11.636  48.888  1.00 57.59  ? 113  LYS C O   1 
ATOM   4515  C CB  . LYS E 1 113 ? 42.069  14.124  49.234  1.00 37.42  ? 113  LYS C CB  1 
ATOM   4516  C CG  . LYS E 1 113 ? 42.173  15.650  49.085  1.00 107.85 ? 113  LYS C CG  1 
ATOM   4517  C CD  . LYS E 1 113 ? 41.176  16.323  48.134  1.00 141.69 ? 113  LYS C CD  1 
ATOM   4518  C CE  . LYS E 1 113 ? 39.706  15.985  48.365  1.00 148.40 ? 113  LYS C CE  1 
ATOM   4519  N NZ  . LYS E 1 113 ? 38.802  16.763  47.499  1.00 163.81 ? 113  LYS C NZ  1 
ATOM   4520  N N   . PRO E 1 114 ? 42.377  11.038  47.899  1.00 47.13  ? 114  PRO C N   1 
ATOM   4521  C CA  . PRO E 1 114 ? 42.351  9.587   48.080  1.00 50.56  ? 114  PRO C CA  1 
ATOM   4522  C C   . PRO E 1 114 ? 41.500  9.080   49.250  1.00 62.15  ? 114  PRO C C   1 
ATOM   4523  O O   . PRO E 1 114 ? 40.777  8.056   49.183  1.00 60.40  ? 114  PRO C O   1 
ATOM   4524  C CB  . PRO E 1 114 ? 43.830  9.237   48.262  1.00 51.30  ? 114  PRO C CB  1 
ATOM   4525  C CG  . PRO E 1 114 ? 44.646  10.534  48.050  1.00 51.76  ? 114  PRO C CG  1 
ATOM   4526  C CD  . PRO E 1 114 ? 43.690  11.707  48.068  1.00 44.33  ? 114  PRO C CD  1 
ATOM   4527  N N   . ASP E 1 115 ? 41.592  9.827   50.334  1.00 66.54  ? 115  ASP C N   1 
ATOM   4528  C CA  . ASP E 1 115 ? 40.812  9.528   51.496  1.00 73.05  ? 115  ASP C CA  1 
ATOM   4529  C C   . ASP E 1 115 ? 39.318  9.699   51.147  1.00 65.55  ? 115  ASP C C   1 
ATOM   4530  O O   . ASP E 1 115 ? 38.456  8.821   51.380  1.00 71.35  ? 115  ASP C O   1 
ATOM   4531  C CB  . ASP E 1 115 ? 41.293  10.454  52.637  1.00 84.19  ? 115  ASP C CB  1 
ATOM   4532  C CG  . ASP E 1 115 ? 40.237  10.826  53.661  1.00 167.64 ? 115  ASP C CG  1 
ATOM   4533  O OD1 . ASP E 1 115 ? 39.232  10.157  53.901  1.00 178.29 ? 115  ASP C OD1 1 
ATOM   4534  O OD2 . ASP E 1 115 ? 40.533  11.942  54.299  1.00 197.05 ? 115  ASP C OD2 1 
ATOM   4535  N N   . ASP E 1 116 ? 39.022  10.849  50.541  1.00 41.01  ? 116  ASP C N   1 
ATOM   4536  C CA  . ASP E 1 116 ? 37.679  11.174  50.147  1.00 34.94  ? 116  ASP C CA  1 
ATOM   4537  C C   . ASP E 1 116 ? 37.177  10.369  48.982  1.00 31.13  ? 116  ASP C C   1 
ATOM   4538  O O   . ASP E 1 116 ? 35.980  10.315  48.662  1.00 30.98  ? 116  ASP C O   1 
ATOM   4539  C CB  . ASP E 1 116 ? 37.613  12.638  49.774  1.00 39.70  ? 116  ASP C CB  1 
ATOM   4540  C CG  . ASP E 1 116 ? 37.949  13.554  50.912  1.00 60.74  ? 116  ASP C CG  1 
ATOM   4541  O OD1 . ASP E 1 116 ? 38.079  13.184  52.071  1.00 63.01  ? 116  ASP C OD1 1 
ATOM   4542  O OD2 . ASP E 1 116 ? 37.982  14.805  50.525  1.00 66.45  ? 116  ASP C OD2 1 
ATOM   4543  N N   . GLN E 1 117 ? 38.104  9.760   48.305  1.00 20.22  ? 117  GLN C N   1 
ATOM   4544  C CA  . GLN E 1 117 ? 37.698  9.030   47.167  1.00 20.01  ? 117  GLN C CA  1 
ATOM   4545  C C   . GLN E 1 117 ? 36.756  7.924   47.479  1.00 30.67  ? 117  GLN C C   1 
ATOM   4546  O O   . GLN E 1 117 ? 35.784  7.673   46.777  1.00 36.77  ? 117  GLN C O   1 
ATOM   4547  C CB  . GLN E 1 117 ? 38.910  8.545   46.414  1.00 22.50  ? 117  GLN C CB  1 
ATOM   4548  C CG  . GLN E 1 117 ? 39.587  9.707   45.677  1.00 37.02  ? 117  GLN C CG  1 
ATOM   4549  C CD  . GLN E 1 117 ? 40.578  9.144   44.706  1.00 29.68  ? 117  GLN C CD  1 
ATOM   4550  O OE1 . GLN E 1 117 ? 41.238  8.152   45.000  1.00 64.54  ? 117  GLN C OE1 1 
ATOM   4551  N NE2 . GLN E 1 117 ? 40.591  9.679   43.503  1.00 42.05  ? 117  GLN C NE2 1 
ATOM   4552  N N   . GLN E 1 118 ? 37.040  7.294   48.574  1.00 33.21  ? 118  GLN C N   1 
ATOM   4553  C CA  . GLN E 1 118 ? 36.222  6.202   48.987  1.00 34.93  ? 118  GLN C CA  1 
ATOM   4554  C C   . GLN E 1 118 ? 34.847  6.569   49.473  1.00 32.72  ? 118  GLN C C   1 
ATOM   4555  O O   . GLN E 1 118 ? 33.855  5.920   49.124  1.00 33.69  ? 118  GLN C O   1 
ATOM   4556  C CB  . GLN E 1 118 ? 36.961  5.265   49.911  1.00 41.88  ? 118  GLN C CB  1 
ATOM   4557  C CG  . GLN E 1 118 ? 36.412  3.827   49.769  1.00 157.13 ? 118  GLN C CG  1 
ATOM   4558  C CD  . GLN E 1 118 ? 36.376  3.331   48.330  1.00 221.48 ? 118  GLN C CD  1 
ATOM   4559  O OE1 . GLN E 1 118 ? 37.223  3.712   47.500  1.00 237.99 ? 118  GLN C OE1 1 
ATOM   4560  N NE2 . GLN E 1 118 ? 35.387  2.487   48.020  1.00 199.58 ? 118  GLN C NE2 1 
ATOM   4561  N N   . LYS E 1 119 ? 34.790  7.619   50.268  1.00 28.62  ? 119  LYS C N   1 
ATOM   4562  C CA  . LYS E 1 119 ? 33.502  8.070   50.738  1.00 25.84  ? 119  LYS C CA  1 
ATOM   4563  C C   . LYS E 1 119 ? 32.589  8.355   49.535  1.00 26.95  ? 119  LYS C C   1 
ATOM   4564  O O   . LYS E 1 119 ? 31.423  8.017   49.450  1.00 33.39  ? 119  LYS C O   1 
ATOM   4565  C CB  . LYS E 1 119 ? 33.589  9.247   51.732  1.00 28.01  ? 119  LYS C CB  1 
ATOM   4566  C CG  . LYS E 1 119 ? 32.249  9.428   52.468  1.00 143.15 ? 119  LYS C CG  1 
ATOM   4567  C CD  . LYS E 1 119 ? 31.136  10.022  51.594  1.00 172.67 ? 119  LYS C CD  1 
ATOM   4568  C CE  . LYS E 1 119 ? 29.764  9.333   51.656  1.00 131.07 ? 119  LYS C CE  1 
ATOM   4569  N NZ  . LYS E 1 119 ? 28.948  9.606   50.427  1.00 24.57  ? 119  LYS C NZ  1 
ATOM   4570  N N   . GLU E 1 120 ? 33.211  8.890   48.535  1.00 19.79  ? 120  GLU C N   1 
ATOM   4571  C CA  . GLU E 1 120 ? 32.603  9.265   47.301  1.00 17.74  ? 120  GLU C CA  1 
ATOM   4572  C C   . GLU E 1 120 ? 31.983  8.196   46.476  1.00 19.67  ? 120  GLU C C   1 
ATOM   4573  O O   . GLU E 1 120 ? 30.934  8.401   45.830  1.00 22.84  ? 120  GLU C O   1 
ATOM   4574  C CB  . GLU E 1 120 ? 33.697  10.013  46.598  1.00 19.73  ? 120  GLU C CB  1 
ATOM   4575  C CG  . GLU E 1 120 ? 33.645  11.283  47.426  1.00 25.31  ? 120  GLU C CG  1 
ATOM   4576  C CD  . GLU E 1 120 ? 32.230  11.792  47.280  1.00 96.14  ? 120  GLU C CD  1 
ATOM   4577  O OE1 . GLU E 1 120 ? 31.516  11.614  46.257  1.00 96.42  ? 120  GLU C OE1 1 
ATOM   4578  O OE2 . GLU E 1 120 ? 31.866  12.419  48.369  1.00 45.20  ? 120  GLU C OE2 1 
ATOM   4579  N N   . VAL E 1 121 ? 32.675  7.077   46.468  1.00 5.57   ? 121  VAL C N   1 
ATOM   4580  C CA  . VAL E 1 121 ? 32.132  5.981   45.756  1.00 6.59   ? 121  VAL C CA  1 
ATOM   4581  C C   . VAL E 1 121 ? 30.824  5.562   46.401  1.00 17.69  ? 121  VAL C C   1 
ATOM   4582  O O   . VAL E 1 121 ? 29.809  5.284   45.752  1.00 24.97  ? 121  VAL C O   1 
ATOM   4583  C CB  . VAL E 1 121 ? 33.051  4.835   45.876  1.00 6.74   ? 121  VAL C CB  1 
ATOM   4584  C CG1 . VAL E 1 121 ? 32.321  3.671   45.271  1.00 4.65   ? 121  VAL C CG1 1 
ATOM   4585  C CG2 . VAL E 1 121 ? 34.259  5.145   45.044  1.00 3.02   ? 121  VAL C CG2 1 
ATOM   4586  N N   . VAL E 1 122 ? 30.857  5.526   47.699  1.00 9.06   ? 122  VAL C N   1 
ATOM   4587  C CA  . VAL E 1 122 ? 29.658  5.195   48.425  1.00 13.35  ? 122  VAL C CA  1 
ATOM   4588  C C   . VAL E 1 122 ? 28.561  6.158   48.058  1.00 18.92  ? 122  VAL C C   1 
ATOM   4589  O O   . VAL E 1 122 ? 27.414  5.774   47.728  1.00 19.82  ? 122  VAL C O   1 
ATOM   4590  C CB  . VAL E 1 122 ? 29.913  5.254   49.933  1.00 16.00  ? 122  VAL C CB  1 
ATOM   4591  C CG1 . VAL E 1 122 ? 28.626  5.032   50.665  1.00 13.10  ? 122  VAL C CG1 1 
ATOM   4592  C CG2 . VAL E 1 122 ? 30.814  4.123   50.316  1.00 11.75  ? 122  VAL C CG2 1 
ATOM   4593  N N   . ASN E 1 123 ? 28.941  7.429   48.008  1.00 15.18  ? 123  ASN C N   1 
ATOM   4594  C CA  . ASN E 1 123 ? 27.931  8.383   47.597  1.00 12.95  ? 123  ASN C CA  1 
ATOM   4595  C C   . ASN E 1 123 ? 27.348  8.182   46.203  1.00 15.30  ? 123  ASN C C   1 
ATOM   4596  O O   . ASN E 1 123 ? 26.121  8.272   46.019  1.00 18.14  ? 123  ASN C O   1 
ATOM   4597  C CB  . ASN E 1 123 ? 28.294  9.813   47.728  1.00 20.55  ? 123  ASN C CB  1 
ATOM   4598  C CG  . ASN E 1 123 ? 27.041  10.691  47.523  1.00 82.12  ? 123  ASN C CG  1 
ATOM   4599  O OD1 . ASN E 1 123 ? 25.900  10.399  48.065  1.00 69.87  ? 123  ASN C OD1 1 
ATOM   4600  N ND2 . ASN E 1 123 ? 27.237  11.757  46.706  1.00 34.52  ? 123  ASN C ND2 1 
ATOM   4601  N N   . MET E 1 124 ? 28.189  7.911   45.209  1.00 5.42   ? 124  MET C N   1 
ATOM   4602  C CA  . MET E 1 124 ? 27.656  7.663   43.873  1.00 2.66   ? 124  MET C CA  1 
ATOM   4603  C C   . MET E 1 124 ? 26.699  6.552   43.944  1.00 12.04  ? 124  MET C C   1 
ATOM   4604  O O   . MET E 1 124 ? 25.649  6.594   43.304  1.00 15.26  ? 124  MET C O   1 
ATOM   4605  C CB  . MET E 1 124 ? 28.661  7.056   42.932  1.00 3.56   ? 124  MET C CB  1 
ATOM   4606  C CG  . MET E 1 124 ? 30.020  7.679   43.044  1.00 11.59  ? 124  MET C CG  1 
ATOM   4607  S SD  . MET E 1 124 ? 31.076  6.938   41.807  1.00 14.50  ? 124  MET C SD  1 
ATOM   4608  C CE  . MET E 1 124 ? 32.417  8.098   42.036  1.00 8.18   ? 124  MET C CE  1 
ATOM   4609  N N   . ALA E 1 125 ? 27.101  5.539   44.721  1.00 8.41   ? 125  ALA C N   1 
ATOM   4610  C CA  . ALA E 1 125 ? 26.218  4.366   44.810  1.00 8.92   ? 125  ALA C CA  1 
ATOM   4611  C C   . ALA E 1 125 ? 24.876  4.803   45.287  1.00 16.57  ? 125  ALA C C   1 
ATOM   4612  O O   . ALA E 1 125 ? 23.870  4.559   44.643  1.00 19.75  ? 125  ALA C O   1 
ATOM   4613  C CB  . ALA E 1 125 ? 26.742  3.330   45.774  1.00 6.67   ? 125  ALA C CB  1 
ATOM   4614  N N   . GLN E 1 126 ? 24.878  5.529   46.395  1.00 7.08   ? 126  GLN C N   1 
ATOM   4615  C CA  . GLN E 1 126 ? 23.591  5.953   46.904  1.00 3.18   ? 126  GLN C CA  1 
ATOM   4616  C C   . GLN E 1 126 ? 22.766  6.819   45.985  1.00 13.31  ? 126  GLN C C   1 
ATOM   4617  O O   . GLN E 1 126 ? 21.539  6.650   45.870  1.00 13.84  ? 126  GLN C O   1 
ATOM   4618  C CB  . GLN E 1 126 ? 23.787  6.658   48.199  1.00 6.18   ? 126  GLN C CB  1 
ATOM   4619  C CG  . GLN E 1 126 ? 24.416  5.768   49.334  1.00 22.38  ? 126  GLN C CG  1 
ATOM   4620  C CD  . GLN E 1 126 ? 24.475  6.519   50.692  1.00 27.21  ? 126  GLN C CD  1 
ATOM   4621  O OE1 . GLN E 1 126 ? 25.554  7.010   51.063  1.00 47.66  ? 126  GLN C OE1 1 
ATOM   4622  N NE2 . GLN E 1 126 ? 23.299  6.893   51.263  1.00 31.54  ? 126  GLN C NE2 1 
ATOM   4623  N N   . LYS E 1 127 ? 23.423  7.773   45.323  1.00 6.91   ? 127  LYS C N   1 
ATOM   4624  C CA  . LYS E 1 127 ? 22.668  8.631   44.475  1.00 7.02   ? 127  LYS C CA  1 
ATOM   4625  C C   . LYS E 1 127 ? 22.057  7.868   43.351  1.00 12.38  ? 127  LYS C C   1 
ATOM   4626  O O   . LYS E 1 127 ? 20.905  8.088   42.967  1.00 11.43  ? 127  LYS C O   1 
ATOM   4627  C CB  . LYS E 1 127 ? 23.618  9.591   43.853  1.00 19.18  ? 127  LYS C CB  1 
ATOM   4628  C CG  . LYS E 1 127 ? 24.081  10.690  44.773  1.00 13.43  ? 127  LYS C CG  1 
ATOM   4629  C CD  . LYS E 1 127 ? 23.078  11.839  44.829  1.00 6.89   ? 127  LYS C CD  1 
ATOM   4630  C CE  . LYS E 1 127 ? 23.004  12.543  46.226  1.00 6.90   ? 127  LYS C CE  1 
ATOM   4631  N NZ  . LYS E 1 127 ? 22.354  11.685  47.275  1.00 114.42 ? 127  LYS C NZ  1 
ATOM   4632  N N   . ALA E 1 128 ? 22.892  6.997   42.773  1.00 5.41   ? 128  ALA C N   1 
ATOM   4633  C CA  . ALA E 1 128 ? 22.458  6.239   41.646  1.00 1.00   ? 128  ALA C CA  1 
ATOM   4634  C C   . ALA E 1 128 ? 21.223  5.462   42.010  1.00 6.77   ? 128  ALA C C   1 
ATOM   4635  O O   . ALA E 1 128 ? 20.187  5.481   41.347  1.00 9.61   ? 128  ALA C O   1 
ATOM   4636  C CB  . ALA E 1 128 ? 23.553  5.338   41.226  1.00 1.00   ? 128  ALA C CB  1 
ATOM   4637  N N   . ILE E 1 129 ? 21.369  4.750   43.094  1.00 4.19   ? 129  ILE C N   1 
ATOM   4638  C CA  . ILE E 1 129 ? 20.363  3.822   43.583  1.00 8.94   ? 129  ILE C CA  1 
ATOM   4639  C C   . ILE E 1 129 ? 19.093  4.498   43.947  1.00 12.61  ? 129  ILE C C   1 
ATOM   4640  O O   . ILE E 1 129 ? 17.987  4.024   43.758  1.00 22.81  ? 129  ILE C O   1 
ATOM   4641  C CB  . ILE E 1 129 ? 20.728  3.135   44.910  1.00 20.48  ? 129  ILE C CB  1 
ATOM   4642  C CG1 . ILE E 1 129 ? 21.906  2.216   44.871  1.00 16.28  ? 129  ILE C CG1 1 
ATOM   4643  C CG2 . ILE E 1 129 ? 19.579  2.224   45.156  1.00 34.42  ? 129  ILE C CG2 1 
ATOM   4644  C CD1 . ILE E 1 129 ? 22.007  1.900   43.416  1.00 9.85   ? 129  ILE C CD1 1 
ATOM   4645  N N   . ILE E 1 130 ? 19.257  5.569   44.614  1.00 8.64   ? 130  ILE C N   1 
ATOM   4646  C CA  . ILE E 1 130 ? 18.097  6.275   45.101  1.00 10.81  ? 130  ILE C CA  1 
ATOM   4647  C C   . ILE E 1 130 ? 17.520  7.361   44.229  1.00 10.87  ? 130  ILE C C   1 
ATOM   4648  O O   . ILE E 1 130 ? 16.325  7.520   44.158  1.00 13.33  ? 130  ILE C O   1 
ATOM   4649  C CB  . ILE E 1 130 ? 18.542  6.982   46.335  1.00 15.81  ? 130  ILE C CB  1 
ATOM   4650  C CG1 . ILE E 1 130 ? 18.887  5.945   47.346  1.00 19.12  ? 130  ILE C CG1 1 
ATOM   4651  C CG2 . ILE E 1 130 ? 17.412  7.751   46.932  1.00 6.62   ? 130  ILE C CG2 1 
ATOM   4652  C CD1 . ILE E 1 130 ? 19.475  6.639   48.543  1.00 24.97  ? 130  ILE C CD1 1 
ATOM   4653  N N   . ARG E 1 131 ? 18.369  8.134   43.612  1.00 3.96   ? 131  ARG C N   1 
ATOM   4654  C CA  . ARG E 1 131 ? 17.894  9.253   42.888  1.00 1.93   ? 131  ARG C CA  1 
ATOM   4655  C C   . ARG E 1 131 ? 17.712  9.086   41.424  1.00 6.36   ? 131  ARG C C   1 
ATOM   4656  O O   . ARG E 1 131 ? 16.741  9.626   40.927  1.00 12.60  ? 131  ARG C O   1 
ATOM   4657  C CB  . ARG E 1 131 ? 18.713  10.466  43.367  1.00 4.26   ? 131  ARG C CB  1 
ATOM   4658  C CG  . ARG E 1 131 ? 18.617  11.817  42.666  1.00 23.64  ? 131  ARG C CG  1 
ATOM   4659  C CD  . ARG E 1 131 ? 18.947  12.956  43.660  1.00 14.16  ? 131  ARG C CD  1 
ATOM   4660  N NE  . ARG E 1 131 ? 18.282  12.615  44.931  1.00 66.89  ? 131  ARG C NE  1 
ATOM   4661  C CZ  . ARG E 1 131 ? 18.256  13.450  45.954  1.00 94.72  ? 131  ARG C CZ  1 
ATOM   4662  N NH1 . ARG E 1 131 ? 18.903  14.635  45.798  1.00 9.97   ? 131  ARG C NH1 1 
ATOM   4663  N NH2 . ARG E 1 131 ? 17.590  13.089  47.099  1.00 69.95  ? 131  ARG C NH2 1 
ATOM   4664  N N   . TYR E 1 132 ? 18.576  8.302   40.765  1.00 7.37   ? 132  TYR C N   1 
ATOM   4665  C CA  . TYR E 1 132 ? 18.504  8.115   39.314  1.00 3.84   ? 132  TYR C CA  1 
ATOM   4666  C C   . TYR E 1 132 ? 17.948  6.832   38.753  1.00 8.16   ? 132  TYR C C   1 
ATOM   4667  O O   . TYR E 1 132 ? 16.987  6.830   37.942  1.00 8.00   ? 132  TYR C O   1 
ATOM   4668  C CB  . TYR E 1 132 ? 19.897  8.376   38.720  1.00 7.62   ? 132  TYR C CB  1 
ATOM   4669  C CG  . TYR E 1 132 ? 20.281  9.827   38.994  1.00 9.15   ? 132  TYR C CG  1 
ATOM   4670  C CD1 . TYR E 1 132 ? 19.670  10.880  38.310  1.00 3.85   ? 132  TYR C CD1 1 
ATOM   4671  C CD2 . TYR E 1 132 ? 21.111  10.161  40.070  1.00 7.21   ? 132  TYR C CD2 1 
ATOM   4672  C CE1 . TYR E 1 132 ? 19.980  12.213  38.572  1.00 1.00   ? 132  TYR C CE1 1 
ATOM   4673  C CE2 . TYR E 1 132 ? 21.341  11.497  40.420  1.00 1.61   ? 132  TYR C CE2 1 
ATOM   4674  C CZ  . TYR E 1 132 ? 20.793  12.532  39.663  1.00 1.00   ? 132  TYR C CZ  1 
ATOM   4675  O OH  . TYR E 1 132 ? 21.038  13.862  39.958  1.00 21.40  ? 132  TYR C OH  1 
ATOM   4676  N N   . PHE E 1 133 ? 18.613  5.735   39.086  1.00 5.39   ? 133  PHE C N   1 
ATOM   4677  C CA  . PHE E 1 133 ? 18.208  4.434   38.552  1.00 2.99   ? 133  PHE C CA  1 
ATOM   4678  C C   . PHE E 1 133 ? 16.699  4.159   38.616  1.00 14.49  ? 133  PHE C C   1 
ATOM   4679  O O   . PHE E 1 133 ? 16.010  3.596   37.740  1.00 18.06  ? 133  PHE C O   1 
ATOM   4680  C CB  . PHE E 1 133 ? 19.023  3.335   39.216  1.00 3.33   ? 133  PHE C CB  1 
ATOM   4681  C CG  . PHE E 1 133 ? 20.432  3.353   38.682  1.00 7.26   ? 133  PHE C CG  1 
ATOM   4682  C CD1 . PHE E 1 133 ? 20.798  4.257   37.682  1.00 8.71   ? 133  PHE C CD1 1 
ATOM   4683  C CD2 . PHE E 1 133 ? 21.399  2.450   39.131  1.00 7.41   ? 133  PHE C CD2 1 
ATOM   4684  C CE1 . PHE E 1 133 ? 22.113  4.302   37.203  1.00 10.38  ? 133  PHE C CE1 1 
ATOM   4685  C CE2 . PHE E 1 133 ? 22.704  2.443   38.625  1.00 6.55   ? 133  PHE C CE2 1 
ATOM   4686  C CZ  . PHE E 1 133 ? 23.076  3.406   37.681  1.00 4.10   ? 133  PHE C CZ  1 
ATOM   4687  N N   . PRO E 1 134 ? 16.130  4.609   39.678  1.00 8.58   ? 134  PRO C N   1 
ATOM   4688  C CA  . PRO E 1 134 ? 14.720  4.329   39.854  1.00 2.15   ? 134  PRO C CA  1 
ATOM   4689  C C   . PRO E 1 134 ? 13.762  4.978   38.872  1.00 13.92  ? 134  PRO C C   1 
ATOM   4690  O O   . PRO E 1 134 ? 12.707  4.451   38.557  1.00 16.26  ? 134  PRO C O   1 
ATOM   4691  C CB  . PRO E 1 134 ? 14.449  4.644   41.296  1.00 1.00   ? 134  PRO C CB  1 
ATOM   4692  C CG  . PRO E 1 134 ? 15.757  4.587   42.046  1.00 1.00   ? 134  PRO C CG  1 
ATOM   4693  C CD  . PRO E 1 134 ? 16.846  4.727   40.982  1.00 6.64   ? 134  PRO C CD  1 
ATOM   4694  N N   . VAL E 1 135 ? 14.184  6.109   38.354  1.00 12.60  ? 135  VAL C N   1 
ATOM   4695  C CA  . VAL E 1 135 ? 13.421  6.897   37.452  1.00 3.53   ? 135  VAL C CA  1 
ATOM   4696  C C   . VAL E 1 135 ? 13.420  6.203   36.129  1.00 9.74   ? 135  VAL C C   1 
ATOM   4697  O O   . VAL E 1 135 ? 12.412  6.029   35.474  1.00 15.21  ? 135  VAL C O   1 
ATOM   4698  C CB  . VAL E 1 135 ? 14.023  8.331   37.392  1.00 1.00   ? 135  VAL C CB  1 
ATOM   4699  C CG1 . VAL E 1 135 ? 13.295  9.266   36.438  1.00 1.00   ? 135  VAL C CG1 1 
ATOM   4700  C CG2 . VAL E 1 135 ? 13.959  9.022   38.721  1.00 1.00   ? 135  VAL C CG2 1 
ATOM   4701  N N   . PHE E 1 136 ? 14.589  5.794   35.778  1.00 1.86   ? 136  PHE C N   1 
ATOM   4702  C CA  . PHE E 1 136 ? 14.726  5.171   34.507  1.00 1.00   ? 136  PHE C CA  1 
ATOM   4703  C C   . PHE E 1 136 ? 14.119  3.819   34.504  1.00 7.71   ? 136  PHE C C   1 
ATOM   4704  O O   . PHE E 1 136 ? 13.434  3.469   33.552  1.00 13.38  ? 136  PHE C O   1 
ATOM   4705  C CB  . PHE E 1 136 ? 16.207  5.107   34.151  1.00 2.78   ? 136  PHE C CB  1 
ATOM   4706  C CG  . PHE E 1 136 ? 16.737  6.518   34.118  1.00 6.31   ? 136  PHE C CG  1 
ATOM   4707  C CD1 . PHE E 1 136 ? 16.102  7.474   33.323  1.00 3.72   ? 136  PHE C CD1 1 
ATOM   4708  C CD2 . PHE E 1 136 ? 17.834  6.939   34.875  1.00 8.93   ? 136  PHE C CD2 1 
ATOM   4709  C CE1 . PHE E 1 136 ? 16.616  8.771   33.209  1.00 3.55   ? 136  PHE C CE1 1 
ATOM   4710  C CE2 . PHE E 1 136 ? 18.334  8.248   34.793  1.00 8.46   ? 136  PHE C CE2 1 
ATOM   4711  C CZ  . PHE E 1 136 ? 17.736  9.178   33.943  1.00 1.00   ? 136  PHE C CZ  1 
ATOM   4712  N N   . GLU E 1 137 ? 14.390  3.063   35.575  1.00 5.46   ? 137  GLU C N   1 
ATOM   4713  C CA  . GLU E 1 137 ? 13.807  1.753   35.690  1.00 8.33   ? 137  GLU C CA  1 
ATOM   4714  C C   . GLU E 1 137 ? 12.281  1.825   35.516  1.00 15.69  ? 137  GLU C C   1 
ATOM   4715  O O   . GLU E 1 137 ? 11.637  1.144   34.729  1.00 20.46  ? 137  GLU C O   1 
ATOM   4716  C CB  . GLU E 1 137 ? 14.155  1.155   37.023  1.00 9.05   ? 137  GLU C CB  1 
ATOM   4717  C CG  . GLU E 1 137 ? 13.583  -0.245  37.147  1.00 4.06   ? 137  GLU C CG  1 
ATOM   4718  C CD  . GLU E 1 137 ? 14.474  -1.377  36.706  1.00 26.79  ? 137  GLU C CD  1 
ATOM   4719  O OE1 . GLU E 1 137 ? 15.478  -1.250  36.034  1.00 17.69  ? 137  GLU C OE1 1 
ATOM   4720  O OE2 . GLU E 1 137 ? 14.001  -2.532  37.109  1.00 30.49  ? 137  GLU C OE2 1 
ATOM   4721  N N   . LYS E 1 138 ? 11.677  2.754   36.177  1.00 5.87   ? 138  LYS C N   1 
ATOM   4722  C CA  . LYS E 1 138 ? 10.261  2.894   36.030  1.00 1.66   ? 138  LYS C CA  1 
ATOM   4723  C C   . LYS E 1 138 ? 9.820   3.351   34.677  1.00 15.78  ? 138  LYS C C   1 
ATOM   4724  O O   . LYS E 1 138 ? 8.762   3.035   34.239  1.00 21.84  ? 138  LYS C O   1 
ATOM   4725  C CB  . LYS E 1 138 ? 9.757   3.825   37.104  1.00 1.00   ? 138  LYS C CB  1 
ATOM   4726  C CG  . LYS E 1 138 ? 8.388   4.408   36.837  1.00 28.85  ? 138  LYS C CG  1 
ATOM   4727  C CD  . LYS E 1 138 ? 7.707   5.020   38.094  1.00 12.27  ? 138  LYS C CD  1 
ATOM   4728  C CE  . LYS E 1 138 ? 6.476   5.893   37.784  1.00 131.11 ? 138  LYS C CE  1 
ATOM   4729  N NZ  . LYS E 1 138 ? 5.772   6.415   38.977  1.00 165.74 ? 138  LYS C NZ  1 
ATOM   4730  N N   . ILE E 1 139 ? 10.590  4.162   34.025  1.00 16.05  ? 139  ILE C N   1 
ATOM   4731  C CA  . ILE E 1 139 ? 10.181  4.633   32.727  1.00 11.73  ? 139  ILE C CA  1 
ATOM   4732  C C   . ILE E 1 139 ? 10.036  3.487   31.788  1.00 18.87  ? 139  ILE C C   1 
ATOM   4733  O O   . ILE E 1 139 ? 9.031   3.342   31.101  1.00 25.87  ? 139  ILE C O   1 
ATOM   4734  C CB  . ILE E 1 139 ? 11.251  5.570   32.208  1.00 10.22  ? 139  ILE C CB  1 
ATOM   4735  C CG1 . ILE E 1 139 ? 10.933  6.886   32.857  1.00 2.56   ? 139  ILE C CG1 1 
ATOM   4736  C CG2 . ILE E 1 139 ? 11.225  5.740   30.693  1.00 3.44   ? 139  ILE C CG2 1 
ATOM   4737  C CD1 . ILE E 1 139 ? 11.948  7.958   32.553  1.00 11.94  ? 139  ILE C CD1 1 
ATOM   4738  N N   . LEU E 1 140 ? 11.100  2.723   31.791  1.00 8.73   ? 140  LEU C N   1 
ATOM   4739  C CA  . LEU E 1 140 ? 11.273  1.548   30.965  1.00 9.66   ? 140  LEU C CA  1 
ATOM   4740  C C   . LEU E 1 140 ? 10.255  0.506   31.261  1.00 19.86  ? 140  LEU C C   1 
ATOM   4741  O O   . LEU E 1 140 ? 9.810   -0.208  30.361  1.00 20.31  ? 140  LEU C O   1 
ATOM   4742  C CB  . LEU E 1 140 ? 12.604  0.867   31.319  1.00 7.37   ? 140  LEU C CB  1 
ATOM   4743  C CG  . LEU E 1 140 ? 13.785  1.658   30.799  1.00 12.43  ? 140  LEU C CG  1 
ATOM   4744  C CD1 . LEU E 1 140 ? 15.055  0.999   31.262  1.00 11.57  ? 140  LEU C CD1 1 
ATOM   4745  C CD2 . LEU E 1 140 ? 13.733  1.635   29.285  1.00 1.00   ? 140  LEU C CD2 1 
ATOM   4746  N N   . ARG E 1 141 ? 10.047  0.328   32.560  1.00 18.13  ? 141  ARG C N   1 
ATOM   4747  C CA  . ARG E 1 141 ? 9.122   -0.672  33.021  1.00 15.20  ? 141  ARG C CA  1 
ATOM   4748  C C   . ARG E 1 141 ? 7.785   -0.189  32.588  1.00 23.36  ? 141  ARG C C   1 
ATOM   4749  O O   . ARG E 1 141 ? 6.886   -0.889  32.211  1.00 26.77  ? 141  ARG C O   1 
ATOM   4750  C CB  . ARG E 1 141 ? 9.169   -0.861  34.534  1.00 12.08  ? 141  ARG C CB  1 
ATOM   4751  C CG  . ARG E 1 141 ? 8.070   -1.743  35.169  1.00 15.77  ? 141  ARG C CG  1 
ATOM   4752  C CD  . ARG E 1 141 ? 8.481   -2.526  36.484  1.00 39.51  ? 141  ARG C CD  1 
ATOM   4753  N NE  . ARG E 1 141 ? 7.427   -3.285  37.274  1.00 24.05  ? 141  ARG C NE  1 
ATOM   4754  C CZ  . ARG E 1 141 ? 6.148   -2.889  37.480  1.00 157.26 ? 141  ARG C CZ  1 
ATOM   4755  N NH1 . ARG E 1 141 ? 5.661   -1.732  37.000  1.00 197.13 ? 141  ARG C NH1 1 
ATOM   4756  N NH2 . ARG E 1 141 ? 5.342   -3.667  38.210  1.00 188.07 ? 141  ARG C NH2 1 
ATOM   4757  N N   . GLY E 1 142 ? 7.645   1.074   32.540  1.00 26.73  ? 142  GLY C N   1 
ATOM   4758  C CA  . GLY E 1 142 ? 6.346   1.521   32.166  1.00 22.08  ? 142  GLY C CA  1 
ATOM   4759  C C   . GLY E 1 142 ? 5.960   1.420   30.711  1.00 28.74  ? 142  GLY C C   1 
ATOM   4760  O O   . GLY E 1 142 ? 4.803   1.478   30.425  1.00 37.30  ? 142  GLY C O   1 
ATOM   4761  N N   . HIS E 1 143 ? 6.872   1.348   29.759  1.00 26.32  ? 143  HIS C N   1 
ATOM   4762  C CA  . HIS E 1 143 ? 6.433   1.341   28.355  1.00 15.58  ? 143  HIS C CA  1 
ATOM   4763  C C   . HIS E 1 143 ? 6.892   0.109   27.608  1.00 22.64  ? 143  HIS C C   1 
ATOM   4764  O O   . HIS E 1 143 ? 6.479   -0.156  26.477  1.00 32.45  ? 143  HIS C O   1 
ATOM   4765  C CB  . HIS E 1 143 ? 6.860   2.627   27.590  1.00 12.14  ? 143  HIS C CB  1 
ATOM   4766  C CG  . HIS E 1 143 ? 8.353   2.936   27.575  1.00 16.77  ? 143  HIS C CG  1 
ATOM   4767  N ND1 . HIS E 1 143 ? 9.338   1.946   27.487  1.00 18.94  ? 143  HIS C ND1 1 
ATOM   4768  C CD2 . HIS E 1 143 ? 8.981   4.141   27.586  1.00 14.09  ? 143  HIS C CD2 1 
ATOM   4769  C CE1 . HIS E 1 143 ? 10.496  2.560   27.469  1.00 18.89  ? 143  HIS C CE1 1 
ATOM   4770  N NE2 . HIS E 1 143 ? 10.312  3.885   27.525  1.00 16.83  ? 143  HIS C NE2 1 
ATOM   4771  N N   . GLY E 1 144 ? 7.800   -0.613  28.256  1.00 12.56  ? 144  GLY C N   1 
ATOM   4772  C CA  . GLY E 1 144 ? 8.350   -1.823  27.737  1.00 11.41  ? 144  GLY C CA  1 
ATOM   4773  C C   . GLY E 1 144 ? 9.301   -1.654  26.558  1.00 29.14  ? 144  GLY C C   1 
ATOM   4774  O O   . GLY E 1 144 ? 9.761   -2.685  26.076  1.00 40.79  ? 144  GLY C O   1 
ATOM   4775  N N   . GLN E 1 145 ? 9.546   -0.404  26.096  1.00 18.28  ? 145  GLN C N   1 
ATOM   4776  C CA  . GLN E 1 145 ? 10.458  -0.234  24.962  1.00 11.15  ? 145  GLN C CA  1 
ATOM   4777  C C   . GLN E 1 145 ? 11.917  -0.320  25.294  1.00 10.67  ? 145  GLN C C   1 
ATOM   4778  O O   . GLN E 1 145 ? 12.320  -0.427  26.473  1.00 11.31  ? 145  GLN C O   1 
ATOM   4779  C CB  . GLN E 1 145 ? 10.077  0.908   24.075  1.00 10.79  ? 145  GLN C CB  1 
ATOM   4780  C CG  . GLN E 1 145 ? 8.551   0.900   24.101  1.00 13.73  ? 145  GLN C CG  1 
ATOM   4781  C CD  . GLN E 1 145 ? 8.039   2.087   23.365  1.00 15.92  ? 145  GLN C CD  1 
ATOM   4782  O OE1 . GLN E 1 145 ? 8.391   3.242   23.703  1.00 39.77  ? 145  GLN C OE1 1 
ATOM   4783  N NE2 . GLN E 1 145 ? 7.421   1.820   22.247  1.00 27.22  ? 145  GLN C NE2 1 
ATOM   4784  N N   . SER E 1 146 ? 12.717  -0.383  24.257  1.00 7.31   ? 146  SER C N   1 
ATOM   4785  C CA  . SER E 1 146 ? 14.131  -0.517  24.549  1.00 15.43  ? 146  SER C CA  1 
ATOM   4786  C C   . SER E 1 146 ? 14.876  0.800   24.676  1.00 19.58  ? 146  SER C C   1 
ATOM   4787  O O   . SER E 1 146 ? 16.055  0.770   24.943  1.00 20.76  ? 146  SER C O   1 
ATOM   4788  C CB  . SER E 1 146 ? 14.902  -1.449  23.631  1.00 23.42  ? 146  SER C CB  1 
ATOM   4789  O OG  . SER E 1 146 ? 14.071  -2.453  23.069  1.00 23.75  ? 146  SER C OG  1 
ATOM   4790  N N   . PHE E 1 147 ? 14.160  1.896   24.511  1.00 12.42  ? 147  PHE C N   1 
ATOM   4791  C CA  . PHE E 1 147 ? 14.672  3.217   24.593  1.00 12.85  ? 147  PHE C CA  1 
ATOM   4792  C C   . PHE E 1 147 ? 13.888  3.987   25.575  1.00 17.51  ? 147  PHE C C   1 
ATOM   4793  O O   . PHE E 1 147 ? 12.721  3.723   25.708  1.00 17.01  ? 147  PHE C O   1 
ATOM   4794  C CB  . PHE E 1 147 ? 14.390  3.867   23.270  1.00 16.68  ? 147  PHE C CB  1 
ATOM   4795  C CG  . PHE E 1 147 ? 15.063  3.015   22.264  1.00 15.38  ? 147  PHE C CG  1 
ATOM   4796  C CD1 . PHE E 1 147 ? 16.453  2.956   22.246  1.00 14.47  ? 147  PHE C CD1 1 
ATOM   4797  C CD2 . PHE E 1 147 ? 14.347  2.221   21.380  1.00 16.29  ? 147  PHE C CD2 1 
ATOM   4798  C CE1 . PHE E 1 147 ? 17.175  2.204   21.320  1.00 10.70  ? 147  PHE C CE1 1 
ATOM   4799  C CE2 . PHE E 1 147 ? 15.057  1.429   20.473  1.00 12.98  ? 147  PHE C CE2 1 
ATOM   4800  C CZ  . PHE E 1 147 ? 16.451  1.412   20.433  1.00 2.23   ? 147  PHE C CZ  1 
ATOM   4801  N N   . LEU E 1 148 ? 14.535  4.958   26.206  1.00 14.06  ? 148  LEU C N   1 
ATOM   4802  C CA  . LEU E 1 148 ? 13.895  5.783   27.213  1.00 7.29   ? 148  LEU C CA  1 
ATOM   4803  C C   . LEU E 1 148 ? 12.756  6.610   26.669  1.00 14.68  ? 148  LEU C C   1 
ATOM   4804  O O   . LEU E 1 148 ? 11.686  6.838   27.325  1.00 11.93  ? 148  LEU C O   1 
ATOM   4805  C CB  . LEU E 1 148 ? 14.907  6.748   27.795  1.00 1.53   ? 148  LEU C CB  1 
ATOM   4806  C CG  . LEU E 1 148 ? 15.795  6.036   28.769  1.00 8.09   ? 148  LEU C CG  1 
ATOM   4807  C CD1 . LEU E 1 148 ? 16.838  7.049   29.142  1.00 6.61   ? 148  LEU C CD1 1 
ATOM   4808  C CD2 . LEU E 1 148 ? 15.016  5.645   30.018  1.00 3.81   ? 148  LEU C CD2 1 
ATOM   4809  N N   . VAL E 1 149 ? 13.043  7.104   25.476  1.00 7.19   ? 149  VAL C N   1 
ATOM   4810  C CA  . VAL E 1 149 ? 12.128  7.987   24.811  1.00 8.20   ? 149  VAL C CA  1 
ATOM   4811  C C   . VAL E 1 149 ? 12.008  7.701   23.319  1.00 17.89  ? 149  VAL C C   1 
ATOM   4812  O O   . VAL E 1 149 ? 13.007  7.435   22.606  1.00 13.91  ? 149  VAL C O   1 
ATOM   4813  C CB  . VAL E 1 149 ? 12.528  9.458   25.004  1.00 8.40   ? 149  VAL C CB  1 
ATOM   4814  C CG1 . VAL E 1 149 ? 11.597  10.443  24.272  1.00 4.74   ? 149  VAL C CG1 1 
ATOM   4815  C CG2 . VAL E 1 149 ? 12.709  9.850   26.469  1.00 7.52   ? 149  VAL C CG2 1 
ATOM   4816  N N   . GLY E 1 150 ? 10.742  7.775   22.905  1.00 11.92  ? 150  GLY C N   1 
ATOM   4817  C CA  . GLY E 1 150 ? 10.291  7.623   21.534  1.00 14.38  ? 150  GLY C CA  1 
ATOM   4818  C C   . GLY E 1 150 ? 10.621  6.324   20.794  1.00 20.27  ? 150  GLY C C   1 
ATOM   4819  O O   . GLY E 1 150 ? 10.625  6.267   19.567  1.00 25.89  ? 150  GLY C O   1 
ATOM   4820  N N   . ASN E 1 151 ? 10.933  5.311   21.524  1.00 19.63  ? 151  ASN C N   1 
ATOM   4821  C CA  . ASN E 1 151 ? 11.230  4.059   20.898  1.00 19.72  ? 151  ASN C CA  1 
ATOM   4822  C C   . ASN E 1 151 ? 12.290  4.113   19.874  1.00 18.61  ? 151  ASN C C   1 
ATOM   4823  O O   . ASN E 1 151 ? 12.292  3.405   18.904  1.00 28.97  ? 151  ASN C O   1 
ATOM   4824  C CB  . ASN E 1 151 ? 9.984   3.395   20.373  1.00 14.88  ? 151  ASN C CB  1 
ATOM   4825  C CG  . ASN E 1 151 ? 10.089  1.911   20.405  1.00 30.62  ? 151  ASN C CG  1 
ATOM   4826  O OD1 . ASN E 1 151 ? 10.898  1.247   21.097  1.00 33.31  ? 151  ASN C OD1 1 
ATOM   4827  N ND2 . ASN E 1 151 ? 9.322   1.404   19.499  1.00 19.00  ? 151  ASN C ND2 1 
ATOM   4828  N N   . GLN E 1 152 ? 13.166  5.010   20.113  1.00 18.45  ? 152  GLN C N   1 
ATOM   4829  C CA  . GLN E 1 152 ? 14.347  5.168   19.321  1.00 16.11  ? 152  GLN C CA  1 
ATOM   4830  C C   . GLN E 1 152 ? 15.477  5.683   20.195  1.00 21.81  ? 152  GLN C C   1 
ATOM   4831  O O   . GLN E 1 152 ? 15.281  6.236   21.299  1.00 26.92  ? 152  GLN C O   1 
ATOM   4832  C CB  . GLN E 1 152 ? 14.152  5.970   18.046  1.00 11.65  ? 152  GLN C CB  1 
ATOM   4833  C CG  . GLN E 1 152 ? 13.743  7.428   18.254  1.00 50.81  ? 152  GLN C CG  1 
ATOM   4834  C CD  . GLN E 1 152 ? 14.128  8.206   17.022  1.00 60.65  ? 152  GLN C CD  1 
ATOM   4835  O OE1 . GLN E 1 152 ? 13.845  7.688   15.938  1.00 31.26  ? 152  GLN C OE1 1 
ATOM   4836  N NE2 . GLN E 1 152 ? 14.841  9.348   17.173  1.00 39.42  ? 152  GLN C NE2 1 
ATOM   4837  N N   . LEU E 1 153 ? 16.666  5.428   19.727  1.00 9.82   ? 153  LEU C N   1 
ATOM   4838  C CA  . LEU E 1 153 ? 17.817  5.858   20.460  1.00 8.50   ? 153  LEU C CA  1 
ATOM   4839  C C   . LEU E 1 153 ? 17.830  7.377   20.496  1.00 17.38  ? 153  LEU C C   1 
ATOM   4840  O O   . LEU E 1 153 ? 17.492  8.045   19.522  1.00 22.43  ? 153  LEU C O   1 
ATOM   4841  C CB  . LEU E 1 153 ? 19.067  5.269   19.804  1.00 7.95   ? 153  LEU C CB  1 
ATOM   4842  C CG  . LEU E 1 153 ? 20.392  5.425   20.527  1.00 9.93   ? 153  LEU C CG  1 
ATOM   4843  C CD1 . LEU E 1 153 ? 20.501  4.492   21.719  1.00 4.74   ? 153  LEU C CD1 1 
ATOM   4844  C CD2 . LEU E 1 153 ? 21.493  5.096   19.566  1.00 1.00   ? 153  LEU C CD2 1 
ATOM   4845  N N   . SER E 1 154 ? 18.214  7.871   21.654  1.00 9.75   ? 154  SER C N   1 
ATOM   4846  C CA  . SER E 1 154 ? 18.289  9.252   21.926  1.00 5.01   ? 154  SER C CA  1 
ATOM   4847  C C   . SER E 1 154 ? 19.555  9.514   22.667  1.00 12.22  ? 154  SER C C   1 
ATOM   4848  O O   . SER E 1 154 ? 20.306  8.645   23.118  1.00 13.00  ? 154  SER C O   1 
ATOM   4849  C CB  . SER E 1 154 ? 17.104  9.702   22.753  1.00 1.00   ? 154  SER C CB  1 
ATOM   4850  O OG  . SER E 1 154 ? 17.286  9.299   24.087  1.00 11.84  ? 154  SER C OG  1 
ATOM   4851  N N   . LEU E 1 155 ? 19.808  10.770  22.755  1.00 9.77   ? 155  LEU C N   1 
ATOM   4852  C CA  . LEU E 1 155 ? 20.959  11.206  23.481  1.00 7.09   ? 155  LEU C CA  1 
ATOM   4853  C C   . LEU E 1 155 ? 20.854  10.738  24.937  1.00 11.75  ? 155  LEU C C   1 
ATOM   4854  O O   . LEU E 1 155 ? 21.832  10.418  25.580  1.00 13.82  ? 155  LEU C O   1 
ATOM   4855  C CB  . LEU E 1 155 ? 20.967  12.726  23.372  1.00 5.55   ? 155  LEU C CB  1 
ATOM   4856  C CG  . LEU E 1 155 ? 22.023  13.389  24.223  1.00 7.79   ? 155  LEU C CG  1 
ATOM   4857  C CD1 . LEU E 1 155 ? 23.396  12.893  23.865  1.00 1.95   ? 155  LEU C CD1 1 
ATOM   4858  C CD2 . LEU E 1 155 ? 21.930  14.877  23.970  1.00 1.00   ? 155  LEU C CD2 1 
ATOM   4859  N N   . ALA E 1 156 ? 19.633  10.675  25.471  1.00 4.41   ? 156  ALA C N   1 
ATOM   4860  C CA  . ALA E 1 156 ? 19.447  10.242  26.833  1.00 1.00   ? 156  ALA C CA  1 
ATOM   4861  C C   . ALA E 1 156 ? 19.961  8.811   27.053  1.00 9.58   ? 156  ALA C C   1 
ATOM   4862  O O   . ALA E 1 156 ? 20.647  8.490   28.049  1.00 11.69  ? 156  ALA C O   1 
ATOM   4863  C CB  . ALA E 1 156 ? 18.001  10.411  27.193  1.00 1.21   ? 156  ALA C CB  1 
ATOM   4864  N N   . ASP E 1 157 ? 19.688  7.930   26.097  1.00 3.22   ? 157  ASP C N   1 
ATOM   4865  C CA  . ASP E 1 157 ? 20.148  6.566   26.263  1.00 1.00   ? 157  ASP C CA  1 
ATOM   4866  C C   . ASP E 1 157 ? 21.671  6.480   26.242  1.00 6.79   ? 157  ASP C C   1 
ATOM   4867  O O   . ASP E 1 157 ? 22.311  5.725   26.970  1.00 9.32   ? 157  ASP C O   1 
ATOM   4868  C CB  . ASP E 1 157 ? 19.586  5.690   25.148  1.00 1.62   ? 157  ASP C CB  1 
ATOM   4869  C CG  . ASP E 1 157 ? 18.092  5.666   24.994  1.00 7.39   ? 157  ASP C CG  1 
ATOM   4870  O OD1 . ASP E 1 157 ? 17.299  5.375   25.872  1.00 7.28   ? 157  ASP C OD1 1 
ATOM   4871  O OD2 . ASP E 1 157 ? 17.721  5.971   23.788  1.00 11.20  ? 157  ASP C OD2 1 
ATOM   4872  N N   . VAL E 1 158 ? 22.311  7.221   25.378  1.00 2.97   ? 158  VAL C N   1 
ATOM   4873  C CA  . VAL E 1 158 ? 23.773  7.102   25.364  1.00 3.11   ? 158  VAL C CA  1 
ATOM   4874  C C   . VAL E 1 158 ? 24.433  7.552   26.659  1.00 12.25  ? 158  VAL C C   1 
ATOM   4875  O O   . VAL E 1 158 ? 25.340  6.909   27.196  1.00 12.12  ? 158  VAL C O   1 
ATOM   4876  C CB  . VAL E 1 158 ? 24.412  7.874   24.207  1.00 6.13   ? 158  VAL C CB  1 
ATOM   4877  C CG1 . VAL E 1 158 ? 25.909  7.655   24.161  1.00 8.89   ? 158  VAL C CG1 1 
ATOM   4878  C CG2 . VAL E 1 158 ? 23.761  7.602   22.876  1.00 1.00   ? 158  VAL C CG2 1 
ATOM   4879  N N   . ILE E 1 159 ? 23.998  8.714   27.154  1.00 8.29   ? 159  ILE C N   1 
ATOM   4880  C CA  . ILE E 1 159 ? 24.589  9.260   28.367  1.00 4.76   ? 159  ILE C CA  1 
ATOM   4881  C C   . ILE E 1 159 ? 24.358  8.361   29.549  1.00 8.02   ? 159  ILE C C   1 
ATOM   4882  O O   . ILE E 1 159 ? 25.216  8.185   30.417  1.00 12.26  ? 159  ILE C O   1 
ATOM   4883  C CB  . ILE E 1 159 ? 24.050  10.653  28.650  1.00 7.13   ? 159  ILE C CB  1 
ATOM   4884  C CG1 . ILE E 1 159 ? 24.301  11.553  27.455  1.00 7.72   ? 159  ILE C CG1 1 
ATOM   4885  C CG2 . ILE E 1 159 ? 24.798  11.245  29.817  1.00 1.00   ? 159  ILE C CG2 1 
ATOM   4886  C CD1 . ILE E 1 159 ? 25.776  11.522  27.041  1.00 2.92   ? 159  ILE C CD1 1 
ATOM   4887  N N   . LEU E 1 160 ? 23.177  7.773   29.539  1.00 1.91   ? 160  LEU C N   1 
ATOM   4888  C CA  . LEU E 1 160 ? 22.798  6.880   30.601  1.00 3.04   ? 160  LEU C CA  1 
ATOM   4889  C C   . LEU E 1 160 ? 23.610  5.648   30.530  1.00 6.29   ? 160  LEU C C   1 
ATOM   4890  O O   . LEU E 1 160 ? 24.253  5.256   31.500  1.00 12.58  ? 160  LEU C O   1 
ATOM   4891  C CB  . LEU E 1 160 ? 21.304  6.631   30.597  1.00 4.78   ? 160  LEU C CB  1 
ATOM   4892  C CG  . LEU E 1 160 ? 20.896  5.675   31.675  1.00 5.70   ? 160  LEU C CG  1 
ATOM   4893  C CD1 . LEU E 1 160 ? 21.343  6.141   33.046  1.00 1.00   ? 160  LEU C CD1 1 
ATOM   4894  C CD2 . LEU E 1 160 ? 19.401  5.633   31.629  1.00 1.00   ? 160  LEU C CD2 1 
ATOM   4895  N N   . LEU E 1 161 ? 23.670  5.100   29.342  1.00 1.00   ? 161  LEU C N   1 
ATOM   4896  C CA  . LEU E 1 161 ? 24.530  3.965   29.159  1.00 2.24   ? 161  LEU C CA  1 
ATOM   4897  C C   . LEU E 1 161 ? 25.970  4.254   29.574  1.00 6.32   ? 161  LEU C C   1 
ATOM   4898  O O   . LEU E 1 161 ? 26.634  3.515   30.303  1.00 7.38   ? 161  LEU C O   1 
ATOM   4899  C CB  . LEU E 1 161 ? 24.565  3.573   27.691  1.00 4.61   ? 161  LEU C CB  1 
ATOM   4900  C CG  . LEU E 1 161 ? 25.534  2.400   27.447  1.00 11.13  ? 161  LEU C CG  1 
ATOM   4901  C CD1 . LEU E 1 161 ? 25.103  1.128   28.152  1.00 6.22   ? 161  LEU C CD1 1 
ATOM   4902  C CD2 . LEU E 1 161 ? 25.566  2.081   25.975  1.00 5.61   ? 161  LEU C CD2 1 
ATOM   4903  N N   . GLN E 1 162 ? 26.458  5.380   29.138  1.00 1.00   ? 162  GLN C N   1 
ATOM   4904  C CA  . GLN E 1 162 ? 27.824  5.706   29.481  1.00 2.60   ? 162  GLN C CA  1 
ATOM   4905  C C   . GLN E 1 162 ? 28.107  5.740   30.965  1.00 9.76   ? 162  GLN C C   1 
ATOM   4906  O O   . GLN E 1 162 ? 29.104  5.218   31.446  1.00 13.96  ? 162  GLN C O   1 
ATOM   4907  C CB  . GLN E 1 162 ? 28.197  7.064   28.886  1.00 5.01   ? 162  GLN C CB  1 
ATOM   4908  C CG  . GLN E 1 162 ? 29.218  7.727   29.803  1.00 1.00   ? 162  GLN C CG  1 
ATOM   4909  C CD  . GLN E 1 162 ? 29.845  9.045   29.332  1.00 7.99   ? 162  GLN C CD  1 
ATOM   4910  O OE1 . GLN E 1 162 ? 31.034  9.249   29.573  1.00 13.25  ? 162  GLN C OE1 1 
ATOM   4911  N NE2 . GLN E 1 162 ? 29.071  10.022  28.838  1.00 1.00   ? 162  GLN C NE2 1 
ATOM   4912  N N   . THR E 1 163 ? 27.144  6.327   31.651  1.00 8.32   ? 163  THR C N   1 
ATOM   4913  C CA  . THR E 1 163 ? 27.202  6.540   33.074  1.00 6.48   ? 163  THR C CA  1 
ATOM   4914  C C   . THR E 1 163 ? 27.086  5.264   33.872  1.00 10.48  ? 163  THR C C   1 
ATOM   4915  O O   . THR E 1 163 ? 27.839  4.966   34.796  1.00 9.86   ? 163  THR C O   1 
ATOM   4916  C CB  . THR E 1 163 ? 26.110  7.550   33.470  1.00 3.83   ? 163  THR C CB  1 
ATOM   4917  O OG1 . THR E 1 163 ? 26.199  8.757   32.725  1.00 7.93   ? 163  THR C OG1 1 
ATOM   4918  C CG2 . THR E 1 163 ? 26.155  7.848   34.945  1.00 1.00   ? 163  THR C CG2 1 
ATOM   4919  N N   . ILE E 1 164 ? 26.097  4.503   33.526  1.00 6.30   ? 164  ILE C N   1 
ATOM   4920  C CA  . ILE E 1 164 ? 25.909  3.239   34.190  1.00 5.83   ? 164  ILE C CA  1 
ATOM   4921  C C   . ILE E 1 164 ? 27.164  2.379   34.073  1.00 10.33  ? 164  ILE C C   1 
ATOM   4922  O O   . ILE E 1 164 ? 27.722  1.848   35.060  1.00 8.32   ? 164  ILE C O   1 
ATOM   4923  C CB  . ILE E 1 164 ? 24.844  2.534   33.408  1.00 8.52   ? 164  ILE C CB  1 
ATOM   4924  C CG1 . ILE E 1 164 ? 23.460  2.984   33.849  1.00 6.79   ? 164  ILE C CG1 1 
ATOM   4925  C CG2 . ILE E 1 164 ? 25.032  1.074   33.659  1.00 3.92   ? 164  ILE C CG2 1 
ATOM   4926  C CD1 . ILE E 1 164 ? 22.374  2.407   32.975  1.00 1.00   ? 164  ILE C CD1 1 
ATOM   4927  N N   . LEU E 1 165 ? 27.676  2.283   32.846  1.00 1.85   ? 165  LEU C N   1 
ATOM   4928  C CA  . LEU E 1 165 ? 28.881  1.488   32.713  1.00 1.15   ? 165  LEU C CA  1 
ATOM   4929  C C   . LEU E 1 165 ? 30.042  1.977   33.520  1.00 7.95   ? 165  LEU C C   1 
ATOM   4930  O O   . LEU E 1 165 ? 30.860  1.210   34.002  1.00 14.91  ? 165  LEU C O   1 
ATOM   4931  C CB  . LEU E 1 165 ? 29.333  1.380   31.280  1.00 3.68   ? 165  LEU C CB  1 
ATOM   4932  C CG  . LEU E 1 165 ? 28.306  0.765   30.341  1.00 9.64   ? 165  LEU C CG  1 
ATOM   4933  C CD1 . LEU E 1 165 ? 28.878  0.660   28.943  1.00 5.44   ? 165  LEU C CD1 1 
ATOM   4934  C CD2 . LEU E 1 165 ? 27.923  -0.611  30.798  1.00 1.00   ? 165  LEU C CD2 1 
ATOM   4935  N N   . ALA E 1 166 ? 30.153  3.275   33.597  1.00 8.71   ? 166  ALA C N   1 
ATOM   4936  C CA  . ALA E 1 166 ? 31.232  3.859   34.360  1.00 1.59   ? 166  ALA C CA  1 
ATOM   4937  C C   . ALA E 1 166 ? 31.075  3.565   35.835  1.00 7.30   ? 166  ALA C C   1 
ATOM   4938  O O   . ALA E 1 166 ? 32.025  3.339   36.568  1.00 7.68   ? 166  ALA C O   1 
ATOM   4939  C CB  . ALA E 1 166 ? 31.110  5.312   34.158  1.00 1.00   ? 166  ALA C CB  1 
ATOM   4940  N N   . LEU E 1 167 ? 29.841  3.559   36.279  1.00 4.92   ? 167  LEU C N   1 
ATOM   4941  C CA  . LEU E 1 167 ? 29.588  3.288   37.654  1.00 4.32   ? 167  LEU C CA  1 
ATOM   4942  C C   . LEU E 1 167 ? 29.923  1.856   37.919  1.00 12.12  ? 167  LEU C C   1 
ATOM   4943  O O   . LEU E 1 167 ? 30.571  1.511   38.915  1.00 11.02  ? 167  LEU C O   1 
ATOM   4944  C CB  . LEU E 1 167 ? 28.098  3.501   37.901  1.00 4.79   ? 167  LEU C CB  1 
ATOM   4945  C CG  . LEU E 1 167 ? 27.791  4.963   38.118  1.00 9.14   ? 167  LEU C CG  1 
ATOM   4946  C CD1 . LEU E 1 167 ? 26.338  5.246   37.996  1.00 6.73   ? 167  LEU C CD1 1 
ATOM   4947  C CD2 . LEU E 1 167 ? 28.144  5.313   39.532  1.00 1.00   ? 167  LEU C CD2 1 
ATOM   4948  N N   . GLU E 1 168 ? 29.475  1.010   36.995  1.00 7.20   ? 168  GLU C N   1 
ATOM   4949  C CA  . GLU E 1 168 ? 29.764  -0.392  37.188  1.00 5.64   ? 168  GLU C CA  1 
ATOM   4950  C C   . GLU E 1 168 ? 31.232  -0.683  37.287  1.00 13.17  ? 168  GLU C C   1 
ATOM   4951  O O   . GLU E 1 168 ? 31.661  -1.693  37.831  1.00 20.60  ? 168  GLU C O   1 
ATOM   4952  C CB  . GLU E 1 168 ? 29.215  -1.274  36.133  1.00 1.00   ? 168  GLU C CB  1 
ATOM   4953  C CG  . GLU E 1 168 ? 27.709  -1.288  36.183  1.00 11.55  ? 168  GLU C CG  1 
ATOM   4954  C CD  . GLU E 1 168 ? 27.166  -2.274  35.184  1.00 4.97   ? 168  GLU C CD  1 
ATOM   4955  O OE1 . GLU E 1 168 ? 27.727  -2.496  34.090  1.00 25.67  ? 168  GLU C OE1 1 
ATOM   4956  O OE2 . GLU E 1 168 ? 26.107  -2.950  35.651  1.00 38.28  ? 168  GLU C OE2 1 
ATOM   4957  N N   . GLU E 1 169 ? 32.015  0.162   36.715  1.00 3.60   ? 169  GLU C N   1 
ATOM   4958  C CA  . GLU E 1 169 ? 33.409  -0.074  36.859  1.00 3.76   ? 169  GLU C CA  1 
ATOM   4959  C C   . GLU E 1 169 ? 33.781  0.053   38.304  1.00 13.90  ? 169  GLU C C   1 
ATOM   4960  O O   . GLU E 1 169 ? 34.704  -0.600  38.730  1.00 20.41  ? 169  GLU C O   1 
ATOM   4961  C CB  . GLU E 1 169 ? 34.311  0.881   36.055  1.00 5.62   ? 169  GLU C CB  1 
ATOM   4962  C CG  . GLU E 1 169 ? 34.216  0.742   34.532  1.00 3.86   ? 169  GLU C CG  1 
ATOM   4963  C CD  . GLU E 1 169 ? 34.803  1.942   33.841  1.00 20.25  ? 169  GLU C CD  1 
ATOM   4964  O OE1 . GLU E 1 169 ? 35.011  2.967   34.416  1.00 27.21  ? 169  GLU C OE1 1 
ATOM   4965  O OE2 . GLU E 1 169 ? 34.871  1.837   32.548  1.00 8.59   ? 169  GLU C OE2 1 
ATOM   4966  N N   . LYS E 1 170 ? 33.107  0.902   39.069  1.00 13.87  ? 170  LYS C N   1 
ATOM   4967  C CA  . LYS E 1 170 ? 33.466  1.025   40.470  1.00 10.02  ? 170  LYS C CA  1 
ATOM   4968  C C   . LYS E 1 170 ? 32.574  0.182   41.371  1.00 19.17  ? 170  LYS C C   1 
ATOM   4969  O O   . LYS E 1 170 ? 33.004  -0.236  42.450  1.00 19.33  ? 170  LYS C O   1 
ATOM   4970  C CB  . LYS E 1 170 ? 33.348  2.447   40.943  1.00 8.99   ? 170  LYS C CB  1 
ATOM   4971  C CG  . LYS E 1 170 ? 34.052  3.385   40.028  1.00 9.35   ? 170  LYS C CG  1 
ATOM   4972  C CD  . LYS E 1 170 ? 34.773  4.578   40.669  1.00 10.16  ? 170  LYS C CD  1 
ATOM   4973  C CE  . LYS E 1 170 ? 35.741  5.252   39.692  1.00 32.81  ? 170  LYS C CE  1 
ATOM   4974  N NZ  . LYS E 1 170 ? 36.810  6.100   40.274  1.00 121.55 ? 170  LYS C NZ  1 
ATOM   4975  N N   . ILE E 1 171 ? 31.316  -0.017  40.950  1.00 13.36  ? 171  ILE C N   1 
ATOM   4976  C CA  . ILE E 1 171 ? 30.323  -0.763  41.735  1.00 7.24   ? 171  ILE C CA  1 
ATOM   4977  C C   . ILE E 1 171 ? 29.529  -1.616  40.808  1.00 13.74  ? 171  ILE C C   1 
ATOM   4978  O O   . ILE E 1 171 ? 28.455  -1.285  40.286  1.00 23.49  ? 171  ILE C O   1 
ATOM   4979  C CB  . ILE E 1 171 ? 29.370  0.194   42.398  1.00 8.56   ? 171  ILE C CB  1 
ATOM   4980  C CG1 . ILE E 1 171 ? 30.130  1.366   42.983  1.00 7.78   ? 171  ILE C CG1 1 
ATOM   4981  C CG2 . ILE E 1 171 ? 28.665  -0.538  43.474  1.00 1.00   ? 171  ILE C CG2 1 
ATOM   4982  C CD1 . ILE E 1 171 ? 29.250  2.574   43.177  1.00 7.31   ? 171  ILE C CD1 1 
ATOM   4983  N N   . PRO E 1 172 ? 30.150  -2.706  40.639  1.00 7.06   ? 172  PRO C N   1 
ATOM   4984  C CA  . PRO E 1 172 ? 29.851  -3.747  39.724  1.00 9.45   ? 172  PRO C CA  1 
ATOM   4985  C C   . PRO E 1 172 ? 28.489  -4.299  39.763  1.00 17.10  ? 172  PRO C C   1 
ATOM   4986  O O   . PRO E 1 172 ? 28.055  -4.784  38.745  1.00 16.45  ? 172  PRO C O   1 
ATOM   4987  C CB  . PRO E 1 172 ? 30.926  -4.829  39.891  1.00 4.38   ? 172  PRO C CB  1 
ATOM   4988  C CG  . PRO E 1 172 ? 32.025  -4.165  40.687  1.00 3.83   ? 172  PRO C CG  1 
ATOM   4989  C CD  . PRO E 1 172 ? 31.428  -2.917  41.330  1.00 6.07   ? 172  PRO C CD  1 
ATOM   4990  N N   . ASN E 1 173 ? 27.866  -4.227  40.916  1.00 15.91  ? 173  ASN C N   1 
ATOM   4991  C CA  . ASN E 1 173 ? 26.532  -4.740  41.132  1.00 14.15  ? 173  ASN C CA  1 
ATOM   4992  C C   . ASN E 1 173 ? 25.570  -3.614  41.324  1.00 21.82  ? 173  ASN C C   1 
ATOM   4993  O O   . ASN E 1 173 ? 24.544  -3.756  41.934  1.00 26.37  ? 173  ASN C O   1 
ATOM   4994  C CB  . ASN E 1 173 ? 26.547  -5.487  42.462  1.00 8.39   ? 173  ASN C CB  1 
ATOM   4995  C CG  . ASN E 1 173 ? 27.128  -4.685  43.619  1.00 42.06  ? 173  ASN C CG  1 
ATOM   4996  O OD1 . ASN E 1 173 ? 28.147  -3.981  43.458  1.00 79.29  ? 173  ASN C OD1 1 
ATOM   4997  N ND2 . ASN E 1 173 ? 26.625  -4.972  44.837  1.00 48.92  ? 173  ASN C ND2 1 
ATOM   4998  N N   . ILE E 1 174 ? 25.931  -2.458  40.864  1.00 17.65  ? 174  ILE C N   1 
ATOM   4999  C CA  . ILE E 1 174 ? 25.074  -1.358  41.096  1.00 10.65  ? 174  ILE C CA  1 
ATOM   5000  C C   . ILE E 1 174 ? 23.699  -1.519  40.476  1.00 15.63  ? 174  ILE C C   1 
ATOM   5001  O O   . ILE E 1 174 ? 22.698  -1.028  40.989  1.00 22.04  ? 174  ILE C O   1 
ATOM   5002  C CB  . ILE E 1 174 ? 25.800  -0.114  40.723  1.00 10.88  ? 174  ILE C CB  1 
ATOM   5003  C CG1 . ILE E 1 174 ? 25.019  0.989   41.358  1.00 5.26   ? 174  ILE C CG1 1 
ATOM   5004  C CG2 . ILE E 1 174 ? 25.916  -0.019  39.178  1.00 1.00   ? 174  ILE C CG2 1 
ATOM   5005  C CD1 . ILE E 1 174 ? 25.888  2.180   41.334  1.00 16.19  ? 174  ILE C CD1 1 
ATOM   5006  N N   . LEU E 1 175 ? 23.619  -2.311  39.405  1.00 13.16  ? 175  LEU C N   1 
ATOM   5007  C CA  . LEU E 1 175 ? 22.341  -2.512  38.718  1.00 10.15  ? 175  LEU C CA  1 
ATOM   5008  C C   . LEU E 1 175 ? 21.496  -3.685  39.184  1.00 23.77  ? 175  LEU C C   1 
ATOM   5009  O O   . LEU E 1 175 ? 20.407  -3.953  38.617  1.00 21.65  ? 175  LEU C O   1 
ATOM   5010  C CB  . LEU E 1 175 ? 22.556  -2.767  37.248  1.00 5.76   ? 175  LEU C CB  1 
ATOM   5011  C CG  . LEU E 1 175 ? 22.704  -1.536  36.375  1.00 9.61   ? 175  LEU C CG  1 
ATOM   5012  C CD1 . LEU E 1 175 ? 22.523  -2.003  34.959  1.00 10.47  ? 175  LEU C CD1 1 
ATOM   5013  C CD2 . LEU E 1 175 ? 21.700  -0.419  36.694  1.00 1.06   ? 175  LEU C CD2 1 
ATOM   5014  N N   . SER E 1 176 ? 22.066  -4.395  40.154  1.00 22.38  ? 176  SER C N   1 
ATOM   5015  C CA  . SER E 1 176 ? 21.479  -5.571  40.782  1.00 20.12  ? 176  SER C CA  1 
ATOM   5016  C C   . SER E 1 176 ? 19.995  -5.389  40.945  1.00 19.57  ? 176  SER C C   1 
ATOM   5017  O O   . SER E 1 176 ? 19.217  -6.157  40.449  1.00 36.15  ? 176  SER C O   1 
ATOM   5018  C CB  . SER E 1 176 ? 22.093  -5.851  42.153  1.00 27.14  ? 176  SER C CB  1 
ATOM   5019  O OG  . SER E 1 176 ? 22.010  -4.653  42.950  1.00 92.26  ? 176  SER C OG  1 
ATOM   5020  N N   . ALA E 1 177 ? 19.572  -4.358  41.615  1.00 14.43  ? 177  ALA C N   1 
ATOM   5021  C CA  . ALA E 1 177 ? 18.151  -4.177  41.796  1.00 7.83   ? 177  ALA C CA  1 
ATOM   5022  C C   . ALA E 1 177 ? 17.373  -3.566  40.645  1.00 15.57  ? 177  ALA C C   1 
ATOM   5023  O O   . ALA E 1 177 ? 16.199  -3.268  40.901  1.00 21.58  ? 177  ALA C O   1 
ATOM   5024  C CB  . ALA E 1 177 ? 17.920  -3.315  42.999  1.00 5.96   ? 177  ALA C CB  1 
ATOM   5025  N N   . PHE E 1 178 ? 18.006  -3.376  39.458  1.00 6.27   ? 178  PHE C N   1 
ATOM   5026  C CA  . PHE E 1 178 ? 17.389  -2.749  38.306  1.00 9.20   ? 178  PHE C CA  1 
ATOM   5027  C C   . PHE E 1 178 ? 17.484  -3.595  37.085  1.00 18.14  ? 178  PHE C C   1 
ATOM   5028  O O   . PHE E 1 178 ? 18.245  -3.384  36.169  1.00 24.51  ? 178  PHE C O   1 
ATOM   5029  C CB  . PHE E 1 178 ? 18.015  -1.371  38.053  1.00 10.48  ? 178  PHE C CB  1 
ATOM   5030  C CG  . PHE E 1 178 ? 17.992  -0.589  39.342  1.00 6.36   ? 178  PHE C CG  1 
ATOM   5031  C CD1 . PHE E 1 178 ? 16.868  0.139   39.716  1.00 1.27   ? 178  PHE C CD1 1 
ATOM   5032  C CD2 . PHE E 1 178 ? 19.088  -0.576  40.200  1.00 11.09  ? 178  PHE C CD2 1 
ATOM   5033  C CE1 . PHE E 1 178 ? 16.853  0.908   40.885  1.00 1.00   ? 178  PHE C CE1 1 
ATOM   5034  C CE2 . PHE E 1 178 ? 19.064  0.133   41.403  1.00 11.28  ? 178  PHE C CE2 1 
ATOM   5035  C CZ  . PHE E 1 178 ? 17.936  0.871   41.759  1.00 1.00   ? 178  PHE C CZ  1 
ATOM   5036  N N   . PRO E 1 179 ? 16.652  -4.556  37.118  1.00 20.81  ? 179  PRO C N   1 
ATOM   5037  C CA  . PRO E 1 179 ? 16.481  -5.589  36.127  1.00 19.51  ? 179  PRO C CA  1 
ATOM   5038  C C   . PRO E 1 179 ? 16.125  -5.003  34.789  1.00 24.18  ? 179  PRO C C   1 
ATOM   5039  O O   . PRO E 1 179 ? 16.655  -5.429  33.775  1.00 26.95  ? 179  PRO C O   1 
ATOM   5040  C CB  . PRO E 1 179 ? 15.320  -6.407  36.633  1.00 15.42  ? 179  PRO C CB  1 
ATOM   5041  C CG  . PRO E 1 179 ? 14.863  -5.828  37.942  1.00 15.39  ? 179  PRO C CG  1 
ATOM   5042  C CD  . PRO E 1 179 ? 15.872  -4.774  38.336  1.00 16.82  ? 179  PRO C CD  1 
ATOM   5043  N N   . PHE E 1 180 ? 15.260  -4.004  34.776  1.00 16.21  ? 180  PHE C N   1 
ATOM   5044  C CA  . PHE E 1 180 ? 14.977  -3.359  33.500  1.00 14.12  ? 180  PHE C CA  1 
ATOM   5045  C C   . PHE E 1 180 ? 16.211  -2.668  32.977  1.00 18.51  ? 180  PHE C C   1 
ATOM   5046  O O   . PHE E 1 180 ? 16.578  -2.829  31.816  1.00 18.74  ? 180  PHE C O   1 
ATOM   5047  C CB  . PHE E 1 180 ? 13.886  -2.330  33.652  1.00 16.34  ? 180  PHE C CB  1 
ATOM   5048  C CG  . PHE E 1 180 ? 12.576  -3.080  33.629  1.00 21.04  ? 180  PHE C CG  1 
ATOM   5049  C CD1 . PHE E 1 180 ? 12.094  -3.726  34.762  1.00 20.75  ? 180  PHE C CD1 1 
ATOM   5050  C CD2 . PHE E 1 180 ? 11.827  -3.237  32.458  1.00 26.78  ? 180  PHE C CD2 1 
ATOM   5051  C CE1 . PHE E 1 180 ? 10.879  -4.422  34.733  1.00 18.28  ? 180  PHE C CE1 1 
ATOM   5052  C CE2 . PHE E 1 180 ? 10.623  -3.948  32.389  1.00 17.67  ? 180  PHE C CE2 1 
ATOM   5053  C CZ  . PHE E 1 180 ? 10.138  -4.536  33.555  1.00 10.82  ? 180  PHE C CZ  1 
ATOM   5054  N N   . LEU E 1 181 ? 16.875  -1.927  33.879  1.00 8.93   ? 181  LEU C N   1 
ATOM   5055  C CA  . LEU E 1 181 ? 18.067  -1.249  33.489  1.00 9.86   ? 181  LEU C CA  1 
ATOM   5056  C C   . LEU E 1 181 ? 19.099  -2.257  33.039  1.00 12.03  ? 181  LEU C C   1 
ATOM   5057  O O   . LEU E 1 181 ? 19.883  -2.033  32.088  1.00 13.20  ? 181  LEU C O   1 
ATOM   5058  C CB  . LEU E 1 181 ? 18.623  -0.348  34.608  1.00 13.77  ? 181  LEU C CB  1 
ATOM   5059  C CG  . LEU E 1 181 ? 17.849  0.932   34.810  1.00 13.05  ? 181  LEU C CG  1 
ATOM   5060  C CD1 . LEU E 1 181 ? 18.359  1.703   36.022  1.00 11.41  ? 181  LEU C CD1 1 
ATOM   5061  C CD2 . LEU E 1 181 ? 18.021  1.724   33.556  1.00 1.82   ? 181  LEU C CD2 1 
ATOM   5062  N N   . GLN E 1 182 ? 19.108  -3.418  33.677  1.00 9.34   ? 182  GLN C N   1 
ATOM   5063  C CA  . GLN E 1 182 ? 20.121  -4.366  33.210  1.00 8.76   ? 182  GLN C CA  1 
ATOM   5064  C C   . GLN E 1 182 ? 19.862  -4.811  31.808  1.00 14.41  ? 182  GLN C C   1 
ATOM   5065  O O   . GLN E 1 182 ? 20.733  -4.884  30.983  1.00 16.30  ? 182  GLN C O   1 
ATOM   5066  C CB  . GLN E 1 182 ? 20.208  -5.618  34.005  1.00 6.64   ? 182  GLN C CB  1 
ATOM   5067  C CG  . GLN E 1 182 ? 20.821  -5.551  35.398  1.00 35.10  ? 182  GLN C CG  1 
ATOM   5068  C CD  . GLN E 1 182 ? 20.357  -6.778  36.169  1.00 18.09  ? 182  GLN C CD  1 
ATOM   5069  O OE1 . GLN E 1 182 ? 20.064  -7.838  35.582  1.00 83.28  ? 182  GLN C OE1 1 
ATOM   5070  N NE2 . GLN E 1 182 ? 20.094  -6.612  37.451  1.00 33.79  ? 182  GLN C NE2 1 
ATOM   5071  N N   . GLU E 1 183 ? 18.640  -5.113  31.517  1.00 15.58  ? 183  GLU C N   1 
ATOM   5072  C CA  . GLU E 1 183 ? 18.377  -5.547  30.196  1.00 18.74  ? 183  GLU C CA  1 
ATOM   5073  C C   . GLU E 1 183 ? 18.619  -4.493  29.190  1.00 16.44  ? 183  GLU C C   1 
ATOM   5074  O O   . GLU E 1 183 ? 19.242  -4.728  28.175  1.00 21.35  ? 183  GLU C O   1 
ATOM   5075  C CB  . GLU E 1 183 ? 16.975  -6.060  30.040  1.00 23.36  ? 183  GLU C CB  1 
ATOM   5076  C CG  . GLU E 1 183 ? 16.796  -7.130  28.937  1.00 90.45  ? 183  GLU C CG  1 
ATOM   5077  C CD  . GLU E 1 183 ? 15.355  -7.398  28.779  1.00 240.06 ? 183  GLU C CD  1 
ATOM   5078  O OE1 . GLU E 1 183 ? 14.526  -7.206  29.639  1.00 286.72 ? 183  GLU C OE1 1 
ATOM   5079  O OE2 . GLU E 1 183 ? 15.065  -8.077  27.698  1.00 267.52 ? 183  GLU C OE2 1 
ATOM   5080  N N   . TYR E 1 184 ? 18.110  -3.328  29.479  1.00 16.75  ? 184  TYR C N   1 
ATOM   5081  C CA  . TYR E 1 184 ? 18.259  -2.183  28.597  1.00 15.59  ? 184  TYR C CA  1 
ATOM   5082  C C   . TYR E 1 184 ? 19.730  -1.973  28.213  1.00 17.05  ? 184  TYR C C   1 
ATOM   5083  O O   . TYR E 1 184 ? 20.120  -1.817  27.036  1.00 16.57  ? 184  TYR C O   1 
ATOM   5084  C CB  . TYR E 1 184 ? 17.754  -1.066  29.448  1.00 10.91  ? 184  TYR C CB  1 
ATOM   5085  C CG  . TYR E 1 184 ? 17.975  0.313   28.947  1.00 13.32  ? 184  TYR C CG  1 
ATOM   5086  C CD1 . TYR E 1 184 ? 17.110  0.966   28.066  1.00 12.11  ? 184  TYR C CD1 1 
ATOM   5087  C CD2 . TYR E 1 184 ? 19.011  1.059   29.506  1.00 10.72  ? 184  TYR C CD2 1 
ATOM   5088  C CE1 . TYR E 1 184 ? 17.390  2.272   27.646  1.00 9.98   ? 184  TYR C CE1 1 
ATOM   5089  C CE2 . TYR E 1 184 ? 19.278  2.374   29.118  1.00 4.44   ? 184  TYR C CE2 1 
ATOM   5090  C CZ  . TYR E 1 184 ? 18.456  3.003   28.190  1.00 8.44   ? 184  TYR C CZ  1 
ATOM   5091  O OH  . TYR E 1 184 ? 18.695  4.338   27.862  1.00 17.51  ? 184  TYR C OH  1 
ATOM   5092  N N   . THR E 1 185 ? 20.571  -2.073  29.229  1.00 2.92   ? 185  THR C N   1 
ATOM   5093  C CA  . THR E 1 185 ? 21.999  -1.888  29.068  1.00 2.77   ? 185  THR C CA  1 
ATOM   5094  C C   . THR E 1 185 ? 22.566  -2.902  28.139  1.00 13.26  ? 185  THR C C   1 
ATOM   5095  O O   . THR E 1 185 ? 23.396  -2.675  27.263  1.00 13.17  ? 185  THR C O   1 
ATOM   5096  C CB  . THR E 1 185 ? 22.636  -2.103  30.449  1.00 14.05  ? 185  THR C CB  1 
ATOM   5097  O OG1 . THR E 1 185 ? 22.265  -1.051  31.239  1.00 9.91   ? 185  THR C OG1 1 
ATOM   5098  C CG2 . THR E 1 185 ? 24.133  -2.060  30.405  1.00 3.34   ? 185  THR C CG2 1 
ATOM   5099  N N   . VAL E 1 186 ? 22.122  -4.078  28.363  1.00 11.46  ? 186  VAL C N   1 
ATOM   5100  C CA  . VAL E 1 186 ? 22.593  -5.139  27.540  1.00 14.52  ? 186  VAL C CA  1 
ATOM   5101  C C   . VAL E 1 186 ? 22.256  -4.948  26.091  1.00 11.38  ? 186  VAL C C   1 
ATOM   5102  O O   . VAL E 1 186 ? 23.093  -5.010  25.211  1.00 16.88  ? 186  VAL C O   1 
ATOM   5103  C CB  . VAL E 1 186 ? 21.939  -6.416  27.990  1.00 19.24  ? 186  VAL C CB  1 
ATOM   5104  C CG1 . VAL E 1 186 ? 22.350  -7.441  26.974  1.00 15.96  ? 186  VAL C CG1 1 
ATOM   5105  C CG2 . VAL E 1 186 ? 22.538  -6.810  29.321  1.00 14.85  ? 186  VAL C CG2 1 
ATOM   5106  N N   . LYS E 1 187 ? 21.013  -4.725  25.843  1.00 4.04   ? 187  LYS C N   1 
ATOM   5107  C CA  . LYS E 1 187 ? 20.639  -4.467  24.481  1.00 8.37   ? 187  LYS C CA  1 
ATOM   5108  C C   . LYS E 1 187 ? 21.352  -3.304  23.835  1.00 18.54  ? 187  LYS C C   1 
ATOM   5109  O O   . LYS E 1 187 ? 21.708  -3.368  22.674  1.00 20.40  ? 187  LYS C O   1 
ATOM   5110  C CB  . LYS E 1 187 ? 19.183  -4.128  24.401  1.00 7.10   ? 187  LYS C CB  1 
ATOM   5111  C CG  . LYS E 1 187 ? 18.330  -5.194  25.034  1.00 17.97  ? 187  LYS C CG  1 
ATOM   5112  C CD  . LYS E 1 187 ? 16.942  -5.267  24.404  1.00 38.64  ? 187  LYS C CD  1 
ATOM   5113  C CE  . LYS E 1 187 ? 15.758  -5.242  25.400  1.00 92.14  ? 187  LYS C CE  1 
ATOM   5114  N NZ  . LYS E 1 187 ? 15.300  -3.894  25.834  1.00 21.76  ? 187  LYS C NZ  1 
ATOM   5115  N N   . LEU E 1 188 ? 21.398  -2.198  24.553  1.00 19.55  ? 188  LEU C N   1 
ATOM   5116  C CA  . LEU E 1 188 ? 21.987  -1.018  24.000  1.00 15.53  ? 188  LEU C CA  1 
ATOM   5117  C C   . LEU E 1 188 ? 23.386  -1.368  23.647  1.00 17.36  ? 188  LEU C C   1 
ATOM   5118  O O   . LEU E 1 188 ? 23.930  -0.916  22.648  1.00 19.51  ? 188  LEU C O   1 
ATOM   5119  C CB  . LEU E 1 188 ? 22.074  0.095   25.070  1.00 11.05  ? 188  LEU C CB  1 
ATOM   5120  C CG  . LEU E 1 188 ? 20.801  0.860   25.367  1.00 12.13  ? 188  LEU C CG  1 
ATOM   5121  C CD1 . LEU E 1 188 ? 21.103  2.044   26.255  1.00 9.57   ? 188  LEU C CD1 1 
ATOM   5122  C CD2 . LEU E 1 188 ? 20.101  1.377   24.124  1.00 12.24  ? 188  LEU C CD2 1 
ATOM   5123  N N   . SER E 1 189 ? 23.992  -2.136  24.531  1.00 6.09   ? 189  SER C N   1 
ATOM   5124  C CA  . SER E 1 189 ? 25.381  -2.390  24.253  1.00 10.27  ? 189  SER C CA  1 
ATOM   5125  C C   . SER E 1 189 ? 25.583  -3.247  23.061  1.00 18.63  ? 189  SER C C   1 
ATOM   5126  O O   . SER E 1 189 ? 26.715  -3.505  22.654  1.00 20.89  ? 189  SER C O   1 
ATOM   5127  C CB  . SER E 1 189 ? 26.167  -2.962  25.388  1.00 16.35  ? 189  SER C CB  1 
ATOM   5128  O OG  . SER E 1 189 ? 25.652  -2.533  26.613  1.00 15.31  ? 189  SER C OG  1 
ATOM   5129  N N   . ASN E 1 190 ? 24.474  -3.786  22.586  1.00 18.88  ? 190  ASN C N   1 
ATOM   5130  C CA  . ASN E 1 190 ? 24.554  -4.655  21.407  1.00 20.58  ? 190  ASN C CA  1 
ATOM   5131  C C   . ASN E 1 190 ? 24.328  -3.937  20.123  1.00 29.19  ? 190  ASN C C   1 
ATOM   5132  O O   . ASN E 1 190 ? 24.488  -4.527  19.094  1.00 34.30  ? 190  ASN C O   1 
ATOM   5133  C CB  . ASN E 1 190 ? 24.038  -6.118  21.438  1.00 18.59  ? 190  ASN C CB  1 
ATOM   5134  C CG  . ASN E 1 190 ? 24.816  -6.976  22.384  1.00 101.46 ? 190  ASN C CG  1 
ATOM   5135  O OD1 . ASN E 1 190 ? 25.885  -7.486  21.978  1.00 120.18 ? 190  ASN C OD1 1 
ATOM   5136  N ND2 . ASN E 1 190 ? 24.368  -7.020  23.662  1.00 89.76  ? 190  ASN C ND2 1 
ATOM   5137  N N   . ILE E 1 191 ? 23.972  -2.657  20.210  1.00 25.31  ? 191  ILE C N   1 
ATOM   5138  C CA  . ILE E 1 191 ? 23.871  -1.828  19.045  1.00 17.82  ? 191  ILE C CA  1 
ATOM   5139  C C   . ILE E 1 191 ? 25.301  -1.753  18.520  1.00 27.30  ? 191  ILE C C   1 
ATOM   5140  O O   . ILE E 1 191 ? 26.336  -1.598  19.196  1.00 34.88  ? 191  ILE C O   1 
ATOM   5141  C CB  . ILE E 1 191 ? 23.299  -0.490  19.403  1.00 21.12  ? 191  ILE C CB  1 
ATOM   5142  C CG1 . ILE E 1 191 ? 21.866  -0.722  19.781  1.00 13.87  ? 191  ILE C CG1 1 
ATOM   5143  C CG2 . ILE E 1 191 ? 23.332  0.417   18.197  1.00 26.89  ? 191  ILE C CG2 1 
ATOM   5144  C CD1 . ILE E 1 191 ? 21.303  0.453   20.563  1.00 11.39  ? 191  ILE C CD1 1 
ATOM   5145  N N   . PRO E 1 192 ? 25.345  -2.013  17.287  1.00 21.14  ? 192  PRO C N   1 
ATOM   5146  C CA  . PRO E 1 192 ? 26.558  -2.220  16.555  1.00 17.83  ? 192  PRO C CA  1 
ATOM   5147  C C   . PRO E 1 192 ? 27.599  -1.189  16.685  1.00 19.97  ? 192  PRO C C   1 
ATOM   5148  O O   . PRO E 1 192 ? 28.735  -1.547  16.965  1.00 22.87  ? 192  PRO C O   1 
ATOM   5149  C CB  . PRO E 1 192 ? 26.148  -2.559  15.148  1.00 17.55  ? 192  PRO C CB  1 
ATOM   5150  C CG  . PRO E 1 192 ? 24.662  -2.907  15.198  1.00 16.14  ? 192  PRO C CG  1 
ATOM   5151  C CD  . PRO E 1 192 ? 24.132  -2.404  16.542  1.00 18.64  ? 192  PRO C CD  1 
ATOM   5152  N N   . THR E 1 193 ? 27.211  0.076   16.537  1.00 14.39  ? 193  THR C N   1 
ATOM   5153  C CA  . THR E 1 193 ? 28.169  1.176   16.715  1.00 9.79   ? 193  THR C CA  1 
ATOM   5154  C C   . THR E 1 193 ? 28.691  1.097   18.115  1.00 16.14  ? 193  THR C C   1 
ATOM   5155  O O   . THR E 1 193 ? 29.889  1.214   18.375  1.00 22.19  ? 193  THR C O   1 
ATOM   5156  C CB  . THR E 1 193 ? 27.434  2.483   16.599  1.00 18.10  ? 193  THR C CB  1 
ATOM   5157  O OG1 . THR E 1 193 ? 26.269  2.398   17.394  1.00 32.46  ? 193  THR C OG1 1 
ATOM   5158  C CG2 . THR E 1 193 ? 26.964  2.609   15.180  1.00 1.00   ? 193  THR C CG2 1 
ATOM   5159  N N   . ILE E 1 194 ? 27.741  0.858   19.012  1.00 10.60  ? 194  ILE C N   1 
ATOM   5160  C CA  . ILE E 1 194 ? 28.052  0.778   20.426  1.00 10.39  ? 194  ILE C CA  1 
ATOM   5161  C C   . ILE E 1 194 ? 28.872  -0.430  20.724  1.00 18.17  ? 194  ILE C C   1 
ATOM   5162  O O   . ILE E 1 194 ? 29.891  -0.378  21.441  1.00 18.32  ? 194  ILE C O   1 
ATOM   5163  C CB  . ILE E 1 194 ? 26.797  0.819   21.255  1.00 10.11  ? 194  ILE C CB  1 
ATOM   5164  C CG1 . ILE E 1 194 ? 26.161  2.175   21.008  1.00 7.74   ? 194  ILE C CG1 1 
ATOM   5165  C CG2 . ILE E 1 194 ? 27.176  0.680   22.700  1.00 3.49   ? 194  ILE C CG2 1 
ATOM   5166  C CD1 . ILE E 1 194 ? 24.888  2.300   21.801  1.00 6.88   ? 194  ILE C CD1 1 
ATOM   5167  N N   . LYS E 1 195 ? 28.425  -1.523  20.127  1.00 14.50  ? 195  LYS C N   1 
ATOM   5168  C CA  . LYS E 1 195 ? 29.139  -2.762  20.306  1.00 16.16  ? 195  LYS C CA  1 
ATOM   5169  C C   . LYS E 1 195 ? 30.590  -2.575  19.919  1.00 18.60  ? 195  LYS C C   1 
ATOM   5170  O O   . LYS E 1 195 ? 31.461  -2.954  20.673  1.00 19.12  ? 195  LYS C O   1 
ATOM   5171  C CB  . LYS E 1 195 ? 28.495  -3.889  19.543  1.00 14.73  ? 195  LYS C CB  1 
ATOM   5172  C CG  . LYS E 1 195 ? 29.262  -5.182  19.723  1.00 22.53  ? 195  LYS C CG  1 
ATOM   5173  C CD  . LYS E 1 195 ? 28.652  -6.426  19.021  1.00 45.07  ? 195  LYS C CD  1 
ATOM   5174  C CE  . LYS E 1 195 ? 29.206  -7.796  19.471  1.00 63.04  ? 195  LYS C CE  1 
ATOM   5175  N NZ  . LYS E 1 195 ? 29.313  -8.793  18.383  1.00 124.12 ? 195  LYS C NZ  1 
ATOM   5176  N N   . ARG E 1 196 ? 30.831  -1.863  18.806  1.00 14.87  ? 196  ARG C N   1 
ATOM   5177  C CA  . ARG E 1 196 ? 32.195  -1.601  18.371  1.00 14.76  ? 196  ARG C CA  1 
ATOM   5178  C C   . ARG E 1 196 ? 32.952  -0.708  19.324  1.00 19.24  ? 196  ARG C C   1 
ATOM   5179  O O   . ARG E 1 196 ? 34.146  -0.887  19.556  1.00 21.84  ? 196  ARG C O   1 
ATOM   5180  C CB  . ARG E 1 196 ? 32.302  -0.984  16.973  1.00 10.93  ? 196  ARG C CB  1 
ATOM   5181  C CG  . ARG E 1 196 ? 31.876  -1.857  15.799  1.00 84.94  ? 196  ARG C CG  1 
ATOM   5182  C CD  . ARG E 1 196 ? 31.704  -1.024  14.531  1.00 131.16 ? 196  ARG C CD  1 
ATOM   5183  N NE  . ARG E 1 196 ? 30.501  -1.355  13.773  1.00 172.78 ? 196  ARG C NE  1 
ATOM   5184  C CZ  . ARG E 1 196 ? 29.720  -0.421  13.236  1.00 214.26 ? 196  ARG C CZ  1 
ATOM   5185  N NH1 . ARG E 1 196 ? 29.999  0.878   13.394  1.00 205.59 ? 196  ARG C NH1 1 
ATOM   5186  N NH2 . ARG E 1 196 ? 28.635  -0.790  12.545  1.00 215.17 ? 196  ARG C NH2 1 
ATOM   5187  N N   . PHE E 1 197 ? 32.258  0.318   19.784  1.00 21.18  ? 197  PHE C N   1 
ATOM   5188  C CA  . PHE E 1 197 ? 32.867  1.307   20.662  1.00 19.20  ? 197  PHE C CA  1 
ATOM   5189  C C   . PHE E 1 197 ? 33.359  0.599   21.885  1.00 18.79  ? 197  PHE C C   1 
ATOM   5190  O O   . PHE E 1 197 ? 34.398  0.894   22.431  1.00 14.50  ? 197  PHE C O   1 
ATOM   5191  C CB  . PHE E 1 197 ? 31.840  2.409   21.031  1.00 16.60  ? 197  PHE C CB  1 
ATOM   5192  C CG  . PHE E 1 197 ? 32.432  3.574   21.798  1.00 16.51  ? 197  PHE C CG  1 
ATOM   5193  C CD1 . PHE E 1 197 ? 33.331  4.454   21.179  1.00 17.86  ? 197  PHE C CD1 1 
ATOM   5194  C CD2 . PHE E 1 197 ? 32.056  3.836   23.119  1.00 11.93  ? 197  PHE C CD2 1 
ATOM   5195  C CE1 . PHE E 1 197 ? 33.909  5.529   21.856  1.00 9.94   ? 197  PHE C CE1 1 
ATOM   5196  C CE2 . PHE E 1 197 ? 32.628  4.901   23.818  1.00 10.07  ? 197  PHE C CE2 1 
ATOM   5197  C CZ  . PHE E 1 197 ? 33.549  5.740   23.185  1.00 6.81   ? 197  PHE C CZ  1 
ATOM   5198  N N   . LEU E 1 198 ? 32.568  -0.354  22.301  1.00 13.52  ? 198  LEU C N   1 
ATOM   5199  C CA  . LEU E 1 198 ? 32.940  -1.099  23.452  1.00 17.31  ? 198  LEU C CA  1 
ATOM   5200  C C   . LEU E 1 198 ? 34.064  -2.056  23.190  1.00 28.14  ? 198  LEU C C   1 
ATOM   5201  O O   . LEU E 1 198 ? 34.802  -2.397  24.092  1.00 31.92  ? 198  LEU C O   1 
ATOM   5202  C CB  . LEU E 1 198 ? 31.744  -1.837  24.005  1.00 17.25  ? 198  LEU C CB  1 
ATOM   5203  C CG  . LEU E 1 198 ? 30.759  -0.830  24.503  1.00 16.15  ? 198  LEU C CG  1 
ATOM   5204  C CD1 . LEU E 1 198 ? 29.462  -1.510  24.791  1.00 6.63   ? 198  LEU C CD1 1 
ATOM   5205  C CD2 . LEU E 1 198 ? 31.319  -0.195  25.755  1.00 15.83  ? 198  LEU C CD2 1 
ATOM   5206  N N   . GLU E 1 199 ? 34.202  -2.459  21.946  1.00 30.95  ? 199  GLU C N   1 
ATOM   5207  C CA  . GLU E 1 199 ? 35.287  -3.342  21.561  1.00 31.65  ? 199  GLU C CA  1 
ATOM   5208  C C   . GLU E 1 199 ? 36.596  -2.599  21.440  1.00 40.90  ? 199  GLU C C   1 
ATOM   5209  O O   . GLU E 1 199 ? 36.670  -1.385  21.375  1.00 48.36  ? 199  GLU C O   1 
ATOM   5210  C CB  . GLU E 1 199 ? 35.017  -4.090  20.243  1.00 33.09  ? 199  GLU C CB  1 
ATOM   5211  C CG  . GLU E 1 199 ? 34.071  -5.290  20.396  1.00 16.15  ? 199  GLU C CG  1 
ATOM   5212  C CD  . GLU E 1 199 ? 33.297  -5.664  19.163  1.00 54.57  ? 199  GLU C CD  1 
ATOM   5213  O OE1 . GLU E 1 199 ? 33.546  -5.269  18.007  1.00 50.51  ? 199  GLU C OE1 1 
ATOM   5214  O OE2 . GLU E 1 199 ? 32.356  -6.525  19.493  1.00 47.42  ? 199  GLU C OE2 1 
ATOM   5215  N N   . PRO E 1 200 ? 37.639  -3.373  21.372  1.00 40.19  ? 200  PRO C N   1 
ATOM   5216  C CA  . PRO E 1 200 ? 38.983  -2.886  21.268  1.00 38.67  ? 200  PRO C CA  1 
ATOM   5217  C C   . PRO E 1 200 ? 39.290  -2.087  20.037  1.00 39.52  ? 200  PRO C C   1 
ATOM   5218  O O   . PRO E 1 200 ? 38.746  -2.305  18.928  1.00 40.62  ? 200  PRO C O   1 
ATOM   5219  C CB  . PRO E 1 200 ? 39.878  -4.103  21.356  1.00 40.92  ? 200  PRO C CB  1 
ATOM   5220  C CG  . PRO E 1 200 ? 39.049  -5.132  22.083  1.00 47.45  ? 200  PRO C CG  1 
ATOM   5221  C CD  . PRO E 1 200 ? 37.597  -4.696  21.997  1.00 43.09  ? 200  PRO C CD  1 
ATOM   5222  N N   . GLY E 1 201 ? 40.177  -1.127  20.279  1.00 32.36  ? 201  GLY C N   1 
ATOM   5223  C CA  . GLY E 1 201 ? 40.586  -0.245  19.214  1.00 29.94  ? 201  GLY C CA  1 
ATOM   5224  C C   . GLY E 1 201 ? 39.631  0.914   18.904  1.00 38.66  ? 201  GLY C C   1 
ATOM   5225  O O   . GLY E 1 201 ? 39.782  1.509   17.838  1.00 44.65  ? 201  GLY C O   1 
ATOM   5226  N N   . SER E 1 202 ? 38.667  1.240   19.828  1.00 26.51  ? 202  SER C N   1 
ATOM   5227  C CA  . SER E 1 202 ? 37.707  2.331   19.660  1.00 13.49  ? 202  SER C CA  1 
ATOM   5228  C C   . SER E 1 202 ? 38.378  3.577   20.193  1.00 20.44  ? 202  SER C C   1 
ATOM   5229  O O   . SER E 1 202 ? 39.507  3.489   20.746  1.00 27.79  ? 202  SER C O   1 
ATOM   5230  C CB  . SER E 1 202 ? 36.420  2.056   20.418  1.00 11.17  ? 202  SER C CB  1 
ATOM   5231  O OG  . SER E 1 202 ? 36.763  1.859   21.783  1.00 33.64  ? 202  SER C OG  1 
ATOM   5232  N N   . LYS E 1 203 ? 37.739  4.741   20.043  1.00 16.86  ? 203  LYS C N   1 
ATOM   5233  C CA  . LYS E 1 203 ? 38.389  5.902   20.640  1.00 12.34  ? 203  LYS C CA  1 
ATOM   5234  C C   . LYS E 1 203 ? 37.908  6.082   22.109  1.00 15.77  ? 203  LYS C C   1 
ATOM   5235  O O   . LYS E 1 203 ? 38.305  6.974   22.817  1.00 15.65  ? 203  LYS C O   1 
ATOM   5236  C CB  . LYS E 1 203 ? 38.389  7.145   19.778  1.00 12.78  ? 203  LYS C CB  1 
ATOM   5237  C CG  . LYS E 1 203 ? 39.229  6.994   18.486  1.00 11.84  ? 203  LYS C CG  1 
ATOM   5238  C CD  . LYS E 1 203 ? 39.271  8.222   17.554  1.00 32.90  ? 203  LYS C CD  1 
ATOM   5239  C CE  . LYS E 1 203 ? 39.754  7.998   16.110  1.00 4.97   ? 203  LYS C CE  1 
ATOM   5240  N NZ  . LYS E 1 203 ? 38.955  6.957   15.384  1.00 139.36 ? 203  LYS C NZ  1 
ATOM   5241  N N   . LYS E 1 204 ? 37.116  5.119   22.563  1.00 9.39   ? 204  LYS C N   1 
ATOM   5242  C CA  . LYS E 1 204 ? 36.644  5.034   23.897  1.00 10.47  ? 204  LYS C CA  1 
ATOM   5243  C C   . LYS E 1 204 ? 37.863  5.038   24.776  1.00 13.83  ? 204  LYS C C   1 
ATOM   5244  O O   . LYS E 1 204 ? 38.821  4.406   24.460  1.00 18.60  ? 204  LYS C O   1 
ATOM   5245  C CB  . LYS E 1 204 ? 35.897  3.721   24.045  1.00 12.59  ? 204  LYS C CB  1 
ATOM   5246  C CG  . LYS E 1 204 ? 35.578  3.410   25.484  1.00 1.00   ? 204  LYS C CG  1 
ATOM   5247  C CD  . LYS E 1 204 ? 34.455  2.391   25.656  1.00 12.50  ? 204  LYS C CD  1 
ATOM   5248  C CE  . LYS E 1 204 ? 33.854  2.364   27.063  1.00 1.00   ? 204  LYS C CE  1 
ATOM   5249  N NZ  . LYS E 1 204 ? 34.829  2.773   28.090  1.00 19.12  ? 204  LYS C NZ  1 
ATOM   5250  N N   . LYS E 1 205 ? 37.850  5.819   25.833  1.00 15.72  ? 205  LYS C N   1 
ATOM   5251  C CA  . LYS E 1 205 ? 38.985  5.939   26.731  1.00 12.07  ? 205  LYS C CA  1 
ATOM   5252  C C   . LYS E 1 205 ? 38.784  5.179   28.026  1.00 19.49  ? 205  LYS C C   1 
ATOM   5253  O O   . LYS E 1 205 ? 37.706  4.954   28.558  1.00 26.86  ? 205  LYS C O   1 
ATOM   5254  C CB  . LYS E 1 205 ? 39.262  7.406   27.062  1.00 8.61   ? 205  LYS C CB  1 
ATOM   5255  C CG  . LYS E 1 205 ? 39.408  8.252   25.822  1.00 17.48  ? 205  LYS C CG  1 
ATOM   5256  C CD  . LYS E 1 205 ? 40.854  8.347   25.374  1.00 9.28   ? 205  LYS C CD  1 
ATOM   5257  C CE  . LYS E 1 205 ? 41.049  9.079   24.057  1.00 1.00   ? 205  LYS C CE  1 
ATOM   5258  N NZ  . LYS E 1 205 ? 40.558  8.293   22.939  1.00 6.31   ? 205  LYS C NZ  1 
ATOM   5259  N N   . PRO E 1 206 ? 39.892  4.833   28.560  1.00 14.76  ? 206  PRO C N   1 
ATOM   5260  C CA  . PRO E 1 206 ? 40.049  4.124   29.810  1.00 11.27  ? 206  PRO C CA  1 
ATOM   5261  C C   . PRO E 1 206 ? 39.880  5.019   30.976  1.00 15.22  ? 206  PRO C C   1 
ATOM   5262  O O   . PRO E 1 206 ? 39.949  6.237   30.885  1.00 21.81  ? 206  PRO C O   1 
ATOM   5263  C CB  . PRO E 1 206 ? 41.482  3.725   29.882  1.00 7.94   ? 206  PRO C CB  1 
ATOM   5264  C CG  . PRO E 1 206 ? 42.196  4.607   28.874  1.00 14.45  ? 206  PRO C CG  1 
ATOM   5265  C CD  . PRO E 1 206 ? 41.151  5.265   27.987  1.00 14.12  ? 206  PRO C CD  1 
ATOM   5266  N N   . PRO E 1 207 ? 39.688  4.375   32.059  1.00 10.85  ? 207  PRO C N   1 
ATOM   5267  C CA  . PRO E 1 207 ? 39.483  5.073   33.279  1.00 11.11  ? 207  PRO C CA  1 
ATOM   5268  C C   . PRO E 1 207 ? 40.804  5.662   33.506  1.00 25.21  ? 207  PRO C C   1 
ATOM   5269  O O   . PRO E 1 207 ? 41.796  5.062   33.170  1.00 31.74  ? 207  PRO C O   1 
ATOM   5270  C CB  . PRO E 1 207 ? 39.171  3.988   34.311  1.00 7.59   ? 207  PRO C CB  1 
ATOM   5271  C CG  . PRO E 1 207 ? 38.778  2.745   33.518  1.00 8.00   ? 207  PRO C CG  1 
ATOM   5272  C CD  . PRO E 1 207 ? 39.403  2.934   32.153  1.00 7.14   ? 207  PRO C CD  1 
ATOM   5273  N N   . PRO E 1 208 ? 40.775  6.860   33.957  1.00 29.08  ? 208  PRO C N   1 
ATOM   5274  C CA  . PRO E 1 208 ? 41.916  7.682   34.267  1.00 30.67  ? 208  PRO C CA  1 
ATOM   5275  C C   . PRO E 1 208 ? 42.824  7.124   35.326  1.00 32.66  ? 208  PRO C C   1 
ATOM   5276  O O   . PRO E 1 208 ? 42.343  6.666   36.346  1.00 36.10  ? 208  PRO C O   1 
ATOM   5277  C CB  . PRO E 1 208 ? 41.309  8.914   34.876  1.00 31.72  ? 208  PRO C CB  1 
ATOM   5278  C CG  . PRO E 1 208 ? 39.911  8.530   35.304  1.00 35.02  ? 208  PRO C CG  1 
ATOM   5279  C CD  . PRO E 1 208 ? 39.534  7.281   34.572  1.00 26.22  ? 208  PRO C CD  1 
ATOM   5280  N N   . ASP E 1 209 ? 44.121  7.273   35.050  1.00 30.07  ? 209  ASP C N   1 
ATOM   5281  C CA  . ASP E 1 209 ? 45.271  6.864   35.840  1.00 30.10  ? 209  ASP C CA  1 
ATOM   5282  C C   . ASP E 1 209 ? 46.002  8.051   36.422  1.00 35.70  ? 209  ASP C C   1 
ATOM   5283  O O   . ASP E 1 209 ? 45.766  9.230   36.098  1.00 35.20  ? 209  ASP C O   1 
ATOM   5284  C CB  . ASP E 1 209 ? 46.290  6.081   34.964  1.00 33.91  ? 209  ASP C CB  1 
ATOM   5285  C CG  . ASP E 1 209 ? 46.480  6.714   33.618  1.00 69.22  ? 209  ASP C CG  1 
ATOM   5286  O OD1 . ASP E 1 209 ? 46.876  7.855   33.477  1.00 74.62  ? 209  ASP C OD1 1 
ATOM   5287  O OD2 . ASP E 1 209 ? 45.939  6.017   32.652  1.00 99.67  ? 209  ASP C OD2 1 
ATOM   5288  N N   . GLU E 1 210 ? 46.962  7.683   37.237  1.00 38.21  ? 210  GLU C N   1 
ATOM   5289  C CA  . GLU E 1 210 ? 47.807  8.639   37.888  1.00 46.01  ? 210  GLU C CA  1 
ATOM   5290  C C   . GLU E 1 210 ? 48.436  9.564   36.852  1.00 38.12  ? 210  GLU C C   1 
ATOM   5291  O O   . GLU E 1 210 ? 48.689  10.752  37.068  1.00 37.81  ? 210  GLU C O   1 
ATOM   5292  C CB  . GLU E 1 210 ? 48.865  7.876   38.717  1.00 55.83  ? 210  GLU C CB  1 
ATOM   5293  C CG  . GLU E 1 210 ? 49.759  8.758   39.630  1.00 125.54 ? 210  GLU C CG  1 
ATOM   5294  C CD  . GLU E 1 210 ? 50.900  9.468   38.920  1.00 218.62 ? 210  GLU C CD  1 
ATOM   5295  O OE1 . GLU E 1 210 ? 51.657  8.924   38.128  1.00 242.90 ? 210  GLU C OE1 1 
ATOM   5296  O OE2 . GLU E 1 210 ? 51.027  10.725  39.282  1.00 231.97 ? 210  GLU C OE2 1 
ATOM   5297  N N   . ILE E 1 211 ? 48.657  9.039   35.680  1.00 27.64  ? 211  ILE C N   1 
ATOM   5298  C CA  . ILE E 1 211 ? 49.252  9.881   34.678  1.00 30.80  ? 211  ILE C CA  1 
ATOM   5299  C C   . ILE E 1 211 ? 48.329  10.959  34.179  1.00 31.42  ? 211  ILE C C   1 
ATOM   5300  O O   . ILE E 1 211 ? 48.712  12.123  34.193  1.00 33.61  ? 211  ILE C O   1 
ATOM   5301  C CB  . ILE E 1 211 ? 49.684  9.067   33.479  1.00 40.88  ? 211  ILE C CB  1 
ATOM   5302  C CG1 . ILE E 1 211 ? 50.965  8.276   33.740  1.00 44.20  ? 211  ILE C CG1 1 
ATOM   5303  C CG2 . ILE E 1 211 ? 49.801  9.979   32.271  1.00 43.55  ? 211  ILE C CG2 1 
ATOM   5304  C CD1 . ILE E 1 211 ? 50.770  7.220   34.837  1.00 91.48  ? 211  ILE C CD1 1 
ATOM   5305  N N   . TYR E 1 212 ? 47.167  10.519  33.661  1.00 20.70  ? 212  TYR C N   1 
ATOM   5306  C CA  . TYR E 1 212 ? 46.180  11.420  33.158  1.00 19.94  ? 212  TYR C CA  1 
ATOM   5307  C C   . TYR E 1 212 ? 45.987  12.505  34.219  1.00 24.87  ? 212  TYR C C   1 
ATOM   5308  O O   . TYR E 1 212 ? 46.044  13.738  33.975  1.00 22.05  ? 212  TYR C O   1 
ATOM   5309  C CB  . TYR E 1 212 ? 44.859  10.679  32.921  1.00 18.24  ? 212  TYR C CB  1 
ATOM   5310  C CG  . TYR E 1 212 ? 43.694  11.609  32.665  1.00 23.41  ? 212  TYR C CG  1 
ATOM   5311  C CD1 . TYR E 1 212 ? 43.518  12.256  31.430  1.00 21.68  ? 212  TYR C CD1 1 
ATOM   5312  C CD2 . TYR E 1 212 ? 42.744  11.833  33.671  1.00 31.30  ? 212  TYR C CD2 1 
ATOM   5313  C CE1 . TYR E 1 212 ? 42.418  13.108  31.226  1.00 20.53  ? 212  TYR C CE1 1 
ATOM   5314  C CE2 . TYR E 1 212 ? 41.639  12.680  33.487  1.00 34.43  ? 212  TYR C CE2 1 
ATOM   5315  C CZ  . TYR E 1 212 ? 41.483  13.331  32.256  1.00 44.89  ? 212  TYR C CZ  1 
ATOM   5316  O OH  . TYR E 1 212 ? 40.429  14.220  32.098  1.00 44.17  ? 212  TYR C OH  1 
ATOM   5317  N N   . VAL E 1 213 ? 45.890  12.014  35.437  1.00 8.44   ? 213  VAL C N   1 
ATOM   5318  C CA  . VAL E 1 213 ? 45.691  12.967  36.478  1.00 8.96   ? 213  VAL C CA  1 
ATOM   5319  C C   . VAL E 1 213 ? 46.753  13.995  36.584  1.00 19.43  ? 213  VAL C C   1 
ATOM   5320  O O   . VAL E 1 213 ? 46.497  15.182  36.507  1.00 23.29  ? 213  VAL C O   1 
ATOM   5321  C CB  . VAL E 1 213 ? 45.438  12.305  37.775  1.00 8.72   ? 213  VAL C CB  1 
ATOM   5322  C CG1 . VAL E 1 213 ? 45.273  13.441  38.757  1.00 3.46   ? 213  VAL C CG1 1 
ATOM   5323  C CG2 . VAL E 1 213 ? 44.151  11.470  37.645  1.00 5.20   ? 213  VAL C CG2 1 
ATOM   5324  N N   . ARG E 1 214 ? 47.944  13.510  36.570  1.00 24.33  ? 214  ARG C N   1 
ATOM   5325  C CA  . ARG E 1 214 ? 49.111  14.351  36.580  1.00 26.47  ? 214  ARG C CA  1 
ATOM   5326  C C   . ARG E 1 214 ? 49.069  15.312  35.424  1.00 23.21  ? 214  ARG C C   1 
ATOM   5327  O O   . ARG E 1 214 ? 49.150  16.511  35.548  1.00 23.56  ? 214  ARG C O   1 
ATOM   5328  C CB  . ARG E 1 214 ? 50.317  13.470  36.340  1.00 47.19  ? 214  ARG C CB  1 
ATOM   5329  C CG  . ARG E 1 214 ? 51.572  14.039  36.975  1.00 121.11 ? 214  ARG C CG  1 
ATOM   5330  C CD  . ARG E 1 214 ? 51.293  14.817  38.265  1.00 191.70 ? 214  ARG C CD  1 
ATOM   5331  N NE  . ARG E 1 214 ? 52.423  15.632  38.729  1.00 254.17 ? 214  ARG C NE  1 
ATOM   5332  C CZ  . ARG E 1 214 ? 53.724  15.332  38.589  1.00 300.00 ? 214  ARG C CZ  1 
ATOM   5333  N NH1 . ARG E 1 214 ? 54.154  14.210  38.010  1.00 300.00 ? 214  ARG C NH1 1 
ATOM   5334  N NH2 . ARG E 1 214 ? 54.633  16.183  39.065  1.00 300.00 ? 214  ARG C NH2 1 
ATOM   5335  N N   . THR E 1 215 ? 48.899  14.767  34.267  1.00 15.52  ? 215  THR C N   1 
ATOM   5336  C CA  . THR E 1 215 ? 48.869  15.577  33.094  1.00 11.87  ? 215  THR C CA  1 
ATOM   5337  C C   . THR E 1 215 ? 47.833  16.658  33.125  1.00 23.89  ? 215  THR C C   1 
ATOM   5338  O O   . THR E 1 215 ? 48.094  17.759  32.641  1.00 25.01  ? 215  THR C O   1 
ATOM   5339  C CB  . THR E 1 215 ? 48.439  14.704  31.931  1.00 22.07  ? 215  THR C CB  1 
ATOM   5340  O OG1 . THR E 1 215 ? 49.391  13.746  31.572  1.00 34.28  ? 215  THR C OG1 1 
ATOM   5341  C CG2 . THR E 1 215 ? 48.190  15.649  30.793  1.00 13.80  ? 215  THR C CG2 1 
ATOM   5342  N N   . VAL E 1 216 ? 46.627  16.312  33.584  1.00 24.68  ? 216  VAL C N   1 
ATOM   5343  C CA  . VAL E 1 216 ? 45.616  17.324  33.536  1.00 23.39  ? 216  VAL C CA  1 
ATOM   5344  C C   . VAL E 1 216 ? 46.012  18.444  34.399  1.00 26.73  ? 216  VAL C C   1 
ATOM   5345  O O   . VAL E 1 216 ? 45.948  19.596  33.991  1.00 27.42  ? 216  VAL C O   1 
ATOM   5346  C CB  . VAL E 1 216 ? 44.162  16.904  33.585  1.00 27.02  ? 216  VAL C CB  1 
ATOM   5347  C CG1 . VAL E 1 216 ? 44.054  15.629  32.811  1.00 24.78  ? 216  VAL C CG1 1 
ATOM   5348  C CG2 . VAL E 1 216 ? 43.699  16.674  34.979  1.00 30.89  ? 216  VAL C CG2 1 
ATOM   5349  N N   . TYR E 1 217 ? 46.512  18.086  35.542  1.00 26.74  ? 217  TYR C N   1 
ATOM   5350  C CA  . TYR E 1 217 ? 47.005  19.119  36.421  1.00 31.47  ? 217  TYR C CA  1 
ATOM   5351  C C   . TYR E 1 217 ? 48.077  19.921  35.737  1.00 36.69  ? 217  TYR C C   1 
ATOM   5352  O O   . TYR E 1 217 ? 48.177  21.116  35.831  1.00 39.94  ? 217  TYR C O   1 
ATOM   5353  C CB  . TYR E 1 217 ? 47.656  18.545  37.655  1.00 37.04  ? 217  TYR C CB  1 
ATOM   5354  C CG  . TYR E 1 217 ? 46.677  18.128  38.696  1.00 57.37  ? 217  TYR C CG  1 
ATOM   5355  C CD1 . TYR E 1 217 ? 45.724  19.003  39.225  1.00 62.60  ? 217  TYR C CD1 1 
ATOM   5356  C CD2 . TYR E 1 217 ? 46.763  16.847  39.241  1.00 69.49  ? 217  TYR C CD2 1 
ATOM   5357  C CE1 . TYR E 1 217 ? 44.865  18.592  40.251  1.00 73.92  ? 217  TYR C CE1 1 
ATOM   5358  C CE2 . TYR E 1 217 ? 45.924  16.427  40.280  1.00 74.53  ? 217  TYR C CE2 1 
ATOM   5359  C CZ  . TYR E 1 217 ? 44.964  17.302  40.794  1.00 80.38  ? 217  TYR C CZ  1 
ATOM   5360  O OH  . TYR E 1 217 ? 44.144  16.893  41.845  1.00 63.60  ? 217  TYR C OH  1 
ATOM   5361  N N   . ASN E 1 218 ? 48.892  19.265  34.978  1.00 38.49  ? 218  ASN C N   1 
ATOM   5362  C CA  . ASN E 1 218 ? 49.901  20.060  34.351  1.00 38.84  ? 218  ASN C CA  1 
ATOM   5363  C C   . ASN E 1 218 ? 49.380  21.006  33.305  1.00 42.20  ? 218  ASN C C   1 
ATOM   5364  O O   . ASN E 1 218 ? 49.979  22.031  33.081  1.00 53.50  ? 218  ASN C O   1 
ATOM   5365  C CB  . ASN E 1 218 ? 51.166  19.281  33.940  1.00 38.59  ? 218  ASN C CB  1 
ATOM   5366  C CG  . ASN E 1 218 ? 51.790  18.621  35.158  1.00 97.21  ? 218  ASN C CG  1 
ATOM   5367  O OD1 . ASN E 1 218 ? 52.528  17.630  35.023  1.00 142.34 ? 218  ASN C OD1 1 
ATOM   5368  N ND2 . ASN E 1 218 ? 51.457  19.139  36.352  1.00 74.68  ? 218  ASN C ND2 1 
ATOM   5369  N N   . ILE E 1 219 ? 48.289  20.690  32.659  1.00 26.47  ? 219  ILE C N   1 
ATOM   5370  C CA  . ILE E 1 219 ? 47.837  21.580  31.640  1.00 21.54  ? 219  ILE C CA  1 
ATOM   5371  C C   . ILE E 1 219 ? 46.946  22.664  32.154  1.00 32.02  ? 219  ILE C C   1 
ATOM   5372  O O   . ILE E 1 219 ? 46.782  23.667  31.493  1.00 34.29  ? 219  ILE C O   1 
ATOM   5373  C CB  . ILE E 1 219 ? 47.061  20.726  30.711  1.00 23.46  ? 219  ILE C CB  1 
ATOM   5374  C CG1 . ILE E 1 219 ? 47.939  19.545  30.362  1.00 21.97  ? 219  ILE C CG1 1 
ATOM   5375  C CG2 . ILE E 1 219 ? 46.646  21.478  29.477  1.00 22.56  ? 219  ILE C CG2 1 
ATOM   5376  C CD1 . ILE E 1 219 ? 47.148  18.568  29.497  1.00 18.18  ? 219  ILE C CD1 1 
ATOM   5377  N N   . PHE E 1 220 ? 46.367  22.492  33.343  1.00 31.03  ? 220  PHE C N   1 
ATOM   5378  C CA  . PHE E 1 220 ? 45.405  23.480  33.867  1.00 29.59  ? 220  PHE C CA  1 
ATOM   5379  C C   . PHE E 1 220 ? 45.563  23.980  35.346  1.00 44.12  ? 220  PHE C C   1 
ATOM   5380  O O   . PHE E 1 220 ? 46.608  24.003  36.052  1.00 60.72  ? 220  PHE C O   1 
ATOM   5381  C CB  . PHE E 1 220 ? 44.010  22.828  33.765  1.00 33.70  ? 220  PHE C CB  1 
ATOM   5382  C CG  . PHE E 1 220 ? 43.500  22.192  32.470  1.00 34.38  ? 220  PHE C CG  1 
ATOM   5383  C CD1 . PHE E 1 220 ? 43.166  22.979  31.370  1.00 36.48  ? 220  PHE C CD1 1 
ATOM   5384  C CD2 . PHE E 1 220 ? 43.160  20.844  32.395  1.00 38.85  ? 220  PHE C CD2 1 
ATOM   5385  C CE1 . PHE E 1 220 ? 42.620  22.442  30.207  1.00 36.82  ? 220  PHE C CE1 1 
ATOM   5386  C CE2 . PHE E 1 220 ? 42.609  20.278  31.242  1.00 41.89  ? 220  PHE C CE2 1 
ATOM   5387  C CZ  . PHE E 1 220 ? 42.357  21.077  30.133  1.00 38.16  ? 220  PHE C CZ  1 
HETATM 5388  N N   . GGL F 2 1   ? 31.058  23.698  31.449  1.00 37.15  ? 231  GGL K N   1 
HETATM 5389  C CA  . GGL F 2 1   ? 32.157  23.470  30.517  1.00 7.63   ? 231  GGL K CA  1 
HETATM 5390  C C   . GGL F 2 1   ? 32.026  22.167  29.732  1.00 7.03   ? 231  GGL K C   1 
HETATM 5391  O O   . GGL F 2 1   ? 32.441  22.204  28.536  1.00 19.40  ? 231  GGL K O   1 
HETATM 5392  C CB  . GGL F 2 1   ? 33.484  23.609  31.231  1.00 6.19   ? 231  GGL K CB  1 
HETATM 5393  C CG  . GGL F 2 1   ? 34.687  23.044  30.490  1.00 24.61  ? 231  GGL K CG  1 
HETATM 5394  C CD  . GGL F 2 1   ? 35.898  23.203  31.386  1.00 18.75  ? 231  GGL K CD  1 
HETATM 5395  O OE1 . GGL F 2 1   ? 35.801  23.372  32.599  1.00 36.14  ? 231  GGL K OE1 1 
HETATM 5396  O OXT . GGL F 2 1   ? 31.325  21.254  30.267  1.00 43.52  ? 231  GGL K OXT 1 
HETATM 5397  C C   . ICY F 2 2   ? 39.297  24.034  30.604  1.00 29.74  ? 232  ICY K C   1 
HETATM 5398  N N   . ICY F 2 2   ? 37.063  23.120  30.773  1.00 39.29  ? 232  ICY K N   1 
HETATM 5399  O O   . ICY F 2 2   ? 39.315  23.962  29.348  1.00 26.16  ? 232  ICY K O   1 
HETATM 5400  C CA  . ICY F 2 2   ? 38.319  23.274  31.482  1.00 38.11  ? 232  ICY K CA  1 
HETATM 5401  C CB  . ICY F 2 2   ? 38.878  21.937  32.045  1.00 43.28  ? 232  ICY K CB  1 
HETATM 5402  S SG  . ICY F 2 2   ? 37.864  21.182  33.365  1.00 46.76  ? 232  ICY K SG  1 
HETATM 5403  I I   . ICY F 2 2   ? 38.534  17.156  33.601  1.00 90.26  ? 232  ICY K I   1 
HETATM 5404  C C0  . ICY F 2 2   ? 39.073  20.236  34.313  1.00 300.00 ? 232  ICY K C0  1 
HETATM 5405  C C1  . ICY F 2 2   ? 38.292  19.574  35.406  1.00 300.00 ? 232  ICY K C1  1 
HETATM 5406  C C2  . ICY F 2 2   ? 37.825  18.264  35.239  1.00 5.69   ? 232  ICY K C2  1 
HETATM 5407  C C3  . ICY F 2 2   ? 37.065  17.734  36.283  1.00 31.59  ? 232  ICY K C3  1 
HETATM 5408  C C4  . ICY F 2 2   ? 36.725  18.508  37.402  1.00 15.35  ? 232  ICY K C4  1 
HETATM 5409  C C5  . ICY F 2 2   ? 37.103  19.846  37.492  1.00 300.00 ? 232  ICY K C5  1 
HETATM 5410  C C6  . ICY F 2 2   ? 37.887  20.379  36.472  1.00 300.00 ? 232  ICY K C6  1 
ATOM   5411  N N   . GLY F 2 3   ? 40.061  24.875  31.259  1.00 27.44  ? 233  GLY K N   1 
ATOM   5412  C CA  . GLY F 2 3   ? 41.007  25.698  30.511  1.00 23.21  ? 233  GLY K CA  1 
ATOM   5413  C C   . GLY F 2 3   ? 41.338  26.964  31.254  1.00 26.89  ? 233  GLY K C   1 
ATOM   5414  O O   . GLY F 2 3   ? 42.441  27.494  30.946  1.00 47.64  ? 233  GLY K O   1 
ATOM   5415  O OXT . GLY F 2 3   ? 40.492  27.282  32.151  1.00 83.82  ? 233  GLY K OXT 1 
ATOM   5416  N N   . ARG G 1 4   ? -0.980  28.963  34.229  1.00 32.33  ? 4    ARG D N   1 
ATOM   5417  C CA  . ARG G 1 4   ? 0.031   29.866  34.827  1.00 27.54  ? 4    ARG D CA  1 
ATOM   5418  C C   . ARG G 1 4   ? 1.118   29.058  35.575  1.00 35.94  ? 4    ARG D C   1 
ATOM   5419  O O   . ARG G 1 4   ? 0.829   28.346  36.543  1.00 45.21  ? 4    ARG D O   1 
ATOM   5420  C CB  . ARG G 1 4   ? -0.748  30.848  35.702  1.00 27.89  ? 4    ARG D CB  1 
ATOM   5421  C CG  . ARG G 1 4   ? -0.092  31.950  36.530  1.00 16.86  ? 4    ARG D CG  1 
ATOM   5422  C CD  . ARG G 1 4   ? -1.130  33.041  36.985  1.00 21.30  ? 4    ARG D CD  1 
ATOM   5423  N NE  . ARG G 1 4   ? -0.492  34.161  37.700  1.00 55.57  ? 4    ARG D NE  1 
ATOM   5424  C CZ  . ARG G 1 4   ? -0.916  35.420  37.883  1.00 124.64 ? 4    ARG D CZ  1 
ATOM   5425  N NH1 . ARG G 1 4   ? -2.089  35.864  37.420  1.00 187.32 ? 4    ARG D NH1 1 
ATOM   5426  N NH2 . ARG G 1 4   ? -0.110  36.250  38.576  1.00 64.09  ? 4    ARG D NH2 1 
ATOM   5427  N N   . PRO G 1 5   ? 2.388   29.155  35.125  1.00 19.55  ? 5    PRO D N   1 
ATOM   5428  C CA  . PRO G 1 5   ? 3.445   28.378  35.720  1.00 10.62  ? 5    PRO D CA  1 
ATOM   5429  C C   . PRO G 1 5   ? 3.625   28.592  37.154  1.00 13.02  ? 5    PRO D C   1 
ATOM   5430  O O   . PRO G 1 5   ? 3.442   29.702  37.681  1.00 17.31  ? 5    PRO D O   1 
ATOM   5431  C CB  . PRO G 1 5   ? 4.701   28.745  34.992  1.00 13.08  ? 5    PRO D CB  1 
ATOM   5432  C CG  . PRO G 1 5   ? 4.235   29.253  33.646  1.00 14.67  ? 5    PRO D CG  1 
ATOM   5433  C CD  . PRO G 1 5   ? 2.915   29.896  33.948  1.00 15.20  ? 5    PRO D CD  1 
ATOM   5434  N N   . LYS G 1 6   ? 4.022   27.488  37.750  1.00 10.63  ? 6    LYS D N   1 
ATOM   5435  C CA  . LYS G 1 6   ? 4.251   27.479  39.157  1.00 12.09  ? 6    LYS D CA  1 
ATOM   5436  C C   . LYS G 1 6   ? 5.658   27.015  39.438  1.00 19.24  ? 6    LYS D C   1 
ATOM   5437  O O   . LYS G 1 6   ? 6.117   25.953  39.016  1.00 23.36  ? 6    LYS D O   1 
ATOM   5438  C CB  . LYS G 1 6   ? 3.206   26.669  39.869  1.00 12.50  ? 6    LYS D CB  1 
ATOM   5439  C CG  . LYS G 1 6   ? 3.247   26.812  41.377  1.00 5.59   ? 6    LYS D CG  1 
ATOM   5440  C CD  . LYS G 1 6   ? 2.072   26.156  42.069  1.00 22.77  ? 6    LYS D CD  1 
ATOM   5441  C CE  . LYS G 1 6   ? 0.985   27.124  42.543  1.00 101.78 ? 6    LYS D CE  1 
ATOM   5442  N NZ  . LYS G 1 6   ? 0.541   26.897  43.938  1.00 121.13 ? 6    LYS D NZ  1 
ATOM   5443  N N   . LEU G 1 7   ? 6.316   27.887  40.150  1.00 10.70  ? 7    LEU D N   1 
ATOM   5444  C CA  . LEU G 1 7   ? 7.677   27.739  40.516  1.00 7.75   ? 7    LEU D CA  1 
ATOM   5445  C C   . LEU G 1 7   ? 7.893   27.265  41.911  1.00 15.45  ? 7    LEU D C   1 
ATOM   5446  O O   . LEU G 1 7   ? 7.571   27.969  42.877  1.00 17.71  ? 7    LEU D O   1 
ATOM   5447  C CB  . LEU G 1 7   ? 8.412   29.090  40.362  1.00 7.11   ? 7    LEU D CB  1 
ATOM   5448  C CG  . LEU G 1 7   ? 8.847   29.301  38.916  1.00 7.44   ? 7    LEU D CG  1 
ATOM   5449  C CD1 . LEU G 1 7   ? 7.655   29.309  37.976  1.00 1.06   ? 7    LEU D CD1 1 
ATOM   5450  C CD2 . LEU G 1 7   ? 9.620   30.559  38.787  1.00 1.92   ? 7    LEU D CD2 1 
ATOM   5451  N N   . HIS G 1 8   ? 8.595   26.136  42.004  1.00 10.78  ? 8    HIS D N   1 
ATOM   5452  C CA  . HIS G 1 8   ? 8.932   25.603  43.308  1.00 10.93  ? 8    HIS D CA  1 
ATOM   5453  C C   . HIS G 1 8   ? 10.328  25.894  43.676  1.00 15.06  ? 8    HIS D C   1 
ATOM   5454  O O   . HIS G 1 8   ? 11.224  25.420  43.034  1.00 21.54  ? 8    HIS D O   1 
ATOM   5455  C CB  . HIS G 1 8   ? 8.723   24.099  43.360  1.00 12.77  ? 8    HIS D CB  1 
ATOM   5456  C CG  . HIS G 1 8   ? 7.275   23.812  43.127  1.00 12.97  ? 8    HIS D CG  1 
ATOM   5457  N ND1 . HIS G 1 8   ? 6.387   23.698  44.200  1.00 9.21   ? 8    HIS D ND1 1 
ATOM   5458  C CD2 . HIS G 1 8   ? 6.579   23.696  41.950  1.00 10.18  ? 8    HIS D CD2 1 
ATOM   5459  C CE1 . HIS G 1 8   ? 5.194   23.520  43.648  1.00 4.88   ? 8    HIS D CE1 1 
ATOM   5460  N NE2 . HIS G 1 8   ? 5.253   23.512  42.308  1.00 6.80   ? 8    HIS D NE2 1 
ATOM   5461  N N   . TYR G 1 9   ? 10.510  26.597  44.752  1.00 14.76  ? 9    TYR D N   1 
ATOM   5462  C CA  . TYR G 1 9   ? 11.836  26.912  45.155  1.00 9.55   ? 9    TYR D CA  1 
ATOM   5463  C C   . TYR G 1 9   ? 11.701  27.707  46.396  1.00 13.90  ? 9    TYR D C   1 
ATOM   5464  O O   . TYR G 1 9   ? 10.667  28.266  46.707  1.00 13.27  ? 9    TYR D O   1 
ATOM   5465  C CB  . TYR G 1 9   ? 12.418  27.863  44.087  1.00 11.18  ? 9    TYR D CB  1 
ATOM   5466  C CG  . TYR G 1 9   ? 13.928  27.811  43.976  1.00 11.92  ? 9    TYR D CG  1 
ATOM   5467  C CD1 . TYR G 1 9   ? 14.490  26.618  43.548  1.00 17.29  ? 9    TYR D CD1 1 
ATOM   5468  C CD2 . TYR G 1 9   ? 14.804  28.847  44.314  1.00 10.61  ? 9    TYR D CD2 1 
ATOM   5469  C CE1 . TYR G 1 9   ? 15.863  26.459  43.410  1.00 8.41   ? 9    TYR D CE1 1 
ATOM   5470  C CE2 . TYR G 1 9   ? 16.197  28.706  44.226  1.00 10.47  ? 9    TYR D CE2 1 
ATOM   5471  C CZ  . TYR G 1 9   ? 16.714  27.490  43.769  1.00 8.46   ? 9    TYR D CZ  1 
ATOM   5472  O OH  . TYR G 1 9   ? 18.036  27.213  43.608  1.00 9.58   ? 9    TYR D OH  1 
ATOM   5473  N N   . PRO G 1 10  ? 12.797  27.802  47.063  1.00 12.04  ? 10   PRO D N   1 
ATOM   5474  C CA  . PRO G 1 10  ? 12.913  28.636  48.206  1.00 6.12   ? 10   PRO D CA  1 
ATOM   5475  C C   . PRO G 1 10  ? 12.671  30.037  47.732  1.00 17.79  ? 10   PRO D C   1 
ATOM   5476  O O   . PRO G 1 10  ? 12.698  30.328  46.543  1.00 18.65  ? 10   PRO D O   1 
ATOM   5477  C CB  . PRO G 1 10  ? 14.388  28.573  48.617  1.00 1.52   ? 10   PRO D CB  1 
ATOM   5478  C CG  . PRO G 1 10  ? 14.941  27.288  48.044  1.00 1.37   ? 10   PRO D CG  1 
ATOM   5479  C CD  . PRO G 1 10  ? 13.945  26.874  46.943  1.00 9.85   ? 10   PRO D CD  1 
ATOM   5480  N N   . ASN G 1 11  ? 12.407  30.921  48.673  1.00 22.88  ? 11   ASN D N   1 
ATOM   5481  C CA  . ASN G 1 11  ? 12.165  32.283  48.253  1.00 21.68  ? 11   ASN D CA  1 
ATOM   5482  C C   . ASN G 1 11  ? 13.443  33.066  48.158  1.00 28.06  ? 11   ASN D C   1 
ATOM   5483  O O   . ASN G 1 11  ? 13.805  33.767  49.113  1.00 29.83  ? 11   ASN D O   1 
ATOM   5484  C CB  . ASN G 1 11  ? 11.223  33.016  49.196  1.00 27.41  ? 11   ASN D CB  1 
ATOM   5485  C CG  . ASN G 1 11  ? 10.976  34.455  48.802  1.00 30.38  ? 11   ASN D CG  1 
ATOM   5486  O OD1 . ASN G 1 11  ? 11.477  35.019  47.814  1.00 49.73  ? 11   ASN D OD1 1 
ATOM   5487  N ND2 . ASN G 1 11  ? 10.116  35.044  49.559  1.00 31.51  ? 11   ASN D ND2 1 
ATOM   5488  N N   . GLY G 1 12  ? 14.115  32.957  47.001  1.00 23.11  ? 12   GLY D N   1 
ATOM   5489  C CA  . GLY G 1 12  ? 15.388  33.616  46.775  1.00 15.19  ? 12   GLY D CA  1 
ATOM   5490  C C   . GLY G 1 12  ? 15.797  33.289  45.390  1.00 17.86  ? 12   GLY D C   1 
ATOM   5491  O O   . GLY G 1 12  ? 15.109  32.536  44.701  1.00 19.68  ? 12   GLY D O   1 
ATOM   5492  N N   . ARG G 1 13  ? 16.928  33.829  45.008  1.00 14.04  ? 13   ARG D N   1 
ATOM   5493  C CA  . ARG G 1 13  ? 17.409  33.675  43.657  1.00 12.54  ? 13   ARG D CA  1 
ATOM   5494  C C   . ARG G 1 13  ? 17.785  32.263  43.250  1.00 9.16   ? 13   ARG D C   1 
ATOM   5495  O O   . ARG G 1 13  ? 17.191  31.662  42.331  1.00 15.29  ? 13   ARG D O   1 
ATOM   5496  C CB  . ARG G 1 13  ? 18.578  34.649  43.405  1.00 7.69   ? 13   ARG D CB  1 
ATOM   5497  C CG  . ARG G 1 13  ? 18.221  36.100  43.205  1.00 1.00   ? 13   ARG D CG  1 
ATOM   5498  C CD  . ARG G 1 13  ? 19.392  37.079  43.136  1.00 1.00   ? 13   ARG D CD  1 
ATOM   5499  N NE  . ARG G 1 13  ? 18.988  38.475  42.946  1.00 19.00  ? 13   ARG D NE  1 
ATOM   5500  C CZ  . ARG G 1 13  ? 19.792  39.518  42.779  1.00 12.92  ? 13   ARG D CZ  1 
ATOM   5501  N NH1 . ARG G 1 13  ? 21.094  39.395  42.709  1.00 18.59  ? 13   ARG D NH1 1 
ATOM   5502  N NH2 . ARG G 1 13  ? 19.271  40.724  42.676  1.00 20.60  ? 13   ARG D NH2 1 
ATOM   5503  N N   . GLY G 1 14  ? 18.891  31.845  43.854  1.00 1.00   ? 14   GLY D N   1 
ATOM   5504  C CA  . GLY G 1 14  ? 19.523  30.571  43.613  1.00 1.00   ? 14   GLY D CA  1 
ATOM   5505  C C   . GLY G 1 14  ? 19.602  30.328  42.152  1.00 9.54   ? 14   GLY D C   1 
ATOM   5506  O O   . GLY G 1 14  ? 19.908  31.260  41.365  1.00 9.47   ? 14   GLY D O   1 
ATOM   5507  N N   . ARG G 1 15  ? 19.232  29.102  41.789  1.00 9.02   ? 15   ARG D N   1 
ATOM   5508  C CA  . ARG G 1 15  ? 19.218  28.732  40.398  1.00 5.35   ? 15   ARG D CA  1 
ATOM   5509  C C   . ARG G 1 15  ? 17.951  29.096  39.656  1.00 14.90  ? 15   ARG D C   1 
ATOM   5510  O O   . ARG G 1 15  ? 17.985  29.129  38.418  1.00 20.18  ? 15   ARG D O   1 
ATOM   5511  C CB  . ARG G 1 15  ? 19.417  27.274  40.286  1.00 3.97   ? 15   ARG D CB  1 
ATOM   5512  C CG  . ARG G 1 15  ? 20.674  26.830  40.956  1.00 5.24   ? 15   ARG D CG  1 
ATOM   5513  C CD  . ARG G 1 15  ? 20.943  25.365  40.695  1.00 3.67   ? 15   ARG D CD  1 
ATOM   5514  N NE  . ARG G 1 15  ? 22.145  24.999  41.421  1.00 14.51  ? 15   ARG D NE  1 
ATOM   5515  C CZ  . ARG G 1 15  ? 23.277  25.381  40.864  1.00 9.50   ? 15   ARG D CZ  1 
ATOM   5516  N NH1 . ARG G 1 15  ? 23.250  26.016  39.718  1.00 22.97  ? 15   ARG D NH1 1 
ATOM   5517  N NH2 . ARG G 1 15  ? 24.425  25.158  41.442  1.00 12.46  ? 15   ARG D NH2 1 
ATOM   5518  N N   . MET G 1 16  ? 16.884  29.387  40.402  1.00 6.25   ? 16   MET D N   1 
ATOM   5519  C CA  . MET G 1 16  ? 15.579  29.693  39.807  1.00 7.96   ? 16   MET D CA  1 
ATOM   5520  C C   . MET G 1 16  ? 15.449  31.043  39.108  1.00 16.37  ? 16   MET D C   1 
ATOM   5521  O O   . MET G 1 16  ? 14.614  31.281  38.191  1.00 16.90  ? 16   MET D O   1 
ATOM   5522  C CB  . MET G 1 16  ? 14.497  29.428  40.879  1.00 7.02   ? 16   MET D CB  1 
ATOM   5523  C CG  . MET G 1 16  ? 13.120  29.603  40.385  1.00 7.94   ? 16   MET D CG  1 
ATOM   5524  S SD  . MET G 1 16  ? 12.532  28.356  39.233  1.00 11.15  ? 16   MET D SD  1 
ATOM   5525  C CE  . MET G 1 16  ? 12.033  27.125  40.389  1.00 5.61   ? 16   MET D CE  1 
ATOM   5526  N N   . GLU G 1 17  ? 16.324  31.936  39.537  1.00 4.20   ? 17   GLU D N   1 
ATOM   5527  C CA  . GLU G 1 17  ? 16.254  33.261  39.011  1.00 1.00   ? 17   GLU D CA  1 
ATOM   5528  C C   . GLU G 1 17  ? 16.294  33.389  37.520  1.00 5.23   ? 17   GLU D C   1 
ATOM   5529  O O   . GLU G 1 17  ? 15.632  34.226  36.927  1.00 11.87  ? 17   GLU D O   1 
ATOM   5530  C CB  . GLU G 1 17  ? 17.219  34.151  39.735  1.00 1.00   ? 17   GLU D CB  1 
ATOM   5531  C CG  . GLU G 1 17  ? 16.830  35.642  39.684  1.00 19.56  ? 17   GLU D CG  1 
ATOM   5532  C CD  . GLU G 1 17  ? 15.730  36.098  40.596  1.00 7.78   ? 17   GLU D CD  1 
ATOM   5533  O OE1 . GLU G 1 17  ? 15.106  35.381  41.339  1.00 31.51  ? 17   GLU D OE1 1 
ATOM   5534  O OE2 . GLU G 1 17  ? 15.443  37.360  40.422  1.00 9.61   ? 17   GLU D OE2 1 
ATOM   5535  N N   . SER G 1 18  ? 17.056  32.545  36.899  1.00 1.00   ? 18   SER D N   1 
ATOM   5536  C CA  . SER G 1 18  ? 17.146  32.595  35.464  1.00 1.00   ? 18   SER D CA  1 
ATOM   5537  C C   . SER G 1 18  ? 15.815  32.339  34.853  1.00 6.76   ? 18   SER D C   1 
ATOM   5538  O O   . SER G 1 18  ? 15.350  33.005  33.918  1.00 9.68   ? 18   SER D O   1 
ATOM   5539  C CB  . SER G 1 18  ? 18.241  31.729  34.895  1.00 1.00   ? 18   SER D CB  1 
ATOM   5540  O OG  . SER G 1 18  ? 19.352  31.806  35.752  1.00 13.54  ? 18   SER D OG  1 
ATOM   5541  N N   . VAL G 1 19  ? 15.139  31.418  35.466  1.00 7.37   ? 19   VAL D N   1 
ATOM   5542  C CA  . VAL G 1 19  ? 13.797  31.081  35.032  1.00 8.08   ? 19   VAL D CA  1 
ATOM   5543  C C   . VAL G 1 19  ? 12.854  32.241  35.225  1.00 9.25   ? 19   VAL D C   1 
ATOM   5544  O O   . VAL G 1 19  ? 12.039  32.523  34.367  1.00 6.66   ? 19   VAL D O   1 
ATOM   5545  C CB  . VAL G 1 19  ? 13.273  29.936  35.850  1.00 8.51   ? 19   VAL D CB  1 
ATOM   5546  C CG1 . VAL G 1 19  ? 11.944  29.579  35.236  1.00 10.56  ? 19   VAL D CG1 1 
ATOM   5547  C CG2 . VAL G 1 19  ? 14.224  28.759  35.729  1.00 1.00   ? 19   VAL D CG2 1 
ATOM   5548  N N   . ARG G 1 20  ? 12.974  32.916  36.369  1.00 5.49   ? 20   ARG D N   1 
ATOM   5549  C CA  . ARG G 1 20  ? 12.140  34.096  36.512  1.00 3.46   ? 20   ARG D CA  1 
ATOM   5550  C C   . ARG G 1 20  ? 12.475  35.071  35.415  1.00 10.61  ? 20   ARG D C   1 
ATOM   5551  O O   . ARG G 1 20  ? 11.587  35.522  34.721  1.00 13.96  ? 20   ARG D O   1 
ATOM   5552  C CB  . ARG G 1 20  ? 12.256  34.783  37.841  1.00 1.00   ? 20   ARG D CB  1 
ATOM   5553  C CG  . ARG G 1 20  ? 11.951  33.761  38.956  1.00 3.22   ? 20   ARG D CG  1 
ATOM   5554  C CD  . ARG G 1 20  ? 12.285  34.295  40.362  1.00 7.99   ? 20   ARG D CD  1 
ATOM   5555  N NE  . ARG G 1 20  ? 12.071  33.333  41.466  1.00 7.20   ? 20   ARG D NE  1 
ATOM   5556  C CZ  . ARG G 1 20  ? 13.005  32.811  42.256  1.00 10.41  ? 20   ARG D CZ  1 
ATOM   5557  N NH1 . ARG G 1 20  ? 14.271  33.118  42.082  1.00 15.20  ? 20   ARG D NH1 1 
ATOM   5558  N NH2 . ARG G 1 20  ? 12.674  31.932  43.218  1.00 6.11   ? 20   ARG D NH2 1 
ATOM   5559  N N   . TRP G 1 21  ? 13.746  35.351  35.212  1.00 7.37   ? 21   TRP D N   1 
ATOM   5560  C CA  . TRP G 1 21  ? 14.092  36.283  34.164  1.00 7.08   ? 21   TRP D CA  1 
ATOM   5561  C C   . TRP G 1 21  ? 13.484  35.968  32.842  1.00 15.16  ? 21   TRP D C   1 
ATOM   5562  O O   . TRP G 1 21  ? 12.912  36.819  32.230  1.00 17.62  ? 21   TRP D O   1 
ATOM   5563  C CB  . TRP G 1 21  ? 15.581  36.296  33.923  1.00 6.41   ? 21   TRP D CB  1 
ATOM   5564  C CG  . TRP G 1 21  ? 16.231  37.285  34.776  1.00 10.05  ? 21   TRP D CG  1 
ATOM   5565  C CD1 . TRP G 1 21  ? 16.736  37.075  36.007  1.00 13.65  ? 21   TRP D CD1 1 
ATOM   5566  C CD2 . TRP G 1 21  ? 16.449  38.662  34.469  1.00 9.28   ? 21   TRP D CD2 1 
ATOM   5567  N NE1 . TRP G 1 21  ? 17.287  38.245  36.496  1.00 8.11   ? 21   TRP D NE1 1 
ATOM   5568  C CE2 . TRP G 1 21  ? 17.086  39.239  35.586  1.00 7.93   ? 21   TRP D CE2 1 
ATOM   5569  C CE3 . TRP G 1 21  ? 16.188  39.444  33.344  1.00 8.18   ? 21   TRP D CE3 1 
ATOM   5570  C CZ2 . TRP G 1 21  ? 17.466  40.575  35.592  1.00 5.43   ? 21   TRP D CZ2 1 
ATOM   5571  C CZ3 . TRP G 1 21  ? 16.576  40.744  33.346  1.00 8.67   ? 21   TRP D CZ3 1 
ATOM   5572  C CH2 . TRP G 1 21  ? 17.191  41.307  34.478  1.00 9.78   ? 21   TRP D CH2 1 
ATOM   5573  N N   . VAL G 1 22  ? 13.558  34.718  32.451  1.00 13.45  ? 22   VAL D N   1 
ATOM   5574  C CA  . VAL G 1 22  ? 13.076  34.363  31.160  1.00 9.94   ? 22   VAL D CA  1 
ATOM   5575  C C   . VAL G 1 22  ? 11.611  34.487  31.039  1.00 12.54  ? 22   VAL D C   1 
ATOM   5576  O O   . VAL G 1 22  ? 11.111  35.002  30.063  1.00 13.70  ? 22   VAL D O   1 
ATOM   5577  C CB  . VAL G 1 22  ? 13.474  32.955  30.787  1.00 15.10  ? 22   VAL D CB  1 
ATOM   5578  C CG1 . VAL G 1 22  ? 12.991  32.694  29.387  1.00 9.55   ? 22   VAL D CG1 1 
ATOM   5579  C CG2 . VAL G 1 22  ? 14.989  32.893  30.705  1.00 16.50  ? 22   VAL D CG2 1 
ATOM   5580  N N   . LEU G 1 23  ? 10.926  33.940  32.013  1.00 5.24   ? 23   LEU D N   1 
ATOM   5581  C CA  . LEU G 1 23  ? 9.487   34.027  32.020  1.00 3.88   ? 23   LEU D CA  1 
ATOM   5582  C C   . LEU G 1 23  ? 9.067   35.468  31.899  1.00 12.19  ? 23   LEU D C   1 
ATOM   5583  O O   . LEU G 1 23  ? 8.336   35.809  30.991  1.00 12.38  ? 23   LEU D O   1 
ATOM   5584  C CB  . LEU G 1 23  ? 8.931   33.407  33.305  1.00 3.09   ? 23   LEU D CB  1 
ATOM   5585  C CG  . LEU G 1 23  ? 8.900   31.885  33.172  1.00 4.80   ? 23   LEU D CG  1 
ATOM   5586  C CD1 . LEU G 1 23  ? 8.485   31.280  34.461  1.00 3.57   ? 23   LEU D CD1 1 
ATOM   5587  C CD2 . LEU G 1 23  ? 7.829   31.491  32.184  1.00 2.17   ? 23   LEU D CD2 1 
ATOM   5588  N N   . ALA G 1 24  ? 9.606   36.309  32.800  1.00 8.67   ? 24   ALA D N   1 
ATOM   5589  C CA  . ALA G 1 24  ? 9.315   37.750  32.816  1.00 3.94   ? 24   ALA D CA  1 
ATOM   5590  C C   . ALA G 1 24  ? 9.579   38.384  31.497  1.00 13.81  ? 24   ALA D C   1 
ATOM   5591  O O   . ALA G 1 24  ? 8.769   39.114  31.003  1.00 20.36  ? 24   ALA D O   1 
ATOM   5592  C CB  . ALA G 1 24  ? 10.034  38.517  33.884  1.00 1.00   ? 24   ALA D CB  1 
ATOM   5593  N N   . ALA G 1 25  ? 10.729  38.115  30.956  1.00 13.24  ? 25   ALA D N   1 
ATOM   5594  C CA  . ALA G 1 25  ? 11.065  38.700  29.696  1.00 9.76   ? 25   ALA D CA  1 
ATOM   5595  C C   . ALA G 1 25  ? 10.102  38.333  28.622  1.00 16.53  ? 25   ALA D C   1 
ATOM   5596  O O   . ALA G 1 25  ? 9.777   39.131  27.782  1.00 21.49  ? 25   ALA D O   1 
ATOM   5597  C CB  . ALA G 1 25  ? 12.461  38.347  29.254  1.00 5.49   ? 25   ALA D CB  1 
ATOM   5598  N N   . ALA G 1 26  ? 9.687   37.086  28.630  1.00 22.51  ? 26   ALA D N   1 
ATOM   5599  C CA  . ALA G 1 26  ? 8.769   36.550  27.626  1.00 14.60  ? 26   ALA D CA  1 
ATOM   5600  C C   . ALA G 1 26  ? 7.369   37.071  27.864  1.00 22.33  ? 26   ALA D C   1 
ATOM   5601  O O   . ALA G 1 26  ? 6.435   36.776  27.165  1.00 28.32  ? 26   ALA D O   1 
ATOM   5602  C CB  . ALA G 1 26  ? 8.804   35.034  27.660  1.00 8.69   ? 26   ALA D CB  1 
ATOM   5603  N N   . GLY G 1 27  ? 7.240   37.859  28.887  1.00 20.41  ? 27   GLY D N   1 
ATOM   5604  C CA  . GLY G 1 27  ? 5.981   38.424  29.247  1.00 17.35  ? 27   GLY D CA  1 
ATOM   5605  C C   . GLY G 1 27  ? 5.022   37.473  29.936  1.00 24.13  ? 27   GLY D C   1 
ATOM   5606  O O   . GLY G 1 27  ? 3.830   37.775  30.046  1.00 32.49  ? 27   GLY D O   1 
ATOM   5607  N N   . VAL G 1 28  ? 5.518   36.349  30.443  1.00 17.82  ? 28   VAL D N   1 
ATOM   5608  C CA  . VAL G 1 28  ? 4.671   35.357  31.109  1.00 8.87   ? 28   VAL D CA  1 
ATOM   5609  C C   . VAL G 1 28  ? 4.553   35.539  32.604  1.00 18.14  ? 28   VAL D C   1 
ATOM   5610  O O   . VAL G 1 28  ? 5.560   35.717  33.275  1.00 22.20  ? 28   VAL D O   1 
ATOM   5611  C CB  . VAL G 1 28  ? 5.264   34.012  30.819  1.00 7.68   ? 28   VAL D CB  1 
ATOM   5612  C CG1 . VAL G 1 28  ? 4.478   32.941  31.521  1.00 6.16   ? 28   VAL D CG1 1 
ATOM   5613  C CG2 . VAL G 1 28  ? 5.353   33.797  29.321  1.00 1.00   ? 28   VAL D CG2 1 
ATOM   5614  N N   . GLU G 1 29  ? 3.296   35.536  33.105  1.00 26.80  ? 29   GLU D N   1 
ATOM   5615  C CA  . GLU G 1 29  ? 3.010   35.687  34.537  1.00 28.31  ? 29   GLU D CA  1 
ATOM   5616  C C   . GLU G 1 29  ? 3.066   34.318  35.163  1.00 30.20  ? 29   GLU D C   1 
ATOM   5617  O O   . GLU G 1 29  ? 2.725   33.334  34.497  1.00 38.03  ? 29   GLU D O   1 
ATOM   5618  C CB  . GLU G 1 29  ? 1.663   36.384  34.855  1.00 32.26  ? 29   GLU D CB  1 
ATOM   5619  C CG  . GLU G 1 29  ? 1.704   37.924  35.050  1.00 67.57  ? 29   GLU D CG  1 
ATOM   5620  C CD  . GLU G 1 29  ? 0.357   38.560  35.313  1.00 160.28 ? 29   GLU D CD  1 
ATOM   5621  O OE1 . GLU G 1 29  ? -0.492  38.710  34.453  1.00 195.37 ? 29   GLU D OE1 1 
ATOM   5622  O OE2 . GLU G 1 29  ? 0.244   38.946  36.568  1.00 192.75 ? 29   GLU D OE2 1 
ATOM   5623  N N   . PHE G 1 30  ? 3.492   34.240  36.426  1.00 13.23  ? 30   PHE D N   1 
ATOM   5624  C CA  . PHE G 1 30  ? 3.580   32.925  36.979  1.00 8.69   ? 30   PHE D CA  1 
ATOM   5625  C C   . PHE G 1 30  ? 3.461   32.977  38.439  1.00 14.26  ? 30   PHE D C   1 
ATOM   5626  O O   . PHE G 1 30  ? 3.516   34.055  39.042  1.00 9.97   ? 30   PHE D O   1 
ATOM   5627  C CB  . PHE G 1 30  ? 4.947   32.330  36.673  1.00 11.39  ? 30   PHE D CB  1 
ATOM   5628  C CG  . PHE G 1 30  ? 6.110   33.236  37.124  1.00 9.08   ? 30   PHE D CG  1 
ATOM   5629  C CD1 . PHE G 1 30  ? 6.619   33.201  38.421  1.00 8.84   ? 30   PHE D CD1 1 
ATOM   5630  C CD2 . PHE G 1 30  ? 6.785   34.083  36.239  1.00 6.88   ? 30   PHE D CD2 1 
ATOM   5631  C CE1 . PHE G 1 30  ? 7.706   33.979  38.841  1.00 5.28   ? 30   PHE D CE1 1 
ATOM   5632  C CE2 . PHE G 1 30  ? 7.875   34.876  36.632  1.00 5.71   ? 30   PHE D CE2 1 
ATOM   5633  C CZ  . PHE G 1 30  ? 8.334   34.855  37.953  1.00 1.00   ? 30   PHE D CZ  1 
ATOM   5634  N N   . ASP G 1 31  ? 3.322   31.791  39.012  1.00 13.28  ? 31   ASP D N   1 
ATOM   5635  C CA  . ASP G 1 31  ? 3.203   31.765  40.435  1.00 12.08  ? 31   ASP D CA  1 
ATOM   5636  C C   . ASP G 1 31  ? 4.402   31.132  41.038  1.00 13.87  ? 31   ASP D C   1 
ATOM   5637  O O   . ASP G 1 31  ? 5.191   30.530  40.348  1.00 21.44  ? 31   ASP D O   1 
ATOM   5638  C CB  . ASP G 1 31  ? 1.884   31.155  40.968  1.00 15.48  ? 31   ASP D CB  1 
ATOM   5639  C CG  . ASP G 1 31  ? 0.634   31.535  40.204  1.00 27.68  ? 31   ASP D CG  1 
ATOM   5640  O OD1 . ASP G 1 31  ? 0.243   32.681  40.165  1.00 37.42  ? 31   ASP D OD1 1 
ATOM   5641  O OD2 . ASP G 1 31  ? 0.026   30.519  39.590  1.00 34.74  ? 31   ASP D OD2 1 
ATOM   5642  N N   . GLU G 1 32  ? 4.495   31.266  42.342  1.00 4.84   ? 32   GLU D N   1 
ATOM   5643  C CA  . GLU G 1 32  ? 5.573   30.707  43.077  1.00 9.08   ? 32   GLU D CA  1 
ATOM   5644  C C   . GLU G 1 32  ? 5.104   29.984  44.340  1.00 23.83  ? 32   GLU D C   1 
ATOM   5645  O O   . GLU G 1 32  ? 4.282   30.486  45.055  1.00 34.10  ? 32   GLU D O   1 
ATOM   5646  C CB  . GLU G 1 32  ? 6.580   31.813  43.504  1.00 10.48  ? 32   GLU D CB  1 
ATOM   5647  C CG  . GLU G 1 32  ? 7.229   32.574  42.317  1.00 10.37  ? 32   GLU D CG  1 
ATOM   5648  C CD  . GLU G 1 32  ? 8.387   33.409  42.774  1.00 18.46  ? 32   GLU D CD  1 
ATOM   5649  O OE1 . GLU G 1 32  ? 8.224   34.446  43.373  1.00 28.62  ? 32   GLU D OE1 1 
ATOM   5650  O OE2 . GLU G 1 32  ? 9.548   32.785  42.696  1.00 29.96  ? 32   GLU D OE2 1 
ATOM   5651  N N   . GLU G 1 33  ? 5.694   28.838  44.659  1.00 17.07  ? 33   GLU D N   1 
ATOM   5652  C CA  . GLU G 1 33  ? 5.385   28.121  45.840  1.00 10.34  ? 33   GLU D CA  1 
ATOM   5653  C C   . GLU G 1 33  ? 6.646   27.908  46.626  1.00 14.02  ? 33   GLU D C   1 
ATOM   5654  O O   . GLU G 1 33  ? 7.462   27.051  46.338  1.00 19.01  ? 33   GLU D O   1 
ATOM   5655  C CB  . GLU G 1 33  ? 4.795   26.802  45.456  1.00 13.07  ? 33   GLU D CB  1 
ATOM   5656  C CG  . GLU G 1 33  ? 4.065   26.246  46.689  1.00 25.16  ? 33   GLU D CG  1 
ATOM   5657  C CD  . GLU G 1 33  ? 3.399   24.920  46.480  1.00 75.56  ? 33   GLU D CD  1 
ATOM   5658  O OE1 . GLU G 1 33  ? 2.364   24.808  45.810  1.00 47.37  ? 33   GLU D OE1 1 
ATOM   5659  O OE2 . GLU G 1 33  ? 4.022   23.940  47.145  1.00 39.17  ? 33   GLU D OE2 1 
ATOM   5660  N N   . PHE G 1 34  ? 6.830   28.724  47.634  1.00 7.61   ? 34   PHE D N   1 
ATOM   5661  C CA  . PHE G 1 34  ? 8.079   28.680  48.335  1.00 8.79   ? 34   PHE D CA  1 
ATOM   5662  C C   . PHE G 1 34  ? 8.419   27.598  49.269  1.00 19.39  ? 34   PHE D C   1 
ATOM   5663  O O   . PHE G 1 34  ? 7.663   27.288  50.156  1.00 24.13  ? 34   PHE D O   1 
ATOM   5664  C CB  . PHE G 1 34  ? 8.311   29.970  49.076  1.00 10.39  ? 34   PHE D CB  1 
ATOM   5665  C CG  . PHE G 1 34  ? 8.378   31.093  48.107  1.00 17.68  ? 34   PHE D CG  1 
ATOM   5666  C CD1 . PHE G 1 34  ? 9.238   31.001  47.015  1.00 28.34  ? 34   PHE D CD1 1 
ATOM   5667  C CD2 . PHE G 1 34  ? 7.590   32.231  48.258  1.00 16.81  ? 34   PHE D CD2 1 
ATOM   5668  C CE1 . PHE G 1 34  ? 9.273   32.026  46.075  1.00 31.51  ? 34   PHE D CE1 1 
ATOM   5669  C CE2 . PHE G 1 34  ? 7.614   33.259  47.321  1.00 16.09  ? 34   PHE D CE2 1 
ATOM   5670  C CZ  . PHE G 1 34  ? 8.473   33.157  46.235  1.00 21.33  ? 34   PHE D CZ  1 
ATOM   5671  N N   . LEU G 1 35  ? 9.651   27.136  49.169  1.00 17.76  ? 35   LEU D N   1 
ATOM   5672  C CA  . LEU G 1 35  ? 10.085  26.204  50.172  1.00 10.55  ? 35   LEU D CA  1 
ATOM   5673  C C   . LEU G 1 35  ? 10.715  26.971  51.300  1.00 19.28  ? 35   LEU D C   1 
ATOM   5674  O O   . LEU G 1 35  ? 11.493  27.894  51.071  1.00 29.56  ? 35   LEU D O   1 
ATOM   5675  C CB  . LEU G 1 35  ? 11.031  25.085  49.734  1.00 7.52   ? 35   LEU D CB  1 
ATOM   5676  C CG  . LEU G 1 35  ? 10.480  24.299  48.564  1.00 13.89  ? 35   LEU D CG  1 
ATOM   5677  C CD1 . LEU G 1 35  ? 11.587  23.561  47.835  1.00 9.47   ? 35   LEU D CD1 1 
ATOM   5678  C CD2 . LEU G 1 35  ? 9.547   23.274  49.080  1.00 11.29  ? 35   LEU D CD2 1 
ATOM   5679  N N   . GLU G 1 36  ? 10.319  26.575  52.520  1.00 21.93  ? 36   GLU D N   1 
ATOM   5680  C CA  . GLU G 1 36  ? 10.833  27.110  53.772  1.00 23.68  ? 36   GLU D CA  1 
ATOM   5681  C C   . GLU G 1 36  ? 11.515  26.135  54.717  1.00 31.22  ? 36   GLU D C   1 
ATOM   5682  O O   . GLU G 1 36  ? 12.339  26.583  55.529  1.00 34.30  ? 36   GLU D O   1 
ATOM   5683  C CB  . GLU G 1 36  ? 9.878   28.048  54.520  1.00 26.56  ? 36   GLU D CB  1 
ATOM   5684  C CG  . GLU G 1 36  ? 9.149   29.086  53.627  1.00 46.80  ? 36   GLU D CG  1 
ATOM   5685  C CD  . GLU G 1 36  ? 7.966   29.744  54.272  1.00 144.65 ? 36   GLU D CD  1 
ATOM   5686  O OE1 . GLU G 1 36  ? 7.941   30.116  55.411  1.00 197.15 ? 36   GLU D OE1 1 
ATOM   5687  O OE2 . GLU G 1 36  ? 6.956   29.822  53.453  1.00 116.08 ? 36   GLU D OE2 1 
ATOM   5688  N N   . THR G 1 37  ? 11.205  24.827  54.585  1.00 31.21  ? 37   THR D N   1 
ATOM   5689  C CA  . THR G 1 37  ? 11.715  23.744  55.434  1.00 29.82  ? 37   THR D CA  1 
ATOM   5690  C C   . THR G 1 37  ? 12.018  22.429  54.718  1.00 35.09  ? 37   THR D C   1 
ATOM   5691  O O   . THR G 1 37  ? 11.448  22.117  53.641  1.00 28.14  ? 37   THR D O   1 
ATOM   5692  C CB  . THR G 1 37  ? 10.558  23.362  56.366  1.00 43.33  ? 37   THR D CB  1 
ATOM   5693  O OG1 . THR G 1 37  ? 9.625   22.537  55.676  1.00 54.39  ? 37   THR D OG1 1 
ATOM   5694  C CG2 . THR G 1 37  ? 9.844   24.595  56.846  1.00 18.64  ? 37   THR D CG2 1 
ATOM   5695  N N   . LYS G 1 38  ? 12.808  21.594  55.434  1.00 29.25  ? 38   LYS D N   1 
ATOM   5696  C CA  . LYS G 1 38  ? 13.137  20.255  54.920  1.00 27.02  ? 38   LYS D CA  1 
ATOM   5697  C C   . LYS G 1 38  ? 11.851  19.526  54.567  1.00 32.21  ? 38   LYS D C   1 
ATOM   5698  O O   . LYS G 1 38  ? 11.619  18.943  53.473  1.00 38.46  ? 38   LYS D O   1 
ATOM   5699  C CB  . LYS G 1 38  ? 13.918  19.404  55.930  1.00 26.43  ? 38   LYS D CB  1 
ATOM   5700  C CG  . LYS G 1 38  ? 15.160  18.675  55.386  1.00 60.64  ? 38   LYS D CG  1 
ATOM   5701  C CD  . LYS G 1 38  ? 16.525  19.315  55.719  1.00 131.05 ? 38   LYS D CD  1 
ATOM   5702  C CE  . LYS G 1 38  ? 17.756  18.550  55.195  1.00 170.26 ? 38   LYS D CE  1 
ATOM   5703  N NZ  . LYS G 1 38  ? 19.073  19.054  55.663  1.00 174.30 ? 38   LYS D NZ  1 
ATOM   5704  N N   . GLU G 1 39  ? 10.974  19.630  55.512  1.00 27.67  ? 39   GLU D N   1 
ATOM   5705  C CA  . GLU G 1 39  ? 9.703   18.984  55.433  1.00 31.08  ? 39   GLU D CA  1 
ATOM   5706  C C   . GLU G 1 39  ? 8.887   19.304  54.216  1.00 30.03  ? 39   GLU D C   1 
ATOM   5707  O O   . GLU G 1 39  ? 8.366   18.397  53.540  1.00 35.32  ? 39   GLU D O   1 
ATOM   5708  C CB  . GLU G 1 39  ? 8.941   19.062  56.752  1.00 37.81  ? 39   GLU D CB  1 
ATOM   5709  C CG  . GLU G 1 39  ? 7.734   18.111  56.797  1.00 79.19  ? 39   GLU D CG  1 
ATOM   5710  C CD  . GLU G 1 39  ? 6.499   18.863  57.212  1.00 193.64 ? 39   GLU D CD  1 
ATOM   5711  O OE1 . GLU G 1 39  ? 6.422   20.086  57.219  1.00 232.66 ? 39   GLU D OE1 1 
ATOM   5712  O OE2 . GLU G 1 39  ? 5.527   18.065  57.574  1.00 227.39 ? 39   GLU D OE2 1 
ATOM   5713  N N   . GLN G 1 40  ? 8.785   20.577  53.879  1.00 21.77  ? 40   GLN D N   1 
ATOM   5714  C CA  . GLN G 1 40  ? 8.050   20.870  52.660  1.00 20.26  ? 40   GLN D CA  1 
ATOM   5715  C C   . GLN G 1 40  ? 8.721   20.271  51.447  1.00 27.16  ? 40   GLN D C   1 
ATOM   5716  O O   . GLN G 1 40  ? 8.053   19.858  50.502  1.00 28.08  ? 40   GLN D O   1 
ATOM   5717  C CB  . GLN G 1 40  ? 7.851   22.335  52.459  1.00 19.08  ? 40   GLN D CB  1 
ATOM   5718  C CG  . GLN G 1 40  ? 7.592   23.009  53.794  1.00 31.96  ? 40   GLN D CG  1 
ATOM   5719  C CD  . GLN G 1 40  ? 7.642   24.497  53.644  1.00 60.17  ? 40   GLN D CD  1 
ATOM   5720  O OE1 . GLN G 1 40  ? 8.733   25.102  53.749  1.00 56.97  ? 40   GLN D OE1 1 
ATOM   5721  N NE2 . GLN G 1 40  ? 6.502   25.051  53.233  1.00 30.70  ? 40   GLN D NE2 1 
ATOM   5722  N N   . LEU G 1 41  ? 10.047  20.200  51.509  1.00 19.89  ? 41   LEU D N   1 
ATOM   5723  C CA  . LEU G 1 41  ? 10.771  19.608  50.447  1.00 18.47  ? 41   LEU D CA  1 
ATOM   5724  C C   . LEU G 1 41  ? 10.400  18.151  50.418  1.00 22.31  ? 41   LEU D C   1 
ATOM   5725  O O   . LEU G 1 41  ? 10.002  17.621  49.373  1.00 20.50  ? 41   LEU D O   1 
ATOM   5726  C CB  . LEU G 1 41  ? 12.252  19.854  50.660  1.00 19.14  ? 41   LEU D CB  1 
ATOM   5727  C CG  . LEU G 1 41  ? 13.152  19.100  49.689  1.00 22.37  ? 41   LEU D CG  1 
ATOM   5728  C CD1 . LEU G 1 41  ? 12.866  19.439  48.216  1.00 14.45  ? 41   LEU D CD1 1 
ATOM   5729  C CD2 . LEU G 1 41  ? 14.594  19.407  50.039  1.00 6.97   ? 41   LEU D CD2 1 
ATOM   5730  N N   . TYR G 1 42  ? 10.433  17.511  51.586  1.00 18.09  ? 42   TYR D N   1 
ATOM   5731  C CA  . TYR G 1 42  ? 10.000  16.104  51.613  1.00 22.08  ? 42   TYR D CA  1 
ATOM   5732  C C   . TYR G 1 42  ? 8.667   15.838  51.032  1.00 21.45  ? 42   TYR D C   1 
ATOM   5733  O O   . TYR G 1 42  ? 8.452   14.867  50.330  1.00 23.96  ? 42   TYR D O   1 
ATOM   5734  C CB  . TYR G 1 42  ? 9.874   15.567  52.981  1.00 34.68  ? 42   TYR D CB  1 
ATOM   5735  C CG  . TYR G 1 42  ? 11.249  15.287  53.472  1.00 69.13  ? 42   TYR D CG  1 
ATOM   5736  C CD1 . TYR G 1 42  ? 12.222  14.840  52.579  1.00 82.25  ? 42   TYR D CD1 1 
ATOM   5737  C CD2 . TYR G 1 42  ? 11.606  15.452  54.812  1.00 76.28  ? 42   TYR D CD2 1 
ATOM   5738  C CE1 . TYR G 1 42  ? 13.523  14.553  53.004  1.00 94.37  ? 42   TYR D CE1 1 
ATOM   5739  C CE2 . TYR G 1 42  ? 12.904  15.175  55.251  1.00 79.12  ? 42   TYR D CE2 1 
ATOM   5740  C CZ  . TYR G 1 42  ? 13.867  14.721  54.349  1.00 95.12  ? 42   TYR D CZ  1 
ATOM   5741  O OH  . TYR G 1 42  ? 15.143  14.432  54.795  1.00 96.88  ? 42   TYR D OH  1 
ATOM   5742  N N   . LYS G 1 43  ? 7.740   16.693  51.328  1.00 13.68  ? 43   LYS D N   1 
ATOM   5743  C CA  . LYS G 1 43  ? 6.459   16.401  50.756  1.00 14.88  ? 43   LYS D CA  1 
ATOM   5744  C C   . LYS G 1 43  ? 6.470   16.479  49.263  1.00 21.16  ? 43   LYS D C   1 
ATOM   5745  O O   . LYS G 1 43  ? 5.800   15.774  48.527  1.00 31.70  ? 43   LYS D O   1 
ATOM   5746  C CB  . LYS G 1 43  ? 5.348   17.256  51.361  1.00 21.00  ? 43   LYS D CB  1 
ATOM   5747  C CG  . LYS G 1 43  ? 5.588   17.466  52.845  1.00 105.48 ? 43   LYS D CG  1 
ATOM   5748  C CD  . LYS G 1 43  ? 4.770   18.600  53.444  1.00 165.45 ? 43   LYS D CD  1 
ATOM   5749  C CE  . LYS G 1 43  ? 3.430   18.147  54.006  1.00 228.51 ? 43   LYS D CE  1 
ATOM   5750  N NZ  . LYS G 1 43  ? 2.753   19.186  54.804  1.00 258.00 ? 43   LYS D NZ  1 
ATOM   5751  N N   . LEU G 1 44  ? 7.257   17.358  48.794  1.00 13.95  ? 44   LEU D N   1 
ATOM   5752  C CA  . LEU G 1 44  ? 7.290   17.546  47.372  1.00 12.63  ? 44   LEU D CA  1 
ATOM   5753  C C   . LEU G 1 44  ? 7.884   16.322  46.733  1.00 15.33  ? 44   LEU D C   1 
ATOM   5754  O O   . LEU G 1 44  ? 7.435   15.784  45.719  1.00 15.90  ? 44   LEU D O   1 
ATOM   5755  C CB  . LEU G 1 44  ? 8.166   18.793  47.243  1.00 12.87  ? 44   LEU D CB  1 
ATOM   5756  C CG  . LEU G 1 44  ? 7.994   19.621  45.991  1.00 16.69  ? 44   LEU D CG  1 
ATOM   5757  C CD1 . LEU G 1 44  ? 6.560   19.792  45.643  1.00 12.70  ? 44   LEU D CD1 1 
ATOM   5758  C CD2 . LEU G 1 44  ? 8.571   21.013  46.191  1.00 18.55  ? 44   LEU D CD2 1 
ATOM   5759  N N   . GLN G 1 45  ? 8.897   15.857  47.425  1.00 10.39  ? 45   GLN D N   1 
ATOM   5760  C CA  . GLN G 1 45  ? 9.639   14.727  46.986  1.00 8.91   ? 45   GLN D CA  1 
ATOM   5761  C C   . GLN G 1 45  ? 8.798   13.528  47.078  1.00 24.32  ? 45   GLN D C   1 
ATOM   5762  O O   . GLN G 1 45  ? 8.671   12.771  46.132  1.00 24.96  ? 45   GLN D O   1 
ATOM   5763  C CB  . GLN G 1 45  ? 10.807  14.544  47.914  1.00 7.27   ? 45   GLN D CB  1 
ATOM   5764  C CG  . GLN G 1 45  ? 11.900  15.503  47.531  1.00 23.17  ? 45   GLN D CG  1 
ATOM   5765  C CD  . GLN G 1 45  ? 13.040  15.390  48.471  1.00 9.01   ? 45   GLN D CD  1 
ATOM   5766  O OE1 . GLN G 1 45  ? 12.817  14.992  49.602  1.00 36.30  ? 45   GLN D OE1 1 
ATOM   5767  N NE2 . GLN G 1 45  ? 14.232  15.827  48.031  1.00 19.47  ? 45   GLN D NE2 1 
ATOM   5768  N N   . ASP G 1 46  ? 8.214   13.410  48.264  1.00 25.91  ? 46   ASP D N   1 
ATOM   5769  C CA  . ASP G 1 46  ? 7.330   12.308  48.567  1.00 24.70  ? 46   ASP D CA  1 
ATOM   5770  C C   . ASP G 1 46  ? 6.206   12.147  47.557  1.00 20.91  ? 46   ASP D C   1 
ATOM   5771  O O   . ASP G 1 46  ? 5.856   11.074  47.163  1.00 23.96  ? 46   ASP D O   1 
ATOM   5772  C CB  . ASP G 1 46  ? 6.741   12.417  49.969  1.00 28.86  ? 46   ASP D CB  1 
ATOM   5773  C CG  . ASP G 1 46  ? 5.792   11.282  50.328  1.00 66.70  ? 46   ASP D CG  1 
ATOM   5774  O OD1 . ASP G 1 46  ? 6.137   10.116  50.334  1.00 73.54  ? 46   ASP D OD1 1 
ATOM   5775  O OD2 . ASP G 1 46  ? 4.543   11.669  50.570  1.00 88.27  ? 46   ASP D OD2 1 
ATOM   5776  N N   . GLY G 1 47  ? 5.586   13.203  47.119  1.00 17.38  ? 47   GLY D N   1 
ATOM   5777  C CA  . GLY G 1 47  ? 4.532   12.994  46.168  1.00 13.80  ? 47   GLY D CA  1 
ATOM   5778  C C   . GLY G 1 47  ? 5.031   12.756  44.779  1.00 20.83  ? 47   GLY D C   1 
ATOM   5779  O O   . GLY G 1 47  ? 4.238   12.748  43.842  1.00 26.10  ? 47   GLY D O   1 
ATOM   5780  N N   . ASN G 1 48  ? 6.339   12.597  44.626  1.00 16.78  ? 48   ASN D N   1 
ATOM   5781  C CA  . ASN G 1 48  ? 6.864   12.344  43.305  1.00 18.70  ? 48   ASN D CA  1 
ATOM   5782  C C   . ASN G 1 48  ? 6.714   13.522  42.376  1.00 23.54  ? 48   ASN D C   1 
ATOM   5783  O O   . ASN G 1 48  ? 6.394   13.390  41.206  1.00 28.81  ? 48   ASN D O   1 
ATOM   5784  C CB  . ASN G 1 48  ? 6.325   10.996  42.720  1.00 19.59  ? 48   ASN D CB  1 
ATOM   5785  C CG  . ASN G 1 48  ? 6.776   9.868   43.649  1.00 101.87 ? 48   ASN D CG  1 
ATOM   5786  O OD1 . ASN G 1 48  ? 7.928   9.860   44.145  1.00 85.57  ? 48   ASN D OD1 1 
ATOM   5787  N ND2 . ASN G 1 48  ? 5.828   9.015   44.047  1.00 131.65 ? 48   ASN D ND2 1 
ATOM   5788  N N   . HIS G 1 49  ? 6.928   14.709  42.887  1.00 14.99  ? 49   HIS D N   1 
ATOM   5789  C CA  . HIS G 1 49  ? 6.773   15.806  41.973  1.00 12.78  ? 49   HIS D CA  1 
ATOM   5790  C C   . HIS G 1 49  ? 8.052   16.252  41.335  1.00 15.54  ? 49   HIS D C   1 
ATOM   5791  O O   . HIS G 1 49  ? 8.013   16.936  40.334  1.00 16.83  ? 49   HIS D O   1 
ATOM   5792  C CB  . HIS G 1 49  ? 6.340   16.941  42.792  1.00 16.79  ? 49   HIS D CB  1 
ATOM   5793  C CG  . HIS G 1 49  ? 5.070   16.626  43.423  1.00 21.98  ? 49   HIS D CG  1 
ATOM   5794  N ND1 . HIS G 1 49  ? 3.921   16.508  42.655  1.00 23.88  ? 49   HIS D ND1 1 
ATOM   5795  C CD2 . HIS G 1 49  ? 4.766   16.454  44.723  1.00 25.84  ? 49   HIS D CD2 1 
ATOM   5796  C CE1 . HIS G 1 49  ? 2.934   16.299  43.501  1.00 21.95  ? 49   HIS D CE1 1 
ATOM   5797  N NE2 . HIS G 1 49  ? 3.402   16.273  44.748  1.00 24.18  ? 49   HIS D NE2 1 
ATOM   5798  N N   . LEU G 1 50  ? 9.158   15.900  41.982  1.00 8.69   ? 50   LEU D N   1 
ATOM   5799  C CA  . LEU G 1 50  ? 10.483  16.203  41.574  1.00 4.38   ? 50   LEU D CA  1 
ATOM   5800  C C   . LEU G 1 50  ? 11.064  14.993  40.919  1.00 11.49  ? 50   LEU D C   1 
ATOM   5801  O O   . LEU G 1 50  ? 11.424  14.095  41.618  1.00 9.66   ? 50   LEU D O   1 
ATOM   5802  C CB  . LEU G 1 50  ? 11.327  16.449  42.828  1.00 1.64   ? 50   LEU D CB  1 
ATOM   5803  C CG  . LEU G 1 50  ? 10.630  17.498  43.663  1.00 3.51   ? 50   LEU D CG  1 
ATOM   5804  C CD1 . LEU G 1 50  ? 11.507  17.969  44.822  1.00 1.06   ? 50   LEU D CD1 1 
ATOM   5805  C CD2 . LEU G 1 50  ? 10.150  18.604  42.750  1.00 1.00   ? 50   LEU D CD2 1 
ATOM   5806  N N   . LEU G 1 51  ? 11.207  15.025  39.598  1.00 8.04   ? 51   LEU D N   1 
ATOM   5807  C CA  . LEU G 1 51  ? 11.737  13.913  38.837  1.00 1.52   ? 51   LEU D CA  1 
ATOM   5808  C C   . LEU G 1 51  ? 12.976  13.355  39.412  1.00 10.02  ? 51   LEU D C   1 
ATOM   5809  O O   . LEU G 1 51  ? 13.136  12.156  39.452  1.00 21.73  ? 51   LEU D O   1 
ATOM   5810  C CB  . LEU G 1 51  ? 11.991  14.348  37.393  1.00 1.31   ? 51   LEU D CB  1 
ATOM   5811  C CG  . LEU G 1 51  ? 12.571  13.272  36.473  1.00 7.53   ? 51   LEU D CG  1 
ATOM   5812  C CD1 . LEU G 1 51  ? 11.557  12.150  36.322  1.00 1.00   ? 51   LEU D CD1 1 
ATOM   5813  C CD2 . LEU G 1 51  ? 12.903  13.771  35.057  1.00 1.00   ? 51   LEU D CD2 1 
ATOM   5814  N N   . PHE G 1 52  ? 13.855  14.238  39.866  1.00 9.94   ? 52   PHE D N   1 
ATOM   5815  C CA  . PHE G 1 52  ? 15.132  13.785  40.400  1.00 7.21   ? 52   PHE D CA  1 
ATOM   5816  C C   . PHE G 1 52  ? 15.300  14.222  41.827  1.00 11.24  ? 52   PHE D C   1 
ATOM   5817  O O   . PHE G 1 52  ? 16.414  14.336  42.288  1.00 6.58   ? 52   PHE D O   1 
ATOM   5818  C CB  . PHE G 1 52  ? 16.369  14.174  39.564  1.00 1.00   ? 52   PHE D CB  1 
ATOM   5819  C CG  . PHE G 1 52  ? 16.414  13.566  38.167  1.00 2.96   ? 52   PHE D CG  1 
ATOM   5820  C CD1 . PHE G 1 52  ? 16.557  12.198  37.964  1.00 7.87   ? 52   PHE D CD1 1 
ATOM   5821  C CD2 . PHE G 1 52  ? 16.338  14.365  37.022  1.00 6.49   ? 52   PHE D CD2 1 
ATOM   5822  C CE1 . PHE G 1 52  ? 16.560  11.630  36.688  1.00 6.37   ? 52   PHE D CE1 1 
ATOM   5823  C CE2 . PHE G 1 52  ? 16.354  13.838  35.732  1.00 6.34   ? 52   PHE D CE2 1 
ATOM   5824  C CZ  . PHE G 1 52  ? 16.441  12.455  35.576  1.00 5.29   ? 52   PHE D CZ  1 
ATOM   5825  N N   . GLN G 1 53  ? 14.190  14.550  42.473  1.00 5.74   ? 53   GLN D N   1 
ATOM   5826  C CA  . GLN G 1 53  ? 14.252  14.940  43.858  1.00 5.09   ? 53   GLN D CA  1 
ATOM   5827  C C   . GLN G 1 53  ? 14.831  16.289  44.130  1.00 13.57  ? 53   GLN D C   1 
ATOM   5828  O O   . GLN G 1 53  ? 15.066  16.628  45.269  1.00 14.23  ? 53   GLN D O   1 
ATOM   5829  C CB  . GLN G 1 53  ? 14.957  13.876  44.696  1.00 3.56   ? 53   GLN D CB  1 
ATOM   5830  C CG  . GLN G 1 53  ? 14.404  12.411  44.492  1.00 13.24  ? 53   GLN D CG  1 
ATOM   5831  C CD  . GLN G 1 53  ? 12.946  12.195  44.903  1.00 42.24  ? 53   GLN D CD  1 
ATOM   5832  O OE1 . GLN G 1 53  ? 12.674  11.465  45.860  1.00 114.27 ? 53   GLN D OE1 1 
ATOM   5833  N NE2 . GLN G 1 53  ? 11.990  12.830  44.235  1.00 50.32  ? 53   GLN D NE2 1 
ATOM   5834  N N   . GLN G 1 54  ? 15.018  17.073  43.090  1.00 11.15  ? 54   GLN D N   1 
ATOM   5835  C CA  . GLN G 1 54  ? 15.535  18.372  43.338  1.00 11.09  ? 54   GLN D CA  1 
ATOM   5836  C C   . GLN G 1 54  ? 14.685  19.381  42.678  1.00 14.96  ? 54   GLN D C   1 
ATOM   5837  O O   . GLN G 1 54  ? 13.869  19.006  41.833  1.00 10.27  ? 54   GLN D O   1 
ATOM   5838  C CB  . GLN G 1 54  ? 16.804  18.545  42.545  1.00 9.52   ? 54   GLN D CB  1 
ATOM   5839  C CG  . GLN G 1 54  ? 17.772  17.453  42.931  1.00 12.31  ? 54   GLN D CG  1 
ATOM   5840  C CD  . GLN G 1 54  ? 18.924  17.341  41.982  1.00 1.00   ? 54   GLN D CD  1 
ATOM   5841  O OE1 . GLN G 1 54  ? 18.773  16.886  40.823  1.00 45.37  ? 54   GLN D OE1 1 
ATOM   5842  N NE2 . GLN G 1 54  ? 20.052  17.868  42.426  1.00 19.84  ? 54   GLN D NE2 1 
ATOM   5843  N N   . VAL G 1 55  ? 14.959  20.623  43.084  1.00 10.42  ? 55   VAL D N   1 
ATOM   5844  C CA  . VAL G 1 55  ? 14.440  21.860  42.542  1.00 9.57   ? 55   VAL D CA  1 
ATOM   5845  C C   . VAL G 1 55  ? 15.657  22.605  41.938  1.00 14.69  ? 55   VAL D C   1 
ATOM   5846  O O   . VAL G 1 55  ? 16.836  22.400  42.280  1.00 8.70   ? 55   VAL D O   1 
ATOM   5847  C CB  . VAL G 1 55  ? 13.762  22.748  43.584  1.00 8.03   ? 55   VAL D CB  1 
ATOM   5848  C CG1 . VAL G 1 55  ? 12.450  22.142  43.965  1.00 3.46   ? 55   VAL D CG1 1 
ATOM   5849  C CG2 . VAL G 1 55  ? 14.632  22.898  44.823  1.00 4.29   ? 55   VAL D CG2 1 
ATOM   5850  N N   . PRO G 1 56  ? 15.439  23.488  40.992  1.00 11.30  ? 56   PRO D N   1 
ATOM   5851  C CA  . PRO G 1 56  ? 14.157  23.934  40.521  1.00 4.11   ? 56   PRO D CA  1 
ATOM   5852  C C   . PRO G 1 56  ? 13.266  22.940  39.903  1.00 9.83   ? 56   PRO D C   1 
ATOM   5853  O O   . PRO G 1 56  ? 13.677  22.110  39.109  1.00 19.45  ? 56   PRO D O   1 
ATOM   5854  C CB  . PRO G 1 56  ? 14.520  24.894  39.360  1.00 1.00   ? 56   PRO D CB  1 
ATOM   5855  C CG  . PRO G 1 56  ? 15.962  25.287  39.561  1.00 4.11   ? 56   PRO D CG  1 
ATOM   5856  C CD  . PRO G 1 56  ? 16.550  24.456  40.686  1.00 3.84   ? 56   PRO D CD  1 
ATOM   5857  N N   . MET G 1 57  ? 11.988  23.150  40.124  1.00 5.04   ? 57   MET D N   1 
ATOM   5858  C CA  . MET G 1 57  ? 10.943  22.414  39.409  1.00 3.72   ? 57   MET D CA  1 
ATOM   5859  C C   . MET G 1 57  ? 9.916   23.475  39.049  1.00 5.29   ? 57   MET D C   1 
ATOM   5860  O O   . MET G 1 57  ? 9.623   24.388  39.817  1.00 10.86  ? 57   MET D O   1 
ATOM   5861  C CB  . MET G 1 57  ? 10.259  21.291  40.191  1.00 5.14   ? 57   MET D CB  1 
ATOM   5862  C CG  . MET G 1 57  ? 9.325   20.531  39.299  1.00 11.13  ? 57   MET D CG  1 
ATOM   5863  S SD  . MET G 1 57  ? 7.633   21.158  39.239  1.00 16.68  ? 57   MET D SD  1 
ATOM   5864  C CE  . MET G 1 57  ? 7.154   20.552  40.847  1.00 5.94   ? 57   MET D CE  1 
ATOM   5865  N N   . VAL G 1 58  ? 9.414   23.411  37.871  1.00 2.32   ? 58   VAL D N   1 
ATOM   5866  C CA  . VAL G 1 58  ? 8.431   24.365  37.428  1.00 2.31   ? 58   VAL D CA  1 
ATOM   5867  C C   . VAL G 1 58  ? 7.307   23.601  36.769  1.00 12.78  ? 58   VAL D C   1 
ATOM   5868  O O   . VAL G 1 58  ? 7.525   22.711  35.916  1.00 11.53  ? 58   VAL D O   1 
ATOM   5869  C CB  . VAL G 1 58  ? 9.055   25.240  36.368  1.00 4.17   ? 58   VAL D CB  1 
ATOM   5870  C CG1 . VAL G 1 58  ? 8.008   26.057  35.611  1.00 2.31   ? 58   VAL D CG1 1 
ATOM   5871  C CG2 . VAL G 1 58  ? 10.038  26.120  37.067  1.00 5.34   ? 58   VAL D CG2 1 
ATOM   5872  N N   . GLU G 1 59  ? 6.111   23.945  37.197  1.00 12.32  ? 59   GLU D N   1 
ATOM   5873  C CA  . GLU G 1 59  ? 4.960   23.297  36.620  1.00 10.70  ? 59   GLU D CA  1 
ATOM   5874  C C   . GLU G 1 59  ? 4.426   24.142  35.544  1.00 17.16  ? 59   GLU D C   1 
ATOM   5875  O O   . GLU G 1 59  ? 3.926   25.228  35.791  1.00 22.45  ? 59   GLU D O   1 
ATOM   5876  C CB  . GLU G 1 59  ? 3.805   23.103  37.550  1.00 9.62   ? 59   GLU D CB  1 
ATOM   5877  C CG  . GLU G 1 59  ? 4.138   22.426  38.879  1.00 29.96  ? 59   GLU D CG  1 
ATOM   5878  C CD  . GLU G 1 59  ? 2.868   22.123  39.662  1.00 5.94   ? 59   GLU D CD  1 
ATOM   5879  O OE1 . GLU G 1 59  ? 1.950   21.439  39.208  1.00 138.83 ? 59   GLU D OE1 1 
ATOM   5880  O OE2 . GLU G 1 59  ? 2.861   22.706  40.845  1.00 37.35  ? 59   GLU D OE2 1 
ATOM   5881  N N   . ILE G 1 60  ? 4.514   23.604  34.370  1.00 10.44  ? 60   ILE D N   1 
ATOM   5882  C CA  . ILE G 1 60  ? 4.087   24.331  33.233  1.00 7.52   ? 60   ILE D CA  1 
ATOM   5883  C C   . ILE G 1 60  ? 3.564   23.419  32.135  1.00 12.99  ? 60   ILE D C   1 
ATOM   5884  O O   . ILE G 1 60  ? 4.084   22.340  31.852  1.00 18.91  ? 60   ILE D O   1 
ATOM   5885  C CB  . ILE G 1 60  ? 5.347   24.992  32.729  1.00 13.20  ? 60   ILE D CB  1 
ATOM   5886  C CG1 . ILE G 1 60  ? 5.009   25.805  31.528  1.00 13.74  ? 60   ILE D CG1 1 
ATOM   5887  C CG2 . ILE G 1 60  ? 6.350   23.910  32.317  1.00 13.67  ? 60   ILE D CG2 1 
ATOM   5888  C CD1 . ILE G 1 60  ? 6.110   26.772  31.139  1.00 4.78   ? 60   ILE D CD1 1 
ATOM   5889  N N   . ASP G 1 61  ? 2.514   23.876  31.500  1.00 13.05  ? 61   ASP D N   1 
ATOM   5890  C CA  . ASP G 1 61  ? 1.892   23.150  30.388  1.00 8.47   ? 61   ASP D CA  1 
ATOM   5891  C C   . ASP G 1 61  ? 1.609   21.727  30.701  1.00 16.67  ? 61   ASP D C   1 
ATOM   5892  O O   . ASP G 1 61  ? 1.747   20.824  29.859  1.00 22.10  ? 61   ASP D O   1 
ATOM   5893  C CB  . ASP G 1 61  ? 2.616   23.320  29.059  1.00 7.69   ? 61   ASP D CB  1 
ATOM   5894  C CG  . ASP G 1 61  ? 2.525   24.761  28.681  1.00 29.36  ? 61   ASP D CG  1 
ATOM   5895  O OD1 . ASP G 1 61  ? 1.827   25.580  29.296  1.00 47.71  ? 61   ASP D OD1 1 
ATOM   5896  O OD2 . ASP G 1 61  ? 3.465   25.086  27.848  1.00 16.19  ? 61   ASP D OD2 1 
ATOM   5897  N N   . GLY G 1 62  ? 1.218   21.576  31.955  1.00 16.28  ? 62   GLY D N   1 
ATOM   5898  C CA  . GLY G 1 62  ? 0.865   20.286  32.500  1.00 16.33  ? 62   GLY D CA  1 
ATOM   5899  C C   . GLY G 1 62  ? 2.014   19.384  32.864  1.00 27.86  ? 62   GLY D C   1 
ATOM   5900  O O   . GLY G 1 62  ? 1.771   18.228  33.193  1.00 31.80  ? 62   GLY D O   1 
ATOM   5901  N N   . MET G 1 63  ? 3.256   19.898  32.806  1.00 21.31  ? 63   MET D N   1 
ATOM   5902  C CA  . MET G 1 63  ? 4.386   19.101  33.148  1.00 10.03  ? 63   MET D CA  1 
ATOM   5903  C C   . MET G 1 63  ? 5.015   19.668  34.384  1.00 19.03  ? 63   MET D C   1 
ATOM   5904  O O   . MET G 1 63  ? 4.714   20.809  34.762  1.00 21.46  ? 63   MET D O   1 
ATOM   5905  C CB  . MET G 1 63  ? 5.384   19.176  32.012  1.00 9.48   ? 63   MET D CB  1 
ATOM   5906  C CG  . MET G 1 63  ? 4.813   18.707  30.686  1.00 9.21   ? 63   MET D CG  1 
ATOM   5907  S SD  . MET G 1 63  ? 5.544   19.552  29.282  1.00 21.16  ? 63   MET D SD  1 
ATOM   5908  C CE  . MET G 1 63  ? 6.627   18.251  28.596  1.00 25.93  ? 63   MET D CE  1 
ATOM   5909  N N   . LYS G 1 64  ? 5.885   18.861  34.969  1.00 11.90  ? 64   LYS D N   1 
ATOM   5910  C CA  . LYS G 1 64  ? 6.668   19.276  36.075  1.00 11.35  ? 64   LYS D CA  1 
ATOM   5911  C C   . LYS G 1 64  ? 8.117   19.204  35.636  1.00 16.18  ? 64   LYS D C   1 
ATOM   5912  O O   . LYS G 1 64  ? 8.812   18.226  35.858  1.00 16.69  ? 64   LYS D O   1 
ATOM   5913  C CB  . LYS G 1 64  ? 6.449   18.387  37.263  1.00 14.15  ? 64   LYS D CB  1 
ATOM   5914  C CG  . LYS G 1 64  ? 4.990   18.360  37.649  1.00 5.89   ? 64   LYS D CG  1 
ATOM   5915  C CD  . LYS G 1 64  ? 4.715   17.528  38.905  1.00 21.21  ? 64   LYS D CD  1 
ATOM   5916  C CE  . LYS G 1 64  ? 3.238   17.401  39.379  1.00 17.64  ? 64   LYS D CE  1 
ATOM   5917  N NZ  . LYS G 1 64  ? 2.910   16.068  39.998  1.00 57.04  ? 64   LYS D NZ  1 
ATOM   5918  N N   . LEU G 1 65  ? 8.574   20.232  35.003  1.00 7.70   ? 65   LEU D N   1 
ATOM   5919  C CA  . LEU G 1 65  ? 9.921   20.228  34.563  1.00 4.37   ? 65   LEU D CA  1 
ATOM   5920  C C   . LEU G 1 65  ? 10.844  20.563  35.671  1.00 6.56   ? 65   LEU D C   1 
ATOM   5921  O O   . LEU G 1 65  ? 10.493  21.369  36.523  1.00 12.20  ? 65   LEU D O   1 
ATOM   5922  C CB  . LEU G 1 65  ? 10.100  21.288  33.498  1.00 6.69   ? 65   LEU D CB  1 
ATOM   5923  C CG  . LEU G 1 65  ? 9.054   21.178  32.399  1.00 7.55   ? 65   LEU D CG  1 
ATOM   5924  C CD1 . LEU G 1 65  ? 9.402   22.116  31.305  1.00 1.00   ? 65   LEU D CD1 1 
ATOM   5925  C CD2 . LEU G 1 65  ? 9.076   19.811  31.777  1.00 1.40   ? 65   LEU D CD2 1 
ATOM   5926  N N   . VAL G 1 66  ? 12.019  19.922  35.577  1.00 1.00   ? 66   VAL D N   1 
ATOM   5927  C CA  . VAL G 1 66  ? 13.189  19.979  36.451  1.00 5.48   ? 66   VAL D CA  1 
ATOM   5928  C C   . VAL G 1 66  ? 14.489  20.194  35.645  1.00 11.95  ? 66   VAL D C   1 
ATOM   5929  O O   . VAL G 1 66  ? 14.512  20.013  34.439  1.00 3.67   ? 66   VAL D O   1 
ATOM   5930  C CB  . VAL G 1 66  ? 13.288  18.782  37.401  1.00 9.76   ? 66   VAL D CB  1 
ATOM   5931  C CG1 . VAL G 1 66  ? 11.975  18.646  38.146  1.00 15.83  ? 66   VAL D CG1 1 
ATOM   5932  C CG2 . VAL G 1 66  ? 13.543  17.502  36.648  1.00 1.21   ? 66   VAL D CG2 1 
ATOM   5933  N N   . GLN G 1 67  ? 15.585  20.623  36.302  1.00 11.12  ? 67   GLN D N   1 
ATOM   5934  C CA  . GLN G 1 67  ? 16.849  20.935  35.621  1.00 3.11   ? 67   GLN D CA  1 
ATOM   5935  C C   . GLN G 1 67  ? 16.715  22.262  34.988  1.00 10.31  ? 67   GLN D C   1 
ATOM   5936  O O   . GLN G 1 67  ? 16.029  22.412  33.961  1.00 11.82  ? 67   GLN D O   1 
ATOM   5937  C CB  . GLN G 1 67  ? 17.250  19.923  34.532  1.00 1.00   ? 67   GLN D CB  1 
ATOM   5938  C CG  . GLN G 1 67  ? 17.443  18.531  35.161  1.00 1.00   ? 67   GLN D CG  1 
ATOM   5939  C CD  . GLN G 1 67  ? 18.748  18.413  35.942  1.00 2.40   ? 67   GLN D CD  1 
ATOM   5940  O OE1 . GLN G 1 67  ? 19.663  19.239  35.715  1.00 19.99  ? 67   GLN D OE1 1 
ATOM   5941  N NE2 . GLN G 1 67  ? 18.829  17.430  36.858  1.00 14.45  ? 67   GLN D NE2 1 
ATOM   5942  N N   . THR G 1 68  ? 17.365  23.201  35.621  1.00 7.66   ? 68   THR D N   1 
ATOM   5943  C CA  . THR G 1 68  ? 17.342  24.576  35.141  1.00 5.71   ? 68   THR D CA  1 
ATOM   5944  C C   . THR G 1 68  ? 17.531  24.706  33.667  1.00 12.38  ? 68   THR D C   1 
ATOM   5945  O O   . THR G 1 68  ? 16.717  25.307  33.008  1.00 12.68  ? 68   THR D O   1 
ATOM   5946  C CB  . THR G 1 68  ? 18.460  25.322  35.823  1.00 4.93   ? 68   THR D CB  1 
ATOM   5947  O OG1 . THR G 1 68  ? 18.354  25.070  37.199  1.00 9.64   ? 68   THR D OG1 1 
ATOM   5948  C CG2 . THR G 1 68  ? 18.403  26.772  35.543  1.00 1.00   ? 68   THR D CG2 1 
ATOM   5949  N N   . ARG G 1 69  ? 18.571  24.100  33.114  1.00 12.11  ? 69   ARG D N   1 
ATOM   5950  C CA  . ARG G 1 69  ? 18.729  24.317  31.683  1.00 11.05  ? 69   ARG D CA  1 
ATOM   5951  C C   . ARG G 1 69  ? 17.617  23.799  30.815  1.00 13.17  ? 69   ARG D C   1 
ATOM   5952  O O   . ARG G 1 69  ? 17.308  24.327  29.760  1.00 15.74  ? 69   ARG D O   1 
ATOM   5953  C CB  . ARG G 1 69  ? 19.974  23.680  31.203  1.00 2.87   ? 69   ARG D CB  1 
ATOM   5954  C CG  . ARG G 1 69  ? 21.191  24.134  31.973  1.00 2.19   ? 69   ARG D CG  1 
ATOM   5955  C CD  . ARG G 1 69  ? 22.368  23.202  31.702  1.00 16.62  ? 69   ARG D CD  1 
ATOM   5956  N NE  . ARG G 1 69  ? 23.659  23.828  31.868  1.00 10.38  ? 69   ARG D NE  1 
ATOM   5957  C CZ  . ARG G 1 69  ? 24.039  24.181  33.078  1.00 32.64  ? 69   ARG D CZ  1 
ATOM   5958  N NH1 . ARG G 1 69  ? 23.233  23.920  34.079  1.00 27.33  ? 69   ARG D NH1 1 
ATOM   5959  N NH2 . ARG G 1 69  ? 25.153  24.886  33.300  1.00 22.95  ? 69   ARG D NH2 1 
ATOM   5960  N N   . SER G 1 70  ? 17.066  22.696  31.233  1.00 7.66   ? 70   SER D N   1 
ATOM   5961  C CA  . SER G 1 70  ? 16.030  22.038  30.470  1.00 3.53   ? 70   SER D CA  1 
ATOM   5962  C C   . SER G 1 70  ? 14.767  22.860  30.499  1.00 9.97   ? 70   SER D C   1 
ATOM   5963  O O   . SER G 1 70  ? 14.075  23.061  29.515  1.00 14.94  ? 70   SER D O   1 
ATOM   5964  C CB  . SER G 1 70  ? 15.856  20.661  31.029  1.00 1.00   ? 70   SER D CB  1 
ATOM   5965  O OG  . SER G 1 70  ? 17.111  19.978  31.034  1.00 15.34  ? 70   SER D OG  1 
ATOM   5966  N N   . ILE G 1 71  ? 14.562  23.422  31.650  1.00 4.81   ? 71   ILE D N   1 
ATOM   5967  C CA  . ILE G 1 71  ? 13.457  24.297  31.844  1.00 3.49   ? 71   ILE D CA  1 
ATOM   5968  C C   . ILE G 1 71  ? 13.588  25.526  30.946  1.00 9.08   ? 71   ILE D C   1 
ATOM   5969  O O   . ILE G 1 71  ? 12.678  25.910  30.231  1.00 13.77  ? 71   ILE D O   1 
ATOM   5970  C CB  . ILE G 1 71  ? 13.393  24.751  33.278  1.00 2.60   ? 71   ILE D CB  1 
ATOM   5971  C CG1 . ILE G 1 71  ? 13.039  23.638  34.300  1.00 2.12   ? 71   ILE D CG1 1 
ATOM   5972  C CG2 . ILE G 1 71  ? 12.311  25.733  33.218  1.00 1.00   ? 71   ILE D CG2 1 
ATOM   5973  C CD1 . ILE G 1 71  ? 13.330  24.039  35.752  1.00 1.00   ? 71   ILE D CD1 1 
ATOM   5974  N N   . LEU G 1 72  ? 14.749  26.135  30.958  1.00 6.18   ? 72   LEU D N   1 
ATOM   5975  C CA  . LEU G 1 72  ? 15.021  27.319  30.146  1.00 4.76   ? 72   LEU D CA  1 
ATOM   5976  C C   . LEU G 1 72  ? 14.845  27.015  28.710  1.00 4.66   ? 72   LEU D C   1 
ATOM   5977  O O   . LEU G 1 72  ? 14.236  27.764  28.001  1.00 11.07  ? 72   LEU D O   1 
ATOM   5978  C CB  . LEU G 1 72  ? 16.445  27.864  30.351  1.00 7.63   ? 72   LEU D CB  1 
ATOM   5979  C CG  . LEU G 1 72  ? 16.721  28.374  31.757  1.00 3.60   ? 72   LEU D CG  1 
ATOM   5980  C CD1 . LEU G 1 72  ? 18.149  28.862  31.888  1.00 1.00   ? 72   LEU D CD1 1 
ATOM   5981  C CD2 . LEU G 1 72  ? 15.762  29.479  32.084  1.00 1.00   ? 72   LEU D CD2 1 
ATOM   5982  N N   . HIS G 1 73  ? 15.365  25.911  28.237  1.00 7.74   ? 73   HIS D N   1 
ATOM   5983  C CA  . HIS G 1 73  ? 15.134  25.587  26.811  1.00 3.88   ? 73   HIS D CA  1 
ATOM   5984  C C   . HIS G 1 73  ? 13.662  25.442  26.505  1.00 11.84  ? 73   HIS D C   1 
ATOM   5985  O O   . HIS G 1 73  ? 13.182  25.830  25.445  1.00 12.42  ? 73   HIS D O   1 
ATOM   5986  C CB  . HIS G 1 73  ? 15.704  24.230  26.480  1.00 1.00   ? 73   HIS D CB  1 
ATOM   5987  C CG  . HIS G 1 73  ? 17.166  24.172  26.732  1.00 6.41   ? 73   HIS D CG  1 
ATOM   5988  N ND1 . HIS G 1 73  ? 17.840  23.014  27.003  1.00 9.52   ? 73   HIS D ND1 1 
ATOM   5989  C CD2 . HIS G 1 73  ? 18.068  25.152  26.712  1.00 12.04  ? 73   HIS D CD2 1 
ATOM   5990  C CE1 . HIS G 1 73  ? 19.108  23.305  27.150  1.00 10.29  ? 73   HIS D CE1 1 
ATOM   5991  N NE2 . HIS G 1 73  ? 19.282  24.589  26.967  1.00 12.17  ? 73   HIS D NE2 1 
ATOM   5992  N N   . TYR G 1 74  ? 12.912  24.811  27.402  1.00 8.27   ? 74   TYR D N   1 
ATOM   5993  C CA  . TYR G 1 74  ? 11.503  24.653  27.082  1.00 9.83   ? 74   TYR D CA  1 
ATOM   5994  C C   . TYR G 1 74  ? 10.831  26.005  26.860  1.00 14.80  ? 74   TYR D C   1 
ATOM   5995  O O   . TYR G 1 74  ? 10.187  26.255  25.835  1.00 13.02  ? 74   TYR D O   1 
ATOM   5996  C CB  . TYR G 1 74  ? 10.748  23.849  28.164  1.00 9.69   ? 74   TYR D CB  1 
ATOM   5997  C CG  . TYR G 1 74  ? 9.269   23.723  27.890  1.00 11.22  ? 74   TYR D CG  1 
ATOM   5998  C CD1 . TYR G 1 74  ? 8.791   22.863  26.906  1.00 11.17  ? 74   TYR D CD1 1 
ATOM   5999  C CD2 . TYR G 1 74  ? 8.318   24.449  28.613  1.00 12.41  ? 74   TYR D CD2 1 
ATOM   6000  C CE1 . TYR G 1 74  ? 7.422   22.753  26.661  1.00 10.74  ? 74   TYR D CE1 1 
ATOM   6001  C CE2 . TYR G 1 74  ? 6.953   24.424  28.319  1.00 9.64   ? 74   TYR D CE2 1 
ATOM   6002  C CZ  . TYR G 1 74  ? 6.494   23.546  27.338  1.00 19.86  ? 74   TYR D CZ  1 
ATOM   6003  O OH  . TYR G 1 74  ? 5.134   23.433  27.052  1.00 17.49  ? 74   TYR D OH  1 
ATOM   6004  N N   . ILE G 1 75  ? 11.048  26.895  27.821  1.00 4.94   ? 75   ILE D N   1 
ATOM   6005  C CA  . ILE G 1 75  ? 10.419  28.175  27.708  1.00 4.38   ? 75   ILE D CA  1 
ATOM   6006  C C   . ILE G 1 75  ? 10.848  28.907  26.483  1.00 15.50  ? 75   ILE D C   1 
ATOM   6007  O O   . ILE G 1 75  ? 10.049  29.485  25.809  1.00 18.12  ? 75   ILE D O   1 
ATOM   6008  C CB  . ILE G 1 75  ? 10.720  28.958  28.941  1.00 7.14   ? 75   ILE D CB  1 
ATOM   6009  C CG1 . ILE G 1 75  ? 10.184  28.167  30.140  1.00 8.39   ? 75   ILE D CG1 1 
ATOM   6010  C CG2 . ILE G 1 75  ? 10.105  30.333  28.861  1.00 2.67   ? 75   ILE D CG2 1 
ATOM   6011  C CD1 . ILE G 1 75  ? 10.683  28.730  31.470  1.00 9.74   ? 75   ILE D CD1 1 
ATOM   6012  N N   . ALA G 1 76  ? 12.132  28.871  26.205  1.00 8.97   ? 76   ALA D N   1 
ATOM   6013  C CA  . ALA G 1 76  ? 12.654  29.570  25.070  1.00 6.89   ? 76   ALA D CA  1 
ATOM   6014  C C   . ALA G 1 76  ? 11.974  29.096  23.828  1.00 14.31  ? 76   ALA D C   1 
ATOM   6015  O O   . ALA G 1 76  ? 11.556  29.833  22.990  1.00 16.32  ? 76   ALA D O   1 
ATOM   6016  C CB  . ALA G 1 76  ? 14.155  29.337  24.947  1.00 7.25   ? 76   ALA D CB  1 
ATOM   6017  N N   . ASP G 1 77  ? 11.883  27.829  23.723  1.00 12.04  ? 77   ASP D N   1 
ATOM   6018  C CA  . ASP G 1 77  ? 11.275  27.234  22.576  1.00 8.15   ? 77   ASP D CA  1 
ATOM   6019  C C   . ASP G 1 77  ? 9.790   27.509  22.524  1.00 20.17  ? 77   ASP D C   1 
ATOM   6020  O O   . ASP G 1 77  ? 9.210   27.530  21.470  1.00 27.38  ? 77   ASP D O   1 
ATOM   6021  C CB  . ASP G 1 77  ? 11.539  25.725  22.594  1.00 1.30   ? 77   ASP D CB  1 
ATOM   6022  C CG  . ASP G 1 77  ? 12.690  25.376  21.691  1.00 15.64  ? 77   ASP D CG  1 
ATOM   6023  O OD1 . ASP G 1 77  ? 13.144  26.150  20.838  1.00 25.53  ? 77   ASP D OD1 1 
ATOM   6024  O OD2 . ASP G 1 77  ? 13.143  24.163  21.918  1.00 25.03  ? 77   ASP D OD2 1 
ATOM   6025  N N   . LYS G 1 78  ? 9.142   27.695  23.644  1.00 13.84  ? 78   LYS D N   1 
ATOM   6026  C CA  . LYS G 1 78  ? 7.740   28.032  23.550  1.00 8.75   ? 78   LYS D CA  1 
ATOM   6027  C C   . LYS G 1 78  ? 7.642   29.524  23.269  1.00 21.37  ? 78   LYS D C   1 
ATOM   6028  O O   . LYS G 1 78  ? 6.571   30.052  23.125  1.00 25.64  ? 78   LYS D O   1 
ATOM   6029  C CB  . LYS G 1 78  ? 6.972   27.862  24.878  1.00 6.78   ? 78   LYS D CB  1 
ATOM   6030  C CG  . LYS G 1 78  ? 6.877   26.441  25.320  1.00 40.33  ? 78   LYS D CG  1 
ATOM   6031  C CD  . LYS G 1 78  ? 6.427   25.558  24.178  1.00 42.81  ? 78   LYS D CD  1 
ATOM   6032  C CE  . LYS G 1 78  ? 4.906   25.505  23.988  1.00 47.35  ? 78   LYS D CE  1 
ATOM   6033  N NZ  . LYS G 1 78  ? 4.480   24.885  22.713  1.00 69.76  ? 78   LYS D NZ  1 
ATOM   6034  N N   . HIS G 1 79  ? 8.713   30.280  23.331  1.00 16.29  ? 79   HIS D N   1 
ATOM   6035  C CA  . HIS G 1 79  ? 8.464   31.686  23.154  1.00 10.72  ? 79   HIS D CA  1 
ATOM   6036  C C   . HIS G 1 79  ? 9.363   32.420  22.223  1.00 14.66  ? 79   HIS D C   1 
ATOM   6037  O O   . HIS G 1 79  ? 9.668   33.573  22.498  1.00 6.93   ? 79   HIS D O   1 
ATOM   6038  C CB  . HIS G 1 79  ? 8.548   32.413  24.455  1.00 10.30  ? 79   HIS D CB  1 
ATOM   6039  C CG  . HIS G 1 79  ? 7.396   32.104  25.300  1.00 20.66  ? 79   HIS D CG  1 
ATOM   6040  N ND1 . HIS G 1 79  ? 7.466   31.128  26.266  1.00 29.24  ? 79   HIS D ND1 1 
ATOM   6041  C CD2 . HIS G 1 79  ? 6.164   32.654  25.355  1.00 21.04  ? 79   HIS D CD2 1 
ATOM   6042  C CE1 . HIS G 1 79  ? 6.285   31.098  26.901  1.00 23.80  ? 79   HIS D CE1 1 
ATOM   6043  N NE2 . HIS G 1 79  ? 5.500   32.006  26.370  1.00 19.97  ? 79   HIS D NE2 1 
ATOM   6044  N N   . ASN G 1 80  ? 9.805   31.758  21.168  1.00 17.51  ? 80   ASN D N   1 
ATOM   6045  C CA  . ASN G 1 80  ? 10.690  32.431  20.271  1.00 17.97  ? 80   ASN D CA  1 
ATOM   6046  C C   . ASN G 1 80  ? 11.928  33.052  20.877  1.00 23.47  ? 80   ASN D C   1 
ATOM   6047  O O   . ASN G 1 80  ? 12.371  34.130  20.452  1.00 33.09  ? 80   ASN D O   1 
ATOM   6048  C CB  . ASN G 1 80  ? 9.930   33.479  19.479  1.00 22.81  ? 80   ASN D CB  1 
ATOM   6049  C CG  . ASN G 1 80  ? 10.653  33.937  18.253  1.00 56.00  ? 80   ASN D CG  1 
ATOM   6050  O OD1 . ASN G 1 80  ? 10.745  35.152  18.053  1.00 61.63  ? 80   ASN D OD1 1 
ATOM   6051  N ND2 . ASN G 1 80  ? 11.080  32.982  17.413  1.00 50.44  ? 80   ASN D ND2 1 
ATOM   6052  N N   . LEU G 1 81  ? 12.521  32.379  21.841  1.00 17.49  ? 81   LEU D N   1 
ATOM   6053  C CA  . LEU G 1 81  ? 13.739  32.931  22.399  1.00 12.09  ? 81   LEU D CA  1 
ATOM   6054  C C   . LEU G 1 81  ? 14.891  32.028  22.066  1.00 9.79   ? 81   LEU D C   1 
ATOM   6055  O O   . LEU G 1 81  ? 15.944  32.156  22.659  1.00 9.64   ? 81   LEU D O   1 
ATOM   6056  C CB  . LEU G 1 81  ? 13.685  33.116  23.896  1.00 6.52   ? 81   LEU D CB  1 
ATOM   6057  C CG  . LEU G 1 81  ? 12.558  34.015  24.300  1.00 4.24   ? 81   LEU D CG  1 
ATOM   6058  C CD1 . LEU G 1 81  ? 12.336  33.855  25.820  1.00 2.56   ? 81   LEU D CD1 1 
ATOM   6059  C CD2 . LEU G 1 81  ? 13.067  35.412  24.131  1.00 1.00   ? 81   LEU D CD2 1 
ATOM   6060  N N   . PHE G 1 82  ? 14.679  31.143  21.108  1.00 7.16   ? 82   PHE D N   1 
ATOM   6061  C CA  . PHE G 1 82  ? 15.720  30.147  20.744  1.00 7.97   ? 82   PHE D CA  1 
ATOM   6062  C C   . PHE G 1 82  ? 16.195  30.174  19.306  1.00 16.81  ? 82   PHE D C   1 
ATOM   6063  O O   . PHE G 1 82  ? 16.648  29.167  18.739  1.00 19.23  ? 82   PHE D O   1 
ATOM   6064  C CB  . PHE G 1 82  ? 15.324  28.708  21.106  1.00 4.68   ? 82   PHE D CB  1 
ATOM   6065  C CG  . PHE G 1 82  ? 16.394  27.960  21.834  1.00 9.05   ? 82   PHE D CG  1 
ATOM   6066  C CD1 . PHE G 1 82  ? 17.753  28.167  21.554  1.00 15.06  ? 82   PHE D CD1 1 
ATOM   6067  C CD2 . PHE G 1 82  ? 16.049  27.015  22.802  1.00 10.50  ? 82   PHE D CD2 1 
ATOM   6068  C CE1 . PHE G 1 82  ? 18.783  27.462  22.182  1.00 9.59   ? 82   PHE D CE1 1 
ATOM   6069  C CE2 . PHE G 1 82  ? 17.060  26.286  23.426  1.00 11.51  ? 82   PHE D CE2 1 
ATOM   6070  C CZ  . PHE G 1 82  ? 18.414  26.507  23.131  1.00 7.34   ? 82   PHE D CZ  1 
ATOM   6071  N N   . GLY G 1 83  ? 16.100  31.348  18.712  1.00 16.51  ? 83   GLY D N   1 
ATOM   6072  C CA  . GLY G 1 83  ? 16.555  31.463  17.360  1.00 18.16  ? 83   GLY D CA  1 
ATOM   6073  C C   . GLY G 1 83  ? 15.498  31.062  16.368  1.00 19.47  ? 83   GLY D C   1 
ATOM   6074  O O   . GLY G 1 83  ? 14.357  30.839  16.761  1.00 16.68  ? 83   GLY D O   1 
ATOM   6075  N N   . LYS G 1 84  ? 15.927  30.973  15.110  1.00 16.34  ? 84   LYS D N   1 
ATOM   6076  C CA  . LYS G 1 84  ? 15.076  30.658  13.975  1.00 15.03  ? 84   LYS D CA  1 
ATOM   6077  C C   . LYS G 1 84  ? 15.655  29.528  13.162  1.00 25.33  ? 84   LYS D C   1 
ATOM   6078  O O   . LYS G 1 84  ? 15.039  28.989  12.264  1.00 23.09  ? 84   LYS D O   1 
ATOM   6079  C CB  . LYS G 1 84  ? 14.657  31.903  13.175  1.00 10.79  ? 84   LYS D CB  1 
ATOM   6080  C CG  . LYS G 1 84  ? 13.771  32.742  14.109  1.00 32.78  ? 84   LYS D CG  1 
ATOM   6081  C CD  . LYS G 1 84  ? 12.915  33.841  13.485  1.00 30.09  ? 84   LYS D CD  1 
ATOM   6082  C CE  . LYS G 1 84  ? 11.620  34.191  14.242  1.00 51.57  ? 84   LYS D CE  1 
ATOM   6083  N NZ  . LYS G 1 84  ? 10.992  35.461  13.783  1.00 126.63 ? 84   LYS D NZ  1 
ATOM   6084  N N   . ASN G 1 85  ? 16.809  29.056  13.594  1.00 25.00  ? 85   ASN D N   1 
ATOM   6085  C CA  . ASN G 1 85  ? 17.394  27.931  12.919  1.00 19.70  ? 85   ASN D CA  1 
ATOM   6086  C C   . ASN G 1 85  ? 18.538  27.296  13.710  1.00 22.04  ? 85   ASN D C   1 
ATOM   6087  O O   . ASN G 1 85  ? 19.058  27.897  14.650  1.00 31.75  ? 85   ASN D O   1 
ATOM   6088  C CB  . ASN G 1 85  ? 17.786  28.371  11.504  1.00 10.80  ? 85   ASN D CB  1 
ATOM   6089  C CG  . ASN G 1 85  ? 19.003  29.252  11.514  1.00 18.33  ? 85   ASN D CG  1 
ATOM   6090  O OD1 . ASN G 1 85  ? 20.070  28.901  12.036  1.00 71.35  ? 85   ASN D OD1 1 
ATOM   6091  N ND2 . ASN G 1 85  ? 18.788  30.460  11.106  1.00 19.54  ? 85   ASN D ND2 1 
ATOM   6092  N N   . LEU G 1 86  ? 18.980  26.110  13.279  1.00 13.64  ? 86   LEU D N   1 
ATOM   6093  C CA  . LEU G 1 86  ? 20.045  25.388  13.956  1.00 7.94   ? 86   LEU D CA  1 
ATOM   6094  C C   . LEU G 1 86  ? 21.260  26.221  14.262  1.00 14.84  ? 86   LEU D C   1 
ATOM   6095  O O   . LEU G 1 86  ? 21.842  26.161  15.354  1.00 20.25  ? 86   LEU D O   1 
ATOM   6096  C CB  . LEU G 1 86  ? 20.484  24.140  13.196  1.00 4.53   ? 86   LEU D CB  1 
ATOM   6097  C CG  . LEU G 1 86  ? 21.329  23.209  14.048  1.00 10.05  ? 86   LEU D CG  1 
ATOM   6098  C CD1 . LEU G 1 86  ? 20.656  23.001  15.370  1.00 13.10  ? 86   LEU D CD1 1 
ATOM   6099  C CD2 . LEU G 1 86  ? 21.407  21.844  13.436  1.00 8.38   ? 86   LEU D CD2 1 
ATOM   6100  N N   . LYS G 1 87  ? 21.631  27.003  13.273  1.00 12.86  ? 87   LYS D N   1 
ATOM   6101  C CA  . LYS G 1 87  ? 22.814  27.837  13.403  1.00 16.47  ? 87   LYS D CA  1 
ATOM   6102  C C   . LYS G 1 87  ? 22.738  28.758  14.566  1.00 17.63  ? 87   LYS D C   1 
ATOM   6103  O O   . LYS G 1 87  ? 23.649  28.797  15.371  1.00 27.41  ? 87   LYS D O   1 
ATOM   6104  C CB  . LYS G 1 87  ? 23.301  28.450  12.096  1.00 18.47  ? 87   LYS D CB  1 
ATOM   6105  C CG  . LYS G 1 87  ? 23.522  27.337  11.054  1.00 136.90 ? 87   LYS D CG  1 
ATOM   6106  C CD  . LYS G 1 87  ? 24.143  26.035  11.622  1.00 174.68 ? 87   LYS D CD  1 
ATOM   6107  C CE  . LYS G 1 87  ? 24.068  24.800  10.694  1.00 151.33 ? 87   LYS D CE  1 
ATOM   6108  N NZ  . LYS G 1 87  ? 24.854  23.604  11.119  1.00 58.97  ? 87   LYS D NZ  1 
ATOM   6109  N N   . GLU G 1 88  ? 21.619  29.435  14.623  1.00 8.70   ? 88   GLU D N   1 
ATOM   6110  C CA  . GLU G 1 88  ? 21.303  30.356  15.675  1.00 11.62  ? 88   GLU D CA  1 
ATOM   6111  C C   . GLU G 1 88  ? 21.202  29.661  16.990  1.00 18.30  ? 88   GLU D C   1 
ATOM   6112  O O   . GLU G 1 88  ? 21.810  30.045  17.983  1.00 23.26  ? 88   GLU D O   1 
ATOM   6113  C CB  . GLU G 1 88  ? 19.938  31.010  15.387  1.00 14.39  ? 88   GLU D CB  1 
ATOM   6114  C CG  . GLU G 1 88  ? 20.027  31.968  14.183  1.00 5.07   ? 88   GLU D CG  1 
ATOM   6115  C CD  . GLU G 1 88  ? 18.836  32.846  13.837  1.00 21.29  ? 88   GLU D CD  1 
ATOM   6116  O OE1 . GLU G 1 88  ? 17.781  33.019  14.509  1.00 20.61  ? 88   GLU D OE1 1 
ATOM   6117  O OE2 . GLU G 1 88  ? 19.174  33.578  12.790  1.00 24.75  ? 88   GLU D OE2 1 
ATOM   6118  N N   . ARG G 1 89  ? 20.354  28.669  16.978  1.00 10.56  ? 89   ARG D N   1 
ATOM   6119  C CA  . ARG G 1 89  ? 20.091  27.869  18.132  1.00 9.51   ? 89   ARG D CA  1 
ATOM   6120  C C   . ARG G 1 89  ? 21.395  27.407  18.714  1.00 9.97   ? 89   ARG D C   1 
ATOM   6121  O O   . ARG G 1 89  ? 21.687  27.478  19.915  1.00 10.78  ? 89   ARG D O   1 
ATOM   6122  C CB  . ARG G 1 89  ? 19.415  26.645  17.651  1.00 3.43   ? 89   ARG D CB  1 
ATOM   6123  C CG  . ARG G 1 89  ? 18.783  26.010  18.833  1.00 18.27  ? 89   ARG D CG  1 
ATOM   6124  C CD  . ARG G 1 89  ? 17.904  24.848  18.413  1.00 6.77   ? 89   ARG D CD  1 
ATOM   6125  N NE  . ARG G 1 89  ? 17.350  24.199  19.547  1.00 16.25  ? 89   ARG D NE  1 
ATOM   6126  C CZ  . ARG G 1 89  ? 16.164  24.424  20.060  1.00 15.11  ? 89   ARG D CZ  1 
ATOM   6127  N NH1 . ARG G 1 89  ? 15.307  25.280  19.501  1.00 14.64  ? 89   ARG D NH1 1 
ATOM   6128  N NH2 . ARG G 1 89  ? 15.864  23.755  21.188  1.00 33.37  ? 89   ARG D NH2 1 
ATOM   6129  N N   . THR G 1 90  ? 22.256  27.014  17.808  1.00 1.00   ? 90   THR D N   1 
ATOM   6130  C CA  . THR G 1 90  ? 23.577  26.570  18.275  1.00 1.00   ? 90   THR D CA  1 
ATOM   6131  C C   . THR G 1 90  ? 24.384  27.644  19.039  1.00 12.66  ? 90   THR D C   1 
ATOM   6132  O O   . THR G 1 90  ? 24.954  27.409  20.116  1.00 12.11  ? 90   THR D O   1 
ATOM   6133  C CB  . THR G 1 90  ? 24.335  25.926  17.131  1.00 11.57  ? 90   THR D CB  1 
ATOM   6134  O OG1 . THR G 1 90  ? 23.590  24.883  16.528  1.00 20.47  ? 90   THR D OG1 1 
ATOM   6135  C CG2 . THR G 1 90  ? 25.627  25.424  17.647  1.00 1.00   ? 90   THR D CG2 1 
ATOM   6136  N N   . LEU G 1 91  ? 24.354  28.876  18.510  1.00 5.25   ? 91   LEU D N   1 
ATOM   6137  C CA  . LEU G 1 91  ? 25.047  29.981  19.121  1.00 1.00   ? 91   LEU D CA  1 
ATOM   6138  C C   . LEU G 1 91  ? 24.482  30.341  20.452  1.00 9.46   ? 91   LEU D C   1 
ATOM   6139  O O   . LEU G 1 91  ? 25.190  30.520  21.430  1.00 13.34  ? 91   LEU D O   1 
ATOM   6140  C CB  . LEU G 1 91  ? 24.917  31.172  18.200  1.00 2.65   ? 91   LEU D CB  1 
ATOM   6141  C CG  . LEU G 1 91  ? 25.738  30.937  16.934  1.00 6.82   ? 91   LEU D CG  1 
ATOM   6142  C CD1 . LEU G 1 91  ? 25.504  32.008  15.924  1.00 2.85   ? 91   LEU D CD1 1 
ATOM   6143  C CD2 . LEU G 1 91  ? 27.201  31.035  17.231  1.00 1.00   ? 91   LEU D CD2 1 
ATOM   6144  N N   . ILE G 1 92  ? 23.180  30.441  20.462  1.00 6.98   ? 92   ILE D N   1 
ATOM   6145  C CA  . ILE G 1 92  ? 22.460  30.809  21.650  1.00 5.61   ? 92   ILE D CA  1 
ATOM   6146  C C   . ILE G 1 92  ? 22.766  29.821  22.725  1.00 12.34  ? 92   ILE D C   1 
ATOM   6147  O O   . ILE G 1 92  ? 23.014  30.179  23.869  1.00 16.34  ? 92   ILE D O   1 
ATOM   6148  C CB  . ILE G 1 92  ? 20.993  30.773  21.288  1.00 9.15   ? 92   ILE D CB  1 
ATOM   6149  C CG1 . ILE G 1 92  ? 20.756  31.873  20.274  1.00 9.09   ? 92   ILE D CG1 1 
ATOM   6150  C CG2 . ILE G 1 92  ? 20.070  30.913  22.485  1.00 4.91   ? 92   ILE D CG2 1 
ATOM   6151  C CD1 . ILE G 1 92  ? 19.308  32.097  19.932  1.00 7.16   ? 92   ILE D CD1 1 
ATOM   6152  N N   . ASP G 1 93  ? 22.794  28.559  22.325  1.00 5.23   ? 93   ASP D N   1 
ATOM   6153  C CA  . ASP G 1 93  ? 23.071  27.520  23.291  1.00 3.41   ? 93   ASP D CA  1 
ATOM   6154  C C   . ASP G 1 93  ? 24.440  27.690  23.944  1.00 13.46  ? 93   ASP D C   1 
ATOM   6155  O O   . ASP G 1 93  ? 24.596  27.782  25.183  1.00 8.81   ? 93   ASP D O   1 
ATOM   6156  C CB  . ASP G 1 93  ? 22.907  26.183  22.585  1.00 3.72   ? 93   ASP D CB  1 
ATOM   6157  C CG  . ASP G 1 93  ? 22.962  24.906  23.423  1.00 15.82  ? 93   ASP D CG  1 
ATOM   6158  O OD1 . ASP G 1 93  ? 23.174  24.885  24.609  1.00 13.84  ? 93   ASP D OD1 1 
ATOM   6159  O OD2 . ASP G 1 93  ? 22.706  23.826  22.705  1.00 24.47  ? 93   ASP D OD2 1 
ATOM   6160  N N   . MET G 1 94  ? 25.427  27.832  23.089  1.00 7.44   ? 94   MET D N   1 
ATOM   6161  C CA  . MET G 1 94  ? 26.730  28.018  23.622  1.00 1.95   ? 94   MET D CA  1 
ATOM   6162  C C   . MET G 1 94  ? 26.866  29.212  24.488  1.00 4.64   ? 94   MET D C   1 
ATOM   6163  O O   . MET G 1 94  ? 27.519  29.170  25.528  1.00 7.26   ? 94   MET D O   1 
ATOM   6164  C CB  . MET G 1 94  ? 27.679  28.158  22.486  1.00 4.75   ? 94   MET D CB  1 
ATOM   6165  C CG  . MET G 1 94  ? 27.856  26.869  21.666  1.00 9.41   ? 94   MET D CG  1 
ATOM   6166  S SD  . MET G 1 94  ? 29.070  27.114  20.282  1.00 14.86  ? 94   MET D SD  1 
ATOM   6167  C CE  . MET G 1 94  ? 30.297  26.209  21.227  1.00 13.63  ? 94   MET D CE  1 
ATOM   6168  N N   . TYR G 1 95  ? 26.259  30.298  24.050  1.00 3.29   ? 95   TYR D N   1 
ATOM   6169  C CA  . TYR G 1 95  ? 26.404  31.523  24.799  1.00 1.00   ? 95   TYR D CA  1 
ATOM   6170  C C   . TYR G 1 95  ? 25.840  31.336  26.157  1.00 6.98   ? 95   TYR D C   1 
ATOM   6171  O O   . TYR G 1 95  ? 26.376  31.699  27.190  1.00 7.33   ? 95   TYR D O   1 
ATOM   6172  C CB  . TYR G 1 95  ? 25.621  32.655  24.149  1.00 2.91   ? 95   TYR D CB  1 
ATOM   6173  C CG  . TYR G 1 95  ? 26.220  32.993  22.810  1.00 8.52   ? 95   TYR D CG  1 
ATOM   6174  C CD1 . TYR G 1 95  ? 27.469  32.469  22.492  1.00 4.73   ? 95   TYR D CD1 1 
ATOM   6175  C CD2 . TYR G 1 95  ? 25.604  33.849  21.878  1.00 10.51  ? 95   TYR D CD2 1 
ATOM   6176  C CE1 . TYR G 1 95  ? 28.039  32.765  21.251  1.00 6.52   ? 95   TYR D CE1 1 
ATOM   6177  C CE2 . TYR G 1 95  ? 26.178  34.177  20.640  1.00 4.52   ? 95   TYR D CE2 1 
ATOM   6178  C CZ  . TYR G 1 95  ? 27.411  33.605  20.323  1.00 16.64  ? 95   TYR D CZ  1 
ATOM   6179  O OH  . TYR G 1 95  ? 28.029  33.845  19.112  1.00 17.95  ? 95   TYR D OH  1 
ATOM   6180  N N   . VAL G 1 96  ? 24.711  30.734  26.127  1.00 4.16   ? 96   VAL D N   1 
ATOM   6181  C CA  . VAL G 1 96  ? 24.057  30.479  27.367  1.00 2.88   ? 96   VAL D CA  1 
ATOM   6182  C C   . VAL G 1 96  ? 24.860  29.605  28.291  1.00 6.46   ? 96   VAL D C   1 
ATOM   6183  O O   . VAL G 1 96  ? 24.999  29.902  29.464  1.00 6.51   ? 96   VAL D O   1 
ATOM   6184  C CB  . VAL G 1 96  ? 22.760  29.810  27.089  1.00 3.29   ? 96   VAL D CB  1 
ATOM   6185  C CG1 . VAL G 1 96  ? 22.230  29.384  28.412  1.00 1.56   ? 96   VAL D CG1 1 
ATOM   6186  C CG2 . VAL G 1 96  ? 21.802  30.812  26.512  1.00 4.65   ? 96   VAL D CG2 1 
ATOM   6187  N N   . GLU G 1 97  ? 25.372  28.488  27.789  1.00 1.62   ? 97   GLU D N   1 
ATOM   6188  C CA  . GLU G 1 97  ? 26.151  27.638  28.694  1.00 2.81   ? 97   GLU D CA  1 
ATOM   6189  C C   . GLU G 1 97  ? 27.360  28.348  29.252  1.00 9.85   ? 97   GLU D C   1 
ATOM   6190  O O   . GLU G 1 97  ? 27.674  28.254  30.447  1.00 10.22  ? 97   GLU D O   1 
ATOM   6191  C CB  . GLU G 1 97  ? 26.580  26.322  28.068  1.00 6.17   ? 97   GLU D CB  1 
ATOM   6192  C CG  . GLU G 1 97  ? 25.397  25.521  27.537  1.00 3.05   ? 97   GLU D CG  1 
ATOM   6193  C CD  . GLU G 1 97  ? 24.536  24.982  28.676  1.00 17.39  ? 97   GLU D CD  1 
ATOM   6194  O OE1 . GLU G 1 97  ? 25.022  24.681  29.738  1.00 7.10   ? 97   GLU D OE1 1 
ATOM   6195  O OE2 . GLU G 1 97  ? 23.257  24.744  28.352  1.00 19.34  ? 97   GLU D OE2 1 
ATOM   6196  N N   . GLY G 1 98  ? 28.037  29.071  28.385  1.00 7.21   ? 98   GLY D N   1 
ATOM   6197  C CA  . GLY G 1 98  ? 29.207  29.801  28.853  1.00 2.67   ? 98   GLY D CA  1 
ATOM   6198  C C   . GLY G 1 98  ? 28.797  30.763  29.928  1.00 3.56   ? 98   GLY D C   1 
ATOM   6199  O O   . GLY G 1 98  ? 29.361  30.831  31.009  1.00 5.22   ? 98   GLY D O   1 
ATOM   6200  N N   . THR G 1 99  ? 27.740  31.478  29.652  1.00 2.16   ? 99   THR D N   1 
ATOM   6201  C CA  . THR G 1 99  ? 27.251  32.441  30.632  1.00 2.83   ? 99   THR D CA  1 
ATOM   6202  C C   . THR G 1 99  ? 26.877  31.827  31.968  1.00 12.76  ? 99   THR D C   1 
ATOM   6203  O O   . THR G 1 99  ? 27.299  32.322  33.014  1.00 12.87  ? 99   THR D O   1 
ATOM   6204  C CB  . THR G 1 99  ? 26.123  33.280  30.072  1.00 7.66   ? 99   THR D CB  1 
ATOM   6205  O OG1 . THR G 1 99  ? 26.465  33.717  28.758  1.00 6.21   ? 99   THR D OG1 1 
ATOM   6206  C CG2 . THR G 1 99  ? 25.849  34.424  31.031  1.00 2.99   ? 99   THR D CG2 1 
ATOM   6207  N N   . LEU G 1 100 ? 26.155  30.704  31.933  1.00 6.88   ? 100  LEU D N   1 
ATOM   6208  C CA  . LEU G 1 100 ? 25.812  29.979  33.169  1.00 3.94   ? 100  LEU D CA  1 
ATOM   6209  C C   . LEU G 1 100 ? 27.058  29.583  33.963  1.00 8.49   ? 100  LEU D C   1 
ATOM   6210  O O   . LEU G 1 100 ? 27.078  29.482  35.208  1.00 13.34  ? 100  LEU D O   1 
ATOM   6211  C CB  . LEU G 1 100 ? 25.005  28.739  32.831  1.00 4.11   ? 100  LEU D CB  1 
ATOM   6212  C CG  . LEU G 1 100 ? 23.577  29.041  32.343  1.00 8.88   ? 100  LEU D CG  1 
ATOM   6213  C CD1 . LEU G 1 100 ? 22.815  27.730  32.208  1.00 2.21   ? 100  LEU D CD1 1 
ATOM   6214  C CD2 . LEU G 1 100 ? 22.863  29.887  33.412  1.00 1.00   ? 100  LEU D CD2 1 
ATOM   6215  N N   . ASP G 1 101 ? 28.141  29.394  33.255  1.00 1.00   ? 101  ASP D N   1 
ATOM   6216  C CA  . ASP G 1 101 ? 29.345  29.083  33.986  1.00 2.36   ? 101  ASP D CA  1 
ATOM   6217  C C   . ASP G 1 101 ? 29.872  30.260  34.784  1.00 8.45   ? 101  ASP D C   1 
ATOM   6218  O O   . ASP G 1 101 ? 30.533  30.135  35.789  1.00 12.15  ? 101  ASP D O   1 
ATOM   6219  C CB  . ASP G 1 101 ? 30.432  28.639  33.033  1.00 1.77   ? 101  ASP D CB  1 
ATOM   6220  C CG  . ASP G 1 101 ? 30.332  27.211  32.533  1.00 3.77   ? 101  ASP D CG  1 
ATOM   6221  O OD1 . ASP G 1 101 ? 29.462  26.432  32.890  1.00 14.68  ? 101  ASP D OD1 1 
ATOM   6222  O OD2 . ASP G 1 101 ? 31.143  27.020  31.515  1.00 33.03  ? 101  ASP D OD2 1 
ATOM   6223  N N   . LEU G 1 102 ? 29.589  31.422  34.307  1.00 8.68   ? 102  LEU D N   1 
ATOM   6224  C CA  . LEU G 1 102 ? 29.993  32.625  34.970  1.00 4.32   ? 102  LEU D CA  1 
ATOM   6225  C C   . LEU G 1 102 ? 29.049  32.903  36.098  1.00 10.80  ? 102  LEU D C   1 
ATOM   6226  O O   . LEU G 1 102 ? 29.428  33.155  37.217  1.00 14.15  ? 102  LEU D O   1 
ATOM   6227  C CB  . LEU G 1 102 ? 29.884  33.756  33.952  1.00 3.76   ? 102  LEU D CB  1 
ATOM   6228  C CG  . LEU G 1 102 ? 30.313  35.164  34.429  1.00 10.55  ? 102  LEU D CG  1 
ATOM   6229  C CD1 . LEU G 1 102 ? 31.635  35.240  35.168  1.00 3.28   ? 102  LEU D CD1 1 
ATOM   6230  C CD2 . LEU G 1 102 ? 30.347  36.134  33.262  1.00 8.71   ? 102  LEU D CD2 1 
ATOM   6231  N N   . LEU G 1 103 ? 27.785  32.822  35.793  1.00 6.51   ? 103  LEU D N   1 
ATOM   6232  C CA  . LEU G 1 103 ? 26.761  33.024  36.773  1.00 1.50   ? 103  LEU D CA  1 
ATOM   6233  C C   . LEU G 1 103 ? 26.910  32.135  37.978  1.00 3.09   ? 103  LEU D C   1 
ATOM   6234  O O   . LEU G 1 103 ? 26.562  32.475  39.091  1.00 11.31  ? 103  LEU D O   1 
ATOM   6235  C CB  . LEU G 1 103 ? 25.449  32.703  36.119  1.00 1.77   ? 103  LEU D CB  1 
ATOM   6236  C CG  . LEU G 1 103 ? 24.226  32.969  37.000  1.00 6.67   ? 103  LEU D CG  1 
ATOM   6237  C CD1 . LEU G 1 103 ? 24.067  34.444  37.335  1.00 1.00   ? 103  LEU D CD1 1 
ATOM   6238  C CD2 . LEU G 1 103 ? 23.017  32.597  36.163  1.00 5.13   ? 103  LEU D CD2 1 
ATOM   6239  N N   . GLU G 1 104 ? 27.443  30.976  37.770  1.00 3.47   ? 104  GLU D N   1 
ATOM   6240  C CA  . GLU G 1 104 ? 27.638  30.050  38.858  1.00 3.16   ? 104  GLU D CA  1 
ATOM   6241  C C   . GLU G 1 104 ? 28.419  30.618  39.997  1.00 10.60  ? 104  GLU D C   1 
ATOM   6242  O O   . GLU G 1 104 ? 28.151  30.400  41.150  1.00 15.54  ? 104  GLU D O   1 
ATOM   6243  C CB  . GLU G 1 104 ? 28.392  28.867  38.328  1.00 4.44   ? 104  GLU D CB  1 
ATOM   6244  C CG  . GLU G 1 104 ? 28.335  27.713  39.302  1.00 1.00   ? 104  GLU D CG  1 
ATOM   6245  C CD  . GLU G 1 104 ? 26.962  27.157  39.556  1.00 11.35  ? 104  GLU D CD  1 
ATOM   6246  O OE1 . GLU G 1 104 ? 25.978  27.445  38.864  1.00 33.25  ? 104  GLU D OE1 1 
ATOM   6247  O OE2 . GLU G 1 104 ? 26.986  26.291  40.560  1.00 12.49  ? 104  GLU D OE2 1 
ATOM   6248  N N   . LEU G 1 105 ? 29.386  31.390  39.660  1.00 7.71   ? 105  LEU D N   1 
ATOM   6249  C CA  . LEU G 1 105 ? 30.159  32.055  40.678  1.00 2.89   ? 105  LEU D CA  1 
ATOM   6250  C C   . LEU G 1 105 ? 29.278  32.884  41.607  1.00 9.81   ? 105  LEU D C   1 
ATOM   6251  O O   . LEU G 1 105 ? 29.453  32.973  42.835  1.00 13.77  ? 105  LEU D O   1 
ATOM   6252  C CB  . LEU G 1 105 ? 31.150  33.007  39.996  1.00 3.27   ? 105  LEU D CB  1 
ATOM   6253  C CG  . LEU G 1 105 ? 32.154  32.317  39.057  1.00 6.52   ? 105  LEU D CG  1 
ATOM   6254  C CD1 . LEU G 1 105 ? 33.320  33.204  38.628  1.00 4.87   ? 105  LEU D CD1 1 
ATOM   6255  C CD2 . LEU G 1 105 ? 32.665  31.058  39.672  1.00 1.00   ? 105  LEU D CD2 1 
ATOM   6256  N N   . LEU G 1 106 ? 28.327  33.519  40.989  1.00 7.80   ? 106  LEU D N   1 
ATOM   6257  C CA  . LEU G 1 106 ? 27.416  34.330  41.770  1.00 6.10   ? 106  LEU D CA  1 
ATOM   6258  C C   . LEU G 1 106 ? 26.540  33.444  42.649  1.00 14.47  ? 106  LEU D C   1 
ATOM   6259  O O   . LEU G 1 106 ? 26.298  33.757  43.842  1.00 13.94  ? 106  LEU D O   1 
ATOM   6260  C CB  . LEU G 1 106 ? 26.487  35.066  40.833  1.00 1.05   ? 106  LEU D CB  1 
ATOM   6261  C CG  . LEU G 1 106 ? 26.908  36.459  40.360  1.00 1.18   ? 106  LEU D CG  1 
ATOM   6262  C CD1 . LEU G 1 106 ? 27.530  37.283  41.475  1.00 1.00   ? 106  LEU D CD1 1 
ATOM   6263  C CD2 . LEU G 1 106 ? 27.803  36.338  39.170  1.00 6.50   ? 106  LEU D CD2 1 
ATOM   6264  N N   . ILE G 1 107 ? 26.041  32.347  42.033  1.00 5.24   ? 107  ILE D N   1 
ATOM   6265  C CA  . ILE G 1 107 ? 25.208  31.351  42.747  1.00 4.29   ? 107  ILE D CA  1 
ATOM   6266  C C   . ILE G 1 107 ? 25.848  30.719  43.966  1.00 16.36  ? 107  ILE D C   1 
ATOM   6267  O O   . ILE G 1 107 ? 25.169  30.573  45.014  1.00 26.57  ? 107  ILE D O   1 
ATOM   6268  C CB  . ILE G 1 107 ? 24.700  30.265  41.862  1.00 7.23   ? 107  ILE D CB  1 
ATOM   6269  C CG1 . ILE G 1 107 ? 23.807  30.960  40.883  1.00 2.25   ? 107  ILE D CG1 1 
ATOM   6270  C CG2 . ILE G 1 107 ? 23.964  29.171  42.633  1.00 6.37   ? 107  ILE D CG2 1 
ATOM   6271  C CD1 . ILE G 1 107 ? 23.361  30.042  39.830  1.00 1.00   ? 107  ILE D CD1 1 
ATOM   6272  N N   . MET G 1 108 ? 27.130  30.368  43.808  1.00 6.24   ? 108  MET D N   1 
ATOM   6273  C CA  . MET G 1 108 ? 27.873  29.795  44.908  1.00 11.25  ? 108  MET D CA  1 
ATOM   6274  C C   . MET G 1 108 ? 28.287  30.770  45.979  1.00 14.93  ? 108  MET D C   1 
ATOM   6275  O O   . MET G 1 108 ? 28.511  30.398  47.105  1.00 18.42  ? 108  MET D O   1 
ATOM   6276  C CB  . MET G 1 108 ? 29.168  29.109  44.489  1.00 16.55  ? 108  MET D CB  1 
ATOM   6277  C CG  . MET G 1 108 ? 29.049  28.163  43.292  1.00 34.20  ? 108  MET D CG  1 
ATOM   6278  S SD  . MET G 1 108 ? 30.637  27.559  42.530  1.00 42.91  ? 108  MET D SD  1 
ATOM   6279  C CE  . MET G 1 108 ? 31.814  28.918  42.939  1.00 38.79  ? 108  MET D CE  1 
ATOM   6280  N N   . HIS G 1 109 ? 28.492  31.997  45.591  1.00 12.04  ? 109  HIS D N   1 
ATOM   6281  C CA  . HIS G 1 109 ? 29.010  33.015  46.442  1.00 8.78   ? 109  HIS D CA  1 
ATOM   6282  C C   . HIS G 1 109 ? 28.601  33.056  47.882  1.00 13.15  ? 109  HIS D C   1 
ATOM   6283  O O   . HIS G 1 109 ? 29.409  32.987  48.764  1.00 19.76  ? 109  HIS D O   1 
ATOM   6284  C CB  . HIS G 1 109 ? 28.811  34.365  45.817  1.00 13.77  ? 109  HIS D CB  1 
ATOM   6285  C CG  . HIS G 1 109 ? 29.830  35.287  46.389  1.00 19.62  ? 109  HIS D CG  1 
ATOM   6286  N ND1 . HIS G 1 109 ? 29.466  36.329  47.228  1.00 21.17  ? 109  HIS D ND1 1 
ATOM   6287  C CD2 . HIS G 1 109 ? 31.195  35.266  46.257  1.00 19.59  ? 109  HIS D CD2 1 
ATOM   6288  C CE1 . HIS G 1 109 ? 30.622  36.933  47.550  1.00 19.93  ? 109  HIS D CE1 1 
ATOM   6289  N NE2 . HIS G 1 109 ? 31.672  36.300  47.010  1.00 19.10  ? 109  HIS D NE2 1 
ATOM   6290  N N   . PRO G 1 110 ? 27.338  33.179  48.131  1.00 12.54  ? 110  PRO D N   1 
ATOM   6291  C CA  . PRO G 1 110 ? 26.822  33.234  49.491  1.00 9.73   ? 110  PRO D CA  1 
ATOM   6292  C C   . PRO G 1 110 ? 27.131  32.047  50.348  1.00 21.00  ? 110  PRO D C   1 
ATOM   6293  O O   . PRO G 1 110 ? 27.073  32.108  51.571  1.00 31.35  ? 110  PRO D O   1 
ATOM   6294  C CB  . PRO G 1 110 ? 25.308  33.304  49.385  1.00 7.40   ? 110  PRO D CB  1 
ATOM   6295  C CG  . PRO G 1 110 ? 24.975  33.409  47.920  1.00 3.83   ? 110  PRO D CG  1 
ATOM   6296  C CD  . PRO G 1 110 ? 26.246  33.145  47.114  1.00 9.25   ? 110  PRO D CD  1 
ATOM   6297  N N   . PHE G 1 111 ? 27.464  30.942  49.758  1.00 15.41  ? 111  PHE D N   1 
ATOM   6298  C CA  . PHE G 1 111 ? 27.751  29.798  50.599  1.00 9.17   ? 111  PHE D CA  1 
ATOM   6299  C C   . PHE G 1 111 ? 29.226  29.569  50.888  1.00 23.69  ? 111  PHE D C   1 
ATOM   6300  O O   . PHE G 1 111 ? 29.623  28.506  51.364  1.00 30.42  ? 111  PHE D O   1 
ATOM   6301  C CB  . PHE G 1 111 ? 27.133  28.582  49.955  1.00 4.06   ? 111  PHE D CB  1 
ATOM   6302  C CG  . PHE G 1 111 ? 25.684  28.824  49.717  1.00 7.88   ? 111  PHE D CG  1 
ATOM   6303  C CD1 . PHE G 1 111 ? 24.747  28.698  50.749  1.00 8.51   ? 111  PHE D CD1 1 
ATOM   6304  C CD2 . PHE G 1 111 ? 25.238  29.199  48.450  1.00 16.26  ? 111  PHE D CD2 1 
ATOM   6305  C CE1 . PHE G 1 111 ? 23.386  28.943  50.542  1.00 11.45  ? 111  PHE D CE1 1 
ATOM   6306  C CE2 . PHE G 1 111 ? 23.880  29.436  48.231  1.00 17.14  ? 111  PHE D CE2 1 
ATOM   6307  C CZ  . PHE G 1 111 ? 22.952  29.325  49.269  1.00 8.93   ? 111  PHE D CZ  1 
ATOM   6308  N N   . LEU G 1 112 ? 30.027  30.532  50.487  1.00 20.71  ? 112  LEU D N   1 
ATOM   6309  C CA  . LEU G 1 112 ? 31.462  30.533  50.683  1.00 19.56  ? 112  LEU D CA  1 
ATOM   6310  C C   . LEU G 1 112 ? 31.718  30.989  52.072  1.00 33.83  ? 112  LEU D C   1 
ATOM   6311  O O   . LEU G 1 112 ? 30.860  31.613  52.690  1.00 37.60  ? 112  LEU D O   1 
ATOM   6312  C CB  . LEU G 1 112 ? 32.136  31.638  49.823  1.00 16.48  ? 112  LEU D CB  1 
ATOM   6313  C CG  . LEU G 1 112 ? 32.106  31.219  48.374  1.00 14.20  ? 112  LEU D CG  1 
ATOM   6314  C CD1 . LEU G 1 112 ? 33.193  31.902  47.621  1.00 11.29  ? 112  LEU D CD1 1 
ATOM   6315  C CD2 . LEU G 1 112 ? 32.398  29.754  48.378  1.00 1.49   ? 112  LEU D CD2 1 
ATOM   6316  N N   . LYS G 1 113 ? 32.936  30.717  52.506  1.00 34.66  ? 113  LYS D N   1 
ATOM   6317  C CA  . LYS G 1 113 ? 33.416  31.174  53.782  1.00 34.60  ? 113  LYS D CA  1 
ATOM   6318  C C   . LYS G 1 113 ? 33.884  32.575  53.530  1.00 48.05  ? 113  LYS D C   1 
ATOM   6319  O O   . LYS G 1 113 ? 34.782  32.848  52.732  1.00 57.59  ? 113  LYS D O   1 
ATOM   6320  C CB  . LYS G 1 113 ? 34.573  30.353  54.343  1.00 37.42  ? 113  LYS D CB  1 
ATOM   6321  C CG  . LYS G 1 113 ? 34.405  28.826  54.386  1.00 107.85 ? 113  LYS D CG  1 
ATOM   6322  C CD  . LYS G 1 113 ? 33.858  28.154  53.121  1.00 141.69 ? 113  LYS D CD  1 
ATOM   6323  C CE  . LYS G 1 113 ? 34.576  28.501  51.820  1.00 148.40 ? 113  LYS D CE  1 
ATOM   6324  N NZ  . LYS G 1 113 ? 34.077  27.723  50.671  1.00 163.81 ? 113  LYS D NZ  1 
ATOM   6325  N N   . PRO G 1 114 ? 33.196  33.431  54.186  1.00 47.13  ? 114  PRO D N   1 
ATOM   6326  C CA  . PRO G 1 114 ? 33.366  34.883  54.229  1.00 50.56  ? 114  PRO D CA  1 
ATOM   6327  C C   . PRO G 1 114 ? 34.755  35.400  53.832  1.00 62.15  ? 114  PRO D C   1 
ATOM   6328  O O   . PRO G 1 114 ? 34.934  36.427  53.134  1.00 60.40  ? 114  PRO D O   1 
ATOM   6329  C CB  . PRO G 1 114 ? 33.029  35.227  55.681  1.00 51.30  ? 114  PRO D CB  1 
ATOM   6330  C CG  . PRO G 1 114 ? 32.557  33.925  56.371  1.00 51.76  ? 114  PRO D CG  1 
ATOM   6331  C CD  . PRO G 1 114 ? 32.909  32.757  55.475  1.00 44.33  ? 114  PRO D CD  1 
ATOM   6332  N N   . ASP G 1 115 ? 35.745  34.656  54.288  1.00 66.54  ? 115  ASP D N   1 
ATOM   6333  C CA  . ASP G 1 115 ? 37.103  34.965  53.954  1.00 73.05  ? 115  ASP D CA  1 
ATOM   6334  C C   . ASP G 1 115 ? 37.288  34.799  52.430  1.00 65.55  ? 115  ASP D C   1 
ATOM   6335  O O   . ASP G 1 115 ? 37.798  35.683  51.703  1.00 71.35  ? 115  ASP D O   1 
ATOM   6336  C CB  . ASP G 1 115 ? 38.015  34.041  54.794  1.00 84.19  ? 115  ASP D CB  1 
ATOM   6337  C CG  . ASP G 1 115 ? 39.341  33.678  54.152  1.00 167.64 ? 115  ASP D CG  1 
ATOM   6338  O OD1 . ASP G 1 115 ? 39.907  34.353  53.292  1.00 178.29 ? 115  ASP D OD1 1 
ATOM   6339  O OD2 . ASP G 1 115 ? 39.845  32.563  54.645  1.00 197.05 ? 115  ASP D OD2 1 
ATOM   6340  N N   . ASP G 1 116 ? 36.827  33.649  51.941  1.00 41.01  ? 116  ASP D N   1 
ATOM   6341  C CA  . ASP G 1 116 ? 36.919  33.329  50.543  1.00 34.94  ? 116  ASP D CA  1 
ATOM   6342  C C   . ASP G 1 116 ? 35.992  34.131  49.675  1.00 31.13  ? 116  ASP D C   1 
ATOM   6343  O O   . ASP G 1 116 ? 36.101  34.190  48.441  1.00 30.98  ? 116  ASP D O   1 
ATOM   6344  C CB  . ASP G 1 116 ? 36.599  31.864  50.348  1.00 39.70  ? 116  ASP D CB  1 
ATOM   6345  C CG  . ASP G 1 116 ? 37.558  30.951  51.051  1.00 60.74  ? 116  ASP D CG  1 
ATOM   6346  O OD1 . ASP G 1 116 ? 38.601  31.324  51.571  1.00 63.01  ? 116  ASP D OD1 1 
ATOM   6347  O OD2 . ASP G 1 116 ? 37.190  29.698  50.945  1.00 66.45  ? 116  ASP D OD2 1 
ATOM   6348  N N   . GLN G 1 117 ? 35.035  34.733  50.316  1.00 20.22  ? 117  GLN D N   1 
ATOM   6349  C CA  . GLN G 1 117 ? 34.101  35.461  49.546  1.00 20.01  ? 117  GLN D CA  1 
ATOM   6350  C C   . GLN G 1 117 ? 34.711  36.572  48.772  1.00 30.67  ? 117  GLN D C   1 
ATOM   6351  O O   . GLN G 1 117 ? 34.383  36.825  47.619  1.00 36.77  ? 117  GLN D O   1 
ATOM   6352  C CB  . GLN G 1 117 ? 32.976  35.936  50.428  1.00 22.50  ? 117  GLN D CB  1 
ATOM   6353  C CG  . GLN G 1 117 ? 32.057  34.767  50.808  1.00 37.02  ? 117  GLN D CG  1 
ATOM   6354  C CD  . GLN G 1 117 ? 30.802  35.321  51.408  1.00 29.68  ? 117  GLN D CD  1 
ATOM   6355  O OE1 . GLN G 1 117 ? 30.847  36.312  52.132  1.00 64.54  ? 117  GLN D OE1 1 
ATOM   6356  N NE2 . GLN G 1 117 ? 29.671  34.782  51.005  1.00 42.05  ? 117  GLN D NE2 1 
ATOM   6357  N N   . GLN G 1 118 ? 35.638  37.205  49.416  1.00 33.21  ? 118  GLN D N   1 
ATOM   6358  C CA  . GLN G 1 118 ? 36.301  38.304  48.793  1.00 34.93  ? 118  GLN D CA  1 
ATOM   6359  C C   . GLN G 1 118 ? 37.231  37.945  47.667  1.00 32.72  ? 118  GLN D C   1 
ATOM   6360  O O   . GLN G 1 118 ? 37.240  38.598  46.618  1.00 33.69  ? 118  GLN D O   1 
ATOM   6361  C CB  . GLN G 1 118 ? 36.911  39.241  49.807  1.00 41.88  ? 118  GLN D CB  1 
ATOM   6362  C CG  . GLN G 1 118 ? 36.957  40.681  49.248  1.00 157.13 ? 118  GLN D CG  1 
ATOM   6363  C CD  . GLN G 1 118 ? 35.615  41.171  48.722  1.00 221.48 ? 118  GLN D CD  1 
ATOM   6364  O OE1 . GLN G 1 118 ? 34.546  40.782  49.232  1.00 237.99 ? 118  GLN D OE1 1 
ATOM   6365  N NE2 . GLN G 1 118 ? 35.658  42.019  47.690  1.00 199.58 ? 118  GLN D NE2 1 
ATOM   6366  N N   . LYS G 1 119 ? 38.003  36.899  47.882  1.00 28.62  ? 119  LYS D N   1 
ATOM   6367  C CA  . LYS G 1 119 ? 38.889  36.457  46.833  1.00 25.84  ? 119  LYS D CA  1 
ATOM   6368  C C   . LYS G 1 119 ? 38.073  36.171  45.561  1.00 26.95  ? 119  LYS D C   1 
ATOM   6369  O O   . LYS G 1 119 ? 38.391  36.515  44.437  1.00 33.39  ? 119  LYS D O   1 
ATOM   6370  C CB  . LYS G 1 119 ? 39.799  35.283  47.251  1.00 28.01  ? 119  LYS D CB  1 
ATOM   6371  C CG  . LYS G 1 119 ? 40.951  35.112  46.244  1.00 143.15 ? 119  LYS D CG  1 
ATOM   6372  C CD  . LYS G 1 119 ? 40.515  34.519  44.896  1.00 172.67 ? 119  LYS D CD  1 
ATOM   6373  C CE  . LYS G 1 119 ? 41.039  35.216  43.632  1.00 131.07 ? 119  LYS D CE  1 
ATOM   6374  N NZ  . LYS G 1 119 ? 40.166  34.942  42.443  1.00 24.57  ? 119  LYS D NZ  1 
ATOM   6375  N N   . GLU G 1 120 ? 36.924  35.629  45.801  1.00 19.79  ? 120  GLU D N   1 
ATOM   6376  C CA  . GLU G 1 120 ? 35.974  35.252  44.806  1.00 17.74  ? 120  GLU D CA  1 
ATOM   6377  C C   . GLU G 1 120 ? 35.406  36.321  43.944  1.00 19.67  ? 120  GLU D C   1 
ATOM   6378  O O   . GLU G 1 120 ? 35.160  36.118  42.736  1.00 22.84  ? 120  GLU D O   1 
ATOM   6379  C CB  . GLU G 1 120 ? 34.943  34.496  45.589  1.00 19.73  ? 120  GLU D CB  1 
ATOM   6380  C CG  . GLU G 1 120 ? 35.746  33.230  45.820  1.00 25.31  ? 120  GLU D CG  1 
ATOM   6381  C CD  . GLU G 1 120 ? 36.097  32.727  44.439  1.00 96.14  ? 120  GLU D CD  1 
ATOM   6382  O OE1 . GLU G 1 120 ? 35.380  32.904  43.419  1.00 96.42  ? 120  GLU D OE1 1 
ATOM   6383  O OE2 . GLU G 1 120 ? 37.249  32.106  44.469  1.00 45.20  ? 120  GLU D OE2 1 
ATOM   6384  N N   . VAL G 1 121 ? 35.155  37.437  44.594  1.00 5.57   ? 121  VAL D N   1 
ATOM   6385  C CA  . VAL G 1 121 ? 34.667  38.532  43.844  1.00 6.59   ? 121  VAL D CA  1 
ATOM   6386  C C   . VAL G 1 121 ? 35.718  38.960  42.838  1.00 17.69  ? 121  VAL D C   1 
ATOM   6387  O O   . VAL G 1 121 ? 35.455  39.241  41.664  1.00 24.97  ? 121  VAL D O   1 
ATOM   6388  C CB  . VAL G 1 121 ? 34.457  39.674  44.753  1.00 6.74   ? 121  VAL D CB  1 
ATOM   6389  C CG1 . VAL G 1 121 ? 34.133  40.839  43.863  1.00 4.65   ? 121  VAL D CG1 1 
ATOM   6390  C CG2 . VAL G 1 121 ? 33.264  39.354  45.602  1.00 3.02   ? 121  VAL D CG2 1 
ATOM   6391  N N   . VAL G 1 122 ? 36.926  39.002  43.315  1.00 9.06   ? 122  VAL D N   1 
ATOM   6392  C CA  . VAL G 1 122 ? 38.017  39.342  42.438  1.00 13.35  ? 122  VAL D CA  1 
ATOM   6393  C C   . VAL G 1 122 ? 38.054  38.382  41.278  1.00 18.92  ? 122  VAL D C   1 
ATOM   6394  O O   . VAL G 1 122 ? 38.136  38.771  40.089  1.00 19.82  ? 122  VAL D O   1 
ATOM   6395  C CB  . VAL G 1 122 ? 39.347  39.287  43.194  1.00 16.00  ? 122  VAL D CB  1 
ATOM   6396  C CG1 . VAL G 1 122 ? 40.474  39.519  42.237  1.00 13.10  ? 122  VAL D CG1 1 
ATOM   6397  C CG2 . VAL G 1 122 ? 39.391  40.415  44.176  1.00 11.75  ? 122  VAL D CG2 1 
ATOM   6398  N N   . ASN G 1 123 ? 37.884  37.109  41.614  1.00 15.18  ? 123  ASN D N   1 
ATOM   6399  C CA  . ASN G 1 123 ? 37.849  36.159  40.521  1.00 12.95  ? 123  ASN D CA  1 
ATOM   6400  C C   . ASN G 1 123 ? 36.739  36.357  39.496  1.00 15.30  ? 123  ASN D C   1 
ATOM   6401  O O   . ASN G 1 123 ? 36.987  36.272  38.280  1.00 18.14  ? 123  ASN D O   1 
ATOM   6402  C CB  . ASN G 1 123 ? 37.856  34.728  40.902  1.00 20.55  ? 123  ASN D CB  1 
ATOM   6403  C CG  . ASN G 1 123 ? 38.098  33.855  39.652  1.00 82.12  ? 123  ASN D CG  1 
ATOM   6404  O OD1 . ASN G 1 123 ? 38.996  34.156  38.767  1.00 69.87  ? 123  ASN D OD1 1 
ATOM   6405  N ND2 . ASN G 1 123 ? 37.269  32.785  39.552  1.00 34.52  ? 123  ASN D ND2 1 
ATOM   6406  N N   . MET G 1 124 ? 35.515  36.619  39.946  1.00 5.42   ? 124  MET D N   1 
ATOM   6407  C CA  . MET G 1 124 ? 34.441  36.865  38.988  1.00 2.66   ? 124  MET D CA  1 
ATOM   6408  C C   . MET G 1 124 ? 34.831  37.982  38.117  1.00 12.04  ? 124  MET D C   1 
ATOM   6409  O O   . MET G 1 124 ? 34.589  37.942  36.911  1.00 15.26  ? 124  MET D O   1 
ATOM   6410  C CB  . MET G 1 124 ? 33.209  37.463  39.612  1.00 3.56   ? 124  MET D CB  1 
ATOM   6411  C CG  . MET G 1 124 ? 32.852  36.834  40.925  1.00 11.59  ? 124  MET D CG  1 
ATOM   6412  S SD  . MET G 1 124 ? 31.324  37.564  41.495  1.00 14.50  ? 124  MET D SD  1 
ATOM   6413  C CE  . MET G 1 124 ? 31.087  36.398  42.829  1.00 8.18   ? 124  MET D CE  1 
ATOM   6414  N N   . ALA G 1 125 ? 35.416  38.996  38.765  1.00 8.41   ? 125  ALA D N   1 
ATOM   6415  C CA  . ALA G 1 125 ? 35.796  40.173  37.970  1.00 8.92   ? 125  ALA D CA  1 
ATOM   6416  C C   . ALA G 1 125 ? 36.707  39.745  36.871  1.00 16.57  ? 125  ALA D C   1 
ATOM   6417  O O   . ALA G 1 125 ? 36.445  39.992  35.706  1.00 19.75  ? 125  ALA D O   1 
ATOM   6418  C CB  . ALA G 1 125 ? 36.517  41.211  38.796  1.00 6.67   ? 125  ALA D CB  1 
ATOM   6419  N N   . GLN G 1 126 ? 37.751  39.023  37.251  1.00 7.08   ? 126  GLN D N   1 
ATOM   6420  C CA  . GLN G 1 126 ? 38.673  38.608  36.214  1.00 3.18   ? 126  GLN D CA  1 
ATOM   6421  C C   . GLN G 1 126 ? 38.097  37.742  35.122  1.00 13.31  ? 126  GLN D C   1 
ATOM   6422  O O   . GLN G 1 126 ? 38.408  37.917  33.930  1.00 13.84  ? 126  GLN D O   1 
ATOM   6423  C CB  . GLN G 1 126 ? 39.826  37.908  36.840  1.00 6.18   ? 126  GLN D CB  1 
ATOM   6424  C CG  . GLN G 1 126 ? 40.671  38.799  37.824  1.00 22.38  ? 126  GLN D CG  1 
ATOM   6425  C CD  . GLN G 1 126 ? 41.931  38.053  38.342  1.00 27.21  ? 126  GLN D CD  1 
ATOM   6426  O OE1 . GLN G 1 126 ? 41.913  37.558  39.481  1.00 47.66  ? 126  GLN D OE1 1 
ATOM   6427  N NE2 . GLN G 1 126 ? 42.873  37.688  37.431  1.00 31.54  ? 126  GLN D NE2 1 
ATOM   6428  N N   . LYS G 1 127 ? 37.255  36.782  35.508  1.00 6.91   ? 127  LYS D N   1 
ATOM   6429  C CA  . LYS G 1 127 ? 36.722  35.925  34.506  1.00 7.02   ? 127  LYS D CA  1 
ATOM   6430  C C   . LYS G 1 127 ? 35.871  36.687  33.549  1.00 12.38  ? 127  LYS D C   1 
ATOM   6431  O O   . LYS G 1 127 ? 35.907  36.471  32.335  1.00 11.43  ? 127  LYS D O   1 
ATOM   6432  C CB  . LYS G 1 127 ? 35.818  34.957  35.182  1.00 19.18  ? 127  LYS D CB  1 
ATOM   6433  C CG  . LYS G 1 127 ? 36.530  33.860  35.928  1.00 13.43  ? 127  LYS D CG  1 
ATOM   6434  C CD  . LYS G 1 127 ? 36.932  32.716  35.001  1.00 6.89   ? 127  LYS D CD  1 
ATOM   6435  C CE  . LYS G 1 127 ? 38.274  32.018  35.408  1.00 6.90   ? 127  LYS D CE  1 
ATOM   6436  N NZ  . LYS G 1 127 ? 39.478  32.884  35.160  1.00 114.42 ? 127  LYS D NZ  1 
ATOM   6437  N N   . ALA G 1 128 ? 35.038  37.551  34.139  1.00 5.41   ? 128  ALA D N   1 
ATOM   6438  C CA  . ALA G 1 128 ? 34.123  38.307  33.347  1.00 1.00   ? 128  ALA D CA  1 
ATOM   6439  C C   . ALA G 1 128 ? 34.884  39.091  32.314  1.00 6.77   ? 128  ALA D C   1 
ATOM   6440  O O   . ALA G 1 128 ? 34.617  39.075  31.113  1.00 9.61   ? 128  ALA D O   1 
ATOM   6441  C CB  . ALA G 1 128 ? 33.348  39.200  34.234  1.00 1.00   ? 128  ALA D CB  1 
ATOM   6442  N N   . ILE G 1 129 ? 35.848  39.807  32.825  1.00 4.19   ? 129  ILE D N   1 
ATOM   6443  C CA  . ILE G 1 129 ? 36.648  40.742  32.051  1.00 8.94   ? 129  ILE D CA  1 
ATOM   6444  C C   . ILE G 1 129 ? 37.429  40.074  30.980  1.00 12.61  ? 129  ILE D C   1 
ATOM   6445  O O   . ILE G 1 129 ? 37.628  40.553  29.878  1.00 22.81  ? 129  ILE D O   1 
ATOM   6446  C CB  . ILE G 1 129 ? 37.765  41.432  32.851  1.00 20.48  ? 129  ILE D CB  1 
ATOM   6447  C CG1 . ILE G 1 129 ? 37.320  42.346  33.947  1.00 16.28  ? 129  ILE D CG1 1 
ATOM   6448  C CG2 . ILE G 1 129 ? 38.386  42.350  31.859  1.00 34.42  ? 129  ILE D CG2 1 
ATOM   6449  C CD1 . ILE G 1 129 ? 35.917  42.655  33.544  1.00 9.85   ? 129  ILE D CD1 1 
ATOM   6450  N N   . ILE G 1 130 ? 38.005  39.005  31.359  1.00 8.64   ? 130  ILE D N   1 
ATOM   6451  C CA  . ILE G 1 130 ? 38.864  38.306  30.435  1.00 10.81  ? 130  ILE D CA  1 
ATOM   6452  C C   . ILE G 1 130 ? 38.249  37.220  29.589  1.00 10.87  ? 130  ILE D C   1 
ATOM   6453  O O   . ILE G 1 130 ? 38.593  37.067  28.442  1.00 13.33  ? 130  ILE D O   1 
ATOM   6454  C CB  . ILE G 1 130 ? 39.875  37.602  31.273  1.00 15.81  ? 130  ILE D CB  1 
ATOM   6455  C CG1 . ILE G 1 130 ? 40.700  38.642  31.947  1.00 19.12  ? 130  ILE D CG1 1 
ATOM   6456  C CG2 . ILE G 1 130 ? 40.827  36.842  30.414  1.00 6.62   ? 130  ILE D CG2 1 
ATOM   6457  C CD1 . ILE G 1 130 ? 41.627  37.950  32.907  1.00 24.97  ? 130  ILE D CD1 1 
ATOM   6458  N N   . ARG G 1 131 ? 37.382  36.440  30.173  1.00 3.96   ? 131  ARG D N   1 
ATOM   6459  C CA  . ARG G 1 131 ? 36.871  35.321  29.474  1.00 1.93   ? 131  ARG D CA  1 
ATOM   6460  C C   . ARG G 1 131 ? 35.558  35.483  28.803  1.00 6.36   ? 131  ARG D C   1 
ATOM   6461  O O   . ARG G 1 131 ? 35.427  34.946  27.718  1.00 12.60  ? 131  ARG D O   1 
ATOM   6462  C CB  . ARG G 1 131 ? 37.047  34.106  30.404  1.00 4.26   ? 131  ARG D CB  1 
ATOM   6463  C CG  . ARG G 1 131 ? 36.429  32.752  30.069  1.00 23.64  ? 131  ARG D CG  1 
ATOM   6464  C CD  . ARG G 1 131 ? 37.257  31.615  30.716  1.00 14.16  ? 131  ARG D CD  1 
ATOM   6465  N NE  . ARG G 1 131 ? 38.677  31.965  30.528  1.00 66.89  ? 131  ARG D NE  1 
ATOM   6466  C CZ  . ARG G 1 131 ? 39.651  31.134  30.852  1.00 94.72  ? 131  ARG D CZ  1 
ATOM   6467  N NH1 . ARG G 1 131 ? 39.289  29.945  31.402  1.00 9.97   ? 131  ARG D NH1 1 
ATOM   6468  N NH2 . ARG G 1 131 ? 40.953  31.503  30.620  1.00 69.95  ? 131  ARG D NH2 1 
ATOM   6469  N N   . TYR G 1 132 ? 34.638  36.260  29.390  1.00 7.37   ? 132  TYR D N   1 
ATOM   6470  C CA  . TYR G 1 132 ? 33.299  36.441  28.826  1.00 3.84   ? 132  TYR D CA  1 
ATOM   6471  C C   . TYR G 1 132 ? 32.955  37.725  28.116  1.00 8.16   ? 132  TYR D C   1 
ATOM   6472  O O   . TYR G 1 132 ? 32.523  37.728  26.936  1.00 8.00   ? 132  TYR D O   1 
ATOM   6473  C CB  . TYR G 1 132 ? 32.264  36.171  29.931  1.00 7.62   ? 132  TYR D CB  1 
ATOM   6474  C CG  . TYR G 1 132 ? 32.398  34.719  30.380  1.00 9.15   ? 132  TYR D CG  1 
ATOM   6475  C CD1 . TYR G 1 132 ? 31.971  33.666  29.569  1.00 3.85   ? 132  TYR D CD1 1 
ATOM   6476  C CD2 . TYR G 1 132 ? 33.126  34.385  31.528  1.00 7.21   ? 132  TYR D CD2 1 
ATOM   6477  C CE1 . TYR G 1 132 ? 32.119  32.332  29.945  1.00 1.00   ? 132  TYR D CE1 1 
ATOM   6478  C CE2 . TYR G 1 132 ? 33.384  33.050  31.859  1.00 1.61   ? 132  TYR D CE2 1 
ATOM   6479  C CZ  . TYR G 1 132 ? 32.866  32.013  31.082  1.00 1.00   ? 132  TYR D CZ  1 
ATOM   6480  O OH  . TYR G 1 132 ? 33.067  30.683  31.408  1.00 21.40  ? 132  TYR D OH  1 
ATOM   6481  N N   . PHE G 1 133 ? 33.034  38.820  28.859  1.00 5.39   ? 133  PHE D N   1 
ATOM   6482  C CA  . PHE G 1 133 ? 32.663  40.120  28.300  1.00 2.99   ? 133  PHE D CA  1 
ATOM   6483  C C   . PHE G 1 133 ? 33.240  40.403  26.905  1.00 14.49  ? 133  PHE D C   1 
ATOM   6484  O O   . PHE G 1 133 ? 32.650  40.966  25.959  1.00 18.06  ? 133  PHE D O   1 
ATOM   6485  C CB  . PHE G 1 133 ? 33.002  41.217  29.296  1.00 3.33   ? 133  PHE D CB  1 
ATOM   6486  C CG  . PHE G 1 133 ? 32.018  41.190  30.437  1.00 7.26   ? 133  PHE D CG  1 
ATOM   6487  C CD1 . PHE G 1 133 ? 30.957  40.281  30.435  1.00 8.71   ? 133  PHE D CD1 1 
ATOM   6488  C CD2 . PHE G 1 133 ? 32.103  42.091  31.503  1.00 7.41   ? 133  PHE D CD2 1 
ATOM   6489  C CE1 . PHE G 1 133 ? 30.057  40.227  31.506  1.00 10.38  ? 133  PHE D CE1 1 
ATOM   6490  C CE2 . PHE G 1 133 ? 31.180  42.089  32.555  1.00 6.55   ? 133  PHE D CE2 1 
ATOM   6491  C CZ  . PHE G 1 133 ? 30.172  41.120  32.577  1.00 4.10   ? 133  PHE D CZ  1 
ATOM   6492  N N   . PRO G 1 134 ? 34.435  39.960  26.733  1.00 8.58   ? 134  PRO D N   1 
ATOM   6493  C CA  . PRO G 1 134 ? 35.082  40.248  25.470  1.00 2.15   ? 134  PRO D CA  1 
ATOM   6494  C C   . PRO G 1 134 ? 34.492  39.600  24.231  1.00 13.92  ? 134  PRO D C   1 
ATOM   6495  O O   . PRO G 1 134 ? 34.555  40.132  23.133  1.00 16.26  ? 134  PRO D O   1 
ATOM   6496  C CB  . PRO G 1 134 ? 36.532  39.940  25.708  1.00 1.00   ? 134  PRO D CB  1 
ATOM   6497  C CG  . PRO G 1 134 ? 36.787  39.994  27.195  1.00 1.00   ? 134  PRO D CG  1 
ATOM   6498  C CD  . PRO G 1 134 ? 35.415  39.844  27.852  1.00 6.64   ? 134  PRO D CD  1 
ATOM   6499  N N   . VAL G 1 135 ? 33.867  38.465  24.446  1.00 12.60  ? 135  VAL D N   1 
ATOM   6500  C CA  . VAL G 1 135 ? 33.286  37.677  23.417  1.00 3.53   ? 135  VAL D CA  1 
ATOM   6501  C C   . VAL G 1 135 ? 32.039  38.366  22.965  1.00 9.74   ? 135  VAL D C   1 
ATOM   6502  O O   . VAL G 1 135 ? 31.768  38.542  21.794  1.00 15.21  ? 135  VAL D O   1 
ATOM   6503  C CB  . VAL G 1 135 ? 33.031  36.240  23.958  1.00 1.00   ? 135  VAL D CB  1 
ATOM   6504  C CG1 . VAL G 1 135 ? 32.389  35.305  22.943  1.00 1.00   ? 135  VAL D CG1 1 
ATOM   6505  C CG2 . VAL G 1 135 ? 34.305  35.555  24.351  1.00 1.00   ? 135  VAL D CG2 1 
ATOM   6506  N N   . PHE G 1 136 ? 31.306  38.768  23.945  1.00 1.86   ? 136  PHE D N   1 
ATOM   6507  C CA  . PHE G 1 136 ? 30.061  39.385  23.640  1.00 1.00   ? 136  PHE D CA  1 
ATOM   6508  C C   . PHE G 1 136 ? 30.259  40.739  23.073  1.00 7.71   ? 136  PHE D C   1 
ATOM   6509  O O   . PHE G 1 136 ? 29.598  41.089  22.104  1.00 13.38  ? 136  PHE D O   1 
ATOM   6510  C CB  . PHE G 1 136 ? 29.220  39.440  24.909  1.00 2.78   ? 136  PHE D CB  1 
ATOM   6511  C CG  . PHE G 1 136 ? 29.014  38.026  25.391  1.00 6.31   ? 136  PHE D CG  1 
ATOM   6512  C CD1 . PHE G 1 136 ? 28.491  37.070  24.518  1.00 3.72   ? 136  PHE D CD1 1 
ATOM   6513  C CD2 . PHE G 1 136 ? 29.352  37.602  26.680  1.00 8.93   ? 136  PHE D CD2 1 
ATOM   6514  C CE1 . PHE G 1 136 ? 28.215  35.769  24.958  1.00 3.55   ? 136  PHE D CE1 1 
ATOM   6515  C CE2 . PHE G 1 136 ? 29.111  36.291  27.116  1.00 8.46   ? 136  PHE D CE2 1 
ATOM   6516  C CZ  . PHE G 1 136 ? 28.523  35.360  26.260  1.00 1.00   ? 136  PHE D CZ  1 
ATOM   6517  N N   . GLU G 1 137 ? 31.169  41.498  23.697  1.00 5.46   ? 137  GLU D N   1 
ATOM   6518  C CA  . GLU G 1 137 ? 31.469  42.812  23.194  1.00 8.33   ? 137  GLU D CA  1 
ATOM   6519  C C   . GLU G 1 137 ? 31.829  42.747  21.700  1.00 15.69  ? 137  GLU D C   1 
ATOM   6520  O O   . GLU G 1 137 ? 31.307  43.428  20.827  1.00 20.46  ? 137  GLU D O   1 
ATOM   6521  C CB  . GLU G 1 137 ? 32.599  43.414  23.979  1.00 9.05   ? 137  GLU D CB  1 
ATOM   6522  C CG  . GLU G 1 137 ? 32.903  44.817  23.489  1.00 4.06   ? 137  GLU D CG  1 
ATOM   6523  C CD  . GLU G 1 137 ? 32.177  45.943  24.179  1.00 26.79  ? 137  GLU D CD  1 
ATOM   6524  O OE1 . GLU G 1 137 ? 31.203  45.807  24.891  1.00 17.69  ? 137  GLU D OE1 1 
ATOM   6525  O OE2 . GLU G 1 137 ? 32.711  47.101  23.876  1.00 30.49  ? 137  GLU D OE2 1 
ATOM   6526  N N   . LYS G 1 138 ? 32.662  41.824  21.356  1.00 5.87   ? 138  LYS D N   1 
ATOM   6527  C CA  . LYS G 1 138 ? 33.011  41.690  19.975  1.00 1.66   ? 138  LYS D CA  1 
ATOM   6528  C C   . LYS G 1 138 ? 31.893  41.230  19.095  1.00 15.78  ? 138  LYS D C   1 
ATOM   6529  O O   . LYS G 1 138 ? 31.842  41.549  17.952  1.00 21.84  ? 138  LYS D O   1 
ATOM   6530  C CB  . LYS G 1 138 ? 34.197  40.767  19.867  1.00 1.00   ? 138  LYS D CB  1 
ATOM   6531  C CG  . LYS G 1 138 ? 34.419  40.189  18.487  1.00 28.85  ? 138  LYS D CG  1 
ATOM   6532  C CD  . LYS G 1 138 ? 35.837  39.586  18.277  1.00 12.27  ? 138  LYS D CD  1 
ATOM   6533  C CE  . LYS G 1 138 ? 35.973  38.718  17.010  1.00 131.11 ? 138  LYS D CE  1 
ATOM   6534  N NZ  . LYS G 1 138 ? 37.337  38.204  16.756  1.00 165.74 ? 138  LYS D NZ  1 
ATOM   6535  N N   . ILE G 1 139 ? 31.022  40.412  19.593  1.00 16.05  ? 139  ILE D N   1 
ATOM   6536  C CA  . ILE G 1 139 ? 29.945  39.938  18.761  1.00 11.73  ? 139  ILE D CA  1 
ATOM   6537  C C   . ILE G 1 139 ? 29.106  41.081  18.307  1.00 18.87  ? 139  ILE D C   1 
ATOM   6538  O O   . ILE G 1 139 ? 28.804  41.228  17.128  1.00 25.87  ? 139  ILE D O   1 
ATOM   6539  C CB  . ILE G 1 139 ? 29.096  38.993  19.585  1.00 10.22  ? 139  ILE D CB  1 
ATOM   6540  C CG1 . ILE G 1 139 ? 29.821  37.683  19.505  1.00 2.56   ? 139  ILE D CG1 1 
ATOM   6541  C CG2 . ILE G 1 139 ? 27.683  38.818  19.041  1.00 3.44   ? 139  ILE D CG2 1 
ATOM   6542  C CD1 . ILE G 1 139 ? 29.195  36.603  20.350  1.00 11.94  ? 139  ILE D CD1 1 
ATOM   6543  N N   . LEU G 1 140 ? 28.740  41.840  19.310  1.00 8.73   ? 140  LEU D N   1 
ATOM   6544  C CA  . LEU G 1 140 ? 27.898  43.010  19.194  1.00 9.66   ? 140  LEU D CA  1 
ATOM   6545  C C   . LEU G 1 140 ? 28.520  44.059  18.342  1.00 19.86  ? 140  LEU D C   1 
ATOM   6546  O O   . LEU G 1 140 ? 27.823  44.771  17.618  1.00 20.31  ? 140  LEU D O   1 
ATOM   6547  C CB  . LEU G 1 140 ? 27.770  43.686  20.568  1.00 7.37   ? 140  LEU D CB  1 
ATOM   6548  C CG  . LEU G 1 140 ? 26.882  42.887  21.496  1.00 12.43  ? 140  LEU D CG  1 
ATOM   6549  C CD1 . LEU G 1 140 ? 26.878  43.542  22.850  1.00 11.57  ? 140  LEU D CD1 1 
ATOM   6550  C CD2 . LEU G 1 140 ? 25.477  42.904  20.929  1.00 1.00   ? 140  LEU D CD2 1 
ATOM   6551  N N   . ARG G 1 141 ? 29.810  44.243  18.593  1.00 18.13  ? 141  ARG D N   1 
ATOM   6552  C CA  . ARG G 1 141 ? 30.554  45.250  17.886  1.00 15.20  ? 141  ARG D CA  1 
ATOM   6553  C C   . ARG G 1 141 ? 30.609  44.772  16.480  1.00 23.36  ? 141  ARG D C   1 
ATOM   6554  O O   . ARG G 1 141 ? 30.559  45.475  15.508  1.00 26.77  ? 141  ARG D O   1 
ATOM   6555  C CB  . ARG G 1 141 ? 31.959  45.445  18.449  1.00 12.08  ? 141  ARG D CB  1 
ATOM   6556  C CG  . ARG G 1 141 ? 32.927  46.335  17.637  1.00 15.77  ? 141  ARG D CG  1 
ATOM   6557  C CD  . ARG G 1 141 ? 34.017  47.121  18.477  1.00 39.51  ? 141  ARG D CD  1 
ATOM   6558  N NE  . ARG G 1 141 ? 35.116  47.888  17.760  1.00 24.05  ? 141  ARG D NE  1 
ATOM   6559  C CZ  . ARG G 1 141 ? 35.750  47.500  16.628  1.00 157.26 ? 141  ARG D CZ  1 
ATOM   6560  N NH1 . ARG G 1 141 ? 35.473  46.343  16.001  1.00 197.13 ? 141  ARG D NH1 1 
ATOM   6561  N NH2 . ARG G 1 141 ? 36.708  48.285  16.123  1.00 188.07 ? 141  ARG D NH2 1 
ATOM   6562  N N   . GLY G 1 142 ? 30.619  43.510  16.327  1.00 26.73  ? 142  GLY D N   1 
ATOM   6563  C CA  . GLY G 1 142 ? 30.715  43.067  14.977  1.00 22.08  ? 142  GLY D CA  1 
ATOM   6564  C C   . GLY G 1 142 ? 29.480  43.164  14.116  1.00 28.74  ? 142  GLY D C   1 
ATOM   6565  O O   . GLY G 1 142 ? 29.608  43.111  12.930  1.00 37.30  ? 142  GLY D O   1 
ATOM   6566  N N   . HIS G 1 143 ? 28.273  43.228  14.647  1.00 26.32  ? 143  HIS D N   1 
ATOM   6567  C CA  . HIS G 1 143 ? 27.104  43.232  13.753  1.00 15.58  ? 143  HIS D CA  1 
ATOM   6568  C C   . HIS G 1 143 ? 26.239  44.458  13.932  1.00 22.64  ? 143  HIS D C   1 
ATOM   6569  O O   . HIS G 1 143 ? 25.316  44.721  13.157  1.00 32.45  ? 143  HIS D O   1 
ATOM   6570  C CB  . HIS G 1 143 ? 26.247  41.940  13.887  1.00 12.14  ? 143  HIS D CB  1 
ATOM   6571  C CG  . HIS G 1 143 ? 25.722  41.623  15.283  1.00 16.77  ? 143  HIS D CG  1 
ATOM   6572  N ND1 . HIS G 1 143 ? 25.297  42.609  16.183  1.00 18.94  ? 143  HIS D ND1 1 
ATOM   6573  C CD2 . HIS G 1 143 ? 25.524  40.415  15.874  1.00 14.09  ? 143  HIS D CD2 1 
ATOM   6574  C CE1 . HIS G 1 143 ? 24.886  41.988  17.261  1.00 18.89  ? 143  HIS D CE1 1 
ATOM   6575  N NE2 . HIS G 1 143 ? 25.009  40.665  17.104  1.00 16.83  ? 143  HIS D NE2 1 
ATOM   6576  N N   . GLY G 1 144 ? 26.532  45.178  15.010  1.00 12.56  ? 144  GLY D N   1 
ATOM   6577  C CA  . GLY G 1 144 ? 25.849  46.384  15.352  1.00 11.41  ? 144  GLY D CA  1 
ATOM   6578  C C   . GLY G 1 144 ? 24.417  46.204  15.841  1.00 29.14  ? 144  GLY D C   1 
ATOM   6579  O O   . GLY G 1 144 ? 23.800  47.231  16.111  1.00 40.79  ? 144  GLY D O   1 
ATOM   6580  N N   . GLN G 1 145 ? 23.906  44.952  15.909  1.00 18.28  ? 145  GLN D N   1 
ATOM   6581  C CA  . GLN G 1 145 ? 22.528  44.772  16.376  1.00 11.15  ? 145  GLN D CA  1 
ATOM   6582  C C   . GLN G 1 145 ? 22.340  44.852  17.861  1.00 10.67  ? 145  GLN D C   1 
ATOM   6583  O O   . GLN G 1 145 ? 23.309  44.962  18.644  1.00 11.31  ? 145  GLN D O   1 
ATOM   6584  C CB  . GLN G 1 145 ? 21.832  43.628  15.711  1.00 10.79  ? 145  GLN D CB  1 
ATOM   6585  C CG  . GLN G 1 145 ? 22.380  43.645  14.285  1.00 13.73  ? 145  GLN D CG  1 
ATOM   6586  C CD  . GLN G 1 145 ? 21.870  42.457  13.549  1.00 15.92  ? 145  GLN D CD  1 
ATOM   6587  O OE1 . GLN G 1 145 ? 22.073  41.301  13.990  1.00 39.77  ? 145  GLN D OE1 1 
ATOM   6588  N NE2 . GLN G 1 145 ? 21.031  42.722  12.586  1.00 27.22  ? 145  GLN D NE2 1 
ATOM   6589  N N   . SER G 1 146 ? 21.091  44.907  18.257  1.00 7.31   ? 146  SER D N   1 
ATOM   6590  C CA  . SER G 1 146 ? 20.879  45.035  19.686  1.00 15.43  ? 146  SER D CA  1 
ATOM   6591  C C   . SER G 1 146 ? 20.751  43.714  20.424  1.00 19.58  ? 146  SER D C   1 
ATOM   6592  O O   . SER G 1 146 ? 20.597  43.739  21.624  1.00 20.76  ? 146  SER D O   1 
ATOM   6593  C CB  . SER G 1 146 ? 19.748  45.959  20.099  1.00 23.42  ? 146  SER D CB  1 
ATOM   6594  O OG  . SER G 1 146 ? 19.500  46.965  19.128  1.00 23.75  ? 146  SER D OG  1 
ATOM   6595  N N   . PHE G 1 147 ? 20.847  42.621  19.691  1.00 12.42  ? 147  PHE D N   1 
ATOM   6596  C CA  . PHE G 1 147 ? 20.757  41.298  20.196  1.00 12.85  ? 147  PHE D CA  1 
ATOM   6597  C C   . PHE G 1 147 ? 21.952  40.537  19.794  1.00 17.51  ? 147  PHE D C   1 
ATOM   6598  O O   . PHE G 1 147 ? 22.475  40.806  18.745  1.00 17.01  ? 147  PHE D O   1 
ATOM   6599  C CB  . PHE G 1 147 ? 19.614  40.644  19.476  1.00 16.68  ? 147  PHE D CB  1 
ATOM   6600  C CG  . PHE G 1 147 ? 18.434  41.489  19.766  1.00 15.38  ? 147  PHE D CG  1 
ATOM   6601  C CD1 . PHE G 1 147 ? 17.940  41.541  21.066  1.00 14.47  ? 147  PHE D CD1 1 
ATOM   6602  C CD2 . PHE G 1 147 ? 17.844  42.283  18.793  1.00 16.29  ? 147  PHE D CD2 1 
ATOM   6603  C CE1 . PHE G 1 147 ? 16.817  42.285  21.429  1.00 10.70  ? 147  PHE D CE1 1 
ATOM   6604  C CE2 . PHE G 1 147 ? 16.744  43.067  19.151  1.00 12.98  ? 147  PHE D CE2 1 
ATOM   6605  C CZ  . PHE G 1 147 ? 16.229  43.077  20.448  1.00 2.23   ? 147  PHE D CZ  1 
ATOM   6606  N N   . LEU G 1 148 ? 22.328  39.565  20.615  1.00 14.06  ? 148  LEU D N   1 
ATOM   6607  C CA  . LEU G 1 148 ? 23.498  38.747  20.356  1.00 7.29   ? 148  LEU D CA  1 
ATOM   6608  C C   . LEU G 1 148 ? 23.382  37.923  19.096  1.00 14.68  ? 148  LEU D C   1 
ATOM   6609  O O   . LEU G 1 148 ? 24.366  37.704  18.316  1.00 11.93  ? 148  LEU D O   1 
ATOM   6610  C CB  . LEU G 1 148 ? 23.703  37.779  21.503  1.00 1.53   ? 148  LEU D CB  1 
ATOM   6611  C CG  . LEU G 1 148 ? 24.310  38.490  22.673  1.00 8.09   ? 148  LEU D CG  1 
ATOM   6612  C CD1 . LEU G 1 148 ? 24.308  37.474  23.778  1.00 6.61   ? 148  LEU D CD1 1 
ATOM   6613  C CD2 . LEU G 1 148 ? 25.749  38.891  22.371  1.00 3.81   ? 148  LEU D CD2 1 
ATOM   6614  N N   . VAL G 1 149 ? 22.166  37.423  18.956  1.00 7.19   ? 149  VAL D N   1 
ATOM   6615  C CA  . VAL G 1 149 ? 21.860  36.543  17.865  1.00 8.20   ? 149  VAL D CA  1 
ATOM   6616  C C   . VAL G 1 149 ? 20.498  36.822  17.242  1.00 17.89  ? 149  VAL D C   1 
ATOM   6617  O O   . VAL G 1 149 ? 19.484  37.081  17.937  1.00 13.91  ? 149  VAL D O   1 
ATOM   6618  C CB  . VAL G 1 149 ? 21.912  35.070  18.302  1.00 8.40   ? 149  VAL D CB  1 
ATOM   6619  C CG1 . VAL G 1 149 ? 21.549  34.087  17.173  1.00 4.74   ? 149  VAL D CG1 1 
ATOM   6620  C CG2 . VAL G 1 149 ? 23.229  34.684  18.974  1.00 7.52   ? 149  VAL D CG2 1 
ATOM   6621  N N   . GLY G 1 150 ? 20.544  36.754  15.910  1.00 11.92  ? 150  GLY D N   1 
ATOM   6622  C CA  . GLY G 1 150 ? 19.410  36.902  15.018  1.00 14.38  ? 150  GLY D CA  1 
ATOM   6623  C C   . GLY G 1 150 ? 18.593  38.197  15.078  1.00 20.27  ? 150  GLY D C   1 
ATOM   6624  O O   . GLY G 1 150 ? 17.440  38.249  14.661  1.00 25.89  ? 150  GLY D O   1 
ATOM   6625  N N   . ASN G 1 151 ? 19.167  39.211  15.624  1.00 19.63  ? 151  ASN D N   1 
ATOM   6626  C CA  . ASN G 1 151 ? 18.470  40.458  15.693  1.00 19.72  ? 151  ASN D CA  1 
ATOM   6627  C C   . ASN G 1 151 ? 17.145  40.395  16.338  1.00 18.61  ? 151  ASN D C   1 
ATOM   6628  O O   . ASN G 1 151 ? 16.229  41.099  16.010  1.00 28.97  ? 151  ASN D O   1 
ATOM   6629  C CB  . ASN G 1 151 ? 18.400  41.126  14.345  1.00 14.88  ? 151  ASN D CB  1 
ATOM   6630  C CG  . ASN G 1 151 ? 18.386  42.611  14.460  1.00 30.62  ? 151  ASN D CG  1 
ATOM   6631  O OD1 . ASN G 1 151 ? 18.755  43.273  15.460  1.00 33.31  ? 151  ASN D OD1 1 
ATOM   6632  N ND2 . ASN G 1 151 ? 17.795  43.118  13.430  1.00 19.00  ? 151  ASN D ND2 1 
ATOM   6633  N N   . GLN G 1 152 ? 17.074  39.495  17.240  1.00 18.45  ? 152  GLN D N   1 
ATOM   6634  C CA  . GLN G 1 152 ? 15.926  39.327  18.077  1.00 16.11  ? 152  GLN D CA  1 
ATOM   6635  C C   . GLN G 1 152 ? 16.363  38.811  19.437  1.00 21.81  ? 152  GLN D C   1 
ATOM   6636  O O   . GLN G 1 152 ? 17.470  38.262  19.629  1.00 26.92  ? 152  GLN D O   1 
ATOM   6637  C CB  . GLN G 1 152 ? 14.800  38.521  17.454  1.00 11.65  ? 152  GLN D CB  1 
ATOM   6638  C CG  . GLN G 1 152 ? 15.144  37.066  17.136  1.00 50.81  ? 152  GLN D CG  1 
ATOM   6639  C CD  . GLN G 1 152 ? 13.858  36.281  17.072  1.00 60.65  ? 152  GLN D CD  1 
ATOM   6640  O OE1 . GLN G 1 152 ? 12.934  36.796  16.437  1.00 31.26  ? 152  GLN D OE1 1 
ATOM   6641  N NE2 . GLN G 1 152 ? 13.763  35.137  17.790  1.00 39.42  ? 152  GLN D NE2 1 
ATOM   6642  N N   . LEU G 1 153 ? 15.514  39.058  20.394  1.00 9.82   ? 153  LEU D N   1 
ATOM   6643  C CA  . LEU G 1 153 ? 15.810  38.624  21.725  1.00 8.50   ? 153  LEU D CA  1 
ATOM   6644  C C   . LEU G 1 153 ? 15.848  37.105  21.745  1.00 17.38  ? 153  LEU D C   1 
ATOM   6645  O O   . LEU G 1 153 ? 15.053  36.435  21.090  1.00 22.43  ? 153  LEU D O   1 
ATOM   6646  C CB  . LEU G 1 153 ? 14.762  39.204  22.676  1.00 7.95   ? 153  LEU D CB  1 
ATOM   6647  C CG  . LEU G 1 153 ? 14.988  39.044  24.169  1.00 9.93   ? 153  LEU D CG  1 
ATOM   6648  C CD1 . LEU G 1 153 ? 16.065  39.982  24.682  1.00 4.74   ? 153  LEU D CD1 1 
ATOM   6649  C CD2 . LEU G 1 153 ? 13.707  39.364  24.875  1.00 1.00   ? 153  LEU D CD2 1 
ATOM   6650  N N   . SER G 1 154 ? 16.807  36.614  22.500  1.00 9.75   ? 154  SER D N   1 
ATOM   6651  C CA  . SER G 1 154 ? 17.045  35.234  22.659  1.00 5.01   ? 154  SER D CA  1 
ATOM   6652  C C   . SER G 1 154 ? 17.308  34.969  24.102  1.00 12.22  ? 154  SER D C   1 
ATOM   6653  O O   . SER G 1 154 ? 17.470  35.836  24.965  1.00 13.00  ? 154  SER D O   1 
ATOM   6654  C CB  . SER G 1 154 ? 18.231  34.794  21.828  1.00 1.00   ? 154  SER D CB  1 
ATOM   6655  O OG  . SER G 1 154 ? 19.418  35.201  22.458  1.00 11.84  ? 154  SER D OG  1 
ATOM   6656  N N   . LEU G 1 155 ? 17.311  33.712  24.365  1.00 9.77   ? 155  LEU D N   1 
ATOM   6657  C CA  . LEU G 1 155 ? 17.601  33.273  25.694  1.00 7.09   ? 155  LEU D CA  1 
ATOM   6658  C C   . LEU G 1 155 ? 19.002  33.747  26.097  1.00 11.75  ? 155  LEU D C   1 
ATOM   6659  O O   . LEU G 1 155 ? 19.269  34.065  27.237  1.00 13.82  ? 155  LEU D O   1 
ATOM   6660  C CB  . LEU G 1 155 ? 17.504  31.753  25.660  1.00 5.55   ? 155  LEU D CB  1 
ATOM   6661  C CG  . LEU G 1 155 ? 17.945  31.088  26.941  1.00 7.79   ? 155  LEU D CG  1 
ATOM   6662  C CD1 . LEU G 1 155 ? 17.136  31.576  28.109  1.00 1.95   ? 155  LEU D CD1 1 
ATOM   6663  C CD2 . LEU G 1 155 ? 17.748  29.599  26.762  1.00 1.00   ? 155  LEU D CD2 1 
ATOM   6664  N N   . ALA G 1 156 ? 19.922  33.819  25.133  1.00 4.41   ? 156  ALA D N   1 
ATOM   6665  C CA  . ALA G 1 156 ? 21.263  34.258  25.427  1.00 1.00   ? 156  ALA D CA  1 
ATOM   6666  C C   . ALA G 1 156 ? 21.285  35.687  25.990  1.00 9.58   ? 156  ALA D C   1 
ATOM   6667  O O   . ALA G 1 156 ? 21.984  36.010  26.976  1.00 11.69  ? 156  ALA D O   1 
ATOM   6668  C CB  . ALA G 1 156 ? 22.098  34.099  24.191  1.00 1.21   ? 156  ALA D CB  1 
ATOM   6669  N N   . ASP G 1 157 ? 20.475  36.566  25.408  1.00 3.22   ? 157  ASP D N   1 
ATOM   6670  C CA  . ASP G 1 157 ? 20.467  37.928  25.902  1.00 1.00   ? 157  ASP D CA  1 
ATOM   6671  C C   . ASP G 1 157 ? 19.924  38.007  27.326  1.00 6.79   ? 157  ASP D C   1 
ATOM   6672  O O   . ASP G 1 157 ? 20.385  38.761  28.179  1.00 9.32   ? 157  ASP D O   1 
ATOM   6673  C CB  . ASP G 1 157 ? 19.607  38.802  24.995  1.00 1.62   ? 157  ASP D CB  1 
ATOM   6674  C CG  . ASP G 1 157 ? 19.974  38.834  23.539  1.00 7.39   ? 157  ASP D CG  1 
ATOM   6675  O OD1 . ASP G 1 157 ? 21.069  39.133  23.095  1.00 7.28   ? 157  ASP D OD1 1 
ATOM   6676  O OD2 . ASP G 1 157 ? 18.970  38.525  22.775  1.00 11.20  ? 157  ASP D OD2 1 
ATOM   6677  N N   . VAL G 1 158 ? 18.898  37.259  27.628  1.00 2.97   ? 158  VAL D N   1 
ATOM   6678  C CA  . VAL G 1 158 ? 18.382  37.371  28.997  1.00 3.11   ? 158  VAL D CA  1 
ATOM   6679  C C   . VAL G 1 158 ? 19.375  36.922  30.059  1.00 12.25  ? 158  VAL D C   1 
ATOM   6680  O O   . VAL G 1 158 ? 19.565  37.563  31.098  1.00 12.12  ? 158  VAL D O   1 
ATOM   6681  C CB  . VAL G 1 158 ? 17.081  36.590  29.198  1.00 6.13   ? 158  VAL D CB  1 
ATOM   6682  C CG1 . VAL G 1 158 ? 16.523  36.802  30.590  1.00 8.89   ? 158  VAL D CG1 1 
ATOM   6683  C CG2 . VAL G 1 158 ? 16.052  36.861  28.131  1.00 1.00   ? 158  VAL D CG2 1 
ATOM   6684  N N   . ILE G 1 159 ? 19.996  35.765  29.816  1.00 8.29   ? 159  ILE D N   1 
ATOM   6685  C CA  . ILE G 1 159 ? 20.936  35.221  30.786  1.00 4.76   ? 159  ILE D CA  1 
ATOM   6686  C C   . ILE G 1 159 ? 22.120  36.126  30.977  1.00 8.02   ? 159  ILE D C   1 
ATOM   6687  O O   . ILE G 1 159 ? 22.640  36.301  32.081  1.00 12.26  ? 159  ILE D O   1 
ATOM   6688  C CB  . ILE G 1 159 ? 21.394  33.832  30.372  1.00 7.13   ? 159  ILE D CB  1 
ATOM   6689  C CG1 . ILE G 1 159 ? 20.191  32.926  30.195  1.00 7.72   ? 159  ILE D CG1 1 
ATOM   6690  C CG2 . ILE G 1 159 ? 22.238  33.240  31.473  1.00 1.00   ? 159  ILE D CG2 1 
ATOM   6691  C CD1 . ILE G 1 159 ? 19.295  32.947  31.439  1.00 2.92   ? 159  ILE D CD1 1 
ATOM   6692  N N   . LEU G 1 160 ? 22.512  36.719  29.866  1.00 1.91   ? 160  LEU D N   1 
ATOM   6693  C CA  . LEU G 1 160 ? 23.635  37.619  29.878  1.00 3.04   ? 160  LEU D CA  1 
ATOM   6694  C C   . LEU G 1 160 ? 23.283  38.846  30.620  1.00 6.29   ? 160  LEU D C   1 
ATOM   6695  O O   . LEU G 1 160 ? 23.972  39.238  31.558  1.00 12.58  ? 160  LEU D O   1 
ATOM   6696  C CB  . LEU G 1 160 ? 24.142  37.875  28.473  1.00 4.78   ? 160  LEU D CB  1 
ATOM   6697  C CG  . LEU G 1 160 ? 25.289  38.838  28.463  1.00 5.70   ? 160  LEU D CG  1 
ATOM   6698  C CD1 . LEU G 1 160 ? 26.426  38.375  29.351  1.00 1.00   ? 160  LEU D CD1 1 
ATOM   6699  C CD2 . LEU G 1 160 ? 25.758  38.887  27.043  1.00 1.00   ? 160  LEU D CD2 1 
ATOM   6700  N N   . LEU G 1 161 ? 22.143  39.389  30.271  1.00 1.00   ? 161  LEU D N   1 
ATOM   6701  C CA  . LEU G 1 161 ? 21.671  40.519  31.020  1.00 2.24   ? 161  LEU D CA  1 
ATOM   6702  C C   . LEU G 1 161 ? 21.568  40.224  32.514  1.00 6.32   ? 161  LEU D C   1 
ATOM   6703  O O   . LEU G 1 161 ? 22.021  40.962  33.390  1.00 7.38   ? 161  LEU D O   1 
ATOM   6704  C CB  . LEU G 1 161 ? 20.278  40.905  30.551  1.00 4.61   ? 161  LEU D CB  1 
ATOM   6705  C CG  . LEU G 1 161 ? 19.709  42.071  31.381  1.00 11.13  ? 161  LEU D CG  1 
ATOM   6706  C CD1 . LEU G 1 161 ? 20.512  43.349  31.223  1.00 6.22   ? 161  LEU D CD1 1 
ATOM   6707  C CD2 . LEU G 1 161 ? 18.314  42.385  30.908  1.00 5.61   ? 161  LEU D CD2 1 
ATOM   6708  N N   . GLN G 1 162 ? 20.998  39.094  32.819  1.00 1.00   ? 162  GLN D N   1 
ATOM   6709  C CA  . GLN G 1 162 ? 20.854  38.762  34.219  1.00 2.60   ? 162  GLN D CA  1 
ATOM   6710  C C   . GLN G 1 162 ? 22.151  38.733  34.993  1.00 9.76   ? 162  GLN D C   1 
ATOM   6711  O O   . GLN G 1 162 ? 22.258  39.252  36.096  1.00 13.96  ? 162  GLN D O   1 
ATOM   6712  C CB  . GLN G 1 162 ? 20.175  37.400  34.360  1.00 5.01   ? 162  GLN D CB  1 
ATOM   6713  C CG  . GLN G 1 162 ? 20.689  36.736  35.631  1.00 1.00   ? 162  GLN D CG  1 
ATOM   6714  C CD  . GLN G 1 162 ? 20.039  35.412  36.055  1.00 7.99   ? 162  GLN D CD  1 
ATOM   6715  O OE1 . GLN G 1 162 ? 19.859  35.203  37.253  1.00 13.25  ? 162  GLN D OE1 1 
ATOM   6716  N NE2 . GLN G 1 162 ? 19.846  34.438  35.155  1.00 1.00   ? 162  GLN D NE2 1 
ATOM   6717  N N   . THR G 1 163 ? 23.129  38.153  34.322  1.00 8.32   ? 163  THR D N   1 
ATOM   6718  C CA  . THR G 1 163 ? 24.447  37.946  34.864  1.00 6.48   ? 163  THR D CA  1 
ATOM   6719  C C   . THR G 1 163 ? 25.228  39.226  35.032  1.00 10.48  ? 163  THR D C   1 
ATOM   6720  O O   . THR G 1 163 ? 25.837  39.524  36.057  1.00 9.86   ? 163  THR D O   1 
ATOM   6721  C CB  . THR G 1 163 ? 25.198  36.944  33.969  1.00 3.83   ? 163  THR D CB  1 
ATOM   6722  O OG1 . THR G 1 163 ? 24.474  35.733  33.794  1.00 7.93   ? 163  THR D OG1 1 
ATOM   6723  C CG2 . THR G 1 163 ? 26.570  36.651  34.516  1.00 1.00   ? 163  THR D CG2 1 
ATOM   6724  N N   . ILE G 1 164 ? 25.238  39.990  33.987  1.00 6.30   ? 164  ILE D N   1 
ATOM   6725  C CA  . ILE G 1 164 ? 25.919  41.258  34.042  1.00 5.83   ? 164  ILE D CA  1 
ATOM   6726  C C   . ILE G 1 164 ? 25.375  42.111  35.185  1.00 10.33  ? 164  ILE D C   1 
ATOM   6727  O O   . ILE G 1 164 ? 26.108  42.644  36.049  1.00 8.32   ? 164  ILE D O   1 
ATOM   6728  C CB  . ILE G 1 164 ? 25.546  41.965  32.777  1.00 8.52   ? 164  ILE D CB  1 
ATOM   6729  C CG1 . ILE G 1 164 ? 26.437  41.524  31.626  1.00 6.79   ? 164  ILE D CG1 1 
ATOM   6730  C CG2 . ILE G 1 164 ? 25.709  43.426  33.044  1.00 3.92   ? 164  ILE D CG2 1 
ATOM   6731  C CD1 . ILE G 1 164 ? 25.985  42.103  30.308  1.00 1.00   ? 164  ILE D CD1 1 
ATOM   6732  N N   . LEU G 1 165 ? 24.046  42.200  35.245  1.00 1.85   ? 165  LEU D N   1 
ATOM   6733  C CA  . LEU G 1 165 ? 23.504  42.988  36.334  1.00 1.15   ? 165  LEU D CA  1 
ATOM   6734  C C   . LEU G 1 165 ? 23.866  42.496  37.699  1.00 7.95   ? 165  LEU D C   1 
ATOM   6735  O O   . LEU G 1 165 ? 24.034  43.261  38.636  1.00 14.91  ? 165  LEU D O   1 
ATOM   6736  C CB  . LEU G 1 165 ? 22.002  43.088  36.268  1.00 3.68   ? 165  LEU D CB  1 
ATOM   6737  C CG  . LEU G 1 165 ? 21.468  43.705  34.983  1.00 9.64   ? 165  LEU D CG  1 
ATOM   6738  C CD1 . LEU G 1 165 ? 19.958  43.801  35.041  1.00 5.44   ? 165  LEU D CD1 1 
ATOM   6739  C CD2 . LEU G 1 165 ? 22.021  45.084  34.784  1.00 1.00   ? 165  LEU D CD2 1 
ATOM   6740  N N   . ALA G 1 166 ? 23.907  41.198  37.826  1.00 8.71   ? 166  ALA D N   1 
ATOM   6741  C CA  . ALA G 1 166 ? 24.258  40.612  39.099  1.00 1.59   ? 166  ALA D CA  1 
ATOM   6742  C C   . ALA G 1 166 ? 25.695  40.913  39.459  1.00 7.30   ? 166  ALA D C   1 
ATOM   6743  O O   . ALA G 1 166 ? 26.057  41.137  40.602  1.00 7.68   ? 166  ALA D O   1 
ATOM   6744  C CB  . ALA G 1 166 ? 24.118  39.159  38.911  1.00 1.00   ? 166  ALA D CB  1 
ATOM   6745  N N   . LEU G 1 167 ? 26.536  40.927  38.451  1.00 4.92   ? 167  LEU D N   1 
ATOM   6746  C CA  . LEU G 1 167 ? 27.913  41.204  38.686  1.00 4.32   ? 167  LEU D CA  1 
ATOM   6747  C C   . LEU G 1 167 ? 28.038  42.637  39.096  1.00 12.12  ? 167  LEU D C   1 
ATOM   6748  O O   . LEU G 1 167 ? 28.751  42.982  40.047  1.00 11.02  ? 167  LEU D O   1 
ATOM   6749  C CB  . LEU G 1 167 ? 28.657  41.001  37.370  1.00 4.79   ? 167  LEU D CB  1 
ATOM   6750  C CG  . LEU G 1 167 ? 28.974  39.541  37.152  1.00 9.14   ? 167  LEU D CG  1 
ATOM   6751  C CD1 . LEU G 1 167 ? 29.359  39.265  35.744  1.00 6.73   ? 167  LEU D CD1 1 
ATOM   6752  C CD2 . LEU G 1 167 ? 30.184  39.195  37.967  1.00 1.00   ? 167  LEU D CD2 1 
ATOM   6753  N N   . GLU G 1 168 ? 27.320  43.480  38.362  1.00 7.20   ? 168  GLU D N   1 
ATOM   6754  C CA  . GLU G 1 168 ? 27.394  44.882  38.704  1.00 5.64   ? 168  GLU D CA  1 
ATOM   6755  C C   . GLU G 1 168 ? 26.982  45.166  40.118  1.00 13.17  ? 168  GLU D C   1 
ATOM   6756  O O   . GLU G 1 168 ? 27.341  46.176  40.711  1.00 20.60  ? 168  GLU D O   1 
ATOM   6757  C CB  . GLU G 1 168 ? 26.586  45.762  37.830  1.00 1.00   ? 168  GLU D CB  1 
ATOM   6758  C CG  . GLU G 1 168 ? 27.150  45.784  36.432  1.00 11.55  ? 168  GLU D CG  1 
ATOM   6759  C CD  . GLU G 1 168 ? 26.391  46.769  35.583  1.00 4.97   ? 168  GLU D CD  1 
ATOM   6760  O OE1 . GLU G 1 168 ? 25.170  46.984  35.736  1.00 25.67  ? 168  GLU D OE1 1 
ATOM   6761  O OE2 . GLU G 1 168 ? 27.190  47.452  34.750  1.00 38.28  ? 168  GLU D OE2 1 
ATOM   6762  N N   . GLU G 1 169 ? 26.181  44.314  40.655  1.00 3.60   ? 169  GLU D N   1 
ATOM   6763  C CA  . GLU G 1 169 ? 25.837  44.544  42.014  1.00 3.76   ? 169  GLU D CA  1 
ATOM   6764  C C   . GLU G 1 169 ? 27.068  44.421  42.859  1.00 13.90  ? 169  GLU D C   1 
ATOM   6765  O O   . GLU G 1 169 ? 27.148  45.071  43.874  1.00 20.41  ? 169  GLU D O   1 
ATOM   6766  C CB  . GLU G 1 169 ? 24.778  43.581  42.582  1.00 5.62   ? 169  GLU D CB  1 
ATOM   6767  C CG  . GLU G 1 169 ? 23.379  43.714  41.971  1.00 3.86   ? 169  GLU D CG  1 
ATOM   6768  C CD  . GLU G 1 169 ? 22.536  42.509  42.282  1.00 20.25  ? 169  GLU D CD  1 
ATOM   6769  O OE1 . GLU G 1 169 ? 23.011  41.485  42.671  1.00 27.21  ? 169  GLU D OE1 1 
ATOM   6770  O OE2 . GLU G 1 169 ? 21.297  42.608  41.903  1.00 8.59   ? 169  GLU D OE2 1 
ATOM   6771  N N   . LYS G 1 170 ? 28.022  43.579  42.484  1.00 13.87  ? 170  LYS D N   1 
ATOM   6772  C CA  . LYS G 1 170 ? 29.216  43.459  43.302  1.00 10.02  ? 170  LYS D CA  1 
ATOM   6773  C C   . LYS G 1 170 ? 30.363  44.310  42.776  1.00 19.17  ? 170  LYS D C   1 
ATOM   6774  O O   . LYS G 1 170 ? 31.227  44.730  43.551  1.00 19.33  ? 170  LYS D O   1 
ATOM   6775  C CB  . LYS G 1 170 ? 29.709  42.040  43.348  1.00 8.99   ? 170  LYS D CB  1 
ATOM   6776  C CG  . LYS G 1 170 ? 28.613  41.095  43.693  1.00 9.35   ? 170  LYS D CG  1 
ATOM   6777  C CD  . LYS G 1 170 ? 28.975  39.901  44.586  1.00 10.16  ? 170  LYS D CD  1 
ATOM   6778  C CE  . LYS G 1 170 ? 27.729  39.218  45.158  1.00 32.81  ? 170  LYS D CE  1 
ATOM   6779  N NZ  . LYS G 1 170 ? 27.914  38.367  46.359  1.00 121.55 ? 170  LYS D NZ  1 
ATOM   6780  N N   . ILE G 1 171 ? 30.399  44.515  41.450  1.00 13.36  ? 171  ILE D N   1 
ATOM   6781  C CA  . ILE G 1 171 ? 31.472  45.269  40.789  1.00 7.24   ? 171  ILE D CA  1 
ATOM   6782  C C   . ILE G 1 171 ? 30.868  46.122  39.728  1.00 13.74  ? 171  ILE D C   1 
ATOM   6783  O O   . ILE G 1 171 ? 30.748  45.795  38.540  1.00 23.49  ? 171  ILE D O   1 
ATOM   6784  C CB  . ILE G 1 171 ? 32.427  44.319  40.118  1.00 8.56   ? 171  ILE D CB  1 
ATOM   6785  C CG1 . ILE G 1 171 ? 32.722  43.146  41.029  1.00 7.78   ? 171  ILE D CG1 1 
ATOM   6786  C CG2 . ILE G 1 171 ? 33.675  45.059  39.827  1.00 1.00   ? 171  ILE D CG2 1 
ATOM   6787  C CD1 . ILE G 1 171 ? 33.212  41.943  40.264  1.00 7.31   ? 171  ILE D CD1 1 
ATOM   6788  N N   . PRO G 1 172 ? 30.491  47.208  40.257  1.00 7.06   ? 172  PRO D N   1 
ATOM   6789  C CA  . PRO G 1 172 ? 29.728  48.246  39.666  1.00 9.45   ? 172  PRO D CA  1 
ATOM   6790  C C   . PRO G 1 172 ? 30.228  48.806  38.402  1.00 17.10  ? 172  PRO D C   1 
ATOM   6791  O O   . PRO G 1 172 ? 29.418  49.289  37.647  1.00 16.45  ? 172  PRO D O   1 
ATOM   6792  C CB  . PRO G 1 172 ? 29.510  49.324  40.737  1.00 4.38   ? 172  PRO D CB  1 
ATOM   6793  C CG  . PRO G 1 172 ? 29.885  48.658  42.040  1.00 3.83   ? 172  PRO D CG  1 
ATOM   6794  C CD  . PRO G 1 172 ? 30.701  47.415  41.695  1.00 6.07   ? 172  PRO D CD  1 
ATOM   6795  N N   . ASN G 1 173 ? 31.525  48.742  38.212  1.00 15.91  ? 173  ASN D N   1 
ATOM   6796  C CA  . ASN G 1 173 ? 32.183  49.262  37.034  1.00 14.15  ? 173  ASN D CA  1 
ATOM   6797  C C   . ASN G 1 173 ? 32.700  48.142  36.193  1.00 21.82  ? 173  ASN D C   1 
ATOM   6798  O O   . ASN G 1 173 ? 33.623  48.292  35.438  1.00 26.37  ? 173  ASN D O   1 
ATOM   6799  C CB  . ASN G 1 173 ? 33.423  50.015  37.507  1.00 8.39   ? 173  ASN D CB  1 
ATOM   6800  C CG  . ASN G 1 173 ? 34.315  49.215  38.447  1.00 42.06  ? 173  ASN D CG  1 
ATOM   6801  O OD1 . ASN G 1 173 ? 33.818  48.505  39.346  1.00 79.29  ? 173  ASN D OD1 1 
ATOM   6802  N ND2 . ASN G 1 173 ? 35.630  49.509  38.393  1.00 48.92  ? 173  ASN D ND2 1 
ATOM   6803  N N   . ILE G 1 174 ? 32.150  46.982  36.370  1.00 17.65  ? 174  ILE D N   1 
ATOM   6804  C CA  . ILE G 1 174 ? 32.668  45.888  35.642  1.00 10.65  ? 174  ILE D CA  1 
ATOM   6805  C C   . ILE G 1 174 ? 32.556  46.053  34.138  1.00 15.63  ? 174  ILE D C   1 
ATOM   6806  O O   . ILE G 1 174 ? 33.384  45.570  33.371  1.00 22.04  ? 174  ILE D O   1 
ATOM   6807  C CB  . ILE G 1 174 ? 32.075  44.639  36.191  1.00 10.88  ? 174  ILE D CB  1 
ATOM   6808  C CG1 . ILE G 1 174 ? 32.945  43.542  35.671  1.00 5.26   ? 174  ILE D CG1 1 
ATOM   6809  C CG2 . ILE G 1 174 ? 30.584  44.537  35.770  1.00 1.00   ? 174  ILE D CG2 1 
ATOM   6810  C CD1 . ILE G 1 174 ? 32.632  42.347  36.475  1.00 16.19  ? 174  ILE D CD1 1 
ATOM   6811  N N   . LEU G 1 175 ? 31.573  46.842  33.698  1.00 13.16  ? 175  LEU D N   1 
ATOM   6812  C CA  . LEU G 1 175 ? 31.364  47.046  32.262  1.00 10.15  ? 175  LEU D CA  1 
ATOM   6813  C C   . LEU G 1 175 ? 32.085  48.225  31.632  1.00 23.77  ? 175  LEU D C   1 
ATOM   6814  O O   . LEU G 1 175 ? 31.924  48.496  30.416  1.00 21.65  ? 175  LEU D O   1 
ATOM   6815  C CB  . LEU G 1 175 ? 29.908  47.294  31.962  1.00 5.76   ? 175  LEU D CB  1 
ATOM   6816  C CG  . LEU G 1 175 ? 29.044  46.058  31.797  1.00 9.61   ? 175  LEU D CG  1 
ATOM   6817  C CD1 . LEU G 1 175 ? 27.774  46.521  31.143  1.00 10.47  ? 175  LEU D CD1 1 
ATOM   6818  C CD2 . LEU G 1 175 ? 29.694  44.948  30.959  1.00 1.06   ? 175  LEU D CD2 1 
ATOM   6819  N N   . SER G 1 176 ? 32.797  48.936  32.503  1.00 22.38  ? 176  SER D N   1 
ATOM   6820  C CA  . SER G 1 176 ? 33.581  50.117  32.170  1.00 20.12  ? 176  SER D CA  1 
ATOM   6821  C C   . SER G 1 176 ? 34.244  49.944  30.832  1.00 19.57  ? 176  SER D C   1 
ATOM   6822  O O   . SER G 1 176 ? 34.040  50.713  29.934  1.00 36.15  ? 176  SER D O   1 
ATOM   6823  C CB  . SER G 1 176 ? 34.657  50.400  33.218  1.00 27.14  ? 176  SER D CB  1 
ATOM   6824  O OG  . SER G 1 176 ? 35.442  49.206  33.409  1.00 92.26  ? 176  SER D OG  1 
ATOM   6825  N N   . ALA G 1 177 ? 35.024  48.918  30.661  1.00 14.43  ? 177  ALA D N   1 
ATOM   6826  C CA  . ALA G 1 177 ? 35.683  48.745  29.387  1.00 7.83   ? 177  ALA D CA  1 
ATOM   6827  C C   . ALA G 1 177 ? 34.872  48.133  28.260  1.00 15.57  ? 177  ALA D C   1 
ATOM   6828  O O   . ALA G 1 177 ? 35.516  47.841  27.244  1.00 21.58  ? 177  ALA D O   1 
ATOM   6829  C CB  . ALA G 1 177 ? 36.897  47.889  29.580  1.00 5.96   ? 177  ALA D CB  1 
ATOM   6830  N N   . PHE G 1 178 ? 33.541  47.935  28.447  1.00 6.27   ? 178  PHE D N   1 
ATOM   6831  C CA  . PHE G 1 178 ? 32.673  47.307  27.470  1.00 9.20   ? 178  PHE D CA  1 
ATOM   6832  C C   . PHE G 1 178 ? 31.490  48.147  27.144  1.00 18.14  ? 178  PHE D C   1 
ATOM   6833  O O   . PHE G 1 178 ? 30.370  47.928  27.544  1.00 24.51  ? 178  PHE D O   1 
ATOM   6834  C CB  . PHE G 1 178 ? 32.229  45.924  27.967  1.00 10.48  ? 178  PHE D CB  1 
ATOM   6835  C CG  . PHE G 1 178 ? 33.452  45.148  28.385  1.00 6.36   ? 178  PHE D CG  1 
ATOM   6836  C CD1 . PHE G 1 178 ? 34.193  44.427  27.454  1.00 1.27   ? 178  PHE D CD1 1 
ATOM   6837  C CD2 . PHE G 1 178 ? 33.882  45.133  29.709  1.00 11.09  ? 178  PHE D CD2 1 
ATOM   6838  C CE1 . PHE G 1 178 ? 35.300  43.663  27.838  1.00 1.00   ? 178  PHE D CE1 1 
ATOM   6839  C CE2 . PHE G 1 178 ? 35.025  44.429  30.095  1.00 11.28  ? 178  PHE D CE2 1 
ATOM   6840  C CZ  . PHE G 1 178 ? 35.750  43.698  29.156  1.00 1.00   ? 178  PHE D CZ  1 
ATOM   6841  N N   . PRO G 1 179 ? 31.800  49.112  26.377  1.00 20.81  ? 179  PRO D N   1 
ATOM   6842  C CA  . PRO G 1 179 ? 30.923  50.142  25.880  1.00 19.51  ? 179  PRO D CA  1 
ATOM   6843  C C   . PRO G 1 179 ? 29.790  49.553  25.085  1.00 24.18  ? 179  PRO D C   1 
ATOM   6844  O O   . PRO G 1 179 ? 28.653  49.972  25.236  1.00 26.95  ? 179  PRO D O   1 
ATOM   6845  C CB  . PRO G 1 179 ? 31.791  50.968  24.965  1.00 15.42  ? 179  PRO D CB  1 
ATOM   6846  C CG  . PRO G 1 179 ? 33.180  50.397  24.983  1.00 15.39  ? 179  PRO D CG  1 
ATOM   6847  C CD  . PRO G 1 179 ? 33.211  49.339  26.062  1.00 16.82  ? 179  PRO D CD  1 
ATOM   6848  N N   . PHE G 1 180 ? 30.080  48.558  24.264  1.00 16.21  ? 180  PHE D N   1 
ATOM   6849  C CA  . PHE G 1 180 ? 28.982  47.909  23.559  1.00 14.12  ? 180  PHE D CA  1 
ATOM   6850  C C   . PHE G 1 180 ? 28.072  47.209  24.537  1.00 18.51  ? 180  PHE D C   1 
ATOM   6851  O O   . PHE G 1 180 ? 26.854  47.363  24.484  1.00 18.74  ? 180  PHE D O   1 
ATOM   6852  C CB  . PHE G 1 180 ? 29.504  46.886  22.583  1.00 16.34  ? 180  PHE D CB  1 
ATOM   6853  C CG  . PHE G 1 180 ? 29.928  47.643  21.347  1.00 21.04  ? 180  PHE D CG  1 
ATOM   6854  C CD1 . PHE G 1 180 ? 31.154  48.296  21.285  1.00 20.75  ? 180  PHE D CD1 1 
ATOM   6855  C CD2 . PHE G 1 180 ? 29.084  47.799  20.242  1.00 26.78  ? 180  PHE D CD2 1 
ATOM   6856  C CE1 . PHE G 1 180 ? 31.540  48.998  20.135  1.00 18.28  ? 180  PHE D CE1 1 
ATOM   6857  C CE2 . PHE G 1 180 ? 29.428  48.515  19.090  1.00 17.67  ? 180  PHE D CE2 1 
ATOM   6858  C CZ  . PHE G 1 180 ? 30.686  49.111  19.036  1.00 10.82  ? 180  PHE D CZ  1 
ATOM   6859  N N   . LEU G 1 181 ? 28.695  46.469  25.467  1.00 8.93   ? 181  LEU D N   1 
ATOM   6860  C CA  . LEU G 1 181 ? 27.925  45.784  26.450  1.00 9.86   ? 181  LEU D CA  1 
ATOM   6861  C C   . LEU G 1 181 ? 27.143  46.785  27.269  1.00 12.03  ? 181  LEU D C   1 
ATOM   6862  O O   . LEU G 1 181 ? 25.981  46.552  27.679  1.00 13.20  ? 181  LEU D O   1 
ATOM   6863  C CB  . LEU G 1 181 ? 28.790  44.884  27.354  1.00 13.77  ? 181  LEU D CB  1 
ATOM   6864  C CG  . LEU G 1 181 ? 29.252  43.608  26.691  1.00 13.05  ? 181  LEU D CG  1 
ATOM   6865  C CD1 . LEU G 1 181 ? 30.221  42.840  27.583  1.00 11.41  ? 181  LEU D CD1 1 
ATOM   6866  C CD2 . LEU G 1 181 ? 28.020  42.811  26.421  1.00 1.82   ? 181  LEU D CD2 1 
ATOM   6867  N N   . GLN G 1 182 ? 27.732  47.947  27.500  1.00 9.34   ? 182  GLN D N   1 
ATOM   6868  C CA  . GLN G 1 182 ? 26.941  48.888  28.295  1.00 8.76   ? 182  GLN D CA  1 
ATOM   6869  C C   . GLN G 1 182 ? 25.710  49.329  27.573  1.00 14.41  ? 182  GLN D C   1 
ATOM   6870  O O   . GLN G 1 182 ? 24.636  49.394  28.108  1.00 16.30  ? 182  GLN D O   1 
ATOM   6871  C CB  . GLN G 1 182 ? 27.650  50.144  28.653  1.00 6.64   ? 182  GLN D CB  1 
ATOM   6872  C CG  . GLN G 1 182 ? 28.750  50.079  29.707  1.00 35.10  ? 182  GLN D CG  1 
ATOM   6873  C CD  . GLN G 1 182 ? 29.626  51.312  29.539  1.00 18.09  ? 182  GLN D CD  1 
ATOM   6874  O OE1 . GLN G 1 182 ? 29.169  52.371  29.067  1.00 83.28  ? 182  GLN D OE1 1 
ATOM   6875  N NE2 . GLN G 1 182 ? 30.922  51.152  29.731  1.00 33.79  ? 182  GLN D NE2 1 
ATOM   6876  N N   . GLU G 1 183 ? 25.854  49.636  26.326  1.00 15.58  ? 183  GLU D N   1 
ATOM   6877  C CA  . GLU G 1 183 ? 24.701  50.066  25.627  1.00 18.74  ? 183  GLU D CA  1 
ATOM   6878  C C   . GLU G 1 183 ? 23.679  49.007  25.506  1.00 16.44  ? 183  GLU D C   1 
ATOM   6879  O O   . GLU G 1 183 ? 22.510  49.235  25.744  1.00 21.35  ? 183  GLU D O   1 
ATOM   6880  C CB  . GLU G 1 183 ? 25.032  50.586  24.259  1.00 23.36  ? 183  GLU D CB  1 
ATOM   6881  C CG  . GLU G 1 183 ? 24.051  51.652  23.716  1.00 90.45  ? 183  GLU D CG  1 
ATOM   6882  C CD  . GLU G 1 183 ? 24.395  51.927  22.309  1.00 240.06 ? 183  GLU D CD  1 
ATOM   6883  O OE1 . GLU G 1 183 ? 25.488  51.743  21.824  1.00 286.72 ? 183  GLU D OE1 1 
ATOM   6884  O OE2 . GLU G 1 183 ? 23.475  52.602  21.668  1.00 267.52 ? 183  GLU D OE2 1 
ATOM   6885  N N   . TYR G 1 184 ? 24.131  47.845  25.123  1.00 16.75  ? 184  TYR D N   1 
ATOM   6886  C CA  . TYR G 1 184 ? 23.258  46.697  24.957  1.00 15.59  ? 184  TYR D CA  1 
ATOM   6887  C C   . TYR G 1 184 ? 22.394  46.478  26.207  1.00 17.05  ? 184  TYR D C   1 
ATOM   6888  O O   . TYR G 1 184 ? 21.155  46.315  26.169  1.00 16.57  ? 184  TYR D O   1 
ATOM   6889  C CB  . TYR G 1 184 ? 24.237  45.586  24.771  1.00 10.91  ? 184  TYR D CB  1 
ATOM   6890  C CG  . TYR G 1 184 ? 23.698  44.203  24.802  1.00 13.32  ? 184  TYR D CG  1 
ATOM   6891  C CD1 . TYR G 1 184 ? 23.170  43.551  23.685  1.00 12.11  ? 184  TYR D CD1 1 
ATOM   6892  C CD2 . TYR G 1 184 ? 23.872  43.454  25.964  1.00 10.72  ? 184  TYR D CD2 1 
ATOM   6893  C CE1 . TYR G 1 184 ? 22.687  42.242  23.800  1.00 9.98   ? 184  TYR D CE1 1 
ATOM   6894  C CE2 . TYR G 1 184 ? 23.423  42.136  26.077  1.00 4.44   ? 184  TYR D CE2 1 
ATOM   6895  C CZ  . TYR G 1 184 ? 22.837  41.507  24.985  1.00 8.44   ? 184  TYR D CZ  1 
ATOM   6896  O OH  . TYR G 1 184 ? 22.454  40.170  25.093  1.00 17.51  ? 184  TYR D OH  1 
ATOM   6897  N N   . THR G 1 185 ? 23.060  46.577  27.345  1.00 2.92   ? 185  THR D N   1 
ATOM   6898  C CA  . THR G 1 185 ? 22.420  46.384  28.631  1.00 2.77   ? 185  THR D CA  1 
ATOM   6899  C C   . THR G 1 185 ? 21.347  47.391  28.848  1.00 13.26  ? 185  THR D C   1 
ATOM   6900  O O   . THR G 1 185 ? 20.241  47.157  29.327  1.00 13.17  ? 185  THR D O   1 
ATOM   6901  C CB  . THR G 1 185 ? 23.498  46.601  29.703  1.00 14.05  ? 185  THR D CB  1 
ATOM   6902  O OG1 . THR G 1 185 ? 24.373  45.555  29.622  1.00 9.91   ? 185  THR D OG1 1 
ATOM   6903  C CG2 . THR G 1 185 ? 22.944  46.550  31.095  1.00 3.34   ? 185  THR D CG2 1 
ATOM   6904  N N   . VAL G 1 186 ? 21.703  48.570  28.512  1.00 11.46  ? 186  VAL D N   1 
ATOM   6905  C CA  . VAL G 1 186 ? 20.763  49.626  28.675  1.00 14.52  ? 186  VAL D CA  1 
ATOM   6906  C C   . VAL G 1 186 ? 19.518  49.430  27.862  1.00 11.38  ? 186  VAL D C   1 
ATOM   6907  O O   . VAL G 1 186 ? 18.404  49.485  28.346  1.00 16.88  ? 186  VAL D O   1 
ATOM   6908  C CB  . VAL G 1 186 ? 21.402  50.908  28.220  1.00 19.24  ? 186  VAL D CB  1 
ATOM   6909  C CG1 . VAL G 1 186 ? 20.301  51.926  28.261  1.00 15.96  ? 186  VAL D CG1 1 
ATOM   6910  C CG2 . VAL G 1 186 ? 22.445  51.304  29.240  1.00 14.85  ? 186  VAL D CG2 1 
ATOM   6911  N N   . LYS G 1 187 ? 19.713  49.213  26.609  1.00 4.04   ? 187  LYS D N   1 
ATOM   6912  C CA  . LYS G 1 187 ? 18.563  48.951  25.790  1.00 8.37   ? 187  LYS D CA  1 
ATOM   6913  C C   . LYS G 1 187 ? 17.718  47.782  26.234  1.00 18.54  ? 187  LYS D C   1 
ATOM   6914  O O   . LYS G 1 187 ? 16.505  47.839  26.170  1.00 20.40  ? 187  LYS D O   1 
ATOM   6915  C CB  . LYS G 1 187 ? 18.989  48.619  24.393  1.00 7.10   ? 187  LYS D CB  1 
ATOM   6916  C CG  . LYS G 1 187 ? 19.870  49.692  23.812  1.00 17.97  ? 187  LYS D CG  1 
ATOM   6917  C CD  . LYS G 1 187 ? 19.753  49.769  22.293  1.00 38.64  ? 187  LYS D CD  1 
ATOM   6918  C CE  . LYS G 1 187 ? 21.095  49.755  21.522  1.00 92.14  ? 187  LYS D CE  1 
ATOM   6919  N NZ  . LYS G 1 187 ? 21.667  48.411  21.236  1.00 21.76  ? 187  LYS D NZ  1 
ATOM   6920  N N   . LEU G 1 188 ? 18.383  46.679  26.519  1.00 19.55  ? 188  LEU D N   1 
ATOM   6921  C CA  . LEU G 1 188 ? 17.668  45.494  26.879  1.00 15.53  ? 188  LEU D CA  1 
ATOM   6922  C C   . LEU G 1 188 ? 16.855  45.835  28.074  1.00 17.36  ? 188  LEU D C   1 
ATOM   6923  O O   . LEU G 1 188 ? 15.733  45.376  28.240  1.00 19.51  ? 188  LEU D O   1 
ATOM   6924  C CB  . LEU G 1 188 ? 18.649  44.385  27.324  1.00 11.05  ? 188  LEU D CB  1 
ATOM   6925  C CG  . LEU G 1 188 ? 19.369  43.628  26.228  1.00 12.13  ? 188  LEU D CG  1 
ATOM   6926  C CD1 . LEU G 1 188 ? 20.106  42.445  26.811  1.00 9.57   ? 188  LEU D CD1 1 
ATOM   6927  C CD2 . LEU G 1 188 ? 18.444  43.109  25.142  1.00 12.24  ? 188  LEU D CD2 1 
ATOM   6928  N N   . SER G 1 189 ? 17.473  46.603  28.948  1.00 6.09   ? 189  SER D N   1 
ATOM   6929  C CA  . SER G 1 189 ? 16.734  46.849  30.159  1.00 10.27  ? 189  SER D CA  1 
ATOM   6930  C C   . SER G 1 189 ? 15.541  47.701  29.943  1.00 18.63  ? 189  SER D C   1 
ATOM   6931  O O   . SER G 1 189 ? 14.769  47.951  30.867  1.00 20.89  ? 189  SER D O   1 
ATOM   6932  C CB  . SER G 1 189 ? 17.528  47.422  31.288  1.00 16.35  ? 189  SER D CB  1 
ATOM   6933  O OG  . SER G 1 189 ? 18.857  47.001  31.223  1.00 15.31  ? 189  SER D OG  1 
ATOM   6934  N N   . ASN G 1 190 ? 15.471  48.243  28.740  1.00 18.88  ? 190  ASN D N   1 
ATOM   6935  C CA  . ASN G 1 190 ? 14.332  49.107  28.414  1.00 20.58  ? 190  ASN D CA  1 
ATOM   6936  C C   . ASN G 1 190 ? 13.207  48.385  27.758  1.00 29.19  ? 190  ASN D C   1 
ATOM   6937  O O   . ASN G 1 190 ? 12.183  48.970  27.558  1.00 34.30  ? 190  ASN D O   1 
ATOM   6938  C CB  . ASN G 1 190 ? 14.530  50.573  27.944  1.00 18.59  ? 190  ASN D CB  1 
ATOM   6939  C CG  . ASN G 1 190 ? 15.147  51.430  29.003  1.00 101.46 ? 190  ASN D CG  1 
ATOM   6940  O OD1 . ASN G 1 190 ? 14.396  51.933  29.869  1.00 120.18 ? 190  ASN D OD1 1 
ATOM   6941  N ND2 . ASN G 1 190 ? 16.501  51.482  29.020  1.00 89.76  ? 190  ASN D ND2 1 
ATOM   6942  N N   . ILE G 1 191 ? 13.418  47.107  27.450  1.00 25.31  ? 191  ILE D N   1 
ATOM   6943  C CA  . ILE G 1 191 ? 12.363  46.274  26.953  1.00 17.82  ? 191  ILE D CA  1 
ATOM   6944  C C   . ILE G 1 191 ? 11.380  46.189  28.116  1.00 27.30  ? 191  ILE D C   1 
ATOM   6945  O O   . ILE G 1 191 ? 11.661  46.032  29.320  1.00 34.88  ? 191  ILE D O   1 
ATOM   6946  C CB  . ILE G 1 191 ? 12.903  44.940  26.534  1.00 21.12  ? 191  ILE D CB  1 
ATOM   6947  C CG1 . ILE G 1 191 ? 13.748  45.181  25.318  1.00 13.87  ? 191  ILE D CG1 1 
ATOM   6948  C CG2 . ILE G 1 191 ? 11.764  44.028  26.149  1.00 26.89  ? 191  ILE D CG2 1 
ATOM   6949  C CD1 . ILE G 1 191 ? 14.682  44.012  25.053  1.00 11.39  ? 191  ILE D CD1 1 
ATOM   6950  N N   . PRO G 1 192 ? 10.205  46.444  27.736  1.00 21.14  ? 192  PRO D N   1 
ATOM   6951  C CA  . PRO G 1 192 ? 9.101   46.642  28.625  1.00 17.83  ? 192  PRO D CA  1 
ATOM   6952  C C   . PRO G 1 192 ? 8.871   45.606  29.644  1.00 19.97  ? 192  PRO D C   1 
ATOM   6953  O O   . PRO G 1 192 ? 8.743   45.959  30.808  1.00 22.87  ? 192  PRO D O   1 
ATOM   6954  C CB  . PRO G 1 192 ? 7.918   46.977  27.758  1.00 17.55  ? 192  PRO D CB  1 
ATOM   6955  C CG  . PRO G 1 192 ? 8.472   47.333  26.380  1.00 16.14  ? 192  PRO D CG  1 
ATOM   6956  C CD  . PRO G 1 192 ? 9.919   46.838  26.341  1.00 18.64  ? 192  PRO D CD  1 
ATOM   6957  N N   . THR G 1 193 ? 8.873   44.342  29.225  1.00 14.39  ? 193  THR D N   1 
ATOM   6958  C CA  . THR G 1 193 ? 8.717   43.239  30.182  1.00 9.79   ? 193  THR D CA  1 
ATOM   6959  C C   . THR G 1 193 ? 9.853   43.320  31.152  1.00 16.14  ? 193  THR D C   1 
ATOM   6960  O O   . THR G 1 193 ? 9.687   43.198  32.366  1.00 22.19  ? 193  THR D O   1 
ATOM   6961  C CB  . THR G 1 193 ? 8.867   41.935  29.447  1.00 18.10  ? 193  THR D CB  1 
ATOM   6962  O OG1 . THR G 1 193 ? 10.014  42.029  28.625  1.00 32.46  ? 193  THR D OG1 1 
ATOM   6963  C CG2 . THR G 1 193 ? 7.697   41.805  28.518  1.00 1.00   ? 193  THR D CG2 1 
ATOM   6964  N N   . ILE G 1 194 ? 11.020  43.568  30.568  1.00 10.60  ? 194  ILE D N   1 
ATOM   6965  C CA  . ILE G 1 194 ? 12.242  43.652  31.346  1.00 10.39  ? 194  ILE D CA  1 
ATOM   6966  C C   . ILE G 1 194 ? 12.233  44.858  32.222  1.00 18.17  ? 194  ILE D C   1 
ATOM   6967  O O   . ILE G 1 194 ? 12.558  44.803  33.424  1.00 18.32  ? 194  ILE D O   1 
ATOM   6968  C CB  . ILE G 1 194 ? 13.451  43.621  30.451  1.00 10.11  ? 194  ILE D CB  1 
ATOM   6969  C CG1 . ILE G 1 194 ? 13.444  42.267  29.763  1.00 7.74   ? 194  ILE D CG1 1 
ATOM   6970  C CG2 . ILE G 1 194 ? 14.678  43.764  31.302  1.00 3.49   ? 194  ILE D CG2 1 
ATOM   6971  C CD1 . ILE G 1 194 ? 14.626  42.152  28.839  1.00 6.88   ? 194  ILE D CD1 1 
ATOM   6972  N N   . LYS G 1 195 ? 11.820  45.950  31.601  1.00 14.50  ? 195  LYS D N   1 
ATOM   6973  C CA  . LYS G 1 195 ? 11.737  47.186  32.337  1.00 16.16  ? 195  LYS D CA  1 
ATOM   6974  C C   . LYS G 1 195 ? 10.877  46.990  33.567  1.00 18.60  ? 195  LYS D C   1 
ATOM   6975  O O   . LYS G 1 195 ? 11.284  47.368  34.644  1.00 19.12  ? 195  LYS D O   1 
ATOM   6976  C CB  . LYS G 1 195 ? 11.234  48.313  31.474  1.00 14.73  ? 195  LYS D CB  1 
ATOM   6977  C CG  . LYS G 1 195 ? 11.133  49.603  32.261  1.00 22.53  ? 195  LYS D CG  1 
ATOM   6978  C CD  . LYS G 1 195 ? 10.676  50.847  31.452  1.00 45.07  ? 195  LYS D CD  1 
ATOM   6979  C CE  . LYS G 1 195 ? 10.900  52.217  32.131  1.00 63.04  ? 195  LYS D CE  1 
ATOM   6980  N NZ  . LYS G 1 195 ? 9.836   53.208  31.862  1.00 124.12 ? 195  LYS D NZ  1 
ATOM   6981  N N   . ARG G 1 196 ? 9.752   46.272  33.410  1.00 14.87  ? 196  ARG D N   1 
ATOM   6982  C CA  . ARG G 1 196 ? 8.878   46.001  34.541  1.00 14.76  ? 196  ARG D CA  1 
ATOM   6983  C C   . ARG G 1 196 ? 9.518   45.109  35.575  1.00 19.24  ? 196  ARG D C   1 
ATOM   6984  O O   . ARG G 1 196 ? 9.326   45.283  36.777  1.00 21.84  ? 196  ARG D O   1 
ATOM   6985  C CB  . ARG G 1 196 ? 7.531   45.379  34.159  1.00 10.93  ? 196  ARG D CB  1 
ATOM   6986  C CG  . ARG G 1 196 ? 6.570   46.249  33.360  1.00 84.94  ? 196  ARG D CG  1 
ATOM   6987  C CD  . ARG G 1 196 ? 5.442   45.411  32.761  1.00 131.16 ? 196  ARG D CD  1 
ATOM   6988  N NE  . ARG G 1 196 ? 5.140   45.746  31.371  1.00 172.78 ? 196  ARG D NE  1 
ATOM   6989  C CZ  . ARG G 1 196 ? 4.908   44.813  30.451  1.00 214.26 ? 196  ARG D CZ  1 
ATOM   6990  N NH1 . ARG G 1 196 ? 4.969   43.513  30.763  1.00 205.59 ? 196  ARG D NH1 1 
ATOM   6991  N NH2 . ARG G 1 196 ? 4.629   45.185  29.197  1.00 215.17 ? 196  ARG D NH2 1 
ATOM   6992  N N   . PHE G 1 197 ? 10.194  44.088  35.078  1.00 21.18  ? 197  PHE D N   1 
ATOM   6993  C CA  . PHE G 1 197 ? 10.816  43.100  35.948  1.00 19.20  ? 197  PHE D CA  1 
ATOM   6994  C C   . PHE G 1 197 ? 11.792  43.810  36.831  1.00 18.79  ? 197  PHE D C   1 
ATOM   6995  O O   . PHE G 1 197 ? 11.950  43.512  37.994  1.00 14.50  ? 197  PHE D O   1 
ATOM   6996  C CB  . PHE G 1 197 ? 11.520  42.004  35.105  1.00 16.60  ? 197  PHE D CB  1 
ATOM   6997  C CG  . PHE G 1 197 ? 12.045  40.839  35.921  1.00 16.51  ? 197  PHE D CG  1 
ATOM   6998  C CD1 . PHE G 1 197 ? 11.159  39.953  36.549  1.00 17.86  ? 197  PHE D CD1 1 
ATOM   6999  C CD2 . PHE G 1 197 ? 13.416  40.585  36.020  1.00 11.93  ? 197  PHE D CD2 1 
ATOM   7000  C CE1 . PHE G 1 197 ? 11.603  38.878  37.322  1.00 9.94   ? 197  PHE D CE1 1 
ATOM   7001  C CE2 . PHE G 1 197 ? 13.882  39.520  36.793  1.00 10.07  ? 197  PHE D CE2 1 
ATOM   7002  C CZ  . PHE G 1 197 ? 12.977  38.674  37.438  1.00 6.81   ? 197  PHE D CZ  1 
ATOM   7003  N N   . LEU G 1 198 ? 12.449  44.769  36.234  1.00 13.52  ? 198  LEU D N   1 
ATOM   7004  C CA  . LEU G 1 198 ? 13.398  45.516  36.981  1.00 17.31  ? 198  LEU D CA  1 
ATOM   7005  C C   . LEU G 1 198 ? 12.762  46.467  37.950  1.00 28.14  ? 198  LEU D C   1 
ATOM   7006  O O   . LEU G 1 198 ? 13.354  46.807  38.954  1.00 31.92  ? 198  LEU D O   1 
ATOM   7007  C CB  . LEU G 1 198 ? 14.323  46.263  36.049  1.00 17.25  ? 198  LEU D CB  1 
ATOM   7008  C CG  . LEU G 1 198 ? 15.135  45.263  35.291  1.00 16.15  ? 198  LEU D CG  1 
ATOM   7009  C CD1 . LEU G 1 198 ? 15.846  45.950  34.174  1.00 6.63   ? 198  LEU D CD1 1 
ATOM   7010  C CD2 . LEU G 1 198 ? 16.122  44.630  36.244  1.00 15.83  ? 198  LEU D CD2 1 
ATOM   7011  N N   . GLU G 1 199 ? 11.543  46.865  37.654  1.00 30.95  ? 199  GLU D N   1 
ATOM   7012  C CA  . GLU G 1 199 ? 10.804  47.739  38.545  1.00 31.65  ? 199  GLU D CA  1 
ATOM   7013  C C   . GLU G 1 199 ? 10.246  46.990  39.730  1.00 40.90  ? 199  GLU D C   1 
ATOM   7014  O O   . GLU G 1 199 ? 10.167  45.775  39.774  1.00 48.36  ? 199  GLU D O   1 
ATOM   7015  C CB  . GLU G 1 199 ? 9.655   48.484  37.842  1.00 33.09  ? 199  GLU D CB  1 
ATOM   7016  C CG  . GLU G 1 199 ? 10.117  49.689  37.009  1.00 16.15  ? 199  GLU D CG  1 
ATOM   7017  C CD  . GLU G 1 199 ? 9.221   50.062  35.861  1.00 54.57  ? 199  GLU D CD  1 
ATOM   7018  O OE1 . GLU G 1 199 ? 8.052   49.661  35.697  1.00 50.51  ? 199  GLU D OE1 1 
ATOM   7019  O OE2 . GLU G 1 199 ? 9.849   50.930  35.093  1.00 47.42  ? 199  GLU D OE2 1 
ATOM   7020  N N   . PRO G 1 200 ? 9.821   47.758  40.689  1.00 40.19  ? 200  PRO D N   1 
ATOM   7021  C CA  . PRO G 1 200 ? 9.265   47.264  41.915  1.00 38.67  ? 200  PRO D CA  1 
ATOM   7022  C C   . PRO G 1 200 ? 8.007   46.459  41.778  1.00 39.52  ? 200  PRO D C   1 
ATOM   7023  O O   . PRO G 1 200 ? 7.151   46.675  40.888  1.00 40.62  ? 200  PRO D O   1 
ATOM   7024  C CB  . PRO G 1 200 ? 9.034   48.476  42.790  1.00 40.92  ? 200  PRO D CB  1 
ATOM   7025  C CG  . PRO G 1 200 ? 9.996   49.513  42.263  1.00 47.45  ? 200  PRO D CG  1 
ATOM   7026  C CD  . PRO G 1 200 ? 10.415  49.084  40.869  1.00 43.09  ? 200  PRO D CD  1 
ATOM   7027  N N   . GLY G 1 201 ? 7.936   45.495  42.691  1.00 32.36  ? 201  GLY D N   1 
ATOM   7028  C CA  . GLY G 1 201 ? 6.800   44.606  42.708  1.00 29.94  ? 201  GLY D CA  1 
ATOM   7029  C C   . GLY G 1 201 ? 6.843   43.452  41.700  1.00 38.66  ? 201  GLY D C   1 
ATOM   7030  O O   . GLY G 1 201 ? 5.793   42.851  41.475  1.00 44.65  ? 201  GLY D O   1 
ATOM   7031  N N   . SER G 1 202 ? 8.043   43.133  41.110  1.00 26.51  ? 202  SER D N   1 
ATOM   7032  C CA  . SER G 1 202 ? 8.220   42.047  40.147  1.00 13.49  ? 202  SER D CA  1 
ATOM   7033  C C   . SER G 1 202 ? 8.499   40.800  40.956  1.00 20.44  ? 202  SER D C   1 
ATOM   7034  O O   . SER G 1 202 ? 8.630   40.884  42.207  1.00 27.79  ? 202  SER D O   1 
ATOM   7035  C CB  . SER G 1 202 ? 9.372   42.331  39.198  1.00 11.17  ? 202  SER D CB  1 
ATOM   7036  O OG  . SER G 1 202 ? 10.536  42.532  39.989  1.00 33.64  ? 202  SER D OG  1 
ATOM   7037  N N   . LYS G 1 203 ? 8.583   39.638  40.300  1.00 16.86  ? 203  LYS D N   1 
ATOM   7038  C CA  . LYS G 1 203 ? 8.928   38.477  41.112  1.00 12.34  ? 203  LYS D CA  1 
ATOM   7039  C C   . LYS G 1 203 ? 10.473  38.305  41.163  1.00 15.77  ? 203  LYS D C   1 
ATOM   7040  O O   . LYS G 1 203 ? 11.007  37.414  41.775  1.00 15.65  ? 203  LYS D O   1 
ATOM   7041  C CB  . LYS G 1 203 ? 8.124   37.230  40.812  1.00 12.78  ? 203  LYS D CB  1 
ATOM   7042  C CG  . LYS G 1 203 ? 6.622   37.371  41.158  1.00 11.84  ? 203  LYS D CG  1 
ATOM   7043  C CD  . LYS G 1 203 ? 5.739   36.139  40.874  1.00 32.90  ? 203  LYS D CD  1 
ATOM   7044  C CE  . LYS G 1 203 ? 4.216   36.355  40.834  1.00 4.97   ? 203  LYS D CE  1 
ATOM   7045  N NZ  . LYS G 1 203 ? 3.802   37.397  39.838  1.00 139.36 ? 203  LYS D NZ  1 
ATOM   7046  N N   . LYS G 1 204 ? 11.166  39.274  40.578  1.00 9.39   ? 204  LYS D N   1 
ATOM   7047  C CA  . LYS G 1 204 ? 12.581  39.367  40.592  1.00 10.47  ? 204  LYS D CA  1 
ATOM   7048  C C   . LYS G 1 204 ? 12.988  39.360  42.038  1.00 13.83  ? 204  LYS D C   1 
ATOM   7049  O O   . LYS G 1 204 ? 12.360  39.986  42.832  1.00 18.60  ? 204  LYS D O   1 
ATOM   7050  C CB  . LYS G 1 204 ? 12.968  40.684  39.946  1.00 12.59  ? 204  LYS D CB  1 
ATOM   7051  C CG  . LYS G 1 204 ? 14.428  41.002  40.140  1.00 1.00   ? 204  LYS D CG  1 
ATOM   7052  C CD  . LYS G 1 204 ? 14.968  42.028  39.148  1.00 12.50  ? 204  LYS D CD  1 
ATOM   7053  C CE  . LYS G 1 204 ? 16.496  42.063  39.066  1.00 1.00   ? 204  LYS D CE  1 
ATOM   7054  N NZ  . LYS G 1 204 ? 17.128  41.654  40.332  1.00 19.12  ? 204  LYS D NZ  1 
ATOM   7055  N N   . LYS G 1 205 ? 13.990  38.584  42.386  1.00 15.72  ? 205  LYS D N   1 
ATOM   7056  C CA  . LYS G 1 205 ? 14.445  38.462  43.759  1.00 12.07  ? 205  LYS D CA  1 
ATOM   7057  C C   . LYS G 1 205 ? 15.727  39.228  44.018  1.00 19.49  ? 205  LYS D C   1 
ATOM   7058  O O   . LYS G 1 205 ? 16.594  39.461  43.188  1.00 26.86  ? 205  LYS D O   1 
ATOM   7059  C CB  . LYS G 1 205 ? 14.669  36.994  44.129  1.00 8.61   ? 205  LYS D CB  1 
ATOM   7060  C CG  . LYS G 1 205 ? 13.459  36.143  43.837  1.00 17.48  ? 205  LYS D CG  1 
ATOM   7061  C CD  . LYS G 1 205 ? 12.543  36.038  45.042  1.00 9.28   ? 205  LYS D CD  1 
ATOM   7062  C CE  . LYS G 1 205 ? 11.243  35.300  44.771  1.00 1.00   ? 205  LYS D CE  1 
ATOM   7063  N NZ  . LYS G 1 205 ? 10.357  36.084  43.930  1.00 6.31   ? 205  LYS D NZ  1 
ATOM   7064  N N   . PRO G 1 206 ? 15.847  39.570  45.242  1.00 14.76  ? 206  PRO D N   1 
ATOM   7065  C CA  . PRO G 1 206 ? 16.963  40.284  45.821  1.00 11.27  ? 206  PRO D CA  1 
ATOM   7066  C C   . PRO G 1 206 ? 18.121  39.394  46.059  1.00 15.22  ? 206  PRO D C   1 
ATOM   7067  O O   . PRO G 1 206 ? 18.019  38.176  46.088  1.00 21.81  ? 206  PRO D O   1 
ATOM   7068  C CB  . PRO G 1 206 ? 16.537  40.676  47.193  1.00 7.94   ? 206  PRO D CB  1 
ATOM   7069  C CG  . PRO G 1 206 ? 15.350  39.786  47.515  1.00 14.45  ? 206  PRO D CG  1 
ATOM   7070  C CD  . PRO G 1 206 ? 14.879  39.129  46.227  1.00 14.12  ? 206  PRO D CD  1 
ATOM   7071  N N   . PRO G 1 207 ? 19.200  40.044  46.251  1.00 10.85  ? 207  PRO D N   1 
ATOM   7072  C CA  . PRO G 1 207 ? 20.421  39.351  46.475  1.00 11.11  ? 207  PRO D CA  1 
ATOM   7073  C C   . PRO G 1 207 ? 20.185  38.757  47.792  1.00 25.21  ? 207  PRO D C   1 
ATOM   7074  O O   . PRO G 1 207 ? 19.526  39.350  48.611  1.00 31.74  ? 207  PRO D O   1 
ATOM   7075  C CB  . PRO G 1 207 ? 21.491  40.443  46.539  1.00 7.59   ? 207  PRO D CB  1 
ATOM   7076  C CG  . PRO G 1 207 ? 20.873  41.684  45.903  1.00 8.00   ? 207  PRO D CG  1 
ATOM   7077  C CD  . PRO G 1 207 ? 19.379  41.486  46.021  1.00 7.14   ? 207  PRO D CD  1 
ATOM   7078  N N   . PRO G 1 208 ? 20.625  37.561  47.915  1.00 29.08  ? 208  PRO D N   1 
ATOM   7079  C CA  . PRO G 1 208 ? 20.529  36.735  49.091  1.00 30.67  ? 208  PRO D CA  1 
ATOM   7080  C C   . PRO G 1 208 ? 21.209  37.292  50.308  1.00 32.66  ? 208  PRO D C   1 
ATOM   7081  O O   . PRO G 1 208 ? 22.330  37.756  50.208  1.00 36.10  ? 208  PRO D O   1 
ATOM   7082  C CB  . PRO G 1 208 ? 21.316  35.507  48.725  1.00 31.72  ? 208  PRO D CB  1 
ATOM   7083  C CG  . PRO G 1 208 ? 22.196  35.901  47.560  1.00 35.02  ? 208  PRO D CG  1 
ATOM   7084  C CD  . PRO G 1 208 ? 21.630  37.149  46.959  1.00 26.22  ? 208  PRO D CD  1 
ATOM   7085  N N   . ASP G 1 209 ? 20.507  37.135  51.432  1.00 30.07  ? 209  ASP D N   1 
ATOM   7086  C CA  . ASP G 1 209 ? 20.852  37.541  52.784  1.00 30.10  ? 209  ASP D CA  1 
ATOM   7087  C C   . ASP G 1 209 ? 21.155  36.354  53.667  1.00 35.70  ? 209  ASP D C   1 
ATOM   7088  O O   . ASP G 1 209 ? 20.938  35.174  53.329  1.00 35.20  ? 209  ASP D O   1 
ATOM   7089  C CB  . ASP G 1 209 ? 19.675  38.316  53.444  1.00 33.91  ? 209  ASP D CB  1 
ATOM   7090  C CG  . ASP G 1 209 ? 18.350  37.676  53.158  1.00 69.22  ? 209  ASP D CG  1 
ATOM   7091  O OD1 . ASP G 1 209 ? 18.088  36.533  53.479  1.00 74.62  ? 209  ASP D OD1 1 
ATOM   7092  O OD2 . ASP G 1 209 ? 17.624  38.372  52.322  1.00 99.67  ? 209  ASP D OD2 1 
ATOM   7093  N N   . GLU G 1 210 ? 21.590  36.720  54.849  1.00 38.21  ? 210  GLU D N   1 
ATOM   7094  C CA  . GLU G 1 210 ? 21.917  35.762  55.863  1.00 46.01  ? 210  GLU D CA  1 
ATOM   7095  C C   . GLU G 1 210 ? 20.733  34.830  56.096  1.00 38.12  ? 210  GLU D C   1 
ATOM   7096  O O   . GLU G 1 210 ? 20.855  33.642  56.403  1.00 37.81  ? 210  GLU D O   1 
ATOM   7097  C CB  . GLU G 1 210 ? 22.328  36.523  57.144  1.00 55.83  ? 210  GLU D CB  1 
ATOM   7098  C CG  . GLU G 1 210 ? 22.885  35.641  58.293  1.00 125.54 ? 210  GLU D CG  1 
ATOM   7099  C CD  . GLU G 1 210 ? 21.830  34.922  59.119  1.00 218.62 ? 210  GLU D CD  1 
ATOM   7100  O OE1 . GLU G 1 210 ? 20.824  35.459  59.560  1.00 242.90 ? 210  GLU D OE1 1 
ATOM   7101  O OE2 . GLU G 1 210 ? 22.134  33.666  59.358  1.00 231.97 ? 210  GLU D OE2 1 
ATOM   7102  N N   . ILE G 1 211 ? 19.554  35.349  55.903  1.00 27.64  ? 211  ILE D N   1 
ATOM   7103  C CA  . ILE G 1 211 ? 18.413  34.500  56.116  1.00 30.80  ? 211  ILE D CA  1 
ATOM   7104  C C   . ILE G 1 211 ? 18.267  33.424  55.074  1.00 31.42  ? 211  ILE D C   1 
ATOM   7105  O O   . ILE G 1 211 ? 18.155  32.259  55.434  1.00 33.61  ? 211  ILE D O   1 
ATOM   7106  C CB  . ILE G 1 211 ? 17.133  35.307  56.113  1.00 40.88  ? 211  ILE D CB  1 
ATOM   7107  C CG1 . ILE G 1 211 ? 16.936  36.092  57.409  1.00 44.20  ? 211  ILE D CG1 1 
ATOM   7108  C CG2 . ILE G 1 211 ? 15.964  34.389  55.806  1.00 43.55  ? 211  ILE D CG2 1 
ATOM   7109  C CD1 . ILE G 1 211 ? 18.027  37.154  57.605  1.00 91.48  ? 211  ILE D CD1 1 
ATOM   7110  N N   . TYR G 1 212 ? 18.175  33.869  53.806  1.00 20.70  ? 212  TYR D N   1 
ATOM   7111  C CA  . TYR G 1 212 ? 18.047  32.970  52.703  1.00 19.94  ? 212  TYR D CA  1 
ATOM   7112  C C   . TYR G 1 212 ? 19.115  31.891  52.882  1.00 24.87  ? 212  TYR D C   1 
ATOM   7113  O O   . TYR G 1 212 ? 18.874  30.656  52.848  1.00 22.05  ? 212  TYR D O   1 
ATOM   7114  C CB  . TYR G 1 212 ? 18.273  33.717  51.384  1.00 18.24  ? 212  TYR D CB  1 
ATOM   7115  C CG  . TYR G 1 212 ? 18.436  32.792  50.199  1.00 23.41  ? 212  TYR D CG  1 
ATOM   7116  C CD1 . TYR G 1 212 ? 17.341  32.141  49.607  1.00 21.68  ? 212  TYR D CD1 1 
ATOM   7117  C CD2 . TYR G 1 212 ? 19.709  32.577  49.650  1.00 31.30  ? 212  TYR D CD2 1 
ATOM   7118  C CE1 . TYR G 1 212 ? 17.531  31.293  48.502  1.00 20.53  ? 212  TYR D CE1 1 
ATOM   7119  C CE2 . TYR G 1 212 ? 19.919  31.735  48.546  1.00 34.43  ? 212  TYR D CE2 1 
ATOM   7120  C CZ  . TYR G 1 212 ? 18.820  31.080  47.976  1.00 44.89  ? 212  TYR D CZ  1 
ATOM   7121  O OH  . TYR G 1 212 ? 19.038  30.195  46.929  1.00 44.17  ? 212  TYR D OH  1 
ATOM   7122  N N   . VAL G 1 213 ? 20.291  32.387  53.211  1.00 8.44   ? 213  VAL D N   1 
ATOM   7123  C CA  . VAL G 1 213 ? 21.341  31.439  53.377  1.00 8.96   ? 213  VAL D CA  1 
ATOM   7124  C C   . VAL G 1 213 ? 21.083  30.406  54.407  1.00 19.43  ? 213  VAL D C   1 
ATOM   7125  O O   . VAL G 1 213 ? 21.105  29.220  54.137  1.00 23.29  ? 213  VAL D O   1 
ATOM   7126  C CB  . VAL G 1 213 ? 22.643  32.108  53.586  1.00 8.72   ? 213  VAL D CB  1 
ATOM   7127  C CG1 . VAL G 1 213 ? 23.628  30.977  53.764  1.00 3.46   ? 213  VAL D CG1 1 
ATOM   7128  C CG2 . VAL G 1 213 ? 22.958  32.949  52.335  1.00 5.20   ? 213  VAL D CG2 1 
ATOM   7129  N N   . ARG G 1 214 ? 20.659  30.885  55.523  1.00 24.33  ? 214  ARG D N   1 
ATOM   7130  C CA  . ARG G 1 214 ? 20.273  30.038  56.620  1.00 26.47  ? 214  ARG D CA  1 
ATOM   7131  C C   . ARG G 1 214 ? 19.207  29.073  56.181  1.00 23.21  ? 214  ARG D C   1 
ATOM   7132  O O   . ARG G 1 214 ? 19.302  27.874  56.296  1.00 23.56  ? 214  ARG D O   1 
ATOM   7133  C CB  . ARG G 1 214 ? 19.628  30.913  57.674  1.00 47.19  ? 214  ARG D CB  1 
ATOM   7134  C CG  . ARG G 1 214 ? 19.799  30.339  59.069  1.00 121.11 ? 214  ARG D CG  1 
ATOM   7135  C CD  . ARG G 1 214 ? 21.111  29.568  59.246  1.00 191.70 ? 214  ARG D CD  1 
ATOM   7136  N NE  . ARG G 1 214 ? 21.163  28.750  60.464  1.00 254.17 ? 214  ARG D NE  1 
ATOM   7137  C CZ  . ARG G 1 214 ? 20.584  29.042  61.639  1.00 300.00 ? 214  ARG D CZ  1 
ATOM   7138  N NH1 . ARG G 1 214 ? 19.886  30.159  61.848  1.00 300.00 ? 214  ARG D NH1 1 
ATOM   7139  N NH2 . ARG G 1 214 ? 20.725  28.189  62.653  1.00 300.00 ? 214  ARG D NH2 1 
ATOM   7140  N N   . THR G 1 215 ? 18.175  29.614  55.626  1.00 15.52  ? 215  THR D N   1 
ATOM   7141  C CA  . THR G 1 215 ? 17.088  28.799  55.194  1.00 11.87  ? 215  THR D CA  1 
ATOM   7142  C C   . THR G 1 215 ? 17.478  27.724  54.228  1.00 23.89  ? 215  THR D C   1 
ATOM   7143  O O   . THR G 1 215 ? 16.941  26.620  54.303  1.00 25.01  ? 215  THR D O   1 
ATOM   7144  C CB  . THR G 1 215 ? 16.138  29.669  54.394  1.00 22.07  ? 215  THR D CB  1 
ATOM   7145  O OG1 . THR G 1 215 ? 15.469  30.622  55.168  1.00 34.28  ? 215  THR D OG1 1 
ATOM   7146  C CG2 . THR G 1 215 ? 15.159  28.721  53.766  1.00 13.80  ? 215  THR D CG2 1 
ATOM   7147  N N   . VAL G 1 216 ? 18.321  28.078  53.252  1.00 24.68  ? 216  VAL D N   1 
ATOM   7148  C CA  . VAL G 1 216 ? 18.628  27.070  52.284  1.00 23.39  ? 216  VAL D CA  1 
ATOM   7149  C C   . VAL G 1 216 ? 19.309  25.952  52.948  1.00 26.73  ? 216  VAL D C   1 
ATOM   7150  O O   . VAL G 1 216 ? 18.955  24.799  52.744  1.00 27.42  ? 216  VAL D O   1 
ATOM   7151  C CB  . VAL G 1 216 ? 19.170  27.499  50.936  1.00 27.02  ? 216  VAL D CB  1 
ATOM   7152  C CG1 . VAL G 1 216 ? 18.473  28.771  50.574  1.00 24.78  ? 216  VAL D CG1 1 
ATOM   7153  C CG2 . VAL G 1 216 ? 20.637  27.736  50.979  1.00 30.89  ? 216  VAL D CG2 1 
ATOM   7154  N N   . TYR G 1 217 ? 20.210  26.313  53.810  1.00 26.74  ? 217  TYR D N   1 
ATOM   7155  C CA  . TYR G 1 217 ? 20.872  25.281  54.571  1.00 31.47  ? 217  TYR D CA  1 
ATOM   7156  C C   . TYR G 1 217 ? 19.867  24.470  55.341  1.00 36.69  ? 217  TYR D C   1 
ATOM   7157  O O   . TYR G 1 217 ? 19.928  23.275  55.463  1.00 39.94  ? 217  TYR D O   1 
ATOM   7158  C CB  . TYR G 1 217 ? 21.805  25.856  55.607  1.00 37.04  ? 217  TYR D CB  1 
ATOM   7159  C CG  . TYR G 1 217 ? 23.116  26.282  55.046  1.00 57.37  ? 217  TYR D CG  1 
ATOM   7160  C CD1 . TYR G 1 217 ? 23.944  25.415  54.330  1.00 62.60  ? 217  TYR D CD1 1 
ATOM   7161  C CD2 . TYR G 1 217 ? 23.592  27.565  55.318  1.00 69.49  ? 217  TYR D CD2 1 
ATOM   7162  C CE1 . TYR G 1 217 ? 25.201  25.834  53.875  1.00 73.92  ? 217  TYR D CE1 1 
ATOM   7163  C CE2 . TYR G 1 217 ? 24.852  27.994  54.887  1.00 74.53  ? 217  TYR D CE2 1 
ATOM   7164  C CZ  . TYR G 1 217 ? 25.670  27.125  54.159  1.00 80.38  ? 217  TYR D CZ  1 
ATOM   7165  O OH  . TYR G 1 217 ? 26.936  27.543  53.750  1.00 63.60  ? 217  TYR D OH  1 
ATOM   7166  N N   . ASN G 1 218 ? 18.870  25.119  55.849  1.00 38.49  ? 218  ASN D N   1 
ATOM   7167  C CA  . ASN G 1 218 ? 17.940  24.316  56.579  1.00 38.84  ? 218  ASN D CA  1 
ATOM   7168  C C   . ASN G 1 218 ? 17.141  23.369  55.728  1.00 42.20  ? 218  ASN D C   1 
ATOM   7169  O O   . ASN G 1 218 ? 16.731  22.340  56.210  1.00 53.50  ? 218  ASN D O   1 
ATOM   7170  C CB  . ASN G 1 218 ? 17.116  25.087  57.629  1.00 38.59  ? 218  ASN D CB  1 
ATOM   7171  C CG  . ASN G 1 218 ? 18.042  25.749  58.635  1.00 97.21  ? 218  ASN D CG  1 
ATOM   7172  O OD1 . ASN G 1 218 ? 17.657  26.736  59.285  1.00 142.34 ? 218  ASN D OD1 1 
ATOM   7173  N ND2 . ASN G 1 218 ? 19.281  25.238  58.729  1.00 74.68  ? 218  ASN D ND2 1 
ATOM   7174  N N   . ILE G 1 219 ? 16.906  23.688  54.482  1.00 26.47  ? 219  ILE D N   1 
ATOM   7175  C CA  . ILE G 1 219 ? 16.109  22.796  53.706  1.00 21.54  ? 219  ILE D CA  1 
ATOM   7176  C C   . ILE G 1 219 ? 16.904  21.719  53.041  1.00 32.02  ? 219  ILE D C   1 
ATOM   7177  O O   . ILE G 1 219 ? 16.345  20.713  52.657  1.00 34.29  ? 219  ILE D O   1 
ATOM   7178  C CB  . ILE G 1 219 ? 15.498  23.650  52.660  1.00 23.46  ? 219  ILE D CB  1 
ATOM   7179  C CG1 . ILE G 1 219 ? 14.862  24.825  53.370  1.00 21.97  ? 219  ILE D CG1 1 
ATOM   7180  C CG2 . ILE G 1 219 ? 14.485  22.895  51.845  1.00 22.56  ? 219  ILE D CG2 1 
ATOM   7181  C CD1 . ILE G 1 219 ? 14.316  25.803  52.333  1.00 18.18  ? 219  ILE D CD1 1 
ATOM   7182  N N   . PHE G 1 220 ? 18.218  21.899  52.905  1.00 31.03  ? 220  PHE D N   1 
ATOM   7183  C CA  . PHE G 1 220 ? 19.046  20.918  52.178  1.00 29.59  ? 220  PHE D CA  1 
ATOM   7184  C C   . PHE G 1 220 ? 20.384  20.423  52.832  1.00 44.12  ? 220  PHE D C   1 
ATOM   7185  O O   . PHE G 1 220 ? 20.689  20.397  54.055  1.00 60.72  ? 220  PHE D O   1 
ATOM   7186  C CB  . PHE G 1 220 ? 19.424  21.576  50.835  1.00 33.70  ? 220  PHE D CB  1 
ATOM   7187  C CG  . PHE G 1 220 ? 18.379  22.209  49.913  1.00 34.38  ? 220  PHE D CG  1 
ATOM   7188  C CD1 . PHE G 1 220 ? 17.465  21.419  49.220  1.00 36.48  ? 220  PHE D CD1 1 
ATOM   7189  C CD2 . PHE G 1 220 ? 18.418  23.559  49.573  1.00 38.85  ? 220  PHE D CD2 1 
ATOM   7190  C CE1 . PHE G 1 220 ? 16.556  21.955  48.310  1.00 36.82  ? 220  PHE D CE1 1 
ATOM   7191  C CE2 . PHE G 1 220 ? 17.521  24.122  48.662  1.00 41.89  ? 220  PHE D CE2 1 
ATOM   7192  C CZ  . PHE G 1 220 ? 16.569  23.320  48.043  1.00 38.16  ? 220  PHE D CZ  1 
HETATM 7193  N N   . GGL H 2 1   ? 21.693  20.762  37.871  1.00 37.15  ? 231  GGL L N   1 
HETATM 7194  C CA  . GGL H 2 1   ? 20.440  20.981  38.585  1.00 7.63   ? 231  GGL L CA  1 
HETATM 7195  C C   . GGL H 2 1   ? 19.741  22.282  38.197  1.00 7.03   ? 231  GGL L C   1 
HETATM 7196  O O   . GGL H 2 1   ? 18.474  22.237  38.176  1.00 19.40  ? 231  GGL L O   1 
HETATM 7197  C CB  . GGL H 2 1   ? 20.657  20.838  40.075  1.00 6.19   ? 231  GGL L CB  1 
HETATM 7198  C CG  . GGL H 2 1   ? 19.546  21.394  40.953  1.00 24.61  ? 231  GGL L CG  1 
HETATM 7199  C CD  . GGL H 2 1   ? 19.973  21.233  42.398  1.00 18.75  ? 231  GGL L CD  1 
HETATM 7200  O OE1 . GGL H 2 1   ? 21.147  21.069  42.721  1.00 36.14  ? 231  GGL L OE1 1 
HETATM 7201  O OXT . GGL H 2 1   ? 20.478  23.200  37.724  1.00 43.52  ? 231  GGL L OXT 1 
HETATM 7202  C C   . ICY H 2 2   ? 18.077  20.381  45.319  1.00 29.74  ? 232  ICY L C   1 
HETATM 7203  N N   . ICY H 2 2   ? 18.997  21.307  43.282  1.00 39.29  ? 232  ICY L N   1 
HETATM 7204  O O   . ICY H 2 2   ? 16.891  20.448  44.906  1.00 26.16  ? 232  ICY L O   1 
HETATM 7205  C CA  . ICY H 2 2   ? 19.234  21.150  44.705  1.00 38.11  ? 232  ICY L CA  1 
HETATM 7206  C CB  . ICY H 2 2   ? 19.563  22.486  45.428  1.00 43.28  ? 232  ICY L CB  1 
HETATM 7207  S SG  . ICY H 2 2   ? 21.146  23.252  44.930  1.00 46.76  ? 232  ICY L SG  1 
HETATM 7208  I I   . ICY H 2 2   ? 21.116  27.275  45.654  1.00 90.26  ? 232  ICY L I   1 
HETATM 7209  C C0  . ICY H 2 2   ? 21.617  24.195  46.394  1.00 300.00 ? 232  ICY L C0  1 
HETATM 7210  C C1  . ICY H 2 2   ? 22.908  24.865  46.037  1.00 300.00 ? 232  ICY L C1  1 
HETATM 7211  C C2  . ICY H 2 2   ? 22.904  26.177  45.545  1.00 5.69   ? 232  ICY L C2  1 
HETATM 7212  C C3  . ICY H 2 2   ? 24.142  26.715  45.191  1.00 31.59  ? 232  ICY L C3  1 
HETATM 7213  C C4  . ICY H 2 2   ? 25.314  25.947  45.252  1.00 15.35  ? 232  ICY L C4  1 
HETATM 7214  C C5  . ICY H 2 2   ? 25.277  24.608  45.634  1.00 300.00 ? 232  ICY L C5  1 
HETATM 7215  C C6  . ICY H 2 2   ? 24.053  24.067  46.019  1.00 300.00 ? 232  ICY L C6  1 
ATOM   7216  N N   . GLY H 2 3   ? 18.436  19.539  46.259  1.00 27.44  ? 233  GLY L N   1 
ATOM   7217  C CA  . GLY H 2 3   ? 17.413  18.708  46.888  1.00 23.21  ? 233  GLY L CA  1 
ATOM   7218  C C   . GLY H 2 3   ? 18.005  17.444  47.450  1.00 26.89  ? 233  GLY L C   1 
ATOM   7219  O O   . GLY H 2 3   ? 17.341  16.907  48.378  1.00 47.64  ? 233  GLY L O   1 
ATOM   7220  O OXT . GLY H 2 3   ? 19.139  17.134  46.962  1.00 83.82  ? 233  GLY L OXT 1 
ATOM   7221  N N   . ARG I 1 4   ? 8.977   47.389  -41.068 1.00 32.33  ? 4    ARG E N   1 
ATOM   7222  C CA  . ARG I 1 4   ? 8.067   47.051  -39.948 1.00 27.54  ? 4    ARG E CA  1 
ATOM   7223  C C   . ARG I 1 4   ? 8.860   46.495  -38.743 1.00 35.94  ? 4    ARG E C   1 
ATOM   7224  O O   . ARG I 1 4   ? 9.519   45.453  -38.839 1.00 45.21  ? 4    ARG E O   1 
ATOM   7225  C CB  . ARG I 1 4   ? 7.028   46.091  -40.526 1.00 27.89  ? 4    ARG E CB  1 
ATOM   7226  C CG  . ARG I 1 4   ? 5.902   45.467  -39.706 1.00 16.86  ? 4    ARG E CG  1 
ATOM   7227  C CD  . ARG I 1 4   ? 4.768   44.871  -40.620 1.00 21.30  ? 4    ARG E CD  1 
ATOM   7228  N NE  . ARG I 1 4   ? 3.629   44.356  -39.839 1.00 55.57  ? 4    ARG E NE  1 
ATOM   7229  C CZ  . ARG I 1 4   ? 2.353   44.157  -40.204 1.00 124.64 ? 4    ARG E CZ  1 
ATOM   7230  N NH1 . ARG I 1 4   ? 1.908   44.399  -41.440 1.00 187.32 ? 4    ARG E NH1 1 
ATOM   7231  N NH2 . ARG I 1 4   ? 1.509   43.683  -39.267 1.00 64.09  ? 4    ARG E NH2 1 
ATOM   7232  N N   . PRO I 1 5   ? 8.812   47.194  -37.587 1.00 19.55  ? 5    PRO E N   1 
ATOM   7233  C CA  . PRO I 1 5   ? 9.582   46.781  -36.441 1.00 10.62  ? 5    PRO E CA  1 
ATOM   7234  C C   . PRO I 1 5   ? 9.303   45.426  -35.976 1.00 13.02  ? 5    PRO E C   1 
ATOM   7235  O O   . PRO I 1 5   ? 8.165   44.930  -36.037 1.00 17.31  ? 5    PRO E O   1 
ATOM   7236  C CB  . PRO I 1 5   ? 9.277   47.763  -35.352 1.00 13.08  ? 5    PRO E CB  1 
ATOM   7237  C CG  . PRO I 1 5   ? 8.825   49.014  -36.073 1.00 14.67  ? 5    PRO E CG  1 
ATOM   7238  C CD  . PRO I 1 5   ? 8.140   48.488  -37.299 1.00 15.20  ? 5    PRO E CD  1 
ATOM   7239  N N   . LYS I 1 6   ? 10.385  44.865  -35.480 1.00 10.63  ? 6    LYS E N   1 
ATOM   7240  C CA  . LYS I 1 6   ? 10.331  43.533  -34.973 1.00 12.09  ? 6    LYS E CA  1 
ATOM   7241  C C   . LYS I 1 6   ? 10.810  43.514  -33.544 1.00 19.24  ? 6    LYS E C   1 
ATOM   7242  O O   . LYS I 1 6   ? 11.900  43.965  -33.190 1.00 23.36  ? 6    LYS E O   1 
ATOM   7243  C CB  . LYS I 1 6   ? 11.084  42.586  -35.864 1.00 12.50  ? 6    LYS E CB  1 
ATOM   7244  C CG  . LYS I 1 6   ? 10.869  41.126  -35.519 1.00 5.59   ? 6    LYS E CG  1 
ATOM   7245  C CD  . LYS I 1 6   ? 11.466  40.181  -36.539 1.00 22.77  ? 6    LYS E CD  1 
ATOM   7246  C CE  . LYS I 1 6   ? 10.453  39.550  -37.499 1.00 101.78 ? 6    LYS E CE  1 
ATOM   7247  N NZ  . LYS I 1 6   ? 10.603  38.084  -37.657 1.00 121.13 ? 6    LYS E NZ  1 
ATOM   7248  N N   . LEU I 1 7   ? 9.918   42.994  -32.747 1.00 10.70  ? 7    LEU E N   1 
ATOM   7249  C CA  . LEU I 1 7   ? 10.077  42.900  -31.342 1.00 7.75   ? 7    LEU E CA  1 
ATOM   7250  C C   . LEU I 1 7   ? 10.488  41.554  -30.856 1.00 15.45  ? 7    LEU E C   1 
ATOM   7251  O O   . LEU I 1 7   ? 9.732   40.581  -30.971 1.00 17.71  ? 7    LEU E O   1 
ATOM   7252  C CB  . LEU I 1 7   ? 8.751   43.267  -30.638 1.00 7.11   ? 7    LEU E CB  1 
ATOM   7253  C CG  . LEU I 1 7   ? 8.619   44.779  -30.499 1.00 7.44   ? 7    LEU E CG  1 
ATOM   7254  C CD1 . LEU I 1 7   ? 8.632   45.461  -31.855 1.00 1.06   ? 7    LEU E CD1 1 
ATOM   7255  C CD2 . LEU I 1 7   ? 7.386   45.124  -29.754 1.00 1.92   ? 7    LEU E CD2 1 
ATOM   7256  N N   . HIS I 1 8   ? 11.626  41.544  -30.162 1.00 10.78  ? 8    HIS E N   1 
ATOM   7257  C CA  . HIS I 1 8   ? 12.102  40.308  -29.577 1.00 10.93  ? 8    HIS E CA  1 
ATOM   7258  C C   . HIS I 1 8   ? 11.823  40.242  -28.132 1.00 15.06  ? 8    HIS E C   1 
ATOM   7259  O O   . HIS I 1 8   ? 12.347  41.024  -27.388 1.00 21.54  ? 8    HIS E O   1 
ATOM   7260  C CB  . HIS I 1 8   ? 13.597  40.138  -29.787 1.00 12.77  ? 8    HIS E CB  1 
ATOM   7261  C CG  . HIS I 1 8   ? 13.864  40.063  -31.256 1.00 12.97  ? 8    HIS E CG  1 
ATOM   7262  N ND1 . HIS I 1 8   ? 13.908  38.830  -31.912 1.00 9.21   ? 8    HIS E ND1 1 
ATOM   7263  C CD2 . HIS I 1 8   ? 14.022  41.069  -32.175 1.00 10.18  ? 8    HIS E CD2 1 
ATOM   7264  C CE1 . HIS I 1 8   ? 14.087  39.123  -33.193 1.00 4.88   ? 8    HIS E CE1 1 
ATOM   7265  N NE2 . HIS I 1 8   ? 14.161  40.446  -33.404 1.00 6.80   ? 8    HIS E NE2 1 
ATOM   7266  N N   . TYR I 1 9   ? 11.073  39.262  -27.730 1.00 14.76  ? 9    TYR E N   1 
ATOM   7267  C CA  . TYR I 1 9   ? 10.766  39.148  -26.347 1.00 9.55   ? 9    TYR E CA  1 
ATOM   7268  C C   . TYR I 1 9   ? 9.910   37.947  -26.223 1.00 13.90  ? 9    TYR E C   1 
ATOM   7269  O O   . TYR I 1 9   ? 9.316   37.465  -27.167 1.00 13.27  ? 9    TYR E O   1 
ATOM   7270  C CB  . TYR I 1 9   ? 9.881   40.358  -25.980 1.00 11.18  ? 9    TYR E CB  1 
ATOM   7271  C CG  . TYR I 1 9   ? 9.970   40.765  -24.524 1.00 11.92  ? 9    TYR E CG  1 
ATOM   7272  C CD1 . TYR I 1 9   ? 11.194  41.234  -24.072 1.00 17.29  ? 9    TYR E CD1 1 
ATOM   7273  C CD2 . TYR I 1 9   ? 8.938   40.662  -23.587 1.00 10.61  ? 9    TYR E CD2 1 
ATOM   7274  C CE1 . TYR I 1 9   ? 11.388  41.635  -22.756 1.00 8.41   ? 9    TYR E CE1 1 
ATOM   7275  C CE2 . TYR I 1 9   ? 9.112   41.019  -22.242 1.00 10.47  ? 9    TYR E CE2 1 
ATOM   7276  C CZ  . TYR I 1 9   ? 10.359  41.507  -21.840 1.00 8.46   ? 9    TYR E CZ  1 
ATOM   7277  O OH  . TYR I 1 9   ? 10.671  41.913  -20.580 1.00 9.58   ? 9    TYR E OH  1 
ATOM   7278  N N   . PRO I 1 10  ? 9.806   37.518  -25.015 1.00 12.04  ? 10   PRO E N   1 
ATOM   7279  C CA  . PRO I 1 10  ? 8.920   36.466  -24.663 1.00 6.12   ? 10   PRO E CA  1 
ATOM   7280  C C   . PRO I 1 10  ? 7.539   36.953  -24.979 1.00 17.79  ? 10   PRO E C   1 
ATOM   7281  O O   . PRO I 1 10  ? 7.307   38.137  -25.188 1.00 18.65  ? 10   PRO E O   1 
ATOM   7282  C CB  . PRO I 1 10  ? 8.995   36.355  -23.136 1.00 1.52   ? 10   PRO E CB  1 
ATOM   7283  C CG  . PRO I 1 10  ? 10.317  36.959  -22.723 1.00 1.37   ? 10   PRO E CG  1 
ATOM   7284  C CD  . PRO I 1 10  ? 10.762  37.816  -23.924 1.00 9.85   ? 10   PRO E CD  1 
ATOM   7285  N N   . ASN I 1 11  ? 6.605   36.025  -25.040 1.00 22.88  ? 11   ASN E N   1 
ATOM   7286  C CA  . ASN I 1 11  ? 5.260   36.458  -25.346 1.00 21.68  ? 11   ASN E CA  1 
ATOM   7287  C C   . ASN I 1 11  ? 4.510   36.846  -24.104 1.00 28.06  ? 11   ASN E C   1 
ATOM   7288  O O   . ASN I 1 11  ? 3.772   36.020  -23.551 1.00 29.83  ? 11   ASN E O   1 
ATOM   7289  C CB  . ASN I 1 11  ? 4.464   35.385  -26.072 1.00 27.41  ? 11   ASN E CB  1 
ATOM   7290  C CG  . ASN I 1 11  ? 3.040   35.795  -26.377 1.00 30.38  ? 11   ASN E CG  1 
ATOM   7291  O OD1 . ASN I 1 11  ? 2.535   36.891  -26.078 1.00 49.73  ? 11   ASN E OD1 1 
ATOM   7292  N ND2 . ASN I 1 11  ? 2.397   34.914  -27.062 1.00 31.51  ? 11   ASN E ND2 1 
ATOM   7293  N N   . GLY I 1 12  ? 4.689   38.106  -23.679 1.00 23.11  ? 12   GLY E N   1 
ATOM   7294  C CA  . GLY I 1 12  ? 4.069   38.616  -22.471 1.00 15.19  ? 12   GLY E CA  1 
ATOM   7295  C C   . GLY I 1 12  ? 4.471   40.036  -22.350 1.00 17.86  ? 12   GLY E C   1 
ATOM   7296  O O   . GLY I 1 12  ? 5.241   40.534  -23.171 1.00 19.68  ? 12   GLY E O   1 
ATOM   7297  N N   . ARG I 1 13  ? 3.973   40.663  -21.313 1.00 14.04  ? 13   ARG E N   1 
ATOM   7298  C CA  . ARG I 1 13  ? 4.203   42.073  -21.114 1.00 12.54  ? 13   ARG E CA  1 
ATOM   7299  C C   . ARG I 1 13  ? 5.640   42.474  -20.842 1.00 9.16   ? 13   ARG E C   1 
ATOM   7300  O O   . ARG I 1 13  ? 6.272   43.223  -21.615 1.00 15.29  ? 13   ARG E O   1 
ATOM   7301  C CB  . ARG I 1 13  ? 3.267   42.603  -20.008 1.00 7.69   ? 13   ARG E CB  1 
ATOM   7302  C CG  . ARG I 1 13  ? 1.819   42.802  -20.382 1.00 1.00   ? 13   ARG E CG  1 
ATOM   7303  C CD  . ARG I 1 13  ? 0.869   43.153  -19.238 1.00 1.00   ? 13   ARG E CD  1 
ATOM   7304  N NE  . ARG I 1 13  ? -0.524  43.331  -19.657 1.00 19.00  ? 13   ARG E NE  1 
ATOM   7305  C CZ  . ARG I 1 13  ? -1.541  43.708  -18.891 1.00 12.92  ? 13   ARG E CZ  1 
ATOM   7306  N NH1 . ARG I 1 13  ? -1.387  44.030  -17.631 1.00 18.59  ? 13   ARG E NH1 1 
ATOM   7307  N NH2 . ARG I 1 13  ? -2.751  43.767  -19.409 1.00 20.60  ? 13   ARG E NH2 1 
ATOM   7308  N N   . GLY I 1 14  ? 6.052   42.082  -19.642 1.00 1.00   ? 14   GLY E N   1 
ATOM   7309  C CA  . GLY I 1 14  ? 7.348   42.378  -19.085 1.00 1.00   ? 14   GLY E CA  1 
ATOM   7310  C C   . GLY I 1 14  ? 7.663   43.811  -19.303 1.00 9.54   ? 14   GLY E C   1 
ATOM   7311  O O   . GLY I 1 14  ? 6.777   44.690  -19.151 1.00 9.47   ? 14   GLY E O   1 
ATOM   7312  N N   . ARG I 1 15  ? 8.897   44.030  -19.752 1.00 9.02   ? 15   ARG E N   1 
ATOM   7313  C CA  . ARG I 1 15  ? 9.333   45.369  -20.048 1.00 5.35   ? 15   ARG E CA  1 
ATOM   7314  C C   . ARG I 1 15  ? 8.979   45.861  -21.434 1.00 14.90  ? 15   ARG E C   1 
ATOM   7315  O O   . ARG I 1 15  ? 9.007   47.081  -21.649 1.00 20.18  ? 15   ARG E O   1 
ATOM   7316  C CB  . ARG I 1 15  ? 10.799  45.443  -19.891 1.00 3.97   ? 15   ARG E CB  1 
ATOM   7317  C CG  . ARG I 1 15  ? 11.237  45.015  -18.531 1.00 5.24   ? 15   ARG E CG  1 
ATOM   7318  C CD  . ARG I 1 15  ? 12.717  45.249  -18.335 1.00 3.67   ? 15   ARG E CD  1 
ATOM   7319  N NE  . ARG I 1 15  ? 13.074  44.759  -17.017 1.00 14.51  ? 15   ARG E NE  1 
ATOM   7320  C CZ  . ARG I 1 15  ? 12.743  45.550  -16.015 1.00 9.50   ? 15   ARG E CZ  1 
ATOM   7321  N NH1 . ARG I 1 15  ? 12.163  46.698  -16.264 1.00 22.97  ? 15   ARG E NH1 1 
ATOM   7322  N NH2 . ARG I 1 15  ? 12.962  45.202  -14.777 1.00 12.46  ? 15   ARG E NH2 1 
ATOM   7323  N N   . MET I 1 16  ? 8.631   44.932  -22.327 1.00 6.25   ? 16   MET E N   1 
ATOM   7324  C CA  . MET I 1 16  ? 8.326   45.271  -23.722 1.00 7.96   ? 16   MET E CA  1 
ATOM   7325  C C   . MET I 1 16  ? 7.009   45.998  -23.974 1.00 16.37  ? 16   MET E C   1 
ATOM   7326  O O   . MET I 1 16  ? 6.798   46.741  -24.973 1.00 16.90  ? 16   MET E O   1 
ATOM   7327  C CB  . MET I 1 16  ? 8.516   43.992  -24.569 1.00 7.02   ? 16   MET E CB  1 
ATOM   7328  C CG  . MET I 1 16  ? 8.336   44.209  -26.016 1.00 7.94   ? 16   MET E CG  1 
ATOM   7329  S SD  . MET I 1 16  ? 9.625   45.155  -26.836 1.00 11.15  ? 16   MET E SD  1 
ATOM   7330  C CE  . MET I 1 16  ? 10.788  43.862  -27.107 1.00 5.61   ? 16   MET E CE  1 
ATOM   7331  N N   . GLU I 1 17  ? 6.115   45.799  -23.021 1.00 4.20   ? 17   GLU E N   1 
ATOM   7332  C CA  . GLU I 1 17  ? 4.816   46.368  -23.180 1.00 1.00   ? 17   GLU E CA  1 
ATOM   7333  C C   . GLU I 1 17  ? 4.760   47.841  -23.439 1.00 5.23   ? 17   GLU E C   1 
ATOM   7334  O O   . GLU I 1 17  ? 3.939   48.333  -24.197 1.00 11.87  ? 17   GLU E O   1 
ATOM   7335  C CB  . GLU I 1 17  ? 3.912   45.898  -22.080 1.00 1.00   ? 17   GLU E CB  1 
ATOM   7336  C CG  . GLU I 1 17  ? 2.418   45.947  -22.455 1.00 19.56  ? 17   GLU E CG  1 
ATOM   7337  C CD  . GLU I 1 17  ? 1.895   44.858  -23.345 1.00 7.78   ? 17   GLU E CD  1 
ATOM   7338  O OE1 . GLU I 1 17  ? 2.562   43.970  -23.815 1.00 31.51  ? 17   GLU E OE1 1 
ATOM   7339  O OE2 . GLU I 1 17  ? 0.637   45.036  -23.648 1.00 9.61   ? 17   GLU E OE2 1 
ATOM   7340  N N   . SER I 1 18  ? 5.649   48.557  -22.825 1.00 1.00   ? 18   SER E N   1 
ATOM   7341  C CA  . SER I 1 18  ? 5.671   49.982  -23.024 1.00 1.00   ? 18   SER E CA  1 
ATOM   7342  C C   . SER I 1 18  ? 5.928   50.301  -24.454 1.00 6.76   ? 18   SER E C   1 
ATOM   7343  O O   . SER I 1 18  ? 5.298   51.158  -25.089 1.00 9.68   ? 18   SER E O   1 
ATOM   7344  C CB  . SER I 1 18  ? 6.586   50.713  -22.075 1.00 1.00   ? 18   SER E CB  1 
ATOM   7345  O OG  . SER I 1 18  ? 6.491   50.100  -20.814 1.00 13.54  ? 18   SER E OG  1 
ATOM   7346  N N   . VAL I 1 19  ? 6.804   49.519  -25.003 1.00 7.37   ? 19   VAL E N   1 
ATOM   7347  C CA  . VAL I 1 19  ? 7.133   49.659  -26.408 1.00 8.08   ? 19   VAL E CA  1 
ATOM   7348  C C   . VAL I 1 19  ? 5.945   49.342  -27.281 1.00 9.25   ? 19   VAL E C   1 
ATOM   7349  O O   . VAL I 1 19  ? 5.688   50.033  -28.248 1.00 6.66   ? 19   VAL E O   1 
ATOM   7350  C CB  . VAL I 1 19  ? 8.226   48.696  -26.771 1.00 8.51   ? 19   VAL E CB  1 
ATOM   7351  C CG1 . VAL I 1 19  ? 8.584   49.012  -28.199 1.00 10.56  ? 19   VAL E CG1 1 
ATOM   7352  C CG2 . VAL I 1 19  ? 9.427   48.943  -25.876 1.00 1.00   ? 19   VAL E CG2 1 
ATOM   7353  N N   . ARG I 1 20  ? 5.219   48.281  -26.927 1.00 5.49   ? 20   ARG E N   1 
ATOM   7354  C CA  . ARG I 1 20  ? 4.016   48.035  -27.702 1.00 3.46   ? 20   ARG E CA  1 
ATOM   7355  C C   . ARG I 1 20  ? 3.102   49.226  -27.583 1.00 10.61  ? 20   ARG E C   1 
ATOM   7356  O O   . ARG I 1 20  ? 2.667   49.751  -28.587 1.00 13.96  ? 20   ARG E O   1 
ATOM   7357  C CB  . ARG I 1 20  ? 3.269   46.794  -27.315 1.00 1.00   ? 20   ARG E CB  1 
ATOM   7358  C CG  . ARG I 1 20  ? 4.229   45.589  -27.402 1.00 3.22   ? 20   ARG E CG  1 
ATOM   7359  C CD  . ARG I 1 20  ? 3.635   44.307  -26.787 1.00 7.99   ? 20   ARG E CD  1 
ATOM   7360  N NE  . ARG I 1 20  ? 4.538   43.135  -26.786 1.00 7.20   ? 20   ARG E NE  1 
ATOM   7361  C CZ  . ARG I 1 20  ? 5.040   42.521  -25.719 1.00 10.41  ? 20   ARG E CZ  1 
ATOM   7362  N NH1 . ARG I 1 20  ? 4.768   42.960  -24.509 1.00 15.20  ? 20   ARG E NH1 1 
ATOM   7363  N NH2 . ARG I 1 20  ? 5.865   41.469  -25.859 1.00 6.11   ? 20   ARG E NH2 1 
ATOM   7364  N N   . TRP I 1 21  ? 2.859   49.692  -26.375 1.00 7.37   ? 21   TRP E N   1 
ATOM   7365  C CA  . TRP I 1 21  ? 1.987   50.835  -26.236 1.00 7.08   ? 21   TRP E CA  1 
ATOM   7366  C C   . TRP I 1 21  ? 2.351   51.991  -27.100 1.00 15.16  ? 21   TRP E C   1 
ATOM   7367  O O   . TRP I 1 21  ? 1.519   52.519  -27.773 1.00 17.62  ? 21   TRP E O   1 
ATOM   7368  C CB  . TRP I 1 21  ? 2.016   51.369  -24.825 1.00 6.41   ? 21   TRP E CB  1 
ATOM   7369  C CG  . TRP I 1 21  ? 1.001   50.714  -24.007 1.00 10.05  ? 21   TRP E CG  1 
ATOM   7370  C CD1 . TRP I 1 21  ? 1.162   49.600  -23.268 1.00 13.65  ? 21   TRP E CD1 1 
ATOM   7371  C CD2 . TRP I 1 21  ? -0.354  51.129  -23.840 1.00 9.28   ? 21   TRP E CD2 1 
ATOM   7372  N NE1 . TRP I 1 21  ? -0.018  49.291  -22.618 1.00 8.11   ? 21   TRP E NE1 1 
ATOM   7373  C CE2 . TRP I 1 21  ? -0.971  50.193  -22.986 1.00 7.93   ? 21   TRP E CE2 1 
ATOM   7374  C CE3 . TRP I 1 21  ? -1.087  52.218  -24.312 1.00 8.18   ? 21   TRP E CE3 1 
ATOM   7375  C CZ2 . TRP I 1 21  ? -2.298  50.332  -22.597 1.00 5.43   ? 21   TRP E CZ2 1 
ATOM   7376  C CZ3 . TRP I 1 21  ? -2.377  52.360  -23.918 1.00 8.67   ? 21   TRP E CZ3 1 
ATOM   7377  C CH2 . TRP I 1 21  ? -2.981  51.404  -23.082 1.00 9.78   ? 21   TRP E CH2 1 
ATOM   7378  N N   . VAL I 1 22  ? 3.621   52.324  -27.119 1.00 13.45  ? 22   VAL E N   1 
ATOM   7379  C CA  . VAL I 1 22  ? 4.028   53.473  -27.854 1.00 9.94   ? 22   VAL E CA  1 
ATOM   7380  C C   . VAL I 1 22  ? 3.878   53.306  -29.312 1.00 12.54  ? 22   VAL E C   1 
ATOM   7381  O O   . VAL I 1 22  ? 3.401   54.187  -29.992 1.00 13.70  ? 22   VAL E O   1 
ATOM   7382  C CB  . VAL I 1 22  ? 5.460   53.845  -27.554 1.00 15.10  ? 22   VAL E CB  1 
ATOM   7383  C CG1 . VAL I 1 22  ? 5.778   55.105  -28.310 1.00 9.55   ? 22   VAL E CG1 1 
ATOM   7384  C CG2 . VAL I 1 22  ? 5.558   54.224  -26.087 1.00 16.50  ? 22   VAL E CG2 1 
ATOM   7385  N N   . LEU I 1 23  ? 4.364   52.188  -29.794 1.00 5.24   ? 23   LEU E N   1 
ATOM   7386  C CA  . LEU I 1 23  ? 4.246   51.899  -31.202 1.00 3.88   ? 23   LEU E CA  1 
ATOM   7387  C C   . LEU I 1 23  ? 2.804   52.007  -31.622 1.00 12.19  ? 23   LEU E C   1 
ATOM   7388  O O   . LEU I 1 23  ? 2.492   52.767  -32.515 1.00 12.38  ? 23   LEU E O   1 
ATOM   7389  C CB  . LEU I 1 23  ? 4.792   50.498  -31.495 1.00 3.09   ? 23   LEU E CB  1 
ATOM   7390  C CG  . LEU I 1 23  ? 6.317   50.544  -31.569 1.00 4.80   ? 23   LEU E CG  1 
ATOM   7391  C CD1 . LEU I 1 23  ? 6.850   49.169  -31.725 1.00 3.57   ? 23   LEU E CD1 1 
ATOM   7392  C CD2 . LEU I 1 23  ? 6.736   51.276  -32.821 1.00 2.17   ? 23   LEU E CD2 1 
ATOM   7393  N N   . ALA I 1 24  ? 1.932   51.276  -30.904 1.00 8.67   ? 24   ALA E N   1 
ATOM   7394  C CA  . ALA I 1 24  ? 0.486   51.276  -31.170 1.00 3.94   ? 24   ALA E CA  1 
ATOM   7395  C C   . ALA I 1 24  ? -0.078  52.653  -31.169 1.00 13.81  ? 24   ALA E C   1 
ATOM   7396  O O   . ALA I 1 24  ? -0.800  53.012  -32.053 1.00 20.36  ? 24   ALA E O   1 
ATOM   7397  C CB  . ALA I 1 24  ? -0.316  50.414  -30.243 1.00 1.00   ? 24   ALA E CB  1 
ATOM   7398  N N   . ALA I 1 25  ? 0.240   53.398  -30.154 1.00 13.24  ? 25   ALA E N   1 
ATOM   7399  C CA  . ALA I 1 25  ? -0.276  54.727  -30.070 1.00 9.76   ? 25   ALA E CA  1 
ATOM   7400  C C   . ALA I 1 25  ? 0.123   55.568  -31.233 1.00 16.53  ? 25   ALA E C   1 
ATOM   7401  O O   . ALA I 1 25  ? -0.641  56.366  -31.711 1.00 21.49  ? 25   ALA E O   1 
ATOM   7402  C CB  . ALA I 1 25  ? 0.128   55.420  -28.795 1.00 5.49   ? 25   ALA E CB  1 
ATOM   7403  N N   . ALA I 1 26  ? 1.359   55.413  -31.651 1.00 22.51  ? 26   ALA E N   1 
ATOM   7404  C CA  . ALA I 1 26  ? 1.923   56.184  -32.757 1.00 14.60  ? 26   ALA E CA  1 
ATOM   7405  C C   . ALA I 1 26  ? 1.362   55.700  -34.075 1.00 22.33  ? 26   ALA E C   1 
ATOM   7406  O O   . ALA I 1 26  ? 1.671   56.182  -35.134 1.00 28.32  ? 26   ALA E O   1 
ATOM   7407  C CB  . ALA I 1 26  ? 3.437   56.080  -32.732 1.00 8.69   ? 26   ALA E CB  1 
ATOM   7408  N N   . GLY I 1 27  ? 0.523   54.713  -33.989 1.00 20.41  ? 27   GLY E N   1 
ATOM   7409  C CA  . GLY I 1 27  ? -0.085  54.139  -35.143 1.00 17.35  ? 27   GLY E CA  1 
ATOM   7410  C C   . GLY I 1 27  ? 0.811   53.224  -35.956 1.00 24.13  ? 27   GLY E C   1 
ATOM   7411  O O   . GLY I 1 27  ? 0.480   52.895  -37.098 1.00 32.49  ? 27   GLY E O   1 
ATOM   7412  N N   . VAL I 1 28  ? 1.920   52.769  -35.380 1.00 17.82  ? 28   VAL E N   1 
ATOM   7413  C CA  . VAL I 1 28  ? 2.860   51.898  -36.087 1.00 8.87   ? 28   VAL E CA  1 
ATOM   7414  C C   . VAL I 1 28  ? 2.604   50.421  -35.902 1.00 18.14  ? 28   VAL E C   1 
ATOM   7415  O O   . VAL I 1 28  ? 2.415   49.974  -34.779 1.00 22.20  ? 28   VAL E O   1 
ATOM   7416  C CB  . VAL I 1 28  ? 4.231   52.230  -35.580 1.00 7.68   ? 28   VAL E CB  1 
ATOM   7417  C CG1 . VAL I 1 28  ? 5.249   51.332  -36.220 1.00 6.16   ? 28   VAL E CG1 1 
ATOM   7418  C CG2 . VAL I 1 28  ? 4.519   53.703  -35.794 1.00 1.00   ? 28   VAL E CG2 1 
ATOM   7419  N N   . GLU I 1 29  ? 2.557   49.680  -37.033 1.00 26.80  ? 29   GLU E N   1 
ATOM   7420  C CA  . GLU I 1 29  ? 2.330   48.229  -37.024 1.00 28.31  ? 29   GLU E CA  1 
ATOM   7421  C C   . GLU I 1 29  ? 3.669   47.557  -36.860 1.00 30.20  ? 29   GLU E C   1 
ATOM   7422  O O   . GLU I 1 29  ? 4.676   48.090  -37.338 1.00 38.03  ? 29   GLU E O   1 
ATOM   7423  C CB  . GLU I 1 29  ? 1.591   47.685  -38.273 1.00 32.26  ? 29   GLU E CB  1 
ATOM   7424  C CG  . GLU I 1 29  ? 0.044   47.582  -38.177 1.00 67.57  ? 29   GLU E CG  1 
ATOM   7425  C CD  . GLU I 1 29  ? -0.631  47.088  -39.437 1.00 160.28 ? 29   GLU E CD  1 
ATOM   7426  O OE1 . GLU I 1 29  ? -0.757  47.768  -40.440 1.00 195.37 ? 29   GLU E OE1 1 
ATOM   7427  O OE2 . GLU I 1 29  ? -1.080  45.858  -39.292 1.00 192.75 ? 29   GLU E OE2 1 
ATOM   7428  N N   . PHE I 1 30  ? 3.695   46.402  -36.190 1.00 13.23  ? 30   PHE E N   1 
ATOM   7429  C CA  . PHE I 1 30  ? 4.984   45.811  -36.008 1.00 8.69   ? 30   PHE E CA  1 
ATOM   7430  C C   . PHE I 1 30  ? 4.858   44.361  -35.831 1.00 14.26  ? 30   PHE E C   1 
ATOM   7431  O O   . PHE I 1 30  ? 3.753   43.838  -35.645 1.00 9.97   ? 30   PHE E O   1 
ATOM   7432  C CB  . PHE I 1 30  ? 5.620   46.352  -34.736 1.00 11.39  ? 30   PHE E CB  1 
ATOM   7433  C CG  . PHE I 1 30  ? 4.718   46.190  -33.496 1.00 9.08   ? 30   PHE E CG  1 
ATOM   7434  C CD1 . PHE I 1 30  ? 4.702   45.020  -32.738 1.00 8.84   ? 30   PHE E CD1 1 
ATOM   7435  C CD2 . PHE I 1 30  ? 3.929   47.234  -33.004 1.00 6.88   ? 30   PHE E CD2 1 
ATOM   7436  C CE1 . PHE I 1 30  ? 3.927   44.866  -31.581 1.00 5.28   ? 30   PHE E CE1 1 
ATOM   7437  C CE2 . PHE I 1 30  ? 3.142   47.107  -31.848 1.00 5.71   ? 30   PHE E CE2 1 
ATOM   7438  C CZ  . PHE I 1 30  ? 3.108   45.905  -31.134 1.00 1.00   ? 30   PHE E CZ  1 
ATOM   7439  N N   . ASP I 1 31  ? 6.012   43.712  -35.865 1.00 13.28  ? 31   ASP E N   1 
ATOM   7440  C CA  . ASP I 1 31  ? 5.967   42.294  -35.697 1.00 12.08  ? 31   ASP E CA  1 
ATOM   7441  C C   . ASP I 1 31  ? 6.596   41.910  -34.409 1.00 13.87  ? 31   ASP E C   1 
ATOM   7442  O O   . ASP I 1 31  ? 7.246   42.712  -33.780 1.00 21.44  ? 31   ASP E O   1 
ATOM   7443  C CB  . ASP I 1 31  ? 6.523   41.478  -36.889 1.00 15.48  ? 31   ASP E CB  1 
ATOM   7444  C CG  . ASP I 1 31  ? 6.154   41.996  -38.263 1.00 27.68  ? 31   ASP E CG  1 
ATOM   7445  O OD1 . ASP I 1 31  ? 5.003   42.015  -38.642 1.00 37.42  ? 31   ASP E OD1 1 
ATOM   7446  O OD2 . ASP I 1 31  ? 7.186   42.423  -38.993 1.00 34.74  ? 31   ASP E OD2 1 
ATOM   7447  N N   . GLU I 1 32  ? 6.400   40.660  -34.055 1.00 4.84   ? 32   GLU E N   1 
ATOM   7448  C CA  . GLU I 1 32  ? 6.945   40.127  -32.858 1.00 9.08   ? 32   GLU E CA  1 
ATOM   7449  C C   . GLU I 1 32  ? 7.597   38.760  -33.073 1.00 23.83  ? 32   GLU E C   1 
ATOM   7450  O O   . GLU I 1 32  ? 7.044   37.922  -33.729 1.00 34.10  ? 32   GLU E O   1 
ATOM   7451  C CB  . GLU I 1 32  ? 5.842   39.967  -31.773 1.00 10.48  ? 32   GLU E CB  1 
ATOM   7452  C CG  . GLU I 1 32  ? 5.153   41.297  -31.367 1.00 10.37  ? 32   GLU E CG  1 
ATOM   7453  C CD  . GLU I 1 32  ? 4.321   41.124  -30.132 1.00 18.46  ? 32   GLU E CD  1 
ATOM   7454  O OE1 . GLU I 1 32  ? 3.253   40.558  -30.161 1.00 28.62  ? 32   GLU E OE1 1 
ATOM   7455  O OE2 . GLU I 1 32  ? 4.973   41.399  -29.017 1.00 29.96  ? 32   GLU E OE2 1 
ATOM   7456  N N   . GLU I 1 33  ? 8.738   38.507  -32.443 1.00 17.07  ? 33   GLU E N   1 
ATOM   7457  C CA  . GLU I 1 33  ? 9.391   37.253  -32.517 1.00 10.34  ? 33   GLU E CA  1 
ATOM   7458  C C   . GLU I 1 33  ? 9.592   36.724  -31.126 1.00 14.02  ? 33   GLU E C   1 
ATOM   7459  O O   . GLU I 1 33  ? 10.479  37.125  -30.394 1.00 19.01  ? 33   GLU E O   1 
ATOM   7460  C CB  . GLU I 1 33  ? 10.714  37.443  -33.187 1.00 13.07  ? 33   GLU E CB  1 
ATOM   7461  C CG  . GLU I 1 33  ? 11.195  36.062  -33.661 1.00 25.16  ? 33   GLU E CG  1 
ATOM   7462  C CD  . GLU I 1 33  ? 12.515  36.066  -34.369 1.00 75.56  ? 33   GLU E CD  1 
ATOM   7463  O OE1 . GLU I 1 33  ? 12.637  36.509  -35.519 1.00 47.37  ? 33   GLU E OE1 1 
ATOM   7464  O OE2 . GLU I 1 33  ? 13.475  35.488  -33.636 1.00 39.17  ? 33   GLU E OE2 1 
ATOM   7465  N N   . PHE I 1 34  ? 8.733   35.817  -30.736 1.00 7.61   ? 34   PHE E N   1 
ATOM   7466  C CA  . PHE I 1 34  ? 8.769   35.377  -29.372 1.00 8.79   ? 34   PHE E CA  1 
ATOM   7467  C C   . PHE I 1 34  ? 9.811   34.476  -28.863 1.00 19.39  ? 34   PHE E C   1 
ATOM   7468  O O   . PHE I 1 34  ? 10.062  33.441  -29.430 1.00 24.13  ? 34   PHE E O   1 
ATOM   7469  C CB  . PHE I 1 34  ? 7.449   34.764  -28.982 1.00 10.39  ? 34   PHE E CB  1 
ATOM   7470  C CG  . PHE I 1 34  ? 6.377   35.784  -29.098 1.00 17.68  ? 34   PHE E CG  1 
ATOM   7471  C CD1 . PHE I 1 34  ? 6.539   37.020  -28.476 1.00 28.34  ? 34   PHE E CD1 1 
ATOM   7472  C CD2 . PHE I 1 34  ? 5.216   35.537  -29.828 1.00 16.81  ? 34   PHE E CD2 1 
ATOM   7473  C CE1 . PHE I 1 34  ? 5.562   37.999  -28.618 1.00 31.51  ? 34   PHE E CE1 1 
ATOM   7474  C CE2 . PHE I 1 34  ? 4.235   36.512  -29.981 1.00 16.09  ? 34   PHE E CE2 1 
ATOM   7475  C CZ  . PHE I 1 34  ? 4.407   37.741  -29.358 1.00 21.33  ? 34   PHE E CZ  1 
ATOM   7476  N N   . LEU I 1 35  ? 10.303  34.796  -27.682 1.00 17.76  ? 35   LEU E N   1 
ATOM   7477  C CA  . LEU I 1 35  ? 11.195  33.852  -27.066 1.00 10.55  ? 35   LEU E CA  1 
ATOM   7478  C C   . LEU I 1 35  ? 10.388  32.914  -26.214 1.00 19.28  ? 35   LEU E C   1 
ATOM   7479  O O   . LEU I 1 35  ? 9.493   33.341  -25.488 1.00 29.56  ? 35   LEU E O   1 
ATOM   7480  C CB  . LEU I 1 35  ? 12.353  34.412  -26.239 1.00 7.52   ? 35   LEU E CB  1 
ATOM   7481  C CG  . LEU I 1 35  ? 13.184  35.407  -27.022 1.00 13.89  ? 35   LEU E CG  1 
ATOM   7482  C CD1 . LEU I 1 35  ? 13.979  36.303  -26.091 1.00 9.47   ? 35   LEU E CD1 1 
ATOM   7483  C CD2 . LEU I 1 35  ? 14.163  34.662  -27.844 1.00 11.29  ? 35   LEU E CD2 1 
ATOM   7484  N N   . GLU I 1 36  ? 10.716  31.620  -26.363 1.00 21.93  ? 36   GLU E N   1 
ATOM   7485  C CA  . GLU I 1 36  ? 10.132  30.525  -25.603 1.00 23.68  ? 36   GLU E CA  1 
ATOM   7486  C C   . GLU I 1 36  ? 11.074  29.686  -24.756 1.00 31.22  ? 36   GLU E C   1 
ATOM   7487  O O   . GLU I 1 36  ? 10.606  29.080  -23.781 1.00 34.30  ? 36   GLU E O   1 
ATOM   7488  C CB  . GLU I 1 36  ? 9.140   29.651  -26.377 1.00 26.56  ? 36   GLU E CB  1 
ATOM   7489  C CG  . GLU I 1 36  ? 8.131   30.433  -27.259 1.00 46.80  ? 36   GLU E CG  1 
ATOM   7490  C CD  . GLU I 1 36  ? 7.418   29.599  -28.282 1.00 144.65 ? 36   GLU E CD  1 
ATOM   7491  O OE1 . GLU I 1 36  ? 6.990   28.500  -28.074 1.00 197.15 ? 36   GLU E OE1 1 
ATOM   7492  O OE2 . GLU I 1 36  ? 7.358   30.204  -29.435 1.00 116.08 ? 36   GLU E OE2 1 
ATOM   7493  N N   . THR I 1 37  ? 12.380  29.686  -25.100 1.00 31.21  ? 37   THR E N   1 
ATOM   7494  C CA  . THR I 1 37  ? 13.432  28.902  -24.442 1.00 29.82  ? 37   THR E CA  1 
ATOM   7495  C C   . THR I 1 37  ? 14.786  29.595  -24.303 1.00 35.09  ? 37   THR E C   1 
ATOM   7496  O O   . THR I 1 37  ? 15.137  30.520  -25.080 1.00 28.14  ? 37   THR E O   1 
ATOM   7497  C CB  . THR I 1 37  ? 13.744  27.739  -25.393 1.00 43.33  ? 37   THR E CB  1 
ATOM   7498  O OG1 . THR I 1 37  ? 14.581  28.186  -26.454 1.00 54.39  ? 37   THR E OG1 1 
ATOM   7499  C CG2 . THR I 1 37  ? 12.475  27.191  -25.983 1.00 18.64  ? 37   THR E CG2 1 
ATOM   7500  N N   . LYS I 1 38  ? 15.602  29.010  -23.394 1.00 29.25  ? 38   LYS E N   1 
ATOM   7501  C CA  . LYS I 1 38  ? 16.971  29.509  -23.190 1.00 27.02  ? 38   LYS E CA  1 
ATOM   7502  C C   . LYS I 1 38  ? 17.688  29.560  -24.529 1.00 32.21  ? 38   LYS E C   1 
ATOM   7503  O O   . LYS I 1 38  ? 18.318  30.555  -24.981 1.00 38.46  ? 38   LYS E O   1 
ATOM   7504  C CB  . LYS I 1 38  ? 17.789  28.633  -22.231 1.00 26.43  ? 38   LYS E CB  1 
ATOM   7505  C CG  . LYS I 1 38  ? 18.569  29.375  -21.132 1.00 60.64  ? 38   LYS E CG  1 
ATOM   7506  C CD  . LYS I 1 38  ? 17.942  29.354  -19.722 1.00 131.05 ? 38   LYS E CD  1 
ATOM   7507  C CE  . LYS I 1 38  ? 18.757  30.073  -18.629 1.00 170.26 ? 38   LYS E CE  1 
ATOM   7508  N NZ  . LYS I 1 38  ? 18.259  29.904  -17.239 1.00 174.30 ? 38   LYS E NZ  1 
ATOM   7509  N N   . GLU I 1 39  ? 17.521  28.466  -25.197 1.00 27.67  ? 39   GLU E N   1 
ATOM   7510  C CA  . GLU I 1 39  ? 18.143  28.256  -26.465 1.00 31.08  ? 39   GLU E CA  1 
ATOM   7511  C C   . GLU I 1 39  ? 17.865  29.301  -27.505 1.00 30.03  ? 39   GLU E C   1 
ATOM   7512  O O   . GLU I 1 39  ? 18.793  29.812  -28.160 1.00 35.32  ? 39   GLU E O   1 
ATOM   7513  C CB  . GLU I 1 39  ? 17.986  26.818  -26.947 1.00 37.81  ? 39   GLU E CB  1 
ATOM   7514  C CG  . GLU I 1 39  ? 18.908  26.484  -28.131 1.00 79.19  ? 39   GLU E CG  1 
ATOM   7515  C CD  . GLU I 1 39  ? 18.111  25.871  -29.249 1.00 193.64 ? 39   GLU E CD  1 
ATOM   7516  O OE1 . GLU I 1 39  ? 16.888  25.911  -29.310 1.00 232.66 ? 39   GLU E OE1 1 
ATOM   7517  O OE2 . GLU I 1 39  ? 18.870  25.281  -30.138 1.00 227.39 ? 39   GLU E OE2 1 
ATOM   7518  N N   . GLN I 1 40  ? 16.608  29.676  -27.658 1.00 21.77  ? 40   GLN E N   1 
ATOM   7519  C CA  . GLN I 1 40  ? 16.359  30.737  -28.620 1.00 20.26  ? 40   GLN E CA  1 
ATOM   7520  C C   . GLN I 1 40  ? 17.029  32.028  -28.212 1.00 27.16  ? 40   GLN E C   1 
ATOM   7521  O O   . GLN I 1 40  ? 17.473  32.798  -29.060 1.00 28.08  ? 40   GLN E O   1 
ATOM   7522  C CB  . GLN I 1 40  ? 14.901  30.969  -28.839 1.00 19.08  ? 40   GLN E CB  1 
ATOM   7523  C CG  . GLN I 1 40  ? 14.158  29.646  -28.818 1.00 31.96  ? 40   GLN E CG  1 
ATOM   7524  C CD  . GLN I 1 40  ? 12.680  29.880  -28.782 1.00 60.17  ? 40   GLN E CD  1 
ATOM   7525  O OE1 . GLN I 1 40  ? 12.094  30.026  -27.687 1.00 56.97  ? 40   GLN E OE1 1 
ATOM   7526  N NE2 . GLN I 1 40  ? 12.124  30.083  -29.976 1.00 30.70  ? 40   GLN E NE2 1 
ATOM   7527  N N   . LEU I 1 41  ? 17.125  32.228  -26.901 1.00 19.89  ? 41   LEU E N   1 
ATOM   7528  C CA  . LEU I 1 41  ? 17.783  33.380  -26.411 1.00 18.47  ? 41   LEU E CA  1 
ATOM   7529  C C   . LEU I 1 41  ? 19.232  33.260  -26.796 1.00 22.31  ? 41   LEU E C   1 
ATOM   7530  O O   . LEU I 1 41  ? 19.802  34.176  -27.401 1.00 20.50  ? 41   LEU E O   1 
ATOM   7531  C CB  . LEU I 1 41  ? 17.558  33.480  -24.915 1.00 19.14  ? 41   LEU E CB  1 
ATOM   7532  C CG  . LEU I 1 41  ? 18.377  34.571  -24.236 1.00 22.37  ? 41   LEU E CG  1 
ATOM   7533  C CD1 . LEU I 1 41  ? 18.103  35.973  -24.807 1.00 14.45  ? 41   LEU E CD1 1 
ATOM   7534  C CD2 . LEU I 1 41  ? 18.084  34.532  -22.749 1.00 6.97   ? 41   LEU E CD2 1 
ATOM   7535  N N   . TYR I 1 42  ? 19.815  32.090  -26.537 1.00 18.09  ? 42   TYR E N   1 
ATOM   7536  C CA  . TYR I 1 42  ? 21.209  31.906  -26.971 1.00 22.08  ? 42   TYR E CA  1 
ATOM   7537  C C   . TYR I 1 42  ? 21.475  32.194  -28.396 1.00 21.45  ? 42   TYR E C   1 
ATOM   7538  O O   . TYR I 1 42  ? 22.475  32.789  -28.757 1.00 23.96  ? 42   TYR E O   1 
ATOM   7539  C CB  . TYR I 1 42  ? 21.677  30.514  -26.826 1.00 34.68  ? 42   TYR E CB  1 
ATOM   7540  C CG  . TYR I 1 42  ? 21.962  30.293  -25.384 1.00 69.13  ? 42   TYR E CG  1 
ATOM   7541  C CD1 . TYR I 1 42  ? 22.472  31.338  -24.614 1.00 82.25  ? 42   TYR E CD1 1 
ATOM   7542  C CD2 . TYR I 1 42  ? 21.741  29.062  -24.764 1.00 76.28  ? 42   TYR E CD2 1 
ATOM   7543  C CE1 . TYR I 1 42  ? 22.765  31.167  -23.257 1.00 94.37  ? 42   TYR E CE1 1 
ATOM   7544  C CE2 . TYR I 1 42  ? 22.023  28.877  -23.407 1.00 79.12  ? 42   TYR E CE2 1 
ATOM   7545  C CZ  . TYR I 1 42  ? 22.540  29.929  -22.650 1.00 95.12  ? 42   TYR E CZ  1 
ATOM   7546  O OH  . TYR I 1 42  ? 22.834  29.732  -21.313 1.00 96.88  ? 42   TYR E OH  1 
ATOM   7547  N N   . LYS I 1 43  ? 20.588  31.764  -29.235 1.00 13.68  ? 43   LYS E N   1 
ATOM   7548  C CA  . LYS I 1 43  ? 20.880  32.053  -30.608 1.00 14.88  ? 43   LYS E CA  1 
ATOM   7549  C C   . LYS I 1 43  ? 20.874  33.520  -30.896 1.00 21.16  ? 43   LYS E C   1 
ATOM   7550  O O   . LYS I 1 43  ? 21.599  34.070  -31.707 1.00 31.70  ? 43   LYS E O   1 
ATOM   7551  C CB  . LYS I 1 43  ? 19.974  31.284  -31.566 1.00 21.00  ? 43   LYS E CB  1 
ATOM   7552  C CG  . LYS I 1 43  ? 19.697  29.890  -31.031 1.00 105.48 ? 43   LYS E CG  1 
ATOM   7553  C CD  . LYS I 1 43  ? 18.519  29.199  -31.701 1.00 165.45 ? 43   LYS E CD  1 
ATOM   7554  C CE  . LYS I 1 43  ? 18.916  28.358  -32.906 1.00 228.51 ? 43   LYS E CE  1 
ATOM   7555  N NZ  . LYS I 1 43  ? 17.826  27.496  -33.398 1.00 258.00 ? 43   LYS E NZ  1 
ATOM   7556  N N   . LEU I 1 44  ? 20.036  34.181  -30.209 1.00 13.95  ? 44   LEU E N   1 
ATOM   7557  C CA  . LEU I 1 44  ? 19.917  35.590  -30.459 1.00 12.63  ? 44   LEU E CA  1 
ATOM   7558  C C   . LEU I 1 44  ? 21.183  36.269  -30.019 1.00 15.33  ? 44   LEU E C   1 
ATOM   7559  O O   . LEU I 1 44  ? 21.759  37.145  -30.667 1.00 15.90  ? 44   LEU E O   1 
ATOM   7560  C CB  . LEU I 1 44  ? 18.696  35.954  -29.613 1.00 12.87  ? 44   LEU E CB  1 
ATOM   7561  C CG  . LEU I 1 44  ? 17.927  37.188  -30.024 1.00 16.69  ? 44   LEU E CG  1 
ATOM   7562  C CD1 . LEU I 1 44  ? 17.742  37.251  -31.496 1.00 12.70  ? 44   LEU E CD1 1 
ATOM   7563  C CD2 . LEU I 1 44  ? 16.539  37.179  -29.403 1.00 18.55  ? 44   LEU E CD2 1 
ATOM   7564  N N   . GLN I 1 45  ? 21.636  35.771  -28.893 1.00 10.39  ? 45   GLN E N   1 
ATOM   7565  C CA  . GLN I 1 45  ? 22.800  36.290  -28.266 1.00 8.91   ? 45   GLN E CA  1 
ATOM   7566  C C   . GLN I 1 45  ? 23.975  35.971  -29.085 1.00 24.32  ? 45   GLN E C   1 
ATOM   7567  O O   . GLN I 1 45  ? 24.774  36.832  -29.407 1.00 24.96  ? 45   GLN E O   1 
ATOM   7568  C CB  . GLN I 1 45  ? 22.963  35.605  -26.938 1.00 7.27   ? 45   GLN E CB  1 
ATOM   7569  C CG  . GLN I 1 45  ? 22.047  36.248  -25.933 1.00 23.17  ? 45   GLN E CG  1 
ATOM   7570  C CD  . GLN I 1 45  ? 22.138  35.550  -24.630 1.00 9.01   ? 45   GLN E CD  1 
ATOM   7571  O OE1 . GLN I 1 45  ? 22.477  34.378  -24.626 1.00 36.30  ? 45   GLN E OE1 1 
ATOM   7572  N NE2 . GLN I 1 45  ? 21.748  36.241  -23.545 1.00 19.47  ? 45   GLN E NE2 1 
ATOM   7573  N N   . ASP I 1 46  ? 24.024  34.688  -29.420 1.00 25.91  ? 46   ASP E N   1 
ATOM   7574  C CA  . ASP I 1 46  ? 25.091  34.158  -30.238 1.00 24.70  ? 46   ASP E CA  1 
ATOM   7575  C C   . ASP I 1 46  ? 25.278  34.914  -31.543 1.00 20.91  ? 46   ASP E C   1 
ATOM   7576  O O   . ASP I 1 46  ? 26.361  35.175  -31.977 1.00 23.96  ? 46   ASP E O   1 
ATOM   7577  C CB  . ASP I 1 46  ? 24.903  32.675  -30.533 1.00 28.86  ? 46   ASP E CB  1 
ATOM   7578  C CG  . ASP I 1 46  ? 25.998  32.076  -31.404 1.00 66.70  ? 46   ASP E CG  1 
ATOM   7579  O OD1 . ASP I 1 46  ? 27.170  32.079  -31.077 1.00 73.54  ? 46   ASP E OD1 1 
ATOM   7580  O OD2 . ASP I 1 46  ? 25.574  31.610  -32.574 1.00 88.27  ? 46   ASP E OD2 1 
ATOM   7581  N N   . GLY I 1 47  ? 24.231  35.273  -32.226 1.00 17.38  ? 47   GLY E N   1 
ATOM   7582  C CA  . GLY I 1 47  ? 24.463  35.983  -33.452 1.00 13.80  ? 47   GLY E CA  1 
ATOM   7583  C C   . GLY I 1 47  ? 24.778  37.430  -33.244 1.00 20.83  ? 47   GLY E C   1 
ATOM   7584  O O   . GLY I 1 47  ? 24.815  38.188  -34.208 1.00 26.10  ? 47   GLY E O   1 
ATOM   7585  N N   . ASN I 1 48  ? 24.972  37.832  -31.995 1.00 16.78  ? 48   ASN E N   1 
ATOM   7586  C CA  . ASN I 1 48  ? 25.300  39.217  -31.748 1.00 18.70  ? 48   ASN E CA  1 
ATOM   7587  C C   . ASN I 1 48  ? 24.165  40.156  -32.069 1.00 23.54  ? 48   ASN E C   1 
ATOM   7588  O O   . ASN I 1 48  ? 24.346  41.230  -32.617 1.00 28.81  ? 48   ASN E O   1 
ATOM   7589  C CB  . ASN I 1 48  ? 26.663  39.612  -32.408 1.00 19.59  ? 48   ASN E CB  1 
ATOM   7590  C CG  . ASN I 1 48  ? 27.754  38.734  -31.793 1.00 101.87 ? 48   ASN E CG  1 
ATOM   7591  O OD1 . ASN I 1 48  ? 27.762  38.479  -30.565 1.00 85.57  ? 48   ASN E OD1 1 
ATOM   7592  N ND2 . ASN I 1 48  ? 28.566  38.112  -32.651 1.00 131.65 ? 48   ASN E ND2 1 
ATOM   7593  N N   . HIS I 1 49  ? 22.959  39.760  -31.743 1.00 14.99  ? 49   HIS E N   1 
ATOM   7594  C CA  . HIS I 1 49  ? 21.904  40.679  -32.066 1.00 12.78  ? 49   HIS E CA  1 
ATOM   7595  C C   . HIS I 1 49  ? 21.517  41.582  -30.936 1.00 15.54  ? 49   HIS E C   1 
ATOM   7596  O O   . HIS I 1 49  ? 20.882  42.589  -31.167 1.00 16.83  ? 49   HIS E O   1 
ATOM   7597  C CB  . HIS I 1 49  ? 20.723  39.850  -32.314 1.00 16.79  ? 49   HIS E CB  1 
ATOM   7598  C CG  . HIS I 1 49  ? 20.980  38.964  -33.435 1.00 21.98  ? 49   HIS E CG  1 
ATOM   7599  N ND1 . HIS I 1 49  ? 21.111  39.480  -34.716 1.00 23.88  ? 49   HIS E ND1 1 
ATOM   7600  C CD2 . HIS I 1 49  ? 21.083  37.622  -33.474 1.00 25.84  ? 49   HIS E CD2 1 
ATOM   7601  C CE1 . HIS I 1 49  ? 21.258  38.444  -35.515 1.00 21.95  ? 49   HIS E CE1 1 
ATOM   7602  N NE2 . HIS I 1 49  ? 21.233  37.316  -34.808 1.00 24.18  ? 49   HIS E NE2 1 
ATOM   7603  N N   . LEU I 1 50  ? 21.860  41.152  -29.727 1.00 8.69   ? 50   LEU E N   1 
ATOM   7604  C CA  . LEU I 1 50  ? 21.605  41.830  -28.507 1.00 4.38   ? 50   LEU E CA  1 
ATOM   7605  C C   . LEU I 1 50  ? 22.857  42.526  -28.082 1.00 11.49  ? 50   LEU E C   1 
ATOM   7606  O O   . LEU I 1 50  ? 23.728  41.866  -27.599 1.00 9.66   ? 50   LEU E O   1 
ATOM   7607  C CB  . LEU I 1 50  ? 21.317  40.784  -27.426 1.00 1.64   ? 50   LEU E CB  1 
ATOM   7608  C CG  . LEU I 1 50  ? 20.214  39.883  -27.931 1.00 3.51   ? 50   LEU E CG  1 
ATOM   7609  C CD1 . LEU I 1 50  ? 19.707  38.948  -26.834 1.00 1.06   ? 50   LEU E CD1 1 
ATOM   7610  C CD2 . LEU I 1 50  ? 19.144  40.737  -28.571 1.00 1.00   ? 50   LEU E CD2 1 
ATOM   7611  N N   . LEU I 1 51  ? 22.892  43.849  -28.206 1.00 8.04   ? 51   LEU E N   1 
ATOM   7612  C CA  . LEU I 1 51  ? 24.050  44.642  -27.852 1.00 1.52   ? 51   LEU E CA  1 
ATOM   7613  C C   . LEU I 1 51  ? 24.606  44.297  -26.528 1.00 10.02  ? 51   LEU E C   1 
ATOM   7614  O O   . LEU I 1 51  ? 25.805  44.228  -26.377 1.00 21.73  ? 51   LEU E O   1 
ATOM   7615  C CB  . LEU I 1 51  ? 23.691  46.127  -27.887 1.00 1.31   ? 51   LEU E CB  1 
ATOM   7616  C CG  . LEU I 1 51  ? 24.822  47.087  -27.515 1.00 7.53   ? 51   LEU E CG  1 
ATOM   7617  C CD1 . LEU I 1 51  ? 25.929  46.976  -28.551 1.00 1.00   ? 51   LEU E CD1 1 
ATOM   7618  C CD2 . LEU I 1 51  ? 24.399  48.566  -27.468 1.00 1.00   ? 51   LEU E CD2 1 
ATOM   7619  N N   . PHE I 1 52  ? 23.721  44.074  -25.567 1.00 9.94   ? 52   PHE E N   1 
ATOM   7620  C CA  . PHE I 1 52  ? 24.174  43.782  -24.214 1.00 7.21   ? 52   PHE E CA  1 
ATOM   7621  C C   . PHE I 1 52  ? 23.673  42.442  -23.759 1.00 11.24  ? 52   PHE E C   1 
ATOM   7622  O O   . PHE I 1 52  ? 23.559  42.219  -22.573 1.00 6.58   ? 52   PHE E O   1 
ATOM   7623  C CB  . PHE I 1 52  ? 23.852  44.867  -23.166 1.00 1.00   ? 52   PHE E CB  1 
ATOM   7624  C CG  . PHE I 1 52  ? 24.527  46.212  -23.408 1.00 2.96   ? 52   PHE E CG  1 
ATOM   7625  C CD1 . PHE I 1 52  ? 25.907  46.368  -23.323 1.00 7.87   ? 52   PHE E CD1 1 
ATOM   7626  C CD2 . PHE I 1 52  ? 23.784  47.358  -23.703 1.00 6.49   ? 52   PHE E CD2 1 
ATOM   7627  C CE1 . PHE I 1 52  ? 26.535  47.588  -23.582 1.00 6.37   ? 52   PHE E CE1 1 
ATOM   7628  C CE2 . PHE I 1 52  ? 24.372  48.596  -23.951 1.00 6.34   ? 52   PHE E CE2 1 
ATOM   7629  C CZ  . PHE I 1 52  ? 25.763  48.696  -23.912 1.00 5.29   ? 52   PHE E CZ  1 
ATOM   7630  N N   . GLN I 1 53  ? 23.290  41.605  -24.713 1.00 5.74   ? 53   GLN E N   1 
ATOM   7631  C CA  . GLN I 1 53  ? 22.835  40.282  -24.371 1.00 5.09   ? 53   GLN E CA  1 
ATOM   7632  C C   . GLN I 1 53  ? 21.487  40.201  -23.735 1.00 13.57  ? 53   GLN E C   1 
ATOM   7633  O O   . GLN I 1 53  ? 21.099  39.151  -23.272 1.00 14.23  ? 53   GLN E O   1 
ATOM   7634  C CB  . GLN I 1 53  ? 23.872  39.548  -23.524 1.00 3.56   ? 53   GLN E CB  1 
ATOM   7635  C CG  . GLN I 1 53  ? 25.333  39.563  -24.123 1.00 13.24  ? 53   GLN E CG  1 
ATOM   7636  C CD  . GLN I 1 53  ? 25.499  38.858  -25.471 1.00 42.24  ? 53   GLN E CD  1 
ATOM   7637  O OE1 . GLN I 1 53  ? 26.176  37.830  -25.554 1.00 114.27 ? 53   GLN E OE1 1 
ATOM   7638  N NE2 . GLN I 1 53  ? 24.877  39.354  -26.535 1.00 50.32  ? 53   GLN E NE2 1 
ATOM   7639  N N   . GLN I 1 54  ? 20.758  41.297  -23.751 1.00 11.15  ? 54   GLN E N   1 
ATOM   7640  C CA  . GLN I 1 54  ? 19.460  41.223  -23.180 1.00 11.09  ? 54   GLN E CA  1 
ATOM   7641  C C   . GLN I 1 54  ? 18.467  41.752  -24.135 1.00 14.96  ? 54   GLN E C   1 
ATOM   7642  O O   . GLN I 1 54  ? 18.865  42.397  -25.107 1.00 10.27  ? 54   GLN E O   1 
ATOM   7643  C CB  . GLN I 1 54  ? 19.352  42.261  -22.094 1.00 9.52   ? 54   GLN E CB  1 
ATOM   7644  C CG  . GLN I 1 54  ? 20.445  42.021  -21.081 1.00 12.31  ? 54   GLN E CG  1 
ATOM   7645  C CD  . GLN I 1 54  ? 20.626  43.174  -20.144 1.00 1.00   ? 54   GLN E CD  1 
ATOM   7646  O OE1 . GLN I 1 54  ? 21.133  44.254  -20.528 1.00 45.37  ? 54   GLN E OE1 1 
ATOM   7647  N NE2 . GLN I 1 54  ? 20.102  42.992  -18.943 1.00 19.84  ? 54   GLN E NE2 1 
ATOM   7648  N N   . VAL I 1 55  ? 17.213  41.473  -23.771 1.00 10.42  ? 55   VAL E N   1 
ATOM   7649  C CA  . VAL I 1 55  ? 15.993  41.964  -24.375 1.00 9.57   ? 55   VAL E CA  1 
ATOM   7650  C C   . VAL I 1 55  ? 15.303  42.836  -23.295 1.00 14.69  ? 55   VAL E C   1 
ATOM   7651  O O   . VAL I 1 55  ? 15.516  42.726  -22.074 1.00 8.70   ? 55   VAL E O   1 
ATOM   7652  C CB  . VAL I 1 55  ? 15.041  40.855  -24.821 1.00 8.03   ? 55   VAL E CB  1 
ATOM   7653  C CG1 . VAL I 1 55  ? 15.601  40.189  -26.036 1.00 3.46   ? 55   VAL E CG1 1 
ATOM   7654  C CG2 . VAL I 1 55  ? 14.850  39.823  -23.719 1.00 4.29   ? 55   VAL E CG2 1 
ATOM   7655  N N   . PRO I 1 56  ? 14.462  43.764  -23.689 1.00 11.30  ? 56   PRO E N   1 
ATOM   7656  C CA  . PRO I 1 56  ? 14.013  43.992  -25.034 1.00 4.11   ? 56   PRO E CA  1 
ATOM   7657  C C   . PRO I 1 56  ? 15.017  44.368  -26.042 1.00 9.83   ? 56   PRO E C   1 
ATOM   7658  O O   . PRO I 1 56  ? 15.892  45.184  -25.807 1.00 19.45  ? 56   PRO E O   1 
ATOM   7659  C CB  . PRO I 1 56  ? 13.118  45.250  -24.901 1.00 1.00   ? 56   PRO E CB  1 
ATOM   7660  C CG  . PRO I 1 56  ? 12.746  45.361  -23.443 1.00 4.11   ? 56   PRO E CG  1 
ATOM   7661  C CD  . PRO I 1 56  ? 13.534  44.335  -22.651 1.00 3.84   ? 56   PRO E CD  1 
ATOM   7662  N N   . MET I 1 57  ? 14.770  43.907  -27.247 1.00 5.04   ? 57   MET E N   1 
ATOM   7663  C CA  . MET I 1 57  ? 15.517  44.360  -28.422 1.00 3.72   ? 57   MET E CA  1 
ATOM   7664  C C   . MET I 1 57  ? 14.454  44.562  -29.489 1.00 5.29   ? 57   MET E C   1 
ATOM   7665  O O   . MET I 1 57  ? 13.498  43.799  -29.612 1.00 10.86  ? 57   MET E O   1 
ATOM   7666  C CB  . MET I 1 57  ? 16.587  43.401  -28.948 1.00 5.14   ? 57   MET E CB  1 
ATOM   7667  C CG  . MET I 1 57  ? 17.368  44.049  -30.050 1.00 11.13  ? 57   MET E CG  1 
ATOM   7668  S SD  . MET I 1 57  ? 16.710  43.802  -31.712 1.00 16.68  ? 57   MET E SD  1 
ATOM   7669  C CE  . MET I 1 57  ? 17.228  42.102  -31.866 1.00 5.94   ? 57   MET E CE  1 
ATOM   7670  N N   . VAL I 1 58  ? 14.563  45.612  -30.217 1.00 2.32   ? 58   VAL E N   1 
ATOM   7671  C CA  . VAL I 1 58  ? 13.612  45.898  -31.259 1.00 2.31   ? 58   VAL E CA  1 
ATOM   7672  C C   . VAL I 1 58  ? 14.382  46.280  -32.500 1.00 12.78  ? 58   VAL E C   1 
ATOM   7673  O O   . VAL I 1 58  ? 15.317  47.113  -32.467 1.00 11.53  ? 58   VAL E O   1 
ATOM   7674  C CB  . VAL I 1 58  ? 12.802  47.105  -30.850 1.00 4.17   ? 58   VAL E CB  1 
ATOM   7675  C CG1 . VAL I 1 58  ? 12.000  47.679  -32.018 1.00 2.31   ? 58   VAL E CG1 1 
ATOM   7676  C CG2 . VAL I 1 58  ? 11.910  46.662  -29.737 1.00 5.34   ? 58   VAL E CG2 1 
ATOM   7677  N N   . GLU I 1 59  ? 13.994  45.640  -33.582 1.00 12.32  ? 59   GLU E N   1 
ATOM   7678  C CA  . GLU I 1 59  ? 14.644  45.942  -34.833 1.00 10.70  ? 59   GLU E CA  1 
ATOM   7679  C C   . GLU I 1 59  ? 13.841  46.932  -35.562 1.00 17.16  ? 59   GLU E C   1 
ATOM   7680  O O   . GLU I 1 59  ? 12.734  46.646  -35.991 1.00 22.45  ? 59   GLU E O   1 
ATOM   7681  C CB  . GLU I 1 59  ? 14.769  44.792  -35.779 1.00 9.62   ? 59   GLU E CB  1 
ATOM   7682  C CG  . GLU I 1 59  ? 15.388  43.522  -35.195 1.00 29.96  ? 59   GLU E CG  1 
ATOM   7683  C CD  . GLU I 1 59  ? 15.626  42.488  -36.286 1.00 5.94   ? 59   GLU E CD  1 
ATOM   7684  O OE1 . GLU I 1 59  ? 16.312  42.713  -37.283 1.00 138.83 ? 59   GLU E OE1 1 
ATOM   7685  O OE2 . GLU I 1 59  ? 14.987  41.359  -36.050 1.00 37.35  ? 59   GLU E OE2 1 
ATOM   7686  N N   . ILE I 1 60  ? 14.437  48.071  -35.716 1.00 10.44  ? 60   ILE E N   1 
ATOM   7687  C CA  . ILE I 1 60  ? 13.756  49.135  -36.355 1.00 7.52   ? 60   ILE E CA  1 
ATOM   7688  C C   . ILE I 1 60  ? 14.709  50.059  -37.097 1.00 12.99  ? 60   ILE E C   1 
ATOM   7689  O O   . ILE I 1 60  ? 15.811  50.384  -36.656 1.00 18.91  ? 60   ILE E O   1 
ATOM   7690  C CB  . ILE I 1 60  ? 13.147  49.914  -35.214 1.00 13.20  ? 60   ILE E CB  1 
ATOM   7691  C CG1 . ILE I 1 60  ? 12.387  51.064  -35.776 1.00 13.74  ? 60   ILE E CG1 1 
ATOM   7692  C CG2 . ILE I 1 60  ? 14.269  50.462  -34.326 1.00 13.67  ? 60   ILE E CG2 1 
ATOM   7693  C CD1 . ILE I 1 60  ? 11.462  51.713  -34.765 1.00 4.78   ? 60   ILE E CD1 1 
ATOM   7694  N N   . ASP I 1 61  ? 14.262  50.494  -38.248 1.00 13.05  ? 61   ASP E N   1 
ATOM   7695  C CA  . ASP I 1 61  ? 15.027  51.421  -39.088 1.00 8.47   ? 61   ASP E CA  1 
ATOM   7696  C C   . ASP I 1 61  ? 16.427  50.985  -39.318 1.00 16.67  ? 61   ASP E C   1 
ATOM   7697  O O   . ASP I 1 61  ? 17.373  51.790  -39.361 1.00 22.10  ? 61   ASP E O   1 
ATOM   7698  C CB  . ASP I 1 61  ? 14.937  52.875  -38.642 1.00 7.69   ? 61   ASP E CB  1 
ATOM   7699  C CG  . ASP I 1 61  ? 13.514  53.300  -38.792 1.00 29.36  ? 61   ASP E CG  1 
ATOM   7700  O OD1 . ASP I 1 61  ? 12.652  52.602  -39.344 1.00 47.71  ? 61   ASP E OD1 1 
ATOM   7701  O OD2 . ASP I 1 61  ? 13.249  54.319  -38.034 1.00 16.19  ? 61   ASP E OD2 1 
ATOM   7702  N N   . GLY I 1 62  ? 16.509  49.672  -39.451 1.00 16.28  ? 62   GLY E N   1 
ATOM   7703  C CA  . GLY I 1 62  ? 17.764  49.002  -39.702 1.00 16.33  ? 62   GLY E CA  1 
ATOM   7704  C C   . GLY I 1 62  ? 18.671  48.828  -38.513 1.00 27.86  ? 62   GLY E C   1 
ATOM   7705  O O   . GLY I 1 62  ? 19.805  48.399  -38.699 1.00 31.80  ? 62   GLY E O   1 
ATOM   7706  N N   . MET I 1 63  ? 18.187  49.159  -37.302 1.00 21.31  ? 63   MET E N   1 
ATOM   7707  C CA  . MET I 1 63  ? 18.990  49.009  -36.136 1.00 10.03  ? 63   MET E CA  1 
ATOM   7708  C C   . MET I 1 63  ? 18.377  47.954  -35.266 1.00 19.03  ? 63   MET E C   1 
ATOM   7709  O O   . MET I 1 63  ? 17.213  47.583  -35.473 1.00 21.46  ? 63   MET E O   1 
ATOM   7710  C CB  . MET I 1 63  ? 18.991  50.324  -35.385 1.00 9.48   ? 63   MET E CB  1 
ATOM   7711  C CG  . MET I 1 63  ? 19.511  51.483  -36.215 1.00 9.21   ? 63   MET E CG  1 
ATOM   7712  S SD  . MET I 1 63  ? 18.750  53.047  -35.770 1.00 21.16  ? 63   MET E SD  1 
ATOM   7713  C CE  . MET I 1 63  ? 20.106  53.866  -34.862 1.00 25.93  ? 63   MET E CE  1 
ATOM   7714  N N   . LYS I 1 64  ? 19.173  47.514  -34.305 1.00 11.90  ? 64   LYS E N   1 
ATOM   7715  C CA  . LYS I 1 64  ? 18.722  46.609  -33.312 1.00 11.35  ? 64   LYS E CA  1 
ATOM   7716  C C   . LYS I 1 64  ? 18.845  47.324  -31.982 1.00 16.18  ? 64   LYS E C   1 
ATOM   7717  O O   . LYS I 1 64  ? 19.826  47.195  -31.266 1.00 16.69  ? 64   LYS E O   1 
ATOM   7718  C CB  . LYS I 1 64  ? 19.547  45.357  -33.298 1.00 14.15  ? 64   LYS E CB  1 
ATOM   7719  C CG  . LYS I 1 64  ? 19.525  44.687  -34.650 1.00 5.89   ? 64   LYS E CG  1 
ATOM   7720  C CD  . LYS I 1 64  ? 20.290  43.360  -34.678 1.00 21.21  ? 64   LYS E CD  1 
ATOM   7721  C CE  . LYS I 1 64  ? 20.362  42.596  -36.032 1.00 17.64  ? 64   LYS E CE  1 
ATOM   7722  N NZ  . LYS I 1 64  ? 21.657  41.855  -36.243 1.00 57.04  ? 64   LYS E NZ  1 
ATOM   7723  N N   . LEU I 1 65  ? 17.859  48.087  -31.649 1.00 7.70   ? 65   LEU E N   1 
ATOM   7724  C CA  . LEU I 1 65  ? 17.912  48.786  -30.417 1.00 4.37   ? 65   LEU E CA  1 
ATOM   7725  C C   . LEU I 1 65  ? 17.544  47.903  -29.288 1.00 6.56   ? 65   LEU E C   1 
ATOM   7726  O O   . LEU I 1 65  ? 16.690  47.041  -29.453 1.00 12.20  ? 65   LEU E O   1 
ATOM   7727  C CB  . LEU I 1 65  ? 16.909  49.918  -30.444 1.00 6.69   ? 65   LEU E CB  1 
ATOM   7728  C CG  . LEU I 1 65  ? 17.050  50.780  -31.690 1.00 7.55   ? 65   LEU E CG  1 
ATOM   7729  C CD1 . LEU I 1 65  ? 16.173  51.968  -31.559 1.00 1.00   ? 65   LEU E CD1 1 
ATOM   7730  C CD2 . LEU I 1 65  ? 18.446  51.323  -31.808 1.00 1.40   ? 65   LEU E CD2 1 
ATOM   7731  N N   . VAL I 1 66  ? 18.213  48.196  -28.163 1.00 1.00   ? 66   VAL E N   1 
ATOM   7732  C CA  . VAL I 1 66  ? 18.138  47.577  -26.841 1.00 5.48   ? 66   VAL E CA  1 
ATOM   7733  C C   . VAL I 1 66  ? 17.990  48.637  -25.727 1.00 11.95  ? 66   VAL E C   1 
ATOM   7734  O O   . VAL I 1 66  ? 18.229  49.812  -25.947 1.00 3.67   ? 66   VAL E O   1 
ATOM   7735  C CB  . VAL I 1 66  ? 19.290  46.606  -26.567 1.00 9.76   ? 66   VAL E CB  1 
ATOM   7736  C CG1 . VAL I 1 66  ? 19.363  45.609  -27.705 1.00 15.83  ? 66   VAL E CG1 1 
ATOM   7737  C CG2 . VAL I 1 66  ? 20.610  47.328  -26.481 1.00 1.21   ? 66   VAL E CG2 1 
ATOM   7738  N N   . GLN I 1 67  ? 17.553  48.235  -24.516 1.00 11.12  ? 67   GLN E N   1 
ATOM   7739  C CA  . GLN I 1 67  ? 17.301  49.169  -23.411 1.00 3.11   ? 67   GLN E CA  1 
ATOM   7740  C C   . GLN I 1 67  ? 16.004  49.830  -23.654 1.00 10.31  ? 67   GLN E C   1 
ATOM   7741  O O   . GLN I 1 67  ? 15.889  50.706  -24.530 1.00 11.82  ? 67   GLN E O   1 
ATOM   7742  C CB  . GLN I 1 67  ? 18.372  50.263  -23.248 1.00 1.00   ? 67   GLN E CB  1 
ATOM   7743  C CG  . GLN I 1 67  ? 19.736  49.614  -22.948 1.00 1.00   ? 67   GLN E CG  1 
ATOM   7744  C CD  . GLN I 1 67  ? 19.843  49.105  -21.514 1.00 2.40   ? 67   GLN E CD  1 
ATOM   7745  O OE1 . GLN I 1 67  ? 19.048  49.552  -20.654 1.00 19.99  ? 67   GLN E OE1 1 
ATOM   7746  N NE2 . GLN I 1 67  ? 20.783  48.173  -21.262 1.00 14.45  ? 67   GLN E NE2 1 
ATOM   7747  N N   . THR I 1 68  ? 15.049  49.389  -22.881 1.00 7.66   ? 68   THR E N   1 
ATOM   7748  C CA  . THR I 1 68  ? 13.699  49.925  -22.984 1.00 5.71   ? 68   THR E CA  1 
ATOM   7749  C C   . THR I 1 68  ? 13.643  51.411  -23.093 1.00 12.38  ? 68   THR E C   1 
ATOM   7750  O O   . THR I 1 68  ? 13.058  51.925  -24.016 1.00 12.68  ? 68   THR E O   1 
ATOM   7751  C CB  . THR I 1 68  ? 12.944  49.518  -21.744 1.00 4.93   ? 68   THR E CB  1 
ATOM   7752  O OG1 . THR I 1 68  ? 13.126  48.139  -21.575 1.00 9.64   ? 68   THR E OG1 1 
ATOM   7753  C CG2 . THR I 1 68  ? 11.508  49.856  -21.840 1.00 1.00   ? 68   THR E CG2 1 
ATOM   7754  N N   . ARG I 1 69  ? 14.297  52.128  -22.191 1.00 12.11  ? 69   ARG E N   1 
ATOM   7755  C CA  . ARG I 1 69  ? 14.153  53.571  -22.321 1.00 11.05  ? 69   ARG E CA  1 
ATOM   7756  C C   . ARG I 1 69  ? 14.689  54.173  -23.590 1.00 13.17  ? 69   ARG E C   1 
ATOM   7757  O O   . ARG I 1 69  ? 14.205  55.171  -24.098 1.00 15.74  ? 69   ARG E O   1 
ATOM   7758  C CB  . ARG I 1 69  ? 14.838  54.257  -21.204 1.00 2.87   ? 69   ARG E CB  1 
ATOM   7759  C CG  . ARG I 1 69  ? 14.373  53.769  -19.853 1.00 2.19   ? 69   ARG E CG  1 
ATOM   7760  C CD  . ARG I 1 69  ? 15.341  54.222  -18.764 1.00 16.62  ? 69   ARG E CD  1 
ATOM   7761  N NE  . ARG I 1 69  ? 14.736  54.349  -17.459 1.00 10.38  ? 69   ARG E NE  1 
ATOM   7762  C CZ  . ARG I 1 69  ? 14.332  53.259  -16.841 1.00 32.64  ? 69   ARG E CZ  1 
ATOM   7763  N NH1 . ARG I 1 69  ? 14.528  52.106  -17.432 1.00 27.33  ? 69   ARG E NH1 1 
ATOM   7764  N NH2 . ARG I 1 69  ? 13.641  53.300  -15.698 1.00 22.95  ? 69   ARG E NH2 1 
ATOM   7765  N N   . SER I 1 70  ? 15.758  53.597  -24.057 1.00 7.66   ? 70   SER E N   1 
ATOM   7766  C CA  . SER I 1 70  ? 16.430  54.104  -25.233 1.00 3.53   ? 70   SER E CA  1 
ATOM   7767  C C   . SER I 1 70  ? 15.582  53.865  -26.455 1.00 9.97   ? 70   SER E C   1 
ATOM   7768  O O   . SER I 1 70  ? 15.414  54.700  -27.328 1.00 14.94  ? 70   SER E O   1 
ATOM   7769  C CB  . SER I 1 70  ? 17.775  53.450  -25.307 1.00 1.00   ? 70   SER E CB  1 
ATOM   7770  O OG  . SER I 1 70  ? 18.483  53.660  -24.083 1.00 15.34  ? 70   SER E OG  1 
ATOM   7771  N N   . ILE I 1 71  ? 14.960  52.727  -26.419 1.00 4.81   ? 71   ILE E N   1 
ATOM   7772  C CA  . ILE I 1 71  ? 14.054  52.362  -27.454 1.00 3.49   ? 71   ILE E CA  1 
ATOM   7773  C C   . ILE I 1 71  ? 12.873  53.330  -27.491 1.00 9.08   ? 71   ILE E C   1 
ATOM   7774  O O   . ILE I 1 71  ? 12.505  53.868  -28.522 1.00 13.77  ? 71   ILE E O   1 
ATOM   7775  C CB  . ILE I 1 71  ? 13.531  50.969  -27.225 1.00 2.60   ? 71   ILE E CB  1 
ATOM   7776  C CG1 . ILE I 1 71  ? 14.585  49.841  -27.378 1.00 2.12   ? 71   ILE E CG1 1 
ATOM   7777  C CG2 . ILE I 1 71  ? 12.530  50.862  -28.286 1.00 1.00   ? 71   ILE E CG2 1 
ATOM   7778  C CD1 . ILE I 1 71  ? 14.121  48.499  -26.799 1.00 1.00   ? 71   ILE E CD1 1 
ATOM   7779  N N   . LEU I 1 72  ? 12.289  53.581  -26.346 1.00 6.18   ? 72   LEU E N   1 
ATOM   7780  C CA  . LEU I 1 72  ? 11.151  54.490  -26.228 1.00 4.76   ? 72   LEU E CA  1 
ATOM   7781  C C   . LEU I 1 72  ? 11.521  55.845  -26.691 1.00 4.66   ? 72   LEU E C   1 
ATOM   7782  O O   . LEU I 1 72  ? 10.794  56.456  -27.422 1.00 11.07  ? 72   LEU E O   1 
ATOM   7783  C CB  . LEU I 1 72  ? 10.627  54.603  -24.786 1.00 7.63   ? 72   LEU E CB  1 
ATOM   7784  C CG  . LEU I 1 72  ? 10.055  53.308  -24.229 1.00 3.60   ? 72   LEU E CG  1 
ATOM   7785  C CD1 . LEU I 1 72  ? 9.592   53.489  -22.798 1.00 1.00   ? 72   LEU E CD1 1 
ATOM   7786  C CD2 . LEU I 1 72  ? 8.917   52.853  -25.091 1.00 1.00   ? 72   LEU E CD2 1 
ATOM   7787  N N   . HIS I 1 73  ? 12.657  56.355  -26.289 1.00 7.74   ? 73   HIS E N   1 
ATOM   7788  C CA  . HIS I 1 73  ? 13.044  57.688  -26.805 1.00 3.88   ? 73   HIS E CA  1 
ATOM   7789  C C   . HIS I 1 73  ? 13.173  57.686  -28.310 1.00 11.84  ? 73   HIS E C   1 
ATOM   7790  O O   . HIS I 1 73  ? 12.826  58.647  -28.988 1.00 12.42  ? 73   HIS E O   1 
ATOM   7791  C CB  . HIS I 1 73  ? 14.427  58.055  -26.327 1.00 1.00   ? 73   HIS E CB  1 
ATOM   7792  C CG  . HIS I 1 73  ? 14.503  58.097  -24.846 1.00 6.41   ? 73   HIS E CG  1 
ATOM   7793  N ND1 . HIS I 1 73  ? 15.661  57.907  -24.143 1.00 9.52   ? 73   HIS E ND1 1 
ATOM   7794  C CD2 . HIS I 1 73  ? 13.545  58.348  -23.955 1.00 12.04  ? 73   HIS E CD2 1 
ATOM   7795  C CE1 . HIS I 1 73  ? 15.390  58.031  -22.869 1.00 10.29  ? 73   HIS E CE1 1 
ATOM   7796  N NE2 . HIS I 1 73  ? 14.121  58.311  -22.720 1.00 12.17  ? 73   HIS E NE2 1 
ATOM   7797  N N   . TYR I 1 74  ? 13.744  56.626  -28.871 1.00 8.27   ? 74   TYR E N   1 
ATOM   7798  C CA  . TYR I 1 74  ? 13.887  56.650  -30.318 1.00 9.83   ? 74   TYR E CA  1 
ATOM   7799  C C   . TYR I 1 74  ? 12.534  56.803  -31.005 1.00 14.80  ? 74   TYR E C   1 
ATOM   7800  O O   . TYR I 1 74  ? 12.320  57.690  -31.839 1.00 13.02  ? 74   TYR E O   1 
ATOM   7801  C CB  . TYR I 1 74  ? 14.622  55.399  -30.849 1.00 9.69   ? 74   TYR E CB  1 
ATOM   7802  C CG  . TYR I 1 74  ? 14.731  55.366  -32.355 1.00 11.22  ? 74   TYR E CG  1 
ATOM   7803  C CD1 . TYR I 1 74  ? 15.626  56.189  -33.029 1.00 11.17  ? 74   TYR E CD1 1 
ATOM   7804  C CD2 . TYR I 1 74  ? 13.950  54.507  -33.134 1.00 12.41  ? 74   TYR E CD2 1 
ATOM   7805  C CE1 . TYR I 1 74  ? 15.719  56.151  -34.420 1.00 10.74  ? 74   TYR E CE1 1 
ATOM   7806  C CE2 . TYR I 1 74  ? 13.961  54.521  -34.530 1.00 9.64   ? 74   TYR E CE2 1 
ATOM   7807  C CZ  . TYR I 1 74  ? 14.875  55.343  -35.186 1.00 19.86  ? 74   TYR E CZ  1 
ATOM   7808  O OH  . TYR I 1 74  ? 14.973  55.347  -36.576 1.00 17.49  ? 74   TYR E OH  1 
ATOM   7809  N N   . ILE I 1 75  ? 11.603  55.952  -30.591 1.00 4.94   ? 75   ILE E N   1 
ATOM   7810  C CA  . ILE I 1 75  ? 10.318  56.003  -31.216 1.00 4.38   ? 75   ILE E CA  1 
ATOM   7811  C C   . ILE I 1 75  ? 9.655   57.325  -31.033 1.00 15.50  ? 75   ILE E C   1 
ATOM   7812  O O   . ILE I 1 75  ? 9.093   57.854  -31.945 1.00 18.12  ? 75   ILE E O   1 
ATOM   7813  C CB  . ILE I 1 75  ? 9.483   54.896  -30.666 1.00 7.14   ? 75   ILE E CB  1 
ATOM   7814  C CG1 . ILE I 1 75  ? 10.203  53.576  -30.960 1.00 8.39   ? 75   ILE E CG1 1 
ATOM   7815  C CG2 . ILE I 1 75  ? 8.100   54.923  -31.270 1.00 2.67   ? 75   ILE E CG2 1 
ATOM   7816  C CD1 . ILE I 1 75  ? 9.587   52.403  -30.197 1.00 9.74   ? 75   ILE E CD1 1 
ATOM   7817  N N   . ALA I 1 76  ? 9.731   57.851  -29.831 1.00 8.97   ? 76   ALA E N   1 
ATOM   7818  C CA  . ALA I 1 76  ? 9.098   59.102  -29.540 1.00 6.89   ? 76   ALA E CA  1 
ATOM   7819  C C   . ALA I 1 76  ? 9.618   60.156  -30.460 1.00 14.31  ? 76   ALA E C   1 
ATOM   7820  O O   . ALA I 1 76  ? 8.913   60.931  -31.029 1.00 16.32  ? 76   ALA E O   1 
ATOM   7821  C CB  . ALA I 1 76  ? 9.368   59.510  -28.096 1.00 7.25   ? 76   ALA E CB  1 
ATOM   7822  N N   . ASP I 1 77  ? 10.886  60.176  -30.584 1.00 12.04  ? 77   ASP E N   1 
ATOM   7823  C CA  . ASP I 1 77  ? 11.523  61.147  -31.416 1.00 8.15   ? 77   ASP E CA  1 
ATOM   7824  C C   . ASP I 1 77  ? 11.220  60.916  -32.878 1.00 20.17  ? 77   ASP E C   1 
ATOM   7825  O O   . ASP I 1 77  ? 11.237  61.832  -33.656 1.00 27.38  ? 77   ASP E O   1 
ATOM   7826  C CB  . ASP I 1 77  ? 13.034  61.105  -31.169 1.00 1.30   ? 77   ASP E CB  1 
ATOM   7827  C CG  . ASP I 1 77  ? 13.450  62.199  -30.227 1.00 15.64  ? 77   ASP E CG  1 
ATOM   7828  O OD1 . ASP I 1 77  ? 12.728  63.165  -29.944 1.00 25.53  ? 77   ASP E OD1 1 
ATOM   7829  O OD2 . ASP I 1 77  ? 14.660  62.005  -29.751 1.00 25.03  ? 77   ASP E OD2 1 
ATOM   7830  N N   . LYS I 1 78  ? 10.966  59.700  -33.286 1.00 13.84  ? 78   LYS E N   1 
ATOM   7831  C CA  . LYS I 1 78  ? 10.604  59.530  -34.674 1.00 8.75   ? 78   LYS E CA  1 
ATOM   7832  C C   . LYS I 1 78  ? 9.126   59.862  -34.811 1.00 21.37  ? 78   LYS E C   1 
ATOM   7833  O O   . LYS I 1 78  ? 8.583   59.817  -35.883 1.00 25.64  ? 78   LYS E O   1 
ATOM   7834  C CB  . LYS I 1 78  ? 10.695  58.068  -35.163 1.00 6.78   ? 78   LYS E CB  1 
ATOM   7835  C CG  . LYS I 1 78  ? 12.090  57.543  -35.183 1.00 40.33  ? 78   LYS E CG  1 
ATOM   7836  C CD  . LYS I 1 78  ? 13.017  58.526  -35.862 1.00 42.81  ? 78   LYS E CD  1 
ATOM   7837  C CE  . LYS I 1 78  ? 13.047  58.406  -37.391 1.00 47.35  ? 78   LYS E CE  1 
ATOM   7838  N NZ  . LYS I 1 78  ? 13.720  59.537  -38.070 1.00 69.76  ? 78   LYS E NZ  1 
ATOM   7839  N N   . HIS I 1 79  ? 8.391   60.054  -33.741 1.00 16.29  ? 79   HIS E N   1 
ATOM   7840  C CA  . HIS I 1 79  ? 6.990   60.250  -34.004 1.00 10.72  ? 79   HIS E CA  1 
ATOM   7841  C C   . HIS I 1 79  ? 6.321   61.378  -33.302 1.00 14.66  ? 79   HIS E C   1 
ATOM   7842  O O   . HIS I 1 79  ? 5.162   61.229  -32.936 1.00 6.93   ? 79   HIS E O   1 
ATOM   7843  C CB  . HIS I 1 79  ? 6.203   59.030  -33.654 1.00 10.30  ? 79   HIS E CB  1 
ATOM   7844  C CG  . HIS I 1 79  ? 6.447   57.959  -34.617 1.00 20.66  ? 79   HIS E CG  1 
ATOM   7845  N ND1 . HIS I 1 79  ? 7.376   56.977  -34.365 1.00 29.24  ? 79   HIS E ND1 1 
ATOM   7846  C CD2 . HIS I 1 79  ? 5.869   57.687  -35.807 1.00 21.04  ? 79   HIS E CD2 1 
ATOM   7847  C CE1 . HIS I 1 79  ? 7.351   56.118  -35.395 1.00 23.80  ? 79   HIS E CE1 1 
ATOM   7848  N NE2 . HIS I 1 79  ? 6.453   56.528  -36.261 1.00 19.97  ? 79   HIS E NE2 1 
ATOM   7849  N N   . ASN I 1 80  ? 7.042   62.464  -33.088 1.00 17.51  ? 80   ASN E N   1 
ATOM   7850  C CA  . ASN I 1 80  ? 6.432   63.553  -32.393 1.00 17.97  ? 80   ASN E CA  1 
ATOM   7851  C C   . ASN I 1 80  ? 5.808   63.239  -31.052 1.00 23.47  ? 80   ASN E C   1 
ATOM   7852  O O   . ASN I 1 80  ? 4.761   63.799  -30.691 1.00 33.09  ? 80   ASN E O   1 
ATOM   7853  C CB  . ASN I 1 80  ? 5.408   64.230  -33.285 1.00 22.81  ? 80   ASN E CB  1 
ATOM   7854  C CG  . ASN I 1 80  ? 5.025   65.598  -32.818 1.00 56.00  ? 80   ASN E CG  1 
ATOM   7855  O OD1 . ASN I 1 80  ? 3.823   65.875  -32.754 1.00 61.63  ? 80   ASN E OD1 1 
ATOM   7856  N ND2 . ASN I 1 80  ? 6.028   66.457  -32.578 1.00 50.44  ? 80   ASN E ND2 1 
ATOM   7857  N N   . LEU I 1 81  ? 6.447   62.379  -30.285 1.00 17.49  ? 81   LEU E N   1 
ATOM   7858  C CA  . LEU I 1 81  ? 5.893   62.105  -28.975 1.00 12.09  ? 81   LEU E CA  1 
ATOM   7859  C C   . LEU I 1 81  ? 6.836   62.614  -27.923 1.00 9.79   ? 81   LEU E C   1 
ATOM   7860  O O   . LEU I 1 81  ? 6.701   62.251  -26.771 1.00 9.64   ? 81   LEU E O   1 
ATOM   7861  C CB  . LEU I 1 81  ? 5.636   60.639  -28.726 1.00 6.52   ? 81   LEU E CB  1 
ATOM   7862  C CG  . LEU I 1 81  ? 4.694   60.064  -29.740 1.00 4.24   ? 81   LEU E CG  1 
ATOM   7863  C CD1 . LEU I 1 81  ? 4.776   58.525  -29.654 1.00 2.56   ? 81   LEU E CD1 1 
ATOM   7864  C CD2 . LEU I 1 81  ? 3.319   60.403  -29.259 1.00 1.00   ? 81   LEU E CD2 1 
ATOM   7865  N N   . PHE I 1 82  ? 7.762   63.464  -28.332 1.00 7.16   ? 82   PHE E N   1 
ATOM   7866  C CA  . PHE I 1 82  ? 8.795   63.976  -27.396 1.00 7.97   ? 82   PHE E CA  1 
ATOM   7867  C C   . PHE I 1 82  ? 8.847   65.479  -27.218 1.00 16.81  ? 82   PHE E C   1 
ATOM   7868  O O   . PHE I 1 82  ? 9.890   66.073  -26.898 1.00 19.23  ? 82   PHE E O   1 
ATOM   7869  C CB  . PHE I 1 82  ? 10.207  63.469  -27.727 1.00 4.68   ? 82   PHE E CB  1 
ATOM   7870  C CG  . PHE I 1 82  ? 10.941  62.932  -26.541 1.00 9.05   ? 82   PHE E CG  1 
ATOM   7871  C CD1 . PHE I 1 82  ? 10.777  63.487  -25.263 1.00 15.06  ? 82   PHE E CD1 1 
ATOM   7872  C CD2 . PHE I 1 82  ? 11.831  61.867  -26.696 1.00 10.50  ? 82   PHE E CD2 1 
ATOM   7873  C CE1 . PHE I 1 82  ? 11.471  63.042  -24.136 1.00 9.59   ? 82   PHE E CE1 1 
ATOM   7874  C CE2 . PHE I 1 82  ? 12.549  61.420  -25.588 1.00 11.51  ? 82   PHE E CE2 1 
ATOM   7875  C CZ  . PHE I 1 82  ? 12.371  61.990  -24.318 1.00 7.34   ? 82   PHE E CZ  1 
ATOM   7876  N N   . GLY I 1 83  ? 7.702   66.102  -27.417 1.00 16.51  ? 83   GLY E N   1 
ATOM   7877  C CA  . GLY I 1 83  ? 7.662   67.522  -27.241 1.00 18.16  ? 83   GLY E CA  1 
ATOM   7878  C C   . GLY I 1 83  ? 8.088   68.261  -28.480 1.00 19.47  ? 83   GLY E C   1 
ATOM   7879  O O   . GLY I 1 83  ? 8.268   67.637  -29.521 1.00 16.68  ? 83   GLY E O   1 
ATOM   7880  N N   . LYS I 1 84  ? 8.247   69.573  -28.312 1.00 16.34  ? 84   LYS E N   1 
ATOM   7881  C CA  . LYS I 1 84  ? 8.598   70.497  -29.377 1.00 15.03  ? 84   LYS E CA  1 
ATOM   7882  C C   . LYS I 1 84  ? 9.777   71.351  -28.984 1.00 25.33  ? 84   LYS E C   1 
ATOM   7883  O O   . LYS I 1 84  ? 10.347  72.078  -29.773 1.00 23.09  ? 84   LYS E O   1 
ATOM   7884  C CB  . LYS I 1 84  ? 7.384   71.262  -29.934 1.00 10.79  ? 84   LYS E CB  1 
ATOM   7885  C CG  . LYS I 1 84  ? 6.483   70.213  -30.606 1.00 32.78  ? 84   LYS E CG  1 
ATOM   7886  C CD  . LYS I 1 84  ? 5.397   70.710  -31.557 1.00 30.09  ? 84   LYS E CD  1 
ATOM   7887  C CE  . LYS I 1 84  ? 4.984   69.729  -32.671 1.00 51.57  ? 84   LYS E CE  1 
ATOM   7888  N NZ  . LYS I 1 84  ? 3.725   70.119  -33.364 1.00 126.63 ? 84   LYS E NZ  1 
ATOM   7889  N N   . ASN I 1 85  ? 10.252  71.134  -27.773 1.00 25.00  ? 85   ASN E N   1 
ATOM   7890  C CA  . ASN I 1 85  ? 11.421  71.853  -27.347 1.00 19.70  ? 85   ASN E CA  1 
ATOM   7891  C C   . ASN I 1 85  ? 12.040  71.274  -26.074 1.00 22.04  ? 85   ASN E C   1 
ATOM   7892  O O   . ASN I 1 85  ? 11.407  70.489  -25.371 1.00 31.75  ? 85   ASN E O   1 
ATOM   7893  C CB  . ASN I 1 85  ? 11.058  73.338  -27.242 1.00 10.80  ? 85   ASN E CB  1 
ATOM   7894  C CG  . ASN I 1 85  ? 10.204  73.617  -26.037 1.00 18.33  ? 85   ASN E CG  1 
ATOM   7895  O OD1 . ASN I 1 85  ? 10.551  73.301  -24.891 1.00 71.35  ? 85   ASN E OD1 1 
ATOM   7896  N ND2 . ASN I 1 85  ? 9.012   74.036  -26.317 1.00 19.54  ? 85   ASN E ND2 1 
ATOM   7897  N N   . LEU I 1 86  ? 13.256  71.724  -25.741 1.00 13.64  ? 86   LEU E N   1 
ATOM   7898  C CA  . LEU I 1 86  ? 13.966  71.237  -24.570 1.00 7.94   ? 86   LEU E CA  1 
ATOM   7899  C C   . LEU I 1 86  ? 13.145  71.222  -23.309 1.00 14.84  ? 86   LEU E C   1 
ATOM   7900  O O   . LEU I 1 86  ? 13.164  70.267  -22.521 1.00 20.25  ? 86   LEU E O   1 
ATOM   7901  C CB  . LEU I 1 86  ? 15.258  72.003  -24.305 1.00 4.53   ? 86   LEU E CB  1 
ATOM   7902  C CG  . LEU I 1 86  ? 16.165  71.290  -23.317 1.00 10.05  ? 86   LEU E CG  1 
ATOM   7903  C CD1 . LEU I 1 86  ? 16.295  69.851  -23.715 1.00 13.10  ? 86   LEU E CD1 1 
ATOM   7904  C CD2 . LEU I 1 86  ? 17.559  71.835  -23.379 1.00 8.38   ? 86   LEU E CD2 1 
ATOM   7905  N N   . LYS I 1 87  ? 12.420  72.304  -23.135 1.00 12.86  ? 87   LYS E N   1 
ATOM   7906  C CA  . LYS I 1 87  ? 11.605  72.456  -21.942 1.00 16.47  ? 87   LYS E CA  1 
ATOM   7907  C C   . LYS I 1 87  ? 10.627  71.350  -21.773 1.00 17.63  ? 87   LYS E C   1 
ATOM   7908  O O   . LYS I 1 87  ? 10.569  70.746  -20.719 1.00 27.41  ? 87   LYS E O   1 
ATOM   7909  C CB  . LYS I 1 87  ? 11.066  73.863  -21.720 1.00 18.47  ? 87   LYS E CB  1 
ATOM   7910  C CG  . LYS I 1 87  ? 12.233  74.869  -21.724 1.00 136.90 ? 87   LYS E CG  1 
ATOM   7911  C CD  . LYS I 1 87  ? 13.518  74.370  -21.016 1.00 174.68 ? 87   LYS E CD  1 
ATOM   7912  C CE  . LYS I 1 87  ? 14.795  75.201  -21.288 1.00 151.33 ? 87   LYS E CE  1 
ATOM   7913  N NZ  . LYS I 1 87  ? 15.985  74.880  -20.446 1.00 58.97  ? 87   LYS E NZ  1 
ATOM   7914  N N   . GLU I 1 88  ? 9.926   71.105  -22.850 1.00 8.70   ? 88   GLU E N   1 
ATOM   7915  C CA  . GLU I 1 88  ? 8.949   70.060  -22.939 1.00 11.62  ? 88   GLU E CA  1 
ATOM   7916  C C   . GLU I 1 88  ? 9.577   68.719  -22.782 1.00 18.30  ? 88   GLU E C   1 
ATOM   7917  O O   . GLU I 1 88  ? 9.159   67.888  -21.983 1.00 23.26  ? 88   GLU E O   1 
ATOM   7918  C CB  . GLU I 1 88  ? 8.280   70.104  -24.327 1.00 14.39  ? 88   GLU E CB  1 
ATOM   7919  C CG  . GLU I 1 88  ? 7.384   71.349  -24.470 1.00 5.07   ? 88   GLU E CG  1 
ATOM   7920  C CD  . GLU I 1 88  ? 6.499   71.496  -25.697 1.00 21.29  ? 88   GLU E CD  1 
ATOM   7921  O OE1 . GLU I 1 88  ? 6.272   70.636  -26.594 1.00 20.61  ? 88   GLU E OE1 1 
ATOM   7922  O OE2 . GLU I 1 88  ? 5.825   72.625  -25.567 1.00 24.75  ? 88   GLU E OE2 1 
ATOM   7923  N N   . ARG I 1 89  ? 10.550  68.510  -23.626 1.00 10.56  ? 89   ARG E N   1 
ATOM   7924  C CA  . ARG I 1 89  ? 11.288  67.287  -23.661 1.00 9.51   ? 89   ARG E CA  1 
ATOM   7925  C C   . ARG I 1 89  ? 11.748  66.953  -22.273 1.00 9.97   ? 89   ARG E C   1 
ATOM   7926  O O   . ARG I 1 89  ? 11.626  65.840  -21.745 1.00 10.78  ? 89   ARG E O   1 
ATOM   7927  C CB  . ARG I 1 89  ? 12.519  67.559  -24.433 1.00 3.43   ? 89   ARG E CB  1 
ATOM   7928  C CG  . ARG I 1 89  ? 13.083  66.244  -24.823 1.00 18.27  ? 89   ARG E CG  1 
ATOM   7929  C CD  . ARG I 1 89  ? 14.245  66.420  -25.781 1.00 6.77   ? 89   ARG E CD  1 
ATOM   7930  N NE  . ARG I 1 89  ? 14.827  65.166  -26.104 1.00 16.25  ? 89   ARG E NE  1 
ATOM   7931  C CZ  . ARG I 1 89  ? 14.553  64.439  -27.160 1.00 15.11  ? 89   ARG E CZ  1 
ATOM   7932  N NH1 . ARG I 1 89  ? 13.707  64.860  -28.102 1.00 14.64  ? 89   ARG E NH1 1 
ATOM   7933  N NH2 . ARG I 1 89  ? 15.160  63.242  -27.236 1.00 33.37  ? 89   ARG E NH2 1 
ATOM   7934  N N   . THR I 1 90  ? 12.203  67.991  -21.615 1.00 1.00   ? 90   THR E N   1 
ATOM   7935  C CA  . THR I 1 90  ? 12.651  67.775  -20.231 1.00 1.00   ? 90   THR E CA  1 
ATOM   7936  C C   . THR I 1 90  ? 11.559  67.244  -19.277 1.00 12.66  ? 90   THR E C   1 
ATOM   7937  O O   . THR I 1 90  ? 11.753  66.292  -18.505 1.00 12.11  ? 90   THR E O   1 
ATOM   7938  C CB  . THR I 1 90  ? 13.365  69.013  -19.725 1.00 11.57  ? 90   THR E CB  1 
ATOM   7939  O OG1 . THR I 1 90  ? 14.420  69.401  -20.588 1.00 20.47  ? 90   THR E OG1 1 
ATOM   7940  C CG2 . THR I 1 90  ? 13.870  68.740  -18.361 1.00 1.00   ? 90   THR E CG2 1 
ATOM   7941  N N   . LEU I 1 91  ? 10.353  67.819  -19.399 1.00 5.25   ? 91   LEU E N   1 
ATOM   7942  C CA  . LEU I 1 91  ? 9.235   67.416  -18.586 1.00 1.00   ? 91   LEU E CA  1 
ATOM   7943  C C   . LEU I 1 91  ? 8.800   66.020  -18.868 1.00 9.46   ? 91   LEU E C   1 
ATOM   7944  O O   . LEU I 1 91  ? 8.588   65.213  -17.977 1.00 13.34  ? 91   LEU E O   1 
ATOM   7945  C CB  . LEU I 1 91  ? 8.087   68.352  -18.884 1.00 2.65   ? 91   LEU E CB  1 
ATOM   7946  C CG  . LEU I 1 91  ? 8.400   69.743  -18.336 1.00 6.82   ? 91   LEU E CG  1 
ATOM   7947  C CD1 . LEU I 1 91  ? 7.375   70.740  -18.756 1.00 2.85   ? 91   LEU E CD1 1 
ATOM   7948  C CD2 . LEU I 1 91  ? 8.319   69.750  -16.842 1.00 1.00   ? 91   LEU E CD2 1 
ATOM   7949  N N   . ILE I 1 92  ? 8.672   65.755  -20.140 1.00 6.98   ? 92   ILE E N   1 
ATOM   7950  C CA  . ILE I 1 92  ? 8.232   64.468  -20.604 1.00 5.61   ? 92   ILE E CA  1 
ATOM   7951  C C   . ILE I 1 92  ? 9.173   63.426  -20.100 1.00 12.34  ? 92   ILE E C   1 
ATOM   7952  O O   . ILE I 1 92  ? 8.766   62.375  -19.624 1.00 16.34  ? 92   ILE E O   1 
ATOM   7953  C CB  . ILE I 1 92  ? 8.254   64.527  -22.114 1.00 9.15   ? 92   ILE E CB  1 
ATOM   7954  C CG1 . ILE I 1 92  ? 7.200   65.529  -22.537 1.00 9.09   ? 92   ILE E CG1 1 
ATOM   7955  C CG2 . ILE I 1 92  ? 8.038   63.180  -22.777 1.00 4.91   ? 92   ILE E CG2 1 
ATOM   7956  C CD1 . ILE I 1 92  ? 6.962   65.587  -24.022 1.00 7.16   ? 92   ILE E CD1 1 
ATOM   7957  N N   . ASP I 1 93  ? 10.453  63.758  -20.166 1.00 5.23   ? 93   ASP E N   1 
ATOM   7958  C CA  . ASP I 1 93  ? 11.450  62.814  -19.713 1.00 3.41   ? 93   ASP E CA  1 
ATOM   7959  C C   . ASP I 1 93  ? 11.278  62.458  -18.239 1.00 13.46  ? 93   ASP E C   1 
ATOM   7960  O O   . ASP I 1 93  ? 11.129  61.281  -17.837 1.00 8.81   ? 93   ASP E O   1 
ATOM   7961  C CB  . ASP I 1 93  ? 12.816  63.404  -20.029 1.00 3.72   ? 93   ASP E CB  1 
ATOM   7962  C CG  . ASP I 1 93  ? 14.051  62.530  -19.821 1.00 15.82  ? 93   ASP E CG  1 
ATOM   7963  O OD1 . ASP I 1 93  ? 14.020  61.409  -19.377 1.00 13.84  ? 93   ASP E OD1 1 
ATOM   7964  O OD2 . ASP I 1 93  ? 15.160  63.125  -20.227 1.00 24.47  ? 93   ASP E OD2 1 
ATOM   7965  N N   . MET I 1 94  ? 11.198  63.499  -17.441 1.00 7.44   ? 94   MET E N   1 
ATOM   7966  C CA  . MET I 1 94  ? 11.014  63.246  -16.056 1.00 1.95   ? 94   MET E CA  1 
ATOM   7967  C C   . MET I 1 94  ? 9.782   62.488  -15.736 1.00 4.64   ? 94   MET E C   1 
ATOM   7968  O O   . MET I 1 94  ? 9.788   61.598  -14.889 1.00 7.26   ? 94   MET E O   1 
ATOM   7969  C CB  . MET I 1 94  ? 10.948  64.554  -15.352 1.00 4.75   ? 94   MET E CB  1 
ATOM   7970  C CG  . MET I 1 94  ? 12.279  65.326  -15.358 1.00 9.41   ? 94   MET E CG  1 
ATOM   7971  S SD  . MET I 1 94  ? 12.126  66.935  -14.443 1.00 14.86  ? 94   MET E SD  1 
ATOM   7972  C CE  . MET I 1 94  ? 13.011  66.208  -13.061 1.00 13.63  ? 94   MET E CE  1 
ATOM   7973  N N   . TYR I 1 95  ? 8.706   62.851  -16.408 1.00 3.29   ? 95   TYR E N   1 
ATOM   7974  C CA  . TYR I 1 95  ? 7.450   62.210  -16.102 1.00 1.00   ? 95   TYR E CA  1 
ATOM   7975  C C   . TYR I 1 95  ? 7.559   60.759  -16.385 1.00 6.98   ? 95   TYR E C   1 
ATOM   7976  O O   . TYR I 1 95  ? 7.158   59.873  -15.648 1.00 7.33   ? 95   TYR E O   1 
ATOM   7977  C CB  . TYR I 1 95  ? 6.335   62.748  -16.987 1.00 2.91   ? 95   TYR E CB  1 
ATOM   7978  C CG  . TYR I 1 95  ? 6.074   64.196  -16.664 1.00 8.52   ? 95   TYR E CG  1 
ATOM   7979  C CD1 . TYR I 1 95  ? 6.638   64.729  -15.510 1.00 4.73   ? 95   TYR E CD1 1 
ATOM   7980  C CD2 . TYR I 1 95  ? 5.252   65.028  -17.445 1.00 10.51  ? 95   TYR E CD2 1 
ATOM   7981  C CE1 . TYR I 1 95  ? 6.415   66.072  -15.197 1.00 6.52   ? 95   TYR E CE1 1 
ATOM   7982  C CE2 . TYR I 1 95  ? 4.996   66.372  -17.127 1.00 4.52   ? 95   TYR E CE2 1 
ATOM   7983  C CZ  . TYR I 1 95  ? 5.608   66.898  -15.989 1.00 16.64  ? 95   TYR E CZ  1 
ATOM   7984  O OH  . TYR I 1 95  ? 5.439   68.219  -15.623 1.00 17.95  ? 95   TYR E OH  1 
ATOM   7985  N N   . VAL I 1 96  ? 8.138   60.532  -17.503 1.00 4.16   ? 96   VAL E N   1 
ATOM   7986  C CA  . VAL I 1 96  ? 8.319   59.176  -17.898 1.00 2.88   ? 96   VAL E CA  1 
ATOM   7987  C C   . VAL I 1 96  ? 9.165   58.386  -16.936 1.00 6.46   ? 96   VAL E C   1 
ATOM   7988  O O   . VAL I 1 96  ? 8.814   57.281  -16.562 1.00 6.51   ? 96   VAL E O   1 
ATOM   7989  C CB  . VAL I 1 96  ? 8.973   59.155  -19.232 1.00 3.29   ? 96   VAL E CB  1 
ATOM   7990  C CG1 . VAL I 1 96  ? 9.324   57.732  -19.490 1.00 1.56   ? 96   VAL E CG1 1 
ATOM   7991  C CG2 . VAL I 1 96  ? 7.981   59.580  -20.275 1.00 4.65   ? 96   VAL E CG2 1 
ATOM   7992  N N   . GLU I 1 97  ? 10.314  58.922  -16.548 1.00 1.62   ? 97   GLU E N   1 
ATOM   7993  C CA  . GLU I 1 97  ? 11.136  58.148  -15.612 1.00 2.81   ? 97   GLU E CA  1 
ATOM   7994  C C   . GLU I 1 97  ? 10.426  57.879  -14.308 1.00 9.85   ? 97   GLU E C   1 
ATOM   7995  O O   . GLU I 1 97  ? 10.468  56.768  -13.763 1.00 10.22  ? 97   GLU E O   1 
ATOM   7996  C CB  . GLU I 1 97  ? 12.490  58.778  -15.331 1.00 6.17   ? 97   GLU E CB  1 
ATOM   7997  C CG  . GLU I 1 97  ? 13.290  59.021  -16.606 1.00 3.05   ? 97   GLU E CG  1 
ATOM   7998  C CD  . GLU I 1 97  ? 13.756  57.707  -17.227 1.00 17.39  ? 97   GLU E CD  1 
ATOM   7999  O OE1 . GLU I 1 97  ? 14.015  56.749  -16.542 1.00 7.10   ? 97   GLU E OE1 1 
ATOM   8000  O OE2 . GLU I 1 97  ? 13.982  57.756  -18.547 1.00 19.34  ? 97   GLU E OE2 1 
ATOM   8001  N N   . GLY I 1 98  ? 9.759   58.900  -13.810 1.00 7.21   ? 98   GLY E N   1 
ATOM   8002  C CA  . GLY I 1 98  ? 9.033   58.713  -12.562 1.00 2.67   ? 98   GLY E CA  1 
ATOM   8003  C C   . GLY I 1 98  ? 8.011   57.629  -12.738 1.00 3.56   ? 98   GLY E C   1 
ATOM   8004  O O   . GLY I 1 98  ? 7.903   56.687  -11.969 1.00 5.22   ? 98   GLY E O   1 
ATOM   8005  N N   . THR I 1 99  ? 7.289   57.725  -13.822 1.00 2.16   ? 99   THR E N   1 
ATOM   8006  C CA  . THR I 1 99  ? 6.269   56.719  -14.094 1.00 2.83   ? 99   THR E CA  1 
ATOM   8007  C C   . THR I 1 99  ? 6.810   55.304  -14.200 1.00 12.76  ? 99   THR E C   1 
ATOM   8008  O O   . THR I 1 99  ? 6.274   54.391  -13.571 1.00 12.87  ? 99   THR E O   1 
ATOM   8009  C CB  . THR I 1 99  ? 5.435   57.084  -15.302 1.00 7.66   ? 99   THR E CB  1 
ATOM   8010  O OG1 . THR I 1 99  ? 5.069   58.461  -15.225 1.00 6.21   ? 99   THR E OG1 1 
ATOM   8011  C CG2 . THR I 1 99  ? 4.240   56.150  -15.366 1.00 2.99   ? 99   THR E CG2 1 
ATOM   8012  N N   . LEU I 1 100 ? 7.918   55.137  -14.926 1.00 6.88   ? 100  LEU E N   1 
ATOM   8013  C CA  . LEU I 1 100 ? 8.575   53.822  -15.022 1.00 3.94   ? 100  LEU E CA  1 
ATOM   8014  C C   . LEU I 1 100 ? 8.958   53.273  -13.647 1.00 8.49   ? 100  LEU E C   1 
ATOM   8015  O O   . LEU I 1 100 ? 9.000   52.054  -13.379 1.00 13.34  ? 100  LEU E O   1 
ATOM   8016  C CB  . LEU I 1 100 ? 9.813   53.928  -15.894 1.00 4.11   ? 100  LEU E CB  1 
ATOM   8017  C CG  . LEU I 1 100 ? 9.505   54.137  -17.387 1.00 8.88   ? 100  LEU E CG  1 
ATOM   8018  C CD1 . LEU I 1 100 ? 10.804  54.048  -18.176 1.00 2.21   ? 100  LEU E CD1 1 
ATOM   8019  C CD2 . LEU I 1 100 ? 8.594   52.992  -17.864 1.00 1.00   ? 100  LEU E CD2 1 
ATOM   8020  N N   . ASP I 1 101 ? 9.204   54.172  -12.730 1.00 1.00   ? 101  ASP E N   1 
ATOM   8021  C CA  . ASP I 1 101 ? 9.505   53.681  -11.407 1.00 2.36   ? 101  ASP E CA  1 
ATOM   8022  C C   . ASP I 1 101 ? 8.302   53.065  -10.718 1.00 8.45   ? 101  ASP E C   1 
ATOM   8023  O O   . ASP I 1 101 ? 8.392   52.208  -9.871  1.00 12.15  ? 101  ASP E O   1 
ATOM   8024  C CB  . ASP I 1 101 ? 10.017  54.808  -10.539 1.00 1.77   ? 101  ASP E CB  1 
ATOM   8025  C CG  . ASP I 1 101 ? 11.465  55.203  -10.752 1.00 3.77   ? 101  ASP E CG  1 
ATOM   8026  O OD1 . ASP I 1 101 ? 12.208  54.641  -11.541 1.00 14.68  ? 101  ASP E OD1 1 
ATOM   8027  O OD2 . ASP I 1 101 ? 11.722  56.351  -10.163 1.00 33.03  ? 101  ASP E OD2 1 
ATOM   8028  N N   . LEU I 1 102 ? 7.159   53.536  -11.079 1.00 8.68   ? 102  LEU E N   1 
ATOM   8029  C CA  . LEU I 1 102 ? 5.934   53.029  -10.537 1.00 4.32   ? 102  LEU E CA  1 
ATOM   8030  C C   . LEU I 1 102 ? 5.582   51.752  -11.232 1.00 10.80  ? 102  LEU E C   1 
ATOM   8031  O O   . LEU I 1 102 ? 5.284   50.745  -10.634 1.00 14.15  ? 102  LEU E O   1 
ATOM   8032  C CB  . LEU I 1 102 ? 4.852   54.062  -10.835 1.00 3.76   ? 102  LEU E CB  1 
ATOM   8033  C CG  . LEU I 1 102 ? 3.431   53.754  -10.304 1.00 10.55  ? 102  LEU E CG  1 
ATOM   8034  C CD1 . LEU I 1 102 ? 3.348   53.298  -8.860  1.00 3.28   ? 102  LEU E CD1 1 
ATOM   8035  C CD2 . LEU I 1 102 ? 2.520   54.952  -10.493 1.00 8.71   ? 102  LEU E CD2 1 
ATOM   8036  N N   . LEU I 1 103 ? 5.652   51.794  -12.533 1.00 6.51   ? 103  LEU E N   1 
ATOM   8037  C CA  . LEU I 1 103 ? 5.380   50.642  -13.338 1.00 1.50   ? 103  LEU E CA  1 
ATOM   8038  C C   . LEU I 1 103 ? 6.214   49.446  -12.960 1.00 3.09   ? 103  LEU E C   1 
ATOM   8039  O O   . LEU I 1 103 ? 5.813   48.305  -13.074 1.00 11.31  ? 103  LEU E O   1 
ATOM   8040  C CB  . LEU I 1 103 ? 5.705   51.003  -14.757 1.00 1.77   ? 103  LEU E CB  1 
ATOM   8041  C CG  . LEU I 1 103 ? 5.371   49.911  -15.777 1.00 6.67   ? 103  LEU E CG  1 
ATOM   8042  C CD1 . LEU I 1 103 ? 3.879   49.627  -15.849 1.00 1.00   ? 103  LEU E CD1 1 
ATOM   8043  C CD2 . LEU I 1 103 ? 5.758   50.469  -17.133 1.00 5.13   ? 103  LEU E CD2 1 
ATOM   8044  N N   . GLU I 1 104 ? 7.392   49.696  -12.492 1.00 3.47   ? 104  GLU E N   1 
ATOM   8045  C CA  . GLU I 1 104 ? 8.268   48.622  -12.094 1.00 3.16   ? 104  GLU E CA  1 
ATOM   8046  C C   . GLU I 1 104 ? 7.662   47.693  -11.094 1.00 10.60  ? 104  GLU E C   1 
ATOM   8047  O O   . GLU I 1 104 ? 7.819   46.500  -11.128 1.00 15.54  ? 104  GLU E O   1 
ATOM   8048  C CB  . GLU I 1 104 ? 9.491   49.231  -11.473 1.00 4.44   ? 104  GLU E CB  1 
ATOM   8049  C CG  . GLU I 1 104 ? 10.595  48.207  -11.347 1.00 1.00   ? 104  GLU E CG  1 
ATOM   8050  C CD  . GLU I 1 104 ? 11.110  47.656  -12.648 1.00 11.35  ? 104  GLU E CD  1 
ATOM   8051  O OE1 . GLU I 1 104 ? 10.835  48.152  -13.747 1.00 33.25  ? 104  GLU E OE1 1 
ATOM   8052  O OE2 . GLU I 1 104 ? 11.926  46.634  -12.433 1.00 12.49  ? 104  GLU E OE2 1 
ATOM   8053  N N   . LEU I 1 105 ? 6.928   48.256  -10.205 1.00 7.71   ? 105  LEU E N   1 
ATOM   8054  C CA  . LEU I 1 105 ? 6.232   47.448  -9.237  1.00 2.89   ? 105  LEU E CA  1 
ATOM   8055  C C   . LEU I 1 105 ? 5.340   46.406  -9.906  1.00 9.81   ? 105  LEU E C   1 
ATOM   8056  O O   . LEU I 1 105 ? 5.195   45.244  -9.487  1.00 13.77  ? 105  LEU E O   1 
ATOM   8057  C CB  . LEU I 1 105 ? 5.334   48.362  -8.392  1.00 3.27   ? 105  LEU E CB  1 
ATOM   8058  C CG  . LEU I 1 105 ? 6.090   49.446  -7.604  1.00 6.52   ? 105  LEU E CG  1 
ATOM   8059  C CD1 . LEU I 1 105 ? 5.249   50.144  -6.538  1.00 4.87   ? 105  LEU E CD1 1 
ATOM   8060  C CD2 . LEU I 1 105 ? 7.328   48.881  -6.995  1.00 1.00   ? 105  LEU E CD2 1 
ATOM   8061  N N   . LEU I 1 106 ? 4.715   46.854  -10.954 1.00 7.80   ? 106  LEU E N   1 
ATOM   8062  C CA  . LEU I 1 106 ? 3.849   45.950  -11.681 1.00 6.10   ? 106  LEU E CA  1 
ATOM   8063  C C   . LEU I 1 106 ? 4.673   44.869  -12.373 1.00 14.47  ? 106  LEU E C   1 
ATOM   8064  O O   . LEU I 1 106 ? 4.298   43.669  -12.368 1.00 13.94  ? 106  LEU E O   1 
ATOM   8065  C CB  . LEU I 1 106 ? 3.140   46.719  -12.771 1.00 1.05   ? 106  LEU E CB  1 
ATOM   8066  C CG  . LEU I 1 106 ? 1.781   47.337  -12.438 1.00 1.18   ? 106  LEU E CG  1 
ATOM   8067  C CD1 . LEU I 1 106 ? 0.917   46.413  -11.596 1.00 1.00   ? 106  LEU E CD1 1 
ATOM   8068  C CD2 . LEU I 1 106 ? 1.978   48.674  -11.801 1.00 6.50   ? 106  LEU E CD2 1 
ATOM   8069  N N   . ILE I 1 107 ? 5.788   45.316  -12.997 1.00 5.24   ? 107  ILE E N   1 
ATOM   8070  C CA  . ILE I 1 107 ? 6.731   44.399  -13.681 1.00 4.29   ? 107  ILE E CA  1 
ATOM   8071  C C   . ILE I 1 107 ? 7.316   43.302  -12.816 1.00 16.36  ? 107  ILE E C   1 
ATOM   8072  O O   . ILE I 1 107 ? 7.397   42.133  -13.274 1.00 26.57  ? 107  ILE E O   1 
ATOM   8073  C CB  . ILE I 1 107 ? 7.847   45.108  -14.368 1.00 7.23   ? 107  ILE E CB  1 
ATOM   8074  C CG1 . ILE I 1 107 ? 7.181   45.923  -15.431 1.00 2.25   ? 107  ILE E CG1 1 
ATOM   8075  C CG2 . ILE I 1 107 ? 8.887   44.151  -14.946 1.00 6.37   ? 107  ILE E CG2 1 
ATOM   8076  C CD1 . ILE I 1 107 ? 8.140   46.818  -16.089 1.00 1.00   ? 107  ILE E CD1 1 
ATOM   8077  N N   . MET I 1 108 ? 7.702   43.694  -11.596 1.00 6.24   ? 108  MET E N   1 
ATOM   8078  C CA  . MET I 1 108 ? 8.236   42.736  -10.654 1.00 11.25  ? 108  MET E CA  1 
ATOM   8079  C C   . MET I 1 108 ? 7.219   41.821  -10.023 1.00 14.93  ? 108  MET E C   1 
ATOM   8080  O O   . MET I 1 108 ? 7.542   40.744  -9.582  1.00 18.42  ? 108  MET E O   1 
ATOM   8081  C CB  . MET I 1 108 ? 8.968   43.370  -9.477  1.00 16.55  ? 108  MET E CB  1 
ATOM   8082  C CG  . MET I 1 108 ? 9.969   44.468  -9.844  1.00 34.20  ? 108  MET E CG  1 
ATOM   8083  S SD  . MET I 1 108 ? 10.642  45.500  -8.447  1.00 42.91  ? 108  MET E SD  1 
ATOM   8084  C CE  . MET I 1 108 ? 9.289   45.404  -7.197  1.00 38.79  ? 108  MET E CE  1 
ATOM   8085  N N   . HIS I 1 109 ? 6.017   42.304  -9.887  1.00 12.04  ? 109  HIS E N   1 
ATOM   8086  C CA  . HIS I 1 109 ? 4.971   41.628  -9.198  1.00 8.78   ? 109  HIS E CA  1 
ATOM   8087  C C   . HIS I 1 109 ? 4.852   40.139  -9.310  1.00 13.15  ? 109  HIS E C   1 
ATOM   8088  O O   . HIS I 1 109 ? 4.895   39.434  -8.343  1.00 19.76  ? 109  HIS E O   1 
ATOM   8089  C CB  . HIS I 1 109 ? 3.648   42.269  -9.503  1.00 13.77  ? 109  HIS E CB  1 
ATOM   8090  C CG  . HIS I 1 109 ? 2.721   41.960  -8.381  1.00 19.62  ? 109  HIS E CG  1 
ATOM   8091  N ND1 . HIS I 1 109 ? 1.632   41.120  -8.557  1.00 21.17  ? 109  HIS E ND1 1 
ATOM   8092  C CD2 . HIS I 1 109 ? 2.777   42.360  -7.070  1.00 19.59  ? 109  HIS E CD2 1 
ATOM   8093  C CE1 . HIS I 1 109 ? 1.038   41.066  -7.354  1.00 19.93  ? 109  HIS E CE1 1 
ATOM   8094  N NE2 . HIS I 1 109 ? 1.718   41.772  -6.441  1.00 19.10  ? 109  HIS E NE2 1 
ATOM   8095  N N   . PRO I 1 110 ? 4.690   39.650  -10.496 1.00 12.54  ? 110  PRO E N   1 
ATOM   8096  C CA  . PRO I 1 110 ? 4.558   38.219  -10.729 1.00 9.73   ? 110  PRO E CA  1 
ATOM   8097  C C   . PRO I 1 110 ? 5.709   37.381  -10.267 1.00 21.00  ? 110  PRO E C   1 
ATOM   8098  O O   . PRO I 1 110 ? 5.588   36.176  -10.079 1.00 31.35  ? 110  PRO E O   1 
ATOM   8099  C CB  . PRO I 1 110 ? 4.462   38.024  -12.232 1.00 7.40   ? 110  PRO E CB  1 
ATOM   8100  C CG  . PRO I 1 110 ? 4.421   39.396  -12.851 1.00 3.83   ? 110  PRO E CG  1 
ATOM   8101  C CD  . PRO I 1 110 ? 4.750   40.425  -11.770 1.00 9.25   ? 110  PRO E CD  1 
ATOM   8102  N N   . PHE I 1 111 ? 6.849   37.968  -10.071 1.00 15.41  ? 111  PHE E N   1 
ATOM   8103  C CA  . PHE I 1 111 ? 7.956   37.144  -9.634  1.00 9.17   ? 111  PHE E CA  1 
ATOM   8104  C C   . PHE I 1 111 ? 8.202   37.143  -8.134  1.00 23.69  ? 111  PHE E C   1 
ATOM   8105  O O   . PHE I 1 111 ? 9.249   36.701  -7.662  1.00 30.42  ? 111  PHE E O   1 
ATOM   8106  C CB  . PHE I 1 111 ? 9.189   37.587  -10.382 1.00 4.06   ? 111  PHE E CB  1 
ATOM   8107  C CG  . PHE I 1 111 ? 8.928   37.544  -11.846 1.00 7.88   ? 111  PHE E CG  1 
ATOM   8108  C CD1 . PHE I 1 111 ? 8.984   36.341  -12.559 1.00 8.51   ? 111  PHE E CD1 1 
ATOM   8109  C CD2 . PHE I 1 111 ? 8.605   38.714  -12.533 1.00 16.26  ? 111  PHE E CD2 1 
ATOM   8110  C CE1 . PHE I 1 111 ? 8.721   36.284  -13.931 1.00 11.45  ? 111  PHE E CE1 1 
ATOM   8111  C CE2 . PHE I 1 111 ? 8.351   38.670  -13.904 1.00 17.14  ? 111  PHE E CE2 1 
ATOM   8112  C CZ  . PHE I 1 111 ? 8.392   37.463  -14.607 1.00 8.93   ? 111  PHE E CZ  1 
ATOM   8113  N N   . LEU I 1 112 ? 7.276   37.744  -7.419  1.00 20.71  ? 112  LEU E N   1 
ATOM   8114  C CA  . LEU I 1 112 ? 7.296   37.839  -5.974  1.00 19.56  ? 112  LEU E CA  1 
ATOM   8115  C C   . LEU I 1 112 ? 6.779   36.554  -5.440  1.00 33.83  ? 112  LEU E C   1 
ATOM   8116  O O   . LEU I 1 112 ? 6.107   35.810  -6.150  1.00 37.60  ? 112  LEU E O   1 
ATOM   8117  C CB  . LEU I 1 112 ? 6.248   38.872  -5.473  1.00 16.48  ? 112  LEU E CB  1 
ATOM   8118  C CG  . LEU I 1 112 ? 6.736   40.262  -5.798  1.00 14.20  ? 112  LEU E CG  1 
ATOM   8119  C CD1 . LEU I 1 112 ? 6.113   41.251  -4.876  1.00 11.29  ? 112  LEU E CD1 1 
ATOM   8120  C CD2 . LEU I 1 112 ? 8.205   40.241  -5.527  1.00 1.49   ? 112  LEU E CD2 1 
ATOM   8121  N N   . LYS I 1 113 ? 7.055   36.358  -4.163  1.00 34.66  ? 113  LYS E N   1 
ATOM   8122  C CA  . LYS I 1 113 ? 6.548   35.230  -3.431  1.00 34.60  ? 113  LYS E CA  1 
ATOM   8123  C C   . LYS I 1 113 ? 5.170   35.641  -3.009  1.00 48.05  ? 113  LYS E C   1 
ATOM   8124  O O   . LYS I 1 113 ? 4.955   36.615  -2.286  1.00 57.59  ? 113  LYS E O   1 
ATOM   8125  C CB  . LYS I 1 113 ? 7.365   34.868  -2.195  1.00 37.42  ? 113  LYS E CB  1 
ATOM   8126  C CG  . LYS I 1 113 ? 8.883   34.715  -2.367  1.00 107.85 ? 113  LYS E CG  1 
ATOM   8127  C CD  . LYS I 1 113 ? 9.605   35.809  -3.164  1.00 141.69 ? 113  LYS E CD  1 
ATOM   8128  C CE  . LYS I 1 113 ? 9.336   37.243  -2.717  1.00 148.40 ? 113  LYS E CE  1 
ATOM   8129  N NZ  . LYS I 1 113 ? 10.157  38.227  -3.444  1.00 163.81 ? 113  LYS E NZ  1 
ATOM   8130  N N   . PRO I 1 114 ? 4.269   34.906  -3.542  1.00 47.13  ? 114  PRO E N   1 
ATOM   8131  C CA  . PRO I 1 114 ? 2.821   34.973  -3.351  1.00 50.56  ? 114  PRO E CA  1 
ATOM   8132  C C   . PRO I 1 114 ? 2.353   35.664  -2.064  1.00 62.15  ? 114  PRO E C   1 
ATOM   8133  O O   . PRO I 1 114 ? 1.364   36.437  -2.017  1.00 60.40  ? 114  PRO E O   1 
ATOM   8134  C CB  . PRO I 1 114 ? 2.400   33.502  -3.387  1.00 51.30  ? 114  PRO E CB  1 
ATOM   8135  C CG  . PRO I 1 114 ? 3.657   32.666  -3.725  1.00 51.76  ? 114  PRO E CG  1 
ATOM   8136  C CD  . PRO I 1 114 ? 4.874   33.552  -3.573  1.00 44.33  ? 114  PRO E CD  1 
ATOM   8137  N N   . ASP I 1 115 ? 3.094   35.378  -1.011  1.00 66.54  ? 115  ASP E N   1 
ATOM   8138  C CA  . ASP I 1 115 ? 2.831   35.991  0.256   1.00 73.05  ? 115  ASP E CA  1 
ATOM   8139  C C   . ASP I 1 115 ? 3.073   37.511  0.130   1.00 65.55  ? 115  ASP E C   1 
ATOM   8140  O O   . ASP I 1 115 ? 2.237   38.369  0.494   1.00 71.35  ? 115  ASP E O   1 
ATOM   8141  C CB  . ASP I 1 115 ? 3.732   35.304  1.308   1.00 84.19  ? 115  ASP E CB  1 
ATOM   8142  C CG  . ASP I 1 115 ? 4.153   36.178  2.475   1.00 167.64 ? 115  ASP E CG  1 
ATOM   8143  O OD1 . ASP I 1 115 ? 3.532   37.167  2.864   1.00 178.29 ? 115  ASP E OD1 1 
ATOM   8144  O OD2 . ASP I 1 115 ? 5.253   35.739  3.055   1.00 197.05 ? 115  ASP E OD2 1 
ATOM   8145  N N   . ASP I 1 116 ? 4.236   37.839  -0.432  1.00 41.01  ? 116  ASP E N   1 
ATOM   8146  C CA  . ASP I 1 116 ? 4.625   39.208  -0.625  1.00 34.94  ? 116  ASP E CA  1 
ATOM   8147  C C   . ASP I 1 116 ? 3.846   39.914  -1.699  1.00 31.13  ? 116  ASP E C   1 
ATOM   8148  O O   . ASP I 1 116 ? 3.849   41.146  -1.838  1.00 30.98  ? 116  ASP E O   1 
ATOM   8149  C CB  . ASP I 1 116 ? 6.091   39.260  -0.994  1.00 39.70  ? 116  ASP E CB  1 
ATOM   8150  C CG  . ASP I 1 116 ? 6.989   38.717  0.077   1.00 60.74  ? 116  ASP E CG  1 
ATOM   8151  O OD1 . ASP I 1 116 ? 6.613   38.434  1.207   1.00 63.01  ? 116  ASP E OD1 1 
ATOM   8152  O OD2 . ASP I 1 116 ? 8.237   38.682  -0.319  1.00 66.45  ? 116  ASP E OD2 1 
ATOM   8153  N N   . GLN I 1 117 ? 3.195   39.127  -2.501  1.00 20.22  ? 117  GLN E N   1 
ATOM   8154  C CA  . GLN I 1 117 ? 2.485   39.731  -3.562  1.00 20.01  ? 117  GLN E CA  1 
ATOM   8155  C C   . GLN I 1 117 ? 1.425   40.668  -3.108  1.00 30.67  ? 117  GLN E C   1 
ATOM   8156  O O   . GLN I 1 117 ? 1.221   41.744  -3.657  1.00 36.77  ? 117  GLN E O   1 
ATOM   8157  C CB  . GLN I 1 117 ? 1.944   38.668  -4.483  1.00 22.50  ? 117  GLN E CB  1 
ATOM   8158  C CG  . GLN I 1 117 ? 3.074   38.053  -5.320  1.00 37.02  ? 117  GLN E CG  1 
ATOM   8159  C CD  . GLN I 1 117 ? 2.465   37.244  -6.423  1.00 29.68  ? 117  GLN E CD  1 
ATOM   8160  O OE1 . GLN I 1 117 ? 1.442   36.596  -6.223  1.00 64.54  ? 117  GLN E OE1 1 
ATOM   8161  N NE2 . GLN I 1 117 ? 3.000   37.385  -7.617  1.00 42.05  ? 117  GLN E NE2 1 
ATOM   8162  N N   . GLN I 1 118 ? 0.781   40.255  -2.063  1.00 33.21  ? 118  GLN E N   1 
ATOM   8163  C CA  . GLN I 1 118 ? -0.271  41.054  -1.527  1.00 34.93  ? 118  GLN E CA  1 
ATOM   8164  C C   . GLN I 1 118 ? 0.161   42.322  -0.845  1.00 32.72  ? 118  GLN E C   1 
ATOM   8165  O O   . GLN I 1 118 ? -0.441  43.385  -1.039  1.00 33.69  ? 118  GLN E O   1 
ATOM   8166  C CB  . GLN I 1 118 ? -1.243  40.231  -0.716  1.00 41.88  ? 118  GLN E CB  1 
ATOM   8167  C CG  . GLN I 1 118 ? -2.653  40.862  -0.767  1.00 157.13 ? 118  GLN E CG  1 
ATOM   8168  C CD  . GLN I 1 118 ? -3.146  41.134  -2.182  1.00 221.48 ? 118  GLN E CD  1 
ATOM   8169  O OE1 . GLN I 1 118 ? -2.805  40.401  -3.131  1.00 237.99 ? 118  GLN E OE1 1 
ATOM   8170  N NE2 . GLN I 1 118 ? -3.941  42.196  -2.337  1.00 199.58 ? 118  GLN E NE2 1 
ATOM   8171  N N   . LYS I 1 119 ? 1.211   42.212  -0.057  1.00 28.62  ? 119  LYS E N   1 
ATOM   8172  C CA  . LYS I 1 119 ? 1.722   43.393  0.596   1.00 25.84  ? 119  LYS E CA  1 
ATOM   8173  C C   . LYS I 1 119 ? 2.051   44.460  -0.461  1.00 26.95  ? 119  LYS E C   1 
ATOM   8174  O O   . LYS I 1 119 ? 1.769   45.641  -0.371  1.00 33.39  ? 119  LYS E O   1 
ATOM   8175  C CB  . LYS I 1 119 ? 2.893   43.105  1.559   1.00 28.01  ? 119  LYS E CB  1 
ATOM   8176  C CG  . LYS I 1 119 ? 3.137   44.312  2.484   1.00 143.15 ? 119  LYS E CG  1 
ATOM   8177  C CD  . LYS I 1 119 ? 3.784   45.512  1.780   1.00 172.67 ? 119  LYS E CD  1 
ATOM   8178  C CE  . LYS I 1 119 ? 3.161   46.890  2.048   1.00 131.07 ? 119  LYS E CE  1 
ATOM   8179  N NZ  . LYS I 1 119 ? 3.473   47.866  0.952   1.00 24.57  ? 119  LYS E NZ  1 
ATOM   8180  N N   . GLU I 1 120 ? 2.557   43.968  -1.545  1.00 19.79  ? 120  GLU E N   1 
ATOM   8181  C CA  . GLU I 1 120 ? 2.962   44.733  -2.679  1.00 17.74  ? 120  GLU E CA  1 
ATOM   8182  C C   . GLU I 1 120 ? 1.924   45.518  -3.396  1.00 19.67  ? 120  GLU E C   1 
ATOM   8183  O O   . GLU I 1 120 ? 2.179   46.641  -3.881  1.00 22.84  ? 120  GLU E O   1 
ATOM   8184  C CB  . GLU I 1 120 ? 3.657   43.722  -3.540  1.00 19.73  ? 120  GLU E CB  1 
ATOM   8185  C CG  . GLU I 1 120 ? 4.928   43.591  -2.721  1.00 25.31  ? 120  GLU E CG  1 
ATOM   8186  C CD  . GLU I 1 120 ? 5.503   44.986  -2.659  1.00 96.14  ? 120  GLU E CD  1 
ATOM   8187  O OE1 . GLU I 1 120 ? 5.361   45.851  -3.564  1.00 96.42  ? 120  GLU E OE1 1 
ATOM   8188  O OE2 . GLU I 1 120 ? 6.147   45.155  -1.532  1.00 45.20  ? 120  GLU E OE2 1 
ATOM   8189  N N   . VAL I 1 121 ? 0.773   44.889  -3.499  1.00 5.57   ? 121  VAL E N   1 
ATOM   8190  C CA  . VAL I 1 121 ? -0.295  45.582  -4.117  1.00 6.59   ? 121  VAL E CA  1 
ATOM   8191  C C   . VAL I 1 121 ? -0.652  46.798  -3.283  1.00 17.69  ? 121  VAL E C   1 
ATOM   8192  O O   . VAL I 1 121 ? -0.881  47.910  -3.773  1.00 24.97  ? 121  VAL E O   1 
ATOM   8193  C CB  . VAL I 1 121 ? -1.484  44.710  -4.127  1.00 6.74   ? 121  VAL E CB  1 
ATOM   8194  C CG1 . VAL I 1 121 ? -2.611  45.576  -4.610  1.00 4.65   ? 121  VAL E CG1 1 
ATOM   8195  C CG2 . VAL I 1 121 ? -1.230  43.625  -5.129  1.00 3.02   ? 121  VAL E CG2 1 
ATOM   8196  N N   . VAL I 1 122 ? -0.691  46.575  -2.004  1.00 9.06   ? 122  VAL E N   1 
ATOM   8197  C CA  . VAL I 1 122 ? -0.965  47.668  -1.107  1.00 13.35  ? 122  VAL E CA  1 
ATOM   8198  C C   . VAL I 1 122 ? 0.050   48.761  -1.314  1.00 18.92  ? 122  VAL E C   1 
ATOM   8199  O O   . VAL I 1 122 ? -0.280  49.961  -1.467  1.00 19.82  ? 122  VAL E O   1 
ATOM   8200  C CB  . VAL I 1 122 ? -0.919  47.191  0.347   1.00 16.00  ? 122  VAL E CB  1 
ATOM   8201  C CG1 . VAL I 1 122 ? -1.081  48.364  1.262   1.00 13.10  ? 122  VAL E CG1 1 
ATOM   8202  C CG2 . VAL I 1 122 ? -2.093  46.297  0.599   1.00 11.75  ? 122  VAL E CG2 1 
ATOM   8203  N N   . ASN I 1 123 ? 1.301   48.333  -1.426  1.00 15.18  ? 123  ASN E N   1 
ATOM   8204  C CA  . ASN I 1 123 ? 2.302   49.347  -1.690  1.00 12.95  ? 123  ASN E CA  1 
ATOM   8205  C C   . ASN I 1 123 ? 2.130   50.138  -2.981  1.00 15.30  ? 123  ASN E C   1 
ATOM   8206  O O   . ASN I 1 123 ? 2.279   51.373  -2.982  1.00 18.14  ? 123  ASN E O   1 
ATOM   8207  C CB  . ASN I 1 123 ? 3.713   48.902  -1.623  1.00 20.55  ? 123  ASN E CB  1 
ATOM   8208  C CG  . ASN I 1 123 ? 4.650   50.128  -1.646  1.00 82.12  ? 123  ASN E CG  1 
ATOM   8209  O OD1 . ASN I 1 123 ? 4.411   51.189  -0.939  1.00 69.87  ? 123  ASN E OD1 1 
ATOM   8210  N ND2 . ASN I 1 123 ? 5.706   50.005  -2.489  1.00 34.52  ? 123  ASN E ND2 1 
ATOM   8211  N N   . MET I 1 124 ? 1.821   49.467  -4.087  1.00 5.42   ? 124  MET E N   1 
ATOM   8212  C CA  . MET I 1 124 ? 1.599   50.203  -5.328  1.00 2.66   ? 124  MET E CA  1 
ATOM   8213  C C   . MET I 1 124 ? 0.534   51.191  -5.109  1.00 12.04  ? 124  MET E C   1 
ATOM   8214  O O   . MET I 1 124 ? 0.627   52.320  -5.587  1.00 15.26  ? 124  MET E O   1 
ATOM   8215  C CB  . MET I 1 124 ? 0.946   49.378  -6.403  1.00 3.56   ? 124  MET E CB  1 
ATOM   8216  C CG  . MET I 1 124 ? 1.504   47.990  -6.497  1.00 11.59  ? 124  MET E CG  1 
ATOM   8217  S SD  . MET I 1 124 ? 0.715   47.164  -7.872  1.00 14.50  ? 124  MET E SD  1 
ATOM   8218  C CE  . MET I 1 124 ? 1.810   45.751  -7.850  1.00 8.18   ? 124  MET E CE  1 
ATOM   8219  N N   . ALA I 1 125 ? -0.497  50.726  -4.394  1.00 8.41   ? 125  ALA E N   1 
ATOM   8220  C CA  . ALA I 1 125 ? -1.627  51.640  -4.169  1.00 8.92   ? 125  ALA E CA  1 
ATOM   8221  C C   . ALA I 1 125 ? -1.127  52.875  -3.501  1.00 16.57  ? 125  ALA E C   1 
ATOM   8222  O O   . ALA I 1 125 ? -1.323  53.975  -3.988  1.00 19.75  ? 125  ALA E O   1 
ATOM   8223  C CB  . ALA I 1 125 ? -2.688  51.028  -3.286  1.00 6.67   ? 125  ALA E CB  1 
ATOM   8224  N N   . GLN I 1 126 ? -0.403  52.674  -2.410  1.00 7.08   ? 126  GLN E N   1 
ATOM   8225  C CA  . GLN I 1 126 ? 0.081   53.851  -1.719  1.00 3.18   ? 126  GLN E CA  1 
ATOM   8226  C C   . GLN I 1 126 ? 0.986   54.761  -2.511  1.00 13.31  ? 126  GLN E C   1 
ATOM   8227  O O   . GLN I 1 126 ? 0.876   55.998  -2.443  1.00 13.84  ? 126  GLN E O   1 
ATOM   8228  C CB  . GLN I 1 126 ? 0.775   53.433  -0.472  1.00 6.18   ? 126  GLN E CB  1 
ATOM   8229  C CG  . GLN I 1 126 ? -0.145  52.685  0.564   1.00 22.38  ? 126  GLN E CG  1 
ATOM   8230  C CD  . GLN I 1 126 ? 0.601   52.391  1.893   1.00 27.21  ? 126  GLN E CD  1 
ATOM   8231  O OE1 . GLN I 1 126 ? 1.040   51.247  2.098   1.00 47.66  ? 126  GLN E OE1 1 
ATOM   8232  N NE2 . GLN I 1 126 ? 1.030   53.451  2.630   1.00 31.54  ? 126  GLN E NE2 1 
ATOM   8233  N N   . LYS I 1 127 ? 1.909   54.165  -3.269  1.00 6.91   ? 127  LYS E N   1 
ATOM   8234  C CA  . LYS I 1 127 ? 2.802   54.996  -4.002  1.00 7.02   ? 127  LYS E CA  1 
ATOM   8235  C C   . LYS I 1 127 ? 2.070   55.802  -5.018  1.00 12.38  ? 127  LYS E C   1 
ATOM   8236  O O   . LYS I 1 127 ? 2.345   56.986  -5.229  1.00 11.43  ? 127  LYS E O   1 
ATOM   8237  C CB  . LYS I 1 127 ? 3.717   54.104  -4.762  1.00 19.18  ? 127  LYS E CB  1 
ATOM   8238  C CG  . LYS I 1 127 ? 4.792   53.459  -3.927  1.00 13.43  ? 127  LYS E CG  1 
ATOM   8239  C CD  . LYS I 1 127 ? 5.987   54.388  -3.732  1.00 6.89   ? 127  LYS E CD  1 
ATOM   8240  C CE  . LYS I 1 127 ? 6.692   54.221  -2.343  1.00 6.90   ? 127  LYS E CE  1 
ATOM   8241  N NZ  . LYS I 1 127 ? 5.865   54.748  -1.204  1.00 114.42 ? 127  LYS E NZ  1 
ATOM   8242  N N   . ALA I 1 128 ? 1.161   55.103  -5.707  1.00 5.41   ? 128  ALA E N   1 
ATOM   8243  C CA  . ALA I 1 128 ? 0.425   55.734  -6.753  1.00 1.00   ? 128  ALA E CA  1 
ATOM   8244  C C   . ALA I 1 128 ? -0.293  56.937  -6.206  1.00 6.77   ? 128  ALA E C   1 
ATOM   8245  O O   . ALA I 1 128 ? -0.224  58.058  -6.709  1.00 9.61   ? 128  ALA E O   1 
ATOM   8246  C CB  . ALA I 1 128 ? -0.526  54.757  -7.325  1.00 1.00   ? 128  ALA E CB  1 
ATOM   8247  N N   . ILE I 1 129 ? -1.012  56.666  -5.151  1.00 4.19   ? 129  ILE E N   1 
ATOM   8248  C CA  . ILE I 1 129 ? -1.891  57.631  -4.513  1.00 8.94   ? 129  ILE E CA  1 
ATOM   8249  C C   . ILE I 1 129 ? -1.156  58.800  -3.970  1.00 12.61  ? 129  ILE E C   1 
ATOM   8250  O O   . ILE I 1 129 ? -1.577  59.943  -3.990  1.00 22.81  ? 129  ILE E O   1 
ATOM   8251  C CB  . ILE I 1 129 ? -2.596  57.107  -3.250  1.00 20.48  ? 129  ILE E CB  1 
ATOM   8252  C CG1 . ILE I 1 129 ? -3.570  55.992  -3.458  1.00 16.28  ? 129  ILE E CG1 1 
ATOM   8253  C CG2 . ILE I 1 129 ? -3.451  58.248  -2.831  1.00 34.42  ? 129  ILE E CG2 1 
ATOM   8254  C CD1 . ILE I 1 129 ? -3.889  56.122  -4.910  1.00 9.85   ? 129  ILE E CD1 1 
ATOM   8255  N N   . ILE I 1 130 ? -0.094  58.489  -3.341  1.00 8.64   ? 130  ILE E N   1 
ATOM   8256  C CA  . ILE I 1 130 ? 0.666   59.530  -2.692  1.00 10.81  ? 130  ILE E CA  1 
ATOM   8257  C C   . ILE I 1 130 ? 1.779   60.178  -3.476  1.00 10.87  ? 130  ILE E C   1 
ATOM   8258  O O   . ILE I 1 130 ? 1.994   61.362  -3.371  1.00 13.33  ? 130  ILE E O   1 
ATOM   8259  C CB  . ILE I 1 130 ? 1.350   58.875  -1.541  1.00 15.81  ? 130  ILE E CB  1 
ATOM   8260  C CG1 . ILE I 1 130 ? 0.296   58.433  -0.587  1.00 19.12  ? 130  ILE E CG1 1 
ATOM   8261  C CG2 . ILE I 1 130 ? 2.170   59.866  -0.789  1.00 6.62   ? 130  ILE E CG2 1 
ATOM   8262  C CD1 . ILE I 1 130 ? 0.960   57.643  0.506   1.00 24.97  ? 130  ILE E CD1 1 
ATOM   8263  N N   . ARG I 1 131 ? 2.510   59.394  -4.217  1.00 3.96   ? 131  ARG E N   1 
ATOM   8264  C CA  . ARG I 1 131 ? 3.651   59.918  -4.869  1.00 1.93   ? 131  ARG E CA  1 
ATOM   8265  C C   . ARG I 1 131 ? 3.495   60.322  -6.289  1.00 6.36   ? 131  ARG E C   1 
ATOM   8266  O O   . ARG I 1 131 ? 4.080   61.330  -6.641  1.00 12.60  ? 131  ARG E O   1 
ATOM   8267  C CB  . ARG I 1 131 ? 4.824   58.981  -4.524  1.00 4.26   ? 131  ARG E CB  1 
ATOM   8268  C CG  . ARG I 1 131 ? 6.178   59.116  -5.212  1.00 23.64  ? 131  ARG E CG  1 
ATOM   8269  C CD  . ARG I 1 131 ? 7.300   58.589  -4.284  1.00 14.16  ? 131  ARG E CD  1 
ATOM   8270  N NE  . ARG I 1 131 ? 6.990   59.074  -2.926  1.00 66.89  ? 131  ARG E NE  1 
ATOM   8271  C CZ  . ARG I 1 131 ? 7.824   58.909  -1.916  1.00 94.72  ? 131  ARG E CZ  1 
ATOM   8272  N NH1 . ARG I 1 131 ? 8.977   58.237  -2.174  1.00 9.97   ? 131  ARG E NH1 1 
ATOM   8273  N NH2 . ARG I 1 131 ? 7.494   59.415  -0.683  1.00 69.95  ? 131  ARG E NH2 1 
ATOM   8274  N N   . TYR I 1 132 ? 2.671   59.603  -7.064  1.00 7.37   ? 132  TYR E N   1 
ATOM   8275  C CA  . TYR I 1 132 ? 2.489   59.897  -8.487  1.00 3.84   ? 132  TYR E CA  1 
ATOM   8276  C C   . TYR I 1 132 ? 1.234   60.589  -8.952  1.00 8.16   ? 132  TYR E C   1 
ATOM   8277  O O   . TYR I 1 132 ? 1.278   61.659  -9.612  1.00 8.00   ? 132  TYR E O   1 
ATOM   8278  C CB  . TYR I 1 132 ? 2.684   58.596  -9.282  1.00 7.62   ? 132  TYR E CB  1 
ATOM   8279  C CG  . TYR I 1 132 ? 4.115   58.108  -9.077  1.00 9.15   ? 132  TYR E CG  1 
ATOM   8280  C CD1 . TYR I 1 132 ? 5.197   58.763  -9.669  1.00 3.85   ? 132  TYR E CD1 1 
ATOM   8281  C CD2 . TYR I 1 132 ? 4.409   57.113  -8.137  1.00 7.21   ? 132  TYR E CD2 1 
ATOM   8282  C CE1 . TYR I 1 132 ? 6.513   58.356  -9.464  1.00 1.00   ? 132  TYR E CE1 1 
ATOM   8283  C CE2 . TYR I 1 132 ? 5.731   56.772  -7.833  1.00 1.61   ? 132  TYR E CE2 1 
ATOM   8284  C CZ  . TYR I 1 132 ? 6.793   57.376  -8.507  1.00 1.00   ? 132  TYR E CZ  1 
ATOM   8285  O OH  . TYR I 1 132 ? 8.109   57.028  -8.260  1.00 21.40  ? 132  TYR E OH  1 
ATOM   8286  N N   . PHE I 1 133 ? 0.106   59.935  -8.714  1.00 5.39   ? 133  PHE E N   1 
ATOM   8287  C CA  . PHE I 1 133 ? -1.173  60.475  -9.175  1.00 2.99   ? 133  PHE E CA  1 
ATOM   8288  C C   . PHE I 1 133 ? -1.376  61.970  -8.886  1.00 14.49  ? 133  PHE E C   1 
ATOM   8289  O O   . PHE I 1 133 ? -1.905  62.807  -9.647  1.00 18.06  ? 133  PHE E O   1 
ATOM   8290  C CB  . PHE I 1 133 ? -2.310  59.624  -8.631  1.00 3.33   ? 133  PHE E CB  1 
ATOM   8291  C CG  . PHE I 1 133 ? -2.358  58.310  -9.368  1.00 7.26   ? 133  PHE E CG  1 
ATOM   8292  C CD1 . PHE I 1 133 ? -1.472  58.054  -10.417 1.00 8.71   ? 133  PHE E CD1 1 
ATOM   8293  C CD2 . PHE I 1 133 ? -3.307  57.330  -9.061  1.00 7.41   ? 133  PHE E CD2 1 
ATOM   8294  C CE1 . PHE I 1 133 ? -1.489  56.824  -11.085 1.00 10.38  ? 133  PHE E CE1 1 
ATOM   8295  C CE2 . PHE I 1 133 ? -3.375  56.116  -9.754  1.00 6.55   ? 133  PHE E CE2 1 
ATOM   8296  C CZ  . PHE I 1 133 ? -2.430  55.844  -10.748 1.00 4.10   ? 133  PHE E CZ  1 
ATOM   8297  N N   . PRO I 1 134 ? -0.901  62.354  -7.754  1.00 8.58   ? 134  PRO E N   1 
ATOM   8298  C CA  . PRO I 1 134 ? -1.114  63.733  -7.370  1.00 2.15   ? 134  PRO E CA  1 
ATOM   8299  C C   . PRO I 1 134 ? -0.419  64.795  -8.204  1.00 13.92  ? 134  PRO E C   1 
ATOM   8300  O O   . PRO I 1 134 ? -0.895  65.909  -8.356  1.00 16.26  ? 134  PRO E O   1 
ATOM   8301  C CB  . PRO I 1 134 ? -0.787  63.774  -5.906  1.00 1.00   ? 134  PRO E CB  1 
ATOM   8302  C CG  . PRO I 1 134 ? -0.907  62.372  -5.357  1.00 1.00   ? 134  PRO E CG  1 
ATOM   8303  C CD  . PRO I 1 134 ? -0.818  61.448  -6.572  1.00 6.64   ? 134  PRO E CD  1 
ATOM   8304  N N   . VAL I 1 135 ? 0.691   64.401  -8.785  1.00 12.60  ? 135  VAL E N   1 
ATOM   8305  C CA  . VAL I 1 135 ? 1.515   65.251  -9.569  1.00 3.53   ? 135  VAL E CA  1 
ATOM   8306  C C   . VAL I 1 135 ? 0.823   65.481  -10.874 1.00 9.74   ? 135  VAL E C   1 
ATOM   8307  O O   . VAL I 1 135 ? 0.698   66.582  -11.372 1.00 15.21  ? 135  VAL E O   1 
ATOM   8308  C CB  . VAL I 1 135 ? 2.919   64.598  -9.726  1.00 1.00   ? 135  VAL E CB  1 
ATOM   8309  C CG1 . VAL I 1 135 ? 3.888   65.414  -10.569 1.00 1.00   ? 135  VAL E CG1 1 
ATOM   8310  C CG2 . VAL I 1 135 ? 3.611   64.432  -8.407  1.00 1.00   ? 135  VAL E CG2 1 
ATOM   8311  N N   . PHE I 1 136 ? 0.359   64.397  -11.391 1.00 1.86   ? 136  PHE E N   1 
ATOM   8312  C CA  . PHE I 1 136 ? -0.268  64.479  -12.665 1.00 1.00   ? 136  PHE E CA  1 
ATOM   8313  C C   . PHE I 1 136 ? -1.590  65.142  -12.570 1.00 7.71   ? 136  PHE E C   1 
ATOM   8314  O O   . PHE I 1 136 ? -1.906  65.977  -13.408 1.00 13.38  ? 136  PHE E O   1 
ATOM   8315  C CB  . PHE I 1 136 ? -0.402  63.071  -13.235 1.00 2.78   ? 136  PHE E CB  1 
ATOM   8316  C CG  . PHE I 1 136 ? 0.982   62.486  -13.355 1.00 6.31   ? 136  PHE E CG  1 
ATOM   8317  C CD1 . PHE I 1 136 ? 1.968   63.186  -14.053 1.00 3.72   ? 136  PHE E CD1 1 
ATOM   8318  C CD2 . PHE I 1 136 ? 1.350   61.270  -12.771 1.00 8.93   ? 136  PHE E CD2 1 
ATOM   8319  C CE1 . PHE I 1 136 ? 3.240   62.634  -14.250 1.00 3.55   ? 136  PHE E CE1 1 
ATOM   8320  C CE2 . PHE I 1 136 ? 2.634   60.728  -12.933 1.00 8.46   ? 136  PHE E CE2 1 
ATOM   8321  C CZ  . PHE I 1 136 ? 3.593   61.401  -13.692 1.00 1.00   ? 136  PHE E CZ  1 
ATOM   8322  N N   . GLU I 1 137 ? -2.359  64.752  -11.546 1.00 5.46   ? 137  GLU E N   1 
ATOM   8323  C CA  . GLU I 1 137 ? -3.639  65.372  -11.338 1.00 8.33   ? 137  GLU E CA  1 
ATOM   8324  C C   . GLU I 1 137 ? -3.495  66.902  -11.285 1.00 15.69  ? 137  GLU E C   1 
ATOM   8325  O O   . GLU I 1 137 ? -4.144  67.687  -11.964 1.00 20.46  ? 137  GLU E O   1 
ATOM   8326  C CB  . GLU I 1 137 ? -4.255  64.859  -10.067 1.00 9.05   ? 137  GLU E CB  1 
ATOM   8327  C CG  . GLU I 1 137 ? -5.627  65.472  -9.852  1.00 4.06   ? 137  GLU E CG  1 
ATOM   8328  C CD  . GLU I 1 137 ? -6.799  64.711  -10.413 1.00 26.79  ? 137  GLU E CD  1 
ATOM   8329  O OE1 . GLU I 1 137 ? -6.719  63.812  -11.226 1.00 17.69  ? 137  GLU E OE1 1 
ATOM   8330  O OE2 . GLU I 1 137 ? -7.930  65.173  -9.937  1.00 30.49  ? 137  GLU E OE2 1 
ATOM   8331  N N   . LYS I 1 138 ? -2.539  67.358  -10.548 1.00 5.87   ? 138  LYS E N   1 
ATOM   8332  C CA  . LYS I 1 138 ? -2.332  68.772  -10.484 1.00 1.66   ? 138  LYS E CA  1 
ATOM   8333  C C   . LYS I 1 138 ? -1.853  69.386  -11.761 1.00 15.78  ? 138  LYS E C   1 
ATOM   8334  O O   . LYS I 1 138 ? -2.118  70.511  -12.036 1.00 21.84  ? 138  LYS E O   1 
ATOM   8335  C CB  . LYS I 1 138 ? -1.380  69.066  -9.354  1.00 1.00   ? 138  LYS E CB  1 
ATOM   8336  C CG  . LYS I 1 138 ? -0.731  70.431  -9.419  1.00 28.85  ? 138  LYS E CG  1 
ATOM   8337  C CD  . LYS I 1 138 ? -0.089  70.889  -8.079  1.00 12.27  ? 138  LYS E CD  1 
ATOM   8338  C CE  . LYS I 1 138 ? 0.841   72.111  -8.209  1.00 131.11 ? 138  LYS E CE  1 
ATOM   8339  N NZ  . LYS I 1 138 ? 1.396   72.605  -6.929  1.00 165.74 ? 138  LYS E NZ  1 
ATOM   8340  N N   . ILE I 1 139 ? -1.079  68.683  -12.524 1.00 16.05  ? 139  ILE E N   1 
ATOM   8341  C CA  . ILE I 1 139 ? -0.588  69.257  -13.750 1.00 11.73  ? 139  ILE E CA  1 
ATOM   8342  C C   . ILE I 1 139 ? -1.725  69.594  -14.650 1.00 18.87  ? 139  ILE E C   1 
ATOM   8343  O O   . ILE I 1 139 ? -1.822  70.694  -15.180 1.00 25.87  ? 139  ILE E O   1 
ATOM   8344  C CB  . ILE I 1 139 ? 0.298   68.233  -14.427 1.00 10.22  ? 139  ILE E CB  1 
ATOM   8345  C CG1 . ILE I 1 139 ? 1.626   68.389  -13.747 1.00 2.56   ? 139  ILE E CG1 1 
ATOM   8346  C CG2 . ILE I 1 139 ? 0.470   68.475  -15.923 1.00 3.44   ? 139  ILE E CG2 1 
ATOM   8347  C CD1 . ILE I 1 139 ? 2.650   67.381  -14.203 1.00 11.94  ? 139  ILE E CD1 1 
ATOM   8348  N N   . LEU I 1 140 ? -2.539  68.578  -14.800 1.00 8.73   ? 140  LEU E N   1 
ATOM   8349  C CA  . LEU I 1 140 ? -3.720  68.584  -15.635 1.00 9.66   ? 140  LEU E CA  1 
ATOM   8350  C C   . LEU I 1 140 ? -4.713  69.595  -15.185 1.00 19.86  ? 140  LEU E C   1 
ATOM   8351  O O   . LEU I 1 140 ? -5.404  70.202  -16.005 1.00 20.31  ? 140  LEU E O   1 
ATOM   8352  C CB  . LEU I 1 140 ? -4.464  67.249  -15.478 1.00 7.37   ? 140  LEU E CB  1 
ATOM   8353  C CG  . LEU I 1 140 ? -3.729  66.122  -16.171 1.00 12.43  ? 140  LEU E CG  1 
ATOM   8354  C CD1 . LEU I 1 140 ? -4.448  64.830  -15.897 1.00 11.57  ? 140  LEU E CD1 1 
ATOM   8355  C CD2 . LEU I 1 140 ? -3.748  66.398  -17.661 1.00 1.00   ? 140  LEU E CD2 1 
ATOM   8356  N N   . ARG I 1 141 ? -4.882  69.616  -13.869 1.00 18.13  ? 141  ARG E N   1 
ATOM   8357  C CA  . ARG I 1 141 ? -5.837  70.509  -13.270 1.00 15.20  ? 141  ARG E CA  1 
ATOM   8358  C C   . ARG I 1 141 ? -5.291  71.871  -13.504 1.00 23.36  ? 141  ARG E C   1 
ATOM   8359  O O   . ARG I 1 141 ? -5.947  72.849  -13.739 1.00 26.77  ? 141  ARG E O   1 
ATOM   8360  C CB  . ARG I 1 141 ? -6.030  70.248  -11.780 1.00 12.08  ? 141  ARG E CB  1 
ATOM   8361  C CG  . ARG I 1 141 ? -6.859  71.282  -10.984 1.00 15.77  ? 141  ARG E CG  1 
ATOM   8362  C CD  . ARG I 1 141 ? -7.662  70.718  -9.740  1.00 39.51  ? 141  ARG E CD  1 
ATOM   8363  N NE  . ARG I 1 141 ? -8.371  71.678  -8.798  1.00 24.05  ? 141  ARG E NE  1 
ATOM   8364  C CZ  . ARG I 1 141 ? -7.914  72.892  -8.408  1.00 157.26 ? 141  ARG E CZ  1 
ATOM   8365  N NH1 . ARG I 1 141 ? -6.735  73.390  -8.818  1.00 197.13 ? 141  ARG E NH1 1 
ATOM   8366  N NH2 . ARG I 1 141 ? -8.654  73.618  -7.562  1.00 188.07 ? 141  ARG E NH2 1 
ATOM   8367  N N   . GLY I 1 142 ? -4.023  71.958  -13.538 1.00 26.73  ? 142  GLY E N   1 
ATOM   8368  C CA  . GLY I 1 142 ? -3.514  73.275  -13.719 1.00 22.08  ? 142  GLY E CA  1 
ATOM   8369  C C   . GLY I 1 142 ? -3.595  73.876  -15.100 1.00 28.74  ? 142  GLY E C   1 
ATOM   8370  O O   . GLY I 1 142 ? -3.482  75.059  -15.213 1.00 37.30  ? 142  GLY E O   1 
ATOM   8371  N N   . HIS I 1 143 ? -3.710  73.120  -16.177 1.00 26.32  ? 143  HIS E N   1 
ATOM   8372  C CA  . HIS I 1 143 ? -3.695  73.761  -17.500 1.00 15.58  ? 143  HIS E CA  1 
ATOM   8373  C C   . HIS I 1 143 ? -4.946  73.476  -18.299 1.00 22.64  ? 143  HIS E C   1 
ATOM   8374  O O   . HIS I 1 143 ? -5.191  74.064  -19.355 1.00 32.45  ? 143  HIS E O   1 
ATOM   8375  C CB  . HIS I 1 143 ? -2.429  73.393  -18.327 1.00 12.14  ? 143  HIS E CB  1 
ATOM   8376  C CG  . HIS I 1 143 ? -2.192  71.905  -18.565 1.00 16.77  ? 143  HIS E CG  1 
ATOM   8377  N ND1 . HIS I 1 143 ? -3.228  70.991  -18.791 1.00 18.94  ? 143  HIS E ND1 1 
ATOM   8378  C CD2 . HIS I 1 143 ? -1.018  71.226  -18.654 1.00 14.09  ? 143  HIS E CD2 1 
ATOM   8379  C CE1 . HIS I 1 143 ? -2.669  69.822  -18.984 1.00 18.89  ? 143  HIS E CE1 1 
ATOM   8380  N NE2 . HIS I 1 143 ? -1.337  69.933  -18.910 1.00 16.83  ? 143  HIS E NE2 1 
ATOM   8381  N N   . GLY I 1 144 ? -5.712  72.517  -17.788 1.00 12.56  ? 144  GLY E N   1 
ATOM   8382  C CA  . GLY I 1 144 ? -6.946  72.108  -18.375 1.00 11.41  ? 144  GLY E CA  1 
ATOM   8383  C C   . GLY I 1 144 ? -6.821  71.335  -19.682 1.00 29.14  ? 144  GLY E C   1 
ATOM   8384  O O   . GLY I 1 144 ? -7.872  71.000  -20.221 1.00 40.79  ? 144  GLY E O   1 
ATOM   8385  N N   . GLN I 1 145 ? -5.584  71.102  -20.183 1.00 18.28  ? 145  GLN E N   1 
ATOM   8386  C CA  . GLN I 1 145 ? -5.456  70.361  -21.441 1.00 11.15  ? 145  GLN E CA  1 
ATOM   8387  C C   . GLN I 1 145 ? -5.611  68.874  -21.327 1.00 10.67  ? 145  GLN E C   1 
ATOM   8388  O O   . GLN I 1 145 ? -5.738  68.307  -20.220 1.00 11.31  ? 145  GLN E O   1 
ATOM   8389  C CB  . GLN I 1 145 ? -4.296  70.815  -22.269 1.00 10.79  ? 145  GLN E CB  1 
ATOM   8390  C CG  . GLN I 1 145 ? -4.232  72.319  -22.017 1.00 13.73  ? 145  GLN E CG  1 
ATOM   8391  C CD  . GLN I 1 145 ? -3.021  72.877  -22.677 1.00 15.92  ? 145  GLN E CD  1 
ATOM   8392  O OE1 . GLN I 1 145 ? -1.884  72.426  -22.402 1.00 39.77  ? 145  GLN E OE1 1 
ATOM   8393  N NE2 . GLN I 1 145 ? -3.257  73.666  -23.690 1.00 27.22  ? 145  GLN E NE2 1 
ATOM   8394  N N   . SER I 1 146 ? -5.711  68.241  -22.471 1.00 7.31   ? 146  SER E N   1 
ATOM   8395  C CA  . SER I 1 146 ? -5.912  66.807  -22.391 1.00 15.43  ? 146  SER E CA  1 
ATOM   8396  C C   . SER I 1 146 ? -4.632  65.991  -22.383 1.00 19.58  ? 146  SER E C   1 
ATOM   8397  O O   . SER I 1 146 ? -4.718  64.787  -22.293 1.00 20.76  ? 146  SER E O   1 
ATOM   8398  C CB  . SER I 1 146 ? -6.879  66.224  -23.406 1.00 23.42  ? 146  SER E CB  1 
ATOM   8399  O OG  . SER I 1 146 ? -7.842  67.177  -23.833 1.00 23.75  ? 146  SER E OG  1 
ATOM   8400  N N   . PHE I 1 147 ? -3.503  66.671  -22.447 1.00 12.42  ? 147  PHE E N   1 
ATOM   8401  C CA  . PHE I 1 147 ? -2.208  66.091  -22.449 1.00 12.85  ? 147  PHE E CA  1 
ATOM   8402  C C   . PHE I 1 147 ? -1.403  66.683  -21.367 1.00 17.51  ? 147  PHE E C   1 
ATOM   8403  O O   . PHE I 1 147 ? -1.611  67.829  -21.062 1.00 17.01  ? 147  PHE E O   1 
ATOM   8404  C CB  . PHE I 1 147 ? -1.544  66.534  -23.720 1.00 16.68  ? 147  PHE E CB  1 
ATOM   8405  C CG  . PHE I 1 147 ? -2.427  66.058  -24.809 1.00 15.38  ? 147  PHE E CG  1 
ATOM   8406  C CD1 . PHE I 1 147 ? -2.552  64.690  -25.032 1.00 14.47  ? 147  PHE E CD1 1 
ATOM   8407  C CD2 . PHE I 1 147 ? -3.185  66.933  -25.573 1.00 16.29  ? 147  PHE E CD2 1 
ATOM   8408  C CE1 . PHE I 1 147 ? -3.336  64.149  -26.051 1.00 10.70  ? 147  PHE E CE1 1 
ATOM   8409  C CE2 . PHE I 1 147 ? -4.009  66.404  -26.571 1.00 12.98  ? 147  PHE E CE2 1 
ATOM   8410  C CZ  . PHE I 1 147 ? -4.092  65.033  -26.815 1.00 2.23   ? 147  PHE E CZ  1 
ATOM   8411  N N   . LEU I 1 148 ? -0.465  65.905  -20.845 1.00 14.06  ? 148  LEU E N   1 
ATOM   8412  C CA  . LEU I 1 148 ? 0.389   66.349  -19.759 1.00 7.29   ? 148  LEU E CA  1 
ATOM   8413  C C   . LEU I 1 148 ? 1.270   67.517  -20.134 1.00 14.68  ? 148  LEU E C   1 
ATOM   8414  O O   . LEU I 1 148 ? 1.548   68.465  -19.329 1.00 11.93  ? 148  LEU E O   1 
ATOM   8415  C CB  . LEU I 1 148 ? 1.305   65.218  -19.340 1.00 1.53   ? 148  LEU E CB  1 
ATOM   8416  C CG  . LEU I 1 148 ? 0.551   64.231  -18.503 1.00 8.09   ? 148  LEU E CG  1 
ATOM   8417  C CD1 . LEU I 1 148 ? 1.512   63.097  -18.295 1.00 6.61   ? 148  LEU E CD1 1 
ATOM   8418  C CD2 . LEU I 1 148 ? 0.196   64.834  -17.150 1.00 3.81   ? 148  LEU E CD2 1 
ATOM   8419  N N   . VAL I 1 149 ? 1.751   67.386  -21.359 1.00 7.19   ? 149  VAL E N   1 
ATOM   8420  C CA  . VAL I 1 149 ? 2.676   68.347  -21.887 1.00 8.20   ? 149  VAL E CA  1 
ATOM   8421  C C   . VAL I 1 149 ? 2.398   68.699  -23.343 1.00 17.89  ? 149  VAL E C   1 
ATOM   8422  O O   . VAL I 1 149 ? 2.085   67.831  -24.194 1.00 13.91  ? 149  VAL E O   1 
ATOM   8423  C CB  . VAL I 1 149 ? 4.127   67.854  -21.765 1.00 8.40   ? 149  VAL E CB  1 
ATOM   8424  C CG1 . VAL I 1 149 ? 5.155   68.836  -22.357 1.00 4.74   ? 149  VAL E CG1 1 
ATOM   8425  C CG2 . VAL I 1 149 ? 4.508   67.440  -20.344 1.00 7.52   ? 149  VAL E CG2 1 
ATOM   8426  N N   . GLY I 1 150 ? 2.532   70.008  -23.566 1.00 11.92  ? 150  GLY E N   1 
ATOM   8427  C CA  . GLY I 1 150 ? 2.403   70.663  -24.854 1.00 14.38  ? 150  GLY E CA  1 
ATOM   8428  C C   . GLY I 1 150 ? 1.091   70.508  -25.627 1.00 20.27  ? 150  GLY E C   1 
ATOM   8429  O O   . GLY I 1 150 ? 1.034   70.688  -26.841 1.00 25.89  ? 150  GLY E O   1 
ATOM   8430  N N   . ASN I 1 151 ? 0.063   70.140  -24.945 1.00 19.63  ? 151  ASN E N   1 
ATOM   8431  C CA  . ASN I 1 151 ? -1.201  69.997  -25.601 1.00 19.72  ? 151  ASN E CA  1 
ATOM   8432  C C   . ASN I 1 151 ? -1.196  69.099  -26.770 1.00 18.61  ? 151  ASN E C   1 
ATOM   8433  O O   . ASN I 1 151 ? -1.903  69.274  -27.725 1.00 28.97  ? 151  ASN E O   1 
ATOM   8434  C CB  . ASN I 1 151 ? -1.804  71.337  -25.932 1.00 14.88  ? 151  ASN E CB  1 
ATOM   8435  C CG  . ASN I 1 151 ? -3.292  71.299  -25.907 1.00 30.62  ? 151  ASN E CG  1 
ATOM   8436  O OD1 . ASN I 1 151 ? -3.994  70.428  -25.338 1.00 33.31  ? 151  ASN E OD1 1 
ATOM   8437  N ND2 . ASN I 1 151 ? -3.761  72.214  -26.686 1.00 19.00  ? 151  ASN E ND2 1 
ATOM   8438  N N   . GLN I 1 152 ? -0.342  68.156  -26.669 1.00 18.45  ? 152  GLN E N   1 
ATOM   8439  C CA  . GLN I 1 152 ? -0.239  67.099  -27.628 1.00 16.11  ? 152  GLN E CA  1 
ATOM   8440  C C   . GLN I 1 152 ? 0.220   65.829  -26.933 1.00 21.81  ? 152  GLN E C   1 
ATOM   8441  O O   . GLN I 1 152 ? 0.782   65.834  -25.816 1.00 26.92  ? 152  GLN E O   1 
ATOM   8442  C CB  . GLN I 1 152 ? 0.573   67.443  -28.865 1.00 11.65  ? 152  GLN E CB  1 
ATOM   8443  C CG  . GLN I 1 152 ? 2.048   67.748  -28.607 1.00 50.81  ? 152  GLN E CG  1 
ATOM   8444  C CD  . GLN I 1 152 ? 2.807   67.513  -29.888 1.00 60.65  ? 152  GLN E CD  1 
ATOM   8445  O OE1 . GLN I 1 152 ? 2.304   67.977  -30.915 1.00 31.26  ? 152  GLN E OE1 1 
ATOM   8446  N NE2 . GLN I 1 152 ? 3.914   66.733  -29.850 1.00 39.42  ? 152  GLN E NE2 1 
ATOM   8447  N N   . LEU I 1 153 ? -0.090  64.736  -27.571 1.00 9.82   ? 153  LEU E N   1 
ATOM   8448  C CA  . LEU I 1 153 ? 0.285   63.471  -27.018 1.00 8.50   ? 153  LEU E CA  1 
ATOM   8449  C C   . LEU I 1 153 ? 1.801   63.381  -26.994 1.00 17.38  ? 153  LEU E C   1 
ATOM   8450  O O   . LEU I 1 153 ? 2.485   63.828  -27.911 1.00 22.43  ? 153  LEU E O   1 
ATOM   8451  C CB  . LEU I 1 153 ? -0.362  62.360  -27.848 1.00 7.95   ? 153  LEU E CB  1 
ATOM   8452  C CG  . LEU I 1 153 ? -0.270  60.937  -27.330 1.00 9.93   ? 153  LEU E CG  1 
ATOM   8453  C CD1 . LEU I 1 153 ? -1.209  60.697  -26.162 1.00 4.74   ? 153  LEU E CD1 1 
ATOM   8454  C CD2 . LEU I 1 153 ? -0.651  60.007  -28.440 1.00 1.00   ? 153  LEU E CD2 1 
ATOM   8455  N N   . SER I 1 154 ? 2.275   62.807  -25.909 1.00 9.75   ? 154  SER E N   1 
ATOM   8456  C CA  . SER I 1 154 ? 3.651   62.628  -25.659 1.00 5.01   ? 154  SER E CA  1 
ATOM   8457  C C   . SER I 1 154 ? 3.851   61.255  -25.115 1.00 12.22  ? 154  SER E C   1 
ATOM   8458  O O   . SER I 1 154 ? 2.947   60.487  -24.774 1.00 13.00  ? 154  SER E O   1 
ATOM   8459  C CB  . SER I 1 154 ? 4.156   63.655  -24.668 1.00 1.00   ? 154  SER E CB  1 
ATOM   8460  O OG  . SER I 1 154 ? 3.743   63.296  -23.374 1.00 11.84  ? 154  SER E OG  1 
ATOM   8461  N N   . LEU I 1 155 ? 5.094   60.933  -25.073 1.00 9.77   ? 155  LEU E N   1 
ATOM   8462  C CA  . LEU I 1 155 ? 5.475   59.668  -24.527 1.00 7.09   ? 155  LEU E CA  1 
ATOM   8463  C C   . LEU I 1 155 ? 5.011   59.578  -23.069 1.00 11.75  ? 155  LEU E C   1 
ATOM   8464  O O   . LEU I 1 155 ? 4.644   58.532  -22.575 1.00 13.82  ? 155  LEU E O   1 
ATOM   8465  C CB  . LEU I 1 155 ? 6.992   59.604  -24.646 1.00 5.55   ? 155  LEU E CB  1 
ATOM   8466  C CG  . LEU I 1 155 ? 7.604   58.405  -23.965 1.00 7.79   ? 155  LEU E CG  1 
ATOM   8467  C CD1 . LEU I 1 155 ? 7.043   57.125  -24.518 1.00 1.95   ? 155  LEU E CD1 1 
ATOM   8468  C CD2 . LEU I 1 155 ? 9.095   58.464  -24.209 1.00 1.00   ? 155  LEU E CD2 1 
ATOM   8469  N N   . ALA I 1 156 ? 5.005   60.709  -22.360 1.00 4.41   ? 156  ALA E N   1 
ATOM   8470  C CA  . ALA I 1 156 ? 4.580   60.711  -20.983 1.00 1.00   ? 156  ALA E CA  1 
ATOM   8471  C C   . ALA I 1 156 ? 3.127   60.238  -20.833 1.00 9.58   ? 156  ALA E C   1 
ATOM   8472  O O   . ALA I 1 156 ? 2.772   59.429  -19.946 1.00 11.69  ? 156  ALA E O   1 
ATOM   8473  C CB  . ALA I 1 156 ? 4.817   62.078  -20.414 1.00 1.21   ? 156  ALA E CB  1 
ATOM   8474  N N   . ASP I 1 157 ? 2.260   60.691  -21.733 1.00 3.22   ? 157  ASP E N   1 
ATOM   8475  C CA  . ASP I 1 157 ? 0.875   60.276  -21.628 1.00 1.00   ? 157  ASP E CA  1 
ATOM   8476  C C   . ASP I 1 157 ? 0.717   58.779  -21.873 1.00 6.79   ? 157  ASP E C   1 
ATOM   8477  O O   . ASP I 1 157 ? -0.067  58.075  -21.243 1.00 9.32   ? 157  ASP E O   1 
ATOM   8478  C CB  . ASP I 1 157 ? 0.029   61.037  -22.642 1.00 1.62   ? 157  ASP E CB  1 
ATOM   8479  C CG  . ASP I 1 157 ? 0.075   62.537  -22.574 1.00 7.39   ? 157  ASP E CG  1 
ATOM   8480  O OD1 . ASP I 1 157 ? -0.179  63.205  -21.587 1.00 7.28   ? 157  ASP E OD1 1 
ATOM   8481  O OD2 . ASP I 1 157 ? 0.399   63.068  -23.713 1.00 11.20  ? 157  ASP E OD2 1 
ATOM   8482  N N   . VAL I 1 158 ? 1.428   58.240  -22.826 1.00 2.97   ? 158  VAL E N   1 
ATOM   8483  C CA  . VAL I 1 158 ? 1.239   56.803  -23.056 1.00 3.11   ? 158  VAL E CA  1 
ATOM   8484  C C   . VAL I 1 158 ? 1.657   55.939  -21.876 1.00 12.25  ? 158  VAL E C   1 
ATOM   8485  O O   . VAL I 1 158 ? 0.971   54.993  -21.474 1.00 12.12  ? 158  VAL E O   1 
ATOM   8486  C CB  . VAL I 1 158 ? 1.982   56.307  -24.299 1.00 6.13   ? 158  VAL E CB  1 
ATOM   8487  C CG1 . VAL I 1 158 ? 1.692   54.844  -24.565 1.00 8.89   ? 158  VAL E CG1 1 
ATOM   8488  C CG2 . VAL I 1 158 ? 1.742   57.160  -25.517 1.00 1.00   ? 158  VAL E CG2 1 
ATOM   8489  N N   . ILE I 1 159 ? 2.838   56.240  -21.329 1.00 8.29   ? 159  ILE E N   1 
ATOM   8490  C CA  . ILE I 1 159 ? 3.354   55.451  -20.219 1.00 4.76   ? 159  ILE E CA  1 
ATOM   8491  C C   . ILE I 1 159 ? 2.466   55.547  -19.011 1.00 8.02   ? 159  ILE E C   1 
ATOM   8492  O O   . ILE I 1 159 ? 2.248   54.579  -18.278 1.00 12.26  ? 159  ILE E O   1 
ATOM   8493  C CB  . ILE I 1 159 ? 4.770   55.876  -19.868 1.00 7.13   ? 159  ILE E CB  1 
ATOM   8494  C CG1 . ILE I 1 159 ? 5.658   55.763  -21.093 1.00 7.72   ? 159  ILE E CG1 1 
ATOM   8495  C CG2 . ILE I 1 159 ? 5.326   54.936  -18.828 1.00 1.00   ? 159  ILE E CG2 1 
ATOM   8496  C CD1 . ILE I 1 159 ? 5.559   54.368  -21.721 1.00 2.92   ? 159  ILE E CD1 1 
ATOM   8497  N N   . LEU I 1 160 ? 1.935   56.743  -18.843 1.00 1.91   ? 160  LEU E N   1 
ATOM   8498  C CA  . LEU I 1 160 ? 1.059   57.002  -17.731 1.00 3.04   ? 160  LEU E CA  1 
ATOM   8499  C C   . LEU I 1 160 ? -0.209  56.268  -17.914 1.00 6.29   ? 160  LEU E C   1 
ATOM   8500  O O   . LEU I 1 160 ? -0.632  55.508  -17.047 1.00 12.58  ? 160  LEU E O   1 
ATOM   8501  C CB  . LEU I 1 160 ? 0.882   58.490  -17.513 1.00 4.78   ? 160  LEU E CB  1 
ATOM   8502  C CG  . LEU I 1 160 ? -0.055  58.779  -16.380 1.00 5.70   ? 160  LEU E CG  1 
ATOM   8503  C CD1 . LEU I 1 160 ? 0.389   58.113  -15.094 1.00 1.00   ? 160  LEU E CD1 1 
ATOM   8504  C CD2 . LEU I 1 160 ? -0.026  60.265  -16.205 1.00 1.00   ? 160  LEU E CD2 1 
ATOM   8505  N N   . LEU I 1 161 ? -0.758  56.410  -19.094 1.00 1.00   ? 161  LEU E N   1 
ATOM   8506  C CA  . LEU I 1 161 ? -1.933  55.641  -19.395 1.00 2.24   ? 161  LEU E CA  1 
ATOM   8507  C C   . LEU I 1 161 ? -1.713  54.144  -19.200 1.00 6.32   ? 161  LEU E C   1 
ATOM   8508  O O   . LEU I 1 161 ? -2.483  53.415  -18.572 1.00 7.38   ? 161  LEU E O   1 
ATOM   8509  C CB  . LEU I 1 161 ? -2.325  55.842  -20.849 1.00 4.61   ? 161  LEU E CB  1 
ATOM   8510  C CG  . LEU I 1 161 ? -3.542  54.977  -21.228 1.00 11.13  ? 161  LEU E CG  1 
ATOM   8511  C CD1 . LEU I 1 161 ? -4.793  55.357  -20.458 1.00 6.22   ? 161  LEU E CD1 1 
ATOM   8512  C CD2 . LEU I 1 161 ? -3.861  55.178  -22.685 1.00 5.61   ? 161  LEU E CD2 1 
ATOM   8513  N N   . GLN I 1 162 ? -0.611  53.673  -19.709 1.00 1.00   ? 162  GLN E N   1 
ATOM   8514  C CA  . GLN I 1 162 ? -0.350  52.257  -19.574 1.00 2.60   ? 162  GLN E CA  1 
ATOM   8515  C C   . GLN I 1 162 ? -0.332  51.757  -18.149 1.00 9.76   ? 162  GLN E C   1 
ATOM   8516  O O   . GLN I 1 162 ? -0.900  50.726  -17.817 1.00 13.96  ? 162  GLN E O   1 
ATOM   8517  C CB  . GLN I 1 162 ? 0.989   51.914  -20.226 1.00 5.01   ? 162  GLN E CB  1 
ATOM   8518  C CG  . GLN I 1 162 ? 1.602   50.738  -19.475 1.00 1.00   ? 162  GLN E CG  1 
ATOM   8519  C CD  . GLN I 1 162 ? 2.889   50.126  -20.041 1.00 7.99   ? 162  GLN E CD  1 
ATOM   8520  O OE1 . GLN I 1 162 ? 3.037   48.907  -19.979 1.00 13.25  ? 162  GLN E OE1 1 
ATOM   8521  N NE2 . GLN I 1 162 ? 3.902   50.918  -20.421 1.00 1.00   ? 162  GLN E NE2 1 
ATOM   8522  N N   . THR I 1 163 ? 0.300   52.579  -17.331 1.00 8.32   ? 163  THR E N   1 
ATOM   8523  C CA  . THR I 1 163 ? 0.509   52.301  -15.934 1.00 6.48   ? 163  THR E CA  1 
ATOM   8524  C C   . THR I 1 163 ? -0.761  52.358  -15.120 1.00 10.48  ? 163  THR E C   1 
ATOM   8525  O O   . THR I 1 163 ? -1.095  51.492  -14.315 1.00 9.86   ? 163  THR E O   1 
ATOM   8526  C CB  . THR I 1 163 ? 1.569   53.275  -15.387 1.00 3.83   ? 163  THR E CB  1 
ATOM   8527  O OG1 . THR I 1 163 ? 2.771   53.239  -16.145 1.00 7.93   ? 163  THR E OG1 1 
ATOM   8528  C CG2 . THR I 1 163 ? 1.863   52.998  -13.937 1.00 1.00   ? 163  THR E CG2 1 
ATOM   8529  N N   . ILE I 1 164 ? -1.474  53.422  -15.311 1.00 6.30   ? 164  ILE E N   1 
ATOM   8530  C CA  . ILE I 1 164 ? -2.728  53.569  -14.619 1.00 5.83   ? 164  ILE E CA  1 
ATOM   8531  C C   . ILE I 1 164 ? -3.646  52.387  -14.915 1.00 10.33  ? 164  ILE E C   1 
ATOM   8532  O O   . ILE I 1 164 ? -4.204  51.715  -14.018 1.00 8.32   ? 164  ILE E O   1 
ATOM   8533  C CB  . ILE I 1 164 ? -3.381  54.770  -15.230 1.00 8.52   ? 164  ILE E CB  1 
ATOM   8534  C CG1 . ILE I 1 164 ? -2.866  56.050  -14.593 1.00 6.79   ? 164  ILE E CG1 1 
ATOM   8535  C CG2 . ILE I 1 164 ? -4.849  54.616  -15.001 1.00 3.92   ? 164  ILE E CG2 1 
ATOM   8536  C CD1 . ILE I 1 164 ? -3.390  57.280  -15.293 1.00 1.00   ? 164  ILE E CD1 1 
ATOM   8537  N N   . LEU I 1 165 ? -3.766  52.067  -16.203 1.00 1.85   ? 165  LEU E N   1 
ATOM   8538  C CA  . LEU I 1 165 ? -4.617  50.934  -16.508 1.00 1.15   ? 165  LEU E CA  1 
ATOM   8539  C C   . LEU I 1 165 ? -4.184  49.645  -15.885 1.00 7.95   ? 165  LEU E C   1 
ATOM   8540  O O   . LEU I 1 165 ? -4.989  48.801  -15.524 1.00 14.91  ? 165  LEU E O   1 
ATOM   8541  C CB  . LEU I 1 165 ? -4.745  50.705  -17.991 1.00 3.68   ? 165  LEU E CB  1 
ATOM   8542  C CG  . LEU I 1 165 ? -5.310  51.887  -18.764 1.00 9.64   ? 165  LEU E CG  1 
ATOM   8543  C CD1 . LEU I 1 165 ? -5.441  51.534  -20.232 1.00 5.44   ? 165  LEU E CD1 1 
ATOM   8544  C CD2 . LEU I 1 165 ? -6.666  52.263  -18.248 1.00 1.00   ? 165  LEU E CD2 1 
ATOM   8545  N N   . ALA I 1 166 ? -2.892  49.462  -15.833 1.00 8.71   ? 166  ALA E N   1 
ATOM   8546  C CA  . ALA I 1 166 ? -2.362  48.257  -15.241 1.00 1.59   ? 166  ALA E CA  1 
ATOM   8547  C C   . ALA I 1 166 ? -2.649  48.207  -13.758 1.00 7.30   ? 166  ALA E C   1 
ATOM   8548  O O   . ALA I 1 166 ? -2.921  47.171  -13.172 1.00 7.68   ? 166  ALA E O   1 
ATOM   8549  C CB  . ALA I 1 166 ? -0.904  48.338  -15.431 1.00 1.00   ? 166  ALA E CB  1 
ATOM   8550  N N   . LEU I 1 167 ? -2.597  49.361  -13.136 1.00 4.92   ? 167  LEU E N   1 
ATOM   8551  C CA  . LEU I 1 167 ? -2.857  49.420  -11.737 1.00 4.32   ? 167  LEU E CA  1 
ATOM   8552  C C   . LEU I 1 167 ? -4.304  49.117  -11.516 1.00 12.12  ? 167  LEU E C   1 
ATOM   8553  O O   . LEU I 1 167 ? -4.679  48.346  -10.624 1.00 11.02  ? 167  LEU E O   1 
ATOM   8554  C CB  . LEU I 1 167 ? -2.574  50.846  -11.274 1.00 4.79   ? 167  LEU E CB  1 
ATOM   8555  C CG  . LEU I 1 167 ? -1.099  51.047  -11.023 1.00 9.14   ? 167  LEU E CG  1 
ATOM   8556  C CD1 . LEU I 1 167 ? -0.748  52.488  -10.930 1.00 6.73   ? 167  LEU E CD1 1 
ATOM   8557  C CD2 . LEU I 1 167 ? -0.767  50.473  -9.678  1.00 1.00   ? 167  LEU E CD2 1 
ATOM   8558  N N   . GLU I 1 168 ? -5.126  49.736  -12.358 1.00 7.20   ? 168  GLU E N   1 
ATOM   8559  C CA  . GLU I 1 168 ? -6.541  49.488  -12.201 1.00 5.64   ? 168  GLU E CA  1 
ATOM   8560  C C   . GLU I 1 168 ? -6.901  48.037  -12.319 1.00 13.17  ? 168  GLU E C   1 
ATOM   8561  O O   . GLU I 1 168 ? -7.931  47.580  -11.837 1.00 20.60  ? 168  GLU E O   1 
ATOM   8562  C CB  . GLU I 1 168 ? -7.394  50.228  -13.158 1.00 1.00   ? 168  GLU E CB  1 
ATOM   8563  C CG  . GLU I 1 168 ? -7.337  51.709  -12.886 1.00 11.55  ? 168  GLU E CG  1 
ATOM   8564  C CD  . GLU I 1 168 ? -8.296  52.440  -13.788 1.00 4.97   ? 168  GLU E CD  1 
ATOM   8565  O OE1 . GLU I 1 168 ? -8.543  52.057  -14.952 1.00 25.67  ? 168  GLU E OE1 1 
ATOM   8566  O OE2 . GLU I 1 168 ? -8.921  53.449  -13.165 1.00 38.28  ? 168  GLU E OE2 1 
ATOM   8567  N N   . GLU I 1 169 ? -6.093  47.308  -13.005 1.00 3.60   ? 169  GLU E N   1 
ATOM   8568  C CA  . GLU I 1 169 ? -6.396  45.922  -13.067 1.00 3.76   ? 169  GLU E CA  1 
ATOM   8569  C C   . GLU I 1 169 ? -6.288  45.334  -11.694 1.00 13.90  ? 169  GLU E C   1 
ATOM   8570  O O   . GLU I 1 169 ? -6.984  44.390  -11.405 1.00 20.41  ? 169  GLU E O   1 
ATOM   8571  C CB  . GLU I 1 169 ? -5.484  45.104  -14.001 1.00 5.62   ? 169  GLU E CB  1 
ATOM   8572  C CG  . GLU I 1 169 ? -5.616  45.430  -15.493 1.00 3.86   ? 169  GLU E CG  1 
ATOM   8573  C CD  . GLU I 1 169 ? -4.445  44.896  -16.270 1.00 20.25  ? 169  GLU E CD  1 
ATOM   8574  O OE1 . GLU I 1 169 ? -3.432  44.557  -15.738 1.00 27.21  ? 169  GLU E OE1 1 
ATOM   8575  O OE2 . GLU I 1 169 ? -4.552  45.024  -17.559 1.00 8.59   ? 169  GLU E OE2 1 
ATOM   8576  N N   . LYS I 1 170 ? -5.409  45.847  -10.843 1.00 13.87  ? 170  LYS E N   1 
ATOM   8577  C CA  . LYS I 1 170 ? -5.303  45.279  -9.511  1.00 10.02  ? 170  LYS E CA  1 
ATOM   8578  C C   . LYS I 1 170 ? -6.104  46.067  -8.483  1.00 19.17  ? 170  LYS E C   1 
ATOM   8579  O O   . LYS I 1 170 ? -6.543  45.502  -7.477  1.00 19.33  ? 170  LYS E O   1 
ATOM   8580  C CB  . LYS I 1 170 ? -3.879  45.259  -9.035  1.00 8.99   ? 170  LYS E CB  1 
ATOM   8581  C CG  . LYS I 1 170 ? -2.974  44.655  -10.049 1.00 9.35   ? 170  LYS E CG  1 
ATOM   8582  C CD  . LYS I 1 170 ? -1.817  43.791  -9.529  1.00 10.16  ? 170  LYS E CD  1 
ATOM   8583  C CE  . LYS I 1 170 ? -1.189  42.948  -10.643 1.00 32.81  ? 170  LYS E CE  1 
ATOM   8584  N NZ  . LYS I 1 170 ? -0.393  41.766  -10.230 1.00 121.55 ? 170  LYS E NZ  1 
ATOM   8585  N N   . ILE I 1 171 ? -6.243  47.381  -8.712  1.00 13.36  ? 171  ILE E N   1 
ATOM   8586  C CA  . ILE I 1 171 ? -6.942  48.281  -7.784  1.00 7.24   ? 171  ILE E CA  1 
ATOM   8587  C C   . ILE I 1 171 ? -7.755  49.243  -8.579  1.00 13.74  ? 171  ILE E C   1 
ATOM   8588  O O   . ILE I 1 171 ? -7.374  50.365  -8.939  1.00 23.49  ? 171  ILE E O   1 
ATOM   8589  C CB  . ILE I 1 171 ? -5.942  49.079  -6.993  1.00 8.56   ? 171  ILE E CB  1 
ATOM   8590  C CG1 . ILE I 1 171 ? -4.808  48.187  -6.535  1.00 7.78   ? 171  ILE E CG1 1 
ATOM   8591  C CG2 . ILE I 1 171 ? -6.640  49.651  -5.821  1.00 1.00   ? 171  ILE E CG2 1 
ATOM   8592  C CD1 . ILE I 1 171 ? -3.559  48.970  -6.221  1.00 7.31   ? 171  ILE E CD1 1 
ATOM   8593  N N   . PRO I 1 172 ? -8.874  48.705  -8.831  1.00 7.06   ? 172  PRO E N   1 
ATOM   8594  C CA  . PRO I 1 172 ? -9.898  49.185  -9.686  1.00 9.45   ? 172  PRO E CA  1 
ATOM   8595  C C   . PRO I 1 172 ? -10.385 50.551  -9.442  1.00 17.10  ? 172  PRO E C   1 
ATOM   8596  O O   . PRO I 1 172 ? -10.848 51.153  -10.382 1.00 16.45  ? 172  PRO E O   1 
ATOM   8597  C CB  . PRO I 1 172 ? -11.030 48.149  -9.673  1.00 4.38   ? 172  PRO E CB  1 
ATOM   8598  C CG  . PRO I 1 172 ? -10.420 46.915  -9.052  1.00 3.83   ? 172  PRO E CG  1 
ATOM   8599  C CD  . PRO I 1 172 ? -9.145  47.351  -8.335  1.00 6.07   ? 172  PRO E CD  1 
ATOM   8600  N N   . ASN I 1 173 ? -10.284 50.992  -8.210  1.00 15.91  ? 173  ASN E N   1 
ATOM   8601  C CA  . ASN I 1 173 ? -10.734 52.303  -7.796  1.00 14.15  ? 173  ASN E CA  1 
ATOM   8602  C C   . ASN I 1 173 ? -9.564  53.172  -7.471  1.00 21.82  ? 173  ASN E C   1 
ATOM   8603  O O   . ASN I 1 173 ? -9.658  54.102  -6.715  1.00 26.37  ? 173  ASN E O   1 
ATOM   8604  C CB  . ASN I 1 173 ? -11.482 52.126  -6.479  1.00 8.39   ? 173  ASN E CB  1 
ATOM   8605  C CG  . ASN I 1 173 ? -10.710 51.343  -5.425  1.00 42.06  ? 173  ASN E CG  1 
ATOM   8606  O OD1 . ASN I 1 173 ? -10.055 50.328  -5.740  1.00 79.29  ? 173  ASN E OD1 1 
ATOM   8607  N ND2 . ASN I 1 173 ? -10.973 51.673  -4.145  1.00 48.92  ? 173  ASN E ND2 1 
ATOM   8608  N N   . ILE I 1 174 ? -8.425  52.828  -7.986  1.00 17.65  ? 174  ILE E N   1 
ATOM   8609  C CA  . ILE I 1 174 ? -7.287  53.589  -7.637  1.00 10.65  ? 174  ILE E CA  1 
ATOM   8610  C C   . ILE I 1 174 ? -7.381  55.046  -8.046  1.00 15.63  ? 174  ILE E C   1 
ATOM   8611  O O   . ILE I 1 174 ? -6.845  55.937  -7.394  1.00 22.04  ? 174  ILE E O   1 
ATOM   8612  C CB  . ILE I 1 174 ? -6.078  52.868  -8.121  1.00 10.88  ? 174  ILE E CB  1 
ATOM   8613  C CG1 . ILE I 1 174 ? -4.940  53.494  -7.385  1.00 5.26   ? 174  ILE E CG1 1 
ATOM   8614  C CG2 . ILE I 1 174 ? -5.987  52.978  -9.667  1.00 1.00   ? 174  ILE E CG2 1 
ATOM   8615  C CD1 . ILE I 1 174 ? -3.792  52.584  -7.544  1.00 16.19  ? 174  ILE E CD1 1 
ATOM   8616  N N   . LEU I 1 175 ? -8.168  55.321  -9.089  1.00 13.16  ? 175  LEU E N   1 
ATOM   8617  C CA  . LEU I 1 175 ? -8.308  56.695  -9.578  1.00 10.15  ? 175  LEU E CA  1 
ATOM   8618  C C   . LEU I 1 175 ? -9.439  57.516  -8.985  1.00 23.77  ? 175  LEU E C   1 
ATOM   8619  O O   . LEU I 1 175 ? -9.655  58.688  -9.384  1.00 21.65  ? 175  LEU E O   1 
ATOM   8620  C CB  . LEU I 1 175 ? -8.572  56.712  -11.062 1.00 5.76   ? 175  LEU E CB  1 
ATOM   8621  C CG  . LEU I 1 175 ? -7.347  56.637  -11.955 1.00 9.61   ? 175  LEU E CG  1 
ATOM   8622  C CD1 . LEU I 1 175 ? -7.804  57.047  -13.325 1.00 10.47  ? 175  LEU E CD1 1 
ATOM   8623  C CD2 . LEU I 1 175 ? -6.184  57.529  -11.498 1.00 1.06   ? 175  LEU E CD2 1 
ATOM   8624  N N   . SER I 1 176 ? -10.177 56.843  -8.106  1.00 22.38  ? 176  SER E N   1 
ATOM   8625  C CA  . SER I 1 176 ? -11.324 57.385  -7.391  1.00 20.12  ? 176  SER E CA  1 
ATOM   8626  C C   . SER I 1 176 ? -11.072 58.818  -7.011  1.00 19.57  ? 176  SER E C   1 
ATOM   8627  O O   . SER I 1 176 ? -11.801 59.696  -7.383  1.00 36.15  ? 176  SER E O   1 
ATOM   8628  C CB  . SER I 1 176 ? -11.634 56.589  -6.124  1.00 27.14  ? 176  SER E CB  1 
ATOM   8629  O OG  . SER I 1 176 ? -10.434 56.497  -5.330  1.00 92.26  ? 176  SER E OG  1 
ATOM   8630  N N   . ALA I 1 177 ? -10.023 59.088  -6.293  1.00 14.43  ? 177  ALA E N   1 
ATOM   8631  C CA  . ALA I 1 177 ? -9.774  60.457  -5.904  1.00 7.83   ? 177  ALA E CA  1 
ATOM   8632  C C   . ALA I 1 177 ? -9.126  61.367  -6.932  1.00 15.57  ? 177  ALA E C   1 
ATOM   8633  O O   . ALA I 1 177 ? -8.773  62.475  -6.507  1.00 21.58  ? 177  ALA E O   1 
ATOM   8634  C CB  . ALA I 1 177 ? -8.904  60.467  -4.686  1.00 5.96   ? 177  ALA E CB  1 
ATOM   8635  N N   . PHE I 1 178 ? -8.965  60.908  -8.200  1.00 6.27   ? 178  PHE E N   1 
ATOM   8636  C CA  . PHE I 1 178 ? -8.309  61.659  -9.253  1.00 9.20   ? 178  PHE E CA  1 
ATOM   8637  C C   . PHE I 1 178 ? -9.158  61.786  -10.469 1.00 18.14  ? 178  PHE E C   1 
ATOM   8638  O O   . PHE I 1 178 ? -8.982  61.160  -11.488 1.00 24.51  ? 178  PHE E O   1 
ATOM   8639  C CB  . PHE I 1 178 ? -6.962  61.013  -9.603  1.00 10.48  ? 178  PHE E CB  1 
ATOM   8640  C CG  . PHE I 1 178 ? -6.181  60.808  -8.330  1.00 6.36   ? 178  PHE E CG  1 
ATOM   8641  C CD1 . PHE I 1 178 ? -5.401  61.830  -7.799  1.00 1.27   ? 178  PHE E CD1 1 
ATOM   8642  C CD2 . PHE I 1 178 ? -6.221  59.598  -7.644  1.00 11.09  ? 178  PHE E CD2 1 
ATOM   8643  C CE1 . PHE I 1 178 ? -4.633  61.635  -6.645  1.00 1.00   ? 178  PHE E CE1 1 
ATOM   8644  C CE2 . PHE I 1 178 ? -5.513  59.411  -6.455  1.00 11.28  ? 178  PHE E CE2 1 
ATOM   8645  C CZ  . PHE I 1 178 ? -4.722  60.437  -5.940  1.00 1.00   ? 178  PHE E CZ  1 
ATOM   8646  N N   . PRO I 1 179 ? -10.078 62.647  -10.307 1.00 20.81  ? 179  PRO E N   1 
ATOM   8647  C CA  . PRO I 1 179 ? -11.101 63.012  -11.255 1.00 19.51  ? 179  PRO E CA  1 
ATOM   8648  C C   . PRO I 1 179 ? -10.497 63.534  -12.530 1.00 24.18  ? 179  PRO E C   1 
ATOM   8649  O O   . PRO I 1 179 ? -10.947 63.180  -13.609 1.00 26.95  ? 179  PRO E O   1 
ATOM   8650  C CB  . PRO I 1 179 ? -11.863 64.123  -10.579 1.00 15.42  ? 179  PRO E CB  1 
ATOM   8651  C CG  . PRO I 1 179 ? -11.264 64.353  -9.220  1.00 15.39  ? 179  PRO E CG  1 
ATOM   8652  C CD  . PRO I 1 179 ? -10.260 63.248  -8.986  1.00 16.82  ? 179  PRO E CD  1 
ATOM   8653  N N   . PHE I 1 180 ? -9.459  64.343  -12.421 1.00 16.21  ? 180  PHE E N   1 
ATOM   8654  C CA  . PHE I 1 180 ? -8.799  64.781  -13.646 1.00 14.12  ? 180  PHE E CA  1 
ATOM   8655  C C   . PHE I 1 180 ? -8.167  63.607  -14.349 1.00 18.51  ? 180  PHE E C   1 
ATOM   8656  O O   . PHE I 1 180 ? -8.344  63.424  -15.551 1.00 18.74  ? 180  PHE E O   1 
ATOM   8657  C CB  . PHE I 1 180 ? -7.720  65.788  -13.340 1.00 16.34  ? 180  PHE E CB  1 
ATOM   8658  C CG  . PHE I 1 180 ? -8.407  67.121  -13.165 1.00 21.04  ? 180  PHE E CG  1 
ATOM   8659  C CD1 . PHE I 1 180 ? -9.030  67.459  -11.969 1.00 20.75  ? 180  PHE E CD1 1 
ATOM   8660  C CD2 . PHE I 1 180 ? -8.527  68.042  -14.211 1.00 26.78  ? 180  PHE E CD2 1 
ATOM   8661  C CE1 . PHE I 1 180 ? -9.668  68.697  -11.814 1.00 18.28  ? 180  PHE E CE1 1 
ATOM   8662  C CE2 . PHE I 1 180 ? -9.180  69.274  -14.097 1.00 17.67  ? 180  PHE E CE2 1 
ATOM   8663  C CZ  . PHE I 1 180 ? -9.746  69.609  -12.869 1.00 10.82  ? 180  PHE E CZ  1 
ATOM   8664  N N   . LEU I 1 181 ? -7.460  62.783  -13.560 1.00 8.93   ? 181  LEU E N   1 
ATOM   8665  C CA  . LEU I 1 181 ? -6.839  61.631  -14.126 1.00 9.86   ? 181  LEU E CA  1 
ATOM   8666  C C   . LEU I 1 181 ? -7.894  60.725  -14.717 1.00 12.03  ? 181  LEU E C   1 
ATOM   8667  O O   . LEU I 1 181 ? -7.706  60.081  -15.775 1.00 13.20  ? 181  LEU E O   1 
ATOM   8668  C CB  . LEU I 1 181 ? -5.966  60.874  -13.107 1.00 13.77  ? 181  LEU E CB  1 
ATOM   8669  C CG  . LEU I 1 181 ? -4.650  61.548  -12.801 1.00 13.05  ? 181  LEU E CG  1 
ATOM   8670  C CD1 . LEU I 1 181 ? -3.906  60.829  -11.682 1.00 11.41  ? 181  LEU E CD1 1 
ATOM   8671  C CD2 . LEU I 1 181 ? -3.867  61.526  -14.071 1.00 1.82   ? 181  LEU E CD2 1 
ATOM   8672  N N   . GLN I 1 182 ? -9.054  60.677  -14.080 1.00 9.34   ? 182  GLN E N   1 
ATOM   8673  C CA  . GLN I 1 182 ? -10.049 59.790  -14.686 1.00 8.76   ? 182  GLN E CA  1 
ATOM   8674  C C   . GLN I 1 182 ? -10.480 60.274  -16.032 1.00 14.41  ? 182  GLN E C   1 
ATOM   8675  O O   . GLN I 1 182 ? -10.593 59.539  -16.976 1.00 16.30  ? 182  GLN E O   1 
ATOM   8676  C CB  . GLN I 1 182 ? -11.305 59.645  -13.906 1.00 6.64   ? 182  GLN E CB  1 
ATOM   8677  C CG  . GLN I 1 182 ? -11.268 58.830  -12.618 1.00 35.10  ? 182  GLN E CG  1 
ATOM   8678  C CD  . GLN I 1 182 ? -12.472 59.232  -11.780 1.00 18.09  ? 182  GLN E CD  1 
ATOM   8679  O OE1 . GLN I 1 182 ? -13.517 59.658  -12.310 1.00 83.28  ? 182  GLN E OE1 1 
ATOM   8680  N NE2 . GLN I 1 182 ? -12.295 59.295  -10.474 1.00 33.79  ? 182  GLN E NE2 1 
ATOM   8681  N N   . GLU I 1 183 ? -10.723 61.538  -16.138 1.00 15.58  ? 183  GLU E N   1 
ATOM   8682  C CA  . GLU I 1 183 ? -11.143 62.014  -17.402 1.00 18.74  ? 183  GLU E CA  1 
ATOM   8683  C C   . GLU I 1 183 ? -10.101 61.874  -18.439 1.00 16.44  ? 183  GLU E C   1 
ATOM   8684  O O   . GLU I 1 183 ? -10.365 61.420  -19.534 1.00 21.35  ? 183  GLU E O   1 
ATOM   8685  C CB  . GLU I 1 183 ? -11.589 63.446  -17.346 1.00 23.36  ? 183  GLU E CB  1 
ATOM   8686  C CG  . GLU I 1 183 ? -12.648 63.836  -18.404 1.00 90.45  ? 183  GLU E CG  1 
ATOM   8687  C CD  . GLU I 1 183 ? -12.848 65.296  -18.346 1.00 240.06 ? 183  GLU E CD  1 
ATOM   8688  O OE1 . GLU I 1 183 ? -12.618 65.979  -17.374 1.00 286.72 ? 183  GLU E OE1 1 
ATOM   8689  O OE2 . GLU I 1 183 ? -13.511 65.774  -19.368 1.00 267.52 ? 183  GLU E OE2 1 
ATOM   8690  N N   . TYR I 1 184 ? -8.913  62.279  -18.086 1.00 16.75  ? 184  TYR E N   1 
ATOM   8691  C CA  . TYR I 1 184 ? -7.777  62.209  -18.987 1.00 15.59  ? 184  TYR E CA  1 
ATOM   8692  C C   . TYR I 1 184 ? -7.636  60.802  -19.585 1.00 17.05  ? 184  TYR E C   1 
ATOM   8693  O O   . TYR I 1 184 ? -7.498  60.584  -20.808 1.00 16.57  ? 184  TYR E O   1 
ATOM   8694  C CB  . TYR I 1 184 ? -6.637  62.529  -18.077 1.00 10.91  ? 184  TYR E CB  1 
ATOM   8695  C CG  . TYR I 1 184 ? -5.270  62.320  -18.614 1.00 13.32  ? 184  TYR E CG  1 
ATOM   8696  C CD1 . TYR I 1 184 ? -4.576  63.274  -19.362 1.00 12.11  ? 184  TYR E CD1 1 
ATOM   8697  C CD2 . TYR I 1 184 ? -4.574  61.179  -18.219 1.00 10.72  ? 184  TYR E CD2 1 
ATOM   8698  C CE1 . TYR I 1 184 ? -3.284  62.998  -19.826 1.00 9.98   ? 184  TYR E CE1 1 
ATOM   8699  C CE2 . TYR I 1 184 ? -3.273  60.911  -18.650 1.00 4.44   ? 184  TYR E CE2 1 
ATOM   8700  C CZ  . TYR I 1 184 ? -2.605  61.830  -19.450 1.00 8.44   ? 184  TYR E CZ  1 
ATOM   8701  O OH  . TYR I 1 184 ? -1.282  61.579  -19.818 1.00 17.51  ? 184  TYR E OH  1 
ATOM   8702  N N   . THR I 1 185 ? -7.776  59.827  -18.704 1.00 2.92   ? 185  THR E N   1 
ATOM   8703  C CA  . THR I 1 185 ? -7.659  58.431  -19.075 1.00 2.77   ? 185  THR E CA  1 
ATOM   8704  C C   . THR I 1 185 ? -8.698  58.055  -20.072 1.00 13.26  ? 185  THR E C   1 
ATOM   8705  O O   . THR I 1 185 ? -8.510  57.354  -21.062 1.00 13.17  ? 185  THR E O   1 
ATOM   8706  C CB  . THR I 1 185 ? -7.905  57.608  -17.802 1.00 14.05  ? 185  THR E CB  1 
ATOM   8707  O OG1 . THR I 1 185 ? -6.838  57.807  -16.973 1.00 9.91   ? 185  THR E OG1 1 
ATOM   8708  C CG2 . THR I 1 185 ? -7.933  56.132  -18.067 1.00 3.34   ? 185  THR E CG2 1 
ATOM   8709  N N   . VAL I 1 186 ? -9.852  58.517  -19.778 1.00 11.46  ? 186  VAL E N   1 
ATOM   8710  C CA  . VAL I 1 186 ? -10.933 58.223  -20.655 1.00 14.52  ? 186  VAL E CA  1 
ATOM   8711  C C   . VAL I 1 186 ? -10.725 58.761  -22.039 1.00 11.38  ? 186  VAL E C   1 
ATOM   8712  O O   . VAL I 1 186 ? -10.827 58.067  -23.033 1.00 16.88  ? 186  VAL E O   1 
ATOM   8713  C CB  . VAL I 1 186 ? -12.178 58.862  -20.105 1.00 19.24  ? 186  VAL E CB  1 
ATOM   8714  C CG1 . VAL I 1 186 ? -13.220 58.655  -21.165 1.00 15.96  ? 186  VAL E CG1 1 
ATOM   8715  C CG2 . VAL I 1 186 ? -12.601 58.092  -18.875 1.00 14.85  ? 186  VAL E CG2 1 
ATOM   8716  N N   . LYS I 1 187 ? -10.444 60.015  -22.102 1.00 4.04   ? 187  LYS E N   1 
ATOM   8717  C CA  . LYS I 1 187 ? -10.167 60.573  -23.395 1.00 8.37   ? 187  LYS E CA  1 
ATOM   8718  C C   . LYS I 1 187 ? -9.038  59.910  -24.147 1.00 18.54  ? 187  LYS E C   1 
ATOM   8719  O O   . LYS I 1 187 ? -9.118  59.734  -25.347 1.00 20.40  ? 187  LYS E O   1 
ATOM   8720  C CB  . LYS I 1 187 ? -9.759  62.008  -23.261 1.00 7.10   ? 187  LYS E CB  1 
ATOM   8721  C CG  . LYS I 1 187 ? -10.784 62.807  -22.502 1.00 17.97  ? 187  LYS E CG  1 
ATOM   8722  C CD  . LYS I 1 187 ? -10.790 64.275  -22.920 1.00 38.64  ? 187  LYS E CD  1 
ATOM   8723  C CE  . LYS I 1 187 ? -10.710 65.296  -21.760 1.00 92.14  ? 187  LYS E CE  1 
ATOM   8724  N NZ  . LYS I 1 187 ? -9.342  65.621  -21.272 1.00 21.76  ? 187  LYS E NZ  1 
ATOM   8725  N N   . LEU I 1 188 ? -7.936  59.707  -23.450 1.00 19.55  ? 188  LEU E N   1 
ATOM   8726  C CA  . LEU I 1 188 ? -6.785  59.151  -24.091 1.00 15.53  ? 188  LEU E CA  1 
ATOM   8727  C C   . LEU I 1 188 ? -7.201  57.837  -24.644 1.00 17.36  ? 188  LEU E C   1 
ATOM   8728  O O   . LEU I 1 188 ? -6.774  57.427  -25.716 1.00 19.51  ? 188  LEU E O   1 
ATOM   8729  C CB  . LEU I 1 188 ? -5.679  58.854  -23.053 1.00 11.05  ? 188  LEU E CB  1 
ATOM   8730  C CG  . LEU I 1 188 ? -4.855  60.032  -22.576 1.00 12.13  ? 188  LEU E CG  1 
ATOM   8731  C CD1 . LEU I 1 188 ? -3.687  59.547  -21.749 1.00 9.57   ? 188  LEU E CD1 1 
ATOM   8732  C CD2 . LEU I 1 188 ? -4.304  60.883  -23.705 1.00 12.24  ? 188  LEU E CD2 1 
ATOM   8733  N N   . SER I 1 189 ? -7.997  57.144  -23.856 1.00 6.09   ? 189  SER E N   1 
ATOM   8734  C CA  . SER I 1 189 ? -8.316  55.825  -24.335 1.00 10.27  ? 189  SER E CA  1 
ATOM   8735  C C   . SER I 1 189 ? -9.182  55.842  -25.537 1.00 18.63  ? 189  SER E C   1 
ATOM   8736  O O   . SER I 1 189 ? -9.492  54.797  -26.106 1.00 20.89  ? 189  SER E O   1 
ATOM   8737  C CB  . SER I 1 189 ? -8.926  54.908  -23.324 1.00 16.35  ? 189  SER E CB  1 
ATOM   8738  O OG  . SER I 1 189 ? -8.475  55.215  -22.040 1.00 15.31  ? 189  SER E OG  1 
ATOM   8739  N N   . ASN I 1 190 ? -9.667  57.034  -25.841 1.00 18.88  ? 190  ASN E N   1 
ATOM   8740  C CA  . ASN I 1 190 ? -10.538 57.170  -27.012 1.00 20.58  ? 190  ASN E CA  1 
ATOM   8741  C C   . ASN I 1 190 ? -9.808  57.550  -28.254 1.00 29.19  ? 190  ASN E C   1 
ATOM   8742  O O   . ASN I 1 190 ? -10.404 57.571  -29.291 1.00 34.30  ? 190  ASN E O   1 
ATOM   8743  C CB  . ASN I 1 190 ? -11.974 57.744  -26.897 1.00 18.59  ? 190  ASN E CB  1 
ATOM   8744  C CG  . ASN I 1 190 ? -12.869 56.875  -26.071 1.00 101.46 ? 190  ASN E CG  1 
ATOM   8745  O OD1 . ASN I 1 190 ? -13.429 55.904  -26.628 1.00 120.18 ? 190  ASN E OD1 1 
ATOM   8746  N ND2 . ASN I 1 190 ? -12.893 57.132  -24.740 1.00 89.76  ? 190  ASN E ND2 1 
ATOM   8747  N N   . ILE I 1 191 ? -8.513  57.828  -28.123 1.00 25.31  ? 191  ILE E N   1 
ATOM   8748  C CA  . ILE I 1 191 ? -7.679  58.061  -29.265 1.00 17.82  ? 191  ILE E CA  1 
ATOM   8749  C C   . ILE I 1 191 ? -7.671  56.722  -29.996 1.00 27.30  ? 191  ILE E C   1 
ATOM   8750  O O   . ILE I 1 191 ? -7.567  55.592  -29.481 1.00 34.88  ? 191  ILE E O   1 
ATOM   8751  C CB  . ILE I 1 191 ? -6.315  58.510  -28.835 1.00 21.12  ? 191  ILE E CB  1 
ATOM   8752  C CG1 . ILE I 1 191 ? -6.480  59.881  -28.247 1.00 13.87  ? 191  ILE E CG1 1 
ATOM   8753  C CG2 . ILE I 1 191 ? -5.410  58.613  -30.037 1.00 26.89  ? 191  ILE E CG2 1 
ATOM   8754  C CD1 . ILE I 1 191 ? -5.280  60.266  -27.399 1.00 11.39  ? 191  ILE E CD1 1 
ATOM   8755  N N   . PRO I 1 192 ? -7.933  56.873  -31.221 1.00 21.14  ? 192  PRO E N   1 
ATOM   8756  C CA  . PRO I 1 192 ? -8.196  55.793  -32.122 1.00 17.83  ? 192  PRO E CA  1 
ATOM   8757  C C   . PRO I 1 192 ? -7.215  54.696  -32.154 1.00 19.97  ? 192  PRO E C   1 
ATOM   8758  O O   . PRO I 1 192 ? -7.627  53.550  -32.043 1.00 22.87  ? 192  PRO E O   1 
ATOM   8759  C CB  . PRO I 1 192 ? -8.513  56.422  -33.451 1.00 17.55  ? 192  PRO E CB  1 
ATOM   8760  C CG  . PRO I 1 192 ? -8.791  57.899  -33.180 1.00 16.14  ? 192  PRO E CG  1 
ATOM   8761  C CD  . PRO I 1 192 ? -8.264  58.201  -31.776 1.00 18.64  ? 192  PRO E CD  1 
ATOM   8762  N N   . THR I 1 193 ? -5.933  55.042  -32.251 1.00 14.39  ? 193  THR E N   1 
ATOM   8763  C CA  . THR I 1 193 ? -4.880  54.018  -32.223 1.00 9.79   ? 193  THR E CA  1 
ATOM   8764  C C   . THR I 1 193 ? -4.985  53.299  -30.915 1.00 16.14  ? 193  THR E C   1 
ATOM   8765  O O   . THR I 1 193 ? -4.925  52.071  -30.836 1.00 22.19  ? 193  THR E O   1 
ATOM   8766  C CB  . THR I 1 193 ? -3.540  54.700  -32.238 1.00 18.10  ? 193  THR E CB  1 
ATOM   8767  O OG1 . THR I 1 193 ? -3.570  55.737  -31.278 1.00 32.46  ? 193  THR E OG1 1 
ATOM   8768  C CG2 . THR I 1 193 ? -3.390  55.368  -33.572 1.00 1.00   ? 193  THR E CG2 1 
ATOM   8769  N N   . ILE I 1 194 ? -5.180  54.116  -29.886 1.00 10.60  ? 194  ILE E N   1 
ATOM   8770  C CA  . ILE I 1 194 ? -5.276  53.603  -28.533 1.00 10.39  ? 194  ILE E CA  1 
ATOM   8771  C C   . ILE I 1 194 ? -6.522  52.806  -28.353 1.00 18.17  ? 194  ILE E C   1 
ATOM   8772  O O   . ILE I 1 194 ? -6.519  51.692  -27.794 1.00 18.32  ? 194  ILE E O   1 
ATOM   8773  C CB  . ILE I 1 194 ? -5.175  54.719  -27.528 1.00 10.11  ? 194  ILE E CB  1 
ATOM   8774  C CG1 . ILE I 1 194 ? -3.791  55.320  -27.687 1.00 7.74   ? 194  ILE E CG1 1 
ATOM   8775  C CG2 . ILE I 1 194 ? -5.334  54.137  -26.154 1.00 3.49   ? 194  ILE E CG2 1 
ATOM   8776  C CD1 . ILE I 1 194 ? -3.607  56.454  -26.715 1.00 6.88   ? 194  ILE E CD1 1 
ATOM   8777  N N   . LYS I 1 195 ? -7.592  53.387  -28.870 1.00 14.50  ? 195  LYS E N   1 
ATOM   8778  C CA  . LYS I 1 195 ? -8.863  52.714  -28.791 1.00 16.16  ? 195  LYS E CA  1 
ATOM   8779  C C   . LYS I 1 195 ? -8.745  51.329  -29.389 1.00 18.60  ? 195  LYS E C   1 
ATOM   8780  O O   . LYS I 1 195 ? -9.165  50.375  -28.770 1.00 19.12  ? 195  LYS E O   1 
ATOM   8781  C CB  . LYS I 1 195 ? -9.957  53.516  -29.443 1.00 14.73  ? 195  LYS E CB  1 
ATOM   8782  C CG  . LYS I 1 195 ? -11.286 52.793  -29.371 1.00 22.53  ? 195  LYS E CG  1 
ATOM   8783  C CD  . LYS I 1 195 ? -12.498 53.557  -29.967 1.00 45.07  ? 195  LYS E CD  1 
ATOM   8784  C CE  . LYS I 1 195 ? -13.894 53.008  -29.596 1.00 63.04  ? 195  LYS E CE  1 
ATOM   8785  N NZ  . LYS I 1 195 ? -14.894 53.110  -30.682 1.00 124.12 ? 195  LYS E NZ  1 
ATOM   8786  N N   . ARG I 1 196 ? -8.044  51.222  -30.530 1.00 14.87  ? 196  ARG E N   1 
ATOM   8787  C CA  . ARG I 1 196 ? -7.846  49.927  -31.163 1.00 14.76  ? 196  ARG E CA  1 
ATOM   8788  C C   . ARG I 1 196 ? -6.992  48.996  -30.338 1.00 19.24  ? 196  ARG E C   1 
ATOM   8789  O O   . ARG I 1 196 ? -7.227  47.791  -30.284 1.00 21.84  ? 196  ARG E O   1 
ATOM   8790  C CB  . ARG I 1 196 ? -7.234  49.999  -32.565 1.00 10.93  ? 196  ARG E CB  1 
ATOM   8791  C CG  . ARG I 1 196 ? -8.085  50.634  -33.658 1.00 84.94  ? 196  ARG E CG  1 
ATOM   8792  C CD  . ARG I 1 196 ? -7.243  50.953  -34.892 1.00 131.16 ? 196  ARG E CD  1 
ATOM   8793  N NE  . ARG I 1 196 ? -7.517  52.269  -35.462 1.00 172.78 ? 196  ARG E NE  1 
ATOM   8794  C CZ  . ARG I 1 196 ? -6.546  53.075  -35.884 1.00 214.26 ? 196  ARG E CZ  1 
ATOM   8795  N NH1 . ARG I 1 196 ? -5.261  52.715  -35.776 1.00 205.59 ? 196  ARG E NH1 1 
ATOM   8796  N NH2 . ARG I 1 196 ? -6.863  54.267  -36.404 1.00 215.17 ? 196  ARG E NH2 1 
ATOM   8797  N N   . PHE I 1 197 ? -5.934  49.565  -29.786 1.00 21.18  ? 197  PHE E N   1 
ATOM   8798  C CA  . PHE I 1 197 ? -4.976  48.787  -29.014 1.00 19.20  ? 197  PHE E CA  1 
ATOM   8799  C C   . PHE I 1 197 ? -5.707  48.154  -27.873 1.00 18.79  ? 197  PHE E C   1 
ATOM   8800  O O   . PHE I 1 197 ? -5.462  47.032  -27.489 1.00 14.50  ? 197  PHE E O   1 
ATOM   8801  C CB  . PHE I 1 197 ? -3.826  49.695  -28.505 1.00 16.60  ? 197  PHE E CB  1 
ATOM   8802  C CG  . PHE I 1 197 ? -2.692  48.942  -27.840 1.00 16.51  ? 197  PHE E CG  1 
ATOM   8803  C CD1 . PHE I 1 197 ? -1.855  48.105  -28.591 1.00 17.86  ? 197  PHE E CD1 1 
ATOM   8804  C CD2 . PHE I 1 197 ? -2.413  49.106  -26.480 1.00 11.93  ? 197  PHE E CD2 1 
ATOM   8805  C CE1 . PHE I 1 197 ? -0.809  47.382  -28.014 1.00 9.94   ? 197  PHE E CE1 1 
ATOM   8806  C CE2 . PHE I 1 197 ? -1.378  48.388  -25.880 1.00 10.07  ? 197  PHE E CE2 1 
ATOM   8807  C CZ  . PHE I 1 197 ? -0.582  47.532  -26.647 1.00 6.81   ? 197  PHE E CZ  1 
ATOM   8808  N N   . LEU I 1 198 ? -6.622  48.918  -27.339 1.00 13.52  ? 198  LEU E N   1 
ATOM   8809  C CA  . LEU I 1 198 ? -7.385  48.415  -26.251 1.00 17.31  ? 198  LEU E CA  1 
ATOM   8810  C C   . LEU I 1 198 ? -8.394  47.389  -26.670 1.00 28.14  ? 198  LEU E C   1 
ATOM   8811  O O   . LEU I 1 198 ? -8.770  46.543  -25.885 1.00 31.92  ? 198  LEU E O   1 
ATOM   8812  C CB  . LEU I 1 198 ? -8.066  49.550  -25.523 1.00 17.25  ? 198  LEU E CB  1 
ATOM   8813  C CG  . LEU I 1 198 ? -7.014  50.402  -24.891 1.00 16.15  ? 198  LEU E CG  1 
ATOM   8814  C CD1 . LEU I 1 198 ? -7.631  51.673  -24.411 1.00 6.63   ? 198  LEU E CD1 1 
ATOM   8815  C CD2 . LEU I 1 198 ? -6.407  49.634  -23.740 1.00 15.83  ? 198  LEU E CD2 1 
ATOM   8816  N N   . GLU I 1 199 ? -8.802  47.456  -27.919 1.00 30.95  ? 199  GLU E N   1 
ATOM   8817  C CA  . GLU I 1 199 ? -9.735  46.482  -28.455 1.00 31.65  ? 199  GLU E CA  1 
ATOM   8818  C C   . GLU I 1 199 ? -9.055  45.172  -28.773 1.00 40.90  ? 199  GLU E C   1 
ATOM   8819  O O   . GLU I 1 199 ? -7.845  45.051  -28.855 1.00 48.36  ? 199  GLU E O   1 
ATOM   8820  C CB  . GLU I 1 199 ? -10.468 46.979  -29.713 1.00 33.09  ? 199  GLU E CB  1 
ATOM   8821  C CG  . GLU I 1 199 ? -11.622 47.948  -29.415 1.00 16.15  ? 199  GLU E CG  1 
ATOM   8822  C CD  . GLU I 1 199 ? -11.958 48.912  -30.518 1.00 54.57  ? 199  GLU E CD  1 
ATOM   8823  O OE1 . GLU I 1 199 ? -11.574 48.818  -31.700 1.00 50.51  ? 199  GLU E OE1 1 
ATOM   8824  O OE2 . GLU I 1 199 ? -12.774 49.834  -30.047 1.00 47.42  ? 199  GLU E OE2 1 
ATOM   8825  N N   . PRO I 1 200 ? -9.878  44.188  -28.989 1.00 40.19  ? 200  PRO E N   1 
ATOM   8826  C CA  . PRO I 1 200 ? -9.455  42.852  -29.293 1.00 38.67  ? 200  PRO E CA  1 
ATOM   8827  C C   . PRO I 1 200 ? -8.670  42.694  -30.561 1.00 39.52  ? 200  PRO E C   1 
ATOM   8828  O O   . PRO I 1 200 ? -8.861  43.405  -31.576 1.00 40.62  ? 200  PRO E O   1 
ATOM   8829  C CB  . PRO I 1 200 ? -10.713 42.013  -29.331 1.00 40.92  ? 200  PRO E CB  1 
ATOM   8830  C CG  . PRO I 1 200 ? -11.702 42.773  -28.483 1.00 47.45  ? 200  PRO E CG  1 
ATOM   8831  C CD  . PRO I 1 200 ? -11.197 44.200  -28.356 1.00 43.09  ? 200  PRO E CD  1 
ATOM   8832  N N   . GLY I 1 201 ? -7.754  41.737  -30.458 1.00 32.36  ? 201  GLY E N   1 
ATOM   8833  C CA  . GLY I 1 201 ? -6.890  41.449  -31.578 1.00 29.94  ? 201  GLY E CA  1 
ATOM   8834  C C   . GLY I 1 201 ? -5.688  42.383  -31.750 1.00 38.66  ? 201  GLY E C   1 
ATOM   8835  O O   . GLY I 1 201 ? -5.099  42.364  -32.831 1.00 44.65  ? 201  GLY E O   1 
ATOM   8836  N N   . SER I 1 202 ? -5.317  43.184  -30.696 1.00 26.51  ? 202  SER E N   1 
ATOM   8837  C CA  . SER I 1 202 ? -4.181  44.106  -30.727 1.00 13.49  ? 202  SER E CA  1 
ATOM   8838  C C   . SER I 1 202 ? -2.969  43.306  -30.306 1.00 20.44  ? 202  SER E C   1 
ATOM   8839  O O   . SER I 1 202 ? -3.111  42.112  -29.926 1.00 27.79  ? 202  SER E O   1 
ATOM   8840  C CB  . SER I 1 202 ? -4.396  45.278  -29.786 1.00 11.17  ? 202  SER E CB  1 
ATOM   8841  O OG  . SER I 1 202 ? -4.610  44.747  -28.485 1.00 33.64  ? 202  SER E OG  1 
ATOM   8842  N N   . LYS I 1 203 ? -1.776  43.905  -30.368 1.00 16.86  ? 203  LYS E N   1 
ATOM   8843  C CA  . LYS I 1 203 ? -0.648  43.119  -29.880 1.00 12.34  ? 203  LYS E CA  1 
ATOM   8844  C C   . LYS I 1 203 ? -0.446  43.368  -28.358 1.00 15.77  ? 203  LYS E C   1 
ATOM   8845  O O   . LYS I 1 203 ? 0.425   42.830  -27.721 1.00 15.65  ? 203  LYS E O   1 
ATOM   8846  C CB  . LYS I 1 203 ? 0.594   43.188  -30.741 1.00 12.78  ? 203  LYS E CB  1 
ATOM   8847  C CG  . LYS I 1 203 ? 0.405   42.557  -32.141 1.00 11.84  ? 203  LYS E CG  1 
ATOM   8848  C CD  . LYS I 1 203 ? 1.631   42.595  -33.077 1.00 32.90  ? 203  LYS E CD  1 
ATOM   8849  C CE  . LYS I 1 203 ? 1.385   42.342  -34.575 1.00 4.97   ? 203  LYS E CE  1 
ATOM   8850  N NZ  . LYS I 1 203 ? 0.384   43.288  -35.169 1.00 139.36 ? 203  LYS E NZ  1 
ATOM   8851  N N   . LYS I 1 204 ? -1.372  44.129  -27.785 1.00 9.39   ? 204  LYS E N   1 
ATOM   8852  C CA  . LYS I 1 204 ? -1.435  44.402  -26.396 1.00 10.47  ? 204  LYS E CA  1 
ATOM   8853  C C   . LYS I 1 204 ? -1.490  43.068  -25.707 1.00 13.83  ? 204  LYS E C   1 
ATOM   8854  O O   . LYS I 1 204 ? -2.166  42.198  -26.157 1.00 18.60  ? 204  LYS E O   1 
ATOM   8855  C CB  . LYS I 1 204 ? -2.712  45.180  -26.132 1.00 12.59  ? 204  LYS E CB  1 
ATOM   8856  C CG  . LYS I 1 204 ? -3.008  45.297  -24.659 1.00 1.00   ? 204  LYS E CG  1 
ATOM   8857  C CD  . LYS I 1 204 ? -3.973  46.428  -24.317 1.00 12.50  ? 204  LYS E CD  1 
ATOM   8858  C CE  . LYS I 1 204 ? -3.972  46.815  -22.836 1.00 1.00   ? 204  LYS E CE  1 
ATOM   8859  N NZ  . LYS I 1 204 ? -3.611  45.681  -21.968 1.00 19.12  ? 204  LYS E NZ  1 
ATOM   8860  N N   . LYS I 1 205 ? -0.710  42.888  -24.664 1.00 15.72  ? 205  LYS E N   1 
ATOM   8861  C CA  . LYS I 1 205 ? -0.645  41.628  -23.945 1.00 12.07  ? 205  LYS E CA  1 
ATOM   8862  C C   . LYS I 1 205 ? -1.395  41.670  -22.629 1.00 19.49  ? 205  LYS E C   1 
ATOM   8863  O O   . LYS I 1 205 ? -1.570  42.668  -21.943 1.00 26.86  ? 205  LYS E O   1 
ATOM   8864  C CB  . LYS I 1 205 ? 0.807   41.236  -23.668 1.00 8.61   ? 205  LYS E CB  1 
ATOM   8865  C CG  . LYS I 1 205 ? 1.646   41.236  -24.920 1.00 17.48  ? 205  LYS E CG  1 
ATOM   8866  C CD  . LYS I 1 205 ? 1.673   39.869  -25.578 1.00 9.28   ? 205  LYS E CD  1 
ATOM   8867  C CE  . LYS I 1 205 ? 2.396   39.836  -26.914 1.00 1.00   ? 205  LYS E CE  1 
ATOM   8868  N NZ  . LYS I 1 205 ? 1.635   40.524  -27.942 1.00 6.31   ? 205  LYS E NZ  1 
ATOM   8869  N N   . PRO I 1 206 ? -1.794  40.514  -22.263 1.00 14.76  ? 206  PRO E N   1 
ATOM   8870  C CA  . PRO I 1 206 ? -2.511  40.207  -21.046 1.00 11.27  ? 206  PRO E CA  1 
ATOM   8871  C C   . PRO I 1 206 ? -1.610  40.159  -19.873 1.00 15.22  ? 206  PRO E C   1 
ATOM   8872  O O   . PRO I 1 206 ? -0.397  40.047  -19.981 1.00 21.81  ? 206  PRO E O   1 
ATOM   8873  C CB  . PRO I 1 206 ? -2.978  38.799  -21.184 1.00 7.94   ? 206  PRO E CB  1 
ATOM   8874  C CG  . PRO I 1 206 ? -2.130  38.201  -22.292 1.00 14.45  ? 206  PRO E CG  1 
ATOM   8875  C CD  . PRO I 1 206 ? -1.421  39.334  -23.018 1.00 14.12  ? 206  PRO E CD  1 
ATOM   8876  N N   . PRO I 1 207 ? -2.245  40.219  -18.770 1.00 10.85  ? 207  PRO E N   1 
ATOM   8877  C CA  . PRO I 1 207 ? -1.539  40.209  -17.537 1.00 11.11  ? 207  PRO E CA  1 
ATOM   8878  C C   . PRO I 1 207 ? -1.014  38.842  -17.511 1.00 25.21  ? 207  PRO E C   1 
ATOM   8879  O O   . PRO I 1 207 ? -1.660  37.939  -17.986 1.00 31.74  ? 207  PRO E O   1 
ATOM   8880  C CB  . PRO I 1 207 ? -2.610  40.415  -16.464 1.00 7.59   ? 207  PRO E CB  1 
ATOM   8881  C CG  . PRO I 1 207 ? -3.832  40.979  -17.183 1.00 8.00   ? 207  PRO E CG  1 
ATOM   8882  C CD  . PRO I 1 207 ? -3.671  40.555  -18.626 1.00 7.14   ? 207  PRO E CD  1 
ATOM   8883  N N   . PRO I 1 208 ? 0.184   38.747  -17.068 1.00 29.08  ? 208  PRO E N   1 
ATOM   8884  C CA  . PRO I 1 208 ? 0.950   37.536  -16.935 1.00 30.67  ? 208  PRO E CA  1 
ATOM   8885  C C   . PRO I 1 208 ? 0.349   36.508  -16.019 1.00 32.66  ? 208  PRO E C   1 
ATOM   8886  O O   . PRO I 1 208 ? -0.086  36.854  -14.936 1.00 36.10  ? 208  PRO E O   1 
ATOM   8887  C CB  . PRO I 1 208 ? 2.210   37.987  -16.251 1.00 31.72  ? 208  PRO E CB  1 
ATOM   8888  C CG  . PRO I 1 208 ? 1.892   39.323  -15.619 1.00 35.02  ? 208  PRO E CG  1 
ATOM   8889  C CD  . PRO I 1 208 ? 0.662   39.862  -16.279 1.00 26.22  ? 208  PRO E CD  1 
ATOM   8890  N N   . ASP I 1 209 ? 0.437   35.261  -16.484 1.00 30.07  ? 209  ASP E N   1 
ATOM   8891  C CA  . ASP I 1 209 ? -0.027  34.027  -15.871 1.00 30.10  ? 209  ASP E CA  1 
ATOM   8892  C C   . ASP I 1 209 ? 1.123   33.163  -15.410 1.00 35.70  ? 209  ASP E C   1 
ATOM   8893  O O   . ASP I 1 209 ? 2.313   33.389  -15.703 1.00 35.20  ? 209  ASP E O   1 
ATOM   8894  C CB  . ASP I 1 209 ? -0.857  33.187  -16.883 1.00 33.91  ? 209  ASP E CB  1 
ATOM   8895  C CG  . ASP I 1 209 ? -0.232  33.169  -18.246 1.00 69.22  ? 209  ASP E CG  1 
ATOM   8896  O OD1 . ASP I 1 209 ? 0.889   32.744  -18.450 1.00 74.62  ? 209  ASP E OD1 1 
ATOM   8897  O OD2 . ASP I 1 209 ? -0.902  33.879  -19.117 1.00 99.67  ? 209  ASP E OD2 1 
ATOM   8898  N N   . GLU I 1 210 ? 0.709   32.112  -14.744 1.00 38.21  ? 210  GLU E N   1 
ATOM   8899  C CA  . GLU I 1 210 ? 1.624   31.135  -14.230 1.00 46.01  ? 210  GLU E CA  1 
ATOM   8900  C C   . GLU I 1 210 ? 2.519   30.624  -15.354 1.00 38.12  ? 210  GLU E C   1 
ATOM   8901  O O   . GLU I 1 210 ? 3.693   30.286  -15.185 1.00 37.81  ? 210  GLU E O   1 
ATOM   8902  C CB  . GLU I 1 210 ? 0.810   30.003  -13.562 1.00 55.83  ? 210  GLU E CB  1 
ATOM   8903  C CG  . GLU I 1 210 ? 1.648   28.944  -12.797 1.00 125.54 ? 210  GLU E CG  1 
ATOM   8904  C CD  . GLU I 1 210 ? 2.304   27.888  -13.673 1.00 218.62 ? 210  GLU E CD  1 
ATOM   8905  O OE1 . GLU I 1 210 ? 1.726   27.284  -14.564 1.00 242.90 ? 210  GLU E OE1 1 
ATOM   8906  O OE2 . GLU I 1 210 ? 3.553   27.650  -13.341 1.00 231.97 ? 210  GLU E OE2 1 
ATOM   8907  N N   . ILE I 1 211 ? 1.985   30.603  -16.542 1.00 27.64  ? 211  ILE E N   1 
ATOM   8908  C CA  . ILE I 1 211 ? 2.799   30.124  -17.626 1.00 30.80  ? 211  ILE E CA  1 
ATOM   8909  C C   . ILE I 1 211 ? 3.920   31.059  -17.990 1.00 31.42  ? 211  ILE E C   1 
ATOM   8910  O O   . ILE I 1 211 ? 5.064   30.624  -18.040 1.00 33.61  ? 211  ILE E O   1 
ATOM   8911  C CB  . ILE I 1 211 ? 1.966   29.913  -18.871 1.00 40.88  ? 211  ILE E CB  1 
ATOM   8912  C CG1 . ILE I 1 211 ? 1.115   28.646  -18.797 1.00 44.20  ? 211  ILE E CG1 1 
ATOM   8913  C CG2 . ILE I 1 211 ? 2.873   29.933  -20.089 1.00 43.55  ? 211  ILE E CG2 1 
ATOM   8914  C CD1 . ILE I 1 211 ? 0.068   28.726  -17.677 1.00 91.48  ? 211  ILE E CD1 1 
ATOM   8915  N N   . TYR I 1 212 ? 3.535   32.304  -18.328 1.00 20.70  ? 212  TYR E N   1 
ATOM   8916  C CA  . TYR I 1 212 ? 4.483   33.312  -18.685 1.00 19.94  ? 212  TYR E CA  1 
ATOM   8917  C C   . TYR I 1 212 ? 5.575   33.294  -17.614 1.00 24.87  ? 212  TYR E C   1 
ATOM   8918  O O   . TYR I 1 212 ? 6.804   33.216  -17.871 1.00 22.05  ? 212  TYR E O   1 
ATOM   8919  C CB  . TYR I 1 212 ? 3.806   34.687  -18.720 1.00 18.24  ? 212  TYR E CB  1 
ATOM   8920  C CG  . TYR I 1 212 ? 4.790   35.831  -18.807 1.00 23.41  ? 212  TYR E CG  1 
ATOM   8921  C CD1 . TYR I 1 212 ? 5.446   36.158  -20.005 1.00 21.68  ? 212  TYR E CD1 1 
ATOM   8922  C CD2 . TYR I 1 212 ? 5.058   36.611  -17.672 1.00 31.30  ? 212  TYR E CD2 1 
ATOM   8923  C CE1 . TYR I 1 212 ? 6.350   37.234  -20.050 1.00 20.53  ? 212  TYR E CE1 1 
ATOM   8924  C CE2 . TYR I 1 212 ? 5.957   37.690  -17.697 1.00 34.43  ? 212  TYR E CE2 1 
ATOM   8925  C CZ  . TYR I 1 212 ? 6.615   37.995  -18.895 1.00 44.89  ? 212  TYR E CZ  1 
ATOM   8926  O OH  . TYR I 1 212 ? 7.554   39.017  -18.900 1.00 44.17  ? 212  TYR E OH  1 
ATOM   8927  N N   . VAL I 1 213 ? 5.088   33.233  -16.392 1.00 8.44   ? 213  VAL E N   1 
ATOM   8928  C CA  . VAL I 1 213 ? 6.048   33.231  -15.339 1.00 8.96   ? 213  VAL E CA  1 
ATOM   8929  C C   . VAL I 1 213 ? 7.025   32.118  -15.397 1.00 19.43  ? 213  VAL E C   1 
ATOM   8930  O O   . VAL I 1 213 ? 8.223   32.326  -15.443 1.00 23.29  ? 213  VAL E O   1 
ATOM   8931  C CB  . VAL I 1 213 ? 5.398   33.320  -14.014 1.00 8.72   ? 213  VAL E CB  1 
ATOM   8932  C CG1 . VAL I 1 213 ? 6.540   33.284  -13.026 1.00 3.46   ? 213  VAL E CG1 1 
ATOM   8933  C CG2 . VAL I 1 213 ? 4.625   34.650  -13.948 1.00 5.20   ? 213  VAL E CG2 1 
ATOM   8934  N N   . ARG I 1 214 ? 6.484   30.966  -15.584 1.00 24.33  ? 214  ARG E N   1 
ATOM   8935  C CA  . ARG I 1 214 ? 7.269   29.772  -15.752 1.00 26.47  ? 214  ARG E CA  1 
ATOM   8936  C C   . ARG I 1 214 ? 8.232   29.940  -16.895 1.00 23.21  ? 214  ARG E C   1 
ATOM   8937  O O   . ARG I 1 214 ? 9.425   29.784  -16.791 1.00 23.56  ? 214  ARG E O   1 
ATOM   8938  C CB  . ARG I 1 214 ? 6.331   28.657  -16.163 1.00 47.19  ? 214  ARG E CB  1 
ATOM   8939  C CG  . ARG I 1 214 ? 6.840   27.297  -15.723 1.00 121.11 ? 214  ARG E CG  1 
ATOM   8940  C CD  . ARG I 1 214 ? 7.629   27.345  -14.410 1.00 191.70 ? 214  ARG E CD  1 
ATOM   8941  N NE  . ARG I 1 214 ? 8.389   26.122  -14.124 1.00 254.17 ? 214  ARG E NE  1 
ATOM   8942  C CZ  . ARG I 1 214 ? 8.028   24.871  -14.453 1.00 300.00 ? 214  ARG E CZ  1 
ATOM   8943  N NH1 . ARG I 1 214 ? 6.888   24.585  -15.082 1.00 300.00 ? 214  ARG E NH1 1 
ATOM   8944  N NH2 . ARG I 1 214 ? 8.834   23.864  -14.121 1.00 300.00 ? 214  ARG E NH2 1 
ATOM   8945  N N   . THR I 1 215 ? 7.697   30.304  -18.010 1.00 15.52  ? 215  THR E N   1 
ATOM   8946  C CA  . THR I 1 215 ? 8.508   30.469  -19.171 1.00 11.87  ? 215  THR E CA  1 
ATOM   8947  C C   . THR I 1 215 ? 9.637   31.437  -18.995 1.00 23.89  ? 215  THR E C   1 
ATOM   8948  O O   . THR I 1 215 ? 10.724  31.199  -19.518 1.00 25.01  ? 215  THR E O   1 
ATOM   8949  C CB  . THR I 1 215 ? 7.658   31.107  -20.253 1.00 22.07  ? 215  THR E CB  1 
ATOM   8950  O OG1 . THR I 1 215 ? 6.655   30.264  -20.742 1.00 34.28  ? 215  THR E OG1 1 
ATOM   8951  C CG2 . THR I 1 215 ? 8.614   31.477  -21.347 1.00 13.80  ? 215  THR E CG2 1 
ATOM   8952  N N   . VAL I 1 216 ? 9.348   32.577  -18.360 1.00 24.68  ? 216  VAL E N   1 
ATOM   8953  C CA  . VAL I 1 216 ? 10.407  33.535  -18.264 1.00 23.39  ? 216  VAL E CA  1 
ATOM   8954  C C   . VAL I 1 216 ? 11.506  32.963  -17.476 1.00 26.73  ? 216  VAL E C   1 
ATOM   8955  O O   . VAL I 1 216 ? 12.660  33.032  -17.877 1.00 27.42  ? 216  VAL E O   1 
ATOM   8956  C CB  . VAL I 1 216 ? 10.056  34.984  -17.999 1.00 27.02  ? 216  VAL E CB  1 
ATOM   8957  C CG1 . VAL I 1 216 ? 8.789   35.265  -18.740 1.00 24.78  ? 216  VAL E CG1 1 
ATOM   8958  C CG2 . VAL I 1 216 ? 9.848   35.246  -16.550 1.00 30.89  ? 216  VAL E CG2 1 
ATOM   8959  N N   . TYR I 1 217 ? 11.123  32.317  -16.417 1.00 26.74  ? 217  TYR E N   1 
ATOM   8960  C CA  . TYR I 1 217 ? 12.131  31.652  -15.627 1.00 31.47  ? 217  TYR E CA  1 
ATOM   8961  C C   . TYR I 1 217 ? 12.882  30.656  -16.467 1.00 36.69  ? 217  TYR E C   1 
ATOM   8962  O O   . TYR I 1 217 ? 14.071  30.487  -16.396 1.00 39.94  ? 217  TYR E O   1 
ATOM   8963  C CB  . TYR I 1 217 ? 11.526  30.853  -14.499 1.00 37.04  ? 217  TYR E CB  1 
ATOM   8964  C CG  . TYR I 1 217 ? 11.155  31.686  -13.322 1.00 57.37  ? 217  TYR E CG  1 
ATOM   8965  C CD1 . TYR I 1 217 ? 12.073  32.508  -12.664 1.00 62.60  ? 217  TYR E CD1 1 
ATOM   8966  C CD2 . TYR I 1 217 ? 9.871   31.581  -12.788 1.00 69.49  ? 217  TYR E CD2 1 
ATOM   8967  C CE1 . TYR I 1 217 ? 11.703  33.224  -11.520 1.00 73.92  ? 217  TYR E CE1 1 
ATOM   8968  C CE2 . TYR I 1 217 ? 9.490   32.276  -11.635 1.00 74.53  ? 217  TYR E CE2 1 
ATOM   8969  C CZ  . TYR I 1 217 ? 10.409  33.107  -10.989 1.00 80.38  ? 217  TYR E CZ  1 
ATOM   8970  O OH  . TYR I 1 217 ? 10.039  33.781  -9.826  1.00 63.60  ? 217  TYR E OH  1 
ATOM   8971  N N   . ASN I 1 218 ? 12.189  29.994  -17.334 1.00 38.49  ? 218  ASN E N   1 
ATOM   8972  C CA  . ASN I 1 218 ? 12.936  29.053  -18.108 1.00 38.84  ? 218  ASN E CA  1 
ATOM   8973  C C   . ASN I 1 218 ? 13.906  29.677  -19.071 1.00 42.20  ? 218  ASN E C   1 
ATOM   8974  O O   . ASN I 1 218 ? 14.902  29.071  -19.388 1.00 53.50  ? 218  ASN E O   1 
ATOM   8975  C CB  . ASN I 1 218 ? 12.098  27.900  -18.696 1.00 38.59  ? 218  ASN E CB  1 
ATOM   8976  C CG  . ASN I 1 218 ? 11.408  27.135  -17.581 1.00 97.21  ? 218  ASN E CG  1 
ATOM   8977  O OD1 . ASN I 1 218 ? 10.383  26.473  -17.817 1.00 142.34 ? 218  ASN E OD1 1 
ATOM   8978  N ND2 . ASN I 1 218 ? 11.940  27.263  -16.354 1.00 74.68  ? 218  ASN E ND2 1 
ATOM   8979  N N   . ILE I 1 219 ? 13.643  30.866  -19.547 1.00 26.47  ? 219  ILE E N   1 
ATOM   8980  C CA  . ILE I 1 219 ? 14.554  31.421  -20.494 1.00 21.54  ? 219  ILE E CA  1 
ATOM   8981  C C   . ILE I 1 219 ? 15.679  32.174  -19.860 1.00 32.02  ? 219  ILE E C   1 
ATOM   8982  O O   . ILE I 1 219 ? 16.690  32.386  -20.496 1.00 34.29  ? 219  ILE E O   1 
ATOM   8983  C CB  . ILE I 1 219 ? 13.739  32.366  -21.293 1.00 23.46  ? 219  ILE E CB  1 
ATOM   8984  C CG1 . ILE I 1 219 ? 12.518  31.605  -21.761 1.00 21.97  ? 219  ILE E CG1 1 
ATOM   8985  C CG2 . ILE I 1 219 ? 14.511  32.923  -22.456 1.00 22.56  ? 219  ILE E CG2 1 
ATOM   8986  C CD1 . ILE I 1 219 ? 11.580  32.561  -22.492 1.00 18.18  ? 219  ILE E CD1 1 
ATOM   8987  N N   . PHE I 1 220 ? 15.533  32.579  -18.597 1.00 31.03  ? 220  PHE E N   1 
ATOM   8988  C CA  . PHE I 1 220 ? 16.565  33.405  -17.943 1.00 29.59  ? 220  PHE E CA  1 
ATOM   8989  C C   . PHE I 1 220 ? 17.056  33.006  -16.507 1.00 44.12  ? 220  PHE E C   1 
ATOM   8990  O O   . PHE I 1 220 ? 17.029  31.868  -15.963 1.00 60.72  ? 220  PHE E O   1 
ATOM   8991  C CB  . PHE I 1 220 ? 15.980  34.829  -17.834 1.00 33.70  ? 220  PHE E CB  1 
ATOM   8992  C CG  . PHE I 1 220 ? 15.371  35.554  -19.036 1.00 34.38  ? 220  PHE E CG  1 
ATOM   8993  C CD1 . PHE I 1 220 ? 16.174  36.010  -20.079 1.00 36.48  ? 220  PHE E CD1 1 
ATOM   8994  C CD2 . PHE I 1 220 ? 14.040  35.964  -19.051 1.00 38.85  ? 220  PHE E CD2 1 
ATOM   8995  C CE1 . PHE I 1 220 ? 15.664  36.746  -21.145 1.00 36.82  ? 220  PHE E CE1 1 
ATOM   8996  C CE2 . PHE I 1 220 ? 13.503  36.706  -20.106 1.00 41.89  ? 220  PHE E CE2 1 
ATOM   8997  C CZ  . PHE I 1 220 ? 14.313  37.081  -21.171 1.00 38.16  ? 220  PHE E CZ  1 
HETATM 8998  N N   . GGL J 2 1   ? 17.466  47.925  -18.216 1.00 37.15  ? 231  GGL M N   1 
HETATM 8999  C CA  . GGL J 2 1   ? 17.187  46.988  -19.299 1.00 7.63   ? 231  GGL M CA  1 
HETATM 9000  C C   . GGL J 2 1   ? 15.892  47.295  -20.047 1.00 7.03   ? 231  GGL M C   1 
HETATM 9001  O O   . GGL J 2 1   ? 15.911  47.060  -21.293 1.00 19.40  ? 231  GGL M O   1 
HETATM 9002  C CB  . GGL J 2 1   ? 17.263  45.565  -18.790 1.00 6.19   ? 231  GGL M CB  1 
HETATM 9003  C CG  . GGL J 2 1   ? 16.642  44.513  -19.696 1.00 24.61  ? 231  GGL M CG  1 
HETATM 9004  C CD  . GGL J 2 1   ? 16.742  43.176  -18.990 1.00 18.75  ? 231  GGL M CD  1 
HETATM 9005  O OE1 . GGL J 2 1   ? 16.914  43.086  -17.777 1.00 36.14  ? 231  GGL M OE1 1 
HETATM 9006  O OXT . GGL J 2 1   ? 15.014  47.951  -19.409 1.00 43.52  ? 231  GGL M OXT 1 
HETATM 9007  C C   . ICY J 2 2   ? 17.411  39.895  -20.271 1.00 29.74  ? 232  ICY M C   1 
HETATM 9008  N N   . ICY J 2 2   ? 16.604  42.120  -19.768 1.00 39.29  ? 232  ICY M N   1 
HETATM 9009  O O   . ICY J 2 2   ? 17.340  40.066  -21.516 1.00 26.16  ? 232  ICY M O   1 
HETATM 9010  C CA  . ICY J 2 2   ? 16.698  40.767  -19.253 1.00 38.11  ? 232  ICY M CA  1 
HETATM 9011  C CB  . ICY J 2 2   ? 15.336  40.194  -18.771 1.00 43.28  ? 232  ICY M CB  1 
HETATM 9012  S SG  . ICY J 2 2   ? 14.628  41.036  -17.312 1.00 46.76  ? 232  ICY M SG  1 
HETATM 9013  I I   . ICY J 2 2   ? 10.575  40.529  -17.152 1.00 90.26  ? 232  ICY M I   1 
HETATM 9014  C C0  . ICY J 2 2   ? 13.625  39.747  -16.546 1.00 300.00 ? 232  ICY M C0  1 
HETATM 9015  C C1  . ICY J 2 2   ? 13.000  40.388  -15.346 1.00 300.00 ? 232  ICY M C1  1 
HETATM 9016  C C2  . ICY J 2 2   ? 11.714  40.936  -15.434 1.00 5.69   ? 232  ICY M C2  1 
HETATM 9017  C C3  . ICY J 2 2   ? 11.220  41.557  -14.286 1.00 31.59  ? 232  ICY M C3  1 
HETATM 9018  C C4  . ICY J 2 2   ? 12.008  41.691  -13.134 1.00 15.35  ? 232  ICY M C4  1 
HETATM 9019  C C5  . ICY J 2 2   ? 13.327  41.241  -13.109 1.00 300.00 ? 232  ICY M C5  1 
HETATM 9020  C C6  . ICY J 2 2   ? 13.823  40.593  -14.237 1.00 300.00 ? 232  ICY M C6  1 
ATOM   9021  N N   . GLY J 2 3   ? 18.215  39.004  -19.741 1.00 27.44  ? 233  GLY M N   1 
ATOM   9022  C CA  . GLY J 2 3   ? 18.993  38.142  -20.626 1.00 23.21  ? 233  GLY M CA  1 
ATOM   9023  C C   . GLY J 2 3   ? 20.241  37.645  -19.948 1.00 26.89  ? 233  GLY M C   1 
ATOM   9024  O O   . GLY J 2 3   ? 20.718  36.576  -20.418 1.00 47.64  ? 233  GLY M O   1 
ATOM   9025  O OXT . GLY J 2 3   ? 20.598  38.333  -18.937 1.00 83.82  ? 233  GLY M OXT 1 
ATOM   9026  N N   . ARG K 1 4   ? 24.416  78.881  -10.967 1.00 32.33  ? 4    ARG F N   1 
ATOM   9027  C CA  . ARG K 1 4   ? 25.264  77.752  -10.520 1.00 27.54  ? 4    ARG F CA  1 
ATOM   9028  C C   . ARG K 1 4   ? 24.400  76.619  -9.917  1.00 35.94  ? 4    ARG F C   1 
ATOM   9029  O O   . ARG K 1 4   ? 23.707  76.812  -8.911  1.00 45.21  ? 4    ARG F O   1 
ATOM   9030  C CB  . ARG K 1 4   ? 26.290  78.352  -9.558  1.00 27.89  ? 4    ARG F CB  1 
ATOM   9031  C CG  . ARG K 1 4   ? 27.356  77.531  -8.836  1.00 16.86  ? 4    ARG F CG  1 
ATOM   9032  C CD  . ARG K 1 4   ? 28.504  78.438  -8.257  1.00 21.30  ? 4    ARG F CD  1 
ATOM   9033  N NE  . ARG K 1 4   ? 29.589  77.649  -7.646  1.00 55.57  ? 4    ARG F NE  1 
ATOM   9034  C CZ  . ARG K 1 4   ? 30.870  77.976  -7.420  1.00 124.64 ? 4    ARG F CZ  1 
ATOM   9035  N NH1 . ARG K 1 4   ? 31.376  79.175  -7.725  1.00 187.32 ? 4    ARG F NH1 1 
ATOM   9036  N NH2 . ARG K 1 4   ? 31.656  77.041  -6.851  1.00 64.09  ? 4    ARG F NH2 1 
ATOM   9037  N N   . PRO K 1 5   ? 24.426  75.418  -10.535 1.00 19.55  ? 5    PRO F N   1 
ATOM   9038  C CA  . PRO K 1 5   ? 23.593  74.334  -10.079 1.00 10.62  ? 5    PRO F CA  1 
ATOM   9039  C C   . PRO K 1 5   ? 23.801  73.951  -8.685  1.00 13.02  ? 5    PRO F C   1 
ATOM   9040  O O   . PRO K 1 5   ? 24.921  74.001  -8.149  1.00 17.31  ? 5    PRO F O   1 
ATOM   9041  C CB  . PRO K 1 5   ? 23.889  73.169  -10.973 1.00 13.08  ? 5    PRO F CB  1 
ATOM   9042  C CG  . PRO K 1 5   ? 24.418  73.785  -12.249 1.00 14.67  ? 5    PRO F CG  1 
ATOM   9043  C CD  . PRO K 1 5   ? 25.134  75.015  -11.779 1.00 15.20  ? 5    PRO F CD  1 
ATOM   9044  N N   . LYS K 1 6   ? 22.679  73.538  -8.137  1.00 10.63  ? 6    LYS F N   1 
ATOM   9045  C CA  . LYS K 1 6   ? 22.660  73.121  -6.773  1.00 12.09  ? 6    LYS F CA  1 
ATOM   9046  C C   . LYS K 1 6   ? 22.121  71.717  -6.679  1.00 19.24  ? 6    LYS F C   1 
ATOM   9047  O O   . LYS K 1 6   ? 21.034  71.376  -7.148  1.00 23.36  ? 6    LYS F O   1 
ATOM   9048  C CB  . LYS K 1 6   ? 21.911  74.103  -5.919  1.00 12.50  ? 6    LYS F CB  1 
ATOM   9049  C CG  . LYS K 1 6   ? 22.056  73.851  -4.431  1.00 5.59   ? 6    LYS F CG  1 
ATOM   9050  C CD  . LYS K 1 6   ? 21.467  74.955  -3.581  1.00 22.77  ? 6    LYS F CD  1 
ATOM   9051  C CE  . LYS K 1 6   ? 22.495  75.915  -2.974  1.00 101.78 ? 6    LYS F CE  1 
ATOM   9052  N NZ  . LYS K 1 6   ? 22.297  76.178  -1.530  1.00 121.13 ? 6    LYS F NZ  1 
ATOM   9053  N N   . LEU K 1 7   ? 22.958  70.923  -6.071  1.00 10.70  ? 7    LEU F N   1 
ATOM   9054  C CA  . LEU K 1 7   ? 22.736  69.534  -5.890  1.00 7.75   ? 7    LEU F CA  1 
ATOM   9055  C C   . LEU K 1 7   ? 22.255  69.158  -4.532  1.00 15.45  ? 7    LEU F C   1 
ATOM   9056  O O   . LEU K 1 7   ? 22.978  69.308  -3.539  1.00 17.71  ? 7    LEU F O   1 
ATOM   9057  C CB  . LEU K 1 7   ? 24.044  68.755  -6.155  1.00 7.11   ? 7    LEU F CB  1 
ATOM   9058  C CG  . LEU K 1 7   ? 24.227  68.508  -7.649  1.00 7.44   ? 7    LEU F CG  1 
ATOM   9059  C CD1 . LEU K 1 7   ? 24.298  69.814  -8.419  1.00 1.06   ? 7    LEU F CD1 1 
ATOM   9060  C CD2 . LEU K 1 7   ? 25.440  67.693  -7.893  1.00 1.92   ? 7    LEU F CD2 1 
ATOM   9061  N N   . HIS K 1 8   ? 21.089  68.512  -4.523  1.00 10.78  ? 8    HIS F N   1 
ATOM   9062  C CA  . HIS K 1 8   ? 20.542  68.032  -3.271  1.00 10.93  ? 8    HIS F CA  1 
ATOM   9063  C C   . HIS K 1 8   ? 20.757  66.584  -3.097  1.00 15.06  ? 8    HIS F C   1 
ATOM   9064  O O   . HIS K 1 8   ? 20.232  65.811  -3.849  1.00 21.54  ? 8    HIS F O   1 
ATOM   9065  C CB  . HIS K 1 8   ? 19.052  68.312  -3.176  1.00 12.77  ? 8    HIS F CB  1 
ATOM   9066  C CG  . HIS K 1 8   ? 18.844  69.792  -3.210  1.00 12.97  ? 8    HIS F CG  1 
ATOM   9067  N ND1 . HIS K 1 8   ? 18.783  70.531  -2.026  1.00 9.21   ? 8    HIS F ND1 1 
ATOM   9068  C CD2 . HIS K 1 8   ? 18.764  70.646  -4.280  1.00 10.18  ? 8    HIS F CD2 1 
ATOM   9069  C CE1 . HIS K 1 8   ? 18.669  71.796  -2.410  1.00 4.88   ? 8    HIS F CE1 1 
ATOM   9070  N NE2 . HIS K 1 8   ? 18.653  71.919  -3.746  1.00 6.80   ? 8    HIS F NE2 1 
ATOM   9071  N N   . TYR K 1 9   ? 21.451  66.221  -2.063  1.00 14.76  ? 9    TYR F N   1 
ATOM   9072  C CA  . TYR K 1 9   ? 21.695  64.838  -1.845  1.00 9.55   ? 9    TYR F CA  1 
ATOM   9073  C C   . TYR K 1 9   ? 22.499  64.761  -0.606  1.00 13.90  ? 9    TYR F C   1 
ATOM   9074  O O   . TYR K 1 9   ? 23.115  65.712  -0.164  1.00 13.27  ? 9    TYR F O   1 
ATOM   9075  C CB  . TYR K 1 9   ? 22.609  64.355  -2.992  1.00 11.18  ? 9    TYR F CB  1 
ATOM   9076  C CG  . TYR K 1 9   ? 22.474  62.879  -3.304  1.00 11.92  ? 9    TYR F CG  1 
ATOM   9077  C CD1 . TYR K 1 9   ? 21.251  62.445  -3.792  1.00 17.29  ? 9    TYR F CD1 1 
ATOM   9078  C CD2 . TYR K 1 9   ? 23.461  61.911  -3.097  1.00 10.61  ? 9    TYR F CD2 1 
ATOM   9079  C CE1 . TYR K 1 9   ? 21.017  61.114  -4.111  1.00 8.41   ? 9    TYR F CE1 1 
ATOM   9080  C CE2 . TYR K 1 9   ? 23.243  60.552  -3.371  1.00 10.47  ? 9    TYR F CE2 1 
ATOM   9081  C CZ  . TYR K 1 9   ? 22.000  60.168  -3.881  1.00 8.46   ? 9    TYR F CZ  1 
ATOM   9082  O OH  . TYR K 1 9   ? 21.651  58.897  -4.216  1.00 9.58   ? 9    TYR F OH  1 
ATOM   9083  N N   . PRO K 1 10  ? 22.535  63.582  -0.093  1.00 12.04  ? 10   PRO F N   1 
ATOM   9084  C CA  . PRO K 1 10  ? 23.366  63.268  1.015   1.00 6.12   ? 10   PRO F CA  1 
ATOM   9085  C C   . PRO K 1 10  ? 24.776  63.495  0.564   1.00 17.79  ? 10   PRO F C   1 
ATOM   9086  O O   . PRO K 1 10  ? 25.062  63.614  -0.621  1.00 18.65  ? 10   PRO F O   1 
ATOM   9087  C CB  . PRO K 1 10  ? 23.222  61.757  1.224   1.00 1.52   ? 10   PRO F CB  1 
ATOM   9088  C CG  . PRO K 1 10  ? 21.907  61.356  0.595   1.00 1.37   ? 10   PRO F CG  1 
ATOM   9089  C CD  . PRO K 1 10  ? 21.546  62.512  -0.357  1.00 9.85   ? 10   PRO F CD  1 
ATOM   9090  N N   . ASN K 1 11  ? 25.676  63.582  1.523   1.00 22.88  ? 11   ASN F N   1 
ATOM   9091  C CA  . ASN K 1 11  ? 27.048  63.804  1.126   1.00 21.68  ? 11   ASN F CA  1 
ATOM   9092  C C   . ASN K 1 11  ? 27.760  62.510  0.851   1.00 28.06  ? 11   ASN F C   1 
ATOM   9093  O O   . ASN K 1 11  ? 28.442  61.985  1.742   1.00 29.83  ? 11   ASN F O   1 
ATOM   9094  C CB  . ASN K 1 11  ? 27.834  64.570  2.179   1.00 27.41  ? 11   ASN F CB  1 
ATOM   9095  C CG  . ASN K 1 11  ? 29.284  64.789  1.808   1.00 30.38  ? 11   ASN F CG  1 
ATOM   9096  O OD1 . ASN K 1 11  ? 29.816  64.396  0.755   1.00 49.73  ? 11   ASN F OD1 1 
ATOM   9097  N ND2 . ASN K 1 11  ? 29.921  65.506  2.667   1.00 31.51  ? 11   ASN F ND2 1 
ATOM   9098  N N   . GLY K 1 12  ? 27.610  62.008  -0.384  1.00 23.11  ? 12   GLY F N   1 
ATOM   9099  C CA  . GLY K 1 12  ? 28.198  60.743  -0.786  1.00 15.19  ? 12   GLY F CA  1 
ATOM   9100  C C   . GLY K 1 12  ? 27.845  60.543  -2.210  1.00 17.86  ? 12   GLY F C   1 
ATOM   9101  O O   . GLY K 1 12  ? 27.129  61.357  -2.792  1.00 19.68  ? 12   GLY F O   1 
ATOM   9102  N N   . ARG K 1 13  ? 28.321  59.446  -2.747  1.00 14.04  ? 13   ARG F N   1 
ATOM   9103  C CA  . ARG K 1 13  ? 28.137  59.161  -4.148  1.00 12.54  ? 13   ARG F CA  1 
ATOM   9104  C C   . ARG K 1 13  ? 26.706  58.920  -4.588  1.00 9.16   ? 13   ARG F C   1 
ATOM   9105  O O   . ARG K 1 13  ? 26.135  59.665  -5.412  1.00 15.29  ? 13   ARG F O   1 
ATOM   9106  C CB  . ARG K 1 13  ? 29.045  57.986  -4.565  1.00 7.69   ? 13   ARG F CB  1 
ATOM   9107  C CG  . ARG K 1 13  ? 30.513  58.287  -4.730  1.00 1.00   ? 13   ARG F CG  1 
ATOM   9108  C CD  . ARG K 1 13  ? 31.426  57.085  -4.966  1.00 1.00   ? 13   ARG F CD  1 
ATOM   9109  N NE  . ARG K 1 13  ? 32.841  57.435  -5.114  1.00 19.00  ? 13   ARG F NE  1 
ATOM   9110  C CZ  . ARG K 1 13  ? 33.838  56.605  -5.398  1.00 12.92  ? 13   ARG F CZ  1 
ATOM   9111  N NH1 . ARG K 1 13  ? 33.644  55.334  -5.641  1.00 18.59  ? 13   ARG F NH1 1 
ATOM   9112  N NH2 . ARG K 1 13  ? 35.071  57.070  -5.442  1.00 20.60  ? 13   ARG F NH2 1 
ATOM   9113  N N   . GLY K 1 14  ? 26.229  57.767  -4.134  1.00 1.00   ? 14   GLY F N   1 
ATOM   9114  C CA  . GLY K 1 14  ? 24.922  57.243  -4.445  1.00 1.00   ? 14   GLY F CA  1 
ATOM   9115  C C   . GLY K 1 14  ? 24.671  57.375  -5.901  1.00 9.54   ? 14   GLY F C   1 
ATOM   9116  O O   . GLY K 1 14  ? 25.582  57.128  -6.731  1.00 9.47   ? 14   GLY F O   1 
ATOM   9117  N N   . ARG K 1 15  ? 23.466  57.856  -6.199  1.00 9.02   ? 15   ARG F N   1 
ATOM   9118  C CA  . ARG K 1 15  ? 23.094  58.078  -7.571  1.00 5.35   ? 15   ARG F CA  1 
ATOM   9119  C C   . ARG K 1 15  ? 23.525  59.412  -8.139  1.00 14.90  ? 15   ARG F C   1 
ATOM   9120  O O   . ARG K 1 15  ? 23.552  59.544  -9.371  1.00 20.18  ? 15   ARG F O   1 
ATOM   9121  C CB  . ARG K 1 15  ? 21.626  57.975  -7.694  1.00 3.97   ? 15   ARG F CB  1 
ATOM   9122  C CG  . ARG K 1 15  ? 21.115  56.666  -7.195  1.00 5.24   ? 15   ARG F CG  1 
ATOM   9123  C CD  . ARG K 1 15  ? 19.638  56.513  -7.475  1.00 3.67   ? 15   ARG F CD  1 
ATOM   9124  N NE  . ARG K 1 15  ? 19.208  55.246  -6.914  1.00 14.51  ? 15   ARG F NE  1 
ATOM   9125  C CZ  . ARG K 1 15  ? 19.525  54.180  -7.622  1.00 9.50   ? 15   ARG F CZ  1 
ATOM   9126  N NH1 . ARG K 1 15  ? 20.158  54.328  -8.760  1.00 22.97  ? 15   ARG F NH1 1 
ATOM   9127  N NH2 . ARG K 1 15  ? 19.241  52.979  -7.201  1.00 12.46  ? 15   ARG F NH2 1 
ATOM   9128  N N   . MET K 1 16  ? 23.875  60.351  -7.259  1.00 6.25   ? 16   MET F N   1 
ATOM   9129  C CA  . MET K 1 16  ? 24.251  61.707  -7.677  1.00 7.96   ? 16   MET F CA  1 
ATOM   9130  C C   . MET K 1 16  ? 25.605  61.856  -8.365  1.00 16.37  ? 16   MET F C   1 
ATOM   9131  O O   . MET K 1 16  ? 25.885  62.794  -9.164  1.00 16.90  ? 16   MET F O   1 
ATOM   9132  C CB  . MET K 1 16  ? 24.049  62.646  -6.466  1.00 7.02   ? 16   MET F CB  1 
ATOM   9133  C CG  . MET K 1 16  ? 24.298  64.066  -6.771  1.00 7.94   ? 16   MET F CG  1 
ATOM   9134  S SD  . MET K 1 16  ? 23.082  64.871  -7.821  1.00 11.15  ? 16   MET F SD  1 
ATOM   9135  C CE  . MET K 1 16  ? 21.884  65.275  -6.597  1.00 5.61   ? 16   MET F CE  1 
ATOM   9136  N N   . GLU K 1 17  ? 26.449  60.885  -8.067  1.00 4.20   ? 17   GLU F N   1 
ATOM   9137  C CA  . GLU K 1 17  ? 27.774  60.953  -8.592  1.00 1.00   ? 17   GLU F CA  1 
ATOM   9138  C C   . GLU K 1 17  ? 27.896  61.108  -10.076 1.00 5.23   ? 17   GLU F C   1 
ATOM   9139  O O   . GLU K 1 17  ? 28.766  61.798  -10.583 1.00 11.87  ? 17   GLU F O   1 
ATOM   9140  C CB  . GLU K 1 17  ? 28.612  59.852  -8.014  1.00 1.00   ? 17   GLU F CB  1 
ATOM   9141  C CG  . GLU K 1 17  ? 30.122  60.163  -8.027  1.00 19.56  ? 17   GLU F CG  1 
ATOM   9142  C CD  . GLU K 1 17  ? 30.640  61.104  -6.980  1.00 7.78   ? 17   GLU F CD  1 
ATOM   9143  O OE1 . GLU K 1 17  ? 29.960  61.660  -6.153  1.00 31.51  ? 17   GLU F OE1 1 
ATOM   9144  O OE2 . GLU K 1 17  ? 31.916  61.343  -7.126  1.00 9.61   ? 17   GLU F OE2 1 
ATOM   9145  N N   . SER K 1 18  ? 27.009  60.483  -10.785 1.00 1.00   ? 18   SER F N   1 
ATOM   9146  C CA  . SER K 1 18  ? 27.051  60.585  -12.220 1.00 1.00   ? 18   SER F CA  1 
ATOM   9147  C C   . SER K 1 18  ? 26.866  61.999  -12.644 1.00 6.76   ? 18   SER F C   1 
ATOM   9148  O O   . SER K 1 18  ? 27.555  62.549  -13.514 1.00 9.68   ? 18   SER F O   1 
ATOM   9149  C CB  . SER K 1 18  ? 26.124  59.625  -12.923 1.00 1.00   ? 18   SER F CB  1 
ATOM   9150  O OG  . SER K 1 18  ? 26.143  58.406  -12.224 1.00 13.54  ? 18   SER F OG  1 
ATOM   9151  N N   . VAL K 1 19  ? 25.985  62.634  -11.936 1.00 7.37   ? 19   VAL F N   1 
ATOM   9152  C CA  . VAL K 1 19  ? 25.721  64.039  -12.182 1.00 8.08   ? 19   VAL F CA  1 
ATOM   9153  C C   . VAL K 1 19  ? 26.933  64.883  -11.875 1.00 9.25   ? 19   VAL F C   1 
ATOM   9154  O O   . VAL K 1 19  ? 27.256  65.790  -12.619 1.00 6.66   ? 19   VAL F O   1 
ATOM   9155  C CB  . VAL K 1 19  ? 24.610  64.509  -11.290 1.00 8.51   ? 19   VAL F CB  1 
ATOM   9156  C CG1 . VAL K 1 19  ? 24.324  65.926  -11.715 1.00 10.56  ? 19   VAL F CG1 1 
ATOM   9157  C CG2 . VAL K 1 19  ? 23.382  63.648  -11.526 1.00 1.00   ? 19   VAL F CG2 1 
ATOM   9158  N N   . ARG K 1 20  ? 27.603  64.573  -10.765 1.00 5.49   ? 20   ARG F N   1 
ATOM   9159  C CA  . ARG K 1 20  ? 28.827  65.316  -10.523 1.00 3.46   ? 20   ARG F CA  1 
ATOM   9160  C C   . ARG K 1 20  ? 29.779  65.079  -11.665 1.00 10.61  ? 20   ARG F C   1 
ATOM   9161  O O   . ARG K 1 20  ? 30.276  66.027  -12.238 1.00 13.96  ? 20   ARG F O   1 
ATOM   9162  C CB  . ARG K 1 20  ? 29.510  64.984  -9.229  1.00 1.00   ? 20   ARG F CB  1 
ATOM   9163  C CG  . ARG K 1 20  ? 28.510  65.191  -8.072  1.00 3.22   ? 20   ARG F CG  1 
ATOM   9164  C CD  . ARG K 1 20  ? 29.029  64.641  -6.729  1.00 7.99   ? 20   ARG F CD  1 
ATOM   9165  N NE  . ARG K 1 20  ? 28.083  64.756  -5.597  1.00 7.20   ? 20   ARG F NE  1 
ATOM   9166  C CZ  . ARG K 1 20  ? 27.513  63.754  -4.935  1.00 10.41  ? 20   ARG F CZ  1 
ATOM   9167  N NH1 . ARG K 1 20  ? 27.749  62.508  -5.281  1.00 15.20  ? 20   ARG F NH1 1 
ATOM   9168  N NH2 . ARG K 1 20  ? 26.656  63.999  -3.928  1.00 6.11   ? 20   ARG F NH2 1 
ATOM   9169  N N   . TRP K 1 21  ? 29.988  63.834  -12.039 1.00 7.37   ? 21   TRP F N   1 
ATOM   9170  C CA  . TRP K 1 21  ? 30.897  63.583  -13.134 1.00 7.08   ? 21   TRP F CA  1 
ATOM   9171  C C   . TRP K 1 21  ? 30.613  64.380  -14.359 1.00 15.16  ? 21   TRP F C   1 
ATOM   9172  O O   . TRP K 1 21  ? 31.492  64.982  -14.897 1.00 17.62  ? 21   TRP F O   1 
ATOM   9173  C CB  . TRP K 1 21  ? 30.828  62.141  -13.574 1.00 6.41   ? 21   TRP F CB  1 
ATOM   9174  C CG  . TRP K 1 21  ? 31.782  61.330  -12.826 1.00 10.05  ? 21   TRP F CG  1 
ATOM   9175  C CD1 . TRP K 1 21  ? 31.548  60.675  -11.672 1.00 13.65  ? 21   TRP F CD1 1 
ATOM   9176  C CD2 . TRP K 1 21  ? 33.143  61.081  -13.173 1.00 9.28   ? 21   TRP F CD2 1 
ATOM   9177  N NE1 . TRP K 1 21  ? 32.687  60.001  -11.274 1.00 8.11   ? 21   TRP F NE1 1 
ATOM   9178  C CE2 . TRP K 1 21  ? 33.688  60.269  -12.159 1.00 7.93   ? 21   TRP F CE2 1 
ATOM   9179  C CE3 . TRP K 1 21  ? 33.936  61.449  -14.261 1.00 8.18   ? 21   TRP F CE3 1 
ATOM   9180  C CZ2 . TRP K 1 21  ? 35.002  59.820  -12.217 1.00 5.43   ? 21   TRP F CZ2 1 
ATOM   9181  C CZ3 . TRP K 1 21  ? 35.213  60.994  -14.324 1.00 8.67   ? 21   TRP F CZ3 1 
ATOM   9182  C CH2 . TRP K 1 21  ? 35.745  60.203  -13.291 1.00 9.78   ? 21   TRP F CH2 1 
ATOM   9183  N N   . VAL K 1 22  ? 29.359  64.427  -14.744 1.00 13.45  ? 22   VAL F N   1 
ATOM   9184  C CA  . VAL K 1 22  ? 29.027  65.098  -15.954 1.00 9.94   ? 22   VAL F CA  1 
ATOM   9185  C C   . VAL K 1 22  ? 29.232  66.556  -15.879 1.00 12.54  ? 22   VAL F C   1 
ATOM   9186  O O   . VAL K 1 22  ? 29.770  67.155  -16.783 1.00 13.70  ? 22   VAL F O   1 
ATOM   9187  C CB  . VAL K 1 22  ? 27.599  64.830  -16.364 1.00 15.10  ? 22   VAL F CB  1 
ATOM   9188  C CG1 . VAL K 1 22  ? 27.361  65.511  -17.683 1.00 9.55   ? 22   VAL F CG1 1 
ATOM   9189  C CG2 . VAL K 1 22  ? 27.453  63.346  -16.648 1.00 16.50  ? 22   VAL F CG2 1 
ATOM   9190  N N   . LEU K 1 23  ? 28.725  67.133  -14.816 1.00 5.24   ? 23   LEU F N   1 
ATOM   9191  C CA  . LEU K 1 23  ? 28.891  68.551  -14.616 1.00 3.88   ? 23   LEU F CA  1 
ATOM   9192  C C   . LEU K 1 23  ? 30.353  68.904  -14.694 1.00 12.19  ? 23   LEU F C   1 
ATOM   9193  O O   . LEU K 1 23  ? 30.731  69.731  -15.498 1.00 12.38  ? 23   LEU F O   1 
ATOM   9194  C CB  . LEU K 1 23  ? 28.306  68.960  -13.262 1.00 3.09   ? 23   LEU F CB  1 
ATOM   9195  C CG  . LEU K 1 23  ? 26.788  69.091  -13.374 1.00 4.80   ? 23   LEU F CG  1 
ATOM   9196  C CD1 . LEU K 1 23  ? 26.211  69.361  -12.035 1.00 3.57   ? 23   LEU F CD1 1 
ATOM   9197  C CD2 . LEU K 1 23  ? 26.451  70.306  -14.204 1.00 2.17   ? 23   LEU F CD2 1 
ATOM   9198  N N   . ALA K 1 24  ? 31.166  68.204  -13.882 1.00 8.67   ? 24   ALA F N   1 
ATOM   9199  C CA  . ALA K 1 24  ? 32.621  68.412  -13.841 1.00 3.94   ? 24   ALA F CA  1 
ATOM   9200  C C   . ALA K 1 24  ? 33.235  68.295  -15.191 1.00 13.81  ? 24   ALA F C   1 
ATOM   9201  O O   . ALA K 1 24  ? 34.008  69.123  -15.578 1.00 20.36  ? 24   ALA F O   1 
ATOM   9202  C CB  . ALA K 1 24  ? 33.350  67.514  -12.888 1.00 1.00   ? 24   ALA F CB  1 
ATOM   9203  N N   . ALA K 1 25  ? 32.903  67.244  -15.879 1.00 13.24  ? 25   ALA F N   1 
ATOM   9204  C CA  . ALA K 1 25  ? 33.465  67.051  -17.178 1.00 9.76   ? 25   ALA F CA  1 
ATOM   9205  C C   . ALA K 1 25  ? 33.148  68.168  -18.110 1.00 16.53  ? 25   ALA F C   1 
ATOM   9206  O O   . ALA K 1 25  ? 33.960  68.560  -18.906 1.00 21.49  ? 25   ALA F O   1 
ATOM   9207  C CB  . ALA K 1 25  ? 33.034  65.747  -17.800 1.00 5.49   ? 25   ALA F CB  1 
ATOM   9208  N N   . ALA K 1 26  ? 31.926  68.645  -18.032 1.00 22.51  ? 26   ALA F N   1 
ATOM   9209  C CA  . ALA K 1 26  ? 31.438  69.717  -18.898 1.00 14.60  ? 26   ALA F CA  1 
ATOM   9210  C C   . ALA K 1 26  ? 32.036  71.042  -18.480 1.00 22.33  ? 26   ALA F C   1 
ATOM   9211  O O   . ALA K 1 26  ? 31.791  72.077  -19.043 1.00 28.32  ? 26   ALA F O   1 
ATOM   9212  C CB  . ALA K 1 26  ? 29.922  69.760  -18.854 1.00 8.69   ? 26   ALA F CB  1 
ATOM   9213  N N   . GLY K 1 27  ? 32.832  70.989  -17.457 1.00 20.41  ? 27   GLY F N   1 
ATOM   9214  C CA  . GLY K 1 27  ? 33.467  72.155  -16.937 1.00 17.35  ? 27   GLY F CA  1 
ATOM   9215  C C   . GLY K 1 27  ? 32.572  73.063  -16.114 1.00 24.13  ? 27   GLY F C   1 
ATOM   9216  O O   . GLY K 1 27  ? 32.939  74.211  -15.848 1.00 32.49  ? 27   GLY F O   1 
ATOM   9217  N N   . VAL K 1 28  ? 31.424  72.564  -15.667 1.00 17.82  ? 28   VAL F N   1 
ATOM   9218  C CA  . VAL K 1 28  ? 30.482  73.366  -14.884 1.00 8.87   ? 28   VAL F CA  1 
ATOM   9219  C C   . VAL K 1 28  ? 30.674  73.272  -13.389 1.00 18.14  ? 28   VAL F C   1 
ATOM   9220  O O   . VAL K 1 28  ? 30.798  72.175  -12.861 1.00 22.20  ? 28   VAL F O   1 
ATOM   9221  C CB  . VAL K 1 28  ? 29.105  72.891  -15.237 1.00 7.68   ? 28   VAL F CB  1 
ATOM   9222  C CG1 . VAL K 1 28  ? 28.081  73.632  -14.425 1.00 6.16   ? 28   VAL F CG1 1 
ATOM   9223  C CG2 . VAL K 1 28  ? 28.881  73.017  -16.731 1.00 1.00   ? 28   VAL F CG2 1 
ATOM   9224  N N   . GLU K 1 29  ? 30.741  74.447  -12.723 1.00 26.80  ? 29   GLU F N   1 
ATOM   9225  C CA  . GLU K 1 29  ? 30.912  74.529  -11.267 1.00 28.31  ? 29   GLU F CA  1 
ATOM   9226  C C   . GLU K 1 29  ? 29.544  74.463  -10.640 1.00 30.20  ? 29   GLU F C   1 
ATOM   9227  O O   . GLU K 1 29  ? 28.578  74.944  -11.245 1.00 38.03  ? 29   GLU F O   1 
ATOM   9228  C CB  . GLU K 1 29  ? 31.683  75.781  -10.777 1.00 32.26  ? 29   GLU F CB  1 
ATOM   9229  C CG  . GLU K 1 29  ? 33.219  75.631  -10.606 1.00 67.57  ? 29   GLU F CG  1 
ATOM   9230  C CD  . GLU K 1 29  ? 33.928  76.893  -10.170 1.00 160.28 ? 29   GLU F CD  1 
ATOM   9231  O OE1 . GLU K 1 29  ? 34.122  77.842  -10.909 1.00 195.37 ? 29   GLU F OE1 1 
ATOM   9232  O OE2 . GLU K 1 29  ? 34.324  76.815  -8.915  1.00 192.75 ? 29   GLU F OE2 1 
ATOM   9233  N N   . PHE K 1 30  ? 29.446  73.875  -9.445  1.00 13.23  ? 30   PHE F N   1 
ATOM   9234  C CA  . PHE K 1 30  ? 28.129  73.785  -8.896  1.00 8.69   ? 30   PHE F CA  1 
ATOM   9235  C C   . PHE K 1 30  ? 28.192  73.702  -7.434  1.00 14.26  ? 30   PHE F C   1 
ATOM   9236  O O   . PHE K 1 30  ? 29.267  73.508  -6.855  1.00 9.97   ? 30   PHE F O   1 
ATOM   9237  C CB  . PHE K 1 30  ? 27.460  72.506  -9.377  1.00 11.39  ? 30   PHE F CB  1 
ATOM   9238  C CG  . PHE K 1 30  ? 28.302  71.245  -9.096  1.00 9.08   ? 30   PHE F CG  1 
ATOM   9239  C CD1 . PHE K 1 30  ? 28.242  70.568  -7.879  1.00 8.84   ? 30   PHE F CD1 1 
ATOM   9240  C CD2 . PHE K 1 30  ? 29.108  70.652  -10.072 1.00 6.88   ? 30   PHE F CD2 1 
ATOM   9241  C CE1 . PHE K 1 30  ? 28.960  69.394  -7.618  1.00 5.28   ? 30   PHE F CE1 1 
ATOM   9242  C CE2 . PHE K 1 30  ? 29.840  69.477  -9.838  1.00 5.71   ? 30   PHE F CE2 1 
ATOM   9243  C CZ  . PHE K 1 30  ? 29.799  68.846  -8.590  1.00 1.00   ? 30   PHE F CZ  1 
ATOM   9244  N N   . ASP K 1 31  ? 27.017  73.827  -6.835  1.00 13.28  ? 31   ASP F N   1 
ATOM   9245  C CA  . ASP K 1 31  ? 27.001  73.754  -5.409  1.00 12.08  ? 31   ASP F CA  1 
ATOM   9246  C C   . ASP K 1 31  ? 26.305  72.521  -4.966  1.00 13.87  ? 31   ASP F C   1 
ATOM   9247  O O   . ASP K 1 31  ? 25.659  71.865  -5.750  1.00 21.44  ? 31   ASP F O   1 
ATOM   9248  C CB  . ASP K 1 31  ? 26.466  75.020  -4.697  1.00 15.48  ? 31   ASP F CB  1 
ATOM   9249  C CG  . ASP K 1 31  ? 26.912  76.339  -5.290  1.00 27.68  ? 31   ASP F CG  1 
ATOM   9250  O OD1 . ASP K 1 31  ? 28.078  76.670  -5.288  1.00 37.42  ? 31   ASP F OD1 1 
ATOM   9251  O OD2 . ASP K 1 31  ? 25.929  77.079  -5.806  1.00 34.74  ? 31   ASP F OD2 1 
ATOM   9252  N N   . GLU K 1 32  ? 26.437  72.245  -3.688  1.00 4.84   ? 32   GLU F N   1 
ATOM   9253  C CA  . GLU K 1 32  ? 25.822  71.110  -3.100  1.00 9.08   ? 32   GLU F CA  1 
ATOM   9254  C C   . GLU K 1 32  ? 25.129  71.443  -1.777  1.00 23.83  ? 32   GLU F C   1 
ATOM   9255  O O   . GLU K 1 32  ? 25.678  72.132  -0.963  1.00 34.10  ? 32   GLU F O   1 
ATOM   9256  C CB  . GLU K 1 32  ? 26.872  69.996  -2.823  1.00 10.48  ? 32   GLU F CB  1 
ATOM   9257  C CG  . GLU K 1 32  ? 27.593  69.473  -4.094  1.00 10.37  ? 32   GLU F CG  1 
ATOM   9258  C CD  . GLU K 1 32  ? 28.365  68.220  -3.806  1.00 18.46  ? 32   GLU F CD  1 
ATOM   9259  O OE1 . GLU K 1 32  ? 29.411  68.245  -3.201  1.00 28.62  ? 32   GLU F OE1 1 
ATOM   9260  O OE2 . GLU K 1 32  ? 27.677  67.116  -4.033  1.00 29.96  ? 32   GLU F OE2 1 
ATOM   9261  N N   . GLU K 1 33  ? 23.954  70.877  -1.529  1.00 17.07  ? 33   GLU F N   1 
ATOM   9262  C CA  . GLU K 1 33  ? 23.258  71.063  -0.310  1.00 10.34  ? 33   GLU F CA  1 
ATOM   9263  C C   . GLU K 1 33  ? 22.978  69.720  0.301   1.00 14.02  ? 33   GLU F C   1 
ATOM   9264  O O   . GLU K 1 33  ? 22.077  68.998  -0.086  1.00 19.01  ? 33   GLU F O   1 
ATOM   9265  C CB  . GLU K 1 33  ? 21.973  71.770  -0.598  1.00 13.07  ? 33   GLU F CB  1 
ATOM   9266  C CG  . GLU K 1 33  ? 21.460  72.355  0.727   1.00 25.16  ? 33   GLU F CG  1 
ATOM   9267  C CD  . GLU K 1 33  ? 20.173  73.114  0.623   1.00 75.56  ? 33   GLU F CD  1 
ATOM   9268  O OE1 . GLU K 1 33  ? 20.116  74.235  0.100   1.00 47.37  ? 33   GLU F OE1 1 
ATOM   9269  O OE2 . GLU K 1 33  ? 19.162  72.461  1.209   1.00 39.17  ? 33   GLU F OE2 1 
ATOM   9270  N N   . PHE K 1 34  ? 23.785  69.359  1.266   1.00 7.61   ? 34   PHE F N   1 
ATOM   9271  C CA  . PHE K 1 34  ? 23.675  68.031  1.794   1.00 8.79   ? 34   PHE F CA  1 
ATOM   9272  C C   . PHE K 1 34  ? 22.579  67.626  2.684   1.00 19.39  ? 34   PHE F C   1 
ATOM   9273  O O   . PHE K 1 34  ? 22.313  68.271  3.668   1.00 24.13  ? 34   PHE F O   1 
ATOM   9274  C CB  . PHE K 1 34  ? 24.953  67.631  2.484   1.00 10.39  ? 34   PHE F CB  1 
ATOM   9275  C CG  . PHE K 1 34  ? 26.067  67.635  1.503   1.00 17.68  ? 34   PHE F CG  1 
ATOM   9276  C CD1 . PHE K 1 34  ? 25.925  66.937  0.306   1.00 28.34  ? 34   PHE F CD1 1 
ATOM   9277  C CD2 . PHE K 1 34  ? 27.247  68.333  1.747   1.00 16.81  ? 34   PHE F CD2 1 
ATOM   9278  C CE1 . PHE K 1 34  ? 26.944  66.973  -0.640  1.00 31.51  ? 34   PHE F CE1 1 
ATOM   9279  C CE2 . PHE K 1 34  ? 28.270  68.380  0.805   1.00 16.09  ? 34   PHE F CE2 1 
ATOM   9280  C CZ  . PHE K 1 34  ? 28.118  67.682  -0.386  1.00 21.33  ? 34   PHE F CZ  1 
ATOM   9281  N N   . LEU K 1 35  ? 22.050  66.446  2.424   1.00 17.76  ? 35   LEU F N   1 
ATOM   9282  C CA  . LEU K 1 35  ? 21.098  65.932  3.369   1.00 10.55  ? 35   LEU F CA  1 
ATOM   9283  C C   . LEU K 1 35  ? 21.832  65.114  4.394   1.00 19.28  ? 35   LEU F C   1 
ATOM   9284  O O   . LEU K 1 35  ? 22.711  64.326  4.053   1.00 29.56  ? 35   LEU F O   1 
ATOM   9285  C CB  . LEU K 1 35  ? 19.927  65.115  2.819   1.00 7.52   ? 35   LEU F CB  1 
ATOM   9286  C CG  . LEU K 1 35  ? 19.169  65.861  1.741   1.00 13.89  ? 35   LEU F CG  1 
ATOM   9287  C CD1 . LEU K 1 35  ? 18.370  64.904  0.877   1.00 9.47   ? 35   LEU F CD1 1 
ATOM   9288  C CD2 . LEU K 1 35  ? 18.198  66.770  2.389   1.00 11.29  ? 35   LEU F CD2 1 
ATOM   9289  N N   . GLU K 1 36  ? 21.462  65.363  5.660   1.00 21.93  ? 36   GLU F N   1 
ATOM   9290  C CA  . GLU K 1 36  ? 21.972  64.657  6.826   1.00 23.68  ? 36   GLU F CA  1 
ATOM   9291  C C   . GLU K 1 36  ? 20.963  63.907  7.681   1.00 31.22  ? 36   GLU F C   1 
ATOM   9292  O O   . GLU K 1 36  ? 21.367  62.958  8.369   1.00 34.30  ? 36   GLU F O   1 
ATOM   9293  C CB  . GLU K 1 36  ? 22.962  65.449  7.687   1.00 26.56  ? 36   GLU F CB  1 
ATOM   9294  C CG  . GLU K 1 36  ? 24.036  66.235  6.889   1.00 46.80  ? 36   GLU F CG  1 
ATOM   9295  C CD  . GLU K 1 36  ? 24.760  67.284  7.681   1.00 144.65 ? 36   GLU F CD  1 
ATOM   9296  O OE1 . GLU K 1 36  ? 25.136  67.134  8.809   1.00 197.15 ? 36   GLU F OE1 1 
ATOM   9297  O OE2 . GLU K 1 36  ? 24.891  68.389  7.004   1.00 116.08 ? 36   GLU F OE2 1 
ATOM   9298  N N   . THR K 1 37  ? 19.674  64.302  7.605   1.00 31.21  ? 37   THR F N   1 
ATOM   9299  C CA  . THR K 1 37  ? 18.567  63.741  8.388   1.00 29.82  ? 37   THR F CA  1 
ATOM   9300  C C   . THR K 1 37  ? 17.235  63.610  7.651   1.00 35.09  ? 37   THR F C   1 
ATOM   9301  O O   . THR K 1 37  ? 16.952  64.335  6.664   1.00 28.14  ? 37   THR F O   1 
ATOM   9302  C CB  . THR K 1 37  ? 18.251  64.781  9.472   1.00 43.33  ? 37   THR F CB  1 
ATOM   9303  O OG1 . THR K 1 37  ? 17.477  65.842  8.921   1.00 54.39  ? 37   THR F OG1 1 
ATOM   9304  C CG2 . THR K 1 37  ? 19.523  65.357  10.031  1.00 18.64  ? 37   THR F CG2 1 
ATOM   9305  N N   . LYS K 1 38  ? 16.359  62.776  8.262   1.00 29.25  ? 38   LYS F N   1 
ATOM   9306  C CA  . LYS K 1 38  ? 15.003  62.593  7.723   1.00 27.02  ? 38   LYS F CA  1 
ATOM   9307  C C   . LYS K 1 38  ? 14.345  63.952  7.554   1.00 32.21  ? 38   LYS F C   1 
ATOM   9308  O O   . LYS K 1 38  ? 13.773  64.361  6.507   1.00 38.46  ? 38   LYS F O   1 
ATOM   9309  C CB  . LYS K 1 38  ? 14.113  61.729  8.627   1.00 26.43  ? 38   LYS F CB  1 
ATOM   9310  C CG  . LYS K 1 38  ? 13.315  60.613  7.928   1.00 60.64  ? 38   LYS F CG  1 
ATOM   9311  C CD  . LYS K 1 38  ? 13.881  59.184  8.068   1.00 131.05 ? 38   LYS F CD  1 
ATOM   9312  C CE  . LYS K 1 38  ? 13.048  58.078  7.391   1.00 170.26 ? 38   LYS F CE  1 
ATOM   9313  N NZ  . LYS K 1 38  ? 13.480  56.685  7.672   1.00 174.30 ? 38   LYS F NZ  1 
ATOM   9314  N N   . GLU K 1 39  ? 14.500  64.686  8.607   1.00 27.67  ? 39   GLU F N   1 
ATOM   9315  C CA  . GLU K 1 39  ? 13.925  65.990  8.707   1.00 31.08  ? 39   GLU F CA  1 
ATOM   9316  C C   . GLU K 1 39  ? 14.285  66.944  7.607   1.00 30.03  ? 39   GLU F C   1 
ATOM   9317  O O   . GLU K 1 39  ? 13.406  67.599  7.016   1.00 35.32  ? 39   GLU F O   1 
ATOM   9318  C CB  . GLU K 1 39  ? 14.047  66.561  10.115  1.00 37.81  ? 39   GLU F CB  1 
ATOM   9319  C CG  . GLU K 1 39  ? 13.164  67.801  10.332  1.00 79.19  ? 39   GLU F CG  1 
ATOM   9320  C CD  . GLU K 1 39  ? 13.985  68.926  10.901  1.00 193.64 ? 39   GLU F CD  1 
ATOM   9321  O OE1 . GLU K 1 39  ? 15.210  68.935  10.907  1.00 232.66 ? 39   GLU F OE1 1 
ATOM   9322  O OE2 . GLU K 1 39  ? 13.242  69.883  11.399  1.00 227.39 ? 39   GLU F OE2 1 
ATOM   9323  N N   . GLN K 1 40  ? 15.561  67.022  7.274   1.00 21.77  ? 40   GLN F N   1 
ATOM   9324  C CA  . GLN K 1 40  ? 15.890  67.898  6.163   1.00 20.26  ? 40   GLN F CA  1 
ATOM   9325  C C   . GLN K 1 40  ? 15.253  67.430  4.875   1.00 27.16  ? 40   GLN F C   1 
ATOM   9326  O O   . GLN K 1 40  ? 14.874  68.241  4.034   1.00 28.08  ? 40   GLN F O   1 
ATOM   9327  C CB  . GLN K 1 40  ? 17.364  68.042  5.975   1.00 19.08  ? 40   GLN F CB  1 
ATOM   9328  C CG  . GLN K 1 40  ? 18.055  68.082  7.326   1.00 31.96  ? 40   GLN F CG  1 
ATOM   9329  C CD  . GLN K 1 40  ? 19.538  67.972  7.155   1.00 60.17  ? 40   GLN F CD  1 
ATOM   9330  O OE1 . GLN K 1 40  ? 20.082  66.846  7.106   1.00 56.97  ? 40   GLN F OE1 1 
ATOM   9331  N NE2 . GLN K 1 40  ? 20.152  69.126  6.896   1.00 30.70  ? 40   GLN F NE2 1 
ATOM   9332  N N   . LEU K 1 41  ? 15.109  66.113  4.759   1.00 19.89  ? 41   LEU F N   1 
ATOM   9333  C CA  . LEU K 1 41  ? 14.474  65.573  3.616   1.00 18.47  ? 41   LEU F CA  1 
ATOM   9334  C C   . LEU K 1 41  ? 13.040  66.022  3.652   1.00 22.31  ? 41   LEU F C   1 
ATOM   9335  O O   . LEU K 1 41  ? 12.531  66.585  2.675   1.00 20.50  ? 41   LEU F O   1 
ATOM   9336  C CB  . LEU K 1 41  ? 14.640  64.065  3.626   1.00 19.14  ? 41   LEU F CB  1 
ATOM   9337  C CG  . LEU K 1 41  ? 13.835  63.346  2.549   1.00 22.37  ? 41   LEU F CG  1 
ATOM   9338  C CD1 . LEU K 1 41  ? 14.185  63.810  1.125   1.00 14.45  ? 41   LEU F CD1 1 
ATOM   9339  C CD2 . LEU K 1 41  ? 14.063  61.856  2.699   1.00 6.97   ? 41   LEU F CD2 1 
ATOM   9340  N N   . TYR K 1 42  ? 12.403  65.867  4.812   1.00 18.09  ? 42   TYR F N   1 
ATOM   9341  C CA  . TYR K 1 42  ? 11.022  66.367  4.910   1.00 22.08  ? 42   TYR F CA  1 
ATOM   9342  C C   . TYR K 1 42  ? 10.828  67.778  4.517   1.00 21.45  ? 42   TYR F C   1 
ATOM   9343  O O   . TYR K 1 42  ? 9.868   68.138  3.860   1.00 23.96  ? 42   TYR F O   1 
ATOM   9344  C CB  . TYR K 1 42  ? 10.496  66.336  6.289   1.00 34.68  ? 42   TYR F CB  1 
ATOM   9345  C CG  . TYR K 1 42  ? 10.143  64.924  6.593   1.00 69.13  ? 42   TYR F CG  1 
ATOM   9346  C CD1 . TYR K 1 42  ? 9.640   64.107  5.582   1.00 82.25  ? 42   TYR F CD1 1 
ATOM   9347  C CD2 . TYR K 1 42  ? 10.291  64.382  7.871   1.00 76.28  ? 42   TYR F CD2 1 
ATOM   9348  C CE1 . TYR K 1 42  ? 9.284   62.777  5.830   1.00 94.37  ? 42   TYR F CE1 1 
ATOM   9349  C CE2 . TYR K 1 42  ? 9.945   63.053  8.134   1.00 79.12  ? 42   TYR F CE2 1 
ATOM   9350  C CZ  . TYR K 1 42  ? 9.436   62.247  7.115   1.00 95.12  ? 42   TYR F CZ  1 
ATOM   9351  O OH  . TYR K 1 42  ? 9.078   60.940  7.388   1.00 96.88  ? 42   TYR F OH  1 
ATOM   9352  N N   . LYS K 1 43  ? 11.733  68.609  4.927   1.00 13.68  ? 43   LYS F N   1 
ATOM   9353  C CA  . LYS K 1 43  ? 11.510  69.970  4.535   1.00 14.88  ? 43   LYS F CA  1 
ATOM   9354  C C   . LYS K 1 43  ? 11.584  70.157  3.054   1.00 21.16  ? 43   LYS F C   1 
ATOM   9355  O O   . LYS K 1 43  ? 10.915  70.957  2.422   1.00 31.70  ? 43   LYS F O   1 
ATOM   9356  C CB  . LYS K 1 43  ? 12.427  70.941  5.275   1.00 21.00  ? 43   LYS F CB  1 
ATOM   9357  C CG  . LYS K 1 43  ? 12.627  70.492  6.712   1.00 105.48 ? 43   LYS F CG  1 
ATOM   9358  C CD  . LYS K 1 43  ? 13.806  71.160  7.403   1.00 165.45 ? 43   LYS F CD  1 
ATOM   9359  C CE  . LYS K 1 43  ? 13.429  72.434  8.146   1.00 228.51 ? 43   LYS F CE  1 
ATOM   9360  N NZ  . LYS K 1 43  ? 14.505  72.940  9.017   1.00 258.00 ? 43   LYS F NZ  1 
ATOM   9361  N N   . LEU K 1 44  ? 12.416  69.394  2.474   1.00 13.95  ? 44   LEU F N   1 
ATOM   9362  C CA  . LEU K 1 44  ? 12.599  69.543  1.058   1.00 12.63  ? 44   LEU F CA  1 
ATOM   9363  C C   . LEU K 1 44  ? 11.342  69.108  0.358   1.00 15.33  ? 44   LEU F C   1 
ATOM   9364  O O   . LEU K 1 44  ? 10.827  69.718  -0.581  1.00 15.90  ? 44   LEU F O   1 
ATOM   9365  C CB  . LEU K 1 44  ? 13.796  68.626  0.801   1.00 12.87  ? 44   LEU F CB  1 
ATOM   9366  C CG  . LEU K 1 44  ? 14.628  68.921  -0.426  1.00 16.69  ? 44   LEU F CG  1 
ATOM   9367  C CD1 . LEU K 1 44  ? 14.877  70.377  -0.579  1.00 12.70  ? 44   LEU F CD1 1 
ATOM   9368  C CD2 . LEU K 1 44  ? 15.987  68.247  -0.319  1.00 18.55  ? 44   LEU F CD2 1 
ATOM   9369  N N   . GLN K 1 45  ? 10.824  68.037  0.912   1.00 10.39  ? 45   GLN F N   1 
ATOM   9370  C CA  . GLN K 1 45  ? 9.654   67.423  0.389   1.00 8.91   ? 45   GLN F CA  1 
ATOM   9371  C C   . GLN K 1 45  ? 8.504   68.308  0.605   1.00 24.32  ? 45   GLN F C   1 
ATOM   9372  O O   . GLN K 1 45  ? 7.752   68.602  -0.307  1.00 24.96  ? 45   GLN F O   1 
ATOM   9373  C CB  . GLN K 1 45  ? 9.409   66.152  1.153   1.00 7.27   ? 45   GLN F CB  1 
ATOM   9374  C CG  . GLN K 1 45  ? 10.306  65.071  0.616   1.00 23.17  ? 45   GLN F CG  1 
ATOM   9375  C CD  . GLN K 1 45  ? 10.133  63.822  1.395   1.00 9.01   ? 45   GLN F CD  1 
ATOM   9376  O OE1 . GLN K 1 45  ? 9.751   63.911  2.550   1.00 36.30  ? 45   GLN F OE1 1 
ATOM   9377  N NE2 . GLN K 1 45  ? 10.503  62.679  0.794   1.00 19.47  ? 45   GLN F NE2 1 
ATOM   9378  N N   . ASP K 1 46  ? 8.420   68.731  1.859   1.00 25.91  ? 46   ASP F N   1 
ATOM   9379  C CA  . ASP K 1 46  ? 7.369   69.625  2.290   1.00 24.70  ? 46   ASP F CA  1 
ATOM   9380  C C   . ASP K 1 46  ? 7.268   70.882  1.443   1.00 20.91  ? 46   ASP F C   1 
ATOM   9381  O O   . ASP K 1 46  ? 6.214   71.340  1.110   1.00 23.96  ? 46   ASP F O   1 
ATOM   9382  C CB  . ASP K 1 46  ? 7.514   70.013  3.757   1.00 28.86  ? 46   ASP F CB  1 
ATOM   9383  C CG  . ASP K 1 46  ? 6.435   70.965  4.253   1.00 66.70  ? 46   ASP F CG  1 
ATOM   9384  O OD1 . ASP K 1 46  ? 5.251   70.686  4.224   1.00 73.54  ? 46   ASP F OD1 1 
ATOM   9385  O OD2 . ASP K 1 46  ? 6.890   72.146  4.656   1.00 88.27  ? 46   ASP F OD2 1 
ATOM   9386  N N   . GLY K 1 47  ? 8.355   71.497  1.082   1.00 17.38  ? 47   GLY F N   1 
ATOM   9387  C CA  . GLY K 1 47  ? 8.202   72.680  0.283   1.00 13.80  ? 47   GLY F CA  1 
ATOM   9388  C C   . GLY K 1 47  ? 7.933   72.386  -1.158  1.00 20.83  ? 47   GLY F C   1 
ATOM   9389  O O   . GLY K 1 47  ? 7.966   73.298  -1.980  1.00 26.10  ? 47   GLY F O   1 
ATOM   9390  N N   . ASN K 1 48  ? 7.702   71.121  -1.484  1.00 16.78  ? 48   ASN F N   1 
ATOM   9391  C CA  . ASN K 1 48  ? 7.416   70.795  -2.862  1.00 18.70  ? 48   ASN F CA  1 
ATOM   9392  C C   . ASN K 1 48  ? 8.599   71.005  -3.773  1.00 23.54  ? 48   ASN F C   1 
ATOM   9393  O O   . ASN K 1 48  ? 8.482   71.486  -4.888  1.00 28.81  ? 48   ASN F O   1 
ATOM   9394  C CB  . ASN K 1 48  ? 6.098   71.479  -3.355  1.00 19.59  ? 48   ASN F CB  1 
ATOM   9395  C CG  . ASN K 1 48  ? 4.950   70.969  -2.483  1.00 101.87 ? 48   ASN F CG  1 
ATOM   9396  O OD1 . ASN K 1 48  ? 4.880   69.763  -2.147  1.00 85.57  ? 48   ASN F OD1 1 
ATOM   9397  N ND2 . ASN K 1 48  ? 4.152   71.899  -1.952  1.00 131.65 ? 48   ASN F ND2 1 
ATOM   9398  N N   . HIS K 1 49  ? 9.774   70.660  -3.308  1.00 14.99  ? 49   HIS F N   1 
ATOM   9399  C CA  . HIS K 1 49  ? 10.875  70.877  -4.203  1.00 12.78  ? 49   HIS F CA  1 
ATOM   9400  C C   . HIS K 1 49  ? 11.248  69.674  -5.013  1.00 15.54  ? 49   HIS F C   1 
ATOM   9401  O O   . HIS K 1 49  ? 11.930  69.810  -6.006  1.00 16.83  ? 49   HIS F O   1 
ATOM   9402  C CB  . HIS K 1 49  ? 12.034  71.134  -3.345  1.00 16.79  ? 49   HIS F CB  1 
ATOM   9403  C CG  . HIS K 1 49  ? 11.791  72.322  -2.547  1.00 21.98  ? 49   HIS F CG  1 
ATOM   9404  N ND1 . HIS K 1 49  ? 11.734  73.569  -3.151  1.00 23.88  ? 49   HIS F ND1 1 
ATOM   9405  C CD2 . HIS K 1 49  ? 11.639  72.456  -1.216  1.00 25.84  ? 49   HIS F CD2 1 
ATOM   9406  C CE1 . HIS K 1 49  ? 11.582  74.442  -2.178  1.00 21.95  ? 49   HIS F CE1 1 
ATOM   9407  N NE2 . HIS K 1 49  ? 11.534  73.812  -1.006  1.00 24.18  ? 49   HIS F NE2 1 
ATOM   9408  N N   . LEU K 1 50  ? 10.838  68.511  -4.517  1.00 8.69   ? 50   LEU F N   1 
ATOM   9409  C CA  . LEU K 1 50  ? 11.066  67.239  -5.102  1.00 4.38   ? 50   LEU F CA  1 
ATOM   9410  C C   . LEU K 1 50  ? 9.825   66.817  -5.818  1.00 11.49  ? 50   LEU F C   1 
ATOM   9411  O O   . LEU K 1 50  ? 8.910   66.416  -5.164  1.00 9.66   ? 50   LEU F O   1 
ATOM   9412  C CB  . LEU K 1 50  ? 11.269  66.221  -3.976  1.00 1.64   ? 50   LEU F CB  1 
ATOM   9413  C CG  . LEU K 1 50  ? 12.357  66.742  -3.066  1.00 3.51   ? 50   LEU F CG  1 
ATOM   9414  C CD1 . LEU K 1 50  ? 12.782  65.692  -2.040  1.00 1.06   ? 50   LEU F CD1 1 
ATOM   9415  C CD2 . LEU K 1 50  ? 13.485  67.279  -3.917  1.00 1.00   ? 50   LEU F CD2 1 
ATOM   9416  N N   . LEU K 1 51  ? 9.845   66.852  -7.146  1.00 8.04   ? 51   LEU F N   1 
ATOM   9417  C CA  . LEU K 1 51  ? 8.704   66.492  -7.960  1.00 1.52   ? 51   LEU F CA  1 
ATOM   9418  C C   . LEU K 1 51  ? 8.080   65.218  -7.552  1.00 10.02  ? 51   LEU F C   1 
ATOM   9419  O O   . LEU K 1 51  ? 6.873   65.119  -7.522  1.00 21.73  ? 51   LEU F O   1 
ATOM   9420  C CB  . LEU K 1 51  ? 9.120   66.411  -9.430  1.00 1.31   ? 51   LEU F CB  1 
ATOM   9421  C CG  . LEU K 1 51  ? 8.011   66.020  -10.408 1.00 7.53   ? 51   LEU F CG  1 
ATOM   9422  C CD1 . LEU K 1 51  ? 6.946   67.104  -10.410 1.00 1.00   ? 51   LEU F CD1 1 
ATOM   9423  C CD2 . LEU K 1 51  ? 8.487   65.856  -11.861 1.00 1.00   ? 51   LEU F CD2 1 
ATOM   9424  N N   . PHE K 1 52  ? 8.914   64.239  -7.229  1.00 9.94   ? 52   PHE F N   1 
ATOM   9425  C CA  . PHE K 1 52  ? 8.394   62.929  -6.867  1.00 7.21   ? 52   PHE F CA  1 
ATOM   9426  C C   . PHE K 1 52  ? 8.824   62.546  -5.480  1.00 11.24  ? 52   PHE F C   1 
ATOM   9427  O O   . PHE K 1 52  ? 8.879   61.375  -5.174  1.00 6.58   ? 52   PHE F O   1 
ATOM   9428  C CB  . PHE K 1 52  ? 8.711   61.797  -7.865  1.00 1.00   ? 52   PHE F CB  1 
ATOM   9429  C CG  . PHE K 1 52  ? 8.099   61.973  -9.250  1.00 2.96   ? 52   PHE F CG  1 
ATOM   9430  C CD1 . PHE K 1 52  ? 6.723   61.933  -9.456  1.00 7.87   ? 52   PHE F CD1 1 
ATOM   9431  C CD2 . PHE K 1 52  ? 8.896   62.160  -10.382 1.00 6.49   ? 52   PHE F CD2 1 
ATOM   9432  C CE1 . PHE K 1 52  ? 6.153   62.133  -10.715 1.00 6.37   ? 52   PHE F CE1 1 
ATOM   9433  C CE2 . PHE K 1 52  ? 8.366   62.346  -11.657 1.00 6.34   ? 52   PHE F CE2 1 
ATOM   9434  C CZ  . PHE K 1 52  ? 6.980   62.356  -11.810 1.00 5.29   ? 52   PHE F CZ  1 
ATOM   9435  N N   . GLN K 1 53  ? 9.215   63.539  -4.694  1.00 5.74   ? 53   GLN F N   1 
ATOM   9436  C CA  . GLN K 1 53  ? 9.604   63.270  -3.334  1.00 5.09   ? 53   GLN F CA  1 
ATOM   9437  C C   . GLN K 1 53  ? 10.920  62.587  -3.157  1.00 13.57  ? 53   GLN F C   1 
ATOM   9438  O O   . GLN K 1 53  ? 11.249  62.183  -2.063  1.00 14.23  ? 53   GLN F O   1 
ATOM   9439  C CB  . GLN K 1 53  ? 8.506   62.516  -2.588  1.00 3.56   ? 53   GLN F CB  1 
ATOM   9440  C CG  . GLN K 1 53  ? 7.073   63.170  -2.701  1.00 13.24  ? 53   GLN F CG  1 
ATOM   9441  C CD  . GLN K 1 53  ? 6.938   64.569  -2.095  1.00 42.24  ? 53   GLN F CD  1 
ATOM   9442  O OE1 . GLN K 1 53  ? 6.227   64.748  -1.103  1.00 114.27 ? 53   GLN F OE1 1 
ATOM   9443  N NE2 . GLN K 1 53  ? 7.623   65.571  -2.635  1.00 50.32  ? 53   GLN F NE2 1 
ATOM   9444  N N   . GLN K 1 54  ? 11.690  62.500  -4.220  1.00 11.15  ? 54   GLN F N   1 
ATOM   9445  C CA  . GLN K 1 54  ? 12.960  61.885  -4.056  1.00 11.09  ? 54   GLN F CA  1 
ATOM   9446  C C   . GLN K 1 54  ? 14.011  62.761  -4.607  1.00 14.96  ? 54   GLN F C   1 
ATOM   9447  O O   . GLN K 1 54  ? 13.680  63.702  -5.330  1.00 10.27  ? 54   GLN F O   1 
ATOM   9448  C CB  . GLN K 1 54  ? 13.060  60.727  -5.015  1.00 9.52   ? 54   GLN F CB  1 
ATOM   9449  C CG  . GLN K 1 54  ? 11.918  59.777  -4.752  1.00 12.31  ? 54   GLN F CG  1 
ATOM   9450  C CD  . GLN K 1 54  ? 11.741  58.771  -5.846  1.00 1.00   ? 54   GLN F CD  1 
ATOM   9451  O OE1 . GLN K 1 54  ? 11.291  59.101  -6.969  1.00 45.37  ? 54   GLN F OE1 1 
ATOM   9452  N NE2 . GLN K 1 54  ? 12.206  57.566  -5.564  1.00 19.84  ? 54   GLN F NE2 1 
ATOM   9453  N N   . VAL K 1 55  ? 15.238  62.368  -4.254  1.00 10.42  ? 55   VAL F N   1 
ATOM   9454  C CA  . VAL K 1 55  ? 16.500  62.888  -4.733  1.00 9.57   ? 55   VAL F CA  1 
ATOM   9455  C C   . VAL K 1 55  ? 17.176  61.724  -5.504  1.00 14.69  ? 55   VAL F C   1 
ATOM   9456  O O   . VAL K 1 55  ? 16.907  60.523  -5.321  1.00 8.70   ? 55   VAL F O   1 
ATOM   9457  C CB  . VAL K 1 55  ? 17.427  63.370  -3.619  1.00 8.03   ? 55   VAL F CB  1 
ATOM   9458  C CG1 . VAL K 1 55  ? 16.895  64.649  -3.059  1.00 3.46   ? 55   VAL F CG1 1 
ATOM   9459  C CG2 . VAL K 1 55  ? 17.532  62.334  -2.509  1.00 4.29   ? 55   VAL F CG2 1 
ATOM   9460  N N   . PRO K 1 56  ? 18.067  62.020  -6.420  1.00 11.30  ? 56   PRO F N   1 
ATOM   9461  C CA  . PRO K 1 56  ? 18.581  63.328  -6.719  1.00 4.11   ? 56   PRO F CA  1 
ATOM   9462  C C   . PRO K 1 56  ? 17.635  64.347  -7.201  1.00 9.83   ? 56   PRO F C   1 
ATOM   9463  O O   . PRO K 1 56  ? 16.782  64.092  -8.035  1.00 19.45  ? 56   PRO F O   1 
ATOM   9464  C CB  . PRO K 1 56  ? 19.517  63.074  -7.928  1.00 1.00   ? 56   PRO F CB  1 
ATOM   9465  C CG  . PRO K 1 56  ? 19.830  61.599  -7.927  1.00 4.11   ? 56   PRO F CG  1 
ATOM   9466  C CD  . PRO K 1 56  ? 18.971  60.910  -6.883  1.00 3.84   ? 56   PRO F CD  1 
ATOM   9467  N N   . MET K 1 57  ? 17.916  65.570  -6.812  1.00 5.04   ? 57   MET F N   1 
ATOM   9468  C CA  . MET K 1 57  ? 17.236  66.740  -7.373  1.00 3.72   ? 57   MET F CA  1 
ATOM   9469  C C   . MET K 1 57  ? 18.351  67.748  -7.602  1.00 5.29   ? 57   MET F C   1 
ATOM   9470  O O   . MET K 1 57  ? 19.281  67.885  -6.811  1.00 10.86  ? 57   MET F O   1 
ATOM   9471  C CB  . MET K 1 57  ? 16.155  67.372  -6.494  1.00 5.14   ? 57   MET F CB  1 
ATOM   9472  C CG  . MET K 1 57  ? 15.445  68.457  -7.245  1.00 11.13  ? 57   MET F CG  1 
ATOM   9473  S SD  . MET K 1 57  ? 16.164  70.105  -7.083  1.00 16.68  ? 57   MET F SD  1 
ATOM   9474  C CE  . MET K 1 57  ? 15.589  70.395  -5.419  1.00 5.94   ? 57   MET F CE  1 
ATOM   9475  N N   . VAL K 1 58  ? 18.312  68.406  -8.701  1.00 2.32   ? 58   VAL F N   1 
ATOM   9476  C CA  . VAL K 1 58  ? 19.317  69.388  -9.017  1.00 2.31   ? 58   VAL F CA  1 
ATOM   9477  C C   . VAL K 1 58  ? 18.615  70.630  -9.511  1.00 12.78  ? 58   VAL F C   1 
ATOM   9478  O O   . VAL K 1 58  ? 17.711  70.577  -10.377 1.00 11.53  ? 58   VAL F O   1 
ATOM   9479  C CB  . VAL K 1 58  ? 20.153  68.866  -10.160 1.00 4.17   ? 58   VAL F CB  1 
ATOM   9480  C CG1 . VAL K 1 58  ? 21.025  69.960  -10.778 1.00 2.31   ? 58   VAL F CG1 1 
ATOM   9481  C CG2 . VAL K 1 58  ? 20.980  67.751  -9.609  1.00 5.34   ? 58   VAL F CG2 1 
ATOM   9482  N N   . GLU K 1 59  ? 19.024  71.737  -8.929  1.00 12.32  ? 59   GLU F N   1 
ATOM   9483  C CA  . GLU K 1 59  ? 18.440  72.989  -9.340  1.00 10.70  ? 59   GLU F CA  1 
ATOM   9484  C C   . GLU K 1 59  ? 19.309  73.616  -10.343 1.00 17.16  ? 59   GLU F C   1 
ATOM   9485  O O   . GLU K 1 59  ? 20.422  74.019  -10.042 1.00 22.45  ? 59   GLU F O   1 
ATOM   9486  C CB  . GLU K 1 59  ? 18.311  74.016  -8.261  1.00 9.62   ? 59   GLU F CB  1 
ATOM   9487  C CG  . GLU K 1 59  ? 17.621  73.543  -6.982  1.00 29.96  ? 59   GLU F CG  1 
ATOM   9488  C CD  . GLU K 1 59  ? 17.390  74.711  -6.032  1.00 5.94   ? 59   GLU F CD  1 
ATOM   9489  O OE1 . GLU K 1 59  ? 16.756  75.717  -6.351  1.00 138.83 ? 59   GLU F OE1 1 
ATOM   9490  O OE2 . GLU K 1 59  ? 17.976  74.527  -4.865  1.00 37.35  ? 59   GLU F OE2 1 
ATOM   9491  N N   . ILE K 1 60  ? 18.764  73.716  -11.513 1.00 10.44  ? 60   ILE F N   1 
ATOM   9492  C CA  . ILE K 1 60  ? 19.511  74.253  -12.589 1.00 7.52   ? 60   ILE F CA  1 
ATOM   9493  C C   . ILE K 1 60  ? 18.625  74.968  -13.597 1.00 12.99  ? 60   ILE F C   1 
ATOM   9494  O O   . ILE K 1 60  ? 17.519  74.550  -13.937 1.00 18.91  ? 60   ILE F O   1 
ATOM   9495  C CB  . ILE K 1 60  ? 20.100  73.038  -13.264 1.00 13.20  ? 60   ILE F CB  1 
ATOM   9496  C CG1 . ILE K 1 60  ? 20.926  73.491  -14.418 1.00 13.74  ? 60   ILE F CG1 1 
ATOM   9497  C CG2 . ILE K 1 60  ? 18.963  72.161  -13.797 1.00 13.67  ? 60   ILE F CG2 1 
ATOM   9498  C CD1 . ILE K 1 60  ? 21.831  72.402  -14.960 1.00 4.78   ? 60   ILE F CD1 1 
ATOM   9499  N N   . ASP K 1 61  ? 19.138  76.068  -14.090 1.00 13.05  ? 61   ASP F N   1 
ATOM   9500  C CA  . ASP K 1 61  ? 18.444  76.872  -15.101 1.00 8.47   ? 61   ASP F CA  1 
ATOM   9501  C C   . ASP K 1 61  ? 17.039  77.187  -14.738 1.00 16.67  ? 61   ASP F C   1 
ATOM   9502  O O   . ASP K 1 61  ? 16.127  77.213  -15.582 1.00 22.10  ? 61   ASP F O   1 
ATOM   9503  C CB  . ASP K 1 61  ? 18.570  76.326  -16.517 1.00 7.69   ? 61   ASP F CB  1 
ATOM   9504  C CG  . ASP K 1 61  ? 20.012  76.390  -16.893 1.00 29.36  ? 61   ASP F CG  1 
ATOM   9505  O OD1 . ASP K 1 61  ? 20.870  76.953  -16.198 1.00 47.71  ? 61   ASP F OD1 1 
ATOM   9506  O OD2 . ASP K 1 61  ? 20.284  75.554  -17.848 1.00 16.19  ? 61   ASP F OD2 1 
ATOM   9507  N N   . GLY K 1 62  ? 16.914  77.413  -13.441 1.00 16.28  ? 62   GLY F N   1 
ATOM   9508  C CA  . GLY K 1 62  ? 15.646  77.758  -12.840 1.00 16.33  ? 62   GLY F CA  1 
ATOM   9509  C C   . GLY K 1 62  ? 14.683  76.621  -12.625 1.00 27.86  ? 62   GLY F C   1 
ATOM   9510  O O   . GLY K 1 62  ? 13.543  76.880  -12.255 1.00 31.80  ? 62   GLY F O   1 
ATOM   9511  N N   . MET K 1 63  ? 15.128  75.372  -12.855 1.00 21.31  ? 63   MET F N   1 
ATOM   9512  C CA  . MET K 1 63  ? 14.271  74.251  -12.660 1.00 10.03  ? 63   MET F CA  1 
ATOM   9513  C C   . MET K 1 63  ? 14.807  73.432  -11.526 1.00 19.03  ? 63   MET F C   1 
ATOM   9514  O O   . MET K 1 63  ? 15.963  73.617  -11.122 1.00 21.46  ? 63   MET F O   1 
ATOM   9515  C CB  . MET K 1 63  ? 14.288  73.414  -13.921 1.00 9.48   ? 63   MET F CB  1 
ATOM   9516  C CG  . MET K 1 63  ? 13.847  74.183  -15.153 1.00 9.21   ? 63   MET F CG  1 
ATOM   9517  S SD  . MET K 1 63  ? 14.648  73.603  -16.652 1.00 21.16  ? 63   MET F SD  1 
ATOM   9518  C CE  . MET K 1 63  ? 13.287  72.695  -17.463 1.00 25.93  ? 63   MET F CE  1 
ATOM   9519  N N   . LYS K 1 64  ? 13.954  72.535  -11.056 1.00 11.90  ? 64   LYS F N   1 
ATOM   9520  C CA  . LYS K 1 64  ? 14.329  71.589  -10.069 1.00 11.35  ? 64   LYS F CA  1 
ATOM   9521  C C   . LYS K 1 64  ? 14.176  70.219  -10.698 1.00 16.18  ? 64   LYS F C   1 
ATOM   9522  O O   . LYS K 1 64  ? 13.162  69.554  -10.562 1.00 16.69  ? 64   LYS F O   1 
ATOM   9523  C CB  . LYS K 1 64  ? 13.457  71.693  -8.853  1.00 14.15  ? 64   LYS F CB  1 
ATOM   9524  C CG  . LYS K 1 64  ? 13.511  73.086  -8.274  1.00 5.89   ? 64   LYS F CG  1 
ATOM   9525  C CD  . LYS K 1 64  ? 12.698  73.234  -6.984  1.00 21.21  ? 64   LYS F CD  1 
ATOM   9526  C CE  . LYS K 1 64  ? 12.655  74.639  -6.315  1.00 17.64  ? 64   LYS F CE  1 
ATOM   9527  N NZ  . LYS K 1 64  ? 11.343  74.951  -5.643  1.00 57.04  ? 64   LYS F NZ  1 
ATOM   9528  N N   . LEU K 1 65  ? 15.175  69.797  -11.397 1.00 7.70   ? 65   LEU F N   1 
ATOM   9529  C CA  . LEU K 1 65  ? 15.097  68.523  -12.014 1.00 4.37   ? 65   LEU F CA  1 
ATOM   9530  C C   . LEU K 1 65  ? 15.383  67.442  -11.044 1.00 6.56   ? 65   LEU F C   1 
ATOM   9531  O O   . LEU K 1 65  ? 16.210  67.632  -10.161 1.00 12.20  ? 65   LEU F O   1 
ATOM   9532  C CB  . LEU K 1 65  ? 16.142  68.433  -13.104 1.00 6.69   ? 65   LEU F CB  1 
ATOM   9533  C CG  . LEU K 1 65  ? 16.087  69.622  -14.052 1.00 7.55   ? 65   LEU F CG  1 
ATOM   9534  C CD1 . LEU K 1 65  ? 17.002  69.375  -15.192 1.00 1.00   ? 65   LEU F CD1 1 
ATOM   9535  C CD2 . LEU K 1 65  ? 14.719  69.758  -14.657 1.00 1.40   ? 65   LEU F CD2 1 
ATOM   9536  N N   . VAL K 1 66  ? 14.679  66.328  -11.289 1.00 1.00   ? 66   VAL F N   1 
ATOM   9537  C CA  . VAL K 1 66  ? 14.674  65.049  -10.581 1.00 5.48   ? 66   VAL F CA  1 
ATOM   9538  C C   . VAL K 1 66  ? 14.815  63.860  -11.557 1.00 11.95  ? 66   VAL F C   1 
ATOM   9539  O O   . VAL K 1 66  ? 14.630  64.010  -12.753 1.00 3.67   ? 66   VAL F O   1 
ATOM   9540  C CB  . VAL K 1 66  ? 13.476  64.888  -9.641  1.00 9.76   ? 66   VAL F CB  1 
ATOM   9541  C CG1 . VAL K 1 66  ? 13.414  66.093  -8.725  1.00 15.83  ? 66   VAL F CG1 1 
ATOM   9542  C CG2 . VAL K 1 66  ? 12.182  64.806  -10.409 1.00 1.21   ? 66   VAL F CG2 1 
ATOM   9543  N N   . GLN K 1 67  ? 15.184  62.664  -11.058 1.00 11.12  ? 67   GLN F N   1 
ATOM   9544  C CA  . GLN K 1 67  ? 15.425  61.488  -11.906 1.00 3.11   ? 67   GLN F CA  1 
ATOM   9545  C C   . GLN K 1 67  ? 16.755  61.634  -12.528 1.00 10.31  ? 67   GLN F C   1 
ATOM   9546  O O   . GLN K 1 67  ? 16.940  62.444  -13.456 1.00 11.82  ? 67   GLN F O   1 
ATOM   9547  C CB  . GLN K 1 67  ? 14.390  61.293  -13.029 1.00 1.00   ? 67   GLN F CB  1 
ATOM   9548  C CG  . GLN K 1 67  ? 12.990  61.093  -12.418 1.00 1.00   ? 67   GLN F CG  1 
ATOM   9549  C CD  . GLN K 1 67  ? 12.804  59.702  -11.818 1.00 2.40   ? 67   GLN F CD  1 
ATOM   9550  O OE1 . GLN K 1 67  ? 13.578  58.783  -12.175 1.00 19.99  ? 67   GLN F OE1 1 
ATOM   9551  N NE2 . GLN K 1 67  ? 11.820  59.552  -10.911 1.00 14.45  ? 67   GLN F NE2 1 
ATOM   9552  N N   . THR K 1 68  ? 17.659  60.855  -11.999 1.00 7.66   ? 68   THR F N   1 
ATOM   9553  C CA  . THR K 1 68  ? 19.032  60.868  -12.485 1.00 5.71   ? 68   THR F CA  1 
ATOM   9554  C C   . THR K 1 68  ? 19.148  60.874  -13.972 1.00 12.38  ? 68   THR F C   1 
ATOM   9555  O O   . THR K 1 68  ? 19.791  61.736  -14.522 1.00 12.68  ? 68   THR F O   1 
ATOM   9556  C CB  . THR K 1 68  ? 19.717  59.629  -11.967 1.00 4.93   ? 68   THR F CB  1 
ATOM   9557  O OG1 . THR K 1 68  ? 19.476  59.563  -10.588 1.00 9.64   ? 68   THR F OG1 1 
ATOM   9558  C CG2 . THR K 1 68  ? 21.168  59.646  -12.252 1.00 1.00   ? 68   THR F CG2 1 
ATOM   9559  N N   . ARG K 1 69  ? 18.483  59.951  -14.654 1.00 12.11  ? 69   ARG F N   1 
ATOM   9560  C CA  . ARG K 1 69  ? 18.688  59.977  -16.095 1.00 11.05  ? 69   ARG F CA  1 
ATOM   9561  C C   . ARG K 1 69  ? 18.229  61.222  -16.801 1.00 13.17  ? 69   ARG F C   1 
ATOM   9562  O O   . ARG K 1 69  ? 18.771  61.642  -17.810 1.00 15.74  ? 69   ARG F O   1 
ATOM   9563  C CB  . ARG K 1 69  ? 17.982  58.844  -16.732 1.00 2.87   ? 69   ARG F CB  1 
ATOM   9564  C CG  . ARG K 1 69  ? 18.370  57.512  -16.137 1.00 2.19   ? 69   ARG F CG  1 
ATOM   9565  C CD  . ARG K 1 69  ? 17.375  56.434  -16.555 1.00 16.62  ? 69   ARG F CD  1 
ATOM   9566  N NE  . ARG K 1 69  ? 17.929  55.100  -16.571 1.00 10.38  ? 69   ARG F NE  1 
ATOM   9567  C CZ  . ARG K 1 69  ? 18.265  54.542  -15.426 1.00 32.64  ? 69   ARG F CZ  1 
ATOM   9568  N NH1 . ARG K 1 69  ? 18.050  55.218  -14.324 1.00 27.33  ? 69   ARG F NH1 1 
ATOM   9569  N NH2 . ARG K 1 69  ? 18.908  53.372  -15.363 1.00 22.95  ? 69   ARG F NH2 1 
ATOM   9570  N N   . SER K 1 70  ? 17.159  61.770  -16.301 1.00 7.66   ? 70   SER F N   1 
ATOM   9571  C CA  . SER K 1 70  ? 16.557  62.934  -16.911 1.00 3.53   ? 70   SER F CA  1 
ATOM   9572  C C   . SER K 1 70  ? 17.447  64.135  -16.720 1.00 9.97   ? 70   SER F C   1 
ATOM   9573  O O   . SER K 1 70  ? 17.683  64.942  -17.604 1.00 14.94  ? 70   SER F O   1 
ATOM   9574  C CB  . SER K 1 70  ? 15.194  63.105  -16.319 1.00 1.00   ? 70   SER F CB  1 
ATOM   9575  O OG  . SER K 1 70  ? 14.442  61.899  -16.476 1.00 15.34  ? 70   SER F OG  1 
ATOM   9576  N N   . ILE K 1 71  ? 18.023  64.152  -15.558 1.00 4.81   ? 71   ILE F N   1 
ATOM   9577  C CA  . ILE K 1 71  ? 18.958  65.172  -15.226 1.00 3.49   ? 71   ILE F CA  1 
ATOM   9578  C C   . ILE K 1 71  ? 20.175  65.097  -16.146 1.00 9.08   ? 71   ILE F C   1 
ATOM   9579  O O   . ILE K 1 71  ? 20.607  66.073  -16.736 1.00 13.77  ? 71   ILE F O   1 
ATOM   9580  C CB  . ILE K 1 71  ? 19.418  65.018  -13.801 1.00 2.60   ? 71   ILE F CB  1 
ATOM   9581  C CG1 . ILE K 1 71  ? 18.329  65.290  -12.730 1.00 2.12   ? 71   ILE F CG1 1 
ATOM   9582  C CG2 . ILE K 1 71  ? 20.458  66.043  -13.725 1.00 1.00   ? 71   ILE F CG2 1 
ATOM   9583  C CD1 . ILE K 1 71  ? 18.718  64.785  -11.334 1.00 1.00   ? 71   ILE F CD1 1 
ATOM   9584  N N   . LEU K 1 72  ? 20.719  63.914  -16.296 1.00 6.18   ? 72   LEU F N   1 
ATOM   9585  C CA  . LEU K 1 72  ? 21.885  63.690  -17.149 1.00 4.76   ? 72   LEU F CA  1 
ATOM   9586  C C   . LEU K 1 72  ? 21.587  64.074  -18.546 1.00 4.66   ? 72   LEU F C   1 
ATOM   9587  O O   . LEU K 1 72  ? 22.366  64.733  -19.174 1.00 11.07  ? 72   LEU F O   1 
ATOM   9588  C CB  . LEU K 1 72  ? 22.351  62.224  -17.144 1.00 7.63   ? 72   LEU F CB  1 
ATOM   9589  C CG  . LEU K 1 72  ? 22.849  61.734  -15.793 1.00 3.60   ? 72   LEU F CG  1 
ATOM   9590  C CD1 . LEU K 1 72  ? 23.258  60.277  -15.860 1.00 1.00   ? 72   LEU F CD1 1 
ATOM   9591  C CD2 . LEU K 1 72  ? 24.006  62.579  -15.351 1.00 1.00   ? 72   LEU F CD2 1 
ATOM   9592  N N   . HIS K 1 73  ? 20.454  63.684  -19.073 1.00 7.74   ? 73   HIS F N   1 
ATOM   9593  C CA  . HIS K 1 73  ? 20.140  64.122  -20.452 1.00 3.88   ? 73   HIS F CA  1 
ATOM   9594  C C   . HIS K 1 73  ? 20.075  65.628  -20.555 1.00 11.84  ? 73   HIS F C   1 
ATOM   9595  O O   . HIS K 1 73  ? 20.486  66.225  -21.544 1.00 12.42  ? 73   HIS F O   1 
ATOM   9596  C CB  . HIS K 1 73  ? 18.752  63.676  -20.842 1.00 1.00   ? 73   HIS F CB  1 
ATOM   9597  C CG  . HIS K 1 73  ? 18.615  62.200  -20.789 1.00 6.41   ? 73   HIS F CG  1 
ATOM   9598  N ND1 . HIS K 1 73  ? 17.423  61.558  -20.600 1.00 9.52   ? 73   HIS F ND1 1 
ATOM   9599  C CD2 . HIS K 1 73  ? 19.544  61.256  -20.941 1.00 12.04  ? 73   HIS F CD2 1 
ATOM   9600  C CE1 . HIS K 1 73  ? 17.644  60.268  -20.628 1.00 10.29  ? 73   HIS F CE1 1 
ATOM   9601  N NE2 . HIS K 1 73  ? 18.916  60.051  -20.846 1.00 12.17  ? 73   HIS F NE2 1 
ATOM   9602  N N   . TYR K 1 74  ? 19.488  66.283  -19.559 1.00 8.27   ? 74   TYR F N   1 
ATOM   9603  C CA  . TYR K 1 74  ? 19.407  67.729  -19.685 1.00 9.83   ? 74   TYR F CA  1 
ATOM   9604  C C   . TYR K 1 74  ? 20.793  68.350  -19.828 1.00 14.80  ? 74   TYR F C   1 
ATOM   9605  O O   . TYR K 1 74  ? 21.076  69.112  -20.759 1.00 13.02  ? 74   TYR F O   1 
ATOM   9606  C CB  . TYR K 1 74  ? 18.649  68.373  -18.503 1.00 9.69   ? 74   TYR F CB  1 
ATOM   9607  C CG  . TYR K 1 74  ? 18.603  69.880  -18.574 1.00 11.22  ? 74   TYR F CG  1 
ATOM   9608  C CD1 . TYR K 1 74  ? 17.769  70.532  -19.476 1.00 11.17  ? 74   TYR F CD1 1 
ATOM   9609  C CD2 . TYR K 1 74  ? 19.383  70.685  -17.737 1.00 12.41  ? 74   TYR F CD2 1 
ATOM   9610  C CE1 . TYR K 1 74  ? 17.733  71.926  -19.534 1.00 10.74  ? 74   TYR F CE1 1 
ATOM   9611  C CE2 . TYR K 1 74  ? 19.432  72.076  -17.845 1.00 9.64   ? 74   TYR F CE2 1 
ATOM   9612  C CZ  . TYR K 1 74  ? 18.578  72.710  -18.746 1.00 19.86  ? 74   TYR F CZ  1 
ATOM   9613  O OH  . TYR K 1 74  ? 18.539  74.100  -18.845 1.00 17.49  ? 74   TYR F OH  1 
ATOM   9614  N N   . ILE K 1 75  ? 21.673  67.958  -18.914 1.00 4.94   ? 75   ILE F N   1 
ATOM   9615  C CA  . ILE K 1 75  ? 22.985  68.527  -18.955 1.00 4.38   ? 75   ILE F CA  1 
ATOM   9616  C C   . ILE K 1 75  ? 23.689  68.228  -20.234 1.00 15.50  ? 75   ILE F C   1 
ATOM   9617  O O   . ILE K 1 75  ? 24.309  69.078  -20.800 1.00 18.12  ? 75   ILE F O   1 
ATOM   9618  C CB  . ILE K 1 75  ? 23.754  68.020  -17.781 1.00 7.14   ? 75   ILE F CB  1 
ATOM   9619  C CG1 . ILE K 1 75  ? 22.997  68.432  -16.513 1.00 8.39   ? 75   ILE F CG1 1 
ATOM   9620  C CG2 . ILE K 1 75  ? 25.161  68.565  -17.792 1.00 2.67   ? 75   ILE F CG2 1 
ATOM   9621  C CD1 . ILE K 1 75  ? 23.536  67.727  -15.268 1.00 9.74   ? 75   ILE F CD1 1 
ATOM   9622  N N   . ALA K 1 76  ? 23.582  66.997  -20.682 1.00 8.97   ? 76   ALA F N   1 
ATOM   9623  C CA  . ALA K 1 76  ? 24.248  66.596  -21.883 1.00 6.89   ? 76   ALA F CA  1 
ATOM   9624  C C   . ALA K 1 76  ? 23.809  67.462  -23.017 1.00 14.31  ? 76   ALA F C   1 
ATOM   9625  O O   . ALA K 1 76  ? 24.565  67.949  -23.799 1.00 16.32  ? 76   ALA F O   1 
ATOM   9626  C CB  . ALA K 1 76  ? 23.933  65.140  -22.205 1.00 7.25   ? 76   ALA F CB  1 
ATOM   9627  N N   . ASP K 1 77  ? 22.548  67.635  -23.097 1.00 12.04  ? 77   ASP F N   1 
ATOM   9628  C CA  . ASP K 1 77  ? 21.984  68.424  -24.145 1.00 8.15   ? 77   ASP F CA  1 
ATOM   9629  C C   . ASP K 1 77  ? 22.340  69.884  -24.000 1.00 20.17  ? 77   ASP F C   1 
ATOM   9630  O O   . ASP K 1 77  ? 22.391  70.599  -24.966 1.00 27.38  ? 77   ASP F O   1 
ATOM   9631  C CB  . ASP K 1 77  ? 20.463  68.241  -24.148 1.00 1.30   ? 77   ASP F CB  1 
ATOM   9632  C CG  . ASP K 1 77  ? 20.049  67.243  -25.193 1.00 15.64  ? 77   ASP F CG  1 
ATOM   9633  O OD1 . ASP K 1 77  ? 20.795  66.867  -26.108 1.00 25.53  ? 77   ASP F OD1 1 
ATOM   9634  O OD2 . ASP K 1 77  ? 18.814  66.830  -25.018 1.00 25.03  ? 77   ASP F OD2 1 
ATOM   9635  N N   . LYS K 1 78  ? 22.565  70.365  -22.804 1.00 13.84  ? 78   LYS F N   1 
ATOM   9636  C CA  . LYS K 1 78  ? 22.979  71.746  -22.712 1.00 8.75   ? 78   LYS F CA  1 
ATOM   9637  C C   . LYS K 1 78  ? 24.473  71.800  -22.993 1.00 21.37  ? 78   LYS F C   1 
ATOM   9638  O O   . LYS K 1 78  ? 25.059  72.850  -22.997 1.00 25.64  ? 78   LYS F O   1 
ATOM   9639  C CB  . LYS K 1 78  ? 22.854  72.336  -21.292 1.00 6.78   ? 78   LYS F CB  1 
ATOM   9640  C CG  . LYS K 1 78  ? 21.442  72.446  -20.826 1.00 40.33  ? 78   LYS F CG  1 
ATOM   9641  C CD  . LYS K 1 78  ? 20.582  73.094  -21.888 1.00 42.81  ? 78   LYS F CD  1 
ATOM   9642  C CE  . LYS K 1 78  ? 20.612  74.627  -21.871 1.00 47.35  ? 78   LYS F CE  1 
ATOM   9643  N NZ  . LYS K 1 78  ? 20.012  75.254  -23.071 1.00 69.76  ? 78   LYS F NZ  1 
ATOM   9644  N N   . HIS K 1 79  ? 25.169  70.692  -23.083 1.00 16.29  ? 79   HIS F N   1 
ATOM   9645  C CA  . HIS K 1 79  ? 26.586  70.885  -23.239 1.00 10.72  ? 79   HIS F CA  1 
ATOM   9646  C C   . HIS K 1 79  ? 27.267  70.082  -24.290 1.00 14.66  ? 79   HIS F C   1 
ATOM   9647  O O   . HIS K 1 79  ? 28.402  69.681  -24.070 1.00 6.93   ? 79   HIS F O   1 
ATOM   9648  C CB  . HIS K 1 79  ? 27.311  70.588  -21.968 1.00 10.30  ? 79   HIS F CB  1 
ATOM   9649  C CG  . HIS K 1 79  ? 27.068  71.630  -20.974 1.00 20.66  ? 79   HIS F CG  1 
ATOM   9650  N ND1 . HIS K 1 79  ? 26.092  71.483  -20.016 1.00 29.24  ? 79   HIS F ND1 1 
ATOM   9651  C CD2 . HIS K 1 79  ? 27.685  72.812  -20.758 1.00 21.04  ? 79   HIS F CD2 1 
ATOM   9652  C CE1 . HIS K 1 79  ? 26.128  72.567  -19.227 1.00 23.80  ? 79   HIS F CE1 1 
ATOM   9653  N NE2 . HIS K 1 79  ? 27.077  73.367  -19.657 1.00 19.97  ? 79   HIS F NE2 1 
ATOM   9654  N N   . ASN K 1 80  ? 26.578  69.823  -25.388 1.00 17.51  ? 80   ASN F N   1 
ATOM   9655  C CA  . ASN K 1 80  ? 27.199  69.032  -26.403 1.00 17.97  ? 80   ASN F CA  1 
ATOM   9656  C C   . ASN K 1 80  ? 27.754  67.692  -25.976 1.00 23.47  ? 80   ASN F C   1 
ATOM   9657  O O   . ASN K 1 80  ? 28.805  67.252  -26.467 1.00 33.09  ? 80   ASN F O   1 
ATOM   9658  C CB  . ASN K 1 80  ? 28.285  69.834  -27.096 1.00 22.81  ? 80   ASN F CB  1 
ATOM   9659  C CG  . ASN K 1 80  ? 28.699  69.260  -28.413 1.00 56.00  ? 80   ASN F CG  1 
ATOM   9660  O OD1 . ASN K 1 80  ? 29.907  69.130  -28.636 1.00 61.63  ? 80   ASN F OD1 1 
ATOM   9661  N ND2 . ASN K 1 80  ? 27.720  69.002  -29.294 1.00 50.44  ? 80   ASN F ND2 1 
ATOM   9662  N N   . LEU K 1 81  ? 27.051  67.011  -25.093 1.00 17.49  ? 81   LEU F N   1 
ATOM   9663  C CA  . LEU K 1 81  ? 27.538  65.701  -24.710 1.00 12.09  ? 81   LEU F CA  1 
ATOM   9664  C C   . LEU K 1 81  ? 26.571  64.655  -25.186 1.00 9.79   ? 81   LEU F C   1 
ATOM   9665  O O   . LEU K 1 81  ? 26.643  63.526  -24.742 1.00 9.64   ? 81   LEU F O   1 
ATOM   9666  C CB  . LEU K 1 81  ? 27.729  65.542  -23.222 1.00 6.52   ? 81   LEU F CB  1 
ATOM   9667  C CG  . LEU K 1 81  ? 28.690  66.555  -22.678 1.00 4.24   ? 81   LEU F CG  1 
ATOM   9668  C CD1 . LEU K 1 81  ? 28.547  66.577  -21.141 1.00 2.56   ? 81   LEU F CD1 1 
ATOM   9669  C CD2 . LEU K 1 81  ? 30.056  65.998  -22.929 1.00 1.00   ? 81   LEU F CD2 1 
ATOM   9670  N N   . PHE K 1 82  ? 25.696  65.042  -26.098 1.00 7.16   ? 82   PHE F N   1 
ATOM   9671  C CA  . PHE K 1 82  ? 24.644  64.115  -26.588 1.00 7.97   ? 82   PHE F CA  1 
ATOM   9672  C C   . PHE K 1 82  ? 24.641  63.838  -28.077 1.00 16.81  ? 82   PHE F C   1 
ATOM   9673  O O   . PHE K 1 82  ? 23.609  63.520  -28.690 1.00 19.23  ? 82   PHE F O   1 
ATOM   9674  C CB  . PHE K 1 82  ? 23.230  64.536  -26.162 1.00 4.68   ? 82   PHE F CB  1 
ATOM   9675  C CG  . PHE K 1 82  ? 22.427  63.420  -25.577 1.00 9.05   ? 82   PHE F CG  1 
ATOM   9676  C CD1 . PHE K 1 82  ? 22.557  62.101  -26.040 1.00 15.06  ? 82   PHE F CD1 1 
ATOM   9677  C CD2 . PHE K 1 82  ? 21.504  63.681  -24.562 1.00 10.50  ? 82   PHE F CD2 1 
ATOM   9678  C CE1 . PHE K 1 82  ? 21.799  61.035  -25.548 1.00 9.59   ? 82   PHE F CE1 1 
ATOM   9679  C CE2 . PHE K 1 82  ? 20.723  62.636  -24.072 1.00 11.51  ? 82   PHE F CE2 1 
ATOM   9680  C CZ  . PHE K 1 82  ? 20.868  61.324  -24.549 1.00 7.34   ? 82   PHE F CZ  1 
ATOM   9681  N N   . GLY K 1 83  ? 25.816  63.948  -28.665 1.00 16.51  ? 83   GLY F N   1 
ATOM   9682  C CA  . GLY K 1 83  ? 25.903  63.674  -30.067 1.00 18.16  ? 83   GLY F CA  1 
ATOM   9683  C C   . GLY K 1 83  ? 25.558  64.876  -30.904 1.00 19.47  ? 83   GLY F C   1 
ATOM   9684  O O   . GLY K 1 83  ? 25.399  65.964  -30.358 1.00 16.68  ? 83   GLY F O   1 
ATOM   9685  N N   . LYS K 1 84  ? 25.442  64.626  -32.207 1.00 16.34  ? 84   LYS F N   1 
ATOM   9686  C CA  . LYS K 1 84  ? 25.171  65.638  -33.213 1.00 15.03  ? 84   LYS F CA  1 
ATOM   9687  C C   . LYS K 1 84  ? 24.009  65.236  -34.086 1.00 25.33  ? 84   LYS F C   1 
ATOM   9688  O O   . LYS K 1 84  ? 23.502  65.996  -34.887 1.00 23.09  ? 84   LYS F O   1 
ATOM   9689  C CB  . LYS K 1 84  ? 26.435  66.093  -33.963 1.00 10.79  ? 84   LYS F CB  1 
ATOM   9690  C CG  . LYS K 1 84  ? 27.324  66.799  -32.926 1.00 32.78  ? 84   LYS F CG  1 
ATOM   9691  C CD  . LYS K 1 84  ? 28.467  67.671  -33.440 1.00 30.09  ? 84   LYS F CD  1 
ATOM   9692  C CE  . LYS K 1 84  ? 28.889  68.831  -32.520 1.00 51.57  ? 84   LYS F CE  1 
ATOM   9693  N NZ  . LYS K 1 84  ? 30.190  69.445  -32.903 1.00 126.63 ? 84   LYS F NZ  1 
ATOM   9694  N N   . ASN K 1 85  ? 23.475  64.062  -33.808 1.00 25.00  ? 85   ASN F N   1 
ATOM   9695  C CA  . ASN K 1 85  ? 22.318  63.635  -34.545 1.00 19.70  ? 85   ASN F CA  1 
ATOM   9696  C C   . ASN K 1 85  ? 21.623  62.430  -33.908 1.00 22.04  ? 85   ASN F C   1 
ATOM   9697  O O   . ASN K 1 85  ? 22.197  61.757  -33.053 1.00 31.75  ? 85   ASN F O   1 
ATOM   9698  C CB  . ASN K 1 85  ? 22.731  63.415  -36.003 1.00 10.80  ? 85   ASN F CB  1 
ATOM   9699  C CG  . ASN K 1 85  ? 23.544  62.161  -36.167 1.00 18.33  ? 85   ASN F CG  1 
ATOM   9700  O OD1 . ASN K 1 85  ? 23.137  61.054  -35.790 1.00 71.35  ? 85   ASN F OD1 1 
ATOM   9701  N ND2 . ASN K 1 85  ? 24.761  62.364  -36.555 1.00 19.54  ? 85   ASN F ND2 1 
ATOM   9702  N N   . LEU K 1 86  ? 20.413  62.115  -34.383 1.00 13.64  ? 86   LEU F N   1 
ATOM   9703  C CA  . LEU K 1 86  ? 19.636  61.009  -33.849 1.00 7.94   ? 86   LEU F CA  1 
ATOM   9704  C C   . LEU K 1 86  ? 20.402  59.720  -33.717 1.00 14.84  ? 86   LEU F C   1 
ATOM   9705  O O   . LEU K 1 86  ? 20.313  59.001  -32.713 1.00 20.25  ? 86   LEU F O   1 
ATOM   9706  C CB  . LEU K 1 86  ? 18.364  60.745  -34.648 1.00 4.53   ? 86   LEU F CB  1 
ATOM   9707  C CG  . LEU K 1 86  ? 17.390  59.844  -33.907 1.00 10.05  ? 86   LEU F CG  1 
ATOM   9708  C CD1 . LEU K 1 86  ? 17.222  60.343  -32.505 1.00 13.10  ? 86   LEU F CD1 1 
ATOM   9709  C CD2 . LEU K 1 86  ? 16.021  59.924  -34.511 1.00 8.38   ? 86   LEU F CD2 1 
ATOM   9710  N N   . LYS K 1 87  ? 21.159  59.445  -34.755 1.00 12.86  ? 87   LYS F N   1 
ATOM   9711  C CA  . LYS K 1 87  ? 21.927  58.212  -34.794 1.00 16.47  ? 87   LYS F CA  1 
ATOM   9712  C C   . LYS K 1 87  ? 22.855  58.081  -33.641 1.00 17.63  ? 87   LYS F C   1 
ATOM   9713  O O   . LYS K 1 87  ? 22.845  57.069  -32.965 1.00 27.41  ? 87   LYS F O   1 
ATOM   9714  C CB  . LYS K 1 87  ? 22.509  57.874  -36.160 1.00 18.47  ? 87   LYS F CB  1 
ATOM   9715  C CG  . LYS K 1 87  ? 21.383  57.856  -37.211 1.00 136.90 ? 87   LYS F CG  1 
ATOM   9716  C CD  . LYS K 1 87  ? 20.051  57.235  -36.719 1.00 174.68 ? 87   LYS F CD  1 
ATOM   9717  C CE  . LYS K 1 87  ? 18.819  57.501  -37.616 1.00 151.33 ? 87   LYS F CE  1 
ATOM   9718  N NZ  . LYS K 1 87  ? 17.582  56.731  -37.289 1.00 58.97  ? 87   LYS F NZ  1 
ATOM   9719  N N   . GLU K 1 88  ? 23.592  59.144  -33.440 1.00 8.70   ? 88   GLU F N   1 
ATOM   9720  C CA  . GLU K 1 88  ? 24.532  59.264  -32.364 1.00 11.62  ? 88   GLU F CA  1 
ATOM   9721  C C   . GLU K 1 88  ? 23.848  59.224  -31.041 1.00 18.30  ? 88   GLU F C   1 
ATOM   9722  O O   . GLU K 1 88  ? 24.200  58.468  -30.143 1.00 23.26  ? 88   GLU F O   1 
ATOM   9723  C CB  . GLU K 1 88  ? 25.259  60.618  -32.473 1.00 14.39  ? 88   GLU F CB  1 
ATOM   9724  C CG  . GLU K 1 88  ? 26.208  60.641  -33.687 1.00 5.07   ? 88   GLU F CG  1 
ATOM   9725  C CD  . GLU K 1 88  ? 27.149  61.819  -33.879 1.00 21.29  ? 88   GLU F CD  1 
ATOM   9726  O OE1 . GLU K 1 88  ? 27.381  62.762  -33.072 1.00 20.61  ? 88   GLU F OE1 1 
ATOM   9727  O OE2 . GLU K 1 88  ? 27.858  61.585  -34.969 1.00 24.75  ? 88   GLU F OE2 1 
ATOM   9728  N N   . ARG K 1 89  ? 22.903  60.119  -30.929 1.00 10.56  ? 89   ARG F N   1 
ATOM   9729  C CA  . ARG K 1 89  ? 22.122  60.266  -29.742 1.00 9.51   ? 89   ARG F CA  1 
ATOM   9730  C C   . ARG K 1 89  ? 21.591  58.923  -29.336 1.00 9.97   ? 89   ARG F C   1 
ATOM   9731  O O   . ARG K 1 89  ? 21.649  58.468  -28.186 1.00 10.78  ? 89   ARG F O   1 
ATOM   9732  C CB  . ARG K 1 89  ? 20.936  61.066  -30.115 1.00 3.43   ? 89   ARG F CB  1 
ATOM   9733  C CG  . ARG K 1 89  ? 20.340  61.566  -28.852 1.00 18.27  ? 89   ARG F CG  1 
ATOM   9734  C CD  . ARG K 1 89  ? 19.227  62.556  -29.138 1.00 6.77   ? 89   ARG F CD  1 
ATOM   9735  N NE  . ARG K 1 89  ? 18.612  62.986  -27.933 1.00 16.25  ? 89   ARG F NE  1 
ATOM   9736  C CZ  . ARG K 1 89  ? 18.903  64.078  -27.268 1.00 15.11  ? 89   ARG F CZ  1 
ATOM   9737  N NH1 . ARG K 1 89  ? 19.803  64.954  -27.715 1.00 14.64  ? 89   ARG F NH1 1 
ATOM   9738  N NH2 . ARG K 1 89  ? 18.255  64.259  -26.103 1.00 33.37  ? 89   ARG F NH2 1 
ATOM   9739  N N   . THR K 1 90  ? 21.149  58.214  -30.345 1.00 1.00   ? 90   THR F N   1 
ATOM   9740  C CA  . THR K 1 90  ? 20.634  56.868  -30.056 1.00 1.00   ? 90   THR F CA  1 
ATOM   9741  C C   . THR K 1 90  ? 21.664  55.909  -29.419 1.00 12.66  ? 90   THR F C   1 
ATOM   9742  O O   . THR K 1 90  ? 21.401  55.212  -28.426 1.00 12.11  ? 90   THR F O   1 
ATOM   9743  C CB  . THR K 1 90  ? 19.947  56.307  -31.285 1.00 11.57  ? 90   THR F CB  1 
ATOM   9744  O OG1 . THR K 1 90  ? 18.944  57.183  -31.772 1.00 20.47  ? 90   THR F OG1 1 
ATOM   9745  C CG2 . THR K 1 90  ? 19.375  54.986  -30.943 1.00 1.00   ? 90   THR F CG2 1 
ATOM   9746  N N   . LEU K 1 91  ? 22.895  55.943  -29.951 1.00 5.25   ? 91   LEU F N   1 
ATOM   9747  C CA  . LEU K 1 91  ? 23.961  55.116  -29.450 1.00 1.00   ? 91   LEU F CA  1 
ATOM   9748  C C   . LEU K 1 91  ? 24.355  55.475  -28.059 1.00 9.46   ? 91   LEU F C   1 
ATOM   9749  O O   . LEU K 1 91  ? 24.498  54.633  -27.187 1.00 13.34  ? 91   LEU F O   1 
ATOM   9750  C CB  . LEU K 1 91  ? 25.156  55.304  -30.357 1.00 2.65   ? 91   LEU F CB  1 
ATOM   9751  C CG  . LEU K 1 91  ? 24.872  54.675  -31.720 1.00 6.82   ? 91   LEU F CG  1 
ATOM   9752  C CD1 . LEU K 1 91  ? 25.951  54.985  -32.700 1.00 2.85   ? 91   LEU F CD1 1 
ATOM   9753  C CD2 . LEU K 1 91  ? 24.890  53.182  -31.624 1.00 1.00   ? 91   LEU F CD2 1 
ATOM   9754  N N   . ILE K 1 92  ? 24.527  56.756  -27.875 1.00 6.98   ? 92   ILE F N   1 
ATOM   9755  C CA  . ILE K 1 92  ? 24.937  57.288  -26.605 1.00 5.61   ? 92   ILE F CA  1 
ATOM   9756  C C   . ILE K 1 92  ? 23.937  56.895  -25.571 1.00 12.34  ? 92   ILE F C   1 
ATOM   9757  O O   . ILE K 1 92  ? 24.284  56.475  -24.474 1.00 16.34  ? 92   ILE F O   1 
ATOM   9758  C CB  . ILE K 1 92  ? 24.981  58.791  -26.765 1.00 9.15   ? 92   ILE F CB  1 
ATOM   9759  C CG1 . ILE K 1 92  ? 26.089  59.103  -27.749 1.00 9.09   ? 92   ILE F CG1 1 
ATOM   9760  C CG2 . ILE K 1 92  ? 25.174  59.535  -25.457 1.00 4.91   ? 92   ILE F CG2 1 
ATOM   9761  C CD1 . ILE K 1 92  ? 26.392  60.569  -27.896 1.00 7.16   ? 92   ILE F CD1 1 
ATOM   9762  N N   . ASP K 1 93  ? 22.675  56.989  -25.958 1.00 5.23   ? 93   ASP F N   1 
ATOM   9763  C CA  . ASP K 1 93  ? 21.624  56.641  -25.027 1.00 3.41   ? 93   ASP F CA  1 
ATOM   9764  C C   . ASP K 1 93  ? 21.720  55.189  -24.567 1.00 13.46  ? 93   ASP F C   1 
ATOM   9765  O O   . ASP K 1 93  ? 21.807  54.862  -23.361 1.00 8.81   ? 93   ASP F O   1 
ATOM   9766  C CB  . ASP K 1 93  ? 20.297  56.970  -25.691 1.00 3.72   ? 93   ASP F CB  1 
ATOM   9767  C CG  . ASP K 1 93  ? 19.021  56.871  -24.856 1.00 15.82  ? 93   ASP F CG  1 
ATOM   9768  O OD1 . ASP K 1 93  ? 18.991  56.503  -23.708 1.00 13.84  ? 93   ASP F OD1 1 
ATOM   9769  O OD2 . ASP K 1 93  ? 17.954  57.280  -25.521 1.00 24.47  ? 93   ASP F OD2 1 
ATOM   9770  N N   . MET K 1 94  ? 21.806  54.319  -25.548 1.00 7.44   ? 94   MET F N   1 
ATOM   9771  C CA  . MET K 1 94  ? 21.921  52.948  -25.197 1.00 1.95   ? 94   MET F CA  1 
ATOM   9772  C C   . MET K 1 94  ? 23.108  52.633  -24.370 1.00 4.64   ? 94   MET F C   1 
ATOM   9773  O O   . MET K 1 94  ? 23.033  51.849  -23.427 1.00 7.26   ? 94   MET F O   1 
ATOM   9774  C CB  . MET K 1 94  ? 22.006  52.155  -26.452 1.00 4.75   ? 94   MET F CB  1 
ATOM   9775  C CG  . MET K 1 94  ? 20.707  52.161  -27.276 1.00 9.41   ? 94   MET F CG  1 
ATOM   9776  S SD  . MET K 1 94  ? 20.881  51.134  -28.812 1.00 14.86  ? 94   MET F SD  1 
ATOM   9777  C CE  . MET K 1 94  ? 19.912  49.841  -28.032 1.00 13.63  ? 94   MET F CE  1 
ATOM   9778  N N   . TYR K 1 95  ? 24.225  53.234  -24.733 1.00 3.29   ? 95   TYR F N   1 
ATOM   9779  C CA  . TYR K 1 95  ? 25.443  52.923  -24.022 1.00 1.00   ? 95   TYR F CA  1 
ATOM   9780  C C   . TYR K 1 95  ? 25.290  53.308  -22.600 1.00 6.98   ? 95   TYR F C   1 
ATOM   9781  O O   . TYR K 1 95  ? 25.626  52.618  -21.651 1.00 7.33   ? 95   TYR F O   1 
ATOM   9782  C CB  . TYR K 1 95  ? 26.613  53.724  -24.573 1.00 2.91   ? 95   TYR F CB  1 
ATOM   9783  C CG  . TYR K 1 95  ? 26.915  53.294  -25.984 1.00 8.52   ? 95   TYR F CG  1 
ATOM   9784  C CD1 . TYR K 1 95  ? 26.322  52.129  -26.462 1.00 4.73   ? 95   TYR F CD1 1 
ATOM   9785  C CD2 . TYR K 1 95  ? 27.800  53.983  -26.833 1.00 10.51  ? 95   TYR F CD2 1 
ATOM   9786  C CE1 . TYR K 1 95  ? 26.583  51.717  -27.771 1.00 6.52   ? 95   TYR F CE1 1 
ATOM   9787  C CE2 . TYR K 1 95  ? 28.093  53.564  -28.140 1.00 4.52   ? 95   TYR F CE2 1 
ATOM   9788  C CZ  . TYR K 1 95  ? 27.454  52.418  -28.615 1.00 16.64  ? 95   TYR F CZ  1 
ATOM   9789  O OH  . TYR K 1 95  ? 27.656  51.957  -29.900 1.00 17.95  ? 95   TYR F OH  1 
ATOM   9790  N N   . VAL K 1 96  ? 24.751  54.461  -22.471 1.00 4.16   ? 96   VAL F N   1 
ATOM   9791  C CA  . VAL K 1 96  ? 24.536  54.955  -21.152 1.00 2.88   ? 96   VAL F CA  1 
ATOM   9792  C C   . VAL K 1 96  ? 23.621  54.083  -20.335 1.00 6.46   ? 96   VAL F C   1 
ATOM   9793  O O   . VAL K 1 96  ? 23.914  53.771  -19.194 1.00 6.51   ? 96   VAL F O   1 
ATOM   9794  C CB  . VAL K 1 96  ? 23.939  56.312  -21.246 1.00 3.29   ? 96   VAL F CB  1 
ATOM   9795  C CG1 . VAL K 1 96  ? 23.545  56.680  -19.859 1.00 1.56   ? 96   VAL F CG1 1 
ATOM   9796  C CG2 . VAL K 1 96  ? 24.990  57.283  -21.699 1.00 4.65   ? 96   VAL F CG2 1 
ATOM   9797  N N   . GLU K 1 97  ? 22.477  53.705  -20.891 1.00 1.62   ? 97   GLU F N   1 
ATOM   9798  C CA  . GLU K 1 97  ? 21.588  52.858  -20.090 1.00 2.81   ? 97   GLU F CA  1 
ATOM   9799  C C   . GLU K 1 97  ? 22.232  51.548  -19.706 1.00 9.85   ? 97   GLU F C   1 
ATOM   9800  O O   . GLU K 1 97  ? 22.124  51.081  -18.564 1.00 10.22  ? 97   GLU F O   1 
ATOM   9801  C CB  . GLU K 1 97  ? 20.249  52.589  -20.754 1.00 6.17   ? 97   GLU F CB  1 
ATOM   9802  C CG  . GLU K 1 97  ? 19.512  53.874  -21.113 1.00 3.05   ? 97   GLU F CG  1 
ATOM   9803  C CD  . GLU K 1 97  ? 19.024  54.601  -19.864 1.00 17.39  ? 97   GLU F CD  1 
ATOM   9804  O OE1 . GLU K 1 97  ? 18.700  53.994  -18.873 1.00 7.10   ? 97   GLU F OE1 1 
ATOM   9805  O OE2 . GLU K 1 97  ? 18.856  55.923  -20.010 1.00 19.34  ? 97   GLU F OE2 1 
ATOM   9806  N N   . GLY K 1 98  ? 22.915  50.956  -20.664 1.00 7.21   ? 98   GLY F N   1 
ATOM   9807  C CA  . GLY K 1 98  ? 23.580  49.695  -20.365 1.00 2.67   ? 98   GLY F CA  1 
ATOM   9808  C C   . GLY K 1 98  ? 24.567  49.904  -19.255 1.00 3.56   ? 98   GLY F C   1 
ATOM   9809  O O   . GLY K 1 98  ? 24.606  49.197  -18.260 1.00 5.22   ? 98   GLY F O   1 
ATOM   9810  N N   . THR K 1 99  ? 25.337  50.949  -19.393 1.00 2.16   ? 99   THR F N   1 
ATOM   9811  C CA  . THR K 1 99  ? 26.329  51.248  -18.367 1.00 2.83   ? 99   THR F CA  1 
ATOM   9812  C C   . THR K 1 99  ? 25.740  51.471  -16.986 1.00 12.76  ? 99   THR F C   1 
ATOM   9813  O O   . THR K 1 99  ? 26.214  50.885  -16.011 1.00 12.87  ? 99   THR F O   1 
ATOM   9814  C CB  . THR K 1 99  ? 27.227  52.394  -18.777 1.00 7.66   ? 99   THR F CB  1 
ATOM   9815  O OG1 . THR K 1 99  ? 27.640  52.210  -20.130 1.00 6.21   ? 99   THR F OG1 1 
ATOM   9816  C CG2 . THR K 1 99  ? 28.387  52.474  -17.803 1.00 2.99   ? 99   THR F CG2 1 
ATOM   9817  N N   . LEU K 1 100 ? 24.658  52.251  -16.912 1.00 6.88   ? 100  LEU F N   1 
ATOM   9818  C CA  . LEU K 1 100 ? 23.957  52.462  -15.634 1.00 3.94   ? 100  LEU F CA  1 
ATOM   9819  C C   . LEU K 1 100 ? 23.495  51.144  -15.010 1.00 8.49   ? 100  LEU F C   1 
ATOM   9820  O O   . LEU K 1 100 ? 23.396  50.962  -13.779 1.00 13.34  ? 100  LEU F O   1 
ATOM   9821  C CB  . LEU K 1 100 ? 22.762  53.373  -15.847 1.00 4.11   ? 100  LEU F CB  1 
ATOM   9822  C CG  . LEU K 1 100 ? 23.140  54.836  -16.142 1.00 8.88   ? 100  LEU F CG  1 
ATOM   9823  C CD1 . LEU K 1 100 ? 21.873  55.679  -16.159 1.00 2.21   ? 100  LEU F CD1 1 
ATOM   9824  C CD2 . LEU K 1 100 ? 24.027  55.353  -14.996 1.00 1.00   ? 100  LEU F CD2 1 
ATOM   9825  N N   . ASP K 1 101 ? 23.245  50.178  -15.856 1.00 1.00   ? 101  ASP F N   1 
ATOM   9826  C CA  . ASP K 1 101 ? 22.870  48.905  -15.291 1.00 2.36   ? 101  ASP F CA  1 
ATOM   9827  C C   . ASP K 1 101 ? 24.019  48.212  -14.583 1.00 8.45   ? 101  ASP F C   1 
ATOM   9828  O O   . ASP K 1 101 ? 23.860  47.430  -13.675 1.00 12.15  ? 101  ASP F O   1 
ATOM   9829  C CB  . ASP K 1 101 ? 22.365  47.983  -16.377 1.00 1.77   ? 101  ASP F CB  1 
ATOM   9830  C CG  . ASP K 1 101 ? 20.943  48.226  -16.844 1.00 3.77   ? 101  ASP F CG  1 
ATOM   9831  O OD1 . ASP K 1 101 ? 20.213  49.080  -16.366 1.00 14.68  ? 101  ASP F OD1 1 
ATOM   9832  O OD2 . ASP K 1 101 ? 20.705  47.571  -17.960 1.00 33.03  ? 101  ASP F OD2 1 
ATOM   9833  N N   . LEU K 1 102 ? 25.193  48.494  -15.030 1.00 8.68   ? 102  LEU F N   1 
ATOM   9834  C CA  . LEU K 1 102 ? 26.374  47.940  -14.439 1.00 4.32   ? 102  LEU F CA  1 
ATOM   9835  C C   . LEU K 1 102 ? 26.706  48.706  -13.197 1.00 10.80  ? 102  LEU F C   1 
ATOM   9836  O O   . LEU K 1 102 ? 26.940  48.166  -12.142 1.00 14.15  ? 102  LEU F O   1 
ATOM   9837  C CB  . LEU K 1 102 ? 27.506  48.124  -15.444 1.00 3.76   ? 102  LEU F CB  1 
ATOM   9838  C CG  . LEU K 1 102 ? 28.890  47.559  -15.044 1.00 10.55  ? 102  LEU F CG  1 
ATOM   9839  C CD1 . LEU K 1 102 ? 28.895  46.147  -14.491 1.00 3.28   ? 102  LEU F CD1 1 
ATOM   9840  C CD2 . LEU K 1 102 ? 29.853  47.630  -16.214 1.00 8.71   ? 102  LEU F CD2 1 
ATOM   9841  N N   . LEU K 1 103 ? 26.693  50.002  -13.329 1.00 6.51   ? 103  LEU F N   1 
ATOM   9842  C CA  . LEU K 1 103 ? 26.955  50.872  -12.222 1.00 1.50   ? 103  LEU F CA  1 
ATOM   9843  C C   . LEU K 1 103 ? 26.062  50.610  -11.039 1.00 3.09   ? 103  LEU F C   1 
ATOM   9844  O O   . LEU K 1 103 ? 26.424  50.786  -9.892  1.00 11.31  ? 103  LEU F O   1 
ATOM   9845  C CB  . LEU K 1 103 ? 26.704  52.276  -12.690 1.00 1.77   ? 103  LEU F CB  1 
ATOM   9846  C CG  . LEU K 1 103 ? 27.040  53.353  -11.655 1.00 6.67   ? 103  LEU F CG  1 
ATOM   9847  C CD1 . LEU K 1 103 ? 28.522  53.385  -11.316 1.00 1.00   ? 103  LEU F CD1 1 
ATOM   9848  C CD2 . LEU K 1 103 ? 26.732  54.682  -12.318 1.00 5.13   ? 103  LEU F CD2 1 
ATOM   9849  N N   . GLU K 1 104 ? 24.875  50.174  -11.304 1.00 3.47   ? 104  GLU F N   1 
ATOM   9850  C CA  . GLU K 1 104 ? 23.943  49.885  -10.243 1.00 3.16   ? 104  GLU F CA  1 
ATOM   9851  C C   . GLU K 1 104 ? 24.470  48.927  -9.226  1.00 10.60  ? 104  GLU F C   1 
ATOM   9852  O O   . GLU K 1 104 ? 24.271  49.049  -8.045  1.00 15.54  ? 104  GLU F O   1 
ATOM   9853  C CB  . GLU K 1 104 ? 22.719  49.273  -10.858 1.00 4.44   ? 104  GLU F CB  1 
ATOM   9854  C CG  . GLU K 1 104 ? 21.573  49.261  -9.873  1.00 1.00   ? 104  GLU F CG  1 
ATOM   9855  C CD  . GLU K 1 104 ? 21.093  50.616  -9.431  1.00 11.35  ? 104  GLU F CD  1 
ATOM   9856  O OE1 . GLU K 1 104 ? 21.433  51.666  -9.988  1.00 33.25  ? 104  GLU F OE1 1 
ATOM   9857  O OE2 . GLU K 1 104 ? 20.230  50.503  -8.431  1.00 12.49  ? 104  GLU F OE2 1 
ATOM   9858  N N   . LEU K 1 105 ? 25.187  47.974  -9.698  1.00 7.71   ? 105  LEU F N   1 
ATOM   9859  C CA  . LEU K 1 105 ? 25.811  47.036  -8.800  1.00 2.89   ? 105  LEU F CA  1 
ATOM   9860  C C   . LEU K 1 105 ? 26.690  47.738  -7.769  1.00 9.81   ? 105  LEU F C   1 
ATOM   9861  O O   . LEU K 1 105 ? 26.773  47.394  -6.577  1.00 13.77  ? 105  LEU F O   1 
ATOM   9862  C CB  . LEU K 1 105 ? 26.706  46.096  -9.619  1.00 3.27   ? 105  LEU F CB  1 
ATOM   9863  C CG  . LEU K 1 105 ? 25.959  45.266  -10.678 1.00 6.52   ? 105  LEU F CG  1 
ATOM   9864  C CD1 . LEU K 1 105 ? 26.779  44.123  -11.268 1.00 4.87   ? 105  LEU F CD1 1 
ATOM   9865  C CD2 . LEU K 1 105 ? 24.675  44.746  -10.124 1.00 1.00   ? 105  LEU F CD2 1 
ATOM   9866  N N   . LEU K 1 106 ? 27.375  48.727  -8.260  1.00 7.80   ? 106  LEU F N   1 
ATOM   9867  C CA  . LEU K 1 106 ? 28.237  49.479  -7.372  1.00 6.10   ? 106  LEU F CA  1 
ATOM   9868  C C   . LEU K 1 106 ? 27.403  50.275  -6.374  1.00 14.47  ? 106  LEU F C   1 
ATOM   9869  O O   . LEU K 1 106 ? 27.731  50.337  -5.162  1.00 13.94  ? 106  LEU F O   1 
ATOM   9870  C CB  . LEU K 1 106 ? 29.019  50.485  -8.183  1.00 1.05   ? 106  LEU F CB  1 
ATOM   9871  C CG  . LEU K 1 106 ? 30.386  50.057  -8.722  1.00 1.18   ? 106  LEU F CG  1 
ATOM   9872  C CD1 . LEU K 1 106 ? 31.178  49.247  -7.709  1.00 1.00   ? 106  LEU F CD1 1 
ATOM   9873  C CD2 . LEU K 1 106 ? 30.213  49.339  -10.020 1.00 6.50   ? 106  LEU F CD2 1 
ATOM   9874  N N   . ILE K 1 107 ? 26.333  50.912  -6.906  1.00 5.24   ? 107  ILE F N   1 
ATOM   9875  C CA  . ILE K 1 107 ? 25.386  51.693  -6.076  1.00 4.29   ? 107  ILE F CA  1 
ATOM   9876  C C   . ILE K 1 107 ? 24.723  50.929  -4.948  1.00 16.36  ? 107  ILE F C   1 
ATOM   9877  O O   . ILE K 1 107 ? 24.618  51.468  -3.817  1.00 26.57  ? 107  ILE F O   1 
ATOM   9878  C CB  . ILE K 1 107 ? 24.327  52.374  -6.873  1.00 7.23   ? 107  ILE F CB  1 
ATOM   9879  C CG1 . ILE K 1 107 ? 25.067  53.352  -7.730  1.00 2.25   ? 107  ILE F CG1 1 
ATOM   9880  C CG2 . ILE K 1 107 ? 23.277  53.057  -6.000  1.00 6.37   ? 107  ILE F CG2 1 
ATOM   9881  C CD1 . ILE K 1 107 ? 24.172  53.985  -8.705  1.00 1.00   ? 107  ILE F CD1 1 
ATOM   9882  N N   . MET K 1 108 ? 24.301  49.702  -5.273  1.00 6.24   ? 108  MET F N   1 
ATOM   9883  C CA  . MET K 1 108 ? 23.692  48.848  -4.278  1.00 11.25  ? 108  MET F CA  1 
ATOM   9884  C C   . MET K 1 108 ? 24.646  48.242  -3.282  1.00 14.93  ? 108  MET F C   1 
ATOM   9885  O O   . MET K 1 108 ? 24.265  47.888  -2.193  1.00 18.42  ? 108  MET F O   1 
ATOM   9886  C CB  . MET K 1 108 ? 22.935  47.662  -4.861  1.00 16.55  ? 108  MET F CB  1 
ATOM   9887  C CG  . MET K 1 108 ? 21.993  47.992  -6.021  1.00 34.20  ? 108  MET F CG  1 
ATOM   9888  S SD  . MET K 1 108 ? 21.301  46.556  -6.984  1.00 42.91  ? 108  MET F SD  1 
ATOM   9889  C CE  . MET K 1 108 ? 22.594  45.263  -6.750  1.00 38.79  ? 108  MET F CE  1 
ATOM   9890  N N   . HIS K 1 109 ? 25.859  48.025  -3.706  1.00 12.04  ? 109  HIS F N   1 
ATOM   9891  C CA  . HIS K 1 109 ? 26.849  47.343  -2.944  1.00 8.78   ? 109  HIS F CA  1 
ATOM   9892  C C   . HIS K 1 109 ? 26.916  47.551  -1.462  1.00 13.15  ? 109  HIS F C   1 
ATOM   9893  O O   . HIS K 1 109 ? 26.805  46.637  -0.696  1.00 19.76  ? 109  HIS F O   1 
ATOM   9894  C CB  . HIS K 1 109 ? 28.206  47.551  -3.550  1.00 13.77  ? 109  HIS F CB  1 
ATOM   9895  C CG  . HIS K 1 109 ? 29.072  46.416  -3.130  1.00 19.62  ? 109  HIS F CG  1 
ATOM   9896  N ND1 . HIS K 1 109 ? 30.135  46.606  -2.260  1.00 21.17  ? 109  HIS F ND1 1 
ATOM   9897  C CD2 . HIS K 1 109 ? 28.976  45.085  -3.444  1.00 19.59  ? 109  HIS F CD2 1 
ATOM   9898  C CE1 . HIS K 1 109 ? 30.676  45.387  -2.102  1.00 19.93  ? 109  HIS F CE1 1 
ATOM   9899  N NE2 . HIS K 1 109 ? 29.984  44.455  -2.773  1.00 19.10  ? 109  HIS F NE2 1 
ATOM   9900  N N   . PRO K 1 110 ? 27.109  48.761  -1.046  1.00 12.54  ? 110  PRO F N   1 
ATOM   9901  C CA  . PRO K 1 110 ? 27.196  49.084  0.369   1.00 9.73   ? 110  PRO F CA  1 
ATOM   9902  C C   . PRO K 1 110 ? 25.996  48.727  1.189   1.00 21.00  ? 110  PRO F C   1 
ATOM   9903  O O   . PRO K 1 110 ? 26.063  48.617  2.408   1.00 31.35  ? 110  PRO F O   1 
ATOM   9904  C CB  . PRO K 1 110 ? 27.349  50.592  0.468   1.00 7.40   ? 110  PRO F CB  1 
ATOM   9905  C CG  . PRO K 1 110 ? 27.467  51.114  -0.940  1.00 3.83   ? 110  PRO F CG  1 
ATOM   9906  C CD  . PRO K 1 110 ? 27.132  49.980  -1.907  1.00 9.25   ? 110  PRO F CD  1 
ATOM   9907  N N   . PHE K 1 111 ? 24.873  48.537  0.571   1.00 15.41  ? 111  PHE F N   1 
ATOM   9908  C CA  . PHE K 1 111 ? 23.718  48.201  1.377   1.00 9.17   ? 111  PHE F CA  1 
ATOM   9909  C C   . PHE K 1 111 ? 23.408  46.716  1.467   1.00 23.69  ? 111  PHE F C   1 
ATOM   9910  O O   . PHE K 1 111 ? 22.326  46.316  1.896   1.00 30.42  ? 111  PHE F O   1 
ATOM   9911  C CB  . PHE K 1 111 ? 22.535  48.965  0.835   1.00 4.06   ? 111  PHE F CB  1 
ATOM   9912  C CG  . PHE K 1 111 ? 22.856  50.418  0.792   1.00 7.88   ? 111  PHE F CG  1 
ATOM   9913  C CD1 . PHE K 1 111 ? 22.784  51.213  1.941   1.00 8.51   ? 111  PHE F CD1 1 
ATOM   9914  C CD2 . PHE K 1 111 ? 23.251  51.011  -0.407  1.00 16.26  ? 111  PHE F CD2 1 
ATOM   9915  C CE1 . PHE K 1 111 ? 23.103  52.574  1.917   1.00 11.45  ? 111  PHE F CE1 1 
ATOM   9916  C CE2 . PHE K 1 111 ? 23.561  52.370  -0.444  1.00 17.14  ? 111  PHE F CE2 1 
ATOM   9917  C CZ  . PHE K 1 111 ? 23.505  53.154  0.710   1.00 8.93   ? 111  PHE F CZ  1 
ATOM   9918  N N   . LEU K 1 112 ? 24.325  45.925  0.953   1.00 20.71  ? 112  LEU F N   1 
ATOM   9919  C CA  . LEU K 1 112 ? 24.248  44.479  0.953   1.00 19.56  ? 112  LEU F CA  1 
ATOM   9920  C C   . LEU K 1 112 ? 24.693  44.014  2.291   1.00 33.83  ? 112  LEU F C   1 
ATOM   9921  O O   . LEU K 1 112 ? 25.365  44.745  3.013   1.00 37.60  ? 112  LEU F O   1 
ATOM   9922  C CB  . LEU K 1 112 ? 25.311  43.868  -0.001  1.00 16.48  ? 112  LEU F CB  1 
ATOM   9923  C CG  . LEU K 1 112 ? 24.891  44.116  -1.428  1.00 14.20  ? 112  LEU F CG  1 
ATOM   9924  C CD1 . LEU K 1 112 ? 25.511  43.106  -2.328  1.00 11.29  ? 112  LEU F CD1 1 
ATOM   9925  C CD2 . LEU K 1 112 ? 23.412  43.906  -1.448  1.00 1.49   ? 112  LEU F CD2 1 
ATOM   9926  N N   . LYS K 1 113 ? 24.356  42.765  2.560   1.00 34.66  ? 113  LYS F N   1 
ATOM   9927  C CA  . LYS K 1 113 ? 24.788  42.092  3.754   1.00 34.60  ? 113  LYS F CA  1 
ATOM   9928  C C   . LYS K 1 113 ? 26.162  41.588  3.428   1.00 48.05  ? 113  LYS F C   1 
ATOM   9929  O O   . LYS K 1 113 ? 26.382  40.793  2.514   1.00 57.59  ? 113  LYS F O   1 
ATOM   9930  C CB  . LYS K 1 113 ? 23.907  40.917  4.164   1.00 37.42  ? 113  LYS F CB  1 
ATOM   9931  C CG  . LYS K 1 113 ? 22.392  41.159  4.244   1.00 107.85 ? 113  LYS F CG  1 
ATOM   9932  C CD  . LYS K 1 113 ? 21.747  41.908  3.071   1.00 141.69 ? 113  LYS F CD  1 
ATOM   9933  C CE  . LYS K 1 113 ? 22.050  41.354  1.682   1.00 148.40 ? 113  LYS F CE  1 
ATOM   9934  N NZ  . LYS K 1 113 ? 21.298  42.045  0.619   1.00 163.81 ? 113  LYS F NZ  1 
ATOM   9935  N N   . PRO K 1 114 ? 27.056  42.134  4.162   1.00 47.13  ? 114  PRO F N   1 
ATOM   9936  C CA  . PRO K 1 114 ? 28.496  41.881  4.167   1.00 50.56  ? 114  PRO F CA  1 
ATOM   9937  C C   . PRO K 1 114 ? 28.935  40.533  3.581   1.00 62.15  ? 114  PRO F C   1 
ATOM   9938  O O   . PRO K 1 114 ? 29.949  40.394  2.855   1.00 60.40  ? 114  PRO F O   1 
ATOM   9939  C CB  . PRO K 1 114 ? 28.862  42.000  5.647   1.00 51.30  ? 114  PRO F CB  1 
ATOM   9940  C CG  . PRO K 1 114 ? 27.590  42.445  6.408   1.00 51.76  ? 114  PRO F CG  1 
ATOM   9941  C CD  . PRO K 1 114 ? 26.402  42.281  5.485   1.00 44.33  ? 114  PRO F CD  1 
ATOM   9942  N N   . ASP K 1 115 ? 28.139  39.532  3.907   1.00 66.54  ? 115  ASP F N   1 
ATOM   9943  C CA  . ASP K 1 115 ? 28.372  38.217  3.390   1.00 73.05  ? 115  ASP F CA  1 
ATOM   9944  C C   . ASP K 1 115 ? 28.192  38.249  1.857   1.00 65.55  ? 115  ASP F C   1 
ATOM   9945  O O   . ASP K 1 115 ? 29.044  37.794  1.059   1.00 71.35  ? 115  ASP F O   1 
ATOM   9946  C CB  . ASP K 1 115 ? 27.402  37.251  4.109   1.00 84.19  ? 115  ASP F CB  1 
ATOM   9947  C CG  . ASP K 1 115 ? 26.965  36.045  3.298   1.00 167.64 ? 115  ASP F CG  1 
ATOM   9948  O OD1 . ASP K 1 115 ? 27.605  35.565  2.363   1.00 178.29 ? 115  ASP F OD1 1 
ATOM   9949  O OD2 . ASP K 1 115 ? 25.825  35.540  3.730   1.00 197.05 ? 115  ASP F OD2 1 
ATOM   9950  N N   . ASP K 1 116 ? 27.067  38.833  1.446   1.00 41.01  ? 116  ASP F N   1 
ATOM   9951  C CA  . ASP K 1 116 ? 26.739  38.948  0.052   1.00 34.94  ? 116  ASP F CA  1 
ATOM   9952  C C   . ASP K 1 116 ? 27.589  39.939  -0.692  1.00 31.13  ? 116  ASP F C   1 
ATOM   9953  O O   . ASP K 1 116 ? 27.638  39.994  -1.929  1.00 30.98  ? 116  ASP F O   1 
ATOM   9954  C CB  . ASP K 1 116 ? 25.293  39.370  -0.084  1.00 39.70  ? 116  ASP F CB  1 
ATOM   9955  C CG  . ASP K 1 116 ? 24.331  38.375  0.493   1.00 60.74  ? 116  ASP F CG  1 
ATOM   9956  O OD1 . ASP K 1 116 ? 24.648  37.253  0.865   1.00 63.01  ? 116  ASP F OD1 1 
ATOM   9957  O OD2 . ASP K 1 116 ? 23.100  38.822  0.451   1.00 66.45  ? 116  ASP F OD2 1 
ATOM   9958  N N   . GLN K 1 117 ? 28.244  40.766  0.066   1.00 20.22  ? 117  GLN F N   1 
ATOM   9959  C CA  . GLN K 1 117 ? 29.020  41.755  -0.578  1.00 20.01  ? 117  GLN F CA  1 
ATOM   9960  C C   . GLN K 1 117 ? 30.094  41.196  -1.438  1.00 30.67  ? 117  GLN F C   1 
ATOM   9961  O O   . GLN K 1 117 ? 30.362  41.662  -2.540  1.00 36.77  ? 117  GLN F O   1 
ATOM   9962  C CB  . GLN K 1 117 ? 29.559  42.724  0.443   1.00 22.50  ? 117  GLN F CB  1 
ATOM   9963  C CG  . GLN K 1 117 ? 28.443  43.644  0.954   1.00 37.02  ? 117  GLN F CG  1 
ATOM   9964  C CD  . GLN K 1 117 ? 29.067  44.775  1.712   1.00 29.68  ? 117  GLN F CD  1 
ATOM   9965  O OE1 . GLN K 1 117 ? 30.055  44.579  2.413   1.00 64.54  ? 117  GLN F OE1 1 
ATOM   9966  N NE2 . GLN K 1 117 ? 28.589  45.978  1.471   1.00 42.05  ? 117  GLN F NE2 1 
ATOM   9967  N N   . GLN K 1 118 ? 30.677  40.157  -0.931  1.00 33.21  ? 118  GLN F N   1 
ATOM   9968  C CA  . GLN K 1 118 ? 31.736  39.527  -1.649  1.00 34.93  ? 118  GLN F CA  1 
ATOM   9969  C C   . GLN K 1 118 ? 31.323  38.778  -2.887  1.00 32.72  ? 118  GLN F C   1 
ATOM   9970  O O   . GLN K 1 118 ? 31.972  38.875  -3.934  1.00 33.69  ? 118  GLN F O   1 
ATOM   9971  C CB  . GLN K 1 118 ? 32.640  38.735  -0.736  1.00 41.88  ? 118  GLN F CB  1 
ATOM   9972  C CG  . GLN K 1 118 ? 34.074  38.688  -1.311  1.00 157.13 ? 118  GLN F CG  1 
ATOM   9973  C CD  . GLN K 1 118 ? 34.636  40.060  -1.656  1.00 221.48 ? 118  GLN F CD  1 
ATOM   9974  O OE1 . GLN K 1 118 ? 34.308  41.069  -1.003  1.00 237.99 ? 118  GLN F OE1 1 
ATOM   9975  N NE2 . GLN K 1 118 ? 35.477  40.111  -2.693  1.00 199.58 ? 118  GLN F NE2 1 
ATOM   9976  N N   . LYS K 1 119 ? 30.237  38.041  -2.766  1.00 28.62  ? 119  LYS F N   1 
ATOM   9977  C CA  . LYS K 1 119 ? 29.744  37.330  -3.921  1.00 25.84  ? 119  LYS F CA  1 
ATOM   9978  C C   . LYS K 1 119 ? 29.500  38.325  -5.068  1.00 26.95  ? 119  LYS F C   1 
ATOM   9979  O O   . LYS K 1 119 ? 29.823  38.143  -6.228  1.00 33.39  ? 119  LYS F O   1 
ATOM   9980  C CB  . LYS K 1 119 ? 28.523  36.437  -3.618  1.00 28.01  ? 119  LYS F CB  1 
ATOM   9981  C CG  . LYS K 1 119 ? 28.286  35.442  -4.769  1.00 143.15 ? 119  LYS F CG  1 
ATOM   9982  C CD  . LYS K 1 119 ? 27.715  36.088  -6.039  1.00 172.67 ? 119  LYS F CD  1 
ATOM   9983  C CE  . LYS K 1 119 ? 28.378  35.702  -7.370  1.00 131.07 ? 119  LYS F CE  1 
ATOM   9984  N NZ  . LYS K 1 119 ? 28.149  36.741  -8.428  1.00 24.57  ? 119  LYS F NZ  1 
ATOM   9985  N N   . GLU K 1 120 ? 29.023  39.459  -4.671  1.00 19.79  ? 120  GLU F N   1 
ATOM   9986  C CA  . GLU K 1 120 ? 28.695  40.553  -5.525  1.00 17.74  ? 120  GLU F CA  1 
ATOM   9987  C C   . GLU K 1 120 ? 29.792  41.173  -6.314  1.00 19.67  ? 120  GLU F C   1 
ATOM   9988  O O   . GLU K 1 120 ? 29.599  41.591  -7.475  1.00 22.84  ? 120  GLU F O   1 
ATOM   9989  C CB  . GLU K 1 120 ? 27.999  41.508  -4.602  1.00 19.73  ? 120  GLU F CB  1 
ATOM   9990  C CG  . GLU K 1 120 ? 26.691  40.751  -4.469  1.00 25.31  ? 120  GLU F CG  1 
ATOM   9991  C CD  . GLU K 1 120 ? 26.166  40.617  -5.879  1.00 96.14  ? 120  GLU F CD  1 
ATOM   9992  O OE1 . GLU K 1 120 ? 26.380  41.455  -6.796  1.00 96.42  ? 120  GLU F OE1 1 
ATOM   9993  O OE2 . GLU K 1 120 ? 25.483  39.507  -5.999  1.00 45.20  ? 120  GLU F OE2 1 
ATOM   9994  N N   . VAL K 1 121 ? 30.921  41.273  -5.646  1.00 5.57   ? 121  VAL F N   1 
ATOM   9995  C CA  . VAL K 1 121 ? 32.039  41.799  -6.335  1.00 6.59   ? 121  VAL F CA  1 
ATOM   9996  C C   . VAL K 1 121 ? 32.407  40.871  -7.478  1.00 17.69  ? 121  VAL F C   1 
ATOM   9997  O O   . VAL K 1 121 ? 32.698  41.274  -8.609  1.00 24.97  ? 121  VAL F O   1 
ATOM   9998  C CB  . VAL K 1 121 ? 33.194  41.821  -5.418  1.00 6.74   ? 121  VAL F CB  1 
ATOM   9999  C CG1 . VAL K 1 121 ? 34.373  42.199  -6.268  1.00 4.65   ? 121  VAL F CG1 1 
ATOM   10000 C CG2 . VAL K 1 121 ? 32.942  42.905  -4.413  1.00 3.02   ? 121  VAL F CG2 1 
ATOM   10001 N N   . VAL K 1 122 ? 32.383  39.609  -7.169  1.00 9.06   ? 122  VAL F N   1 
ATOM   10002 C CA  . VAL K 1 122 ? 32.660  38.630  -8.187  1.00 13.35  ? 122  VAL F CA  1 
ATOM   10003 C C   . VAL K 1 122 ? 31.697  38.802  -9.332  1.00 18.92  ? 122  VAL F C   1 
ATOM   10004 O O   . VAL K 1 122 ? 32.077  38.861  -10.525 1.00 19.82  ? 122  VAL F O   1 
ATOM   10005 C CB  . VAL K 1 122 ? 32.535  37.215  -7.617  1.00 16.00  ? 122  VAL F CB  1 
ATOM   10006 C CG1 . VAL K 1 122 ? 32.701  36.216  -8.719  1.00 13.10  ? 122  VAL F CG1 1 
ATOM   10007 C CG2 . VAL K 1 122 ? 33.662  36.978  -6.662  1.00 11.75  ? 122  VAL F CG2 1 
ATOM   10008 N N   . ASN K 1 123 ? 30.436  38.993  -8.964  1.00 15.18  ? 123  ASN F N   1 
ATOM   10009 C CA  . ASN K 1 123 ? 29.486  39.227  -10.032 1.00 12.95  ? 123  ASN F CA  1 
ATOM   10010 C C   . ASN K 1 123 ? 29.742  40.453  -10.900 1.00 15.30  ? 123  ASN F C   1 
ATOM   10011 O O   . ASN K 1 123 ? 29.640  40.377  -12.137 1.00 18.14  ? 123  ASN F O   1 
ATOM   10012 C CB  . ASN K 1 123 ? 28.058  39.246  -9.641  1.00 20.55  ? 123  ASN F CB  1 
ATOM   10013 C CG  . ASN K 1 123 ? 27.170  39.223  -10.904 1.00 82.12  ? 123  ASN F CG  1 
ATOM   10014 O OD1 . ASN K 1 123 ? 27.418  38.437  -11.905 1.00 69.87  ? 123  ASN F OD1 1 
ATOM   10015 N ND2 . ASN K 1 123 ? 26.146  40.114  -10.880 1.00 34.52  ? 123  ASN F ND2 1 
ATOM   10016 N N   . MET K 1 124 ? 30.072  41.589  -10.292 1.00 5.42   ? 124  MET F N   1 
ATOM   10017 C CA  . MET K 1 124 ? 30.374  42.767  -11.099 1.00 2.66   ? 124  MET F CA  1 
ATOM   10018 C C   . MET K 1 124 ? 31.465  42.439  -12.026 1.00 12.04  ? 124  MET F C   1 
ATOM   10019 O O   . MET K 1 124 ? 31.435  42.843  -13.188 1.00 15.26  ? 124  MET F O   1 
ATOM   10020 C CB  . MET K 1 124 ? 31.040  43.870  -10.322 1.00 3.56   ? 124  MET F CB  1 
ATOM   10021 C CG  . MET K 1 124 ? 30.436  44.080  -8.966  1.00 11.59  ? 124  MET F CG  1 
ATOM   10022 S SD  . MET K 1 124 ? 31.250  45.475  -8.203  1.00 14.50  ? 124  MET F SD  1 
ATOM   10023 C CE  . MET K 1 124 ? 30.103  45.593  -6.837  1.00 8.18   ? 124  MET F CE  1 
ATOM   10024 N N   . ALA K 1 125 ? 32.447  41.717  -11.474 1.00 8.41   ? 125  ALA F N   1 
ATOM   10025 C CA  . ALA K 1 125 ? 33.600  41.386  -12.325 1.00 8.92   ? 125  ALA F CA  1 
ATOM   10026 C C   . ALA K 1 125 ? 33.119  40.656  -13.532 1.00 16.57  ? 125  ALA F C   1 
ATOM   10027 O O   . ALA K 1 125 ? 33.377  41.059  -14.653 1.00 19.75  ? 125  ALA F O   1 
ATOM   10028 C CB  . ALA K 1 125 ? 34.599  40.505  -11.613 1.00 6.67   ? 125  ALA F CB  1 
ATOM   10029 N N   . GLN K 1 126 ? 32.342  39.610  -13.288 1.00 7.08   ? 126  GLN F N   1 
ATOM   10030 C CA  . GLN K 1 126 ? 31.875  38.861  -14.435 1.00 3.18   ? 126  GLN F CA  1 
ATOM   10031 C C   . GLN K 1 126 ? 31.039  39.625  -15.431 1.00 13.31  ? 126  GLN F C   1 
ATOM   10032 O O   . GLN K 1 126 ? 31.193  39.468  -16.656 1.00 13.84  ? 126  GLN F O   1 
ATOM   10033 C CB  . GLN K 1 126 ? 31.114  37.674  -13.963 1.00 6.18   ? 126  GLN F CB  1 
ATOM   10034 C CG  . GLN K 1 126 ? 31.960  36.656  -13.111 1.00 22.38  ? 126  GLN F CG  1 
ATOM   10035 C CD  . GLN K 1 126 ? 31.147  35.380  -12.760 1.00 27.21  ? 126  GLN F CD  1 
ATOM   10036 O OE1 . GLN K 1 126 ? 30.657  35.271  -11.624 1.00 47.66  ? 126  GLN F OE1 1 
ATOM   10037 N NE2 . GLN K 1 126 ? 30.728  34.591  -13.785 1.00 31.54  ? 126  GLN F NE2 1 
ATOM   10038 N N   . LYS K 1 127 ? 30.127  40.458  -14.925 1.00 6.91   ? 127  LYS F N   1 
ATOM   10039 C CA  . LYS K 1 127 ? 29.298  41.167  -15.838 1.00 7.02   ? 127  LYS F CA  1 
ATOM   10040 C C   . LYS K 1 127 ? 30.103  42.096  -16.679 1.00 12.38  ? 127  LYS F C   1 
ATOM   10041 O O   . LYS K 1 127 ? 29.882  42.237  -17.885 1.00 11.43  ? 127  LYS F O   1 
ATOM   10042 C CB  . LYS K 1 127 ? 28.383  42.022  -15.037 1.00 19.18  ? 127  LYS F CB  1 
ATOM   10043 C CG  . LYS K 1 127 ? 27.250  41.276  -14.382 1.00 13.43  ? 127  LYS F CG  1 
ATOM   10044 C CD  . LYS K 1 127 ? 26.084  41.065  -15.343 1.00 6.89   ? 127  LYS F CD  1 
ATOM   10045 C CE  . LYS K 1 127 ? 25.314  39.721  -15.113 1.00 6.90   ? 127  LYS F CE  1 
ATOM   10046 N NZ  . LYS K 1 127 ? 26.112  38.516  -15.530 1.00 114.42 ? 127  LYS F NZ  1 
ATOM   10047 N N   . ALA K 1 128 ? 31.013  42.795  -15.992 1.00 5.41   ? 128  ALA F N   1 
ATOM   10048 C CA  . ALA K 1 128 ? 31.815  43.765  -16.661 1.00 1.00   ? 128  ALA F CA  1 
ATOM   10049 C C   . ALA K 1 128 ? 32.554  43.110  -17.795 1.00 6.77   ? 128  ALA F C   1 
ATOM   10050 O O   . ALA K 1 128 ? 32.549  43.537  -18.948 1.00 9.61   ? 128  ALA F O   1 
ATOM   10051 C CB  . ALA K 1 128 ? 32.752  44.364  -15.686 1.00 1.00   ? 128  ALA F CB  1 
ATOM   10052 N N   . ILE K 1 129 ? 33.218  42.048  -17.425 1.00 4.19   ? 129  ILE F N   1 
ATOM   10053 C CA  . ILE K 1 129 ? 34.105  41.311  -18.310 1.00 8.94   ? 129  ILE F CA  1 
ATOM   10054 C C   . ILE K 1 129 ? 33.392  40.719  -19.469 1.00 12.61  ? 129  ILE F C   1 
ATOM   10055 O O   . ILE K 1 129 ? 33.856  40.645  -20.593 1.00 22.81  ? 129  ILE F O   1 
ATOM   10056 C CB  . ILE K 1 129 ? 34.735  40.060  -17.674 1.00 20.48  ? 129  ILE F CB  1 
ATOM   10057 C CG1 . ILE K 1 129 ? 35.674  40.304  -16.537 1.00 16.28  ? 129  ILE F CG1 1 
ATOM   10058 C CG2 . ILE K 1 129 ? 35.614  39.531  -18.750 1.00 34.42  ? 129  ILE F CG2 1 
ATOM   10059 C CD1 . ILE K 1 129 ? 36.059  41.729  -16.751 1.00 9.85   ? 129  ILE F CD1 1 
ATOM   10060 N N   . ILE K 1 130 ? 32.293  40.155  -19.160 1.00 8.64   ? 130  ILE F N   1 
ATOM   10061 C CA  . ILE K 1 130 ? 31.546  39.468  -20.185 1.00 10.81  ? 130  ILE F CA  1 
ATOM   10062 C C   . ILE K 1 130 ? 30.493  40.249  -20.928 1.00 10.87  ? 130  ILE F C   1 
ATOM   10063 O O   . ILE K 1 130 ? 30.318  40.073  -22.110 1.00 13.33  ? 130  ILE F O   1 
ATOM   10064 C CB  . ILE K 1 130 ? 30.790  38.392  -19.483 1.00 15.81  ? 130  ILE F CB  1 
ATOM   10065 C CG1 . ILE K 1 130 ? 31.785  37.429  -18.936 1.00 19.12  ? 130  ILE F CG1 1 
ATOM   10066 C CG2 . ILE K 1 130 ? 29.976  37.608  -20.454 1.00 6.62   ? 130  ILE F CG2 1 
ATOM   10067 C CD1 . ILE K 1 130 ? 31.046  36.420  -18.103 1.00 24.97  ? 130  ILE F CD1 1 
ATOM   10068 N N   . ARG K 1 131 ? 29.764  41.070  -20.225 1.00 3.96   ? 131  ARG F N   1 
ATOM   10069 C CA  . ARG K 1 131 ? 28.673  41.730  -20.838 1.00 1.93   ? 131  ARG F CA  1 
ATOM   10070 C C   . ARG K 1 131 ? 28.904  43.112  -21.328 1.00 6.36   ? 131  ARG F C   1 
ATOM   10071 O O   . ARG K 1 131 ? 28.373  43.417  -22.380 1.00 12.60  ? 131  ARG F O   1 
ATOM   10072 C CB  . ARG K 1 131 ? 27.452  41.497  -19.928 1.00 4.26   ? 131  ARG F CB  1 
ATOM   10073 C CG  . ARG K 1 131 ? 26.134  42.227  -20.163 1.00 23.64  ? 131  ARG F CG  1 
ATOM   10074 C CD  . ARG K 1 131 ? 24.955  41.382  -19.621 1.00 14.16  ? 131  ARG F CD  1 
ATOM   10075 N NE  . ARG K 1 131 ? 25.225  39.984  -20.002 1.00 66.89  ? 131  ARG F NE  1 
ATOM   10076 C CZ  . ARG K 1 131 ? 24.343  39.021  -19.804 1.00 94.72  ? 131  ARG F CZ  1 
ATOM   10077 N NH1 . ARG K 1 131 ? 23.178  39.369  -19.198 1.00 9.97   ? 131  ARG F NH1 1 
ATOM   10078 N NH2 . ARG K 1 131 ? 24.640  37.744  -20.213 1.00 69.95  ? 131  ARG F NH2 1 
ATOM   10079 N N   . TYR K 1 132 ? 29.732  43.901  -20.630 1.00 7.37   ? 132  TYR F N   1 
ATOM   10080 C CA  . TYR K 1 132 ? 29.986  45.292  -21.010 1.00 3.84   ? 132  TYR F CA  1 
ATOM   10081 C C   . TYR K 1 132 ? 31.284  45.658  -21.680 1.00 8.16   ? 132  TYR F C   1 
ATOM   10082 O O   . TYR K 1 132 ? 31.308  46.246  -22.792 1.00 8.00   ? 132  TYR F O   1 
ATOM   10083 C CB  . TYR K 1 132 ? 29.776  46.181  -19.774 1.00 7.62   ? 132  TYR F CB  1 
ATOM   10084 C CG  . TYR K 1 132 ? 28.319  46.066  -19.332 1.00 9.15   ? 132  TYR F CG  1 
ATOM   10085 C CD1 . TYR K 1 132 ? 27.289  46.655  -20.068 1.00 3.85   ? 132  TYR F CD1 1 
ATOM   10086 C CD2 . TYR K 1 132 ? 27.949  45.209  -18.289 1.00 7.21   ? 132  TYR F CD2 1 
ATOM   10087 C CE1 . TYR K 1 132 ? 25.951  46.530  -19.701 1.00 1.00   ? 132  TYR F CE1 1 
ATOM   10088 C CE2 . TYR K 1 132 ? 26.603  44.982  -17.982 1.00 1.61   ? 132  TYR F CE2 1 
ATOM   10089 C CZ  . TYR K 1 132 ? 25.594  45.655  -18.673 1.00 1.00   ? 132  TYR F CZ  1 
ATOM   10090 O OH  . TYR K 1 132 ? 24.256  45.484  -18.362 1.00 21.40  ? 132  TYR F OH  1 
ATOM   10091 N N   . PHE K 1 133 ? 32.375  45.421  -20.966 1.00 5.39   ? 133  PHE F N   1 
ATOM   10092 C CA  . PHE K 1 133 ? 33.692  45.793  -21.484 1.00 2.99   ? 133  PHE F CA  1 
ATOM   10093 C C   . PHE K 1 133 ? 33.940  45.396  -22.946 1.00 14.49  ? 133  PHE F C   1 
ATOM   10094 O O   . PHE K 1 133 ? 34.531  46.076  -23.810 1.00 18.06  ? 133  PHE F O   1 
ATOM   10095 C CB  . PHE K 1 133 ? 34.772  45.264  -20.553 1.00 3.33   ? 133  PHE F CB  1 
ATOM   10096 C CG  . PHE K 1 133 ? 34.802  46.086  -19.290 1.00 7.26   ? 133  PHE F CG  1 
ATOM   10097 C CD1 . PHE K 1 133 ? 33.952  47.184  -19.140 1.00 8.71   ? 133  PHE F CD1 1 
ATOM   10098 C CD2 . PHE K 1 133 ? 35.700  45.809  -18.254 1.00 7.41   ? 133  PHE F CD2 1 
ATOM   10099 C CE1 . PHE K 1 133 ? 33.951  47.933  -17.957 1.00 10.38  ? 133  PHE F CE1 1 
ATOM   10100 C CE2 . PHE K 1 133 ? 35.751  46.580  -17.088 1.00 6.55   ? 133  PHE F CE2 1 
ATOM   10101 C CZ  . PHE K 1 133 ? 34.840  47.627  -16.920 1.00 4.10   ? 133  PHE F CZ  1 
ATOM   10102 N N   . PRO K 1 134 ? 33.431  44.260  -23.273 1.00 8.58   ? 134  PRO F N   1 
ATOM   10103 C CA  . PRO K 1 134 ? 33.680  43.775  -24.614 1.00 2.15   ? 134  PRO F CA  1 
ATOM   10104 C C   . PRO K 1 134 ? 33.061  44.561  -25.756 1.00 13.92  ? 134  PRO F C   1 
ATOM   10105 O O   . PRO K 1 134 ? 33.586  44.618  -26.858 1.00 16.26  ? 134  PRO F O   1 
ATOM   10106 C CB  . PRO K 1 134 ? 33.293  42.325  -24.571 1.00 1.00   ? 134  PRO F CB  1 
ATOM   10107 C CG  . PRO K 1 134 ? 33.337  41.869  -23.132 1.00 1.00   ? 134  PRO F CG  1 
ATOM   10108 C CD  . PRO K 1 134 ? 33.265  43.146  -22.295 1.00 6.64   ? 134  PRO F CD  1 
ATOM   10109 N N   . VAL K 1 135 ? 31.963  45.212  -25.447 1.00 12.60  ? 135  VAL F N   1 
ATOM   10110 C CA  . VAL K 1 135 ? 31.205  45.968  -26.381 1.00 3.53   ? 135  VAL F CA  1 
ATOM   10111 C C   . VAL K 1 135 ? 31.960  47.226  -26.668 1.00 9.74   ? 135  VAL F C   1 
ATOM   10112 O O   . VAL K 1 135 ? 32.148  47.642  -27.793 1.00 15.21  ? 135  VAL F O   1 
ATOM   10113 C CB  . VAL K 1 135 ? 29.786  46.225  -25.796 1.00 1.00   ? 135  VAL F CB  1 
ATOM   10114 C CG1 . VAL K 1 135 ? 28.885  47.048  -26.706 1.00 1.00   ? 135  VAL F CG1 1 
ATOM   10115 C CG2 . VAL K 1 135 ? 29.033  44.949  -25.571 1.00 1.00   ? 135  VAL F CG2 1 
ATOM   10116 N N   . PHE K 1 136 ? 32.405  47.796  -25.603 1.00 1.86   ? 136  PHE F N   1 
ATOM   10117 C CA  . PHE K 1 136 ? 33.088  49.036  -25.743 1.00 1.00   ? 136  PHE F CA  1 
ATOM   10118 C C   . PHE K 1 136 ? 34.428  48.844  -26.346 1.00 7.71   ? 136  PHE F C   1 
ATOM   10119 O O   . PHE K 1 136 ? 34.811  49.610  -27.220 1.00 13.38  ? 136  PHE F O   1 
ATOM   10120 C CB  . PHE K 1 136 ? 33.193  49.695  -24.373 1.00 2.78   ? 136  PHE F CB  1 
ATOM   10121 C CG  . PHE K 1 136 ? 31.794  49.909  -23.854 1.00 6.31   ? 136  PHE F CG  1 
ATOM   10122 C CD1 . PHE K 1 136 ? 30.866  50.596  -24.638 1.00 3.72   ? 136  PHE F CD1 1 
ATOM   10123 C CD2 . PHE K 1 136 ? 31.356  49.424  -22.618 1.00 8.93   ? 136  PHE F CD2 1 
ATOM   10124 C CE1 . PHE K 1 136 ? 29.583  50.881  -24.152 1.00 3.55   ? 136  PHE F CE1 1 
ATOM   10125 C CE2 . PHE K 1 136 ? 30.061  49.674  -22.139 1.00 8.46   ? 136  PHE F CE2 1 
ATOM   10126 C CZ  . PHE K 1 136 ? 29.161  50.422  -22.899 1.00 1.00   ? 136  PHE F CZ  1 
ATOM   10127 N N   . GLU K 1 137 ? 35.138  47.819  -25.857 1.00 5.46   ? 137  GLU F N   1 
ATOM   10128 C CA  . GLU K 1 137 ? 36.431  47.518  -26.410 1.00 8.33   ? 137  GLU F CA  1 
ATOM   10129 C C   . GLU K 1 137 ? 36.343  47.367  -27.937 1.00 15.69  ? 137  GLU F C   1 
ATOM   10130 O O   . GLU K 1 137 ? 37.049  47.965  -28.739 1.00 20.46  ? 137  GLU F O   1 
ATOM   10131 C CB  . GLU K 1 137 ? 36.973  46.262  -25.789 1.00 9.05   ? 137  GLU F CB  1 
ATOM   10132 C CG  . GLU K 1 137 ? 38.356  45.951  -26.330 1.00 4.06   ? 137  GLU F CG  1 
ATOM   10133 C CD  . GLU K 1 137 ? 39.521  46.516  -25.561 1.00 26.79  ? 137  GLU F CD  1 
ATOM   10134 O OE1 . GLU K 1 137 ? 39.442  47.391  -24.722 1.00 17.69  ? 137  GLU F OE1 1 
ATOM   10135 O OE2 . GLU K 1 137 ? 40.648  45.965  -25.944 1.00 30.49  ? 137  GLU F OE2 1 
ATOM   10136 N N   . LYS K 1 138 ? 35.375  46.639  -28.381 1.00 5.87   ? 138  LYS F N   1 
ATOM   10137 C CA  . LYS K 1 138 ? 35.218  46.488  -29.795 1.00 1.66   ? 138  LYS F CA  1 
ATOM   10138 C C   . LYS K 1 138 ? 34.817  47.737  -30.511 1.00 15.78  ? 138  LYS F C   1 
ATOM   10139 O O   . LYS K 1 138 ? 35.136  47.925  -31.641 1.00 21.84  ? 138  LYS F O   1 
ATOM   10140 C CB  . LYS K 1 138 ? 34.230  45.379  -30.053 1.00 1.00   ? 138  LYS F CB  1 
ATOM   10141 C CG  . LYS K 1 138 ? 33.637  45.376  -31.443 1.00 28.85  ? 138  LYS F CG  1 
ATOM   10142 C CD  . LYS K 1 138 ? 32.957  44.035  -31.837 1.00 12.27  ? 138  LYS F CD  1 
ATOM   10143 C CE  . LYS K 1 138 ? 32.079  44.118  -33.101 1.00 131.11 ? 138  LYS F CE  1 
ATOM   10144 N NZ  . LYS K 1 138 ? 31.490  42.830  -33.531 1.00 165.74 ? 138  LYS F NZ  1 
ATOM   10145 N N   . ILE K 1 139 ? 34.050  48.577  -29.893 1.00 16.05  ? 139  ILE F N   1 
ATOM   10146 C CA  . ILE K 1 139 ? 33.633  49.780  -30.567 1.00 11.73  ? 139  ILE F CA  1 
ATOM   10147 C C   . ILE K 1 139 ? 34.819  50.609  -30.916 1.00 18.87  ? 139  ILE F C   1 
ATOM   10148 O O   . ILE K 1 139 ? 34.980  51.059  -32.045 1.00 25.87  ? 139  ILE F O   1 
ATOM   10149 C CB  . ILE K 1 139 ? 32.739  50.560  -29.627 1.00 10.22  ? 139  ILE F CB  1 
ATOM   10150 C CG1 . ILE K 1 139 ? 31.390  49.923  -29.791 1.00 2.56   ? 139  ILE F CG1 1 
ATOM   10151 C CG2 . ILE K 1 139 ? 32.640  52.041  -29.974 1.00 3.44   ? 139  ILE F CG2 1 
ATOM   10152 C CD1 . ILE K 1 139 ? 30.349  50.488  -28.858 1.00 11.94  ? 139  ILE F CD1 1 
ATOM   10153 N N   . LEU K 1 140 ? 35.600  50.795  -29.880 1.00 8.73   ? 140  LEU F N   1 
ATOM   10154 C CA  . LEU K 1 140 ? 36.815  51.580  -29.894 1.00 9.66   ? 140  LEU F CA  1 
ATOM   10155 C C   . LEU K 1 140 ? 37.826  51.024  -30.832 1.00 19.86  ? 140  LEU F C   1 
ATOM   10156 O O   . LEU K 1 140 ? 38.573  51.772  -31.463 1.00 20.31  ? 140  LEU F O   1 
ATOM   10157 C CB  . LEU K 1 140 ? 37.500  51.485  -28.523 1.00 7.37   ? 140  LEU F CB  1 
ATOM   10158 C CG  . LEU K 1 140 ? 36.753  52.282  -27.475 1.00 12.43  ? 140  LEU F CG  1 
ATOM   10159 C CD1 . LEU K 1 140 ? 37.412  52.068  -26.139 1.00 11.57  ? 140  LEU F CD1 1 
ATOM   10160 C CD2 . LEU K 1 140 ? 36.846  53.747  -27.848 1.00 1.00   ? 140  LEU F CD2 1 
ATOM   10161 N N   . ARG K 1 141 ? 37.939  49.703  -30.759 1.00 18.13  ? 141  ARG F N   1 
ATOM   10162 C CA  . ARG K 1 141 ? 38.901  49.008  -31.571 1.00 15.20  ? 141  ARG F CA  1 
ATOM   10163 C C   . ARG K 1 141 ? 38.417  49.169  -32.966 1.00 23.36  ? 141  ARG F C   1 
ATOM   10164 O O   . ARG K 1 141 ? 39.119  49.312  -33.930 1.00 26.77  ? 141  ARG F O   1 
ATOM   10165 C CB  . ARG K 1 141 ? 39.020  47.532  -31.203 1.00 12.08  ? 141  ARG F CB  1 
ATOM   10166 C CG  . ARG K 1 141 ? 39.853  46.635  -32.148 1.00 15.77  ? 141  ARG F CG  1 
ATOM   10167 C CD  . ARG K 1 141 ? 40.581  45.401  -31.470 1.00 39.51  ? 141  ARG F CD  1 
ATOM   10168 N NE  . ARG K 1 141 ? 41.285  44.369  -32.336 1.00 24.05  ? 141  ARG F NE  1 
ATOM   10169 C CZ  . ARG K 1 141 ? 40.859  43.916  -33.539 1.00 157.26 ? 141  ARG F CZ  1 
ATOM   10170 N NH1 . ARG K 1 141 ? 39.718  44.337  -34.111 1.00 197.13 ? 141  ARG F NH1 1 
ATOM   10171 N NH2 . ARG K 1 141 ? 41.589  42.993  -34.176 1.00 188.07 ? 141  ARG F NH2 1 
ATOM   10172 N N   . GLY K 1 142 ? 37.156  49.248  -33.106 1.00 26.73  ? 142  GLY F N   1 
ATOM   10173 C CA  . GLY K 1 142 ? 36.705  49.359  -34.452 1.00 22.08  ? 142  GLY F CA  1 
ATOM   10174 C C   . GLY K 1 142 ? 36.867  50.692  -35.140 1.00 28.74  ? 142  GLY F C   1 
ATOM   10175 O O   . GLY K 1 142 ? 36.804  50.728  -36.331 1.00 37.30  ? 142  GLY F O   1 
ATOM   10176 N N   . HIS K 1 143 ? 36.999  51.812  -34.452 1.00 26.32  ? 143  HIS F N   1 
ATOM   10177 C CA  . HIS K 1 143 ? 37.064  53.088  -35.180 1.00 15.58  ? 143  HIS F CA  1 
ATOM   10178 C C   . HIS K 1 143 ? 38.337  53.854  -34.899 1.00 22.64  ? 143  HIS F C   1 
ATOM   10179 O O   . HIS K 1 143 ? 38.647  54.857  -35.545 1.00 32.45  ? 143  HIS F O   1 
ATOM   10180 C CB  . HIS K 1 143 ? 35.822  53.988  -34.919 1.00 12.14  ? 143  HIS F CB  1 
ATOM   10181 C CG  . HIS K 1 143 ? 35.538  54.336  -33.462 1.00 16.77  ? 143  HIS F CG  1 
ATOM   10182 N ND1 . HIS K 1 143 ? 36.548  54.582  -32.524 1.00 18.94  ? 143  HIS F ND1 1 
ATOM   10183 C CD2 . HIS K 1 143 ? 34.345  54.518  -32.838 1.00 14.09  ? 143  HIS F CD2 1 
ATOM   10184 C CE1 . HIS K 1 143 ? 35.954  54.877  -31.393 1.00 18.89  ? 143  HIS F CE1 1 
ATOM   10185 N NE2 . HIS K 1 143 ? 34.625  54.848  -31.553 1.00 16.83  ? 143  HIS F NE2 1 
ATOM   10186 N N   . GLY K 1 144 ? 39.043  53.379  -33.878 1.00 12.56  ? 144  GLY F N   1 
ATOM   10187 C CA  . GLY K 1 144 ? 40.285  53.944  -33.459 1.00 11.41  ? 144  GLY F CA  1 
ATOM   10188 C C   . GLY K 1 144 ? 40.186  55.305  -32.780 1.00 29.14  ? 144  GLY F C   1 
ATOM   10189 O O   . GLY K 1 144 ? 41.246  55.823  -32.439 1.00 40.79  ? 144  GLY F O   1 
ATOM   10190 N N   . GLN K 1 145 ? 38.963  55.869  -32.632 1.00 18.28  ? 145  GLN F N   1 
ATOM   10191 C CA  . GLN K 1 145 ? 38.861  57.178  -31.981 1.00 11.15  ? 145  GLN F CA  1 
ATOM   10192 C C   . GLN K 1 145 ? 38.955  57.160  -30.485 1.00 10.67  ? 145  GLN F C   1 
ATOM   10193 O O   . GLN K 1 145 ? 39.014  56.090  -29.841 1.00 11.31  ? 145  GLN F O   1 
ATOM   10194 C CB  . GLN K 1 145 ? 37.755  58.019  -32.535 1.00 10.79  ? 145  GLN F CB  1 
ATOM   10195 C CG  . GLN K 1 145 ? 37.737  57.668  -34.021 1.00 13.73  ? 145  GLN F CG  1 
ATOM   10196 C CD  . GLN K 1 145 ? 36.578  58.336  -34.671 1.00 15.92  ? 145  GLN F CD  1 
ATOM   10197 O OE1 . GLN K 1 145 ? 35.414  58.138  -34.249 1.00 39.77  ? 145  GLN F OE1 1 
ATOM   10198 N NE2 . GLN K 1 145 ? 36.886  59.282  -35.515 1.00 27.22  ? 145  GLN F NE2 1 
ATOM   10199 N N   . SER K 1 146 ? 39.080  58.339  -29.926 1.00 7.31   ? 146  SER F N   1 
ATOM   10200 C CA  . SER K 1 146 ? 39.223  58.349  -28.482 1.00 15.43  ? 146  SER F CA  1 
ATOM   10201 C C   . SER K 1 146 ? 37.913  58.447  -27.720 1.00 19.58  ? 146  SER F C   1 
ATOM   10202 O O   . SER K 1 146 ? 37.950  58.436  -26.511 1.00 20.76  ? 146  SER F O   1 
ATOM   10203 C CB  . SER K 1 146 ? 40.209  59.362  -27.930 1.00 23.42  ? 146  SER F CB  1 
ATOM   10204 O OG  . SER K 1 146 ? 41.224  59.685  -28.869 1.00 23.75  ? 146  SER F OG  1 
ATOM   10205 N N   . PHE K 1 147 ? 36.815  58.510  -28.448 1.00 12.42  ? 147  PHE F N   1 
ATOM   10206 C CA  . PHE K 1 147 ? 35.500  58.603  -27.922 1.00 12.85  ? 147  PHE F CA  1 
ATOM   10207 C C   . PHE K 1 147 ? 34.673  57.516  -28.474 1.00 17.51  ? 147  PHE F C   1 
ATOM   10208 O O   . PHE K 1 147 ? 34.911  57.126  -29.587 1.00 17.01  ? 147  PHE F O   1 
ATOM   10209 C CB  . PHE K 1 147 ? 34.908  59.866  -28.476 1.00 16.68  ? 147  PHE F CB  1 
ATOM   10210 C CG  . PHE K 1 147 ? 35.817  60.949  -28.038 1.00 15.38  ? 147  PHE F CG  1 
ATOM   10211 C CD1 . PHE K 1 147 ? 35.900  61.260  -26.684 1.00 14.47  ? 147  PHE F CD1 1 
ATOM   10212 C CD2 . PHE K 1 147 ? 36.640  61.621  -28.930 1.00 16.29  ? 147  PHE F CD2 1 
ATOM   10213 C CE1 . PHE K 1 147 ? 36.705  62.281  -26.180 1.00 10.70  ? 147  PHE F CE1 1 
ATOM   10214 C CE2 . PHE K 1 147 ? 37.484  62.619  -28.435 1.00 12.98  ? 147  PHE F CE2 1 
ATOM   10215 C CZ  . PHE K 1 147 ? 37.526  62.953  -27.082 1.00 2.23   ? 147  PHE F CZ  1 
ATOM   10216 N N   . LEU K 1 148 ? 33.684  57.086  -27.701 1.00 14.06  ? 148  LEU F N   1 
ATOM   10217 C CA  . LEU K 1 148 ? 32.802  56.007  -28.107 1.00 7.29   ? 148  LEU F CA  1 
ATOM   10218 C C   . LEU K 1 148 ? 31.983  56.336  -29.331 1.00 14.68  ? 148  LEU F C   1 
ATOM   10219 O O   . LEU K 1 148 ? 31.708  55.480  -30.235 1.00 11.93  ? 148  LEU F O   1 
ATOM   10220 C CB  . LEU K 1 148 ? 31.828  55.702  -26.988 1.00 1.53   ? 148  LEU F CB  1 
ATOM   10221 C CG  . LEU K 1 148 ? 32.508  54.905  -25.918 1.00 8.09   ? 148  LEU F CG  1 
ATOM   10222 C CD1 . LEU K 1 148 ? 31.496  54.813  -24.813 1.00 6.61   ? 148  LEU F CD1 1 
ATOM   10223 C CD2 . LEU K 1 148 ? 32.828  53.501  -26.415 1.00 3.81   ? 148  LEU F CD2 1 
ATOM   10224 N N   . VAL K 1 149 ? 31.550  57.586  -29.302 1.00 7.19   ? 149  VAL F N   1 
ATOM   10225 C CA  . VAL K 1 149 ? 30.685  58.083  -30.332 1.00 8.20   ? 149  VAL F CA  1 
ATOM   10226 C C   . VAL K 1 149 ? 31.037  59.500  -30.769 1.00 17.89  ? 149  VAL F C   1 
ATOM   10227 O O   . VAL K 1 149 ? 31.353  60.395  -29.947 1.00 13.91  ? 149  VAL F O   1 
ATOM   10228 C CB  . VAL K 1 149 ? 29.213  58.052  -29.891 1.00 8.40   ? 149  VAL F CB  1 
ATOM   10229 C CG1 . VAL K 1 149 ? 28.248  58.617  -30.951 1.00 4.74   ? 149  VAL F CG1 1 
ATOM   10230 C CG2 . VAL K 1 149 ? 28.756  56.680  -29.399 1.00 7.52   ? 149  VAL F CG2 1 
ATOM   10231 N N   . GLY K 1 150 ? 30.962  59.638  -32.094 1.00 11.92  ? 150  GLY F N   1 
ATOM   10232 C CA  . GLY K 1 150 ? 31.171  60.872  -32.828 1.00 14.38  ? 150  GLY F CA  1 
ATOM   10233 C C   . GLY K 1 150 ? 32.508  61.602  -32.671 1.00 20.27  ? 150  GLY F C   1 
ATOM   10234 O O   . GLY K 1 150 ? 32.622  62.797  -32.929 1.00 25.89  ? 150  GLY F O   1 
ATOM   10235 N N   . ASN K 1 151 ? 33.491  60.906  -32.217 1.00 19.63  ? 151  ASN F N   1 
ATOM   10236 C CA  . ASN K 1 151 ? 34.775  61.519  -32.067 1.00 19.72  ? 151  ASN F CA  1 
ATOM   10237 C C   . ASN K 1 151 ? 34.786  62.746  -31.250 1.00 18.61  ? 151  ASN F C   1 
ATOM   10238 O O   . ASN K 1 151 ? 35.539  63.658  -31.459 1.00 28.97  ? 151  ASN F O   1 
ATOM   10239 C CB  . ASN K 1 151 ? 35.442  61.734  -33.400 1.00 14.88  ? 151  ASN F CB  1 
ATOM   10240 C CG  . ASN K 1 151 ? 36.925  61.652  -33.300 1.00 30.62  ? 151  ASN F CG  1 
ATOM   10241 O OD1 . ASN K 1 151 ? 37.569  61.116  -32.366 1.00 33.31  ? 151  ASN F OD1 1 
ATOM   10242 N ND2 . ASN K 1 151 ? 37.461  62.348  -34.246 1.00 19.00  ? 151  ASN F ND2 1 
ATOM   10243 N N   . GLN K 1 152 ? 33.894  62.743  -30.338 1.00 18.45  ? 152  GLN F N   1 
ATOM   10244 C CA  . GLN K 1 152 ? 33.792  63.775  -29.351 1.00 16.11  ? 152  GLN F CA  1 
ATOM   10245 C C   . GLN K 1 152 ? 33.255  63.187  -28.058 1.00 21.81  ? 152  GLN F C   1 
ATOM   10246 O O   . GLN K 1 152 ? 32.648  62.096  -28.011 1.00 26.92  ? 152  GLN F O   1 
ATOM   10247 C CB  . GLN K 1 152 ? 33.047  65.017  -29.810 1.00 11.65  ? 152  GLN F CB  1 
ATOM   10248 C CG  . GLN K 1 152 ? 31.574  64.798  -30.156 1.00 50.81  ? 152  GLN F CG  1 
ATOM   10249 C CD  . GLN K 1 152 ? 30.861  66.121  -30.038 1.00 60.65  ? 152  GLN F CD  1 
ATOM   10250 O OE1 . GLN K 1 152 ? 31.425  67.093  -30.548 1.00 31.26  ? 152  GLN F OE1 1 
ATOM   10251 N NE2 . GLN K 1 152 ? 29.725  66.180  -29.302 1.00 39.42  ? 152  GLN F NE2 1 
ATOM   10252 N N   . LEU K 1 153 ? 33.551  63.885  -26.998 1.00 9.82   ? 153  LEU F N   1 
ATOM   10253 C CA  . LEU K 1 153 ? 33.106  63.435  -25.715 1.00 8.50   ? 153  LEU F CA  1 
ATOM   10254 C C   . LEU K 1 153 ? 31.587  63.477  -25.685 1.00 17.38  ? 153  LEU F C   1 
ATOM   10255 O O   . LEU K 1 153 ? 30.960  64.388  -26.219 1.00 22.43  ? 153  LEU F O   1 
ATOM   10256 C CB  . LEU K 1 153 ? 33.745  64.312  -24.637 1.00 7.95   ? 153  LEU F CB  1 
ATOM   10257 C CG  . LEU K 1 153 ? 33.577  63.896  -23.187 1.00 9.93   ? 153  LEU F CG  1 
ATOM   10258 C CD1 . LEU K 1 153 ? 34.456  62.711  -22.832 1.00 4.74   ? 153  LEU F CD1 1 
ATOM   10259 C CD2 . LEU K 1 153 ? 33.969  65.051  -22.318 1.00 1.00   ? 153  LEU F CD2 1 
ATOM   10260 N N   . SER K 1 154 ? 31.047  62.453  -25.060 1.00 9.75   ? 154  SER F N   1 
ATOM   10261 C CA  . SER K 1 154 ? 29.655  62.271  -24.921 1.00 5.01   ? 154  SER F CA  1 
ATOM   10262 C C   . SER K 1 154 ? 29.381  61.830  -23.524 1.00 12.22  ? 154  SER F C   1 
ATOM   10263 O O   . SER K 1 154 ? 30.240  61.507  -22.699 1.00 13.00  ? 154  SER F O   1 
ATOM   10264 C CB  . SER K 1 154 ? 29.149  61.234  -25.899 1.00 1.00   ? 154  SER F CB  1 
ATOM   10265 O OG  . SER K 1 154 ? 29.492  59.952  -25.439 1.00 11.84  ? 154  SER F OG  1 
ATOM   10266 N N   . LEU K 1 155 ? 28.126  61.860  -23.251 1.00 9.77   ? 155  LEU F N   1 
ATOM   10267 C CA  . LEU K 1 155 ? 27.675  61.417  -21.968 1.00 7.09   ? 155  LEU F CA  1 
ATOM   10268 C C   . LEU K 1 155 ? 28.073  59.951  -21.763 1.00 11.75  ? 155  LEU F C   1 
ATOM   10269 O O   . LEU K 1 155 ? 28.379  59.515  -20.672 1.00 13.82  ? 155  LEU F O   1 
ATOM   10270 C CB  . LEU K 1 155 ? 26.163  61.600  -21.974 1.00 5.55   ? 155  LEU F CB  1 
ATOM   10271 C CG  . LEU K 1 155 ? 25.478  61.026  -20.758 1.00 7.79   ? 155  LEU F CG  1 
ATOM   10272 C CD1 . LEU K 1 155 ? 26.013  61.643  -19.495 1.00 1.95   ? 155  LEU F CD1 1 
ATOM   10273 C CD2 . LEU K 1 155 ? 24.002  61.326  -20.893 1.00 1.00   ? 155  LEU F CD2 1 
ATOM   10274 N N   . ALA K 1 156 ? 28.092  59.166  -22.843 1.00 4.41   ? 156  ALA F N   1 
ATOM   10275 C CA  . ALA K 1 156 ? 28.458  57.777  -22.736 1.00 1.00   ? 156  ALA F CA  1 
ATOM   10276 C C   . ALA K 1 156 ? 29.884  57.602  -22.196 1.00 9.58   ? 156  ALA F C   1 
ATOM   10277 O O   . ALA K 1 156 ? 30.171  56.759  -21.316 1.00 11.69  ? 156  ALA F O   1 
ATOM   10278 C CB  . ALA K 1 156 ? 28.249  57.126  -24.071 1.00 1.21   ? 156  ALA F CB  1 
ATOM   10279 N N   . ASP K 1 157 ? 30.805  58.434  -22.672 1.00 3.22   ? 157  ASP F N   1 
ATOM   10280 C CA  . ASP K 1 157 ? 32.167  58.302  -22.195 1.00 1.00   ? 157  ASP F CA  1 
ATOM   10281 C C   . ASP K 1 157 ? 32.279  58.642  -20.712 1.00 6.79   ? 157  ASP F C   1 
ATOM   10282 O O   . ASP K 1 157 ? 33.009  58.031  -19.937 1.00 9.32   ? 157  ASP F O   1 
ATOM   10283 C CB  . ASP K 1 157 ? 33.084  59.228  -22.987 1.00 1.62   ? 157  ASP F CB  1 
ATOM   10284 C CG  . ASP K 1 157 ? 33.092  59.060  -24.480 1.00 7.39   ? 157  ASP F CG  1 
ATOM   10285 O OD1 . ASP K 1 157 ? 33.329  58.020  -25.070 1.00 7.28   ? 157  ASP F OD1 1 
ATOM   10286 O OD2 . ASP K 1 157 ? 32.837  60.172  -25.098 1.00 11.20  ? 157  ASP F OD2 1 
ATOM   10287 N N   . VAL K 1 158 ? 31.589  59.658  -20.267 1.00 2.97   ? 158  VAL F N   1 
ATOM   10288 C CA  . VAL K 1 158 ? 31.733  59.977  -18.843 1.00 3.11   ? 158  VAL F CA  1 
ATOM   10289 C C   . VAL K 1 158 ? 31.234  58.876  -17.919 1.00 12.25  ? 158  VAL F C   1 
ATOM   10290 O O   . VAL K 1 158 ? 31.866  58.512  -16.922 1.00 12.12  ? 158  VAL F O   1 
ATOM   10291 C CB  . VAL K 1 158 ? 31.026  61.279  -18.461 1.00 6.13   ? 158  VAL F CB  1 
ATOM   10292 C CG1 . VAL K 1 158 ? 31.272  61.632  -17.008 1.00 8.89   ? 158  VAL F CG1 1 
ATOM   10293 C CG2 . VAL K 1 158 ? 31.350  62.426  -19.382 1.00 1.00   ? 158  VAL F CG2 1 
ATOM   10294 N N   . ILE K 1 159 ? 30.043  58.357  -18.232 1.00 8.29   ? 159  ILE F N   1 
ATOM   10295 C CA  . ILE K 1 159 ? 29.451  57.325  -17.392 1.00 4.76   ? 159  ILE F CA  1 
ATOM   10296 C C   . ILE K 1 159 ? 30.290  56.079  -17.371 1.00 8.02   ? 159  ILE F C   1 
ATOM   10297 O O   . ILE K 1 159 ? 30.440  55.406  -16.349 1.00 12.26  ? 159  ILE F O   1 
ATOM   10298 C CB  . ILE K 1 159 ? 28.038  57.002  -17.850 1.00 7.13   ? 159  ILE F CB  1 
ATOM   10299 C CG1 . ILE K 1 159 ? 27.199  58.266  -17.854 1.00 7.72   ? 159  ILE F CG1 1 
ATOM   10300 C CG2 . ILE K 1 159 ? 27.404  56.052  -16.866 1.00 1.00   ? 159  ILE F CG2 1 
ATOM   10301 C CD1 . ILE K 1 159 ? 27.273  58.983  -16.501 1.00 2.92   ? 159  ILE F CD1 1 
ATOM   10302 N N   . LEU K 1 160 ? 30.859  55.809  -18.531 1.00 1.91   ? 160  LEU F N   1 
ATOM   10303 C CA  . LEU K 1 160 ? 31.695  54.648  -18.680 1.00 3.04   ? 160  LEU F CA  1 
ATOM   10304 C C   . LEU K 1 160 ? 32.942  54.830  -17.909 1.00 6.29   ? 160  LEU F C   1 
ATOM   10305 O O   . LEU K 1 160 ? 33.298  54.000  -17.077 1.00 12.58  ? 160  LEU F O   1 
ATOM   10306 C CB  . LEU K 1 160 ? 31.919  54.322  -20.142 1.00 4.78   ? 160  LEU F CB  1 
ATOM   10307 C CG  . LEU K 1 160 ? 32.818  53.136  -20.316 1.00 5.70   ? 160  LEU F CG  1 
ATOM   10308 C CD1 . LEU K 1 160 ? 32.295  51.916  -19.585 1.00 1.00   ? 160  LEU F CD1 1 
ATOM   10309 C CD2 . LEU K 1 160 ? 32.837  52.861  -21.787 1.00 1.00   ? 160  LEU F CD2 1 
ATOM   10310 N N   . LEU K 1 161 ? 33.545  55.975  -18.107 1.00 1.00   ? 161  LEU F N   1 
ATOM   10311 C CA  . LEU K 1 161 ? 34.702  56.280  -17.313 1.00 2.24   ? 161  LEU F CA  1 
ATOM   10312 C C   . LEU K 1 161 ? 34.417  56.196  -15.816 1.00 6.32   ? 161  LEU F C   1 
ATOM   10313 O O   . LEU K 1 161 ? 35.132  55.590  -15.016 1.00 7.38   ? 161  LEU F O   1 
ATOM   10314 C CB  . LEU K 1 161 ? 35.163  57.701  -17.594 1.00 4.61   ? 161  LEU F CB  1 
ATOM   10315 C CG  . LEU K 1 161 ? 36.361  58.088  -16.707 1.00 11.13  ? 161  LEU F CG  1 
ATOM   10316 C CD1 . LEU K 1 161 ? 37.592  57.246  -16.985 1.00 6.22   ? 161  LEU F CD1 1 
ATOM   10317 C CD2 . LEU K 1 161 ? 36.749  59.515  -16.991 1.00 5.61   ? 161  LEU F CD2 1 
ATOM   10318 N N   . GLN K 1 162 ? 33.321  56.780  -15.425 1.00 1.00   ? 162  GLN F N   1 
ATOM   10319 C CA  . GLN K 1 162 ? 33.001  56.752  -14.015 1.00 2.60   ? 162  GLN F CA  1 
ATOM   10320 C C   . GLN K 1 162 ? 32.904  55.366  -13.422 1.00 9.76   ? 162  GLN F C   1 
ATOM   10321 O O   . GLN K 1 162 ? 33.418  55.082  -12.349 1.00 13.96  ? 162  GLN F O   1 
ATOM   10322 C CB  . GLN K 1 162 ? 31.679  57.478  -13.770 1.00 5.01   ? 162  GLN F CB  1 
ATOM   10323 C CG  . GLN K 1 162 ? 30.991  56.834  -12.573 1.00 1.00   ? 162  GLN F CG  1 
ATOM   10324 C CD  . GLN K 1 162 ? 29.707  57.491  -12.052 1.00 7.99   ? 162  GLN F CD  1 
ATOM   10325 O OE1 . GLN K 1 162 ? 29.511  57.519  -10.839 1.00 13.25  ? 162  GLN F OE1 1 
ATOM   10326 N NE2 . GLN K 1 162 ? 28.741  57.856  -12.908 1.00 1.00   ? 162  GLN F NE2 1 
ATOM   10327 N N   . THR K 1 163 ? 32.269  54.520  -14.213 1.00 8.32   ? 163  THR F N   1 
ATOM   10328 C CA  . THR K 1 163 ? 31.991  53.154  -13.852 1.00 6.48   ? 163  THR F CA  1 
ATOM   10329 C C   . THR K 1 163 ? 33.226  52.289  -13.803 1.00 10.48  ? 163  THR F C   1 
ATOM   10330 O O   . THR K 1 163 ? 33.493  51.532  -12.873 1.00 9.86   ? 163  THR F O   1 
ATOM   10331 C CB  . THR K 1 163 ? 30.947  52.585  -14.829 1.00 3.83   ? 163  THR F CB  1 
ATOM   10332 O OG1 . THR K 1 163 ? 29.776  53.391  -14.893 1.00 7.93   ? 163  THR F OG1 1 
ATOM   10333 C CG2 . THR K 1 163 ? 30.581  51.170  -14.469 1.00 1.00   ? 163  THR F CG2 1 
ATOM   10334 N N   . ILE K 1 164 ? 33.986  52.378  -14.847 1.00 6.30   ? 164  ILE F N   1 
ATOM   10335 C CA  . ILE K 1 164 ? 35.215  51.629  -14.898 1.00 5.83   ? 164  ILE F CA  1 
ATOM   10336 C C   . ILE K 1 164 ? 36.100  51.967  -13.701 1.00 10.33  ? 164  ILE F C   1 
ATOM   10337 O O   . ILE K 1 164 ? 36.594  51.097  -12.949 1.00 8.32   ? 164  ILE F O   1 
ATOM   10338 C CB  . ILE K 1 164 ? 35.938  52.130  -16.108 1.00 8.52   ? 164  ILE F CB  1 
ATOM   10339 C CG1 . ILE K 1 164 ? 35.445  51.429  -17.364 1.00 6.79   ? 164  ILE F CG1 1 
ATOM   10340 C CG2 . ILE K 1 164 ? 37.388  51.854  -15.881 1.00 3.92   ? 164  ILE F CG2 1 
ATOM   10341 C CD1 . ILE K 1 164 ? 36.045  52.022  -18.615 1.00 1.00   ? 164  ILE F CD1 1 
ATOM   10342 N N   . LEU K 1 165 ? 36.262  53.269  -13.463 1.00 1.85   ? 165  LEU F N   1 
ATOM   10343 C CA  . LEU K 1 165 ? 37.081  53.616  -12.319 1.00 1.15   ? 165  LEU F CA  1 
ATOM   10344 C C   . LEU K 1 165 ? 36.574  53.100  -11.010 1.00 7.95   ? 165  LEU F C   1 
ATOM   10345 O O   . LEU K 1 165 ? 37.331  52.766  -10.112 1.00 14.91  ? 165  LEU F O   1 
ATOM   10346 C CB  . LEU K 1 165 ? 37.264  55.105  -12.184 1.00 3.68   ? 165  LEU F CB  1 
ATOM   10347 C CG  . LEU K 1 165 ? 37.905  55.773  -13.391 1.00 9.64   ? 165  LEU F CG  1 
ATOM   10348 C CD1 . LEU K 1 165 ? 38.084  57.254  -13.131 1.00 5.44   ? 165  LEU F CD1 1 
ATOM   10349 C CD2 . LEU K 1 165 ? 39.251  55.179  -13.676 1.00 1.00   ? 165  LEU F CD2 1 
ATOM   10350 N N   . ALA K 1 166 ? 35.276  53.112  -10.877 1.00 8.71   ? 166  ALA F N   1 
ATOM   10351 C CA  . ALA K 1 166 ? 34.675  52.625  -9.657  1.00 1.59   ? 166  ALA F CA  1 
ATOM   10352 C C   . ALA K 1 166 ? 34.897  51.138  -9.497  1.00 7.30   ? 166  ALA F C   1 
ATOM   10353 O O   . ALA K 1 166 ? 35.105  50.613  -8.415  1.00 7.68   ? 166  ALA F O   1 
ATOM   10354 C CB  . ALA K 1 166 ? 33.231  52.867  -9.810  1.00 1.00   ? 166  ALA F CB  1 
ATOM   10355 N N   . LEU K 1 167 ? 34.863  50.441  -10.609 1.00 4.92   ? 167  LEU F N   1 
ATOM   10356 C CA  . LEU K 1 167 ? 35.065  49.032  -10.564 1.00 4.32   ? 167  LEU F CA  1 
ATOM   10357 C C   . LEU K 1 167 ? 36.489  48.776  -10.189 1.00 12.12  ? 167  LEU F C   1 
ATOM   10358 O O   . LEU K 1 167 ? 36.797  47.924  -9.346  1.00 11.02  ? 167  LEU F O   1 
ATOM   10359 C CB  . LEU K 1 167 ? 34.817  48.485  -11.966 1.00 4.79   ? 167  LEU F CB  1 
ATOM   10360 C CG  . LEU K 1 167 ? 33.341  48.280  -12.210 1.00 9.14   ? 167  LEU F CG  1 
ATOM   10361 C CD1 . LEU K 1 167 ? 33.041  48.103  -13.654 1.00 6.73   ? 167  LEU F CD1 1 
ATOM   10362 C CD2 . LEU K 1 167 ? 32.931  46.992  -11.562 1.00 1.00   ? 167  LEU F CD2 1 
ATOM   10363 N N   . GLU K 1 168 ? 37.369  49.540  -10.829 1.00 7.20   ? 168  GLU F N   1 
ATOM   10364 C CA  . GLU K 1 168 ? 38.765  49.345  -10.514 1.00 5.64   ? 168  GLU F CA  1 
ATOM   10365 C C   . GLU K 1 168 ? 39.075  49.546  -9.060  1.00 13.17  ? 168  GLU F C   1 
ATOM   10366 O O   . GLU K 1 168 ? 40.066  49.056  -8.531  1.00 20.60  ? 168  GLU F O   1 
ATOM   10367 C CB  . GLU K 1 168 ? 39.686  50.214  -11.280 1.00 1.00   ? 168  GLU F CB  1 
ATOM   10368 C CG  . GLU K 1 168 ? 39.673  49.844  -12.741 1.00 11.55  ? 168  GLU F CG  1 
ATOM   10369 C CD  . GLU K 1 168 ? 40.696  50.656  -13.491 1.00 4.97   ? 168  GLU F CD  1 
ATOM   10370 O OE1 . GLU K 1 168 ? 40.977  51.832  -13.177 1.00 25.67  ? 168  GLU F OE1 1 
ATOM   10371 O OE2 . GLU K 1 168 ? 41.332  49.942  -14.430 1.00 38.28  ? 168  GLU F OE2 1 
ATOM   10372 N N   . GLU K 1 169 ? 38.270  50.312  -8.412  1.00 3.60   ? 169  GLU F N   1 
ATOM   10373 C CA  . GLU K 1 169 ? 38.523  50.456  -7.021  1.00 3.76   ? 169  GLU F CA  1 
ATOM   10374 C C   . GLU K 1 169 ? 38.335  49.131  -6.349  1.00 13.90  ? 169  GLU F C   1 
ATOM   10375 O O   . GLU K 1 169 ? 38.982  48.881  -5.360  1.00 20.41  ? 169  GLU F O   1 
ATOM   10376 C CB  . GLU K 1 169 ? 37.621  51.480  -6.306  1.00 5.62   ? 169  GLU F CB  1 
ATOM   10377 C CG  . GLU K 1 169 ? 37.829  52.939  -6.724  1.00 3.86   ? 169  GLU F CG  1 
ATOM   10378 C CD  . GLU K 1 169 ? 36.672  53.796  -6.291  1.00 20.25  ? 169  GLU F CD  1 
ATOM   10379 O OE1 . GLU K 1 169 ? 35.625  53.330  -5.958  1.00 27.21  ? 169  GLU F OE1 1 
ATOM   10380 O OE2 . GLU K 1 169 ? 36.839  55.068  -6.500  1.00 8.59   ? 169  GLU F OE2 1 
ATOM   10381 N N   . LYS K 1 170 ? 37.440  48.284  -6.839  1.00 13.87  ? 170  LYS F N   1 
ATOM   10382 C CA  . LYS K 1 170 ? 37.257  46.998  -6.189  1.00 10.02  ? 170  LYS F CA  1 
ATOM   10383 C C   . LYS K 1 170 ? 38.043  45.888  -6.873  1.00 19.17  ? 170  LYS F C   1 
ATOM   10384 O O   . LYS K 1 170 ? 38.417  44.906  -6.226  1.00 19.33  ? 170  LYS F O   1 
ATOM   10385 C CB  . LYS K 1 170 ? 35.814  46.581  -6.195  1.00 8.99   ? 170  LYS F CB  1 
ATOM   10386 C CG  . LYS K 1 170 ? 34.931  47.670  -5.696  1.00 9.35   ? 170  LYS F CG  1 
ATOM   10387 C CD  . LYS K 1 170 ? 33.721  47.256  -4.848  1.00 10.16  ? 170  LYS F CD  1 
ATOM   10388 C CE  . LYS K 1 170 ? 33.109  48.449  -4.107  1.00 32.81  ? 170  LYS F CE  1 
ATOM   10389 N NZ  . LYS K 1 170 ? 32.252  48.149  -2.933  1.00 121.55 ? 170  LYS F NZ  1 
ATOM   10390 N N   . ILE K 1 171 ? 38.241  46.021  -8.193  1.00 13.36  ? 171  ILE F N   1 
ATOM   10391 C CA  . ILE K 1 171 ? 38.933  45.008  -9.001  1.00 7.24   ? 171  ILE F CA  1 
ATOM   10392 C C   . ILE K 1 171 ? 39.815  45.702  -9.979  1.00 13.74  ? 171  ILE F C   1 
ATOM   10393 O O   . ILE K 1 171 ? 39.492  45.999  -11.137 1.00 23.49  ? 171  ILE F O   1 
ATOM   10394 C CB  . ILE K 1 171 ? 37.931  44.205  -9.785  1.00 8.56   ? 171  ILE F CB  1 
ATOM   10395 C CG1 . ILE K 1 171 ? 36.746  43.853  -8.910  1.00 7.78   ? 171  ILE F CG1 1 
ATOM   10396 C CG2 . ILE K 1 171 ? 38.600  42.969  -10.248 1.00 1.00   ? 171  ILE F CG2 1 
ATOM   10397 C CD1 . ILE K 1 171 ? 35.515  43.536  -9.721  1.00 7.31   ? 171  ILE F CD1 1 
ATOM   10398 N N   . PRO K 1 172 ? 40.922  45.945  -9.415  1.00 7.06   ? 172  PRO F N   1 
ATOM   10399 C CA  . PRO K 1 172 ? 41.999  46.724  -9.908  1.00 9.45   ? 172  PRO F CA  1 
ATOM   10400 C C   . PRO K 1 172 ? 42.526  46.369  -11.235 1.00 17.10  ? 172  PRO F C   1 
ATOM   10401 O O   . PRO K 1 172 ? 43.051  47.247  -11.878 1.00 16.45  ? 172  PRO F O   1 
ATOM   10402 C CB  . PRO K 1 172 ? 43.089  46.737  -8.829  1.00 4.38   ? 172  PRO F CB  1 
ATOM   10403 C CG  . PRO K 1 172 ? 42.408  46.226  -7.582  1.00 3.83   ? 172  PRO F CG  1 
ATOM   10404 C CD  . PRO K 1 172 ? 41.121  45.532  -8.020  1.00 6.07   ? 172  PRO F CD  1 
ATOM   10405 N N   . ASN K 1 173 ? 42.391  45.115  -11.596 1.00 15.91  ? 173  ASN F N   1 
ATOM   10406 C CA  . ASN K 1 173 ? 42.871  44.595  -12.857 1.00 14.15  ? 173  ASN F CA  1 
ATOM   10407 C C   . ASN K 1 173 ? 41.722  44.258  -13.749 1.00 21.82  ? 173  ASN F C   1 
ATOM   10408 O O   . ASN K 1 173 ? 41.819  43.438  -14.622 1.00 26.37  ? 173  ASN F O   1 
ATOM   10409 C CB  . ASN K 1 173 ? 43.556  43.264  -12.564 1.00 8.39   ? 173  ASN F CB  1 
ATOM   10410 C CG  . ASN K 1 173 ? 42.710  42.297  -11.744 1.00 42.06  ? 173  ASN F CG  1 
ATOM   10411 O OD1 . ASN K 1 173 ? 42.031  42.706  -10.779 1.00 79.29  ? 173  ASN F OD1 1 
ATOM   10412 N ND2 . ASN K 1 173 ? 42.932  40.989  -11.977 1.00 48.92  ? 173  ASN F ND2 1 
ATOM   10413 N N   . ILE K 1 174 ? 40.594  44.841  -13.488 1.00 17.65  ? 174  ILE F N   1 
ATOM   10414 C CA  . ILE K 1 174 ? 39.472  44.486  -14.268 1.00 10.65  ? 174  ILE F CA  1 
ATOM   10415 C C   . ILE K 1 174 ? 39.638  44.791  -15.745 1.00 15.63  ? 174  ILE F C   1 
ATOM   10416 O O   . ILE K 1 174 ? 39.108  44.101  -16.611 1.00 22.04  ? 174  ILE F O   1 
ATOM   10417 C CB  . ILE K 1 174 ? 38.258  45.066  -13.631 1.00 10.88  ? 174  ILE F CB  1 
ATOM   10418 C CG1 . ILE K 1 174 ? 37.114  44.334  -14.252 1.00 5.26   ? 174  ILE F CG1 1 
ATOM   10419 C CG2 . ILE K 1 174 ? 38.237  46.603  -13.847 1.00 1.00   ? 174  ILE F CG2 1 
ATOM   10420 C CD1 . ILE K 1 174 ? 35.940  44.600  -13.402 1.00 16.19  ? 174  ILE F CD1 1 
ATOM   10421 N N   . LEU K 1 175 ? 40.478  45.780  -16.057 1.00 13.16  ? 175  LEU F N   1 
ATOM   10422 C CA  . LEU K 1 175 ? 40.690  46.169  -17.453 1.00 10.15  ? 175  LEU F CA  1 
ATOM   10423 C C   . LEU K 1 175 ? 41.826  45.477  -18.186 1.00 23.77  ? 175  LEU F C   1 
ATOM   10424 O O   . LEU K 1 175 ? 42.102  45.786  -19.372 1.00 21.65  ? 175  LEU F O   1 
ATOM   10425 C CB  . LEU K 1 175 ? 41.017  47.637  -17.557 1.00 5.76   ? 175  LEU F CB  1 
ATOM   10426 C CG  . LEU K 1 175 ? 39.830  48.581  -17.592 1.00 9.61   ? 175  LEU F CG  1 
ATOM   10427 C CD1 . LEU K 1 175 ? 40.360  49.901  -18.073 1.00 10.47  ? 175  LEU F CD1 1 
ATOM   10428 C CD2 . LEU K 1 175 ? 38.683  48.111  -18.498 1.00 1.06   ? 175  LEU F CD2 1 
ATOM   10429 N N   . SER K 1 176 ? 42.499  44.617  -17.427 1.00 22.38  ? 176  SER F N   1 
ATOM   10430 C CA  . SER K 1 176 ? 43.635  43.822  -17.874 1.00 20.12  ? 176  SER F CA  1 
ATOM   10431 C C   . SER K 1 176 ? 43.421  43.356  -19.287 1.00 19.57  ? 176  SER F C   1 
ATOM   10432 O O   . SER K 1 176 ? 44.198  43.637  -20.158 1.00 36.15  ? 176  SER F O   1 
ATOM   10433 C CB  . SER K 1 176 ? 43.861  42.601  -16.983 1.00 27.14  ? 176  SER F CB  1 
ATOM   10434 O OG  . SER K 1 176 ? 42.626  41.864  -16.887 1.00 92.26  ? 176  SER F OG  1 
ATOM   10435 N N   . ALA K 1 177 ? 42.354  42.663  -19.551 1.00 14.43  ? 177  ALA F N   1 
ATOM   10436 C CA  . ALA K 1 177 ? 42.141  42.192  -20.900 1.00 7.83   ? 177  ALA F CA  1 
ATOM   10437 C C   . ALA K 1 177 ? 41.571  43.180  -21.902 1.00 15.57  ? 177  ALA F C   1 
ATOM   10438 O O   . ALA K 1 177 ? 41.242  42.696  -22.992 1.00 21.58  ? 177  ALA F O   1 
ATOM   10439 C CB  . ALA K 1 177 ? 41.221  41.011  -20.864 1.00 5.96   ? 177  ALA F CB  1 
ATOM   10440 N N   . PHE K 1 178 ? 41.447  44.483  -21.535 1.00 6.27   ? 178  PHE F N   1 
ATOM   10441 C CA  . PHE K 1 178 ? 40.865  45.507  -22.380 1.00 9.20   ? 178  PHE F CA  1 
ATOM   10442 C C   . PHE K 1 178 ? 41.768  46.677  -22.553 1.00 18.14  ? 178  PHE F C   1 
ATOM   10443 O O   . PHE K 1 178 ? 41.613  47.742  -22.003 1.00 24.51  ? 178  PHE F O   1 
ATOM   10444 C CB  . PHE K 1 178 ? 39.510  45.954  -21.814 1.00 10.48  ? 178  PHE F CB  1 
ATOM   10445 C CG  . PHE K 1 178 ? 38.669  44.729  -21.556 1.00 6.36   ? 178  PHE F CG  1 
ATOM   10446 C CD1 . PHE K 1 178 ? 37.906  44.161  -22.571 1.00 1.27   ? 178  PHE F CD1 1 
ATOM   10447 C CD2 . PHE K 1 178 ? 38.634  44.126  -20.303 1.00 11.09  ? 178  PHE F CD2 1 
ATOM   10448 C CE1 . PHE K 1 178 ? 37.083  43.055  -22.332 1.00 1.00   ? 178  PHE F CE1 1 
ATOM   10449 C CE2 . PHE K 1 178 ? 37.870  42.982  -20.066 1.00 11.28  ? 178  PHE F CE2 1 
ATOM   10450 C CZ  . PHE K 1 178 ? 37.098  42.430  -21.087 1.00 1.00   ? 178  PHE F CZ  1 
ATOM   10451 N N   . PRO K 1 179 ? 42.713  46.420  -23.364 1.00 20.81  ? 179  PRO F N   1 
ATOM   10452 C CA  . PRO K 1 179 ? 43.788  47.300  -23.749 1.00 19.51  ? 179  PRO F CA  1 
ATOM   10453 C C   . PRO K 1 179 ? 43.259  48.560  -24.378 1.00 24.18  ? 179  PRO F C   1 
ATOM   10454 O O   . PRO K 1 179 ? 43.741  49.641  -24.079 1.00 26.95  ? 179  PRO F O   1 
ATOM   10455 C CB  . PRO K 1 179 ? 44.563  46.520  -24.780 1.00 15.42  ? 179  PRO F CB  1 
ATOM   10456 C CG  . PRO K 1 179 ? 43.916  45.174  -24.944 1.00 15.39  ? 179  PRO F CG  1 
ATOM   10457 C CD  . PRO K 1 179 ? 42.861  45.055  -23.868 1.00 16.82  ? 179  PRO F CD  1 
ATOM   10458 N N   . PHE K 1 180 ? 42.248  48.437  -25.220 1.00 16.21  ? 180  PHE F N   1 
ATOM   10459 C CA  . PHE K 1 180 ? 41.658  49.654  -25.764 1.00 14.12  ? 180  PHE F CA  1 
ATOM   10460 C C   . PHE K 1 180 ? 41.012  50.460  -24.666 1.00 18.51  ? 180  PHE F C   1 
ATOM   10461 O O   . PHE K 1 180 ? 41.233  51.664  -24.556 1.00 18.74  ? 180  PHE F O   1 
ATOM   10462 C CB  . PHE K 1 180 ? 40.606  49.324  -26.792 1.00 16.34  ? 180  PHE F CB  1 
ATOM   10463 C CG  . PHE K 1 180 ? 41.335  49.031  -28.081 1.00 21.04  ? 180  PHE F CG  1 
ATOM   10464 C CD1 . PHE K 1 180 ? 41.919  47.791  -28.314 1.00 20.75  ? 180  PHE F CD1 1 
ATOM   10465 C CD2 . PHE K 1 180 ? 41.534  50.007  -29.064 1.00 26.78  ? 180  PHE F CD2 1 
ATOM   10466 C CE1 . PHE K 1 180 ? 42.596  47.527  -29.512 1.00 18.28  ? 180  PHE F CE1 1 
ATOM   10467 C CE2 . PHE K 1 180 ? 42.227  49.783  -30.259 1.00 17.67  ? 180  PHE F CE2 1 
ATOM   10468 C CZ  . PHE K 1 180 ? 42.753  48.513  -30.488 1.00 10.82  ? 180  PHE F CZ  1 
ATOM   10469 N N   . LEU K 1 181 ? 40.242  49.758  -23.821 1.00 8.93   ? 181  LEU F N   1 
ATOM   10470 C CA  . LEU K 1 181 ? 39.603  50.425  -22.736 1.00 9.86   ? 181  LEU F CA  1 
ATOM   10471 C C   . LEU K 1 181 ? 40.647  51.034  -21.829 1.00 12.03  ? 181  LEU F C   1 
ATOM   10472 O O   . LEU K 1 181 ? 40.480  52.140  -21.264 1.00 13.20  ? 181  LEU F O   1 
ATOM   10473 C CB  . LEU K 1 181 ? 38.659  49.496  -21.948 1.00 13.77  ? 181  LEU F CB  1 
ATOM   10474 C CG  . LEU K 1 181 ? 37.358  49.197  -22.653 1.00 13.05  ? 181  LEU F CG  1 
ATOM   10475 C CD1 . LEU K 1 181 ? 36.541  48.159  -21.893 1.00 11.41  ? 181  LEU F CD1 1 
ATOM   10476 C CD2 . LEU K 1 181 ? 36.629  50.495  -22.748 1.00 1.82   ? 181  LEU F CD2 1 
ATOM   10477 N N   . GLN K 1 182 ? 41.776  50.357  -21.692 1.00 9.34   ? 182  GLN F N   1 
ATOM   10478 C CA  . GLN K 1 182 ? 42.762  50.981  -20.807 1.00 8.76   ? 182  GLN F CA  1 
ATOM   10479 C C   . GLN K 1 182 ? 43.267  52.273  -21.362 1.00 14.41  ? 182  GLN F C   1 
ATOM   10480 O O   . GLN K 1 182 ? 43.393  53.260  -20.687 1.00 16.30  ? 182  GLN F O   1 
ATOM   10481 C CB  . GLN K 1 182 ? 43.977  50.163  -20.561 1.00 6.64   ? 182  GLN F CB  1 
ATOM   10482 C CG  . GLN K 1 182 ? 43.855  48.937  -19.664 1.00 35.10  ? 182  GLN F CG  1 
ATOM   10483 C CD  . GLN K 1 182 ? 45.037  48.026  -19.960 1.00 18.09  ? 182  GLN F CD  1 
ATOM   10484 O OE1 . GLN K 1 182 ? 46.119  48.484  -20.378 1.00 83.28  ? 182  GLN F OE1 1 
ATOM   10485 N NE2 . GLN K 1 182 ? 44.807  46.727  -19.943 1.00 33.79  ? 182  GLN F NE2 1 
ATOM   10486 N N   . GLU K 1 183 ? 43.562  52.283  -22.620 1.00 15.58  ? 183  GLU F N   1 
ATOM   10487 C CA  . GLU K 1 183 ? 44.053  53.494  -23.161 1.00 18.74  ? 183  GLU F CA  1 
ATOM   10488 C C   . GLU K 1 183 ? 43.051  54.579  -23.132 1.00 16.44  ? 183  GLU F C   1 
ATOM   10489 O O   . GLU K 1 183 ? 43.344  55.691  -22.742 1.00 21.35  ? 183  GLU F O   1 
ATOM   10490 C CB  . GLU K 1 183 ? 44.550  53.323  -24.566 1.00 23.36  ? 183  GLU F CB  1 
ATOM   10491 C CG  . GLU K 1 183 ? 45.667  54.309  -24.983 1.00 90.45  ? 183  GLU F CG  1 
ATOM   10492 C CD  . GLU K 1 183 ? 45.918  54.144  -26.426 1.00 240.06 ? 183  GLU F CD  1 
ATOM   10493 O OE1 . GLU K 1 183 ? 45.674  53.138  -27.052 1.00 286.72 ? 183  GLU F OE1 1 
ATOM   10494 O OE2 . GLU K 1 183 ? 46.642  55.104  -26.944 1.00 267.52 ? 183  GLU F OE2 1 
ATOM   10495 N N   . TYR K 1 184 ? 41.865  54.246  -23.561 1.00 16.75  ? 184  TYR F N   1 
ATOM   10496 C CA  . TYR K 1 184 ? 40.766  55.194  -23.596 1.00 15.59  ? 184  TYR F CA  1 
ATOM   10497 C C   . TYR K 1 184 ? 40.598  55.892  -22.240 1.00 17.05  ? 184  TYR F C   1 
ATOM   10498 O O   . TYR K 1 184 ? 40.504  57.132  -22.109 1.00 16.57  ? 184  TYR F O   1 
ATOM   10499 C CB  . TYR K 1 184 ? 39.603  54.311  -23.902 1.00 10.91  ? 184  TYR F CB  1 
ATOM   10500 C CG  . TYR K 1 184 ? 38.252  54.915  -23.784 1.00 13.32  ? 184  TYR F CG  1 
ATOM   10501 C CD1 . TYR K 1 184 ? 37.627  55.623  -24.814 1.00 12.11  ? 184  TYR F CD1 1 
ATOM   10502 C CD2 . TYR K 1 184 ? 37.498  54.626  -22.648 1.00 10.72  ? 184  TYR F CD2 1 
ATOM   10503 C CE1 . TYR K 1 184 ? 36.346  56.156  -24.621 1.00 9.98   ? 184  TYR F CE1 1 
ATOM   10504 C CE2 . TYR K 1 184 ? 36.207  55.126  -22.462 1.00 4.44   ? 184  TYR F CE2 1 
ATOM   10505 C CZ  . TYR K 1 184 ? 35.608  55.887  -23.460 1.00 8.44   ? 184  TYR F CZ  1 
ATOM   10506 O OH  . TYR K 1 184 ? 34.294  56.324  -23.287 1.00 17.51  ? 184  TYR F OH  1 
ATOM   10507 N N   . THR K 1 185 ? 40.664  55.074  -21.203 1.00 2.92   ? 185  THR F N   1 
ATOM   10508 C CA  . THR K 1 185 ? 40.510  55.544  -19.841 1.00 2.77   ? 185  THR F CA  1 
ATOM   10509 C C   . THR K 1 185 ? 41.576  56.522  -19.491 1.00 13.26  ? 185  THR F C   1 
ATOM   10510 O O   . THR K 1 185 ? 41.404  57.564  -18.865 1.00 13.17  ? 185  THR F O   1 
ATOM   10511 C CB  . THR K 1 185 ? 40.671  54.322  -18.925 1.00 14.05  ? 185  THR F CB  1 
ATOM   10512 O OG1 . THR K 1 185 ? 39.578  53.523  -19.112 1.00 9.91   ? 185  THR F OG1 1 
ATOM   10513 C CG2 . THR K 1 185 ? 40.654  54.685  -17.471 1.00 3.34   ? 185  THR F CG2 1 
ATOM   10514 N N   . VAL K 1 186 ? 42.732  56.152  -19.884 1.00 11.46  ? 186  VAL F N   1 
ATOM   10515 C CA  . VAL K 1 186 ? 43.838  57.003  -19.606 1.00 14.52  ? 186  VAL F CA  1 
ATOM   10516 C C   . VAL K 1 186 ? 43.709  58.355  -20.242 1.00 11.38  ? 186  VAL F C   1 
ATOM   10517 O O   . VAL K 1 186 ? 43.826  59.388  -19.613 1.00 16.88  ? 186  VAL F O   1 
ATOM   10518 C CB  . VAL K 1 186 ? 45.082  56.362  -20.156 1.00 19.24  ? 186  VAL F CB  1 
ATOM   10519 C CG1 . VAL K 1 186 ? 46.159  57.391  -19.977 1.00 15.96  ? 186  VAL F CG1 1 
ATOM   10520 C CG2 . VAL K 1 186 ? 45.423  55.171  -19.290 1.00 14.85  ? 186  VAL F CG2 1 
ATOM   10521 N N   . LYS K 1 187 ? 43.478  58.343  -21.508 1.00 4.04   ? 187  LYS F N   1 
ATOM   10522 C CA  . LYS K 1 187 ? 43.278  59.605  -22.162 1.00 8.37   ? 187  LYS F CA  1 
ATOM   10523 C C   . LYS K 1 187 ? 42.158  60.445  -21.597 1.00 18.54  ? 187  LYS F C   1 
ATOM   10524 O O   . LYS K 1 187 ? 42.281  61.650  -21.497 1.00 20.40  ? 187  LYS F O   1 
ATOM   10525 C CB  . LYS K 1 187 ? 42.919  59.390  -23.601 1.00 7.10   ? 187  LYS F CB  1 
ATOM   10526 C CG  . LYS K 1 187 ? 43.940  58.539  -24.305 1.00 17.97  ? 187  LYS F CG  1 
ATOM   10527 C CD  . LYS K 1 187 ? 44.019  58.855  -25.795 1.00 38.64  ? 187  LYS F CD  1 
ATOM   10528 C CE  . LYS K 1 187 ? 43.929  57.633  -26.740 1.00 92.14  ? 187  LYS F CE  1 
ATOM   10529 N NZ  . LYS K 1 187 ? 42.555  57.178  -27.087 1.00 21.76  ? 187  LYS F NZ  1 
ATOM   10530 N N   . LEU K 1 188 ? 41.020  59.807  -21.392 1.00 19.55  ? 188  LEU F N   1 
ATOM   10531 C CA  . LEU K 1 188 ? 39.877  60.531  -20.927 1.00 15.53  ? 188  LEU F CA  1 
ATOM   10532 C C   . LEU K 1 188 ? 40.266  61.155  -19.638 1.00 17.36  ? 188  LEU F C   1 
ATOM   10533 O O   . LEU K 1 188 ? 39.870  62.268  -19.317 1.00 19.51  ? 188  LEU F O   1 
ATOM   10534 C CB  . LEU K 1 188 ? 38.718  59.560  -20.607 1.00 11.05  ? 188  LEU F CB  1 
ATOM   10535 C CG  . LEU K 1 188 ? 37.919  59.036  -21.783 1.00 12.13  ? 188  LEU F CG  1 
ATOM   10536 C CD1 . LEU K 1 188 ? 36.700  58.292  -21.292 1.00 9.57   ? 188  LEU F CD1 1 
ATOM   10537 C CD2 . LEU K 1 188 ? 37.449  60.126  -22.729 1.00 12.24  ? 188  LEU F CD2 1 
ATOM   10538 N N   . SER K 1 189 ? 41.002  60.384  -18.862 1.00 6.09   ? 189  SER F N   1 
ATOM   10539 C CA  . SER K 1 189 ? 41.291  60.938  -17.565 1.00 10.27  ? 189  SER F CA  1 
ATOM   10540 C C   . SER K 1 189 ? 42.206  62.102  -17.628 1.00 18.63  ? 189  SER F C   1 
ATOM   10541 O O   . SER K 1 189 ? 42.501  62.727  -16.610 1.00 20.89  ? 189  SER F O   1 
ATOM   10542 C CB  . SER K 1 189 ? 41.822  59.969  -16.559 1.00 16.35  ? 189  SER F CB  1 
ATOM   10543 O OG  . SER K 1 189 ? 41.329  58.686  -16.799 1.00 15.31  ? 189  SER F OG  1 
ATOM   10544 N N   . ASN K 1 190 ? 42.749  62.304  -18.816 1.00 18.88  ? 190  ASN F N   1 
ATOM   10545 C CA  . ASN K 1 190 ? 43.673  63.428  -18.994 1.00 20.58  ? 190  ASN F CA  1 
ATOM   10546 C C   . ASN K 1 190 ? 43.012  64.669  -19.485 1.00 29.19  ? 190  ASN F C   1 
ATOM   10547 O O   . ASN K 1 190 ? 43.651  65.678  -19.551 1.00 34.30  ? 190  ASN F O   1 
ATOM   10548 C CB  . ASN K 1 190 ? 45.124  63.217  -19.501 1.00 18.59  ? 190  ASN F CB  1 
ATOM   10549 C CG  . ASN K 1 190 ? 45.949  62.417  -18.544 1.00 101.46 ? 190  ASN F CG  1 
ATOM   10550 O OD1 . ASN K 1 190 ? 46.495  63.016  -17.589 1.00 120.18 ? 190  ASN F OD1 1 
ATOM   10551 N ND2 . ASN K 1 190 ? 45.926  61.072  -18.710 1.00 89.76  ? 190  ASN F ND2 1 
ATOM   10552 N N   . ILE K 1 191 ? 41.724  64.571  -19.806 1.00 25.31  ? 191  ILE F N   1 
ATOM   10553 C CA  . ILE K 1 191 ? 40.948  65.727  -20.148 1.00 17.82  ? 191  ILE F CA  1 
ATOM   10554 C C   . ILE K 1 191 ? 40.920  66.547  -18.862 1.00 27.30  ? 191  ILE F C   1 
ATOM   10555 O O   . ILE K 1 191 ? 40.752  66.114  -17.706 1.00 34.88  ? 191  ILE F O   1 
ATOM   10556 C CB  . ILE K 1 191 ? 39.585  65.321  -20.622 1.00 21.12  ? 191  ILE F CB  1 
ATOM   10557 C CG1 . ILE K 1 191 ? 39.776  64.636  -21.944 1.00 13.87  ? 191  ILE F CG1 1 
ATOM   10558 C CG2 . ILE K 1 191 ? 38.736  66.549  -20.841 1.00 26.89  ? 191  ILE F CG2 1 
ATOM   10559 C CD1 . ILE K 1 191 ? 38.557  63.811  -22.319 1.00 11.39  ? 191  ILE F CD1 1 
ATOM   10560 N N   . PRO K 1 192 ? 41.239  67.747  -19.084 1.00 21.14  ? 192  PRO F N   1 
ATOM   10561 C CA  . PRO K 1 192 ? 41.499  68.709  -18.056 1.00 17.83  ? 192  PRO F CA  1 
ATOM   10562 C C   . PRO K 1 192 ? 40.480  68.854  -17.005 1.00 19.97  ? 192  PRO F C   1 
ATOM   10563 O O   . PRO K 1 192 ? 40.843  68.805  -15.838 1.00 22.87  ? 192  PRO F O   1 
ATOM   10564 C CB  . PRO K 1 192 ? 41.896  69.978  -18.759 1.00 17.55  ? 192  PRO F CB  1 
ATOM   10565 C CG  . PRO K 1 192 ? 42.217  69.596  -20.202 1.00 16.14  ? 192  PRO F CG  1 
ATOM   10566 C CD  . PRO K 1 192 ? 41.644  68.197  -20.431 1.00 18.64  ? 192  PRO F CD  1 
ATOM   10567 N N   . THR K 1 193 ? 39.217  68.978  -17.408 1.00 14.39  ? 193  THR F N   1 
ATOM   10568 C CA  . THR K 1 193 ? 38.126  69.062  -16.427 1.00 9.79   ? 193  THR F CA  1 
ATOM   10569 C C   . THR K 1 193 ? 38.148  67.803  -15.619 1.00 16.14  ? 193  THR F C   1 
ATOM   10570 O O   . THR K 1 193 ? 38.039  67.810  -14.393 1.00 22.19  ? 193  THR F O   1 
ATOM   10571 C CB  . THR K 1 193 ? 36.815  69.083  -17.163 1.00 18.10  ? 193  THR F CB  1 
ATOM   10572 O OG1 . THR K 1 193 ? 36.843  68.055  -18.132 1.00 32.46  ? 193  THR F OG1 1 
ATOM   10573 C CG2 . THR K 1 193 ? 36.747  70.374  -17.924 1.00 1.00   ? 193  THR F CG2 1 
ATOM   10574 N N   . ILE K 1 194 ? 38.330  66.714  -16.358 1.00 10.60  ? 194  ILE F N   1 
ATOM   10575 C CA  . ILE K 1 194 ? 38.349  65.396  -15.752 1.00 10.39  ? 194  ILE F CA  1 
ATOM   10576 C C   . ILE K 1 194 ? 39.555  65.221  -14.895 1.00 18.17  ? 194  ILE F C   1 
ATOM   10577 O O   . ILE K 1 194 ? 39.487  64.740  -13.747 1.00 18.32  ? 194  ILE F O   1 
ATOM   10578 C CB  . ILE K 1 194 ? 38.249  64.322  -16.802 1.00 10.11  ? 194  ILE F CB  1 
ATOM   10579 C CG1 . ILE K 1 194 ? 36.896  64.494  -17.468 1.00 7.74   ? 194  ILE F CG1 1 
ATOM   10580 C CG2 . ILE K 1 194 ? 38.327  62.985  -16.125 1.00 3.49   ? 194  ILE F CG2 1 
ATOM   10581 C CD1 . ILE K 1 194 ? 36.713  63.456  -18.542 1.00 6.88   ? 194  ILE F CD1 1 
ATOM   10582 N N   . LYS K 1 195 ? 40.667  65.655  -15.466 1.00 14.50  ? 195  LYS F N   1 
ATOM   10583 C CA  . LYS K 1 195 ? 41.908  65.571  -14.738 1.00 16.16  ? 195  LYS F CA  1 
ATOM   10584 C C   . LYS K 1 195 ? 41.763  66.266  -13.402 1.00 18.60  ? 195  LYS F C   1 
ATOM   10585 O O   . LYS K 1 195 ? 42.121  65.697  -12.393 1.00 19.12  ? 195  LYS F O   1 
ATOM   10586 C CB  . LYS K 1 195 ? 43.058  66.123  -15.537 1.00 14.73  ? 195  LYS F CB  1 
ATOM   10587 C CG  . LYS K 1 195 ? 44.355  66.048  -14.757 1.00 22.53  ? 195  LYS F CG  1 
ATOM   10588 C CD  . LYS K 1 195 ? 45.619  66.542  -15.509 1.00 45.07  ? 195  LYS F CD  1 
ATOM   10589 C CE  . LYS K 1 195 ? 46.976  66.154  -14.881 1.00 63.04  ? 195  LYS F CE  1 
ATOM   10590 N NZ  . LYS K 1 195 ? 48.024  67.189  -15.014 1.00 124.12 ? 195  LYS F NZ  1 
ATOM   10591 N N   . ARG K 1 196 ? 41.108  67.439  -13.399 1.00 14.87  ? 196  ARG F N   1 
ATOM   10592 C CA  . ARG K 1 196 ? 40.888  68.166  -12.158 1.00 14.76  ? 196  ARG F CA  1 
ATOM   10593 C C   . ARG K 1 196 ? 39.965  67.441  -11.210 1.00 19.24  ? 196  ARG F C   1 
ATOM   10594 O O   . ARG K 1 196 ? 40.152  67.459  -9.995  1.00 21.84  ? 196  ARG F O   1 
ATOM   10595 C CB  . ARG K 1 196 ? 40.339  69.583  -12.348 1.00 10.93  ? 196  ARG F CB  1 
ATOM   10596 C CG  . ARG K 1 196 ? 41.259  70.595  -13.019 1.00 84.94  ? 196  ARG F CG  1 
ATOM   10597 C CD  . ARG K 1 196 ? 40.483  71.837  -13.453 1.00 131.16 ? 196  ARG F CD  1 
ATOM   10598 N NE  . ARG K 1 196 ? 40.830  72.305  -14.792 1.00 172.78 ? 196  ARG F NE  1 
ATOM   10599 C CZ  . ARG K 1 196 ? 39.909  72.709  -15.663 1.00 214.26 ? 196  ARG F CZ  1 
ATOM   10600 N NH1 . ARG K 1 196 ? 38.608  72.678  -15.349 1.00 205.59 ? 196  ARG F NH1 1 
ATOM   10601 N NH2 . ARG K 1 196 ? 40.292  73.134  -16.873 1.00 215.17 ? 196  ARG F NH2 1 
ATOM   10602 N N   . PHE K 1 197 ? 38.907  66.894  -11.783 1.00 21.18  ? 197  PHE F N   1 
ATOM   10603 C CA  . PHE K 1 197 ? 37.888  66.215  -10.995 1.00 19.20  ? 197  PHE F CA  1 
ATOM   10604 C C   . PHE K 1 197 ? 38.546  65.092  -10.259 1.00 18.79  ? 197  PHE F C   1 
ATOM   10605 O O   . PHE K 1 197 ? 38.243  64.795  -9.125  1.00 14.50  ? 197  PHE F O   1 
ATOM   10606 C CB  . PHE K 1 197 ? 36.753  65.691  -11.913 1.00 16.60  ? 197  PHE F CB  1 
ATOM   10607 C CG  . PHE K 1 197 ? 35.564  65.125  -11.164 1.00 16.51  ? 197  PHE F CG  1 
ATOM   10608 C CD1 . PHE K 1 197 ? 34.729  65.964  -10.413 1.00 17.86  ? 197  PHE F CD1 1 
ATOM   10609 C CD2 . PHE K 1 197 ? 35.235  63.769  -11.248 1.00 11.93  ? 197  PHE F CD2 1 
ATOM   10610 C CE1 . PHE K 1 197 ? 33.633  65.479  -9.697  1.00 9.94   ? 197  PHE F CE1 1 
ATOM   10611 C CE2 . PHE K 1 197 ? 34.148  63.261  -10.534 1.00 10.07  ? 197  PHE F CE2 1 
ATOM   10612 C CZ  . PHE K 1 197 ? 33.354  64.115  -9.764  1.00 6.81   ? 197  PHE F CZ  1 
ATOM   10613 N N   . LEU K 1 198 ? 39.466  64.471  -10.948 1.00 13.52  ? 198  LEU F N   1 
ATOM   10614 C CA  . LEU K 1 198 ? 40.162  63.390  -10.343 1.00 17.31  ? 198  LEU F CA  1 
ATOM   10615 C C   . LEU K 1 198 ? 41.150  63.838  -9.308  1.00 28.14  ? 198  LEU F C   1 
ATOM   10616 O O   . LEU K 1 198 ? 41.459  63.098  -8.396  1.00 31.92  ? 198  LEU F O   1 
ATOM   10617 C CB  . LEU K 1 198 ? 40.855  62.561  -11.399 1.00 17.25  ? 198  LEU F CB  1 
ATOM   10618 C CG  . LEU K 1 198 ? 39.809  61.914  -12.249 1.00 16.15  ? 198  LEU F CG  1 
ATOM   10619 C CD1 . LEU K 1 198 ? 40.454  61.324  -13.459 1.00 6.63   ? 198  LEU F CD1 1 
ATOM   10620 C CD2 . LEU K 1 198 ? 39.126  60.843  -11.431 1.00 15.83  ? 198  LEU F CD2 1 
ATOM   10621 N N   . GLU K 1 199 ? 41.612  65.062  -9.441  1.00 30.95  ? 199  GLU F N   1 
ATOM   10622 C CA  . GLU K 1 199 ? 42.529  65.626  -8.467  1.00 31.65  ? 199  GLU F CA  1 
ATOM   10623 C C   . GLU K 1 199 ? 41.815  66.058  -7.210  1.00 40.90  ? 199  GLU F C   1 
ATOM   10624 O O   . GLU K 1 199 ? 40.606  66.196  -7.144  1.00 48.36  ? 199  GLU F O   1 
ATOM   10625 C CB  . GLU K 1 199 ? 43.333  66.817  -9.017  1.00 33.09  ? 199  GLU F CB  1 
ATOM   10626 C CG  . GLU K 1 199 ? 44.509  66.407  -9.916  1.00 16.15  ? 199  GLU F CG  1 
ATOM   10627 C CD  . GLU K 1 199 ? 44.928  67.429  -10.937 1.00 54.57  ? 199  GLU F CD  1 
ATOM   10628 O OE1 . GLU K 1 199 ? 44.591  68.629  -10.938 1.00 50.51  ? 199  GLU F OE1 1 
ATOM   10629 O OE2 . GLU K 1 199 ? 45.757  66.864  -11.791 1.00 47.42  ? 199  GLU F OE2 1 
ATOM   10630 N N   . PRO K 1 200 ? 42.608  66.308  -6.210  1.00 40.19  ? 200  PRO F N   1 
ATOM   10631 C CA  . PRO K 1 200 ? 42.148  66.719  -4.916  1.00 38.67  ? 200  PRO F CA  1 
ATOM   10632 C C   . PRO K 1 200 ? 41.413  68.025  -4.874  1.00 39.52  ? 200  PRO F C   1 
ATOM   10633 O O   . PRO K 1 200 ? 41.673  68.981  -5.643  1.00 40.62  ? 200  PRO F O   1 
ATOM   10634 C CB  . PRO K 1 200 ? 43.374  66.764  -4.030  1.00 40.92  ? 200  PRO F CB  1 
ATOM   10635 C CG  . PRO K 1 200 ? 44.355  65.827  -4.692  1.00 47.45  ? 200  PRO F CG  1 
ATOM   10636 C CD  . PRO K 1 200 ? 43.899  65.624  -6.126  1.00 43.09  ? 200  PRO F CD  1 
ATOM   10637 N N   . GLY K 1 201 ? 40.457  68.024  -3.950  1.00 32.36  ? 201  GLY F N   1 
ATOM   10638 C CA  . GLY K 1 201 ? 39.632  69.194  -3.772  1.00 29.94  ? 201  GLY F CA  1 
ATOM   10639 C C   . GLY K 1 201 ? 38.474  69.350  -4.764  1.00 38.66  ? 201  GLY F C   1 
ATOM   10640 O O   . GLY K 1 201 ? 37.931  70.452  -4.840  1.00 44.65  ? 201  GLY F O   1 
ATOM   10641 N N   . SER K 1 202 ? 38.089  68.260  -5.507  1.00 26.51  ? 202  SER F N   1 
ATOM   10642 C CA  . SER K 1 202 ? 36.991  68.273  -6.474  1.00 13.49  ? 202  SER F CA  1 
ATOM   10643 C C   . SER K 1 202 ? 35.733  67.956  -5.698  1.00 20.44  ? 202  SER F C   1 
ATOM   10644 O O   . SER K 1 202 ? 35.814  67.653  -4.477  1.00 27.79  ? 202  SER F O   1 
ATOM   10645 C CB  . SER K 1 202 ? 37.210  67.246  -7.572  1.00 11.17  ? 202  SER F CB  1 
ATOM   10646 O OG  . SER K 1 202 ? 37.348  65.977  -6.947  1.00 33.64  ? 202  SER F OG  1 
ATOM   10647 N N   . LYS K 1 203 ? 34.567  68.024  -6.347  1.00 16.86  ? 203  LYS F N   1 
ATOM   10648 C CA  . LYS K 1 203 ? 33.391  67.636  -5.577  1.00 12.34  ? 203  LYS F CA  1 
ATOM   10649 C C   . LYS K 1 203 ? 33.134  66.110  -5.733  1.00 15.77  ? 203  LYS F C   1 
ATOM   10650 O O   . LYS K 1 203 ? 32.217  65.546  -5.189  1.00 15.65  ? 203  LYS F O   1 
ATOM   10651 C CB  . LYS K 1 203 ? 32.189  68.539  -5.753  1.00 12.78  ? 203  LYS F CB  1 
ATOM   10652 C CG  . LYS K 1 203 ? 32.413  69.970  -5.210  1.00 11.84  ? 203  LYS F CG  1 
ATOM   10653 C CD  . LYS K 1 203 ? 31.231  70.949  -5.360  1.00 32.90  ? 203  LYS F CD  1 
ATOM   10654 C CE  . LYS K 1 203 ? 31.530  72.450  -5.197  1.00 4.97   ? 203  LYS F CE  1 
ATOM   10655 N NZ  . LYS K 1 203 ? 32.590  72.938  -6.139  1.00 139.36 ? 203  LYS F NZ  1 
ATOM   10656 N N   . LYS K 1 204 ? 34.062  65.450  -6.416  1.00 9.39   ? 204  LYS F N   1 
ATOM   10657 C CA  . LYS K 1 204 ? 34.077  64.044  -6.593  1.00 10.47  ? 204  LYS F CA  1 
ATOM   10658 C C   . LYS K 1 204 ? 34.052  63.446  -5.215  1.00 13.83  ? 204  LYS F C   1 
ATOM   10659 O O   . LYS K 1 204 ? 34.713  63.927  -4.350  1.00 18.60  ? 204  LYS F O   1 
ATOM   10660 C CB  . LYS K 1 204 ? 35.370  63.677  -7.299  1.00 12.59  ? 204  LYS F CB  1 
ATOM   10661 C CG  . LYS K 1 204 ? 35.607  62.189  -7.306  1.00 1.00   ? 204  LYS F CG  1 
ATOM   10662 C CD  . LYS K 1 204 ? 36.599  61.733  -8.372  1.00 12.50  ? 204  LYS F CD  1 
ATOM   10663 C CE  . LYS K 1 204 ? 36.550  60.230  -8.660  1.00 1.00   ? 204  LYS F CE  1 
ATOM   10664 N NZ  . LYS K 1 204 ? 36.111  59.456  -7.486  1.00 19.12  ? 204  LYS F NZ  1 
ATOM   10665 N N   . LYS K 1 205 ? 33.223  62.450  -4.998  1.00 15.72  ? 205  LYS F N   1 
ATOM   10666 C CA  . LYS K 1 205 ? 33.080  61.820  -3.696  1.00 12.07  ? 205  LYS F CA  1 
ATOM   10667 C C   . LYS K 1 205 ? 33.775  60.477  -3.621  1.00 19.49  ? 205  LYS F C   1 
ATOM   10668 O O   . LYS K 1 205 ? 33.958  59.718  -4.562  1.00 26.86  ? 205  LYS F O   1 
ATOM   10669 C CB  . LYS K 1 205 ? 31.603  61.629  -3.346  1.00 8.61   ? 205  LYS F CB  1 
ATOM   10670 C CG  . LYS K 1 205 ? 30.819  62.911  -3.463  1.00 17.48  ? 205  LYS F CG  1 
ATOM   10671 C CD  . LYS K 1 205 ? 30.768  63.660  -2.145  1.00 9.28   ? 205  LYS F CD  1 
ATOM   10672 C CE  . LYS K 1 205 ? 30.101  65.023  -2.230  1.00 1.00   ? 205  LYS F CE  1 
ATOM   10673 N NZ  . LYS K 1 205 ? 30.931  65.971  -2.953  1.00 6.31   ? 205  LYS F NZ  1 
ATOM   10674 N N   . PRO K 1 206 ? 34.113  60.174  -2.427  1.00 14.76  ? 206  PRO F N   1 
ATOM   10675 C CA  . PRO K 1 206 ? 34.767  58.953  -2.011  1.00 11.27  ? 206  PRO F CA  1 
ATOM   10676 C C   . PRO K 1 206 ? 33.815  57.823  -1.922  1.00 15.22  ? 206  PRO F C   1 
ATOM   10677 O O   . PRO K 1 206 ? 32.604  57.986  -1.867  1.00 21.81  ? 206  PRO F O   1 
ATOM   10678 C CB  . PRO K 1 206 ? 35.185  59.168  -0.598  1.00 7.94   ? 206  PRO F CB  1 
ATOM   10679 C CG  . PRO K 1 206 ? 34.363  60.347  -0.110  1.00 14.45  ? 206  PRO F CG  1 
ATOM   10680 C CD  . PRO K 1 206 ? 33.729  61.022  -1.317  1.00 14.12  ? 206  PRO F CD  1 
ATOM   10681 N N   . PRO K 1 207 ? 34.405  56.694  -1.883  1.00 10.85  ? 207  PRO F N   1 
ATOM   10682 C CA  . PRO K 1 207 ? 33.647  55.494  -1.819  1.00 11.11  ? 207  PRO F CA  1 
ATOM   10683 C C   . PRO K 1 207 ? 33.070  55.582  -0.477  1.00 25.21  ? 207  PRO F C   1 
ATOM   10684 O O   . PRO K 1 207 ? 33.701  56.091  0.418   1.00 31.74  ? 207  PRO F O   1 
ATOM   10685 C CB  . PRO K 1 207 ? 34.679  54.368  -1.910  1.00 7.59   ? 207  PRO F CB  1 
ATOM   10686 C CG  . PRO K 1 207 ? 35.950  54.997  -2.471  1.00 8.00   ? 207  PRO F CG  1 
ATOM   10687 C CD  . PRO K 1 207 ? 35.835  56.471  -2.150  1.00 7.14   ? 207  PRO F CD  1 
ATOM   10688 N N   . PRO K 1 208 ? 31.852  55.195  -0.401  1.00 29.08  ? 208  PRO F N   1 
ATOM   10689 C CA  . PRO K 1 208 ? 31.036  55.175  0.785   1.00 30.67  ? 208  PRO F CA  1 
ATOM   10690 C C   . PRO K 1 208 ? 31.558  54.308  1.894   1.00 32.66  ? 208  PRO F C   1 
ATOM   10691 O O   . PRO K 1 208 ? 31.960  53.187  1.639   1.00 36.10  ? 208  PRO F O   1 
ATOM   10692 C CB  . PRO K 1 208 ? 29.766  54.512  0.329   1.00 31.72  ? 208  PRO F CB  1 
ATOM   10693 C CG  . PRO K 1 208 ? 30.107  53.778  -0.948  1.00 35.02  ? 208  PRO F CG  1 
ATOM   10694 C CD  . PRO K 1 208 ? 31.383  54.351  -1.479  1.00 26.22  ? 208  PRO F CD  1 
ATOM   10695 N N   . ASP K 1 209 ? 31.444  54.860  3.103   1.00 30.07  ? 209  ASP F N   1 
ATOM   10696 C CA  . ASP K 1 209 ? 31.834  54.313  4.393   1.00 30.10  ? 209  ASP F CA  1 
ATOM   10697 C C   . ASP K 1 209 ? 30.634  53.959  5.239   1.00 35.70  ? 209  ASP F C   1 
ATOM   10698 O O   . ASP K 1 209 ? 29.467  54.283  4.945   1.00 35.20  ? 209  ASP F O   1 
ATOM   10699 C CB  . ASP K 1 209 ? 32.674  55.347  5.197   1.00 33.91  ? 209  ASP F CB  1 
ATOM   10700 C CG  . ASP K 1 209 ? 32.107  56.732  5.099   1.00 69.22  ? 209  ASP F CG  1 
ATOM   10701 O OD1 . ASP K 1 209 ? 30.981  57.009  5.463   1.00 74.62  ? 209  ASP F OD1 1 
ATOM   10702 O OD2 . ASP K 1 209 ? 32.839  57.525  4.360   1.00 99.67  ? 209  ASP F OD2 1 
ATOM   10703 N N   . GLU K 1 210 ? 30.979  53.350  6.347   1.00 38.21  ? 210  GLU F N   1 
ATOM   10704 C CA  . GLU K 1 210 ? 30.007  52.941  7.318   1.00 46.01  ? 210  GLU F CA  1 
ATOM   10705 C C   . GLU K 1 210 ? 29.142  54.131  7.717   1.00 38.12  ? 210  GLU F C   1 
ATOM   10706 O O   . GLU K 1 210 ? 27.950  54.033  8.018   1.00 37.81  ? 210  GLU F O   1 
ATOM   10707 C CB  . GLU K 1 210 ? 30.748  52.320  8.524   1.00 55.83  ? 210  GLU F CB  1 
ATOM   10708 C CG  . GLU K 1 210 ? 29.840  51.662  9.597   1.00 125.54 ? 210  GLU F CG  1 
ATOM   10709 C CD  . GLU K 1 210 ? 29.182  52.633  10.565  1.00 218.62 ? 210  GLU F CD  1 
ATOM   10710 O OE1 . GLU K 1 210 ? 29.774  53.539  11.132  1.00 242.90 ? 210  GLU F OE1 1 
ATOM   10711 O OE2 . GLU K 1 210 ? 27.912  52.368  10.773  1.00 231.97 ? 210  GLU F OE2 1 
ATOM   10712 N N   . ILE K 1 211 ? 29.725  55.296  7.680   1.00 27.64  ? 211  ILE F N   1 
ATOM   10713 C CA  . ILE K 1 211 ? 28.940  56.442  8.053   1.00 30.80  ? 211  ILE F CA  1 
ATOM   10714 C C   . ILE K 1 211 ? 27.871  56.785  7.051   1.00 31.42  ? 211  ILE F C   1 
ATOM   10715 O O   . ILE K 1 211 ? 26.715  56.910  7.435   1.00 33.61  ? 211  ILE F O   1 
ATOM   10716 C CB  . ILE K 1 211 ? 29.816  57.664  8.215   1.00 40.88  ? 211  ILE F CB  1 
ATOM   10717 C CG1 . ILE K 1 211 ? 30.615  57.643  9.517   1.00 44.20  ? 211  ILE F CG1 1 
ATOM   10718 C CG2 . ILE K 1 211 ? 28.963  58.912  8.077   1.00 43.55  ? 211  ILE F CG2 1 
ATOM   10719 C CD1 . ILE K 1 211 ? 31.616  56.479  9.554   1.00 91.48  ? 211  ILE F CD1 1 
ATOM   10720 N N   . TYR K 1 212 ? 28.316  57.022  5.803   1.00 20.70  ? 212  TYR F N   1 
ATOM   10721 C CA  . TYR K 1 212 ? 27.423  57.347  4.737   1.00 19.94  ? 212  TYR F CA  1 
ATOM   10722 C C   . TYR K 1 212 ? 26.287  56.324  4.781   1.00 24.87  ? 212  TYR F C   1 
ATOM   10723 O O   . TYR K 1 212 ? 25.068  56.634  4.792   1.00 22.05  ? 212  TYR F O   1 
ATOM   10724 C CB  . TYR K 1 212 ? 28.153  57.261  3.391   1.00 18.24  ? 212  TYR F CB  1 
ATOM   10725 C CG  . TYR K 1 212 ? 27.217  57.309  2.204   1.00 23.41  ? 212  TYR F CG  1 
ATOM   10726 C CD1 . TYR K 1 212 ? 26.626  58.508  1.772   1.00 21.68  ? 212  TYR F CD1 1 
ATOM   10727 C CD2 . TYR K 1 212 ? 26.931  56.136  1.491   1.00 31.30  ? 212  TYR F CD2 1 
ATOM   10728 C CE1 . TYR K 1 212 ? 25.765  58.515  0.660   1.00 20.53  ? 212  TYR F CE1 1 
ATOM   10729 C CE2 . TYR K 1 212 ? 26.075  56.122  0.378   1.00 34.43  ? 212  TYR F CE2 1 
ATOM   10730 C CZ  . TYR K 1 212 ? 25.480  57.322  -0.033  1.00 44.89  ? 212  TYR F CZ  1 
ATOM   10731 O OH  . TYR K 1 212 ? 24.582  57.295  -1.090  1.00 44.17  ? 212  TYR F OH  1 
ATOM   10732 N N   . VAL K 1 213 ? 26.719  55.090  4.943   1.00 8.44   ? 213  VAL F N   1 
ATOM   10733 C CA  . VAL K 1 213 ? 25.716  54.079  4.976   1.00 8.96   ? 213  VAL F CA  1 
ATOM   10734 C C   . VAL K 1 213 ? 24.702  54.251  6.042   1.00 19.43  ? 213  VAL F C   1 
ATOM   10735 O O   . VAL K 1 213 ? 23.515  54.331  5.783   1.00 23.29  ? 213  VAL F O   1 
ATOM   10736 C CB  . VAL K 1 213 ? 26.313  52.727  5.002   1.00 8.72   ? 213  VAL F CB  1 
ATOM   10737 C CG1 . VAL K 1 213 ? 25.129  51.789  5.057   1.00 3.46   ? 213  VAL F CG1 1 
ATOM   10738 C CG2 . VAL K 1 213 ? 27.132  52.539  3.711   1.00 5.20   ? 213  VAL F CG2 1 
ATOM   10739 N N   . ARG K 1 214 ? 25.206  54.495  7.200   1.00 24.33  ? 214  ARG F N   1 
ATOM   10740 C CA  . ARG K 1 214 ? 24.384  54.774  8.348   1.00 26.47  ? 214  ARG F CA  1 
ATOM   10741 C C   . ARG K 1 214 ? 23.478  55.941  8.065   1.00 23.21  ? 214  ARG F C   1 
ATOM   10742 O O   . ARG K 1 214 ? 22.276  55.896  8.179   1.00 23.56  ? 214  ARG F O   1 
ATOM   10743 C CB  . ARG K 1 214 ? 25.296  55.223  9.470   1.00 47.19  ? 214  ARG F CB  1 
ATOM   10744 C CG  . ARG K 1 214 ? 24.718  54.897  10.834  1.00 121.11 ? 214  ARG F CG  1 
ATOM   10745 C CD  . ARG K 1 214 ? 23.876  53.617  10.841  1.00 191.70 ? 214  ARG F CD  1 
ATOM   10746 N NE  . ARG K 1 214 ? 23.059  53.444  12.049  1.00 254.17 ? 214  ARG F NE  1 
ATOM   10747 C CZ  . ARG K 1 214 ? 23.387  53.843  13.289  1.00 300.00 ? 214  ARG F CZ  1 
ATOM   10748 N NH1 . ARG K 1 214 ? 24.541  54.445  13.579  1.00 300.00 ? 214  ARG F NH1 1 
ATOM   10749 N NH2 . ARG K 1 214 ? 22.529  53.613  14.283  1.00 300.00 ? 214  ARG F NH2 1 
ATOM   10750 N N   . THR K 1 215 ? 24.073  57.007  7.649   1.00 15.52  ? 215  THR F N   1 
ATOM   10751 C CA  . THR K 1 215 ? 23.318  58.185  7.375   1.00 11.87  ? 215  THR F CA  1 
ATOM   10752 C C   . THR K 1 215 ? 22.220  57.988  6.377   1.00 23.89  ? 215  THR F C   1 
ATOM   10753 O O   . THR K 1 215 ? 21.148  58.569  6.534   1.00 25.01  ? 215  THR F O   1 
ATOM   10754 C CB  . THR K 1 215 ? 24.237  59.186  6.702   1.00 22.07  ? 215  THR F CB  1 
ATOM   10755 O OG1 . THR K 1 215 ? 25.227  59.692  7.550   1.00 34.28  ? 215  THR F OG1 1 
ATOM   10756 C CG2 . THR K 1 215 ? 23.342  60.290  6.222   1.00 13.80  ? 215  THR F CG2 1 
ATOM   10757 N N   . VAL K 1 216 ? 22.525  57.266  5.293   1.00 24.68  ? 216  VAL F N   1 
ATOM   10758 C CA  . VAL K 1 216 ? 21.499  57.148  4.302   1.00 23.39  ? 216  VAL F CA  1 
ATOM   10759 C C   . VAL K 1 216 ? 20.347  56.444  4.880   1.00 26.73  ? 216  VAL F C   1 
ATOM   10760 O O   . VAL K 1 216 ? 19.215  56.885  4.737   1.00 27.42  ? 216  VAL F O   1 
ATOM   10761 C CB  . VAL K 1 216 ? 21.894  56.770  2.889   1.00 27.02  ? 216  VAL F CB  1 
ATOM   10762 C CG1 . VAL K 1 216 ? 23.201  57.440  2.612   1.00 24.78  ? 216  VAL F CG1 1 
ATOM   10763 C CG2 . VAL K 1 216 ? 22.050  55.300  2.732   1.00 30.89  ? 216  VAL F CG2 1 
ATOM   10764 N N   . TYR K 1 217 ? 20.660  55.417  5.610   1.00 26.74  ? 217  TYR F N   1 
ATOM   10765 C CA  . TYR K 1 217 ? 19.596  54.715  6.285   1.00 31.47  ? 217  TYR F CA  1 
ATOM   10766 C C   . TYR K 1 217 ? 18.844  55.650  7.192   1.00 36.69  ? 217  TYR F C   1 
ATOM   10767 O O   . TYR K 1 217 ? 17.647  55.638  7.316   1.00 39.94  ? 217  TYR F O   1 
ATOM   10768 C CB  . TYR K 1 217 ? 20.121  53.621  7.180   1.00 37.04  ? 217  TYR F CB  1 
ATOM   10769 C CG  . TYR K 1 217 ? 20.474  52.377  6.443   1.00 57.37  ? 217  TYR F CG  1 
ATOM   10770 C CD1 . TYR K 1 217 ? 19.560  51.701  5.631   1.00 62.60  ? 217  TYR F CD1 1 
ATOM   10771 C CD2 . TYR K 1 217 ? 21.729  51.800  6.636   1.00 69.49  ? 217  TYR F CD2 1 
ATOM   10772 C CE1 . TYR K 1 217 ? 19.909  50.496  5.007   1.00 73.92  ? 217  TYR F CE1 1 
ATOM   10773 C CE2 . TYR K 1 217 ? 22.087  50.588  6.035   1.00 74.53  ? 217  TYR F CE2 1 
ATOM   10774 C CZ  . TYR K 1 217 ? 21.173  49.925  5.212   1.00 80.38  ? 217  TYR F CZ  1 
ATOM   10775 O OH  . TYR K 1 217 ? 21.519  48.704  4.633   1.00 63.60  ? 217  TYR F OH  1 
ATOM   10776 N N   . ASN K 1 218 ? 19.547  56.532  7.822   1.00 38.49  ? 218  ASN F N   1 
ATOM   10777 C CA  . ASN K 1 218 ? 18.799  57.398  8.679   1.00 38.84  ? 218  ASN F CA  1 
ATOM   10778 C C   . ASN K 1 218 ? 17.895  58.354  7.953   1.00 42.20  ? 218  ASN F C   1 
ATOM   10779 O O   . ASN K 1 218 ? 16.891  58.750  8.496   1.00 53.50  ? 218  ASN F O   1 
ATOM   10780 C CB  . ASN K 1 218 ? 19.617  58.029  9.823   1.00 38.59  ? 218  ASN F CB  1 
ATOM   10781 C CG  . ASN K 1 218 ? 20.230  56.942  10.688  1.00 97.21  ? 218  ASN F CG  1 
ATOM   10782 O OD1 . ASN K 1 218 ? 21.238  57.182  11.373  1.00 142.34 ? 218  ASN F OD1 1 
ATOM   10783 N ND2 . ASN K 1 218 ? 19.652  55.731  10.620  1.00 74.68  ? 218  ASN F ND2 1 
ATOM   10784 N N   . ILE K 1 219 ? 18.223  58.737  6.747   1.00 26.47  ? 219  ILE F N   1 
ATOM   10785 C CA  . ILE K 1 219 ? 17.373  59.679  6.094   1.00 21.54  ? 219  ILE F CA  1 
ATOM   10786 C C   . ILE K 1 219 ? 16.253  59.041  5.339   1.00 32.02  ? 219  ILE F C   1 
ATOM   10787 O O   . ILE K 1 219 ? 15.278  59.700  5.044   1.00 34.29  ? 219  ILE F O   1 
ATOM   10788 C CB  . ILE K 1 219 ? 18.257  60.378  5.132   1.00 23.46  ? 219  ILE F CB  1 
ATOM   10789 C CG1 . ILE K 1 219 ? 19.467  60.848  5.908   1.00 21.97  ? 219  ILE F CG1 1 
ATOM   10790 C CG2 . ILE K 1 219 ? 17.557  61.531  4.468   1.00 22.56  ? 219  ILE F CG2 1 
ATOM   10791 C CD1 . ILE K 1 219 ? 20.471  61.475  4.945   1.00 18.18  ? 219  ILE F CD1 1 
ATOM   10792 N N   . PHE K 1 220 ? 16.360  57.748  5.025   1.00 31.03  ? 220  PHE F N   1 
ATOM   10793 C CA  . PHE K 1 220 ? 15.333  57.081  4.204   1.00 29.59  ? 220  PHE F CA  1 
ATOM   10794 C C   . PHE K 1 220 ? 14.767  55.696  4.677   1.00 44.12  ? 220  PHE F C   1 
ATOM   10795 O O   . PHE K 1 220 ? 14.728  55.230  5.848   1.00 60.72  ? 220  PHE F O   1 
ATOM   10796 C CB  . PHE K 1 220 ? 15.966  56.852  2.815   1.00 33.70  ? 220  PHE F CB  1 
ATOM   10797 C CG  . PHE K 1 220 ? 16.653  57.977  2.036   1.00 34.38  ? 220  PHE F CG  1 
ATOM   10798 C CD1 . PHE K 1 220 ? 15.912  59.017  1.481   1.00 36.48  ? 220  PHE F CD1 1 
ATOM   10799 C CD2 . PHE K 1 220 ? 17.998  57.911  1.680   1.00 38.85  ? 220  PHE F CD2 1 
ATOM   10800 C CE1 . PHE K 1 220 ? 16.494  60.010  0.696   1.00 36.82  ? 220  PHE F CE1 1 
ATOM   10801 C CE2 . PHE K 1 220 ? 18.607  58.891  0.893   1.00 41.89  ? 220  PHE F CE2 1 
ATOM   10802 C CZ  . PHE K 1 220 ? 17.856  59.959  0.415   1.00 38.16  ? 220  PHE F CZ  1 
HETATM 10803 N N   . GGL L 2 1   ? 14.993  56.401  -10.327 1.00 37.15  ? 231  GGL N N   1 
HETATM 10804 C CA  . GGL L 2 1   ? 15.282  57.533  -9.453  1.00 7.63   ? 231  GGL N CA  1 
HETATM 10805 C C   . GGL L 2 1   ? 16.618  58.207  -9.757  1.00 7.03   ? 231  GGL N C   1 
HETATM 10806 O O   . GGL L 2 1   ? 16.643  59.465  -9.606  1.00 19.40  ? 231  GGL N O   1 
HETATM 10807 C CB  . GGL L 2 1   ? 15.131  57.125  -8.004  1.00 6.19   ? 231  GGL N CB  1 
HETATM 10808 C CG  . GGL L 2 1   ? 15.750  58.076  -6.991  1.00 24.61  ? 231  GGL N CG  1 
HETATM 10809 C CD  . GGL L 2 1   ? 15.570  57.467  -5.615  1.00 18.75  ? 231  GGL N CD  1 
HETATM 10810 O OE1 . GGL L 2 1   ? 15.343  56.271  -5.451  1.00 36.14  ? 231  GGL N OE1 1 
HETATM 10811 O OXT . GGL L 2 1   ? 17.493  57.491  -10.333 1.00 43.52  ? 231  GGL N OXT 1 
HETATM 10812 C C   . ICY L 2 2   ? 14.832  58.994  -2.456  1.00 29.74  ? 232  ICY N C   1 
HETATM 10813 N N   . ICY L 2 2   ? 15.700  58.309  -4.608  1.00 39.29  ? 232  ICY N N   1 
HETATM 10814 O O   . ICY L 2 2   ? 14.962  60.220  -2.707  1.00 26.16  ? 232  ICY N O   1 
HETATM 10815 C CA  . ICY L 2 2   ? 15.533  57.891  -3.229  1.00 38.11  ? 232  ICY N CA  1 
HETATM 10816 C CB  . ICY L 2 2   ? 16.852  57.395  -2.570  1.00 43.28  ? 232  ICY N CB  1 
HETATM 10817 S SG  . ICY L 2 2   ? 17.528  55.855  -3.284  1.00 46.76  ? 232  ICY N SG  1 
HETATM 10818 I I   . ICY L 2 2   ? 21.548  55.570  -2.604  1.00 90.26  ? 232  ICY N I   1 
HETATM 10819 C C0  . ICY L 2 2   ? 18.448  55.140  -1.907  1.00 300.00 ? 232  ICY N C0  1 
HETATM 10820 C C1  . ICY L 2 2   ? 19.045  53.875  -2.441  1.00 300.00 ? 232  ICY N C1  1 
HETATM 10821 C C2  . ICY L 2 2   ? 20.354  53.875  -2.941  1.00 5.69   ? 232  ICY N C2  1 
HETATM 10822 C C3  . ICY L 2 2   ? 20.822  52.668  -3.464  1.00 31.59  ? 232  ICY N C3  1 
HETATM 10823 C C4  . ICY L 2 2   ? 19.991  51.542  -3.553  1.00 15.35  ? 232  ICY N C4  1 
HETATM 10824 C C5  . ICY L 2 2   ? 18.657  51.600  -3.157  1.00 300.00 ? 232  ICY N C5  1 
HETATM 10825 C C6  . ICY L 2 2   ? 18.185  52.788  -2.605  1.00 300.00 ? 232  ICY N C6  1 
ATOM   10826 N N   . GLY L 2 3   ? 13.973  58.558  -1.565  1.00 27.44  ? 233  GLY N N   1 
ATOM   10827 C CA  . GLY L 2 3   ? 13.201  59.530  -0.796  1.00 23.21  ? 233  GLY N CA  1 
ATOM   10828 C C   . GLY L 2 3   ? 11.908  58.937  -0.306  1.00 26.89  ? 233  GLY N C   1 
ATOM   10829 O O   . GLY L 2 3   ? 11.411  59.498  0.709   1.00 47.64  ? 233  GLY N O   1 
ATOM   10830 O OXT . GLY L 2 3   ? 11.535  57.897  -0.939  1.00 83.82  ? 233  GLY N OXT 1 
ATOM   10831 N N   . ARG M 1 4   ? 47.548  -2.663  -6.804  1.00 32.33  ? 4    ARG G N   1 
ATOM   10832 C CA  . ARG M 1 4   ? 46.671  -1.517  -6.468  1.00 27.54  ? 4    ARG G CA  1 
ATOM   10833 C C   . ARG M 1 4   ? 47.508  -0.295  -6.021  1.00 35.94  ? 4    ARG G C   1 
ATOM   10834 O O   . ARG M 1 4   ? 48.229  -0.349  -5.017  1.00 45.21  ? 4    ARG G O   1 
ATOM   10835 C CB  . ARG M 1 4   ? 45.688  -2.035  -5.418  1.00 27.89  ? 4    ARG G CB  1 
ATOM   10836 C CG  . ARG M 1 4   ? 44.610  -1.171  -4.768  1.00 16.86  ? 4    ARG G CG  1 
ATOM   10837 C CD  . ARG M 1 4   ? 43.507  -2.041  -4.060  1.00 21.30  ? 4    ARG G CD  1 
ATOM   10838 N NE  . ARG M 1 4   ? 42.409  -1.222  -3.515  1.00 55.57  ? 4    ARG G NE  1 
ATOM   10839 C CZ  . ARG M 1 4   ? 41.144  -1.562  -3.221  1.00 124.64 ? 4    ARG G CZ  1 
ATOM   10840 N NH1 . ARG M 1 4   ? 40.674  -2.803  -3.374  1.00 187.32 ? 4    ARG G NH1 1 
ATOM   10841 N NH2 . ARG M 1 4   ? 40.339  -0.593  -2.743  1.00 64.09  ? 4    ARG G NH2 1 
ATOM   10842 N N   . PRO M 1 5   ? 47.428  0.826   -6.771  1.00 19.55  ? 5    PRO G N   1 
ATOM   10843 C CA  . PRO M 1 5   ? 48.232  1.981   -6.463  1.00 10.62  ? 5    PRO G CA  1 
ATOM   10844 C C   . PRO M 1 5   ? 48.040  2.515   -5.118  1.00 13.02  ? 5    PRO G C   1 
ATOM   10845 O O   . PRO M 1 5   ? 46.935  2.491   -4.551  1.00 17.31  ? 5    PRO G O   1 
ATOM   10846 C CB  . PRO M 1 5   ? 47.876  3.024   -7.477  1.00 13.08  ? 5    PRO G CB  1 
ATOM   10847 C CG  . PRO M 1 5   ? 47.342  2.249   -8.661  1.00 14.67  ? 5    PRO G CG  1 
ATOM   10848 C CD  . PRO M 1 5   ? 46.679  1.059   -8.035  1.00 15.20  ? 5    PRO G CD  1 
ATOM   10849 N N   . LYS M 1 6   ? 49.159  3.025   -4.649  1.00 10.63  ? 6    LYS G N   1 
ATOM   10850 C CA  . LYS M 1 6   ? 49.193  3.596   -3.343  1.00 12.09  ? 6    LYS G CA  1 
ATOM   10851 C C   . LYS M 1 6   ? 49.685  5.018   -3.424  1.00 19.24  ? 6    LYS G C   1 
ATOM   10852 O O   . LYS M 1 6   ? 50.749  5.337   -3.957  1.00 23.36  ? 6    LYS G O   1 
ATOM   10853 C CB  . LYS M 1 6   ? 49.994  2.743   -2.401  1.00 12.50  ? 6    LYS G CB  1 
ATOM   10854 C CG  . LYS M 1 6   ? 49.873  3.161   -0.949  1.00 5.59   ? 6    LYS G CG  1 
ATOM   10855 C CD  . LYS M 1 6   ? 50.517  2.181   0.006   1.00 22.77  ? 6    LYS G CD  1 
ATOM   10856 C CE  . LYS M 1 6   ? 49.537  1.265   0.745   1.00 101.78 ? 6    LYS G CE  1 
ATOM   10857 N NZ  . LYS M 1 6   ? 49.775  1.177   2.204   1.00 121.13 ? 6    LYS G NZ  1 
ATOM   10858 N N   . LEU M 1 7   ? 48.834  5.850   -2.890  1.00 10.70  ? 7    LEU G N   1 
ATOM   10859 C CA  . LEU M 1 7   ? 49.011  7.257   -2.875  1.00 7.75   ? 7    LEU G CA  1 
ATOM   10860 C C   . LEU M 1 7   ? 49.508  7.802   -1.582  1.00 15.45  ? 7    LEU G C   1 
ATOM   10861 O O   . LEU M 1 7   ? 48.813  7.744   -0.560  1.00 17.71  ? 7    LEU G O   1 
ATOM   10862 C CB  . LEU M 1 7   ? 47.671  7.958   -3.194  1.00 7.11   ? 7    LEU G CB  1 
ATOM   10863 C CG  . LEU M 1 7   ? 47.448  8.025   -4.701  1.00 7.44   ? 7    LEU G CG  1 
ATOM   10864 C CD1 . LEU M 1 7   ? 47.406  6.637   -5.315  1.00 1.06   ? 7    LEU G CD1 1 
ATOM   10865 C CD2 . LEU M 1 7   ? 46.202  8.767   -5.006  1.00 1.92   ? 7    LEU G CD2 1 
ATOM   10866 N N   . HIS M 1 8   ? 50.651  8.482   -1.676  1.00 10.78  ? 8    HIS G N   1 
ATOM   10867 C CA  . HIS M 1 8   ? 51.207  9.120   -0.502  1.00 10.93  ? 8    HIS G CA  1 
ATOM   10868 C C   . HIS M 1 8   ? 50.947  10.571  -0.490  1.00 15.06  ? 8    HIS G C   1 
ATOM   10869 O O   . HIS M 1 8   ? 51.428  11.269  -1.338  1.00 21.54  ? 8    HIS G O   1 
ATOM   10870 C CB  . HIS M 1 8   ? 52.708  8.901   -0.414  1.00 12.77  ? 8    HIS G CB  1 
ATOM   10871 C CG  . HIS M 1 8   ? 52.967  7.435   -0.283  1.00 12.97  ? 8    HIS G CG  1 
ATOM   10872 N ND1 . HIS M 1 8   ? 53.080  6.839   0.976   1.00 9.21   ? 8    HIS G ND1 1 
ATOM   10873 C CD2 . HIS M 1 8   ? 53.054  6.466   -1.250  1.00 10.18  ? 8    HIS G CD2 1 
ATOM   10874 C CE1 . HIS M 1 8   ? 53.229  5.543   0.736   1.00 4.88   ? 8    HIS G CE1 1 
ATOM   10875 N NE2 . HIS M 1 8   ? 53.220  5.267   -0.576  1.00 6.80   ? 8    HIS G NE2 1 
ATOM   10876 N N   . TYR M 1 9   ? 50.262  11.028  0.513   1.00 14.76  ? 9    TYR G N   1 
ATOM   10877 C CA  . TYR M 1 9   ? 49.976  12.418  0.578   1.00 9.55   ? 9    TYR G CA  1 
ATOM   10878 C C   . TYR M 1 9   ? 49.196  12.612  1.821   1.00 13.90  ? 9    TYR G C   1 
ATOM   10879 O O   . TYR M 1 9   ? 48.624  11.699  2.384   1.00 13.27  ? 9    TYR G O   1 
ATOM   10880 C CB  . TYR M 1 9   ? 49.021  12.737  -0.593  1.00 11.18  ? 9    TYR G CB  1 
ATOM   10881 C CG  . TYR M 1 9   ? 49.097  14.171  -1.076  1.00 11.92  ? 9    TYR G CG  1 
ATOM   10882 C CD1 . TYR M 1 9   ? 50.294  14.585  -1.640  1.00 17.29  ? 9    TYR G CD1 1 
ATOM   10883 C CD2 . TYR M 1 9   ? 48.082  15.124  -0.956  1.00 10.61  ? 9    TYR G CD2 1 
ATOM   10884 C CE1 . TYR M 1 9   ? 50.475  15.877  -2.116  1.00 8.41   ? 9    TYR G CE1 1 
ATOM   10885 C CE2 . TYR M 1 9   ? 48.246  16.448  -1.389  1.00 10.47  ? 9    TYR G CE2 1 
ATOM   10886 C CZ  . TYR M 1 9   ? 49.464  16.811  -1.971  1.00 8.46   ? 9    TYR G CZ  1 
ATOM   10887 O OH  . TYR M 1 9   ? 49.762  18.045  -2.457  1.00 9.58   ? 9    TYR G OH  1 
ATOM   10888 N N   . PRO M 1 10  ? 49.130  13.840  2.195   1.00 12.04  ? 10   PRO G N   1 
ATOM   10889 C CA  . PRO M 1 10  ? 48.313  14.254  3.281   1.00 6.12   ? 10   PRO G CA  1 
ATOM   10890 C C   . PRO M 1 10  ? 46.902  13.931  2.895   1.00 17.79  ? 10   PRO G C   1 
ATOM   10891 O O   . PRO M 1 10  ? 46.596  13.667  1.739   1.00 18.65  ? 10   PRO G O   1 
ATOM   10892 C CB  . PRO M 1 10  ? 48.409  15.783  3.312   1.00 1.52   ? 10   PRO G CB  1 
ATOM   10893 C CG  . PRO M 1 10  ? 49.695  16.150  2.608   1.00 1.37   ? 10   PRO G CG  1 
ATOM   10894 C CD  . PRO M 1 10  ? 50.075  14.904  1.786   1.00 9.85   ? 10   PRO G CD  1 
ATOM   10895 N N   . ASN M 1 11  ? 46.026  13.927  3.881   1.00 22.88  ? 11   ASN G N   1 
ATOM   10896 C CA  . ASN M 1 11  ? 44.655  13.616  3.547   1.00 21.68  ? 11   ASN G CA  1 
ATOM   10897 C C   . ASN M 1 11  ? 43.893  14.846  3.144   1.00 28.06  ? 11   ASN G C   1 
ATOM   10898 O O   . ASN M 1 11  ? 43.212  15.448  3.986   1.00 29.83  ? 11   ASN G O   1 
ATOM   10899 C CB  . ASN M 1 11  ? 43.919  12.952  4.700   1.00 27.41  ? 11   ASN G CB  1 
ATOM   10900 C CG  . ASN M 1 11  ? 42.470  12.645  4.393   1.00 30.38  ? 11   ASN G CG  1 
ATOM   10901 O OD1 . ASN M 1 11  ? 41.902  12.897  3.316   1.00 49.73  ? 11   ASN G OD1 1 
ATOM   10902 N ND2 . ASN M 1 11  ? 41.877  12.012  5.345   1.00 31.51  ? 11   ASN G ND2 1 
ATOM   10903 N N   . GLY M 1 12  ? 43.998  15.207  1.856   1.00 23.11  ? 12   GLY G N   1 
ATOM   10904 C CA  . GLY M 1 12  ? 43.359  16.397  1.326   1.00 15.19  ? 12   GLY G CA  1 
ATOM   10905 C C   . GLY M 1 12  ? 43.674  16.444  -0.120  1.00 17.86  ? 12   GLY G C   1 
ATOM   10906 O O   . GLY M 1 12  ? 44.405  15.591  -0.623  1.00 19.68  ? 12   GLY G O   1 
ATOM   10907 N N   . ARG M 1 13  ? 43.148  17.455  -0.766  1.00 14.04  ? 13   ARG G N   1 
ATOM   10908 C CA  . ARG M 1 13  ? 43.292  17.583  -2.195  1.00 12.54  ? 13   ARG G CA  1 
ATOM   10909 C C   . ARG M 1 13  ? 44.704  17.817  -2.696  1.00 9.16   ? 13   ARG G C   1 
ATOM   10910 O O   . ARG M 1 13  ? 45.282  17.001  -3.444  1.00 15.29  ? 13   ARG G O   1 
ATOM   10911 C CB  . ARG M 1 13  ? 42.335  18.672  -2.721  1.00 7.69   ? 13   ARG G CB  1 
ATOM   10912 C CG  . ARG M 1 13  ? 40.875  18.307  -2.812  1.00 1.00   ? 13   ARG G CG  1 
ATOM   10913 C CD  . ARG M 1 13  ? 39.915  19.444  -3.161  1.00 1.00   ? 13   ARG G CD  1 
ATOM   10914 N NE  . ARG M 1 13  ? 38.510  19.034  -3.232  1.00 19.00  ? 13   ARG G NE  1 
ATOM   10915 C CZ  . ARG M 1 13  ? 37.479  19.793  -3.584  1.00 12.92  ? 13   ARG G CZ  1 
ATOM   10916 N NH1 . ARG M 1 13  ? 37.624  21.033  -3.976  1.00 18.59  ? 13   ARG G NH1 1 
ATOM   10917 N NH2 . ARG M 1 13  ? 36.263  19.287  -3.543  1.00 20.60  ? 13   ARG G NH2 1 
ATOM   10918 N N   . GLY M 1 14  ? 45.150  19.030  -2.389  1.00 1.00   ? 14   GLY G N   1 
ATOM   10919 C CA  . GLY M 1 14  ? 46.431  19.556  -2.791  1.00 1.00   ? 14   GLY G CA  1 
ATOM   10920 C C   . GLY M 1 14  ? 46.655  19.265  -4.228  1.00 9.54   ? 14   GLY G C   1 
ATOM   10921 O O   . GLY M 1 14  ? 45.718  19.385  -5.058  1.00 9.47   ? 14   GLY G O   1 
ATOM   10922 N N   . ARG M 1 15  ? 47.869  18.792  -4.500  1.00 9.02   ? 15   ARG G N   1 
ATOM   10923 C CA  . ARG M 1 15  ? 48.219  18.426  -5.846  1.00 5.35   ? 15   ARG G CA  1 
ATOM   10924 C C   . ARG M 1 15  ? 47.823  17.021  -6.247  1.00 14.90  ? 15   ARG G C   1 
ATOM   10925 O O   . ARG M 1 15  ? 47.774  16.747  -7.455  1.00 20.18  ? 15   ARG G O   1 
ATOM   10926 C CB  . ARG M 1 15  ? 49.679  18.561  -6.018  1.00 3.97   ? 15   ARG G CB  1 
ATOM   10927 C CG  . ARG M 1 15  ? 50.155  19.934  -5.685  1.00 5.24   ? 15   ARG G CG  1 
ATOM   10928 C CD  . ARG M 1 15  ? 51.620  20.101  -6.018  1.00 3.67   ? 15   ARG G CD  1 
ATOM   10929 N NE  . ARG M 1 15  ? 52.018  21.437  -5.617  1.00 14.51  ? 15   ARG G NE  1 
ATOM   10930 C CZ  . ARG M 1 15  ? 51.648  22.403  -6.434  1.00 9.50   ? 15   ARG G CZ  1 
ATOM   10931 N NH1 . ARG M 1 15  ? 50.996  22.106  -7.531  1.00 22.97  ? 15   ARG G NH1 1 
ATOM   10932 N NH2 . ARG M 1 15  ? 51.899  23.654  -6.161  1.00 12.46  ? 15   ARG G NH2 1 
ATOM   10933 N N   . MET M 1 16  ? 47.524  16.179  -5.257  1.00 6.25   ? 16   MET G N   1 
ATOM   10934 C CA  . MET M 1 16  ? 47.187  14.773  -5.507  1.00 7.96   ? 16   MET G CA  1 
ATOM   10935 C C   . MET M 1 16  ? 45.825  14.502  -6.139  1.00 16.37  ? 16   MET G C   1 
ATOM   10936 O O   . MET M 1 16  ? 45.559  13.470  -6.818  1.00 16.90  ? 16   MET G O   1 
ATOM   10937 C CB  . MET M 1 16  ? 47.448  13.987  -4.202  1.00 7.02   ? 16   MET G CB  1 
ATOM   10938 C CG  . MET M 1 16  ? 47.241  12.533  -4.336  1.00 7.94   ? 16   MET G CG  1 
ATOM   10939 S SD  . MET M 1 16  ? 48.462  11.653  -5.317  1.00 11.15  ? 16   MET G SD  1 
ATOM   10940 C CE  . MET M 1 16  ? 49.699  11.431  -4.086  1.00 5.61   ? 16   MET G CE  1 
ATOM   10941 N N   . GLU M 1 17  ? 44.954  15.474  -5.933  1.00 4.20   ? 17   GLU G N   1 
ATOM   10942 C CA  . GLU M 1 17  ? 43.620  15.303  -6.413  1.00 1.00   ? 17   GLU G CA  1 
ATOM   10943 C C   . GLU M 1 17  ? 43.472  14.974  -7.865  1.00 5.23   ? 17   GLU G C   1 
ATOM   10944 O O   . GLU M 1 17  ? 42.616  14.203  -8.268  1.00 11.87  ? 17   GLU G O   1 
ATOM   10945 C CB  . GLU M 1 17  ? 42.758  16.436  -5.943  1.00 1.00   ? 17   GLU G CB  1 
ATOM   10946 C CG  . GLU M 1 17  ? 41.260  16.077  -5.882  1.00 19.56  ? 17   GLU G CG  1 
ATOM   10947 C CD  . GLU M 1 17  ? 40.797  15.247  -4.721  1.00 7.78   ? 17   GLU G CD  1 
ATOM   10948 O OE1 . GLU M 1 17  ? 41.513  14.812  -3.853  1.00 31.51  ? 17   GLU G OE1 1 
ATOM   10949 O OE2 . GLU M 1 17  ? 39.527  14.951  -4.806  1.00 9.61   ? 17   GLU G OE2 1 
ATOM   10950 N N   . SER M 1 18  ? 44.321  15.541  -8.664  1.00 1.00   ? 18   SER G N   1 
ATOM   10951 C CA  . SER M 1 18  ? 44.253  15.273  -10.075 1.00 1.00   ? 18   SER G CA  1 
ATOM   10952 C C   . SER M 1 18  ? 44.477  13.827  -10.339 1.00 6.76   ? 18   SER G C   1 
ATOM   10953 O O   . SER M 1 18  ? 43.789  13.158  -11.123 1.00 9.68   ? 18   SER G O   1 
ATOM   10954 C CB  . SER M 1 18  ? 45.129  16.175  -10.907 1.00 1.00   ? 18   SER G CB  1 
ATOM   10955 O OG  . SER M 1 18  ? 45.084  17.465  -10.352 1.00 13.54  ? 18   SER G OG  1 
ATOM   10956 N N   . VAL M 1 19  ? 45.394  13.306  -9.586  1.00 7.37   ? 19   VAL G N   1 
ATOM   10957 C CA  . VAL M 1 19  ? 45.702  11.891  -9.677  1.00 8.08   ? 19   VAL G CA  1 
ATOM   10958 C C   . VAL M 1 19  ? 44.527  11.049  -9.245  1.00 9.25   ? 19   VAL G C   1 
ATOM   10959 O O   . VAL M 1 19  ? 44.219  10.053  -9.871  1.00 6.66   ? 19   VAL G O   1 
ATOM   10960 C CB  . VAL M 1 19  ? 46.848  11.563  -8.765  1.00 8.51   ? 19   VAL G CB  1 
ATOM   10961 C CG1 . VAL M 1 19  ? 47.173  10.117  -9.032  1.00 10.56  ? 19   VAL G CG1 1 
ATOM   10962 C CG2 . VAL M 1 19  ? 48.040  12.430  -9.129  1.00 1.00   ? 19   VAL G CG2 1 
ATOM   10963 N N   . ARG M 1 20  ? 43.871  11.463  -8.161  1.00 5.49   ? 20   ARG G N   1 
ATOM   10964 C CA  . ARG M 1 20  ? 42.678  10.715  -7.804  1.00 3.46   ? 20   ARG G CA  1 
ATOM   10965 C C   . ARG M 1 20  ? 41.694  10.788  -8.941  1.00 10.61  ? 20   ARG G C   1 
ATOM   10966 O O   . ARG M 1 20  ? 41.218  9.765   -9.389  1.00 13.96  ? 20   ARG G O   1 
ATOM   10967 C CB  . ARG M 1 20  ? 42.013  11.171  -6.539  1.00 1.00   ? 20   ARG G CB  1 
ATOM   10968 C CG  . ARG M 1 20  ? 43.044  11.132  -5.392  1.00 3.22   ? 20   ARG G CG  1 
ATOM   10969 C CD  . ARG M 1 20  ? 42.536  11.816  -4.108  1.00 7.99   ? 20   ARG G CD  1 
ATOM   10970 N NE  . ARG M 1 20  ? 43.509  11.862  -2.995  1.00 7.20   ? 20   ARG G NE  1 
ATOM   10971 C CZ  . ARG M 1 20  ? 44.058  12.952  -2.467  1.00 10.41  ? 20   ARG G CZ  1 
ATOM   10972 N NH1 . ARG M 1 20  ? 43.771  14.142  -2.947  1.00 15.20  ? 20   ARG G NH1 1 
ATOM   10973 N NH2 . ARG M 1 20  ? 44.945  12.853  -1.461  1.00 6.11   ? 20   ARG G NH2 1 
ATOM   10974 N N   . TRP M 1 21  ? 41.434  11.974  -9.450  1.00 7.37