data_1GW3
# 
_entry.id   1GW3 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1GW3         
WWPDB D_1000173724 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1GW3 
_pdbx_database_status.recvd_initial_deposition_date   1997-06-04 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Wang, G.'      1 
'Sparrow, J.T.' 2 
'Cushley, R.J.' 3 
# 
_citation.id                        primary 
_citation.title                     
'The helix-hinge-helix structural motif in human apolipoprotein A-I determined by NMR spectroscopy.' 
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            36 
_citation.page_first                13657 
_citation.page_last                 13666 
_citation.year                      1997 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   9354635 
_citation.pdbx_database_id_DOI      10.1021/bi971151q 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Wang, G.'      1 
primary 'Sparrow, J.T.' 2 
primary 'Cushley, R.J.' 3 
# 
_cell.entry_id           1GW3 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1GW3 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           APOA-I 
_entity.formula_weight             5151.779 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'RESIDUES 142 - 187' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'APOLIPOPROTEIN A-I' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       SPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGA 
_entity_poly.pdbx_seq_one_letter_code_can   SPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGA 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  SER n 
1 2  PRO n 
1 3  LEU n 
1 4  GLY n 
1 5  GLU n 
1 6  GLU n 
1 7  MET n 
1 8  ARG n 
1 9  ASP n 
1 10 ARG n 
1 11 ALA n 
1 12 ARG n 
1 13 ALA n 
1 14 HIS n 
1 15 VAL n 
1 16 ASP n 
1 17 ALA n 
1 18 LEU n 
1 19 ARG n 
1 20 THR n 
1 21 HIS n 
1 22 LEU n 
1 23 ALA n 
1 24 PRO n 
1 25 TYR n 
1 26 SER n 
1 27 ASP n 
1 28 GLU n 
1 29 LEU n 
1 30 ARG n 
1 31 GLN n 
1 32 ARG n 
1 33 LEU n 
1 34 ALA n 
1 35 ALA n 
1 36 ARG n 
1 37 LEU n 
1 38 GLU n 
1 39 ALA n 
1 40 LEU n 
1 41 LYS n 
1 42 GLU n 
1 43 ASN n 
1 44 GLY n 
1 45 GLY n 
1 46 ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    APOA1_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P02647 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MKAAVLTLAVLFLTGSQARHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTST
FSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHE
LQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQ
GLLPVLESFKVSFLSALEEYTKKLNTQ
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1GW3 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 46 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P02647 
_struct_ref_seq.db_align_beg                  166 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  211 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       46 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 NOESY    1 
2 1 TOCSY    1 
3 1 DQF-COSY 1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         310 
_pdbx_nmr_exptl_sample_conditions.pressure            ? 
_pdbx_nmr_exptl_sample_conditions.pH                  4.9 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      ? 
_pdbx_nmr_exptl_sample_conditions.pressure_units      . 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.model             'AMX 600' 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.field_strength    600 
# 
_pdbx_nmr_refine.entry_id           1GW3 
_pdbx_nmr_refine.method             'DISTANCE GEOMETRY CALCULATIONS USING NOE-DERIVED DISTANCES' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                             1GW3 
_pdbx_nmr_ensemble.conformers_calculated_total_number   50 
_pdbx_nmr_ensemble.conformers_submitted_total_number    1 
_pdbx_nmr_ensemble.conformer_selection_criteria         'LOWER OPTIMIZATION ERROR AND NO DISTANCE VIOLATION GREATER THAN 0.5 A)' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
refinement           DGII ? HAVEL 1 
'structure solution' DGII ? ?     2 
# 
_exptl.entry_id          1GW3 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  1GW3 
_struct.title                     
'THE HELIX-HINGE-HELIX STRUCTURAL MOTIF IN HUMAN APOLIPOPROTEIN A-I DETERMINED BY NMR SPECTROSCOPY, 1 STRUCTURE' 
_struct.pdbx_descriptor           APOA-I 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1GW3 
_struct_keywords.pdbx_keywords   'HIGH DENSITY LIPOPROTEINS' 
_struct_keywords.text            
;HIGH DENSITY LIPOPROTEINS, KEY IN VIVO COFACTOR FOR THE ENZYME LECITHIN-CHOLESTEROL TRANSFERASE, CHOLESTEROL EFFLUX, RECEPTOR BINDING, AMPHIPATHIC HELICES, HELIX-HINGE-HELIX MOTIF
;
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   Y 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 HIS A 14 ? HIS A 21 ? HIS A 14 HIS A 21 1 ? 8  
HELX_P HELX_P2 2 ASP A 27 ? GLU A 38 ? ASP A 27 GLU A 38 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_database_PDB_matrix.entry_id          1GW3 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1GW3 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1   N N    . SER A 1 1  ? 29.068  -6.703  -8.148  1.00 0.00 ? 1  SER A N    1 
ATOM 2   C CA   . SER A 1 1  ? 29.505  -5.508  -7.432  1.00 0.00 ? 1  SER A CA   1 
ATOM 3   C C    . SER A 1 1  ? 28.483  -5.090  -6.401  1.00 0.00 ? 1  SER A C    1 
ATOM 4   O O    . SER A 1 1  ? 27.655  -4.203  -6.624  1.00 0.00 ? 1  SER A O    1 
ATOM 5   C CB   . SER A 1 1  ? 29.820  -4.357  -8.420  1.00 0.00 ? 1  SER A CB   1 
ATOM 6   O OG   . SER A 1 1  ? 28.991  -4.383  -9.587  1.00 0.00 ? 1  SER A OG   1 
ATOM 7   H H1   . SER A 1 1  ? 28.044  -6.686  -8.252  1.00 0.00 ? 1  SER A H1   1 
ATOM 8   H H2   . SER A 1 1  ? 29.507  -6.725  -9.079  1.00 0.00 ? 1  SER A H2   1 
ATOM 9   H H3   . SER A 1 1  ? 29.345  -7.542  -7.618  1.00 0.00 ? 1  SER A H3   1 
ATOM 10  H HA   . SER A 1 1  ? 30.431  -5.759  -6.882  1.00 0.00 ? 1  SER A HA   1 
ATOM 11  H HB2  . SER A 1 1  ? 29.680  -3.382  -7.914  1.00 0.00 ? 1  SER A HB2  1 
ATOM 12  H HB3  . SER A 1 1  ? 30.885  -4.371  -8.723  1.00 0.00 ? 1  SER A HB3  1 
ATOM 13  H HG   . SER A 1 1  ? 29.012  -3.503  -9.974  1.00 0.00 ? 1  SER A HG   1 
ATOM 14  N N    . PRO A 1 2  ? 28.522  -5.737  -5.251  1.00 0.00 ? 2  PRO A N    1 
ATOM 15  C CA   . PRO A 1 2  ? 27.584  -5.531  -4.064  1.00 0.00 ? 2  PRO A CA   1 
ATOM 16  C C    . PRO A 1 2  ? 27.378  -4.088  -3.659  1.00 0.00 ? 2  PRO A C    1 
ATOM 17  O O    . PRO A 1 2  ? 28.099  -3.182  -4.092  1.00 0.00 ? 2  PRO A O    1 
ATOM 18  C CB   . PRO A 1 2  ? 28.215  -6.272  -2.892  1.00 0.00 ? 2  PRO A CB   1 
ATOM 19  C CG   . PRO A 1 2  ? 28.890  -7.449  -3.616  1.00 0.00 ? 2  PRO A CG   1 
ATOM 20  C CD   . PRO A 1 2  ? 29.484  -6.801  -4.873  1.00 0.00 ? 2  PRO A CD   1 
ATOM 21  H HA   . PRO A 1 2  ? 26.609  -5.938  -4.301  1.00 0.00 ? 2  PRO A HA   1 
ATOM 22  H HB2  . PRO A 1 2  ? 29.003  -5.640  -2.444  1.00 0.00 ? 2  PRO A HB2  1 
ATOM 23  H HB3  . PRO A 1 2  ? 27.423  -6.656  -2.236  1.00 0.00 ? 2  PRO A HB3  1 
ATOM 24  H HG2  . PRO A 1 2  ? 29.816  -7.802  -3.136  1.00 0.00 ? 2  PRO A HG2  1 
ATOM 25  H HG3  . PRO A 1 2  ? 28.100  -8.180  -3.825  1.00 0.00 ? 2  PRO A HG3  1 
ATOM 26  H HD2  . PRO A 1 2  ? 30.449  -6.336  -4.619  1.00 0.00 ? 2  PRO A HD2  1 
ATOM 27  H HD3  . PRO A 1 2  ? 29.549  -7.547  -5.683  1.00 0.00 ? 2  PRO A HD3  1 
ATOM 28  N N    . LEU A 1 3  ? 26.373  -3.852  -2.837  1.00 0.00 ? 3  LEU A N    1 
ATOM 29  C CA   . LEU A 1 3  ? 26.071  -2.512  -2.341  1.00 0.00 ? 3  LEU A CA   1 
ATOM 30  C C    . LEU A 1 3  ? 26.311  -2.418  -0.853  1.00 0.00 ? 3  LEU A C    1 
ATOM 31  O O    . LEU A 1 3  ? 26.860  -3.330  -0.223  1.00 0.00 ? 3  LEU A O    1 
ATOM 32  C CB   . LEU A 1 3  ? 24.607  -2.120  -2.695  1.00 0.00 ? 3  LEU A CB   1 
ATOM 33  C CG   . LEU A 1 3  ? 24.213  -2.052  -4.196  1.00 0.00 ? 3  LEU A CG   1 
ATOM 34  C CD1  . LEU A 1 3  ? 22.953  -1.194  -4.371  1.00 0.00 ? 3  LEU A CD1  1 
ATOM 35  C CD2  . LEU A 1 3  ? 25.343  -1.502  -5.085  1.00 0.00 ? 3  LEU A CD2  1 
ATOM 36  H H    . LEU A 1 3  ? 25.767  -4.674  -2.599  1.00 0.00 ? 3  LEU A H    1 
ATOM 37  H HA   . LEU A 1 3  ? 26.770  -1.799  -2.814  1.00 0.00 ? 3  LEU A HA   1 
ATOM 38  H HB2  . LEU A 1 3  ? 23.923  -2.829  -2.187  1.00 0.00 ? 3  LEU A HB2  1 
ATOM 39  H HB3  . LEU A 1 3  ? 24.382  -1.138  -2.233  1.00 0.00 ? 3  LEU A HB3  1 
ATOM 40  H HG   . LEU A 1 3  ? 23.974  -3.081  -4.538  1.00 0.00 ? 3  LEU A HG   1 
ATOM 41  H HD11 . LEU A 1 3  ? 22.103  -1.585  -3.780  1.00 0.00 ? 3  LEU A HD11 1 
ATOM 42  H HD12 . LEU A 1 3  ? 23.112  -0.144  -4.059  1.00 0.00 ? 3  LEU A HD12 1 
ATOM 43  H HD13 . LEU A 1 3  ? 22.618  -1.172  -5.426  1.00 0.00 ? 3  LEU A HD13 1 
ATOM 44  H HD21 . LEU A 1 3  ? 25.687  -0.505  -4.753  1.00 0.00 ? 3  LEU A HD21 1 
ATOM 45  H HD22 . LEU A 1 3  ? 26.221  -2.174  -5.075  1.00 0.00 ? 3  LEU A HD22 1 
ATOM 46  H HD23 . LEU A 1 3  ? 25.033  -1.418  -6.141  1.00 0.00 ? 3  LEU A HD23 1 
ATOM 47  N N    . GLY A 1 4  ? 25.916  -1.304  -0.264  1.00 0.00 ? 4  GLY A N    1 
ATOM 48  C CA   . GLY A 1 4  ? 25.972  -1.131  1.184   1.00 0.00 ? 4  GLY A CA   1 
ATOM 49  C C    . GLY A 1 4  ? 24.666  -0.591  1.716   1.00 0.00 ? 4  GLY A C    1 
ATOM 50  O O    . GLY A 1 4  ? 23.820  -1.327  2.236   1.00 0.00 ? 4  GLY A O    1 
ATOM 51  H H    . GLY A 1 4  ? 25.603  -0.532  -0.902  1.00 0.00 ? 4  GLY A H    1 
ATOM 52  H HA2  . GLY A 1 4  ? 26.193  -2.096  1.676   1.00 0.00 ? 4  GLY A HA2  1 
ATOM 53  H HA3  . GLY A 1 4  ? 26.789  -0.437  1.455   1.00 0.00 ? 4  GLY A HA3  1 
ATOM 54  N N    . GLU A 1 5  ? 24.486  0.713   1.608   1.00 0.00 ? 5  GLU A N    1 
ATOM 55  C CA   . GLU A 1 5  ? 23.314  1.379   2.169   1.00 0.00 ? 5  GLU A CA   1 
ATOM 56  C C    . GLU A 1 5  ? 23.331  2.861   1.869   1.00 0.00 ? 5  GLU A C    1 
ATOM 57  O O    . GLU A 1 5  ? 23.509  3.708   2.752   1.00 0.00 ? 5  GLU A O    1 
ATOM 58  C CB   . GLU A 1 5  ? 23.284  1.111   3.700   1.00 0.00 ? 5  GLU A CB   1 
ATOM 59  C CG   . GLU A 1 5  ? 24.382  1.795   4.580   1.00 0.00 ? 5  GLU A CG   1 
ATOM 60  C CD   . GLU A 1 5  ? 25.166  0.930   5.569   1.00 0.00 ? 5  GLU A CD   1 
ATOM 61  O OE1  . GLU A 1 5  ? 24.729  -0.115  6.032   1.00 0.00 ? 5  GLU A OE1  1 
ATOM 62  O OE2  . GLU A 1 5  ? 26.393  1.431   5.883   1.00 0.00 ? 5  GLU A OE2  1 
ATOM 63  H H    . GLU A 1 5  ? 25.226  1.236   1.079   1.00 0.00 ? 5  GLU A H    1 
ATOM 64  H HA   . GLU A 1 5  ? 22.407  0.954   1.701   1.00 0.00 ? 5  GLU A HA   1 
ATOM 65  H HB2  . GLU A 1 5  ? 22.289  1.405   4.093   1.00 0.00 ? 5  GLU A HB2  1 
ATOM 66  H HB3  . GLU A 1 5  ? 23.322  0.014   3.868   1.00 0.00 ? 5  GLU A HB3  1 
ATOM 67  H HG2  . GLU A 1 5  ? 25.126  2.290   3.929   1.00 0.00 ? 5  GLU A HG2  1 
ATOM 68  H HG3  . GLU A 1 5  ? 23.939  2.625   5.164   1.00 0.00 ? 5  GLU A HG3  1 
ATOM 69  N N    . GLU A 1 6  ? 23.112  3.201   0.612   1.00 0.00 ? 6  GLU A N    1 
ATOM 70  C CA   . GLU A 1 6  ? 23.027  4.596   0.189   1.00 0.00 ? 6  GLU A CA   1 
ATOM 71  C C    . GLU A 1 6  ? 22.227  4.729   -1.086  1.00 0.00 ? 6  GLU A C    1 
ATOM 72  O O    . GLU A 1 6  ? 21.417  5.649   -1.253  1.00 0.00 ? 6  GLU A O    1 
ATOM 73  C CB   . GLU A 1 6  ? 24.468  5.149   0.010   1.00 0.00 ? 6  GLU A CB   1 
ATOM 74  C CG   . GLU A 1 6  ? 24.688  6.235   -1.094  1.00 0.00 ? 6  GLU A CG   1 
ATOM 75  C CD   . GLU A 1 6  ? 26.122  6.567   -1.513  1.00 0.00 ? 6  GLU A CD   1 
ATOM 76  O OE1  . GLU A 1 6  ? 26.848  7.313   -0.869  1.00 0.00 ? 6  GLU A OE1  1 
ATOM 77  O OE2  . GLU A 1 6  ? 26.512  5.955   -2.666  1.00 0.00 ? 6  GLU A OE2  1 
ATOM 78  H H    . GLU A 1 6  ? 22.950  2.412   -0.059  1.00 0.00 ? 6  GLU A H    1 
ATOM 79  H HA   . GLU A 1 6  ? 22.501  5.168   0.976   1.00 0.00 ? 6  GLU A HA   1 
ATOM 80  H HB2  . GLU A 1 6  ? 24.818  5.549   0.982   1.00 0.00 ? 6  GLU A HB2  1 
ATOM 81  H HB3  . GLU A 1 6  ? 25.151  4.301   -0.194  1.00 0.00 ? 6  GLU A HB3  1 
ATOM 82  H HG2  . GLU A 1 6  ? 24.147  5.944   -2.015  1.00 0.00 ? 6  GLU A HG2  1 
ATOM 83  H HG3  . GLU A 1 6  ? 24.215  7.188   -0.791  1.00 0.00 ? 6  GLU A HG3  1 
ATOM 84  N N    . MET A 1 7  ? 22.457  3.825   -2.020  1.00 0.00 ? 7  MET A N    1 
ATOM 85  C CA   . MET A 1 7  ? 21.631  3.728   -3.220  1.00 0.00 ? 7  MET A CA   1 
ATOM 86  C C    . MET A 1 7  ? 20.209  3.360   -2.867  1.00 0.00 ? 7  MET A C    1 
ATOM 87  O O    . MET A 1 7  ? 19.240  3.850   -3.459  1.00 0.00 ? 7  MET A O    1 
ATOM 88  C CB   . MET A 1 7  ? 22.244  2.692   -4.203  1.00 0.00 ? 7  MET A CB   1 
ATOM 89  C CG   . MET A 1 7  ? 21.587  2.612   -5.598  1.00 0.00 ? 7  MET A CG   1 
ATOM 90  S SD   . MET A 1 7  ? 20.186  1.483   -5.549  1.00 0.00 ? 7  MET A SD   1 
ATOM 91  C CE   . MET A 1 7  ? 20.711  0.350   -6.842  1.00 0.00 ? 7  MET A CE   1 
ATOM 92  H H    . MET A 1 7  ? 23.240  3.153   -1.827  1.00 0.00 ? 7  MET A H    1 
ATOM 93  H HA   . MET A 1 7  ? 21.599  4.720   -3.708  1.00 0.00 ? 7  MET A HA   1 
ATOM 94  H HB2  . MET A 1 7  ? 23.318  2.916   -4.350  1.00 0.00 ? 7  MET A HB2  1 
ATOM 95  H HB3  . MET A 1 7  ? 22.226  1.682   -3.744  1.00 0.00 ? 7  MET A HB3  1 
ATOM 96  H HG2  . MET A 1 7  ? 21.239  3.615   -5.912  1.00 0.00 ? 7  MET A HG2  1 
ATOM 97  H HG3  . MET A 1 7  ? 22.304  2.270   -6.367  1.00 0.00 ? 7  MET A HG3  1 
ATOM 98  H HE1  . MET A 1 7  ? 21.763  0.539   -7.119  1.00 0.00 ? 7  MET A HE1  1 
ATOM 99  H HE2  . MET A 1 7  ? 20.622  -0.699  -6.509  1.00 0.00 ? 7  MET A HE2  1 
ATOM 100 H HE3  . MET A 1 7  ? 20.088  0.482   -7.746  1.00 0.00 ? 7  MET A HE3  1 
ATOM 101 N N    . ARG A 1 8  ? 20.062  2.461   -1.912  1.00 0.00 ? 8  ARG A N    1 
ATOM 102 C CA   . ARG A 1 8  ? 18.765  1.872   -1.583  1.00 0.00 ? 8  ARG A CA   1 
ATOM 103 C C    . ARG A 1 8  ? 18.185  2.418   -0.298  1.00 0.00 ? 8  ARG A C    1 
ATOM 104 O O    . ARG A 1 8  ? 17.008  2.170   0.019   1.00 0.00 ? 8  ARG A O    1 
ATOM 105 C CB   . ARG A 1 8  ? 18.931  0.326   -1.507  1.00 0.00 ? 8  ARG A CB   1 
ATOM 106 C CG   . ARG A 1 8  ? 18.255  -0.455  -2.665  1.00 0.00 ? 8  ARG A CG   1 
ATOM 107 C CD   . ARG A 1 8  ? 16.810  -0.854  -2.341  1.00 0.00 ? 8  ARG A CD   1 
ATOM 108 N NE   . ARG A 1 8  ? 16.111  -1.159  -3.615  1.00 0.00 ? 8  ARG A NE   1 
ATOM 109 C CZ   . ARG A 1 8  ? 15.641  -2.347  -3.971  1.00 0.00 ? 8  ARG A CZ   1 
ATOM 110 N NH1  . ARG A 1 8  ? 15.735  -3.421  -3.244  1.00 0.00 ? 8  ARG A NH1  1 
ATOM 111 N NH2  . ARG A 1 8  ? 15.055  -2.436  -5.112  1.00 0.00 ? 8  ARG A NH2  1 
ATOM 112 H H    . ARG A 1 8  ? 20.938  2.148   -1.432  1.00 0.00 ? 8  ARG A H    1 
ATOM 113 H HA   . ARG A 1 8  ? 18.066  2.133   -2.399  1.00 0.00 ? 8  ARG A HA   1 
ATOM 114 H HB2  . ARG A 1 8  ? 20.011  0.076   -1.466  1.00 0.00 ? 8  ARG A HB2  1 
ATOM 115 H HB3  . ARG A 1 8  ? 18.520  -0.050  -0.549  1.00 0.00 ? 8  ARG A HB3  1 
ATOM 116 H HG2  . ARG A 1 8  ? 18.271  0.150   -3.594  1.00 0.00 ? 8  ARG A HG2  1 
ATOM 117 H HG3  . ARG A 1 8  ? 18.824  -1.375  -2.910  1.00 0.00 ? 8  ARG A HG3  1 
ATOM 118 H HD2  . ARG A 1 8  ? 16.793  -1.737  -1.670  1.00 0.00 ? 8  ARG A HD2  1 
ATOM 119 H HD3  . ARG A 1 8  ? 16.294  -0.031  -1.805  1.00 0.00 ? 8  ARG A HD3  1 
ATOM 120 H HE   . ARG A 1 8  ? 15.979  -0.381  -4.278  1.00 0.00 ? 8  ARG A HE   1 
ATOM 121 H HH11 . ARG A 1 8  ? 16.210  -3.262  -2.355  1.00 0.00 ? 8  ARG A HH11 1 
ATOM 122 H HH12 . ARG A 1 8  ? 15.336  -4.276  -3.626  1.00 0.00 ? 8  ARG A HH12 1 
ATOM 123 H HH21 . ARG A 1 8  ? 15.033  -1.539  -5.601  1.00 0.00 ? 8  ARG A HH21 1 
ATOM 124 H HH22 . ARG A 1 8  ? 14.693  -3.345  -5.392  1.00 0.00 ? 8  ARG A HH22 1 
ATOM 125 N N    . ASP A 1 9  ? 18.973  3.129   0.485   1.00 0.00 ? 9  ASP A N    1 
ATOM 126 C CA   . ASP A 1 9  ? 18.505  3.703   1.746   1.00 0.00 ? 9  ASP A CA   1 
ATOM 127 C C    . ASP A 1 9  ? 17.493  4.800   1.508   1.00 0.00 ? 9  ASP A C    1 
ATOM 128 O O    . ASP A 1 9  ? 16.638  5.088   2.357   1.00 0.00 ? 9  ASP A O    1 
ATOM 129 C CB   . ASP A 1 9  ? 19.705  4.204   2.592   1.00 0.00 ? 9  ASP A CB   1 
ATOM 130 C CG   . ASP A 1 9  ? 19.370  4.874   3.932   1.00 0.00 ? 9  ASP A CG   1 
ATOM 131 O OD1  . ASP A 1 9  ? 19.279  3.981   4.963   1.00 0.00 ? 9  ASP A OD1  1 
ATOM 132 O OD2  . ASP A 1 9  ? 19.224  6.081   4.055   1.00 0.00 ? 9  ASP A OD2  1 
ATOM 133 H H    . ASP A 1 9  ? 19.971  3.214   0.178   1.00 0.00 ? 9  ASP A H    1 
ATOM 134 H HA   . ASP A 1 9  ? 17.973  2.894   2.280   1.00 0.00 ? 9  ASP A HA   1 
ATOM 135 H HB2  . ASP A 1 9  ? 20.380  3.351   2.810   1.00 0.00 ? 9  ASP A HB2  1 
ATOM 136 H HB3  . ASP A 1 9  ? 20.329  4.910   2.016   1.00 0.00 ? 9  ASP A HB3  1 
ATOM 137 N N    . ARG A 1 10 ? 17.587  5.456   0.366   1.00 0.00 ? 10 ARG A N    1 
ATOM 138 C CA   . ARG A 1 10 ? 16.580  6.430   -0.047  1.00 0.00 ? 10 ARG A CA   1 
ATOM 139 C C    . ARG A 1 10 ? 15.212  5.792   -0.121  1.00 0.00 ? 10 ARG A C    1 
ATOM 140 O O    . ARG A 1 10 ? 14.181  6.425   0.134   1.00 0.00 ? 10 ARG A O    1 
ATOM 141 C CB   . ARG A 1 10 ? 16.998  7.039   -1.414  1.00 0.00 ? 10 ARG A CB   1 
ATOM 142 C CG   . ARG A 1 10 ? 18.217  7.997   -1.357  1.00 0.00 ? 10 ARG A CG   1 
ATOM 143 C CD   . ARG A 1 10 ? 18.061  9.205   -2.290  1.00 0.00 ? 10 ARG A CD   1 
ATOM 144 N NE   . ARG A 1 10 ? 18.339  8.762   -3.679  1.00 0.00 ? 10 ARG A NE   1 
ATOM 145 C CZ   . ARG A 1 10 ? 18.778  9.537   -4.662  1.00 0.00 ? 10 ARG A CZ   1 
ATOM 146 N NH1  . ARG A 1 10 ? 19.024  10.808  -4.540  1.00 0.00 ? 10 ARG A NH1  1 
ATOM 147 N NH2  . ARG A 1 10 ? 18.972  8.988   -5.809  1.00 0.00 ? 10 ARG A NH2  1 
ATOM 148 H H    . ARG A 1 10 ? 18.440  5.257   -0.210  1.00 0.00 ? 10 ARG A H    1 
ATOM 149 H HA   . ARG A 1 10 ? 16.536  7.228   0.717   1.00 0.00 ? 10 ARG A HA   1 
ATOM 150 H HB2  . ARG A 1 10 ? 17.230  6.226   -2.130  1.00 0.00 ? 10 ARG A HB2  1 
ATOM 151 H HB3  . ARG A 1 10 ? 16.130  7.565   -1.863  1.00 0.00 ? 10 ARG A HB3  1 
ATOM 152 H HG2  . ARG A 1 10 ? 18.375  8.352   -0.318  1.00 0.00 ? 10 ARG A HG2  1 
ATOM 153 H HG3  . ARG A 1 10 ? 19.152  7.467   -1.628  1.00 0.00 ? 10 ARG A HG3  1 
ATOM 154 H HD2  . ARG A 1 10 ? 17.036  9.622   -2.214  1.00 0.00 ? 10 ARG A HD2  1 
ATOM 155 H HD3  . ARG A 1 10 ? 18.761  10.013  -1.995  1.00 0.00 ? 10 ARG A HD3  1 
ATOM 156 H HE   . ARG A 1 10 ? 18.177  7.768   -3.899  1.00 0.00 ? 10 ARG A HE   1 
ATOM 157 H HH11 . ARG A 1 10 ? 18.847  11.161  -3.599  1.00 0.00 ? 10 ARG A HH11 1 
ATOM 158 H HH12 . ARG A 1 10 ? 19.359  11.297  -5.367  1.00 0.00 ? 10 ARG A HH12 1 
ATOM 159 H HH21 . ARG A 1 10 ? 18.750  7.991   -5.798  1.00 0.00 ? 10 ARG A HH21 1 
ATOM 160 H HH22 . ARG A 1 10 ? 19.310  9.577   -6.567  1.00 0.00 ? 10 ARG A HH22 1 
ATOM 161 N N    . ALA A 1 11 ? 15.185  4.512   -0.445  1.00 0.00 ? 11 ALA A N    1 
ATOM 162 C CA   . ALA A 1 11 ? 13.959  3.720   -0.393  1.00 0.00 ? 11 ALA A CA   1 
ATOM 163 C C    . ALA A 1 11 ? 13.615  3.338   1.027   1.00 0.00 ? 11 ALA A C    1 
ATOM 164 O O    . ALA A 1 11 ? 12.445  3.145   1.383   1.00 0.00 ? 11 ALA A O    1 
ATOM 165 C CB   . ALA A 1 11 ? 14.157  2.497   -1.306  1.00 0.00 ? 11 ALA A CB   1 
ATOM 166 H H    . ALA A 1 11 ? 16.090  4.108   -0.791  1.00 0.00 ? 11 ALA A H    1 
ATOM 167 H HA   . ALA A 1 11 ? 13.125  4.337   -0.777  1.00 0.00 ? 11 ALA A HA   1 
ATOM 168 H HB1  . ALA A 1 11 ? 14.367  2.794   -2.351  1.00 0.00 ? 11 ALA A HB1  1 
ATOM 169 H HB2  . ALA A 1 11 ? 15.001  1.861   -0.974  1.00 0.00 ? 11 ALA A HB2  1 
ATOM 170 H HB3  . ALA A 1 11 ? 13.257  1.855   -1.334  1.00 0.00 ? 11 ALA A HB3  1 
ATOM 171 N N    . ARG A 1 12 ? 14.627  3.207   1.864   1.00 0.00 ? 12 ARG A N    1 
ATOM 172 C CA   . ARG A 1 12 ? 14.433  2.926   3.285   1.00 0.00 ? 12 ARG A CA   1 
ATOM 173 C C    . ARG A 1 12 ? 14.450  4.196   4.102   1.00 0.00 ? 12 ARG A C    1 
ATOM 174 O O    . ARG A 1 12 ? 14.951  4.233   5.235   1.00 0.00 ? 12 ARG A O    1 
ATOM 175 C CB   . ARG A 1 12 ? 15.534  1.937   3.760   1.00 0.00 ? 12 ARG A CB   1 
ATOM 176 C CG   . ARG A 1 12 ? 15.700  0.669   2.881   1.00 0.00 ? 12 ARG A CG   1 
ATOM 177 C CD   . ARG A 1 12 ? 14.357  0.091   2.418   1.00 0.00 ? 12 ARG A CD   1 
ATOM 178 N NE   . ARG A 1 12 ? 14.605  -1.245  1.817   1.00 0.00 ? 12 ARG A NE   1 
ATOM 179 C CZ   . ARG A 1 12 ? 13.746  -1.925  1.070   1.00 0.00 ? 12 ARG A CZ   1 
ATOM 180 N NH1  . ARG A 1 12 ? 12.553  -1.510  0.762   1.00 0.00 ? 12 ARG A NH1  1 
ATOM 181 N NH2  . ARG A 1 12 ? 14.125  -3.070  0.623   1.00 0.00 ? 12 ARG A NH2  1 
ATOM 182 H H    . ARG A 1 12 ? 15.585  3.261   1.445   1.00 0.00 ? 12 ARG A H    1 
ATOM 183 H HA   . ARG A 1 12 ? 13.438  2.460   3.404   1.00 0.00 ? 12 ARG A HA   1 
ATOM 184 H HB2  . ARG A 1 12 ? 16.511  2.458   3.802   1.00 0.00 ? 12 ARG A HB2  1 
ATOM 185 H HB3  . ARG A 1 12 ? 15.333  1.639   4.810   1.00 0.00 ? 12 ARG A HB3  1 
ATOM 186 H HG2  . ARG A 1 12 ? 16.328  0.897   1.996   1.00 0.00 ? 12 ARG A HG2  1 
ATOM 187 H HG3  . ARG A 1 12 ? 16.250  -0.124  3.427   1.00 0.00 ? 12 ARG A HG3  1 
ATOM 188 H HD2  . ARG A 1 12 ? 13.657  0.006   3.274   1.00 0.00 ? 12 ARG A HD2  1 
ATOM 189 H HD3  . ARG A 1 12 ? 13.882  0.765   1.676   1.00 0.00 ? 12 ARG A HD3  1 
ATOM 190 H HE   . ARG A 1 12 ? 15.522  -1.679  1.996   1.00 0.00 ? 12 ARG A HE   1 
ATOM 191 H HH11 . ARG A 1 12 ? 12.334  -0.593  1.154   1.00 0.00 ? 12 ARG A HH11 1 
ATOM 192 H HH12 . ARG A 1 12 ? 11.984  -2.122  0.180   1.00 0.00 ? 12 ARG A HH12 1 
ATOM 193 H HH21 . ARG A 1 12 ? 15.074  -3.301  0.922   1.00 0.00 ? 12 ARG A HH21 1 
ATOM 194 H HH22 . ARG A 1 12 ? 13.470  -3.598  0.051   1.00 0.00 ? 12 ARG A HH22 1 
ATOM 195 N N    . ALA A 1 13 ? 13.901  5.262   3.551   1.00 0.00 ? 13 ALA A N    1 
ATOM 196 C CA   . ALA A 1 13 ? 13.794  6.535   4.260   1.00 0.00 ? 13 ALA A CA   1 
ATOM 197 C C    . ALA A 1 13 ? 12.410  7.125   4.116   1.00 0.00 ? 13 ALA A C    1 
ATOM 198 O O    . ALA A 1 13 ? 11.825  7.649   5.073   1.00 0.00 ? 13 ALA A O    1 
ATOM 199 C CB   . ALA A 1 13 ? 14.895  7.465   3.721   1.00 0.00 ? 13 ALA A CB   1 
ATOM 200 H H    . ALA A 1 13 ? 13.500  5.134   2.592   1.00 0.00 ? 13 ALA A H    1 
ATOM 201 H HA   . ALA A 1 13 ? 13.959  6.347   5.337   1.00 0.00 ? 13 ALA A HA   1 
ATOM 202 H HB1  . ALA A 1 13 ? 15.905  7.036   3.872   1.00 0.00 ? 13 ALA A HB1  1 
ATOM 203 H HB2  . ALA A 1 13 ? 14.784  7.656   2.636   1.00 0.00 ? 13 ALA A HB2  1 
ATOM 204 H HB3  . ALA A 1 13 ? 14.889  8.447   4.228   1.00 0.00 ? 13 ALA A HB3  1 
ATOM 205 N N    . HIS A 1 14 ? 11.859  7.046   2.919   1.00 0.00 ? 14 HIS A N    1 
ATOM 206 C CA   . HIS A 1 14 ? 10.494  7.502   2.666   1.00 0.00 ? 14 HIS A CA   1 
ATOM 207 C C    . HIS A 1 14 ? 9.466   6.412   2.862   1.00 0.00 ? 14 HIS A C    1 
ATOM 208 O O    . HIS A 1 14 ? 8.250   6.665   2.770   1.00 0.00 ? 14 HIS A O    1 
ATOM 209 C CB   . HIS A 1 14 ? 10.474  7.986   1.203   1.00 0.00 ? 14 HIS A CB   1 
ATOM 210 C CG   . HIS A 1 14 ? 10.252  6.871   0.222   1.00 0.00 ? 14 HIS A CG   1 
ATOM 211 N ND1  . HIS A 1 14 ? 9.528   6.960   -0.964  1.00 0.00 ? 14 HIS A ND1  1 
ATOM 212 C CD2  . HIS A 1 14 ? 10.765  5.596   0.411   1.00 0.00 ? 14 HIS A CD2  1 
ATOM 213 C CE1  . HIS A 1 14 ? 9.660   5.696   -1.409  1.00 0.00 ? 14 HIS A CE1  1 
ATOM 214 N NE2  . HIS A 1 14 ? 10.381  4.823   -0.654  1.00 0.00 ? 14 HIS A NE2  1 
ATOM 215 H H    . HIS A 1 14 ? 12.467  6.666   2.155   1.00 0.00 ? 14 HIS A H    1 
ATOM 216 H HA   . HIS A 1 14 ? 10.265  8.281   3.415   1.00 0.00 ? 14 HIS A HA   1 
ATOM 217 H HB2  . HIS A 1 14 ? 9.678   8.741   1.030   1.00 0.00 ? 14 HIS A HB2  1 
ATOM 218 H HB3  . HIS A 1 14 ? 11.423  8.492   0.936   1.00 0.00 ? 14 HIS A HB3  1 
ATOM 219 H HD1  . HIS A 1 14 ? 9.034   7.762   -1.382  1.00 0.00 ? 14 HIS A HD1  1 
ATOM 220 H HD2  . HIS A 1 14 ? 11.363  5.296   1.266   1.00 0.00 ? 14 HIS A HD2  1 
ATOM 221 H HE1  . HIS A 1 14 ? 9.185   5.443   -2.348  1.00 0.00 ? 14 HIS A HE1  1 
ATOM 222 H HE2  . HIS A 1 14 ? 10.588  3.829   -0.830  1.00 0.00 ? 14 HIS A HE2  1 
ATOM 223 N N    . VAL A 1 15 ? 9.893   5.193   3.128   1.00 0.00 ? 15 VAL A N    1 
ATOM 224 C CA   . VAL A 1 15 ? 8.977   4.085   3.388   1.00 0.00 ? 15 VAL A CA   1 
ATOM 225 C C    . VAL A 1 15 ? 8.578   4.041   4.844   1.00 0.00 ? 15 VAL A C    1 
ATOM 226 O O    . VAL A 1 15 ? 7.459   3.655   5.202   1.00 0.00 ? 15 VAL A O    1 
ATOM 227 C CB   . VAL A 1 15 ? 9.647   2.723   2.947   1.00 0.00 ? 15 VAL A CB   1 
ATOM 228 C CG1  . VAL A 1 15 ? 9.096   1.433   3.616   1.00 0.00 ? 15 VAL A CG1  1 
ATOM 229 C CG2  . VAL A 1 15 ? 9.581   2.455   1.424   1.00 0.00 ? 15 VAL A CG2  1 
ATOM 230 H H    . VAL A 1 15 ? 10.931  5.050   3.094   1.00 0.00 ? 15 VAL A H    1 
ATOM 231 H HA   . VAL A 1 15 ? 8.051   4.242   2.805   1.00 0.00 ? 15 VAL A HA   1 
ATOM 232 H HB   . VAL A 1 15 ? 10.723  2.784   3.221   1.00 0.00 ? 15 VAL A HB   1 
ATOM 233 H HG11 . VAL A 1 15 ? 8.017   1.285   3.423   1.00 0.00 ? 15 VAL A HG11 1 
ATOM 234 H HG12 . VAL A 1 15 ? 9.620   0.523   3.267   1.00 0.00 ? 15 VAL A HG12 1 
ATOM 235 H HG13 . VAL A 1 15 ? 9.232   1.436   4.714   1.00 0.00 ? 15 VAL A HG13 1 
ATOM 236 H HG21 . VAL A 1 15 ? 10.014  3.287   0.841   1.00 0.00 ? 15 VAL A HG21 1 
ATOM 237 H HG22 . VAL A 1 15 ? 10.154  1.551   1.140   1.00 0.00 ? 15 VAL A HG22 1 
ATOM 238 H HG23 . VAL A 1 15 ? 8.544   2.312   1.068   1.00 0.00 ? 15 VAL A HG23 1 
ATOM 239 N N    . ASP A 1 16 ? 9.491   4.436   5.712   1.00 0.00 ? 16 ASP A N    1 
ATOM 240 C CA   . ASP A 1 16 ? 9.230   4.468   7.149   1.00 0.00 ? 16 ASP A CA   1 
ATOM 241 C C    . ASP A 1 16 ? 8.236   5.553   7.494   1.00 0.00 ? 16 ASP A C    1 
ATOM 242 O O    . ASP A 1 16 ? 7.444   5.435   8.436   1.00 0.00 ? 16 ASP A O    1 
ATOM 243 C CB   . ASP A 1 16 ? 10.558  4.631   7.934   1.00 0.00 ? 16 ASP A CB   1 
ATOM 244 C CG   . ASP A 1 16 ? 11.139  3.363   8.577   1.00 0.00 ? 16 ASP A CG   1 
ATOM 245 O OD1  . ASP A 1 16 ? 10.561  3.067   9.780   1.00 0.00 ? 16 ASP A OD1  1 
ATOM 246 O OD2  . ASP A 1 16 ? 12.023  2.698   8.058   1.00 0.00 ? 16 ASP A OD2  1 
ATOM 247 H H    . ASP A 1 16 ? 10.426  4.693   5.313   1.00 0.00 ? 16 ASP A H    1 
ATOM 248 H HA   . ASP A 1 16 ? 8.752   3.505   7.406   1.00 0.00 ? 16 ASP A HA   1 
ATOM 249 H HB2  . ASP A 1 16 ? 11.346  5.067   7.295   1.00 0.00 ? 16 ASP A HB2  1 
ATOM 250 H HB3  . ASP A 1 16 ? 10.415  5.374   8.744   1.00 0.00 ? 16 ASP A HB3  1 
ATOM 251 N N    . ALA A 1 17 ? 8.266   6.633   6.736   1.00 0.00 ? 17 ALA A N    1 
ATOM 252 C CA   . ALA A 1 17 ? 7.290   7.708   6.882   1.00 0.00 ? 17 ALA A CA   1 
ATOM 253 C C    . ALA A 1 17 ? 5.982   7.347   6.217   1.00 0.00 ? 17 ALA A C    1 
ATOM 254 O O    . ALA A 1 17 ? 4.900   7.784   6.628   1.00 0.00 ? 17 ALA A O    1 
ATOM 255 C CB   . ALA A 1 17 ? 7.917   8.989   6.305   1.00 0.00 ? 17 ALA A CB   1 
ATOM 256 H H    . ALA A 1 17 ? 9.053   6.689   6.045   1.00 0.00 ? 17 ALA A H    1 
ATOM 257 H HA   . ALA A 1 17 ? 7.081   7.853   7.958   1.00 0.00 ? 17 ALA A HA   1 
ATOM 258 H HB1  . ALA A 1 17 ? 8.854   9.260   6.829   1.00 0.00 ? 17 ALA A HB1  1 
ATOM 259 H HB2  . ALA A 1 17 ? 8.166   8.884   5.231   1.00 0.00 ? 17 ALA A HB2  1 
ATOM 260 H HB3  . ALA A 1 17 ? 7.240   9.858   6.398   1.00 0.00 ? 17 ALA A HB3  1 
ATOM 261 N N    . LEU A 1 18 ? 6.061   6.563   5.157   1.00 0.00 ? 18 LEU A N    1 
ATOM 262 C CA   . LEU A 1 18 ? 4.873   6.012   4.511   1.00 0.00 ? 18 LEU A CA   1 
ATOM 263 C C    . LEU A 1 18 ? 3.976   5.329   5.517   1.00 0.00 ? 18 LEU A C    1 
ATOM 264 O O    . LEU A 1 18 ? 2.754   5.518   5.532   1.00 0.00 ? 18 LEU A O    1 
ATOM 265 C CB   . LEU A 1 18 ? 5.273   5.031   3.370   1.00 0.00 ? 18 LEU A CB   1 
ATOM 266 C CG   . LEU A 1 18 ? 4.324   4.908   2.148   1.00 0.00 ? 18 LEU A CG   1 
ATOM 267 C CD1  . LEU A 1 18 ? 2.946   4.336   2.521   1.00 0.00 ? 18 LEU A CD1  1 
ATOM 268 C CD2  . LEU A 1 18 ? 4.150   6.276   1.473   1.00 0.00 ? 18 LEU A CD2  1 
ATOM 269 H H    . LEU A 1 18 ? 7.028   6.348   4.815   1.00 0.00 ? 18 LEU A H    1 
ATOM 270 H HA   . LEU A 1 18 ? 4.284   6.843   4.085   1.00 0.00 ? 18 LEU A HA   1 
ATOM 271 H HB2  . LEU A 1 18 ? 6.282   5.305   3.001   1.00 0.00 ? 18 LEU A HB2  1 
ATOM 272 H HB3  . LEU A 1 18 ? 5.398   4.025   3.814   1.00 0.00 ? 18 LEU A HB3  1 
ATOM 273 H HG   . LEU A 1 18 ? 4.796   4.223   1.413   1.00 0.00 ? 18 LEU A HG   1 
ATOM 274 H HD11 . LEU A 1 18 ? 3.022   3.354   3.022   1.00 0.00 ? 18 LEU A HD11 1 
ATOM 275 H HD12 . LEU A 1 18 ? 2.403   5.014   3.206   1.00 0.00 ? 18 LEU A HD12 1 
ATOM 276 H HD13 . LEU A 1 18 ? 2.297   4.212   1.635   1.00 0.00 ? 18 LEU A HD13 1 
ATOM 277 H HD21 . LEU A 1 18 ? 3.756   7.034   2.176   1.00 0.00 ? 18 LEU A HD21 1 
ATOM 278 H HD22 . LEU A 1 18 ? 5.103   6.669   1.070   1.00 0.00 ? 18 LEU A HD22 1 
ATOM 279 H HD23 . LEU A 1 18 ? 3.436   6.227   0.630   1.00 0.00 ? 18 LEU A HD23 1 
ATOM 280 N N    . ARG A 1 19 ? 4.564   4.498   6.357   1.00 0.00 ? 19 ARG A N    1 
ATOM 281 C CA   . ARG A 1 19 ? 3.801   3.636   7.255   1.00 0.00 ? 19 ARG A CA   1 
ATOM 282 C C    . ARG A 1 19 ? 2.935   4.452   8.187   1.00 0.00 ? 19 ARG A C    1 
ATOM 283 O O    . ARG A 1 19 ? 1.763   4.135   8.429   1.00 0.00 ? 19 ARG A O    1 
ATOM 284 C CB   . ARG A 1 19 ? 4.788   2.733   8.045   1.00 0.00 ? 19 ARG A CB   1 
ATOM 285 C CG   . ARG A 1 19 ? 5.676   1.813   7.164   1.00 0.00 ? 19 ARG A CG   1 
ATOM 286 C CD   . ARG A 1 19 ? 5.615   0.343   7.600   1.00 0.00 ? 19 ARG A CD   1 
ATOM 287 N NE   . ARG A 1 19 ? 6.428   -0.459  6.651   1.00 0.00 ? 19 ARG A NE   1 
ATOM 288 C CZ   . ARG A 1 19 ? 7.108   -1.556  6.956   1.00 0.00 ? 19 ARG A CZ   1 
ATOM 289 N NH1  . ARG A 1 19 ? 7.151   -2.086  8.142   1.00 0.00 ? 19 ARG A NH1  1 
ATOM 290 N NH2  . ARG A 1 19 ? 7.764   -2.130  6.011   1.00 0.00 ? 19 ARG A NH2  1 
ATOM 291 H H    . ARG A 1 19 ? 5.612   4.470   6.320   1.00 0.00 ? 19 ARG A H    1 
ATOM 292 H HA   . ARG A 1 19 ? 3.129   3.006   6.642   1.00 0.00 ? 19 ARG A HA   1 
ATOM 293 H HB2  . ARG A 1 19 ? 5.430   3.366   8.691   1.00 0.00 ? 19 ARG A HB2  1 
ATOM 294 H HB3  . ARG A 1 19 ? 4.224   2.094   8.753   1.00 0.00 ? 19 ARG A HB3  1 
ATOM 295 H HG2  . ARG A 1 19 ? 5.375   1.873   6.099   1.00 0.00 ? 19 ARG A HG2  1 
ATOM 296 H HG3  . ARG A 1 19 ? 6.728   2.162   7.188   1.00 0.00 ? 19 ARG A HG3  1 
ATOM 297 H HD2  . ARG A 1 19 ? 6.002   0.230   8.633   1.00 0.00 ? 19 ARG A HD2  1 
ATOM 298 H HD3  . ARG A 1 19 ? 4.565   -0.014  7.606   1.00 0.00 ? 19 ARG A HD3  1 
ATOM 299 H HE   . ARG A 1 19 ? 6.468   -0.136  5.674   1.00 0.00 ? 19 ARG A HE   1 
ATOM 300 H HH11 . ARG A 1 19 ? 6.605   -1.569  8.832   1.00 0.00 ? 19 ARG A HH11 1 
ATOM 301 H HH12 . ARG A 1 19 ? 7.709   -2.931  8.253   1.00 0.00 ? 19 ARG A HH12 1 
ATOM 302 H HH21 . ARG A 1 19 ? 7.664   -1.635  5.122   1.00 0.00 ? 19 ARG A HH21 1 
ATOM 303 H HH22 . ARG A 1 19 ? 8.289   -2.972  6.238   1.00 0.00 ? 19 ARG A HH22 1 
ATOM 304 N N    . THR A 1 20 ? 3.495   5.517   8.729   1.00 0.00 ? 20 THR A N    1 
ATOM 305 C CA   . THR A 1 20 ? 2.770   6.389   9.650   1.00 0.00 ? 20 THR A CA   1 
ATOM 306 C C    . THR A 1 20 ? 1.646   7.107   8.941   1.00 0.00 ? 20 THR A C    1 
ATOM 307 O O    . THR A 1 20 ? 0.561   7.324   9.493   1.00 0.00 ? 20 THR A O    1 
ATOM 308 C CB   . THR A 1 20 ? 3.746   7.414   10.320  1.00 0.00 ? 20 THR A CB   1 
ATOM 309 O OG1  . THR A 1 20 ? 4.347   6.846   11.476  1.00 0.00 ? 20 THR A OG1  1 
ATOM 310 C CG2  . THR A 1 20 ? 3.115   8.732   10.820  1.00 0.00 ? 20 THR A CG2  1 
ATOM 311 H H    . THR A 1 20 ? 4.476   5.727   8.424   1.00 0.00 ? 20 THR A H    1 
ATOM 312 H HA   . THR A 1 20 ? 2.316   5.762   10.439  1.00 0.00 ? 20 THR A HA   1 
ATOM 313 H HB   . THR A 1 20 ? 4.545   7.664   9.590   1.00 0.00 ? 20 THR A HB   1 
ATOM 314 H HG1  . THR A 1 20 ? 4.981   7.497   11.794  1.00 0.00 ? 20 THR A HG1  1 
ATOM 315 H HG21 . THR A 1 20 ? 2.312   8.549   11.559  1.00 0.00 ? 20 THR A HG21 1 
ATOM 316 H HG22 . THR A 1 20 ? 3.859   9.393   11.301  1.00 0.00 ? 20 THR A HG22 1 
ATOM 317 H HG23 . THR A 1 20 ? 2.672   9.327   9.999   1.00 0.00 ? 20 THR A HG23 1 
ATOM 318 N N    . HIS A 1 21 ? 1.885   7.486   7.699   1.00 0.00 ? 21 HIS A N    1 
ATOM 319 C CA   . HIS A 1 21 ? 0.943   8.312   6.949   1.00 0.00 ? 21 HIS A CA   1 
ATOM 320 C C    . HIS A 1 21 ? -0.375  7.597   6.761   1.00 0.00 ? 21 HIS A C    1 
ATOM 321 O O    . HIS A 1 21 ? -1.450  8.210   6.746   1.00 0.00 ? 21 HIS A O    1 
ATOM 322 C CB   . HIS A 1 21 ? 1.598   8.595   5.586   1.00 0.00 ? 21 HIS A CB   1 
ATOM 323 C CG   . HIS A 1 21 ? 1.910   10.050  5.394   1.00 0.00 ? 21 HIS A CG   1 
ATOM 324 N ND1  . HIS A 1 21 ? 0.996   11.041  5.040   1.00 0.00 ? 21 HIS A ND1  1 
ATOM 325 C CD2  . HIS A 1 21 ? 3.186   10.571  5.558   1.00 0.00 ? 21 HIS A CD2  1 
ATOM 326 C CE1  . HIS A 1 21 ? 1.815   12.110  5.016   1.00 0.00 ? 21 HIS A CE1  1 
ATOM 327 N NE2  . HIS A 1 21 ? 3.129   11.918  5.310   1.00 0.00 ? 21 HIS A NE2  1 
ATOM 328 H H    . HIS A 1 21 ? 2.789   7.153   7.284   1.00 0.00 ? 21 HIS A H    1 
ATOM 329 H HA   . HIS A 1 21 ? 0.732   9.210   7.553   1.00 0.00 ? 21 HIS A HA   1 
ATOM 330 H HB2  . HIS A 1 21 ? 2.545   8.030   5.457   1.00 0.00 ? 21 HIS A HB2  1 
ATOM 331 H HB3  . HIS A 1 21 ? 0.945   8.271   4.751   1.00 0.00 ? 21 HIS A HB3  1 
ATOM 332 H HD1  . HIS A 1 21 ? -0.014  10.974  4.851   1.00 0.00 ? 21 HIS A HD1  1 
ATOM 333 H HD2  . HIS A 1 21 ? 4.059   9.987   5.835   1.00 0.00 ? 21 HIS A HD2  1 
ATOM 334 H HE1  . HIS A 1 21 ? 1.379   13.068  4.764   1.00 0.00 ? 21 HIS A HE1  1 
ATOM 335 H HE2  . HIS A 1 21 ? 3.895   12.607  5.340   1.00 0.00 ? 21 HIS A HE2  1 
ATOM 336 N N    . LEU A 1 22 ? -0.317  6.289   6.597   1.00 0.00 ? 22 LEU A N    1 
ATOM 337 C CA   . LEU A 1 22 ? -1.513  5.485   6.356   1.00 0.00 ? 22 LEU A CA   1 
ATOM 338 C C    . LEU A 1 22 ? -1.412  4.145   7.047   1.00 0.00 ? 22 LEU A C    1 
ATOM 339 O O    . LEU A 1 22 ? -1.610  3.083   6.446   1.00 0.00 ? 22 LEU A O    1 
ATOM 340 C CB   . LEU A 1 22 ? -1.753  5.305   4.830   1.00 0.00 ? 22 LEU A CB   1 
ATOM 341 C CG   . LEU A 1 22 ? -1.120  6.340   3.861   1.00 0.00 ? 22 LEU A CG   1 
ATOM 342 C CD1  . LEU A 1 22 ? -0.775  5.735   2.490   1.00 0.00 ? 22 LEU A CD1  1 
ATOM 343 C CD2  . LEU A 1 22 ? -2.063  7.537   3.676   1.00 0.00 ? 22 LEU A CD2  1 
ATOM 344 H H    . LEU A 1 22 ? 0.630   5.850   6.698   1.00 0.00 ? 22 LEU A H    1 
ATOM 345 H HA   . LEU A 1 22 ? -2.377  6.002   6.810   1.00 0.00 ? 22 LEU A HA   1 
ATOM 346 H HB2  . LEU A 1 22 ? -1.403  4.296   4.532   1.00 0.00 ? 22 LEU A HB2  1 
ATOM 347 H HB3  . LEU A 1 22 ? -2.846  5.284   4.647   1.00 0.00 ? 22 LEU A HB3  1 
ATOM 348 H HG   . LEU A 1 22 ? -0.181  6.714   4.321   1.00 0.00 ? 22 LEU A HG   1 
ATOM 349 H HD11 . LEU A 1 22 ? -0.201  4.796   2.599   1.00 0.00 ? 22 LEU A HD11 1 
ATOM 350 H HD12 . LEU A 1 22 ? -1.682  5.474   1.914   1.00 0.00 ? 22 LEU A HD12 1 
ATOM 351 H HD13 . LEU A 1 22 ? -0.169  6.421   1.870   1.00 0.00 ? 22 LEU A HD13 1 
ATOM 352 H HD21 . LEU A 1 22 ? -2.368  7.974   4.646   1.00 0.00 ? 22 LEU A HD21 1 
ATOM 353 H HD22 . LEU A 1 22 ? -1.600  8.349   3.083   1.00 0.00 ? 22 LEU A HD22 1 
ATOM 354 H HD23 . LEU A 1 22 ? -2.994  7.245   3.155   1.00 0.00 ? 22 LEU A HD23 1 
ATOM 355 N N    . ALA A 1 23 ? -1.111  4.173   8.333   1.00 0.00 ? 23 ALA A N    1 
ATOM 356 C CA   . ALA A 1 23 ? -1.146  2.973   9.163   1.00 0.00 ? 23 ALA A CA   1 
ATOM 357 C C    . ALA A 1 23 ? -2.568  2.526   9.406   1.00 0.00 ? 23 ALA A C    1 
ATOM 358 O O    . ALA A 1 23 ? -2.986  1.433   9.014   1.00 0.00 ? 23 ALA A O    1 
ATOM 359 C CB   . ALA A 1 23 ? -0.388  3.284   10.465  1.00 0.00 ? 23 ALA A CB   1 
ATOM 360 H H    . ALA A 1 23 ? -0.830  5.106   8.719   1.00 0.00 ? 23 ALA A H    1 
ATOM 361 H HA   . ALA A 1 23 ? -0.632  2.155   8.624   1.00 0.00 ? 23 ALA A HA   1 
ATOM 362 H HB1  . ALA A 1 23 ? 0.662   3.573   10.270  1.00 0.00 ? 23 ALA A HB1  1 
ATOM 363 H HB2  . ALA A 1 23 ? -0.854  4.116   11.029  1.00 0.00 ? 23 ALA A HB2  1 
ATOM 364 H HB3  . ALA A 1 23 ? -0.356  2.410   11.142  1.00 0.00 ? 23 ALA A HB3  1 
ATOM 365 N N    . PRO A 1 24 ? -3.338  3.377   10.066  1.00 0.00 ? 24 PRO A N    1 
ATOM 366 C CA   . PRO A 1 24 ? -4.819  3.178   10.394  1.00 0.00 ? 24 PRO A CA   1 
ATOM 367 C C    . PRO A 1 24 ? -5.781  3.331   9.233   1.00 0.00 ? 24 PRO A C    1 
ATOM 368 O O    . PRO A 1 24 ? -6.940  2.895   9.310   1.00 0.00 ? 24 PRO A O    1 
ATOM 369 C CB   . PRO A 1 24 ? -5.170  4.224   11.442  1.00 0.00 ? 24 PRO A CB   1 
ATOM 370 C CG   . PRO A 1 24 ? -4.198  5.366   11.117  1.00 0.00 ? 24 PRO A CG   1 
ATOM 371 C CD   . PRO A 1 24 ? -2.922  4.687   10.617  1.00 0.00 ? 24 PRO A CD   1 
ATOM 372 H HA   . PRO A 1 24 ? -4.958  2.179   10.788  1.00 0.00 ? 24 PRO A HA   1 
ATOM 373 H HB2  . PRO A 1 24 ? -6.202  4.568   11.276  1.00 0.00 ? 24 PRO A HB2  1 
ATOM 374 H HB3  . PRO A 1 24 ? -4.917  3.827   12.445  1.00 0.00 ? 24 PRO A HB3  1 
ATOM 375 H HG2  . PRO A 1 24 ? -4.692  5.998   10.367  1.00 0.00 ? 24 PRO A HG2  1 
ATOM 376 H HG3  . PRO A 1 24 ? -3.791  5.866   12.020  1.00 0.00 ? 24 PRO A HG3  1 
ATOM 377 H HD2  . PRO A 1 24 ? -2.485  5.292   9.802   1.00 0.00 ? 24 PRO A HD2  1 
ATOM 378 H HD3  . PRO A 1 24 ? -2.226  4.529   11.460  1.00 0.00 ? 24 PRO A HD3  1 
ATOM 379 N N    . TYR A 1 25 ? -5.342  3.933   8.144   1.00 0.00 ? 25 TYR A N    1 
ATOM 380 C CA   . TYR A 1 25 ? -6.144  4.046   6.931   1.00 0.00 ? 25 TYR A CA   1 
ATOM 381 C C    . TYR A 1 25 ? -5.929  2.852   6.028   1.00 0.00 ? 25 TYR A C    1 
ATOM 382 O O    . TYR A 1 25 ? -5.292  2.944   4.972   1.00 0.00 ? 25 TYR A O    1 
ATOM 383 C CB   . TYR A 1 25 ? -5.768  5.330   6.134   1.00 0.00 ? 25 TYR A CB   1 
ATOM 384 C CG   . TYR A 1 25 ? -5.694  6.645   6.921   1.00 0.00 ? 25 TYR A CG   1 
ATOM 385 C CD1  . TYR A 1 25 ? -5.790  6.666   8.316   1.00 0.00 ? 25 TYR A CD1  1 
ATOM 386 C CD2  . TYR A 1 25 ? -5.530  7.851   6.227   1.00 0.00 ? 25 TYR A CD2  1 
ATOM 387 C CE1  . TYR A 1 25 ? -5.721  7.873   9.006   1.00 0.00 ? 25 TYR A CE1  1 
ATOM 388 C CE2  . TYR A 1 25 ? -5.464  9.056   6.919   1.00 0.00 ? 25 TYR A CE2  1 
ATOM 389 C CZ   . TYR A 1 25 ? -5.557  9.067   8.308   1.00 0.00 ? 25 TYR A CZ   1 
ATOM 390 O OH   . TYR A 1 25 ? -5.488  10.249  8.988   1.00 0.00 ? 25 TYR A OH   1 
ATOM 391 H H    . TYR A 1 25 ? -4.369  4.330   8.209   1.00 0.00 ? 25 TYR A H    1 
ATOM 392 H HA   . TYR A 1 25 ? -7.214  4.074   7.207   1.00 0.00 ? 25 TYR A HA   1 
ATOM 393 H HB2  . TYR A 1 25 ? -4.787  5.193   5.637   1.00 0.00 ? 25 TYR A HB2  1 
ATOM 394 H HB3  . TYR A 1 25 ? -6.471  5.441   5.275   1.00 0.00 ? 25 TYR A HB3  1 
ATOM 395 H HD1  . TYR A 1 25 ? -5.913  5.743   8.867   1.00 0.00 ? 25 TYR A HD1  1 
ATOM 396 H HD2  . TYR A 1 25 ? -5.445  7.849   5.148   1.00 0.00 ? 25 TYR A HD2  1 
ATOM 397 H HE1  . TYR A 1 25 ? -5.789  7.887   10.084  1.00 0.00 ? 25 TYR A HE1  1 
ATOM 398 H HE2  . TYR A 1 25 ? -5.333  9.977   6.370   1.00 0.00 ? 25 TYR A HE2  1 
ATOM 399 H HH   . TYR A 1 25 ? -6.111  10.866  8.599   1.00 0.00 ? 25 TYR A HH   1 
ATOM 400 N N    . SER A 1 26 ? -6.448  1.707   6.431   1.00 0.00 ? 26 SER A N    1 
ATOM 401 C CA   . SER A 1 26 ? -6.324  0.478   5.650   1.00 0.00 ? 26 SER A CA   1 
ATOM 402 C C    . SER A 1 26 ? -7.568  -0.371  5.775   1.00 0.00 ? 26 SER A C    1 
ATOM 403 O O    . SER A 1 26 ? -8.140  -0.838  4.783   1.00 0.00 ? 26 SER A O    1 
ATOM 404 C CB   . SER A 1 26 ? -5.054  -0.310  6.058   1.00 0.00 ? 26 SER A CB   1 
ATOM 405 O OG   . SER A 1 26 ? -5.266  -1.159  7.192   1.00 0.00 ? 26 SER A OG   1 
ATOM 406 H H    . SER A 1 26 ? -6.970  1.731   7.340   1.00 0.00 ? 26 SER A H    1 
ATOM 407 H HA   . SER A 1 26 ? -6.234  0.759   4.585   1.00 0.00 ? 26 SER A HA   1 
ATOM 408 H HB2  . SER A 1 26 ? -4.716  -0.938  5.211   1.00 0.00 ? 26 SER A HB2  1 
ATOM 409 H HB3  . SER A 1 26 ? -4.207  0.374   6.262   1.00 0.00 ? 26 SER A HB3  1 
ATOM 410 H HG   . SER A 1 26 ? -4.641  -1.887  7.126   1.00 0.00 ? 26 SER A HG   1 
ATOM 411 N N    . ASP A 1 27 ? -8.008  -0.588  7.001   1.00 0.00 ? 27 ASP A N    1 
ATOM 412 C CA   . ASP A 1 27 ? -9.178  -1.418  7.271   1.00 0.00 ? 27 ASP A CA   1 
ATOM 413 C C    . ASP A 1 27 ? -10.457 -0.664  6.988   1.00 0.00 ? 27 ASP A C    1 
ATOM 414 O O    . ASP A 1 27 ? -11.454 -1.228  6.520   1.00 0.00 ? 27 ASP A O    1 
ATOM 415 C CB   . ASP A 1 27 ? -9.134  -1.951  8.727   1.00 0.00 ? 27 ASP A CB   1 
ATOM 416 C CG   . ASP A 1 27 ? -8.380  -3.270  8.957   1.00 0.00 ? 27 ASP A CG   1 
ATOM 417 O OD1  . ASP A 1 27 ? -7.041  -3.165  8.706   1.00 0.00 ? 27 ASP A OD1  1 
ATOM 418 O OD2  . ASP A 1 27 ? -8.931  -4.298  9.321   1.00 0.00 ? 27 ASP A OD2  1 
ATOM 419 H H    . ASP A 1 27 ? -7.454  -0.145  7.773   1.00 0.00 ? 27 ASP A H    1 
ATOM 420 H HA   . ASP A 1 27 ? -9.140  -2.260  6.556   1.00 0.00 ? 27 ASP A HA   1 
ATOM 421 H HB2  . ASP A 1 27 ? -8.702  -1.201  9.412   1.00 0.00 ? 27 ASP A HB2  1 
ATOM 422 H HB3  . ASP A 1 27 ? -10.170 -2.098  9.094   1.00 0.00 ? 27 ASP A HB3  1 
ATOM 423 N N    . GLU A 1 28 ? -10.458 0.621   7.287   1.00 0.00 ? 28 GLU A N    1 
ATOM 424 C CA   . GLU A 1 28 ? -11.652 1.450   7.146   1.00 0.00 ? 28 GLU A CA   1 
ATOM 425 C C    . GLU A 1 28 ? -12.108 1.498   5.707   1.00 0.00 ? 28 GLU A C    1 
ATOM 426 O O    . GLU A 1 28 ? -13.252 1.164   5.375   1.00 0.00 ? 28 GLU A O    1 
ATOM 427 C CB   . GLU A 1 28 ? -11.335 2.874   7.689   1.00 0.00 ? 28 GLU A CB   1 
ATOM 428 C CG   . GLU A 1 28 ? -12.537 3.744   8.183   1.00 0.00 ? 28 GLU A CG   1 
ATOM 429 C CD   . GLU A 1 28 ? -12.732 5.131   7.565   1.00 0.00 ? 28 GLU A CD   1 
ATOM 430 O OE1  . GLU A 1 28 ? -12.872 5.113   6.210   1.00 0.00 ? 28 GLU A OE1  1 
ATOM 431 O OE2  . GLU A 1 28 ? -12.760 6.159   8.229   1.00 0.00 ? 28 GLU A OE2  1 
ATOM 432 H H    . GLU A 1 28 ? -9.536  1.023   7.585   1.00 0.00 ? 28 GLU A H    1 
ATOM 433 H HA   . GLU A 1 28 ? -12.470 1.010   7.744   1.00 0.00 ? 28 GLU A HA   1 
ATOM 434 H HB2  . GLU A 1 28 ? -10.592 2.784   8.506   1.00 0.00 ? 28 GLU A HB2  1 
ATOM 435 H HB3  . GLU A 1 28 ? -10.802 3.431   6.895   1.00 0.00 ? 28 GLU A HB3  1 
ATOM 436 H HG2  . GLU A 1 28 ? -13.483 3.192   8.031   1.00 0.00 ? 28 GLU A HG2  1 
ATOM 437 H HG3  . GLU A 1 28 ? -12.479 3.888   9.278   1.00 0.00 ? 28 GLU A HG3  1 
ATOM 438 N N    . LEU A 1 29 ? -11.225 1.933   4.827   1.00 0.00 ? 29 LEU A N    1 
ATOM 439 C CA   . LEU A 1 29 ? -11.571 2.153   3.426   1.00 0.00 ? 29 LEU A CA   1 
ATOM 440 C C    . LEU A 1 29 ? -11.913 0.850   2.742   1.00 0.00 ? 29 LEU A C    1 
ATOM 441 O O    . LEU A 1 29 ? -12.802 0.778   1.885   1.00 0.00 ? 29 LEU A O    1 
ATOM 442 C CB   . LEU A 1 29 ? -10.413 2.881   2.685   1.00 0.00 ? 29 LEU A CB   1 
ATOM 443 C CG   . LEU A 1 29 ? -10.008 4.297   3.175   1.00 0.00 ? 29 LEU A CG   1 
ATOM 444 C CD1  . LEU A 1 29 ? -8.510  4.587   2.984   1.00 0.00 ? 29 LEU A CD1  1 
ATOM 445 C CD2  . LEU A 1 29 ? -10.837 5.365   2.447   1.00 0.00 ? 29 LEU A CD2  1 
ATOM 446 H H    . LEU A 1 29 ? -10.252 2.082   5.188   1.00 0.00 ? 29 LEU A H    1 
ATOM 447 H HA   . LEU A 1 29 ? -12.484 2.774   3.384   1.00 0.00 ? 29 LEU A HA   1 
ATOM 448 H HB2  . LEU A 1 29 ? -9.511  2.236   2.717   1.00 0.00 ? 29 LEU A HB2  1 
ATOM 449 H HB3  . LEU A 1 29 ? -10.670 2.946   1.610   1.00 0.00 ? 29 LEU A HB3  1 
ATOM 450 H HG   . LEU A 1 29 ? -10.239 4.367   4.258   1.00 0.00 ? 29 LEU A HG   1 
ATOM 451 H HD11 . LEU A 1 29 ? -7.888  3.766   3.388   1.00 0.00 ? 29 LEU A HD11 1 
ATOM 452 H HD12 . LEU A 1 29 ? -8.239  4.677   1.915   1.00 0.00 ? 29 LEU A HD12 1 
ATOM 453 H HD13 . LEU A 1 29 ? -8.194  5.518   3.490   1.00 0.00 ? 29 LEU A HD13 1 
ATOM 454 H HD21 . LEU A 1 29 ? -11.923 5.166   2.526   1.00 0.00 ? 29 LEU A HD21 1 
ATOM 455 H HD22 . LEU A 1 29 ? -10.661 6.380   2.850   1.00 0.00 ? 29 LEU A HD22 1 
ATOM 456 H HD23 . LEU A 1 29 ? -10.601 5.397   1.367   1.00 0.00 ? 29 LEU A HD23 1 
ATOM 457 N N    . ARG A 1 30 ? -11.204 -0.203  3.104   1.00 0.00 ? 30 ARG A N    1 
ATOM 458 C CA   . ARG A 1 30 ? -11.352 -1.500  2.450   1.00 0.00 ? 30 ARG A CA   1 
ATOM 459 C C    . ARG A 1 30 ? -12.756 -2.035  2.612   1.00 0.00 ? 30 ARG A C    1 
ATOM 460 O O    . ARG A 1 30 ? -13.289 -2.732  1.738   1.00 0.00 ? 30 ARG A O    1 
ATOM 461 C CB   . ARG A 1 30 ? -10.302 -2.482  3.039   1.00 0.00 ? 30 ARG A CB   1 
ATOM 462 C CG   . ARG A 1 30 ? -8.950  -2.535  2.279   1.00 0.00 ? 30 ARG A CG   1 
ATOM 463 C CD   . ARG A 1 30 ? -8.778  -1.372  1.294   1.00 0.00 ? 30 ARG A CD   1 
ATOM 464 N NE   . ARG A 1 30 ? -7.513  -0.666  1.619   1.00 0.00 ? 30 ARG A NE   1 
ATOM 465 C CZ   . ARG A 1 30 ? -6.542  -0.389  0.758   1.00 0.00 ? 30 ARG A CZ   1 
ATOM 466 N NH1  . ARG A 1 30 ? -6.566  -0.708  -0.502  1.00 0.00 ? 30 ARG A NH1  1 
ATOM 467 N NH2  . ARG A 1 30 ? -5.512  0.237   1.207   1.00 0.00 ? 30 ARG A NH2  1 
ATOM 468 H H    . ARG A 1 30 ? -10.534 -0.056  3.897   1.00 0.00 ? 30 ARG A H    1 
ATOM 469 H HA   . ARG A 1 30 ? -11.170 -1.364  1.367   1.00 0.00 ? 30 ARG A HA   1 
ATOM 470 H HB2  . ARG A 1 30 ? -10.094 -2.216  4.096   1.00 0.00 ? 30 ARG A HB2  1 
ATOM 471 H HB3  . ARG A 1 30 ? -10.741 -3.501  3.093   1.00 0.00 ? 30 ARG A HB3  1 
ATOM 472 H HG2  . ARG A 1 30 ? -8.095  -2.522  2.986   1.00 0.00 ? 30 ARG A HG2  1 
ATOM 473 H HG3  . ARG A 1 30 ? -8.857  -3.497  1.734   1.00 0.00 ? 30 ARG A HG3  1 
ATOM 474 H HD2  . ARG A 1 30 ? -8.753  -1.750  0.251   1.00 0.00 ? 30 ARG A HD2  1 
ATOM 475 H HD3  . ARG A 1 30 ? -9.639  -0.676  1.365   1.00 0.00 ? 30 ARG A HD3  1 
ATOM 476 H HE   . ARG A 1 30 ? -7.378  -0.364  2.595   1.00 0.00 ? 30 ARG A HE   1 
ATOM 477 H HH11 . ARG A 1 30 ? -7.416  -1.204  -0.773  1.00 0.00 ? 30 ARG A HH11 1 
ATOM 478 H HH12 . ARG A 1 30 ? -5.760  -0.441  -1.064  1.00 0.00 ? 30 ARG A HH12 1 
ATOM 479 H HH21 . ARG A 1 30 ? -5.593  0.440   2.205   1.00 0.00 ? 30 ARG A HH21 1 
ATOM 480 H HH22 . ARG A 1 30 ? -4.765  0.454   0.551   1.00 0.00 ? 30 ARG A HH22 1 
ATOM 481 N N    . GLN A 1 31 ? -13.371 -1.748  3.744   1.00 0.00 ? 31 GLN A N    1 
ATOM 482 C CA   . GLN A 1 31 ? -14.673 -2.318  4.083   1.00 0.00 ? 31 GLN A CA   1 
ATOM 483 C C    . GLN A 1 31 ? -15.743 -1.829  3.134   1.00 0.00 ? 31 GLN A C    1 
ATOM 484 O O    . GLN A 1 31 ? -16.726 -2.524  2.850   1.00 0.00 ? 31 GLN A O    1 
ATOM 485 C CB   . GLN A 1 31 ? -15.011 -1.943  5.543   1.00 0.00 ? 31 GLN A CB   1 
ATOM 486 C CG   . GLN A 1 31 ? -15.823 -0.625  5.764   1.00 0.00 ? 31 GLN A CG   1 
ATOM 487 C CD   . GLN A 1 31 ? -17.193 -0.697  6.450   1.00 0.00 ? 31 GLN A CD   1 
ATOM 488 O OE1  . GLN A 1 31 ? -17.552 -1.704  7.038   1.00 0.00 ? 31 GLN A OE1  1 
ATOM 489 N NE2  . GLN A 1 31 ? -17.988 0.343   6.432   1.00 0.00 ? 31 GLN A NE2  1 
ATOM 490 H H    . GLN A 1 31 ? -12.852 -1.124  4.407   1.00 0.00 ? 31 GLN A H    1 
ATOM 491 H HA   . GLN A 1 31 ? -14.615 -3.418  3.982   1.00 0.00 ? 31 GLN A HA   1 
ATOM 492 H HB2  . GLN A 1 31 ? -15.572 -2.783  6.006   1.00 0.00 ? 31 GLN A HB2  1 
ATOM 493 H HB3  . GLN A 1 31 ? -14.062 -1.882  6.120   1.00 0.00 ? 31 GLN A HB3  1 
ATOM 494 H HG2  . GLN A 1 31 ? -15.211 0.108   6.325   1.00 0.00 ? 31 GLN A HG2  1 
ATOM 495 H HG3  . GLN A 1 31 ? -16.025 -0.128  4.797   1.00 0.00 ? 31 GLN A HG3  1 
ATOM 496 H HE21 . GLN A 1 31 ? -17.642 1.143   5.899   1.00 0.00 ? 31 GLN A HE21 1 
ATOM 497 H HE22 . GLN A 1 31 ? -18.888 0.206   6.896   1.00 0.00 ? 31 GLN A HE22 1 
ATOM 498 N N    . ARG A 1 32 ? -15.559 -0.632  2.609   1.00 0.00 ? 32 ARG A N    1 
ATOM 499 C CA   . ARG A 1 32 ? -16.460 -0.085  1.599   1.00 0.00 ? 32 ARG A CA   1 
ATOM 500 C C    . ARG A 1 32 ? -16.252 -0.759  0.263   1.00 0.00 ? 32 ARG A C    1 
ATOM 501 O O    . ARG A 1 32 ? -17.199 -0.991  -0.501  1.00 0.00 ? 32 ARG A O    1 
ATOM 502 C CB   . ARG A 1 32 ? -16.235 1.449   1.501   1.00 0.00 ? 32 ARG A CB   1 
ATOM 503 C CG   . ARG A 1 32 ? -15.137 1.888   0.497   1.00 0.00 ? 32 ARG A CG   1 
ATOM 504 C CD   . ARG A 1 32 ? -15.411 3.272   -0.107  1.00 0.00 ? 32 ARG A CD   1 
ATOM 505 N NE   . ARG A 1 32 ? -16.037 4.123   0.937   1.00 0.00 ? 32 ARG A NE   1 
ATOM 506 C CZ   . ARG A 1 32 ? -15.390 4.743   1.914   1.00 0.00 ? 32 ARG A CZ   1 
ATOM 507 N NH1  . ARG A 1 32 ? -14.104 4.685   2.095   1.00 0.00 ? 32 ARG A NH1  1 
ATOM 508 N NH2  . ARG A 1 32 ? -16.087 5.448   2.734   1.00 0.00 ? 32 ARG A NH2  1 
ATOM 509 H H    . ARG A 1 32 ? -14.758 -0.078  2.996   1.00 0.00 ? 32 ARG A H    1 
ATOM 510 H HA   . ARG A 1 32 ? -17.500 -0.288  1.917   1.00 0.00 ? 32 ARG A HA   1 
ATOM 511 H HB2  . ARG A 1 32 ? -17.183 1.948   1.217   1.00 0.00 ? 32 ARG A HB2  1 
ATOM 512 H HB3  . ARG A 1 32 ? -16.002 1.852   2.509   1.00 0.00 ? 32 ARG A HB3  1 
ATOM 513 H HG2  . ARG A 1 32 ? -14.140 1.912   0.981   1.00 0.00 ? 32 ARG A HG2  1 
ATOM 514 H HG3  . ARG A 1 32 ? -15.045 1.142   -0.319  1.00 0.00 ? 32 ARG A HG3  1 
ATOM 515 H HD2  . ARG A 1 32 ? -14.468 3.731   -0.467  1.00 0.00 ? 32 ARG A HD2  1 
ATOM 516 H HD3  . ARG A 1 32 ? -16.083 3.183   -0.986  1.00 0.00 ? 32 ARG A HD3  1 
ATOM 517 H HE   . ARG A 1 32 ? -17.059 4.242   0.898   1.00 0.00 ? 32 ARG A HE   1 
ATOM 518 H HH11 . ARG A 1 32 ? -13.628 4.105   1.404   1.00 0.00 ? 32 ARG A HH11 1 
ATOM 519 H HH12 . ARG A 1 32 ? -13.722 5.206   2.883   1.00 0.00 ? 32 ARG A HH12 1 
ATOM 520 H HH21 . ARG A 1 32 ? -17.083 5.428   2.503   1.00 0.00 ? 32 ARG A HH21 1 
ATOM 521 H HH22 . ARG A 1 32 ? -15.597 5.929   3.485   1.00 0.00 ? 32 ARG A HH22 1 
ATOM 522 N N    . LEU A 1 33 ? -15.008 -1.059  -0.059  1.00 0.00 ? 33 LEU A N    1 
ATOM 523 C CA   . LEU A 1 33 ? -14.669 -1.689  -1.333  1.00 0.00 ? 33 LEU A CA   1 
ATOM 524 C C    . LEU A 1 33 ? -14.611 -3.198  -1.242  1.00 0.00 ? 33 LEU A C    1 
ATOM 525 O O    . LEU A 1 33 ? -14.230 -3.877  -2.212  1.00 0.00 ? 33 LEU A O    1 
ATOM 526 C CB   . LEU A 1 33 ? -13.315 -1.127  -1.863  1.00 0.00 ? 33 LEU A CB   1 
ATOM 527 C CG   . LEU A 1 33 ? -13.307 0.302   -2.470  1.00 0.00 ? 33 LEU A CG   1 
ATOM 528 C CD1  . LEU A 1 33 ? -11.965 1.025   -2.272  1.00 0.00 ? 33 LEU A CD1  1 
ATOM 529 C CD2  . LEU A 1 33 ? -13.646 0.241   -3.966  1.00 0.00 ? 33 LEU A CD2  1 
ATOM 530 H H    . LEU A 1 33 ? -14.270 -0.775  0.629   1.00 0.00 ? 33 LEU A H    1 
ATOM 531 H HA   . LEU A 1 33 ? -15.475 -1.458  -2.053  1.00 0.00 ? 33 LEU A HA   1 
ATOM 532 H HB2  . LEU A 1 33 ? -12.574 -1.155  -1.039  1.00 0.00 ? 33 LEU A HB2  1 
ATOM 533 H HB3  . LEU A 1 33 ? -12.917 -1.829  -2.620  1.00 0.00 ? 33 LEU A HB3  1 
ATOM 534 H HG   . LEU A 1 33 ? -14.099 0.895   -1.967  1.00 0.00 ? 33 LEU A HG   1 
ATOM 535 H HD11 . LEU A 1 33 ? -11.633 0.972   -1.218  1.00 0.00 ? 33 LEU A HD11 1 
ATOM 536 H HD12 . LEU A 1 33 ? -11.156 0.566   -2.870  1.00 0.00 ? 33 LEU A HD12 1 
ATOM 537 H HD13 . LEU A 1 33 ? -12.020 2.094   -2.546  1.00 0.00 ? 33 LEU A HD13 1 
ATOM 538 H HD21 . LEU A 1 33 ? -14.587 -0.311  -4.153  1.00 0.00 ? 33 LEU A HD21 1 
ATOM 539 H HD22 . LEU A 1 33 ? -13.764 1.248   -4.411  1.00 0.00 ? 33 LEU A HD22 1 
ATOM 540 H HD23 . LEU A 1 33 ? -12.857 -0.279  -4.542  1.00 0.00 ? 33 LEU A HD23 1 
ATOM 541 N N    . ALA A 1 34 ? -15.004 -3.765  -0.119  1.00 0.00 ? 34 ALA A N    1 
ATOM 542 C CA   . ALA A 1 34 ? -14.918 -5.208  0.097   1.00 0.00 ? 34 ALA A CA   1 
ATOM 543 C C    . ALA A 1 34 ? -16.186 -5.908  -0.335  1.00 0.00 ? 34 ALA A C    1 
ATOM 544 O O    . ALA A 1 34 ? -16.173 -7.085  -0.727  1.00 0.00 ? 34 ALA A O    1 
ATOM 545 C CB   . ALA A 1 34 ? -14.591 -5.437  1.583   1.00 0.00 ? 34 ALA A CB   1 
ATOM 546 H H    . ALA A 1 34 ? -15.430 -3.131  0.598   1.00 0.00 ? 34 ALA A H    1 
ATOM 547 H HA   . ALA A 1 34 ? -14.096 -5.604  -0.529  1.00 0.00 ? 34 ALA A HA   1 
ATOM 548 H HB1  . ALA A 1 34 ? -13.637 -4.957  1.873   1.00 0.00 ? 34 ALA A HB1  1 
ATOM 549 H HB2  . ALA A 1 34 ? -15.375 -5.028  2.250   1.00 0.00 ? 34 ALA A HB2  1 
ATOM 550 H HB3  . ALA A 1 34 ? -14.490 -6.512  1.821   1.00 0.00 ? 34 ALA A HB3  1 
ATOM 551 N N    . ALA A 1 35 ? -17.308 -5.221  -0.244  1.00 0.00 ? 35 ALA A N    1 
ATOM 552 C CA   . ALA A 1 35 ? -18.613 -5.827  -0.500  1.00 0.00 ? 35 ALA A CA   1 
ATOM 553 C C    . ALA A 1 35 ? -19.152 -5.422  -1.852  1.00 0.00 ? 35 ALA A C    1 
ATOM 554 O O    . ALA A 1 35 ? -19.935 -6.147  -2.481  1.00 0.00 ? 35 ALA A O    1 
ATOM 555 C CB   . ALA A 1 35 ? -19.545 -5.425  0.656   1.00 0.00 ? 35 ALA A CB   1 
ATOM 556 H H    . ALA A 1 35 ? -17.218 -4.225  0.071   1.00 0.00 ? 35 ALA A H    1 
ATOM 557 H HA   . ALA A 1 35 ? -18.493 -6.927  -0.513  1.00 0.00 ? 35 ALA A HA   1 
ATOM 558 H HB1  . ALA A 1 35 ? -19.159 -5.767  1.635   1.00 0.00 ? 35 ALA A HB1  1 
ATOM 559 H HB2  . ALA A 1 35 ? -19.676 -4.327  0.725   1.00 0.00 ? 35 ALA A HB2  1 
ATOM 560 H HB3  . ALA A 1 35 ? -20.554 -5.865  0.543   1.00 0.00 ? 35 ALA A HB3  1 
ATOM 561 N N    . ARG A 1 36 ? -18.774 -4.245  -2.313  1.00 0.00 ? 36 ARG A N    1 
ATOM 562 C CA   . ARG A 1 36 ? -19.187 -3.757  -3.627  1.00 0.00 ? 36 ARG A CA   1 
ATOM 563 C C    . ARG A 1 36 ? -18.616 -4.613  -4.733  1.00 0.00 ? 36 ARG A C    1 
ATOM 564 O O    . ARG A 1 36 ? -19.251 -4.847  -5.769  1.00 0.00 ? 36 ARG A O    1 
ATOM 565 C CB   . ARG A 1 36 ? -18.742 -2.275  -3.776  1.00 0.00 ? 36 ARG A CB   1 
ATOM 566 C CG   . ARG A 1 36 ? -19.728 -1.232  -3.186  1.00 0.00 ? 36 ARG A CG   1 
ATOM 567 C CD   . ARG A 1 36 ? -20.256 -1.636  -1.804  1.00 0.00 ? 36 ARG A CD   1 
ATOM 568 N NE   . ARG A 1 36 ? -20.433 -0.406  -0.991  1.00 0.00 ? 36 ARG A NE   1 
ATOM 569 C CZ   . ARG A 1 36 ? -21.565 0.270   -0.851  1.00 0.00 ? 36 ARG A CZ   1 
ATOM 570 N NH1  . ARG A 1 36 ? -22.688 -0.054  -1.420  1.00 0.00 ? 36 ARG A NH1  1 
ATOM 571 N NH2  . ARG A 1 36 ? -21.544 1.314   -0.100  1.00 0.00 ? 36 ARG A NH2  1 
ATOM 572 H H    . ARG A 1 36 ? -18.198 -3.657  -1.663  1.00 0.00 ? 36 ARG A H    1 
ATOM 573 H HA   . ARG A 1 36 ? -20.290 -3.824  -3.688  1.00 0.00 ? 36 ARG A HA   1 
ATOM 574 H HB2  . ARG A 1 36 ? -17.754 -2.134  -3.295  1.00 0.00 ? 36 ARG A HB2  1 
ATOM 575 H HB3  . ARG A 1 36 ? -18.562 -2.053  -4.849  1.00 0.00 ? 36 ARG A HB3  1 
ATOM 576 H HG2  . ARG A 1 36 ? -19.248 -0.237  -3.099  1.00 0.00 ? 36 ARG A HG2  1 
ATOM 577 H HG3  . ARG A 1 36 ? -20.582 -1.081  -3.878  1.00 0.00 ? 36 ARG A HG3  1 
ATOM 578 H HD2  . ARG A 1 36 ? -21.221 -2.174  -1.899  1.00 0.00 ? 36 ARG A HD2  1 
ATOM 579 H HD3  . ARG A 1 36 ? -19.547 -2.329  -1.307  1.00 0.00 ? 36 ARG A HD3  1 
ATOM 580 H HE   . ARG A 1 36 ? -19.605 -0.051  -0.491  1.00 0.00 ? 36 ARG A HE   1 
ATOM 581 H HH11 . ARG A 1 36 ? -22.603 -0.852  -2.050  1.00 0.00 ? 36 ARG A HH11 1 
ATOM 582 H HH12 . ARG A 1 36 ? -23.507 0.503   -1.182  1.00 0.00 ? 36 ARG A HH12 1 
ATOM 583 H HH21 . ARG A 1 36 ? -20.617 1.481   0.295   1.00 0.00 ? 36 ARG A HH21 1 
ATOM 584 H HH22 . ARG A 1 36 ? -22.411 1.834   0.018   1.00 0.00 ? 36 ARG A HH22 1 
ATOM 585 N N    . LEU A 1 37 ? -17.407 -5.104  -4.531  1.00 0.00 ? 37 LEU A N    1 
ATOM 586 C CA   . LEU A 1 37 ? -16.662 -5.794  -5.580  1.00 0.00 ? 37 LEU A CA   1 
ATOM 587 C C    . LEU A 1 37 ? -16.859 -7.290  -5.511  1.00 0.00 ? 37 LEU A C    1 
ATOM 588 O O    . LEU A 1 37 ? -15.943 -8.078  -5.782  1.00 0.00 ? 37 LEU A O    1 
ATOM 589 C CB   . LEU A 1 37 ? -15.149 -5.435  -5.496  1.00 0.00 ? 37 LEU A CB   1 
ATOM 590 C CG   . LEU A 1 37 ? -14.498 -4.710  -6.704  1.00 0.00 ? 37 LEU A CG   1 
ATOM 591 C CD1  . LEU A 1 37 ? -13.896 -3.346  -6.325  1.00 0.00 ? 37 LEU A CD1  1 
ATOM 592 C CD2  . LEU A 1 37 ? -13.411 -5.597  -7.328  1.00 0.00 ? 37 LEU A CD2  1 
ATOM 593 H H    . LEU A 1 37 ? -16.990 -4.922  -3.585  1.00 0.00 ? 37 LEU A H    1 
ATOM 594 H HA   . LEU A 1 37 ? -17.064 -5.475  -6.559  1.00 0.00 ? 37 LEU A HA   1 
ATOM 595 H HB2  . LEU A 1 37 ? -14.983 -4.813  -4.591  1.00 0.00 ? 37 LEU A HB2  1 
ATOM 596 H HB3  . LEU A 1 37 ? -14.579 -6.364  -5.300  1.00 0.00 ? 37 LEU A HB3  1 
ATOM 597 H HG   . LEU A 1 37 ? -15.282 -4.542  -7.471  1.00 0.00 ? 37 LEU A HG   1 
ATOM 598 H HD11 . LEU A 1 37 ? -14.621 -2.733  -5.758  1.00 0.00 ? 37 LEU A HD11 1 
ATOM 599 H HD12 . LEU A 1 37 ? -13.010 -3.452  -5.673  1.00 0.00 ? 37 LEU A HD12 1 
ATOM 600 H HD13 . LEU A 1 37 ? -13.593 -2.761  -7.212  1.00 0.00 ? 37 LEU A HD13 1 
ATOM 601 H HD21 . LEU A 1 37 ? -13.796 -6.605  -7.576  1.00 0.00 ? 37 LEU A HD21 1 
ATOM 602 H HD22 . LEU A 1 37 ? -13.001 -5.166  -8.261  1.00 0.00 ? 37 LEU A HD22 1 
ATOM 603 H HD23 . LEU A 1 37 ? -12.560 -5.747  -6.637  1.00 0.00 ? 37 LEU A HD23 1 
ATOM 604 N N    . GLU A 1 38 ? -18.064 -7.714  -5.179  1.00 0.00 ? 38 GLU A N    1 
ATOM 605 C CA   . GLU A 1 38 ? -18.438 -9.124  -5.254  1.00 0.00 ? 38 GLU A CA   1 
ATOM 606 C C    . GLU A 1 38 ? -19.824 -9.284  -5.834  1.00 0.00 ? 38 GLU A C    1 
ATOM 607 O O    . GLU A 1 38 ? -20.608 -10.146 -5.422  1.00 0.00 ? 38 GLU A O    1 
ATOM 608 C CB   . GLU A 1 38 ? -18.349 -9.735  -3.827  1.00 0.00 ? 38 GLU A CB   1 
ATOM 609 C CG   . GLU A 1 38 ? -16.987 -10.380 -3.407  1.00 0.00 ? 38 GLU A CG   1 
ATOM 610 C CD   . GLU A 1 38 ? -16.854 -11.903 -3.468  1.00 0.00 ? 38 GLU A CD   1 
ATOM 611 O OE1  . GLU A 1 38 ? -16.673 -12.515 -4.512  1.00 0.00 ? 38 GLU A OE1  1 
ATOM 612 O OE2  . GLU A 1 38 ? -16.956 -12.511 -2.253  1.00 0.00 ? 38 GLU A OE2  1 
ATOM 613 H H    . GLU A 1 38 ? -18.724 -6.986  -4.813  1.00 0.00 ? 38 GLU A H    1 
ATOM 614 H HA   . GLU A 1 38 ? -17.730 -9.645  -5.925  1.00 0.00 ? 38 GLU A HA   1 
ATOM 615 H HB2  . GLU A 1 38 ? -18.607 -8.952  -3.088  1.00 0.00 ? 38 GLU A HB2  1 
ATOM 616 H HB3  . GLU A 1 38 ? -19.153 -10.489 -3.714  1.00 0.00 ? 38 GLU A HB3  1 
ATOM 617 H HG2  . GLU A 1 38 ? -16.171 -9.964  -4.028  1.00 0.00 ? 38 GLU A HG2  1 
ATOM 618 H HG3  . GLU A 1 38 ? -16.723 -10.077 -2.376  1.00 0.00 ? 38 GLU A HG3  1 
ATOM 619 N N    . ALA A 1 39 ? -20.159 -8.430  -6.783  1.00 0.00 ? 39 ALA A N    1 
ATOM 620 C CA   . ALA A 1 39 ? -21.506 -8.383  -7.345  1.00 0.00 ? 39 ALA A CA   1 
ATOM 621 C C    . ALA A 1 39 ? -21.514 -7.655  -8.670  1.00 0.00 ? 39 ALA A C    1 
ATOM 622 O O    . ALA A 1 39 ? -21.991 -8.165  -9.690  1.00 0.00 ? 39 ALA A O    1 
ATOM 623 C CB   . ALA A 1 39 ? -22.426 -7.728  -6.300  1.00 0.00 ? 39 ALA A CB   1 
ATOM 624 H H    . ALA A 1 39 ? -19.400 -7.784  -7.110  1.00 0.00 ? 39 ALA A H    1 
ATOM 625 H HA   . ALA A 1 39 ? -21.845 -9.418  -7.538  1.00 0.00 ? 39 ALA A HA   1 
ATOM 626 H HB1  . ALA A 1 39 ? -22.437 -8.295  -5.350  1.00 0.00 ? 39 ALA A HB1  1 
ATOM 627 H HB2  . ALA A 1 39 ? -22.110 -6.695  -6.057  1.00 0.00 ? 39 ALA A HB2  1 
ATOM 628 H HB3  . ALA A 1 39 ? -23.473 -7.675  -6.649  1.00 0.00 ? 39 ALA A HB3  1 
ATOM 629 N N    . LEU A 1 40 ? -20.981 -6.448  -8.676  1.00 0.00 ? 40 LEU A N    1 
ATOM 630 C CA   . LEU A 1 40 ? -21.061 -5.571  -9.840  1.00 0.00 ? 40 LEU A CA   1 
ATOM 631 C C    . LEU A 1 40 ? -20.330 -6.168  -11.020 1.00 0.00 ? 40 LEU A C    1 
ATOM 632 O O    . LEU A 1 40 ? -20.922 -6.518  -12.048 1.00 0.00 ? 40 LEU A O    1 
ATOM 633 C CB   . LEU A 1 40 ? -20.504 -4.159  -9.500  1.00 0.00 ? 40 LEU A CB   1 
ATOM 634 C CG   . LEU A 1 40 ? -20.404 -3.116  -10.645 1.00 0.00 ? 40 LEU A CG   1 
ATOM 635 C CD1  . LEU A 1 40 ? -21.676 -2.264  -10.786 1.00 0.00 ? 40 LEU A CD1  1 
ATOM 636 C CD2  . LEU A 1 40 ? -19.191 -2.201  -10.423 1.00 0.00 ? 40 LEU A CD2  1 
ATOM 637 H H    . LEU A 1 40 ? -20.489 -6.158  -7.796  1.00 0.00 ? 40 LEU A H    1 
ATOM 638 H HA   . LEU A 1 40 ? -22.121 -5.486  -10.142 1.00 0.00 ? 40 LEU A HA   1 
ATOM 639 H HB2  . LEU A 1 40 ? -21.119 -3.721  -8.688  1.00 0.00 ? 40 LEU A HB2  1 
ATOM 640 H HB3  . LEU A 1 40 ? -19.498 -4.278  -9.051  1.00 0.00 ? 40 LEU A HB3  1 
ATOM 641 H HG   . LEU A 1 40 ? -20.246 -3.664  -11.598 1.00 0.00 ? 40 LEU A HG   1 
ATOM 642 H HD11 . LEU A 1 40 ? -22.581 -2.899  -10.820 1.00 0.00 ? 40 LEU A HD11 1 
ATOM 643 H HD12 . LEU A 1 40 ? -21.814 -1.582  -9.927  1.00 0.00 ? 40 LEU A HD12 1 
ATOM 644 H HD13 . LEU A 1 40 ? -21.671 -1.650  -11.705 1.00 0.00 ? 40 LEU A HD13 1 
ATOM 645 H HD21 . LEU A 1 40 ? -18.260 -2.781  -10.274 1.00 0.00 ? 40 LEU A HD21 1 
ATOM 646 H HD22 . LEU A 1 40 ? -19.018 -1.518  -11.276 1.00 0.00 ? 40 LEU A HD22 1 
ATOM 647 H HD23 . LEU A 1 40 ? -19.316 -1.571  -9.522  1.00 0.00 ? 40 LEU A HD23 1 
ATOM 648 N N    . LYS A 1 41 ? -19.025 -6.310  -10.884 1.00 0.00 ? 41 LYS A N    1 
ATOM 649 C CA   . LYS A 1 41 ? -18.165 -6.708  -11.995 1.00 0.00 ? 41 LYS A CA   1 
ATOM 650 C C    . LYS A 1 41 ? -18.000 -8.209  -12.054 1.00 0.00 ? 41 LYS A C    1 
ATOM 651 O O    . LYS A 1 41 ? -17.660 -8.781  -13.100 1.00 0.00 ? 41 LYS A O    1 
ATOM 652 C CB   . LYS A 1 41 ? -16.785 -6.006  -11.855 1.00 0.00 ? 41 LYS A CB   1 
ATOM 653 C CG   . LYS A 1 41 ? -15.833 -6.710  -10.858 1.00 0.00 ? 41 LYS A CG   1 
ATOM 654 C CD   . LYS A 1 41 ? -14.985 -5.766  -10.001 1.00 0.00 ? 41 LYS A CD   1 
ATOM 655 C CE   . LYS A 1 41 ? -13.927 -5.093  -10.885 1.00 0.00 ? 41 LYS A CE   1 
ATOM 656 N NZ   . LYS A 1 41 ? -12.672 -5.862  -10.819 1.00 0.00 ? 41 LYS A NZ   1 
ATOM 657 H H    . LYS A 1 41 ? -18.638 -6.109  -9.930  1.00 0.00 ? 41 LYS A H    1 
ATOM 658 H HA   . LYS A 1 41 ? -18.647 -6.392  -12.939 1.00 0.00 ? 41 LYS A HA   1 
ATOM 659 H HB2  . LYS A 1 41 ? -16.294 -5.949  -12.847 1.00 0.00 ? 41 LYS A HB2  1 
ATOM 660 H HB3  . LYS A 1 41 ? -16.935 -4.949  -11.551 1.00 0.00 ? 41 LYS A HB3  1 
ATOM 661 H HG2  . LYS A 1 41 ? -16.412 -7.336  -10.152 1.00 0.00 ? 41 LYS A HG2  1 
ATOM 662 H HG3  . LYS A 1 41 ? -15.176 -7.415  -11.406 1.00 0.00 ? 41 LYS A HG3  1 
ATOM 663 H HD2  . LYS A 1 41 ? -15.638 -5.018  -9.510  1.00 0.00 ? 41 LYS A HD2  1 
ATOM 664 H HD3  . LYS A 1 41 ? -14.496 -6.337  -9.185  1.00 0.00 ? 41 LYS A HD3  1 
ATOM 665 H HE2  . LYS A 1 41 ? -14.285 -5.024  -11.934 1.00 0.00 ? 41 LYS A HE2  1 
ATOM 666 H HE3  . LYS A 1 41 ? -13.740 -4.048  -10.561 1.00 0.00 ? 41 LYS A HE3  1 
ATOM 667 H HZ1  . LYS A 1 41 ? -12.798 -6.674  -10.198 1.00 0.00 ? 41 LYS A HZ1  1 
ATOM 668 H HZ2  . LYS A 1 41 ? -12.418 -6.188  -11.763 1.00 0.00 ? 41 LYS A HZ2  1 
ATOM 669 H HZ3  . LYS A 1 41 ? -11.920 -5.262  -10.450 1.00 0.00 ? 41 LYS A HZ3  1 
ATOM 670 N N    . GLU A 1 42 ? -18.200 -8.875  -10.932 1.00 0.00 ? 42 GLU A N    1 
ATOM 671 C CA   . GLU A 1 42 ? -18.249 -10.334 -10.899 1.00 0.00 ? 42 GLU A CA   1 
ATOM 672 C C    . GLU A 1 42 ? -16.916 -10.926 -11.294 1.00 0.00 ? 42 GLU A C    1 
ATOM 673 O O    . GLU A 1 42 ? -16.694 -11.327 -12.443 1.00 0.00 ? 42 GLU A O    1 
ATOM 674 C CB   . GLU A 1 42 ? -19.384 -10.815 -11.847 1.00 0.00 ? 42 GLU A CB   1 
ATOM 675 C CG   . GLU A 1 42 ? -20.836 -10.320 -11.536 1.00 0.00 ? 42 GLU A CG   1 
ATOM 676 C CD   . GLU A 1 42 ? -21.544 -10.877 -10.299 1.00 0.00 ? 42 GLU A CD   1 
ATOM 677 O OE1  . GLU A 1 42 ? -20.942 -11.345 -9.341  1.00 0.00 ? 42 GLU A OE1  1 
ATOM 678 O OE2  . GLU A 1 42 ? -22.902 -10.805 -10.365 1.00 0.00 ? 42 GLU A OE2  1 
ATOM 679 H H    . GLU A 1 42 ? -18.268 -8.292  -10.061 1.00 0.00 ? 42 GLU A H    1 
ATOM 680 H HA   . GLU A 1 42 ? -18.468 -10.663 -9.866  1.00 0.00 ? 42 GLU A HA   1 
ATOM 681 H HB2  . GLU A 1 42 ? -19.132 -10.523 -12.885 1.00 0.00 ? 42 GLU A HB2  1 
ATOM 682 H HB3  . GLU A 1 42 ? -19.380 -11.923 -11.870 1.00 0.00 ? 42 GLU A HB3  1 
ATOM 683 H HG2  . GLU A 1 42 ? -20.840 -9.218  -11.436 1.00 0.00 ? 42 GLU A HG2  1 
ATOM 684 H HG3  . GLU A 1 42 ? -21.499 -10.516 -12.399 1.00 0.00 ? 42 GLU A HG3  1 
ATOM 685 N N    . ASN A 1 43 ? -15.993 -10.961 -10.350 1.00 0.00 ? 43 ASN A N    1 
ATOM 686 C CA   . ASN A 1 43 ? -14.697 -11.600 -10.557 1.00 0.00 ? 43 ASN A CA   1 
ATOM 687 C C    . ASN A 1 43 ? -14.867 -13.007 -11.081 1.00 0.00 ? 43 ASN A C    1 
ATOM 688 O O    . ASN A 1 43 ? -14.205 -13.431 -12.036 1.00 0.00 ? 43 ASN A O    1 
ATOM 689 C CB   . ASN A 1 43 ? -13.898 -11.604 -9.221  1.00 0.00 ? 43 ASN A CB   1 
ATOM 690 C CG   . ASN A 1 43 ? -12.390 -11.861 -9.314  1.00 0.00 ? 43 ASN A CG   1 
ATOM 691 O OD1  . ASN A 1 43 ? -11.720 -11.484 -10.264 1.00 0.00 ? 43 ASN A OD1  1 
ATOM 692 N ND2  . ASN A 1 43 ? -11.802 -12.507 -8.344  1.00 0.00 ? 43 ASN A ND2  1 
ATOM 693 H H    . ASN A 1 43 ? -16.231 -10.460 -9.459  1.00 0.00 ? 43 ASN A H    1 
ATOM 694 H HA   . ASN A 1 43 ? -14.144 -11.030 -11.326 1.00 0.00 ? 43 ASN A HA   1 
ATOM 695 H HB2  . ASN A 1 43 ? -14.023 -10.627 -8.715  1.00 0.00 ? 43 ASN A HB2  1 
ATOM 696 H HB3  . ASN A 1 43 ? -14.331 -12.335 -8.515  1.00 0.00 ? 43 ASN A HB3  1 
ATOM 697 H HD21 . ASN A 1 43 ? -12.369 -12.740 -7.529  1.00 0.00 ? 43 ASN A HD21 1 
ATOM 698 H HD22 . ASN A 1 43 ? -10.786 -12.553 -8.463  1.00 0.00 ? 43 ASN A HD22 1 
ATOM 699 N N    . GLY A 1 44 ? -15.737 -13.767 -10.442 1.00 0.00 ? 44 GLY A N    1 
ATOM 700 C CA   . GLY A 1 44 ? -16.006 -15.144 -10.848 1.00 0.00 ? 44 GLY A CA   1 
ATOM 701 C C    . GLY A 1 44 ? -17.287 -15.232 -11.645 1.00 0.00 ? 44 GLY A C    1 
ATOM 702 O O    . GLY A 1 44 ? -17.413 -14.667 -12.738 1.00 0.00 ? 44 GLY A O    1 
ATOM 703 H H    . GLY A 1 44 ? -16.189 -13.340 -9.598  1.00 0.00 ? 44 GLY A H    1 
ATOM 704 H HA2  . GLY A 1 44 ? -15.171 -15.533 -11.459 1.00 0.00 ? 44 GLY A HA2  1 
ATOM 705 H HA3  . GLY A 1 44 ? -16.087 -15.796 -9.960  1.00 0.00 ? 44 GLY A HA3  1 
ATOM 706 N N    . GLY A 1 45 ? -18.248 -15.971 -11.124 1.00 0.00 ? 45 GLY A N    1 
ATOM 707 C CA   . GLY A 1 45 ? -19.551 -16.111 -11.768 1.00 0.00 ? 45 GLY A CA   1 
ATOM 708 C C    . GLY A 1 45 ? -19.627 -17.394 -12.563 1.00 0.00 ? 45 GLY A C    1 
ATOM 709 O O    . GLY A 1 45 ? -18.788 -18.292 -12.432 1.00 0.00 ? 45 GLY A O    1 
ATOM 710 H H    . GLY A 1 45 ? -18.009 -16.484 -10.241 1.00 0.00 ? 45 GLY A H    1 
ATOM 711 H HA2  . GLY A 1 45 ? -20.355 -16.106 -11.009 1.00 0.00 ? 45 GLY A HA2  1 
ATOM 712 H HA3  . GLY A 1 45 ? -19.739 -15.255 -12.442 1.00 0.00 ? 45 GLY A HA3  1 
ATOM 713 N N    . ALA A 1 46 ? -20.631 -17.494 -13.414 1.00 0.00 ? 46 ALA A N    1 
ATOM 714 C CA   . ALA A 1 46 ? -20.900 -18.725 -14.152 1.00 0.00 ? 46 ALA A CA   1 
ATOM 715 C C    . ALA A 1 46 ? -20.404 -18.623 -15.574 1.00 0.00 ? 46 ALA A C    1 
ATOM 716 O O    . ALA A 1 46 ? -21.093 -18.077 -16.490 1.00 0.00 ? 46 ALA A O    1 
ATOM 717 C CB   . ALA A 1 46 ? -22.412 -18.998 -14.066 1.00 0.00 ? 46 ALA A CB   1 
ATOM 718 O OXT  . ALA A 1 46 ? -19.257 -19.121 -15.801 1.00 0.00 ? 46 ALA A OXT  1 
ATOM 719 H H    . ALA A 1 46 ? -21.215 -16.633 -13.541 1.00 0.00 ? 46 ALA A H    1 
ATOM 720 H HA   . ALA A 1 46 ? -20.348 -19.553 -13.670 1.00 0.00 ? 46 ALA A HA   1 
ATOM 721 H HB1  . ALA A 1 46 ? -22.826 -18.743 -13.071 1.00 0.00 ? 46 ALA A HB1  1 
ATOM 722 H HB2  . ALA A 1 46 ? -22.979 -18.413 -14.814 1.00 0.00 ? 46 ALA A HB2  1 
ATOM 723 H HB3  . ALA A 1 46 ? -22.648 -20.063 -14.252 1.00 0.00 ? 46 ALA A HB3  1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  SER 1  1  1  SER SER A . n 
A 1 2  PRO 2  2  2  PRO PRO A . n 
A 1 3  LEU 3  3  3  LEU LEU A . n 
A 1 4  GLY 4  4  4  GLY GLY A . n 
A 1 5  GLU 5  5  5  GLU GLU A . n 
A 1 6  GLU 6  6  6  GLU GLU A . n 
A 1 7  MET 7  7  7  MET MET A . n 
A 1 8  ARG 8  8  8  ARG ARG A . n 
A 1 9  ASP 9  9  9  ASP ASP A . n 
A 1 10 ARG 10 10 10 ARG ARG A . n 
A 1 11 ALA 11 11 11 ALA ALA A . n 
A 1 12 ARG 12 12 12 ARG ARG A . n 
A 1 13 ALA 13 13 13 ALA ALA A . n 
A 1 14 HIS 14 14 14 HIS HIS A . n 
A 1 15 VAL 15 15 15 VAL VAL A . n 
A 1 16 ASP 16 16 16 ASP ASP A . n 
A 1 17 ALA 17 17 17 ALA ALA A . n 
A 1 18 LEU 18 18 18 LEU LEU A . n 
A 1 19 ARG 19 19 19 ARG ARG A . n 
A 1 20 THR 20 20 20 THR THR A . n 
A 1 21 HIS 21 21 21 HIS HIS A . n 
A 1 22 LEU 22 22 22 LEU LEU A . n 
A 1 23 ALA 23 23 23 ALA ALA A . n 
A 1 24 PRO 24 24 24 PRO PRO A . n 
A 1 25 TYR 25 25 25 TYR TYR A . n 
A 1 26 SER 26 26 26 SER SER A . n 
A 1 27 ASP 27 27 27 ASP ASP A . n 
A 1 28 GLU 28 28 28 GLU GLU A . n 
A 1 29 LEU 29 29 29 LEU LEU A . n 
A 1 30 ARG 30 30 30 ARG ARG A . n 
A 1 31 GLN 31 31 31 GLN GLN A . n 
A 1 32 ARG 32 32 32 ARG ARG A . n 
A 1 33 LEU 33 33 33 LEU LEU A . n 
A 1 34 ALA 34 34 34 ALA ALA A . n 
A 1 35 ALA 35 35 35 ALA ALA A . n 
A 1 36 ARG 36 36 36 ARG ARG A . n 
A 1 37 LEU 37 37 37 LEU LEU A . n 
A 1 38 GLU 38 38 38 GLU GLU A . n 
A 1 39 ALA 39 39 39 ALA ALA A . n 
A 1 40 LEU 40 40 40 LEU LEU A . n 
A 1 41 LYS 41 41 41 LYS LYS A . n 
A 1 42 GLU 42 42 42 GLU GLU A . n 
A 1 43 ASN 43 43 43 ASN ASN A . n 
A 1 44 GLY 44 44 44 GLY GLY A . n 
A 1 45 GLY 45 45 45 GLY GLY A . n 
A 1 46 ALA 46 46 46 ALA ALA A . n 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1997-07-23 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CD A GLU 5  ? ? OE2 A GLU 5  ? ? 1.362 1.252 0.110 0.011 N 
2 1 CD A GLU 6  ? ? OE2 A GLU 6  ? ? 1.362 1.252 0.110 0.011 N 
3 1 CD A GLU 28 ? ? OE1 A GLU 28 ? ? 1.362 1.252 0.110 0.011 N 
4 1 CD A GLU 38 ? ? OE2 A GLU 38 ? ? 1.362 1.252 0.110 0.011 N 
5 1 CD A GLU 42 ? ? OE2 A GLU 42 ? ? 1.362 1.252 0.110 0.011 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 NE A ARG 8  ? ? CZ A ARG 8  ? ? NH1 A ARG 8  ? ? 124.34 120.30 4.04  0.50 N 
2  1 CB A ASP 9  ? ? CG A ASP 9  ? ? OD1 A ASP 9  ? ? 112.81 118.30 -5.49 0.90 N 
3  1 NE A ARG 10 ? ? CZ A ARG 10 ? ? NH1 A ARG 10 ? ? 124.34 120.30 4.04  0.50 N 
4  1 NE A ARG 12 ? ? CZ A ARG 12 ? ? NH1 A ARG 12 ? ? 124.35 120.30 4.05  0.50 N 
5  1 CB A ASP 16 ? ? CG A ASP 16 ? ? OD1 A ASP 16 ? ? 112.78 118.30 -5.52 0.90 N 
6  1 NE A ARG 19 ? ? CZ A ARG 19 ? ? NH1 A ARG 19 ? ? 124.34 120.30 4.04  0.50 N 
7  1 CB A ASP 27 ? ? CG A ASP 27 ? ? OD1 A ASP 27 ? ? 112.79 118.30 -5.51 0.90 N 
8  1 NE A ARG 30 ? ? CZ A ARG 30 ? ? NH1 A ARG 30 ? ? 124.34 120.30 4.04  0.50 N 
9  1 NE A ARG 32 ? ? CZ A ARG 32 ? ? NH1 A ARG 32 ? ? 124.37 120.30 4.07  0.50 N 
10 1 NE A ARG 36 ? ? CZ A ARG 36 ? ? NH1 A ARG 36 ? ? 124.35 120.30 4.05  0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PRO A 2  ? ? -48.13  166.21 
2  1 GLU A 5  ? ? -178.22 70.89  
3  1 GLU A 6  ? ? -156.10 -42.21 
4  1 ARG A 12 ? ? -95.43  36.56  
5  1 ALA A 13 ? ? -133.55 -41.82 
6  1 LEU A 22 ? ? -143.38 51.92  
7  1 SER A 26 ? ? -144.75 -49.35 
8  1 LEU A 37 ? ? -94.33  37.37  
9  1 ALA A 39 ? ? -162.15 -53.38 
10 1 GLU A 42 ? ? 64.12   80.57  
#