data_1GXD
# 
_entry.id   1GXD 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.312 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1GXD         
PDBE  EBI-9625     
WWPDB D_1290009625 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1CK7 unspecified 'GELATINASE A (FULL-LENGTH)'                                                                  
PDB 1CXW unspecified 'THE SECOND TYPE II MODULE FROM HUMAN MATRIXMETALLOPROTEINASE 2'                              
PDB 1EAK unspecified 'CATALYTIC DOMAIN OF PROMMP-2 E404Q MUTANT'                                                   
PDB 1GEN unspecified 'C-TERMINAL DOMAIN OF GELATINASE A'                                                           
PDB 1J7M unspecified 'THE THIRD FIBRONECTIN TYPE II MODULE FROM HUMAN MATRIXMETALLOPROTEINASE 2'                   
PDB 1KS0 unspecified 'THE FIRST FIBRONECTIN TYPE II MODULE FROM HUMAN MATRIXMETALLOPROTEINASE 2'                   
PDB 1RTG unspecified 'C-TERMINAL DOMAIN (HAEMOPEXIN-LIKE DOMAIN) OF HUMAN MATRIXMETALLOPROTEINASE-2'               
PDB 1BR9 unspecified 'HUMAN TISSUE INHIBITOR OF METALLOPROTEINASE-2'                                               
PDB 2TMP unspecified 'N-TERMINAL DOMAIN OF TISSUE INHIBITOR OF METALLOPROTEINASE-2 (N-TIMP-2), NMR, 49 STRUCTURES' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1GXD 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2002-04-02 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Morgunova, E.'  1 
'Tuuttila, A.'   2 
'Bergmann, U.'   3 
'Tryggvason, K.' 4 
# 
_citation.id                        primary 
_citation.title                     
'Structural Insight Into the Complex Formation of Latent Matrix Metalloproteinase 2 with Tissue Inhibitor of Metalloproteinase 2' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            99 
_citation.page_first                7414 
_citation.page_last                 ? 
_citation.year                      2002 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12032297 
_citation.pdbx_database_id_DOI      10.1073/PNAS.102185399 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Morgunova, E.'  1 ? 
primary 'Tuuttila, A.'   2 ? 
primary 'Bergmann, U.'   3 ? 
primary 'Tryggvason, K.' 4 ? 
# 
_cell.entry_id           1GXD 
_cell.length_a           75.696 
_cell.length_b           374.575 
_cell.length_c           191.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1GXD 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man '72 KDA TYPE IV COLLAGENASE'    70995.406 2 3.4.24.24 YES ? ? 
2 polymer     man 'METALLOPROTEINASE INHIBITOR 2' 21783.039 2 ?         ?   ? ? 
3 non-polymer syn 'SULFATE ION'                   96.063    2 ?         ?   ? ? 
4 non-polymer syn 'ZINC ION'                      65.409    4 ?         ?   ? ? 
5 non-polymer syn 'CALCIUM ION'                   40.078    2 ?         ?   ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'GELATINASE A, 72 KDA GELATINASE, MATRIX METALLOPROTEINASE-2, MMP-2, TBE-1' 
2 'TISSUE INHIBITOR OF METALLOPROTEINASES-2, TIMP-2'                          
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;APSPIIKFPGDVAPKTDKELAVQYLNTFYGCPKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVAN
YNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDG
LLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDG
KYGFCPHEALFTMGGNAEGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPC
VFPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHAFGHAMGLEHSQDPGALMAPIYTYTK
NFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLV
ATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFW
RYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC
;
;APSPIIKFPGDVAPKTDKELAVQYLNTFYGCPKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVAN
YNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDG
LLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDG
KYGFCPHEALFTMGGNAEGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPC
VFPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHAFGHAMGLEHSQDPGALMAPIYTYTK
NFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLV
ATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFW
RYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC
;
A,B ? 
2 'polypeptide(L)' no no 
;CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGG
KKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGH
QAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP
;
;CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGG
KKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGH
QAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP
;
C,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   PRO n 
1 3   SER n 
1 4   PRO n 
1 5   ILE n 
1 6   ILE n 
1 7   LYS n 
1 8   PHE n 
1 9   PRO n 
1 10  GLY n 
1 11  ASP n 
1 12  VAL n 
1 13  ALA n 
1 14  PRO n 
1 15  LYS n 
1 16  THR n 
1 17  ASP n 
1 18  LYS n 
1 19  GLU n 
1 20  LEU n 
1 21  ALA n 
1 22  VAL n 
1 23  GLN n 
1 24  TYR n 
1 25  LEU n 
1 26  ASN n 
1 27  THR n 
1 28  PHE n 
1 29  TYR n 
1 30  GLY n 
1 31  CYS n 
1 32  PRO n 
1 33  LYS n 
1 34  GLU n 
1 35  SER n 
1 36  CYS n 
1 37  ASN n 
1 38  LEU n 
1 39  PHE n 
1 40  VAL n 
1 41  LEU n 
1 42  LYS n 
1 43  ASP n 
1 44  THR n 
1 45  LEU n 
1 46  LYS n 
1 47  LYS n 
1 48  MET n 
1 49  GLN n 
1 50  LYS n 
1 51  PHE n 
1 52  PHE n 
1 53  GLY n 
1 54  LEU n 
1 55  PRO n 
1 56  GLN n 
1 57  THR n 
1 58  GLY n 
1 59  ASP n 
1 60  LEU n 
1 61  ASP n 
1 62  GLN n 
1 63  ASN n 
1 64  THR n 
1 65  ILE n 
1 66  GLU n 
1 67  THR n 
1 68  MET n 
1 69  ARG n 
1 70  LYS n 
1 71  PRO n 
1 72  ARG n 
1 73  CYS n 
1 74  GLY n 
1 75  ASN n 
1 76  PRO n 
1 77  ASP n 
1 78  VAL n 
1 79  ALA n 
1 80  ASN n 
1 81  TYR n 
1 82  ASN n 
1 83  PHE n 
1 84  PHE n 
1 85  PRO n 
1 86  ARG n 
1 87  LYS n 
1 88  PRO n 
1 89  LYS n 
1 90  TRP n 
1 91  ASP n 
1 92  LYS n 
1 93  ASN n 
1 94  GLN n 
1 95  ILE n 
1 96  THR n 
1 97  TYR n 
1 98  ARG n 
1 99  ILE n 
1 100 ILE n 
1 101 GLY n 
1 102 TYR n 
1 103 THR n 
1 104 PRO n 
1 105 ASP n 
1 106 LEU n 
1 107 ASP n 
1 108 PRO n 
1 109 GLU n 
1 110 THR n 
1 111 VAL n 
1 112 ASP n 
1 113 ASP n 
1 114 ALA n 
1 115 PHE n 
1 116 ALA n 
1 117 ARG n 
1 118 ALA n 
1 119 PHE n 
1 120 GLN n 
1 121 VAL n 
1 122 TRP n 
1 123 SER n 
1 124 ASP n 
1 125 VAL n 
1 126 THR n 
1 127 PRO n 
1 128 LEU n 
1 129 ARG n 
1 130 PHE n 
1 131 SER n 
1 132 ARG n 
1 133 ILE n 
1 134 HIS n 
1 135 ASP n 
1 136 GLY n 
1 137 GLU n 
1 138 ALA n 
1 139 ASP n 
1 140 ILE n 
1 141 MET n 
1 142 ILE n 
1 143 ASN n 
1 144 PHE n 
1 145 GLY n 
1 146 ARG n 
1 147 TRP n 
1 148 GLU n 
1 149 HIS n 
1 150 GLY n 
1 151 ASP n 
1 152 GLY n 
1 153 TYR n 
1 154 PRO n 
1 155 PHE n 
1 156 ASP n 
1 157 GLY n 
1 158 LYS n 
1 159 ASP n 
1 160 GLY n 
1 161 LEU n 
1 162 LEU n 
1 163 ALA n 
1 164 HIS n 
1 165 ALA n 
1 166 PHE n 
1 167 ALA n 
1 168 PRO n 
1 169 GLY n 
1 170 THR n 
1 171 GLY n 
1 172 VAL n 
1 173 GLY n 
1 174 GLY n 
1 175 ASP n 
1 176 SER n 
1 177 HIS n 
1 178 PHE n 
1 179 ASP n 
1 180 ASP n 
1 181 ASP n 
1 182 GLU n 
1 183 LEU n 
1 184 TRP n 
1 185 THR n 
1 186 LEU n 
1 187 GLY n 
1 188 GLU n 
1 189 GLY n 
1 190 GLN n 
1 191 VAL n 
1 192 VAL n 
1 193 ARG n 
1 194 VAL n 
1 195 LYS n 
1 196 TYR n 
1 197 GLY n 
1 198 ASN n 
1 199 ALA n 
1 200 ASP n 
1 201 GLY n 
1 202 GLU n 
1 203 TYR n 
1 204 CYS n 
1 205 LYS n 
1 206 PHE n 
1 207 PRO n 
1 208 PHE n 
1 209 LEU n 
1 210 PHE n 
1 211 ASN n 
1 212 GLY n 
1 213 LYS n 
1 214 GLU n 
1 215 TYR n 
1 216 ASN n 
1 217 SER n 
1 218 CYS n 
1 219 THR n 
1 220 ASP n 
1 221 THR n 
1 222 GLY n 
1 223 ARG n 
1 224 SER n 
1 225 ASP n 
1 226 GLY n 
1 227 PHE n 
1 228 LEU n 
1 229 TRP n 
1 230 CYS n 
1 231 SER n 
1 232 THR n 
1 233 THR n 
1 234 TYR n 
1 235 ASN n 
1 236 PHE n 
1 237 GLU n 
1 238 LYS n 
1 239 ASP n 
1 240 GLY n 
1 241 LYS n 
1 242 TYR n 
1 243 GLY n 
1 244 PHE n 
1 245 CYS n 
1 246 PRO n 
1 247 HIS n 
1 248 GLU n 
1 249 ALA n 
1 250 LEU n 
1 251 PHE n 
1 252 THR n 
1 253 MET n 
1 254 GLY n 
1 255 GLY n 
1 256 ASN n 
1 257 ALA n 
1 258 GLU n 
1 259 GLY n 
1 260 GLN n 
1 261 PRO n 
1 262 CYS n 
1 263 LYS n 
1 264 PHE n 
1 265 PRO n 
1 266 PHE n 
1 267 ARG n 
1 268 PHE n 
1 269 GLN n 
1 270 GLY n 
1 271 THR n 
1 272 SER n 
1 273 TYR n 
1 274 ASP n 
1 275 SER n 
1 276 CYS n 
1 277 THR n 
1 278 THR n 
1 279 GLU n 
1 280 GLY n 
1 281 ARG n 
1 282 THR n 
1 283 ASP n 
1 284 GLY n 
1 285 TYR n 
1 286 ARG n 
1 287 TRP n 
1 288 CYS n 
1 289 GLY n 
1 290 THR n 
1 291 THR n 
1 292 GLU n 
1 293 ASP n 
1 294 TYR n 
1 295 ASP n 
1 296 ARG n 
1 297 ASP n 
1 298 LYS n 
1 299 LYS n 
1 300 TYR n 
1 301 GLY n 
1 302 PHE n 
1 303 CYS n 
1 304 PRO n 
1 305 GLU n 
1 306 THR n 
1 307 ALA n 
1 308 MET n 
1 309 SER n 
1 310 THR n 
1 311 VAL n 
1 312 GLY n 
1 313 GLY n 
1 314 ASN n 
1 315 SER n 
1 316 GLU n 
1 317 GLY n 
1 318 ALA n 
1 319 PRO n 
1 320 CYS n 
1 321 VAL n 
1 322 PHE n 
1 323 PRO n 
1 324 PHE n 
1 325 THR n 
1 326 PHE n 
1 327 LEU n 
1 328 GLY n 
1 329 ASN n 
1 330 LYS n 
1 331 TYR n 
1 332 GLU n 
1 333 SER n 
1 334 CYS n 
1 335 THR n 
1 336 SER n 
1 337 ALA n 
1 338 GLY n 
1 339 ARG n 
1 340 SER n 
1 341 ASP n 
1 342 GLY n 
1 343 LYS n 
1 344 MET n 
1 345 TRP n 
1 346 CYS n 
1 347 ALA n 
1 348 THR n 
1 349 THR n 
1 350 ALA n 
1 351 ASN n 
1 352 TYR n 
1 353 ASP n 
1 354 ASP n 
1 355 ASP n 
1 356 ARG n 
1 357 LYS n 
1 358 TRP n 
1 359 GLY n 
1 360 PHE n 
1 361 CYS n 
1 362 PRO n 
1 363 ASP n 
1 364 GLN n 
1 365 GLY n 
1 366 TYR n 
1 367 SER n 
1 368 LEU n 
1 369 PHE n 
1 370 LEU n 
1 371 VAL n 
1 372 ALA n 
1 373 ALA n 
1 374 HIS n 
1 375 ALA n 
1 376 PHE n 
1 377 GLY n 
1 378 HIS n 
1 379 ALA n 
1 380 MET n 
1 381 GLY n 
1 382 LEU n 
1 383 GLU n 
1 384 HIS n 
1 385 SER n 
1 386 GLN n 
1 387 ASP n 
1 388 PRO n 
1 389 GLY n 
1 390 ALA n 
1 391 LEU n 
1 392 MET n 
1 393 ALA n 
1 394 PRO n 
1 395 ILE n 
1 396 TYR n 
1 397 THR n 
1 398 TYR n 
1 399 THR n 
1 400 LYS n 
1 401 ASN n 
1 402 PHE n 
1 403 ARG n 
1 404 LEU n 
1 405 SER n 
1 406 GLN n 
1 407 ASP n 
1 408 ASP n 
1 409 ILE n 
1 410 LYS n 
1 411 GLY n 
1 412 ILE n 
1 413 GLN n 
1 414 GLU n 
1 415 LEU n 
1 416 TYR n 
1 417 GLY n 
1 418 ALA n 
1 419 SER n 
1 420 PRO n 
1 421 ASP n 
1 422 ILE n 
1 423 ASP n 
1 424 LEU n 
1 425 GLY n 
1 426 THR n 
1 427 GLY n 
1 428 PRO n 
1 429 THR n 
1 430 PRO n 
1 431 THR n 
1 432 LEU n 
1 433 GLY n 
1 434 PRO n 
1 435 VAL n 
1 436 THR n 
1 437 PRO n 
1 438 GLU n 
1 439 ILE n 
1 440 CYS n 
1 441 LYS n 
1 442 GLN n 
1 443 ASP n 
1 444 ILE n 
1 445 VAL n 
1 446 PHE n 
1 447 ASP n 
1 448 GLY n 
1 449 ILE n 
1 450 ALA n 
1 451 GLN n 
1 452 ILE n 
1 453 ARG n 
1 454 GLY n 
1 455 GLU n 
1 456 ILE n 
1 457 PHE n 
1 458 PHE n 
1 459 PHE n 
1 460 LYS n 
1 461 ASP n 
1 462 ARG n 
1 463 PHE n 
1 464 ILE n 
1 465 TRP n 
1 466 ARG n 
1 467 THR n 
1 468 VAL n 
1 469 THR n 
1 470 PRO n 
1 471 ARG n 
1 472 ASP n 
1 473 LYS n 
1 474 PRO n 
1 475 MET n 
1 476 GLY n 
1 477 PRO n 
1 478 LEU n 
1 479 LEU n 
1 480 VAL n 
1 481 ALA n 
1 482 THR n 
1 483 PHE n 
1 484 TRP n 
1 485 PRO n 
1 486 GLU n 
1 487 LEU n 
1 488 PRO n 
1 489 GLU n 
1 490 LYS n 
1 491 ILE n 
1 492 ASP n 
1 493 ALA n 
1 494 VAL n 
1 495 TYR n 
1 496 GLU n 
1 497 ALA n 
1 498 PRO n 
1 499 GLN n 
1 500 GLU n 
1 501 GLU n 
1 502 LYS n 
1 503 ALA n 
1 504 VAL n 
1 505 PHE n 
1 506 PHE n 
1 507 ALA n 
1 508 GLY n 
1 509 ASN n 
1 510 GLU n 
1 511 TYR n 
1 512 TRP n 
1 513 ILE n 
1 514 TYR n 
1 515 SER n 
1 516 ALA n 
1 517 SER n 
1 518 THR n 
1 519 LEU n 
1 520 GLU n 
1 521 ARG n 
1 522 GLY n 
1 523 TYR n 
1 524 PRO n 
1 525 LYS n 
1 526 PRO n 
1 527 LEU n 
1 528 THR n 
1 529 SER n 
1 530 LEU n 
1 531 GLY n 
1 532 LEU n 
1 533 PRO n 
1 534 PRO n 
1 535 ASP n 
1 536 VAL n 
1 537 GLN n 
1 538 ARG n 
1 539 VAL n 
1 540 ASP n 
1 541 ALA n 
1 542 ALA n 
1 543 PHE n 
1 544 ASN n 
1 545 TRP n 
1 546 SER n 
1 547 LYS n 
1 548 ASN n 
1 549 LYS n 
1 550 LYS n 
1 551 THR n 
1 552 TYR n 
1 553 ILE n 
1 554 PHE n 
1 555 ALA n 
1 556 GLY n 
1 557 ASP n 
1 558 LYS n 
1 559 PHE n 
1 560 TRP n 
1 561 ARG n 
1 562 TYR n 
1 563 ASN n 
1 564 GLU n 
1 565 VAL n 
1 566 LYS n 
1 567 LYS n 
1 568 LYS n 
1 569 MET n 
1 570 ASP n 
1 571 PRO n 
1 572 GLY n 
1 573 PHE n 
1 574 PRO n 
1 575 LYS n 
1 576 LEU n 
1 577 ILE n 
1 578 ALA n 
1 579 ASP n 
1 580 ALA n 
1 581 TRP n 
1 582 ASN n 
1 583 ALA n 
1 584 ILE n 
1 585 PRO n 
1 586 ASP n 
1 587 ASN n 
1 588 LEU n 
1 589 ASP n 
1 590 ALA n 
1 591 VAL n 
1 592 VAL n 
1 593 ASP n 
1 594 LEU n 
1 595 GLN n 
1 596 GLY n 
1 597 GLY n 
1 598 GLY n 
1 599 HIS n 
1 600 SER n 
1 601 TYR n 
1 602 PHE n 
1 603 PHE n 
1 604 LYS n 
1 605 GLY n 
1 606 ALA n 
1 607 TYR n 
1 608 TYR n 
1 609 LEU n 
1 610 LYS n 
1 611 LEU n 
1 612 GLU n 
1 613 ASN n 
1 614 GLN n 
1 615 SER n 
1 616 LEU n 
1 617 LYS n 
1 618 SER n 
1 619 VAL n 
1 620 LYS n 
1 621 PHE n 
1 622 GLY n 
1 623 SER n 
1 624 ILE n 
1 625 LYS n 
1 626 SER n 
1 627 ASP n 
1 628 TRP n 
1 629 LEU n 
1 630 GLY n 
1 631 CYS n 
2 1   CYS n 
2 2   SER n 
2 3   CYS n 
2 4   SER n 
2 5   PRO n 
2 6   VAL n 
2 7   HIS n 
2 8   PRO n 
2 9   GLN n 
2 10  GLN n 
2 11  ALA n 
2 12  PHE n 
2 13  CYS n 
2 14  ASN n 
2 15  ALA n 
2 16  ASP n 
2 17  VAL n 
2 18  VAL n 
2 19  ILE n 
2 20  ARG n 
2 21  ALA n 
2 22  LYS n 
2 23  ALA n 
2 24  VAL n 
2 25  SER n 
2 26  GLU n 
2 27  LYS n 
2 28  GLU n 
2 29  VAL n 
2 30  ASP n 
2 31  SER n 
2 32  GLY n 
2 33  ASN n 
2 34  ASP n 
2 35  ILE n 
2 36  TYR n 
2 37  GLY n 
2 38  ASN n 
2 39  PRO n 
2 40  ILE n 
2 41  LYS n 
2 42  ARG n 
2 43  ILE n 
2 44  GLN n 
2 45  TYR n 
2 46  GLU n 
2 47  ILE n 
2 48  LYS n 
2 49  GLN n 
2 50  ILE n 
2 51  LYS n 
2 52  MET n 
2 53  PHE n 
2 54  LYS n 
2 55  GLY n 
2 56  PRO n 
2 57  GLU n 
2 58  LYS n 
2 59  ASP n 
2 60  ILE n 
2 61  GLU n 
2 62  PHE n 
2 63  ILE n 
2 64  TYR n 
2 65  THR n 
2 66  ALA n 
2 67  PRO n 
2 68  SER n 
2 69  SER n 
2 70  ALA n 
2 71  VAL n 
2 72  CYS n 
2 73  GLY n 
2 74  VAL n 
2 75  SER n 
2 76  LEU n 
2 77  ASP n 
2 78  VAL n 
2 79  GLY n 
2 80  GLY n 
2 81  LYS n 
2 82  LYS n 
2 83  GLU n 
2 84  TYR n 
2 85  LEU n 
2 86  ILE n 
2 87  ALA n 
2 88  GLY n 
2 89  LYS n 
2 90  ALA n 
2 91  GLU n 
2 92  GLY n 
2 93  ASP n 
2 94  GLY n 
2 95  LYS n 
2 96  MET n 
2 97  HIS n 
2 98  ILE n 
2 99  THR n 
2 100 LEU n 
2 101 CYS n 
2 102 ASP n 
2 103 PHE n 
2 104 ILE n 
2 105 VAL n 
2 106 PRO n 
2 107 TRP n 
2 108 ASP n 
2 109 THR n 
2 110 LEU n 
2 111 SER n 
2 112 THR n 
2 113 THR n 
2 114 GLN n 
2 115 LYS n 
2 116 LYS n 
2 117 SER n 
2 118 LEU n 
2 119 ASN n 
2 120 HIS n 
2 121 ARG n 
2 122 TYR n 
2 123 GLN n 
2 124 MET n 
2 125 GLY n 
2 126 CYS n 
2 127 GLU n 
2 128 CYS n 
2 129 LYS n 
2 130 ILE n 
2 131 THR n 
2 132 ARG n 
2 133 CYS n 
2 134 PRO n 
2 135 MET n 
2 136 ILE n 
2 137 PRO n 
2 138 CYS n 
2 139 TYR n 
2 140 ILE n 
2 141 SER n 
2 142 SER n 
2 143 PRO n 
2 144 ASP n 
2 145 GLU n 
2 146 CYS n 
2 147 LEU n 
2 148 TRP n 
2 149 MET n 
2 150 ASP n 
2 151 TRP n 
2 152 VAL n 
2 153 THR n 
2 154 GLU n 
2 155 LYS n 
2 156 ASN n 
2 157 ILE n 
2 158 ASN n 
2 159 GLY n 
2 160 HIS n 
2 161 GLN n 
2 162 ALA n 
2 163 LYS n 
2 164 PHE n 
2 165 PHE n 
2 166 ALA n 
2 167 CYS n 
2 168 ILE n 
2 169 LYS n 
2 170 ARG n 
2 171 SER n 
2 172 ASP n 
2 173 GLY n 
2 174 SER n 
2 175 CYS n 
2 176 ALA n 
2 177 TRP n 
2 178 TYR n 
2 179 ARG n 
2 180 GLY n 
2 181 ALA n 
2 182 ALA n 
2 183 PRO n 
2 184 PRO n 
2 185 LYS n 
2 186 GLN n 
2 187 GLU n 
2 188 PHE n 
2 189 LEU n 
2 190 ASP n 
2 191 ILE n 
2 192 GLU n 
2 193 ASP n 
2 194 PRO n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? 'TRICHOPLUSIA NI' 7111 ? ? ? ? ? ? ? ? H5 ? ? ? ? ? 
BACULOVIRUS ?           ? ? PVL1393 ? ? 
2 1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? 'TRICHOPLUSIA NI' 7111 ? ? ? ? ? ? ? ? H5 ? ? ? ? ? ? 
BACULOVIRUS ? ? PVL1393 ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP MM02_HUMAN 1 ? ? P08253 ? 
2 UNP TIM2_HUMAN 2 ? ? P16035 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1GXD A 1 ? 631 ? P08253 30 ? 660 ? 1 631 
2 1 1GXD B 1 ? 631 ? P08253 30 ? 660 ? 1 631 
3 2 1GXD C 1 ? 194 ? P16035 27 ? 220 ? 1 194 
4 2 1GXD D 1 ? 194 ? P16035 27 ? 220 ? 1 194 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1GXD ALA A 375 ? UNP P08253 GLU 404 'engineered mutation' 375 1 
2 1GXD ALA B 375 ? UNP P08253 GLU 404 'engineered mutation' 375 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CA  non-polymer         . 'CALCIUM ION'   ? 'Ca 2'           40.078  
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'   ? 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
_exptl.entry_id          1GXD 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.7 
_exptl_crystal.density_percent_sol   67.5 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.50 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'pH 8.50' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   ? 
_diffrn_detector.pdbx_collection_date   1998-05-15 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.8342 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'EMBL/DESY, HAMBURG BEAMLINE BW7B' 
_diffrn_source.pdbx_synchrotron_site       'EMBL/DESY, HAMBURG' 
_diffrn_source.pdbx_synchrotron_beamline   BW7B 
_diffrn_source.pdbx_wavelength             0.8342 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     1GXD 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             12.900 
_reflns.d_resolution_high            3.100 
_reflns.number_obs                   46264 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         94.1 
_reflns.pdbx_Rmerge_I_obs            0.01100 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        10.0000 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              10.200 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 1GXD 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.ls_number_reflns_obs                     41759 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             8.00 
_refine.ls_d_res_high                            3.10 
_refine.ls_percent_reflns_obs                    100.0 
_refine.ls_R_factor_obs                          0.278 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.275 
_refine.ls_R_factor_R_free                       0.333 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.000 
_refine.ls_number_reflns_R_free                  2207 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.861 
_refine.correlation_coeff_Fo_to_Fc_free          0.783 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1CK7,1BR9 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  0.585 
_refine.overall_SU_ML                            0.508 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             27.950 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        12929 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         16 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               12945 
_refine_hist.d_res_high                       3.10 
_refine_hist.d_res_low                        8.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.008  0.021  ? 13344 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.360  1.943  ? 18092 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       3.154  3.000  ? 1623  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       20.697 15.000 ? 2324  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.097  0.200  ? 1820  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.003  0.020  ? 10416 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.332  0.300  ? 7373  'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.208  0.500  ? 1053  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          0.282  0.500  ? 18    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.417  0.300  ? 144   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.648  0.500  ? 9     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.339  1.500  ? 8105  'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcangle_it                 0.642  2.000  ? 13037 'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scbond_it                  0.731  3.000  ? 5239  'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scangle_it                 1.263  4.500  ? 5055  'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       3.10 
_refine_ls_shell.d_res_low                        3.17 
_refine_ls_shell.number_reflns_R_work             1943 
_refine_ls_shell.R_factor_R_work                  0.3410 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.4260 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             106 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1GXD 
_struct.title                     'proMMP-2/TIMP-2 complex' 
_struct.pdbx_descriptor           '72 KDA TYPE IV COLLAGENASE (E.C.3.4.24.24), METALLOPROTEINASE INHIBITOR 2' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1GXD 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
;HYDROLASE, METALLOPROTEASE, ZYMOGEN, COLLAGEN DEGRADATION, EXTRACELLULAR MATRIX, GELATINASE A, MATRIX METALLOPROTEINASE 2, PROTEINASE INHIBITOR
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 4 ? 
H N N 5 ? 
I N N 3 ? 
J N N 4 ? 
K N N 4 ? 
L N N 5 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 17  ? TYR A 24  ? ASP A 17  TYR A 24  1 ? 8  
HELX_P HELX_P2  2  THR A 44  ? PHE A 51  ? THR A 44  PHE A 51  1 ? 8  
HELX_P HELX_P3  3  ASP A 107 ? ASP A 124 ? ASP A 107 ASP A 124 1 ? 18 
HELX_P HELX_P4  4  TYR A 196 ? ASP A 200 ? TYR A 196 ASP A 200 5 ? 5  
HELX_P HELX_P5  5  ASN A 235 ? GLY A 240 ? ASN A 235 GLY A 240 1 ? 6  
HELX_P HELX_P6  6  ASP A 293 ? LYS A 298 ? ASP A 293 LYS A 298 1 ? 6  
HELX_P HELX_P7  7  ASN A 351 ? ARG A 356 ? ASN A 351 ARG A 356 1 ? 6  
HELX_P HELX_P8  8  LEU A 368 ? MET A 380 ? LEU A 368 MET A 380 1 ? 13 
HELX_P HELX_P9  9  SER A 405 ? TYR A 416 ? SER A 405 TYR A 416 1 ? 12 
HELX_P HELX_P10 10 ALA A 481 ? PHE A 483 ? ALA A 481 PHE A 483 5 ? 3  
HELX_P HELX_P11 11 ILE A 624 ? TRP A 628 ? ILE A 624 TRP A 628 1 ? 5  
HELX_P HELX_P12 12 THR B 16  ? THR B 27  ? THR B 16  THR B 27  1 ? 12 
HELX_P HELX_P13 13 ASN B 37  ? LYS B 42  ? ASN B 37  LYS B 42  1 ? 6  
HELX_P HELX_P14 14 LYS B 46  ? GLY B 53  ? LYS B 46  GLY B 53  1 ? 8  
HELX_P HELX_P15 15 LEU B 60  ? LYS B 70  ? LEU B 60  LYS B 70  1 ? 11 
HELX_P HELX_P16 16 ASP B 107 ? ASP B 124 ? ASP B 107 ASP B 124 1 ? 18 
HELX_P HELX_P17 17 ASN B 235 ? GLY B 240 ? ASN B 235 GLY B 240 1 ? 6  
HELX_P HELX_P18 18 ASP B 293 ? LYS B 298 ? ASP B 293 LYS B 298 1 ? 6  
HELX_P HELX_P19 19 ASN B 351 ? ARG B 356 ? ASN B 351 ARG B 356 1 ? 6  
HELX_P HELX_P20 20 LEU B 368 ? MET B 380 ? LEU B 368 MET B 380 1 ? 13 
HELX_P HELX_P21 21 SER B 405 ? GLY B 417 ? SER B 405 GLY B 417 1 ? 13 
HELX_P HELX_P22 22 LEU B 479 ? PHE B 483 ? LEU B 479 PHE B 483 5 ? 5  
HELX_P HELX_P23 23 LEU B 576 ? ALA B 580 ? LEU B 576 ALA B 580 5 ? 5  
HELX_P HELX_P24 24 ILE B 624 ? TRP B 628 ? ILE B 624 TRP B 628 1 ? 5  
HELX_P HELX_P25 25 HIS C 7   ? ALA C 15  ? HIS C 7   ALA C 15  1 ? 9  
HELX_P HELX_P26 26 SER C 68  ? GLY C 73  ? SER C 68  GLY C 73  1 ? 6  
HELX_P HELX_P27 27 SER C 111 ? SER C 117 ? SER C 111 SER C 117 1 ? 7  
HELX_P HELX_P28 28 ARG C 121 ? GLY C 125 ? ARG C 121 GLY C 125 5 ? 5  
HELX_P HELX_P29 29 MET C 149 ? GLU C 154 ? MET C 149 GLU C 154 1 ? 6  
HELX_P HELX_P30 30 GLY C 159 ? PHE C 164 ? GLY C 159 PHE C 164 1 ? 6  
HELX_P HELX_P31 31 HIS D 7   ? ALA D 15  ? HIS D 7   ALA D 15  1 ? 9  
HELX_P HELX_P32 32 SER D 68  ? CYS D 72  ? SER D 68  CYS D 72  5 ? 5  
HELX_P HELX_P33 33 ASP D 77  ? LYS D 81  ? ASP D 77  LYS D 81  5 ? 5  
HELX_P HELX_P34 34 SER D 111 ? LYS D 116 ? SER D 111 LYS D 116 1 ? 6  
HELX_P HELX_P35 35 TYR D 122 ? CYS D 126 ? TYR D 122 CYS D 126 5 ? 5  
HELX_P HELX_P36 36 MET D 149 ? THR D 153 ? MET D 149 THR D 153 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 31  SG ? ? ? 1_555 A CYS 36  SG  ? ? A CYS 31   A CYS 36  1_555 ? ? ? ? ? ? ? 2.033 ? 
disulf2  disulf ? ? A CYS 204 SG ? ? ? 1_555 A CYS 230 SG  ? ? A CYS 204  A CYS 230 1_555 ? ? ? ? ? ? ? 2.014 ? 
disulf3  disulf ? ? A CYS 218 SG ? ? ? 1_555 A CYS 245 SG  ? ? A CYS 218  A CYS 245 1_555 ? ? ? ? ? ? ? 2.033 ? 
disulf4  disulf ? ? A CYS 262 SG ? ? ? 1_555 A CYS 288 SG  ? ? A CYS 262  A CYS 288 1_555 ? ? ? ? ? ? ? 2.018 ? 
disulf5  disulf ? ? A CYS 276 SG ? ? ? 1_555 A CYS 303 SG  ? ? A CYS 276  A CYS 303 1_555 ? ? ? ? ? ? ? 2.059 ? 
disulf6  disulf ? ? A CYS 320 SG ? ? ? 1_555 A CYS 346 SG  ? ? A CYS 320  A CYS 346 1_555 ? ? ? ? ? ? ? 2.050 ? 
disulf7  disulf ? ? A CYS 334 SG ? ? ? 1_555 A CYS 361 SG  ? ? A CYS 334  A CYS 361 1_555 ? ? ? ? ? ? ? 2.024 ? 
disulf8  disulf ? ? A CYS 440 SG ? ? ? 1_555 A CYS 631 SG  ? ? A CYS 440  A CYS 631 1_555 ? ? ? ? ? ? ? 2.027 ? 
disulf9  disulf ? ? B CYS 31  SG ? ? ? 1_555 B CYS 36  SG  ? ? B CYS 31   B CYS 36  1_555 ? ? ? ? ? ? ? 2.034 ? 
disulf10 disulf ? ? B CYS 204 SG ? ? ? 1_555 B CYS 230 SG  ? ? B CYS 204  B CYS 230 1_555 ? ? ? ? ? ? ? 2.039 ? 
disulf11 disulf ? ? B CYS 218 SG ? ? ? 1_555 B CYS 245 SG  ? ? B CYS 218  B CYS 245 1_555 ? ? ? ? ? ? ? 2.022 ? 
disulf12 disulf ? ? B CYS 262 SG ? ? ? 1_555 B CYS 288 SG  ? ? B CYS 262  B CYS 288 1_555 ? ? ? ? ? ? ? 2.017 ? 
disulf13 disulf ? ? B CYS 276 SG ? ? ? 1_555 B CYS 303 SG  ? ? B CYS 276  B CYS 303 1_555 ? ? ? ? ? ? ? 2.048 ? 
disulf14 disulf ? ? B CYS 320 SG ? ? ? 1_555 B CYS 346 SG  ? ? B CYS 320  B CYS 346 1_555 ? ? ? ? ? ? ? 2.028 ? 
disulf15 disulf ? ? B CYS 334 SG ? ? ? 1_555 B CYS 361 SG  ? ? B CYS 334  B CYS 361 1_555 ? ? ? ? ? ? ? 2.043 ? 
disulf16 disulf ? ? B CYS 440 SG ? ? ? 1_555 B CYS 631 SG  ? ? B CYS 440  B CYS 631 1_555 ? ? ? ? ? ? ? 2.037 ? 
disulf17 disulf ? ? C CYS 1   SG ? ? ? 1_555 C CYS 72  SG  ? ? C CYS 1    C CYS 72  1_555 ? ? ? ? ? ? ? 2.040 ? 
disulf18 disulf ? ? C CYS 3   SG ? ? ? 1_555 C CYS 101 SG  ? ? C CYS 3    C CYS 101 1_555 ? ? ? ? ? ? ? 2.022 ? 
disulf19 disulf ? ? C CYS 13  SG ? ? ? 1_555 C CYS 126 SG  ? ? C CYS 13   C CYS 126 1_555 ? ? ? ? ? ? ? 2.033 ? 
disulf20 disulf ? ? C CYS 128 SG ? ? ? 1_555 C CYS 175 SG  ? ? C CYS 128  C CYS 175 1_555 ? ? ? ? ? ? ? 2.028 ? 
disulf21 disulf ? ? C CYS 133 SG ? ? ? 1_555 C CYS 138 SG  ? ? C CYS 133  C CYS 138 1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf22 disulf ? ? C CYS 146 SG ? ? ? 1_555 C CYS 167 SG  ? ? C CYS 146  C CYS 167 1_555 ? ? ? ? ? ? ? 2.030 ? 
disulf23 disulf ? ? D CYS 1   SG ? ? ? 1_555 D CYS 72  SG  ? ? D CYS 1    D CYS 72  1_555 ? ? ? ? ? ? ? 2.033 ? 
disulf24 disulf ? ? D CYS 3   SG ? ? ? 1_555 D CYS 101 SG  ? ? D CYS 3    D CYS 101 1_555 ? ? ? ? ? ? ? 2.028 ? 
disulf25 disulf ? ? D CYS 13  SG ? ? ? 1_555 D CYS 126 SG  ? ? D CYS 13   D CYS 126 1_555 ? ? ? ? ? ? ? 2.033 ? 
disulf26 disulf ? ? D CYS 128 SG ? ? ? 1_555 D CYS 167 SG  ? ? D CYS 128  D CYS 167 1_555 ? ? ? ? ? ? ? 2.446 ? 
disulf27 disulf ? ? D CYS 128 SG ? ? ? 1_555 D CYS 175 SG  ? ? D CYS 128  D CYS 175 1_555 ? ? ? ? ? ? ? 2.025 ? 
disulf28 disulf ? ? D CYS 133 SG ? ? ? 1_555 D CYS 138 SG  ? ? D CYS 133  D CYS 138 1_555 ? ? ? ? ? ? ? 2.028 ? 
disulf29 disulf ? ? D CYS 146 SG ? ? ? 1_555 D CYS 167 SG  ? ? D CYS 146  D CYS 167 1_555 ? ? ? ? ? ? ? 2.029 ? 
metalc1  metalc ? ? F ZN  .   ZN ? ? ? 1_555 A HIS 177 ND1 ? ? A ZN  1633 A HIS 177 1_555 ? ? ? ? ? ? ? 1.805 ? 
metalc2  metalc ? ? F ZN  .   ZN ? ? ? 1_555 A HIS 149 NE2 ? ? A ZN  1633 A HIS 149 1_555 ? ? ? ? ? ? ? 1.751 ? 
metalc3  metalc ? ? F ZN  .   ZN ? ? ? 1_555 A HIS 164 NE2 ? ? A ZN  1633 A HIS 164 1_555 ? ? ? ? ? ? ? 1.947 ? 
metalc4  metalc ? ? F ZN  .   ZN ? ? ? 1_555 A ASP 151 OD2 ? ? A ZN  1633 A ASP 151 1_555 ? ? ? ? ? ? ? 1.624 ? 
metalc5  metalc ? ? G ZN  .   ZN ? ? ? 1_555 A HIS 374 NE2 ? ? A ZN  1634 A HIS 374 1_555 ? ? ? ? ? ? ? 1.756 ? 
metalc6  metalc ? ? G ZN  .   ZN ? ? ? 1_555 A HIS 378 NE2 ? ? A ZN  1634 A HIS 378 1_555 ? ? ? ? ? ? ? 1.776 ? 
metalc7  metalc ? ? G ZN  .   ZN ? ? ? 1_555 A HIS 384 NE2 ? ? A ZN  1634 A HIS 384 1_555 ? ? ? ? ? ? ? 1.953 ? 
metalc8  metalc ? ? G ZN  .   ZN ? ? ? 1_555 A CYS 73  SG  ? ? A ZN  1634 A CYS 73  1_555 ? ? ? ? ? ? ? 1.932 ? 
metalc9  metalc ? ? H CA  .   CA ? ? ? 1_555 A LEU 161 O   ? ? A CA  1635 A LEU 161 1_555 ? ? ? ? ? ? ? 2.456 ? 
metalc10 metalc ? ? H CA  .   CA ? ? ? 1_555 A ASP 159 O   ? ? A CA  1635 A ASP 159 1_555 ? ? ? ? ? ? ? 2.185 ? 
metalc11 metalc ? ? H CA  .   CA ? ? ? 1_555 A GLY 157 O   ? ? A CA  1635 A GLY 157 1_555 ? ? ? ? ? ? ? 2.627 ? 
metalc12 metalc ? ? H CA  .   CA ? ? ? 1_555 A ASP 156 O   ? ? A CA  1635 A ASP 156 1_555 ? ? ? ? ? ? ? 2.812 ? 
metalc13 metalc ? ? H CA  .   CA ? ? ? 1_555 A ASP 179 OD2 ? ? A CA  1635 A ASP 179 1_555 ? ? ? ? ? ? ? 2.503 ? 
metalc14 metalc ? ? H CA  .   CA ? ? ? 1_555 A GLU 182 OE2 ? ? A CA  1635 A GLU 182 1_555 ? ? ? ? ? ? ? 2.298 ? 
metalc15 metalc ? ? H CA  .   CA ? ? ? 1_555 A ASP 156 OD1 ? ? A CA  1635 A ASP 156 1_555 ? ? ? ? ? ? ? 3.001 ? 
metalc16 metalc ? ? J ZN  .   ZN ? ? ? 1_555 B HIS 149 NE2 ? ? B ZN  1633 B HIS 149 1_555 ? ? ? ? ? ? ? 1.613 ? 
metalc17 metalc ? ? J ZN  .   ZN ? ? ? 1_555 B ASP 151 OD1 ? ? B ZN  1633 B ASP 151 1_555 ? ? ? ? ? ? ? 2.697 ? 
metalc18 metalc ? ? J ZN  .   ZN ? ? ? 1_555 B HIS 164 NE2 ? ? B ZN  1633 B HIS 164 1_555 ? ? ? ? ? ? ? 1.713 ? 
metalc19 metalc ? ? J ZN  .   ZN ? ? ? 1_555 B HIS 177 ND1 ? ? B ZN  1633 B HIS 177 1_555 ? ? ? ? ? ? ? 1.859 ? 
metalc20 metalc ? ? J ZN  .   ZN ? ? ? 1_555 B ASP 151 OD2 ? ? B ZN  1633 B ASP 151 1_555 ? ? ? ? ? ? ? 1.492 ? 
metalc21 metalc ? ? K ZN  .   ZN ? ? ? 1_555 B HIS 384 NE2 ? ? B ZN  1634 B HIS 384 1_555 ? ? ? ? ? ? ? 1.705 ? 
metalc22 metalc ? ? K ZN  .   ZN ? ? ? 1_555 B HIS 374 NE2 ? ? B ZN  1634 B HIS 374 1_555 ? ? ? ? ? ? ? 1.821 ? 
metalc23 metalc ? ? K ZN  .   ZN ? ? ? 1_555 B HIS 378 NE2 ? ? B ZN  1634 B HIS 378 1_555 ? ? ? ? ? ? ? 1.930 ? 
metalc24 metalc ? ? K ZN  .   ZN ? ? ? 1_555 B CYS 73  SG  ? ? B ZN  1634 B CYS 73  1_555 ? ? ? ? ? ? ? 1.842 ? 
metalc25 metalc ? ? L CA  .   CA ? ? ? 1_555 B ASP 159 O   ? ? B CA  1635 B ASP 159 1_555 ? ? ? ? ? ? ? 2.380 ? 
metalc26 metalc ? ? L CA  .   CA ? ? ? 1_555 B GLY 157 O   ? ? B CA  1635 B GLY 157 1_555 ? ? ? ? ? ? ? 2.252 ? 
metalc27 metalc ? ? L CA  .   CA ? ? ? 1_555 B ASP 179 OD2 ? ? B CA  1635 B ASP 179 1_555 ? ? ? ? ? ? ? 2.531 ? 
metalc28 metalc ? ? L CA  .   CA ? ? ? 1_555 B LEU 161 O   ? ? B CA  1635 B LEU 161 1_555 ? ? ? ? ? ? ? 2.467 ? 
metalc29 metalc ? ? L CA  .   CA ? ? ? 1_555 B GLU 182 OE2 ? ? B CA  1635 B GLU 182 1_555 ? ? ? ? ? ? ? 2.705 ? 
metalc30 metalc ? ? L CA  .   CA ? ? ? 1_555 B ASP 156 OD1 ? ? B CA  1635 B ASP 156 1_555 ? ? ? ? ? ? ? 2.529 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  PHE 206 A . ? PHE 206 A PRO 207 A ? PRO 207 A 1 -3.08 
2  PHE 264 A . ? PHE 264 A PRO 265 A ? PRO 265 A 1 1.31  
3  PHE 322 A . ? PHE 322 A PRO 323 A ? PRO 323 A 1 -1.38 
4  GLY 476 A . ? GLY 476 A PRO 477 A ? PRO 477 A 1 1.37  
5  TYR 523 A . ? TYR 523 A PRO 524 A ? PRO 524 A 1 9.50  
6  PHE 573 A . ? PHE 573 A PRO 574 A ? PRO 574 A 1 12.97 
7  PHE 206 B . ? PHE 206 B PRO 207 B ? PRO 207 B 1 1.68  
8  PHE 264 B . ? PHE 264 B PRO 265 B ? PRO 265 B 1 0.94  
9  PHE 322 B . ? PHE 322 B PRO 323 B ? PRO 323 B 1 -3.12 
10 GLY 476 B . ? GLY 476 B PRO 477 B ? PRO 477 B 1 -0.84 
11 TYR 523 B . ? TYR 523 B PRO 524 B ? PRO 524 B 1 6.72  
12 PHE 573 B . ? PHE 573 B PRO 574 B ? PRO 574 B 1 16.58 
13 ILE 136 C . ? ILE 136 C PRO 137 C ? PRO 137 C 1 7.90  
14 ILE 136 D . ? ILE 136 D PRO 137 D ? PRO 137 D 1 -7.07 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 5 ? 
AB ? 2 ? 
AC ? 2 ? 
AD ? 2 ? 
AE ? 2 ? 
AF ? 2 ? 
AG ? 2 ? 
AH ? 2 ? 
AI ? 2 ? 
AJ ? 2 ? 
AK ? 4 ? 
AL ? 4 ? 
AM ? 4 ? 
AN ? 4 ? 
BA ? 5 ? 
BB ? 2 ? 
BC ? 2 ? 
BD ? 2 ? 
BE ? 2 ? 
BF ? 2 ? 
BG ? 2 ? 
BH ? 2 ? 
BI ? 3 ? 
BJ ? 4 ? 
BK ? 4 ? 
BL ? 2 ? 
BM ? 4 ? 
CA ? 2 ? 
CB ? 5 ? 
CC ? 2 ? 
CD ? 2 ? 
DA ? 3 ? 
DB ? 6 ? 
DC ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? parallel      
AA 2 3 ? parallel      
AA 3 4 ? parallel      
AA 4 5 ? anti-parallel 
AB 1 2 ? parallel      
AC 1 2 ? anti-parallel 
AD 1 2 ? anti-parallel 
AE 1 2 ? anti-parallel 
AF 1 2 ? anti-parallel 
AG 1 2 ? anti-parallel 
AH 1 2 ? anti-parallel 
AI 1 2 ? anti-parallel 
AJ 1 2 ? anti-parallel 
AK 1 2 ? anti-parallel 
AK 2 3 ? anti-parallel 
AK 3 4 ? anti-parallel 
AL 1 2 ? anti-parallel 
AL 2 3 ? anti-parallel 
AL 3 4 ? anti-parallel 
AM 1 2 ? anti-parallel 
AM 2 3 ? anti-parallel 
AM 3 4 ? anti-parallel 
AN 1 2 ? anti-parallel 
AN 2 3 ? anti-parallel 
AN 3 4 ? anti-parallel 
BA 1 2 ? parallel      
BA 2 3 ? parallel      
BA 3 4 ? parallel      
BA 4 5 ? anti-parallel 
BB 1 2 ? parallel      
BC 1 2 ? anti-parallel 
BD 1 2 ? anti-parallel 
BE 1 2 ? anti-parallel 
BF 1 2 ? anti-parallel 
BG 1 2 ? anti-parallel 
BH 1 2 ? anti-parallel 
BI 1 2 ? anti-parallel 
BI 2 3 ? anti-parallel 
BJ 1 2 ? anti-parallel 
BJ 2 3 ? anti-parallel 
BJ 3 4 ? anti-parallel 
BK 1 2 ? anti-parallel 
BK 2 3 ? anti-parallel 
BK 3 4 ? anti-parallel 
BL 1 2 ? anti-parallel 
BM 1 2 ? anti-parallel 
BM 2 3 ? anti-parallel 
BM 3 4 ? anti-parallel 
CA 1 2 ? anti-parallel 
CB 1 2 ? anti-parallel 
CB 2 3 ? anti-parallel 
CB 3 4 ? parallel      
CB 4 5 ? anti-parallel 
CC 1 2 ? parallel      
CD 1 2 ? anti-parallel 
DA 1 2 ? anti-parallel 
DA 2 3 ? anti-parallel 
DB 1 2 ? anti-parallel 
DB 2 3 ? anti-parallel 
DB 3 4 ? parallel      
DB 4 5 ? anti-parallel 
DB 5 6 ? anti-parallel 
DC 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 ARG A 129 ? ARG A 132 ? ARG A 129 ARG A 132 
AA 2 GLN A 94  ? ILE A 99  ? GLN A 94  ILE A 99  
AA 3 MET A 141 ? GLY A 145 ? MET A 141 GLY A 145 
AA 4 SER A 176 ? ASP A 179 ? SER A 176 ASP A 179 
AA 5 ALA A 163 ? ALA A 165 ? ALA A 163 ALA A 165 
AB 1 TRP A 184 ? THR A 185 ? TRP A 184 THR A 185 
AB 2 TYR A 366 ? SER A 367 ? TYR A 366 SER A 367 
AC 1 PHE A 208 ? PHE A 210 ? PHE A 208 PHE A 210 
AC 2 LYS A 213 ? TYR A 215 ? LYS A 213 TYR A 215 
AD 1 TRP A 229 ? SER A 231 ? TRP A 229 SER A 231 
AD 2 TYR A 242 ? PHE A 244 ? TYR A 242 PHE A 244 
AE 1 PHE A 266 ? ARG A 267 ? PHE A 266 ARG A 267 
AE 2 SER A 272 ? TYR A 273 ? SER A 272 TYR A 273 
AF 1 TRP A 287 ? GLY A 289 ? TRP A 287 GLY A 289 
AF 2 TYR A 300 ? PHE A 302 ? TYR A 300 PHE A 302 
AG 1 PHE A 324 ? PHE A 326 ? PHE A 324 PHE A 326 
AG 2 ASN A 329 ? TYR A 331 ? ASN A 329 TYR A 331 
AH 1 TRP A 345 ? ALA A 347 ? TRP A 345 ALA A 347 
AH 2 TRP A 358 ? PHE A 360 ? TRP A 358 PHE A 360 
AI 1 ILE A 449 ? GLN A 451 ? ILE A 449 GLN A 451 
AI 2 ILE A 456 ? PHE A 458 ? ILE A 456 PHE A 458 
AJ 1 PHE A 463 ? ILE A 464 ? PHE A 463 ILE A 464 
AJ 2 LEU A 478 ? LEU A 479 ? LEU A 478 LEU A 479 
AK 1 VAL A 494 ? GLU A 496 ? VAL A 494 GLU A 496 
AK 2 ALA A 503 ? ALA A 507 ? ALA A 503 ALA A 507 
AK 3 GLU A 510 ? SER A 515 ? GLU A 510 SER A 515 
AK 4 LYS A 525 ? PRO A 526 ? LYS A 525 PRO A 526 
AL 1 VAL A 494 ? GLU A 496 ? VAL A 494 GLU A 496 
AL 2 ALA A 503 ? ALA A 507 ? ALA A 503 ALA A 507 
AL 3 GLU A 510 ? SER A 515 ? GLU A 510 SER A 515 
AL 4 THR A 518 ? LEU A 519 ? THR A 518 LEU A 519 
AM 1 ALA A 541 ? ASN A 544 ? ALA A 541 ASN A 544 
AM 2 THR A 551 ? ALA A 555 ? THR A 551 ALA A 555 
AM 3 LYS A 558 ? PHE A 559 ? LYS A 558 PHE A 559 
AM 4 LYS A 575 ? LEU A 576 ? LYS A 575 LEU A 576 
AN 1 ALA A 590 ? ASP A 593 ? ALA A 590 ASP A 593 
AN 2 SER A 600 ? LYS A 604 ? SER A 600 LYS A 604 
AN 3 TYR A 607 ? LEU A 609 ? TYR A 607 LEU A 609 
AN 4 PHE A 621 ? SER A 623 ? PHE A 621 SER A 623 
BA 1 ARG B 129 ? ARG B 132 ? ARG B 129 ARG B 132 
BA 2 GLN B 94  ? ILE B 99  ? GLN B 94  ILE B 99  
BA 3 ILE B 140 ? GLY B 145 ? ILE B 140 GLY B 145 
BA 4 SER B 176 ? ASP B 179 ? SER B 176 ASP B 179 
BA 5 ALA B 163 ? ALA B 165 ? ALA B 163 ALA B 165 
BB 1 TRP B 184 ? THR B 185 ? TRP B 184 THR B 185 
BB 2 TYR B 366 ? SER B 367 ? TYR B 366 SER B 367 
BC 1 PHE B 208 ? PHE B 210 ? PHE B 208 PHE B 210 
BC 2 LYS B 213 ? TYR B 215 ? LYS B 213 TYR B 215 
BD 1 TRP B 229 ? SER B 231 ? TRP B 229 SER B 231 
BD 2 TYR B 242 ? PHE B 244 ? TYR B 242 PHE B 244 
BE 1 PHE B 266 ? ARG B 267 ? PHE B 266 ARG B 267 
BE 2 SER B 272 ? TYR B 273 ? SER B 272 TYR B 273 
BF 1 TRP B 287 ? GLY B 289 ? TRP B 287 GLY B 289 
BF 2 TYR B 300 ? PHE B 302 ? TYR B 300 PHE B 302 
BG 1 PHE B 324 ? PHE B 326 ? PHE B 324 PHE B 326 
BG 2 ASN B 329 ? TYR B 331 ? ASN B 329 TYR B 331 
BH 1 TRP B 345 ? ALA B 347 ? TRP B 345 ALA B 347 
BH 2 TRP B 358 ? PHE B 360 ? TRP B 358 PHE B 360 
BI 1 ILE B 449 ? ILE B 452 ? ILE B 449 ILE B 452 
BI 2 GLU B 455 ? LYS B 460 ? GLU B 455 LYS B 460 
BI 3 PHE B 463 ? THR B 467 ? PHE B 463 THR B 467 
BJ 1 ALA B 493 ? GLU B 496 ? ALA B 493 GLU B 496 
BJ 2 ALA B 503 ? ALA B 507 ? ALA B 503 ALA B 507 
BJ 3 GLU B 510 ? SER B 515 ? GLU B 510 SER B 515 
BJ 4 LYS B 525 ? PRO B 526 ? LYS B 525 PRO B 526 
BK 1 ALA B 493 ? GLU B 496 ? ALA B 493 GLU B 496 
BK 2 ALA B 503 ? ALA B 507 ? ALA B 503 ALA B 507 
BK 3 GLU B 510 ? SER B 515 ? GLU B 510 SER B 515 
BK 4 THR B 518 ? LEU B 519 ? THR B 518 LEU B 519 
BL 1 THR B 551 ? PHE B 554 ? THR B 551 PHE B 554 
BL 2 PHE B 559 ? TYR B 562 ? PHE B 559 TYR B 562 
BM 1 ALA B 590 ? VAL B 591 ? ALA B 590 VAL B 591 
BM 2 HIS B 599 ? LYS B 604 ? HIS B 599 LYS B 604 
BM 3 TYR B 607 ? GLU B 612 ? TYR B 607 GLU B 612 
BM 4 PHE B 621 ? SER B 623 ? PHE B 621 SER B 623 
CA 1 VAL C 17  ? ILE C 19  ? VAL C 17  ILE C 19  
CA 2 MET C 52  ? LYS C 54  ? MET C 52  LYS C 54  
CB 1 ALA C 23  ? GLU C 26  ? ALA C 23  GLU C 26  
CB 2 ILE C 43  ? ILE C 47  ? ILE C 43  ILE C 47  
CB 3 PHE C 62  ? THR C 65  ? PHE C 62  THR C 65  
CB 4 LYS C 95  ? HIS C 97  ? LYS C 95  HIS C 97  
CB 5 LYS C 89  ? GLU C 91  ? LYS C 89  GLU C 91  
CC 1 THR C 131 ? ARG C 132 ? THR C 131 ARG C 132 
CC 2 LEU C 147 ? TRP C 148 ? LEU C 147 TRP C 148 
CD 1 ILE C 168 ? LYS C 169 ? ILE C 168 LYS C 169 
CD 2 CYS C 175 ? ALA C 176 ? CYS C 175 ALA C 176 
DA 1 VAL D 17  ? ALA D 21  ? VAL D 17  ALA D 21  
DA 2 TYR D 84  ? ALA D 90  ? TYR D 84  ALA D 90  
DA 3 VAL D 105 ? PRO D 106 ? VAL D 105 PRO D 106 
DB 1 VAL D 17  ? ALA D 21  ? VAL D 17  ALA D 21  
DB 2 TYR D 84  ? ALA D 90  ? TYR D 84  ALA D 90  
DB 3 LYS D 95  ? HIS D 97  ? LYS D 95  HIS D 97  
DB 4 PHE D 62  ? THR D 65  ? PHE D 62  THR D 65  
DB 5 ASN D 38  ? GLU D 46  ? ASN D 38  GLU D 46  
DB 6 GLU D 26  ? ASP D 34  ? GLU D 26  ASP D 34  
DC 1 ILE D 168 ? LYS D 169 ? ILE D 168 LYS D 169 
DC 2 CYS D 175 ? ALA D 176 ? CYS D 175 ALA D 176 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N SER A 131 ? N SER A 131 O ILE A 95  ? O ILE A 95  
AA 2 3 O ARG A 98  ? O ARG A 98  N ILE A 142 ? N ILE A 142 
AA 3 4 N ASN A 143 ? N ASN A 143 O SER A 176 ? O SER A 176 
AA 4 5 N HIS A 177 ? N HIS A 177 O HIS A 164 ? O HIS A 164 
AB 1 2 N THR A 185 ? N THR A 185 O TYR A 366 ? O TYR A 366 
AC 1 2 N PHE A 210 ? N PHE A 210 O LYS A 213 ? O LYS A 213 
AD 1 2 N CYS A 230 ? N CYS A 230 O GLY A 243 ? O GLY A 243 
AE 1 2 N PHE A 266 ? N PHE A 266 O TYR A 273 ? O TYR A 273 
AF 1 2 N CYS A 288 ? N CYS A 288 O GLY A 301 ? O GLY A 301 
AG 1 2 N PHE A 326 ? N PHE A 326 O ASN A 329 ? O ASN A 329 
AH 1 2 N CYS A 346 ? N CYS A 346 O GLY A 359 ? O GLY A 359 
AI 1 2 N ALA A 450 ? N ALA A 450 O PHE A 457 ? O PHE A 457 
AJ 1 2 N ILE A 464 ? N ILE A 464 O LEU A 478 ? O LEU A 478 
AK 1 2 N TYR A 495 ? N TYR A 495 O VAL A 504 ? O VAL A 504 
AK 2 3 N ALA A 507 ? N ALA A 507 O GLU A 510 ? O GLU A 510 
AK 3 4 N TYR A 511 ? N TYR A 511 O LYS A 525 ? O LYS A 525 
AL 1 2 N TYR A 495 ? N TYR A 495 O VAL A 504 ? O VAL A 504 
AL 2 3 N ALA A 507 ? N ALA A 507 O GLU A 510 ? O GLU A 510 
AL 3 4 N SER A 515 ? N SER A 515 O THR A 518 ? O THR A 518 
AM 1 2 O PHE A 543 ? O PHE A 543 N TYR A 552 ? N TYR A 552 
AM 2 3 N ALA A 555 ? N ALA A 555 O LYS A 558 ? O LYS A 558 
AM 3 4 N PHE A 559 ? N PHE A 559 O LYS A 575 ? O LYS A 575 
AN 1 2 N VAL A 592 ? N VAL A 592 O TYR A 601 ? O TYR A 601 
AN 2 3 N LYS A 604 ? N LYS A 604 O TYR A 607 ? O TYR A 607 
AN 3 4 N TYR A 608 ? N TYR A 608 O GLY A 622 ? O GLY A 622 
BA 1 2 N SER B 131 ? N SER B 131 O ILE B 95  ? O ILE B 95  
BA 2 3 N ARG B 98  ? N ARG B 98  O ILE B 140 ? O ILE B 140 
BA 3 4 N ASN B 143 ? N ASN B 143 O SER B 176 ? O SER B 176 
BA 4 5 N HIS B 177 ? N HIS B 177 O HIS B 164 ? O HIS B 164 
BB 1 2 N THR B 185 ? N THR B 185 O TYR B 366 ? O TYR B 366 
BC 1 2 N PHE B 210 ? N PHE B 210 O LYS B 213 ? O LYS B 213 
BD 1 2 N CYS B 230 ? N CYS B 230 O GLY B 243 ? O GLY B 243 
BE 1 2 N PHE B 266 ? N PHE B 266 O TYR B 273 ? O TYR B 273 
BF 1 2 N CYS B 288 ? N CYS B 288 O GLY B 301 ? O GLY B 301 
BG 1 2 N PHE B 326 ? N PHE B 326 O ASN B 329 ? O ASN B 329 
BH 1 2 N CYS B 346 ? N CYS B 346 O GLY B 359 ? O GLY B 359 
BI 1 2 N ILE B 452 ? N ILE B 452 O GLU B 455 ? O GLU B 455 
BI 2 3 N LYS B 460 ? N LYS B 460 O PHE B 463 ? O PHE B 463 
BJ 1 2 N TYR B 495 ? N TYR B 495 O VAL B 504 ? O VAL B 504 
BJ 2 3 N ALA B 507 ? N ALA B 507 O GLU B 510 ? O GLU B 510 
BJ 3 4 N TYR B 511 ? N TYR B 511 O LYS B 525 ? O LYS B 525 
BK 1 2 N TYR B 495 ? N TYR B 495 O VAL B 504 ? O VAL B 504 
BK 2 3 N ALA B 507 ? N ALA B 507 O GLU B 510 ? O GLU B 510 
BK 3 4 N SER B 515 ? N SER B 515 O THR B 518 ? O THR B 518 
BL 1 2 N ILE B 553 ? N ILE B 553 O TRP B 560 ? O TRP B 560 
BM 1 2 O ALA B 590 ? O ALA B 590 N PHE B 603 ? N PHE B 603 
BM 2 3 N LYS B 604 ? N LYS B 604 O TYR B 607 ? O TYR B 607 
BM 3 4 N TYR B 608 ? N TYR B 608 O GLY B 622 ? O GLY B 622 
CA 1 2 N VAL C 18  ? N VAL C 18  O PHE C 53  ? O PHE C 53  
CB 1 2 N VAL C 24  ? N VAL C 24  O GLU C 46  ? O GLU C 46  
CB 2 3 N TYR C 45  ? N TYR C 45  O ILE C 63  ? O ILE C 63  
CB 3 4 N TYR C 64  ? N TYR C 64  O MET C 96  ? O MET C 96  
CB 4 5 N HIS C 97  ? N HIS C 97  O LYS C 89  ? O LYS C 89  
CC 1 2 O THR C 131 ? O THR C 131 N TRP C 148 ? N TRP C 148 
CD 1 2 N ILE C 168 ? N ILE C 168 O ALA C 176 ? O ALA C 176 
DA 1 2 O ALA D 21  ? O ALA D 21  N TYR D 84  ? N TYR D 84  
DA 2 3 N LEU D 85  ? N LEU D 85  O VAL D 105 ? O VAL D 105 
DB 1 2 O ALA D 21  ? O ALA D 21  N TYR D 84  ? N TYR D 84  
DB 2 3 N LYS D 89  ? N LYS D 89  O HIS D 97  ? O HIS D 97  
DB 3 4 N MET D 96  ? N MET D 96  O PHE D 62  ? O PHE D 62  
DB 4 5 N THR D 65  ? N THR D 65  O ILE D 43  ? O ILE D 43  
DB 5 6 N GLN D 44  ? N GLN D 44  O LYS D 27  ? O LYS D 27  
DC 1 2 N ILE D 168 ? N ILE D 168 O ALA D 176 ? O ALA D 176 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SO4 A 1632' 
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 1633'  
AC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE ZN A 1634'  
AC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA A 1635'  
AC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SO4 B 1632' 
AC6 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN B 1633'  
AC7 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE ZN B 1634'  
AC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA B 1635'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 GLN A 269 ? GLN A 269 . ? 1_555 ? 
2  AC1 4 GLY A 270 ? GLY A 270 . ? 1_555 ? 
3  AC1 4 THR A 271 ? THR A 271 . ? 1_555 ? 
4  AC1 4 THR B 278 ? THR B 278 . ? 1_555 ? 
5  AC2 4 HIS A 149 ? HIS A 149 . ? 1_555 ? 
6  AC2 4 ASP A 151 ? ASP A 151 . ? 1_555 ? 
7  AC2 4 HIS A 164 ? HIS A 164 . ? 1_555 ? 
8  AC2 4 HIS A 177 ? HIS A 177 . ? 1_555 ? 
9  AC3 5 CYS A 73  ? CYS A 73  . ? 1_555 ? 
10 AC3 5 ASN A 75  ? ASN A 75  . ? 1_555 ? 
11 AC3 5 HIS A 374 ? HIS A 374 . ? 1_555 ? 
12 AC3 5 HIS A 378 ? HIS A 378 . ? 1_555 ? 
13 AC3 5 HIS A 384 ? HIS A 384 . ? 1_555 ? 
14 AC4 6 ASP A 156 ? ASP A 156 . ? 1_555 ? 
15 AC4 6 GLY A 157 ? GLY A 157 . ? 1_555 ? 
16 AC4 6 ASP A 159 ? ASP A 159 . ? 1_555 ? 
17 AC4 6 LEU A 161 ? LEU A 161 . ? 1_555 ? 
18 AC4 6 ASP A 179 ? ASP A 179 . ? 1_555 ? 
19 AC4 6 GLU A 182 ? GLU A 182 . ? 1_555 ? 
20 AC5 4 THR A 278 ? THR A 278 . ? 1_555 ? 
21 AC5 4 GLN B 269 ? GLN B 269 . ? 1_555 ? 
22 AC5 4 GLY B 270 ? GLY B 270 . ? 1_555 ? 
23 AC5 4 THR B 271 ? THR B 271 . ? 1_555 ? 
24 AC6 4 HIS B 149 ? HIS B 149 . ? 1_555 ? 
25 AC6 4 ASP B 151 ? ASP B 151 . ? 1_555 ? 
26 AC6 4 HIS B 164 ? HIS B 164 . ? 1_555 ? 
27 AC6 4 HIS B 177 ? HIS B 177 . ? 1_555 ? 
28 AC7 5 CYS B 73  ? CYS B 73  . ? 1_555 ? 
29 AC7 5 ASN B 75  ? ASN B 75  . ? 1_555 ? 
30 AC7 5 HIS B 374 ? HIS B 374 . ? 1_555 ? 
31 AC7 5 HIS B 378 ? HIS B 378 . ? 1_555 ? 
32 AC7 5 HIS B 384 ? HIS B 384 . ? 1_555 ? 
33 AC8 6 ASP B 156 ? ASP B 156 . ? 1_555 ? 
34 AC8 6 GLY B 157 ? GLY B 157 . ? 1_555 ? 
35 AC8 6 ASP B 159 ? ASP B 159 . ? 1_555 ? 
36 AC8 6 LEU B 161 ? LEU B 161 . ? 1_555 ? 
37 AC8 6 ASP B 179 ? ASP B 179 . ? 1_555 ? 
38 AC8 6 GLU B 182 ? GLU B 182 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1GXD 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1GXD 
_atom_sites.fract_transf_matrix[1][1]   0.013211 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.002670 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005236 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . ALA A 1 1   ? 72.602 58.913  2.112   1.00 37.44  ? 1    ALA A N   1 
ATOM   2     C  CA  . ALA A 1 1   ? 73.861 58.351  2.696   1.00 37.54  ? 1    ALA A CA  1 
ATOM   3     C  C   . ALA A 1 1   ? 74.689 59.383  3.484   1.00 37.47  ? 1    ALA A C   1 
ATOM   4     O  O   . ALA A 1 1   ? 74.579 59.431  4.713   1.00 37.65  ? 1    ALA A O   1 
ATOM   5     C  CB  . ALA A 1 1   ? 74.710 57.645  1.620   1.00 37.43  ? 1    ALA A CB  1 
ATOM   6     N  N   . PRO A 1 2   ? 75.504 60.202  2.806   1.00 37.21  ? 2    PRO A N   1 
ATOM   7     C  CA  . PRO A 1 2   ? 76.330 61.205  3.496   1.00 36.87  ? 2    PRO A CA  1 
ATOM   8     C  C   . PRO A 1 2   ? 75.442 62.309  4.071   1.00 36.63  ? 2    PRO A C   1 
ATOM   9     O  O   . PRO A 1 2   ? 75.753 63.494  4.013   1.00 36.78  ? 2    PRO A O   1 
ATOM   10    C  CB  . PRO A 1 2   ? 77.237 61.746  2.383   1.00 36.90  ? 2    PRO A CB  1 
ATOM   11    C  CG  . PRO A 1 2   ? 77.114 60.750  1.259   1.00 37.07  ? 2    PRO A CG  1 
ATOM   12    C  CD  . PRO A 1 2   ? 75.703 60.242  1.347   1.00 37.21  ? 2    PRO A CD  1 
ATOM   13    N  N   . SER A 1 3   ? 74.327 61.879  4.645   1.00 36.26  ? 3    SER A N   1 
ATOM   14    C  CA  . SER A 1 3   ? 73.303 62.758  5.195   1.00 35.98  ? 3    SER A CA  1 
ATOM   15    C  C   . SER A 1 3   ? 73.678 64.216  5.486   1.00 35.70  ? 3    SER A C   1 
ATOM   16    O  O   . SER A 1 3   ? 74.351 64.538  6.460   1.00 35.90  ? 3    SER A O   1 
ATOM   17    C  CB  . SER A 1 3   ? 72.640 62.108  6.407   1.00 36.07  ? 3    SER A CB  1 
ATOM   18    O  OG  . SER A 1 3   ? 71.283 61.833  6.118   1.00 36.28  ? 3    SER A OG  1 
ATOM   19    N  N   . PRO A 1 4   ? 73.149 65.085  4.637   1.00 35.33  ? 4    PRO A N   1 
ATOM   20    C  CA  . PRO A 1 4   ? 73.318 66.539  4.695   1.00 35.06  ? 4    PRO A CA  1 
ATOM   21    C  C   . PRO A 1 4   ? 72.803 67.245  5.932   1.00 34.82  ? 4    PRO A C   1 
ATOM   22    O  O   . PRO A 1 4   ? 71.673 66.998  6.320   1.00 34.97  ? 4    PRO A O   1 
ATOM   23    C  CB  . PRO A 1 4   ? 72.413 67.001  3.558   1.00 34.86  ? 4    PRO A CB  1 
ATOM   24    C  CG  . PRO A 1 4   ? 71.349 65.990  3.565   1.00 34.72  ? 4    PRO A CG  1 
ATOM   25    C  CD  . PRO A 1 4   ? 72.116 64.714  3.651   1.00 35.40  ? 4    PRO A CD  1 
ATOM   26    N  N   . ILE A 1 5   ? 73.578 68.160  6.499   1.00 34.63  ? 5    ILE A N   1 
ATOM   27    C  CA  . ILE A 1 5   ? 73.116 68.902  7.667   1.00 34.46  ? 5    ILE A CA  1 
ATOM   28    C  C   . ILE A 1 5   ? 72.835 70.367  7.358   1.00 34.78  ? 5    ILE A C   1 
ATOM   29    O  O   . ILE A 1 5   ? 73.692 71.075  6.831   1.00 35.01  ? 5    ILE A O   1 
ATOM   30    C  CB  . ILE A 1 5   ? 74.138 68.810  8.780   1.00 34.17  ? 5    ILE A CB  1 
ATOM   31    C  CG1 . ILE A 1 5   ? 74.289 67.358  9.216   1.00 33.29  ? 5    ILE A CG1 1 
ATOM   32    C  CG2 . ILE A 1 5   ? 73.722 69.705  9.940   1.00 33.91  ? 5    ILE A CG2 1 
ATOM   33    C  CD1 . ILE A 1 5   ? 74.183 67.171  10.694  1.00 32.37  ? 5    ILE A CD1 1 
ATOM   34    N  N   . ILE A 1 6   ? 71.647 70.832  7.713   1.00 34.83  ? 6    ILE A N   1 
ATOM   35    C  CA  . ILE A 1 6   ? 71.264 72.195  7.391   1.00 35.35  ? 6    ILE A CA  1 
ATOM   36    C  C   . ILE A 1 6   ? 70.852 72.996  8.621   1.00 35.76  ? 6    ILE A C   1 
ATOM   37    O  O   . ILE A 1 6   ? 70.502 72.442  9.655   1.00 36.16  ? 6    ILE A O   1 
ATOM   38    C  CB  . ILE A 1 6   ? 70.096 72.172  6.392   1.00 35.32  ? 6    ILE A CB  1 
ATOM   39    C  CG1 . ILE A 1 6   ? 70.068 73.429  5.540   1.00 35.75  ? 6    ILE A CG1 1 
ATOM   40    C  CG2 . ILE A 1 6   ? 68.776 72.110  7.119   1.00 35.40  ? 6    ILE A CG2 1 
ATOM   41    C  CD1 . ILE A 1 6   ? 68.644 73.928  5.278   1.00 35.67  ? 6    ILE A CD1 1 
ATOM   42    N  N   . LYS A 1 7   ? 70.889 74.311  8.490   1.00 36.15  ? 7    LYS A N   1 
ATOM   43    C  CA  . LYS A 1 7   ? 70.466 75.224  9.534   1.00 36.64  ? 7    LYS A CA  1 
ATOM   44    C  C   . LYS A 1 7   ? 69.128 75.771  9.108   1.00 36.59  ? 7    LYS A C   1 
ATOM   45    O  O   . LYS A 1 7   ? 69.009 76.306  8.014   1.00 36.98  ? 7    LYS A O   1 
ATOM   46    C  CB  . LYS A 1 7   ? 71.440 76.381  9.562   1.00 37.04  ? 7    LYS A CB  1 
ATOM   47    C  CG  . LYS A 1 7   ? 72.242 76.460  8.246   1.00 38.92  ? 7    LYS A CG  1 
ATOM   48    C  CD  . LYS A 1 7   ? 72.130 77.822  7.556   1.00 40.80  ? 7    LYS A CD  1 
ATOM   49    C  CE  . LYS A 1 7   ? 72.772 77.794  6.162   1.00 42.32  ? 7    LYS A CE  1 
ATOM   50    N  NZ  . LYS A 1 7   ? 74.270 77.959  6.137   1.00 42.19  ? 7    LYS A NZ  1 
ATOM   51    N  N   . PHE A 1 8   ? 68.108 75.648  9.939   1.00 36.53  ? 8    PHE A N   1 
ATOM   52    C  CA  . PHE A 1 8   ? 66.816 76.182  9.545   1.00 36.46  ? 8    PHE A CA  1 
ATOM   53    C  C   . PHE A 1 8   ? 66.670 77.568  10.125  1.00 37.12  ? 8    PHE A C   1 
ATOM   54    O  O   . PHE A 1 8   ? 67.064 77.819  11.254  1.00 37.25  ? 8    PHE A O   1 
ATOM   55    C  CB  . PHE A 1 8   ? 65.679 75.265  9.995   1.00 36.26  ? 8    PHE A CB  1 
ATOM   56    C  CG  . PHE A 1 8   ? 65.485 74.066  9.108   1.00 34.57  ? 8    PHE A CG  1 
ATOM   57    C  CD1 . PHE A 1 8   ? 66.282 72.951  9.245   1.00 32.99  ? 8    PHE A CD1 1 
ATOM   58    C  CD2 . PHE A 1 8   ? 64.511 74.061  8.135   1.00 33.41  ? 8    PHE A CD2 1 
ATOM   59    C  CE1 . PHE A 1 8   ? 66.103 71.866  8.434   1.00 32.27  ? 8    PHE A CE1 1 
ATOM   60    C  CE2 . PHE A 1 8   ? 64.337 72.973  7.319   1.00 32.32  ? 8    PHE A CE2 1 
ATOM   61    C  CZ  . PHE A 1 8   ? 65.129 71.878  7.470   1.00 31.80  ? 8    PHE A CZ  1 
ATOM   62    N  N   . PRO A 1 9   ? 66.098 78.481  9.363   1.00 37.80  ? 9    PRO A N   1 
ATOM   63    C  CA  . PRO A 1 9   ? 65.979 79.856  9.822   1.00 38.63  ? 9    PRO A CA  1 
ATOM   64    C  C   . PRO A 1 9   ? 65.178 79.888  11.102  1.00 39.76  ? 9    PRO A C   1 
ATOM   65    O  O   . PRO A 1 9   ? 64.026 79.448  11.115  1.00 39.88  ? 9    PRO A O   1 
ATOM   66    C  CB  . PRO A 1 9   ? 65.195 80.530  8.701   1.00 38.50  ? 9    PRO A CB  1 
ATOM   67    C  CG  . PRO A 1 9   ? 65.385 79.680  7.539   1.00 37.89  ? 9    PRO A CG  1 
ATOM   68    C  CD  . PRO A 1 9   ? 65.482 78.281  8.046   1.00 37.81  ? 9    PRO A CD  1 
ATOM   69    N  N   . GLY A 1 10  ? 65.778 80.392  12.170  1.00 41.02  ? 10   GLY A N   1 
ATOM   70    C  CA  . GLY A 1 10  ? 65.071 80.500  13.427  1.00 42.87  ? 10   GLY A CA  1 
ATOM   71    C  C   . GLY A 1 10  ? 65.634 79.547  14.452  1.00 44.15  ? 10   GLY A C   1 
ATOM   72    O  O   . GLY A 1 10  ? 65.716 79.866  15.631  1.00 44.77  ? 10   GLY A O   1 
ATOM   73    N  N   . ASP A 1 11  ? 66.021 78.368  13.994  1.00 45.03  ? 11   ASP A N   1 
ATOM   74    C  CA  . ASP A 1 11  ? 66.603 77.366  14.857  1.00 46.03  ? 11   ASP A CA  1 
ATOM   75    C  C   . ASP A 1 11  ? 68.098 77.639  14.835  1.00 46.50  ? 11   ASP A C   1 
ATOM   76    O  O   . ASP A 1 11  ? 68.647 77.950  13.785  1.00 46.73  ? 11   ASP A O   1 
ATOM   77    C  CB  . ASP A 1 11  ? 66.331 75.986  14.250  1.00 46.32  ? 11   ASP A CB  1 
ATOM   78    C  CG  . ASP A 1 11  ? 65.715 75.004  15.240  1.00 47.33  ? 11   ASP A CG  1 
ATOM   79    O  OD1 . ASP A 1 11  ? 65.708 75.176  16.480  1.00 49.56  ? 11   ASP A OD1 1 
ATOM   80    O  OD2 . ASP A 1 11  ? 65.183 73.966  14.784  1.00 46.82  ? 11   ASP A OD2 1 
ATOM   81    N  N   . VAL A 1 12  ? 68.766 77.565  15.977  1.00 47.09  ? 12   VAL A N   1 
ATOM   82    C  CA  . VAL A 1 12  ? 70.224 77.705  15.977  1.00 47.87  ? 12   VAL A CA  1 
ATOM   83    C  C   . VAL A 1 12  ? 70.744 76.319  16.314  1.00 48.13  ? 12   VAL A C   1 
ATOM   84    O  O   . VAL A 1 12  ? 70.714 75.914  17.474  1.00 48.46  ? 12   VAL A O   1 
ATOM   85    C  CB  . VAL A 1 12  ? 70.711 78.769  16.991  1.00 47.97  ? 12   VAL A CB  1 
ATOM   86    C  CG1 . VAL A 1 12  ? 69.803 78.792  18.221  1.00 48.69  ? 12   VAL A CG1 1 
ATOM   87    C  CG2 . VAL A 1 12  ? 72.188 78.558  17.369  1.00 47.65  ? 12   VAL A CG2 1 
ATOM   88    N  N   . ALA A 1 13  ? 71.217 75.584  15.308  1.00 48.26  ? 13   ALA A N   1 
ATOM   89    C  CA  . ALA A 1 13  ? 71.496 74.163  15.521  1.00 48.36  ? 13   ALA A CA  1 
ATOM   90    C  C   . ALA A 1 13  ? 72.885 73.630  15.254  1.00 48.42  ? 13   ALA A C   1 
ATOM   91    O  O   . ALA A 1 13  ? 73.052 72.735  14.420  1.00 48.48  ? 13   ALA A O   1 
ATOM   92    C  CB  . ALA A 1 13  ? 70.481 73.312  14.753  1.00 48.54  ? 13   ALA A CB  1 
ATOM   93    N  N   . PRO A 1 14  ? 73.875 74.135  15.975  1.00 48.41  ? 14   PRO A N   1 
ATOM   94    C  CA  . PRO A 1 14  ? 75.221 73.568  15.882  1.00 48.27  ? 14   PRO A CA  1 
ATOM   95    C  C   . PRO A 1 14  ? 75.172 72.249  16.636  1.00 48.15  ? 14   PRO A C   1 
ATOM   96    O  O   . PRO A 1 14  ? 74.705 71.258  16.078  1.00 47.93  ? 14   PRO A O   1 
ATOM   97    C  CB  . PRO A 1 14  ? 76.091 74.590  16.619  1.00 48.29  ? 14   PRO A CB  1 
ATOM   98    C  CG  . PRO A 1 14  ? 75.165 75.272  17.578  1.00 48.53  ? 14   PRO A CG  1 
ATOM   99    C  CD  . PRO A 1 14  ? 73.788 75.243  16.941  1.00 48.47  ? 14   PRO A CD  1 
ATOM   100   N  N   . LYS A 1 15  ? 75.603 72.263  17.896  1.00 48.20  ? 15   LYS A N   1 
ATOM   101   C  CA  . LYS A 1 15  ? 75.596 71.084  18.764  1.00 48.13  ? 15   LYS A CA  1 
ATOM   102   C  C   . LYS A 1 15  ? 75.887 69.787  18.027  1.00 48.13  ? 15   LYS A C   1 
ATOM   103   O  O   . LYS A 1 15  ? 74.971 69.073  17.626  1.00 48.28  ? 15   LYS A O   1 
ATOM   104   C  CB  . LYS A 1 15  ? 74.265 70.966  19.504  1.00 47.99  ? 15   LYS A CB  1 
ATOM   105   C  CG  . LYS A 1 15  ? 74.073 71.989  20.603  1.00 48.30  ? 15   LYS A CG  1 
ATOM   106   C  CD  . LYS A 1 15  ? 72.700 71.831  21.242  1.00 49.06  ? 15   LYS A CD  1 
ATOM   107   C  CE  . LYS A 1 15  ? 72.181 73.157  21.783  1.00 49.30  ? 15   LYS A CE  1 
ATOM   108   N  NZ  . LYS A 1 15  ? 70.686 73.195  21.798  1.00 49.47  ? 15   LYS A NZ  1 
ATOM   109   N  N   . THR A 1 16  ? 77.164 69.475  17.855  1.00 48.03  ? 16   THR A N   1 
ATOM   110   C  CA  . THR A 1 16  ? 77.531 68.247  17.171  1.00 47.99  ? 16   THR A CA  1 
ATOM   111   C  C   . THR A 1 16  ? 77.980 67.208  18.180  1.00 47.98  ? 16   THR A C   1 
ATOM   112   O  O   . THR A 1 16  ? 78.888 67.468  18.978  1.00 48.06  ? 16   THR A O   1 
ATOM   113   C  CB  . THR A 1 16  ? 78.672 68.493  16.162  1.00 48.03  ? 16   THR A CB  1 
ATOM   114   O  OG1 . THR A 1 16  ? 79.923 68.108  16.746  1.00 47.63  ? 16   THR A OG1 1 
ATOM   115   C  CG2 . THR A 1 16  ? 78.836 69.989  15.872  1.00 48.14  ? 16   THR A CG2 1 
ATOM   116   N  N   . ASP A 1 17  ? 77.352 66.033  18.142  1.00 47.86  ? 17   ASP A N   1 
ATOM   117   C  CA  . ASP A 1 17  ? 77.745 64.947  19.027  1.00 47.47  ? 17   ASP A CA  1 
ATOM   118   C  C   . ASP A 1 17  ? 77.969 65.505  20.414  1.00 46.82  ? 17   ASP A C   1 
ATOM   119   O  O   . ASP A 1 17  ? 77.074 66.093  21.016  1.00 46.87  ? 17   ASP A O   1 
ATOM   120   C  CB  . ASP A 1 17  ? 79.063 64.358  18.542  1.00 47.84  ? 17   ASP A CB  1 
ATOM   121   C  CG  . ASP A 1 17  ? 78.882 63.083  17.765  1.00 49.14  ? 17   ASP A CG  1 
ATOM   122   O  OD1 . ASP A 1 17  ? 78.146 62.201  18.258  1.00 50.86  ? 17   ASP A OD1 1 
ATOM   123   O  OD2 . ASP A 1 17  ? 79.453 62.862  16.670  1.00 50.39  ? 17   ASP A OD2 1 
ATOM   124   N  N   . LYS A 1 18  ? 79.194 65.336  20.892  1.00 45.97  ? 18   LYS A N   1 
ATOM   125   C  CA  . LYS A 1 18  ? 79.606 65.834  22.190  1.00 45.35  ? 18   LYS A CA  1 
ATOM   126   C  C   . LYS A 1 18  ? 79.228 67.278  22.403  1.00 44.93  ? 18   LYS A C   1 
ATOM   127   O  O   . LYS A 1 18  ? 78.524 67.580  23.348  1.00 45.21  ? 18   LYS A O   1 
ATOM   128   C  CB  . LYS A 1 18  ? 81.116 65.668  22.379  1.00 45.58  ? 18   LYS A CB  1 
ATOM   129   C  CG  . LYS A 1 18  ? 81.517 64.639  23.435  1.00 45.47  ? 18   LYS A CG  1 
ATOM   130   C  CD  . LYS A 1 18  ? 80.628 63.399  23.382  1.00 45.18  ? 18   LYS A CD  1 
ATOM   131   C  CE  . LYS A 1 18  ? 80.533 62.730  24.749  1.00 44.47  ? 18   LYS A CE  1 
ATOM   132   N  NZ  . LYS A 1 18  ? 79.420 61.742  24.802  1.00 43.34  ? 18   LYS A NZ  1 
ATOM   133   N  N   . GLU A 1 19  ? 79.694 68.177  21.541  1.00 44.33  ? 19   GLU A N   1 
ATOM   134   C  CA  . GLU A 1 19  ? 79.368 69.595  21.697  1.00 43.90  ? 19   GLU A CA  1 
ATOM   135   C  C   . GLU A 1 19  ? 78.229 69.799  22.713  1.00 43.71  ? 19   GLU A C   1 
ATOM   136   O  O   . GLU A 1 19  ? 78.375 70.547  23.684  1.00 43.59  ? 19   GLU A O   1 
ATOM   137   C  CB  . GLU A 1 19  ? 79.010 70.229  20.347  1.00 43.83  ? 19   GLU A CB  1 
ATOM   138   C  CG  . GLU A 1 19  ? 78.976 71.752  20.365  1.00 43.74  ? 19   GLU A CG  1 
ATOM   139   C  CD  . GLU A 1 19  ? 79.021 72.365  18.977  1.00 43.51  ? 19   GLU A CD  1 
ATOM   140   O  OE1 . GLU A 1 19  ? 80.053 72.226  18.290  1.00 44.07  ? 19   GLU A OE1 1 
ATOM   141   O  OE2 . GLU A 1 19  ? 78.029 72.997  18.571  1.00 43.31  ? 19   GLU A OE2 1 
ATOM   142   N  N   . LEU A 1 20  ? 77.104 69.117  22.494  1.00 43.29  ? 20   LEU A N   1 
ATOM   143   C  CA  . LEU A 1 20  ? 75.956 69.206  23.392  1.00 43.02  ? 20   LEU A CA  1 
ATOM   144   C  C   . LEU A 1 20  ? 76.248 68.684  24.809  1.00 42.91  ? 20   LEU A C   1 
ATOM   145   O  O   . LEU A 1 20  ? 76.064 69.403  25.791  1.00 42.79  ? 20   LEU A O   1 
ATOM   146   C  CB  . LEU A 1 20  ? 74.749 68.492  22.779  1.00 43.04  ? 20   LEU A CB  1 
ATOM   147   C  CG  . LEU A 1 20  ? 74.314 67.114  23.284  1.00 43.30  ? 20   LEU A CG  1 
ATOM   148   C  CD1 . LEU A 1 20  ? 73.012 66.689  22.591  1.00 43.11  ? 20   LEU A CD1 1 
ATOM   149   C  CD2 . LEU A 1 20  ? 75.405 66.063  23.094  1.00 43.06  ? 20   LEU A CD2 1 
ATOM   150   N  N   . ALA A 1 21  ? 76.701 67.435  24.906  1.00 42.91  ? 21   ALA A N   1 
ATOM   151   C  CA  . ALA A 1 21  ? 77.073 66.827  26.186  1.00 42.96  ? 21   ALA A CA  1 
ATOM   152   C  C   . ALA A 1 21  ? 77.751 67.859  27.074  1.00 42.96  ? 21   ALA A C   1 
ATOM   153   O  O   . ALA A 1 21  ? 77.651 67.804  28.298  1.00 42.91  ? 21   ALA A O   1 
ATOM   154   C  CB  . ALA A 1 21  ? 77.997 65.635  25.964  1.00 42.92  ? 21   ALA A CB  1 
ATOM   155   N  N   . VAL A 1 22  ? 78.445 68.797  26.441  1.00 43.02  ? 22   VAL A N   1 
ATOM   156   C  CA  . VAL A 1 22  ? 79.100 69.880  27.154  1.00 43.11  ? 22   VAL A CA  1 
ATOM   157   C  C   . VAL A 1 22  ? 78.051 70.839  27.710  1.00 43.15  ? 22   VAL A C   1 
ATOM   158   O  O   . VAL A 1 22  ? 78.025 71.129  28.907  1.00 43.12  ? 22   VAL A O   1 
ATOM   159   C  CB  . VAL A 1 22  ? 80.046 70.658  26.227  1.00 43.12  ? 22   VAL A CB  1 
ATOM   160   C  CG1 . VAL A 1 22  ? 80.968 71.564  27.039  1.00 43.05  ? 22   VAL A CG1 1 
ATOM   161   C  CG2 . VAL A 1 22  ? 80.846 69.695  25.355  1.00 43.16  ? 22   VAL A CG2 1 
ATOM   162   N  N   . GLN A 1 23  ? 77.177 71.323  26.836  1.00 43.22  ? 23   GLN A N   1 
ATOM   163   C  CA  . GLN A 1 23  ? 76.142 72.258  27.252  1.00 43.43  ? 23   GLN A CA  1 
ATOM   164   C  C   . GLN A 1 23  ? 75.084 71.532  28.064  1.00 43.45  ? 23   GLN A C   1 
ATOM   165   O  O   . GLN A 1 23  ? 74.289 72.159  28.767  1.00 43.52  ? 23   GLN A O   1 
ATOM   166   C  CB  . GLN A 1 23  ? 75.498 72.931  26.035  1.00 43.49  ? 23   GLN A CB  1 
ATOM   167   C  CG  . GLN A 1 23  ? 74.428 73.965  26.371  1.00 43.64  ? 23   GLN A CG  1 
ATOM   168   C  CD  . GLN A 1 23  ? 73.583 74.350  25.161  1.00 44.28  ? 23   GLN A CD  1 
ATOM   169   O  OE1 . GLN A 1 23  ? 73.099 73.481  24.427  1.00 43.36  ? 23   GLN A OE1 1 
ATOM   170   N  NE2 . GLN A 1 23  ? 73.399 75.653  24.956  1.00 44.63  ? 23   GLN A NE2 1 
ATOM   171   N  N   . TYR A 1 24  ? 75.095 70.207  27.986  1.00 43.39  ? 24   TYR A N   1 
ATOM   172   C  CA  . TYR A 1 24  ? 74.070 69.415  28.646  1.00 43.57  ? 24   TYR A CA  1 
ATOM   173   C  C   . TYR A 1 24  ? 74.540 68.635  29.876  1.00 43.22  ? 24   TYR A C   1 
ATOM   174   O  O   . TYR A 1 24  ? 73.822 67.770  30.377  1.00 43.06  ? 24   TYR A O   1 
ATOM   175   C  CB  . TYR A 1 24  ? 73.369 68.509  27.622  1.00 43.93  ? 24   TYR A CB  1 
ATOM   176   C  CG  . TYR A 1 24  ? 72.572 69.300  26.596  1.00 45.49  ? 24   TYR A CG  1 
ATOM   177   C  CD1 . TYR A 1 24  ? 71.263 69.701  26.858  1.00 47.16  ? 24   TYR A CD1 1 
ATOM   178   C  CD2 . TYR A 1 24  ? 73.137 69.673  25.384  1.00 46.52  ? 24   TYR A CD2 1 
ATOM   179   C  CE1 . TYR A 1 24  ? 70.534 70.438  25.930  1.00 48.41  ? 24   TYR A CE1 1 
ATOM   180   C  CE2 . TYR A 1 24  ? 72.421 70.410  24.447  1.00 47.49  ? 24   TYR A CE2 1 
ATOM   181   C  CZ  . TYR A 1 24  ? 71.120 70.791  24.725  1.00 48.70  ? 24   TYR A CZ  1 
ATOM   182   O  OH  . TYR A 1 24  ? 70.390 71.525  23.810  1.00 49.17  ? 24   TYR A OH  1 
ATOM   183   N  N   . LEU A 1 25  ? 75.738 68.951  30.364  1.00 42.94  ? 25   LEU A N   1 
ATOM   184   C  CA  . LEU A 1 25  ? 76.259 68.308  31.573  1.00 42.64  ? 25   LEU A CA  1 
ATOM   185   C  C   . LEU A 1 25  ? 76.366 69.283  32.737  1.00 42.43  ? 25   LEU A C   1 
ATOM   186   O  O   . LEU A 1 25  ? 76.397 68.882  33.894  1.00 42.14  ? 25   LEU A O   1 
ATOM   187   C  CB  . LEU A 1 25  ? 77.612 67.636  31.325  1.00 42.62  ? 25   LEU A CB  1 
ATOM   188   C  CG  . LEU A 1 25  ? 77.630 66.104  31.237  1.00 42.65  ? 25   LEU A CG  1 
ATOM   189   C  CD1 . LEU A 1 25  ? 79.016 65.594  30.856  1.00 42.33  ? 25   LEU A CD1 1 
ATOM   190   C  CD2 . LEU A 1 25  ? 77.176 65.474  32.545  1.00 42.30  ? 25   LEU A CD2 1 
ATOM   191   N  N   . ASN A 1 26  ? 76.424 70.570  32.428  1.00 42.38  ? 26   ASN A N   1 
ATOM   192   C  CA  . ASN A 1 26  ? 76.503 71.574  33.479  1.00 42.36  ? 26   ASN A CA  1 
ATOM   193   C  C   . ASN A 1 26  ? 75.142 72.173  33.816  1.00 42.25  ? 26   ASN A C   1 
ATOM   194   O  O   . ASN A 1 26  ? 74.990 72.873  34.816  1.00 42.30  ? 26   ASN A O   1 
ATOM   195   C  CB  . ASN A 1 26  ? 77.505 72.668  33.124  1.00 42.33  ? 26   ASN A CB  1 
ATOM   196   C  CG  . ASN A 1 26  ? 77.008 73.595  32.048  1.00 42.58  ? 26   ASN A CG  1 
ATOM   197   O  OD1 . ASN A 1 26  ? 77.237 74.804  32.113  1.00 42.90  ? 26   ASN A OD1 1 
ATOM   198   N  ND2 . ASN A 1 26  ? 76.330 73.039  31.044  1.00 42.69  ? 26   ASN A ND2 1 
ATOM   199   N  N   . THR A 1 27  ? 74.153 71.909  32.975  1.00 41.98  ? 27   THR A N   1 
ATOM   200   C  CA  . THR A 1 27  ? 72.819 72.375  33.278  1.00 41.87  ? 27   THR A CA  1 
ATOM   201   C  C   . THR A 1 27  ? 72.293 71.547  34.435  1.00 41.76  ? 27   THR A C   1 
ATOM   202   O  O   . THR A 1 27  ? 71.741 72.083  35.392  1.00 41.81  ? 27   THR A O   1 
ATOM   203   C  CB  . THR A 1 27  ? 71.907 72.245  32.061  1.00 41.96  ? 27   THR A CB  1 
ATOM   204   O  OG1 . THR A 1 27  ? 72.131 73.357  31.186  1.00 42.40  ? 27   THR A OG1 1 
ATOM   205   C  CG2 . THR A 1 27  ? 70.450 72.416  32.468  1.00 41.86  ? 27   THR A CG2 1 
ATOM   206   N  N   . PHE A 1 28  ? 72.488 70.235  34.356  1.00 41.65  ? 28   PHE A N   1 
ATOM   207   C  CA  . PHE A 1 28  ? 72.030 69.348  35.414  1.00 41.49  ? 28   PHE A CA  1 
ATOM   208   C  C   . PHE A 1 28  ? 73.186 68.698  36.178  1.00 41.93  ? 28   PHE A C   1 
ATOM   209   O  O   . PHE A 1 28  ? 72.956 67.797  36.989  1.00 41.92  ? 28   PHE A O   1 
ATOM   210   C  CB  . PHE A 1 28  ? 71.124 68.250  34.857  1.00 41.14  ? 28   PHE A CB  1 
ATOM   211   C  CG  . PHE A 1 28  ? 70.369 68.633  33.615  1.00 39.76  ? 28   PHE A CG  1 
ATOM   212   C  CD1 . PHE A 1 28  ? 70.985 68.610  32.374  1.00 39.21  ? 28   PHE A CD1 1 
ATOM   213   C  CD2 . PHE A 1 28  ? 69.035 68.973  33.677  1.00 38.33  ? 28   PHE A CD2 1 
ATOM   214   C  CE1 . PHE A 1 28  ? 70.282 68.943  31.222  1.00 37.96  ? 28   PHE A CE1 1 
ATOM   215   C  CE2 . PHE A 1 28  ? 68.338 69.303  32.533  1.00 37.35  ? 28   PHE A CE2 1 
ATOM   216   C  CZ  . PHE A 1 28  ? 68.964 69.284  31.307  1.00 36.86  ? 28   PHE A CZ  1 
ATOM   217   N  N   . TYR A 1 29  ? 74.420 69.139  35.915  1.00 42.50  ? 29   TYR A N   1 
ATOM   218   C  CA  . TYR A 1 29  ? 75.598 68.590  36.598  1.00 42.88  ? 29   TYR A CA  1 
ATOM   219   C  C   . TYR A 1 29  ? 76.680 69.607  36.970  1.00 43.45  ? 29   TYR A C   1 
ATOM   220   O  O   . TYR A 1 29  ? 77.770 69.215  37.364  1.00 43.74  ? 29   TYR A O   1 
ATOM   221   C  CB  . TYR A 1 29  ? 76.246 67.479  35.767  1.00 42.75  ? 29   TYR A CB  1 
ATOM   222   C  CG  . TYR A 1 29  ? 75.399 66.245  35.602  1.00 42.31  ? 29   TYR A CG  1 
ATOM   223   C  CD1 . TYR A 1 29  ? 75.402 65.246  36.563  1.00 42.13  ? 29   TYR A CD1 1 
ATOM   224   C  CD2 . TYR A 1 29  ? 74.602 66.074  34.482  1.00 41.40  ? 29   TYR A CD2 1 
ATOM   225   C  CE1 . TYR A 1 29  ? 74.626 64.116  36.412  1.00 41.93  ? 29   TYR A CE1 1 
ATOM   226   C  CE2 . TYR A 1 29  ? 73.829 64.951  34.325  1.00 41.02  ? 29   TYR A CE2 1 
ATOM   227   C  CZ  . TYR A 1 29  ? 73.839 63.977  35.292  1.00 41.25  ? 29   TYR A CZ  1 
ATOM   228   O  OH  . TYR A 1 29  ? 73.068 62.851  35.141  1.00 41.20  ? 29   TYR A OH  1 
ATOM   229   N  N   . GLY A 1 30  ? 76.403 70.898  36.830  1.00 44.17  ? 30   GLY A N   1 
ATOM   230   C  CA  . GLY A 1 30  ? 77.363 71.930  37.210  1.00 45.25  ? 30   GLY A CA  1 
ATOM   231   C  C   . GLY A 1 30  ? 78.772 71.858  36.623  1.00 46.00  ? 30   GLY A C   1 
ATOM   232   O  O   . GLY A 1 30  ? 79.680 71.254  37.205  1.00 45.89  ? 30   GLY A O   1 
ATOM   233   N  N   . CYS A 1 31  ? 78.959 72.525  35.487  1.00 46.82  ? 31   CYS A N   1 
ATOM   234   C  CA  . CYS A 1 31  ? 80.226 72.526  34.755  1.00 47.63  ? 31   CYS A CA  1 
ATOM   235   C  C   . CYS A 1 31  ? 80.131 73.581  33.640  1.00 48.27  ? 31   CYS A C   1 
ATOM   236   O  O   . CYS A 1 31  ? 79.709 73.272  32.520  1.00 48.45  ? 31   CYS A O   1 
ATOM   237   C  CB  . CYS A 1 31  ? 80.447 71.130  34.177  1.00 47.44  ? 31   CYS A CB  1 
ATOM   238   S  SG  . CYS A 1 31  ? 81.728 70.964  32.923  1.00 47.87  ? 31   CYS A SG  1 
ATOM   239   N  N   . PRO A 1 32  ? 80.532 74.818  33.946  1.00 48.77  ? 32   PRO A N   1 
ATOM   240   C  CA  . PRO A 1 32  ? 80.306 75.977  33.058  1.00 48.93  ? 32   PRO A CA  1 
ATOM   241   C  C   . PRO A 1 32  ? 81.174 76.113  31.792  1.00 49.04  ? 32   PRO A C   1 
ATOM   242   O  O   . PRO A 1 32  ? 81.576 75.124  31.180  1.00 49.26  ? 32   PRO A O   1 
ATOM   243   C  CB  . PRO A 1 32  ? 80.541 77.183  33.985  1.00 48.97  ? 32   PRO A CB  1 
ATOM   244   C  CG  . PRO A 1 32  ? 80.717 76.601  35.374  1.00 49.02  ? 32   PRO A CG  1 
ATOM   245   C  CD  . PRO A 1 32  ? 81.242 75.202  35.179  1.00 48.85  ? 32   PRO A CD  1 
ATOM   246   N  N   . LYS A 1 33  ? 81.440 77.368  31.427  1.00 49.01  ? 33   LYS A N   1 
ATOM   247   C  CA  . LYS A 1 33  ? 82.172 77.765  30.211  1.00 48.72  ? 33   LYS A CA  1 
ATOM   248   C  C   . LYS A 1 33  ? 83.310 76.867  29.721  1.00 48.35  ? 33   LYS A C   1 
ATOM   249   O  O   . LYS A 1 33  ? 83.608 76.850  28.526  1.00 48.52  ? 33   LYS A O   1 
ATOM   250   C  CB  . LYS A 1 33  ? 82.696 79.201  30.345  1.00 48.83  ? 33   LYS A CB  1 
ATOM   251   C  CG  . LYS A 1 33  ? 83.810 79.366  31.356  1.00 48.70  ? 33   LYS A CG  1 
ATOM   252   C  CD  . LYS A 1 33  ? 84.253 80.818  31.431  1.00 49.53  ? 33   LYS A CD  1 
ATOM   253   C  CE  . LYS A 1 33  ? 84.781 81.311  30.089  1.00 49.90  ? 33   LYS A CE  1 
ATOM   254   N  NZ  . LYS A 1 33  ? 85.500 82.615  30.215  1.00 50.40  ? 33   LYS A NZ  1 
ATOM   255   N  N   . GLU A 1 34  ? 83.960 76.146  30.623  1.00 47.65  ? 34   GLU A N   1 
ATOM   256   C  CA  . GLU A 1 34  ? 85.035 75.269  30.202  1.00 47.10  ? 34   GLU A CA  1 
ATOM   257   C  C   . GLU A 1 34  ? 84.463 73.951  29.703  1.00 46.94  ? 34   GLU A C   1 
ATOM   258   O  O   . GLU A 1 34  ? 83.402 73.516  30.154  1.00 46.79  ? 34   GLU A O   1 
ATOM   259   C  CB  . GLU A 1 34  ? 85.955 74.965  31.379  1.00 47.03  ? 34   GLU A CB  1 
ATOM   260   C  CG  . GLU A 1 34  ? 85.534 73.713  32.127  1.00 46.38  ? 34   GLU A CG  1 
ATOM   261   C  CD  . GLU A 1 34  ? 85.838 73.779  33.600  1.00 45.23  ? 34   GLU A CD  1 
ATOM   262   O  OE1 . GLU A 1 34  ? 86.671 74.616  33.992  1.00 44.55  ? 34   GLU A OE1 1 
ATOM   263   O  OE2 . GLU A 1 34  ? 85.236 72.994  34.361  1.00 45.34  ? 34   GLU A OE2 1 
ATOM   264   N  N   . SER A 1 35  ? 85.155 73.328  28.754  1.00 46.77  ? 35   SER A N   1 
ATOM   265   C  CA  . SER A 1 35  ? 84.825 71.968  28.368  1.00 46.54  ? 35   SER A CA  1 
ATOM   266   C  C   . SER A 1 35  ? 85.111 71.219  29.653  1.00 46.23  ? 35   SER A C   1 
ATOM   267   O  O   . SER A 1 35  ? 86.224 71.301  30.175  1.00 46.23  ? 35   SER A O   1 
ATOM   268   C  CB  . SER A 1 35  ? 85.754 71.476  27.258  1.00 46.68  ? 35   SER A CB  1 
ATOM   269   O  OG  . SER A 1 35  ? 86.070 70.099  27.414  1.00 46.82  ? 35   SER A OG  1 
ATOM   270   N  N   . CYS A 1 36  ? 84.111 70.529  30.187  1.00 45.77  ? 36   CYS A N   1 
ATOM   271   C  CA  . CYS A 1 36  ? 84.267 69.836  31.457  1.00 45.56  ? 36   CYS A CA  1 
ATOM   272   C  C   . CYS A 1 36  ? 85.701 69.405  31.783  1.00 45.38  ? 36   CYS A C   1 
ATOM   273   O  O   . CYS A 1 36  ? 86.451 68.943  30.917  1.00 45.47  ? 36   CYS A O   1 
ATOM   274   C  CB  . CYS A 1 36  ? 83.327 68.643  31.530  1.00 45.62  ? 36   CYS A CB  1 
ATOM   275   S  SG  . CYS A 1 36  ? 81.810 68.994  32.427  1.00 46.10  ? 36   CYS A SG  1 
ATOM   276   N  N   . ASN A 1 37  ? 86.077 69.555  33.047  1.00 44.97  ? 37   ASN A N   1 
ATOM   277   C  CA  . ASN A 1 37  ? 87.417 69.187  33.470  1.00 44.47  ? 37   ASN A CA  1 
ATOM   278   C  C   . ASN A 1 37  ? 87.583 67.687  33.666  1.00 44.18  ? 37   ASN A C   1 
ATOM   279   O  O   . ASN A 1 37  ? 88.125 67.247  34.673  1.00 44.12  ? 37   ASN A O   1 
ATOM   280   C  CB  . ASN A 1 37  ? 87.838 69.959  34.728  1.00 44.53  ? 37   ASN A CB  1 
ATOM   281   C  CG  . ASN A 1 37  ? 86.652 70.409  35.572  1.00 44.56  ? 37   ASN A CG  1 
ATOM   282   O  OD1 . ASN A 1 37  ? 85.820 69.600  35.982  1.00 44.74  ? 37   ASN A OD1 1 
ATOM   283   N  ND2 . ASN A 1 37  ? 86.578 71.710  35.842  1.00 44.33  ? 37   ASN A ND2 1 
ATOM   284   N  N   . LEU A 1 38  ? 87.114 66.903  32.699  1.00 43.82  ? 38   LEU A N   1 
ATOM   285   C  CA  . LEU A 1 38  ? 87.291 65.454  32.758  1.00 43.48  ? 38   LEU A CA  1 
ATOM   286   C  C   . LEU A 1 38  ? 88.649 65.064  32.183  1.00 43.14  ? 38   LEU A C   1 
ATOM   287   O  O   . LEU A 1 38  ? 89.036 63.903  32.241  1.00 43.05  ? 38   LEU A O   1 
ATOM   288   C  CB  . LEU A 1 38  ? 86.176 64.706  32.011  1.00 43.57  ? 38   LEU A CB  1 
ATOM   289   C  CG  . LEU A 1 38  ? 84.737 64.803  32.535  1.00 43.54  ? 38   LEU A CG  1 
ATOM   290   C  CD1 . LEU A 1 38  ? 84.142 66.139  32.171  1.00 43.02  ? 38   LEU A CD1 1 
ATOM   291   C  CD2 . LEU A 1 38  ? 83.854 63.676  32.005  1.00 43.39  ? 38   LEU A CD2 1 
ATOM   292   N  N   . PHE A 1 39  ? 89.370 66.039  31.635  1.00 42.91  ? 39   PHE A N   1 
ATOM   293   C  CA  . PHE A 1 39  ? 90.685 65.792  31.035  1.00 42.64  ? 39   PHE A CA  1 
ATOM   294   C  C   . PHE A 1 39  ? 91.709 65.250  32.035  1.00 42.51  ? 39   PHE A C   1 
ATOM   295   O  O   . PHE A 1 39  ? 92.147 64.107  31.916  1.00 42.60  ? 39   PHE A O   1 
ATOM   296   C  CB  . PHE A 1 39  ? 91.221 67.047  30.327  1.00 42.62  ? 39   PHE A CB  1 
ATOM   297   C  CG  . PHE A 1 39  ? 91.581 68.175  31.260  1.00 42.67  ? 39   PHE A CG  1 
ATOM   298   C  CD1 . PHE A 1 39  ? 90.611 69.060  31.720  1.00 42.88  ? 39   PHE A CD1 1 
ATOM   299   C  CD2 . PHE A 1 39  ? 92.896 68.363  31.665  1.00 42.41  ? 39   PHE A CD2 1 
ATOM   300   C  CE1 . PHE A 1 39  ? 90.948 70.100  32.576  1.00 42.88  ? 39   PHE A CE1 1 
ATOM   301   C  CE2 . PHE A 1 39  ? 93.239 69.397  32.518  1.00 42.31  ? 39   PHE A CE2 1 
ATOM   302   C  CZ  . PHE A 1 39  ? 92.268 70.266  32.976  1.00 42.63  ? 39   PHE A CZ  1 
ATOM   303   N  N   . VAL A 1 40  ? 92.100 66.071  33.007  1.00 42.29  ? 40   VAL A N   1 
ATOM   304   C  CA  . VAL A 1 40  ? 93.027 65.632  34.047  1.00 42.04  ? 40   VAL A CA  1 
ATOM   305   C  C   . VAL A 1 40  ? 92.187 65.064  35.179  1.00 41.97  ? 40   VAL A C   1 
ATOM   306   O  O   . VAL A 1 40  ? 92.675 64.320  36.029  1.00 41.96  ? 40   VAL A O   1 
ATOM   307   C  CB  . VAL A 1 40  ? 93.901 66.784  34.580  1.00 42.03  ? 40   VAL A CB  1 
ATOM   308   C  CG1 . VAL A 1 40  ? 93.081 67.714  35.464  1.00 41.92  ? 40   VAL A CG1 1 
ATOM   309   C  CG2 . VAL A 1 40  ? 95.098 66.240  35.342  1.00 41.72  ? 40   VAL A CG2 1 
ATOM   310   N  N   . LEU A 1 41  ? 90.912 65.444  35.178  1.00 41.84  ? 41   LEU A N   1 
ATOM   311   C  CA  . LEU A 1 41  ? 89.940 64.946  36.134  1.00 41.67  ? 41   LEU A CA  1 
ATOM   312   C  C   . LEU A 1 41  ? 89.107 63.928  35.378  1.00 41.58  ? 41   LEU A C   1 
ATOM   313   O  O   . LEU A 1 41  ? 89.220 63.821  34.164  1.00 41.61  ? 41   LEU A O   1 
ATOM   314   C  CB  . LEU A 1 41  ? 89.049 66.078  36.641  1.00 41.69  ? 41   LEU A CB  1 
ATOM   315   C  CG  . LEU A 1 41  ? 89.734 67.239  37.362  1.00 41.60  ? 41   LEU A CG  1 
ATOM   316   C  CD1 . LEU A 1 41  ? 88.744 68.362  37.640  1.00 41.40  ? 41   LEU A CD1 1 
ATOM   317   C  CD2 . LEU A 1 41  ? 90.374 66.752  38.649  1.00 40.99  ? 41   LEU A CD2 1 
ATOM   318   N  N   . LYS A 1 42  ? 88.258 63.192  36.079  1.00 41.44  ? 42   LYS A N   1 
ATOM   319   C  CA  . LYS A 1 42  ? 87.449 62.171  35.427  1.00 41.23  ? 42   LYS A CA  1 
ATOM   320   C  C   . LYS A 1 42  ? 85.949 62.304  35.690  1.00 41.14  ? 42   LYS A C   1 
ATOM   321   O  O   . LYS A 1 42  ? 85.140 61.593  35.092  1.00 41.22  ? 42   LYS A O   1 
ATOM   322   C  CB  . LYS A 1 42  ? 87.944 60.780  35.834  1.00 41.20  ? 42   LYS A CB  1 
ATOM   323   C  CG  . LYS A 1 42  ? 88.971 60.772  36.976  1.00 41.11  ? 42   LYS A CG  1 
ATOM   324   C  CD  . LYS A 1 42  ? 88.342 60.815  38.369  1.00 40.68  ? 42   LYS A CD  1 
ATOM   325   C  CE  . LYS A 1 42  ? 88.306 62.221  38.945  1.00 40.12  ? 42   LYS A CE  1 
ATOM   326   N  NZ  . LYS A 1 42  ? 86.969 62.834  38.818  1.00 40.05  ? 42   LYS A NZ  1 
ATOM   327   N  N   . ASP A 1 43  ? 85.575 63.234  36.560  1.00 40.93  ? 43   ASP A N   1 
ATOM   328   C  CA  . ASP A 1 43  ? 84.178 63.360  36.967  1.00 40.75  ? 43   ASP A CA  1 
ATOM   329   C  C   . ASP A 1 43  ? 83.270 64.137  36.021  1.00 40.59  ? 43   ASP A C   1 
ATOM   330   O  O   . ASP A 1 43  ? 83.731 64.917  35.194  1.00 40.65  ? 43   ASP A O   1 
ATOM   331   C  CB  . ASP A 1 43  ? 84.079 63.929  38.388  1.00 40.75  ? 43   ASP A CB  1 
ATOM   332   C  CG  . ASP A 1 43  ? 84.065 62.842  39.449  1.00 40.68  ? 43   ASP A CG  1 
ATOM   333   O  OD1 . ASP A 1 43  ? 83.098 62.051  39.468  1.00 40.71  ? 43   ASP A OD1 1 
ATOM   334   O  OD2 . ASP A 1 43  ? 84.973 62.692  40.296  1.00 40.35  ? 43   ASP A OD2 1 
ATOM   335   N  N   . THR A 1 44  ? 81.970 63.904  36.179  1.00 40.33  ? 44   THR A N   1 
ATOM   336   C  CA  . THR A 1 44  ? 80.915 64.547  35.400  1.00 40.09  ? 44   THR A CA  1 
ATOM   337   C  C   . THR A 1 44  ? 80.032 63.489  34.738  1.00 39.91  ? 44   THR A C   1 
ATOM   338   O  O   . THR A 1 44  ? 79.072 63.006  35.341  1.00 39.78  ? 44   THR A O   1 
ATOM   339   C  CB  . THR A 1 44  ? 81.482 65.522  34.350  1.00 40.12  ? 44   THR A CB  1 
ATOM   340   O  OG1 . THR A 1 44  ? 82.242 66.550  34.998  1.00 39.96  ? 44   THR A OG1 1 
ATOM   341   C  CG2 . THR A 1 44  ? 80.358 66.302  33.709  1.00 40.31  ? 44   THR A CG2 1 
ATOM   342   N  N   . LEU A 1 45  ? 80.374 63.123  33.505  1.00 39.68  ? 45   LEU A N   1 
ATOM   343   C  CA  . LEU A 1 45  ? 79.632 62.115  32.754  1.00 39.46  ? 45   LEU A CA  1 
ATOM   344   C  C   . LEU A 1 45  ? 79.358 60.863  33.575  1.00 39.35  ? 45   LEU A C   1 
ATOM   345   O  O   . LEU A 1 45  ? 78.346 60.194  33.390  1.00 39.46  ? 45   LEU A O   1 
ATOM   346   C  CB  . LEU A 1 45  ? 80.399 61.726  31.495  1.00 39.34  ? 45   LEU A CB  1 
ATOM   347   C  CG  . LEU A 1 45  ? 79.550 61.399  30.270  1.00 39.40  ? 45   LEU A CG  1 
ATOM   348   C  CD1 . LEU A 1 45  ? 78.291 62.271  30.216  1.00 39.23  ? 45   LEU A CD1 1 
ATOM   349   C  CD2 . LEU A 1 45  ? 80.386 61.596  29.030  1.00 39.07  ? 45   LEU A CD2 1 
ATOM   350   N  N   . LYS A 1 46  ? 80.270 60.544  34.480  1.00 39.23  ? 46   LYS A N   1 
ATOM   351   C  CA  . LYS A 1 46  ? 80.115 59.371  35.327  1.00 39.13  ? 46   LYS A CA  1 
ATOM   352   C  C   . LYS A 1 46  ? 78.796 59.380  36.111  1.00 39.06  ? 46   LYS A C   1 
ATOM   353   O  O   . LYS A 1 46  ? 77.956 58.494  35.937  1.00 38.81  ? 46   LYS A O   1 
ATOM   354   C  CB  . LYS A 1 46  ? 81.319 59.245  36.264  1.00 39.14  ? 46   LYS A CB  1 
ATOM   355   C  CG  . LYS A 1 46  ? 82.634 59.158  35.512  1.00 39.16  ? 46   LYS A CG  1 
ATOM   356   C  CD  . LYS A 1 46  ? 83.731 58.569  36.365  1.00 39.85  ? 46   LYS A CD  1 
ATOM   357   C  CE  . LYS A 1 46  ? 84.767 59.604  36.762  1.00 40.49  ? 46   LYS A CE  1 
ATOM   358   N  NZ  . LYS A 1 46  ? 84.411 60.390  37.968  1.00 40.95  ? 46   LYS A NZ  1 
ATOM   359   N  N   . LYS A 1 47  ? 78.622 60.387  36.965  1.00 39.09  ? 47   LYS A N   1 
ATOM   360   C  CA  . LYS A 1 47  ? 77.417 60.527  37.780  1.00 39.16  ? 47   LYS A CA  1 
ATOM   361   C  C   . LYS A 1 47  ? 76.176 60.611  36.896  1.00 39.25  ? 47   LYS A C   1 
ATOM   362   O  O   . LYS A 1 47  ? 75.075 60.232  37.307  1.00 39.33  ? 47   LYS A O   1 
ATOM   363   C  CB  . LYS A 1 47  ? 77.519 61.763  38.684  1.00 39.13  ? 47   LYS A CB  1 
ATOM   364   C  CG  . LYS A 1 47  ? 78.503 61.612  39.837  1.00 39.25  ? 47   LYS A CG  1 
ATOM   365   C  CD  . LYS A 1 47  ? 79.092 62.950  40.287  1.00 39.53  ? 47   LYS A CD  1 
ATOM   366   C  CE  . LYS A 1 47  ? 78.336 63.559  41.463  1.00 39.77  ? 47   LYS A CE  1 
ATOM   367   N  NZ  . LYS A 1 47  ? 77.159 64.367  41.041  1.00 39.65  ? 47   LYS A NZ  1 
ATOM   368   N  N   . MET A 1 48  ? 76.363 61.117  35.682  1.00 39.24  ? 48   MET A N   1 
ATOM   369   C  CA  . MET A 1 48  ? 75.284 61.211  34.712  1.00 39.20  ? 48   MET A CA  1 
ATOM   370   C  C   . MET A 1 48  ? 74.774 59.814  34.430  1.00 39.28  ? 48   MET A C   1 
ATOM   371   O  O   . MET A 1 48  ? 73.571 59.565  34.429  1.00 39.31  ? 48   MET A O   1 
ATOM   372   C  CB  . MET A 1 48  ? 75.789 61.854  33.420  1.00 39.13  ? 48   MET A CB  1 
ATOM   373   C  CG  . MET A 1 48  ? 74.702 62.394  32.522  1.00 39.10  ? 48   MET A CG  1 
ATOM   374   S  SD  . MET A 1 48  ? 73.862 61.135  31.562  1.00 39.41  ? 48   MET A SD  1 
ATOM   375   C  CE  . MET A 1 48  ? 75.105 60.783  30.367  1.00 39.01  ? 48   MET A CE  1 
ATOM   376   N  N   . GLN A 1 49  ? 75.711 58.899  34.209  1.00 39.46  ? 49   GLN A N   1 
ATOM   377   C  CA  . GLN A 1 49  ? 75.390 57.509  33.919  1.00 39.55  ? 49   GLN A CA  1 
ATOM   378   C  C   . GLN A 1 49  ? 75.018 56.729  35.175  1.00 39.62  ? 49   GLN A C   1 
ATOM   379   O  O   . GLN A 1 49  ? 74.407 55.667  35.084  1.00 39.66  ? 49   GLN A O   1 
ATOM   380   C  CB  . GLN A 1 49  ? 76.540 56.850  33.162  1.00 39.48  ? 49   GLN A CB  1 
ATOM   381   C  CG  . GLN A 1 49  ? 76.899 57.633  31.920  1.00 39.32  ? 49   GLN A CG  1 
ATOM   382   C  CD  . GLN A 1 49  ? 77.981 56.986  31.109  1.00 39.16  ? 49   GLN A CD  1 
ATOM   383   O  OE1 . GLN A 1 49  ? 78.992 56.551  31.651  1.00 39.29  ? 49   GLN A OE1 1 
ATOM   384   N  NE2 . GLN A 1 49  ? 77.779 56.924  29.801  1.00 39.19  ? 49   GLN A NE2 1 
ATOM   385   N  N   . LYS A 1 50  ? 75.401 57.246  36.342  1.00 39.68  ? 50   LYS A N   1 
ATOM   386   C  CA  . LYS A 1 50  ? 74.952 56.657  37.594  1.00 39.66  ? 50   LYS A CA  1 
ATOM   387   C  C   . LYS A 1 50  ? 73.445 56.737  37.475  1.00 39.46  ? 50   LYS A C   1 
ATOM   388   O  O   . LYS A 1 50  ? 72.748 55.724  37.435  1.00 39.51  ? 50   LYS A O   1 
ATOM   389   C  CB  . LYS A 1 50  ? 75.415 57.483  38.793  1.00 39.80  ? 50   LYS A CB  1 
ATOM   390   C  CG  . LYS A 1 50  ? 74.715 57.113  40.103  1.00 40.17  ? 50   LYS A CG  1 
ATOM   391   C  CD  . LYS A 1 50  ? 74.650 58.289  41.078  1.00 40.32  ? 50   LYS A CD  1 
ATOM   392   C  CE  . LYS A 1 50  ? 73.761 59.412  40.552  1.00 40.06  ? 50   LYS A CE  1 
ATOM   393   N  NZ  . LYS A 1 50  ? 73.539 60.480  41.573  1.00 40.15  ? 50   LYS A NZ  1 
ATOM   394   N  N   . PHE A 1 51  ? 72.948 57.965  37.408  1.00 39.18  ? 51   PHE A N   1 
ATOM   395   C  CA  . PHE A 1 51  ? 71.548 58.188  37.141  1.00 38.96  ? 51   PHE A CA  1 
ATOM   396   C  C   . PHE A 1 51  ? 71.248 57.403  35.878  1.00 39.03  ? 51   PHE A C   1 
ATOM   397   O  O   . PHE A 1 51  ? 72.157 57.084  35.114  1.00 38.97  ? 51   PHE A O   1 
ATOM   398   C  CB  . PHE A 1 51  ? 71.310 59.675  36.862  1.00 38.88  ? 51   PHE A CB  1 
ATOM   399   C  CG  . PHE A 1 51  ? 70.400 60.352  37.847  1.00 38.42  ? 51   PHE A CG  1 
ATOM   400   C  CD1 . PHE A 1 51  ? 70.809 60.593  39.143  1.00 38.29  ? 51   PHE A CD1 1 
ATOM   401   C  CD2 . PHE A 1 51  ? 69.131 60.760  37.465  1.00 37.85  ? 51   PHE A CD2 1 
ATOM   402   C  CE1 . PHE A 1 51  ? 69.969 61.223  40.042  1.00 38.11  ? 51   PHE A CE1 1 
ATOM   403   C  CE2 . PHE A 1 51  ? 68.286 61.385  38.359  1.00 37.27  ? 51   PHE A CE2 1 
ATOM   404   C  CZ  . PHE A 1 51  ? 68.704 61.619  39.646  1.00 37.43  ? 51   PHE A CZ  1 
ATOM   405   N  N   . PHE A 1 52  ? 69.981 57.064  35.675  1.00 39.11  ? 52   PHE A N   1 
ATOM   406   C  CA  . PHE A 1 52  ? 69.536 56.474  34.412  1.00 39.10  ? 52   PHE A CA  1 
ATOM   407   C  C   . PHE A 1 52  ? 70.057 55.079  34.062  1.00 39.15  ? 52   PHE A C   1 
ATOM   408   O  O   . PHE A 1 52  ? 70.248 54.776  32.886  1.00 39.31  ? 52   PHE A O   1 
ATOM   409   C  CB  . PHE A 1 52  ? 69.878 57.426  33.265  1.00 38.91  ? 52   PHE A CB  1 
ATOM   410   C  CG  . PHE A 1 52  ? 69.310 58.798  33.434  1.00 38.86  ? 52   PHE A CG  1 
ATOM   411   C  CD1 . PHE A 1 52  ? 67.964 58.972  33.702  1.00 38.77  ? 52   PHE A CD1 1 
ATOM   412   C  CD2 . PHE A 1 52  ? 70.116 59.915  33.322  1.00 38.70  ? 52   PHE A CD2 1 
ATOM   413   C  CE1 . PHE A 1 52  ? 67.431 60.232  33.847  1.00 38.75  ? 52   PHE A CE1 1 
ATOM   414   C  CE2 . PHE A 1 52  ? 69.584 61.181  33.473  1.00 38.87  ? 52   PHE A CE2 1 
ATOM   415   C  CZ  . PHE A 1 52  ? 68.240 61.339  33.736  1.00 38.58  ? 52   PHE A CZ  1 
ATOM   416   N  N   . GLY A 1 53  ? 70.260 54.222  35.054  1.00 39.08  ? 53   GLY A N   1 
ATOM   417   C  CA  . GLY A 1 53  ? 70.761 52.893  34.765  1.00 39.12  ? 53   GLY A CA  1 
ATOM   418   C  C   . GLY A 1 53  ? 72.249 53.017  34.546  1.00 39.22  ? 53   GLY A C   1 
ATOM   419   O  O   . GLY A 1 53  ? 72.694 53.880  33.794  1.00 39.14  ? 53   GLY A O   1 
ATOM   420   N  N   . LEU A 1 54  ? 73.016 52.145  35.193  1.00 39.35  ? 54   LEU A N   1 
ATOM   421   C  CA  . LEU A 1 54  ? 74.474 52.242  35.199  1.00 39.44  ? 54   LEU A CA  1 
ATOM   422   C  C   . LEU A 1 54  ? 75.249 51.595  34.040  1.00 39.59  ? 54   LEU A C   1 
ATOM   423   O  O   . LEU A 1 54  ? 75.943 50.595  34.240  1.00 39.57  ? 54   LEU A O   1 
ATOM   424   C  CB  . LEU A 1 54  ? 75.012 51.712  36.532  1.00 39.42  ? 54   LEU A CB  1 
ATOM   425   C  CG  . LEU A 1 54  ? 74.587 50.296  36.941  1.00 39.49  ? 54   LEU A CG  1 
ATOM   426   C  CD1 . LEU A 1 54  ? 75.536 49.718  37.998  1.00 39.37  ? 54   LEU A CD1 1 
ATOM   427   C  CD2 . LEU A 1 54  ? 73.139 50.263  37.426  1.00 39.30  ? 54   LEU A CD2 1 
ATOM   428   N  N   . PRO A 1 55  ? 75.141 52.156  32.835  1.00 39.67  ? 55   PRO A N   1 
ATOM   429   C  CA  . PRO A 1 55  ? 75.959 51.703  31.709  1.00 39.75  ? 55   PRO A CA  1 
ATOM   430   C  C   . PRO A 1 55  ? 77.243 52.526  31.719  1.00 39.85  ? 55   PRO A C   1 
ATOM   431   O  O   . PRO A 1 55  ? 77.588 53.131  30.702  1.00 39.94  ? 55   PRO A O   1 
ATOM   432   C  CB  . PRO A 1 55  ? 75.116 52.098  30.492  1.00 39.68  ? 55   PRO A CB  1 
ATOM   433   C  CG  . PRO A 1 55  ? 73.853 52.714  31.063  1.00 39.69  ? 55   PRO A CG  1 
ATOM   434   C  CD  . PRO A 1 55  ? 74.220 53.223  32.421  1.00 39.56  ? 55   PRO A CD  1 
ATOM   435   N  N   . GLN A 1 56  ? 77.924 52.554  32.864  1.00 39.82  ? 56   GLN A N   1 
ATOM   436   C  CA  . GLN A 1 56  ? 79.117 53.374  33.050  1.00 39.85  ? 56   GLN A CA  1 
ATOM   437   C  C   . GLN A 1 56  ? 80.291 52.933  32.198  1.00 40.01  ? 56   GLN A C   1 
ATOM   438   O  O   . GLN A 1 56  ? 80.980 51.976  32.542  1.00 40.33  ? 56   GLN A O   1 
ATOM   439   C  CB  . GLN A 1 56  ? 79.548 53.369  34.518  1.00 39.74  ? 56   GLN A CB  1 
ATOM   440   C  CG  . GLN A 1 56  ? 78.512 53.890  35.495  1.00 39.71  ? 56   GLN A CG  1 
ATOM   441   C  CD  . GLN A 1 56  ? 79.089 54.117  36.884  1.00 39.74  ? 56   GLN A CD  1 
ATOM   442   O  OE1 . GLN A 1 56  ? 80.205 54.621  37.026  1.00 39.29  ? 56   GLN A OE1 1 
ATOM   443   N  NE2 . GLN A 1 56  ? 78.331 53.745  37.910  1.00 39.92  ? 56   GLN A NE2 1 
ATOM   444   N  N   . THR A 1 57  ? 80.531 53.636  31.096  1.00 40.16  ? 57   THR A N   1 
ATOM   445   C  CA  . THR A 1 57  ? 81.663 53.327  30.231  1.00 40.35  ? 57   THR A CA  1 
ATOM   446   C  C   . THR A 1 57  ? 82.597 54.514  30.220  1.00 40.52  ? 57   THR A C   1 
ATOM   447   O  O   . THR A 1 57  ? 83.775 54.400  29.906  1.00 40.56  ? 57   THR A O   1 
ATOM   448   C  CB  . THR A 1 57  ? 81.202 53.098  28.794  1.00 40.31  ? 57   THR A CB  1 
ATOM   449   O  OG1 . THR A 1 57  ? 81.050 54.367  28.148  1.00 40.38  ? 57   THR A OG1 1 
ATOM   450   C  CG2 . THR A 1 57  ? 79.806 52.505  28.758  1.00 40.44  ? 57   THR A CG2 1 
ATOM   451   N  N   . GLY A 1 58  ? 82.048 55.663  30.568  1.00 40.80  ? 58   GLY A N   1 
ATOM   452   C  CA  . GLY A 1 58  ? 82.776 56.906  30.503  1.00 41.24  ? 58   GLY A CA  1 
ATOM   453   C  C   . GLY A 1 58  ? 81.852 57.788  29.703  1.00 41.67  ? 58   GLY A C   1 
ATOM   454   O  O   . GLY A 1 58  ? 80.647 57.797  29.946  1.00 41.87  ? 58   GLY A O   1 
ATOM   455   N  N   . ASP A 1 59  ? 82.389 58.505  28.727  1.00 41.98  ? 59   ASP A N   1 
ATOM   456   C  CA  . ASP A 1 59  ? 81.553 59.370  27.906  1.00 42.32  ? 59   ASP A CA  1 
ATOM   457   C  C   . ASP A 1 59  ? 80.492 58.604  27.100  1.00 42.56  ? 59   ASP A C   1 
ATOM   458   O  O   . ASP A 1 59  ? 79.485 59.183  26.692  1.00 42.60  ? 59   ASP A O   1 
ATOM   459   C  CB  . ASP A 1 59  ? 82.420 60.259  27.015  1.00 42.27  ? 59   ASP A CB  1 
ATOM   460   C  CG  . ASP A 1 59  ? 83.876 59.825  27.007  1.00 42.73  ? 59   ASP A CG  1 
ATOM   461   O  OD1 . ASP A 1 59  ? 84.257 58.706  27.420  1.00 42.87  ? 59   ASP A OD1 1 
ATOM   462   O  OD2 . ASP A 1 59  ? 84.736 60.626  26.578  1.00 43.15  ? 59   ASP A OD2 1 
ATOM   463   N  N   . LEU A 1 60  ? 80.711 57.305  26.895  1.00 42.86  ? 60   LEU A N   1 
ATOM   464   C  CA  . LEU A 1 60  ? 79.773 56.456  26.152  1.00 43.15  ? 60   LEU A CA  1 
ATOM   465   C  C   . LEU A 1 60  ? 79.015 57.238  25.095  1.00 43.33  ? 60   LEU A C   1 
ATOM   466   O  O   . LEU A 1 60  ? 77.786 57.216  25.058  1.00 43.42  ? 60   LEU A O   1 
ATOM   467   C  CB  . LEU A 1 60  ? 78.766 55.796  27.098  1.00 43.20  ? 60   LEU A CB  1 
ATOM   468   C  CG  . LEU A 1 60  ? 77.550 55.146  26.426  1.00 43.33  ? 60   LEU A CG  1 
ATOM   469   C  CD1 . LEU A 1 60  ? 77.943 53.842  25.760  1.00 43.39  ? 60   LEU A CD1 1 
ATOM   470   C  CD2 . LEU A 1 60  ? 76.417 54.923  27.416  1.00 43.34  ? 60   LEU A CD2 1 
ATOM   471   N  N   . ASP A 1 61  ? 79.746 57.915  24.222  1.00 43.61  ? 61   ASP A N   1 
ATOM   472   C  CA  . ASP A 1 61  ? 79.119 58.781  23.229  1.00 44.01  ? 61   ASP A CA  1 
ATOM   473   C  C   . ASP A 1 61  ? 78.174 58.054  22.261  1.00 44.01  ? 61   ASP A C   1 
ATOM   474   O  O   . ASP A 1 61  ? 77.425 58.690  21.510  1.00 43.82  ? 61   ASP A O   1 
ATOM   475   C  CB  . ASP A 1 61  ? 80.194 59.569  22.477  1.00 44.22  ? 61   ASP A CB  1 
ATOM   476   C  CG  . ASP A 1 61  ? 81.226 60.170  23.414  1.00 44.67  ? 61   ASP A CG  1 
ATOM   477   O  OD1 . ASP A 1 61  ? 81.168 60.023  24.651  1.00 44.74  ? 61   ASP A OD1 1 
ATOM   478   O  OD2 . ASP A 1 61  ? 82.166 60.844  22.940  1.00 45.66  ? 61   ASP A OD2 1 
ATOM   479   N  N   . GLN A 1 62  ? 78.192 56.724  22.303  1.00 43.99  ? 62   GLN A N   1 
ATOM   480   C  CA  . GLN A 1 62  ? 77.364 55.933  21.394  1.00 43.89  ? 62   GLN A CA  1 
ATOM   481   C  C   . GLN A 1 62  ? 75.955 55.661  21.921  1.00 43.68  ? 62   GLN A C   1 
ATOM   482   O  O   . GLN A 1 62  ? 75.002 55.628  21.148  1.00 43.52  ? 62   GLN A O   1 
ATOM   483   C  CB  . GLN A 1 62  ? 78.064 54.615  21.034  1.00 43.87  ? 62   GLN A CB  1 
ATOM   484   C  CG  . GLN A 1 62  ? 77.812 53.481  22.011  1.00 43.78  ? 62   GLN A CG  1 
ATOM   485   C  CD  . GLN A 1 62  ? 78.802 52.345  21.853  1.00 43.61  ? 62   GLN A CD  1 
ATOM   486   O  OE1 . GLN A 1 62  ? 79.432 51.928  22.825  1.00 43.62  ? 62   GLN A OE1 1 
ATOM   487   N  NE2 . GLN A 1 62  ? 78.945 51.843  20.632  1.00 43.69  ? 62   GLN A NE2 1 
ATOM   488   N  N   . ASN A 1 63  ? 75.826 55.478  23.232  1.00 43.60  ? 63   ASN A N   1 
ATOM   489   C  CA  . ASN A 1 63  ? 74.535 55.131  23.823  1.00 43.57  ? 63   ASN A CA  1 
ATOM   490   C  C   . ASN A 1 63  ? 73.982 56.157  24.817  1.00 43.60  ? 63   ASN A C   1 
ATOM   491   O  O   . ASN A 1 63  ? 72.765 56.263  25.008  1.00 43.30  ? 63   ASN A O   1 
ATOM   492   C  CB  . ASN A 1 63  ? 74.627 53.755  24.488  1.00 43.44  ? 63   ASN A CB  1 
ATOM   493   C  CG  . ASN A 1 63  ? 73.279 53.079  24.614  1.00 43.40  ? 63   ASN A CG  1 
ATOM   494   O  OD1 . ASN A 1 63  ? 72.239 53.739  24.581  1.00 43.07  ? 63   ASN A OD1 1 
ATOM   495   N  ND2 . ASN A 1 63  ? 73.287 51.754  24.755  1.00 43.19  ? 63   ASN A ND2 1 
ATOM   496   N  N   . THR A 1 64  ? 74.878 56.915  25.442  1.00 43.67  ? 64   THR A N   1 
ATOM   497   C  CA  . THR A 1 64  ? 74.479 57.882  26.458  1.00 43.68  ? 64   THR A CA  1 
ATOM   498   C  C   . THR A 1 64  ? 73.935 59.169  25.860  1.00 43.58  ? 64   THR A C   1 
ATOM   499   O  O   . THR A 1 64  ? 72.962 59.723  26.367  1.00 43.82  ? 64   THR A O   1 
ATOM   500   C  CB  . THR A 1 64  ? 75.658 58.203  27.397  1.00 43.72  ? 64   THR A CB  1 
ATOM   501   O  OG1 . THR A 1 64  ? 75.218 58.146  28.760  1.00 44.00  ? 64   THR A OG1 1 
ATOM   502   C  CG2 . THR A 1 64  ? 76.117 59.647  27.218  1.00 43.61  ? 64   THR A CG2 1 
ATOM   503   N  N   . ILE A 1 65  ? 74.555 59.646  24.784  1.00 43.39  ? 65   ILE A N   1 
ATOM   504   C  CA  . ILE A 1 65  ? 74.115 60.896  24.172  1.00 43.20  ? 65   ILE A CA  1 
ATOM   505   C  C   . ILE A 1 65  ? 72.656 60.840  23.756  1.00 43.06  ? 65   ILE A C   1 
ATOM   506   O  O   . ILE A 1 65  ? 72.058 61.872  23.474  1.00 43.38  ? 65   ILE A O   1 
ATOM   507   C  CB  . ILE A 1 65  ? 74.992 61.299  22.967  1.00 43.16  ? 65   ILE A CB  1 
ATOM   508   C  CG1 . ILE A 1 65  ? 74.815 60.305  21.814  1.00 43.44  ? 65   ILE A CG1 1 
ATOM   509   C  CG2 . ILE A 1 65  ? 76.444 61.435  23.387  1.00 43.14  ? 65   ILE A CG2 1 
ATOM   510   C  CD1 . ILE A 1 65  ? 75.308 60.815  20.470  1.00 43.35  ? 65   ILE A CD1 1 
ATOM   511   N  N   . GLU A 1 66  ? 72.076 59.646  23.712  1.00 42.75  ? 66   GLU A N   1 
ATOM   512   C  CA  . GLU A 1 66  ? 70.666 59.549  23.358  1.00 42.66  ? 66   GLU A CA  1 
ATOM   513   C  C   . GLU A 1 66  ? 69.757 59.838  24.548  1.00 42.30  ? 66   GLU A C   1 
ATOM   514   O  O   . GLU A 1 66  ? 68.561 60.082  24.378  1.00 42.33  ? 66   GLU A O   1 
ATOM   515   C  CB  . GLU A 1 66  ? 70.325 58.200  22.721  1.00 42.71  ? 66   GLU A CB  1 
ATOM   516   C  CG  . GLU A 1 66  ? 70.609 58.137  21.224  1.00 43.79  ? 66   GLU A CG  1 
ATOM   517   C  CD  . GLU A 1 66  ? 70.346 59.456  20.501  1.00 45.53  ? 66   GLU A CD  1 
ATOM   518   O  OE1 . GLU A 1 66  ? 69.184 59.934  20.498  1.00 45.86  ? 66   GLU A OE1 1 
ATOM   519   O  OE2 . GLU A 1 66  ? 71.310 60.021  19.928  1.00 45.98  ? 66   GLU A OE2 1 
ATOM   520   N  N   . THR A 1 67  ? 70.330 59.835  25.747  1.00 41.82  ? 67   THR A N   1 
ATOM   521   C  CA  . THR A 1 67  ? 69.546 60.077  26.949  1.00 41.39  ? 67   THR A CA  1 
ATOM   522   C  C   . THR A 1 67  ? 69.447 61.566  27.280  1.00 41.36  ? 67   THR A C   1 
ATOM   523   O  O   . THR A 1 67  ? 68.418 62.026  27.776  1.00 41.40  ? 67   THR A O   1 
ATOM   524   C  CB  . THR A 1 67  ? 70.069 59.231  28.139  1.00 41.39  ? 67   THR A CB  1 
ATOM   525   O  OG1 . THR A 1 67  ? 69.789 57.846  27.898  1.00 40.92  ? 67   THR A OG1 1 
ATOM   526   C  CG2 . THR A 1 67  ? 69.270 59.511  29.404  1.00 41.13  ? 67   THR A CG2 1 
ATOM   527   N  N   . MET A 1 68  ? 70.498 62.332  27.000  1.00 41.22  ? 68   MET A N   1 
ATOM   528   C  CA  . MET A 1 68  ? 70.414 63.779  27.202  1.00 41.15  ? 68   MET A CA  1 
ATOM   529   C  C   . MET A 1 68  ? 69.696 64.381  26.007  1.00 40.78  ? 68   MET A C   1 
ATOM   530   O  O   . MET A 1 68  ? 69.603 65.596  25.864  1.00 40.83  ? 68   MET A O   1 
ATOM   531   C  CB  . MET A 1 68  ? 71.796 64.413  27.355  1.00 41.44  ? 68   MET A CB  1 
ATOM   532   C  CG  . MET A 1 68  ? 72.255 64.653  28.804  1.00 42.35  ? 68   MET A CG  1 
ATOM   533   S  SD  . MET A 1 68  ? 71.345 65.962  29.687  1.00 42.96  ? 68   MET A SD  1 
ATOM   534   C  CE  . MET A 1 68  ? 70.250 64.978  30.764  1.00 42.38  ? 68   MET A CE  1 
ATOM   535   N  N   . ARG A 1 69  ? 69.191 63.505  25.148  1.00 40.34  ? 69   ARG A N   1 
ATOM   536   C  CA  . ARG A 1 69  ? 68.484 63.909  23.946  1.00 39.99  ? 69   ARG A CA  1 
ATOM   537   C  C   . ARG A 1 69  ? 66.978 63.701  24.161  1.00 39.23  ? 69   ARG A C   1 
ATOM   538   O  O   . ARG A 1 69  ? 66.154 63.986  23.291  1.00 38.83  ? 69   ARG A O   1 
ATOM   539   C  CB  . ARG A 1 69  ? 69.019 63.103  22.751  1.00 40.35  ? 69   ARG A CB  1 
ATOM   540   C  CG  . ARG A 1 69  ? 68.604 63.616  21.363  1.00 41.87  ? 69   ARG A CG  1 
ATOM   541   C  CD  . ARG A 1 69  ? 69.398 63.011  20.198  1.00 43.82  ? 69   ARG A CD  1 
ATOM   542   N  NE  . ARG A 1 69  ? 70.334 63.970  19.607  1.00 45.76  ? 69   ARG A NE  1 
ATOM   543   C  CZ  . ARG A 1 69  ? 70.379 64.276  18.313  1.00 46.12  ? 69   ARG A CZ  1 
ATOM   544   N  NH1 . ARG A 1 69  ? 69.550 63.692  17.457  1.00 46.42  ? 69   ARG A NH1 1 
ATOM   545   N  NH2 . ARG A 1 69  ? 71.261 65.160  17.869  1.00 46.40  ? 69   ARG A NH2 1 
ATOM   546   N  N   . LYS A 1 70  ? 66.630 63.209  25.345  1.00 38.63  ? 70   LYS A N   1 
ATOM   547   C  CA  . LYS A 1 70  ? 65.236 62.981  25.713  1.00 38.01  ? 70   LYS A CA  1 
ATOM   548   C  C   . LYS A 1 70  ? 64.689 64.151  26.526  1.00 37.45  ? 70   LYS A C   1 
ATOM   549   O  O   . LYS A 1 70  ? 65.418 64.791  27.280  1.00 37.54  ? 70   LYS A O   1 
ATOM   550   C  CB  . LYS A 1 70  ? 65.090 61.669  26.489  1.00 38.01  ? 70   LYS A CB  1 
ATOM   551   C  CG  . LYS A 1 70  ? 65.253 60.418  25.638  1.00 37.88  ? 70   LYS A CG  1 
ATOM   552   C  CD  . LYS A 1 70  ? 65.250 59.155  26.493  1.00 38.38  ? 70   LYS A CD  1 
ATOM   553   C  CE  . LYS A 1 70  ? 65.157 57.885  25.641  1.00 38.68  ? 70   LYS A CE  1 
ATOM   554   N  NZ  . LYS A 1 70  ? 65.000 56.643  26.466  1.00 38.07  ? 70   LYS A NZ  1 
ATOM   555   N  N   . PRO A 1 71  ? 63.390 64.384  26.412  1.00 36.88  ? 71   PRO A N   1 
ATOM   556   C  CA  . PRO A 1 71  ? 62.724 65.526  27.037  1.00 36.49  ? 71   PRO A CA  1 
ATOM   557   C  C   . PRO A 1 71  ? 62.729 65.344  28.532  1.00 35.91  ? 71   PRO A C   1 
ATOM   558   O  O   . PRO A 1 71  ? 62.267 64.313  29.008  1.00 36.13  ? 71   PRO A O   1 
ATOM   559   C  CB  . PRO A 1 71  ? 61.302 65.366  26.537  1.00 36.62  ? 71   PRO A CB  1 
ATOM   560   C  CG  . PRO A 1 71  ? 61.171 63.877  26.531  1.00 37.01  ? 71   PRO A CG  1 
ATOM   561   C  CD  . PRO A 1 71  ? 62.417 63.495  25.761  1.00 37.10  ? 71   PRO A CD  1 
ATOM   562   N  N   . ARG A 1 72  ? 63.216 66.327  29.272  1.00 35.09  ? 72   ARG A N   1 
ATOM   563   C  CA  . ARG A 1 72  ? 63.330 66.152  30.707  1.00 34.26  ? 72   ARG A CA  1 
ATOM   564   C  C   . ARG A 1 72  ? 62.907 67.374  31.510  1.00 33.64  ? 72   ARG A C   1 
ATOM   565   O  O   . ARG A 1 72  ? 62.532 68.398  30.950  1.00 33.77  ? 72   ARG A O   1 
ATOM   566   C  CB  . ARG A 1 72  ? 64.765 65.753  31.033  1.00 34.39  ? 72   ARG A CB  1 
ATOM   567   C  CG  . ARG A 1 72  ? 65.747 66.889  31.040  1.00 34.44  ? 72   ARG A CG  1 
ATOM   568   C  CD  . ARG A 1 72  ? 66.286 67.173  32.415  1.00 35.28  ? 72   ARG A CD  1 
ATOM   569   N  NE  . ARG A 1 72  ? 67.038 66.032  32.920  1.00 36.56  ? 72   ARG A NE  1 
ATOM   570   C  CZ  . ARG A 1 72  ? 67.482 65.922  34.165  1.00 37.20  ? 72   ARG A CZ  1 
ATOM   571   N  NH1 . ARG A 1 72  ? 67.241 66.890  35.038  1.00 37.30  ? 72   ARG A NH1 1 
ATOM   572   N  NH2 . ARG A 1 72  ? 68.167 64.845  34.539  1.00 36.90  ? 72   ARG A NH2 1 
ATOM   573   N  N   . CYS A 1 73  ? 62.950 67.246  32.828  1.00 32.79  ? 73   CYS A N   1 
ATOM   574   C  CA  . CYS A 1 73  ? 62.621 68.336  33.728  1.00 32.05  ? 73   CYS A CA  1 
ATOM   575   C  C   . CYS A 1 73  ? 63.755 69.349  33.674  1.00 32.02  ? 73   CYS A C   1 
ATOM   576   O  O   . CYS A 1 73  ? 64.883 68.997  33.357  1.00 32.02  ? 73   CYS A O   1 
ATOM   577   C  CB  . CYS A 1 73  ? 62.445 67.785  35.135  1.00 31.82  ? 73   CYS A CB  1 
ATOM   578   S  SG  . CYS A 1 73  ? 62.206 69.002  36.428  1.00 31.06  ? 73   CYS A SG  1 
ATOM   579   N  N   . GLY A 1 74  ? 63.471 70.606  33.968  1.00 31.95  ? 74   GLY A N   1 
ATOM   580   C  CA  . GLY A 1 74  ? 64.498 71.622  33.869  1.00 32.35  ? 74   GLY A CA  1 
ATOM   581   C  C   . GLY A 1 74  ? 65.399 71.637  35.080  1.00 32.82  ? 74   GLY A C   1 
ATOM   582   O  O   . GLY A 1 74  ? 66.412 72.338  35.110  1.00 32.69  ? 74   GLY A O   1 
ATOM   583   N  N   . ASN A 1 75  ? 65.025 70.845  36.078  1.00 33.35  ? 75   ASN A N   1 
ATOM   584   C  CA  . ASN A 1 75  ? 65.734 70.792  37.353  1.00 33.82  ? 75   ASN A CA  1 
ATOM   585   C  C   . ASN A 1 75  ? 67.004 69.950  37.349  1.00 34.34  ? 75   ASN A C   1 
ATOM   586   O  O   . ASN A 1 75  ? 67.128 68.998  36.585  1.00 34.43  ? 75   ASN A O   1 
ATOM   587   C  CB  . ASN A 1 75  ? 64.790 70.283  38.448  1.00 33.73  ? 75   ASN A CB  1 
ATOM   588   C  CG  . ASN A 1 75  ? 63.912 71.374  39.009  1.00 33.69  ? 75   ASN A CG  1 
ATOM   589   O  OD1 . ASN A 1 75  ? 64.400 72.419  39.426  1.00 34.07  ? 75   ASN A OD1 1 
ATOM   590   N  ND2 . ASN A 1 75  ? 62.611 71.140  39.021  1.00 34.09  ? 75   ASN A ND2 1 
ATOM   591   N  N   . PRO A 1 76  ? 67.953 70.315  38.202  1.00 34.82  ? 76   PRO A N   1 
ATOM   592   C  CA  . PRO A 1 76  ? 69.186 69.549  38.356  1.00 35.40  ? 76   PRO A CA  1 
ATOM   593   C  C   . PRO A 1 76  ? 68.930 68.250  39.110  1.00 36.12  ? 76   PRO A C   1 
ATOM   594   O  O   . PRO A 1 76  ? 67.953 68.148  39.853  1.00 36.01  ? 76   PRO A O   1 
ATOM   595   C  CB  . PRO A 1 76  ? 70.055 70.475  39.204  1.00 35.32  ? 76   PRO A CB  1 
ATOM   596   C  CG  . PRO A 1 76  ? 69.400 71.806  39.100  1.00 34.89  ? 76   PRO A CG  1 
ATOM   597   C  CD  . PRO A 1 76  ? 67.946 71.512  39.054  1.00 34.84  ? 76   PRO A CD  1 
ATOM   598   N  N   . ASP A 1 77  ? 69.808 67.273  38.914  1.00 37.04  ? 77   ASP A N   1 
ATOM   599   C  CA  . ASP A 1 77  ? 69.692 65.986  39.583  1.00 38.12  ? 77   ASP A CA  1 
ATOM   600   C  C   . ASP A 1 77  ? 70.542 65.964  40.845  1.00 38.86  ? 77   ASP A C   1 
ATOM   601   O  O   . ASP A 1 77  ? 70.241 65.252  41.806  1.00 38.81  ? 77   ASP A O   1 
ATOM   602   C  CB  . ASP A 1 77  ? 70.148 64.871  38.649  1.00 38.08  ? 77   ASP A CB  1 
ATOM   603   C  CG  . ASP A 1 77  ? 69.562 65.003  37.267  1.00 38.26  ? 77   ASP A CG  1 
ATOM   604   O  OD1 . ASP A 1 77  ? 68.389 65.434  37.151  1.00 36.93  ? 77   ASP A OD1 1 
ATOM   605   O  OD2 . ASP A 1 77  ? 70.207 64.697  36.241  1.00 39.02  ? 77   ASP A OD2 1 
ATOM   606   N  N   . VAL A 1 78  ? 71.613 66.748  40.825  1.00 39.95  ? 78   VAL A N   1 
ATOM   607   C  CA  . VAL A 1 78  ? 72.529 66.840  41.953  1.00 40.95  ? 78   VAL A CA  1 
ATOM   608   C  C   . VAL A 1 78  ? 72.394 68.188  42.644  1.00 41.85  ? 78   VAL A C   1 
ATOM   609   O  O   . VAL A 1 78  ? 71.717 69.091  42.144  1.00 41.90  ? 78   VAL A O   1 
ATOM   610   C  CB  . VAL A 1 78  ? 73.985 66.695  41.493  1.00 40.83  ? 78   VAL A CB  1 
ATOM   611   C  CG1 . VAL A 1 78  ? 74.207 65.340  40.845  1.00 40.80  ? 78   VAL A CG1 1 
ATOM   612   C  CG2 . VAL A 1 78  ? 74.348 67.823  40.533  1.00 40.61  ? 78   VAL A CG2 1 
ATOM   613   N  N   . ALA A 1 79  ? 73.044 68.313  43.796  1.00 43.04  ? 79   ALA A N   1 
ATOM   614   C  CA  . ALA A 1 79  ? 73.051 69.558  44.556  1.00 44.31  ? 79   ALA A CA  1 
ATOM   615   C  C   . ALA A 1 79  ? 71.657 70.152  44.721  1.00 45.25  ? 79   ALA A C   1 
ATOM   616   O  O   . ALA A 1 79  ? 71.218 70.977  43.901  1.00 45.33  ? 79   ALA A O   1 
ATOM   617   C  CB  . ALA A 1 79  ? 73.973 70.569  43.898  1.00 44.26  ? 79   ALA A CB  1 
ATOM   618   N  N   . ASN A 1 80  ? 70.963 69.747  45.782  1.00 46.29  ? 80   ASN A N   1 
ATOM   619   C  CA  . ASN A 1 80  ? 69.647 70.324  46.046  1.00 47.28  ? 80   ASN A CA  1 
ATOM   620   C  C   . ASN A 1 80  ? 69.679 71.807  46.395  1.00 47.69  ? 80   ASN A C   1 
ATOM   621   O  O   . ASN A 1 80  ? 68.636 72.456  46.420  1.00 47.78  ? 80   ASN A O   1 
ATOM   622   C  CB  . ASN A 1 80  ? 68.882 69.529  47.120  1.00 47.41  ? 80   ASN A CB  1 
ATOM   623   C  CG  . ASN A 1 80  ? 67.381 69.886  47.165  1.00 47.82  ? 80   ASN A CG  1 
ATOM   624   O  OD1 . ASN A 1 80  ? 66.653 69.453  48.064  1.00 48.31  ? 80   ASN A OD1 1 
ATOM   625   N  ND2 . ASN A 1 80  ? 66.923 70.680  46.193  1.00 47.11  ? 80   ASN A ND2 1 
ATOM   626   N  N   . TYR A 1 81  ? 70.876 72.343  46.625  1.00 47.99  ? 81   TYR A N   1 
ATOM   627   C  CA  . TYR A 1 81  ? 71.041 73.747  47.004  1.00 48.36  ? 81   TYR A CA  1 
ATOM   628   C  C   . TYR A 1 81  ? 70.608 74.810  45.971  1.00 48.75  ? 81   TYR A C   1 
ATOM   629   O  O   . TYR A 1 81  ? 70.590 76.000  46.296  1.00 48.97  ? 81   TYR A O   1 
ATOM   630   C  CB  . TYR A 1 81  ? 72.495 74.015  47.386  1.00 48.20  ? 81   TYR A CB  1 
ATOM   631   C  CG  . TYR A 1 81  ? 73.069 73.077  48.422  1.00 48.11  ? 81   TYR A CG  1 
ATOM   632   C  CD1 . TYR A 1 81  ? 73.375 71.762  48.109  1.00 48.04  ? 81   TYR A CD1 1 
ATOM   633   C  CD2 . TYR A 1 81  ? 73.331 73.515  49.707  1.00 47.66  ? 81   TYR A CD2 1 
ATOM   634   C  CE1 . TYR A 1 81  ? 73.912 70.912  49.058  1.00 47.73  ? 81   TYR A CE1 1 
ATOM   635   C  CE2 . TYR A 1 81  ? 73.862 72.679  50.658  1.00 47.57  ? 81   TYR A CE2 1 
ATOM   636   C  CZ  . TYR A 1 81  ? 74.151 71.380  50.332  1.00 47.58  ? 81   TYR A CZ  1 
ATOM   637   O  OH  . TYR A 1 81  ? 74.682 70.546  51.286  1.00 47.70  ? 81   TYR A OH  1 
ATOM   638   N  N   . ASN A 1 82  ? 70.274 74.424  44.741  1.00 48.98  ? 82   ASN A N   1 
ATOM   639   C  CA  . ASN A 1 82  ? 69.920 75.449  43.757  1.00 49.33  ? 82   ASN A CA  1 
ATOM   640   C  C   . ASN A 1 82  ? 68.700 76.262  44.201  1.00 49.36  ? 82   ASN A C   1 
ATOM   641   O  O   . ASN A 1 82  ? 67.570 75.759  44.221  1.00 49.65  ? 82   ASN A O   1 
ATOM   642   C  CB  . ASN A 1 82  ? 69.760 74.875  42.345  1.00 49.56  ? 82   ASN A CB  1 
ATOM   643   C  CG  . ASN A 1 82  ? 68.976 73.586  42.319  1.00 50.12  ? 82   ASN A CG  1 
ATOM   644   O  OD1 . ASN A 1 82  ? 69.529 72.522  42.033  1.00 50.61  ? 82   ASN A OD1 1 
ATOM   645   N  ND2 . ASN A 1 82  ? 67.675 73.670  42.603  1.00 50.87  ? 82   ASN A ND2 1 
ATOM   646   N  N   . PHE A 1 83  ? 68.941 77.534  44.508  1.00 49.09  ? 83   PHE A N   1 
ATOM   647   C  CA  . PHE A 1 83  ? 67.951 78.383  45.184  1.00 48.73  ? 83   PHE A CA  1 
ATOM   648   C  C   . PHE A 1 83  ? 66.484 77.947  45.341  1.00 48.46  ? 83   PHE A C   1 
ATOM   649   O  O   . PHE A 1 83  ? 65.647 78.004  44.430  1.00 48.14  ? 83   PHE A O   1 
ATOM   650   C  CB  . PHE A 1 83  ? 68.101 79.885  44.924  1.00 48.73  ? 83   PHE A CB  1 
ATOM   651   C  CG  . PHE A 1 83  ? 67.981 80.686  46.185  1.00 48.57  ? 83   PHE A CG  1 
ATOM   652   C  CD1 . PHE A 1 83  ? 68.909 80.508  47.203  1.00 48.01  ? 83   PHE A CD1 1 
ATOM   653   C  CD2 . PHE A 1 83  ? 66.909 81.540  46.398  1.00 48.37  ? 83   PHE A CD2 1 
ATOM   654   C  CE1 . PHE A 1 83  ? 68.806 81.201  48.389  1.00 47.92  ? 83   PHE A CE1 1 
ATOM   655   C  CE2 . PHE A 1 83  ? 66.799 82.242  47.591  1.00 48.34  ? 83   PHE A CE2 1 
ATOM   656   C  CZ  . PHE A 1 83  ? 67.751 82.071  48.587  1.00 47.97  ? 83   PHE A CZ  1 
ATOM   657   N  N   . PHE A 1 84  ? 66.259 77.520  46.580  1.00 48.09  ? 84   PHE A N   1 
ATOM   658   C  CA  . PHE A 1 84  ? 65.159 76.990  47.319  1.00 47.54  ? 84   PHE A CA  1 
ATOM   659   C  C   . PHE A 1 84  ? 65.875 76.826  48.665  1.00 47.14  ? 84   PHE A C   1 
ATOM   660   O  O   . PHE A 1 84  ? 67.060 76.475  48.674  1.00 46.93  ? 84   PHE A O   1 
ATOM   661   C  CB  . PHE A 1 84  ? 64.878 75.587  46.821  1.00 47.56  ? 84   PHE A CB  1 
ATOM   662   C  CG  . PHE A 1 84  ? 65.765 74.580  47.470  1.00 47.69  ? 84   PHE A CG  1 
ATOM   663   C  CD1 . PHE A 1 84  ? 65.584 74.255  48.803  1.00 48.14  ? 84   PHE A CD1 1 
ATOM   664   C  CD2 . PHE A 1 84  ? 66.833 74.040  46.799  1.00 47.44  ? 84   PHE A CD2 1 
ATOM   665   C  CE1 . PHE A 1 84  ? 66.426 73.373  49.448  1.00 48.45  ? 84   PHE A CE1 1 
ATOM   666   C  CE2 . PHE A 1 84  ? 67.667 73.161  47.438  1.00 48.23  ? 84   PHE A CE2 1 
ATOM   667   C  CZ  . PHE A 1 84  ? 67.468 72.825  48.771  1.00 48.54  ? 84   PHE A CZ  1 
ATOM   668   N  N   . PRO A 1 85  ? 65.213 77.079  49.790  1.00 46.77  ? 85   PRO A N   1 
ATOM   669   C  CA  . PRO A 1 85  ? 65.855 76.942  51.109  1.00 46.45  ? 85   PRO A CA  1 
ATOM   670   C  C   . PRO A 1 85  ? 66.277 75.517  51.495  1.00 46.17  ? 85   PRO A C   1 
ATOM   671   O  O   . PRO A 1 85  ? 65.620 74.551  51.108  1.00 46.07  ? 85   PRO A O   1 
ATOM   672   C  CB  . PRO A 1 85  ? 64.773 77.441  52.073  1.00 46.47  ? 85   PRO A CB  1 
ATOM   673   C  CG  . PRO A 1 85  ? 63.855 78.263  51.224  1.00 46.56  ? 85   PRO A CG  1 
ATOM   674   C  CD  . PRO A 1 85  ? 63.828 77.569  49.893  1.00 46.80  ? 85   PRO A CD  1 
ATOM   675   N  N   . ARG A 1 86  ? 67.353 75.402  52.274  1.00 45.84  ? 86   ARG A N   1 
ATOM   676   C  CA  . ARG A 1 86  ? 67.869 74.104  52.731  1.00 45.50  ? 86   ARG A CA  1 
ATOM   677   C  C   . ARG A 1 86  ? 66.776 73.109  53.132  1.00 45.18  ? 86   ARG A C   1 
ATOM   678   O  O   . ARG A 1 86  ? 66.775 71.965  52.668  1.00 45.20  ? 86   ARG A O   1 
ATOM   679   C  CB  . ARG A 1 86  ? 68.847 74.280  53.904  1.00 45.49  ? 86   ARG A CB  1 
ATOM   680   C  CG  . ARG A 1 86  ? 70.130 75.028  53.565  1.00 45.48  ? 86   ARG A CG  1 
ATOM   681   C  CD  . ARG A 1 86  ? 70.722 74.663  52.213  1.00 45.69  ? 86   ARG A CD  1 
ATOM   682   N  NE  . ARG A 1 86  ? 72.118 75.073  52.091  1.00 45.42  ? 86   ARG A NE  1 
ATOM   683   C  CZ  . ARG A 1 86  ? 72.639 75.634  51.007  1.00 45.45  ? 86   ARG A CZ  1 
ATOM   684   N  NH1 . ARG A 1 86  ? 71.878 75.861  49.934  1.00 45.01  ? 86   ARG A NH1 1 
ATOM   685   N  NH2 . ARG A 1 86  ? 73.927 75.963  50.995  1.00 45.04  ? 86   ARG A NH2 1 
ATOM   686   N  N   . LYS A 1 87  ? 65.866 73.545  54.005  1.00 44.67  ? 87   LYS A N   1 
ATOM   687   C  CA  . LYS A 1 87  ? 64.766 72.699  54.476  1.00 44.05  ? 87   LYS A CA  1 
ATOM   688   C  C   . LYS A 1 87  ? 63.633 72.681  53.442  1.00 43.34  ? 87   LYS A C   1 
ATOM   689   O  O   . LYS A 1 87  ? 62.850 73.622  53.328  1.00 43.21  ? 87   LYS A O   1 
ATOM   690   C  CB  . LYS A 1 87  ? 64.280 73.145  55.870  1.00 44.19  ? 87   LYS A CB  1 
ATOM   691   C  CG  . LYS A 1 87  ? 62.880 73.778  55.935  1.00 44.38  ? 87   LYS A CG  1 
ATOM   692   C  CD  . LYS A 1 87  ? 62.854 75.239  55.493  1.00 44.56  ? 87   LYS A CD  1 
ATOM   693   C  CE  . LYS A 1 87  ? 61.466 75.835  55.686  1.00 44.76  ? 87   LYS A CE  1 
ATOM   694   N  NZ  . LYS A 1 87  ? 61.217 77.002  54.786  1.00 45.13  ? 87   LYS A NZ  1 
ATOM   695   N  N   . PRO A 1 88  ? 63.567 71.603  52.674  1.00 42.67  ? 88   PRO A N   1 
ATOM   696   C  CA  . PRO A 1 88  ? 62.590 71.487  51.593  1.00 42.08  ? 88   PRO A CA  1 
ATOM   697   C  C   . PRO A 1 88  ? 61.250 70.940  52.072  1.00 41.49  ? 88   PRO A C   1 
ATOM   698   O  O   . PRO A 1 88  ? 60.953 69.773  51.828  1.00 41.63  ? 88   PRO A O   1 
ATOM   699   C  CB  . PRO A 1 88  ? 63.248 70.475  50.647  1.00 42.12  ? 88   PRO A CB  1 
ATOM   700   C  CG  . PRO A 1 88  ? 64.569 70.097  51.313  1.00 42.60  ? 88   PRO A CG  1 
ATOM   701   C  CD  . PRO A 1 88  ? 64.422 70.409  52.771  1.00 42.65  ? 88   PRO A CD  1 
ATOM   702   N  N   . LYS A 1 89  ? 60.454 71.761  52.744  1.00 40.63  ? 89   LYS A N   1 
ATOM   703   C  CA  . LYS A 1 89  ? 59.145 71.316  53.200  1.00 39.89  ? 89   LYS A CA  1 
ATOM   704   C  C   . LYS A 1 89  ? 58.317 72.500  53.657  1.00 39.54  ? 89   LYS A C   1 
ATOM   705   O  O   . LYS A 1 89  ? 58.765 73.321  54.451  1.00 39.59  ? 89   LYS A O   1 
ATOM   706   C  CB  . LYS A 1 89  ? 59.269 70.316  54.350  1.00 39.85  ? 89   LYS A CB  1 
ATOM   707   C  CG  . LYS A 1 89  ? 58.692 70.826  55.662  1.00 39.87  ? 89   LYS A CG  1 
ATOM   708   C  CD  . LYS A 1 89  ? 59.364 70.214  56.878  1.00 39.95  ? 89   LYS A CD  1 
ATOM   709   C  CE  . LYS A 1 89  ? 58.907 70.928  58.148  1.00 40.31  ? 89   LYS A CE  1 
ATOM   710   N  NZ  . LYS A 1 89  ? 59.775 70.656  59.339  1.00 40.52  ? 89   LYS A NZ  1 
ATOM   711   N  N   . TRP A 1 90  ? 57.099 72.587  53.149  1.00 39.07  ? 90   TRP A N   1 
ATOM   712   C  CA  . TRP A 1 90  ? 56.199 73.647  53.553  1.00 38.63  ? 90   TRP A CA  1 
ATOM   713   C  C   . TRP A 1 90  ? 55.949 73.597  55.048  1.00 38.63  ? 90   TRP A C   1 
ATOM   714   O  O   . TRP A 1 90  ? 55.690 72.535  55.604  1.00 38.73  ? 90   TRP A O   1 
ATOM   715   C  CB  . TRP A 1 90  ? 54.885 73.520  52.795  1.00 38.50  ? 90   TRP A CB  1 
ATOM   716   C  CG  . TRP A 1 90  ? 55.045 73.907  51.377  1.00 37.63  ? 90   TRP A CG  1 
ATOM   717   C  CD1 . TRP A 1 90  ? 55.012 73.089  50.289  1.00 36.91  ? 90   TRP A CD1 1 
ATOM   718   C  CD2 . TRP A 1 90  ? 55.298 75.222  50.886  1.00 36.58  ? 90   TRP A CD2 1 
ATOM   719   N  NE1 . TRP A 1 90  ? 55.214 73.822  49.146  1.00 37.06  ? 90   TRP A NE1 1 
ATOM   720   C  CE2 . TRP A 1 90  ? 55.396 75.136  49.489  1.00 36.79  ? 90   TRP A CE2 1 
ATOM   721   C  CE3 . TRP A 1 90  ? 55.448 76.473  51.490  1.00 35.92  ? 90   TRP A CE3 1 
ATOM   722   C  CZ2 . TRP A 1 90  ? 55.638 76.247  48.692  1.00 36.98  ? 90   TRP A CZ2 1 
ATOM   723   C  CZ3 . TRP A 1 90  ? 55.689 77.567  50.703  1.00 35.67  ? 90   TRP A CZ3 1 
ATOM   724   C  CH2 . TRP A 1 90  ? 55.782 77.453  49.320  1.00 36.60  ? 90   TRP A CH2 1 
ATOM   725   N  N   . ASP A 1 91  ? 56.035 74.749  55.699  1.00 38.53  ? 91   ASP A N   1 
ATOM   726   C  CA  . ASP A 1 91  ? 55.799 74.827  57.137  1.00 38.44  ? 91   ASP A CA  1 
ATOM   727   C  C   . ASP A 1 91  ? 54.305 74.883  57.448  1.00 38.22  ? 91   ASP A C   1 
ATOM   728   O  O   . ASP A 1 91  ? 53.906 75.127  58.584  1.00 38.17  ? 91   ASP A O   1 
ATOM   729   C  CB  . ASP A 1 91  ? 56.498 76.061  57.718  1.00 38.58  ? 91   ASP A CB  1 
ATOM   730   C  CG  . ASP A 1 91  ? 57.990 75.837  57.960  1.00 39.02  ? 91   ASP A CG  1 
ATOM   731   O  OD1 . ASP A 1 91  ? 58.511 74.757  57.596  1.00 39.16  ? 91   ASP A OD1 1 
ATOM   732   O  OD2 . ASP A 1 91  ? 58.720 76.689  58.513  1.00 39.36  ? 91   ASP A OD2 1 
ATOM   733   N  N   . LYS A 1 92  ? 53.488 74.636  56.428  1.00 38.09  ? 92   LYS A N   1 
ATOM   734   C  CA  . LYS A 1 92  ? 52.038 74.768  56.524  1.00 37.81  ? 92   LYS A CA  1 
ATOM   735   C  C   . LYS A 1 92  ? 51.352 73.534  55.955  1.00 37.76  ? 92   LYS A C   1 
ATOM   736   O  O   . LYS A 1 92  ? 52.015 72.604  55.500  1.00 37.83  ? 92   LYS A O   1 
ATOM   737   C  CB  . LYS A 1 92  ? 51.616 75.986  55.701  1.00 37.66  ? 92   LYS A CB  1 
ATOM   738   C  CG  . LYS A 1 92  ? 52.805 76.844  55.274  1.00 37.37  ? 92   LYS A CG  1 
ATOM   739   C  CD  . LYS A 1 92  ? 52.465 77.806  54.163  1.00 37.18  ? 92   LYS A CD  1 
ATOM   740   C  CE  . LYS A 1 92  ? 51.657 78.975  54.674  1.00 37.37  ? 92   LYS A CE  1 
ATOM   741   N  NZ  . LYS A 1 92  ? 51.074 79.750  53.545  1.00 37.63  ? 92   LYS A NZ  1 
ATOM   742   N  N   . ASN A 1 93  ? 50.025 73.523  55.982  1.00 37.64  ? 93   ASN A N   1 
ATOM   743   C  CA  . ASN A 1 93  ? 49.271 72.440  55.354  1.00 37.62  ? 93   ASN A CA  1 
ATOM   744   C  C   . ASN A 1 93  ? 48.166 72.963  54.439  1.00 37.54  ? 93   ASN A C   1 
ATOM   745   O  O   . ASN A 1 93  ? 47.521 72.200  53.720  1.00 37.64  ? 93   ASN A O   1 
ATOM   746   C  CB  . ASN A 1 93  ? 48.732 71.448  56.381  1.00 37.73  ? 93   ASN A CB  1 
ATOM   747   C  CG  . ASN A 1 93  ? 49.622 70.227  56.522  1.00 38.22  ? 93   ASN A CG  1 
ATOM   748   O  OD1 . ASN A 1 93  ? 50.703 70.167  55.937  1.00 38.83  ? 93   ASN A OD1 1 
ATOM   749   N  ND2 . ASN A 1 93  ? 49.170 69.243  57.292  1.00 38.51  ? 93   ASN A ND2 1 
ATOM   750   N  N   . GLN A 1 94  ? 47.963 74.275  54.474  1.00 37.30  ? 94   GLN A N   1 
ATOM   751   C  CA  . GLN A 1 94  ? 47.004 74.935  53.608  1.00 37.05  ? 94   GLN A CA  1 
ATOM   752   C  C   . GLN A 1 94  ? 47.847 75.807  52.678  1.00 36.97  ? 94   GLN A C   1 
ATOM   753   O  O   . GLN A 1 94  ? 48.421 76.808  53.106  1.00 36.94  ? 94   GLN A O   1 
ATOM   754   C  CB  . GLN A 1 94  ? 46.030 75.776  54.436  1.00 36.96  ? 94   GLN A CB  1 
ATOM   755   C  CG  . GLN A 1 94  ? 44.598 75.763  53.921  1.00 37.21  ? 94   GLN A CG  1 
ATOM   756   C  CD  . GLN A 1 94  ? 43.627 76.483  54.845  1.00 37.56  ? 94   GLN A CD  1 
ATOM   757   O  OE1 . GLN A 1 94  ? 43.903 76.658  56.028  1.00 37.39  ? 94   GLN A OE1 1 
ATOM   758   N  NE2 . GLN A 1 94  ? 42.486 76.899  54.302  1.00 38.07  ? 94   GLN A NE2 1 
ATOM   759   N  N   . ILE A 1 95  ? 47.934 75.409  51.409  1.00 36.82  ? 95   ILE A N   1 
ATOM   760   C  CA  . ILE A 1 95  ? 48.817 76.070  50.447  1.00 36.71  ? 95   ILE A CA  1 
ATOM   761   C  C   . ILE A 1 95  ? 48.116 76.704  49.240  1.00 36.54  ? 95   ILE A C   1 
ATOM   762   O  O   . ILE A 1 95  ? 47.461 76.016  48.454  1.00 36.68  ? 95   ILE A O   1 
ATOM   763   C  CB  . ILE A 1 95  ? 49.862 75.055  49.935  1.00 36.76  ? 95   ILE A CB  1 
ATOM   764   C  CG1 . ILE A 1 95  ? 50.570 74.376  51.104  1.00 36.91  ? 95   ILE A CG1 1 
ATOM   765   C  CG2 . ILE A 1 95  ? 50.865 75.721  49.006  1.00 36.75  ? 95   ILE A CG2 1 
ATOM   766   C  CD1 . ILE A 1 95  ? 51.624 73.400  50.664  1.00 37.57  ? 95   ILE A CD1 1 
ATOM   767   N  N   . THR A 1 96  ? 48.295 78.011  49.074  1.00 36.02  ? 96   THR A N   1 
ATOM   768   C  CA  . THR A 1 96  ? 47.704 78.718  47.950  1.00 35.46  ? 96   THR A CA  1 
ATOM   769   C  C   . THR A 1 96  ? 48.570 78.595  46.697  1.00 35.25  ? 96   THR A C   1 
ATOM   770   O  O   . THR A 1 96  ? 49.753 78.272  46.786  1.00 35.14  ? 96   THR A O   1 
ATOM   771   C  CB  . THR A 1 96  ? 47.511 80.201  48.300  1.00 35.39  ? 96   THR A CB  1 
ATOM   772   O  OG1 . THR A 1 96  ? 48.772 80.774  48.657  1.00 35.08  ? 96   THR A OG1 1 
ATOM   773   C  CG2 . THR A 1 96  ? 46.699 80.349  49.563  1.00 35.28  ? 96   THR A CG2 1 
ATOM   774   N  N   . TYR A 1 97  ? 47.956 78.844  45.538  1.00 34.93  ? 97   TYR A N   1 
ATOM   775   C  CA  . TYR A 1 97  ? 48.638 78.868  44.242  1.00 34.48  ? 97   TYR A CA  1 
ATOM   776   C  C   . TYR A 1 97  ? 47.870 79.774  43.291  1.00 34.50  ? 97   TYR A C   1 
ATOM   777   O  O   . TYR A 1 97  ? 46.649 79.890  43.403  1.00 34.61  ? 97   TYR A O   1 
ATOM   778   C  CB  . TYR A 1 97  ? 48.773 77.465  43.642  1.00 34.30  ? 97   TYR A CB  1 
ATOM   779   C  CG  . TYR A 1 97  ? 47.496 76.865  43.099  1.00 33.44  ? 97   TYR A CG  1 
ATOM   780   C  CD1 . TYR A 1 97  ? 47.103 77.087  41.796  1.00 32.89  ? 97   TYR A CD1 1 
ATOM   781   C  CD2 . TYR A 1 97  ? 46.697 76.050  43.888  1.00 33.61  ? 97   TYR A CD2 1 
ATOM   782   C  CE1 . TYR A 1 97  ? 45.939 76.533  41.296  1.00 32.65  ? 97   TYR A CE1 1 
ATOM   783   C  CE2 . TYR A 1 97  ? 45.535 75.484  43.393  1.00 32.78  ? 97   TYR A CE2 1 
ATOM   784   C  CZ  . TYR A 1 97  ? 45.164 75.733  42.096  1.00 31.94  ? 97   TYR A CZ  1 
ATOM   785   O  OH  . TYR A 1 97  ? 44.016 75.185  41.593  1.00 30.76  ? 97   TYR A OH  1 
ATOM   786   N  N   . ARG A 1 98  ? 48.574 80.419  42.363  1.00 34.28  ? 98   ARG A N   1 
ATOM   787   C  CA  . ARG A 1 98  ? 47.918 81.317  41.416  1.00 34.15  ? 98   ARG A CA  1 
ATOM   788   C  C   . ARG A 1 98  ? 48.448 81.264  39.986  1.00 34.07  ? 98   ARG A C   1 
ATOM   789   O  O   . ARG A 1 98  ? 49.641 81.446  39.730  1.00 33.90  ? 98   ARG A O   1 
ATOM   790   C  CB  . ARG A 1 98  ? 47.948 82.757  41.911  1.00 34.26  ? 98   ARG A CB  1 
ATOM   791   C  CG  . ARG A 1 98  ? 47.506 83.746  40.848  1.00 34.73  ? 98   ARG A CG  1 
ATOM   792   C  CD  . ARG A 1 98  ? 47.034 85.080  41.385  1.00 35.60  ? 98   ARG A CD  1 
ATOM   793   N  NE  . ARG A 1 98  ? 47.232 86.130  40.397  1.00 35.91  ? 98   ARG A NE  1 
ATOM   794   C  CZ  . ARG A 1 98  ? 47.758 87.310  40.666  1.00 35.96  ? 98   ARG A CZ  1 
ATOM   795   N  NH1 . ARG A 1 98  ? 48.130 87.607  41.905  1.00 35.50  ? 98   ARG A NH1 1 
ATOM   796   N  NH2 . ARG A 1 98  ? 47.906 88.197  39.691  1.00 36.32  ? 98   ARG A NH2 1 
ATOM   797   N  N   . ILE A 1 99  ? 47.525 81.051  39.052  1.00 34.04  ? 99   ILE A N   1 
ATOM   798   C  CA  . ILE A 1 99  ? 47.848 80.964  37.635  1.00 33.71  ? 99   ILE A CA  1 
ATOM   799   C  C   . ILE A 1 99  ? 48.052 82.339  37.018  1.00 33.67  ? 99   ILE A C   1 
ATOM   800   O  O   . ILE A 1 99  ? 47.096 83.027  36.679  1.00 33.81  ? 99   ILE A O   1 
ATOM   801   C  CB  . ILE A 1 99  ? 46.753 80.186  36.905  1.00 33.47  ? 99   ILE A CB  1 
ATOM   802   C  CG1 . ILE A 1 99  ? 46.734 78.745  37.418  1.00 33.41  ? 99   ILE A CG1 1 
ATOM   803   C  CG2 . ILE A 1 99  ? 46.999 80.195  35.428  1.00 33.55  ? 99   ILE A CG2 1 
ATOM   804   C  CD1 . ILE A 1 99  ? 45.848 77.827  36.629  1.00 33.55  ? 99   ILE A CD1 1 
ATOM   805   N  N   . ILE A 1 100 ? 49.311 82.736  36.889  1.00 33.62  ? 100  ILE A N   1 
ATOM   806   C  CA  . ILE A 1 100 ? 49.651 84.028  36.323  1.00 33.63  ? 100  ILE A CA  1 
ATOM   807   C  C   . ILE A 1 100 ? 49.683 83.995  34.805  1.00 33.81  ? 100  ILE A C   1 
ATOM   808   O  O   . ILE A 1 100 ? 49.207 84.911  34.140  1.00 33.83  ? 100  ILE A O   1 
ATOM   809   C  CB  . ILE A 1 100 ? 51.005 84.489  36.847  1.00 33.32  ? 100  ILE A CB  1 
ATOM   810   C  CG1 . ILE A 1 100 ? 50.929 84.660  38.356  1.00 33.98  ? 100  ILE A CG1 1 
ATOM   811   C  CG2 . ILE A 1 100 ? 51.395 85.786  36.194  1.00 33.28  ? 100  ILE A CG2 1 
ATOM   812   C  CD1 . ILE A 1 100 ? 51.860 85.721  38.906  1.00 35.33  ? 100  ILE A CD1 1 
ATOM   813   N  N   . GLY A 1 101 ? 50.257 82.939  34.255  1.00 34.06  ? 101  GLY A N   1 
ATOM   814   C  CA  . GLY A 1 101 ? 50.393 82.835  32.819  1.00 34.53  ? 101  GLY A CA  1 
ATOM   815   C  C   . GLY A 1 101 ? 49.733 81.578  32.318  1.00 34.82  ? 101  GLY A C   1 
ATOM   816   O  O   . GLY A 1 101 ? 49.597 80.613  33.064  1.00 35.07  ? 101  GLY A O   1 
ATOM   817   N  N   . TYR A 1 102 ? 49.323 81.597  31.053  1.00 34.90  ? 102  TYR A N   1 
ATOM   818   C  CA  . TYR A 1 102 ? 48.642 80.472  30.443  1.00 34.67  ? 102  TYR A CA  1 
ATOM   819   C  C   . TYR A 1 102 ? 49.428 80.021  29.231  1.00 34.73  ? 102  TYR A C   1 
ATOM   820   O  O   . TYR A 1 102 ? 50.619 80.284  29.146  1.00 34.98  ? 102  TYR A O   1 
ATOM   821   C  CB  . TYR A 1 102 ? 47.249 80.899  30.022  1.00 34.66  ? 102  TYR A CB  1 
ATOM   822   C  CG  . TYR A 1 102 ? 46.197 80.789  31.098  1.00 33.90  ? 102  TYR A CG  1 
ATOM   823   C  CD1 . TYR A 1 102 ? 45.599 79.574  31.381  1.00 33.97  ? 102  TYR A CD1 1 
ATOM   824   C  CD2 . TYR A 1 102 ? 45.777 81.897  31.794  1.00 33.67  ? 102  TYR A CD2 1 
ATOM   825   C  CE1 . TYR A 1 102 ? 44.624 79.456  32.337  1.00 34.22  ? 102  TYR A CE1 1 
ATOM   826   C  CE2 . TYR A 1 102 ? 44.799 81.795  32.762  1.00 35.15  ? 102  TYR A CE2 1 
ATOM   827   C  CZ  . TYR A 1 102 ? 44.223 80.566  33.032  1.00 35.16  ? 102  TYR A CZ  1 
ATOM   828   O  OH  . TYR A 1 102 ? 43.244 80.455  34.000  1.00 35.15  ? 102  TYR A OH  1 
ATOM   829   N  N   . THR A 1 103 ? 48.774 79.320  28.311  1.00 34.68  ? 103  THR A N   1 
ATOM   830   C  CA  . THR A 1 103 ? 49.407 78.905  27.060  1.00 34.86  ? 103  THR A CA  1 
ATOM   831   C  C   . THR A 1 103 ? 48.380 78.770  25.961  1.00 35.09  ? 103  THR A C   1 
ATOM   832   O  O   . THR A 1 103 ? 47.295 78.214  26.168  1.00 35.49  ? 103  THR A O   1 
ATOM   833   C  CB  . THR A 1 103 ? 50.098 77.571  27.178  1.00 34.91  ? 103  THR A CB  1 
ATOM   834   O  OG1 . THR A 1 103 ? 50.222 77.024  25.855  1.00 35.23  ? 103  THR A OG1 1 
ATOM   835   C  CG2 . THR A 1 103 ? 49.193 76.567  27.869  1.00 35.00  ? 103  THR A CG2 1 
ATOM   836   N  N   . PRO A 1 104 ? 48.712 79.275  24.785  1.00 34.88  ? 104  PRO A N   1 
ATOM   837   C  CA  . PRO A 1 104 ? 47.782 79.252  23.661  1.00 34.97  ? 104  PRO A CA  1 
ATOM   838   C  C   . PRO A 1 104 ? 47.379 77.848  23.214  1.00 35.47  ? 104  PRO A C   1 
ATOM   839   O  O   . PRO A 1 104 ? 46.294 77.679  22.655  1.00 35.90  ? 104  PRO A O   1 
ATOM   840   C  CB  . PRO A 1 104 ? 48.556 79.964  22.569  1.00 34.55  ? 104  PRO A CB  1 
ATOM   841   C  CG  . PRO A 1 104 ? 49.498 80.773  23.289  1.00 34.69  ? 104  PRO A CG  1 
ATOM   842   C  CD  . PRO A 1 104 ? 49.960 79.961  24.451  1.00 34.68  ? 104  PRO A CD  1 
ATOM   843   N  N   . ASP A 1 105 ? 48.203 76.841  23.448  1.00 35.39  ? 105  ASP A N   1 
ATOM   844   C  CA  . ASP A 1 105 ? 47.821 75.535  22.946  1.00 35.42  ? 105  ASP A CA  1 
ATOM   845   C  C   . ASP A 1 105 ? 46.588 74.976  23.605  1.00 35.23  ? 105  ASP A C   1 
ATOM   846   O  O   . ASP A 1 105 ? 46.049 73.985  23.142  1.00 35.58  ? 105  ASP A O   1 
ATOM   847   C  CB  . ASP A 1 105 ? 48.969 74.559  23.079  1.00 35.61  ? 105  ASP A CB  1 
ATOM   848   C  CG  . ASP A 1 105 ? 50.137 74.986  22.285  1.00 36.96  ? 105  ASP A CG  1 
ATOM   849   O  OD1 . ASP A 1 105 ? 49.941 75.911  21.471  1.00 37.98  ? 105  ASP A OD1 1 
ATOM   850   O  OD2 . ASP A 1 105 ? 51.277 74.488  22.395  1.00 39.86  ? 105  ASP A OD2 1 
ATOM   851   N  N   . LEU A 1 106 ? 46.135 75.600  24.682  1.00 35.00  ? 106  LEU A N   1 
ATOM   852   C  CA  . LEU A 1 106 ? 45.022 75.044  25.434  1.00 34.99  ? 106  LEU A CA  1 
ATOM   853   C  C   . LEU A 1 106 ? 44.078 76.117  25.929  1.00 35.40  ? 106  LEU A C   1 
ATOM   854   O  O   . LEU A 1 106 ? 44.510 77.195  26.329  1.00 35.89  ? 106  LEU A O   1 
ATOM   855   C  CB  . LEU A 1 106 ? 45.560 74.268  26.627  1.00 34.61  ? 106  LEU A CB  1 
ATOM   856   C  CG  . LEU A 1 106 ? 46.334 72.990  26.333  1.00 33.96  ? 106  LEU A CG  1 
ATOM   857   C  CD1 . LEU A 1 106 ? 47.338 72.723  27.420  1.00 34.66  ? 106  LEU A CD1 1 
ATOM   858   C  CD2 . LEU A 1 106 ? 45.388 71.842  26.222  1.00 34.33  ? 106  LEU A CD2 1 
ATOM   859   N  N   . ASP A 1 107 ? 42.785 75.834  25.899  1.00 35.68  ? 107  ASP A N   1 
ATOM   860   C  CA  . ASP A 1 107 ? 41.825 76.792  26.412  1.00 35.95  ? 107  ASP A CA  1 
ATOM   861   C  C   . ASP A 1 107 ? 42.006 76.846  27.920  1.00 36.40  ? 107  ASP A C   1 
ATOM   862   O  O   . ASP A 1 107 ? 42.179 75.810  28.565  1.00 36.49  ? 107  ASP A O   1 
ATOM   863   C  CB  . ASP A 1 107 ? 40.404 76.394  26.045  1.00 35.97  ? 107  ASP A CB  1 
ATOM   864   C  CG  . ASP A 1 107 ? 39.936 75.166  26.777  1.00 35.47  ? 107  ASP A CG  1 
ATOM   865   O  OD1 . ASP A 1 107 ? 40.230 74.045  26.313  1.00 35.95  ? 107  ASP A OD1 1 
ATOM   866   O  OD2 . ASP A 1 107 ? 39.255 75.227  27.812  1.00 34.71  ? 107  ASP A OD2 1 
ATOM   867   N  N   . PRO A 1 108 ? 41.965 78.056  28.475  1.00 36.65  ? 108  PRO A N   1 
ATOM   868   C  CA  . PRO A 1 108 ? 42.236 78.291  29.895  1.00 36.64  ? 108  PRO A CA  1 
ATOM   869   C  C   . PRO A 1 108 ? 41.388 77.444  30.836  1.00 36.66  ? 108  PRO A C   1 
ATOM   870   O  O   . PRO A 1 108 ? 41.752 77.320  31.999  1.00 36.79  ? 108  PRO A O   1 
ATOM   871   C  CB  . PRO A 1 108 ? 41.880 79.766  30.054  1.00 36.70  ? 108  PRO A CB  1 
ATOM   872   C  CG  . PRO A 1 108 ? 40.953 80.002  28.927  1.00 36.59  ? 108  PRO A CG  1 
ATOM   873   C  CD  . PRO A 1 108 ? 41.630 79.312  27.788  1.00 36.58  ? 108  PRO A CD  1 
ATOM   874   N  N   . GLU A 1 109 ? 40.274 76.891  30.374  1.00 36.58  ? 109  GLU A N   1 
ATOM   875   C  CA  . GLU A 1 109 ? 39.530 75.990  31.240  1.00 36.91  ? 109  GLU A CA  1 
ATOM   876   C  C   . GLU A 1 109 ? 40.327 74.697  31.339  1.00 36.37  ? 109  GLU A C   1 
ATOM   877   O  O   . GLU A 1 109 ? 40.480 74.144  32.421  1.00 36.53  ? 109  GLU A O   1 
ATOM   878   C  CB  . GLU A 1 109 ? 38.116 75.705  30.727  1.00 37.46  ? 109  GLU A CB  1 
ATOM   879   C  CG  . GLU A 1 109 ? 37.060 76.742  31.094  1.00 40.00  ? 109  GLU A CG  1 
ATOM   880   C  CD  . GLU A 1 109 ? 35.645 76.184  31.000  1.00 44.19  ? 109  GLU A CD  1 
ATOM   881   O  OE1 . GLU A 1 109 ? 35.452 75.142  30.334  1.00 45.21  ? 109  GLU A OE1 1 
ATOM   882   O  OE2 . GLU A 1 109 ? 34.716 76.774  31.603  1.00 46.74  ? 109  GLU A OE2 1 
ATOM   883   N  N   . THR A 1 110 ? 40.854 74.227  30.212  1.00 35.72  ? 110  THR A N   1 
ATOM   884   C  CA  . THR A 1 110 ? 41.636 73.006  30.218  1.00 35.09  ? 110  THR A CA  1 
ATOM   885   C  C   . THR A 1 110 ? 42.879 73.192  31.068  1.00 35.11  ? 110  THR A C   1 
ATOM   886   O  O   . THR A 1 110 ? 43.227 72.317  31.850  1.00 35.62  ? 110  THR A O   1 
ATOM   887   C  CB  . THR A 1 110 ? 42.024 72.591  28.810  1.00 34.94  ? 110  THR A CB  1 
ATOM   888   O  OG1 . THR A 1 110 ? 40.845 72.428  28.027  1.00 34.97  ? 110  THR A OG1 1 
ATOM   889   C  CG2 . THR A 1 110 ? 42.605 71.198  28.814  1.00 35.00  ? 110  THR A CG2 1 
ATOM   890   N  N   . VAL A 1 111 ? 43.550 74.330  30.934  1.00 34.86  ? 111  VAL A N   1 
ATOM   891   C  CA  . VAL A 1 111 ? 44.749 74.568  31.733  1.00 34.53  ? 111  VAL A CA  1 
ATOM   892   C  C   . VAL A 1 111 ? 44.402 74.608  33.215  1.00 34.52  ? 111  VAL A C   1 
ATOM   893   O  O   . VAL A 1 111 ? 44.994 73.887  34.021  1.00 34.55  ? 111  VAL A O   1 
ATOM   894   C  CB  . VAL A 1 111 ? 45.458 75.865  31.351  1.00 34.39  ? 111  VAL A CB  1 
ATOM   895   C  CG1 . VAL A 1 111 ? 46.324 76.327  32.488  1.00 34.32  ? 111  VAL A CG1 1 
ATOM   896   C  CG2 . VAL A 1 111 ? 46.294 75.664  30.106  1.00 34.31  ? 111  VAL A CG2 1 
ATOM   897   N  N   . ASP A 1 112 ? 43.433 75.446  33.569  1.00 34.36  ? 112  ASP A N   1 
ATOM   898   C  CA  . ASP A 1 112 ? 42.997 75.551  34.948  1.00 34.25  ? 112  ASP A CA  1 
ATOM   899   C  C   . ASP A 1 112 ? 42.831 74.160  35.541  1.00 34.28  ? 112  ASP A C   1 
ATOM   900   O  O   . ASP A 1 112 ? 43.388 73.841  36.596  1.00 34.13  ? 112  ASP A O   1 
ATOM   901   C  CB  . ASP A 1 112 ? 41.681 76.320  35.034  1.00 34.22  ? 112  ASP A CB  1 
ATOM   902   C  CG  . ASP A 1 112 ? 41.878 77.818  34.945  1.00 34.40  ? 112  ASP A CG  1 
ATOM   903   O  OD1 . ASP A 1 112 ? 43.003 78.281  35.231  1.00 34.37  ? 112  ASP A OD1 1 
ATOM   904   O  OD2 . ASP A 1 112 ? 40.971 78.609  34.604  1.00 34.10  ? 112  ASP A OD2 1 
ATOM   905   N  N   . ASP A 1 113 ? 42.070 73.326  34.846  1.00 34.39  ? 113  ASP A N   1 
ATOM   906   C  CA  . ASP A 1 113 ? 41.822 71.973  35.316  1.00 34.42  ? 113  ASP A CA  1 
ATOM   907   C  C   . ASP A 1 113 ? 43.099 71.150  35.300  1.00 34.08  ? 113  ASP A C   1 
ATOM   908   O  O   . ASP A 1 113 ? 43.439 70.523  36.298  1.00 34.03  ? 113  ASP A O   1 
ATOM   909   C  CB  . ASP A 1 113 ? 40.734 71.290  34.491  1.00 34.57  ? 113  ASP A CB  1 
ATOM   910   C  CG  . ASP A 1 113 ? 40.576 69.839  34.852  1.00 35.48  ? 113  ASP A CG  1 
ATOM   911   O  OD1 . ASP A 1 113 ? 41.562 69.099  34.681  1.00 37.03  ? 113  ASP A OD1 1 
ATOM   912   O  OD2 . ASP A 1 113 ? 39.528 69.345  35.323  1.00 36.29  ? 113  ASP A OD2 1 
ATOM   913   N  N   . ALA A 1 114 ? 43.806 71.158  34.174  1.00 33.69  ? 114  ALA A N   1 
ATOM   914   C  CA  . ALA A 1 114 ? 45.037 70.391  34.059  1.00 33.52  ? 114  ALA A CA  1 
ATOM   915   C  C   . ALA A 1 114 ? 45.860 70.515  35.336  1.00 33.62  ? 114  ALA A C   1 
ATOM   916   O  O   . ALA A 1 114 ? 46.214 69.511  35.948  1.00 33.73  ? 114  ALA A O   1 
ATOM   917   C  CB  . ALA A 1 114 ? 45.839 70.831  32.857  1.00 33.29  ? 114  ALA A CB  1 
ATOM   918   N  N   . PHE A 1 115 ? 46.149 71.745  35.747  1.00 33.73  ? 115  PHE A N   1 
ATOM   919   C  CA  . PHE A 1 115 ? 46.899 71.979  36.980  1.00 33.80  ? 115  PHE A CA  1 
ATOM   920   C  C   . PHE A 1 115 ? 46.223 71.326  38.169  1.00 33.60  ? 115  PHE A C   1 
ATOM   921   O  O   . PHE A 1 115 ? 46.748 70.388  38.756  1.00 33.60  ? 115  PHE A O   1 
ATOM   922   C  CB  . PHE A 1 115 ? 47.022 73.474  37.268  1.00 34.03  ? 115  PHE A CB  1 
ATOM   923   C  CG  . PHE A 1 115 ? 47.960 74.196  36.351  1.00 34.77  ? 115  PHE A CG  1 
ATOM   924   C  CD1 . PHE A 1 115 ? 49.134 73.603  35.932  1.00 35.29  ? 115  PHE A CD1 1 
ATOM   925   C  CD2 . PHE A 1 115 ? 47.669 75.473  35.918  1.00 34.99  ? 115  PHE A CD2 1 
ATOM   926   C  CE1 . PHE A 1 115 ? 49.990 74.267  35.100  1.00 35.49  ? 115  PHE A CE1 1 
ATOM   927   C  CE2 . PHE A 1 115 ? 48.526 76.139  35.088  1.00 35.37  ? 115  PHE A CE2 1 
ATOM   928   C  CZ  . PHE A 1 115 ? 49.685 75.535  34.675  1.00 35.65  ? 115  PHE A CZ  1 
ATOM   929   N  N   . ALA A 1 116 ? 45.047 71.836  38.519  1.00 33.50  ? 116  ALA A N   1 
ATOM   930   C  CA  . ALA A 1 116 ? 44.305 71.348  39.676  1.00 33.28  ? 116  ALA A CA  1 
ATOM   931   C  C   . ALA A 1 116 ? 44.345 69.836  39.794  1.00 33.12  ? 116  ALA A C   1 
ATOM   932   O  O   . ALA A 1 116 ? 44.287 69.298  40.898  1.00 33.28  ? 116  ALA A O   1 
ATOM   933   C  CB  . ALA A 1 116 ? 42.872 71.836  39.634  1.00 33.37  ? 116  ALA A CB  1 
ATOM   934   N  N   . ARG A 1 117 ? 44.432 69.154  38.657  1.00 32.79  ? 117  ARG A N   1 
ATOM   935   C  CA  . ARG A 1 117 ? 44.511 67.704  38.661  1.00 32.44  ? 117  ARG A CA  1 
ATOM   936   C  C   . ARG A 1 117 ? 45.895 67.318  39.138  1.00 32.45  ? 117  ARG A C   1 
ATOM   937   O  O   . ARG A 1 117 ? 46.057 66.348  39.871  1.00 32.51  ? 117  ARG A O   1 
ATOM   938   C  CB  . ARG A 1 117 ? 44.231 67.121  37.269  1.00 32.40  ? 117  ARG A CB  1 
ATOM   939   C  CG  . ARG A 1 117 ? 42.810 67.347  36.762  1.00 31.50  ? 117  ARG A CG  1 
ATOM   940   C  CD  . ARG A 1 117 ? 42.347 66.418  35.643  1.00 30.41  ? 117  ARG A CD  1 
ATOM   941   N  NE  . ARG A 1 117 ? 43.445 65.862  34.861  1.00 31.04  ? 117  ARG A NE  1 
ATOM   942   C  CZ  . ARG A 1 117 ? 43.863 66.347  33.695  1.00 31.70  ? 117  ARG A CZ  1 
ATOM   943   N  NH1 . ARG A 1 117 ? 43.286 67.417  33.164  1.00 32.30  ? 117  ARG A NH1 1 
ATOM   944   N  NH2 . ARG A 1 117 ? 44.867 65.764  33.056  1.00 31.65  ? 117  ARG A NH2 1 
ATOM   945   N  N   . ALA A 1 118 ? 46.895 68.093  38.734  1.00 32.46  ? 118  ALA A N   1 
ATOM   946   C  CA  . ALA A 1 118 ? 48.272 67.809  39.128  1.00 32.53  ? 118  ALA A CA  1 
ATOM   947   C  C   . ALA A 1 118 ? 48.409 67.864  40.643  1.00 32.51  ? 118  ALA A C   1 
ATOM   948   O  O   . ALA A 1 118 ? 48.885 66.922  41.266  1.00 32.38  ? 118  ALA A O   1 
ATOM   949   C  CB  . ALA A 1 118 ? 49.242 68.772  38.459  1.00 32.34  ? 118  ALA A CB  1 
ATOM   950   N  N   . PHE A 1 119 ? 47.987 68.974  41.230  1.00 32.62  ? 119  PHE A N   1 
ATOM   951   C  CA  . PHE A 1 119 ? 48.041 69.129  42.668  1.00 32.81  ? 119  PHE A CA  1 
ATOM   952   C  C   . PHE A 1 119 ? 47.377 67.938  43.350  1.00 32.94  ? 119  PHE A C   1 
ATOM   953   O  O   . PHE A 1 119 ? 47.925 67.364  44.290  1.00 33.02  ? 119  PHE A O   1 
ATOM   954   C  CB  . PHE A 1 119 ? 47.331 70.411  43.079  1.00 32.87  ? 119  PHE A CB  1 
ATOM   955   C  CG  . PHE A 1 119 ? 48.162 71.647  42.918  1.00 33.39  ? 119  PHE A CG  1 
ATOM   956   C  CD1 . PHE A 1 119 ? 49.416 71.737  43.491  1.00 34.14  ? 119  PHE A CD1 1 
ATOM   957   C  CD2 . PHE A 1 119 ? 47.677 72.732  42.216  1.00 34.32  ? 119  PHE A CD2 1 
ATOM   958   C  CE1 . PHE A 1 119 ? 50.174 72.882  43.355  1.00 34.19  ? 119  PHE A CE1 1 
ATOM   959   C  CE2 . PHE A 1 119 ? 48.432 73.880  42.074  1.00 34.55  ? 119  PHE A CE2 1 
ATOM   960   C  CZ  . PHE A 1 119 ? 49.681 73.954  42.645  1.00 34.46  ? 119  PHE A CZ  1 
ATOM   961   N  N   . GLN A 1 120 ? 46.196 67.564  42.869  1.00 33.04  ? 120  GLN A N   1 
ATOM   962   C  CA  . GLN A 1 120 ? 45.439 66.467  43.463  1.00 33.18  ? 120  GLN A CA  1 
ATOM   963   C  C   . GLN A 1 120 ? 46.264 65.214  43.599  1.00 33.01  ? 120  GLN A C   1 
ATOM   964   O  O   . GLN A 1 120 ? 46.092 64.457  44.548  1.00 33.31  ? 120  GLN A O   1 
ATOM   965   C  CB  . GLN A 1 120 ? 44.215 66.136  42.629  1.00 33.41  ? 120  GLN A CB  1 
ATOM   966   C  CG  . GLN A 1 120 ? 43.026 67.017  42.868  1.00 34.13  ? 120  GLN A CG  1 
ATOM   967   C  CD  . GLN A 1 120 ? 41.795 66.422  42.253  1.00 35.21  ? 120  GLN A CD  1 
ATOM   968   O  OE1 . GLN A 1 120 ? 41.724 65.203  42.065  1.00 35.33  ? 120  GLN A OE1 1 
ATOM   969   N  NE2 . GLN A 1 120 ? 40.826 67.264  41.921  1.00 36.11  ? 120  GLN A NE2 1 
ATOM   970   N  N   . VAL A 1 121 ? 47.135 64.980  42.628  1.00 32.71  ? 121  VAL A N   1 
ATOM   971   C  CA  . VAL A 1 121 ? 48.015 63.827  42.666  1.00 32.43  ? 121  VAL A CA  1 
ATOM   972   C  C   . VAL A 1 121 ? 48.688 63.761  44.031  1.00 32.27  ? 121  VAL A C   1 
ATOM   973   O  O   . VAL A 1 121 ? 48.857 62.686  44.597  1.00 32.31  ? 121  VAL A O   1 
ATOM   974   C  CB  . VAL A 1 121 ? 49.083 63.926  41.567  1.00 32.45  ? 121  VAL A CB  1 
ATOM   975   C  CG1 . VAL A 1 121 ? 50.302 63.104  41.913  1.00 32.33  ? 121  VAL A CG1 1 
ATOM   976   C  CG2 . VAL A 1 121 ? 48.505 63.508  40.227  1.00 32.72  ? 121  VAL A CG2 1 
ATOM   977   N  N   . TRP A 1 122 ? 49.039 64.923  44.570  1.00 32.02  ? 122  TRP A N   1 
ATOM   978   C  CA  . TRP A 1 122 ? 49.718 64.997  45.853  1.00 31.85  ? 122  TRP A CA  1 
ATOM   979   C  C   . TRP A 1 122 ? 48.767 65.037  47.030  1.00 31.86  ? 122  TRP A C   1 
ATOM   980   O  O   . TRP A 1 122 ? 49.047 64.468  48.078  1.00 31.87  ? 122  TRP A O   1 
ATOM   981   C  CB  . TRP A 1 122 ? 50.628 66.218  45.894  1.00 31.78  ? 122  TRP A CB  1 
ATOM   982   C  CG  . TRP A 1 122 ? 51.662 66.185  44.840  1.00 31.51  ? 122  TRP A CG  1 
ATOM   983   C  CD1 . TRP A 1 122 ? 51.853 67.103  43.856  1.00 31.71  ? 122  TRP A CD1 1 
ATOM   984   C  CD2 . TRP A 1 122 ? 52.650 65.172  44.643  1.00 31.31  ? 122  TRP A CD2 1 
ATOM   985   N  NE1 . TRP A 1 122 ? 52.908 66.728  43.059  1.00 31.92  ? 122  TRP A NE1 1 
ATOM   986   C  CE2 . TRP A 1 122 ? 53.413 65.542  43.521  1.00 31.32  ? 122  TRP A CE2 1 
ATOM   987   C  CE3 . TRP A 1 122 ? 52.974 63.987  45.306  1.00 31.12  ? 122  TRP A CE3 1 
ATOM   988   C  CZ2 . TRP A 1 122 ? 54.469 64.775  43.050  1.00 31.05  ? 122  TRP A CZ2 1 
ATOM   989   C  CZ3 . TRP A 1 122 ? 54.022 63.230  44.838  1.00 31.16  ? 122  TRP A CZ3 1 
ATOM   990   C  CH2 . TRP A 1 122 ? 54.759 63.627  43.723  1.00 31.15  ? 122  TRP A CH2 1 
ATOM   991   N  N   . SER A 1 123 ? 47.648 65.725  46.867  1.00 31.99  ? 123  SER A N   1 
ATOM   992   C  CA  . SER A 1 123 ? 46.689 65.830  47.951  1.00 32.11  ? 123  SER A CA  1 
ATOM   993   C  C   . SER A 1 123 ? 46.201 64.458  48.357  1.00 32.25  ? 123  SER A C   1 
ATOM   994   O  O   . SER A 1 123 ? 46.272 64.092  49.526  1.00 32.52  ? 123  SER A O   1 
ATOM   995   C  CB  . SER A 1 123 ? 45.500 66.692  47.542  1.00 32.06  ? 123  SER A CB  1 
ATOM   996   O  OG  . SER A 1 123 ? 45.863 68.056  47.501  1.00 32.28  ? 123  SER A OG  1 
ATOM   997   N  N   . ASP A 1 124 ? 45.734 63.689  47.382  1.00 32.31  ? 124  ASP A N   1 
ATOM   998   C  CA  . ASP A 1 124 ? 45.142 62.384  47.649  1.00 32.56  ? 124  ASP A CA  1 
ATOM   999   C  C   . ASP A 1 124 ? 45.985 61.479  48.548  1.00 32.55  ? 124  ASP A C   1 
ATOM   1000  O  O   . ASP A 1 124 ? 45.504 60.456  49.035  1.00 32.60  ? 124  ASP A O   1 
ATOM   1001  C  CB  . ASP A 1 124 ? 44.779 61.690  46.338  1.00 32.72  ? 124  ASP A CB  1 
ATOM   1002  C  CG  . ASP A 1 124 ? 43.756 62.477  45.532  1.00 33.54  ? 124  ASP A CG  1 
ATOM   1003  O  OD1 . ASP A 1 124 ? 43.169 63.430  46.089  1.00 34.58  ? 124  ASP A OD1 1 
ATOM   1004  O  OD2 . ASP A 1 124 ? 43.472 62.225  44.341  1.00 34.23  ? 124  ASP A OD2 1 
ATOM   1005  N  N   . VAL A 1 125 ? 47.235 61.868  48.780  1.00 32.58  ? 125  VAL A N   1 
ATOM   1006  C  CA  . VAL A 1 125 ? 48.118 61.101  49.644  1.00 32.53  ? 125  VAL A CA  1 
ATOM   1007  C  C   . VAL A 1 125 ? 48.746 61.977  50.721  1.00 32.71  ? 125  VAL A C   1 
ATOM   1008  O  O   . VAL A 1 125 ? 49.724 61.582  51.351  1.00 32.81  ? 125  VAL A O   1 
ATOM   1009  C  CB  . VAL A 1 125 ? 49.230 60.381  48.850  1.00 32.46  ? 125  VAL A CB  1 
ATOM   1010  C  CG1 . VAL A 1 125 ? 48.686 59.836  47.535  1.00 32.15  ? 125  VAL A CG1 1 
ATOM   1011  C  CG2 . VAL A 1 125 ? 50.402 61.309  48.600  1.00 32.41  ? 125  VAL A CG2 1 
ATOM   1012  N  N   . THR A 1 126 ? 48.186 63.164  50.937  1.00 32.94  ? 126  THR A N   1 
ATOM   1013  C  CA  . THR A 1 126 ? 48.693 64.072  51.969  1.00 33.32  ? 126  THR A CA  1 
ATOM   1014  C  C   . THR A 1 126 ? 47.603 64.957  52.576  1.00 33.58  ? 126  THR A C   1 
ATOM   1015  O  O   . THR A 1 126 ? 46.570 65.203  51.953  1.00 33.67  ? 126  THR A O   1 
ATOM   1016  C  CB  . THR A 1 126 ? 49.789 64.999  51.401  1.00 33.24  ? 126  THR A CB  1 
ATOM   1017  O  OG1 . THR A 1 126 ? 49.198 65.910  50.469  1.00 33.35  ? 126  THR A OG1 1 
ATOM   1018  C  CG2 . THR A 1 126 ? 50.797 64.233  50.567  1.00 33.25  ? 126  THR A CG2 1 
ATOM   1019  N  N   . PRO A 1 127 ? 47.841 65.437  53.796  1.00 33.79  ? 127  PRO A N   1 
ATOM   1020  C  CA  . PRO A 1 127 ? 46.949 66.402  54.441  1.00 33.97  ? 127  PRO A CA  1 
ATOM   1021  C  C   . PRO A 1 127 ? 47.123 67.770  53.788  1.00 34.28  ? 127  PRO A C   1 
ATOM   1022  O  O   . PRO A 1 127 ? 46.606 68.763  54.290  1.00 34.36  ? 127  PRO A O   1 
ATOM   1023  C  CB  . PRO A 1 127 ? 47.507 66.467  55.856  1.00 33.93  ? 127  PRO A CB  1 
ATOM   1024  C  CG  . PRO A 1 127 ? 48.952 66.207  55.654  1.00 33.70  ? 127  PRO A CG  1 
ATOM   1025  C  CD  . PRO A 1 127 ? 48.957 65.063  54.682  1.00 33.73  ? 127  PRO A CD  1 
ATOM   1026  N  N   . LEU A 1 128 ? 47.878 67.822  52.696  1.00 34.61  ? 128  LEU A N   1 
ATOM   1027  C  CA  . LEU A 1 128 ? 48.099 69.071  51.978  1.00 34.95  ? 128  LEU A CA  1 
ATOM   1028  C  C   . LEU A 1 128 ? 46.834 69.443  51.226  1.00 35.23  ? 128  LEU A C   1 
ATOM   1029  O  O   . LEU A 1 128 ? 46.158 68.575  50.679  1.00 35.27  ? 128  LEU A O   1 
ATOM   1030  C  CB  . LEU A 1 128 ? 49.258 68.926  50.991  1.00 34.85  ? 128  LEU A CB  1 
ATOM   1031  C  CG  . LEU A 1 128 ? 50.661 68.837  51.581  1.00 34.72  ? 128  LEU A CG  1 
ATOM   1032  C  CD1 . LEU A 1 128 ? 51.616 68.201  50.596  1.00 34.51  ? 128  LEU A CD1 1 
ATOM   1033  C  CD2 . LEU A 1 128 ? 51.132 70.217  51.968  1.00 34.99  ? 128  LEU A CD2 1 
ATOM   1034  N  N   . ARG A 1 129 ? 46.511 70.730  51.204  1.00 35.54  ? 129  ARG A N   1 
ATOM   1035  C  CA  . ARG A 1 129 ? 45.320 71.196  50.507  1.00 35.89  ? 129  ARG A CA  1 
ATOM   1036  C  C   . ARG A 1 129 ? 45.604 72.462  49.718  1.00 35.78  ? 129  ARG A C   1 
ATOM   1037  O  O   . ARG A 1 129 ? 45.929 73.507  50.279  1.00 35.72  ? 129  ARG A O   1 
ATOM   1038  C  CB  . ARG A 1 129 ? 44.166 71.415  51.485  1.00 36.19  ? 129  ARG A CB  1 
ATOM   1039  C  CG  . ARG A 1 129 ? 43.711 70.139  52.173  1.00 37.24  ? 129  ARG A CG  1 
ATOM   1040  C  CD  . ARG A 1 129 ? 43.606 68.943  51.232  1.00 38.86  ? 129  ARG A CD  1 
ATOM   1041  N  NE  . ARG A 1 129 ? 43.520 67.679  51.959  1.00 40.19  ? 129  ARG A NE  1 
ATOM   1042  C  CZ  . ARG A 1 129 ? 43.018 66.555  51.457  1.00 40.61  ? 129  ARG A CZ  1 
ATOM   1043  N  NH1 . ARG A 1 129 ? 42.552 66.527  50.214  1.00 40.23  ? 129  ARG A NH1 1 
ATOM   1044  N  NH2 . ARG A 1 129 ? 42.977 65.455  52.201  1.00 41.10  ? 129  ARG A NH2 1 
ATOM   1045  N  N   . PHE A 1 130 ? 45.470 72.362  48.405  1.00 35.72  ? 130  PHE A N   1 
ATOM   1046  C  CA  . PHE A 1 130 ? 45.755 73.490  47.543  1.00 35.74  ? 130  PHE A CA  1 
ATOM   1047  C  C   . PHE A 1 130 ? 44.493 74.233  47.107  1.00 35.91  ? 130  PHE A C   1 
ATOM   1048  O  O   . PHE A 1 130 ? 43.549 73.634  46.597  1.00 35.83  ? 130  PHE A O   1 
ATOM   1049  C  CB  . PHE A 1 130 ? 46.574 73.029  46.344  1.00 35.64  ? 130  PHE A CB  1 
ATOM   1050  C  CG  . PHE A 1 130 ? 47.819 72.280  46.723  1.00 35.08  ? 130  PHE A CG  1 
ATOM   1051  C  CD1 . PHE A 1 130 ? 48.908 72.947  47.255  1.00 34.92  ? 130  PHE A CD1 1 
ATOM   1052  C  CD2 . PHE A 1 130 ? 47.896 70.909  46.560  1.00 34.41  ? 130  PHE A CD2 1 
ATOM   1053  C  CE1 . PHE A 1 130 ? 50.054 72.258  47.602  1.00 34.50  ? 130  PHE A CE1 1 
ATOM   1054  C  CE2 . PHE A 1 130 ? 49.039 70.217  46.904  1.00 33.66  ? 130  PHE A CE2 1 
ATOM   1055  C  CZ  . PHE A 1 130 ? 50.115 70.889  47.426  1.00 33.91  ? 130  PHE A CZ  1 
ATOM   1056  N  N   . SER A 1 131 ? 44.493 75.543  47.333  1.00 36.10  ? 131  SER A N   1 
ATOM   1057  C  CA  . SER A 1 131 ? 43.372 76.398  46.992  1.00 36.30  ? 131  SER A CA  1 
ATOM   1058  C  C   . SER A 1 131 ? 43.914 77.536  46.167  1.00 36.33  ? 131  SER A C   1 
ATOM   1059  O  O   . SER A 1 131 ? 44.849 78.214  46.590  1.00 36.40  ? 131  SER A O   1 
ATOM   1060  C  CB  . SER A 1 131 ? 42.739 76.963  48.254  1.00 36.41  ? 131  SER A CB  1 
ATOM   1061  O  OG  . SER A 1 131 ? 42.750 76.003  49.297  1.00 37.36  ? 131  SER A OG  1 
ATOM   1062  N  N   . ARG A 1 132 ? 43.318 77.746  44.997  1.00 36.35  ? 132  ARG A N   1 
ATOM   1063  C  CA  . ARG A 1 132 ? 43.765 78.769  44.060  1.00 36.29  ? 132  ARG A CA  1 
ATOM   1064  C  C   . ARG A 1 132 ? 43.282 80.154  44.459  1.00 36.36  ? 132  ARG A C   1 
ATOM   1065  O  O   . ARG A 1 132 ? 42.145 80.323  44.886  1.00 36.38  ? 132  ARG A O   1 
ATOM   1066  C  CB  . ARG A 1 132 ? 43.261 78.423  42.657  1.00 36.28  ? 132  ARG A CB  1 
ATOM   1067  C  CG  . ARG A 1 132 ? 43.470 79.476  41.577  1.00 35.66  ? 132  ARG A CG  1 
ATOM   1068  C  CD  . ARG A 1 132 ? 42.464 79.313  40.452  1.00 34.85  ? 132  ARG A CD  1 
ATOM   1069  N  NE  . ARG A 1 132 ? 42.744 80.089  39.248  1.00 33.51  ? 132  ARG A NE  1 
ATOM   1070  C  CZ  . ARG A 1 132 ? 42.343 79.719  38.042  1.00 32.28  ? 132  ARG A CZ  1 
ATOM   1071  N  NH1 . ARG A 1 132 ? 41.671 78.593  37.889  1.00 31.43  ? 132  ARG A NH1 1 
ATOM   1072  N  NH2 . ARG A 1 132 ? 42.622 80.457  36.988  1.00 33.13  ? 132  ARG A NH2 1 
ATOM   1073  N  N   . ILE A 1 133 ? 44.160 81.142  44.344  1.00 36.38  ? 133  ILE A N   1 
ATOM   1074  C  CA  . ILE A 1 133 ? 43.778 82.518  44.611  1.00 36.38  ? 133  ILE A CA  1 
ATOM   1075  C  C   . ILE A 1 133 ? 43.971 83.309  43.329  1.00 36.51  ? 133  ILE A C   1 
ATOM   1076  O  O   . ILE A 1 133 ? 44.807 82.957  42.502  1.00 36.41  ? 133  ILE A O   1 
ATOM   1077  C  CB  . ILE A 1 133 ? 44.592 83.126  45.774  1.00 36.26  ? 133  ILE A CB  1 
ATOM   1078  C  CG1 . ILE A 1 133 ? 46.034 83.401  45.346  1.00 35.99  ? 133  ILE A CG1 1 
ATOM   1079  C  CG2 . ILE A 1 133 ? 44.537 82.224  46.989  1.00 36.00  ? 133  ILE A CG2 1 
ATOM   1080  C  CD1 . ILE A 1 133 ? 46.825 84.206  46.347  1.00 35.62  ? 133  ILE A CD1 1 
ATOM   1081  N  N   . HIS A 1 134 ? 43.183 84.366  43.167  1.00 36.82  ? 134  HIS A N   1 
ATOM   1082  C  CA  . HIS A 1 134 ? 43.229 85.193  41.973  1.00 37.10  ? 134  HIS A CA  1 
ATOM   1083  C  C   . HIS A 1 134 ? 43.876 86.548  42.213  1.00 37.56  ? 134  HIS A C   1 
ATOM   1084  O  O   . HIS A 1 134 ? 43.909 87.387  41.318  1.00 37.56  ? 134  HIS A O   1 
ATOM   1085  C  CB  . HIS A 1 134 ? 41.818 85.430  41.464  1.00 36.93  ? 134  HIS A CB  1 
ATOM   1086  C  CG  . HIS A 1 134 ? 41.145 84.204  40.946  1.00 36.80  ? 134  HIS A CG  1 
ATOM   1087  N  ND1 . HIS A 1 134 ? 40.298 83.440  41.716  1.00 37.01  ? 134  HIS A ND1 1 
ATOM   1088  C  CD2 . HIS A 1 134 ? 41.175 83.621  39.725  1.00 37.31  ? 134  HIS A CD2 1 
ATOM   1089  C  CE1 . HIS A 1 134 ? 39.839 82.433  40.996  1.00 37.42  ? 134  HIS A CE1 1 
ATOM   1090  N  NE2 . HIS A 1 134 ? 40.356 82.519  39.784  1.00 37.97  ? 134  HIS A NE2 1 
ATOM   1091  N  N   . ASP A 1 135 ? 44.386 86.780  43.413  1.00 38.11  ? 135  ASP A N   1 
ATOM   1092  C  CA  . ASP A 1 135 ? 44.961 88.085  43.683  1.00 38.79  ? 135  ASP A CA  1 
ATOM   1093  C  C   . ASP A 1 135 ? 46.114 88.088  44.672  1.00 38.85  ? 135  ASP A C   1 
ATOM   1094  O  O   . ASP A 1 135 ? 46.107 87.367  45.664  1.00 38.76  ? 135  ASP A O   1 
ATOM   1095  C  CB  . ASP A 1 135 ? 43.875 89.054  44.160  1.00 39.19  ? 135  ASP A CB  1 
ATOM   1096  C  CG  . ASP A 1 135 ? 44.378 90.485  44.256  1.00 40.23  ? 135  ASP A CG  1 
ATOM   1097  O  OD1 . ASP A 1 135 ? 44.789 91.115  43.254  1.00 42.11  ? 135  ASP A OD1 1 
ATOM   1098  O  OD2 . ASP A 1 135 ? 44.400 91.048  45.377  1.00 40.14  ? 135  ASP A OD2 1 
ATOM   1099  N  N   . GLY A 1 136 ? 47.094 88.936  44.392  1.00 39.16  ? 136  GLY A N   1 
ATOM   1100  C  CA  . GLY A 1 136 ? 48.250 89.079  45.248  1.00 39.55  ? 136  GLY A CA  1 
ATOM   1101  C  C   . GLY A 1 136 ? 49.179 87.890  45.145  1.00 39.78  ? 136  GLY A C   1 
ATOM   1102  O  O   . GLY A 1 136 ? 49.022 87.032  44.273  1.00 39.86  ? 136  GLY A O   1 
ATOM   1103  N  N   . GLU A 1 137 ? 50.150 87.837  46.047  1.00 39.79  ? 137  GLU A N   1 
ATOM   1104  C  CA  . GLU A 1 137 ? 51.120 86.760  46.047  1.00 39.86  ? 137  GLU A CA  1 
ATOM   1105  C  C   . GLU A 1 137 ? 50.599 85.490  46.706  1.00 39.50  ? 137  GLU A C   1 
ATOM   1106  O  O   . GLU A 1 137 ? 49.980 85.538  47.763  1.00 39.43  ? 137  GLU A O   1 
ATOM   1107  C  CB  . GLU A 1 137 ? 52.408 87.221  46.720  1.00 40.14  ? 137  GLU A CB  1 
ATOM   1108  C  CG  . GLU A 1 137 ? 53.557 87.388  45.751  1.00 41.55  ? 137  GLU A CG  1 
ATOM   1109  C  CD  . GLU A 1 137 ? 54.055 86.045  45.266  1.00 44.17  ? 137  GLU A CD  1 
ATOM   1110  O  OE1 . GLU A 1 137 ? 54.171 85.121  46.110  1.00 45.24  ? 137  GLU A OE1 1 
ATOM   1111  O  OE2 . GLU A 1 137 ? 54.313 85.906  44.048  1.00 44.87  ? 137  GLU A OE2 1 
ATOM   1112  N  N   . ALA A 1 138 ? 50.846 84.356  46.060  1.00 39.16  ? 138  ALA A N   1 
ATOM   1113  C  CA  . ALA A 1 138 ? 50.462 83.055  46.598  1.00 38.81  ? 138  ALA A CA  1 
ATOM   1114  C  C   . ALA A 1 138 ? 51.699 82.168  46.760  1.00 38.53  ? 138  ALA A C   1 
ATOM   1115  O  O   . ALA A 1 138 ? 52.805 82.552  46.368  1.00 38.47  ? 138  ALA A O   1 
ATOM   1116  C  CB  . ALA A 1 138 ? 49.446 82.387  45.700  1.00 38.86  ? 138  ALA A CB  1 
ATOM   1117  N  N   . ASP A 1 139 ? 51.509 80.979  47.326  1.00 38.08  ? 139  ASP A N   1 
ATOM   1118  C  CA  . ASP A 1 139 ? 52.619 80.058  47.579  1.00 37.61  ? 139  ASP A CA  1 
ATOM   1119  C  C   . ASP A 1 139 ? 53.225 79.482  46.304  1.00 36.94  ? 139  ASP A C   1 
ATOM   1120  O  O   . ASP A 1 139 ? 54.377 79.064  46.285  1.00 36.87  ? 139  ASP A O   1 
ATOM   1121  C  CB  . ASP A 1 139 ? 52.174 78.919  48.497  1.00 37.77  ? 139  ASP A CB  1 
ATOM   1122  C  CG  . ASP A 1 139 ? 51.562 79.419  49.788  1.00 38.48  ? 139  ASP A CG  1 
ATOM   1123  O  OD1 . ASP A 1 139 ? 52.326 79.781  50.708  1.00 38.67  ? 139  ASP A OD1 1 
ATOM   1124  O  OD2 . ASP A 1 139 ? 50.327 79.488  49.971  1.00 39.73  ? 139  ASP A OD2 1 
ATOM   1125  N  N   . ILE A 1 140 ? 52.441 79.452  45.240  1.00 36.22  ? 140  ILE A N   1 
ATOM   1126  C  CA  . ILE A 1 140 ? 52.922 78.929  43.979  1.00 35.60  ? 140  ILE A CA  1 
ATOM   1127  C  C   . ILE A 1 140 ? 52.481 79.842  42.849  1.00 35.21  ? 140  ILE A C   1 
ATOM   1128  O  O   . ILE A 1 140 ? 51.288 80.008  42.614  1.00 35.18  ? 140  ILE A O   1 
ATOM   1129  C  CB  . ILE A 1 140 ? 52.360 77.518  43.737  1.00 35.54  ? 140  ILE A CB  1 
ATOM   1130  C  CG1 . ILE A 1 140 ? 52.764 76.569  44.851  1.00 35.31  ? 140  ILE A CG1 1 
ATOM   1131  C  CG2 . ILE A 1 140 ? 52.847 76.967  42.420  1.00 35.67  ? 140  ILE A CG2 1 
ATOM   1132  C  CD1 . ILE A 1 140 ? 52.157 75.211  44.691  1.00 35.15  ? 140  ILE A CD1 1 
ATOM   1133  N  N   . MET A 1 141 ? 53.438 80.451  42.162  1.00 34.64  ? 141  MET A N   1 
ATOM   1134  C  CA  . MET A 1 141 ? 53.103 81.260  41.007  1.00 34.23  ? 141  MET A CA  1 
ATOM   1135  C  C   . MET A 1 141 ? 53.303 80.396  39.776  1.00 33.99  ? 141  MET A C   1 
ATOM   1136  O  O   . MET A 1 141 ? 54.427 79.992  39.480  1.00 34.17  ? 141  MET A O   1 
ATOM   1137  C  CB  . MET A 1 141 ? 53.975 82.510  40.927  1.00 34.19  ? 141  MET A CB  1 
ATOM   1138  C  CG  . MET A 1 141 ? 53.698 83.530  42.016  1.00 34.16  ? 141  MET A CG  1 
ATOM   1139  S  SD  . MET A 1 141 ? 51.992 83.511  42.590  1.00 33.30  ? 141  MET A SD  1 
ATOM   1140  C  CE  . MET A 1 141 ? 51.828 85.157  43.146  1.00 33.35  ? 141  MET A CE  1 
ATOM   1141  N  N   . ILE A 1 142 ? 52.215 80.089  39.073  1.00 33.43  ? 142  ILE A N   1 
ATOM   1142  C  CA  . ILE A 1 142 ? 52.309 79.256  37.887  1.00 32.89  ? 142  ILE A CA  1 
ATOM   1143  C  C   . ILE A 1 142 ? 52.419 80.139  36.667  1.00 32.95  ? 142  ILE A C   1 
ATOM   1144  O  O   . ILE A 1 142 ? 51.602 81.029  36.483  1.00 33.28  ? 142  ILE A O   1 
ATOM   1145  C  CB  . ILE A 1 142 ? 51.087 78.350  37.756  1.00 32.55  ? 142  ILE A CB  1 
ATOM   1146  C  CG1 . ILE A 1 142 ? 50.875 77.552  39.031  1.00 32.14  ? 142  ILE A CG1 1 
ATOM   1147  C  CG2 . ILE A 1 142 ? 51.282 77.374  36.632  1.00 32.33  ? 142  ILE A CG2 1 
ATOM   1148  C  CD1 . ILE A 1 142 ? 50.040 76.325  38.813  1.00 31.42  ? 142  ILE A CD1 1 
ATOM   1149  N  N   . ASN A 1 143 ? 53.433 79.908  35.839  1.00 32.75  ? 143  ASN A N   1 
ATOM   1150  C  CA  . ASN A 1 143 ? 53.601 80.704  34.632  1.00 32.70  ? 143  ASN A CA  1 
ATOM   1151  C  C   . ASN A 1 143 ? 54.296 79.949  33.510  1.00 32.71  ? 143  ASN A C   1 
ATOM   1152  O  O   . ASN A 1 143 ? 54.858 78.887  33.716  1.00 32.76  ? 143  ASN A O   1 
ATOM   1153  C  CB  . ASN A 1 143 ? 54.360 81.995  34.935  1.00 32.62  ? 143  ASN A CB  1 
ATOM   1154  C  CG  . ASN A 1 143 ? 54.134 83.075  33.886  1.00 32.55  ? 143  ASN A CG  1 
ATOM   1155  O  OD1 . ASN A 1 143 ? 54.561 84.206  34.060  1.00 33.29  ? 143  ASN A OD1 1 
ATOM   1156  N  ND2 . ASN A 1 143 ? 53.465 82.731  32.797  1.00 33.10  ? 143  ASN A ND2 1 
ATOM   1157  N  N   . PHE A 1 144 ? 54.218 80.517  32.315  1.00 32.79  ? 144  PHE A N   1 
ATOM   1158  C  CA  . PHE A 1 144 ? 54.854 79.988  31.131  1.00 32.78  ? 144  PHE A CA  1 
ATOM   1159  C  C   . PHE A 1 144 ? 55.800 81.091  30.678  1.00 32.47  ? 144  PHE A C   1 
ATOM   1160  O  O   . PHE A 1 144 ? 55.521 82.262  30.890  1.00 32.55  ? 144  PHE A O   1 
ATOM   1161  C  CB  . PHE A 1 144 ? 53.810 79.714  30.041  1.00 33.21  ? 144  PHE A CB  1 
ATOM   1162  C  CG  . PHE A 1 144 ? 52.818 78.617  30.384  1.00 33.58  ? 144  PHE A CG  1 
ATOM   1163  C  CD1 . PHE A 1 144 ? 51.811 78.830  31.309  1.00 33.41  ? 144  PHE A CD1 1 
ATOM   1164  C  CD2 . PHE A 1 144 ? 52.878 77.384  29.747  1.00 33.32  ? 144  PHE A CD2 1 
ATOM   1165  C  CE1 . PHE A 1 144 ? 50.904 77.820  31.604  1.00 33.59  ? 144  PHE A CE1 1 
ATOM   1166  C  CE2 . PHE A 1 144 ? 51.974 76.379  30.045  1.00 32.82  ? 144  PHE A CE2 1 
ATOM   1167  C  CZ  . PHE A 1 144 ? 50.990 76.596  30.973  1.00 32.72  ? 144  PHE A CZ  1 
ATOM   1168  N  N   . GLY A 1 145 ? 56.917 80.724  30.064  1.00 32.25  ? 145  GLY A N   1 
ATOM   1169  C  CA  . GLY A 1 145 ? 57.896 81.697  29.613  1.00 32.09  ? 145  GLY A CA  1 
ATOM   1170  C  C   . GLY A 1 145 ? 58.898 81.028  28.700  1.00 32.11  ? 145  GLY A C   1 
ATOM   1171  O  O   . GLY A 1 145 ? 59.001 79.802  28.703  1.00 32.08  ? 145  GLY A O   1 
ATOM   1172  N  N   . ARG A 1 146 ? 59.622 81.814  27.907  1.00 32.13  ? 146  ARG A N   1 
ATOM   1173  C  CA  . ARG A 1 146 ? 60.614 81.258  26.990  1.00 32.43  ? 146  ARG A CA  1 
ATOM   1174  C  C   . ARG A 1 146 ? 62.019 81.533  27.496  1.00 33.09  ? 146  ARG A C   1 
ATOM   1175  O  O   . ARG A 1 146 ? 62.183 82.053  28.597  1.00 34.14  ? 146  ARG A O   1 
ATOM   1176  C  CB  . ARG A 1 146 ? 60.463 81.847  25.603  1.00 32.21  ? 146  ARG A CB  1 
ATOM   1177  C  CG  . ARG A 1 146 ? 59.047 82.075  25.179  1.00 31.13  ? 146  ARG A CG  1 
ATOM   1178  C  CD  . ARG A 1 146 ? 58.954 82.766  23.855  1.00 28.26  ? 146  ARG A CD  1 
ATOM   1179  N  NE  . ARG A 1 146 ? 59.588 81.975  22.819  1.00 25.92  ? 146  ARG A NE  1 
ATOM   1180  C  CZ  . ARG A 1 146 ? 60.272 82.498  21.829  1.00 26.02  ? 146  ARG A CZ  1 
ATOM   1181  N  NH1 . ARG A 1 146 ? 60.415 83.808  21.753  1.00 26.07  ? 146  ARG A NH1 1 
ATOM   1182  N  NH2 . ARG A 1 146 ? 60.819 81.717  20.915  1.00 26.28  ? 146  ARG A NH2 1 
ATOM   1183  N  N   . TRP A 1 147 ? 63.040 81.202  26.712  1.00 33.11  ? 147  TRP A N   1 
ATOM   1184  C  CA  . TRP A 1 147 ? 64.399 81.408  27.189  1.00 32.99  ? 147  TRP A CA  1 
ATOM   1185  C  C   . TRP A 1 147 ? 64.451 82.754  27.863  1.00 33.29  ? 147  TRP A C   1 
ATOM   1186  O  O   . TRP A 1 147 ? 63.900 83.711  27.330  1.00 34.31  ? 147  TRP A O   1 
ATOM   1187  C  CB  . TRP A 1 147 ? 65.408 81.465  26.048  1.00 32.95  ? 147  TRP A CB  1 
ATOM   1188  C  CG  . TRP A 1 147 ? 65.017 80.913  24.726  1.00 31.69  ? 147  TRP A CG  1 
ATOM   1189  C  CD1 . TRP A 1 147 ? 63.852 81.110  24.055  1.00 30.80  ? 147  TRP A CD1 1 
ATOM   1190  C  CD2 . TRP A 1 147 ? 65.840 80.116  23.876  1.00 30.49  ? 147  TRP A CD2 1 
ATOM   1191  N  NE1 . TRP A 1 147 ? 63.890 80.458  22.846  1.00 30.39  ? 147  TRP A NE1 1 
ATOM   1192  C  CE2 . TRP A 1 147 ? 65.108 79.842  22.716  1.00 30.74  ? 147  TRP A CE2 1 
ATOM   1193  C  CE3 . TRP A 1 147 ? 67.127 79.595  23.986  1.00 30.32  ? 147  TRP A CE3 1 
ATOM   1194  C  CZ2 . TRP A 1 147 ? 65.619 79.068  21.679  1.00 31.02  ? 147  TRP A CZ2 1 
ATOM   1195  C  CZ3 . TRP A 1 147 ? 67.629 78.835  22.959  1.00 30.50  ? 147  TRP A CZ3 1 
ATOM   1196  C  CH2 . TRP A 1 147 ? 66.880 78.574  21.825  1.00 30.29  ? 147  TRP A CH2 1 
ATOM   1197  N  N   . GLU A 1 148 ? 65.122 82.863  29.000  1.00 33.05  ? 148  GLU A N   1 
ATOM   1198  C  CA  . GLU A 1 148 ? 65.191 84.153  29.666  1.00 33.29  ? 148  GLU A CA  1 
ATOM   1199  C  C   . GLU A 1 148 ? 63.770 84.550  30.085  1.00 32.73  ? 148  GLU A C   1 
ATOM   1200  O  O   . GLU A 1 148 ? 63.175 85.481  29.533  1.00 32.66  ? 148  GLU A O   1 
ATOM   1201  C  CB  . GLU A 1 148 ? 65.774 85.193  28.705  1.00 33.78  ? 148  GLU A CB  1 
ATOM   1202  C  CG  . GLU A 1 148 ? 66.184 86.516  29.337  1.00 36.98  ? 148  GLU A CG  1 
ATOM   1203  C  CD  . GLU A 1 148 ? 67.617 86.502  29.851  1.00 41.03  ? 148  GLU A CD  1 
ATOM   1204  O  OE1 . GLU A 1 148 ? 68.233 85.413  29.863  1.00 42.35  ? 148  GLU A OE1 1 
ATOM   1205  O  OE2 . GLU A 1 148 ? 68.141 87.578  30.236  1.00 42.76  ? 148  GLU A OE2 1 
ATOM   1206  N  N   . HIS A 1 149 ? 63.205 83.829  31.045  1.00 32.06  ? 149  HIS A N   1 
ATOM   1207  C  CA  . HIS A 1 149 ? 61.874 84.170  31.515  1.00 31.66  ? 149  HIS A CA  1 
ATOM   1208  C  C   . HIS A 1 149 ? 61.823 85.034  32.789  1.00 31.51  ? 149  HIS A C   1 
ATOM   1209  O  O   . HIS A 1 149 ? 60.741 85.431  33.216  1.00 31.61  ? 149  HIS A O   1 
ATOM   1210  C  CB  . HIS A 1 149 ? 60.967 82.935  31.608  1.00 31.71  ? 149  HIS A CB  1 
ATOM   1211  C  CG  . HIS A 1 149 ? 61.526 81.818  32.427  1.00 32.01  ? 149  HIS A CG  1 
ATOM   1212  N  ND1 . HIS A 1 149 ? 62.593 81.053  32.016  1.00 32.63  ? 149  HIS A ND1 1 
ATOM   1213  C  CD2 . HIS A 1 149 ? 61.145 81.318  33.626  1.00 32.81  ? 149  HIS A CD2 1 
ATOM   1214  C  CE1 . HIS A 1 149 ? 62.862 80.144  32.938  1.00 33.01  ? 149  HIS A CE1 1 
ATOM   1215  N  NE2 . HIS A 1 149 ? 61.995 80.281  33.924  1.00 32.78  ? 149  HIS A NE2 1 
ATOM   1216  N  N   . GLY A 1 150 ? 62.978 85.334  33.382  1.00 31.31  ? 150  GLY A N   1 
ATOM   1217  C  CA  . GLY A 1 150 ? 63.040 86.224  34.535  1.00 31.18  ? 150  GLY A CA  1 
ATOM   1218  C  C   . GLY A 1 150 ? 63.714 85.738  35.814  1.00 31.33  ? 150  GLY A C   1 
ATOM   1219  O  O   . GLY A 1 150 ? 63.904 86.514  36.755  1.00 31.45  ? 150  GLY A O   1 
ATOM   1220  N  N   . ASP A 1 151 ? 64.090 84.464  35.855  1.00 31.20  ? 151  ASP A N   1 
ATOM   1221  C  CA  . ASP A 1 151 ? 64.655 83.872  37.058  1.00 30.89  ? 151  ASP A CA  1 
ATOM   1222  C  C   . ASP A 1 151 ? 66.125 83.548  36.902  1.00 31.01  ? 151  ASP A C   1 
ATOM   1223  O  O   . ASP A 1 151 ? 66.766 83.093  37.847  1.00 31.08  ? 151  ASP A O   1 
ATOM   1224  C  CB  . ASP A 1 151 ? 63.881 82.606  37.437  1.00 30.71  ? 151  ASP A CB  1 
ATOM   1225  C  CG  . ASP A 1 151 ? 63.516 81.760  36.228  1.00 30.81  ? 151  ASP A CG  1 
ATOM   1226  O  OD1 . ASP A 1 151 ? 64.289 81.746  35.240  1.00 30.57  ? 151  ASP A OD1 1 
ATOM   1227  O  OD2 . ASP A 1 151 ? 62.469 81.076  36.171  1.00 30.48  ? 151  ASP A OD2 1 
ATOM   1228  N  N   . GLY A 1 152 ? 66.663 83.766  35.710  1.00 31.08  ? 152  GLY A N   1 
ATOM   1229  C  CA  . GLY A 1 152 ? 68.074 83.499  35.477  1.00 31.24  ? 152  GLY A CA  1 
ATOM   1230  C  C   . GLY A 1 152 ? 68.390 82.109  34.950  1.00 31.25  ? 152  GLY A C   1 
ATOM   1231  O  O   . GLY A 1 152 ? 69.509 81.843  34.515  1.00 31.14  ? 152  GLY A O   1 
ATOM   1232  N  N   . TYR A 1 153 ? 67.403 81.221  34.990  1.00 31.32  ? 153  TYR A N   1 
ATOM   1233  C  CA  . TYR A 1 153 ? 67.554 79.865  34.473  1.00 31.39  ? 153  TYR A CA  1 
ATOM   1234  C  C   . TYR A 1 153 ? 66.769 79.692  33.154  1.00 31.54  ? 153  TYR A C   1 
ATOM   1235  O  O   . TYR A 1 153 ? 65.612 79.269  33.159  1.00 31.65  ? 153  TYR A O   1 
ATOM   1236  C  CB  . TYR A 1 153 ? 67.062 78.871  35.515  1.00 31.37  ? 153  TYR A CB  1 
ATOM   1237  C  CG  . TYR A 1 153 ? 67.720 79.031  36.866  1.00 31.38  ? 153  TYR A CG  1 
ATOM   1238  C  CD1 . TYR A 1 153 ? 68.935 78.424  37.135  1.00 31.18  ? 153  TYR A CD1 1 
ATOM   1239  C  CD2 . TYR A 1 153 ? 67.122 79.780  37.874  1.00 31.36  ? 153  TYR A CD2 1 
ATOM   1240  C  CE1 . TYR A 1 153 ? 69.542 78.560  38.358  1.00 31.66  ? 153  TYR A CE1 1 
ATOM   1241  C  CE2 . TYR A 1 153 ? 67.722 79.920  39.109  1.00 31.38  ? 153  TYR A CE2 1 
ATOM   1242  C  CZ  . TYR A 1 153 ? 68.934 79.308  39.344  1.00 31.90  ? 153  TYR A CZ  1 
ATOM   1243  O  OH  . TYR A 1 153 ? 69.553 79.440  40.568  1.00 33.08  ? 153  TYR A OH  1 
ATOM   1244  N  N   . PRO A 1 154 ? 67.411 80.002  32.031  1.00 31.32  ? 154  PRO A N   1 
ATOM   1245  C  CA  . PRO A 1 154 ? 66.762 80.007  30.719  1.00 30.96  ? 154  PRO A CA  1 
ATOM   1246  C  C   . PRO A 1 154 ? 66.330 78.657  30.225  1.00 30.84  ? 154  PRO A C   1 
ATOM   1247  O  O   . PRO A 1 154 ? 66.924 77.643  30.573  1.00 31.25  ? 154  PRO A O   1 
ATOM   1248  C  CB  . PRO A 1 154 ? 67.874 80.493  29.791  1.00 30.81  ? 154  PRO A CB  1 
ATOM   1249  C  CG  . PRO A 1 154 ? 68.821 81.163  30.668  1.00 31.25  ? 154  PRO A CG  1 
ATOM   1250  C  CD  . PRO A 1 154 ? 68.831 80.368  31.936  1.00 31.40  ? 154  PRO A CD  1 
ATOM   1251  N  N   . PHE A 1 155 ? 65.307 78.666  29.385  1.00 30.62  ? 155  PHE A N   1 
ATOM   1252  C  CA  . PHE A 1 155 ? 64.838 77.471  28.716  1.00 30.40  ? 155  PHE A CA  1 
ATOM   1253  C  C   . PHE A 1 155 ? 65.488 77.388  27.333  1.00 30.46  ? 155  PHE A C   1 
ATOM   1254  O  O   . PHE A 1 155 ? 65.984 78.373  26.804  1.00 30.00  ? 155  PHE A O   1 
ATOM   1255  C  CB  . PHE A 1 155 ? 63.316 77.510  28.560  1.00 30.42  ? 155  PHE A CB  1 
ATOM   1256  C  CG  . PHE A 1 155 ? 62.565 77.215  29.822  1.00 30.00  ? 155  PHE A CG  1 
ATOM   1257  C  CD1 . PHE A 1 155 ? 63.078 76.348  30.762  1.00 29.27  ? 155  PHE A CD1 1 
ATOM   1258  C  CD2 . PHE A 1 155 ? 61.337 77.801  30.063  1.00 30.45  ? 155  PHE A CD2 1 
ATOM   1259  C  CE1 . PHE A 1 155 ? 62.387 76.072  31.919  1.00 29.14  ? 155  PHE A CE1 1 
ATOM   1260  C  CE2 . PHE A 1 155 ? 60.647 77.530  31.222  1.00 30.52  ? 155  PHE A CE2 1 
ATOM   1261  C  CZ  . PHE A 1 155 ? 61.180 76.663  32.152  1.00 29.80  ? 155  PHE A CZ  1 
ATOM   1262  N  N   . ASP A 1 156 ? 65.473 76.199  26.750  1.00 30.85  ? 156  ASP A N   1 
ATOM   1263  C  CA  . ASP A 1 156 ? 66.029 75.974  25.431  1.00 31.28  ? 156  ASP A CA  1 
ATOM   1264  C  C   . ASP A 1 156 ? 64.885 75.686  24.511  1.00 31.71  ? 156  ASP A C   1 
ATOM   1265  O  O   . ASP A 1 156 ? 64.149 74.733  24.744  1.00 32.31  ? 156  ASP A O   1 
ATOM   1266  C  CB  . ASP A 1 156 ? 66.909 74.745  25.466  1.00 31.46  ? 156  ASP A CB  1 
ATOM   1267  C  CG  . ASP A 1 156 ? 66.260 73.579  26.198  1.00 31.80  ? 156  ASP A CG  1 
ATOM   1268  O  OD1 . ASP A 1 156 ? 65.013 73.559  26.335  1.00 30.62  ? 156  ASP A OD1 1 
ATOM   1269  O  OD2 . ASP A 1 156 ? 66.936 72.631  26.670  1.00 33.26  ? 156  ASP A OD2 1 
ATOM   1270  N  N   . GLY A 1 157 ? 64.730 76.496  23.470  1.00 31.86  ? 157  GLY A N   1 
ATOM   1271  C  CA  . GLY A 1 157 ? 63.606 76.381  22.543  1.00 31.87  ? 157  GLY A CA  1 
ATOM   1272  C  C   . GLY A 1 157 ? 62.671 75.188  22.667  1.00 31.71  ? 157  GLY A C   1 
ATOM   1273  O  O   . GLY A 1 157 ? 62.432 74.672  23.753  1.00 31.80  ? 157  GLY A O   1 
ATOM   1274  N  N   . LYS A 1 158 ? 62.123 74.743  21.545  1.00 31.79  ? 158  LYS A N   1 
ATOM   1275  C  CA  . LYS A 1 158 ? 61.208 73.603  21.580  1.00 32.00  ? 158  LYS A CA  1 
ATOM   1276  C  C   . LYS A 1 158 ? 61.930 72.340  22.058  1.00 31.90  ? 158  LYS A C   1 
ATOM   1277  O  O   . LYS A 1 158 ? 63.136 72.187  21.862  1.00 32.08  ? 158  LYS A O   1 
ATOM   1278  C  CB  . LYS A 1 158 ? 60.528 73.396  20.216  1.00 32.02  ? 158  LYS A CB  1 
ATOM   1279  C  CG  . LYS A 1 158 ? 60.112 71.967  19.918  1.00 32.11  ? 158  LYS A CG  1 
ATOM   1280  C  CD  . LYS A 1 158 ? 59.500 71.845  18.534  1.00 33.20  ? 158  LYS A CD  1 
ATOM   1281  C  CE  . LYS A 1 158 ? 58.011 71.518  18.603  1.00 35.37  ? 158  LYS A CE  1 
ATOM   1282  N  NZ  . LYS A 1 158 ? 57.186 72.568  19.273  1.00 36.90  ? 158  LYS A NZ  1 
ATOM   1283  N  N   . ASP A 1 159 ? 61.187 71.452  22.707  1.00 31.58  ? 159  ASP A N   1 
ATOM   1284  C  CA  . ASP A 1 159 ? 61.748 70.222  23.239  1.00 31.18  ? 159  ASP A CA  1 
ATOM   1285  C  C   . ASP A 1 159 ? 62.770 70.553  24.316  1.00 30.95  ? 159  ASP A C   1 
ATOM   1286  O  O   . ASP A 1 159 ? 62.798 71.682  24.810  1.00 31.34  ? 159  ASP A O   1 
ATOM   1287  C  CB  . ASP A 1 159 ? 62.358 69.390  22.120  1.00 31.15  ? 159  ASP A CB  1 
ATOM   1288  C  CG  . ASP A 1 159 ? 61.306 68.735  21.249  1.00 32.05  ? 159  ASP A CG  1 
ATOM   1289  O  OD1 . ASP A 1 159 ? 60.349 68.147  21.804  1.00 32.71  ? 159  ASP A OD1 1 
ATOM   1290  O  OD2 . ASP A 1 159 ? 61.341 68.755  20.000  1.00 32.94  ? 159  ASP A OD2 1 
ATOM   1291  N  N   . GLY A 1 160 ? 63.599 69.576  24.685  1.00 30.37  ? 160  GLY A N   1 
ATOM   1292  C  CA  . GLY A 1 160 ? 64.614 69.775  25.706  1.00 29.14  ? 160  GLY A CA  1 
ATOM   1293  C  C   . GLY A 1 160 ? 64.029 69.885  27.096  1.00 28.44  ? 160  GLY A C   1 
ATOM   1294  O  O   . GLY A 1 160 ? 63.249 69.034  27.510  1.00 28.06  ? 160  GLY A O   1 
ATOM   1295  N  N   . LEU A 1 161 ? 64.414 70.933  27.819  1.00 28.09  ? 161  LEU A N   1 
ATOM   1296  C  CA  . LEU A 1 161 ? 63.895 71.171  29.160  1.00 27.79  ? 161  LEU A CA  1 
ATOM   1297  C  C   . LEU A 1 161 ? 62.429 71.518  29.043  1.00 27.98  ? 161  LEU A C   1 
ATOM   1298  O  O   . LEU A 1 161 ? 62.060 72.374  28.244  1.00 28.17  ? 161  LEU A O   1 
ATOM   1299  C  CB  . LEU A 1 161 ? 64.608 72.339  29.828  1.00 27.55  ? 161  LEU A CB  1 
ATOM   1300  C  CG  . LEU A 1 161 ? 66.113 72.468  29.701  1.00 26.24  ? 161  LEU A CG  1 
ATOM   1301  C  CD1 . LEU A 1 161 ? 66.565 73.595  30.592  1.00 25.46  ? 161  LEU A CD1 1 
ATOM   1302  C  CD2 . LEU A 1 161 ? 66.737 71.180  30.103  1.00 25.26  ? 161  LEU A CD2 1 
ATOM   1303  N  N   . LEU A 1 162 ? 61.592 70.878  29.849  1.00 27.99  ? 162  LEU A N   1 
ATOM   1304  C  CA  . LEU A 1 162 ? 60.160 71.107  29.752  1.00 28.09  ? 162  LEU A CA  1 
ATOM   1305  C  C   . LEU A 1 162 ? 59.621 72.167  30.679  1.00 28.17  ? 162  LEU A C   1 
ATOM   1306  O  O   . LEU A 1 162 ? 58.653 72.830  30.321  1.00 28.77  ? 162  LEU A O   1 
ATOM   1307  C  CB  . LEU A 1 162 ? 59.383 69.819  29.981  1.00 28.02  ? 162  LEU A CB  1 
ATOM   1308  C  CG  . LEU A 1 162 ? 59.661 68.712  28.976  1.00 28.34  ? 162  LEU A CG  1 
ATOM   1309  C  CD1 . LEU A 1 162 ? 58.594 67.647  29.093  1.00 28.52  ? 162  LEU A CD1 1 
ATOM   1310  C  CD2 . LEU A 1 162 ? 59.707 69.277  27.566  1.00 28.75  ? 162  LEU A CD2 1 
ATOM   1311  N  N   . ALA A 1 163 ? 60.218 72.313  31.860  1.00 27.87  ? 163  ALA A N   1 
ATOM   1312  C  CA  . ALA A 1 163 ? 59.737 73.262  32.857  1.00 27.81  ? 163  ALA A CA  1 
ATOM   1313  C  C   . ALA A 1 163 ? 60.679 73.274  34.038  1.00 28.16  ? 163  ALA A C   1 
ATOM   1314  O  O   . ALA A 1 163 ? 61.761 72.693  33.971  1.00 29.05  ? 163  ALA A O   1 
ATOM   1315  C  CB  . ALA A 1 163 ? 58.381 72.848  33.320  1.00 27.75  ? 163  ALA A CB  1 
ATOM   1316  N  N   . HIS A 1 164 ? 60.291 73.930  35.126  1.00 27.83  ? 164  HIS A N   1 
ATOM   1317  C  CA  . HIS A 1 164 ? 61.094 73.865  36.350  1.00 27.47  ? 164  HIS A CA  1 
ATOM   1318  C  C   . HIS A 1 164 ? 60.396 74.583  37.480  1.00 27.63  ? 164  HIS A C   1 
ATOM   1319  O  O   . HIS A 1 164 ? 59.508 75.397  37.242  1.00 27.57  ? 164  HIS A O   1 
ATOM   1320  C  CB  . HIS A 1 164 ? 62.535 74.347  36.151  1.00 27.06  ? 164  HIS A CB  1 
ATOM   1321  C  CG  . HIS A 1 164 ? 62.659 75.797  35.815  1.00 26.48  ? 164  HIS A CG  1 
ATOM   1322  N  ND1 . HIS A 1 164 ? 63.670 76.286  35.017  1.00 25.98  ? 164  HIS A ND1 1 
ATOM   1323  C  CD2 . HIS A 1 164 ? 61.917 76.868  36.182  1.00 26.14  ? 164  HIS A CD2 1 
ATOM   1324  C  CE1 . HIS A 1 164 ? 63.538 77.596  34.899  1.00 26.60  ? 164  HIS A CE1 1 
ATOM   1325  N  NE2 . HIS A 1 164 ? 62.480 77.973  35.594  1.00 26.03  ? 164  HIS A NE2 1 
ATOM   1326  N  N   . ALA A 1 165 ? 60.780 74.256  38.710  1.00 27.77  ? 165  ALA A N   1 
ATOM   1327  C  CA  . ALA A 1 165 ? 60.130 74.820  39.881  1.00 27.90  ? 165  ALA A CA  1 
ATOM   1328  C  C   . ALA A 1 165 ? 61.070 74.838  41.068  1.00 28.22  ? 165  ALA A C   1 
ATOM   1329  O  O   . ALA A 1 165 ? 61.829 73.898  41.282  1.00 28.29  ? 165  ALA A O   1 
ATOM   1330  C  CB  . ALA A 1 165 ? 58.877 74.032  40.220  1.00 27.77  ? 165  ALA A CB  1 
ATOM   1331  N  N   . PHE A 1 166 ? 61.005 75.920  41.835  1.00 28.55  ? 166  PHE A N   1 
ATOM   1332  C  CA  . PHE A 1 166 ? 61.826 76.095  43.017  1.00 28.82  ? 166  PHE A CA  1 
ATOM   1333  C  C   . PHE A 1 166 ? 61.165 75.403  44.198  1.00 29.11  ? 166  PHE A C   1 
ATOM   1334  O  O   . PHE A 1 166 ? 59.950 75.306  44.264  1.00 28.95  ? 166  PHE A O   1 
ATOM   1335  C  CB  . PHE A 1 166 ? 62.020 77.588  43.288  1.00 28.88  ? 166  PHE A CB  1 
ATOM   1336  C  CG  . PHE A 1 166 ? 62.601 78.338  42.119  1.00 29.12  ? 166  PHE A CG  1 
ATOM   1337  C  CD1 . PHE A 1 166 ? 63.938 78.226  41.806  1.00 29.22  ? 166  PHE A CD1 1 
ATOM   1338  C  CD2 . PHE A 1 166 ? 61.803 79.131  41.315  1.00 30.17  ? 166  PHE A CD2 1 
ATOM   1339  C  CE1 . PHE A 1 166 ? 64.474 78.901  40.724  1.00 29.36  ? 166  PHE A CE1 1 
ATOM   1340  C  CE2 . PHE A 1 166 ? 62.341 79.812  40.226  1.00 29.89  ? 166  PHE A CE2 1 
ATOM   1341  C  CZ  . PHE A 1 166 ? 63.677 79.696  39.937  1.00 29.31  ? 166  PHE A CZ  1 
ATOM   1342  N  N   . ALA A 1 167 ? 61.971 74.895  45.120  1.00 29.88  ? 167  ALA A N   1 
ATOM   1343  C  CA  . ALA A 1 167 ? 61.440 74.212  46.298  1.00 30.42  ? 167  ALA A CA  1 
ATOM   1344  C  C   . ALA A 1 167 ? 60.896 75.232  47.292  1.00 30.74  ? 167  ALA A C   1 
ATOM   1345  O  O   . ALA A 1 167 ? 61.263 76.403  47.238  1.00 30.99  ? 167  ALA A O   1 
ATOM   1346  C  CB  . ALA A 1 167 ? 62.506 73.339  46.936  1.00 30.22  ? 167  ALA A CB  1 
ATOM   1347  N  N   . PRO A 1 168 ? 60.035 74.782  48.200  1.00 31.00  ? 168  PRO A N   1 
ATOM   1348  C  CA  . PRO A 1 168 ? 59.348 75.662  49.153  1.00 31.23  ? 168  PRO A CA  1 
ATOM   1349  C  C   . PRO A 1 168 ? 60.224 76.747  49.771  1.00 31.61  ? 168  PRO A C   1 
ATOM   1350  O  O   . PRO A 1 168 ? 61.354 76.489  50.181  1.00 31.42  ? 168  PRO A O   1 
ATOM   1351  C  CB  . PRO A 1 168 ? 58.866 74.691  50.222  1.00 31.24  ? 168  PRO A CB  1 
ATOM   1352  C  CG  . PRO A 1 168 ? 58.625 73.432  49.470  1.00 31.16  ? 168  PRO A CG  1 
ATOM   1353  C  CD  . PRO A 1 168 ? 59.668 73.370  48.394  1.00 30.90  ? 168  PRO A CD  1 
ATOM   1354  N  N   . GLY A 1 169 ? 59.678 77.958  49.836  1.00 32.13  ? 169  GLY A N   1 
ATOM   1355  C  CA  . GLY A 1 169 ? 60.394 79.102  50.369  1.00 32.83  ? 169  GLY A CA  1 
ATOM   1356  C  C   . GLY A 1 169 ? 59.663 80.411  50.130  1.00 33.27  ? 169  GLY A C   1 
ATOM   1357  O  O   . GLY A 1 169 ? 58.462 80.423  49.879  1.00 33.21  ? 169  GLY A O   1 
ATOM   1358  N  N   . THR A 1 170 ? 60.399 81.514  50.191  1.00 33.88  ? 170  THR A N   1 
ATOM   1359  C  CA  . THR A 1 170 ? 59.809 82.836  50.036  1.00 34.71  ? 170  THR A CA  1 
ATOM   1360  C  C   . THR A 1 170 ? 59.712 83.311  48.577  1.00 35.22  ? 170  THR A C   1 
ATOM   1361  O  O   . THR A 1 170 ? 60.578 83.023  47.746  1.00 35.39  ? 170  THR A O   1 
ATOM   1362  C  CB  . THR A 1 170 ? 60.596 83.850  50.867  1.00 34.67  ? 170  THR A CB  1 
ATOM   1363  O  OG1 . THR A 1 170 ? 60.883 83.289  52.150  1.00 35.07  ? 170  THR A OG1 1 
ATOM   1364  C  CG2 . THR A 1 170 ? 59.726 85.042  51.199  1.00 35.15  ? 170  THR A CG2 1 
ATOM   1365  N  N   . GLY A 1 171 ? 58.651 84.052  48.277  1.00 35.64  ? 171  GLY A N   1 
ATOM   1366  C  CA  . GLY A 1 171 ? 58.438 84.559  46.939  1.00 36.14  ? 171  GLY A CA  1 
ATOM   1367  C  C   . GLY A 1 171 ? 58.634 83.490  45.884  1.00 36.54  ? 171  GLY A C   1 
ATOM   1368  O  O   . GLY A 1 171 ? 57.723 82.704  45.607  1.00 36.82  ? 171  GLY A O   1 
ATOM   1369  N  N   . VAL A 1 172 ? 59.831 83.451  45.303  1.00 36.65  ? 172  VAL A N   1 
ATOM   1370  C  CA  . VAL A 1 172 ? 60.136 82.505  44.232  1.00 36.61  ? 172  VAL A CA  1 
ATOM   1371  C  C   . VAL A 1 172 ? 60.065 81.057  44.681  1.00 36.48  ? 172  VAL A C   1 
ATOM   1372  O  O   . VAL A 1 172 ? 59.935 80.154  43.858  1.00 36.65  ? 172  VAL A O   1 
ATOM   1373  C  CB  . VAL A 1 172 ? 61.516 82.783  43.613  1.00 36.67  ? 172  VAL A CB  1 
ATOM   1374  C  CG1 . VAL A 1 172 ? 62.303 81.500  43.453  1.00 36.71  ? 172  VAL A CG1 1 
ATOM   1375  C  CG2 . VAL A 1 172 ? 61.359 83.490  42.281  1.00 36.99  ? 172  VAL A CG2 1 
ATOM   1376  N  N   . GLY A 1 173 ? 60.147 80.844  45.989  1.00 36.28  ? 173  GLY A N   1 
ATOM   1377  C  CA  . GLY A 1 173 ? 60.068 79.510  46.552  1.00 35.96  ? 173  GLY A CA  1 
ATOM   1378  C  C   . GLY A 1 173 ? 58.765 78.803  46.226  1.00 35.79  ? 173  GLY A C   1 
ATOM   1379  O  O   . GLY A 1 173 ? 57.695 79.169  46.714  1.00 35.55  ? 173  GLY A O   1 
ATOM   1380  N  N   . GLY A 1 174 ? 58.861 77.784  45.382  1.00 35.78  ? 174  GLY A N   1 
ATOM   1381  C  CA  . GLY A 1 174 ? 57.701 77.003  45.004  1.00 35.73  ? 174  GLY A CA  1 
ATOM   1382  C  C   . GLY A 1 174 ? 57.111 77.349  43.653  1.00 35.65  ? 174  GLY A C   1 
ATOM   1383  O  O   . GLY A 1 174 ? 56.209 76.663  43.179  1.00 35.45  ? 174  GLY A O   1 
ATOM   1384  N  N   . ASP A 1 175 ? 57.610 78.405  43.024  1.00 35.82  ? 175  ASP A N   1 
ATOM   1385  C  CA  . ASP A 1 175 ? 57.040 78.827  41.751  1.00 36.20  ? 175  ASP A CA  1 
ATOM   1386  C  C   . ASP A 1 175 ? 57.252 77.766  40.685  1.00 36.16  ? 175  ASP A C   1 
ATOM   1387  O  O   . ASP A 1 175 ? 58.255 77.058  40.698  1.00 36.51  ? 175  ASP A O   1 
ATOM   1388  C  CB  . ASP A 1 175 ? 57.609 80.171  41.303  1.00 36.42  ? 175  ASP A CB  1 
ATOM   1389  C  CG  . ASP A 1 175 ? 57.034 81.340  42.092  1.00 37.32  ? 175  ASP A CG  1 
ATOM   1390  O  OD1 . ASP A 1 175 ? 56.092 81.126  42.886  1.00 37.20  ? 175  ASP A OD1 1 
ATOM   1391  O  OD2 . ASP A 1 175 ? 57.462 82.510  41.980  1.00 38.81  ? 175  ASP A OD2 1 
ATOM   1392  N  N   . SER A 1 176 ? 56.296 77.649  39.772  1.00 35.75  ? 176  SER A N   1 
ATOM   1393  C  CA  . SER A 1 176 ? 56.389 76.665  38.711  1.00 35.38  ? 176  SER A CA  1 
ATOM   1394  C  C   . SER A 1 176 ? 56.345 77.333  37.347  1.00 35.27  ? 176  SER A C   1 
ATOM   1395  O  O   . SER A 1 176 ? 55.340 77.943  36.980  1.00 35.44  ? 176  SER A O   1 
ATOM   1396  C  CB  . SER A 1 176 ? 55.262 75.648  38.841  1.00 35.38  ? 176  SER A CB  1 
ATOM   1397  O  OG  . SER A 1 176 ? 55.431 74.892  40.022  1.00 35.45  ? 176  SER A OG  1 
ATOM   1398  N  N   . HIS A 1 177 ? 57.440 77.206  36.600  1.00 34.81  ? 177  HIS A N   1 
ATOM   1399  C  CA  . HIS A 1 177 ? 57.572 77.804  35.277  1.00 34.31  ? 177  HIS A CA  1 
ATOM   1400  C  C   . HIS A 1 177 ? 57.557 76.733  34.194  1.00 34.47  ? 177  HIS A C   1 
ATOM   1401  O  O   . HIS A 1 177 ? 58.421 75.866  34.185  1.00 34.99  ? 177  HIS A O   1 
ATOM   1402  C  CB  . HIS A 1 177 ? 58.904 78.545  35.188  1.00 33.94  ? 177  HIS A CB  1 
ATOM   1403  C  CG  . HIS A 1 177 ? 59.009 79.733  36.091  1.00 33.07  ? 177  HIS A CG  1 
ATOM   1404  N  ND1 . HIS A 1 177 ? 60.192 80.415  36.282  1.00 32.06  ? 177  HIS A ND1 1 
ATOM   1405  C  CD2 . HIS A 1 177 ? 58.081 80.371  36.842  1.00 32.50  ? 177  HIS A CD2 1 
ATOM   1406  C  CE1 . HIS A 1 177 ? 59.986 81.422  37.111  1.00 32.21  ? 177  HIS A CE1 1 
ATOM   1407  N  NE2 . HIS A 1 177 ? 58.714 81.416  37.468  1.00 32.35  ? 177  HIS A NE2 1 
ATOM   1408  N  N   . PHE A 1 178 ? 56.604 76.789  33.272  1.00 34.49  ? 178  PHE A N   1 
ATOM   1409  C  CA  . PHE A 1 178 ? 56.550 75.823  32.175  1.00 34.66  ? 178  PHE A CA  1 
ATOM   1410  C  C   . PHE A 1 178 ? 57.020 76.447  30.879  1.00 34.84  ? 178  PHE A C   1 
ATOM   1411  O  O   . PHE A 1 178 ? 56.771 77.620  30.640  1.00 35.15  ? 178  PHE A O   1 
ATOM   1412  C  CB  . PHE A 1 178 ? 55.134 75.314  31.978  1.00 34.82  ? 178  PHE A CB  1 
ATOM   1413  C  CG  . PHE A 1 178 ? 54.540 74.716  33.205  1.00 34.89  ? 178  PHE A CG  1 
ATOM   1414  C  CD1 . PHE A 1 178 ? 54.009 75.524  34.189  1.00 35.01  ? 178  PHE A CD1 1 
ATOM   1415  C  CD2 . PHE A 1 178 ? 54.521 73.348  33.377  1.00 34.61  ? 178  PHE A CD2 1 
ATOM   1416  C  CE1 . PHE A 1 178 ? 53.468 74.984  35.316  1.00 35.57  ? 178  PHE A CE1 1 
ATOM   1417  C  CE2 . PHE A 1 178 ? 53.977 72.801  34.497  1.00 35.16  ? 178  PHE A CE2 1 
ATOM   1418  C  CZ  . PHE A 1 178 ? 53.449 73.619  35.475  1.00 35.90  ? 178  PHE A CZ  1 
ATOM   1419  N  N   . ASP A 1 179 ? 57.663 75.659  30.023  1.00 34.95  ? 179  ASP A N   1 
ATOM   1420  C  CA  . ASP A 1 179 ? 58.215 76.190  28.773  1.00 34.89  ? 179  ASP A CA  1 
ATOM   1421  C  C   . ASP A 1 179 ? 57.168 76.512  27.695  1.00 35.13  ? 179  ASP A C   1 
ATOM   1422  O  O   . ASP A 1 179 ? 56.419 75.644  27.252  1.00 35.11  ? 179  ASP A O   1 
ATOM   1423  C  CB  . ASP A 1 179 ? 59.288 75.272  28.209  1.00 34.61  ? 179  ASP A CB  1 
ATOM   1424  C  CG  . ASP A 1 179 ? 60.122 75.960  27.176  1.00 34.34  ? 179  ASP A CG  1 
ATOM   1425  O  OD1 . ASP A 1 179 ? 59.641 76.978  26.651  1.00 34.33  ? 179  ASP A OD1 1 
ATOM   1426  O  OD2 . ASP A 1 179 ? 61.262 75.583  26.828  1.00 34.31  ? 179  ASP A OD2 1 
ATOM   1427  N  N   . ASP A 1 180 ? 57.150 77.764  27.256  1.00 35.19  ? 180  ASP A N   1 
ATOM   1428  C  CA  . ASP A 1 180 ? 56.151 78.221  26.309  1.00 35.13  ? 180  ASP A CA  1 
ATOM   1429  C  C   . ASP A 1 180 ? 56.411 77.782  24.884  1.00 34.58  ? 180  ASP A C   1 
ATOM   1430  O  O   . ASP A 1 180 ? 55.514 77.792  24.064  1.00 34.71  ? 180  ASP A O   1 
ATOM   1431  C  CB  . ASP A 1 180 ? 56.057 79.740  26.358  1.00 35.64  ? 180  ASP A CB  1 
ATOM   1432  C  CG  . ASP A 1 180 ? 54.663 80.245  26.076  1.00 37.54  ? 180  ASP A CG  1 
ATOM   1433  O  OD1 . ASP A 1 180 ? 53.713 79.428  26.059  1.00 38.42  ? 180  ASP A OD1 1 
ATOM   1434  O  OD2 . ASP A 1 180 ? 54.425 81.453  25.871  1.00 40.80  ? 180  ASP A OD2 1 
ATOM   1435  N  N   . ASP A 1 181 ? 57.634 77.409  24.568  1.00 34.18  ? 181  ASP A N   1 
ATOM   1436  C  CA  . ASP A 1 181 ? 57.916 77.026  23.200  1.00 34.13  ? 181  ASP A CA  1 
ATOM   1437  C  C   . ASP A 1 181 ? 57.524 75.585  22.916  1.00 33.84  ? 181  ASP A C   1 
ATOM   1438  O  O   . ASP A 1 181 ? 57.648 75.109  21.783  1.00 33.95  ? 181  ASP A O   1 
ATOM   1439  C  CB  . ASP A 1 181 ? 59.387 77.241  22.892  1.00 34.32  ? 181  ASP A CB  1 
ATOM   1440  C  CG  . ASP A 1 181 ? 59.711 78.687  22.636  1.00 35.93  ? 181  ASP A CG  1 
ATOM   1441  O  OD1 . ASP A 1 181 ? 58.750 79.481  22.540  1.00 37.20  ? 181  ASP A OD1 1 
ATOM   1442  O  OD2 . ASP A 1 181 ? 60.884 79.123  22.504  1.00 38.30  ? 181  ASP A OD2 1 
ATOM   1443  N  N   . GLU A 1 182 ? 57.058 74.890  23.947  1.00 33.22  ? 182  GLU A N   1 
ATOM   1444  C  CA  . GLU A 1 182 ? 56.688 73.500  23.805  1.00 32.80  ? 182  GLU A CA  1 
ATOM   1445  C  C   . GLU A 1 182 ? 55.323 73.496  23.206  1.00 32.63  ? 182  GLU A C   1 
ATOM   1446  O  O   . GLU A 1 182 ? 54.736 74.551  23.036  1.00 33.07  ? 182  GLU A O   1 
ATOM   1447  C  CB  . GLU A 1 182 ? 56.627 72.814  25.165  1.00 32.80  ? 182  GLU A CB  1 
ATOM   1448  C  CG  . GLU A 1 182 ? 57.958 72.700  25.882  1.00 33.28  ? 182  GLU A CG  1 
ATOM   1449  C  CD  . GLU A 1 182 ? 59.023 72.092  25.007  1.00 34.23  ? 182  GLU A CD  1 
ATOM   1450  O  OE1 . GLU A 1 182 ? 58.647 71.631  23.900  1.00 34.92  ? 182  GLU A OE1 1 
ATOM   1451  O  OE2 . GLU A 1 182 ? 60.215 72.079  25.423  1.00 33.22  ? 182  GLU A OE2 1 
ATOM   1452  N  N   . LEU A 1 183 ? 54.824 72.316  22.856  1.00 32.29  ? 183  LEU A N   1 
ATOM   1453  C  CA  . LEU A 1 183 ? 53.459 72.181  22.381  1.00 31.62  ? 183  LEU A CA  1 
ATOM   1454  C  C   . LEU A 1 183 ? 52.715 71.539  23.512  1.00 31.82  ? 183  LEU A C   1 
ATOM   1455  O  O   . LEU A 1 183 ? 52.768 70.329  23.664  1.00 32.33  ? 183  LEU A O   1 
ATOM   1456  C  CB  . LEU A 1 183 ? 53.389 71.277  21.158  1.00 31.19  ? 183  LEU A CB  1 
ATOM   1457  C  CG  . LEU A 1 183 ? 52.045 70.600  20.897  1.00 29.60  ? 183  LEU A CG  1 
ATOM   1458  C  CD1 . LEU A 1 183 ? 50.920 71.570  21.045  1.00 30.05  ? 183  LEU A CD1 1 
ATOM   1459  C  CD2 . LEU A 1 183 ? 52.015 69.996  19.530  1.00 28.58  ? 183  LEU A CD2 1 
ATOM   1460  N  N   . TRP A 1 184 ? 52.039 72.326  24.335  1.00 31.88  ? 184  TRP A N   1 
ATOM   1461  C  CA  . TRP A 1 184 ? 51.335 71.722  25.461  1.00 31.81  ? 184  TRP A CA  1 
ATOM   1462  C  C   . TRP A 1 184 ? 50.063 71.058  25.010  1.00 31.85  ? 184  TRP A C   1 
ATOM   1463  O  O   . TRP A 1 184 ? 49.338 71.592  24.175  1.00 31.88  ? 184  TRP A O   1 
ATOM   1464  C  CB  . TRP A 1 184 ? 51.073 72.737  26.567  1.00 31.77  ? 184  TRP A CB  1 
ATOM   1465  C  CG  . TRP A 1 184 ? 52.354 73.230  27.160  1.00 31.09  ? 184  TRP A CG  1 
ATOM   1466  C  CD1 . TRP A 1 184 ? 52.888 74.472  27.031  1.00 30.60  ? 184  TRP A CD1 1 
ATOM   1467  C  CD2 . TRP A 1 184 ? 53.278 72.475  27.946  1.00 29.54  ? 184  TRP A CD2 1 
ATOM   1468  N  NE1 . TRP A 1 184 ? 54.082 74.542  27.701  1.00 30.68  ? 184  TRP A NE1 1 
ATOM   1469  C  CE2 . TRP A 1 184 ? 54.343 73.324  28.271  1.00 30.17  ? 184  TRP A CE2 1 
ATOM   1470  C  CE3 . TRP A 1 184 ? 53.314 71.162  28.405  1.00 28.97  ? 184  TRP A CE3 1 
ATOM   1471  C  CZ2 . TRP A 1 184 ? 55.431 72.903  29.035  1.00 30.12  ? 184  TRP A CZ2 1 
ATOM   1472  C  CZ3 . TRP A 1 184 ? 54.385 70.749  29.154  1.00 29.00  ? 184  TRP A CZ3 1 
ATOM   1473  C  CH2 . TRP A 1 184 ? 55.431 71.613  29.465  1.00 29.12  ? 184  TRP A CH2 1 
ATOM   1474  N  N   . THR A 1 185 ? 49.826 69.865  25.546  1.00 32.05  ? 185  THR A N   1 
ATOM   1475  C  CA  . THR A 1 185 ? 48.629 69.084  25.243  1.00 32.04  ? 185  THR A CA  1 
ATOM   1476  C  C   . THR A 1 185 ? 48.201 68.280  26.460  1.00 32.29  ? 185  THR A C   1 
ATOM   1477  O  O   . THR A 1 185 ? 48.850 68.299  27.499  1.00 32.28  ? 185  THR A O   1 
ATOM   1478  C  CB  . THR A 1 185 ? 48.948 68.075  24.173  1.00 31.76  ? 185  THR A CB  1 
ATOM   1479  O  OG1 . THR A 1 185 ? 49.498 66.915  24.803  1.00 31.16  ? 185  THR A OG1 1 
ATOM   1480  C  CG2 . THR A 1 185 ? 50.084 68.560  23.316  1.00 31.82  ? 185  THR A CG2 1 
ATOM   1481  N  N   . LEU A 1 186 ? 47.108 67.547  26.319  1.00 32.70  ? 186  LEU A N   1 
ATOM   1482  C  CA  . LEU A 1 186 ? 46.777 66.544  27.339  1.00 32.98  ? 186  LEU A CA  1 
ATOM   1483  C  C   . LEU A 1 186 ? 47.533 65.223  27.164  1.00 33.34  ? 186  LEU A C   1 
ATOM   1484  O  O   . LEU A 1 186 ? 47.184 64.215  27.762  1.00 33.28  ? 186  LEU A O   1 
ATOM   1485  C  CB  . LEU A 1 186 ? 45.274 66.321  27.369  1.00 32.71  ? 186  LEU A CB  1 
ATOM   1486  C  CG  . LEU A 1 186 ? 44.571 67.546  27.943  1.00 33.11  ? 186  LEU A CG  1 
ATOM   1487  C  CD1 . LEU A 1 186 ? 43.118 67.251  28.269  1.00 34.05  ? 186  LEU A CD1 1 
ATOM   1488  C  CD2 . LEU A 1 186 ? 45.309 68.036  29.171  1.00 32.28  ? 186  LEU A CD2 1 
ATOM   1489  N  N   . GLY A 1 187 ? 48.581 65.237  26.342  1.00 33.82  ? 187  GLY A N   1 
ATOM   1490  C  CA  . GLY A 1 187 ? 49.418 64.061  26.176  1.00 34.20  ? 187  GLY A CA  1 
ATOM   1491  C  C   . GLY A 1 187 ? 49.475 63.410  24.804  1.00 34.41  ? 187  GLY A C   1 
ATOM   1492  O  O   . GLY A 1 187 ? 50.540 62.975  24.365  1.00 34.44  ? 187  GLY A O   1 
ATOM   1493  N  N   . GLU A 1 188 ? 48.337 63.341  24.122  1.00 34.54  ? 188  GLU A N   1 
ATOM   1494  C  CA  . GLU A 1 188 ? 48.271 62.653  22.838  1.00 34.45  ? 188  GLU A CA  1 
ATOM   1495  C  C   . GLU A 1 188 ? 48.005 63.588  21.667  1.00 34.48  ? 188  GLU A C   1 
ATOM   1496  O  O   . GLU A 1 188 ? 46.980 63.477  20.997  1.00 34.50  ? 188  GLU A O   1 
ATOM   1497  C  CB  . GLU A 1 188 ? 47.181 61.585  22.873  1.00 34.46  ? 188  GLU A CB  1 
ATOM   1498  C  CG  . GLU A 1 188 ? 46.819 61.109  24.268  1.00 34.53  ? 188  GLU A CG  1 
ATOM   1499  C  CD  . GLU A 1 188 ? 45.613 60.205  24.258  1.00 33.88  ? 188  GLU A CD  1 
ATOM   1500  O  OE1 . GLU A 1 188 ? 45.397 59.544  23.234  1.00 34.51  ? 188  GLU A OE1 1 
ATOM   1501  O  OE2 . GLU A 1 188 ? 44.883 60.160  25.263  1.00 34.23  ? 188  GLU A OE2 1 
ATOM   1502  N  N   . GLY A 1 189 ? 48.924 64.508  21.411  1.00 34.52  ? 189  GLY A N   1 
ATOM   1503  C  CA  . GLY A 1 189 ? 48.776 65.393  20.272  1.00 34.54  ? 189  GLY A CA  1 
ATOM   1504  C  C   . GLY A 1 189 ? 48.004 66.668  20.538  1.00 34.40  ? 189  GLY A C   1 
ATOM   1505  O  O   . GLY A 1 189 ? 47.419 66.855  21.603  1.00 34.34  ? 189  GLY A O   1 
ATOM   1506  N  N   . GLN A 1 190 ? 47.993 67.543  19.546  1.00 34.25  ? 190  GLN A N   1 
ATOM   1507  C  CA  . GLN A 1 190 ? 47.353 68.835  19.688  1.00 34.38  ? 190  GLN A CA  1 
ATOM   1508  C  C   . GLN A 1 190 ? 45.931 68.732  20.182  1.00 33.76  ? 190  GLN A C   1 
ATOM   1509  O  O   . GLN A 1 190 ? 45.226 67.799  19.858  1.00 33.88  ? 190  GLN A O   1 
ATOM   1510  C  CB  . GLN A 1 190 ? 47.377 69.576  18.356  1.00 34.98  ? 190  GLN A CB  1 
ATOM   1511  C  CG  . GLN A 1 190 ? 46.646 70.904  18.377  1.00 36.67  ? 190  GLN A CG  1 
ATOM   1512  C  CD  . GLN A 1 190 ? 47.006 71.769  17.194  1.00 38.32  ? 190  GLN A CD  1 
ATOM   1513  O  OE1 . GLN A 1 190 ? 47.395 71.255  16.141  1.00 39.18  ? 190  GLN A OE1 1 
ATOM   1514  N  NE2 . GLN A 1 190 ? 46.891 73.083  17.361  1.00 38.90  ? 190  GLN A NE2 1 
ATOM   1515  N  N   . VAL A 1 191 ? 45.521 69.704  20.978  1.00 33.36  ? 191  VAL A N   1 
ATOM   1516  C  CA  . VAL A 1 191 ? 44.170 69.755  21.498  1.00 33.09  ? 191  VAL A CA  1 
ATOM   1517  C  C   . VAL A 1 191 ? 43.588 71.103  21.069  1.00 33.30  ? 191  VAL A C   1 
ATOM   1518  O  O   . VAL A 1 191 ? 44.309 72.106  21.020  1.00 33.29  ? 191  VAL A O   1 
ATOM   1519  C  CB  . VAL A 1 191 ? 44.152 69.623  23.042  1.00 32.80  ? 191  VAL A CB  1 
ATOM   1520  C  CG1 . VAL A 1 191 ? 42.782 69.862  23.574  1.00 32.73  ? 191  VAL A CG1 1 
ATOM   1521  C  CG2 . VAL A 1 191 ? 44.625 68.261  23.472  1.00 32.24  ? 191  VAL A CG2 1 
ATOM   1522  N  N   . VAL A 1 192 ? 42.300 71.120  20.726  1.00 33.18  ? 192  VAL A N   1 
ATOM   1523  C  CA  . VAL A 1 192 ? 41.632 72.338  20.300  1.00 32.90  ? 192  VAL A CA  1 
ATOM   1524  C  C   . VAL A 1 192 ? 40.209 72.271  20.759  1.00 33.33  ? 192  VAL A C   1 
ATOM   1525  O  O   . VAL A 1 192 ? 39.485 71.387  20.345  1.00 33.85  ? 192  VAL A O   1 
ATOM   1526  C  CB  . VAL A 1 192 ? 41.570 72.457  18.777  1.00 32.44  ? 192  VAL A CB  1 
ATOM   1527  C  CG1 . VAL A 1 192 ? 40.894 73.723  18.396  1.00 31.98  ? 192  VAL A CG1 1 
ATOM   1528  C  CG2 . VAL A 1 192 ? 42.941 72.422  18.169  1.00 32.57  ? 192  VAL A CG2 1 
ATOM   1529  N  N   . ARG A 1 193 ? 39.793 73.193  21.615  1.00 33.87  ? 193  ARG A N   1 
ATOM   1530  C  CA  . ARG A 1 193 ? 38.412 73.214  22.062  1.00 34.18  ? 193  ARG A CA  1 
ATOM   1531  C  C   . ARG A 1 193 ? 37.643 73.983  21.017  1.00 34.53  ? 193  ARG A C   1 
ATOM   1532  O  O   . ARG A 1 193 ? 37.864 75.168  20.835  1.00 34.85  ? 193  ARG A O   1 
ATOM   1533  C  CB  . ARG A 1 193 ? 38.300 73.884  23.425  1.00 34.27  ? 193  ARG A CB  1 
ATOM   1534  C  CG  . ARG A 1 193 ? 36.944 73.724  24.088  1.00 34.76  ? 193  ARG A CG  1 
ATOM   1535  C  CD  . ARG A 1 193 ? 36.935 73.974  25.602  1.00 34.99  ? 193  ARG A CD  1 
ATOM   1536  N  NE  . ARG A 1 193 ? 35.605 73.763  26.172  1.00 35.44  ? 193  ARG A NE  1 
ATOM   1537  C  CZ  . ARG A 1 193 ? 35.235 74.203  27.363  1.00 35.43  ? 193  ARG A CZ  1 
ATOM   1538  N  NH1 . ARG A 1 193 ? 36.108 74.872  28.106  1.00 36.48  ? 193  ARG A NH1 1 
ATOM   1539  N  NH2 . ARG A 1 193 ? 34.000 73.986  27.810  1.00 33.42  ? 193  ARG A NH2 1 
ATOM   1540  N  N   . VAL A 1 194 ? 36.767 73.287  20.310  1.00 35.15  ? 194  VAL A N   1 
ATOM   1541  C  CA  . VAL A 1 194 ? 35.961 73.843  19.219  1.00 35.80  ? 194  VAL A CA  1 
ATOM   1542  C  C   . VAL A 1 194 ? 35.045 75.018  19.591  1.00 36.33  ? 194  VAL A C   1 
ATOM   1543  O  O   . VAL A 1 194 ? 34.619 75.140  20.728  1.00 36.35  ? 194  VAL A O   1 
ATOM   1544  C  CB  . VAL A 1 194 ? 35.127 72.729  18.611  1.00 35.75  ? 194  VAL A CB  1 
ATOM   1545  C  CG1 . VAL A 1 194 ? 33.756 73.215  18.233  1.00 35.74  ? 194  VAL A CG1 1 
ATOM   1546  C  CG2 . VAL A 1 194 ? 35.872 72.101  17.446  1.00 36.11  ? 194  VAL A CG2 1 
ATOM   1547  N  N   . LYS A 1 195 ? 34.730 75.878  18.626  1.00 37.15  ? 195  LYS A N   1 
ATOM   1548  C  CA  . LYS A 1 195 ? 33.937 77.069  18.936  1.00 37.69  ? 195  LYS A CA  1 
ATOM   1549  C  C   . LYS A 1 195 ? 32.499 77.145  18.448  1.00 38.28  ? 195  LYS A C   1 
ATOM   1550  O  O   . LYS A 1 195 ? 31.613 77.503  19.217  1.00 39.18  ? 195  LYS A O   1 
ATOM   1551  C  CB  . LYS A 1 195 ? 34.674 78.350  18.571  1.00 37.69  ? 195  LYS A CB  1 
ATOM   1552  C  CG  . LYS A 1 195 ? 35.191 79.059  19.791  1.00 37.67  ? 195  LYS A CG  1 
ATOM   1553  C  CD  . LYS A 1 195 ? 34.048 79.465  20.693  1.00 36.60  ? 195  LYS A CD  1 
ATOM   1554  C  CE  . LYS A 1 195 ? 34.483 79.448  22.142  1.00 36.68  ? 195  LYS A CE  1 
ATOM   1555  N  NZ  . LYS A 1 195 ? 33.730 80.422  22.978  1.00 36.38  ? 195  LYS A NZ  1 
ATOM   1556  N  N   . TYR A 1 196 ? 32.213 76.848  17.197  1.00 38.35  ? 196  TYR A N   1 
ATOM   1557  C  CA  . TYR A 1 196 ? 30.799 76.940  16.842  1.00 38.44  ? 196  TYR A CA  1 
ATOM   1558  C  C   . TYR A 1 196 ? 30.280 75.714  16.116  1.00 38.40  ? 196  TYR A C   1 
ATOM   1559  O  O   . TYR A 1 196 ? 30.912 74.671  16.116  1.00 38.88  ? 196  TYR A O   1 
ATOM   1560  C  CB  . TYR A 1 196 ? 30.527 78.213  16.053  1.00 38.51  ? 196  TYR A CB  1 
ATOM   1561  C  CG  . TYR A 1 196 ? 30.853 79.473  16.817  1.00 38.99  ? 196  TYR A CG  1 
ATOM   1562  C  CD1 . TYR A 1 196 ? 29.972 79.987  17.744  1.00 40.12  ? 196  TYR A CD1 1 
ATOM   1563  C  CD2 . TYR A 1 196 ? 32.045 80.143  16.615  1.00 40.03  ? 196  TYR A CD2 1 
ATOM   1564  C  CE1 . TYR A 1 196 ? 30.262 81.139  18.440  1.00 40.91  ? 196  TYR A CE1 1 
ATOM   1565  C  CE2 . TYR A 1 196 ? 32.343 81.288  17.303  1.00 40.99  ? 196  TYR A CE2 1 
ATOM   1566  C  CZ  . TYR A 1 196 ? 31.446 81.782  18.213  1.00 41.52  ? 196  TYR A CZ  1 
ATOM   1567  O  OH  . TYR A 1 196 ? 31.740 82.932  18.902  1.00 44.07  ? 196  TYR A OH  1 
ATOM   1568  N  N   . GLY A 1 197 ? 29.123 75.824  15.493  1.00 38.17  ? 197  GLY A N   1 
ATOM   1569  C  CA  . GLY A 1 197 ? 28.605 74.683  14.779  1.00 37.66  ? 197  GLY A CA  1 
ATOM   1570  C  C   . GLY A 1 197 ? 27.834 73.850  15.763  1.00 37.47  ? 197  GLY A C   1 
ATOM   1571  O  O   . GLY A 1 197 ? 27.408 74.360  16.799  1.00 37.54  ? 197  GLY A O   1 
ATOM   1572  N  N   . ASN A 1 198 ? 27.690 72.564  15.460  1.00 37.18  ? 198  ASN A N   1 
ATOM   1573  C  CA  . ASN A 1 198 ? 26.861 71.664  16.254  1.00 36.75  ? 198  ASN A CA  1 
ATOM   1574  C  C   . ASN A 1 198 ? 27.510 70.976  17.472  1.00 37.03  ? 198  ASN A C   1 
ATOM   1575  O  O   . ASN A 1 198 ? 26.866 70.177  18.149  1.00 37.32  ? 198  ASN A O   1 
ATOM   1576  C  CB  . ASN A 1 198 ? 26.255 70.622  15.331  1.00 36.31  ? 198  ASN A CB  1 
ATOM   1577  C  CG  . ASN A 1 198 ? 27.303 69.884  14.550  1.00 35.47  ? 198  ASN A CG  1 
ATOM   1578  O  OD1 . ASN A 1 198 ? 28.479 69.947  14.890  1.00 35.15  ? 198  ASN A OD1 1 
ATOM   1579  N  ND2 . ASN A 1 198 ? 26.892 69.175  13.503  1.00 34.09  ? 198  ASN A ND2 1 
ATOM   1580  N  N   . ALA A 1 199 ? 28.766 71.277  17.766  1.00 37.14  ? 199  ALA A N   1 
ATOM   1581  C  CA  . ALA A 1 199 ? 29.400 70.684  18.935  1.00 37.61  ? 199  ALA A CA  1 
ATOM   1582  C  C   . ALA A 1 199 ? 30.242 71.717  19.673  1.00 38.09  ? 199  ALA A C   1 
ATOM   1583  O  O   . ALA A 1 199 ? 31.353 71.437  20.110  1.00 38.28  ? 199  ALA A O   1 
ATOM   1584  C  CB  . ALA A 1 199 ? 30.241 69.496  18.536  1.00 37.45  ? 199  ALA A CB  1 
ATOM   1585  N  N   . ASP A 1 200 ? 29.678 72.906  19.837  1.00 38.73  ? 200  ASP A N   1 
ATOM   1586  C  CA  . ASP A 1 200 ? 30.402 74.046  20.395  1.00 39.20  ? 200  ASP A CA  1 
ATOM   1587  C  C   . ASP A 1 200 ? 31.341 73.755  21.565  1.00 39.37  ? 200  ASP A C   1 
ATOM   1588  O  O   . ASP A 1 200 ? 32.385 74.389  21.708  1.00 39.81  ? 200  ASP A O   1 
ATOM   1589  C  CB  . ASP A 1 200 ? 29.435 75.185  20.738  1.00 39.19  ? 200  ASP A CB  1 
ATOM   1590  C  CG  . ASP A 1 200 ? 29.933 76.046  21.873  1.00 39.68  ? 200  ASP A CG  1 
ATOM   1591  O  OD1 . ASP A 1 200 ? 29.901 75.547  23.024  1.00 40.44  ? 200  ASP A OD1 1 
ATOM   1592  O  OD2 . ASP A 1 200 ? 30.370 77.215  21.717  1.00 39.09  ? 200  ASP A OD2 1 
ATOM   1593  N  N   . GLY A 1 201 ? 31.008 72.789  22.396  1.00 39.37  ? 201  GLY A N   1 
ATOM   1594  C  CA  . GLY A 1 201 ? 31.864 72.563  23.546  1.00 39.47  ? 201  GLY A CA  1 
ATOM   1595  C  C   . GLY A 1 201 ? 33.021 71.590  23.417  1.00 39.11  ? 201  GLY A C   1 
ATOM   1596  O  O   . GLY A 1 201 ? 33.998 71.704  24.151  1.00 38.69  ? 201  GLY A O   1 
ATOM   1597  N  N   . GLU A 1 202 ? 32.925 70.654  22.480  1.00 39.09  ? 202  GLU A N   1 
ATOM   1598  C  CA  . GLU A 1 202 ? 33.878 69.553  22.430  1.00 39.37  ? 202  GLU A CA  1 
ATOM   1599  C  C   . GLU A 1 202 ? 35.286 69.842  22.007  1.00 39.10  ? 202  GLU A C   1 
ATOM   1600  O  O   . GLU A 1 202 ? 35.605 70.918  21.542  1.00 39.21  ? 202  GLU A O   1 
ATOM   1601  C  CB  . GLU A 1 202 ? 33.355 68.389  21.600  1.00 39.69  ? 202  GLU A CB  1 
ATOM   1602  C  CG  . GLU A 1 202 ? 32.582 67.407  22.437  1.00 40.79  ? 202  GLU A CG  1 
ATOM   1603  C  CD  . GLU A 1 202 ? 31.431 68.107  23.093  1.00 43.93  ? 202  GLU A CD  1 
ATOM   1604  O  OE1 . GLU A 1 202 ? 31.011 69.150  22.535  1.00 44.96  ? 202  GLU A OE1 1 
ATOM   1605  O  OE2 . GLU A 1 202 ? 30.957 67.633  24.151  1.00 45.86  ? 202  GLU A OE2 1 
ATOM   1606  N  N   . TYR A 1 203 ? 36.126 68.842  22.211  1.00 38.96  ? 203  TYR A N   1 
ATOM   1607  C  CA  . TYR A 1 203 ? 37.497 68.916  21.814  1.00 39.13  ? 203  TYR A CA  1 
ATOM   1608  C  C   . TYR A 1 203 ? 37.542 68.378  20.406  1.00 39.01  ? 203  TYR A C   1 
ATOM   1609  O  O   . TYR A 1 203 ? 36.798 67.460  20.055  1.00 38.97  ? 203  TYR A O   1 
ATOM   1610  C  CB  . TYR A 1 203 ? 38.355 68.021  22.698  1.00 39.56  ? 203  TYR A CB  1 
ATOM   1611  C  CG  . TYR A 1 203 ? 38.743 68.576  24.055  1.00 40.16  ? 203  TYR A CG  1 
ATOM   1612  C  CD1 . TYR A 1 203 ? 39.706 69.563  24.183  1.00 40.07  ? 203  TYR A CD1 1 
ATOM   1613  C  CD2 . TYR A 1 203 ? 38.174 68.070  25.208  1.00 41.33  ? 203  TYR A CD2 1 
ATOM   1614  C  CE1 . TYR A 1 203 ? 40.067 70.046  25.421  1.00 41.17  ? 203  TYR A CE1 1 
ATOM   1615  C  CE2 . TYR A 1 203 ? 38.531 68.538  26.448  1.00 42.15  ? 203  TYR A CE2 1 
ATOM   1616  C  CZ  . TYR A 1 203 ? 39.478 69.522  26.554  1.00 42.36  ? 203  TYR A CZ  1 
ATOM   1617  O  OH  . TYR A 1 203 ? 39.814 69.976  27.813  1.00 43.27  ? 203  TYR A OH  1 
ATOM   1618  N  N   . CYS A 1 204 ? 38.400 68.963  19.587  1.00 38.89  ? 204  CYS A N   1 
ATOM   1619  C  CA  . CYS A 1 204 ? 38.578 68.471  18.248  1.00 38.93  ? 204  CYS A CA  1 
ATOM   1620  C  C   . CYS A 1 204 ? 38.974 67.015  18.401  1.00 38.78  ? 204  CYS A C   1 
ATOM   1621  O  O   . CYS A 1 204 ? 39.782 66.687  19.258  1.00 39.14  ? 204  CYS A O   1 
ATOM   1622  C  CB  . CYS A 1 204 ? 39.719 69.219  17.569  1.00 39.16  ? 204  CYS A CB  1 
ATOM   1623  S  SG  . CYS A 1 204 ? 39.288 70.796  16.818  1.00 39.07  ? 204  CYS A SG  1 
ATOM   1624  N  N   . LYS A 1 205 ? 38.392 66.135  17.603  1.00 38.41  ? 205  LYS A N   1 
ATOM   1625  C  CA  . LYS A 1 205 ? 38.826 64.751  17.613  1.00 38.08  ? 205  LYS A CA  1 
ATOM   1626  C  C   . LYS A 1 205 ? 39.820 64.498  16.475  1.00 37.91  ? 205  LYS A C   1 
ATOM   1627  O  O   . LYS A 1 205 ? 39.447 64.249  15.327  1.00 37.42  ? 205  LYS A O   1 
ATOM   1628  C  CB  . LYS A 1 205 ? 37.634 63.789  17.547  1.00 38.22  ? 205  LYS A CB  1 
ATOM   1629  C  CG  . LYS A 1 205 ? 37.978 62.339  17.167  1.00 38.35  ? 205  LYS A CG  1 
ATOM   1630  C  CD  . LYS A 1 205 ? 38.683 61.573  18.268  1.00 38.75  ? 205  LYS A CD  1 
ATOM   1631  C  CE  . LYS A 1 205 ? 37.787 61.394  19.487  1.00 39.68  ? 205  LYS A CE  1 
ATOM   1632  N  NZ  . LYS A 1 205 ? 38.572 60.872  20.657  1.00 40.90  ? 205  LYS A NZ  1 
ATOM   1633  N  N   . PHE A 1 206 ? 41.098 64.604  16.807  1.00 37.93  ? 206  PHE A N   1 
ATOM   1634  C  CA  . PHE A 1 206 ? 42.156 64.247  15.880  1.00 37.78  ? 206  PHE A CA  1 
ATOM   1635  C  C   . PHE A 1 206 ? 42.603 62.837  16.242  1.00 37.52  ? 206  PHE A C   1 
ATOM   1636  O  O   . PHE A 1 206 ? 42.702 62.492  17.415  1.00 37.66  ? 206  PHE A O   1 
ATOM   1637  C  CB  . PHE A 1 206 ? 43.343 65.198  16.005  1.00 37.86  ? 206  PHE A CB  1 
ATOM   1638  C  CG  . PHE A 1 206 ? 43.002 66.637  15.766  1.00 37.77  ? 206  PHE A CG  1 
ATOM   1639  C  CD1 . PHE A 1 206 ? 42.533 67.061  14.537  1.00 38.46  ? 206  PHE A CD1 1 
ATOM   1640  C  CD2 . PHE A 1 206 ? 43.171 67.566  16.763  1.00 36.97  ? 206  PHE A CD2 1 
ATOM   1641  C  CE1 . PHE A 1 206 ? 42.229 68.384  14.320  1.00 38.30  ? 206  PHE A CE1 1 
ATOM   1642  C  CE2 . PHE A 1 206 ? 42.874 68.881  16.552  1.00 36.97  ? 206  PHE A CE2 1 
ATOM   1643  C  CZ  . PHE A 1 206 ? 42.397 69.295  15.333  1.00 37.55  ? 206  PHE A CZ  1 
ATOM   1644  N  N   . PRO A 1 207 ? 42.820 62.012  15.233  1.00 37.25  ? 207  PRO A N   1 
ATOM   1645  C  CA  . PRO A 1 207 ? 42.578 62.409  13.855  1.00 37.00  ? 207  PRO A CA  1 
ATOM   1646  C  C   . PRO A 1 207 ? 41.095 62.295  13.638  1.00 36.60  ? 207  PRO A C   1 
ATOM   1647  O  O   . PRO A 1 207 ? 40.390 61.944  14.577  1.00 36.59  ? 207  PRO A O   1 
ATOM   1648  C  CB  . PRO A 1 207 ? 43.274 61.296  13.084  1.00 37.01  ? 207  PRO A CB  1 
ATOM   1649  C  CG  . PRO A 1 207 ? 42.958 60.123  13.909  1.00 37.14  ? 207  PRO A CG  1 
ATOM   1650  C  CD  . PRO A 1 207 ? 43.306 60.624  15.310  1.00 37.37  ? 207  PRO A CD  1 
ATOM   1651  N  N   . PHE A 1 208 ? 40.634 62.619  12.439  1.00 36.25  ? 208  PHE A N   1 
ATOM   1652  C  CA  . PHE A 1 208 ? 39.243 62.399  12.059  1.00 35.63  ? 208  PHE A CA  1 
ATOM   1653  C  C   . PHE A 1 208 ? 39.211 62.172  10.563  1.00 35.37  ? 208  PHE A C   1 
ATOM   1654  O  O   . PHE A 1 208 ? 40.112 62.598  9.839   1.00 35.04  ? 208  PHE A O   1 
ATOM   1655  C  CB  . PHE A 1 208 ? 38.337 63.553  12.500  1.00 35.68  ? 208  PHE A CB  1 
ATOM   1656  C  CG  . PHE A 1 208 ? 38.608 64.864  11.808  1.00 34.76  ? 208  PHE A CG  1 
ATOM   1657  C  CD1 . PHE A 1 208 ? 38.033 65.151  10.595  1.00 34.52  ? 208  PHE A CD1 1 
ATOM   1658  C  CD2 . PHE A 1 208 ? 39.391 65.818  12.400  1.00 34.56  ? 208  PHE A CD2 1 
ATOM   1659  C  CE1 . PHE A 1 208 ? 38.257 66.342  9.976   1.00 35.01  ? 208  PHE A CE1 1 
ATOM   1660  C  CE2 . PHE A 1 208 ? 39.615 67.016  11.787  1.00 35.10  ? 208  PHE A CE2 1 
ATOM   1661  C  CZ  . PHE A 1 208 ? 39.047 67.278  10.568  1.00 35.51  ? 208  PHE A CZ  1 
ATOM   1662  N  N   . LEU A 1 209 ? 38.190 61.478  10.096  1.00 35.14  ? 209  LEU A N   1 
ATOM   1663  C  CA  . LEU A 1 209 ? 38.133 61.157  8.684   1.00 35.17  ? 209  LEU A CA  1 
ATOM   1664  C  C   . LEU A 1 209 ? 37.161 62.050  7.908   1.00 35.17  ? 209  LEU A C   1 
ATOM   1665  O  O   . LEU A 1 209 ? 35.998 62.187  8.280   1.00 35.16  ? 209  LEU A O   1 
ATOM   1666  C  CB  . LEU A 1 209 ? 37.756 59.680  8.505   1.00 35.18  ? 209  LEU A CB  1 
ATOM   1667  C  CG  . LEU A 1 209 ? 37.996 59.051  7.129   1.00 34.62  ? 209  LEU A CG  1 
ATOM   1668  C  CD1 . LEU A 1 209 ? 39.287 58.268  7.131   1.00 34.16  ? 209  LEU A CD1 1 
ATOM   1669  C  CD2 . LEU A 1 209 ? 36.839 58.156  6.740   1.00 34.24  ? 209  LEU A CD2 1 
ATOM   1670  N  N   . PHE A 1 210 ? 37.651 62.657  6.833   1.00 35.11  ? 210  PHE A N   1 
ATOM   1671  C  CA  . PHE A 1 210 ? 36.808 63.433  5.937   1.00 35.28  ? 210  PHE A CA  1 
ATOM   1672  C  C   . PHE A 1 210 ? 37.316 63.272  4.509   1.00 35.36  ? 210  PHE A C   1 
ATOM   1673  O  O   . PHE A 1 210 ? 38.514 63.361  4.264   1.00 35.91  ? 210  PHE A O   1 
ATOM   1674  C  CB  . PHE A 1 210 ? 36.786 64.911  6.324   1.00 35.23  ? 210  PHE A CB  1 
ATOM   1675  C  CG  . PHE A 1 210 ? 36.137 65.786  5.288   1.00 35.90  ? 210  PHE A CG  1 
ATOM   1676  C  CD1 . PHE A 1 210 ? 34.798 65.613  4.959   1.00 36.06  ? 210  PHE A CD1 1 
ATOM   1677  C  CD2 . PHE A 1 210 ? 36.865 66.758  4.621   1.00 36.15  ? 210  PHE A CD2 1 
ATOM   1678  C  CE1 . PHE A 1 210 ? 34.195 66.400  3.996   1.00 35.82  ? 210  PHE A CE1 1 
ATOM   1679  C  CE2 . PHE A 1 210 ? 36.267 67.544  3.652   1.00 36.43  ? 210  PHE A CE2 1 
ATOM   1680  C  CZ  . PHE A 1 210 ? 34.929 67.363  3.339   1.00 36.14  ? 210  PHE A CZ  1 
ATOM   1681  N  N   . ASN A 1 211 ? 36.417 63.026  3.568   1.00 35.26  ? 211  ASN A N   1 
ATOM   1682  C  CA  . ASN A 1 211 ? 36.801 62.866  2.168   1.00 35.34  ? 211  ASN A CA  1 
ATOM   1683  C  C   . ASN A 1 211 ? 37.886 61.833  1.951   1.00 35.42  ? 211  ASN A C   1 
ATOM   1684  O  O   . ASN A 1 211 ? 38.688 61.968  1.032   1.00 35.38  ? 211  ASN A O   1 
ATOM   1685  C  CB  . ASN A 1 211 ? 37.279 64.186  1.584   1.00 35.45  ? 211  ASN A CB  1 
ATOM   1686  C  CG  . ASN A 1 211 ? 36.508 64.580  0.344   1.00 35.67  ? 211  ASN A CG  1 
ATOM   1687  O  OD1 . ASN A 1 211 ? 36.254 63.762  -0.535  1.00 34.75  ? 211  ASN A OD1 1 
ATOM   1688  N  ND2 . ASN A 1 211 ? 36.116 65.847  0.278   1.00 37.01  ? 211  ASN A ND2 1 
ATOM   1689  N  N   . GLY A 1 212 ? 37.919 60.814  2.802   1.00 35.62  ? 212  GLY A N   1 
ATOM   1690  C  CA  . GLY A 1 212 ? 38.888 59.739  2.668   1.00 35.82  ? 212  GLY A CA  1 
ATOM   1691  C  C   . GLY A 1 212 ? 40.326 60.113  2.982   1.00 35.92  ? 212  GLY A C   1 
ATOM   1692  O  O   . GLY A 1 212 ? 41.258 59.577  2.385   1.00 36.07  ? 212  GLY A O   1 
ATOM   1693  N  N   . LYS A 1 213 ? 40.514 61.036  3.915   1.00 35.87  ? 213  LYS A N   1 
ATOM   1694  C  CA  . LYS A 1 213 ? 41.849 61.414  4.339   1.00 36.09  ? 213  LYS A CA  1 
ATOM   1695  C  C   . LYS A 1 213 ? 41.795 61.777  5.806   1.00 36.10  ? 213  LYS A C   1 
ATOM   1696  O  O   . LYS A 1 213 ? 40.889 62.491  6.234   1.00 36.09  ? 213  LYS A O   1 
ATOM   1697  C  CB  . LYS A 1 213 ? 42.378 62.590  3.524   1.00 36.21  ? 213  LYS A CB  1 
ATOM   1698  C  CG  . LYS A 1 213 ? 43.714 63.108  4.012   1.00 37.06  ? 213  LYS A CG  1 
ATOM   1699  C  CD  . LYS A 1 213 ? 43.946 64.545  3.588   1.00 39.24  ? 213  LYS A CD  1 
ATOM   1700  C  CE  . LYS A 1 213 ? 44.852 65.259  4.584   1.00 41.09  ? 213  LYS A CE  1 
ATOM   1701  N  NZ  . LYS A 1 213 ? 44.874 66.738  4.363   1.00 43.08  ? 213  LYS A NZ  1 
ATOM   1702  N  N   . GLU A 1 214 ? 42.755 61.272  6.580   1.00 36.11  ? 214  GLU A N   1 
ATOM   1703  C  CA  . GLU A 1 214 ? 42.793 61.557  8.010   1.00 36.07  ? 214  GLU A CA  1 
ATOM   1704  C  C   . GLU A 1 214 ? 43.364 62.933  8.292   1.00 36.26  ? 214  GLU A C   1 
ATOM   1705  O  O   . GLU A 1 214 ? 44.356 63.351  7.696   1.00 36.58  ? 214  GLU A O   1 
ATOM   1706  C  CB  . GLU A 1 214 ? 43.558 60.476  8.768   1.00 35.85  ? 214  GLU A CB  1 
ATOM   1707  C  CG  . GLU A 1 214 ? 42.755 59.193  8.922   1.00 36.01  ? 214  GLU A CG  1 
ATOM   1708  C  CD  . GLU A 1 214 ? 43.157 58.378  10.132  1.00 35.69  ? 214  GLU A CD  1 
ATOM   1709  O  OE1 . GLU A 1 214 ? 44.261 58.610  10.668  1.00 36.02  ? 214  GLU A OE1 1 
ATOM   1710  O  OE2 . GLU A 1 214 ? 42.367 57.506  10.545  1.00 35.35  ? 214  GLU A OE2 1 
ATOM   1711  N  N   . TYR A 1 215 ? 42.713 63.655  9.188   1.00 36.33  ? 215  TYR A N   1 
ATOM   1712  C  CA  . TYR A 1 215 ? 43.151 64.995  9.529   1.00 36.25  ? 215  TYR A CA  1 
ATOM   1713  C  C   . TYR A 1 215 ? 43.594 64.963  10.983  1.00 36.70  ? 215  TYR A C   1 
ATOM   1714  O  O   . TYR A 1 215 ? 42.933 64.369  11.823  1.00 36.79  ? 215  TYR A O   1 
ATOM   1715  C  CB  . TYR A 1 215 ? 42.018 66.004  9.265   1.00 35.94  ? 215  TYR A CB  1 
ATOM   1716  C  CG  . TYR A 1 215 ? 41.813 66.275  7.786   1.00 34.97  ? 215  TYR A CG  1 
ATOM   1717  C  CD1 . TYR A 1 215 ? 40.991 65.468  7.017   1.00 34.26  ? 215  TYR A CD1 1 
ATOM   1718  C  CD2 . TYR A 1 215 ? 42.481 67.318  7.151   1.00 34.51  ? 215  TYR A CD2 1 
ATOM   1719  C  CE1 . TYR A 1 215 ? 40.831 65.697  5.661   1.00 34.23  ? 215  TYR A CE1 1 
ATOM   1720  C  CE2 . TYR A 1 215 ? 42.326 67.561  5.798   1.00 33.46  ? 215  TYR A CE2 1 
ATOM   1721  C  CZ  . TYR A 1 215 ? 41.503 66.748  5.057   1.00 33.94  ? 215  TYR A CZ  1 
ATOM   1722  O  OH  . TYR A 1 215 ? 41.346 66.983  3.711   1.00 33.47  ? 215  TYR A OH  1 
ATOM   1723  N  N   . ASN A 1 216 ? 44.740 65.557  11.281  1.00 37.35  ? 216  ASN A N   1 
ATOM   1724  C  CA  . ASN A 1 216 ? 45.235 65.548  12.657  1.00 37.90  ? 216  ASN A CA  1 
ATOM   1725  C  C   . ASN A 1 216 ? 45.294 66.933  13.291  1.00 37.90  ? 216  ASN A C   1 
ATOM   1726  O  O   . ASN A 1 216 ? 45.659 67.084  14.456  1.00 37.92  ? 216  ASN A O   1 
ATOM   1727  C  CB  . ASN A 1 216 ? 46.599 64.866  12.732  1.00 38.07  ? 216  ASN A CB  1 
ATOM   1728  C  CG  . ASN A 1 216 ? 46.522 63.391  12.407  1.00 38.76  ? 216  ASN A CG  1 
ATOM   1729  O  OD1 . ASN A 1 216 ? 46.177 62.578  13.264  1.00 39.98  ? 216  ASN A OD1 1 
ATOM   1730  N  ND2 . ASN A 1 216 ? 46.832 63.036  11.162  1.00 38.95  ? 216  ASN A ND2 1 
ATOM   1731  N  N   . SER A 1 217 ? 44.934 67.943  12.511  1.00 37.68  ? 217  SER A N   1 
ATOM   1732  C  CA  . SER A 1 217 ? 44.909 69.299  13.003  1.00 37.50  ? 217  SER A CA  1 
ATOM   1733  C  C   . SER A 1 217 ? 43.786 69.996  12.280  1.00 37.43  ? 217  SER A C   1 
ATOM   1734  O  O   . SER A 1 217 ? 43.348 69.543  11.225  1.00 37.36  ? 217  SER A O   1 
ATOM   1735  C  CB  . SER A 1 217 ? 46.219 70.006  12.706  1.00 37.29  ? 217  SER A CB  1 
ATOM   1736  O  OG  . SER A 1 217 ? 46.242 70.393  11.350  1.00 38.03  ? 217  SER A OG  1 
ATOM   1737  N  N   . CYS A 1 218 ? 43.324 71.100  12.850  1.00 37.29  ? 218  CYS A N   1 
ATOM   1738  C  CA  . CYS A 1 218 ? 42.246 71.859  12.259  1.00 37.33  ? 218  CYS A CA  1 
ATOM   1739  C  C   . CYS A 1 218 ? 42.574 72.162  10.817  1.00 36.79  ? 218  CYS A C   1 
ATOM   1740  O  O   . CYS A 1 218 ? 43.750 72.281  10.469  1.00 36.94  ? 218  CYS A O   1 
ATOM   1741  C  CB  . CYS A 1 218 ? 42.028 73.126  13.060  1.00 37.52  ? 218  CYS A CB  1 
ATOM   1742  S  SG  . CYS A 1 218 ? 41.264 72.760  14.661  1.00 40.30  ? 218  CYS A SG  1 
ATOM   1743  N  N   . THR A 1 219 ? 41.539 72.276  9.984   1.00 36.19  ? 219  THR A N   1 
ATOM   1744  C  CA  . THR A 1 219 ? 41.714 72.516  8.554   1.00 35.56  ? 219  THR A CA  1 
ATOM   1745  C  C   . THR A 1 219 ? 40.674 73.456  7.951   1.00 35.43  ? 219  THR A C   1 
ATOM   1746  O  O   . THR A 1 219 ? 39.611 73.673  8.533   1.00 35.11  ? 219  THR A O   1 
ATOM   1747  C  CB  . THR A 1 219 ? 41.614 71.188  7.826   1.00 35.53  ? 219  THR A CB  1 
ATOM   1748  O  OG1 . THR A 1 219 ? 41.722 71.402  6.413   1.00 35.27  ? 219  THR A OG1 1 
ATOM   1749  C  CG2 . THR A 1 219 ? 40.212 70.623  7.995   1.00 35.42  ? 219  THR A CG2 1 
ATOM   1750  N  N   . ASP A 1 220 ? 40.992 74.006  6.775   1.00 35.37  ? 220  ASP A N   1 
ATOM   1751  C  CA  . ASP A 1 220 ? 40.053 74.833  6.008   1.00 35.06  ? 220  ASP A CA  1 
ATOM   1752  C  C   . ASP A 1 220 ? 39.601 74.098  4.761   1.00 35.01  ? 220  ASP A C   1 
ATOM   1753  O  O   . ASP A 1 220 ? 38.942 74.673  3.905   1.00 35.07  ? 220  ASP A O   1 
ATOM   1754  C  CB  . ASP A 1 220 ? 40.657 76.174  5.604   1.00 35.05  ? 220  ASP A CB  1 
ATOM   1755  C  CG  . ASP A 1 220 ? 41.807 76.026  4.632   1.00 36.06  ? 220  ASP A CG  1 
ATOM   1756  O  OD1 . ASP A 1 220 ? 42.601 75.079  4.818   1.00 38.36  ? 220  ASP A OD1 1 
ATOM   1757  O  OD2 . ASP A 1 220 ? 42.013 76.805  3.667   1.00 35.65  ? 220  ASP A OD2 1 
ATOM   1758  N  N   . THR A 1 221 ? 39.966 72.826  4.644   1.00 35.15  ? 221  THR A N   1 
ATOM   1759  C  CA  . THR A 1 221 ? 39.525 72.043  3.508   1.00 35.10  ? 221  THR A CA  1 
ATOM   1760  C  C   . THR A 1 221 ? 38.023 72.024  3.568   1.00 35.65  ? 221  THR A C   1 
ATOM   1761  O  O   . THR A 1 221 ? 37.441 71.952  4.643   1.00 35.45  ? 221  THR A O   1 
ATOM   1762  C  CB  . THR A 1 221 ? 40.076 70.626  3.557   1.00 34.94  ? 221  THR A CB  1 
ATOM   1763  O  OG1 . THR A 1 221 ? 40.038 70.059  2.242   1.00 34.53  ? 221  THR A OG1 1 
ATOM   1764  C  CG2 . THR A 1 221 ? 39.164 69.724  4.355   1.00 34.22  ? 221  THR A CG2 1 
ATOM   1765  N  N   . GLY A 1 222 ? 37.391 72.094  2.407   1.00 36.59  ? 222  GLY A N   1 
ATOM   1766  C  CA  . GLY A 1 222 ? 35.947 72.210  2.351   1.00 37.64  ? 222  GLY A CA  1 
ATOM   1767  C  C   . GLY A 1 222 ? 35.631 73.689  2.172   1.00 38.35  ? 222  GLY A C   1 
ATOM   1768  O  O   . GLY A 1 222 ? 35.252 74.122  1.083   1.00 38.77  ? 222  GLY A O   1 
ATOM   1769  N  N   . ARG A 1 223 ? 35.847 74.466  3.231   1.00 38.55  ? 223  ARG A N   1 
ATOM   1770  C  CA  . ARG A 1 223 ? 35.570 75.898  3.256   1.00 38.90  ? 223  ARG A CA  1 
ATOM   1771  C  C   . ARG A 1 223 ? 36.174 76.726  2.129   1.00 39.41  ? 223  ARG A C   1 
ATOM   1772  O  O   . ARG A 1 223 ? 37.124 76.315  1.456   1.00 39.73  ? 223  ARG A O   1 
ATOM   1773  C  CB  . ARG A 1 223 ? 36.084 76.471  4.563   1.00 38.72  ? 223  ARG A CB  1 
ATOM   1774  C  CG  . ARG A 1 223 ? 35.781 75.611  5.751   1.00 39.31  ? 223  ARG A CG  1 
ATOM   1775  C  CD  . ARG A 1 223 ? 34.397 75.826  6.266   1.00 39.90  ? 223  ARG A CD  1 
ATOM   1776  N  NE  . ARG A 1 223 ? 34.047 77.225  6.073   1.00 39.70  ? 223  ARG A NE  1 
ATOM   1777  C  CZ  . ARG A 1 223 ? 33.071 77.826  6.710   1.00 39.36  ? 223  ARG A CZ  1 
ATOM   1778  N  NH1 . ARG A 1 223 ? 32.346 77.148  7.586   1.00 39.39  ? 223  ARG A NH1 1 
ATOM   1779  N  NH2 . ARG A 1 223 ? 32.819 79.100  6.474   1.00 39.19  ? 223  ARG A NH2 1 
ATOM   1780  N  N   . SER A 1 224 ? 35.634 77.929  1.964   1.00 39.62  ? 224  SER A N   1 
ATOM   1781  C  CA  . SER A 1 224 ? 36.129 78.852  0.962   1.00 39.74  ? 224  SER A CA  1 
ATOM   1782  C  C   . SER A 1 224 ? 36.601 80.137  1.611   1.00 39.63  ? 224  SER A C   1 
ATOM   1783  O  O   . SER A 1 224 ? 37.476 80.829  1.079   1.00 40.12  ? 224  SER A O   1 
ATOM   1784  C  CB  . SER A 1 224 ? 35.022 79.175  -0.034  1.00 39.85  ? 224  SER A CB  1 
ATOM   1785  O  OG  . SER A 1 224 ? 34.191 78.045  -0.234  1.00 40.61  ? 224  SER A OG  1 
ATOM   1786  N  N   . ASP A 1 225 ? 36.020 80.463  2.762   1.00 39.20  ? 225  ASP A N   1 
ATOM   1787  C  CA  . ASP A 1 225 ? 36.344 81.716  3.444   1.00 38.61  ? 225  ASP A CA  1 
ATOM   1788  C  C   . ASP A 1 225 ? 37.696 81.704  4.119   1.00 38.64  ? 225  ASP A C   1 
ATOM   1789  O  O   . ASP A 1 225 ? 38.287 82.754  4.331   1.00 39.32  ? 225  ASP A O   1 
ATOM   1790  C  CB  . ASP A 1 225 ? 35.273 82.088  4.455   1.00 38.19  ? 225  ASP A CB  1 
ATOM   1791  C  CG  . ASP A 1 225 ? 34.909 80.952  5.325   1.00 36.94  ? 225  ASP A CG  1 
ATOM   1792  O  OD1 . ASP A 1 225 ? 35.671 79.977  5.344   1.00 36.59  ? 225  ASP A OD1 1 
ATOM   1793  O  OD2 . ASP A 1 225 ? 33.877 80.931  6.015   1.00 36.37  ? 225  ASP A OD2 1 
ATOM   1794  N  N   . GLY A 1 226 ? 38.183 80.522  4.468   1.00 38.27  ? 226  GLY A N   1 
ATOM   1795  C  CA  . GLY A 1 226 ? 39.501 80.414  5.055   1.00 37.63  ? 226  GLY A CA  1 
ATOM   1796  C  C   . GLY A 1 226 ? 39.458 79.991  6.497   1.00 37.38  ? 226  GLY A C   1 
ATOM   1797  O  O   . GLY A 1 226 ? 40.495 79.819  7.125   1.00 37.84  ? 226  GLY A O   1 
ATOM   1798  N  N   . PHE A 1 227 ? 38.256 79.806  7.022   1.00 36.85  ? 227  PHE A N   1 
ATOM   1799  C  CA  . PHE A 1 227 ? 38.092 79.448  8.422   1.00 36.28  ? 227  PHE A CA  1 
ATOM   1800  C  C   . PHE A 1 227 ? 38.582 78.055  8.740   1.00 36.07  ? 227  PHE A C   1 
ATOM   1801  O  O   . PHE A 1 227 ? 38.800 77.244  7.855   1.00 36.25  ? 227  PHE A O   1 
ATOM   1802  C  CB  . PHE A 1 227 ? 36.629 79.574  8.841   1.00 36.36  ? 227  PHE A CB  1 
ATOM   1803  C  CG  . PHE A 1 227 ? 36.245 80.951  9.251   1.00 35.37  ? 227  PHE A CG  1 
ATOM   1804  C  CD1 . PHE A 1 227 ? 36.187 81.967  8.318   1.00 34.86  ? 227  PHE A CD1 1 
ATOM   1805  C  CD2 . PHE A 1 227 ? 35.962 81.231  10.570  1.00 35.16  ? 227  PHE A CD2 1 
ATOM   1806  C  CE1 . PHE A 1 227 ? 35.843 83.232  8.686   1.00 35.06  ? 227  PHE A CE1 1 
ATOM   1807  C  CE2 . PHE A 1 227 ? 35.616 82.493  10.955  1.00 35.68  ? 227  PHE A CE2 1 
ATOM   1808  C  CZ  . PHE A 1 227 ? 35.558 83.504  10.009  1.00 36.17  ? 227  PHE A CZ  1 
ATOM   1809  N  N   . LEU A 1 228 ? 38.719 77.776  10.025  1.00 35.57  ? 228  LEU A N   1 
ATOM   1810  C  CA  . LEU A 1 228 ? 39.204 76.495  10.472  1.00 34.96  ? 228  LEU A CA  1 
ATOM   1811  C  C   . LEU A 1 228 ? 38.106 75.708  11.177  1.00 35.41  ? 228  LEU A C   1 
ATOM   1812  O  O   . LEU A 1 228 ? 37.491 76.195  12.123  1.00 35.99  ? 228  LEU A O   1 
ATOM   1813  C  CB  . LEU A 1 228 ? 40.383 76.719  11.416  1.00 34.58  ? 228  LEU A CB  1 
ATOM   1814  C  CG  . LEU A 1 228 ? 41.804 76.622  10.848  1.00 32.24  ? 228  LEU A CG  1 
ATOM   1815  C  CD1 . LEU A 1 228 ? 41.808 76.854  9.363   1.00 29.93  ? 228  LEU A CD1 1 
ATOM   1816  C  CD2 . LEU A 1 228 ? 42.731 77.585  11.565  1.00 29.46  ? 228  LEU A CD2 1 
ATOM   1817  N  N   . TRP A 1 229 ? 37.849 74.491  10.713  1.00 35.44  ? 229  TRP A N   1 
ATOM   1818  C  CA  . TRP A 1 229 ? 36.872 73.617  11.359  1.00 35.21  ? 229  TRP A CA  1 
ATOM   1819  C  C   . TRP A 1 229 ? 37.491 72.252  11.546  1.00 35.89  ? 229  TRP A C   1 
ATOM   1820  O  O   . TRP A 1 229 ? 38.365 71.856  10.790  1.00 36.61  ? 229  TRP A O   1 
ATOM   1821  C  CB  . TRP A 1 229 ? 35.643 73.437  10.498  1.00 34.44  ? 229  TRP A CB  1 
ATOM   1822  C  CG  . TRP A 1 229 ? 35.906 72.622  9.282   1.00 32.68  ? 229  TRP A CG  1 
ATOM   1823  C  CD1 . TRP A 1 229 ? 36.427 73.065  8.114   1.00 32.04  ? 229  TRP A CD1 1 
ATOM   1824  C  CD2 . TRP A 1 229 ? 35.661 71.223  9.101   1.00 32.01  ? 229  TRP A CD2 1 
ATOM   1825  N  NE1 . TRP A 1 229 ? 36.524 72.039  7.208   1.00 31.06  ? 229  TRP A NE1 1 
ATOM   1826  C  CE2 . TRP A 1 229 ? 36.053 70.895  7.788   1.00 31.49  ? 229  TRP A CE2 1 
ATOM   1827  C  CE3 . TRP A 1 229 ? 35.133 70.210  9.911   1.00 31.95  ? 229  TRP A CE3 1 
ATOM   1828  C  CZ2 . TRP A 1 229 ? 35.935 69.605  7.265   1.00 31.27  ? 229  TRP A CZ2 1 
ATOM   1829  C  CZ3 . TRP A 1 229 ? 35.016 68.928  9.391   1.00 31.10  ? 229  TRP A CZ3 1 
ATOM   1830  C  CH2 . TRP A 1 229 ? 35.420 68.637  8.082   1.00 31.39  ? 229  TRP A CH2 1 
ATOM   1831  N  N   . CYS A 1 230 ? 37.032 71.520  12.542  1.00 36.18  ? 230  CYS A N   1 
ATOM   1832  C  CA  . CYS A 1 230 ? 37.549 70.191  12.759  1.00 36.80  ? 230  CYS A CA  1 
ATOM   1833  C  C   . CYS A 1 230 ? 36.356 69.335  13.133  1.00 36.59  ? 230  CYS A C   1 
ATOM   1834  O  O   . CYS A 1 230 ? 35.387 69.849  13.692  1.00 36.70  ? 230  CYS A O   1 
ATOM   1835  C  CB  . CYS A 1 230 ? 38.569 70.208  13.890  1.00 37.04  ? 230  CYS A CB  1 
ATOM   1836  S  SG  . CYS A 1 230 ? 37.801 70.459  15.502  1.00 38.96  ? 230  CYS A SG  1 
ATOM   1837  N  N   . SER A 1 231 ? 36.405 68.041  12.830  1.00 36.10  ? 231  SER A N   1 
ATOM   1838  C  CA  . SER A 1 231 ? 35.264 67.207  13.150  1.00 35.73  ? 231  SER A CA  1 
ATOM   1839  C  C   . SER A 1 231 ? 35.383 66.839  14.590  1.00 35.13  ? 231  SER A C   1 
ATOM   1840  O  O   . SER A 1 231 ? 36.484 66.693  15.095  1.00 34.98  ? 231  SER A O   1 
ATOM   1841  C  CB  . SER A 1 231 ? 35.238 65.931  12.330  1.00 36.04  ? 231  SER A CB  1 
ATOM   1842  O  OG  . SER A 1 231 ? 35.382 64.820  13.189  1.00 36.80  ? 231  SER A OG  1 
ATOM   1843  N  N   . THR A 1 232 ? 34.242 66.657  15.241  1.00 34.57  ? 232  THR A N   1 
ATOM   1844  C  CA  . THR A 1 232 ? 34.220 66.354  16.662  1.00 33.74  ? 232  THR A CA  1 
ATOM   1845  C  C   . THR A 1 232 ? 34.194 64.873  17.019  1.00 33.38  ? 232  THR A C   1 
ATOM   1846  O  O   . THR A 1 232 ? 33.998 64.505  18.175  1.00 33.75  ? 232  THR A O   1 
ATOM   1847  C  CB  . THR A 1 232 ? 33.105 67.157  17.339  1.00 33.56  ? 232  THR A CB  1 
ATOM   1848  O  OG1 . THR A 1 232 ? 33.708 68.026  18.301  1.00 33.29  ? 232  THR A OG1 1 
ATOM   1849  C  CG2 . THR A 1 232 ? 32.190 66.271  18.176  1.00 33.86  ? 232  THR A CG2 1 
ATOM   1850  N  N   . THR A 1 233 ? 34.395 64.016  16.029  1.00 32.59  ? 233  THR A N   1 
ATOM   1851  C  CA  . THR A 1 233 ? 34.522 62.590  16.289  1.00 32.05  ? 233  THR A CA  1 
ATOM   1852  C  C   . THR A 1 233 ? 35.313 61.964  15.152  1.00 31.91  ? 233  THR A C   1 
ATOM   1853  O  O   . THR A 1 233 ? 35.736 62.665  14.241  1.00 32.07  ? 233  THR A O   1 
ATOM   1854  C  CB  . THR A 1 233 ? 33.171 61.927  16.462  1.00 31.86  ? 233  THR A CB  1 
ATOM   1855  O  OG1 . THR A 1 233 ? 32.409 62.098  15.270  1.00 32.64  ? 233  THR A OG1 1 
ATOM   1856  C  CG2 . THR A 1 233 ? 32.357 62.657  17.508  1.00 31.25  ? 233  THR A CG2 1 
ATOM   1857  N  N   . TYR A 1 234 ? 35.550 60.662  15.196  1.00 31.59  ? 234  TYR A N   1 
ATOM   1858  C  CA  . TYR A 1 234 ? 36.352 60.084  14.139  1.00 31.61  ? 234  TYR A CA  1 
ATOM   1859  C  C   . TYR A 1 234 ? 35.682 60.185  12.773  1.00 32.19  ? 234  TYR A C   1 
ATOM   1860  O  O   . TYR A 1 234 ? 36.252 60.755  11.828  1.00 32.64  ? 234  TYR A O   1 
ATOM   1861  C  CB  . TYR A 1 234 ? 36.729 58.638  14.412  1.00 31.24  ? 234  TYR A CB  1 
ATOM   1862  C  CG  . TYR A 1 234 ? 37.647 58.123  13.337  1.00 30.49  ? 234  TYR A CG  1 
ATOM   1863  C  CD1 . TYR A 1 234 ? 38.986 58.473  13.324  1.00 30.37  ? 234  TYR A CD1 1 
ATOM   1864  C  CD2 . TYR A 1 234 ? 37.168 57.350  12.300  1.00 29.26  ? 234  TYR A CD2 1 
ATOM   1865  C  CE1 . TYR A 1 234 ? 39.827 58.029  12.330  1.00 30.17  ? 234  TYR A CE1 1 
ATOM   1866  C  CE2 . TYR A 1 234 ? 38.002 56.897  11.308  1.00 29.22  ? 234  TYR A CE2 1 
ATOM   1867  C  CZ  . TYR A 1 234 ? 39.327 57.235  11.330  1.00 29.75  ? 234  TYR A CZ  1 
ATOM   1868  O  OH  . TYR A 1 234 ? 40.163 56.788  10.341  1.00 30.81  ? 234  TYR A OH  1 
ATOM   1869  N  N   . ASN A 1 235 ? 34.477 59.630  12.676  1.00 32.22  ? 235  ASN A N   1 
ATOM   1870  C  CA  . ASN A 1 235 ? 33.752 59.568  11.418  1.00 32.29  ? 235  ASN A CA  1 
ATOM   1871  C  C   . ASN A 1 235 ? 32.847 60.752  11.185  1.00 32.49  ? 235  ASN A C   1 
ATOM   1872  O  O   . ASN A 1 235 ? 31.745 60.801  11.710  1.00 32.62  ? 235  ASN A O   1 
ATOM   1873  C  CB  . ASN A 1 235 ? 32.902 58.301  11.373  1.00 32.37  ? 235  ASN A CB  1 
ATOM   1874  C  CG  . ASN A 1 235 ? 32.621 57.845  9.966   1.00 31.85  ? 235  ASN A CG  1 
ATOM   1875  O  OD1 . ASN A 1 235 ? 32.971 56.734  9.586   1.00 31.56  ? 235  ASN A OD1 1 
ATOM   1876  N  ND2 . ASN A 1 235 ? 32.006 58.706  9.177   1.00 31.48  ? 235  ASN A ND2 1 
ATOM   1877  N  N   . PHE A 1 236 ? 33.298 61.697  10.374  1.00 32.92  ? 236  PHE A N   1 
ATOM   1878  C  CA  . PHE A 1 236 ? 32.486 62.866  10.074  1.00 33.23  ? 236  PHE A CA  1 
ATOM   1879  C  C   . PHE A 1 236 ? 31.307 62.457  9.206   1.00 33.60  ? 236  PHE A C   1 
ATOM   1880  O  O   . PHE A 1 236 ? 30.170 62.846  9.461   1.00 33.69  ? 236  PHE A O   1 
ATOM   1881  C  CB  . PHE A 1 236 ? 33.316 63.949  9.382   1.00 33.08  ? 236  PHE A CB  1 
ATOM   1882  C  CG  . PHE A 1 236 ? 32.598 65.250  9.240   1.00 32.67  ? 236  PHE A CG  1 
ATOM   1883  C  CD1 . PHE A 1 236 ? 32.213 65.964  10.364  1.00 32.38  ? 236  PHE A CD1 1 
ATOM   1884  C  CD2 . PHE A 1 236 ? 32.296 65.756  7.987   1.00 32.37  ? 236  PHE A CD2 1 
ATOM   1885  C  CE1 . PHE A 1 236 ? 31.535 67.156  10.245  1.00 32.28  ? 236  PHE A CE1 1 
ATOM   1886  C  CE2 . PHE A 1 236 ? 31.620 66.951  7.858   1.00 32.41  ? 236  PHE A CE2 1 
ATOM   1887  C  CZ  . PHE A 1 236 ? 31.236 67.651  8.988   1.00 32.40  ? 236  PHE A CZ  1 
ATOM   1888  N  N   . GLU A 1 237 ? 31.590 61.647  8.193   1.00 34.19  ? 237  GLU A N   1 
ATOM   1889  C  CA  . GLU A 1 237 ? 30.578 61.161  7.252   1.00 34.67  ? 237  GLU A CA  1 
ATOM   1890  C  C   . GLU A 1 237 ? 29.418 60.473  7.939   1.00 34.91  ? 237  GLU A C   1 
ATOM   1891  O  O   . GLU A 1 237 ? 28.330 60.379  7.387   1.00 35.04  ? 237  GLU A O   1 
ATOM   1892  C  CB  . GLU A 1 237 ? 31.218 60.185  6.265   1.00 34.77  ? 237  GLU A CB  1 
ATOM   1893  C  CG  . GLU A 1 237 ? 30.242 59.445  5.374   1.00 35.08  ? 237  GLU A CG  1 
ATOM   1894  C  CD  . GLU A 1 237 ? 30.948 58.557  4.368   1.00 36.22  ? 237  GLU A CD  1 
ATOM   1895  O  OE1 . GLU A 1 237 ? 32.128 58.839  4.060   1.00 37.06  ? 237  GLU A OE1 1 
ATOM   1896  O  OE2 . GLU A 1 237 ? 30.327 57.581  3.887   1.00 36.50  ? 237  GLU A OE2 1 
ATOM   1897  N  N   . LYS A 1 238 ? 29.652 59.985  9.146   1.00 35.49  ? 238  LYS A N   1 
ATOM   1898  C  CA  . LYS A 1 238 ? 28.617 59.280  9.879   1.00 35.96  ? 238  LYS A CA  1 
ATOM   1899  C  C   . LYS A 1 238 ? 28.045 60.157  10.988  1.00 36.01  ? 238  LYS A C   1 
ATOM   1900  O  O   . LYS A 1 238 ? 26.836 60.365  11.055  1.00 36.43  ? 238  LYS A O   1 
ATOM   1901  C  CB  . LYS A 1 238 ? 29.159 57.952  10.419  1.00 36.10  ? 238  LYS A CB  1 
ATOM   1902  C  CG  . LYS A 1 238 ? 28.239 57.195  11.374  1.00 37.21  ? 238  LYS A CG  1 
ATOM   1903  C  CD  . LYS A 1 238 ? 26.859 56.941  10.781  1.00 38.56  ? 238  LYS A CD  1 
ATOM   1904  C  CE  . LYS A 1 238 ? 26.114 55.823  11.521  1.00 39.55  ? 238  LYS A CE  1 
ATOM   1905  N  NZ  . LYS A 1 238 ? 26.284 54.477  10.878  1.00 39.73  ? 238  LYS A NZ  1 
ATOM   1906  N  N   . ASP A 1 239 ? 28.902 60.695  11.840  1.00 35.85  ? 239  ASP A N   1 
ATOM   1907  C  CA  . ASP A 1 239 ? 28.419 61.523  12.940  1.00 36.05  ? 239  ASP A CA  1 
ATOM   1908  C  C   . ASP A 1 239 ? 27.938 62.933  12.520  1.00 35.93  ? 239  ASP A C   1 
ATOM   1909  O  O   . ASP A 1 239 ? 26.839 63.348  12.874  1.00 35.64  ? 239  ASP A O   1 
ATOM   1910  C  CB  . ASP A 1 239 ? 29.467 61.567  14.062  1.00 36.19  ? 239  ASP A CB  1 
ATOM   1911  C  CG  . ASP A 1 239 ? 29.943 60.174  14.456  1.00 36.67  ? 239  ASP A CG  1 
ATOM   1912  O  OD1 . ASP A 1 239 ? 29.201 59.206  14.168  1.00 37.02  ? 239  ASP A OD1 1 
ATOM   1913  O  OD2 . ASP A 1 239 ? 31.034 59.940  15.031  1.00 36.86  ? 239  ASP A OD2 1 
ATOM   1914  N  N   . GLY A 1 240 ? 28.759 63.667  11.778  1.00 35.97  ? 240  GLY A N   1 
ATOM   1915  C  CA  . GLY A 1 240 ? 28.384 64.996  11.320  1.00 35.90  ? 240  GLY A CA  1 
ATOM   1916  C  C   . GLY A 1 240 ? 28.593 66.137  12.307  1.00 35.90  ? 240  GLY A C   1 
ATOM   1917  O  O   . GLY A 1 240 ? 28.081 67.242  12.102  1.00 35.95  ? 240  GLY A O   1 
ATOM   1918  N  N   . LYS A 1 241 ? 29.350 65.887  13.371  1.00 35.63  ? 241  LYS A N   1 
ATOM   1919  C  CA  . LYS A 1 241 ? 29.570 66.908  14.387  1.00 35.50  ? 241  LYS A CA  1 
ATOM   1920  C  C   . LYS A 1 241 ? 30.942 67.573  14.244  1.00 35.67  ? 241  LYS A C   1 
ATOM   1921  O  O   . LYS A 1 241 ? 31.953 66.906  14.008  1.00 36.13  ? 241  LYS A O   1 
ATOM   1922  C  CB  . LYS A 1 241 ? 29.353 66.321  15.782  1.00 35.43  ? 241  LYS A CB  1 
ATOM   1923  C  CG  . LYS A 1 241 ? 27.891 66.012  16.089  1.00 35.15  ? 241  LYS A CG  1 
ATOM   1924  C  CD  . LYS A 1 241 ? 27.738 64.594  16.612  1.00 36.42  ? 241  LYS A CD  1 
ATOM   1925  C  CE  . LYS A 1 241 ? 26.439 63.943  16.105  1.00 37.11  ? 241  LYS A CE  1 
ATOM   1926  N  NZ  . LYS A 1 241 ? 26.419 62.443  16.188  1.00 36.45  ? 241  LYS A NZ  1 
ATOM   1927  N  N   . TYR A 1 242 ? 30.970 68.894  14.393  1.00 35.31  ? 242  TYR A N   1 
ATOM   1928  C  CA  . TYR A 1 242 ? 32.180 69.659  14.174  1.00 34.84  ? 242  TYR A CA  1 
ATOM   1929  C  C   . TYR A 1 242 ? 32.000 71.032  14.761  1.00 34.61  ? 242  TYR A C   1 
ATOM   1930  O  O   . TYR A 1 242 ? 30.931 71.384  15.218  1.00 34.63  ? 242  TYR A O   1 
ATOM   1931  C  CB  . TYR A 1 242 ? 32.366 69.861  12.687  1.00 34.90  ? 242  TYR A CB  1 
ATOM   1932  C  CG  . TYR A 1 242 ? 31.387 70.875  12.165  1.00 35.46  ? 242  TYR A CG  1 
ATOM   1933  C  CD1 . TYR A 1 242 ? 30.029 70.605  12.149  1.00 36.03  ? 242  TYR A CD1 1 
ATOM   1934  C  CD2 . TYR A 1 242 ? 31.810 72.116  11.724  1.00 36.42  ? 242  TYR A CD2 1 
ATOM   1935  C  CE1 . TYR A 1 242 ? 29.124 71.528  11.694  1.00 36.15  ? 242  TYR A CE1 1 
ATOM   1936  C  CE2 . TYR A 1 242 ? 30.908 73.049  11.264  1.00 37.08  ? 242  TYR A CE2 1 
ATOM   1937  C  CZ  . TYR A 1 242 ? 29.567 72.746  11.258  1.00 37.01  ? 242  TYR A CZ  1 
ATOM   1938  O  OH  . TYR A 1 242 ? 28.663 73.670  10.804  1.00 38.97  ? 242  TYR A OH  1 
ATOM   1939  N  N   . GLY A 1 243 ? 33.048 71.831  14.694  1.00 34.57  ? 243  GLY A N   1 
ATOM   1940  C  CA  . GLY A 1 243 ? 33.005 73.181  15.208  1.00 34.52  ? 243  GLY A CA  1 
ATOM   1941  C  C   . GLY A 1 243 ? 34.150 73.978  14.633  1.00 34.55  ? 243  GLY A C   1 
ATOM   1942  O  O   . GLY A 1 243 ? 34.999 73.424  13.945  1.00 34.83  ? 243  GLY A O   1 
ATOM   1943  N  N   . PHE A 1 244 ? 34.202 75.271  14.911  1.00 34.39  ? 244  PHE A N   1 
ATOM   1944  C  CA  . PHE A 1 244 ? 35.267 76.062  14.324  1.00 34.36  ? 244  PHE A CA  1 
ATOM   1945  C  C   . PHE A 1 244 ? 36.481 76.160  15.237  1.00 34.55  ? 244  PHE A C   1 
ATOM   1946  O  O   . PHE A 1 244 ? 36.378 76.079  16.455  1.00 34.85  ? 244  PHE A O   1 
ATOM   1947  C  CB  . PHE A 1 244 ? 34.738 77.419  13.868  1.00 34.28  ? 244  PHE A CB  1 
ATOM   1948  C  CG  . PHE A 1 244 ? 33.844 77.321  12.676  1.00 33.71  ? 244  PHE A CG  1 
ATOM   1949  C  CD1 . PHE A 1 244 ? 32.494 77.109  12.827  1.00 33.69  ? 244  PHE A CD1 1 
ATOM   1950  C  CD2 . PHE A 1 244 ? 34.362 77.381  11.403  1.00 33.58  ? 244  PHE A CD2 1 
ATOM   1951  C  CE1 . PHE A 1 244 ? 31.679 76.985  11.730  1.00 33.70  ? 244  PHE A CE1 1 
ATOM   1952  C  CE2 . PHE A 1 244 ? 33.539 77.261  10.300  1.00 33.10  ? 244  PHE A CE2 1 
ATOM   1953  C  CZ  . PHE A 1 244 ? 32.206 77.064  10.465  1.00 32.67  ? 244  PHE A CZ  1 
ATOM   1954  N  N   . CYS A 1 245 ? 37.650 76.297  14.646  1.00 34.73  ? 245  CYS A N   1 
ATOM   1955  C  CA  . CYS A 1 245 ? 38.848 76.356  15.455  1.00 35.12  ? 245  CYS A CA  1 
ATOM   1956  C  C   . CYS A 1 245 ? 39.306 77.788  15.701  1.00 35.04  ? 245  CYS A C   1 
ATOM   1957  O  O   . CYS A 1 245 ? 39.514 78.573  14.760  1.00 35.21  ? 245  CYS A O   1 
ATOM   1958  C  CB  . CYS A 1 245 ? 39.946 75.511  14.839  1.00 35.28  ? 245  CYS A CB  1 
ATOM   1959  S  SG  . CYS A 1 245 ? 39.503 73.769  14.771  1.00 36.23  ? 245  CYS A SG  1 
ATOM   1960  N  N   . PRO A 1 246 ? 39.404 78.113  16.986  1.00 34.50  ? 246  PRO A N   1 
ATOM   1961  C  CA  . PRO A 1 246 ? 39.800 79.430  17.470  1.00 34.03  ? 246  PRO A CA  1 
ATOM   1962  C  C   . PRO A 1 246 ? 41.049 79.956  16.818  1.00 33.76  ? 246  PRO A C   1 
ATOM   1963  O  O   . PRO A 1 246 ? 41.987 79.202  16.614  1.00 34.17  ? 246  PRO A O   1 
ATOM   1964  C  CB  . PRO A 1 246 ? 40.101 79.157  18.934  1.00 33.98  ? 246  PRO A CB  1 
ATOM   1965  C  CG  . PRO A 1 246 ? 39.172 78.082  19.287  1.00 34.34  ? 246  PRO A CG  1 
ATOM   1966  C  CD  . PRO A 1 246 ? 39.074 77.199  18.090  1.00 34.43  ? 246  PRO A CD  1 
ATOM   1967  N  N   . HIS A 1 247 ? 41.059 81.246  16.513  1.00 33.30  ? 247  HIS A N   1 
ATOM   1968  C  CA  . HIS A 1 247 ? 42.229 81.897  15.963  1.00 32.66  ? 247  HIS A CA  1 
ATOM   1969  C  C   . HIS A 1 247 ? 41.998 83.401  15.905  1.00 32.77  ? 247  HIS A C   1 
ATOM   1970  O  O   . HIS A 1 247 ? 41.101 83.880  15.222  1.00 32.62  ? 247  HIS A O   1 
ATOM   1971  C  CB  . HIS A 1 247 ? 42.544 81.353  14.589  1.00 32.46  ? 247  HIS A CB  1 
ATOM   1972  C  CG  . HIS A 1 247 ? 43.970 81.540  14.197  1.00 32.51  ? 247  HIS A CG  1 
ATOM   1973  N  ND1 . HIS A 1 247 ? 44.459 82.739  13.721  1.00 31.69  ? 247  HIS A ND1 1 
ATOM   1974  C  CD2 . HIS A 1 247 ? 45.021 80.689  14.233  1.00 31.55  ? 247  HIS A CD2 1 
ATOM   1975  C  CE1 . HIS A 1 247 ? 45.747 82.611  13.469  1.00 31.56  ? 247  HIS A CE1 1 
ATOM   1976  N  NE2 . HIS A 1 247 ? 46.114 81.380  13.777  1.00 31.44  ? 247  HIS A NE2 1 
ATOM   1977  N  N   . GLU A 1 248 ? 42.806 84.154  16.634  1.00 32.96  ? 248  GLU A N   1 
ATOM   1978  C  CA  . GLU A 1 248 ? 42.600 85.591  16.706  1.00 33.10  ? 248  GLU A CA  1 
ATOM   1979  C  C   . GLU A 1 248 ? 42.506 86.206  15.324  1.00 33.07  ? 248  GLU A C   1 
ATOM   1980  O  O   . GLU A 1 248 ? 41.871 87.231  15.143  1.00 33.49  ? 248  GLU A O   1 
ATOM   1981  C  CB  . GLU A 1 248 ? 43.667 86.277  17.565  1.00 32.95  ? 248  GLU A CB  1 
ATOM   1982  C  CG  . GLU A 1 248 ? 45.093 85.818  17.307  1.00 34.22  ? 248  GLU A CG  1 
ATOM   1983  C  CD  . GLU A 1 248 ? 45.468 84.535  18.047  1.00 35.11  ? 248  GLU A CD  1 
ATOM   1984  O  OE1 . GLU A 1 248 ? 44.556 83.771  18.431  1.00 35.58  ? 248  GLU A OE1 1 
ATOM   1985  O  OE2 . GLU A 1 248 ? 46.681 84.284  18.246  1.00 34.95  ? 248  GLU A OE2 1 
ATOM   1986  N  N   . ALA A 1 249 ? 43.116 85.575  14.337  1.00 33.00  ? 249  ALA A N   1 
ATOM   1987  C  CA  . ALA A 1 249 ? 43.021 86.104  12.995  1.00 33.05  ? 249  ALA A CA  1 
ATOM   1988  C  C   . ALA A 1 249 ? 41.656 85.792  12.418  1.00 33.44  ? 249  ALA A C   1 
ATOM   1989  O  O   . ALA A 1 249 ? 41.264 86.355  11.406  1.00 33.79  ? 249  ALA A O   1 
ATOM   1990  C  CB  . ALA A 1 249 ? 44.078 85.507  12.136  1.00 33.23  ? 249  ALA A CB  1 
ATOM   1991  N  N   . LEU A 1 250 ? 40.923 84.898  13.073  1.00 33.69  ? 250  LEU A N   1 
ATOM   1992  C  CA  . LEU A 1 250 ? 39.640 84.425  12.553  1.00 33.57  ? 250  LEU A CA  1 
ATOM   1993  C  C   . LEU A 1 250 ? 38.417 84.885  13.355  1.00 33.78  ? 250  LEU A C   1 
ATOM   1994  O  O   . LEU A 1 250 ? 37.387 85.227  12.768  1.00 33.90  ? 250  LEU A O   1 
ATOM   1995  C  CB  . LEU A 1 250 ? 39.664 82.904  12.438  1.00 33.40  ? 250  LEU A CB  1 
ATOM   1996  C  CG  . LEU A 1 250 ? 40.379 82.418  11.192  1.00 32.59  ? 250  LEU A CG  1 
ATOM   1997  C  CD1 . LEU A 1 250 ? 40.365 80.915  11.132  1.00 32.31  ? 250  LEU A CD1 1 
ATOM   1998  C  CD2 . LEU A 1 250 ? 39.671 83.002  9.998   1.00 32.16  ? 250  LEU A CD2 1 
ATOM   1999  N  N   . PHE A 1 251 ? 38.524 84.842  14.682  1.00 33.68  ? 251  PHE A N   1 
ATOM   2000  C  CA  . PHE A 1 251 ? 37.497 85.369  15.579  1.00 33.65  ? 251  PHE A CA  1 
ATOM   2001  C  C   . PHE A 1 251 ? 38.015 85.496  17.000  1.00 34.31  ? 251  PHE A C   1 
ATOM   2002  O  O   . PHE A 1 251 ? 39.169 85.162  17.283  1.00 34.57  ? 251  PHE A O   1 
ATOM   2003  C  CB  . PHE A 1 251 ? 36.202 84.574  15.546  1.00 33.09  ? 251  PHE A CB  1 
ATOM   2004  C  CG  . PHE A 1 251 ? 36.353 83.112  15.848  1.00 32.47  ? 251  PHE A CG  1 
ATOM   2005  C  CD1 . PHE A 1 251 ? 36.589 82.199  14.833  1.00 31.92  ? 251  PHE A CD1 1 
ATOM   2006  C  CD2 . PHE A 1 251 ? 36.175 82.636  17.129  1.00 31.49  ? 251  PHE A CD2 1 
ATOM   2007  C  CE1 . PHE A 1 251 ? 36.687 80.848  15.108  1.00 30.90  ? 251  PHE A CE1 1 
ATOM   2008  C  CE2 . PHE A 1 251 ? 36.278 81.291  17.399  1.00 30.98  ? 251  PHE A CE2 1 
ATOM   2009  C  CZ  . PHE A 1 251 ? 36.531 80.400  16.388  1.00 30.39  ? 251  PHE A CZ  1 
ATOM   2010  N  N   . THR A 1 252 ? 37.168 85.987  17.893  1.00 34.64  ? 252  THR A N   1 
ATOM   2011  C  CA  . THR A 1 252 ? 37.579 86.183  19.274  1.00 35.11  ? 252  THR A CA  1 
ATOM   2012  C  C   . THR A 1 252 ? 36.465 85.817  20.218  1.00 35.49  ? 252  THR A C   1 
ATOM   2013  O  O   . THR A 1 252 ? 35.377 85.437  19.794  1.00 35.94  ? 252  THR A O   1 
ATOM   2014  C  CB  . THR A 1 252 ? 37.957 87.629  19.490  1.00 35.14  ? 252  THR A CB  1 
ATOM   2015  O  OG1 . THR A 1 252 ? 37.516 88.393  18.359  1.00 35.71  ? 252  THR A OG1 1 
ATOM   2016  C  CG2 . THR A 1 252 ? 39.458 87.786  19.444  1.00 35.14  ? 252  THR A CG2 1 
ATOM   2017  N  N   . MET A 1 253 ? 36.725 85.931  21.506  1.00 35.76  ? 253  MET A N   1 
ATOM   2018  C  CA  . MET A 1 253 ? 35.700 85.587  22.466  1.00 36.46  ? 253  MET A CA  1 
ATOM   2019  C  C   . MET A 1 253 ? 35.256 86.763  23.306  1.00 36.00  ? 253  MET A C   1 
ATOM   2020  O  O   . MET A 1 253 ? 36.055 87.619  23.677  1.00 36.45  ? 253  MET A O   1 
ATOM   2021  C  CB  . MET A 1 253 ? 36.166 84.438  23.363  1.00 37.02  ? 253  MET A CB  1 
ATOM   2022  C  CG  . MET A 1 253 ? 35.579 83.088  22.964  1.00 40.45  ? 253  MET A CG  1 
ATOM   2023  S  SD  . MET A 1 253 ? 35.618 82.687  21.138  1.00 46.67  ? 253  MET A SD  1 
ATOM   2024  C  CE  . MET A 1 253 ? 37.163 81.638  21.028  1.00 43.77  ? 253  MET A CE  1 
ATOM   2025  N  N   . GLY A 1 254 ? 33.968 86.803  23.596  1.00 35.38  ? 254  GLY A N   1 
ATOM   2026  C  CA  . GLY A 1 254 ? 33.426 87.803  24.485  1.00 35.13  ? 254  GLY A CA  1 
ATOM   2027  C  C   . GLY A 1 254 ? 33.907 89.203  24.221  1.00 34.99  ? 254  GLY A C   1 
ATOM   2028  O  O   . GLY A 1 254 ? 34.060 89.613  23.075  1.00 35.17  ? 254  GLY A O   1 
ATOM   2029  N  N   . GLY A 1 255 ? 34.154 89.945  25.291  1.00 34.91  ? 255  GLY A N   1 
ATOM   2030  C  CA  . GLY A 1 255 ? 34.578 91.319  25.150  1.00 34.56  ? 255  GLY A CA  1 
ATOM   2031  C  C   . GLY A 1 255 ? 33.418 92.021  24.506  1.00 34.36  ? 255  GLY A C   1 
ATOM   2032  O  O   . GLY A 1 255 ? 32.285 91.587  24.678  1.00 34.53  ? 255  GLY A O   1 
ATOM   2033  N  N   . ASN A 1 256 ? 33.691 93.073  23.745  1.00 34.22  ? 256  ASN A N   1 
ATOM   2034  C  CA  . ASN A 1 256 ? 32.631 93.820  23.088  1.00 34.17  ? 256  ASN A CA  1 
ATOM   2035  C  C   . ASN A 1 256 ? 32.812 93.835  21.575  1.00 34.29  ? 256  ASN A C   1 
ATOM   2036  O  O   . ASN A 1 256 ? 32.214 94.647  20.870  1.00 34.39  ? 256  ASN A O   1 
ATOM   2037  C  CB  . ASN A 1 256 ? 32.608 95.247  23.623  1.00 34.05  ? 256  ASN A CB  1 
ATOM   2038  C  CG  . ASN A 1 256 ? 33.888 95.995  23.320  1.00 34.24  ? 256  ASN A CG  1 
ATOM   2039  O  OD1 . ASN A 1 256 ? 34.589 95.662  22.375  1.00 35.16  ? 256  ASN A OD1 1 
ATOM   2040  N  ND2 . ASN A 1 256 ? 34.200 97.006  24.119  1.00 33.88  ? 256  ASN A ND2 1 
ATOM   2041  N  N   . ALA A 1 257 ? 33.634 92.927  21.069  1.00 34.42  ? 257  ALA A N   1 
ATOM   2042  C  CA  . ALA A 1 257 ? 33.960 92.938  19.642  1.00 34.44  ? 257  ALA A CA  1 
ATOM   2043  C  C   . ALA A 1 257 ? 33.021 92.124  18.776  1.00 34.22  ? 257  ALA A C   1 
ATOM   2044  O  O   . ALA A 1 257 ? 33.204 92.073  17.560  1.00 34.25  ? 257  ALA A O   1 
ATOM   2045  C  CB  . ALA A 1 257 ? 35.416 92.506  19.408  1.00 34.49  ? 257  ALA A CB  1 
ATOM   2046  N  N   . GLU A 1 258 ? 32.045 91.476  19.407  1.00 33.77  ? 258  GLU A N   1 
ATOM   2047  C  CA  . GLU A 1 258 ? 31.047 90.673  18.701  1.00 33.56  ? 258  GLU A CA  1 
ATOM   2048  C  C   . GLU A 1 258 ? 31.619 89.544  17.844  1.00 33.40  ? 258  GLU A C   1 
ATOM   2049  O  O   . GLU A 1 258 ? 31.043 89.204  16.803  1.00 33.27  ? 258  GLU A O   1 
ATOM   2050  C  CB  . GLU A 1 258 ? 30.148 91.559  17.848  1.00 33.33  ? 258  GLU A CB  1 
ATOM   2051  C  CG  . GLU A 1 258 ? 29.253 92.471  18.663  1.00 34.88  ? 258  GLU A CG  1 
ATOM   2052  C  CD  . GLU A 1 258 ? 28.089 93.019  17.859  1.00 37.19  ? 258  GLU A CD  1 
ATOM   2053  O  OE1 . GLU A 1 258 ? 28.269 93.278  16.646  1.00 38.31  ? 258  GLU A OE1 1 
ATOM   2054  O  OE2 . GLU A 1 258 ? 26.992 93.189  18.439  1.00 37.85  ? 258  GLU A OE2 1 
ATOM   2055  N  N   . GLY A 1 259 ? 32.751 88.982  18.275  1.00 33.13  ? 259  GLY A N   1 
ATOM   2056  C  CA  . GLY A 1 259 ? 33.377 87.870  17.582  1.00 32.49  ? 259  GLY A CA  1 
ATOM   2057  C  C   . GLY A 1 259 ? 34.413 88.278  16.557  1.00 32.38  ? 259  GLY A C   1 
ATOM   2058  O  O   . GLY A 1 259 ? 35.233 87.461  16.149  1.00 32.76  ? 259  GLY A O   1 
ATOM   2059  N  N   . GLN A 1 260 ? 34.370 89.539  16.144  1.00 32.03  ? 260  GLN A N   1 
ATOM   2060  C  CA  . GLN A 1 260 ? 35.305 90.111  15.177  1.00 31.77  ? 260  GLN A CA  1 
ATOM   2061  C  C   . GLN A 1 260 ? 36.783 89.754  15.403  1.00 31.56  ? 260  GLN A C   1 
ATOM   2062  O  O   . GLN A 1 260 ? 37.212 89.587  16.537  1.00 31.05  ? 260  GLN A O   1 
ATOM   2063  C  CB  . GLN A 1 260 ? 35.133 91.625  15.197  1.00 32.14  ? 260  GLN A CB  1 
ATOM   2064  C  CG  . GLN A 1 260 ? 33.773 92.066  14.735  1.00 31.40  ? 260  GLN A CG  1 
ATOM   2065  C  CD  . GLN A 1 260 ? 33.458 91.506  13.378  1.00 31.57  ? 260  GLN A CD  1 
ATOM   2066  O  OE1 . GLN A 1 260 ? 34.170 91.782  12.405  1.00 30.47  ? 260  GLN A OE1 1 
ATOM   2067  N  NE2 . GLN A 1 260 ? 32.403 90.698  13.300  1.00 32.59  ? 260  GLN A NE2 1 
ATOM   2068  N  N   . PRO A 1 261 ? 37.566 89.694  14.326  1.00 31.69  ? 261  PRO A N   1 
ATOM   2069  C  CA  . PRO A 1 261 ? 38.969 89.248  14.395  1.00 32.14  ? 261  PRO A CA  1 
ATOM   2070  C  C   . PRO A 1 261 ? 39.920 90.328  14.907  1.00 32.42  ? 261  PRO A C   1 
ATOM   2071  O  O   . PRO A 1 261 ? 39.615 91.507  14.735  1.00 32.81  ? 261  PRO A O   1 
ATOM   2072  C  CB  . PRO A 1 261 ? 39.322 88.932  12.934  1.00 31.75  ? 261  PRO A CB  1 
ATOM   2073  C  CG  . PRO A 1 261 ? 38.121 89.275  12.128  1.00 31.86  ? 261  PRO A CG  1 
ATOM   2074  C  CD  . PRO A 1 261 ? 37.191 90.096  12.965  1.00 31.78  ? 261  PRO A CD  1 
ATOM   2075  N  N   . CYS A 1 262 ? 41.035 89.942  15.521  1.00 32.22  ? 262  CYS A N   1 
ATOM   2076  C  CA  . CYS A 1 262 ? 41.988 90.922  15.990  1.00 32.79  ? 262  CYS A CA  1 
ATOM   2077  C  C   . CYS A 1 262 ? 42.443 91.768  14.801  1.00 32.85  ? 262  CYS A C   1 
ATOM   2078  O  O   . CYS A 1 262 ? 42.476 91.273  13.673  1.00 32.95  ? 262  CYS A O   1 
ATOM   2079  C  CB  . CYS A 1 262 ? 43.210 90.239  16.601  1.00 32.97  ? 262  CYS A CB  1 
ATOM   2080  S  SG  . CYS A 1 262 ? 43.031 89.508  18.254  1.00 34.84  ? 262  CYS A SG  1 
ATOM   2081  N  N   . LYS A 1 263 ? 42.772 93.039  15.044  1.00 32.72  ? 263  LYS A N   1 
ATOM   2082  C  CA  . LYS A 1 263 ? 43.323 93.892  13.999  1.00 32.61  ? 263  LYS A CA  1 
ATOM   2083  C  C   . LYS A 1 263 ? 44.791 94.070  14.268  1.00 32.84  ? 263  LYS A C   1 
ATOM   2084  O  O   . LYS A 1 263 ? 45.171 94.444  15.363  1.00 33.10  ? 263  LYS A O   1 
ATOM   2085  C  CB  . LYS A 1 263 ? 42.699 95.267  14.017  1.00 32.58  ? 263  LYS A CB  1 
ATOM   2086  C  CG  . LYS A 1 263 ? 43.077 96.106  12.803  1.00 32.42  ? 263  LYS A CG  1 
ATOM   2087  C  CD  . LYS A 1 263 ? 42.101 95.855  11.668  1.00 32.55  ? 263  LYS A CD  1 
ATOM   2088  C  CE  . LYS A 1 263 ? 42.341 96.760  10.480  1.00 32.91  ? 263  LYS A CE  1 
ATOM   2089  N  NZ  . LYS A 1 263 ? 43.484 96.274  9.650   1.00 34.52  ? 263  LYS A NZ  1 
ATOM   2090  N  N   . PHE A 1 264 ? 45.630 93.814  13.280  1.00 33.04  ? 264  PHE A N   1 
ATOM   2091  C  CA  . PHE A 1 264 ? 47.059 93.970  13.495  1.00 33.28  ? 264  PHE A CA  1 
ATOM   2092  C  C   . PHE A 1 264 ? 47.685 94.961  12.515  1.00 33.20  ? 264  PHE A C   1 
ATOM   2093  O  O   . PHE A 1 264 ? 47.528 94.851  11.291  1.00 33.48  ? 264  PHE A O   1 
ATOM   2094  C  CB  . PHE A 1 264 ? 47.770 92.616  13.434  1.00 33.65  ? 264  PHE A CB  1 
ATOM   2095  C  CG  . PHE A 1 264 ? 47.276 91.619  14.456  1.00 33.63  ? 264  PHE A CG  1 
ATOM   2096  C  CD1 . PHE A 1 264 ? 47.152 91.967  15.775  1.00 33.83  ? 264  PHE A CD1 1 
ATOM   2097  C  CD2 . PHE A 1 264 ? 46.947 90.335  14.084  1.00 34.22  ? 264  PHE A CD2 1 
ATOM   2098  C  CE1 . PHE A 1 264 ? 46.716 91.057  16.697  1.00 34.52  ? 264  PHE A CE1 1 
ATOM   2099  C  CE2 . PHE A 1 264 ? 46.508 89.432  14.997  1.00 34.70  ? 264  PHE A CE2 1 
ATOM   2100  C  CZ  . PHE A 1 264 ? 46.392 89.792  16.310  1.00 34.86  ? 264  PHE A CZ  1 
ATOM   2101  N  N   . PRO A 1 265 ? 48.410 95.918  13.069  1.00 32.69  ? 265  PRO A N   1 
ATOM   2102  C  CA  . PRO A 1 265 ? 48.617 95.998  14.507  1.00 32.53  ? 265  PRO A CA  1 
ATOM   2103  C  C   . PRO A 1 265 ? 47.505 96.809  15.136  1.00 32.44  ? 265  PRO A C   1 
ATOM   2104  O  O   . PRO A 1 265 ? 46.690 97.360  14.405  1.00 32.87  ? 265  PRO A O   1 
ATOM   2105  C  CB  . PRO A 1 265 ? 49.923 96.782  14.606  1.00 32.74  ? 265  PRO A CB  1 
ATOM   2106  C  CG  . PRO A 1 265 ? 50.353 97.030  13.185  1.00 32.27  ? 265  PRO A CG  1 
ATOM   2107  C  CD  . PRO A 1 265 ? 49.106 97.000  12.369  1.00 32.57  ? 265  PRO A CD  1 
ATOM   2108  N  N   . PHE A 1 266 ? 47.468 96.883  16.461  1.00 32.03  ? 266  PHE A N   1 
ATOM   2109  C  CA  . PHE A 1 266 ? 46.473 97.687  17.151  1.00 31.70  ? 266  PHE A CA  1 
ATOM   2110  C  C   . PHE A 1 266 ? 47.201 98.483  18.221  1.00 31.85  ? 266  PHE A C   1 
ATOM   2111  O  O   . PHE A 1 266 ? 47.954 97.920  19.015  1.00 32.08  ? 266  PHE A O   1 
ATOM   2112  C  CB  . PHE A 1 266 ? 45.400 96.804  17.771  1.00 31.58  ? 266  PHE A CB  1 
ATOM   2113  C  CG  . PHE A 1 266 ? 45.819 96.128  19.053  1.00 31.43  ? 266  PHE A CG  1 
ATOM   2114  C  CD1 . PHE A 1 266 ? 46.056 96.860  20.200  1.00 31.14  ? 266  PHE A CD1 1 
ATOM   2115  C  CD2 . PHE A 1 266 ? 45.939 94.759  19.118  1.00 31.44  ? 266  PHE A CD2 1 
ATOM   2116  C  CE1 . PHE A 1 266 ? 46.420 96.245  21.371  1.00 30.55  ? 266  PHE A CE1 1 
ATOM   2117  C  CE2 . PHE A 1 266 ? 46.300 94.143  20.293  1.00 31.51  ? 266  PHE A CE2 1 
ATOM   2118  C  CZ  . PHE A 1 266 ? 46.539 94.895  21.422  1.00 30.93  ? 266  PHE A CZ  1 
ATOM   2119  N  N   . ARG A 1 267 ? 46.992 99.793  18.239  1.00 31.49  ? 267  ARG A N   1 
ATOM   2120  C  CA  . ARG A 1 267 ? 47.704 100.637 19.174  1.00 31.05  ? 267  ARG A CA  1 
ATOM   2121  C  C   . ARG A 1 267 ? 47.064 100.603 20.556  1.00 31.14  ? 267  ARG A C   1 
ATOM   2122  O  O   . ARG A 1 267 ? 45.843 100.678 20.690  1.00 31.53  ? 267  ARG A O   1 
ATOM   2123  C  CB  . ARG A 1 267 ? 47.788 102.070 18.631  1.00 30.94  ? 267  ARG A CB  1 
ATOM   2124  C  CG  . ARG A 1 267 ? 48.211 103.121 19.658  1.00 31.11  ? 267  ARG A CG  1 
ATOM   2125  C  CD  . ARG A 1 267 ? 49.075 104.253 19.108  1.00 30.94  ? 267  ARG A CD  1 
ATOM   2126  N  NE  . ARG A 1 267 ? 49.445 105.209 20.152  1.00 31.13  ? 267  ARG A NE  1 
ATOM   2127  C  CZ  . ARG A 1 267 ? 49.549 106.519 19.961  1.00 31.53  ? 267  ARG A CZ  1 
ATOM   2128  N  NH1 . ARG A 1 267 ? 49.320 107.040 18.763  1.00 31.96  ? 267  ARG A NH1 1 
ATOM   2129  N  NH2 . ARG A 1 267 ? 49.884 107.317 20.963  1.00 31.41  ? 267  ARG A NH2 1 
ATOM   2130  N  N   . PHE A 1 268 ? 47.888 100.441 21.583  1.00 30.81  ? 268  PHE A N   1 
ATOM   2131  C  CA  . PHE A 1 268 ? 47.412 100.539 22.952  1.00 30.30  ? 268  PHE A CA  1 
ATOM   2132  C  C   . PHE A 1 268 ? 48.426 101.306 23.786  1.00 30.64  ? 268  PHE A C   1 
ATOM   2133  O  O   . PHE A 1 268 ? 49.444 100.752 24.223  1.00 30.96  ? 268  PHE A O   1 
ATOM   2134  C  CB  . PHE A 1 268 ? 47.160 99.170  23.569  1.00 29.80  ? 268  PHE A CB  1 
ATOM   2135  C  CG  . PHE A 1 268 ? 46.804 99.222  25.033  1.00 28.75  ? 268  PHE A CG  1 
ATOM   2136  C  CD1 . PHE A 1 268 ? 45.870 100.118 25.502  1.00 27.69  ? 268  PHE A CD1 1 
ATOM   2137  C  CD2 . PHE A 1 268 ? 47.403 98.374  25.943  1.00 28.30  ? 268  PHE A CD2 1 
ATOM   2138  C  CE1 . PHE A 1 268 ? 45.547 100.170 26.846  1.00 26.27  ? 268  PHE A CE1 1 
ATOM   2139  C  CE2 . PHE A 1 268 ? 47.073 98.430  27.293  1.00 26.63  ? 268  PHE A CE2 1 
ATOM   2140  C  CZ  . PHE A 1 268 ? 46.152 99.330  27.736  1.00 25.29  ? 268  PHE A CZ  1 
ATOM   2141  N  N   . GLN A 1 269 ? 48.164 102.592 23.972  1.00 30.58  ? 269  GLN A N   1 
ATOM   2142  C  CA  . GLN A 1 269 ? 48.997 103.405 24.831  1.00 30.61  ? 269  GLN A CA  1 
ATOM   2143  C  C   . GLN A 1 269 ? 50.447 103.523 24.360  1.00 31.42  ? 269  GLN A C   1 
ATOM   2144  O  O   . GLN A 1 269 ? 51.375 103.246 25.111  1.00 31.95  ? 269  GLN A O   1 
ATOM   2145  C  CB  . GLN A 1 269 ? 48.951 102.815 26.236  1.00 30.35  ? 269  GLN A CB  1 
ATOM   2146  C  CG  . GLN A 1 269 ? 47.647 103.053 26.949  1.00 28.23  ? 269  GLN A CG  1 
ATOM   2147  C  CD  . GLN A 1 269 ? 47.576 104.456 27.443  1.00 25.47  ? 269  GLN A CD  1 
ATOM   2148  O  OE1 . GLN A 1 269 ? 48.543 104.940 28.016  1.00 26.13  ? 269  GLN A OE1 1 
ATOM   2149  N  NE2 . GLN A 1 269 ? 46.455 105.128 27.216  1.00 23.59  ? 269  GLN A NE2 1 
ATOM   2150  N  N   . GLY A 1 270 ? 50.668 103.925 23.120  1.00 31.91  ? 270  GLY A N   1 
ATOM   2151  C  CA  . GLY A 1 270 ? 52.042 104.105 22.677  1.00 32.50  ? 270  GLY A CA  1 
ATOM   2152  C  C   . GLY A 1 270 ? 52.800 102.862 22.230  1.00 32.93  ? 270  GLY A C   1 
ATOM   2153  O  O   . GLY A 1 270 ? 53.995 102.941 21.918  1.00 33.00  ? 270  GLY A O   1 
ATOM   2154  N  N   . THR A 1 271 ? 52.116 101.717 22.200  1.00 33.07  ? 271  THR A N   1 
ATOM   2155  C  CA  . THR A 1 271 ? 52.707 100.472 21.711  1.00 33.11  ? 271  THR A CA  1 
ATOM   2156  C  C   . THR A 1 271 ? 51.766 99.850  20.715  1.00 33.20  ? 271  THR A C   1 
ATOM   2157  O  O   . THR A 1 271 ? 50.554 99.867  20.915  1.00 33.34  ? 271  THR A O   1 
ATOM   2158  C  CB  . THR A 1 271 ? 52.909 99.454  22.847  1.00 33.18  ? 271  THR A CB  1 
ATOM   2159  O  OG1 . THR A 1 271 ? 53.980 99.869  23.697  1.00 33.91  ? 271  THR A OG1 1 
ATOM   2160  C  CG2 . THR A 1 271 ? 53.403 98.129  22.288  1.00 32.43  ? 271  THR A CG2 1 
ATOM   2161  N  N   . SER A 1 272 ? 52.315 99.284  19.650  1.00 33.26  ? 272  SER A N   1 
ATOM   2162  C  CA  . SER A 1 272 ? 51.496 98.593  18.675  1.00 33.53  ? 272  SER A CA  1 
ATOM   2163  C  C   . SER A 1 272 ? 51.656 97.093  18.816  1.00 33.80  ? 272  SER A C   1 
ATOM   2164  O  O   . SER A 1 272 ? 52.739 96.550  18.641  1.00 33.91  ? 272  SER A O   1 
ATOM   2165  C  CB  . SER A 1 272 ? 51.846 99.042  17.276  1.00 33.41  ? 272  SER A CB  1 
ATOM   2166  O  OG  . SER A 1 272 ? 51.215 100.272 17.023  1.00 33.99  ? 272  SER A OG  1 
ATOM   2167  N  N   . TYR A 1 273 ? 50.567 96.419  19.145  1.00 34.24  ? 273  TYR A N   1 
ATOM   2168  C  CA  . TYR A 1 273 ? 50.613 94.985  19.345  1.00 34.67  ? 273  TYR A CA  1 
ATOM   2169  C  C   . TYR A 1 273 ? 50.325 94.259  18.050  1.00 35.16  ? 273  TYR A C   1 
ATOM   2170  O  O   . TYR A 1 273 ? 49.538 94.711  17.233  1.00 35.53  ? 273  TYR A O   1 
ATOM   2171  C  CB  . TYR A 1 273 ? 49.663 94.583  20.457  1.00 34.47  ? 273  TYR A CB  1 
ATOM   2172  C  CG  . TYR A 1 273 ? 50.108 95.164  21.755  1.00 34.21  ? 273  TYR A CG  1 
ATOM   2173  C  CD1 . TYR A 1 273 ? 49.762 96.451  22.107  1.00 34.93  ? 273  TYR A CD1 1 
ATOM   2174  C  CD2 . TYR A 1 273 ? 50.924 94.455  22.603  1.00 34.47  ? 273  TYR A CD2 1 
ATOM   2175  C  CE1 . TYR A 1 273 ? 50.180 97.001  23.284  1.00 35.00  ? 273  TYR A CE1 1 
ATOM   2176  C  CE2 . TYR A 1 273 ? 51.355 94.999  23.783  1.00 35.24  ? 273  TYR A CE2 1 
ATOM   2177  C  CZ  . TYR A 1 273 ? 50.975 96.271  24.118  1.00 35.26  ? 273  TYR A CZ  1 
ATOM   2178  O  OH  . TYR A 1 273 ? 51.400 96.826  25.295  1.00 37.15  ? 273  TYR A OH  1 
ATOM   2179  N  N   . ASP A 1 274 ? 50.979 93.131  17.857  1.00 35.59  ? 274  ASP A N   1 
ATOM   2180  C  CA  . ASP A 1 274 ? 50.880 92.456  16.596  1.00 36.06  ? 274  ASP A CA  1 
ATOM   2181  C  C   . ASP A 1 274 ? 50.240 91.132  16.825  1.00 36.45  ? 274  ASP A C   1 
ATOM   2182  O  O   . ASP A 1 274 ? 49.953 90.380  15.887  1.00 36.75  ? 274  ASP A O   1 
ATOM   2183  C  CB  . ASP A 1 274 ? 52.257 92.260  16.030  1.00 36.10  ? 274  ASP A CB  1 
ATOM   2184  C  CG  . ASP A 1 274 ? 52.235 92.138  14.559  1.00 37.32  ? 274  ASP A CG  1 
ATOM   2185  O  OD1 . ASP A 1 274 ? 52.046 91.042  13.997  1.00 39.36  ? 274  ASP A OD1 1 
ATOM   2186  O  OD2 . ASP A 1 274 ? 52.396 93.177  13.879  1.00 38.53  ? 274  ASP A OD2 1 
ATOM   2187  N  N   . SER A 1 275 ? 50.015 90.858  18.098  1.00 36.46  ? 275  SER A N   1 
ATOM   2188  C  CA  . SER A 1 275 ? 49.359 89.651  18.517  1.00 36.61  ? 275  SER A CA  1 
ATOM   2189  C  C   . SER A 1 275 ? 48.638 90.112  19.741  1.00 36.83  ? 275  SER A C   1 
ATOM   2190  O  O   . SER A 1 275 ? 48.789 91.265  20.134  1.00 36.99  ? 275  SER A O   1 
ATOM   2191  C  CB  . SER A 1 275 ? 50.386 88.650  18.961  1.00 36.63  ? 275  SER A CB  1 
ATOM   2192  O  OG  . SER A 1 275 ? 50.678 88.886  20.324  1.00 36.75  ? 275  SER A OG  1 
ATOM   2193  N  N   . CYS A 1 276 ? 47.874 89.224  20.365  1.00 36.92  ? 276  CYS A N   1 
ATOM   2194  C  CA  . CYS A 1 276 ? 47.209 89.583  21.609  1.00 37.05  ? 276  CYS A CA  1 
ATOM   2195  C  C   . CYS A 1 276 ? 48.260 89.723  22.706  1.00 36.67  ? 276  CYS A C   1 
ATOM   2196  O  O   . CYS A 1 276 ? 49.368 89.201  22.581  1.00 36.78  ? 276  CYS A O   1 
ATOM   2197  C  CB  . CYS A 1 276 ? 46.197 88.508  22.008  1.00 37.21  ? 276  CYS A CB  1 
ATOM   2198  S  SG  . CYS A 1 276 ? 45.261 87.786  20.638  1.00 39.05  ? 276  CYS A SG  1 
ATOM   2199  N  N   . THR A 1 277 ? 47.930 90.455  23.761  1.00 36.20  ? 277  THR A N   1 
ATOM   2200  C  CA  . THR A 1 277 ? 48.814 90.552  24.914  1.00 35.84  ? 277  THR A CA  1 
ATOM   2201  C  C   . THR A 1 277 ? 47.981 90.335  26.116  1.00 35.72  ? 277  THR A C   1 
ATOM   2202  O  O   . THR A 1 277 ? 46.772 90.175  26.027  1.00 35.89  ? 277  THR A O   1 
ATOM   2203  C  CB  . THR A 1 277 ? 49.445 91.945  25.111  1.00 35.54  ? 277  THR A CB  1 
ATOM   2204  O  OG1 . THR A 1 277 ? 48.915 92.870  24.163  1.00 35.53  ? 277  THR A OG1 1 
ATOM   2205  C  CG2 . THR A 1 277 ? 50.895 91.913  24.808  1.00 35.33  ? 277  THR A CG2 1 
ATOM   2206  N  N   . THR A 1 278 ? 48.653 90.391  27.250  1.00 35.38  ? 278  THR A N   1 
ATOM   2207  C  CA  . THR A 1 278 ? 48.014 90.337  28.525  1.00 35.37  ? 278  THR A CA  1 
ATOM   2208  C  C   . THR A 1 278 ? 48.301 91.687  29.151  1.00 35.41  ? 278  THR A C   1 
ATOM   2209  O  O   . THR A 1 278 ? 47.991 91.917  30.310  1.00 35.34  ? 278  THR A O   1 
ATOM   2210  C  CB  . THR A 1 278 ? 48.675 89.271  29.323  1.00 35.43  ? 278  THR A CB  1 
ATOM   2211  O  OG1 . THR A 1 278 ? 50.089 89.427  29.190  1.00 36.18  ? 278  THR A OG1 1 
ATOM   2212  C  CG2 . THR A 1 278 ? 48.438 87.942  28.676  1.00 35.79  ? 278  THR A CG2 1 
ATOM   2213  N  N   . GLU A 1 279 ? 48.908 92.579  28.372  1.00 35.68  ? 279  GLU A N   1 
ATOM   2214  C  CA  . GLU A 1 279 ? 49.263 93.899  28.870  1.00 35.87  ? 279  GLU A CA  1 
ATOM   2215  C  C   . GLU A 1 279 ? 48.030 94.506  29.468  1.00 35.72  ? 279  GLU A C   1 
ATOM   2216  O  O   . GLU A 1 279 ? 47.004 94.583  28.819  1.00 35.73  ? 279  GLU A O   1 
ATOM   2217  C  CB  . GLU A 1 279 ? 49.800 94.800  27.765  1.00 35.88  ? 279  GLU A CB  1 
ATOM   2218  C  CG  . GLU A 1 279 ? 50.400 96.094  28.284  1.00 37.80  ? 279  GLU A CG  1 
ATOM   2219  C  CD  . GLU A 1 279 ? 51.782 95.899  28.892  1.00 41.78  ? 279  GLU A CD  1 
ATOM   2220  O  OE1 . GLU A 1 279 ? 52.774 95.906  28.127  1.00 43.19  ? 279  GLU A OE1 1 
ATOM   2221  O  OE2 . GLU A 1 279 ? 51.889 95.738  30.134  1.00 43.75  ? 279  GLU A OE2 1 
ATOM   2222  N  N   . GLY A 1 280 ? 48.126 94.917  30.721  1.00 35.92  ? 280  GLY A N   1 
ATOM   2223  C  CA  . GLY A 1 280 ? 46.992 95.496  31.404  1.00 36.17  ? 280  GLY A CA  1 
ATOM   2224  C  C   . GLY A 1 280 ? 46.190 94.480  32.195  1.00 36.40  ? 280  GLY A C   1 
ATOM   2225  O  O   . GLY A 1 280 ? 45.305 94.860  32.952  1.00 36.93  ? 280  GLY A O   1 
ATOM   2226  N  N   . ARG A 1 281 ? 46.501 93.197  32.054  1.00 36.39  ? 281  ARG A N   1 
ATOM   2227  C  CA  . ARG A 1 281 ? 45.704 92.163  32.706  1.00 36.52  ? 281  ARG A CA  1 
ATOM   2228  C  C   . ARG A 1 281 ? 46.448 91.309  33.707  1.00 37.06  ? 281  ARG A C   1 
ATOM   2229  O  O   . ARG A 1 281 ? 47.636 91.044  33.558  1.00 37.57  ? 281  ARG A O   1 
ATOM   2230  C  CB  . ARG A 1 281 ? 45.082 91.251  31.656  1.00 36.17  ? 281  ARG A CB  1 
ATOM   2231  C  CG  . ARG A 1 281 ? 44.279 92.004  30.627  1.00 35.75  ? 281  ARG A CG  1 
ATOM   2232  C  CD  . ARG A 1 281 ? 43.251 91.168  29.945  1.00 34.18  ? 281  ARG A CD  1 
ATOM   2233  N  NE  . ARG A 1 281 ? 42.364 90.582  30.929  1.00 33.34  ? 281  ARG A NE  1 
ATOM   2234  C  CZ  . ARG A 1 281 ? 41.151 91.025  31.167  1.00 33.16  ? 281  ARG A CZ  1 
ATOM   2235  N  NH1 . ARG A 1 281 ? 40.685 92.051  30.480  1.00 34.16  ? 281  ARG A NH1 1 
ATOM   2236  N  NH2 . ARG A 1 281 ? 40.397 90.441  32.080  1.00 33.12  ? 281  ARG A NH2 1 
ATOM   2237  N  N   . THR A 1 282 ? 45.732 90.842  34.721  1.00 37.44  ? 282  THR A N   1 
ATOM   2238  C  CA  . THR A 1 282 ? 46.349 89.997  35.730  1.00 37.73  ? 282  THR A CA  1 
ATOM   2239  C  C   . THR A 1 282 ? 45.744 88.604  35.794  1.00 38.06  ? 282  THR A C   1 
ATOM   2240  O  O   . THR A 1 282 ? 46.234 87.755  36.547  1.00 38.48  ? 282  THR A O   1 
ATOM   2241  C  CB  . THR A 1 282 ? 46.236 90.646  37.081  1.00 37.67  ? 282  THR A CB  1 
ATOM   2242  O  OG1 . THR A 1 282 ? 44.888 91.112  37.254  1.00 37.62  ? 282  THR A OG1 1 
ATOM   2243  C  CG2 . THR A 1 282 ? 47.088 91.907  37.106  1.00 37.69  ? 282  THR A CG2 1 
ATOM   2244  N  N   . ASP A 1 283 ? 44.677 88.368  35.032  1.00 37.76  ? 283  ASP A N   1 
ATOM   2245  C  CA  . ASP A 1 283 ? 44.086 87.038  34.985  1.00 37.34  ? 283  ASP A CA  1 
ATOM   2246  C  C   . ASP A 1 283 ? 44.838 86.227  33.957  1.00 36.84  ? 283  ASP A C   1 
ATOM   2247  O  O   . ASP A 1 283 ? 44.458 85.098  33.642  1.00 37.09  ? 283  ASP A O   1 
ATOM   2248  C  CB  . ASP A 1 283 ? 42.607 87.096  34.638  1.00 37.57  ? 283  ASP A CB  1 
ATOM   2249  C  CG  . ASP A 1 283 ? 42.274 88.257  33.742  1.00 38.57  ? 283  ASP A CG  1 
ATOM   2250  O  OD1 . ASP A 1 283 ? 43.021 88.615  32.804  1.00 38.91  ? 283  ASP A OD1 1 
ATOM   2251  O  OD2 . ASP A 1 283 ? 41.210 88.887  33.961  1.00 40.06  ? 283  ASP A OD2 1 
ATOM   2252  N  N   . GLY A 1 284 ? 45.911 86.821  33.439  1.00 36.06  ? 284  GLY A N   1 
ATOM   2253  C  CA  . GLY A 1 284 ? 46.758 86.187  32.449  1.00 35.05  ? 284  GLY A CA  1 
ATOM   2254  C  C   . GLY A 1 284 ? 46.050 85.843  31.160  1.00 34.42  ? 284  GLY A C   1 
ATOM   2255  O  O   . GLY A 1 284 ? 46.431 84.907  30.495  1.00 34.78  ? 284  GLY A O   1 
ATOM   2256  N  N   . TYR A 1 285 ? 45.036 86.616  30.802  1.00 34.04  ? 285  TYR A N   1 
ATOM   2257  C  CA  . TYR A 1 285 ? 44.239 86.384  29.606  1.00 33.74  ? 285  TYR A CA  1 
ATOM   2258  C  C   . TYR A 1 285 ? 44.652 87.205  28.394  1.00 33.81  ? 285  TYR A C   1 
ATOM   2259  O  O   . TYR A 1 285 ? 44.570 88.428  28.427  1.00 33.83  ? 285  TYR A O   1 
ATOM   2260  C  CB  . TYR A 1 285 ? 42.792 86.735  29.909  1.00 33.59  ? 285  TYR A CB  1 
ATOM   2261  C  CG  . TYR A 1 285 ? 42.095 85.679  30.690  1.00 33.75  ? 285  TYR A CG  1 
ATOM   2262  C  CD1 . TYR A 1 285 ? 42.386 84.353  30.474  1.00 35.01  ? 285  TYR A CD1 1 
ATOM   2263  C  CD2 . TYR A 1 285 ? 41.154 85.996  31.637  1.00 34.23  ? 285  TYR A CD2 1 
ATOM   2264  C  CE1 . TYR A 1 285 ? 41.766 83.364  31.170  1.00 35.42  ? 285  TYR A CE1 1 
ATOM   2265  C  CE2 . TYR A 1 285 ? 40.525 85.011  32.352  1.00 36.06  ? 285  TYR A CE2 1 
ATOM   2266  C  CZ  . TYR A 1 285 ? 40.842 83.689  32.111  1.00 36.58  ? 285  TYR A CZ  1 
ATOM   2267  O  OH  . TYR A 1 285 ? 40.233 82.673  32.811  1.00 38.64  ? 285  TYR A OH  1 
ATOM   2268  N  N   . ARG A 1 286 ? 45.056 86.545  27.312  1.00 33.71  ? 286  ARG A N   1 
ATOM   2269  C  CA  . ARG A 1 286 ? 45.363 87.270  26.084  1.00 33.66  ? 286  ARG A CA  1 
ATOM   2270  C  C   . ARG A 1 286 ? 44.134 88.011  25.557  1.00 33.56  ? 286  ARG A C   1 
ATOM   2271  O  O   . ARG A 1 286 ? 43.052 87.438  25.468  1.00 33.60  ? 286  ARG A O   1 
ATOM   2272  C  CB  . ARG A 1 286 ? 45.862 86.331  24.992  1.00 33.68  ? 286  ARG A CB  1 
ATOM   2273  C  CG  . ARG A 1 286 ? 47.028 85.471  25.391  1.00 34.52  ? 286  ARG A CG  1 
ATOM   2274  C  CD  . ARG A 1 286 ? 48.117 85.400  24.329  1.00 36.10  ? 286  ARG A CD  1 
ATOM   2275  N  NE  . ARG A 1 286 ? 47.651 84.817  23.076  1.00 37.04  ? 286  ARG A NE  1 
ATOM   2276  C  CZ  . ARG A 1 286 ? 47.014 83.663  23.000  1.00 38.25  ? 286  ARG A CZ  1 
ATOM   2277  N  NH1 . ARG A 1 286 ? 46.761 82.984  24.117  1.00 38.91  ? 286  ARG A NH1 1 
ATOM   2278  N  NH2 . ARG A 1 286 ? 46.629 83.185  21.820  1.00 38.20  ? 286  ARG A NH2 1 
ATOM   2279  N  N   . TRP A 1 287 ? 44.315 89.283  25.210  1.00 33.52  ? 287  TRP A N   1 
ATOM   2280  C  CA  . TRP A 1 287 ? 43.268 90.097  24.606  1.00 33.22  ? 287  TRP A CA  1 
ATOM   2281  C  C   . TRP A 1 287 ? 43.810 90.874  23.411  1.00 33.74  ? 287  TRP A C   1 
ATOM   2282  O  O   . TRP A 1 287 ? 44.995 90.801  23.101  1.00 34.10  ? 287  TRP A O   1 
ATOM   2283  C  CB  . TRP A 1 287 ? 42.727 91.086  25.617  1.00 33.03  ? 287  TRP A CB  1 
ATOM   2284  C  CG  . TRP A 1 287 ? 43.687 92.165  26.012  1.00 31.19  ? 287  TRP A CG  1 
ATOM   2285  C  CD1 . TRP A 1 287 ? 44.651 92.079  26.953  1.00 30.34  ? 287  TRP A CD1 1 
ATOM   2286  C  CD2 . TRP A 1 287 ? 43.741 93.504  25.505  1.00 28.94  ? 287  TRP A CD2 1 
ATOM   2287  N  NE1 . TRP A 1 287 ? 45.317 93.275  27.062  1.00 29.89  ? 287  TRP A NE1 1 
ATOM   2288  C  CE2 . TRP A 1 287 ? 44.773 94.168  26.182  1.00 28.54  ? 287  TRP A CE2 1 
ATOM   2289  C  CE3 . TRP A 1 287 ? 43.027 94.203  24.539  1.00 27.86  ? 287  TRP A CE3 1 
ATOM   2290  C  CZ2 . TRP A 1 287 ? 45.111 95.483  25.925  1.00 27.63  ? 287  TRP A CZ2 1 
ATOM   2291  C  CZ3 . TRP A 1 287 ? 43.362 95.507  24.286  1.00 28.09  ? 287  TRP A CZ3 1 
ATOM   2292  C  CH2 . TRP A 1 287 ? 44.395 96.135  24.977  1.00 28.11  ? 287  TRP A CH2 1 
ATOM   2293  N  N   . CYS A 1 288 ? 42.959 91.644  22.747  1.00 34.06  ? 288  CYS A N   1 
ATOM   2294  C  CA  . CYS A 1 288 ? 43.451 92.423  21.621  1.00 34.35  ? 288  CYS A CA  1 
ATOM   2295  C  C   . CYS A 1 288 ? 42.457 93.427  21.027  1.00 34.76  ? 288  CYS A C   1 
ATOM   2296  O  O   . CYS A 1 288 ? 41.235 93.329  21.214  1.00 34.32  ? 288  CYS A O   1 
ATOM   2297  C  CB  . CYS A 1 288 ? 43.902 91.486  20.523  1.00 34.28  ? 288  CYS A CB  1 
ATOM   2298  S  SG  . CYS A 1 288 ? 42.481 90.834  19.672  1.00 33.44  ? 288  CYS A SG  1 
ATOM   2299  N  N   . GLY A 1 289 ? 43.016 94.395  20.304  1.00 35.18  ? 289  GLY A N   1 
ATOM   2300  C  CA  . GLY A 1 289 ? 42.230 95.401  19.625  1.00 35.81  ? 289  GLY A CA  1 
ATOM   2301  C  C   . GLY A 1 289 ? 41.552 94.750  18.439  1.00 36.29  ? 289  GLY A C   1 
ATOM   2302  O  O   . GLY A 1 289 ? 42.076 93.801  17.851  1.00 36.76  ? 289  GLY A O   1 
ATOM   2303  N  N   . THR A 1 290 ? 40.388 95.256  18.076  1.00 36.16  ? 290  THR A N   1 
ATOM   2304  C  CA  . THR A 1 290 ? 39.643 94.665  17.001  1.00 36.26  ? 290  THR A CA  1 
ATOM   2305  C  C   . THR A 1 290 ? 39.561 95.745  15.954  1.00 36.53  ? 290  THR A C   1 
ATOM   2306  O  O   . THR A 1 290 ? 39.078 95.546  14.838  1.00 36.68  ? 290  THR A O   1 
ATOM   2307  C  CB  . THR A 1 290 ? 38.268 94.290  17.527  1.00 36.25  ? 290  THR A CB  1 
ATOM   2308  O  OG1 . THR A 1 290 ? 37.984 92.934  17.189  1.00 37.12  ? 290  THR A OG1 1 
ATOM   2309  C  CG2 . THR A 1 290 ? 37.169 95.094  16.845  1.00 36.32  ? 290  THR A CG2 1 
ATOM   2310  N  N   . THR A 1 291 ? 40.081 96.898  16.341  1.00 36.82  ? 291  THR A N   1 
ATOM   2311  C  CA  . THR A 1 291 ? 40.100 98.094  15.524  1.00 37.04  ? 291  THR A CA  1 
ATOM   2312  C  C   . THR A 1 291 ? 41.555 98.568  15.589  1.00 37.16  ? 291  THR A C   1 
ATOM   2313  O  O   . THR A 1 291 ? 42.288 98.136  16.469  1.00 37.46  ? 291  THR A O   1 
ATOM   2314  C  CB  . THR A 1 291 ? 39.156 99.113  16.175  1.00 36.92  ? 291  THR A CB  1 
ATOM   2315  O  OG1 . THR A 1 291 ? 38.697 100.052 15.206  1.00 37.54  ? 291  THR A OG1 1 
ATOM   2316  C  CG2 . THR A 1 291 ? 39.907 99.964  17.185  1.00 37.04  ? 291  THR A CG2 1 
ATOM   2317  N  N   . GLU A 1 292 ? 42.006 99.438  14.697  1.00 37.24  ? 292  GLU A N   1 
ATOM   2318  C  CA  . GLU A 1 292 ? 43.431 99.789  14.727  1.00 37.46  ? 292  GLU A CA  1 
ATOM   2319  C  C   . GLU A 1 292 ? 43.930 100.701 15.856  1.00 36.97  ? 292  GLU A C   1 
ATOM   2320  O  O   . GLU A 1 292 ? 45.125 100.954 15.932  1.00 37.17  ? 292  GLU A O   1 
ATOM   2321  C  CB  . GLU A 1 292 ? 43.930 100.302 13.368  1.00 37.83  ? 292  GLU A CB  1 
ATOM   2322  C  CG  . GLU A 1 292 ? 43.027 101.306 12.670  1.00 40.18  ? 292  GLU A CG  1 
ATOM   2323  C  CD  . GLU A 1 292 ? 43.807 102.380 11.923  1.00 43.05  ? 292  GLU A CD  1 
ATOM   2324  O  OE1 . GLU A 1 292 ? 44.939 102.103 11.473  1.00 44.22  ? 292  GLU A OE1 1 
ATOM   2325  O  OE2 . GLU A 1 292 ? 43.293 103.516 11.795  1.00 44.86  ? 292  GLU A OE2 1 
ATOM   2326  N  N   . ASP A 1 293 ? 43.043 101.158 16.741  1.00 36.39  ? 293  ASP A N   1 
ATOM   2327  C  CA  . ASP A 1 293 ? 43.417 102.077 17.832  1.00 35.47  ? 293  ASP A CA  1 
ATOM   2328  C  C   . ASP A 1 293 ? 42.629 101.724 19.077  1.00 35.05  ? 293  ASP A C   1 
ATOM   2329  O  O   . ASP A 1 293 ? 41.631 102.369 19.370  1.00 35.17  ? 293  ASP A O   1 
ATOM   2330  C  CB  . ASP A 1 293 ? 43.075 103.515 17.427  1.00 35.32  ? 293  ASP A CB  1 
ATOM   2331  C  CG  . ASP A 1 293 ? 43.660 104.556 18.358  1.00 34.79  ? 293  ASP A CG  1 
ATOM   2332  O  OD1 . ASP A 1 293 ? 43.511 104.437 19.591  1.00 33.77  ? 293  ASP A OD1 1 
ATOM   2333  O  OD2 . ASP A 1 293 ? 44.279 105.550 17.930  1.00 34.82  ? 293  ASP A OD2 1 
ATOM   2334  N  N   . TYR A 1 294 ? 43.065 100.724 19.828  1.00 34.59  ? 294  TYR A N   1 
ATOM   2335  C  CA  . TYR A 1 294 ? 42.272 100.297 20.982  1.00 34.42  ? 294  TYR A CA  1 
ATOM   2336  C  C   . TYR A 1 294 ? 41.783 101.424 21.892  1.00 34.14  ? 294  TYR A C   1 
ATOM   2337  O  O   . TYR A 1 294 ? 40.683 101.368 22.436  1.00 33.95  ? 294  TYR A O   1 
ATOM   2338  C  CB  . TYR A 1 294 ? 42.993 99.252  21.840  1.00 34.37  ? 294  TYR A CB  1 
ATOM   2339  C  CG  . TYR A 1 294 ? 42.254 99.054  23.136  1.00 34.34  ? 294  TYR A CG  1 
ATOM   2340  C  CD1 . TYR A 1 294 ? 41.023 98.434  23.154  1.00 34.60  ? 294  TYR A CD1 1 
ATOM   2341  C  CD2 . TYR A 1 294 ? 42.748 99.553  24.322  1.00 34.57  ? 294  TYR A CD2 1 
ATOM   2342  C  CE1 . TYR A 1 294 ? 40.320 98.278  24.319  1.00 35.06  ? 294  TYR A CE1 1 
ATOM   2343  C  CE2 . TYR A 1 294 ? 42.050 99.406  25.492  1.00 35.47  ? 294  TYR A CE2 1 
ATOM   2344  C  CZ  . TYR A 1 294 ? 40.832 98.766  25.486  1.00 35.28  ? 294  TYR A CZ  1 
ATOM   2345  O  OH  . TYR A 1 294 ? 40.127 98.603  26.654  1.00 35.51  ? 294  TYR A OH  1 
ATOM   2346  N  N   . ASP A 1 295 ? 42.617 102.434 22.073  1.00 33.87  ? 295  ASP A N   1 
ATOM   2347  C  CA  . ASP A 1 295 ? 42.285 103.537 22.952  1.00 33.73  ? 295  ASP A CA  1 
ATOM   2348  C  C   . ASP A 1 295 ? 41.125 104.366 22.447  1.00 33.73  ? 295  ASP A C   1 
ATOM   2349  O  O   . ASP A 1 295 ? 40.178 104.633 23.174  1.00 33.91  ? 295  ASP A O   1 
ATOM   2350  C  CB  . ASP A 1 295 ? 43.496 104.443 23.117  1.00 33.65  ? 295  ASP A CB  1 
ATOM   2351  C  CG  . ASP A 1 295 ? 44.574 103.813 23.945  1.00 32.98  ? 295  ASP A CG  1 
ATOM   2352  O  OD1 . ASP A 1 295 ? 44.255 103.244 25.018  1.00 31.28  ? 295  ASP A OD1 1 
ATOM   2353  O  OD2 . ASP A 1 295 ? 45.768 103.843 23.592  1.00 33.26  ? 295  ASP A OD2 1 
ATOM   2354  N  N   . ARG A 1 296 ? 41.237 104.793 21.200  1.00 33.75  ? 296  ARG A N   1 
ATOM   2355  C  CA  . ARG A 1 296 ? 40.249 105.638 20.562  1.00 33.62  ? 296  ARG A CA  1 
ATOM   2356  C  C   . ARG A 1 296 ? 38.906 104.942 20.531  1.00 33.49  ? 296  ARG A C   1 
ATOM   2357  O  O   . ARG A 1 296 ? 37.961 105.389 21.163  1.00 33.65  ? 296  ARG A O   1 
ATOM   2358  C  CB  . ARG A 1 296 ? 40.714 105.953 19.137  1.00 33.81  ? 296  ARG A CB  1 
ATOM   2359  C  CG  . ARG A 1 296 ? 39.907 106.982 18.368  1.00 34.44  ? 296  ARG A CG  1 
ATOM   2360  C  CD  . ARG A 1 296 ? 40.280 107.037 16.886  1.00 36.29  ? 296  ARG A CD  1 
ATOM   2361  N  NE  . ARG A 1 296 ? 40.246 105.711 16.261  1.00 37.69  ? 296  ARG A NE  1 
ATOM   2362  C  CZ  . ARG A 1 296 ? 41.072 105.303 15.293  1.00 38.59  ? 296  ARG A CZ  1 
ATOM   2363  N  NH1 . ARG A 1 296 ? 42.017 106.112 14.813  1.00 37.56  ? 296  ARG A NH1 1 
ATOM   2364  N  NH2 . ARG A 1 296 ? 40.950 104.074 14.797  1.00 38.93  ? 296  ARG A NH2 1 
ATOM   2365  N  N   . ASP A 1 297 ? 38.836 103.825 19.818  1.00 33.45  ? 297  ASP A N   1 
ATOM   2366  C  CA  . ASP A 1 297 ? 37.576 103.121 19.613  1.00 33.41  ? 297  ASP A CA  1 
ATOM   2367  C  C   . ASP A 1 297 ? 37.177 102.164 20.749  1.00 33.53  ? 297  ASP A C   1 
ATOM   2368  O  O   . ASP A 1 297 ? 36.019 101.794 20.876  1.00 33.73  ? 297  ASP A O   1 
ATOM   2369  C  CB  . ASP A 1 297 ? 37.610 102.388 18.273  1.00 33.32  ? 297  ASP A CB  1 
ATOM   2370  C  CG  . ASP A 1 297 ? 38.378 103.152 17.206  1.00 33.46  ? 297  ASP A CG  1 
ATOM   2371  O  OD1 . ASP A 1 297 ? 38.140 104.363 17.027  1.00 34.42  ? 297  ASP A OD1 1 
ATOM   2372  O  OD2 . ASP A 1 297 ? 39.243 102.626 16.484  1.00 33.10  ? 297  ASP A OD2 1 
ATOM   2373  N  N   . LYS A 1 298 ? 38.134 101.741 21.559  1.00 33.74  ? 298  LYS A N   1 
ATOM   2374  C  CA  . LYS A 1 298 ? 37.819 100.896 22.707  1.00 33.72  ? 298  LYS A CA  1 
ATOM   2375  C  C   . LYS A 1 298 ? 37.005 99.656  22.337  1.00 33.85  ? 298  LYS A C   1 
ATOM   2376  O  O   . LYS A 1 298 ? 35.990 99.349  22.972  1.00 33.94  ? 298  LYS A O   1 
ATOM   2377  C  CB  . LYS A 1 298 ? 37.099 101.728 23.771  1.00 33.50  ? 298  LYS A CB  1 
ATOM   2378  C  CG  . LYS A 1 298 ? 37.977 102.827 24.370  1.00 33.15  ? 298  LYS A CG  1 
ATOM   2379  C  CD  . LYS A 1 298 ? 37.163 103.951 25.013  1.00 33.06  ? 298  LYS A CD  1 
ATOM   2380  C  CE  . LYS A 1 298 ? 36.503 104.886 23.975  1.00 31.88  ? 298  LYS A CE  1 
ATOM   2381  N  NZ  . LYS A 1 298 ? 37.260 106.151 23.724  1.00 30.25  ? 298  LYS A NZ  1 
ATOM   2382  N  N   . LYS A 1 299 ? 37.464 98.943  21.313  1.00 33.80  ? 299  LYS A N   1 
ATOM   2383  C  CA  . LYS A 1 299 ? 36.791 97.731  20.857  1.00 33.77  ? 299  LYS A CA  1 
ATOM   2384  C  C   . LYS A 1 299 ? 37.724 96.551  21.085  1.00 33.49  ? 299  LYS A C   1 
ATOM   2385  O  O   . LYS A 1 299 ? 38.880 96.603  20.680  1.00 33.77  ? 299  LYS A O   1 
ATOM   2386  C  CB  . LYS A 1 299 ? 36.464 97.858  19.374  1.00 33.75  ? 299  LYS A CB  1 
ATOM   2387  C  CG  . LYS A 1 299 ? 35.035 97.527  19.022  1.00 34.64  ? 299  LYS A CG  1 
ATOM   2388  C  CD  . LYS A 1 299 ? 34.088 98.616  19.494  1.00 36.31  ? 299  LYS A CD  1 
ATOM   2389  C  CE  . LYS A 1 299 ? 32.652 98.373  19.007  1.00 36.98  ? 299  LYS A CE  1 
ATOM   2390  N  NZ  . LYS A 1 299 ? 32.061 97.134  19.582  1.00 37.08  ? 299  LYS A NZ  1 
ATOM   2391  N  N   . TYR A 1 300 ? 37.235 95.488  21.717  1.00 33.31  ? 300  TYR A N   1 
ATOM   2392  C  CA  . TYR A 1 300 ? 38.095 94.354  22.054  1.00 33.17  ? 300  TYR A CA  1 
ATOM   2393  C  C   . TYR A 1 300 ? 37.395 93.017  22.290  1.00 33.37  ? 300  TYR A C   1 
ATOM   2394  O  O   . TYR A 1 300 ? 36.210 92.955  22.601  1.00 33.62  ? 300  TYR A O   1 
ATOM   2395  C  CB  . TYR A 1 300 ? 38.841 94.664  23.330  1.00 32.95  ? 300  TYR A CB  1 
ATOM   2396  C  CG  . TYR A 1 300 ? 38.024 94.355  24.549  1.00 32.15  ? 300  TYR A CG  1 
ATOM   2397  C  CD1 . TYR A 1 300 ? 37.028 95.210  24.964  1.00 32.49  ? 300  TYR A CD1 1 
ATOM   2398  C  CD2 . TYR A 1 300 ? 38.241 93.204  25.277  1.00 32.06  ? 300  TYR A CD2 1 
ATOM   2399  C  CE1 . TYR A 1 300 ? 36.282 94.942  26.081  1.00 33.58  ? 300  TYR A CE1 1 
ATOM   2400  C  CE2 . TYR A 1 300 ? 37.501 92.919  26.399  1.00 33.02  ? 300  TYR A CE2 1 
ATOM   2401  C  CZ  . TYR A 1 300 ? 36.521 93.791  26.802  1.00 34.08  ? 300  TYR A CZ  1 
ATOM   2402  O  OH  . TYR A 1 300 ? 35.765 93.515  27.926  1.00 35.46  ? 300  TYR A OH  1 
ATOM   2403  N  N   . GLY A 1 301 ? 38.173 91.948  22.187  1.00 33.44  ? 301  GLY A N   1 
ATOM   2404  C  CA  . GLY A 1 301 ? 37.697 90.595  22.404  1.00 33.61  ? 301  GLY A CA  1 
ATOM   2405  C  C   . GLY A 1 301 ? 38.876 89.777  22.898  1.00 33.74  ? 301  GLY A C   1 
ATOM   2406  O  O   . GLY A 1 301 ? 40.013 90.229  22.782  1.00 33.88  ? 301  GLY A O   1 
ATOM   2407  N  N   . PHE A 1 302 ? 38.625 88.586  23.439  1.00 33.57  ? 302  PHE A N   1 
ATOM   2408  C  CA  . PHE A 1 302 ? 39.694 87.785  24.019  1.00 33.37  ? 302  PHE A CA  1 
ATOM   2409  C  C   . PHE A 1 302 ? 40.178 86.732  23.074  1.00 33.61  ? 302  PHE A C   1 
ATOM   2410  O  O   . PHE A 1 302 ? 39.492 86.416  22.127  1.00 33.88  ? 302  PHE A O   1 
ATOM   2411  C  CB  . PHE A 1 302 ? 39.226 87.141  25.318  1.00 33.33  ? 302  PHE A CB  1 
ATOM   2412  C  CG  . PHE A 1 302 ? 39.121 88.103  26.449  1.00 32.23  ? 302  PHE A CG  1 
ATOM   2413  C  CD1 . PHE A 1 302 ? 40.236 88.443  27.183  1.00 31.00  ? 302  PHE A CD1 1 
ATOM   2414  C  CD2 . PHE A 1 302 ? 37.923 88.697  26.751  1.00 31.91  ? 302  PHE A CD2 1 
ATOM   2415  C  CE1 . PHE A 1 302 ? 40.160 89.342  28.204  1.00 30.41  ? 302  PHE A CE1 1 
ATOM   2416  C  CE2 . PHE A 1 302 ? 37.838 89.593  27.780  1.00 32.39  ? 302  PHE A CE2 1 
ATOM   2417  C  CZ  . PHE A 1 302 ? 38.966 89.913  28.510  1.00 31.69  ? 302  PHE A CZ  1 
ATOM   2418  N  N   . CYS A 1 303 ? 41.358 86.187  23.350  1.00 34.14  ? 303  CYS A N   1 
ATOM   2419  C  CA  . CYS A 1 303 ? 41.976 85.165  22.512  1.00 34.84  ? 303  CYS A CA  1 
ATOM   2420  C  C   . CYS A 1 303 ? 42.314 83.907  23.333  1.00 35.03  ? 303  CYS A C   1 
ATOM   2421  O  O   . CYS A 1 303 ? 43.484 83.618  23.591  1.00 35.03  ? 303  CYS A O   1 
ATOM   2422  C  CB  . CYS A 1 303 ? 43.274 85.701  21.887  1.00 35.16  ? 303  CYS A CB  1 
ATOM   2423  S  SG  . CYS A 1 303 ? 43.309 87.369  21.143  1.00 37.01  ? 303  CYS A SG  1 
ATOM   2424  N  N   . PRO A 1 304 ? 41.301 83.133  23.692  1.00 35.24  ? 304  PRO A N   1 
ATOM   2425  C  CA  . PRO A 1 304 ? 41.459 81.966  24.576  1.00 35.47  ? 304  PRO A CA  1 
ATOM   2426  C  C   . PRO A 1 304 ? 42.277 80.786  24.043  1.00 35.87  ? 304  PRO A C   1 
ATOM   2427  O  O   . PRO A 1 304 ? 42.652 79.928  24.834  1.00 36.36  ? 304  PRO A O   1 
ATOM   2428  C  CB  . PRO A 1 304 ? 40.032 81.492  24.797  1.00 35.50  ? 304  PRO A CB  1 
ATOM   2429  C  CG  . PRO A 1 304 ? 39.167 82.580  24.277  1.00 36.09  ? 304  PRO A CG  1 
ATOM   2430  C  CD  . PRO A 1 304 ? 39.921 83.312  23.231  1.00 35.28  ? 304  PRO A CD  1 
ATOM   2431  N  N   . GLU A 1 305 ? 42.520 80.694  22.748  1.00 36.00  ? 305  GLU A N   1 
ATOM   2432  C  CA  . GLU A 1 305 ? 43.341 79.604  22.245  1.00 36.25  ? 305  GLU A CA  1 
ATOM   2433  C  C   . GLU A 1 305 ? 43.649 79.831  20.783  1.00 36.48  ? 305  GLU A C   1 
ATOM   2434  O  O   . GLU A 1 305 ? 42.920 80.555  20.107  1.00 36.82  ? 305  GLU A O   1 
ATOM   2435  C  CB  . GLU A 1 305 ? 42.651 78.260  22.423  1.00 36.18  ? 305  GLU A CB  1 
ATOM   2436  C  CG  . GLU A 1 305 ? 43.554 77.089  22.072  1.00 37.96  ? 305  GLU A CG  1 
ATOM   2437  C  CD  . GLU A 1 305 ? 42.829 75.760  21.871  1.00 39.96  ? 305  GLU A CD  1 
ATOM   2438  O  OE1 . GLU A 1 305 ? 41.594 75.691  22.109  1.00 41.67  ? 305  GLU A OE1 1 
ATOM   2439  O  OE2 . GLU A 1 305 ? 43.509 74.777  21.474  1.00 39.39  ? 305  GLU A OE2 1 
ATOM   2440  N  N   . THR A 1 306 ? 44.733 79.238  20.293  1.00 36.47  ? 306  THR A N   1 
ATOM   2441  C  CA  . THR A 1 306 ? 45.076 79.382  18.889  1.00 36.57  ? 306  THR A CA  1 
ATOM   2442  C  C   . THR A 1 306 ? 45.366 78.039  18.270  1.00 36.89  ? 306  THR A C   1 
ATOM   2443  O  O   . THR A 1 306 ? 46.281 77.340  18.705  1.00 37.44  ? 306  THR A O   1 
ATOM   2444  C  CB  . THR A 1 306 ? 46.281 80.289  18.713  1.00 36.43  ? 306  THR A CB  1 
ATOM   2445  O  OG1 . THR A 1 306 ? 46.013 81.559  19.319  1.00 37.02  ? 306  THR A OG1 1 
ATOM   2446  C  CG2 . THR A 1 306 ? 46.450 80.644  17.251  1.00 36.25  ? 306  THR A CG2 1 
ATOM   2447  N  N   . ALA A 1 307 ? 44.585 77.677  17.259  1.00 36.76  ? 307  ALA A N   1 
ATOM   2448  C  CA  . ALA A 1 307 ? 44.770 76.420  16.570  1.00 37.07  ? 307  ALA A CA  1 
ATOM   2449  C  C   . ALA A 1 307 ? 45.921 76.553  15.590  1.00 37.72  ? 307  ALA A C   1 
ATOM   2450  O  O   . ALA A 1 307 ? 46.166 77.624  15.058  1.00 37.99  ? 307  ALA A O   1 
ATOM   2451  C  CB  . ALA A 1 307 ? 43.499 76.045  15.840  1.00 36.98  ? 307  ALA A CB  1 
ATOM   2452  N  N   . MET A 1 308 ? 46.652 75.476  15.351  1.00 38.63  ? 308  MET A N   1 
ATOM   2453  C  CA  . MET A 1 308 ? 47.719 75.550  14.354  1.00 39.55  ? 308  MET A CA  1 
ATOM   2454  C  C   . MET A 1 308 ? 48.162 74.228  13.731  1.00 39.37  ? 308  MET A C   1 
ATOM   2455  O  O   . MET A 1 308 ? 48.357 73.240  14.421  1.00 39.34  ? 308  MET A O   1 
ATOM   2456  C  CB  . MET A 1 308 ? 48.913 76.364  14.852  1.00 39.97  ? 308  MET A CB  1 
ATOM   2457  C  CG  . MET A 1 308 ? 49.220 76.262  16.307  1.00 41.63  ? 308  MET A CG  1 
ATOM   2458  S  SD  . MET A 1 308 ? 50.144 77.764  16.734  1.00 47.11  ? 308  MET A SD  1 
ATOM   2459  C  CE  . MET A 1 308 ? 51.423 77.818  15.461  1.00 43.88  ? 308  MET A CE  1 
ATOM   2460  N  N   . SER A 1 309 ? 48.323 74.243  12.412  1.00 39.37  ? 309  SER A N   1 
ATOM   2461  C  CA  . SER A 1 309 ? 48.641 73.050  11.651  1.00 39.74  ? 309  SER A CA  1 
ATOM   2462  C  C   . SER A 1 309 ? 50.093 72.681  11.839  1.00 39.93  ? 309  SER A C   1 
ATOM   2463  O  O   . SER A 1 309 ? 50.456 71.507  11.889  1.00 40.05  ? 309  SER A O   1 
ATOM   2464  C  CB  . SER A 1 309 ? 48.406 73.304  10.157  1.00 39.89  ? 309  SER A CB  1 
ATOM   2465  O  OG  . SER A 1 309 ? 47.146 73.906  9.888   1.00 40.92  ? 309  SER A OG  1 
ATOM   2466  N  N   . THR A 1 310 ? 50.916 73.716  11.936  1.00 39.98  ? 310  THR A N   1 
ATOM   2467  C  CA  . THR A 1 310 ? 52.353 73.596  12.035  1.00 39.49  ? 310  THR A CA  1 
ATOM   2468  C  C   . THR A 1 310 ? 52.833 74.150  13.371  1.00 39.50  ? 310  THR A C   1 
ATOM   2469  O  O   . THR A 1 310 ? 52.172 74.989  13.976  1.00 39.99  ? 310  THR A O   1 
ATOM   2470  C  CB  . THR A 1 310 ? 52.920 74.414  10.895  1.00 39.36  ? 310  THR A CB  1 
ATOM   2471  O  OG1 . THR A 1 310 ? 53.501 73.533  9.934   1.00 39.30  ? 310  THR A OG1 1 
ATOM   2472  C  CG2 . THR A 1 310 ? 54.071 75.272  11.362  1.00 40.05  ? 310  THR A CG2 1 
ATOM   2473  N  N   . VAL A 1 311 ? 53.977 73.693  13.852  1.00 39.25  ? 311  VAL A N   1 
ATOM   2474  C  CA  . VAL A 1 311 ? 54.496 74.223  15.106  1.00 38.99  ? 311  VAL A CA  1 
ATOM   2475  C  C   . VAL A 1 311 ? 55.954 74.676  14.970  1.00 39.15  ? 311  VAL A C   1 
ATOM   2476  O  O   . VAL A 1 311 ? 56.741 74.073  14.249  1.00 39.16  ? 311  VAL A O   1 
ATOM   2477  C  CB  . VAL A 1 311 ? 54.388 73.185  16.234  1.00 38.89  ? 311  VAL A CB  1 
ATOM   2478  C  CG1 . VAL A 1 311 ? 54.983 73.728  17.521  1.00 38.90  ? 311  VAL A CG1 1 
ATOM   2479  C  CG2 . VAL A 1 311 ? 52.947 72.775  16.442  1.00 38.35  ? 311  VAL A CG2 1 
ATOM   2480  N  N   . GLY A 1 312 ? 56.309 75.749  15.660  1.00 39.31  ? 312  GLY A N   1 
ATOM   2481  C  CA  . GLY A 1 312 ? 57.677 76.225  15.646  1.00 39.47  ? 312  GLY A CA  1 
ATOM   2482  C  C   . GLY A 1 312 ? 58.062 76.716  14.278  1.00 39.67  ? 312  GLY A C   1 
ATOM   2483  O  O   . GLY A 1 312 ? 57.223 77.191  13.521  1.00 39.73  ? 312  GLY A O   1 
ATOM   2484  N  N   . GLY A 1 313 ? 59.338 76.598  13.949  1.00 40.01  ? 313  GLY A N   1 
ATOM   2485  C  CA  . GLY A 1 313 ? 59.789 77.034  12.648  1.00 40.19  ? 313  GLY A CA  1 
ATOM   2486  C  C   . GLY A 1 313 ? 59.475 78.497  12.451  1.00 40.30  ? 313  GLY A C   1 
ATOM   2487  O  O   . GLY A 1 313 ? 59.367 79.248  13.419  1.00 40.38  ? 313  GLY A O   1 
ATOM   2488  N  N   . ASN A 1 314 ? 59.300 78.905  11.201  1.00 40.33  ? 314  ASN A N   1 
ATOM   2489  C  CA  . ASN A 1 314 ? 59.093 80.309  10.923  1.00 40.45  ? 314  ASN A CA  1 
ATOM   2490  C  C   . ASN A 1 314 ? 57.834 80.619  10.144  1.00 40.73  ? 314  ASN A C   1 
ATOM   2491  O  O   . ASN A 1 314 ? 57.713 81.706  9.594   1.00 41.23  ? 314  ASN A O   1 
ATOM   2492  C  CB  . ASN A 1 314 ? 60.305 80.888  10.195  1.00 40.30  ? 314  ASN A CB  1 
ATOM   2493  C  CG  . ASN A 1 314 ? 60.479 80.314  8.813   1.00 40.13  ? 314  ASN A CG  1 
ATOM   2494  O  OD1 . ASN A 1 314 ? 61.466 80.593  8.131   1.00 39.32  ? 314  ASN A OD1 1 
ATOM   2495  N  ND2 . ASN A 1 314 ? 59.518 79.506  8.386   1.00 40.51  ? 314  ASN A ND2 1 
ATOM   2496  N  N   . SER A 1 315 ? 56.893 79.689  10.097  1.00 40.77  ? 315  SER A N   1 
ATOM   2497  C  CA  . SER A 1 315 ? 55.664 79.944  9.365   1.00 41.04  ? 315  SER A CA  1 
ATOM   2498  C  C   . SER A 1 315 ? 54.456 80.274  10.239  1.00 41.46  ? 315  SER A C   1 
ATOM   2499  O  O   . SER A 1 315 ? 53.313 80.152  9.790   1.00 41.73  ? 315  SER A O   1 
ATOM   2500  C  CB  . SER A 1 315 ? 55.322 78.760  8.482   1.00 41.12  ? 315  SER A CB  1 
ATOM   2501  O  OG  . SER A 1 315 ? 56.350 78.529  7.544   1.00 41.62  ? 315  SER A OG  1 
ATOM   2502  N  N   . GLU A 1 316 ? 54.687 80.662  11.487  1.00 41.57  ? 316  GLU A N   1 
ATOM   2503  C  CA  . GLU A 1 316 ? 53.577 81.066  12.342  1.00 41.59  ? 316  GLU A CA  1 
ATOM   2504  C  C   . GLU A 1 316 ? 52.367 80.135  12.319  1.00 41.04  ? 316  GLU A C   1 
ATOM   2505  O  O   . GLU A 1 316 ? 51.260 80.576  12.568  1.00 41.32  ? 316  GLU A O   1 
ATOM   2506  C  CB  . GLU A 1 316 ? 53.115 82.478  11.951  1.00 41.90  ? 316  GLU A CB  1 
ATOM   2507  C  CG  . GLU A 1 316 ? 53.722 83.598  12.787  1.00 43.98  ? 316  GLU A CG  1 
ATOM   2508  C  CD  . GLU A 1 316 ? 53.914 84.886  12.002  1.00 46.47  ? 316  GLU A CD  1 
ATOM   2509  O  OE1 . GLU A 1 316 ? 52.969 85.283  11.281  1.00 47.64  ? 316  GLU A OE1 1 
ATOM   2510  O  OE2 . GLU A 1 316 ? 55.012 85.497  12.101  1.00 47.10  ? 316  GLU A OE2 1 
ATOM   2511  N  N   . GLY A 1 317 ? 52.543 78.859  12.007  1.00 40.69  ? 317  GLY A N   1 
ATOM   2512  C  CA  . GLY A 1 317 ? 51.410 77.942  12.082  1.00 39.98  ? 317  GLY A CA  1 
ATOM   2513  C  C   . GLY A 1 317 ? 50.829 77.487  10.758  1.00 39.40  ? 317  GLY A C   1 
ATOM   2514  O  O   . GLY A 1 317 ? 50.042 76.529  10.699  1.00 39.18  ? 317  GLY A O   1 
ATOM   2515  N  N   . ALA A 1 318 ? 51.218 78.192  9.699   1.00 38.62  ? 318  ALA A N   1 
ATOM   2516  C  CA  . ALA A 1 318 ? 50.843 77.850  8.339   1.00 37.68  ? 318  ALA A CA  1 
ATOM   2517  C  C   . ALA A 1 318 ? 50.903 76.352  8.130   1.00 37.18  ? 318  ALA A C   1 
ATOM   2518  O  O   . ALA A 1 318 ? 51.880 75.700  8.506   1.00 37.27  ? 318  ALA A O   1 
ATOM   2519  C  CB  . ALA A 1 318 ? 51.795 78.527  7.374   1.00 37.75  ? 318  ALA A CB  1 
ATOM   2520  N  N   . PRO A 1 319 ? 49.867 75.801  7.521   1.00 36.56  ? 319  PRO A N   1 
ATOM   2521  C  CA  . PRO A 1 319 ? 49.818 74.370  7.211   1.00 36.31  ? 319  PRO A CA  1 
ATOM   2522  C  C   . PRO A 1 319 ? 50.945 73.933  6.282   1.00 36.06  ? 319  PRO A C   1 
ATOM   2523  O  O   . PRO A 1 319 ? 51.542 74.753  5.591   1.00 36.29  ? 319  PRO A O   1 
ATOM   2524  C  CB  . PRO A 1 319 ? 48.488 74.228  6.498   1.00 35.94  ? 319  PRO A CB  1 
ATOM   2525  C  CG  . PRO A 1 319 ? 47.708 75.341  6.999   1.00 36.36  ? 319  PRO A CG  1 
ATOM   2526  C  CD  . PRO A 1 319 ? 48.650 76.498  7.100   1.00 36.55  ? 319  PRO A CD  1 
ATOM   2527  N  N   . CYS A 1 320 ? 51.250 72.648  6.274   1.00 35.64  ? 320  CYS A N   1 
ATOM   2528  C  CA  . CYS A 1 320 ? 52.277 72.171  5.387   1.00 35.64  ? 320  CYS A CA  1 
ATOM   2529  C  C   . CYS A 1 320 ? 51.776 72.307  3.974   1.00 35.75  ? 320  CYS A C   1 
ATOM   2530  O  O   . CYS A 1 320 ? 50.600 72.581  3.747   1.00 35.93  ? 320  CYS A O   1 
ATOM   2531  C  CB  . CYS A 1 320 ? 52.568 70.718  5.669   1.00 35.53  ? 320  CYS A CB  1 
ATOM   2532  S  SG  . CYS A 1 320 ? 53.305 70.505  7.284   1.00 36.86  ? 320  CYS A SG  1 
ATOM   2533  N  N   . VAL A 1 321 ? 52.674 72.113  3.019   1.00 35.73  ? 321  VAL A N   1 
ATOM   2534  C  CA  . VAL A 1 321 ? 52.319 72.166  1.615   1.00 35.49  ? 321  VAL A CA  1 
ATOM   2535  C  C   . VAL A 1 321 ? 52.976 70.982  0.936   1.00 35.66  ? 321  VAL A C   1 
ATOM   2536  O  O   . VAL A 1 321 ? 54.175 70.758  1.081   1.00 35.74  ? 321  VAL A O   1 
ATOM   2537  C  CB  . VAL A 1 321 ? 52.817 73.450  0.968   1.00 35.38  ? 321  VAL A CB  1 
ATOM   2538  C  CG1 . VAL A 1 321 ? 52.490 73.448  -0.506  1.00 35.51  ? 321  VAL A CG1 1 
ATOM   2539  C  CG2 . VAL A 1 321 ? 52.215 74.662  1.659   1.00 35.26  ? 321  VAL A CG2 1 
ATOM   2540  N  N   . PHE A 1 322 ? 52.187 70.198  0.220   1.00 35.77  ? 322  PHE A N   1 
ATOM   2541  C  CA  . PHE A 1 322 ? 52.727 69.040  -0.469  1.00 35.87  ? 322  PHE A CA  1 
ATOM   2542  C  C   . PHE A 1 322 ? 52.288 69.069  -1.925  1.00 35.77  ? 322  PHE A C   1 
ATOM   2543  O  O   . PHE A 1 322 ? 51.165 69.455  -2.239  1.00 35.90  ? 322  PHE A O   1 
ATOM   2544  C  CB  . PHE A 1 322 ? 52.269 67.740  0.198   1.00 35.99  ? 322  PHE A CB  1 
ATOM   2545  C  CG  . PHE A 1 322 ? 52.646 67.625  1.651   1.00 36.72  ? 322  PHE A CG  1 
ATOM   2546  C  CD1 . PHE A 1 322 ? 53.943 67.321  2.024   1.00 37.76  ? 322  PHE A CD1 1 
ATOM   2547  C  CD2 . PHE A 1 322 ? 51.698 67.801  2.646   1.00 37.77  ? 322  PHE A CD2 1 
ATOM   2548  C  CE1 . PHE A 1 322 ? 54.292 67.207  3.362   1.00 38.09  ? 322  PHE A CE1 1 
ATOM   2549  C  CE2 . PHE A 1 322 ? 52.039 67.687  3.988   1.00 38.11  ? 322  PHE A CE2 1 
ATOM   2550  C  CZ  . PHE A 1 322 ? 53.336 67.392  4.343   1.00 38.44  ? 322  PHE A CZ  1 
ATOM   2551  N  N   . PRO A 1 323 ? 53.193 68.692  -2.816  1.00 35.69  ? 323  PRO A N   1 
ATOM   2552  C  CA  . PRO A 1 323 ? 54.544 68.300  -2.435  1.00 35.60  ? 323  PRO A CA  1 
ATOM   2553  C  C   . PRO A 1 323 ? 55.417 69.535  -2.200  1.00 35.53  ? 323  PRO A C   1 
ATOM   2554  O  O   . PRO A 1 323 ? 55.012 70.664  -2.523  1.00 35.66  ? 323  PRO A O   1 
ATOM   2555  C  CB  . PRO A 1 323 ? 55.012 67.587  -3.694  1.00 35.57  ? 323  PRO A CB  1 
ATOM   2556  C  CG  . PRO A 1 323 ? 54.445 68.465  -4.747  1.00 35.33  ? 323  PRO A CG  1 
ATOM   2557  C  CD  . PRO A 1 323 ? 53.013 68.616  -4.278  1.00 35.71  ? 323  PRO A CD  1 
ATOM   2558  N  N   . PHE A 1 324 ? 56.594 69.333  -1.618  1.00 35.12  ? 324  PHE A N   1 
ATOM   2559  C  CA  . PHE A 1 324 ? 57.535 70.434  -1.475  1.00 34.78  ? 324  PHE A CA  1 
ATOM   2560  C  C   . PHE A 1 324 ? 58.949 69.999  -1.821  1.00 34.16  ? 324  PHE A C   1 
ATOM   2561  O  O   . PHE A 1 324 ? 59.336 68.859  -1.575  1.00 33.89  ? 324  PHE A O   1 
ATOM   2562  C  CB  . PHE A 1 324 ? 57.461 71.083  -0.086  1.00 35.05  ? 324  PHE A CB  1 
ATOM   2563  C  CG  . PHE A 1 324 ? 58.066 70.259  1.028   1.00 35.95  ? 324  PHE A CG  1 
ATOM   2564  C  CD1 . PHE A 1 324 ? 59.441 70.149  1.167   1.00 36.15  ? 324  PHE A CD1 1 
ATOM   2565  C  CD2 . PHE A 1 324 ? 57.253 69.633  1.963   1.00 36.71  ? 324  PHE A CD2 1 
ATOM   2566  C  CE1 . PHE A 1 324 ? 59.990 69.409  2.191   1.00 36.39  ? 324  PHE A CE1 1 
ATOM   2567  C  CE2 . PHE A 1 324 ? 57.801 68.894  2.995   1.00 36.67  ? 324  PHE A CE2 1 
ATOM   2568  C  CZ  . PHE A 1 324 ? 59.169 68.781  3.108   1.00 36.69  ? 324  PHE A CZ  1 
ATOM   2569  N  N   . THR A 1 325 ? 59.708 70.902  -2.426  1.00 33.51  ? 325  THR A N   1 
ATOM   2570  C  CA  . THR A 1 325 ? 61.090 70.594  -2.741  1.00 33.07  ? 325  THR A CA  1 
ATOM   2571  C  C   . THR A 1 325 ? 61.990 71.161  -1.666  1.00 32.49  ? 325  THR A C   1 
ATOM   2572  O  O   . THR A 1 325 ? 61.748 72.242  -1.138  1.00 32.29  ? 325  THR A O   1 
ATOM   2573  C  CB  . THR A 1 325 ? 61.511 71.162  -4.105  1.00 33.13  ? 325  THR A CB  1 
ATOM   2574  O  OG1 . THR A 1 325 ? 61.079 72.525  -4.209  1.00 33.58  ? 325  THR A OG1 1 
ATOM   2575  C  CG2 . THR A 1 325 ? 60.780 70.461  -5.233  1.00 33.45  ? 325  THR A CG2 1 
ATOM   2576  N  N   . PHE A 1 326 ? 63.037 70.415  -1.359  1.00 31.93  ? 326  PHE A N   1 
ATOM   2577  C  CA  . PHE A 1 326 ? 64.018 70.815  -0.380  1.00 31.45  ? 326  PHE A CA  1 
ATOM   2578  C  C   . PHE A 1 326 ? 65.332 70.179  -0.789  1.00 31.30  ? 326  PHE A C   1 
ATOM   2579  O  O   . PHE A 1 326 ? 65.394 68.977  -1.014  1.00 31.44  ? 326  PHE A O   1 
ATOM   2580  C  CB  . PHE A 1 326 ? 63.598 70.335  0.998   1.00 31.39  ? 326  PHE A CB  1 
ATOM   2581  C  CG  . PHE A 1 326 ? 64.712 70.311  1.987   1.00 30.81  ? 326  PHE A CG  1 
ATOM   2582  C  CD1 . PHE A 1 326 ? 65.138 71.475  2.588   1.00 30.18  ? 326  PHE A CD1 1 
ATOM   2583  C  CD2 . PHE A 1 326 ? 65.331 69.121  2.316   1.00 30.26  ? 326  PHE A CD2 1 
ATOM   2584  C  CE1 . PHE A 1 326 ? 66.160 71.454  3.492   1.00 30.54  ? 326  PHE A CE1 1 
ATOM   2585  C  CE2 . PHE A 1 326 ? 66.352 69.092  3.220   1.00 30.36  ? 326  PHE A CE2 1 
ATOM   2586  C  CZ  . PHE A 1 326 ? 66.774 70.260  3.809   1.00 30.71  ? 326  PHE A CZ  1 
ATOM   2587  N  N   . LEU A 1 327 ? 66.380 70.983  -0.910  1.00 31.10  ? 327  LEU A N   1 
ATOM   2588  C  CA  . LEU A 1 327 ? 67.676 70.473  -1.356  1.00 30.91  ? 327  LEU A CA  1 
ATOM   2589  C  C   . LEU A 1 327 ? 67.614 69.766  -2.714  1.00 30.95  ? 327  LEU A C   1 
ATOM   2590  O  O   . LEU A 1 327 ? 68.495 68.997  -3.062  1.00 30.53  ? 327  LEU A O   1 
ATOM   2591  C  CB  . LEU A 1 327 ? 68.293 69.559  -0.303  1.00 30.78  ? 327  LEU A CB  1 
ATOM   2592  C  CG  . LEU A 1 327 ? 68.684 70.259  0.991   1.00 30.15  ? 327  LEU A CG  1 
ATOM   2593  C  CD1 . LEU A 1 327 ? 69.507 69.327  1.844   1.00 29.65  ? 327  LEU A CD1 1 
ATOM   2594  C  CD2 . LEU A 1 327 ? 69.462 71.509  0.685   1.00 29.83  ? 327  LEU A CD2 1 
ATOM   2595  N  N   . GLY A 1 328 ? 66.557 70.023  -3.471  1.00 31.47  ? 328  GLY A N   1 
ATOM   2596  C  CA  . GLY A 1 328 ? 66.445 69.485  -4.811  1.00 32.37  ? 328  GLY A CA  1 
ATOM   2597  C  C   . GLY A 1 328 ? 65.542 68.284  -5.002  1.00 32.97  ? 328  GLY A C   1 
ATOM   2598  O  O   . GLY A 1 328 ? 65.412 67.785  -6.115  1.00 33.07  ? 328  GLY A O   1 
ATOM   2599  N  N   . ASN A 1 329 ? 64.917 67.816  -3.932  1.00 33.52  ? 329  ASN A N   1 
ATOM   2600  C  CA  . ASN A 1 329 ? 64.041 66.662  -4.026  1.00 34.16  ? 329  ASN A CA  1 
ATOM   2601  C  C   . ASN A 1 329 ? 62.663 67.018  -3.533  1.00 34.50  ? 329  ASN A C   1 
ATOM   2602  O  O   . ASN A 1 329 ? 62.525 67.780  -2.586  1.00 34.75  ? 329  ASN A O   1 
ATOM   2603  C  CB  . ASN A 1 329 ? 64.579 65.536  -3.166  1.00 34.35  ? 329  ASN A CB  1 
ATOM   2604  C  CG  . ASN A 1 329 ? 66.068 65.619  -2.983  1.00 35.07  ? 329  ASN A CG  1 
ATOM   2605  O  OD1 . ASN A 1 329 ? 66.833 65.183  -3.849  1.00 34.72  ? 329  ASN A OD1 1 
ATOM   2606  N  ND2 . ASN A 1 329 ? 66.499 66.186  -1.846  1.00 35.89  ? 329  ASN A ND2 1 
ATOM   2607  N  N   . LYS A 1 330 ? 61.633 66.474  -4.164  1.00 34.80  ? 330  LYS A N   1 
ATOM   2608  C  CA  . LYS A 1 330 ? 60.292 66.766  -3.700  1.00 35.06  ? 330  LYS A CA  1 
ATOM   2609  C  C   . LYS A 1 330 ? 59.896 65.753  -2.625  1.00 34.80  ? 330  LYS A C   1 
ATOM   2610  O  O   . LYS A 1 330 ? 60.278 64.589  -2.679  1.00 34.55  ? 330  LYS A O   1 
ATOM   2611  C  CB  . LYS A 1 330 ? 59.288 66.829  -4.862  1.00 35.21  ? 330  LYS A CB  1 
ATOM   2612  C  CG  . LYS A 1 330 ? 59.226 65.581  -5.707  1.00 36.83  ? 330  LYS A CG  1 
ATOM   2613  C  CD  . LYS A 1 330 ? 57.797 65.283  -6.161  1.00 39.17  ? 330  LYS A CD  1 
ATOM   2614  C  CE  . LYS A 1 330 ? 57.539 63.769  -6.156  1.00 40.46  ? 330  LYS A CE  1 
ATOM   2615  N  NZ  . LYS A 1 330 ? 56.260 63.396  -6.827  1.00 41.41  ? 330  LYS A NZ  1 
ATOM   2616  N  N   . TYR A 1 331 ? 59.163 66.230  -1.630  1.00 34.87  ? 331  TYR A N   1 
ATOM   2617  C  CA  . TYR A 1 331 ? 58.699 65.411  -0.523  1.00 35.02  ? 331  TYR A CA  1 
ATOM   2618  C  C   . TYR A 1 331 ? 57.190 65.601  -0.447  1.00 35.42  ? 331  TYR A C   1 
ATOM   2619  O  O   . TYR A 1 331 ? 56.706 66.733  -0.527  1.00 35.55  ? 331  TYR A O   1 
ATOM   2620  C  CB  . TYR A 1 331 ? 59.354 65.873  0.795   1.00 34.96  ? 331  TYR A CB  1 
ATOM   2621  C  CG  . TYR A 1 331 ? 60.870 65.794  0.796   1.00 34.06  ? 331  TYR A CG  1 
ATOM   2622  C  CD1 . TYR A 1 331 ? 61.637 66.724  0.116   1.00 33.24  ? 331  TYR A CD1 1 
ATOM   2623  C  CD2 . TYR A 1 331 ? 61.530 64.779  1.467   1.00 33.52  ? 331  TYR A CD2 1 
ATOM   2624  C  CE1 . TYR A 1 331 ? 63.009 66.642  0.102   1.00 32.57  ? 331  TYR A CE1 1 
ATOM   2625  C  CE2 . TYR A 1 331 ? 62.908 64.691  1.457   1.00 32.79  ? 331  TYR A CE2 1 
ATOM   2626  C  CZ  . TYR A 1 331 ? 63.639 65.624  0.775   1.00 32.30  ? 331  TYR A CZ  1 
ATOM   2627  O  OH  . TYR A 1 331 ? 65.005 65.529  0.765   1.00 31.89  ? 331  TYR A OH  1 
ATOM   2628  N  N   . GLU A 1 332 ? 56.443 64.510  -0.302  1.00 35.67  ? 332  GLU A N   1 
ATOM   2629  C  CA  . GLU A 1 332 ? 54.990 64.608  -0.213  1.00 36.13  ? 332  GLU A CA  1 
ATOM   2630  C  C   . GLU A 1 332 ? 54.524 64.259  1.192   1.00 36.12  ? 332  GLU A C   1 
ATOM   2631  O  O   . GLU A 1 332 ? 53.345 64.025  1.436   1.00 36.37  ? 332  GLU A O   1 
ATOM   2632  C  CB  . GLU A 1 332 ? 54.314 63.699  -1.235  1.00 36.26  ? 332  GLU A CB  1 
ATOM   2633  C  CG  . GLU A 1 332 ? 55.157 63.387  -2.457  1.00 37.92  ? 332  GLU A CG  1 
ATOM   2634  C  CD  . GLU A 1 332 ? 56.102 62.204  -2.238  1.00 40.79  ? 332  GLU A CD  1 
ATOM   2635  O  OE1 . GLU A 1 332 ? 56.575 61.998  -1.082  1.00 41.33  ? 332  GLU A OE1 1 
ATOM   2636  O  OE2 . GLU A 1 332 ? 56.380 61.476  -3.229  1.00 41.23  ? 332  GLU A OE2 1 
ATOM   2637  N  N   . SER A 1 333 ? 55.464 64.242  2.121   1.00 36.20  ? 333  SER A N   1 
ATOM   2638  C  CA  . SER A 1 333 ? 55.172 63.926  3.506   1.00 36.13  ? 333  SER A CA  1 
ATOM   2639  C  C   . SER A 1 333 ? 56.205 64.599  4.397   1.00 35.97  ? 333  SER A C   1 
ATOM   2640  O  O   . SER A 1 333 ? 57.313 64.885  3.951   1.00 35.97  ? 333  SER A O   1 
ATOM   2641  C  CB  . SER A 1 333 ? 55.236 62.419  3.700   1.00 36.16  ? 333  SER A CB  1 
ATOM   2642  O  OG  . SER A 1 333 ? 55.832 62.096  4.944   1.00 36.95  ? 333  SER A OG  1 
ATOM   2643  N  N   . CYS A 1 334 ? 55.849 64.856  5.650   1.00 35.68  ? 334  CYS A N   1 
ATOM   2644  C  CA  . CYS A 1 334 ? 56.811 65.412  6.588   1.00 35.72  ? 334  CYS A CA  1 
ATOM   2645  C  C   . CYS A 1 334 ? 58.086 64.618  6.497   1.00 35.07  ? 334  CYS A C   1 
ATOM   2646  O  O   . CYS A 1 334 ? 58.059 63.394  6.350   1.00 35.22  ? 334  CYS A O   1 
ATOM   2647  C  CB  . CYS A 1 334 ? 56.316 65.277  8.017   1.00 36.10  ? 334  CYS A CB  1 
ATOM   2648  S  SG  . CYS A 1 334 ? 54.804 66.157  8.363   1.00 38.48  ? 334  CYS A SG  1 
ATOM   2649  N  N   . THR A 1 335 ? 59.209 65.303  6.624   1.00 34.35  ? 335  THR A N   1 
ATOM   2650  C  CA  . THR A 1 335 ? 60.480 64.624  6.552   1.00 33.76  ? 335  THR A CA  1 
ATOM   2651  C  C   . THR A 1 335 ? 61.328 65.029  7.714   1.00 33.91  ? 335  THR A C   1 
ATOM   2652  O  O   . THR A 1 335 ? 60.923 65.844  8.534   1.00 34.54  ? 335  THR A O   1 
ATOM   2653  C  CB  . THR A 1 335 ? 61.205 65.034  5.296   1.00 33.38  ? 335  THR A CB  1 
ATOM   2654  O  OG1 . THR A 1 335 ? 62.477 64.398  5.275   1.00 33.20  ? 335  THR A OG1 1 
ATOM   2655  C  CG2 . THR A 1 335 ? 61.571 66.479  5.379   1.00 32.83  ? 335  THR A CG2 1 
ATOM   2656  N  N   . SER A 1 336 ? 62.514 64.445  7.784   1.00 33.79  ? 336  SER A N   1 
ATOM   2657  C  CA  . SER A 1 336 ? 63.504 64.842  8.762   1.00 33.35  ? 336  SER A CA  1 
ATOM   2658  C  C   . SER A 1 336 ? 64.715 65.309  7.969   1.00 33.18  ? 336  SER A C   1 
ATOM   2659  O  O   . SER A 1 336 ? 65.790 65.514  8.515   1.00 33.33  ? 336  SER A O   1 
ATOM   2660  C  CB  . SER A 1 336 ? 63.867 63.677  9.665   1.00 33.24  ? 336  SER A CB  1 
ATOM   2661  O  OG  . SER A 1 336 ? 64.904 64.045  10.550  1.00 33.48  ? 336  SER A OG  1 
ATOM   2662  N  N   . ALA A 1 337 ? 64.528 65.465  6.663   1.00 32.98  ? 337  ALA A N   1 
ATOM   2663  C  CA  . ALA A 1 337 ? 65.602 65.908  5.793   1.00 32.89  ? 337  ALA A CA  1 
ATOM   2664  C  C   . ALA A 1 337 ? 66.156 67.200  6.348   1.00 32.99  ? 337  ALA A C   1 
ATOM   2665  O  O   . ALA A 1 337 ? 65.401 68.060  6.804   1.00 33.08  ? 337  ALA A O   1 
ATOM   2666  C  CB  . ALA A 1 337 ? 65.104 66.111  4.371   1.00 32.69  ? 337  ALA A CB  1 
ATOM   2667  N  N   . GLY A 1 338 ? 67.476 67.328  6.330   1.00 32.95  ? 338  GLY A N   1 
ATOM   2668  C  CA  . GLY A 1 338 ? 68.115 68.525  6.829   1.00 32.82  ? 338  GLY A CA  1 
ATOM   2669  C  C   . GLY A 1 338 ? 68.236 68.547  8.338   1.00 32.90  ? 338  GLY A C   1 
ATOM   2670  O  O   . GLY A 1 338 ? 68.950 69.380  8.889   1.00 33.13  ? 338  GLY A O   1 
ATOM   2671  N  N   . ARG A 1 339 ? 67.545 67.642  9.022   1.00 32.72  ? 339  ARG A N   1 
ATOM   2672  C  CA  . ARG A 1 339 ? 67.623 67.609  10.474  1.00 32.54  ? 339  ARG A CA  1 
ATOM   2673  C  C   . ARG A 1 339 ? 68.468 66.450  10.963  1.00 32.92  ? 339  ARG A C   1 
ATOM   2674  O  O   . ARG A 1 339 ? 68.428 65.363  10.392  1.00 33.01  ? 339  ARG A O   1 
ATOM   2675  C  CB  . ARG A 1 339 ? 66.237 67.522  11.097  1.00 32.37  ? 339  ARG A CB  1 
ATOM   2676  C  CG  . ARG A 1 339 ? 65.468 68.814  11.088  1.00 31.23  ? 339  ARG A CG  1 
ATOM   2677  C  CD  . ARG A 1 339 ? 64.515 68.942  12.249  1.00 30.45  ? 339  ARG A CD  1 
ATOM   2678  N  NE  . ARG A 1 339 ? 65.165 69.521  13.417  1.00 29.84  ? 339  ARG A NE  1 
ATOM   2679  C  CZ  . ARG A 1 339 ? 65.342 70.822  13.586  1.00 29.35  ? 339  ARG A CZ  1 
ATOM   2680  N  NH1 . ARG A 1 339 ? 64.911 71.670  12.667  1.00 29.23  ? 339  ARG A NH1 1 
ATOM   2681  N  NH2 . ARG A 1 339 ? 65.945 71.280  14.670  1.00 29.50  ? 339  ARG A NH2 1 
ATOM   2682  N  N   . SER A 1 340 ? 69.233 66.688  12.026  1.00 33.28  ? 340  SER A N   1 
ATOM   2683  C  CA  . SER A 1 340 ? 70.068 65.648  12.615  1.00 33.27  ? 340  SER A CA  1 
ATOM   2684  C  C   . SER A 1 340 ? 69.446 65.152  13.919  1.00 33.59  ? 340  SER A C   1 
ATOM   2685  O  O   . SER A 1 340 ? 69.832 64.110  14.442  1.00 33.96  ? 340  SER A O   1 
ATOM   2686  C  CB  . SER A 1 340 ? 71.470 66.173  12.895  1.00 33.04  ? 340  SER A CB  1 
ATOM   2687  O  OG  . SER A 1 340 ? 71.671 66.366  14.283  1.00 32.36  ? 340  SER A OG  1 
ATOM   2688  N  N   . ASP A 1 341 ? 68.477 65.896  14.439  1.00 33.50  ? 341  ASP A N   1 
ATOM   2689  C  CA  . ASP A 1 341 ? 67.857 65.539  15.702  1.00 33.43  ? 341  ASP A CA  1 
ATOM   2690  C  C   . ASP A 1 341 ? 66.573 64.741  15.539  1.00 33.54  ? 341  ASP A C   1 
ATOM   2691  O  O   . ASP A 1 341 ? 65.810 64.584  16.495  1.00 33.42  ? 341  ASP A O   1 
ATOM   2692  C  CB  . ASP A 1 341 ? 67.574 66.798  16.514  1.00 33.59  ? 341  ASP A CB  1 
ATOM   2693  C  CG  . ASP A 1 341 ? 66.777 67.827  15.739  1.00 33.26  ? 341  ASP A CG  1 
ATOM   2694  O  OD1 . ASP A 1 341 ? 66.028 67.445  14.816  1.00 33.16  ? 341  ASP A OD1 1 
ATOM   2695  O  OD2 . ASP A 1 341 ? 66.833 69.045  15.989  1.00 32.88  ? 341  ASP A OD2 1 
ATOM   2696  N  N   . GLY A 1 342 ? 66.323 64.254  14.328  1.00 33.63  ? 342  GLY A N   1 
ATOM   2697  C  CA  . GLY A 1 342 ? 65.141 63.451  14.063  1.00 33.54  ? 342  GLY A CA  1 
ATOM   2698  C  C   . GLY A 1 342 ? 63.817 64.195  14.013  1.00 33.55  ? 342  GLY A C   1 
ATOM   2699  O  O   . GLY A 1 342 ? 62.855 63.682  13.458  1.00 33.46  ? 342  GLY A O   1 
ATOM   2700  N  N   . LYS A 1 343 ? 63.750 65.392  14.590  1.00 33.69  ? 343  LYS A N   1 
ATOM   2701  C  CA  . LYS A 1 343 ? 62.508 66.160  14.557  1.00 33.83  ? 343  LYS A CA  1 
ATOM   2702  C  C   . LYS A 1 343 ? 61.974 66.197  13.125  1.00 33.71  ? 343  LYS A C   1 
ATOM   2703  O  O   . LYS A 1 343 ? 62.748 66.219  12.168  1.00 33.62  ? 343  LYS A O   1 
ATOM   2704  C  CB  . LYS A 1 343 ? 62.712 67.577  15.098  1.00 34.05  ? 343  LYS A CB  1 
ATOM   2705  C  CG  . LYS A 1 343 ? 62.588 67.699  16.608  1.00 34.40  ? 343  LYS A CG  1 
ATOM   2706  C  CD  . LYS A 1 343 ? 63.802 68.416  17.191  1.00 36.26  ? 343  LYS A CD  1 
ATOM   2707  C  CE  . LYS A 1 343 ? 63.385 69.602  18.020  1.00 36.57  ? 343  LYS A CE  1 
ATOM   2708  N  NZ  . LYS A 1 343 ? 61.905 69.639  18.009  1.00 38.00  ? 343  LYS A NZ  1 
ATOM   2709  N  N   . MET A 1 344 ? 60.650 66.202  12.989  1.00 33.59  ? 344  MET A N   1 
ATOM   2710  C  CA  . MET A 1 344 ? 59.994 66.131  11.684  1.00 33.30  ? 344  MET A CA  1 
ATOM   2711  C  C   . MET A 1 344 ? 59.392 67.456  11.247  1.00 33.24  ? 344  MET A C   1 
ATOM   2712  O  O   . MET A 1 344 ? 58.567 68.045  11.946  1.00 33.31  ? 344  MET A O   1 
ATOM   2713  C  CB  . MET A 1 344 ? 58.900 65.068  11.714  1.00 33.23  ? 344  MET A CB  1 
ATOM   2714  C  CG  . MET A 1 344 ? 59.379 63.710  12.138  1.00 32.93  ? 344  MET A CG  1 
ATOM   2715  S  SD  . MET A 1 344 ? 59.748 62.728  10.699  1.00 33.38  ? 344  MET A SD  1 
ATOM   2716  C  CE  . MET A 1 344 ? 58.092 62.189  10.261  1.00 33.57  ? 344  MET A CE  1 
ATOM   2717  N  N   . TRP A 1 345 ? 59.789 67.911  10.068  1.00 33.12  ? 345  TRP A N   1 
ATOM   2718  C  CA  . TRP A 1 345 ? 59.318 69.185  9.557   1.00 32.85  ? 345  TRP A CA  1 
ATOM   2719  C  C   . TRP A 1 345 ? 58.730 69.032  8.170   1.00 33.31  ? 345  TRP A C   1 
ATOM   2720  O  O   . TRP A 1 345 ? 58.781 67.959  7.560   1.00 33.34  ? 345  TRP A O   1 
ATOM   2721  C  CB  . TRP A 1 345 ? 60.479 70.169  9.480   1.00 32.61  ? 345  TRP A CB  1 
ATOM   2722  C  CG  . TRP A 1 345 ? 61.497 69.771  8.477   1.00 30.36  ? 345  TRP A CG  1 
ATOM   2723  C  CD1 . TRP A 1 345 ? 62.427 68.790  8.602   1.00 29.12  ? 345  TRP A CD1 1 
ATOM   2724  C  CD2 . TRP A 1 345 ? 61.683 70.337  7.179   1.00 28.79  ? 345  TRP A CD2 1 
ATOM   2725  N  NE1 . TRP A 1 345 ? 63.192 68.711  7.464   1.00 28.65  ? 345  TRP A NE1 1 
ATOM   2726  C  CE2 . TRP A 1 345 ? 62.754 69.653  6.572   1.00 28.21  ? 345  TRP A CE2 1 
ATOM   2727  C  CE3 . TRP A 1 345 ? 61.056 71.364  6.467   1.00 27.67  ? 345  TRP A CE3 1 
ATOM   2728  C  CZ2 . TRP A 1 345 ? 63.203 69.954  5.297   1.00 26.97  ? 345  TRP A CZ2 1 
ATOM   2729  C  CZ3 . TRP A 1 345 ? 61.499 71.660  5.209   1.00 26.97  ? 345  TRP A CZ3 1 
ATOM   2730  C  CH2 . TRP A 1 345 ? 62.562 70.953  4.630   1.00 27.43  ? 345  TRP A CH2 1 
ATOM   2731  N  N   . CYS A 1 346 ? 58.191 70.133  7.668   1.00 33.49  ? 346  CYS A N   1 
ATOM   2732  C  CA  . CYS A 1 346 ? 57.609 70.155  6.347   1.00 33.56  ? 346  CYS A CA  1 
ATOM   2733  C  C   . CYS A 1 346 ? 57.685 71.583  5.886   1.00 33.19  ? 346  CYS A C   1 
ATOM   2734  O  O   . CYS A 1 346 ? 58.020 72.469  6.663   1.00 33.08  ? 346  CYS A O   1 
ATOM   2735  C  CB  . CYS A 1 346 ? 56.162 69.780  6.441   1.00 33.83  ? 346  CYS A CB  1 
ATOM   2736  S  SG  . CYS A 1 346 ? 55.242 71.158  7.124   1.00 35.31  ? 346  CYS A SG  1 
ATOM   2737  N  N   . ALA A 1 347 ? 57.361 71.817  4.625   1.00 32.99  ? 347  ALA A N   1 
ATOM   2738  C  CA  . ALA A 1 347 ? 57.469 73.162  4.079   1.00 32.72  ? 347  ALA A CA  1 
ATOM   2739  C  C   . ALA A 1 347 ? 56.115 73.848  4.030   1.00 32.50  ? 347  ALA A C   1 
ATOM   2740  O  O   . ALA A 1 347 ? 55.087 73.202  3.856   1.00 32.37  ? 347  ALA A O   1 
ATOM   2741  C  CB  . ALA A 1 347 ? 58.116 73.124  2.701   1.00 32.54  ? 347  ALA A CB  1 
ATOM   2742  N  N   . THR A 1 348 ? 56.115 75.162  4.194   1.00 32.47  ? 348  THR A N   1 
ATOM   2743  C  CA  . THR A 1 348 ? 54.864 75.909  4.171   1.00 32.43  ? 348  THR A CA  1 
ATOM   2744  C  C   . THR A 1 348 ? 54.613 76.554  2.801   1.00 32.80  ? 348  THR A C   1 
ATOM   2745  O  O   . THR A 1 348 ? 53.681 77.347  2.635   1.00 33.02  ? 348  THR A O   1 
ATOM   2746  C  CB  . THR A 1 348 ? 54.828 76.932  5.310   1.00 32.24  ? 348  THR A CB  1 
ATOM   2747  O  OG1 . THR A 1 348 ? 56.119 77.526  5.459   1.00 31.43  ? 348  THR A OG1 1 
ATOM   2748  C  CG2 . THR A 1 348 ? 54.647 76.221  6.625   1.00 31.73  ? 348  THR A CG2 1 
ATOM   2749  N  N   . THR A 1 349 ? 55.462 76.202  1.833   1.00 32.66  ? 349  THR A N   1 
ATOM   2750  C  CA  . THR A 1 349 ? 55.306 76.598  0.440   1.00 32.52  ? 349  THR A CA  1 
ATOM   2751  C  C   . THR A 1 349 ? 55.870 75.445  -0.362  1.00 32.38  ? 349  THR A C   1 
ATOM   2752  O  O   . THR A 1 349 ? 56.674 74.683  0.145   1.00 32.37  ? 349  THR A O   1 
ATOM   2753  C  CB  . THR A 1 349 ? 56.087 77.875  0.124   1.00 32.73  ? 349  THR A CB  1 
ATOM   2754  O  OG1 . THR A 1 349 ? 57.253 77.556  -0.653  1.00 32.98  ? 349  THR A OG1 1 
ATOM   2755  C  CG2 . THR A 1 349 ? 56.637 78.494  1.394   1.00 32.80  ? 349  THR A CG2 1 
ATOM   2756  N  N   . ALA A 1 350 ? 55.477 75.317  -1.618  1.00 32.48  ? 350  ALA A N   1 
ATOM   2757  C  CA  . ALA A 1 350 ? 55.913 74.177  -2.421  1.00 32.51  ? 350  ALA A CA  1 
ATOM   2758  C  C   . ALA A 1 350 ? 57.430 74.077  -2.617  1.00 32.70  ? 350  ALA A C   1 
ATOM   2759  O  O   . ALA A 1 350 ? 57.932 73.100  -3.184  1.00 33.05  ? 350  ALA A O   1 
ATOM   2760  C  CB  . ALA A 1 350 ? 55.198 74.174  -3.766  1.00 32.33  ? 350  ALA A CB  1 
ATOM   2761  N  N   . ASN A 1 351 ? 58.175 75.067  -2.149  1.00 32.48  ? 351  ASN A N   1 
ATOM   2762  C  CA  . ASN A 1 351 ? 59.610 75.025  -2.378  1.00 32.41  ? 351  ASN A CA  1 
ATOM   2763  C  C   . ASN A 1 351 ? 60.402 75.721  -1.282  1.00 32.38  ? 351  ASN A C   1 
ATOM   2764  O  O   . ASN A 1 351 ? 60.460 76.954  -1.234  1.00 32.61  ? 351  ASN A O   1 
ATOM   2765  C  CB  . ASN A 1 351 ? 59.931 75.626  -3.757  1.00 32.42  ? 351  ASN A CB  1 
ATOM   2766  C  CG  . ASN A 1 351 ? 61.403 75.526  -4.124  1.00 32.07  ? 351  ASN A CG  1 
ATOM   2767  O  OD1 . ASN A 1 351 ? 62.278 75.874  -3.339  1.00 32.10  ? 351  ASN A OD1 1 
ATOM   2768  N  ND2 . ASN A 1 351 ? 61.676 75.062  -5.335  1.00 31.72  ? 351  ASN A ND2 1 
ATOM   2769  N  N   . TYR A 1 352 ? 61.019 74.931  -0.409  1.00 31.99  ? 352  TYR A N   1 
ATOM   2770  C  CA  . TYR A 1 352 ? 61.822 75.491  0.665   1.00 31.80  ? 352  TYR A CA  1 
ATOM   2771  C  C   . TYR A 1 352 ? 63.068 76.188  0.121   1.00 31.75  ? 352  TYR A C   1 
ATOM   2772  O  O   . TYR A 1 352 ? 63.465 77.249  0.596   1.00 31.85  ? 352  TYR A O   1 
ATOM   2773  C  CB  . TYR A 1 352 ? 62.228 74.414  1.656   1.00 31.59  ? 352  TYR A CB  1 
ATOM   2774  C  CG  . TYR A 1 352 ? 63.097 74.941  2.773   1.00 31.85  ? 352  TYR A CG  1 
ATOM   2775  C  CD1 . TYR A 1 352 ? 64.453 75.147  2.580   1.00 31.24  ? 352  TYR A CD1 1 
ATOM   2776  C  CD2 . TYR A 1 352 ? 62.557 75.244  4.024   1.00 31.91  ? 352  TYR A CD2 1 
ATOM   2777  C  CE1 . TYR A 1 352 ? 65.245 75.630  3.587   1.00 31.65  ? 352  TYR A CE1 1 
ATOM   2778  C  CE2 . TYR A 1 352 ? 63.349 75.728  5.040   1.00 31.71  ? 352  TYR A CE2 1 
ATOM   2779  C  CZ  . TYR A 1 352 ? 64.693 75.919  4.809   1.00 31.98  ? 352  TYR A CZ  1 
ATOM   2780  O  OH  . TYR A 1 352 ? 65.505 76.396  5.804   1.00 33.26  ? 352  TYR A OH  1 
ATOM   2781  N  N   . ASP A 1 353 ? 63.688 75.589  -0.879  1.00 31.66  ? 353  ASP A N   1 
ATOM   2782  C  CA  . ASP A 1 353 ? 64.877 76.181  -1.454  1.00 31.68  ? 353  ASP A CA  1 
ATOM   2783  C  C   . ASP A 1 353 ? 64.685 77.672  -1.739  1.00 32.03  ? 353  ASP A C   1 
ATOM   2784  O  O   . ASP A 1 353 ? 65.516 78.494  -1.364  1.00 31.83  ? 353  ASP A O   1 
ATOM   2785  C  CB  . ASP A 1 353 ? 65.267 75.428  -2.719  1.00 31.46  ? 353  ASP A CB  1 
ATOM   2786  C  CG  . ASP A 1 353 ? 65.734 74.021  -2.430  1.00 30.59  ? 353  ASP A CG  1 
ATOM   2787  O  OD1 . ASP A 1 353 ? 65.592 73.565  -1.282  1.00 28.67  ? 353  ASP A OD1 1 
ATOM   2788  O  OD2 . ASP A 1 353 ? 66.271 73.299  -3.291  1.00 31.11  ? 353  ASP A OD2 1 
ATOM   2789  N  N   . ASP A 1 354 ? 63.571 78.017  -2.373  1.00 32.59  ? 354  ASP A N   1 
ATOM   2790  C  CA  . ASP A 1 354 ? 63.308 79.396  -2.752  1.00 33.15  ? 354  ASP A CA  1 
ATOM   2791  C  C   . ASP A 1 354 ? 62.724 80.247  -1.640  1.00 33.43  ? 354  ASP A C   1 
ATOM   2792  O  O   . ASP A 1 354 ? 62.982 81.447  -1.580  1.00 33.70  ? 354  ASP A O   1 
ATOM   2793  C  CB  . ASP A 1 354 ? 62.351 79.442  -3.933  1.00 33.35  ? 354  ASP A CB  1 
ATOM   2794  C  CG  . ASP A 1 354 ? 62.778 78.539  -5.056  1.00 34.37  ? 354  ASP A CG  1 
ATOM   2795  O  OD1 . ASP A 1 354 ? 63.999 78.321  -5.204  1.00 35.38  ? 354  ASP A OD1 1 
ATOM   2796  O  OD2 . ASP A 1 354 ? 61.966 78.001  -5.840  1.00 35.65  ? 354  ASP A OD2 1 
ATOM   2797  N  N   . ASP A 1 355 ? 61.934 79.647  -0.759  1.00 33.60  ? 355  ASP A N   1 
ATOM   2798  C  CA  . ASP A 1 355 ? 61.255 80.450  0.251   1.00 33.73  ? 355  ASP A CA  1 
ATOM   2799  C  C   . ASP A 1 355 ? 61.762 80.315  1.674   1.00 33.67  ? 355  ASP A C   1 
ATOM   2800  O  O   . ASP A 1 355 ? 61.545 81.206  2.484   1.00 34.13  ? 355  ASP A O   1 
ATOM   2801  C  CB  . ASP A 1 355 ? 59.750 80.180  0.231   1.00 33.90  ? 355  ASP A CB  1 
ATOM   2802  C  CG  . ASP A 1 355 ? 59.139 80.391  -1.136  1.00 34.11  ? 355  ASP A CG  1 
ATOM   2803  O  OD1 . ASP A 1 355 ? 59.617 81.291  -1.870  1.00 33.79  ? 355  ASP A OD1 1 
ATOM   2804  O  OD2 . ASP A 1 355 ? 58.178 79.701  -1.552  1.00 33.99  ? 355  ASP A OD2 1 
ATOM   2805  N  N   . ARG A 1 356 ? 62.417 79.211  1.992   1.00 33.41  ? 356  ARG A N   1 
ATOM   2806  C  CA  . ARG A 1 356 ? 62.877 78.999  3.358   1.00 33.40  ? 356  ARG A CA  1 
ATOM   2807  C  C   . ARG A 1 356 ? 61.730 79.220  4.343   1.00 33.37  ? 356  ARG A C   1 
ATOM   2808  O  O   . ARG A 1 356 ? 61.874 79.906  5.354   1.00 33.26  ? 356  ARG A O   1 
ATOM   2809  C  CB  . ARG A 1 356 ? 64.024 79.936  3.682   1.00 33.14  ? 356  ARG A CB  1 
ATOM   2810  C  CG  . ARG A 1 356 ? 64.971 80.108  2.541   1.00 33.69  ? 356  ARG A CG  1 
ATOM   2811  C  CD  . ARG A 1 356 ? 66.116 79.105  2.472   1.00 33.97  ? 356  ARG A CD  1 
ATOM   2812  N  NE  . ARG A 1 356 ? 67.022 79.500  1.401   1.00 34.22  ? 356  ARG A NE  1 
ATOM   2813  C  CZ  . ARG A 1 356 ? 67.882 78.703  0.799   1.00 35.89  ? 356  ARG A CZ  1 
ATOM   2814  N  NH1 . ARG A 1 356 ? 67.998 77.425  1.150   1.00 37.51  ? 356  ARG A NH1 1 
ATOM   2815  N  NH2 . ARG A 1 356 ? 68.641 79.190  -0.167  1.00 37.04  ? 356  ARG A NH2 1 
ATOM   2816  N  N   . LYS A 1 357 ? 60.574 78.660  4.030   1.00 33.35  ? 357  LYS A N   1 
ATOM   2817  C  CA  . LYS A 1 357 ? 59.454 78.772  4.936   1.00 33.53  ? 357  LYS A CA  1 
ATOM   2818  C  C   . LYS A 1 357 ? 59.088 77.355  5.311   1.00 33.59  ? 357  LYS A C   1 
ATOM   2819  O  O   . LYS A 1 357 ? 58.698 76.551  4.457   1.00 33.73  ? 357  LYS A O   1 
ATOM   2820  C  CB  . LYS A 1 357 ? 58.265 79.491  4.289   1.00 33.68  ? 357  LYS A CB  1 
ATOM   2821  C  CG  . LYS A 1 357 ? 58.583 80.858  3.699   1.00 33.65  ? 357  LYS A CG  1 
ATOM   2822  C  CD  . LYS A 1 357 ? 59.260 81.763  4.709   1.00 34.26  ? 357  LYS A CD  1 
ATOM   2823  C  CE  . LYS A 1 357 ? 58.258 82.609  5.472   1.00 33.94  ? 357  LYS A CE  1 
ATOM   2824  N  NZ  . LYS A 1 357 ? 57.363 81.787  6.298   1.00 33.76  ? 357  LYS A NZ  1 
ATOM   2825  N  N   . TRP A 1 358 ? 59.216 77.060  6.597   1.00 33.40  ? 358  TRP A N   1 
ATOM   2826  C  CA  . TRP A 1 358 ? 58.987 75.728  7.101   1.00 33.20  ? 358  TRP A CA  1 
ATOM   2827  C  C   . TRP A 1 358 ? 58.379 75.810  8.475   1.00 33.36  ? 358  TRP A C   1 
ATOM   2828  O  O   . TRP A 1 358 ? 58.200 76.889  9.028   1.00 33.55  ? 358  TRP A O   1 
ATOM   2829  C  CB  . TRP A 1 358 ? 60.328 75.041  7.252   1.00 33.25  ? 358  TRP A CB  1 
ATOM   2830  C  CG  . TRP A 1 358 ? 61.165 75.739  8.263   1.00 32.35  ? 358  TRP A CG  1 
ATOM   2831  C  CD1 . TRP A 1 358 ? 61.782 76.929  8.114   1.00 31.95  ? 358  TRP A CD1 1 
ATOM   2832  C  CD2 . TRP A 1 358 ? 61.453 75.302  9.590   1.00 32.00  ? 358  TRP A CD2 1 
ATOM   2833  N  NE1 . TRP A 1 358 ? 62.450 77.266  9.264   1.00 31.81  ? 358  TRP A NE1 1 
ATOM   2834  C  CE2 . TRP A 1 358 ? 62.264 76.276  10.186  1.00 31.69  ? 358  TRP A CE2 1 
ATOM   2835  C  CE3 . TRP A 1 358 ? 61.111 74.176  10.337  1.00 32.90  ? 358  TRP A CE3 1 
ATOM   2836  C  CZ2 . TRP A 1 358 ? 62.734 76.166  11.482  1.00 32.33  ? 358  TRP A CZ2 1 
ATOM   2837  C  CZ3 . TRP A 1 358 ? 61.576 74.068  11.623  1.00 33.41  ? 358  TRP A CZ3 1 
ATOM   2838  C  CH2 . TRP A 1 358 ? 62.375 75.057  12.186  1.00 33.26  ? 358  TRP A CH2 1 
ATOM   2839  N  N   . GLY A 1 359 ? 58.102 74.642  9.035   1.00 33.51  ? 359  GLY A N   1 
ATOM   2840  C  CA  . GLY A 1 359 ? 57.556 74.516  10.368  1.00 33.68  ? 359  GLY A CA  1 
ATOM   2841  C  C   . GLY A 1 359 ? 57.801 73.106  10.860  1.00 33.86  ? 359  GLY A C   1 
ATOM   2842  O  O   . GLY A 1 359 ? 58.469 72.310  10.188  1.00 33.78  ? 359  GLY A O   1 
ATOM   2843  N  N   . PHE A 1 360 ? 57.284 72.793  12.040  1.00 33.92  ? 360  PHE A N   1 
ATOM   2844  C  CA  . PHE A 1 360 ? 57.388 71.439  12.550  1.00 34.08  ? 360  PHE A CA  1 
ATOM   2845  C  C   . PHE A 1 360 ? 56.020 70.822  12.419  1.00 34.30  ? 360  PHE A C   1 
ATOM   2846  O  O   . PHE A 1 360 ? 55.025 71.511  12.604  1.00 34.78  ? 360  PHE A O   1 
ATOM   2847  C  CB  . PHE A 1 360 ? 57.820 71.437  14.000  1.00 33.84  ? 360  PHE A CB  1 
ATOM   2848  C  CG  . PHE A 1 360 ? 59.266 71.693  14.179  1.00 33.88  ? 360  PHE A CG  1 
ATOM   2849  C  CD1 . PHE A 1 360 ? 60.171 70.658  14.087  1.00 34.25  ? 360  PHE A CD1 1 
ATOM   2850  C  CD2 . PHE A 1 360 ? 59.728 72.970  14.422  1.00 34.45  ? 360  PHE A CD2 1 
ATOM   2851  C  CE1 . PHE A 1 360 ? 61.509 70.880  14.243  1.00 34.86  ? 360  PHE A CE1 1 
ATOM   2852  C  CE2 . PHE A 1 360 ? 61.064 73.208  14.586  1.00 35.02  ? 360  PHE A CE2 1 
ATOM   2853  C  CZ  . PHE A 1 360 ? 61.961 72.158  14.494  1.00 36.03  ? 360  PHE A CZ  1 
ATOM   2854  N  N   . CYS A 1 361 ? 55.967 69.554  12.034  1.00 34.19  ? 361  CYS A N   1 
ATOM   2855  C  CA  . CYS A 1 361 ? 54.708 68.858  11.952  1.00 34.36  ? 361  CYS A CA  1 
ATOM   2856  C  C   . CYS A 1 361 ? 54.508 68.541  13.398  1.00 33.79  ? 361  CYS A C   1 
ATOM   2857  O  O   . CYS A 1 361 ? 55.421 68.043  14.033  1.00 34.31  ? 361  CYS A O   1 
ATOM   2858  C  CB  . CYS A 1 361 ? 54.862 67.580  11.140  1.00 34.83  ? 361  CYS A CB  1 
ATOM   2859  S  SG  . CYS A 1 361 ? 55.276 67.840  9.384   1.00 38.38  ? 361  CYS A SG  1 
ATOM   2860  N  N   . PRO A 1 362 ? 53.338 68.828  13.940  1.00 33.20  ? 362  PRO A N   1 
ATOM   2861  C  CA  . PRO A 1 362 ? 53.126 68.691  15.372  1.00 33.01  ? 362  PRO A CA  1 
ATOM   2862  C  C   . PRO A 1 362 ? 53.184 67.247  15.759  1.00 33.01  ? 362  PRO A C   1 
ATOM   2863  O  O   . PRO A 1 362 ? 52.485 66.455  15.140  1.00 32.90  ? 362  PRO A O   1 
ATOM   2864  C  CB  . PRO A 1 362 ? 51.705 69.217  15.562  1.00 33.06  ? 362  PRO A CB  1 
ATOM   2865  C  CG  . PRO A 1 362 ? 51.429 69.990  14.361  1.00 33.05  ? 362  PRO A CG  1 
ATOM   2866  C  CD  . PRO A 1 362 ? 52.123 69.266  13.250  1.00 33.30  ? 362  PRO A CD  1 
ATOM   2867  N  N   . ASP A 1 363 ? 54.016 66.909  16.740  1.00 33.22  ? 363  ASP A N   1 
ATOM   2868  C  CA  . ASP A 1 363 ? 54.067 65.544  17.251  1.00 33.52  ? 363  ASP A CA  1 
ATOM   2869  C  C   . ASP A 1 363 ? 53.031 65.355  18.341  1.00 33.45  ? 363  ASP A C   1 
ATOM   2870  O  O   . ASP A 1 363 ? 51.933 65.905  18.270  1.00 33.81  ? 363  ASP A O   1 
ATOM   2871  C  CB  . ASP A 1 363 ? 55.442 65.195  17.803  1.00 33.76  ? 363  ASP A CB  1 
ATOM   2872  C  CG  . ASP A 1 363 ? 55.847 66.072  18.967  1.00 34.68  ? 363  ASP A CG  1 
ATOM   2873  O  OD1 . ASP A 1 363 ? 55.048 66.821  19.582  1.00 34.57  ? 363  ASP A OD1 1 
ATOM   2874  O  OD2 . ASP A 1 363 ? 57.050 66.036  19.320  1.00 35.92  ? 363  ASP A OD2 1 
ATOM   2875  N  N   . GLN A 1 364 ? 53.390 64.597  19.364  1.00 33.19  ? 364  GLN A N   1 
ATOM   2876  C  CA  . GLN A 1 364 ? 52.448 64.291  20.422  1.00 33.26  ? 364  GLN A CA  1 
ATOM   2877  C  C   . GLN A 1 364 ? 52.368 65.396  21.476  1.00 33.07  ? 364  GLN A C   1 
ATOM   2878  O  O   . GLN A 1 364 ? 51.366 65.509  22.178  1.00 33.01  ? 364  GLN A O   1 
ATOM   2879  C  CB  . GLN A 1 364 ? 52.830 62.964  21.071  1.00 33.42  ? 364  GLN A CB  1 
ATOM   2880  C  CG  . GLN A 1 364 ? 51.722 61.932  21.070  1.00 34.92  ? 364  GLN A CG  1 
ATOM   2881  C  CD  . GLN A 1 364 ? 51.245 61.611  19.669  1.00 37.29  ? 364  GLN A CD  1 
ATOM   2882  O  OE1 . GLN A 1 364 ? 51.993 61.791  18.709  1.00 38.66  ? 364  GLN A OE1 1 
ATOM   2883  N  NE2 . GLN A 1 364 ? 50.000 61.140  19.543  1.00 37.91  ? 364  GLN A NE2 1 
ATOM   2884  N  N   . GLY A 1 365 ? 53.420 66.208  21.578  1.00 32.81  ? 365  GLY A N   1 
ATOM   2885  C  CA  . GLY A 1 365 ? 53.485 67.270  22.568  1.00 32.52  ? 365  GLY A CA  1 
ATOM   2886  C  C   . GLY A 1 365 ? 53.769 66.759  23.972  1.00 32.43  ? 365  GLY A C   1 
ATOM   2887  O  O   . GLY A 1 365 ? 54.230 65.639  24.136  1.00 32.54  ? 365  GLY A O   1 
ATOM   2888  N  N   . TYR A 1 366 ? 53.492 67.577  24.987  1.00 32.35  ? 366  TYR A N   1 
ATOM   2889  C  CA  . TYR A 1 366 ? 53.707 67.191  26.387  1.00 32.19  ? 366  TYR A CA  1 
ATOM   2890  C  C   . TYR A 1 366 ? 52.482 67.460  27.252  1.00 32.30  ? 366  TYR A C   1 
ATOM   2891  O  O   . TYR A 1 366 ? 51.865 68.520  27.162  1.00 32.87  ? 366  TYR A O   1 
ATOM   2892  C  CB  . TYR A 1 366 ? 54.913 67.932  26.949  1.00 31.94  ? 366  TYR A CB  1 
ATOM   2893  C  CG  . TYR A 1 366 ? 56.141 67.634  26.152  1.00 31.53  ? 366  TYR A CG  1 
ATOM   2894  C  CD1 . TYR A 1 366 ? 56.604 66.335  26.040  1.00 30.79  ? 366  TYR A CD1 1 
ATOM   2895  C  CD2 . TYR A 1 366 ? 56.815 68.631  25.475  1.00 31.24  ? 366  TYR A CD2 1 
ATOM   2896  C  CE1 . TYR A 1 366 ? 57.714 66.037  25.298  1.00 30.44  ? 366  TYR A CE1 1 
ATOM   2897  C  CE2 . TYR A 1 366 ? 57.940 68.336  24.723  1.00 31.08  ? 366  TYR A CE2 1 
ATOM   2898  C  CZ  . TYR A 1 366 ? 58.380 67.035  24.642  1.00 30.09  ? 366  TYR A CZ  1 
ATOM   2899  O  OH  . TYR A 1 366 ? 59.487 66.723  23.901  1.00 29.15  ? 366  TYR A OH  1 
ATOM   2900  N  N   . SER A 1 367 ? 52.123 66.504  28.093  1.00 32.02  ? 367  SER A N   1 
ATOM   2901  C  CA  . SER A 1 367 ? 50.948 66.665  28.937  1.00 31.66  ? 367  SER A CA  1 
ATOM   2902  C  C   . SER A 1 367 ? 51.176 67.657  30.056  1.00 31.36  ? 367  SER A C   1 
ATOM   2903  O  O   . SER A 1 367 ? 51.996 67.412  30.942  1.00 31.27  ? 367  SER A O   1 
ATOM   2904  C  CB  . SER A 1 367 ? 50.541 65.325  29.553  1.00 31.87  ? 367  SER A CB  1 
ATOM   2905  O  OG  . SER A 1 367 ? 49.877 65.525  30.791  1.00 31.82  ? 367  SER A OG  1 
ATOM   2906  N  N   . LEU A 1 368 ? 50.438 68.765  30.023  1.00 31.06  ? 368  LEU A N   1 
ATOM   2907  C  CA  . LEU A 1 368 ? 50.496 69.745  31.098  1.00 30.78  ? 368  LEU A CA  1 
ATOM   2908  C  C   . LEU A 1 368 ? 50.130 69.011  32.365  1.00 30.99  ? 368  LEU A C   1 
ATOM   2909  O  O   . LEU A 1 368 ? 50.726 69.223  33.418  1.00 31.38  ? 368  LEU A O   1 
ATOM   2910  C  CB  . LEU A 1 368 ? 49.508 70.876  30.890  1.00 30.46  ? 368  LEU A CB  1 
ATOM   2911  C  CG  . LEU A 1 368 ? 49.940 72.132  31.629  1.00 30.33  ? 368  LEU A CG  1 
ATOM   2912  C  CD1 . LEU A 1 368 ? 51.295 72.554  31.105  1.00 32.00  ? 368  LEU A CD1 1 
ATOM   2913  C  CD2 . LEU A 1 368 ? 48.953 73.246  31.441  1.00 30.12  ? 368  LEU A CD2 1 
ATOM   2914  N  N   . PHE A 1 369 ? 49.148 68.128  32.275  1.00 30.78  ? 369  PHE A N   1 
ATOM   2915  C  CA  . PHE A 1 369 ? 48.812 67.368  33.453  1.00 30.66  ? 369  PHE A CA  1 
ATOM   2916  C  C   . PHE A 1 369 ? 50.077 66.814  34.101  1.00 30.36  ? 369  PHE A C   1 
ATOM   2917  O  O   . PHE A 1 369 ? 50.443 67.217  35.197  1.00 30.42  ? 369  PHE A O   1 
ATOM   2918  C  CB  . PHE A 1 369 ? 47.865 66.219  33.138  1.00 30.67  ? 369  PHE A CB  1 
ATOM   2919  C  CG  . PHE A 1 369 ? 47.626 65.316  34.319  1.00 31.36  ? 369  PHE A CG  1 
ATOM   2920  C  CD1 . PHE A 1 369 ? 47.101 65.826  35.496  1.00 31.11  ? 369  PHE A CD1 1 
ATOM   2921  C  CD2 . PHE A 1 369 ? 47.958 63.970  34.265  1.00 31.19  ? 369  PHE A CD2 1 
ATOM   2922  C  CE1 . PHE A 1 369 ? 46.891 65.014  36.573  1.00 31.11  ? 369  PHE A CE1 1 
ATOM   2923  C  CE2 . PHE A 1 369 ? 47.747 63.156  35.341  1.00 30.81  ? 369  PHE A CE2 1 
ATOM   2924  C  CZ  . PHE A 1 369 ? 47.213 63.678  36.496  1.00 31.46  ? 369  PHE A CZ  1 
ATOM   2925  N  N   . LEU A 1 370 ? 50.745 65.902  33.407  1.00 30.04  ? 370  LEU A N   1 
ATOM   2926  C  CA  . LEU A 1 370 ? 51.916 65.220  33.947  1.00 29.72  ? 370  LEU A CA  1 
ATOM   2927  C  C   . LEU A 1 370 ? 53.086 66.136  34.282  1.00 29.73  ? 370  LEU A C   1 
ATOM   2928  O  O   . LEU A 1 370 ? 53.651 66.060  35.374  1.00 29.53  ? 370  LEU A O   1 
ATOM   2929  C  CB  . LEU A 1 370 ? 52.397 64.149  32.972  1.00 29.65  ? 370  LEU A CB  1 
ATOM   2930  C  CG  . LEU A 1 370 ? 51.465 62.974  32.727  1.00 29.16  ? 370  LEU A CG  1 
ATOM   2931  C  CD1 . LEU A 1 370 ? 52.052 62.046  31.695  1.00 28.89  ? 370  LEU A CD1 1 
ATOM   2932  C  CD2 . LEU A 1 370 ? 51.249 62.247  34.018  1.00 29.45  ? 370  LEU A CD2 1 
ATOM   2933  N  N   . VAL A 1 371 ? 53.461 66.995  33.338  1.00 29.57  ? 371  VAL A N   1 
ATOM   2934  C  CA  . VAL A 1 371 ? 54.620 67.852  33.557  1.00 29.18  ? 371  VAL A CA  1 
ATOM   2935  C  C   . VAL A 1 371 ? 54.407 68.686  34.808  1.00 29.13  ? 371  VAL A C   1 
ATOM   2936  O  O   . VAL A 1 371 ? 55.317 68.845  35.608  1.00 29.38  ? 371  VAL A O   1 
ATOM   2937  C  CB  . VAL A 1 371 ? 54.973 68.707  32.324  1.00 28.97  ? 371  VAL A CB  1 
ATOM   2938  C  CG1 . VAL A 1 371 ? 56.069 69.688  32.653  1.00 28.99  ? 371  VAL A CG1 1 
ATOM   2939  C  CG2 . VAL A 1 371 ? 55.412 67.813  31.173  1.00 28.45  ? 371  VAL A CG2 1 
ATOM   2940  N  N   . ALA A 1 372 ? 53.194 69.178  35.006  1.00 28.85  ? 372  ALA A N   1 
ATOM   2941  C  CA  . ALA A 1 372 ? 52.917 69.949  36.198  1.00 28.94  ? 372  ALA A CA  1 
ATOM   2942  C  C   . ALA A 1 372 ? 52.956 69.067  37.443  1.00 29.13  ? 372  ALA A C   1 
ATOM   2943  O  O   . ALA A 1 372 ? 53.303 69.535  38.528  1.00 29.43  ? 372  ALA A O   1 
ATOM   2944  C  CB  . ALA A 1 372 ? 51.583 70.650  36.084  1.00 29.07  ? 372  ALA A CB  1 
ATOM   2945  N  N   . ALA A 1 373 ? 52.598 67.794  37.290  1.00 28.97  ? 373  ALA A N   1 
ATOM   2946  C  CA  . ALA A 1 373 ? 52.606 66.874  38.418  1.00 28.84  ? 373  ALA A CA  1 
ATOM   2947  C  C   . ALA A 1 373 ? 54.002 66.866  39.023  1.00 28.93  ? 373  ALA A C   1 
ATOM   2948  O  O   . ALA A 1 373 ? 54.213 67.356  40.133  1.00 28.94  ? 373  ALA A O   1 
ATOM   2949  C  CB  . ALA A 1 373 ? 52.201 65.490  37.976  1.00 28.69  ? 373  ALA A CB  1 
ATOM   2950  N  N   . HIS A 1 374 ? 54.945 66.302  38.276  1.00 29.02  ? 374  HIS A N   1 
ATOM   2951  C  CA  . HIS A 1 374 ? 56.356 66.286  38.642  1.00 28.92  ? 374  HIS A CA  1 
ATOM   2952  C  C   . HIS A 1 374 ? 56.729 67.639  39.226  1.00 29.15  ? 374  HIS A C   1 
ATOM   2953  O  O   . HIS A 1 374 ? 57.134 67.730  40.382  1.00 29.30  ? 374  HIS A O   1 
ATOM   2954  C  CB  . HIS A 1 374 ? 57.180 65.980  37.387  1.00 28.82  ? 374  HIS A CB  1 
ATOM   2955  C  CG  . HIS A 1 374 ? 58.641 66.298  37.492  1.00 27.97  ? 374  HIS A CG  1 
ATOM   2956  N  ND1 . HIS A 1 374 ? 59.616 65.337  37.336  1.00 27.35  ? 374  HIS A ND1 1 
ATOM   2957  C  CD2 . HIS A 1 374 ? 59.295 67.470  37.671  1.00 27.11  ? 374  HIS A CD2 1 
ATOM   2958  C  CE1 . HIS A 1 374 ? 60.807 65.897  37.446  1.00 26.89  ? 374  HIS A CE1 1 
ATOM   2959  N  NE2 . HIS A 1 374 ? 60.640 67.190  37.649  1.00 26.84  ? 374  HIS A NE2 1 
ATOM   2960  N  N   . ALA A 1 375 ? 56.561 68.689  38.432  1.00 29.27  ? 375  ALA A N   1 
ATOM   2961  C  CA  . ALA A 1 375 ? 56.880 70.039  38.869  1.00 29.76  ? 375  ALA A CA  1 
ATOM   2962  C  C   . ALA A 1 375 ? 56.377 70.310  40.276  1.00 30.17  ? 375  ALA A C   1 
ATOM   2963  O  O   . ALA A 1 375 ? 57.137 70.659  41.172  1.00 30.21  ? 375  ALA A O   1 
ATOM   2964  C  CB  . ALA A 1 375 ? 56.290 71.044  37.916  1.00 29.70  ? 375  ALA A CB  1 
ATOM   2965  N  N   . PHE A 1 376 ? 55.083 70.139  40.469  1.00 30.72  ? 376  PHE A N   1 
ATOM   2966  C  CA  . PHE A 1 376 ? 54.488 70.431  41.758  1.00 31.24  ? 376  PHE A CA  1 
ATOM   2967  C  C   . PHE A 1 376 ? 55.172 69.729  42.932  1.00 31.44  ? 376  PHE A C   1 
ATOM   2968  O  O   . PHE A 1 376 ? 55.356 70.318  43.993  1.00 31.67  ? 376  PHE A O   1 
ATOM   2969  C  CB  . PHE A 1 376 ? 52.983 70.188  41.702  1.00 31.32  ? 376  PHE A CB  1 
ATOM   2970  C  CG  . PHE A 1 376 ? 52.254 71.222  40.896  1.00 31.63  ? 376  PHE A CG  1 
ATOM   2971  C  CD1 . PHE A 1 376 ? 52.828 72.465  40.684  1.00 32.22  ? 376  PHE A CD1 1 
ATOM   2972  C  CD2 . PHE A 1 376 ? 51.015 70.961  40.349  1.00 31.97  ? 376  PHE A CD2 1 
ATOM   2973  C  CE1 . PHE A 1 376 ? 52.176 73.429  39.951  1.00 32.40  ? 376  PHE A CE1 1 
ATOM   2974  C  CE2 . PHE A 1 376 ? 50.358 71.919  39.615  1.00 32.28  ? 376  PHE A CE2 1 
ATOM   2975  C  CZ  . PHE A 1 376 ? 50.938 73.154  39.414  1.00 32.82  ? 376  PHE A CZ  1 
ATOM   2976  N  N   . GLY A 1 377 ? 55.567 68.478  42.743  1.00 31.63  ? 377  GLY A N   1 
ATOM   2977  C  CA  . GLY A 1 377 ? 56.286 67.778  43.791  1.00 31.84  ? 377  GLY A CA  1 
ATOM   2978  C  C   . GLY A 1 377 ? 57.507 68.597  44.162  1.00 31.92  ? 377  GLY A C   1 
ATOM   2979  O  O   . GLY A 1 377 ? 57.749 68.888  45.341  1.00 31.83  ? 377  GLY A O   1 
ATOM   2980  N  N   . HIS A 1 378 ? 58.271 68.977  43.138  1.00 31.85  ? 378  HIS A N   1 
ATOM   2981  C  CA  . HIS A 1 378 ? 59.440 69.827  43.321  1.00 31.66  ? 378  HIS A CA  1 
ATOM   2982  C  C   . HIS A 1 378 ? 59.065 70.948  44.275  1.00 31.76  ? 378  HIS A C   1 
ATOM   2983  O  O   . HIS A 1 378 ? 59.782 71.226  45.232  1.00 31.90  ? 378  HIS A O   1 
ATOM   2984  C  CB  . HIS A 1 378 ? 59.868 70.453  41.990  1.00 31.46  ? 378  HIS A CB  1 
ATOM   2985  C  CG  . HIS A 1 378 ? 60.766 69.592  41.155  1.00 30.37  ? 378  HIS A CG  1 
ATOM   2986  N  ND1 . HIS A 1 378 ? 62.013 69.189  41.573  1.00 29.45  ? 378  HIS A ND1 1 
ATOM   2987  C  CD2 . HIS A 1 378 ? 60.612 69.096  39.906  1.00 29.60  ? 378  HIS A CD2 1 
ATOM   2988  C  CE1 . HIS A 1 378 ? 62.581 68.466  40.625  1.00 28.81  ? 378  HIS A CE1 1 
ATOM   2989  N  NE2 . HIS A 1 378 ? 61.751 68.393  39.603  1.00 28.28  ? 378  HIS A NE2 1 
ATOM   2990  N  N   . ALA A 1 379 ? 57.923 71.575  44.002  1.00 31.79  ? 379  ALA A N   1 
ATOM   2991  C  CA  . ALA A 1 379 ? 57.436 72.708  44.780  1.00 31.91  ? 379  ALA A CA  1 
ATOM   2992  C  C   . ALA A 1 379 ? 56.956 72.306  46.157  1.00 32.06  ? 379  ALA A C   1 
ATOM   2993  O  O   . ALA A 1 379 ? 56.744 73.158  47.013  1.00 32.19  ? 379  ALA A O   1 
ATOM   2994  C  CB  . ALA A 1 379 ? 56.320 73.417  44.041  1.00 31.91  ? 379  ALA A CB  1 
ATOM   2995  N  N   . MET A 1 380 ? 56.760 71.015  46.374  1.00 32.08  ? 380  MET A N   1 
ATOM   2996  C  CA  . MET A 1 380 ? 56.338 70.574  47.684  1.00 32.26  ? 380  MET A CA  1 
ATOM   2997  C  C   . MET A 1 380 ? 57.578 70.178  48.470  1.00 32.21  ? 380  MET A C   1 
ATOM   2998  O  O   . MET A 1 380 ? 57.495 69.742  49.621  1.00 32.13  ? 380  MET A O   1 
ATOM   2999  C  CB  . MET A 1 380 ? 55.350 69.420  47.575  1.00 32.45  ? 380  MET A CB  1 
ATOM   3000  C  CG  . MET A 1 380 ? 54.043 69.725  48.262  1.00 32.83  ? 380  MET A CG  1 
ATOM   3001  S  SD  . MET A 1 380 ? 53.466 71.331  47.704  1.00 33.01  ? 380  MET A SD  1 
ATOM   3002  C  CE  . MET A 1 380 ? 53.164 70.978  45.983  1.00 32.86  ? 380  MET A CE  1 
ATOM   3003  N  N   . GLY A 1 381 ? 58.731 70.341  47.826  1.00 32.07  ? 381  GLY A N   1 
ATOM   3004  C  CA  . GLY A 1 381 ? 60.010 70.040  48.440  1.00 31.84  ? 381  GLY A CA  1 
ATOM   3005  C  C   . GLY A 1 381 ? 60.738 68.861  47.824  1.00 31.68  ? 381  GLY A C   1 
ATOM   3006  O  O   . GLY A 1 381 ? 61.947 68.714  47.999  1.00 31.69  ? 381  GLY A O   1 
ATOM   3007  N  N   . LEU A 1 382 ? 60.008 68.027  47.092  1.00 31.52  ? 382  LEU A N   1 
ATOM   3008  C  CA  . LEU A 1 382 ? 60.583 66.813  46.525  1.00 31.35  ? 382  LEU A CA  1 
ATOM   3009  C  C   . LEU A 1 382 ? 61.742 67.056  45.571  1.00 31.40  ? 382  LEU A C   1 
ATOM   3010  O  O   . LEU A 1 382 ? 61.893 68.139  45.019  1.00 31.42  ? 382  LEU A O   1 
ATOM   3011  C  CB  . LEU A 1 382 ? 59.504 65.946  45.882  1.00 31.35  ? 382  LEU A CB  1 
ATOM   3012  C  CG  . LEU A 1 382 ? 58.920 64.963  46.890  1.00 30.85  ? 382  LEU A CG  1 
ATOM   3013  C  CD1 . LEU A 1 382 ? 57.718 64.246  46.326  1.00 30.62  ? 382  LEU A CD1 1 
ATOM   3014  C  CD2 . LEU A 1 382 ? 59.996 63.981  47.273  1.00 31.08  ? 382  LEU A CD2 1 
ATOM   3015  N  N   . GLU A 1 383 ? 62.548 66.020  45.381  1.00 31.53  ? 383  GLU A N   1 
ATOM   3016  C  CA  . GLU A 1 383 ? 63.761 66.097  44.582  1.00 31.76  ? 383  GLU A CA  1 
ATOM   3017  C  C   . GLU A 1 383 ? 63.797 64.967  43.545  1.00 31.72  ? 383  GLU A C   1 
ATOM   3018  O  O   . GLU A 1 383 ? 63.148 63.940  43.727  1.00 31.80  ? 383  GLU A O   1 
ATOM   3019  C  CB  . GLU A 1 383 ? 64.954 65.995  45.530  1.00 32.01  ? 383  GLU A CB  1 
ATOM   3020  C  CG  . GLU A 1 383 ? 66.319 66.211  44.907  1.00 32.87  ? 383  GLU A CG  1 
ATOM   3021  C  CD  . GLU A 1 383 ? 66.665 67.675  44.741  1.00 33.92  ? 383  GLU A CD  1 
ATOM   3022  O  OE1 . GLU A 1 383 ? 65.733 68.508  44.621  1.00 34.80  ? 383  GLU A OE1 1 
ATOM   3023  O  OE2 . GLU A 1 383 ? 67.876 67.986  44.725  1.00 33.48  ? 383  GLU A OE2 1 
ATOM   3024  N  N   . HIS A 1 384 ? 64.561 65.151  42.471  1.00 31.68  ? 384  HIS A N   1 
ATOM   3025  C  CA  . HIS A 1 384 ? 64.626 64.173  41.375  1.00 31.75  ? 384  HIS A CA  1 
ATOM   3026  C  C   . HIS A 1 384 ? 64.929 62.731  41.762  1.00 31.78  ? 384  HIS A C   1 
ATOM   3027  O  O   . HIS A 1 384 ? 65.959 62.441  42.369  1.00 31.92  ? 384  HIS A O   1 
ATOM   3028  C  CB  . HIS A 1 384 ? 65.632 64.612  40.313  1.00 31.83  ? 384  HIS A CB  1 
ATOM   3029  C  CG  . HIS A 1 384 ? 65.053 65.527  39.285  1.00 32.05  ? 384  HIS A CG  1 
ATOM   3030  N  ND1 . HIS A 1 384 ? 65.819 66.414  38.562  1.00 32.50  ? 384  HIS A ND1 1 
ATOM   3031  C  CD2 . HIS A 1 384 ? 63.778 65.699  38.867  1.00 32.24  ? 384  HIS A CD2 1 
ATOM   3032  C  CE1 . HIS A 1 384 ? 65.038 67.095  37.741  1.00 32.59  ? 384  HIS A CE1 1 
ATOM   3033  N  NE2 . HIS A 1 384 ? 63.794 66.683  37.909  1.00 32.14  ? 384  HIS A NE2 1 
ATOM   3034  N  N   . SER A 1 385 ? 64.042 61.827  41.359  1.00 31.72  ? 385  SER A N   1 
ATOM   3035  C  CA  . SER A 1 385 ? 64.187 60.406  41.652  1.00 31.63  ? 385  SER A CA  1 
ATOM   3036  C  C   . SER A 1 385 ? 65.003 59.648  40.612  1.00 31.68  ? 385  SER A C   1 
ATOM   3037  O  O   . SER A 1 385 ? 65.167 60.088  39.481  1.00 31.67  ? 385  SER A O   1 
ATOM   3038  C  CB  . SER A 1 385 ? 62.818 59.752  41.795  1.00 31.60  ? 385  SER A CB  1 
ATOM   3039  O  OG  . SER A 1 385 ? 62.907 58.364  41.534  1.00 31.52  ? 385  SER A OG  1 
ATOM   3040  N  N   . GLN A 1 386 ? 65.498 58.485  41.011  1.00 31.97  ? 386  GLN A N   1 
ATOM   3041  C  CA  . GLN A 1 386 ? 66.342 57.656  40.163  1.00 32.09  ? 386  GLN A CA  1 
ATOM   3042  C  C   . GLN A 1 386 ? 65.578 56.406  39.754  1.00 32.17  ? 386  GLN A C   1 
ATOM   3043  O  O   . GLN A 1 386 ? 66.147 55.477  39.186  1.00 32.10  ? 386  GLN A O   1 
ATOM   3044  C  CB  . GLN A 1 386 ? 67.599 57.262  40.942  1.00 31.93  ? 386  GLN A CB  1 
ATOM   3045  C  CG  . GLN A 1 386 ? 68.878 57.240  40.130  1.00 32.04  ? 386  GLN A CG  1 
ATOM   3046  C  CD  . GLN A 1 386 ? 70.114 57.282  41.012  1.00 32.09  ? 386  GLN A CD  1 
ATOM   3047  O  OE1 . GLN A 1 386 ? 70.043 57.715  42.159  1.00 32.22  ? 386  GLN A OE1 1 
ATOM   3048  N  NE2 . GLN A 1 386 ? 71.244 56.833  40.482  1.00 32.12  ? 386  GLN A NE2 1 
ATOM   3049  N  N   . ASP A 1 387 ? 64.281 56.406  40.046  1.00 32.30  ? 387  ASP A N   1 
ATOM   3050  C  CA  . ASP A 1 387 ? 63.420 55.258  39.803  1.00 32.52  ? 387  ASP A CA  1 
ATOM   3051  C  C   . ASP A 1 387 ? 62.578 55.454  38.554  1.00 32.40  ? 387  ASP A C   1 
ATOM   3052  O  O   . ASP A 1 387 ? 61.586 56.174  38.578  1.00 32.51  ? 387  ASP A O   1 
ATOM   3053  C  CB  . ASP A 1 387 ? 62.509 55.042  41.013  1.00 32.81  ? 387  ASP A CB  1 
ATOM   3054  C  CG  . ASP A 1 387 ? 61.724 53.746  40.936  1.00 33.69  ? 387  ASP A CG  1 
ATOM   3055  O  OD1 . ASP A 1 387 ? 61.990 52.941  40.017  1.00 34.66  ? 387  ASP A OD1 1 
ATOM   3056  O  OD2 . ASP A 1 387 ? 60.826 53.445  41.755  1.00 34.39  ? 387  ASP A OD2 1 
ATOM   3057  N  N   . PRO A 1 388 ? 62.951 54.766  37.482  1.00 32.25  ? 388  PRO A N   1 
ATOM   3058  C  CA  . PRO A 1 388 ? 62.302 54.906  36.172  1.00 32.07  ? 388  PRO A CA  1 
ATOM   3059  C  C   . PRO A 1 388 ? 60.779 55.062  36.207  1.00 31.93  ? 388  PRO A C   1 
ATOM   3060  O  O   . PRO A 1 388 ? 60.225 55.744  35.345  1.00 31.89  ? 388  PRO A O   1 
ATOM   3061  C  CB  . PRO A 1 388 ? 62.675 53.601  35.469  1.00 32.10  ? 388  PRO A CB  1 
ATOM   3062  C  CG  . PRO A 1 388 ? 63.994 53.239  36.046  1.00 32.26  ? 388  PRO A CG  1 
ATOM   3063  C  CD  . PRO A 1 388 ? 64.019 53.753  37.464  1.00 32.22  ? 388  PRO A CD  1 
ATOM   3064  N  N   . GLY A 1 389 ? 60.116 54.429  37.170  1.00 31.70  ? 389  GLY A N   1 
ATOM   3065  C  CA  . GLY A 1 389 ? 58.669 54.504  37.265  1.00 31.30  ? 389  GLY A CA  1 
ATOM   3066  C  C   . GLY A 1 389 ? 58.203 55.626  38.168  1.00 31.09  ? 389  GLY A C   1 
ATOM   3067  O  O   . GLY A 1 389 ? 57.008 55.809  38.382  1.00 31.03  ? 389  GLY A O   1 
ATOM   3068  N  N   . ALA A 1 390 ? 59.149 56.384  38.704  1.00 30.91  ? 390  ALA A N   1 
ATOM   3069  C  CA  . ALA A 1 390 ? 58.812 57.478  39.602  1.00 30.82  ? 390  ALA A CA  1 
ATOM   3070  C  C   . ALA A 1 390 ? 58.404 58.737  38.847  1.00 30.77  ? 390  ALA A C   1 
ATOM   3071  O  O   . ALA A 1 390 ? 59.097 59.186  37.934  1.00 30.78  ? 390  ALA A O   1 
ATOM   3072  C  CB  . ALA A 1 390 ? 59.972 57.775  40.532  1.00 30.80  ? 390  ALA A CB  1 
ATOM   3073  N  N   . LEU A 1 391 ? 57.268 59.305  39.230  1.00 30.51  ? 391  LEU A N   1 
ATOM   3074  C  CA  . LEU A 1 391 ? 56.825 60.542  38.626  1.00 30.15  ? 391  LEU A CA  1 
ATOM   3075  C  C   . LEU A 1 391 ? 57.966 61.537  38.729  1.00 29.95  ? 391  LEU A C   1 
ATOM   3076  O  O   . LEU A 1 391 ? 58.334 62.189  37.754  1.00 29.88  ? 391  LEU A O   1 
ATOM   3077  C  CB  . LEU A 1 391 ? 55.596 61.083  39.350  1.00 30.12  ? 391  LEU A CB  1 
ATOM   3078  C  CG  . LEU A 1 391 ? 55.116 62.451  38.870  1.00 29.97  ? 391  LEU A CG  1 
ATOM   3079  C  CD1 . LEU A 1 391 ? 54.726 62.403  37.410  1.00 28.98  ? 391  LEU A CD1 1 
ATOM   3080  C  CD2 . LEU A 1 391 ? 53.953 62.898  39.720  1.00 30.86  ? 391  LEU A CD2 1 
ATOM   3081  N  N   . MET A 1 392 ? 58.544 61.636  39.917  1.00 29.67  ? 392  MET A N   1 
ATOM   3082  C  CA  . MET A 1 392 ? 59.630 62.569  40.130  1.00 29.53  ? 392  MET A CA  1 
ATOM   3083  C  C   . MET A 1 392 ? 60.912 62.133  39.442  1.00 29.65  ? 392  MET A C   1 
ATOM   3084  O  O   . MET A 1 392 ? 62.006 62.474  39.879  1.00 29.72  ? 392  MET A O   1 
ATOM   3085  C  CB  . MET A 1 392 ? 59.861 62.777  41.614  1.00 29.46  ? 392  MET A CB  1 
ATOM   3086  C  CG  . MET A 1 392 ? 58.645 63.310  42.315  1.00 29.46  ? 392  MET A CG  1 
ATOM   3087  S  SD  . MET A 1 392 ? 58.160 64.879  41.627  1.00 29.88  ? 392  MET A SD  1 
ATOM   3088  C  CE  . MET A 1 392 ? 59.682 65.795  41.733  1.00 30.06  ? 392  MET A CE  1 
ATOM   3089  N  N   . ALA A 1 393 ? 60.775 61.359  38.373  1.00 29.80  ? 393  ALA A N   1 
ATOM   3090  C  CA  . ALA A 1 393 ? 61.925 61.003  37.556  1.00 29.87  ? 393  ALA A CA  1 
ATOM   3091  C  C   . ALA A 1 393 ? 62.075 62.122  36.539  1.00 29.97  ? 393  ALA A C   1 
ATOM   3092  O  O   . ALA A 1 393 ? 61.084 62.623  36.018  1.00 29.84  ? 393  ALA A O   1 
ATOM   3093  C  CB  . ALA A 1 393 ? 61.707 59.679  36.863  1.00 29.84  ? 393  ALA A CB  1 
ATOM   3094  N  N   . PRO A 1 394 ? 63.309 62.521  36.270  1.00 30.08  ? 394  PRO A N   1 
ATOM   3095  C  CA  . PRO A 1 394 ? 63.593 63.636  35.365  1.00 30.23  ? 394  PRO A CA  1 
ATOM   3096  C  C   . PRO A 1 394 ? 63.040 63.487  33.951  1.00 30.48  ? 394  PRO A C   1 
ATOM   3097  O  O   . PRO A 1 394 ? 62.370 64.383  33.450  1.00 30.64  ? 394  PRO A O   1 
ATOM   3098  C  CB  . PRO A 1 394 ? 65.116 63.636  35.314  1.00 30.22  ? 394  PRO A CB  1 
ATOM   3099  C  CG  . PRO A 1 394 ? 65.471 62.265  35.716  1.00 30.16  ? 394  PRO A CG  1 
ATOM   3100  C  CD  . PRO A 1 394 ? 64.545 61.956  36.831  1.00 30.05  ? 394  PRO A CD  1 
ATOM   3101  N  N   . ILE A 1 395 ? 63.325 62.378  33.292  1.00 30.82  ? 395  ILE A N   1 
ATOM   3102  C  CA  . ILE A 1 395 ? 62.872 62.219  31.916  1.00 30.95  ? 395  ILE A CA  1 
ATOM   3103  C  C   . ILE A 1 395 ? 61.357 62.173  31.791  1.00 31.14  ? 395  ILE A C   1 
ATOM   3104  O  O   . ILE A 1 395 ? 60.673 61.627  32.652  1.00 31.28  ? 395  ILE A O   1 
ATOM   3105  C  CB  . ILE A 1 395 ? 63.500 60.979  31.307  1.00 30.91  ? 395  ILE A CB  1 
ATOM   3106  C  CG1 . ILE A 1 395 ? 64.988 61.221  31.115  1.00 31.39  ? 395  ILE A CG1 1 
ATOM   3107  C  CG2 . ILE A 1 395 ? 62.859 60.647  29.991  1.00 30.59  ? 395  ILE A CG2 1 
ATOM   3108  C  CD1 . ILE A 1 395 ? 65.539 60.525  29.918  1.00 32.74  ? 395  ILE A CD1 1 
ATOM   3109  N  N   . TYR A 1 396 ? 60.837 62.755  30.716  1.00 31.50  ? 396  TYR A N   1 
ATOM   3110  C  CA  . TYR A 1 396 ? 59.400 62.767  30.469  1.00 31.71  ? 396  TYR A CA  1 
ATOM   3111  C  C   . TYR A 1 396 ? 58.954 61.448  29.877  1.00 32.25  ? 396  TYR A C   1 
ATOM   3112  O  O   . TYR A 1 396 ? 59.624 60.894  29.011  1.00 32.35  ? 396  TYR A O   1 
ATOM   3113  C  CB  . TYR A 1 396 ? 59.026 63.887  29.510  1.00 31.40  ? 396  TYR A CB  1 
ATOM   3114  C  CG  . TYR A 1 396 ? 57.576 63.857  29.092  1.00 30.76  ? 396  TYR A CG  1 
ATOM   3115  C  CD1 . TYR A 1 396 ? 56.575 64.208  29.982  1.00 30.57  ? 396  TYR A CD1 1 
ATOM   3116  C  CD2 . TYR A 1 396 ? 57.208 63.483  27.809  1.00 29.76  ? 396  TYR A CD2 1 
ATOM   3117  C  CE1 . TYR A 1 396 ? 55.249 64.187  29.614  1.00 30.05  ? 396  TYR A CE1 1 
ATOM   3118  C  CE2 . TYR A 1 396 ? 55.892 63.460  27.430  1.00 29.69  ? 396  TYR A CE2 1 
ATOM   3119  C  CZ  . TYR A 1 396 ? 54.909 63.811  28.338  1.00 30.29  ? 396  TYR A CZ  1 
ATOM   3120  O  OH  . TYR A 1 396 ? 53.579 63.794  27.970  1.00 30.24  ? 396  TYR A OH  1 
ATOM   3121  N  N   . THR A 1 397 ? 57.813 60.954  30.341  1.00 32.97  ? 397  THR A N   1 
ATOM   3122  C  CA  . THR A 1 397 ? 57.263 59.698  29.855  1.00 33.60  ? 397  THR A CA  1 
ATOM   3123  C  C   . THR A 1 397 ? 55.757 59.730  29.932  1.00 34.22  ? 397  THR A C   1 
ATOM   3124  O  O   . THR A 1 397 ? 55.195 59.774  31.026  1.00 34.08  ? 397  THR A O   1 
ATOM   3125  C  CB  . THR A 1 397 ? 57.745 58.554  30.712  1.00 33.38  ? 397  THR A CB  1 
ATOM   3126  O  OG1 . THR A 1 397 ? 59.171 58.491  30.656  1.00 33.60  ? 397  THR A OG1 1 
ATOM   3127  C  CG2 . THR A 1 397 ? 57.310 57.253  30.096  1.00 33.41  ? 397  THR A CG2 1 
ATOM   3128  N  N   . TYR A 1 398 ? 55.097 59.684  28.782  1.00 35.15  ? 398  TYR A N   1 
ATOM   3129  C  CA  . TYR A 1 398 ? 53.646 59.768  28.786  1.00 36.33  ? 398  TYR A CA  1 
ATOM   3130  C  C   . TYR A 1 398 ? 52.937 58.475  29.097  1.00 37.28  ? 398  TYR A C   1 
ATOM   3131  O  O   . TYR A 1 398 ? 53.043 57.507  28.341  1.00 37.73  ? 398  TYR A O   1 
ATOM   3132  C  CB  . TYR A 1 398 ? 53.104 60.242  27.462  1.00 36.30  ? 398  TYR A CB  1 
ATOM   3133  C  CG  . TYR A 1 398 ? 51.612 60.064  27.406  1.00 36.08  ? 398  TYR A CG  1 
ATOM   3134  C  CD1 . TYR A 1 398 ? 50.787 60.837  28.184  1.00 36.57  ? 398  TYR A CD1 1 
ATOM   3135  C  CD2 . TYR A 1 398 ? 51.034 59.109  26.596  1.00 36.11  ? 398  TYR A CD2 1 
ATOM   3136  C  CE1 . TYR A 1 398 ? 49.427 60.685  28.138  1.00 37.35  ? 398  TYR A CE1 1 
ATOM   3137  C  CE2 . TYR A 1 398 ? 49.678 58.951  26.544  1.00 36.39  ? 398  TYR A CE2 1 
ATOM   3138  C  CZ  . TYR A 1 398 ? 48.874 59.742  27.319  1.00 36.62  ? 398  TYR A CZ  1 
ATOM   3139  O  OH  . TYR A 1 398 ? 47.506 59.602  27.287  1.00 36.23  ? 398  TYR A OH  1 
ATOM   3140  N  N   . THR A 1 399 ? 52.167 58.499  30.183  1.00 38.18  ? 399  THR A N   1 
ATOM   3141  C  CA  . THR A 1 399 ? 51.391 57.355  30.646  1.00 38.76  ? 399  THR A CA  1 
ATOM   3142  C  C   . THR A 1 399 ? 49.914 57.752  30.692  1.00 39.31  ? 399  THR A C   1 
ATOM   3143  O  O   . THR A 1 399 ? 49.530 58.672  31.415  1.00 39.21  ? 399  THR A O   1 
ATOM   3144  C  CB  . THR A 1 399 ? 51.851 56.969  32.045  1.00 38.64  ? 399  THR A CB  1 
ATOM   3145  O  OG1 . THR A 1 399 ? 51.051 57.658  33.011  1.00 38.69  ? 399  THR A OG1 1 
ATOM   3146  C  CG2 . THR A 1 399 ? 53.242 57.518  32.302  1.00 38.51  ? 399  THR A CG2 1 
ATOM   3147  N  N   . LYS A 1 400 ? 49.083 57.066  29.919  1.00 40.04  ? 400  LYS A N   1 
ATOM   3148  C  CA  . LYS A 1 400 ? 47.670 57.412  29.886  1.00 40.82  ? 400  LYS A CA  1 
ATOM   3149  C  C   . LYS A 1 400 ? 47.080 57.298  31.279  1.00 41.18  ? 400  LYS A C   1 
ATOM   3150  O  O   . LYS A 1 400 ? 46.500 58.245  31.808  1.00 41.21  ? 400  LYS A O   1 
ATOM   3151  C  CB  . LYS A 1 400 ? 46.910 56.508  28.912  1.00 40.90  ? 400  LYS A CB  1 
ATOM   3152  C  CG  . LYS A 1 400 ? 45.483 56.956  28.630  1.00 41.55  ? 400  LYS A CG  1 
ATOM   3153  C  CD  . LYS A 1 400 ? 44.934 56.262  27.390  1.00 43.39  ? 400  LYS A CD  1 
ATOM   3154  C  CE  . LYS A 1 400 ? 43.526 56.746  27.030  1.00 44.14  ? 400  LYS A CE  1 
ATOM   3155  N  NZ  . LYS A 1 400 ? 42.945 55.956  25.895  1.00 45.06  ? 400  LYS A NZ  1 
ATOM   3156  N  N   . ASN A 1 401 ? 47.247 56.129  31.878  1.00 41.76  ? 401  ASN A N   1 
ATOM   3157  C  CA  . ASN A 1 401 ? 46.713 55.876  33.205  1.00 42.27  ? 401  ASN A CA  1 
ATOM   3158  C  C   . ASN A 1 401 ? 47.790 56.084  34.252  1.00 42.23  ? 401  ASN A C   1 
ATOM   3159  O  O   . ASN A 1 401 ? 48.357 55.129  34.774  1.00 42.37  ? 401  ASN A O   1 
ATOM   3160  C  CB  . ASN A 1 401 ? 46.134 54.465  33.256  1.00 42.52  ? 401  ASN A CB  1 
ATOM   3161  C  CG  . ASN A 1 401 ? 45.211 54.181  32.072  1.00 43.52  ? 401  ASN A CG  1 
ATOM   3162  O  OD1 . ASN A 1 401 ? 45.516 53.348  31.209  1.00 44.32  ? 401  ASN A OD1 1 
ATOM   3163  N  ND2 . ASN A 1 401 ? 44.085 54.897  32.014  1.00 43.92  ? 401  ASN A ND2 1 
ATOM   3164  N  N   . PHE A 1 402 ? 48.066 57.351  34.544  1.00 42.30  ? 402  PHE A N   1 
ATOM   3165  C  CA  . PHE A 1 402 ? 49.137 57.722  35.461  1.00 42.36  ? 402  PHE A CA  1 
ATOM   3166  C  C   . PHE A 1 402 ? 48.836 57.475  36.928  1.00 42.29  ? 402  PHE A C   1 
ATOM   3167  O  O   . PHE A 1 402 ? 47.780 57.853  37.434  1.00 42.41  ? 402  PHE A O   1 
ATOM   3168  C  CB  . PHE A 1 402 ? 49.511 59.197  35.301  1.00 42.41  ? 402  PHE A CB  1 
ATOM   3169  C  CG  . PHE A 1 402 ? 50.214 59.756  36.499  1.00 42.77  ? 402  PHE A CG  1 
ATOM   3170  C  CD1 . PHE A 1 402 ? 51.549 59.460  36.730  1.00 42.82  ? 402  PHE A CD1 1 
ATOM   3171  C  CD2 . PHE A 1 402 ? 49.531 60.539  37.419  1.00 42.99  ? 402  PHE A CD2 1 
ATOM   3172  C  CE1 . PHE A 1 402 ? 52.197 59.948  37.841  1.00 42.87  ? 402  PHE A CE1 1 
ATOM   3173  C  CE2 . PHE A 1 402 ? 50.173 61.029  38.533  1.00 43.25  ? 402  PHE A CE2 1 
ATOM   3174  C  CZ  . PHE A 1 402 ? 51.510 60.734  38.744  1.00 43.40  ? 402  PHE A CZ  1 
ATOM   3175  N  N   . ARG A 1 403 ? 49.787 56.865  37.618  1.00 42.09  ? 403  ARG A N   1 
ATOM   3176  C  CA  . ARG A 1 403 ? 49.637 56.653  39.047  1.00 42.03  ? 403  ARG A CA  1 
ATOM   3177  C  C   . ARG A 1 403 ? 50.914 57.059  39.755  1.00 41.49  ? 403  ARG A C   1 
ATOM   3178  O  O   . ARG A 1 403 ? 52.011 56.781  39.266  1.00 41.62  ? 403  ARG A O   1 
ATOM   3179  C  CB  . ARG A 1 403 ? 49.309 55.193  39.341  1.00 42.18  ? 403  ARG A CB  1 
ATOM   3180  C  CG  . ARG A 1 403 ? 48.043 54.732  38.660  1.00 43.26  ? 403  ARG A CG  1 
ATOM   3181  C  CD  . ARG A 1 403 ? 47.767 53.251  38.800  1.00 45.74  ? 403  ARG A CD  1 
ATOM   3182  N  NE  . ARG A 1 403 ? 47.533 52.849  40.187  1.00 47.38  ? 403  ARG A NE  1 
ATOM   3183  C  CZ  . ARG A 1 403 ? 46.760 53.511  41.041  1.00 47.79  ? 403  ARG A CZ  1 
ATOM   3184  N  NH1 . ARG A 1 403 ? 46.144 54.625  40.663  1.00 47.86  ? 403  ARG A NH1 1 
ATOM   3185  N  NH2 . ARG A 1 403 ? 46.603 53.058  42.280  1.00 47.96  ? 403  ARG A NH2 1 
ATOM   3186  N  N   . LEU A 1 404 ? 50.779 57.743  40.887  1.00 40.60  ? 404  LEU A N   1 
ATOM   3187  C  CA  . LEU A 1 404 ? 51.953 58.098  41.656  1.00 39.62  ? 404  LEU A CA  1 
ATOM   3188  C  C   . LEU A 1 404 ? 52.619 56.789  41.976  1.00 39.14  ? 404  LEU A C   1 
ATOM   3189  O  O   . LEU A 1 404 ? 51.953 55.767  42.081  1.00 39.15  ? 404  LEU A O   1 
ATOM   3190  C  CB  . LEU A 1 404 ? 51.587 58.825  42.944  1.00 39.50  ? 404  LEU A CB  1 
ATOM   3191  C  CG  . LEU A 1 404 ? 51.756 60.337  42.910  1.00 39.08  ? 404  LEU A CG  1 
ATOM   3192  C  CD1 . LEU A 1 404 ? 51.705 60.888  44.314  1.00 38.37  ? 404  LEU A CD1 1 
ATOM   3193  C  CD2 . LEU A 1 404 ? 53.063 60.700  42.238  1.00 38.91  ? 404  LEU A CD2 1 
ATOM   3194  N  N   . SER A 1 405 ? 53.936 56.812  42.103  1.00 38.59  ? 405  SER A N   1 
ATOM   3195  C  CA  . SER A 1 405 ? 54.681 55.610  42.422  1.00 38.02  ? 405  SER A CA  1 
ATOM   3196  C  C   . SER A 1 405 ? 54.963 55.565  43.912  1.00 37.73  ? 405  SER A C   1 
ATOM   3197  O  O   . SER A 1 405 ? 55.158 56.600  44.548  1.00 37.56  ? 405  SER A O   1 
ATOM   3198  C  CB  . SER A 1 405 ? 55.994 55.582  41.639  1.00 37.97  ? 405  SER A CB  1 
ATOM   3199  O  OG  . SER A 1 405 ? 57.033 55.000  42.407  1.00 37.88  ? 405  SER A OG  1 
ATOM   3200  N  N   . GLN A 1 406 ? 54.975 54.367  44.480  1.00 37.48  ? 406  GLN A N   1 
ATOM   3201  C  CA  . GLN A 1 406 ? 55.305 54.257  45.883  1.00 37.17  ? 406  GLN A CA  1 
ATOM   3202  C  C   . GLN A 1 406 ? 56.437 55.235  46.117  1.00 36.87  ? 406  GLN A C   1 
ATOM   3203  O  O   . GLN A 1 406 ? 56.320 56.148  46.933  1.00 37.00  ? 406  GLN A O   1 
ATOM   3204  C  CB  . GLN A 1 406 ? 55.737 52.847  46.246  1.00 37.07  ? 406  GLN A CB  1 
ATOM   3205  C  CG  . GLN A 1 406 ? 56.231 52.730  47.677  1.00 37.83  ? 406  GLN A CG  1 
ATOM   3206  C  CD  . GLN A 1 406 ? 55.222 53.233  48.705  1.00 38.32  ? 406  GLN A CD  1 
ATOM   3207  O  OE1 . GLN A 1 406 ? 55.521 53.279  49.901  1.00 38.80  ? 406  GLN A OE1 1 
ATOM   3208  N  NE2 . GLN A 1 406 ? 54.032 53.605  48.245  1.00 37.97  ? 406  GLN A NE2 1 
ATOM   3209  N  N   . ASP A 1 407 ? 57.518 55.067  45.360  1.00 36.39  ? 407  ASP A N   1 
ATOM   3210  C  CA  . ASP A 1 407 ? 58.664 55.954  45.477  1.00 35.88  ? 407  ASP A CA  1 
ATOM   3211  C  C   . ASP A 1 407 ? 58.195 57.375  45.743  1.00 35.67  ? 407  ASP A C   1 
ATOM   3212  O  O   . ASP A 1 407 ? 58.707 58.050  46.633  1.00 35.72  ? 407  ASP A O   1 
ATOM   3213  C  CB  . ASP A 1 407 ? 59.536 55.904  44.229  1.00 35.63  ? 407  ASP A CB  1 
ATOM   3214  C  CG  . ASP A 1 407 ? 60.888 56.539  44.451  1.00 35.45  ? 407  ASP A CG  1 
ATOM   3215  O  OD1 . ASP A 1 407 ? 61.603 56.286  45.440  1.00 35.40  ? 407  ASP A OD1 1 
ATOM   3216  O  OD2 . ASP A 1 407 ? 61.308 57.361  43.617  1.00 35.64  ? 407  ASP A OD2 1 
ATOM   3217  N  N   . ASP A 1 408 ? 57.207 57.824  44.982  1.00 35.41  ? 408  ASP A N   1 
ATOM   3218  C  CA  . ASP A 1 408 ? 56.666 59.155  45.196  1.00 35.32  ? 408  ASP A CA  1 
ATOM   3219  C  C   . ASP A 1 408 ? 55.940 59.202  46.535  1.00 35.29  ? 408  ASP A C   1 
ATOM   3220  O  O   . ASP A 1 408 ? 56.368 59.907  47.444  1.00 35.44  ? 408  ASP A O   1 
ATOM   3221  C  CB  . ASP A 1 408 ? 55.737 59.553  44.055  1.00 35.20  ? 408  ASP A CB  1 
ATOM   3222  C  CG  . ASP A 1 408 ? 56.354 59.306  42.698  1.00 35.11  ? 408  ASP A CG  1 
ATOM   3223  O  OD1 . ASP A 1 408 ? 57.550 59.612  42.525  1.00 34.90  ? 408  ASP A OD1 1 
ATOM   3224  O  OD2 . ASP A 1 408 ? 55.729 58.802  41.745  1.00 35.55  ? 408  ASP A OD2 1 
ATOM   3225  N  N   . ILE A 1 409 ? 54.860 58.437  46.670  1.00 35.13  ? 409  ILE A N   1 
ATOM   3226  C  CA  . ILE A 1 409 ? 54.115 58.426  47.921  1.00 35.04  ? 409  ILE A CA  1 
ATOM   3227  C  C   . ILE A 1 409 ? 55.102 58.471  49.074  1.00 35.09  ? 409  ILE A C   1 
ATOM   3228  O  O   . ILE A 1 409 ? 54.932 59.220  50.033  1.00 35.14  ? 409  ILE A O   1 
ATOM   3229  C  CB  . ILE A 1 409 ? 53.267 57.157  48.047  1.00 35.06  ? 409  ILE A CB  1 
ATOM   3230  C  CG1 . ILE A 1 409 ? 52.583 56.825  46.724  1.00 35.11  ? 409  ILE A CG1 1 
ATOM   3231  C  CG2 . ILE A 1 409 ? 52.236 57.322  49.154  1.00 34.82  ? 409  ILE A CG2 1 
ATOM   3232  C  CD1 . ILE A 1 409 ? 51.179 57.356  46.627  1.00 35.30  ? 409  ILE A CD1 1 
ATOM   3233  N  N   . LYS A 1 410 ? 56.141 57.653  48.974  1.00 35.10  ? 410  LYS A N   1 
ATOM   3234  C  CA  . LYS A 1 410 ? 57.161 57.604  50.002  1.00 35.08  ? 410  LYS A CA  1 
ATOM   3235  C  C   . LYS A 1 410 ? 57.713 59.008  50.234  1.00 34.86  ? 410  LYS A C   1 
ATOM   3236  O  O   . LYS A 1 410 ? 57.440 59.624  51.259  1.00 34.80  ? 410  LYS A O   1 
ATOM   3237  C  CB  . LYS A 1 410 ? 58.275 56.625  49.609  1.00 35.15  ? 410  LYS A CB  1 
ATOM   3238  C  CG  . LYS A 1 410 ? 58.870 55.878  50.794  1.00 36.25  ? 410  LYS A CG  1 
ATOM   3239  C  CD  . LYS A 1 410 ? 59.664 54.636  50.380  1.00 37.98  ? 410  LYS A CD  1 
ATOM   3240  C  CE  . LYS A 1 410 ? 61.175 54.872  50.400  1.00 38.49  ? 410  LYS A CE  1 
ATOM   3241  N  NZ  . LYS A 1 410 ? 61.691 55.447  49.122  1.00 38.90  ? 410  LYS A NZ  1 
ATOM   3242  N  N   . GLY A 1 411 ? 58.456 59.523  49.261  1.00 34.72  ? 411  GLY A N   1 
ATOM   3243  C  CA  . GLY A 1 411 ? 59.079 60.830  49.380  1.00 34.63  ? 411  GLY A CA  1 
ATOM   3244  C  C   . GLY A 1 411 ? 58.194 61.951  49.896  1.00 34.65  ? 411  GLY A C   1 
ATOM   3245  O  O   . GLY A 1 411 ? 58.609 62.726  50.757  1.00 34.55  ? 411  GLY A O   1 
ATOM   3246  N  N   . ILE A 1 412 ? 56.975 62.036  49.372  1.00 34.78  ? 412  ILE A N   1 
ATOM   3247  C  CA  . ILE A 1 412 ? 56.051 63.109  49.726  1.00 34.89  ? 412  ILE A CA  1 
ATOM   3248  C  C   . ILE A 1 412 ? 55.464 62.948  51.124  1.00 35.18  ? 412  ILE A C   1 
ATOM   3249  O  O   . ILE A 1 412 ? 55.358 63.925  51.869  1.00 35.10  ? 412  ILE A O   1 
ATOM   3250  C  CB  . ILE A 1 412 ? 54.928 63.232  48.665  1.00 34.85  ? 412  ILE A CB  1 
ATOM   3251  C  CG1 . ILE A 1 412 ? 54.132 64.523  48.862  1.00 34.96  ? 412  ILE A CG1 1 
ATOM   3252  C  CG2 . ILE A 1 412 ? 54.013 62.024  48.685  1.00 34.54  ? 412  ILE A CG2 1 
ATOM   3253  C  CD1 . ILE A 1 412 ? 54.851 65.766  48.373  1.00 35.03  ? 412  ILE A CD1 1 
ATOM   3254  N  N   . GLN A 1 413 ? 55.091 61.716  51.471  1.00 35.54  ? 413  GLN A N   1 
ATOM   3255  C  CA  . GLN A 1 413 ? 54.524 61.413  52.783  1.00 35.87  ? 413  GLN A CA  1 
ATOM   3256  C  C   . GLN A 1 413 ? 55.594 61.564  53.855  1.00 36.27  ? 413  GLN A C   1 
ATOM   3257  O  O   . GLN A 1 413 ? 55.303 61.895  55.003  1.00 36.30  ? 413  GLN A O   1 
ATOM   3258  C  CB  . GLN A 1 413 ? 53.954 59.991  52.823  1.00 35.75  ? 413  GLN A CB  1 
ATOM   3259  C  CG  . GLN A 1 413 ? 52.692 59.776  52.003  1.00 35.57  ? 413  GLN A CG  1 
ATOM   3260  C  CD  . GLN A 1 413 ? 51.933 58.524  52.415  1.00 35.36  ? 413  GLN A CD  1 
ATOM   3261  O  OE1 . GLN A 1 413 ? 52.516 57.587  52.951  1.00 34.84  ? 413  GLN A OE1 1 
ATOM   3262  N  NE2 . GLN A 1 413 ? 50.630 58.510  52.164  1.00 35.60  ? 413  GLN A NE2 1 
ATOM   3263  N  N   . GLU A 1 414 ? 56.835 61.312  53.460  1.00 36.77  ? 414  GLU A N   1 
ATOM   3264  C  CA  . GLU A 1 414 ? 57.984 61.414  54.344  1.00 37.19  ? 414  GLU A CA  1 
ATOM   3265  C  C   . GLU A 1 414 ? 58.080 62.830  54.907  1.00 37.55  ? 414  GLU A C   1 
ATOM   3266  O  O   . GLU A 1 414 ? 58.504 63.027  56.042  1.00 37.59  ? 414  GLU A O   1 
ATOM   3267  C  CB  . GLU A 1 414 ? 59.246 61.084  53.552  1.00 37.17  ? 414  GLU A CB  1 
ATOM   3268  C  CG  . GLU A 1 414 ? 60.368 60.446  54.345  1.00 37.49  ? 414  GLU A CG  1 
ATOM   3269  C  CD  . GLU A 1 414 ? 61.689 60.511  53.602  1.00 37.75  ? 414  GLU A CD  1 
ATOM   3270  O  OE1 . GLU A 1 414 ? 61.961 59.622  52.769  1.00 37.43  ? 414  GLU A OE1 1 
ATOM   3271  O  OE2 . GLU A 1 414 ? 62.453 61.466  53.842  1.00 38.39  ? 414  GLU A OE2 1 
ATOM   3272  N  N   . LEU A 1 415 ? 57.679 63.810  54.102  1.00 38.08  ? 415  LEU A N   1 
ATOM   3273  C  CA  . LEU A 1 415 ? 57.708 65.212  54.502  1.00 38.62  ? 415  LEU A CA  1 
ATOM   3274  C  C   . LEU A 1 415 ? 56.398 65.635  55.145  1.00 39.31  ? 415  LEU A C   1 
ATOM   3275  O  O   . LEU A 1 415 ? 56.384 66.390  56.113  1.00 39.35  ? 415  LEU A O   1 
ATOM   3276  C  CB  . LEU A 1 415 ? 57.956 66.100  53.285  1.00 38.37  ? 415  LEU A CB  1 
ATOM   3277  C  CG  . LEU A 1 415 ? 59.327 66.060  52.621  1.00 37.95  ? 415  LEU A CG  1 
ATOM   3278  C  CD1 . LEU A 1 415 ? 59.182 66.317  51.146  1.00 38.16  ? 415  LEU A CD1 1 
ATOM   3279  C  CD2 . LEU A 1 415 ? 60.245 67.083  53.237  1.00 37.62  ? 415  LEU A CD2 1 
ATOM   3280  N  N   . TYR A 1 416 ? 55.295 65.153  54.590  1.00 40.28  ? 416  TYR A N   1 
ATOM   3281  C  CA  . TYR A 1 416 ? 53.974 65.527  55.071  1.00 41.23  ? 416  TYR A CA  1 
ATOM   3282  C  C   . TYR A 1 416 ? 53.221 64.304  55.580  1.00 42.27  ? 416  TYR A C   1 
ATOM   3283  O  O   . TYR A 1 416 ? 53.744 63.194  55.549  1.00 42.22  ? 416  TYR A O   1 
ATOM   3284  C  CB  . TYR A 1 416 ? 53.203 66.235  53.953  1.00 41.08  ? 416  TYR A CB  1 
ATOM   3285  C  CG  . TYR A 1 416 ? 53.968 67.404  53.358  1.00 40.34  ? 416  TYR A CG  1 
ATOM   3286  C  CD1 . TYR A 1 416 ? 53.983 68.639  53.988  1.00 39.86  ? 416  TYR A CD1 1 
ATOM   3287  C  CD2 . TYR A 1 416 ? 54.687 67.266  52.183  1.00 39.58  ? 416  TYR A CD2 1 
ATOM   3288  C  CE1 . TYR A 1 416 ? 54.682 69.703  53.465  1.00 39.00  ? 416  TYR A CE1 1 
ATOM   3289  C  CE2 . TYR A 1 416 ? 55.388 68.329  51.651  1.00 39.14  ? 416  TYR A CE2 1 
ATOM   3290  C  CZ  . TYR A 1 416 ? 55.383 69.542  52.299  1.00 38.93  ? 416  TYR A CZ  1 
ATOM   3291  O  OH  . TYR A 1 416 ? 56.079 70.603  51.772  1.00 38.88  ? 416  TYR A OH  1 
ATOM   3292  N  N   . GLY A 1 417 ? 52.001 64.500  56.061  1.00 43.59  ? 417  GLY A N   1 
ATOM   3293  C  CA  . GLY A 1 417 ? 51.199 63.383  56.531  1.00 45.36  ? 417  GLY A CA  1 
ATOM   3294  C  C   . GLY A 1 417 ? 50.826 62.395  55.442  1.00 46.60  ? 417  GLY A C   1 
ATOM   3295  O  O   . GLY A 1 417 ? 51.470 62.341  54.399  1.00 46.67  ? 417  GLY A O   1 
ATOM   3296  N  N   . ALA A 1 418 ? 49.782 61.611  55.677  1.00 47.95  ? 418  ALA A N   1 
ATOM   3297  C  CA  . ALA A 1 418 ? 49.343 60.646  54.681  1.00 49.42  ? 418  ALA A CA  1 
ATOM   3298  C  C   . ALA A 1 418 ? 47.881 60.844  54.285  1.00 50.62  ? 418  ALA A C   1 
ATOM   3299  O  O   . ALA A 1 418 ? 47.579 61.093  53.119  1.00 50.79  ? 418  ALA A O   1 
ATOM   3300  C  CB  . ALA A 1 418 ? 49.582 59.234  55.164  1.00 49.23  ? 418  ALA A CB  1 
ATOM   3301  N  N   . SER A 1 419 ? 46.971 60.730  55.247  1.00 52.14  ? 419  SER A N   1 
ATOM   3302  C  CA  . SER A 1 419 ? 45.548 60.886  54.948  1.00 53.62  ? 419  SER A CA  1 
ATOM   3303  C  C   . SER A 1 419 ? 44.691 61.071  56.192  1.00 54.83  ? 419  SER A C   1 
ATOM   3304  O  O   . SER A 1 419 ? 44.370 60.109  56.894  1.00 54.81  ? 419  SER A O   1 
ATOM   3305  C  CB  . SER A 1 419 ? 45.031 59.701  54.127  1.00 53.60  ? 419  SER A CB  1 
ATOM   3306  O  OG  . SER A 1 419 ? 45.410 59.819  52.765  1.00 53.60  ? 419  SER A OG  1 
ATOM   3307  N  N   . PRO A 1 420 ? 44.320 62.318  56.452  1.00 56.12  ? 420  PRO A N   1 
ATOM   3308  C  CA  . PRO A 1 420 ? 43.493 62.666  57.611  1.00 57.29  ? 420  PRO A CA  1 
ATOM   3309  C  C   . PRO A 1 420 ? 42.027 62.265  57.471  1.00 58.51  ? 420  PRO A C   1 
ATOM   3310  O  O   . PRO A 1 420 ? 41.561 61.918  56.385  1.00 58.62  ? 420  PRO A O   1 
ATOM   3311  C  CB  . PRO A 1 420 ? 43.590 64.198  57.661  1.00 57.16  ? 420  PRO A CB  1 
ATOM   3312  C  CG  . PRO A 1 420 ? 44.685 64.556  56.721  1.00 56.72  ? 420  PRO A CG  1 
ATOM   3313  C  CD  . PRO A 1 420 ? 44.696 63.501  55.664  1.00 56.16  ? 420  PRO A CD  1 
ATOM   3314  N  N   . ASP A 1 421 ? 41.319 62.326  58.595  1.00 60.05  ? 421  ASP A N   1 
ATOM   3315  C  CA  . ASP A 1 421 ? 39.875 62.074  58.660  1.00 61.39  ? 421  ASP A CA  1 
ATOM   3316  C  C   . ASP A 1 421 ? 39.473 60.794  57.938  1.00 61.71  ? 421  ASP A C   1 
ATOM   3317  O  O   . ASP A 1 421 ? 38.605 60.057  58.410  1.00 62.34  ? 421  ASP A O   1 
ATOM   3318  C  CB  . ASP A 1 421 ? 39.081 63.275  58.112  1.00 61.72  ? 421  ASP A CB  1 
ATOM   3319  C  CG  . ASP A 1 421 ? 39.927 64.559  58.013  1.00 63.40  ? 421  ASP A CG  1 
ATOM   3320  O  OD1 . ASP A 1 421 ? 40.801 64.787  58.888  1.00 65.32  ? 421  ASP A OD1 1 
ATOM   3321  O  OD2 . ASP A 1 421 ? 39.797 65.392  57.082  1.00 64.39  ? 421  ASP A OD2 1 
ATOM   3322  N  N   . THR A 1 429 ? 46.048 50.191  57.087  1.00 73.58  ? 429  THR A N   1 
ATOM   3323  C  CA  . THR A 1 429 ? 46.313 51.437  56.379  1.00 73.59  ? 429  THR A CA  1 
ATOM   3324  C  C   . THR A 1 429 ? 46.868 51.195  54.962  1.00 73.14  ? 429  THR A C   1 
ATOM   3325  O  O   . THR A 1 429 ? 47.868 50.483  54.781  1.00 73.41  ? 429  THR A O   1 
ATOM   3326  C  CB  . THR A 1 429 ? 47.275 52.323  57.206  1.00 73.77  ? 429  THR A CB  1 
ATOM   3327  O  OG1 . THR A 1 429 ? 46.709 52.563  58.503  1.00 74.52  ? 429  THR A OG1 1 
ATOM   3328  C  CG2 . THR A 1 429 ? 47.373 53.722  56.601  1.00 74.03  ? 429  THR A CG2 1 
ATOM   3329  N  N   . PRO A 1 430 ? 46.209 51.799  53.970  1.00 72.38  ? 430  PRO A N   1 
ATOM   3330  C  CA  . PRO A 1 430 ? 46.573 51.650  52.546  1.00 71.23  ? 430  PRO A CA  1 
ATOM   3331  C  C   . PRO A 1 430 ? 47.993 52.082  52.175  1.00 69.91  ? 430  PRO A C   1 
ATOM   3332  O  O   . PRO A 1 430 ? 48.687 52.748  52.960  1.00 69.99  ? 430  PRO A O   1 
ATOM   3333  C  CB  . PRO A 1 430 ? 45.568 52.558  51.819  1.00 71.42  ? 430  PRO A CB  1 
ATOM   3334  C  CG  . PRO A 1 430 ? 44.420 52.739  52.791  1.00 72.39  ? 430  PRO A CG  1 
ATOM   3335  C  CD  . PRO A 1 430 ? 45.032 52.668  54.166  1.00 72.48  ? 430  PRO A CD  1 
ATOM   3336  N  N   . THR A 1 431 ? 48.385 51.712  50.956  1.00 67.98  ? 431  THR A N   1 
ATOM   3337  C  CA  . THR A 1 431 ? 49.697 52.003  50.382  1.00 66.04  ? 431  THR A CA  1 
ATOM   3338  C  C   . THR A 1 431 ? 49.542 52.068  48.860  1.00 64.63  ? 431  THR A C   1 
ATOM   3339  O  O   . THR A 1 431 ? 48.443 51.878  48.341  1.00 64.48  ? 431  THR A O   1 
ATOM   3340  C  CB  . THR A 1 431 ? 50.698 50.885  50.757  1.00 66.13  ? 431  THR A CB  1 
ATOM   3341  O  OG1 . THR A 1 431 ? 50.710 50.696  52.178  1.00 65.97  ? 431  THR A OG1 1 
ATOM   3342  C  CG2 . THR A 1 431 ? 52.129 51.303  50.444  1.00 66.00  ? 431  THR A CG2 1 
ATOM   3343  N  N   . LEU A 1 432 ? 50.631 52.332  48.145  1.00 62.77  ? 432  LEU A N   1 
ATOM   3344  C  CA  . LEU A 1 432 ? 50.591 52.374  46.680  1.00 60.96  ? 432  LEU A CA  1 
ATOM   3345  C  C   . LEU A 1 432 ? 50.525 50.970  46.075  1.00 59.64  ? 432  LEU A C   1 
ATOM   3346  O  O   . LEU A 1 432 ? 49.827 50.753  45.080  1.00 59.50  ? 432  LEU A O   1 
ATOM   3347  C  CB  . LEU A 1 432 ? 51.811 53.119  46.128  1.00 61.04  ? 432  LEU A CB  1 
ATOM   3348  C  CG  . LEU A 1 432 ? 51.976 54.578  46.561  1.00 20.00  ? 432  LEU A CG  1 
ATOM   3349  C  CD1 . LEU A 1 432 ? 53.227 55.184  45.945  1.00 20.00  ? 432  LEU A CD1 1 
ATOM   3350  C  CD2 . LEU A 1 432 ? 50.747 55.392  46.183  1.00 20.00  ? 432  LEU A CD2 1 
ATOM   3351  N  N   . GLY A 1 433 ? 51.257 50.027  46.659  1.00 58.02  ? 433  GLY A N   1 
ATOM   3352  C  CA  . GLY A 1 433 ? 51.238 48.650  46.194  1.00 55.97  ? 433  GLY A CA  1 
ATOM   3353  C  C   . GLY A 1 433 ? 52.571 48.095  45.721  1.00 54.44  ? 433  GLY A C   1 
ATOM   3354  O  O   . GLY A 1 433 ? 53.458 47.805  46.525  1.00 54.44  ? 433  GLY A O   1 
ATOM   3355  N  N   . PRO A 1 434 ? 52.699 47.932  44.407  1.00 53.17  ? 434  PRO A N   1 
ATOM   3356  C  CA  . PRO A 1 434 ? 53.911 47.380  43.784  1.00 51.96  ? 434  PRO A CA  1 
ATOM   3357  C  C   . PRO A 1 434 ? 55.056 48.381  43.641  1.00 50.69  ? 434  PRO A C   1 
ATOM   3358  O  O   . PRO A 1 434 ? 54.838 49.591  43.651  1.00 50.61  ? 434  PRO A O   1 
ATOM   3359  C  CB  . PRO A 1 434 ? 53.432 46.979  42.381  1.00 52.02  ? 434  PRO A CB  1 
ATOM   3360  C  CG  . PRO A 1 434 ? 51.937 47.196  42.381  1.00 52.56  ? 434  PRO A CG  1 
ATOM   3361  C  CD  . PRO A 1 434 ? 51.662 48.247  43.412  1.00 53.06  ? 434  PRO A CD  1 
ATOM   3362  N  N   . VAL A 1 435 ? 56.271 47.860  43.499  1.00 49.19  ? 435  VAL A N   1 
ATOM   3363  C  CA  . VAL A 1 435 ? 57.452 48.689  43.298  1.00 47.76  ? 435  VAL A CA  1 
ATOM   3364  C  C   . VAL A 1 435 ? 58.134 48.219  42.016  1.00 46.82  ? 435  VAL A C   1 
ATOM   3365  O  O   . VAL A 1 435 ? 57.670 47.274  41.383  1.00 46.67  ? 435  VAL A O   1 
ATOM   3366  C  CB  . VAL A 1 435 ? 58.425 48.608  44.495  1.00 47.81  ? 435  VAL A CB  1 
ATOM   3367  C  CG1 . VAL A 1 435 ? 59.236 49.894  44.615  1.00 47.51  ? 435  VAL A CG1 1 
ATOM   3368  C  CG2 . VAL A 1 435 ? 57.664 48.354  45.787  1.00 47.60  ? 435  VAL A CG2 1 
ATOM   3369  N  N   . THR A 1 436 ? 59.231 48.870  41.635  1.00 45.66  ? 436  THR A N   1 
ATOM   3370  C  CA  . THR A 1 436 ? 59.968 48.507  40.425  1.00 44.61  ? 436  THR A CA  1 
ATOM   3371  C  C   . THR A 1 436 ? 60.824 47.241  40.509  1.00 43.97  ? 436  THR A C   1 
ATOM   3372  O  O   . THR A 1 436 ? 61.802 47.184  41.254  1.00 43.87  ? 436  THR A O   1 
ATOM   3373  C  CB  . THR A 1 436 ? 60.844 49.679  39.997  1.00 44.55  ? 436  THR A CB  1 
ATOM   3374  O  OG1 . THR A 1 436 ? 60.058 50.876  39.986  1.00 44.70  ? 436  THR A OG1 1 
ATOM   3375  C  CG2 . THR A 1 436 ? 61.270 49.511  38.551  1.00 44.29  ? 436  THR A CG2 1 
ATOM   3376  N  N   . PRO A 1 437 ? 60.460 46.237  39.717  1.00 43.28  ? 437  PRO A N   1 
ATOM   3377  C  CA  . PRO A 1 437 ? 61.174 44.959  39.688  1.00 42.77  ? 437  PRO A CA  1 
ATOM   3378  C  C   . PRO A 1 437 ? 62.653 45.124  39.360  1.00 42.39  ? 437  PRO A C   1 
ATOM   3379  O  O   . PRO A 1 437 ? 63.012 45.994  38.571  1.00 42.18  ? 437  PRO A O   1 
ATOM   3380  C  CB  . PRO A 1 437 ? 60.475 44.207  38.557  1.00 42.69  ? 437  PRO A CB  1 
ATOM   3381  C  CG  . PRO A 1 437 ? 59.126 44.808  38.489  1.00 42.77  ? 437  PRO A CG  1 
ATOM   3382  C  CD  . PRO A 1 437 ? 59.320 46.258  38.784  1.00 43.18  ? 437  PRO A CD  1 
ATOM   3383  N  N   . GLU A 1 438 ? 63.503 44.295  39.960  1.00 42.15  ? 438  GLU A N   1 
ATOM   3384  C  CA  . GLU A 1 438 ? 64.935 44.368  39.689  1.00 41.84  ? 438  GLU A CA  1 
ATOM   3385  C  C   . GLU A 1 438 ? 65.442 43.193  38.859  1.00 41.77  ? 438  GLU A C   1 
ATOM   3386  O  O   . GLU A 1 438 ? 65.227 42.033  39.204  1.00 41.76  ? 438  GLU A O   1 
ATOM   3387  C  CB  . GLU A 1 438 ? 65.753 44.506  40.976  1.00 41.64  ? 438  GLU A CB  1 
ATOM   3388  C  CG  . GLU A 1 438 ? 67.230 44.763  40.713  1.00 41.20  ? 438  GLU A CG  1 
ATOM   3389  C  CD  . GLU A 1 438 ? 67.946 45.395  41.895  1.00 41.00  ? 438  GLU A CD  1 
ATOM   3390  O  OE1 . GLU A 1 438 ? 67.386 45.385  43.011  1.00 40.78  ? 438  GLU A OE1 1 
ATOM   3391  O  OE2 . GLU A 1 438 ? 69.078 45.897  41.711  1.00 40.72  ? 438  GLU A OE2 1 
ATOM   3392  N  N   . ILE A 1 439 ? 66.107 43.530  37.758  1.00 41.72  ? 439  ILE A N   1 
ATOM   3393  C  CA  . ILE A 1 439 ? 66.711 42.578  36.826  1.00 41.59  ? 439  ILE A CA  1 
ATOM   3394  C  C   . ILE A 1 439 ? 66.705 41.119  37.272  1.00 41.35  ? 439  ILE A C   1 
ATOM   3395  O  O   . ILE A 1 439 ? 65.797 40.358  36.934  1.00 41.48  ? 439  ILE A O   1 
ATOM   3396  C  CB  . ILE A 1 439 ? 68.157 43.030  36.502  1.00 41.73  ? 439  ILE A CB  1 
ATOM   3397  C  CG1 . ILE A 1 439 ? 68.134 44.130  35.443  1.00 42.01  ? 439  ILE A CG1 1 
ATOM   3398  C  CG2 . ILE A 1 439 ? 68.993 41.876  35.992  1.00 41.81  ? 439  ILE A CG2 1 
ATOM   3399  C  CD1 . ILE A 1 439 ? 67.592 43.650  34.114  1.00 41.90  ? 439  ILE A CD1 1 
ATOM   3400  N  N   . CYS A 1 440 ? 67.726 40.732  38.026  1.00 40.89  ? 440  CYS A N   1 
ATOM   3401  C  CA  . CYS A 1 440 ? 67.876 39.354  38.453  1.00 40.43  ? 440  CYS A CA  1 
ATOM   3402  C  C   . CYS A 1 440 ? 67.706 39.225  39.947  1.00 40.27  ? 440  CYS A C   1 
ATOM   3403  O  O   . CYS A 1 440 ? 67.021 38.329  40.431  1.00 40.43  ? 440  CYS A O   1 
ATOM   3404  C  CB  . CYS A 1 440 ? 69.257 38.847  38.062  1.00 40.39  ? 440  CYS A CB  1 
ATOM   3405  S  SG  . CYS A 1 440 ? 69.452 38.574  36.293  1.00 39.85  ? 440  CYS A SG  1 
ATOM   3406  N  N   . LYS A 1 441 ? 68.348 40.124  40.676  1.00 39.90  ? 441  LYS A N   1 
ATOM   3407  C  CA  . LYS A 1 441 ? 68.294 40.116  42.126  1.00 39.61  ? 441  LYS A CA  1 
ATOM   3408  C  C   . LYS A 1 441 ? 67.226 39.204  42.708  1.00 39.41  ? 441  LYS A C   1 
ATOM   3409  O  O   . LYS A 1 441 ? 67.538 38.314  43.493  1.00 39.33  ? 441  LYS A O   1 
ATOM   3410  C  CB  . LYS A 1 441 ? 68.115 41.530  42.650  1.00 39.62  ? 441  LYS A CB  1 
ATOM   3411  C  CG  . LYS A 1 441 ? 69.356 42.364  42.495  1.00 39.83  ? 441  LYS A CG  1 
ATOM   3412  C  CD  . LYS A 1 441 ? 69.378 43.451  43.535  1.00 40.50  ? 441  LYS A CD  1 
ATOM   3413  C  CE  . LYS A 1 441 ? 70.695 44.194  43.530  1.00 40.91  ? 441  LYS A CE  1 
ATOM   3414  N  NZ  . LYS A 1 441 ? 70.565 45.482  44.262  1.00 41.19  ? 441  LYS A NZ  1 
ATOM   3415  N  N   . GLN A 1 442 ? 65.968 39.415  42.335  1.00 39.20  ? 442  GLN A N   1 
ATOM   3416  C  CA  . GLN A 1 442 ? 64.899 38.577  42.872  1.00 39.05  ? 442  GLN A CA  1 
ATOM   3417  C  C   . GLN A 1 442 ? 64.185 37.746  41.809  1.00 38.79  ? 442  GLN A C   1 
ATOM   3418  O  O   . GLN A 1 442 ? 64.296 38.010  40.607  1.00 38.77  ? 442  GLN A O   1 
ATOM   3419  C  CB  . GLN A 1 442 ? 63.886 39.412  43.659  1.00 39.17  ? 442  GLN A CB  1 
ATOM   3420  C  CG  . GLN A 1 442 ? 63.330 38.692  44.887  1.00 39.48  ? 442  GLN A CG  1 
ATOM   3421  C  CD  . GLN A 1 442 ? 62.097 39.364  45.461  1.00 39.86  ? 442  GLN A CD  1 
ATOM   3422  O  OE1 . GLN A 1 442 ? 61.229 38.695  46.022  1.00 39.72  ? 442  GLN A OE1 1 
ATOM   3423  N  NE2 . GLN A 1 442 ? 62.015 40.685  45.319  1.00 40.07  ? 442  GLN A NE2 1 
ATOM   3424  N  N   . ASP A 1 443 ? 63.453 36.736  42.267  1.00 38.40  ? 443  ASP A N   1 
ATOM   3425  C  CA  . ASP A 1 443 ? 62.711 35.863  41.371  1.00 38.02  ? 443  ASP A CA  1 
ATOM   3426  C  C   . ASP A 1 443 ? 61.658 36.649  40.613  1.00 37.76  ? 443  ASP A C   1 
ATOM   3427  O  O   . ASP A 1 443 ? 60.958 37.486  41.185  1.00 37.73  ? 443  ASP A O   1 
ATOM   3428  C  CB  . ASP A 1 443 ? 62.066 34.722  42.147  1.00 37.98  ? 443  ASP A CB  1 
ATOM   3429  C  CG  . ASP A 1 443 ? 63.083 33.859  42.846  1.00 37.81  ? 443  ASP A CG  1 
ATOM   3430  O  OD1 . ASP A 1 443 ? 63.517 34.120  43.986  1.00 38.05  ? 443  ASP A OD1 1 
ATOM   3431  O  OD2 . ASP A 1 443 ? 63.516 32.850  42.256  1.00 37.45  ? 443  ASP A OD2 1 
ATOM   3432  N  N   . ILE A 1 444 ? 61.543 36.380  39.322  1.00 37.35  ? 444  ILE A N   1 
ATOM   3433  C  CA  . ILE A 1 444 ? 60.583 37.112  38.527  1.00 37.01  ? 444  ILE A CA  1 
ATOM   3434  C  C   . ILE A 1 444 ? 59.848 36.240  37.511  1.00 36.84  ? 444  ILE A C   1 
ATOM   3435  O  O   . ILE A 1 444 ? 60.456 35.556  36.689  1.00 36.90  ? 444  ILE A O   1 
ATOM   3436  C  CB  . ILE A 1 444 ? 61.280 38.326  37.863  1.00 36.99  ? 444  ILE A CB  1 
ATOM   3437  C  CG1 . ILE A 1 444 ? 60.332 39.521  37.796  1.00 36.61  ? 444  ILE A CG1 1 
ATOM   3438  C  CG2 . ILE A 1 444 ? 61.841 37.968  36.499  1.00 37.11  ? 444  ILE A CG2 1 
ATOM   3439  C  CD1 . ILE A 1 444 ? 61.019 40.823  38.077  1.00 36.12  ? 444  ILE A CD1 1 
ATOM   3440  N  N   . VAL A 1 445 ? 58.525 36.238  37.611  1.00 36.57  ? 445  VAL A N   1 
ATOM   3441  C  CA  . VAL A 1 445 ? 57.691 35.560  36.635  1.00 36.34  ? 445  VAL A CA  1 
ATOM   3442  C  C   . VAL A 1 445 ? 57.177 36.646  35.692  1.00 36.25  ? 445  VAL A C   1 
ATOM   3443  O  O   . VAL A 1 445 ? 56.250 37.394  36.022  1.00 36.33  ? 445  VAL A O   1 
ATOM   3444  C  CB  . VAL A 1 445 ? 56.526 34.809  37.297  1.00 36.34  ? 445  VAL A CB  1 
ATOM   3445  C  CG1 . VAL A 1 445 ? 55.995 35.586  38.499  1.00 36.32  ? 445  VAL A CG1 1 
ATOM   3446  C  CG2 . VAL A 1 445 ? 55.424 34.521  36.280  1.00 36.19  ? 445  VAL A CG2 1 
ATOM   3447  N  N   . PHE A 1 446 ? 57.811 36.755  34.530  1.00 35.92  ? 446  PHE A N   1 
ATOM   3448  C  CA  . PHE A 1 446 ? 57.462 37.790  33.569  1.00 35.44  ? 446  PHE A CA  1 
ATOM   3449  C  C   . PHE A 1 446 ? 56.023 37.674  33.105  1.00 35.35  ? 446  PHE A C   1 
ATOM   3450  O  O   . PHE A 1 446 ? 55.454 36.587  33.079  1.00 35.26  ? 446  PHE A O   1 
ATOM   3451  C  CB  . PHE A 1 446 ? 58.402 37.737  32.373  1.00 35.37  ? 446  PHE A CB  1 
ATOM   3452  C  CG  . PHE A 1 446 ? 59.808 38.126  32.699  1.00 34.85  ? 446  PHE A CG  1 
ATOM   3453  C  CD1 . PHE A 1 446 ? 60.132 39.446  32.947  1.00 34.50  ? 446  PHE A CD1 1 
ATOM   3454  C  CD2 . PHE A 1 446 ? 60.805 37.174  32.756  1.00 34.47  ? 446  PHE A CD2 1 
ATOM   3455  C  CE1 . PHE A 1 446 ? 61.424 39.810  33.245  1.00 34.39  ? 446  PHE A CE1 1 
ATOM   3456  C  CE2 . PHE A 1 446 ? 62.098 37.533  33.053  1.00 34.46  ? 446  PHE A CE2 1 
ATOM   3457  C  CZ  . PHE A 1 446 ? 62.407 38.855  33.299  1.00 34.24  ? 446  PHE A CZ  1 
ATOM   3458  N  N   . ASP A 1 447 ? 55.435 38.805  32.737  1.00 35.31  ? 447  ASP A N   1 
ATOM   3459  C  CA  . ASP A 1 447 ? 54.051 38.811  32.280  1.00 35.14  ? 447  ASP A CA  1 
ATOM   3460  C  C   . ASP A 1 447 ? 53.945 38.454  30.804  1.00 34.96  ? 447  ASP A C   1 
ATOM   3461  O  O   . ASP A 1 447 ? 52.895 38.017  30.335  1.00 34.81  ? 447  ASP A O   1 
ATOM   3462  C  CB  . ASP A 1 447 ? 53.384 40.144  32.595  1.00 35.08  ? 447  ASP A CB  1 
ATOM   3463  C  CG  . ASP A 1 447 ? 52.917 40.218  34.031  1.00 35.16  ? 447  ASP A CG  1 
ATOM   3464  O  OD1 . ASP A 1 447 ? 51.837 39.724  34.414  1.00 35.03  ? 447  ASP A OD1 1 
ATOM   3465  O  OD2 . ASP A 1 447 ? 53.653 40.768  34.877  1.00 35.51  ? 447  ASP A OD2 1 
ATOM   3466  N  N   . GLY A 1 448 ? 55.053 38.624  30.090  1.00 34.79  ? 448  GLY A N   1 
ATOM   3467  C  CA  . GLY A 1 448 ? 55.125 38.271  28.688  1.00 34.49  ? 448  GLY A CA  1 
ATOM   3468  C  C   . GLY A 1 448 ? 56.519 38.452  28.125  1.00 34.28  ? 448  GLY A C   1 
ATOM   3469  O  O   . GLY A 1 448 ? 57.161 39.466  28.363  1.00 34.38  ? 448  GLY A O   1 
ATOM   3470  N  N   . ILE A 1 449 ? 57.005 37.448  27.409  1.00 34.13  ? 449  ILE A N   1 
ATOM   3471  C  CA  . ILE A 1 449 ? 58.264 37.568  26.699  1.00 34.11  ? 449  ILE A CA  1 
ATOM   3472  C  C   . ILE A 1 449 ? 57.833 37.613  25.256  1.00 34.26  ? 449  ILE A C   1 
ATOM   3473  O  O   . ILE A 1 449 ? 56.865 36.954  24.890  1.00 34.25  ? 449  ILE A O   1 
ATOM   3474  C  CB  . ILE A 1 449 ? 59.145 36.334  26.903  1.00 34.07  ? 449  ILE A CB  1 
ATOM   3475  C  CG1 . ILE A 1 449 ? 59.196 35.922  28.376  1.00 33.98  ? 449  ILE A CG1 1 
ATOM   3476  C  CG2 . ILE A 1 449 ? 60.543 36.597  26.355  1.00 33.91  ? 449  ILE A CG2 1 
ATOM   3477  C  CD1 . ILE A 1 449 ? 60.524 36.182  29.042  1.00 33.87  ? 449  ILE A CD1 1 
ATOM   3478  N  N   . ALA A 1 450 ? 58.522 38.385  24.426  1.00 34.51  ? 450  ALA A N   1 
ATOM   3479  C  CA  . ALA A 1 450 ? 58.122 38.457  23.028  1.00 34.78  ? 450  ALA A CA  1 
ATOM   3480  C  C   . ALA A 1 450 ? 59.151 39.062  22.086  1.00 34.99  ? 450  ALA A C   1 
ATOM   3481  O  O   . ALA A 1 450 ? 59.976 39.890  22.479  1.00 34.87  ? 450  ALA A O   1 
ATOM   3482  C  CB  . ALA A 1 450 ? 56.796 39.195  22.899  1.00 34.83  ? 450  ALA A CB  1 
ATOM   3483  N  N   . GLN A 1 451 ? 59.081 38.628  20.833  1.00 35.26  ? 451  GLN A N   1 
ATOM   3484  C  CA  . GLN A 1 451 ? 59.908 39.168  19.771  1.00 35.73  ? 451  GLN A CA  1 
ATOM   3485  C  C   . GLN A 1 451 ? 59.080 40.245  19.091  1.00 35.83  ? 451  GLN A C   1 
ATOM   3486  O  O   . GLN A 1 451 ? 58.280 39.962  18.208  1.00 35.91  ? 451  GLN A O   1 
ATOM   3487  C  CB  . GLN A 1 451 ? 60.279 38.068  18.775  1.00 35.85  ? 451  GLN A CB  1 
ATOM   3488  C  CG  . GLN A 1 451 ? 59.214 36.977  18.602  1.00 36.95  ? 451  GLN A CG  1 
ATOM   3489  C  CD  . GLN A 1 451 ? 57.981 37.452  17.838  1.00 38.41  ? 451  GLN A CD  1 
ATOM   3490  O  OE1 . GLN A 1 451 ? 58.032 37.655  16.620  1.00 38.71  ? 451  GLN A OE1 1 
ATOM   3491  N  NE2 . GLN A 1 451 ? 56.872 37.630  18.552  1.00 39.11  ? 451  GLN A NE2 1 
ATOM   3492  N  N   . ILE A 1 452 ? 59.257 41.489  19.507  1.00 35.97  ? 452  ILE A N   1 
ATOM   3493  C  CA  . ILE A 1 452 ? 58.436 42.556  18.961  1.00 36.16  ? 452  ILE A CA  1 
ATOM   3494  C  C   . ILE A 1 452 ? 58.917 43.071  17.605  1.00 36.40  ? 452  ILE A C   1 
ATOM   3495  O  O   . ILE A 1 452 ? 58.156 43.090  16.641  1.00 36.52  ? 452  ILE A O   1 
ATOM   3496  C  CB  . ILE A 1 452 ? 58.296 43.695  19.977  1.00 36.13  ? 452  ILE A CB  1 
ATOM   3497  C  CG1 . ILE A 1 452 ? 57.568 43.189  21.222  1.00 36.07  ? 452  ILE A CG1 1 
ATOM   3498  C  CG2 . ILE A 1 452 ? 57.548 44.863  19.364  1.00 35.98  ? 452  ILE A CG2 1 
ATOM   3499  C  CD1 . ILE A 1 452 ? 56.072 43.383  21.174  1.00 35.92  ? 452  ILE A CD1 1 
ATOM   3500  N  N   . ARG A 1 453 ? 60.176 43.483  17.530  1.00 36.59  ? 453  ARG A N   1 
ATOM   3501  C  CA  . ARG A 1 453 ? 60.725 44.026  16.294  1.00 36.79  ? 453  ARG A CA  1 
ATOM   3502  C  C   . ARG A 1 453 ? 62.014 43.293  15.968  1.00 36.78  ? 453  ARG A C   1 
ATOM   3503  O  O   . ARG A 1 453 ? 62.043 42.390  15.137  1.00 36.87  ? 453  ARG A O   1 
ATOM   3504  C  CB  . ARG A 1 453 ? 60.992 45.522  16.466  1.00 36.90  ? 453  ARG A CB  1 
ATOM   3505  C  CG  . ARG A 1 453 ? 61.397 46.259  15.195  1.00 37.46  ? 453  ARG A CG  1 
ATOM   3506  C  CD  . ARG A 1 453 ? 60.241 46.602  14.263  1.00 38.15  ? 453  ARG A CD  1 
ATOM   3507  N  NE  . ARG A 1 453 ? 59.208 47.417  14.905  1.00 38.68  ? 453  ARG A NE  1 
ATOM   3508  C  CZ  . ARG A 1 453 ? 59.330 48.710  15.183  1.00 39.00  ? 453  ARG A CZ  1 
ATOM   3509  N  NH1 . ARG A 1 453 ? 60.449 49.357  14.888  1.00 39.49  ? 453  ARG A NH1 1 
ATOM   3510  N  NH2 . ARG A 1 453 ? 58.330 49.363  15.760  1.00 39.02  ? 453  ARG A NH2 1 
ATOM   3511  N  N   . GLY A 1 454 ? 63.085 43.699  16.629  1.00 36.80  ? 454  GLY A N   1 
ATOM   3512  C  CA  . GLY A 1 454 ? 64.360 43.024  16.516  1.00 36.83  ? 454  GLY A CA  1 
ATOM   3513  C  C   . GLY A 1 454 ? 64.732 42.732  17.950  1.00 36.84  ? 454  GLY A C   1 
ATOM   3514  O  O   . GLY A 1 454 ? 65.439 41.773  18.261  1.00 36.82  ? 454  GLY A O   1 
ATOM   3515  N  N   . GLU A 1 455 ? 64.213 43.581  18.830  1.00 36.87  ? 455  GLU A N   1 
ATOM   3516  C  CA  . GLU A 1 455 ? 64.444 43.480  20.262  1.00 36.86  ? 455  GLU A CA  1 
ATOM   3517  C  C   . GLU A 1 455 ? 63.597 42.363  20.866  1.00 36.88  ? 455  GLU A C   1 
ATOM   3518  O  O   . GLU A 1 455 ? 62.559 41.994  20.316  1.00 36.93  ? 455  GLU A O   1 
ATOM   3519  C  CB  . GLU A 1 455 ? 64.091 44.807  20.935  1.00 36.85  ? 455  GLU A CB  1 
ATOM   3520  C  CG  . GLU A 1 455 ? 64.543 46.044  20.178  1.00 36.44  ? 455  GLU A CG  1 
ATOM   3521  C  CD  . GLU A 1 455 ? 66.007 46.356  20.398  1.00 36.07  ? 455  GLU A CD  1 
ATOM   3522  O  OE1 . GLU A 1 455 ? 66.471 46.235  21.549  1.00 35.83  ? 455  GLU A OE1 1 
ATOM   3523  O  OE2 . GLU A 1 455 ? 66.693 46.723  19.422  1.00 36.24  ? 455  GLU A OE2 1 
ATOM   3524  N  N   . ILE A 1 456 ? 64.045 41.835  22.002  1.00 36.81  ? 456  ILE A N   1 
ATOM   3525  C  CA  . ILE A 1 456 ? 63.319 40.784  22.702  1.00 36.78  ? 456  ILE A CA  1 
ATOM   3526  C  C   . ILE A 1 456 ? 62.837 41.328  24.043  1.00 36.72  ? 456  ILE A C   1 
ATOM   3527  O  O   . ILE A 1 456 ? 63.527 41.209  25.052  1.00 36.78  ? 456  ILE A O   1 
ATOM   3528  C  CB  . ILE A 1 456 ? 64.226 39.561  22.917  1.00 36.85  ? 456  ILE A CB  1 
ATOM   3529  C  CG1 . ILE A 1 456 ? 65.024 39.254  21.647  1.00 37.04  ? 456  ILE A CG1 1 
ATOM   3530  C  CG2 . ILE A 1 456 ? 63.407 38.352  23.347  1.00 36.90  ? 456  ILE A CG2 1 
ATOM   3531  C  CD1 . ILE A 1 456 ? 64.167 38.870  20.459  1.00 37.48  ? 456  ILE A CD1 1 
ATOM   3532  N  N   . PHE A 1 457 ? 61.651 41.924  24.047  1.00 36.66  ? 457  PHE A N   1 
ATOM   3533  C  CA  . PHE A 1 457 ? 61.093 42.545  25.247  1.00 36.50  ? 457  PHE A CA  1 
ATOM   3534  C  C   . PHE A 1 457 ? 60.710 41.552  26.347  1.00 36.43  ? 457  PHE A C   1 
ATOM   3535  O  O   . PHE A 1 457 ? 60.232 40.454  26.070  1.00 36.45  ? 457  PHE A O   1 
ATOM   3536  C  CB  . PHE A 1 457 ? 59.865 43.391  24.886  1.00 36.42  ? 457  PHE A CB  1 
ATOM   3537  C  CG  . PHE A 1 457 ? 60.165 44.565  24.001  1.00 36.38  ? 457  PHE A CG  1 
ATOM   3538  C  CD1 . PHE A 1 457 ? 60.874 44.405  22.825  1.00 36.41  ? 457  PHE A CD1 1 
ATOM   3539  C  CD2 . PHE A 1 457 ? 59.721 45.834  24.340  1.00 36.54  ? 457  PHE A CD2 1 
ATOM   3540  C  CE1 . PHE A 1 457 ? 61.144 45.494  22.009  1.00 36.57  ? 457  PHE A CE1 1 
ATOM   3541  C  CE2 . PHE A 1 457 ? 59.988 46.924  23.529  1.00 36.12  ? 457  PHE A CE2 1 
ATOM   3542  C  CZ  . PHE A 1 457 ? 60.701 46.754  22.364  1.00 36.18  ? 457  PHE A CZ  1 
ATOM   3543  N  N   . PHE A 1 458 ? 60.933 41.957  27.593  1.00 36.35  ? 458  PHE A N   1 
ATOM   3544  C  CA  . PHE A 1 458 ? 60.526 41.196  28.768  1.00 36.38  ? 458  PHE A CA  1 
ATOM   3545  C  C   . PHE A 1 458 ? 59.508 42.080  29.481  1.00 36.58  ? 458  PHE A C   1 
ATOM   3546  O  O   . PHE A 1 458 ? 59.780 43.251  29.741  1.00 36.62  ? 458  PHE A O   1 
ATOM   3547  C  CB  . PHE A 1 458 ? 61.708 40.972  29.715  1.00 36.30  ? 458  PHE A CB  1 
ATOM   3548  C  CG  . PHE A 1 458 ? 62.645 39.870  29.301  1.00 35.69  ? 458  PHE A CG  1 
ATOM   3549  C  CD1 . PHE A 1 458 ? 63.468 40.009  28.201  1.00 35.31  ? 458  PHE A CD1 1 
ATOM   3550  C  CD2 . PHE A 1 458 ? 62.732 38.710  30.047  1.00 35.04  ? 458  PHE A CD2 1 
ATOM   3551  C  CE1 . PHE A 1 458 ? 64.338 39.000  27.842  1.00 34.94  ? 458  PHE A CE1 1 
ATOM   3552  C  CE2 . PHE A 1 458 ? 63.598 37.704  29.692  1.00 34.55  ? 458  PHE A CE2 1 
ATOM   3553  C  CZ  . PHE A 1 458 ? 64.400 37.848  28.589  1.00 34.58  ? 458  PHE A CZ  1 
ATOM   3554  N  N   . PHE A 1 459 ? 58.348 41.535  29.823  1.00 36.76  ? 459  PHE A N   1 
ATOM   3555  C  CA  . PHE A 1 459 ? 57.316 42.357  30.449  1.00 36.98  ? 459  PHE A CA  1 
ATOM   3556  C  C   . PHE A 1 459 ? 57.122 42.115  31.938  1.00 37.18  ? 459  PHE A C   1 
ATOM   3557  O  O   . PHE A 1 459 ? 57.690 41.192  32.517  1.00 37.29  ? 459  PHE A O   1 
ATOM   3558  C  CB  . PHE A 1 459 ? 55.983 42.201  29.714  1.00 37.02  ? 459  PHE A CB  1 
ATOM   3559  C  CG  . PHE A 1 459 ? 55.956 42.860  28.369  1.00 36.97  ? 459  PHE A CG  1 
ATOM   3560  C  CD1 . PHE A 1 459 ? 56.544 42.252  27.275  1.00 37.07  ? 459  PHE A CD1 1 
ATOM   3561  C  CD2 . PHE A 1 459 ? 55.349 44.093  28.200  1.00 37.17  ? 459  PHE A CD2 1 
ATOM   3562  C  CE1 . PHE A 1 459 ? 56.525 42.859  26.035  1.00 37.55  ? 459  PHE A CE1 1 
ATOM   3563  C  CE2 . PHE A 1 459 ? 55.326 44.710  26.960  1.00 37.25  ? 459  PHE A CE2 1 
ATOM   3564  C  CZ  . PHE A 1 459 ? 55.915 44.093  25.877  1.00 37.67  ? 459  PHE A CZ  1 
ATOM   3565  N  N   . LYS A 1 460 ? 56.306 42.967  32.545  1.00 37.41  ? 460  LYS A N   1 
ATOM   3566  C  CA  . LYS A 1 460 ? 55.995 42.878  33.962  1.00 37.57  ? 460  LYS A CA  1 
ATOM   3567  C  C   . LYS A 1 460 ? 54.773 43.743  34.263  1.00 37.75  ? 460  LYS A C   1 
ATOM   3568  O  O   . LYS A 1 460 ? 53.825 43.790  33.470  1.00 37.95  ? 460  LYS A O   1 
ATOM   3569  C  CB  . LYS A 1 460 ? 57.190 43.326  34.799  1.00 37.54  ? 460  LYS A CB  1 
ATOM   3570  C  CG  . LYS A 1 460 ? 57.230 42.699  36.178  1.00 37.47  ? 460  LYS A CG  1 
ATOM   3571  C  CD  . LYS A 1 460 ? 56.718 41.271  36.130  1.00 37.24  ? 460  LYS A CD  1 
ATOM   3572  C  CE  . LYS A 1 460 ? 56.228 40.814  37.495  1.00 36.94  ? 460  LYS A CE  1 
ATOM   3573  N  NZ  . LYS A 1 460 ? 55.134 39.811  37.372  1.00 36.44  ? 460  LYS A NZ  1 
ATOM   3574  N  N   . ASP A 1 461 ? 54.785 44.427  35.399  1.00 37.73  ? 461  ASP A N   1 
ATOM   3575  C  CA  . ASP A 1 461 ? 53.659 45.280  35.750  1.00 37.77  ? 461  ASP A CA  1 
ATOM   3576  C  C   . ASP A 1 461 ? 53.610 46.493  34.830  1.00 37.75  ? 461  ASP A C   1 
ATOM   3577  O  O   . ASP A 1 461 ? 52.768 46.570  33.938  1.00 37.74  ? 461  ASP A O   1 
ATOM   3578  C  CB  . ASP A 1 461 ? 53.727 45.708  37.217  1.00 37.83  ? 461  ASP A CB  1 
ATOM   3579  C  CG  . ASP A 1 461 ? 53.721 44.527  38.167  1.00 37.67  ? 461  ASP A CG  1 
ATOM   3580  O  OD1 . ASP A 1 461 ? 52.831 43.657  38.036  1.00 37.22  ? 461  ASP A OD1 1 
ATOM   3581  O  OD2 . ASP A 1 461 ? 54.572 44.385  39.071  1.00 37.42  ? 461  ASP A OD2 1 
ATOM   3582  N  N   . ARG A 1 462 ? 54.518 47.436  35.041  1.00 37.74  ? 462  ARG A N   1 
ATOM   3583  C  CA  . ARG A 1 462 ? 54.565 48.627  34.205  1.00 37.79  ? 462  ARG A CA  1 
ATOM   3584  C  C   . ARG A 1 462 ? 55.910 48.750  33.505  1.00 37.69  ? 462  ARG A C   1 
ATOM   3585  O  O   . ARG A 1 462 ? 56.288 49.845  33.085  1.00 37.80  ? 462  ARG A O   1 
ATOM   3586  C  CB  . ARG A 1 462 ? 54.341 49.894  35.036  1.00 37.91  ? 462  ARG A CB  1 
ATOM   3587  C  CG  . ARG A 1 462 ? 53.156 49.868  35.977  1.00 38.25  ? 462  ARG A CG  1 
ATOM   3588  C  CD  . ARG A 1 462 ? 52.555 51.243  36.238  1.00 38.77  ? 462  ARG A CD  1 
ATOM   3589  N  NE  . ARG A 1 462 ? 53.542 52.321  36.198  1.00 40.14  ? 462  ARG A NE  1 
ATOM   3590  C  CZ  . ARG A 1 462 ? 53.237 53.620  36.245  1.00 41.22  ? 462  ARG A CZ  1 
ATOM   3591  N  NH1 . ARG A 1 462 ? 51.968 54.010  36.340  1.00 41.55  ? 462  ARG A NH1 1 
ATOM   3592  N  NH2 . ARG A 1 462 ? 54.199 54.537  36.201  1.00 41.10  ? 462  ARG A NH2 1 
ATOM   3593  N  N   . PHE A 1 463 ? 56.626 47.638  33.362  1.00 37.53  ? 463  PHE A N   1 
ATOM   3594  C  CA  . PHE A 1 463 ? 57.981 47.701  32.817  1.00 37.23  ? 463  PHE A CA  1 
ATOM   3595  C  C   . PHE A 1 463 ? 58.377 46.634  31.805  1.00 37.20  ? 463  PHE A C   1 
ATOM   3596  O  O   . PHE A 1 463 ? 57.962 45.476  31.897  1.00 37.33  ? 463  PHE A O   1 
ATOM   3597  C  CB  . PHE A 1 463 ? 58.992 47.676  33.962  1.00 37.10  ? 463  PHE A CB  1 
ATOM   3598  C  CG  . PHE A 1 463 ? 58.843 48.813  34.926  1.00 36.30  ? 463  PHE A CG  1 
ATOM   3599  C  CD1 . PHE A 1 463 ? 59.417 50.040  34.661  1.00 35.33  ? 463  PHE A CD1 1 
ATOM   3600  C  CD2 . PHE A 1 463 ? 58.133 48.650  36.101  1.00 35.78  ? 463  PHE A CD2 1 
ATOM   3601  C  CE1 . PHE A 1 463 ? 59.285 51.081  35.549  1.00 35.23  ? 463  PHE A CE1 1 
ATOM   3602  C  CE2 . PHE A 1 463 ? 57.998 49.688  36.991  1.00 35.46  ? 463  PHE A CE2 1 
ATOM   3603  C  CZ  . PHE A 1 463 ? 58.573 50.907  36.713  1.00 35.35  ? 463  PHE A CZ  1 
ATOM   3604  N  N   . ILE A 1 464 ? 59.209 47.043  30.851  1.00 37.02  ? 464  ILE A N   1 
ATOM   3605  C  CA  . ILE A 1 464 ? 59.773 46.130  29.867  1.00 36.98  ? 464  ILE A CA  1 
ATOM   3606  C  C   . ILE A 1 464 ? 61.291 46.250  29.818  1.00 37.07  ? 464  ILE A C   1 
ATOM   3607  O  O   . ILE A 1 464 ? 61.839 47.352  29.773  1.00 37.30  ? 464  ILE A O   1 
ATOM   3608  C  CB  . ILE A 1 464 ? 59.173 46.355  28.449  1.00 36.83  ? 464  ILE A CB  1 
ATOM   3609  C  CG1 . ILE A 1 464 ? 59.304 47.817  28.002  1.00 36.71  ? 464  ILE A CG1 1 
ATOM   3610  C  CG2 . ILE A 1 464 ? 57.733 45.934  28.412  1.00 36.81  ? 464  ILE A CG2 1 
ATOM   3611  C  CD1 . ILE A 1 464 ? 60.475 48.089  27.075  1.00 36.08  ? 464  ILE A CD1 1 
ATOM   3612  N  N   . TRP A 1 465 ? 61.970 45.114  29.874  1.00 37.01  ? 465  TRP A N   1 
ATOM   3613  C  CA  . TRP A 1 465 ? 63.403 45.081  29.674  1.00 36.98  ? 465  TRP A CA  1 
ATOM   3614  C  C   . TRP A 1 465 ? 63.485 44.458  28.311  1.00 37.24  ? 465  TRP A C   1 
ATOM   3615  O  O   . TRP A 1 465 ? 62.665 43.606  27.980  1.00 37.37  ? 465  TRP A O   1 
ATOM   3616  C  CB  . TRP A 1 465 ? 64.089 44.132  30.657  1.00 36.85  ? 465  TRP A CB  1 
ATOM   3617  C  CG  . TRP A 1 465 ? 63.947 44.480  32.092  1.00 36.24  ? 465  TRP A CG  1 
ATOM   3618  C  CD1 . TRP A 1 465 ? 64.906 44.993  32.902  1.00 36.30  ? 465  TRP A CD1 1 
ATOM   3619  C  CD2 . TRP A 1 465 ? 62.784 44.316  32.902  1.00 35.64  ? 465  TRP A CD2 1 
ATOM   3620  N  NE1 . TRP A 1 465 ? 64.411 45.171  34.171  1.00 36.26  ? 465  TRP A NE1 1 
ATOM   3621  C  CE2 . TRP A 1 465 ? 63.105 44.763  34.194  1.00 35.57  ? 465  TRP A CE2 1 
ATOM   3622  C  CE3 . TRP A 1 465 ? 61.494 43.846  32.663  1.00 35.90  ? 465  TRP A CE3 1 
ATOM   3623  C  CZ2 . TRP A 1 465 ? 62.190 44.754  35.236  1.00 35.49  ? 465  TRP A CZ2 1 
ATOM   3624  C  CZ3 . TRP A 1 465 ? 60.591 43.836  33.696  1.00 36.12  ? 465  TRP A CZ3 1 
ATOM   3625  C  CH2 . TRP A 1 465 ? 60.941 44.287  34.968  1.00 35.79  ? 465  TRP A CH2 1 
ATOM   3626  N  N   . ARG A 1 466 ? 64.443 44.862  27.497  1.00 37.43  ? 466  ARG A N   1 
ATOM   3627  C  CA  . ARG A 1 466 ? 64.564 44.198  26.212  1.00 37.80  ? 466  ARG A CA  1 
ATOM   3628  C  C   . ARG A 1 466 ? 65.976 44.238  25.671  1.00 37.98  ? 466  ARG A C   1 
ATOM   3629  O  O   . ARG A 1 466 ? 66.806 45.012  26.144  1.00 38.07  ? 466  ARG A O   1 
ATOM   3630  C  CB  . ARG A 1 466 ? 63.539 44.726  25.201  1.00 37.78  ? 466  ARG A CB  1 
ATOM   3631  C  CG  . ARG A 1 466 ? 63.466 46.235  25.073  1.00 38.12  ? 466  ARG A CG  1 
ATOM   3632  C  CD  . ARG A 1 466 ? 64.362 46.802  23.990  1.00 38.41  ? 466  ARG A CD  1 
ATOM   3633  N  NE  . ARG A 1 466 ? 64.262 48.253  23.888  1.00 38.64  ? 466  ARG A NE  1 
ATOM   3634  C  CZ  . ARG A 1 466 ? 64.754 49.095  24.786  1.00 39.03  ? 466  ARG A CZ  1 
ATOM   3635  N  NH1 . ARG A 1 466 ? 65.377 48.630  25.862  1.00 39.07  ? 466  ARG A NH1 1 
ATOM   3636  N  NH2 . ARG A 1 466 ? 64.623 50.404  24.612  1.00 39.07  ? 466  ARG A NH2 1 
ATOM   3637  N  N   . THR A 1 467 ? 66.240 43.385  24.689  1.00 38.22  ? 467  THR A N   1 
ATOM   3638  C  CA  . THR A 1 467 ? 67.550 43.307  24.063  1.00 38.39  ? 467  THR A CA  1 
ATOM   3639  C  C   . THR A 1 467 ? 67.447 42.604  22.724  1.00 38.53  ? 467  THR A C   1 
ATOM   3640  O  O   . THR A 1 467 ? 66.486 41.885  22.455  1.00 38.49  ? 467  THR A O   1 
ATOM   3641  C  CB  . THR A 1 467 ? 68.537 42.541  24.959  1.00 38.39  ? 467  THR A CB  1 
ATOM   3642  O  OG1 . THR A 1 467 ? 69.798 42.429  24.290  1.00 38.32  ? 467  THR A OG1 1 
ATOM   3643  C  CG2 . THR A 1 467 ? 68.099 41.093  25.113  1.00 38.33  ? 467  THR A CG2 1 
ATOM   3644  N  N   . VAL A 1 468 ? 68.443 42.817  21.880  1.00 38.75  ? 468  VAL A N   1 
ATOM   3645  C  CA  . VAL A 1 468 ? 68.469 42.156  20.595  1.00 38.98  ? 468  VAL A CA  1 
ATOM   3646  C  C   . VAL A 1 468 ? 68.991 40.747  20.815  1.00 39.21  ? 468  VAL A C   1 
ATOM   3647  O  O   . VAL A 1 468 ? 68.236 39.843  21.175  1.00 39.25  ? 468  VAL A O   1 
ATOM   3648  C  CB  . VAL A 1 468 ? 69.376 42.887  19.594  1.00 38.95  ? 468  VAL A CB  1 
ATOM   3649  C  CG1 . VAL A 1 468 ? 69.039 42.465  18.173  1.00 38.88  ? 468  VAL A CG1 1 
ATOM   3650  C  CG2 . VAL A 1 468 ? 69.238 44.395  19.752  1.00 38.98  ? 468  VAL A CG2 1 
ATOM   3651  N  N   . THR A 1 469 ? 70.296 40.576  20.634  1.00 39.47  ? 469  THR A N   1 
ATOM   3652  C  CA  . THR A 1 469 ? 70.924 39.263  20.758  1.00 39.70  ? 469  THR A CA  1 
ATOM   3653  C  C   . THR A 1 469 ? 71.480 38.937  22.151  1.00 39.90  ? 469  THR A C   1 
ATOM   3654  O  O   . THR A 1 469 ? 71.405 37.782  22.586  1.00 39.95  ? 469  THR A O   1 
ATOM   3655  C  CB  . THR A 1 469 ? 72.031 39.083  19.681  1.00 39.66  ? 469  THR A CB  1 
ATOM   3656  O  OG1 . THR A 1 469 ? 73.155 39.920  19.986  1.00 39.56  ? 469  THR A OG1 1 
ATOM   3657  C  CG2 . THR A 1 469 ? 71.556 39.606  18.333  1.00 39.60  ? 469  THR A CG2 1 
ATOM   3658  N  N   . PRO A 1 470 ? 72.036 39.934  22.844  1.00 40.03  ? 470  PRO A N   1 
ATOM   3659  C  CA  . PRO A 1 470 ? 72.661 39.712  24.156  1.00 40.09  ? 470  PRO A CA  1 
ATOM   3660  C  C   . PRO A 1 470 ? 71.818 38.935  25.167  1.00 40.13  ? 470  PRO A C   1 
ATOM   3661  O  O   . PRO A 1 470 ? 70.761 39.400  25.597  1.00 40.15  ? 470  PRO A O   1 
ATOM   3662  C  CB  . PRO A 1 470 ? 72.917 41.135  24.666  1.00 40.07  ? 470  PRO A CB  1 
ATOM   3663  C  CG  . PRO A 1 470 ? 73.091 41.939  23.432  1.00 39.97  ? 470  PRO A CG  1 
ATOM   3664  C  CD  . PRO A 1 470 ? 72.130 41.348  22.432  1.00 40.01  ? 470  PRO A CD  1 
ATOM   3665  N  N   . ARG A 1 471 ? 72.294 37.745  25.522  1.00 40.14  ? 471  ARG A N   1 
ATOM   3666  C  CA  . ARG A 1 471 ? 71.669 36.945  26.558  1.00 40.09  ? 471  ARG A CA  1 
ATOM   3667  C  C   . ARG A 1 471 ? 72.303 37.426  27.848  1.00 40.10  ? 471  ARG A C   1 
ATOM   3668  O  O   . ARG A 1 471 ? 71.689 37.375  28.911  1.00 40.15  ? 471  ARG A O   1 
ATOM   3669  C  CB  . ARG A 1 471 ? 71.980 35.464  26.365  1.00 40.10  ? 471  ARG A CB  1 
ATOM   3670  C  CG  . ARG A 1 471 ? 73.470 35.135  26.419  1.00 40.04  ? 471  ARG A CG  1 
ATOM   3671  C  CD  . ARG A 1 471 ? 73.820 33.910  27.260  1.00 39.77  ? 471  ARG A CD  1 
ATOM   3672  N  NE  . ARG A 1 471 ? 72.980 32.759  26.944  1.00 39.48  ? 471  ARG A NE  1 
ATOM   3673  C  CZ  . ARG A 1 471 ? 73.012 31.607  27.601  1.00 39.54  ? 471  ARG A CZ  1 
ATOM   3674  N  NH1 . ARG A 1 471 ? 73.848 31.435  28.618  1.00 39.57  ? 471  ARG A NH1 1 
ATOM   3675  N  NH2 . ARG A 1 471 ? 72.206 30.619  27.238  1.00 39.68  ? 471  ARG A NH2 1 
ATOM   3676  N  N   . ASP A 1 472 ? 73.545 37.895  27.721  1.00 40.05  ? 472  ASP A N   1 
ATOM   3677  C  CA  . ASP A 1 472 ? 74.365 38.391  28.830  1.00 39.92  ? 472  ASP A CA  1 
ATOM   3678  C  C   . ASP A 1 472 ? 73.628 39.334  29.781  1.00 39.74  ? 472  ASP A C   1 
ATOM   3679  O  O   . ASP A 1 472 ? 73.680 39.149  31.000  1.00 39.86  ? 472  ASP A O   1 
ATOM   3680  C  CB  . ASP A 1 472 ? 75.631 39.070  28.287  1.00 39.97  ? 472  ASP A CB  1 
ATOM   3681  C  CG  . ASP A 1 472 ? 76.318 39.954  29.318  1.00 39.99  ? 472  ASP A CG  1 
ATOM   3682  O  OD1 . ASP A 1 472 ? 76.021 41.156  29.496  1.00 39.98  ? 472  ASP A OD1 1 
ATOM   3683  O  OD2 . ASP A 1 472 ? 77.232 39.461  30.011  1.00 40.08  ? 472  ASP A OD2 1 
ATOM   3684  N  N   . LYS A 1 473 ? 72.967 40.350  29.228  1.00 39.24  ? 473  LYS A N   1 
ATOM   3685  C  CA  . LYS A 1 473 ? 72.190 41.277  30.041  1.00 38.79  ? 473  LYS A CA  1 
ATOM   3686  C  C   . LYS A 1 473 ? 71.340 42.209  29.190  1.00 38.68  ? 473  LYS A C   1 
ATOM   3687  O  O   . LYS A 1 473 ? 71.849 42.936  28.339  1.00 38.63  ? 473  LYS A O   1 
ATOM   3688  C  CB  . LYS A 1 473 ? 73.085 42.084  30.986  1.00 38.66  ? 473  LYS A CB  1 
ATOM   3689  C  CG  . LYS A 1 473 ? 72.426 42.367  32.331  1.00 38.35  ? 473  LYS A CG  1 
ATOM   3690  C  CD  . LYS A 1 473 ? 73.288 43.226  33.251  1.00 38.04  ? 473  LYS A CD  1 
ATOM   3691  C  CE  . LYS A 1 473 ? 74.545 42.504  33.715  1.00 37.64  ? 473  LYS A CE  1 
ATOM   3692  N  NZ  . LYS A 1 473 ? 75.694 42.688  32.784  1.00 37.40  ? 473  LYS A NZ  1 
ATOM   3693  N  N   . PRO A 1 474 ? 70.034 42.166  29.423  1.00 38.53  ? 474  PRO A N   1 
ATOM   3694  C  CA  . PRO A 1 474 ? 69.078 43.021  28.724  1.00 38.45  ? 474  PRO A CA  1 
ATOM   3695  C  C   . PRO A 1 474 ? 69.256 44.453  29.197  1.00 38.42  ? 474  PRO A C   1 
ATOM   3696  O  O   . PRO A 1 474 ? 70.177 44.723  29.971  1.00 38.52  ? 474  PRO A O   1 
ATOM   3697  C  CB  . PRO A 1 474 ? 67.742 42.501  29.238  1.00 38.47  ? 474  PRO A CB  1 
ATOM   3698  C  CG  . PRO A 1 474 ? 68.084 42.018  30.595  1.00 38.46  ? 474  PRO A CG  1 
ATOM   3699  C  CD  . PRO A 1 474 ? 69.360 41.270  30.378  1.00 38.58  ? 474  PRO A CD  1 
ATOM   3700  N  N   . MET A 1 475 ? 68.382 45.351  28.750  1.00 38.22  ? 475  MET A N   1 
ATOM   3701  C  CA  . MET A 1 475 ? 68.437 46.747  29.155  1.00 38.07  ? 475  MET A CA  1 
ATOM   3702  C  C   . MET A 1 475 ? 67.214 47.031  30.019  1.00 37.78  ? 475  MET A C   1 
ATOM   3703  O  O   . MET A 1 475 ? 66.405 46.139  30.248  1.00 37.96  ? 475  MET A O   1 
ATOM   3704  C  CB  . MET A 1 475 ? 68.457 47.640  27.922  1.00 38.26  ? 475  MET A CB  1 
ATOM   3705  C  CG  . MET A 1 475 ? 69.252 48.919  28.087  1.00 39.12  ? 475  MET A CG  1 
ATOM   3706  S  SD  . MET A 1 475 ? 69.857 49.553  26.506  1.00 41.01  ? 475  MET A SD  1 
ATOM   3707  C  CE  . MET A 1 475 ? 68.371 49.432  25.480  1.00 40.11  ? 475  MET A CE  1 
ATOM   3708  N  N   . GLY A 1 476 ? 67.076 48.256  30.513  1.00 37.43  ? 476  GLY A N   1 
ATOM   3709  C  CA  . GLY A 1 476 ? 65.928 48.602  31.339  1.00 36.98  ? 476  GLY A CA  1 
ATOM   3710  C  C   . GLY A 1 476 ? 66.255 48.895  32.796  1.00 36.60  ? 476  GLY A C   1 
ATOM   3711  O  O   . GLY A 1 476 ? 67.422 48.954  33.177  1.00 36.67  ? 476  GLY A O   1 
ATOM   3712  N  N   . PRO A 1 477 ? 65.226 49.067  33.621  1.00 36.26  ? 477  PRO A N   1 
ATOM   3713  C  CA  . PRO A 1 477 ? 63.826 48.958  33.195  1.00 36.00  ? 477  PRO A CA  1 
ATOM   3714  C  C   . PRO A 1 477 ? 63.291 50.229  32.533  1.00 35.79  ? 477  PRO A C   1 
ATOM   3715  O  O   . PRO A 1 477 ? 63.822 51.321  32.751  1.00 35.66  ? 477  PRO A O   1 
ATOM   3716  C  CB  . PRO A 1 477 ? 63.083 48.728  34.516  1.00 35.96  ? 477  PRO A CB  1 
ATOM   3717  C  CG  . PRO A 1 477 ? 64.162 48.612  35.570  1.00 36.03  ? 477  PRO A CG  1 
ATOM   3718  C  CD  . PRO A 1 477 ? 65.338 49.374  35.054  1.00 36.18  ? 477  PRO A CD  1 
ATOM   3719  N  N   . LEU A 1 478 ? 62.241 50.071  31.732  1.00 35.55  ? 478  LEU A N   1 
ATOM   3720  C  CA  . LEU A 1 478 ? 61.598 51.189  31.049  1.00 35.33  ? 478  LEU A CA  1 
ATOM   3721  C  C   . LEU A 1 478 ? 60.095 51.040  31.160  1.00 34.97  ? 478  LEU A C   1 
ATOM   3722  O  O   . LEU A 1 478 ? 59.580 49.932  31.095  1.00 35.09  ? 478  LEU A O   1 
ATOM   3723  C  CB  . LEU A 1 478 ? 61.973 51.215  29.567  1.00 35.42  ? 478  LEU A CB  1 
ATOM   3724  C  CG  . LEU A 1 478 ? 63.422 51.483  29.165  1.00 35.82  ? 478  LEU A CG  1 
ATOM   3725  C  CD1 . LEU A 1 478 ? 63.512 51.693  27.657  1.00 35.96  ? 478  LEU A CD1 1 
ATOM   3726  C  CD2 . LEU A 1 478 ? 63.980 52.684  29.910  1.00 35.87  ? 478  LEU A CD2 1 
ATOM   3727  N  N   . LEU A 1 479 ? 59.393 52.154  31.321  1.00 34.58  ? 479  LEU A N   1 
ATOM   3728  C  CA  . LEU A 1 479 ? 57.938 52.129  31.406  1.00 34.28  ? 479  LEU A CA  1 
ATOM   3729  C  C   . LEU A 1 479 ? 57.352 51.592  30.110  1.00 34.01  ? 479  LEU A C   1 
ATOM   3730  O  O   . LEU A 1 479 ? 57.663 52.092  29.034  1.00 34.00  ? 479  LEU A O   1 
ATOM   3731  C  CB  . LEU A 1 479 ? 57.405 53.531  31.686  1.00 34.32  ? 479  LEU A CB  1 
ATOM   3732  C  CG  . LEU A 1 479 ? 57.669 53.991  33.114  1.00 34.37  ? 479  LEU A CG  1 
ATOM   3733  C  CD1 . LEU A 1 479 ? 57.349 55.463  33.294  1.00 34.51  ? 479  LEU A CD1 1 
ATOM   3734  C  CD2 . LEU A 1 479 ? 56.851 53.134  34.066  1.00 34.76  ? 479  LEU A CD2 1 
ATOM   3735  N  N   . VAL A 1 480 ? 56.507 50.573  30.206  1.00 33.71  ? 480  VAL A N   1 
ATOM   3736  C  CA  . VAL A 1 480 ? 55.942 49.978  29.002  1.00 33.51  ? 480  VAL A CA  1 
ATOM   3737  C  C   . VAL A 1 480 ? 55.244 51.043  28.185  1.00 33.31  ? 480  VAL A C   1 
ATOM   3738  O  O   . VAL A 1 480 ? 55.271 51.011  26.959  1.00 33.40  ? 480  VAL A O   1 
ATOM   3739  C  CB  . VAL A 1 480 ? 54.935 48.845  29.309  1.00 33.66  ? 480  VAL A CB  1 
ATOM   3740  C  CG1 . VAL A 1 480 ? 55.531 47.830  30.283  1.00 33.32  ? 480  VAL A CG1 1 
ATOM   3741  C  CG2 . VAL A 1 480 ? 53.620 49.412  29.837  1.00 33.73  ? 480  VAL A CG2 1 
ATOM   3742  N  N   . ALA A 1 481 ? 54.635 51.999  28.878  1.00 33.05  ? 481  ALA A N   1 
ATOM   3743  C  CA  . ALA A 1 481 ? 53.901 53.081  28.233  1.00 32.70  ? 481  ALA A CA  1 
ATOM   3744  C  C   . ALA A 1 481 ? 54.788 53.965  27.362  1.00 32.43  ? 481  ALA A C   1 
ATOM   3745  O  O   . ALA A 1 481 ? 54.292 54.854  26.672  1.00 32.42  ? 481  ALA A O   1 
ATOM   3746  C  CB  . ALA A 1 481 ? 53.170 53.920  29.271  1.00 32.71  ? 481  ALA A CB  1 
ATOM   3747  N  N   . THR A 1 482 ? 56.096 53.733  27.406  1.00 32.14  ? 482  THR A N   1 
ATOM   3748  C  CA  . THR A 1 482 ? 57.019 54.488  26.573  1.00 31.79  ? 482  THR A CA  1 
ATOM   3749  C  C   . THR A 1 482 ? 56.559 54.342  25.141  1.00 31.86  ? 482  THR A C   1 
ATOM   3750  O  O   . THR A 1 482 ? 56.390 55.329  24.418  1.00 31.83  ? 482  THR A O   1 
ATOM   3751  C  CB  . THR A 1 482 ? 58.438 53.933  26.699  1.00 31.63  ? 482  THR A CB  1 
ATOM   3752  O  OG1 . THR A 1 482 ? 59.002 54.356  27.941  1.00 31.40  ? 482  THR A OG1 1 
ATOM   3753  C  CG2 . THR A 1 482 ? 59.353 54.568  25.666  1.00 31.28  ? 482  THR A CG2 1 
ATOM   3754  N  N   . PHE A 1 483 ? 56.331 53.094  24.752  1.00 31.73  ? 483  PHE A N   1 
ATOM   3755  C  CA  . PHE A 1 483 ? 55.938 52.773  23.392  1.00 31.74  ? 483  PHE A CA  1 
ATOM   3756  C  C   . PHE A 1 483 ? 54.433 52.577  23.241  1.00 31.71  ? 483  PHE A C   1 
ATOM   3757  O  O   . PHE A 1 483 ? 53.858 52.887  22.197  1.00 31.66  ? 483  PHE A O   1 
ATOM   3758  C  CB  . PHE A 1 483 ? 56.687 51.523  22.937  1.00 31.67  ? 483  PHE A CB  1 
ATOM   3759  C  CG  . PHE A 1 483 ? 58.164 51.576  23.207  1.00 31.49  ? 483  PHE A CG  1 
ATOM   3760  C  CD1 . PHE A 1 483 ? 58.994 52.382  22.445  1.00 31.78  ? 483  PHE A CD1 1 
ATOM   3761  C  CD2 . PHE A 1 483 ? 58.722 50.824  24.225  1.00 30.95  ? 483  PHE A CD2 1 
ATOM   3762  C  CE1 . PHE A 1 483 ? 60.356 52.426  22.695  1.00 31.98  ? 483  PHE A CE1 1 
ATOM   3763  C  CE2 . PHE A 1 483 ? 60.080 50.862  24.479  1.00 30.44  ? 483  PHE A CE2 1 
ATOM   3764  C  CZ  . PHE A 1 483 ? 60.899 51.659  23.718  1.00 31.13  ? 483  PHE A CZ  1 
ATOM   3765  N  N   . TRP A 1 484 ? 53.799 52.063  24.288  1.00 31.72  ? 484  TRP A N   1 
ATOM   3766  C  CA  . TRP A 1 484 ? 52.372 51.790  24.252  1.00 31.79  ? 484  TRP A CA  1 
ATOM   3767  C  C   . TRP A 1 484 ? 51.713 52.296  25.524  1.00 31.76  ? 484  TRP A C   1 
ATOM   3768  O  O   . TRP A 1 484 ? 51.795 51.661  26.571  1.00 31.82  ? 484  TRP A O   1 
ATOM   3769  C  CB  . TRP A 1 484 ? 52.128 50.288  24.105  1.00 31.87  ? 484  TRP A CB  1 
ATOM   3770  C  CG  . TRP A 1 484 ? 53.027 49.625  23.110  1.00 32.14  ? 484  TRP A CG  1 
ATOM   3771  C  CD1 . TRP A 1 484 ? 52.884 49.616  21.755  1.00 32.65  ? 484  TRP A CD1 1 
ATOM   3772  C  CD2 . TRP A 1 484 ? 54.215 48.878  23.389  1.00 32.20  ? 484  TRP A CD2 1 
ATOM   3773  N  NE1 . TRP A 1 484 ? 53.908 48.908  21.174  1.00 32.77  ? 484  TRP A NE1 1 
ATOM   3774  C  CE2 . TRP A 1 484 ? 54.740 48.445  22.157  1.00 32.55  ? 484  TRP A CE2 1 
ATOM   3775  C  CE3 . TRP A 1 484 ? 54.894 48.530  24.559  1.00 32.40  ? 484  TRP A CE3 1 
ATOM   3776  C  CZ2 . TRP A 1 484 ? 55.903 47.686  22.063  1.00 33.10  ? 484  TRP A CZ2 1 
ATOM   3777  C  CZ3 . TRP A 1 484 ? 56.051 47.773  24.463  1.00 32.62  ? 484  TRP A CZ3 1 
ATOM   3778  C  CH2 . TRP A 1 484 ? 56.542 47.359  23.227  1.00 32.72  ? 484  TRP A CH2 1 
ATOM   3779  N  N   . PRO A 1 485 ? 51.080 53.456  25.439  1.00 31.77  ? 485  PRO A N   1 
ATOM   3780  C  CA  . PRO A 1 485 ? 50.402 54.056  26.591  1.00 31.87  ? 485  PRO A CA  1 
ATOM   3781  C  C   . PRO A 1 485 ? 49.055 53.416  26.943  1.00 31.99  ? 485  PRO A C   1 
ATOM   3782  O  O   . PRO A 1 485 ? 48.853 53.032  28.096  1.00 31.97  ? 485  PRO A O   1 
ATOM   3783  C  CB  . PRO A 1 485 ? 50.213 55.508  26.155  1.00 31.79  ? 485  PRO A CB  1 
ATOM   3784  C  CG  . PRO A 1 485 ? 51.093 55.650  24.939  1.00 31.72  ? 485  PRO A CG  1 
ATOM   3785  C  CD  . PRO A 1 485 ? 51.025 54.323  24.255  1.00 31.69  ? 485  PRO A CD  1 
ATOM   3786  N  N   . GLU A 1 486 ? 48.156 53.287  25.973  1.00 32.16  ? 486  GLU A N   1 
ATOM   3787  C  CA  . GLU A 1 486 ? 46.830 52.721  26.237  1.00 32.41  ? 486  GLU A CA  1 
ATOM   3788  C  C   . GLU A 1 486 ? 46.852 51.282  26.763  1.00 32.41  ? 486  GLU A C   1 
ATOM   3789  O  O   . GLU A 1 486 ? 45.814 50.630  26.843  1.00 32.38  ? 486  GLU A O   1 
ATOM   3790  C  CB  . GLU A 1 486 ? 45.946 52.798  24.989  1.00 32.41  ? 486  GLU A CB  1 
ATOM   3791  C  CG  . GLU A 1 486 ? 45.762 54.201  24.441  1.00 32.66  ? 486  GLU A CG  1 
ATOM   3792  C  CD  . GLU A 1 486 ? 46.929 54.645  23.585  1.00 32.91  ? 486  GLU A CD  1 
ATOM   3793  O  OE1 . GLU A 1 486 ? 47.747 53.775  23.201  1.00 31.74  ? 486  GLU A OE1 1 
ATOM   3794  O  OE2 . GLU A 1 486 ? 47.023 55.863  23.298  1.00 33.59  ? 486  GLU A OE2 1 
ATOM   3795  N  N   . LEU A 1 487 ? 48.034 50.797  27.124  1.00 32.53  ? 487  LEU A N   1 
ATOM   3796  C  CA  . LEU A 1 487 ? 48.195 49.435  27.619  1.00 32.56  ? 487  LEU A CA  1 
ATOM   3797  C  C   . LEU A 1 487 ? 48.123 49.431  29.144  1.00 32.78  ? 487  LEU A C   1 
ATOM   3798  O  O   . LEU A 1 487 ? 48.768 50.247  29.804  1.00 32.89  ? 487  LEU A O   1 
ATOM   3799  C  CB  . LEU A 1 487 ? 49.535 48.881  27.147  1.00 32.38  ? 487  LEU A CB  1 
ATOM   3800  C  CG  . LEU A 1 487 ? 49.569 47.493  26.523  1.00 32.02  ? 487  LEU A CG  1 
ATOM   3801  C  CD1 . LEU A 1 487 ? 48.306 47.222  25.739  1.00 32.24  ? 487  LEU A CD1 1 
ATOM   3802  C  CD2 . LEU A 1 487 ? 50.779 47.394  25.628  1.00 31.58  ? 487  LEU A CD2 1 
ATOM   3803  N  N   . PRO A 1 488 ? 47.329 48.521  29.698  1.00 32.90  ? 488  PRO A N   1 
ATOM   3804  C  CA  . PRO A 1 488 ? 47.137 48.420  31.149  1.00 33.11  ? 488  PRO A CA  1 
ATOM   3805  C  C   . PRO A 1 488 ? 48.426 48.118  31.901  1.00 33.44  ? 488  PRO A C   1 
ATOM   3806  O  O   . PRO A 1 488 ? 49.418 47.693  31.305  1.00 33.44  ? 488  PRO A O   1 
ATOM   3807  C  CB  . PRO A 1 488 ? 46.163 47.253  31.290  1.00 33.08  ? 488  PRO A CB  1 
ATOM   3808  C  CG  . PRO A 1 488 ? 45.495 47.167  29.976  1.00 33.04  ? 488  PRO A CG  1 
ATOM   3809  C  CD  . PRO A 1 488 ? 46.537 47.523  28.964  1.00 32.94  ? 488  PRO A CD  1 
ATOM   3810  N  N   . GLU A 1 489 ? 48.390 48.313  33.215  1.00 33.80  ? 489  GLU A N   1 
ATOM   3811  C  CA  . GLU A 1 489 ? 49.583 48.182  34.049  1.00 34.12  ? 489  GLU A CA  1 
ATOM   3812  C  C   . GLU A 1 489 ? 50.035 46.758  34.330  1.00 34.21  ? 489  GLU A C   1 
ATOM   3813  O  O   . GLU A 1 489 ? 50.869 46.544  35.202  1.00 34.25  ? 489  GLU A O   1 
ATOM   3814  C  CB  . GLU A 1 489 ? 49.410 48.961  35.361  1.00 34.15  ? 489  GLU A CB  1 
ATOM   3815  C  CG  . GLU A 1 489 ? 49.075 50.434  35.146  1.00 34.69  ? 489  GLU A CG  1 
ATOM   3816  C  CD  . GLU A 1 489 ? 49.474 51.322  36.314  1.00 35.01  ? 489  GLU A CD  1 
ATOM   3817  O  OE1 . GLU A 1 489 ? 49.547 50.819  37.455  1.00 35.31  ? 489  GLU A OE1 1 
ATOM   3818  O  OE2 . GLU A 1 489 ? 49.718 52.527  36.088  1.00 34.82  ? 489  GLU A OE2 1 
ATOM   3819  N  N   . LYS A 1 490 ? 49.490 45.795  33.590  1.00 34.48  ? 490  LYS A N   1 
ATOM   3820  C  CA  . LYS A 1 490 ? 49.864 44.385  33.734  1.00 34.66  ? 490  LYS A CA  1 
ATOM   3821  C  C   . LYS A 1 490 ? 49.327 43.579  32.559  1.00 34.72  ? 490  LYS A C   1 
ATOM   3822  O  O   . LYS A 1 490 ? 48.183 43.134  32.569  1.00 34.72  ? 490  LYS A O   1 
ATOM   3823  C  CB  . LYS A 1 490 ? 49.356 43.801  35.059  1.00 34.65  ? 490  LYS A CB  1 
ATOM   3824  C  CG  . LYS A 1 490 ? 47.848 43.579  35.135  1.00 34.88  ? 490  LYS A CG  1 
ATOM   3825  C  CD  . LYS A 1 490 ? 47.078 44.889  35.109  1.00 35.10  ? 490  LYS A CD  1 
ATOM   3826  C  CE  . LYS A 1 490 ? 45.580 44.657  35.176  1.00 35.35  ? 490  LYS A CE  1 
ATOM   3827  N  NZ  . LYS A 1 490 ? 44.829 45.942  35.129  1.00 35.78  ? 490  LYS A NZ  1 
ATOM   3828  N  N   . ILE A 1 491 ? 50.155 43.403  31.537  1.00 34.90  ? 491  ILE A N   1 
ATOM   3829  C  CA  . ILE A 1 491 ? 49.731 42.678  30.350  1.00 35.18  ? 491  ILE A CA  1 
ATOM   3830  C  C   . ILE A 1 491 ? 50.019 41.201  30.526  1.00 35.50  ? 491  ILE A C   1 
ATOM   3831  O  O   . ILE A 1 491 ? 50.745 40.816  31.436  1.00 35.84  ? 491  ILE A O   1 
ATOM   3832  C  CB  . ILE A 1 491 ? 50.436 43.230  29.111  1.00 35.11  ? 491  ILE A CB  1 
ATOM   3833  C  CG1 . ILE A 1 491 ? 51.916 42.858  29.124  1.00 35.01  ? 491  ILE A CG1 1 
ATOM   3834  C  CG2 . ILE A 1 491 ? 50.277 44.736  29.048  1.00 35.22  ? 491  ILE A CG2 1 
ATOM   3835  C  CD1 . ILE A 1 491 ? 52.221 41.577  28.410  1.00 34.90  ? 491  ILE A CD1 1 
ATOM   3836  N  N   . ASP A 1 492 ? 49.460 40.369  29.658  1.00 35.76  ? 492  ASP A N   1 
ATOM   3837  C  CA  . ASP A 1 492 ? 49.645 38.928  29.787  1.00 35.95  ? 492  ASP A CA  1 
ATOM   3838  C  C   . ASP A 1 492 ? 50.411 38.309  28.613  1.00 36.01  ? 492  ASP A C   1 
ATOM   3839  O  O   . ASP A 1 492 ? 51.638 38.258  28.629  1.00 36.18  ? 492  ASP A O   1 
ATOM   3840  C  CB  . ASP A 1 492 ? 48.294 38.256  30.013  1.00 36.05  ? 492  ASP A CB  1 
ATOM   3841  C  CG  . ASP A 1 492 ? 47.500 38.923  31.128  1.00 36.23  ? 492  ASP A CG  1 
ATOM   3842  O  OD1 . ASP A 1 492 ? 48.116 39.304  32.147  1.00 35.91  ? 492  ASP A OD1 1 
ATOM   3843  O  OD2 . ASP A 1 492 ? 46.267 39.122  31.070  1.00 36.60  ? 492  ASP A OD2 1 
ATOM   3844  N  N   . ALA A 1 493 ? 49.706 37.822  27.603  1.00 35.95  ? 493  ALA A N   1 
ATOM   3845  C  CA  . ALA A 1 493 ? 50.391 37.261  26.446  1.00 35.97  ? 493  ALA A CA  1 
ATOM   3846  C  C   . ALA A 1 493 ? 50.565 38.363  25.419  1.00 35.89  ? 493  ALA A C   1 
ATOM   3847  O  O   . ALA A 1 493 ? 49.813 39.329  25.427  1.00 36.03  ? 493  ALA A O   1 
ATOM   3848  C  CB  . ALA A 1 493 ? 49.604 36.107  25.865  1.00 36.02  ? 493  ALA A CB  1 
ATOM   3849  N  N   . VAL A 1 494 ? 51.550 38.232  24.539  1.00 35.82  ? 494  VAL A N   1 
ATOM   3850  C  CA  . VAL A 1 494 ? 51.783 39.261  23.529  1.00 35.84  ? 494  VAL A CA  1 
ATOM   3851  C  C   . VAL A 1 494 ? 52.594 38.770  22.337  1.00 35.85  ? 494  VAL A C   1 
ATOM   3852  O  O   . VAL A 1 494 ? 53.570 38.039  22.504  1.00 35.94  ? 494  VAL A O   1 
ATOM   3853  C  CB  . VAL A 1 494 ? 52.493 40.468  24.142  1.00 35.81  ? 494  VAL A CB  1 
ATOM   3854  C  CG1 . VAL A 1 494 ? 53.198 40.059  25.412  1.00 35.95  ? 494  VAL A CG1 1 
ATOM   3855  C  CG2 . VAL A 1 494 ? 53.471 41.074  23.149  1.00 35.91  ? 494  VAL A CG2 1 
ATOM   3856  N  N   . TYR A 1 495 ? 52.182 39.174  21.136  1.00 35.79  ? 495  TYR A N   1 
ATOM   3857  C  CA  . TYR A 1 495 ? 52.885 38.787  19.916  1.00 35.82  ? 495  TYR A CA  1 
ATOM   3858  C  C   . TYR A 1 495 ? 52.735 39.795  18.788  1.00 36.08  ? 495  TYR A C   1 
ATOM   3859  O  O   . TYR A 1 495 ? 51.939 40.730  18.862  1.00 36.23  ? 495  TYR A O   1 
ATOM   3860  C  CB  . TYR A 1 495 ? 52.431 37.413  19.427  1.00 35.73  ? 495  TYR A CB  1 
ATOM   3861  C  CG  . TYR A 1 495 ? 51.111 37.385  18.679  1.00 35.23  ? 495  TYR A CG  1 
ATOM   3862  C  CD1 . TYR A 1 495 ? 51.062 37.568  17.301  1.00 34.78  ? 495  TYR A CD1 1 
ATOM   3863  C  CD2 . TYR A 1 495 ? 49.920 37.137  19.348  1.00 34.87  ? 495  TYR A CD2 1 
ATOM   3864  C  CE1 . TYR A 1 495 ? 49.861 37.525  16.616  1.00 34.63  ? 495  TYR A CE1 1 
ATOM   3865  C  CE2 . TYR A 1 495 ? 48.716 37.092  18.672  1.00 34.90  ? 495  TYR A CE2 1 
ATOM   3866  C  CZ  . TYR A 1 495 ? 48.691 37.285  17.308  1.00 34.76  ? 495  TYR A CZ  1 
ATOM   3867  O  OH  . TYR A 1 495 ? 47.487 37.233  16.641  1.00 34.54  ? 495  TYR A OH  1 
ATOM   3868  N  N   . GLU A 1 496 ? 53.515 39.589  17.736  1.00 36.23  ? 496  GLU A N   1 
ATOM   3869  C  CA  . GLU A 1 496 ? 53.468 40.452  16.569  1.00 36.35  ? 496  GLU A CA  1 
ATOM   3870  C  C   . GLU A 1 496 ? 53.415 39.579  15.325  1.00 36.60  ? 496  GLU A C   1 
ATOM   3871  O  O   . GLU A 1 496 ? 54.235 38.679  15.158  1.00 36.68  ? 496  GLU A O   1 
ATOM   3872  C  CB  . GLU A 1 496 ? 54.672 41.401  16.556  1.00 36.24  ? 496  GLU A CB  1 
ATOM   3873  C  CG  . GLU A 1 496 ? 55.093 41.913  15.188  1.00 35.85  ? 496  GLU A CG  1 
ATOM   3874  C  CD  . GLU A 1 496 ? 56.296 41.173  14.637  1.00 35.05  ? 496  GLU A CD  1 
ATOM   3875  O  OE1 . GLU A 1 496 ? 57.437 41.562  14.958  1.00 34.24  ? 496  GLU A OE1 1 
ATOM   3876  O  OE2 . GLU A 1 496 ? 56.104 40.200  13.883  1.00 35.11  ? 496  GLU A OE2 1 
ATOM   3877  N  N   . ALA A 1 497 ? 52.430 39.829  14.471  1.00 36.90  ? 497  ALA A N   1 
ATOM   3878  C  CA  . ALA A 1 497 ? 52.263 39.047  13.251  1.00 37.29  ? 497  ALA A CA  1 
ATOM   3879  C  C   . ALA A 1 497 ? 53.321 39.379  12.207  1.00 37.56  ? 497  ALA A C   1 
ATOM   3880  O  O   . ALA A 1 497 ? 53.323 40.466  11.631  1.00 37.48  ? 497  ALA A O   1 
ATOM   3881  C  CB  . ALA A 1 497 ? 50.872 39.246  12.676  1.00 37.24  ? 497  ALA A CB  1 
ATOM   3882  N  N   . PRO A 1 498 ? 54.216 38.429  11.962  1.00 37.88  ? 498  PRO A N   1 
ATOM   3883  C  CA  . PRO A 1 498 ? 55.285 38.599  10.975  1.00 38.14  ? 498  PRO A CA  1 
ATOM   3884  C  C   . PRO A 1 498 ? 54.731 38.691  9.557   1.00 38.36  ? 498  PRO A C   1 
ATOM   3885  O  O   . PRO A 1 498 ? 55.494 38.869  8.606   1.00 38.48  ? 498  PRO A O   1 
ATOM   3886  C  CB  . PRO A 1 498 ? 56.111 37.319  11.134  1.00 38.19  ? 498  PRO A CB  1 
ATOM   3887  C  CG  . PRO A 1 498 ? 55.726 36.779  12.479  1.00 38.07  ? 498  PRO A CG  1 
ATOM   3888  C  CD  . PRO A 1 498 ? 54.275 37.116  12.625  1.00 37.94  ? 498  PRO A CD  1 
ATOM   3889  N  N   . GLN A 1 499 ? 53.416 38.567  9.419   1.00 38.48  ? 499  GLN A N   1 
ATOM   3890  C  CA  . GLN A 1 499 ? 52.776 38.666  8.115   1.00 38.52  ? 499  GLN A CA  1 
ATOM   3891  C  C   . GLN A 1 499 ? 52.377 40.114  7.814   1.00 38.51  ? 499  GLN A C   1 
ATOM   3892  O  O   . GLN A 1 499 ? 52.178 40.482  6.659   1.00 38.51  ? 499  GLN A O   1 
ATOM   3893  C  CB  . GLN A 1 499 ? 51.561 37.737  8.042   1.00 38.53  ? 499  GLN A CB  1 
ATOM   3894  C  CG  . GLN A 1 499 ? 51.854 36.285  8.425   1.00 38.78  ? 499  GLN A CG  1 
ATOM   3895  C  CD  . GLN A 1 499 ? 52.266 35.421  7.239   1.00 39.18  ? 499  GLN A CD  1 
ATOM   3896  O  OE1 . GLN A 1 499 ? 52.966 35.882  6.337   1.00 39.34  ? 499  GLN A OE1 1 
ATOM   3897  N  NE2 . GLN A 1 499 ? 51.828 34.164  7.241   1.00 39.04  ? 499  GLN A NE2 1 
ATOM   3898  N  N   . GLU A 1 500 ? 52.271 40.936  8.855   1.00 38.53  ? 500  GLU A N   1 
ATOM   3899  C  CA  . GLU A 1 500 ? 51.909 42.344  8.679   1.00 38.52  ? 500  GLU A CA  1 
ATOM   3900  C  C   . GLU A 1 500 ? 52.637 43.285  9.647   1.00 38.53  ? 500  GLU A C   1 
ATOM   3901  O  O   . GLU A 1 500 ? 52.420 44.500  9.630   1.00 38.36  ? 500  GLU A O   1 
ATOM   3902  C  CB  . GLU A 1 500 ? 50.393 42.540  8.790   1.00 38.51  ? 500  GLU A CB  1 
ATOM   3903  C  CG  . GLU A 1 500 ? 49.761 41.933  10.031  1.00 38.51  ? 500  GLU A CG  1 
ATOM   3904  C  CD  . GLU A 1 500 ? 49.252 40.528  9.794   1.00 38.67  ? 500  GLU A CD  1 
ATOM   3905  O  OE1 . GLU A 1 500 ? 49.306 40.065  8.636   1.00 38.60  ? 500  GLU A OE1 1 
ATOM   3906  O  OE2 . GLU A 1 500 ? 48.791 39.889  10.763  1.00 38.86  ? 500  GLU A OE2 1 
ATOM   3907  N  N   . GLU A 1 501 ? 53.498 42.715  10.487  1.00 38.61  ? 501  GLU A N   1 
ATOM   3908  C  CA  . GLU A 1 501 ? 54.277 43.486  11.458  1.00 38.57  ? 501  GLU A CA  1 
ATOM   3909  C  C   . GLU A 1 501 ? 53.399 44.287  12.419  1.00 38.43  ? 501  GLU A C   1 
ATOM   3910  O  O   . GLU A 1 501 ? 53.606 45.488  12.610  1.00 38.53  ? 501  GLU A O   1 
ATOM   3911  C  CB  . GLU A 1 501 ? 55.269 44.414  10.743  1.00 38.61  ? 501  GLU A CB  1 
ATOM   3912  C  CG  . GLU A 1 501 ? 56.307 43.687  9.904   1.00 38.76  ? 501  GLU A CG  1 
ATOM   3913  C  CD  . GLU A 1 501 ? 56.984 42.559  10.660  1.00 38.91  ? 501  GLU A CD  1 
ATOM   3914  O  OE1 . GLU A 1 501 ? 57.063 42.635  11.906  1.00 38.99  ? 501  GLU A OE1 1 
ATOM   3915  O  OE2 . GLU A 1 501 ? 57.436 41.594  10.008  1.00 38.95  ? 501  GLU A OE2 1 
ATOM   3916  N  N   . LYS A 1 502 ? 52.421 43.619  13.024  1.00 38.10  ? 502  LYS A N   1 
ATOM   3917  C  CA  . LYS A 1 502 ? 51.509 44.285  13.945  1.00 37.75  ? 502  LYS A CA  1 
ATOM   3918  C  C   . LYS A 1 502 ? 51.658 43.749  15.356  1.00 37.52  ? 502  LYS A C   1 
ATOM   3919  O  O   . LYS A 1 502 ? 51.472 42.564  15.598  1.00 37.61  ? 502  LYS A O   1 
ATOM   3920  C  CB  . LYS A 1 502 ? 50.059 44.143  13.474  1.00 37.74  ? 502  LYS A CB  1 
ATOM   3921  C  CG  . LYS A 1 502 ? 49.784 44.766  12.108  1.00 37.59  ? 502  LYS A CG  1 
ATOM   3922  C  CD  . LYS A 1 502 ? 48.291 44.986  11.888  1.00 37.12  ? 502  LYS A CD  1 
ATOM   3923  C  CE  . LYS A 1 502 ? 47.987 45.336  10.444  1.00 36.61  ? 502  LYS A CE  1 
ATOM   3924  N  NZ  . LYS A 1 502 ? 48.808 46.478  9.969   1.00 36.35  ? 502  LYS A NZ  1 
ATOM   3925  N  N   . ALA A 1 503 ? 51.990 44.634  16.285  1.00 37.36  ? 503  ALA A N   1 
ATOM   3926  C  CA  . ALA A 1 503 ? 52.175 44.260  17.680  1.00 37.27  ? 503  ALA A CA  1 
ATOM   3927  C  C   . ALA A 1 503 ? 50.844 44.007  18.386  1.00 37.15  ? 503  ALA A C   1 
ATOM   3928  O  O   . ALA A 1 503 ? 50.097 44.942  18.665  1.00 37.14  ? 503  ALA A O   1 
ATOM   3929  C  CB  . ALA A 1 503 ? 52.958 45.341  18.404  1.00 37.30  ? 503  ALA A CB  1 
ATOM   3930  N  N   . VAL A 1 504 ? 50.556 42.743  18.682  1.00 36.97  ? 504  VAL A N   1 
ATOM   3931  C  CA  . VAL A 1 504 ? 49.312 42.378  19.351  1.00 36.90  ? 504  VAL A CA  1 
ATOM   3932  C  C   . VAL A 1 504 ? 49.525 42.167  20.842  1.00 36.92  ? 504  VAL A C   1 
ATOM   3933  O  O   . VAL A 1 504 ? 50.401 41.403  21.246  1.00 37.04  ? 504  VAL A O   1 
ATOM   3934  C  CB  . VAL A 1 504 ? 48.720 41.090  18.765  1.00 36.88  ? 504  VAL A CB  1 
ATOM   3935  C  CG1 . VAL A 1 504 ? 47.484 40.675  19.542  1.00 36.94  ? 504  VAL A CG1 1 
ATOM   3936  C  CG2 . VAL A 1 504 ? 48.396 41.272  17.294  1.00 36.94  ? 504  VAL A CG2 1 
ATOM   3937  N  N   . PHE A 1 505 ? 48.716 42.834  21.660  1.00 36.91  ? 505  PHE A N   1 
ATOM   3938  C  CA  . PHE A 1 505 ? 48.843 42.726  23.113  1.00 36.89  ? 505  PHE A CA  1 
ATOM   3939  C  C   . PHE A 1 505 ? 47.565 42.210  23.773  1.00 36.81  ? 505  PHE A C   1 
ATOM   3940  O  O   . PHE A 1 505 ? 46.489 42.770  23.579  1.00 36.71  ? 505  PHE A O   1 
ATOM   3941  C  CB  . PHE A 1 505 ? 49.228 44.080  23.720  1.00 36.96  ? 505  PHE A CB  1 
ATOM   3942  C  CG  . PHE A 1 505 ? 50.598 44.563  23.324  1.00 36.92  ? 505  PHE A CG  1 
ATOM   3943  C  CD1 . PHE A 1 505 ? 50.852 44.995  22.038  1.00 36.98  ? 505  PHE A CD1 1 
ATOM   3944  C  CD2 . PHE A 1 505 ? 51.628 44.590  24.245  1.00 37.04  ? 505  PHE A CD2 1 
ATOM   3945  C  CE1 . PHE A 1 505 ? 52.108 45.439  21.677  1.00 36.99  ? 505  PHE A CE1 1 
ATOM   3946  C  CE2 . PHE A 1 505 ? 52.884 45.037  23.888  1.00 37.06  ? 505  PHE A CE2 1 
ATOM   3947  C  CZ  . PHE A 1 505 ? 53.122 45.463  22.601  1.00 36.93  ? 505  PHE A CZ  1 
ATOM   3948  N  N   . PHE A 1 506 ? 47.693 41.144  24.558  1.00 36.75  ? 506  PHE A N   1 
ATOM   3949  C  CA  . PHE A 1 506 ? 46.557 40.558  25.262  1.00 36.77  ? 506  PHE A CA  1 
ATOM   3950  C  C   . PHE A 1 506 ? 46.554 41.013  26.713  1.00 36.79  ? 506  PHE A C   1 
ATOM   3951  O  O   . PHE A 1 506 ? 47.613 41.175  27.310  1.00 36.81  ? 506  PHE A O   1 
ATOM   3952  C  CB  . PHE A 1 506 ? 46.622 39.034  25.206  1.00 36.72  ? 506  PHE A CB  1 
ATOM   3953  C  CG  . PHE A 1 506 ? 46.314 38.464  23.854  1.00 36.85  ? 506  PHE A CG  1 
ATOM   3954  C  CD1 . PHE A 1 506 ? 47.303 38.353  22.891  1.00 36.93  ? 506  PHE A CD1 1 
ATOM   3955  C  CD2 . PHE A 1 506 ? 45.034 38.034  23.546  1.00 36.84  ? 506  PHE A CD2 1 
ATOM   3956  C  CE1 . PHE A 1 506 ? 47.018 37.824  21.641  1.00 37.03  ? 506  PHE A CE1 1 
ATOM   3957  C  CE2 . PHE A 1 506 ? 44.745 37.506  22.301  1.00 36.71  ? 506  PHE A CE2 1 
ATOM   3958  C  CZ  . PHE A 1 506 ? 45.736 37.401  21.347  1.00 36.82  ? 506  PHE A CZ  1 
ATOM   3959  N  N   . ALA A 1 507 ? 45.370 41.211  27.282  1.00 36.92  ? 507  ALA A N   1 
ATOM   3960  C  CA  . ALA A 1 507 ? 45.271 41.665  28.667  1.00 37.05  ? 507  ALA A CA  1 
ATOM   3961  C  C   . ALA A 1 507 ? 43.842 41.690  29.195  1.00 37.15  ? 507  ALA A C   1 
ATOM   3962  O  O   . ALA A 1 507 ? 42.982 42.395  28.665  1.00 37.12  ? 507  ALA A O   1 
ATOM   3963  C  CB  . ALA A 1 507 ? 45.910 43.040  28.824  1.00 37.09  ? 507  ALA A CB  1 
ATOM   3964  N  N   . GLY A 1 508 ? 43.607 40.930  30.259  1.00 37.29  ? 508  GLY A N   1 
ATOM   3965  C  CA  . GLY A 1 508 ? 42.302 40.864  30.886  1.00 37.48  ? 508  GLY A CA  1 
ATOM   3966  C  C   . GLY A 1 508 ? 41.242 40.288  29.971  1.00 37.59  ? 508  GLY A C   1 
ATOM   3967  O  O   . GLY A 1 508 ? 41.424 39.225  29.378  1.00 37.56  ? 508  GLY A O   1 
ATOM   3968  N  N   . ASN A 1 509 ? 40.129 41.000  29.852  1.00 37.73  ? 509  ASN A N   1 
ATOM   3969  C  CA  . ASN A 1 509 ? 39.032 40.554  29.009  1.00 37.90  ? 509  ASN A CA  1 
ATOM   3970  C  C   . ASN A 1 509 ? 39.127 41.140  27.605  1.00 37.85  ? 509  ASN A C   1 
ATOM   3971  O  O   . ASN A 1 509 ? 38.341 40.791  26.724  1.00 37.87  ? 509  ASN A O   1 
ATOM   3972  C  CB  . ASN A 1 509 ? 37.692 40.934  29.643  1.00 38.03  ? 509  ASN A CB  1 
ATOM   3973  C  CG  . ASN A 1 509 ? 37.704 40.804  31.154  1.00 38.29  ? 509  ASN A CG  1 
ATOM   3974  O  OD1 . ASN A 1 509 ? 38.345 39.910  31.708  1.00 38.57  ? 509  ASN A OD1 1 
ATOM   3975  N  ND2 . ASN A 1 509 ? 36.998 41.703  31.830  1.00 38.56  ? 509  ASN A ND2 1 
ATOM   3976  N  N   . GLU A 1 510 ? 40.095 42.028  27.399  1.00 37.72  ? 510  GLU A N   1 
ATOM   3977  C  CA  . GLU A 1 510 ? 40.264 42.680  26.107  1.00 37.57  ? 510  GLU A CA  1 
ATOM   3978  C  C   . GLU A 1 510 ? 41.619 42.388  25.473  1.00 37.44  ? 510  GLU A C   1 
ATOM   3979  O  O   . GLU A 1 510 ? 42.447 41.675  26.040  1.00 37.43  ? 510  GLU A O   1 
ATOM   3980  C  CB  . GLU A 1 510 ? 40.120 44.194  26.262  1.00 37.63  ? 510  GLU A CB  1 
ATOM   3981  C  CG  . GLU A 1 510 ? 39.019 44.640  27.207  1.00 37.68  ? 510  GLU A CG  1 
ATOM   3982  C  CD  . GLU A 1 510 ? 39.123 46.113  27.549  1.00 37.70  ? 510  GLU A CD  1 
ATOM   3983  O  OE1 . GLU A 1 510 ? 40.255 46.591  27.781  1.00 37.38  ? 510  GLU A OE1 1 
ATOM   3984  O  OE2 . GLU A 1 510 ? 38.074 46.791  27.584  1.00 37.77  ? 510  GLU A OE2 1 
ATOM   3985  N  N   . TYR A 1 511 ? 41.829 42.942  24.282  1.00 37.29  ? 511  TYR A N   1 
ATOM   3986  C  CA  . TYR A 1 511 ? 43.130 42.863  23.618  1.00 37.17  ? 511  TYR A CA  1 
ATOM   3987  C  C   . TYR A 1 511 ? 43.412 44.082  22.731  1.00 37.13  ? 511  TYR A C   1 
ATOM   3988  O  O   . TYR A 1 511 ? 42.507 44.638  22.115  1.00 37.14  ? 511  TYR A O   1 
ATOM   3989  C  CB  . TYR A 1 511 ? 43.283 41.544  22.851  1.00 37.04  ? 511  TYR A CB  1 
ATOM   3990  C  CG  . TYR A 1 511 ? 42.566 41.451  21.520  1.00 36.88  ? 511  TYR A CG  1 
ATOM   3991  C  CD1 . TYR A 1 511 ? 41.187 41.570  21.434  1.00 36.68  ? 511  TYR A CD1 1 
ATOM   3992  C  CD2 . TYR A 1 511 ? 43.272 41.198  20.352  1.00 36.84  ? 511  TYR A CD2 1 
ATOM   3993  C  CE1 . TYR A 1 511 ? 40.533 41.463  20.215  1.00 36.52  ? 511  TYR A CE1 1 
ATOM   3994  C  CE2 . TYR A 1 511 ? 42.628 41.085  19.134  1.00 36.55  ? 511  TYR A CE2 1 
ATOM   3995  C  CZ  . TYR A 1 511 ? 41.260 41.220  19.070  1.00 36.43  ? 511  TYR A CZ  1 
ATOM   3996  O  OH  . TYR A 1 511 ? 40.619 41.114  17.856  1.00 36.15  ? 511  TYR A OH  1 
ATOM   3997  N  N   . TRP A 1 512 ? 44.677 44.491  22.698  1.00 37.03  ? 512  TRP A N   1 
ATOM   3998  C  CA  . TRP A 1 512 ? 45.115 45.638  21.917  1.00 36.93  ? 512  TRP A CA  1 
ATOM   3999  C  C   . TRP A 1 512 ? 45.968 45.177  20.747  1.00 36.98  ? 512  TRP A C   1 
ATOM   4000  O  O   . TRP A 1 512 ? 46.686 44.186  20.852  1.00 37.01  ? 512  TRP A O   1 
ATOM   4001  C  CB  . TRP A 1 512 ? 45.954 46.574  22.789  1.00 36.92  ? 512  TRP A CB  1 
ATOM   4002  C  CG  . TRP A 1 512 ? 45.174 47.378  23.777  1.00 36.81  ? 512  TRP A CG  1 
ATOM   4003  C  CD1 . TRP A 1 512 ? 44.855 48.699  23.682  1.00 36.90  ? 512  TRP A CD1 1 
ATOM   4004  C  CD2 . TRP A 1 512 ? 44.626 46.924  25.021  1.00 36.75  ? 512  TRP A CD2 1 
ATOM   4005  N  NE1 . TRP A 1 512 ? 44.136 49.095  24.784  1.00 36.92  ? 512  TRP A NE1 1 
ATOM   4006  C  CE2 . TRP A 1 512 ? 43.982 48.023  25.623  1.00 36.76  ? 512  TRP A CE2 1 
ATOM   4007  C  CE3 . TRP A 1 512 ? 44.610 45.696  25.689  1.00 36.77  ? 512  TRP A CE3 1 
ATOM   4008  C  CZ2 . TRP A 1 512 ? 43.329 47.930  26.849  1.00 36.68  ? 512  TRP A CZ2 1 
ATOM   4009  C  CZ3 . TRP A 1 512 ? 43.964 45.608  26.908  1.00 36.66  ? 512  TRP A CZ3 1 
ATOM   4010  C  CH2 . TRP A 1 512 ? 43.332 46.717  27.473  1.00 36.57  ? 512  TRP A CH2 1 
ATOM   4011  N  N   . ILE A 1 513 ? 45.894 45.898  19.634  1.00 37.06  ? 513  ILE A N   1 
ATOM   4012  C  CA  . ILE A 1 513 ? 46.715 45.579  18.474  1.00 37.27  ? 513  ILE A CA  1 
ATOM   4013  C  C   . ILE A 1 513 ? 47.306 46.832  17.857  1.00 37.41  ? 513  ILE A C   1 
ATOM   4014  O  O   . ILE A 1 513 ? 46.692 47.463  17.001  1.00 37.52  ? 513  ILE A O   1 
ATOM   4015  C  CB  . ILE A 1 513 ? 45.913 44.834  17.412  1.00 37.29  ? 513  ILE A CB  1 
ATOM   4016  C  CG1 . ILE A 1 513 ? 45.282 43.577  18.005  1.00 37.67  ? 513  ILE A CG1 1 
ATOM   4017  C  CG2 . ILE A 1 513 ? 46.815 44.475  16.241  1.00 37.26  ? 513  ILE A CG2 1 
ATOM   4018  C  CD1 . ILE A 1 513 ? 44.352 42.872  17.051  1.00 38.58  ? 513  ILE A CD1 1 
ATOM   4019  N  N   . TYR A 1 514 ? 48.505 47.187  18.295  1.00 37.65  ? 514  TYR A N   1 
ATOM   4020  C  CA  . TYR A 1 514 ? 49.199 48.350  17.768  1.00 37.83  ? 514  TYR A CA  1 
ATOM   4021  C  C   . TYR A 1 514 ? 49.780 48.083  16.387  1.00 37.88  ? 514  TYR A C   1 
ATOM   4022  O  O   . TYR A 1 514 ? 50.043 46.947  16.009  1.00 38.02  ? 514  TYR A O   1 
ATOM   4023  C  CB  . TYR A 1 514 ? 50.355 48.740  18.691  1.00 37.91  ? 514  TYR A CB  1 
ATOM   4024  C  CG  . TYR A 1 514 ? 49.963 49.403  19.988  1.00 37.96  ? 514  TYR A CG  1 
ATOM   4025  C  CD1 . TYR A 1 514 ? 49.806 50.781  20.069  1.00 38.18  ? 514  TYR A CD1 1 
ATOM   4026  C  CD2 . TYR A 1 514 ? 49.776 48.655  21.138  1.00 37.95  ? 514  TYR A CD2 1 
ATOM   4027  C  CE1 . TYR A 1 514 ? 49.461 51.392  21.258  1.00 38.40  ? 514  TYR A CE1 1 
ATOM   4028  C  CE2 . TYR A 1 514 ? 49.432 49.255  22.329  1.00 38.29  ? 514  TYR A CE2 1 
ATOM   4029  C  CZ  . TYR A 1 514 ? 49.276 50.623  22.385  1.00 38.38  ? 514  TYR A CZ  1 
ATOM   4030  O  OH  . TYR A 1 514 ? 48.933 51.222  23.573  1.00 38.79  ? 514  TYR A OH  1 
ATOM   4031  N  N   . SER A 1 515 ? 49.988 49.156  15.644  1.00 38.04  ? 515  SER A N   1 
ATOM   4032  C  CA  . SER A 1 515 ? 50.644 49.103  14.353  1.00 38.29  ? 515  SER A CA  1 
ATOM   4033  C  C   . SER A 1 515 ? 51.184 50.498  14.145  1.00 38.49  ? 515  SER A C   1 
ATOM   4034  O  O   . SER A 1 515 ? 50.438 51.473  14.233  1.00 38.61  ? 515  SER A O   1 
ATOM   4035  C  CB  . SER A 1 515 ? 49.662 48.754  13.236  1.00 38.38  ? 515  SER A CB  1 
ATOM   4036  O  OG  . SER A 1 515 ? 50.191 49.109  11.967  1.00 38.17  ? 515  SER A OG  1 
ATOM   4037  N  N   . ALA A 1 516 ? 52.483 50.602  13.899  1.00 38.62  ? 516  ALA A N   1 
ATOM   4038  C  CA  . ALA A 1 516 ? 53.095 51.903  13.663  1.00 38.70  ? 516  ALA A CA  1 
ATOM   4039  C  C   . ALA A 1 516 ? 52.920 52.840  14.858  1.00 38.71  ? 516  ALA A C   1 
ATOM   4040  O  O   . ALA A 1 516 ? 52.599 54.021  14.693  1.00 38.64  ? 516  ALA A O   1 
ATOM   4041  C  CB  . ALA A 1 516 ? 52.534 52.537  12.391  1.00 38.66  ? 516  ALA A CB  1 
ATOM   4042  N  N   . SER A 1 517 ? 53.117 52.292  16.056  1.00 38.69  ? 517  SER A N   1 
ATOM   4043  C  CA  . SER A 1 517 ? 53.066 53.059  17.303  1.00 38.64  ? 517  SER A CA  1 
ATOM   4044  C  C   . SER A 1 517 ? 51.703 53.637  17.667  1.00 38.56  ? 517  SER A C   1 
ATOM   4045  O  O   . SER A 1 517 ? 51.599 54.494  18.544  1.00 38.56  ? 517  SER A O   1 
ATOM   4046  C  CB  . SER A 1 517 ? 54.123 54.164  17.304  1.00 38.61  ? 517  SER A CB  1 
ATOM   4047  O  OG  . SER A 1 517 ? 55.353 53.661  17.789  1.00 38.66  ? 517  SER A OG  1 
ATOM   4048  N  N   . THR A 1 518 ? 50.660 53.154  17.005  1.00 38.40  ? 518  THR A N   1 
ATOM   4049  C  CA  . THR A 1 518 ? 49.314 53.615  17.286  1.00 38.17  ? 518  THR A CA  1 
ATOM   4050  C  C   . THR A 1 518 ? 48.344 52.459  17.183  1.00 38.02  ? 518  THR A C   1 
ATOM   4051  O  O   . THR A 1 518 ? 48.451 51.634  16.284  1.00 37.94  ? 518  THR A O   1 
ATOM   4052  C  CB  . THR A 1 518 ? 48.927 54.720  16.307  1.00 38.16  ? 518  THR A CB  1 
ATOM   4053  O  OG1 . THR A 1 518 ? 49.712 54.585  15.116  1.00 37.99  ? 518  THR A OG1 1 
ATOM   4054  C  CG2 . THR A 1 518 ? 49.352 56.076  16.851  1.00 38.23  ? 518  THR A CG2 1 
ATOM   4055  N  N   . LEU A 1 519 ? 47.410 52.386  18.120  1.00 37.96  ? 519  LEU A N   1 
ATOM   4056  C  CA  . LEU A 1 519 ? 46.412 51.337  18.083  1.00 38.06  ? 519  LEU A CA  1 
ATOM   4057  C  C   . LEU A 1 519 ? 45.392 51.700  17.018  1.00 38.27  ? 519  LEU A C   1 
ATOM   4058  O  O   . LEU A 1 519 ? 45.140 52.878  16.767  1.00 38.33  ? 519  LEU A O   1 
ATOM   4059  C  CB  . LEU A 1 519 ? 45.740 51.165  19.445  1.00 37.98  ? 519  LEU A CB  1 
ATOM   4060  C  CG  . LEU A 1 519 ? 44.809 52.274  19.931  1.00 37.77  ? 519  LEU A CG  1 
ATOM   4061  C  CD1 . LEU A 1 519 ? 44.078 51.842  21.193  1.00 37.54  ? 519  LEU A CD1 1 
ATOM   4062  C  CD2 . LEU A 1 519 ? 45.579 53.563  20.166  1.00 37.84  ? 519  LEU A CD2 1 
ATOM   4063  N  N   . GLU A 1 520 ? 44.814 50.693  16.379  1.00 38.46  ? 520  GLU A N   1 
ATOM   4064  C  CA  . GLU A 1 520 ? 43.842 50.949  15.326  1.00 38.65  ? 520  GLU A CA  1 
ATOM   4065  C  C   . GLU A 1 520 ? 42.460 51.247  15.895  1.00 38.47  ? 520  GLU A C   1 
ATOM   4066  O  O   . GLU A 1 520 ? 42.134 50.851  17.012  1.00 38.51  ? 520  GLU A O   1 
ATOM   4067  C  CB  . GLU A 1 520 ? 43.797 49.778  14.344  1.00 38.82  ? 520  GLU A CB  1 
ATOM   4068  C  CG  . GLU A 1 520 ? 45.149 49.491  13.709  1.00 39.50  ? 520  GLU A CG  1 
ATOM   4069  C  CD  . GLU A 1 520 ? 45.150 48.222  12.884  1.00 40.43  ? 520  GLU A CD  1 
ATOM   4070  O  OE1 . GLU A 1 520 ? 44.067 47.842  12.384  1.00 40.80  ? 520  GLU A OE1 1 
ATOM   4071  O  OE2 . GLU A 1 520 ? 46.233 47.609  12.738  1.00 40.46  ? 520  GLU A OE2 1 
ATOM   4072  N  N   . ARG A 1 521 ? 41.660 51.964  15.120  1.00 38.30  ? 521  ARG A N   1 
ATOM   4073  C  CA  . ARG A 1 521 ? 40.308 52.314  15.521  1.00 38.16  ? 521  ARG A CA  1 
ATOM   4074  C  C   . ARG A 1 521 ? 39.530 51.034  15.819  1.00 38.05  ? 521  ARG A C   1 
ATOM   4075  O  O   . ARG A 1 521 ? 39.597 50.071  15.057  1.00 38.01  ? 521  ARG A O   1 
ATOM   4076  C  CB  . ARG A 1 521 ? 39.646 53.108  14.391  1.00 38.16  ? 521  ARG A CB  1 
ATOM   4077  C  CG  . ARG A 1 521 ? 38.332 53.799  14.723  1.00 38.20  ? 521  ARG A CG  1 
ATOM   4078  C  CD  . ARG A 1 521 ? 37.745 54.528  13.522  1.00 38.36  ? 521  ARG A CD  1 
ATOM   4079  N  NE  . ARG A 1 521 ? 36.332 54.879  13.665  1.00 38.49  ? 521  ARG A NE  1 
ATOM   4080  C  CZ  . ARG A 1 521 ? 35.432 54.781  12.685  1.00 38.22  ? 521  ARG A CZ  1 
ATOM   4081  N  NH1 . ARG A 1 521 ? 35.794 54.336  11.488  1.00 37.84  ? 521  ARG A NH1 1 
ATOM   4082  N  NH2 . ARG A 1 521 ? 34.169 55.128  12.897  1.00 37.81  ? 521  ARG A NH2 1 
ATOM   4083  N  N   . GLY A 1 522 ? 38.816 51.010  16.940  1.00 37.94  ? 522  GLY A N   1 
ATOM   4084  C  CA  . GLY A 1 522 ? 38.011 49.852  17.292  1.00 37.81  ? 522  GLY A CA  1 
ATOM   4085  C  C   . GLY A 1 522 ? 38.592 48.989  18.395  1.00 37.71  ? 522  GLY A C   1 
ATOM   4086  O  O   . GLY A 1 522 ? 37.884 48.584  19.315  1.00 37.67  ? 522  GLY A O   1 
ATOM   4087  N  N   . TYR A 1 523 ? 39.875 48.668  18.287  1.00 37.67  ? 523  TYR A N   1 
ATOM   4088  C  CA  . TYR A 1 523 ? 40.550 47.931  19.344  1.00 37.79  ? 523  TYR A CA  1 
ATOM   4089  C  C   . TYR A 1 523 ? 40.687 48.975  20.447  1.00 37.69  ? 523  TYR A C   1 
ATOM   4090  O  O   . TYR A 1 523 ? 40.737 50.161  20.142  1.00 37.77  ? 523  TYR A O   1 
ATOM   4091  C  CB  . TYR A 1 523 ? 41.882 47.376  18.832  1.00 37.84  ? 523  TYR A CB  1 
ATOM   4092  C  CG  . TYR A 1 523 ? 41.687 46.568  17.560  1.00 38.26  ? 523  TYR A CG  1 
ATOM   4093  C  CD1 . TYR A 1 523 ? 40.839 45.466  17.543  1.00 38.42  ? 523  TYR A CD1 1 
ATOM   4094  C  CD2 . TYR A 1 523 ? 42.307 46.933  16.370  1.00 38.66  ? 523  TYR A CD2 1 
ATOM   4095  C  CE1 . TYR A 1 523 ? 40.630 44.736  16.385  1.00 38.56  ? 523  TYR A CE1 1 
ATOM   4096  C  CE2 . TYR A 1 523 ? 42.105 46.205  15.204  1.00 38.74  ? 523  TYR A CE2 1 
ATOM   4097  C  CZ  . TYR A 1 523 ? 41.265 45.109  15.219  1.00 38.66  ? 523  TYR A CZ  1 
ATOM   4098  O  OH  . TYR A 1 523 ? 41.059 44.384  14.067  1.00 38.75  ? 523  TYR A OH  1 
ATOM   4099  N  N   . PRO A 1 524 ? 40.767 48.581  21.714  1.00 37.65  ? 524  PRO A N   1 
ATOM   4100  C  CA  . PRO A 1 524 ? 40.933 47.196  22.165  1.00 37.69  ? 524  PRO A CA  1 
ATOM   4101  C  C   . PRO A 1 524 ? 39.640 46.425  22.382  1.00 37.71  ? 524  PRO A C   1 
ATOM   4102  O  O   . PRO A 1 524 ? 38.926 46.687  23.349  1.00 37.80  ? 524  PRO A O   1 
ATOM   4103  C  CB  . PRO A 1 524 ? 41.592 47.375  23.533  1.00 37.75  ? 524  PRO A CB  1 
ATOM   4104  C  CG  . PRO A 1 524 ? 41.562 48.878  23.806  1.00 37.71  ? 524  PRO A CG  1 
ATOM   4105  C  CD  . PRO A 1 524 ? 40.615 49.501  22.847  1.00 37.60  ? 524  PRO A CD  1 
ATOM   4106  N  N   . LYS A 1 525 ? 39.374 45.453  21.520  1.00 37.64  ? 525  LYS A N   1 
ATOM   4107  C  CA  . LYS A 1 525 ? 38.172 44.642  21.619  1.00 37.57  ? 525  LYS A CA  1 
ATOM   4108  C  C   . LYS A 1 525 ? 38.372 43.488  22.595  1.00 37.47  ? 525  LYS A C   1 
ATOM   4109  O  O   . LYS A 1 525 ? 39.503 43.166  22.952  1.00 37.51  ? 525  LYS A O   1 
ATOM   4110  C  CB  . LYS A 1 525 ? 37.831 44.075  20.243  1.00 37.62  ? 525  LYS A CB  1 
ATOM   4111  C  CG  . LYS A 1 525 ? 37.638 45.120  19.155  1.00 37.84  ? 525  LYS A CG  1 
ATOM   4112  C  CD  . LYS A 1 525 ? 37.221 44.450  17.852  1.00 38.37  ? 525  LYS A CD  1 
ATOM   4113  C  CE  . LYS A 1 525 ? 36.517 45.413  16.909  1.00 38.43  ? 525  LYS A CE  1 
ATOM   4114  N  NZ  . LYS A 1 525 ? 37.473 46.297  16.189  1.00 38.61  ? 525  LYS A NZ  1 
ATOM   4115  N  N   . PRO A 1 526 ? 37.275 42.879  23.043  1.00 37.37  ? 526  PRO A N   1 
ATOM   4116  C  CA  . PRO A 1 526 ? 37.347 41.683  23.889  1.00 37.26  ? 526  PRO A CA  1 
ATOM   4117  C  C   . PRO A 1 526 ? 37.901 40.508  23.087  1.00 37.16  ? 526  PRO A C   1 
ATOM   4118  O  O   . PRO A 1 526 ? 38.152 40.661  21.893  1.00 37.21  ? 526  PRO A O   1 
ATOM   4119  C  CB  . PRO A 1 526 ? 35.882 41.420  24.251  1.00 37.25  ? 526  PRO A CB  1 
ATOM   4120  C  CG  . PRO A 1 526 ? 35.179 42.706  23.987  1.00 37.24  ? 526  PRO A CG  1 
ATOM   4121  C  CD  . PRO A 1 526 ? 35.886 43.311  22.815  1.00 37.35  ? 526  PRO A CD  1 
ATOM   4122  N  N   . LEU A 1 527 ? 38.081 39.353  23.721  1.00 37.00  ? 527  LEU A N   1 
ATOM   4123  C  CA  . LEU A 1 527 ? 38.610 38.191  23.015  1.00 36.77  ? 527  LEU A CA  1 
ATOM   4124  C  C   . LEU A 1 527 ? 37.517 37.442  22.266  1.00 36.57  ? 527  LEU A C   1 
ATOM   4125  O  O   . LEU A 1 527 ? 37.805 36.558  21.462  1.00 36.49  ? 527  LEU A O   1 
ATOM   4126  C  CB  . LEU A 1 527 ? 39.321 37.235  23.972  1.00 36.83  ? 527  LEU A CB  1 
ATOM   4127  C  CG  . LEU A 1 527 ? 40.423 37.774  24.880  1.00 36.85  ? 527  LEU A CG  1 
ATOM   4128  C  CD1 . LEU A 1 527 ? 41.046 36.625  25.657  1.00 36.89  ? 527  LEU A CD1 1 
ATOM   4129  C  CD2 . LEU A 1 527 ? 41.471 38.507  24.068  1.00 36.96  ? 527  LEU A CD2 1 
ATOM   4130  N  N   . THR A 1 528 ? 36.264 37.786  22.545  1.00 36.39  ? 528  THR A N   1 
ATOM   4131  C  CA  . THR A 1 528 ? 35.142 37.149  21.872  1.00 36.25  ? 528  THR A CA  1 
ATOM   4132  C  C   . THR A 1 528 ? 35.283 37.356  20.374  1.00 36.22  ? 528  THR A C   1 
ATOM   4133  O  O   . THR A 1 528 ? 35.440 36.402  19.615  1.00 36.15  ? 528  THR A O   1 
ATOM   4134  C  CB  . THR A 1 528 ? 33.811 37.739  22.360  1.00 36.20  ? 528  THR A CB  1 
ATOM   4135  O  OG1 . THR A 1 528 ? 33.671 37.510  23.767  1.00 36.08  ? 528  THR A OG1 1 
ATOM   4136  C  CG2 . THR A 1 528 ? 32.643 36.974  21.763  1.00 36.22  ? 528  THR A CG2 1 
ATOM   4137  N  N   . SER A 1 529 ? 35.249 38.615  19.957  1.00 36.29  ? 529  SER A N   1 
ATOM   4138  C  CA  . SER A 1 529 ? 35.385 38.956  18.548  1.00 36.35  ? 529  SER A CA  1 
ATOM   4139  C  C   . SER A 1 529 ? 36.766 38.554  18.034  1.00 36.38  ? 529  SER A C   1 
ATOM   4140  O  O   . SER A 1 529 ? 37.015 38.553  16.830  1.00 36.34  ? 529  SER A O   1 
ATOM   4141  C  CB  . SER A 1 529 ? 35.132 40.451  18.327  1.00 36.35  ? 529  SER A CB  1 
ATOM   4142  O  OG  . SER A 1 529 ? 34.479 40.684  17.089  1.00 36.13  ? 529  SER A OG  1 
ATOM   4143  N  N   . LEU A 1 530 ? 37.665 38.215  18.951  1.00 36.49  ? 530  LEU A N   1 
ATOM   4144  C  CA  . LEU A 1 530 ? 38.985 37.747  18.553  1.00 36.64  ? 530  LEU A CA  1 
ATOM   4145  C  C   . LEU A 1 530 ? 38.858 36.373  17.911  1.00 36.67  ? 530  LEU A C   1 
ATOM   4146  O  O   . LEU A 1 530 ? 39.275 36.175  16.773  1.00 36.75  ? 530  LEU A O   1 
ATOM   4147  C  CB  . LEU A 1 530 ? 39.941 37.679  19.742  1.00 36.65  ? 530  LEU A CB  1 
ATOM   4148  C  CG  . LEU A 1 530 ? 41.244 36.932  19.449  1.00 36.69  ? 530  LEU A CG  1 
ATOM   4149  C  CD1 . LEU A 1 530 ? 42.022 37.620  18.338  1.00 36.73  ? 530  LEU A CD1 1 
ATOM   4150  C  CD2 . LEU A 1 530 ? 42.089 36.808  20.702  1.00 37.03  ? 530  LEU A CD2 1 
ATOM   4151  N  N   . GLY A 1 531 ? 38.272 35.429  18.643  1.00 36.69  ? 531  GLY A N   1 
ATOM   4152  C  CA  . GLY A 1 531 ? 38.071 34.086  18.129  1.00 36.65  ? 531  GLY A CA  1 
ATOM   4153  C  C   . GLY A 1 531 ? 37.685 33.076  19.194  1.00 36.64  ? 531  GLY A C   1 
ATOM   4154  O  O   . GLY A 1 531 ? 36.846 32.207  18.965  1.00 36.63  ? 531  GLY A O   1 
ATOM   4155  N  N   . LEU A 1 532 ? 38.301 33.198  20.364  1.00 36.65  ? 532  LEU A N   1 
ATOM   4156  C  CA  . LEU A 1 532 ? 38.054 32.294  21.479  1.00 36.61  ? 532  LEU A CA  1 
ATOM   4157  C  C   . LEU A 1 532 ? 36.649 32.478  22.047  1.00 36.62  ? 532  LEU A C   1 
ATOM   4158  O  O   . LEU A 1 532 ? 36.025 33.519  21.855  1.00 36.64  ? 532  LEU A O   1 
ATOM   4159  C  CB  . LEU A 1 532 ? 39.084 32.547  22.582  1.00 36.61  ? 532  LEU A CB  1 
ATOM   4160  C  CG  . LEU A 1 532 ? 40.454 33.037  22.106  1.00 36.73  ? 532  LEU A CG  1 
ATOM   4161  C  CD1 . LEU A 1 532 ? 41.351 33.421  23.280  1.00 36.91  ? 532  LEU A CD1 1 
ATOM   4162  C  CD2 . LEU A 1 532 ? 41.119 31.990  21.229  1.00 36.71  ? 532  LEU A CD2 1 
ATOM   4163  N  N   . PRO A 1 533 ? 36.146 31.451  22.724  1.00 36.64  ? 533  PRO A N   1 
ATOM   4164  C  CA  . PRO A 1 533 ? 34.846 31.519  23.400  1.00 36.69  ? 533  PRO A CA  1 
ATOM   4165  C  C   . PRO A 1 533 ? 34.876 32.549  24.527  1.00 36.77  ? 533  PRO A C   1 
ATOM   4166  O  O   . PRO A 1 533 ? 35.921 33.151  24.758  1.00 36.71  ? 533  PRO A O   1 
ATOM   4167  C  CB  . PRO A 1 533 ? 34.692 30.114  23.990  1.00 36.68  ? 533  PRO A CB  1 
ATOM   4168  C  CG  . PRO A 1 533 ? 35.605 29.256  23.188  1.00 36.64  ? 533  PRO A CG  1 
ATOM   4169  C  CD  . PRO A 1 533 ? 36.771 30.124  22.850  1.00 36.68  ? 533  PRO A CD  1 
ATOM   4170  N  N   . PRO A 1 534 ? 33.753 32.753  25.212  1.00 36.89  ? 534  PRO A N   1 
ATOM   4171  C  CA  . PRO A 1 534 ? 33.684 33.701  26.332  1.00 37.03  ? 534  PRO A CA  1 
ATOM   4172  C  C   . PRO A 1 534 ? 34.662 33.384  27.467  1.00 37.19  ? 534  PRO A C   1 
ATOM   4173  O  O   . PRO A 1 534 ? 34.658 34.076  28.486  1.00 37.21  ? 534  PRO A O   1 
ATOM   4174  C  CB  . PRO A 1 534 ? 32.240 33.560  26.819  1.00 36.99  ? 534  PRO A CB  1 
ATOM   4175  C  CG  . PRO A 1 534 ? 31.499 33.055  25.636  1.00 36.91  ? 534  PRO A CG  1 
ATOM   4176  C  CD  . PRO A 1 534 ? 32.450 32.122  24.945  1.00 36.88  ? 534  PRO A CD  1 
ATOM   4177  N  N   . ASP A 1 535 ? 35.479 32.348  27.291  1.00 37.37  ? 535  ASP A N   1 
ATOM   4178  C  CA  . ASP A 1 535 ? 36.504 31.984  28.264  1.00 37.55  ? 535  ASP A CA  1 
ATOM   4179  C  C   . ASP A 1 535 ? 37.430 33.176  28.456  1.00 37.65  ? 535  ASP A C   1 
ATOM   4180  O  O   . ASP A 1 535 ? 38.252 33.211  29.371  1.00 37.71  ? 535  ASP A O   1 
ATOM   4181  C  CB  . ASP A 1 535 ? 37.337 30.833  27.714  1.00 37.57  ? 535  ASP A CB  1 
ATOM   4182  C  CG  . ASP A 1 535 ? 38.152 31.244  26.498  1.00 37.68  ? 535  ASP A CG  1 
ATOM   4183  O  OD1 . ASP A 1 535 ? 39.099 32.048  26.649  1.00 37.60  ? 535  ASP A OD1 1 
ATOM   4184  O  OD2 . ASP A 1 535 ? 37.909 30.829  25.348  1.00 37.93  ? 535  ASP A OD2 1 
ATOM   4185  N  N   . VAL A 1 536 ? 37.279 34.142  27.561  1.00 37.74  ? 536  VAL A N   1 
ATOM   4186  C  CA  . VAL A 1 536 ? 38.120 35.330  27.472  1.00 37.81  ? 536  VAL A CA  1 
ATOM   4187  C  C   . VAL A 1 536 ? 38.520 36.037  28.770  1.00 37.81  ? 536  VAL A C   1 
ATOM   4188  O  O   . VAL A 1 536 ? 39.189 37.070  28.723  1.00 37.91  ? 536  VAL A O   1 
ATOM   4189  C  CB  . VAL A 1 536 ? 37.470 36.357  26.529  1.00 37.83  ? 536  VAL A CB  1 
ATOM   4190  C  CG1 . VAL A 1 536 ? 37.184 35.709  25.188  1.00 37.88  ? 536  VAL A CG1 1 
ATOM   4191  C  CG2 . VAL A 1 536 ? 36.187 36.900  27.133  1.00 37.87  ? 536  VAL A CG2 1 
ATOM   4192  N  N   . GLN A 1 537 ? 38.127 35.494  29.918  1.00 37.75  ? 537  GLN A N   1 
ATOM   4193  C  CA  . GLN A 1 537 ? 38.477 36.111  31.194  1.00 37.71  ? 537  GLN A CA  1 
ATOM   4194  C  C   . GLN A 1 537 ? 39.937 36.565  31.205  1.00 37.67  ? 537  GLN A C   1 
ATOM   4195  O  O   . GLN A 1 537 ? 40.234 37.711  31.541  1.00 37.64  ? 537  GLN A O   1 
ATOM   4196  C  CB  . GLN A 1 537 ? 38.194 35.161  32.359  1.00 37.74  ? 537  GLN A CB  1 
ATOM   4197  C  CG  . GLN A 1 537 ? 36.716 34.820  32.530  1.00 37.92  ? 537  GLN A CG  1 
ATOM   4198  C  CD  . GLN A 1 537 ? 36.454 33.880  33.696  1.00 38.03  ? 537  GLN A CD  1 
ATOM   4199  O  OE1 . GLN A 1 537 ? 37.377 33.502  34.417  1.00 38.26  ? 537  GLN A OE1 1 
ATOM   4200  N  NE2 . GLN A 1 537 ? 35.194 33.501  33.882  1.00 37.86  ? 537  GLN A NE2 1 
ATOM   4201  N  N   . ARG A 1 538 ? 40.842 35.667  30.827  1.00 37.61  ? 538  ARG A N   1 
ATOM   4202  C  CA  . ARG A 1 538 ? 42.264 35.995  30.764  1.00 37.57  ? 538  ARG A CA  1 
ATOM   4203  C  C   . ARG A 1 538 ? 43.016 35.006  29.882  1.00 37.51  ? 538  ARG A C   1 
ATOM   4204  O  O   . ARG A 1 538 ? 42.485 33.958  29.520  1.00 37.57  ? 538  ARG A O   1 
ATOM   4205  C  CB  . ARG A 1 538 ? 42.877 36.015  32.163  1.00 37.54  ? 538  ARG A CB  1 
ATOM   4206  C  CG  . ARG A 1 538 ? 43.110 34.639  32.746  1.00 37.79  ? 538  ARG A CG  1 
ATOM   4207  C  CD  . ARG A 1 538 ? 43.339 34.641  34.243  1.00 38.28  ? 538  ARG A CD  1 
ATOM   4208  N  NE  . ARG A 1 538 ? 42.257 35.323  34.947  1.00 38.50  ? 538  ARG A NE  1 
ATOM   4209  C  CZ  . ARG A 1 538 ? 41.709 34.890  36.075  1.00 38.43  ? 538  ARG A CZ  1 
ATOM   4210  N  NH1 . ARG A 1 538 ? 42.141 33.770  36.639  1.00 38.22  ? 538  ARG A NH1 1 
ATOM   4211  N  NH2 . ARG A 1 538 ? 40.727 35.579  36.644  1.00 38.42  ? 538  ARG A NH2 1 
ATOM   4212  N  N   . VAL A 1 539 ? 44.255 35.346  29.541  1.00 37.47  ? 539  VAL A N   1 
ATOM   4213  C  CA  . VAL A 1 539 ? 45.091 34.490  28.703  1.00 37.43  ? 539  VAL A CA  1 
ATOM   4214  C  C   . VAL A 1 539 ? 46.381 34.100  29.431  1.00 37.44  ? 539  VAL A C   1 
ATOM   4215  O  O   . VAL A 1 539 ? 46.669 34.611  30.514  1.00 37.49  ? 539  VAL A O   1 
ATOM   4216  C  CB  . VAL A 1 539 ? 45.408 35.173  27.353  1.00 37.40  ? 539  VAL A CB  1 
ATOM   4217  C  CG1 . VAL A 1 539 ? 46.529 34.456  26.620  1.00 37.46  ? 539  VAL A CG1 1 
ATOM   4218  C  CG2 . VAL A 1 539 ? 44.165 35.225  26.488  1.00 37.33  ? 539  VAL A CG2 1 
ATOM   4219  N  N   . ASP A 1 540 ? 47.148 33.186  28.844  1.00 37.39  ? 540  ASP A N   1 
ATOM   4220  C  CA  . ASP A 1 540 ? 48.392 32.736  29.456  1.00 37.32  ? 540  ASP A CA  1 
ATOM   4221  C  C   . ASP A 1 540 ? 49.624 32.986  28.583  1.00 37.30  ? 540  ASP A C   1 
ATOM   4222  O  O   . ASP A 1 540 ? 50.648 33.464  29.073  1.00 37.34  ? 540  ASP A O   1 
ATOM   4223  C  CB  . ASP A 1 540 ? 48.290 31.263  29.846  1.00 37.30  ? 540  ASP A CB  1 
ATOM   4224  C  CG  . ASP A 1 540 ? 47.470 31.054  31.104  1.00 37.36  ? 540  ASP A CG  1 
ATOM   4225  O  OD1 . ASP A 1 540 ? 47.721 31.760  32.103  1.00 37.30  ? 540  ASP A OD1 1 
ATOM   4226  O  OD2 . ASP A 1 540 ? 46.553 30.211  31.187  1.00 37.61  ? 540  ASP A OD2 1 
ATOM   4227  N  N   . ALA A 1 541 ? 49.526 32.669  27.296  1.00 37.20  ? 541  ALA A N   1 
ATOM   4228  C  CA  . ALA A 1 541 ? 50.637 32.889  26.372  1.00 37.10  ? 541  ALA A CA  1 
ATOM   4229  C  C   . ALA A 1 541 ? 50.177 32.822  24.918  1.00 37.04  ? 541  ALA A C   1 
ATOM   4230  O  O   . ALA A 1 541 ? 49.112 32.282  24.625  1.00 37.10  ? 541  ALA A O   1 
ATOM   4231  C  CB  . ALA A 1 541 ? 51.746 31.887  26.627  1.00 37.05  ? 541  ALA A CB  1 
ATOM   4232  N  N   . ALA A 1 542 ? 50.981 33.370  24.011  1.00 36.93  ? 542  ALA A N   1 
ATOM   4233  C  CA  . ALA A 1 542 ? 50.644 33.358  22.592  1.00 36.89  ? 542  ALA A CA  1 
ATOM   4234  C  C   . ALA A 1 542 ? 51.848 33.685  21.710  1.00 36.91  ? 542  ALA A C   1 
ATOM   4235  O  O   . ALA A 1 542 ? 52.779 34.356  22.145  1.00 36.90  ? 542  ALA A O   1 
ATOM   4236  C  CB  . ALA A 1 542 ? 49.502 34.317  22.315  1.00 36.95  ? 542  ALA A CB  1 
ATOM   4237  N  N   . PHE A 1 543 ? 51.812 33.227  20.464  1.00 37.04  ? 543  PHE A N   1 
ATOM   4238  C  CA  . PHE A 1 543 ? 52.922 33.430  19.543  1.00 37.26  ? 543  PHE A CA  1 
ATOM   4239  C  C   . PHE A 1 543 ? 52.573 32.986  18.126  1.00 37.45  ? 543  PHE A C   1 
ATOM   4240  O  O   . PHE A 1 543 ? 51.436 32.613  17.834  1.00 37.54  ? 543  PHE A O   1 
ATOM   4241  C  CB  . PHE A 1 543 ? 54.111 32.595  20.002  1.00 37.26  ? 543  PHE A CB  1 
ATOM   4242  C  CG  . PHE A 1 543 ? 53.976 31.130  19.672  1.00 37.58  ? 543  PHE A CG  1 
ATOM   4243  C  CD1 . PHE A 1 543 ? 52.977 30.363  20.245  1.00 37.97  ? 543  PHE A CD1 1 
ATOM   4244  C  CD2 . PHE A 1 543 ? 54.839 30.524  18.777  1.00 37.83  ? 543  PHE A CD2 1 
ATOM   4245  C  CE1 . PHE A 1 543 ? 52.851 29.016  19.935  1.00 38.20  ? 543  PHE A CE1 1 
ATOM   4246  C  CE2 . PHE A 1 543 ? 54.713 29.177  18.460  1.00 38.03  ? 543  PHE A CE2 1 
ATOM   4247  C  CZ  . PHE A 1 543 ? 53.718 28.425  19.041  1.00 38.10  ? 543  PHE A CZ  1 
ATOM   4248  N  N   . ASN A 1 544 ? 53.579 33.010  17.255  1.00 37.63  ? 544  ASN A N   1 
ATOM   4249  C  CA  . ASN A 1 544 ? 53.447 32.554  15.874  1.00 37.81  ? 544  ASN A CA  1 
ATOM   4250  C  C   . ASN A 1 544 ? 54.344 31.350  15.633  1.00 37.78  ? 544  ASN A C   1 
ATOM   4251  O  O   . ASN A 1 544 ? 55.313 31.148  16.355  1.00 37.91  ? 544  ASN A O   1 
ATOM   4252  C  CB  . ASN A 1 544 ? 53.882 33.655  14.916  1.00 37.96  ? 544  ASN A CB  1 
ATOM   4253  C  CG  . ASN A 1 544 ? 55.398 33.793  14.843  1.00 38.23  ? 544  ASN A CG  1 
ATOM   4254  O  OD1 . ASN A 1 544 ? 55.982 33.782  13.757  1.00 38.80  ? 544  ASN A OD1 1 
ATOM   4255  N  ND2 . ASN A 1 544 ? 56.041 33.912  16.004  1.00 37.85  ? 544  ASN A ND2 1 
ATOM   4256  N  N   . TRP A 1 545 ? 54.046 30.558  14.612  1.00 37.68  ? 545  TRP A N   1 
ATOM   4257  C  CA  . TRP A 1 545 ? 54.903 29.423  14.298  1.00 37.64  ? 545  TRP A CA  1 
ATOM   4258  C  C   . TRP A 1 545 ? 56.103 29.823  13.449  1.00 37.61  ? 545  TRP A C   1 
ATOM   4259  O  O   . TRP A 1 545 ? 56.026 30.739  12.637  1.00 37.57  ? 545  TRP A O   1 
ATOM   4260  C  CB  . TRP A 1 545 ? 54.119 28.315  13.605  1.00 37.69  ? 545  TRP A CB  1 
ATOM   4261  C  CG  . TRP A 1 545 ? 54.011 27.066  14.425  1.00 37.79  ? 545  TRP A CG  1 
ATOM   4262  C  CD1 . TRP A 1 545 ? 53.372 26.922  15.618  1.00 37.89  ? 545  TRP A CD1 1 
ATOM   4263  C  CD2 . TRP A 1 545 ? 54.570 25.786  14.115  1.00 37.60  ? 545  TRP A CD2 1 
ATOM   4264  N  NE1 . TRP A 1 545 ? 53.487 25.629  16.066  1.00 37.70  ? 545  TRP A NE1 1 
ATOM   4265  C  CE2 . TRP A 1 545 ? 54.221 24.910  15.161  1.00 37.74  ? 545  TRP A CE2 1 
ATOM   4266  C  CE3 . TRP A 1 545 ? 55.331 25.286  13.055  1.00 37.69  ? 545  TRP A CE3 1 
ATOM   4267  C  CZ2 . TRP A 1 545 ? 54.605 23.570  15.177  1.00 38.06  ? 545  TRP A CZ2 1 
ATOM   4268  C  CZ3 . TRP A 1 545 ? 55.708 23.958  13.071  1.00 37.94  ? 545  TRP A CZ3 1 
ATOM   4269  C  CH2 . TRP A 1 545 ? 55.346 23.115  14.124  1.00 38.09  ? 545  TRP A CH2 1 
ATOM   4270  N  N   . SER A 1 546 ? 57.215 29.126  13.647  1.00 37.67  ? 546  SER A N   1 
ATOM   4271  C  CA  . SER A 1 546 ? 58.428 29.390  12.887  1.00 37.68  ? 546  SER A CA  1 
ATOM   4272  C  C   . SER A 1 546 ? 58.434 28.581  11.600  1.00 37.77  ? 546  SER A C   1 
ATOM   4273  O  O   . SER A 1 546 ? 59.403 28.620  10.844  1.00 37.82  ? 546  SER A O   1 
ATOM   4274  C  CB  . SER A 1 546 ? 59.669 29.045  13.712  1.00 37.69  ? 546  SER A CB  1 
ATOM   4275  O  OG  . SER A 1 546 ? 59.750 29.832  14.886  1.00 37.46  ? 546  SER A OG  1 
ATOM   4276  N  N   . LYS A 1 547 ? 57.355 27.842  11.357  1.00 37.84  ? 547  LYS A N   1 
ATOM   4277  C  CA  . LYS A 1 547 ? 57.251 27.020  10.154  1.00 37.89  ? 547  LYS A CA  1 
ATOM   4278  C  C   . LYS A 1 547 ? 55.810 26.909  9.651   1.00 37.86  ? 547  LYS A C   1 
ATOM   4279  O  O   . LYS A 1 547 ? 55.570 26.777  8.450   1.00 37.87  ? 547  LYS A O   1 
ATOM   4280  C  CB  . LYS A 1 547 ? 57.828 25.625  10.399  1.00 37.89  ? 547  LYS A CB  1 
ATOM   4281  C  CG  . LYS A 1 547 ? 57.972 24.795  9.137   1.00 38.02  ? 547  LYS A CG  1 
ATOM   4282  C  CD  . LYS A 1 547 ? 57.521 23.374  9.385   1.00 38.50  ? 547  LYS A CD  1 
ATOM   4283  C  CE  . LYS A 1 547 ? 56.309 23.373  10.296  1.00 38.74  ? 547  LYS A CE  1 
ATOM   4284  N  NZ  . LYS A 1 547 ? 55.432 22.189  10.106  1.00 39.17  ? 547  LYS A NZ  1 
ATOM   4285  N  N   . ASN A 1 548 ? 54.856 26.941  10.575  1.00 37.80  ? 548  ASN A N   1 
ATOM   4286  C  CA  . ASN A 1 548 ? 53.445 26.879  10.218  1.00 37.70  ? 548  ASN A CA  1 
ATOM   4287  C  C   . ASN A 1 548 ? 52.948 28.288  9.960   1.00 37.70  ? 548  ASN A C   1 
ATOM   4288  O  O   . ASN A 1 548 ? 52.045 28.510  9.152   1.00 37.65  ? 548  ASN A O   1 
ATOM   4289  C  CB  . ASN A 1 548 ? 52.639 26.209  11.331  1.00 37.67  ? 548  ASN A CB  1 
ATOM   4290  C  CG  . ASN A 1 548 ? 51.178 26.598  11.316  1.00 37.53  ? 548  ASN A CG  1 
ATOM   4291  O  OD1 . ASN A 1 548 ? 50.572 26.750  10.257  1.00 37.47  ? 548  ASN A OD1 1 
ATOM   4292  N  ND2 . ASN A 1 548 ? 50.599 26.752  12.500  1.00 37.41  ? 548  ASN A ND2 1 
ATOM   4293  N  N   . LYS A 1 549 ? 53.567 29.238  10.649  1.00 37.67  ? 549  LYS A N   1 
ATOM   4294  C  CA  . LYS A 1 549 ? 53.238 30.651  10.503  1.00 37.71  ? 549  LYS A CA  1 
ATOM   4295  C  C   . LYS A 1 549 ? 51.792 30.971  10.877  1.00 37.69  ? 549  LYS A C   1 
ATOM   4296  O  O   . LYS A 1 549 ? 51.101 31.707  10.172  1.00 37.71  ? 549  LYS A O   1 
ATOM   4297  C  CB  . LYS A 1 549 ? 53.591 31.152  9.095   1.00 37.70  ? 549  LYS A CB  1 
ATOM   4298  C  CG  . LYS A 1 549 ? 55.076 31.467  8.928   1.00 37.75  ? 549  LYS A CG  1 
ATOM   4299  C  CD  . LYS A 1 549 ? 55.551 31.300  7.493   1.00 37.82  ? 549  LYS A CD  1 
ATOM   4300  C  CE  . LYS A 1 549 ? 57.071 31.378  7.415   1.00 37.92  ? 549  LYS A CE  1 
ATOM   4301  N  NZ  . LYS A 1 549 ? 57.601 30.823  6.138   1.00 37.99  ? 549  LYS A NZ  1 
ATOM   4302  N  N   . LYS A 1 550 ? 51.347 30.407  11.996  1.00 37.67  ? 550  LYS A N   1 
ATOM   4303  C  CA  . LYS A 1 550 ? 50.021 30.689  12.529  1.00 37.70  ? 550  LYS A CA  1 
ATOM   4304  C  C   . LYS A 1 550 ? 50.135 31.147  13.977  1.00 37.72  ? 550  LYS A C   1 
ATOM   4305  O  O   . LYS A 1 550 ? 51.233 31.226  14.525  1.00 37.93  ? 550  LYS A O   1 
ATOM   4306  C  CB  . LYS A 1 550 ? 49.118 29.463  12.432  1.00 37.67  ? 550  LYS A CB  1 
ATOM   4307  C  CG  . LYS A 1 550 ? 48.646 29.169  11.021  1.00 37.78  ? 550  LYS A CG  1 
ATOM   4308  C  CD  . LYS A 1 550 ? 47.460 28.225  11.021  1.00 37.73  ? 550  LYS A CD  1 
ATOM   4309  C  CE  . LYS A 1 550 ? 46.961 27.960  9.612   1.00 37.65  ? 550  LYS A CE  1 
ATOM   4310  N  NZ  . LYS A 1 550 ? 45.610 27.343  9.615   1.00 37.36  ? 550  LYS A NZ  1 
ATOM   4311  N  N   . THR A 1 551 ? 49.003 31.455  14.598  1.00 37.59  ? 551  THR A N   1 
ATOM   4312  C  CA  . THR A 1 551 ? 49.013 31.892  15.987  1.00 37.43  ? 551  THR A CA  1 
ATOM   4313  C  C   . THR A 1 551 ? 48.497 30.799  16.914  1.00 37.36  ? 551  THR A C   1 
ATOM   4314  O  O   . THR A 1 551 ? 47.539 30.101  16.582  1.00 37.35  ? 551  THR A O   1 
ATOM   4315  C  CB  . THR A 1 551 ? 48.181 33.175  16.154  1.00 37.43  ? 551  THR A CB  1 
ATOM   4316  O  OG1 . THR A 1 551 ? 48.991 34.311  15.830  1.00 37.35  ? 551  THR A OG1 1 
ATOM   4317  C  CG2 . THR A 1 551 ? 47.840 33.406  17.615  1.00 37.39  ? 551  THR A CG2 1 
ATOM   4318  N  N   . TYR A 1 552 ? 49.150 30.641  18.065  1.00 37.16  ? 552  TYR A N   1 
ATOM   4319  C  CA  . TYR A 1 552 ? 48.723 29.661  19.060  1.00 36.98  ? 552  TYR A CA  1 
ATOM   4320  C  C   . TYR A 1 552 ? 48.463 30.334  20.395  1.00 36.82  ? 552  TYR A C   1 
ATOM   4321  O  O   . TYR A 1 552 ? 49.389 30.755  21.080  1.00 36.83  ? 552  TYR A O   1 
ATOM   4322  C  CB  . TYR A 1 552 ? 49.749 28.538  19.211  1.00 37.00  ? 552  TYR A CB  1 
ATOM   4323  C  CG  . TYR A 1 552 ? 49.719 27.565  18.063  1.00 37.17  ? 552  TYR A CG  1 
ATOM   4324  C  CD1 . TYR A 1 552 ? 50.477 27.787  16.925  1.00 37.34  ? 552  TYR A CD1 1 
ATOM   4325  C  CD2 . TYR A 1 552 ? 48.911 26.434  18.103  1.00 37.27  ? 552  TYR A CD2 1 
ATOM   4326  C  CE1 . TYR A 1 552 ? 50.442 26.905  15.861  1.00 37.30  ? 552  TYR A CE1 1 
ATOM   4327  C  CE2 . TYR A 1 552 ? 48.869 25.552  17.043  1.00 36.86  ? 552  TYR A CE2 1 
ATOM   4328  C  CZ  . TYR A 1 552 ? 49.641 25.791  15.926  1.00 36.86  ? 552  TYR A CZ  1 
ATOM   4329  O  OH  . TYR A 1 552 ? 49.615 24.924  14.862  1.00 36.66  ? 552  TYR A OH  1 
ATOM   4330  N  N   . ILE A 1 553 ? 47.190 30.435  20.755  1.00 36.70  ? 553  ILE A N   1 
ATOM   4331  C  CA  . ILE A 1 553 ? 46.791 31.091  21.991  1.00 36.55  ? 553  ILE A CA  1 
ATOM   4332  C  C   . ILE A 1 553 ? 46.620 30.082  23.116  1.00 36.45  ? 553  ILE A C   1 
ATOM   4333  O  O   . ILE A 1 553 ? 45.589 29.421  23.219  1.00 36.42  ? 553  ILE A O   1 
ATOM   4334  C  CB  . ILE A 1 553 ? 45.481 31.879  21.782  1.00 36.54  ? 553  ILE A CB  1 
ATOM   4335  C  CG1 . ILE A 1 553 ? 45.600 32.799  20.568  1.00 36.35  ? 553  ILE A CG1 1 
ATOM   4336  C  CG2 . ILE A 1 553 ? 45.126 32.676  23.027  1.00 36.53  ? 553  ILE A CG2 1 
ATOM   4337  C  CD1 . ILE A 1 553 ? 44.312 33.493  20.209  1.00 36.24  ? 553  ILE A CD1 1 
ATOM   4338  N  N   . PHE A 1 554 ? 47.638 29.970  23.961  1.00 36.37  ? 554  PHE A N   1 
ATOM   4339  C  CA  . PHE A 1 554 ? 47.591 29.048  25.084  1.00 36.34  ? 554  PHE A CA  1 
ATOM   4340  C  C   . PHE A 1 554 ? 46.863 29.667  26.269  1.00 36.42  ? 554  PHE A C   1 
ATOM   4341  O  O   . PHE A 1 554 ? 47.197 30.767  26.713  1.00 36.37  ? 554  PHE A O   1 
ATOM   4342  C  CB  . PHE A 1 554 ? 49.002 28.635  25.487  1.00 36.29  ? 554  PHE A CB  1 
ATOM   4343  C  CG  . PHE A 1 554 ? 49.796 28.049  24.363  1.00 36.01  ? 554  PHE A CG  1 
ATOM   4344  C  CD1 . PHE A 1 554 ? 49.627 26.725  23.999  1.00 35.44  ? 554  PHE A CD1 1 
ATOM   4345  C  CD2 . PHE A 1 554 ? 50.707 28.822  23.664  1.00 35.68  ? 554  PHE A CD2 1 
ATOM   4346  C  CE1 . PHE A 1 554 ? 50.354 26.181  22.963  1.00 35.22  ? 554  PHE A CE1 1 
ATOM   4347  C  CE2 . PHE A 1 554 ? 51.439 28.282  22.627  1.00 35.57  ? 554  PHE A CE2 1 
ATOM   4348  C  CZ  . PHE A 1 554 ? 51.261 26.958  22.274  1.00 35.37  ? 554  PHE A CZ  1 
ATOM   4349  N  N   . ALA A 1 555 ? 45.865 28.950  26.774  1.00 36.48  ? 555  ALA A N   1 
ATOM   4350  C  CA  . ALA A 1 555 ? 45.079 29.412  27.910  1.00 36.55  ? 555  ALA A CA  1 
ATOM   4351  C  C   . ALA A 1 555 ? 44.503 28.229  28.678  1.00 36.59  ? 555  ALA A C   1 
ATOM   4352  O  O   . ALA A 1 555 ? 43.546 27.596  28.235  1.00 36.61  ? 555  ALA A O   1 
ATOM   4353  C  CB  . ALA A 1 555 ? 43.963 30.336  27.446  1.00 36.52  ? 555  ALA A CB  1 
ATOM   4354  N  N   . GLY A 1 556 ? 45.090 27.933  29.833  1.00 36.65  ? 556  GLY A N   1 
ATOM   4355  C  CA  . GLY A 1 556 ? 44.626 26.829  30.654  1.00 36.72  ? 556  GLY A CA  1 
ATOM   4356  C  C   . GLY A 1 556 ? 45.262 25.504  30.271  1.00 36.75  ? 556  GLY A C   1 
ATOM   4357  O  O   . GLY A 1 556 ? 46.421 25.436  29.863  1.00 36.79  ? 556  GLY A O   1 
ATOM   4358  N  N   . ASP A 1 557 ? 44.500 24.434  30.414  1.00 36.73  ? 557  ASP A N   1 
ATOM   4359  C  CA  . ASP A 1 557 ? 44.994 23.125  30.045  1.00 36.77  ? 557  ASP A CA  1 
ATOM   4360  C  C   . ASP A 1 557 ? 44.842 22.953  28.541  1.00 36.74  ? 557  ASP A C   1 
ATOM   4361  O  O   . ASP A 1 557 ? 45.374 22.016  27.950  1.00 36.73  ? 557  ASP A O   1 
ATOM   4362  C  CB  . ASP A 1 557 ? 44.196 22.058  30.784  1.00 36.83  ? 557  ASP A CB  1 
ATOM   4363  C  CG  . ASP A 1 557 ? 42.717 22.377  30.831  1.00 36.98  ? 557  ASP A CG  1 
ATOM   4364  O  OD1 . ASP A 1 557 ? 42.188 23.224  30.084  1.00 36.99  ? 557  ASP A OD1 1 
ATOM   4365  O  OD2 . ASP A 1 557 ? 41.996 21.774  31.653  1.00 37.34  ? 557  ASP A OD2 1 
ATOM   4366  N  N   . LYS A 1 558 ? 44.119 23.883  27.927  1.00 36.75  ? 558  LYS A N   1 
ATOM   4367  C  CA  . LYS A 1 558 ? 43.824 23.815  26.502  1.00 36.77  ? 558  LYS A CA  1 
ATOM   4368  C  C   . LYS A 1 558 ? 44.401 24.982  25.710  1.00 36.76  ? 558  LYS A C   1 
ATOM   4369  O  O   . LYS A 1 558 ? 44.325 26.132  26.134  1.00 36.75  ? 558  LYS A O   1 
ATOM   4370  C  CB  . LYS A 1 558 ? 42.309 23.735  26.296  1.00 36.80  ? 558  LYS A CB  1 
ATOM   4371  C  CG  . LYS A 1 558 ? 41.513 24.604  27.260  1.00 36.82  ? 558  LYS A CG  1 
ATOM   4372  C  CD  . LYS A 1 558 ? 40.158 23.986  27.566  1.00 36.93  ? 558  LYS A CD  1 
ATOM   4373  C  CE  . LYS A 1 558 ? 39.582 24.528  28.866  1.00 37.03  ? 558  LYS A CE  1 
ATOM   4374  N  NZ  . LYS A 1 558 ? 38.582 23.594  29.461  1.00 37.09  ? 558  LYS A NZ  1 
ATOM   4375  N  N   . PHE A 1 559 ? 44.975 24.673  24.554  1.00 36.80  ? 559  PHE A N   1 
ATOM   4376  C  CA  . PHE A 1 559 ? 45.556 25.685  23.680  1.00 36.86  ? 559  PHE A CA  1 
ATOM   4377  C  C   . PHE A 1 559 ? 44.550 26.057  22.602  1.00 36.87  ? 559  PHE A C   1 
ATOM   4378  O  O   . PHE A 1 559 ? 43.547 25.368  22.419  1.00 36.88  ? 559  PHE A O   1 
ATOM   4379  C  CB  . PHE A 1 559 ? 46.815 25.142  23.017  1.00 36.91  ? 559  PHE A CB  1 
ATOM   4380  C  CG  . PHE A 1 559 ? 46.536 24.104  21.979  1.00 37.08  ? 559  PHE A CG  1 
ATOM   4381  C  CD1 . PHE A 1 559 ? 46.086 22.846  22.347  1.00 37.27  ? 559  PHE A CD1 1 
ATOM   4382  C  CD2 . PHE A 1 559 ? 46.701 24.390  20.636  1.00 37.07  ? 559  PHE A CD2 1 
ATOM   4383  C  CE1 . PHE A 1 559 ? 45.816 21.888  21.396  1.00 37.39  ? 559  PHE A CE1 1 
ATOM   4384  C  CE2 . PHE A 1 559 ? 46.430 23.440  19.682  1.00 37.52  ? 559  PHE A CE2 1 
ATOM   4385  C  CZ  . PHE A 1 559 ? 45.984 22.183  20.064  1.00 37.54  ? 559  PHE A CZ  1 
ATOM   4386  N  N   . TRP A 1 560 ? 44.826 27.141  21.880  1.00 36.91  ? 560  TRP A N   1 
ATOM   4387  C  CA  . TRP A 1 560 ? 43.928 27.605  20.821  1.00 36.84  ? 560  TRP A CA  1 
ATOM   4388  C  C   . TRP A 1 560 ? 44.614 27.815  19.475  1.00 36.91  ? 560  TRP A C   1 
ATOM   4389  O  O   . TRP A 1 560 ? 45.823 27.632  19.341  1.00 36.96  ? 560  TRP A O   1 
ATOM   4390  C  CB  . TRP A 1 560 ? 43.192 28.875  21.244  1.00 36.70  ? 560  TRP A CB  1 
ATOM   4391  C  CG  . TRP A 1 560 ? 41.841 28.606  21.826  1.00 36.38  ? 560  TRP A CG  1 
ATOM   4392  C  CD1 . TRP A 1 560 ? 40.681 28.398  21.139  1.00 36.01  ? 560  TRP A CD1 1 
ATOM   4393  C  CD2 . TRP A 1 560 ? 41.505 28.510  23.214  1.00 36.16  ? 560  TRP A CD2 1 
ATOM   4394  N  NE1 . TRP A 1 560 ? 39.644 28.183  22.014  1.00 35.77  ? 560  TRP A NE1 1 
ATOM   4395  C  CE2 . TRP A 1 560 ? 40.123 28.246  23.295  1.00 35.87  ? 560  TRP A CE2 1 
ATOM   4396  C  CE3 . TRP A 1 560 ? 42.232 28.624  24.404  1.00 36.22  ? 560  TRP A CE3 1 
ATOM   4397  C  CZ2 . TRP A 1 560 ? 39.459 28.096  24.511  1.00 35.72  ? 560  TRP A CZ2 1 
ATOM   4398  C  CZ3 . TRP A 1 560 ? 41.569 28.470  25.610  1.00 36.05  ? 560  TRP A CZ3 1 
ATOM   4399  C  CH2 . TRP A 1 560 ? 40.198 28.209  25.654  1.00 35.75  ? 560  TRP A CH2 1 
ATOM   4400  N  N   . ARG A 1 561 ? 43.828 28.211  18.482  1.00 36.96  ? 561  ARG A N   1 
ATOM   4401  C  CA  . ARG A 1 561 ? 44.348 28.404  17.139  1.00 37.05  ? 561  ARG A CA  1 
ATOM   4402  C  C   . ARG A 1 561 ? 43.709 29.634  16.491  1.00 37.18  ? 561  ARG A C   1 
ATOM   4403  O  O   . ARG A 1 561 ? 42.568 29.983  16.793  1.00 37.18  ? 561  ARG A O   1 
ATOM   4404  C  CB  . ARG A 1 561 ? 44.081 27.151  16.309  1.00 37.01  ? 561  ARG A CB  1 
ATOM   4405  C  CG  . ARG A 1 561 ? 45.284 26.618  15.550  1.00 36.97  ? 561  ARG A CG  1 
ATOM   4406  C  CD  . ARG A 1 561 ? 45.587 27.364  14.268  1.00 36.88  ? 561  ARG A CD  1 
ATOM   4407  N  NE  . ARG A 1 561 ? 46.177 26.500  13.247  1.00 36.71  ? 561  ARG A NE  1 
ATOM   4408  C  CZ  . ARG A 1 561 ? 45.563 25.458  12.696  1.00 36.31  ? 561  ARG A CZ  1 
ATOM   4409  N  NH1 . ARG A 1 561 ? 44.337 25.129  13.070  1.00 36.07  ? 561  ARG A NH1 1 
ATOM   4410  N  NH2 . ARG A 1 561 ? 46.180 24.738  11.770  1.00 36.05  ? 561  ARG A NH2 1 
ATOM   4411  N  N   . TYR A 1 562 ? 44.453 30.290  15.606  1.00 37.33  ? 562  TYR A N   1 
ATOM   4412  C  CA  . TYR A 1 562 ? 43.975 31.503  14.952  1.00 37.41  ? 562  TYR A CA  1 
ATOM   4413  C  C   . TYR A 1 562 ? 44.541 31.611  13.541  1.00 37.44  ? 562  TYR A C   1 
ATOM   4414  O  O   . TYR A 1 562 ? 45.665 31.189  13.277  1.00 37.41  ? 562  TYR A O   1 
ATOM   4415  C  CB  . TYR A 1 562 ? 44.384 32.728  15.771  1.00 37.45  ? 562  TYR A CB  1 
ATOM   4416  C  CG  . TYR A 1 562 ? 43.550 33.969  15.526  1.00 37.57  ? 562  TYR A CG  1 
ATOM   4417  C  CD1 . TYR A 1 562 ? 42.166 33.931  15.617  1.00 37.76  ? 562  TYR A CD1 1 
ATOM   4418  C  CD2 . TYR A 1 562 ? 44.151 35.181  15.222  1.00 37.69  ? 562  TYR A CD2 1 
ATOM   4419  C  CE1 . TYR A 1 562 ? 41.405 35.064  15.402  1.00 37.78  ? 562  TYR A CE1 1 
ATOM   4420  C  CE2 . TYR A 1 562 ? 43.398 36.319  15.007  1.00 37.94  ? 562  TYR A CE2 1 
ATOM   4421  C  CZ  . TYR A 1 562 ? 42.026 36.257  15.098  1.00 37.92  ? 562  TYR A CZ  1 
ATOM   4422  O  OH  . TYR A 1 562 ? 41.277 37.393  14.883  1.00 38.19  ? 562  TYR A OH  1 
ATOM   4423  N  N   . ASN A 1 563 ? 43.758 32.183  12.634  1.00 37.55  ? 563  ASN A N   1 
ATOM   4424  C  CA  . ASN A 1 563 ? 44.195 32.341  11.256  1.00 37.66  ? 563  ASN A CA  1 
ATOM   4425  C  C   . ASN A 1 563 ? 44.815 33.706  11.018  1.00 37.73  ? 563  ASN A C   1 
ATOM   4426  O  O   . ASN A 1 563 ? 44.112 34.658  10.698  1.00 37.74  ? 563  ASN A O   1 
ATOM   4427  C  CB  . ASN A 1 563 ? 43.021 32.151  10.299  1.00 37.63  ? 563  ASN A CB  1 
ATOM   4428  C  CG  . ASN A 1 563 ? 42.056 31.096  10.775  1.00 37.69  ? 563  ASN A CG  1 
ATOM   4429  O  OD1 . ASN A 1 563 ? 41.630 31.111  11.929  1.00 37.89  ? 563  ASN A OD1 1 
ATOM   4430  N  ND2 . ASN A 1 563 ? 41.703 30.171  9.892   1.00 37.59  ? 563  ASN A ND2 1 
ATOM   4431  N  N   . GLU A 1 564 ? 46.130 33.805  11.177  1.00 37.86  ? 564  GLU A N   1 
ATOM   4432  C  CA  . GLU A 1 564 ? 46.813 35.070  10.934  1.00 37.96  ? 564  GLU A CA  1 
ATOM   4433  C  C   . GLU A 1 564 ? 46.989 35.302  9.441   1.00 37.97  ? 564  GLU A C   1 
ATOM   4434  O  O   . GLU A 1 564 ? 47.551 36.315  9.020   1.00 38.12  ? 564  GLU A O   1 
ATOM   4435  C  CB  . GLU A 1 564 ? 48.168 35.111  11.640  1.00 37.99  ? 564  GLU A CB  1 
ATOM   4436  C  CG  . GLU A 1 564 ? 48.078 35.508  13.101  1.00 38.17  ? 564  GLU A CG  1 
ATOM   4437  C  CD  . GLU A 1 564 ? 47.311 36.799  13.295  1.00 38.34  ? 564  GLU A CD  1 
ATOM   4438  O  OE1 . GLU A 1 564 ? 47.598 37.777  12.572  1.00 38.43  ? 564  GLU A OE1 1 
ATOM   4439  O  OE2 . GLU A 1 564 ? 46.421 36.834  14.167  1.00 38.52  ? 564  GLU A OE2 1 
ATOM   4440  N  N   . VAL A 1 565 ? 46.500 34.354  8.648   1.00 37.84  ? 565  VAL A N   1 
ATOM   4441  C  CA  . VAL A 1 565 ? 46.587 34.432  7.198   1.00 37.73  ? 565  VAL A CA  1 
ATOM   4442  C  C   . VAL A 1 565 ? 45.191 34.605  6.604   1.00 37.62  ? 565  VAL A C   1 
ATOM   4443  O  O   . VAL A 1 565 ? 45.033 34.791  5.398   1.00 37.53  ? 565  VAL A O   1 
ATOM   4444  C  CB  . VAL A 1 565 ? 47.251 33.168  6.615   1.00 37.80  ? 565  VAL A CB  1 
ATOM   4445  C  CG1 . VAL A 1 565 ? 48.605 32.926  7.272   1.00 37.69  ? 565  VAL A CG1 1 
ATOM   4446  C  CG2 . VAL A 1 565 ? 46.349 31.953  6.799   1.00 37.87  ? 565  VAL A CG2 1 
ATOM   4447  N  N   . LYS A 1 566 ? 44.185 34.537  7.471   1.00 37.50  ? 566  LYS A N   1 
ATOM   4448  C  CA  . LYS A 1 566 ? 42.788 34.704  7.086   1.00 37.41  ? 566  LYS A CA  1 
ATOM   4449  C  C   . LYS A 1 566 ? 42.005 35.184  8.305   1.00 37.41  ? 566  LYS A C   1 
ATOM   4450  O  O   . LYS A 1 566 ? 42.533 35.213  9.411   1.00 37.41  ? 566  LYS A O   1 
ATOM   4451  C  CB  . LYS A 1 566 ? 42.201 33.392  6.560   1.00 37.37  ? 566  LYS A CB  1 
ATOM   4452  C  CG  . LYS A 1 566 ? 42.948 32.793  5.373   1.00 37.32  ? 566  LYS A CG  1 
ATOM   4453  C  CD  . LYS A 1 566 ? 42.201 31.608  4.772   1.00 37.10  ? 566  LYS A CD  1 
ATOM   4454  C  CE  . LYS A 1 566 ? 43.036 30.896  3.713   1.00 36.84  ? 566  LYS A CE  1 
ATOM   4455  N  NZ  . LYS A 1 566 ? 44.108 30.052  4.314   1.00 36.72  ? 566  LYS A NZ  1 
ATOM   4456  N  N   . LYS A 1 567 ? 40.746 35.554  8.110   1.00 37.43  ? 567  LYS A N   1 
ATOM   4457  C  CA  . LYS A 1 567 ? 39.929 36.066  9.208   1.00 37.45  ? 567  LYS A CA  1 
ATOM   4458  C  C   . LYS A 1 567 ? 39.178 34.955  9.940   1.00 37.44  ? 567  LYS A C   1 
ATOM   4459  O  O   . LYS A 1 567 ? 38.829 35.095  11.114  1.00 37.42  ? 567  LYS A O   1 
ATOM   4460  C  CB  . LYS A 1 567 ? 38.945 37.114  8.680   1.00 37.48  ? 567  LYS A CB  1 
ATOM   4461  C  CG  . LYS A 1 567 ? 38.165 37.866  9.750   1.00 37.49  ? 567  LYS A CG  1 
ATOM   4462  C  CD  . LYS A 1 567 ? 37.386 39.031  9.144   1.00 37.38  ? 567  LYS A CD  1 
ATOM   4463  C  CE  . LYS A 1 567 ? 36.454 38.564  8.033   1.00 37.21  ? 567  LYS A CE  1 
ATOM   4464  N  NZ  . LYS A 1 567 ? 35.796 39.703  7.335   1.00 36.90  ? 567  LYS A NZ  1 
ATOM   4465  N  N   . LYS A 1 568 ? 38.951 33.847  9.241   1.00 37.44  ? 568  LYS A N   1 
ATOM   4466  C  CA  . LYS A 1 568 ? 38.198 32.712  9.772   1.00 37.48  ? 568  LYS A CA  1 
ATOM   4467  C  C   . LYS A 1 568 ? 38.818 32.080  11.023  1.00 37.61  ? 568  LYS A C   1 
ATOM   4468  O  O   . LYS A 1 568 ? 39.772 32.607  11.598  1.00 37.57  ? 568  LYS A O   1 
ATOM   4469  C  CB  . LYS A 1 568 ? 38.023 31.653  8.678   1.00 37.43  ? 568  LYS A CB  1 
ATOM   4470  C  CG  . LYS A 1 568 ? 37.927 32.250  7.278   1.00 37.18  ? 568  LYS A CG  1 
ATOM   4471  C  CD  . LYS A 1 568 ? 37.884 31.189  6.185   1.00 36.60  ? 568  LYS A CD  1 
ATOM   4472  C  CE  . LYS A 1 568 ? 36.463 30.914  5.715   1.00 35.98  ? 568  LYS A CE  1 
ATOM   4473  N  NZ  . LYS A 1 568 ? 36.454 30.287  4.366   1.00 35.37  ? 568  LYS A NZ  1 
ATOM   4474  N  N   . MET A 1 569 ? 38.256 30.948  11.438  1.00 37.73  ? 569  MET A N   1 
ATOM   4475  C  CA  . MET A 1 569 ? 38.728 30.221  12.613  1.00 37.86  ? 569  MET A CA  1 
ATOM   4476  C  C   . MET A 1 569 ? 38.720 28.725  12.331  1.00 37.85  ? 569  MET A C   1 
ATOM   4477  O  O   . MET A 1 569 ? 37.935 28.246  11.512  1.00 37.86  ? 569  MET A O   1 
ATOM   4478  C  CB  . MET A 1 569 ? 37.848 30.535  13.827  1.00 37.93  ? 569  MET A CB  1 
ATOM   4479  C  CG  . MET A 1 569 ? 38.051 29.612  15.027  1.00 38.09  ? 569  MET A CG  1 
ATOM   4480  S  SD  . MET A 1 569 ? 39.606 29.878  15.897  1.00 38.66  ? 569  MET A SD  1 
ATOM   4481  C  CE  . MET A 1 569 ? 39.601 31.685  16.068  1.00 38.65  ? 569  MET A CE  1 
ATOM   4482  N  N   . ASP A 1 570 ? 39.592 27.987  13.008  1.00 37.83  ? 570  ASP A N   1 
ATOM   4483  C  CA  . ASP A 1 570 ? 39.674 26.546  12.803  1.00 37.89  ? 570  ASP A CA  1 
ATOM   4484  C  C   . ASP A 1 570 ? 38.564 25.770  13.489  1.00 37.90  ? 570  ASP A C   1 
ATOM   4485  O  O   . ASP A 1 570 ? 38.145 26.108  14.596  1.00 37.92  ? 570  ASP A O   1 
ATOM   4486  C  CB  . ASP A 1 570 ? 41.025 26.017  13.257  1.00 37.86  ? 570  ASP A CB  1 
ATOM   4487  C  CG  . ASP A 1 570 ? 42.022 25.979  12.140  1.00 37.81  ? 570  ASP A CG  1 
ATOM   4488  O  OD1 . ASP A 1 570 ? 42.351 27.057  11.601  1.00 37.54  ? 570  ASP A OD1 1 
ATOM   4489  O  OD2 . ASP A 1 570 ? 42.521 24.912  11.730  1.00 37.81  ? 570  ASP A OD2 1 
ATOM   4490  N  N   . PRO A 1 571 ? 38.102 24.716  12.824  1.00 37.92  ? 571  PRO A N   1 
ATOM   4491  C  CA  . PRO A 1 571 ? 37.035 23.874  13.360  1.00 37.93  ? 571  PRO A CA  1 
ATOM   4492  C  C   . PRO A 1 571 ? 37.279 23.531  14.818  1.00 37.92  ? 571  PRO A C   1 
ATOM   4493  O  O   . PRO A 1 571 ? 38.411 23.283  15.232  1.00 37.94  ? 571  PRO A O   1 
ATOM   4494  C  CB  . PRO A 1 571 ? 37.135 22.607  12.510  1.00 37.94  ? 571  PRO A CB  1 
ATOM   4495  C  CG  . PRO A 1 571 ? 37.665 23.080  11.206  1.00 37.95  ? 571  PRO A CG  1 
ATOM   4496  C  CD  . PRO A 1 571 ? 38.575 24.243  11.511  1.00 37.93  ? 571  PRO A CD  1 
ATOM   4497  N  N   . GLY A 1 572 ? 36.201 23.540  15.586  1.00 37.86  ? 572  GLY A N   1 
ATOM   4498  C  CA  . GLY A 1 572 ? 36.226 23.162  16.981  1.00 37.76  ? 572  GLY A CA  1 
ATOM   4499  C  C   . GLY A 1 572 ? 37.542 23.009  17.723  1.00 37.67  ? 572  GLY A C   1 
ATOM   4500  O  O   . GLY A 1 572 ? 38.041 21.901  17.911  1.00 37.65  ? 572  GLY A O   1 
ATOM   4501  N  N   . PHE A 1 573 ? 38.133 24.140  18.082  1.00 37.59  ? 573  PHE A N   1 
ATOM   4502  C  CA  . PHE A 1 573 ? 39.144 24.180  19.119  1.00 37.51  ? 573  PHE A CA  1 
ATOM   4503  C  C   . PHE A 1 573 ? 38.112 24.764  20.077  1.00 37.58  ? 573  PHE A C   1 
ATOM   4504  O  O   . PHE A 1 573 ? 37.180 25.410  19.599  1.00 37.61  ? 573  PHE A O   1 
ATOM   4505  C  CB  . PHE A 1 573 ? 40.282 25.144  18.772  1.00 37.45  ? 573  PHE A CB  1 
ATOM   4506  C  CG  . PHE A 1 573 ? 41.381 24.519  17.934  1.00 37.07  ? 573  PHE A CG  1 
ATOM   4507  C  CD1 . PHE A 1 573 ? 42.437 23.851  18.533  1.00 36.74  ? 573  PHE A CD1 1 
ATOM   4508  C  CD2 . PHE A 1 573 ? 41.359 24.606  16.550  1.00 36.80  ? 573  PHE A CD2 1 
ATOM   4509  C  CE1 . PHE A 1 573 ? 43.444 23.283  17.768  1.00 36.51  ? 573  PHE A CE1 1 
ATOM   4510  C  CE2 . PHE A 1 573 ? 42.366 24.038  15.783  1.00 36.44  ? 573  PHE A CE2 1 
ATOM   4511  C  CZ  . PHE A 1 573 ? 43.407 23.379  16.393  1.00 36.31  ? 573  PHE A CZ  1 
ATOM   4512  N  N   . PRO A 1 574 ? 38.228 24.611  21.392  1.00 37.62  ? 574  PRO A N   1 
ATOM   4513  C  CA  . PRO A 1 574 ? 39.418 24.140  22.098  1.00 37.68  ? 574  PRO A CA  1 
ATOM   4514  C  C   . PRO A 1 574 ? 39.580 22.642  22.241  1.00 37.80  ? 574  PRO A C   1 
ATOM   4515  O  O   . PRO A 1 574 ? 38.721 21.958  22.800  1.00 37.90  ? 574  PRO A O   1 
ATOM   4516  C  CB  . PRO A 1 574 ? 39.211 24.708  23.510  1.00 37.65  ? 574  PRO A CB  1 
ATOM   4517  C  CG  . PRO A 1 574 ? 37.810 25.317  23.515  1.00 37.63  ? 574  PRO A CG  1 
ATOM   4518  C  CD  . PRO A 1 574 ? 37.097 24.810  22.310  1.00 37.62  ? 574  PRO A CD  1 
ATOM   4519  N  N   . LYS A 1 575 ? 40.700 22.143  21.742  1.00 37.85  ? 575  LYS A N   1 
ATOM   4520  C  CA  . LYS A 1 575 ? 41.080 20.772  21.993  1.00 37.90  ? 575  LYS A CA  1 
ATOM   4521  C  C   . LYS A 1 575 ? 42.283 20.918  22.910  1.00 37.92  ? 575  LYS A C   1 
ATOM   4522  O  O   . LYS A 1 575 ? 43.038 21.884  22.795  1.00 37.90  ? 575  LYS A O   1 
ATOM   4523  C  CB  . LYS A 1 575 ? 41.426 20.033  20.698  1.00 37.90  ? 575  LYS A CB  1 
ATOM   4524  C  CG  . LYS A 1 575 ? 42.801 20.329  20.131  1.00 37.88  ? 575  LYS A CG  1 
ATOM   4525  C  CD  . LYS A 1 575 ? 42.955 19.710  18.753  1.00 37.84  ? 575  LYS A CD  1 
ATOM   4526  C  CE  . LYS A 1 575 ? 44.415 19.607  18.352  1.00 37.85  ? 575  LYS A CE  1 
ATOM   4527  N  NZ  . LYS A 1 575 ? 44.574 19.173  16.939  1.00 37.80  ? 575  LYS A NZ  1 
ATOM   4528  N  N   . LEU A 1 576 ? 42.436 19.994  23.849  1.00 37.95  ? 576  LEU A N   1 
ATOM   4529  C  CA  . LEU A 1 576 ? 43.539 20.061  24.798  1.00 37.93  ? 576  LEU A CA  1 
ATOM   4530  C  C   . LEU A 1 576 ? 44.862 19.740  24.123  1.00 37.94  ? 576  LEU A C   1 
ATOM   4531  O  O   . LEU A 1 576 ? 44.902 19.347  22.957  1.00 37.93  ? 576  LEU A O   1 
ATOM   4532  C  CB  . LEU A 1 576 ? 43.304 19.077  25.942  1.00 37.92  ? 576  LEU A CB  1 
ATOM   4533  C  CG  . LEU A 1 576 ? 42.006 19.256  26.729  1.00 37.97  ? 576  LEU A CG  1 
ATOM   4534  C  CD1 . LEU A 1 576 ? 41.327 17.911  26.957  1.00 37.85  ? 576  LEU A CD1 1 
ATOM   4535  C  CD2 . LEU A 1 576 ? 42.260 19.985  28.042  1.00 37.89  ? 576  LEU A CD2 1 
ATOM   4536  N  N   . ILE A 1 577 ? 45.943 19.903  24.874  1.00 37.97  ? 577  ILE A N   1 
ATOM   4537  C  CA  . ILE A 1 577 ? 47.282 19.598  24.389  1.00 37.97  ? 577  ILE A CA  1 
ATOM   4538  C  C   . ILE A 1 577 ? 47.391 18.105  24.059  1.00 37.93  ? 577  ILE A C   1 
ATOM   4539  O  O   . ILE A 1 577 ? 48.425 17.628  23.588  1.00 37.92  ? 577  ILE A O   1 
ATOM   4540  C  CB  . ILE A 1 577 ? 48.320 20.015  25.456  1.00 37.99  ? 577  ILE A CB  1 
ATOM   4541  C  CG1 . ILE A 1 577 ? 48.084 21.470  25.879  1.00 37.87  ? 577  ILE A CG1 1 
ATOM   4542  C  CG2 . ILE A 1 577 ? 49.736 19.819  24.951  1.00 38.01  ? 577  ILE A CG2 1 
ATOM   4543  C  CD1 . ILE A 1 577 ? 49.223 22.080  26.672  1.00 37.64  ? 577  ILE A CD1 1 
ATOM   4544  N  N   . ALA A 1 578 ? 46.298 17.384  24.286  1.00 37.87  ? 578  ALA A N   1 
ATOM   4545  C  CA  . ALA A 1 578 ? 46.239 15.942  24.061  1.00 37.85  ? 578  ALA A CA  1 
ATOM   4546  C  C   . ALA A 1 578 ? 46.613 15.500  22.647  1.00 37.80  ? 578  ALA A C   1 
ATOM   4547  O  O   . ALA A 1 578 ? 46.723 14.304  22.381  1.00 37.78  ? 578  ALA A O   1 
ATOM   4548  C  CB  . ALA A 1 578 ? 44.855 15.409  24.427  1.00 37.87  ? 578  ALA A CB  1 
ATOM   4549  N  N   . ASP A 1 579 ? 46.814 16.451  21.741  1.00 37.77  ? 579  ASP A N   1 
ATOM   4550  C  CA  . ASP A 1 579 ? 47.135 16.093  20.362  1.00 37.71  ? 579  ASP A CA  1 
ATOM   4551  C  C   . ASP A 1 579 ? 48.562 16.410  19.908  1.00 37.62  ? 579  ASP A C   1 
ATOM   4552  O  O   . ASP A 1 579 ? 49.428 15.539  19.928  1.00 37.63  ? 579  ASP A O   1 
ATOM   4553  C  CB  . ASP A 1 579 ? 46.095 16.669  19.399  1.00 37.73  ? 579  ASP A CB  1 
ATOM   4554  C  CG  . ASP A 1 579 ? 44.722 16.051  19.598  1.00 37.80  ? 579  ASP A CG  1 
ATOM   4555  O  OD1 . ASP A 1 579 ? 44.654 14.887  20.050  1.00 37.88  ? 579  ASP A OD1 1 
ATOM   4556  O  OD2 . ASP A 1 579 ? 43.658 16.644  19.330  1.00 37.85  ? 579  ASP A OD2 1 
ATOM   4557  N  N   . ALA A 1 580 ? 48.814 17.652  19.513  1.00 37.54  ? 580  ALA A N   1 
ATOM   4558  C  CA  . ALA A 1 580 ? 50.127 18.009  18.974  1.00 37.45  ? 580  ALA A CA  1 
ATOM   4559  C  C   . ALA A 1 580 ? 51.217 18.352  19.992  1.00 37.35  ? 580  ALA A C   1 
ATOM   4560  O  O   . ALA A 1 580 ? 52.317 17.809  19.915  1.00 37.38  ? 580  ALA A O   1 
ATOM   4561  C  CB  . ALA A 1 580 ? 50.001 19.112  17.941  1.00 37.48  ? 580  ALA A CB  1 
ATOM   4562  N  N   . TRP A 1 581 ? 50.934 19.257  20.925  1.00 37.21  ? 581  TRP A N   1 
ATOM   4563  C  CA  . TRP A 1 581 ? 51.952 19.658  21.898  1.00 37.10  ? 581  TRP A CA  1 
ATOM   4564  C  C   . TRP A 1 581 ? 52.309 18.519  22.842  1.00 37.10  ? 581  TRP A C   1 
ATOM   4565  O  O   . TRP A 1 581 ? 51.459 17.699  23.191  1.00 37.19  ? 581  TRP A O   1 
ATOM   4566  C  CB  . TRP A 1 581 ? 51.538 20.916  22.665  1.00 37.13  ? 581  TRP A CB  1 
ATOM   4567  C  CG  . TRP A 1 581 ? 51.447 22.141  21.797  1.00 36.94  ? 581  TRP A CG  1 
ATOM   4568  C  CD1 . TRP A 1 581 ? 50.457 23.076  21.806  1.00 36.60  ? 581  TRP A CD1 1 
ATOM   4569  C  CD2 . TRP A 1 581 ? 52.379 22.556  20.788  1.00 36.70  ? 581  TRP A CD2 1 
ATOM   4570  N  NE1 . TRP A 1 581 ? 50.716 24.046  20.868  1.00 36.71  ? 581  TRP A NE1 1 
ATOM   4571  C  CE2 . TRP A 1 581 ? 51.891 23.750  20.231  1.00 36.60  ? 581  TRP A CE2 1 
ATOM   4572  C  CE3 . TRP A 1 581 ? 53.583 22.039  20.299  1.00 36.78  ? 581  TRP A CE3 1 
ATOM   4573  C  CZ2 . TRP A 1 581 ? 52.557 24.429  19.214  1.00 36.68  ? 581  TRP A CZ2 1 
ATOM   4574  C  CZ3 . TRP A 1 581 ? 54.241 22.715  19.292  1.00 36.49  ? 581  TRP A CZ3 1 
ATOM   4575  C  CH2 . TRP A 1 581 ? 53.728 23.893  18.760  1.00 36.57  ? 581  TRP A CH2 1 
ATOM   4576  N  N   . ASN A 1 582 ? 53.571 18.469  23.252  1.00 36.98  ? 582  ASN A N   1 
ATOM   4577  C  CA  . ASN A 1 582 ? 54.050 17.354  24.061  1.00 36.84  ? 582  ASN A CA  1 
ATOM   4578  C  C   . ASN A 1 582 ? 54.478 17.685  25.491  1.00 36.78  ? 582  ASN A C   1 
ATOM   4579  O  O   . ASN A 1 582 ? 53.646 17.747  26.396  1.00 36.80  ? 582  ASN A O   1 
ATOM   4580  C  CB  . ASN A 1 582 ? 55.167 16.614  23.320  1.00 36.80  ? 582  ASN A CB  1 
ATOM   4581  C  CG  . ASN A 1 582 ? 54.638 15.749  22.194  1.00 36.57  ? 582  ASN A CG  1 
ATOM   4582  O  OD1 . ASN A 1 582 ? 55.099 15.832  21.057  1.00 36.34  ? 582  ASN A OD1 1 
ATOM   4583  N  ND2 . ASN A 1 582 ? 53.659 14.913  22.508  1.00 36.59  ? 582  ASN A ND2 1 
ATOM   4584  N  N   . ALA A 1 583 ? 55.777 17.883  25.692  1.00 36.63  ? 583  ALA A N   1 
ATOM   4585  C  CA  . ALA A 1 583 ? 56.302 18.183  27.018  1.00 36.52  ? 583  ALA A CA  1 
ATOM   4586  C  C   . ALA A 1 583 ? 55.648 19.427  27.616  1.00 36.52  ? 583  ALA A C   1 
ATOM   4587  O  O   . ALA A 1 583 ? 55.475 19.516  28.830  1.00 36.58  ? 583  ALA A O   1 
ATOM   4588  C  CB  . ALA A 1 583 ? 57.812 18.339  26.968  1.00 36.48  ? 583  ALA A CB  1 
ATOM   4589  N  N   . ILE A 1 584 ? 55.285 20.374  26.753  1.00 36.45  ? 584  ILE A N   1 
ATOM   4590  C  CA  . ILE A 1 584 ? 54.639 21.626  27.154  1.00 36.27  ? 584  ILE A CA  1 
ATOM   4591  C  C   . ILE A 1 584 ? 53.711 21.467  28.361  1.00 36.29  ? 584  ILE A C   1 
ATOM   4592  O  O   . ILE A 1 584 ? 52.694 20.776  28.292  1.00 36.27  ? 584  ILE A O   1 
ATOM   4593  C  CB  . ILE A 1 584 ? 53.858 22.224  25.966  1.00 36.25  ? 584  ILE A CB  1 
ATOM   4594  C  CG1 . ILE A 1 584 ? 54.813 22.659  24.853  1.00 36.19  ? 584  ILE A CG1 1 
ATOM   4595  C  CG2 . ILE A 1 584 ? 52.985 23.376  26.422  1.00 36.09  ? 584  ILE A CG2 1 
ATOM   4596  C  CD1 . ILE A 1 584 ? 55.078 21.585  23.819  1.00 36.22  ? 584  ILE A CD1 1 
ATOM   4597  N  N   . PRO A 1 585 ? 54.085 22.107  29.465  1.00 36.27  ? 585  PRO A N   1 
ATOM   4598  C  CA  . PRO A 1 585 ? 53.340 22.054  30.734  1.00 36.31  ? 585  PRO A CA  1 
ATOM   4599  C  C   . PRO A 1 585 ? 52.001 22.802  30.737  1.00 36.36  ? 585  PRO A C   1 
ATOM   4600  O  O   . PRO A 1 585 ? 51.737 23.553  29.799  1.00 36.27  ? 585  PRO A O   1 
ATOM   4601  C  CB  . PRO A 1 585 ? 54.303 22.719  31.719  1.00 36.25  ? 585  PRO A CB  1 
ATOM   4602  C  CG  . PRO A 1 585 ? 55.634 22.703  31.019  1.00 36.29  ? 585  PRO A CG  1 
ATOM   4603  C  CD  . PRO A 1 585 ? 55.321 22.895  29.577  1.00 36.24  ? 585  PRO A CD  1 
ATOM   4604  N  N   . ASP A 1 586 ? 51.169 22.596  31.764  1.00 36.54  ? 586  ASP A N   1 
ATOM   4605  C  CA  . ASP A 1 586 ? 49.891 23.306  31.829  1.00 36.70  ? 586  ASP A CA  1 
ATOM   4606  C  C   . ASP A 1 586 ? 50.182 24.779  32.023  1.00 36.83  ? 586  ASP A C   1 
ATOM   4607  O  O   . ASP A 1 586 ? 50.981 25.149  32.883  1.00 36.83  ? 586  ASP A O   1 
ATOM   4608  C  CB  . ASP A 1 586 ? 48.950 22.873  32.979  1.00 36.72  ? 586  ASP A CB  1 
ATOM   4609  C  CG  . ASP A 1 586 ? 49.383 21.602  33.697  1.00 36.73  ? 586  ASP A CG  1 
ATOM   4610  O  OD1 . ASP A 1 586 ? 50.130 21.600  34.700  1.00 36.61  ? 586  ASP A OD1 1 
ATOM   4611  O  OD2 . ASP A 1 586 ? 48.910 20.514  33.316  1.00 36.79  ? 586  ASP A OD2 1 
ATOM   4612  N  N   . ASN A 1 587 ? 49.522 25.610  31.226  1.00 37.07  ? 587  ASN A N   1 
ATOM   4613  C  CA  . ASN A 1 587 ? 49.650 27.063  31.324  1.00 37.24  ? 587  ASN A CA  1 
ATOM   4614  C  C   . ASN A 1 587 ? 51.074 27.579  31.418  1.00 37.20  ? 587  ASN A C   1 
ATOM   4615  O  O   . ASN A 1 587 ? 51.603 27.783  32.512  1.00 37.18  ? 587  ASN A O   1 
ATOM   4616  C  CB  . ASN A 1 587 ? 48.837 27.585  32.508  1.00 37.36  ? 587  ASN A CB  1 
ATOM   4617  C  CG  . ASN A 1 587 ? 47.391 27.193  32.418  1.00 37.62  ? 587  ASN A CG  1 
ATOM   4618  O  OD1 . ASN A 1 587 ? 46.897 26.916  31.334  1.00 38.10  ? 587  ASN A OD1 1 
ATOM   4619  N  ND2 . ASN A 1 587 ? 46.702 27.158  33.552  1.00 37.70  ? 587  ASN A ND2 1 
ATOM   4620  N  N   . LEU A 1 588 ? 51.686 27.801  30.264  1.00 37.13  ? 588  LEU A N   1 
ATOM   4621  C  CA  . LEU A 1 588 ? 53.037 28.322  30.224  1.00 37.19  ? 588  LEU A CA  1 
ATOM   4622  C  C   . LEU A 1 588 ? 52.991 29.837  30.228  1.00 37.05  ? 588  LEU A C   1 
ATOM   4623  O  O   . LEU A 1 588 ? 52.201 30.437  29.508  1.00 37.21  ? 588  LEU A O   1 
ATOM   4624  C  CB  . LEU A 1 588 ? 53.755 27.807  28.985  1.00 37.26  ? 588  LEU A CB  1 
ATOM   4625  C  CG  . LEU A 1 588 ? 53.783 26.283  28.979  1.00 38.07  ? 588  LEU A CG  1 
ATOM   4626  C  CD1 . LEU A 1 588 ? 54.838 25.781  28.025  1.00 38.89  ? 588  LEU A CD1 1 
ATOM   4627  C  CD2 . LEU A 1 588 ? 54.035 25.759  30.390  1.00 38.66  ? 588  LEU A CD2 1 
ATOM   4628  N  N   . ASP A 1 589 ? 53.839 30.456  31.040  1.00 36.84  ? 589  ASP A N   1 
ATOM   4629  C  CA  . ASP A 1 589 ? 53.861 31.907  31.151  1.00 36.58  ? 589  ASP A CA  1 
ATOM   4630  C  C   . ASP A 1 589 ? 54.093 32.603  29.818  1.00 36.39  ? 589  ASP A C   1 
ATOM   4631  O  O   . ASP A 1 589 ? 53.590 33.698  29.604  1.00 36.41  ? 589  ASP A O   1 
ATOM   4632  C  CB  . ASP A 1 589 ? 54.932 32.350  32.142  1.00 36.64  ? 589  ASP A CB  1 
ATOM   4633  C  CG  . ASP A 1 589 ? 54.952 31.503  33.384  1.00 36.87  ? 589  ASP A CG  1 
ATOM   4634  O  OD1 . ASP A 1 589 ? 53.866 31.081  33.825  1.00 37.49  ? 589  ASP A OD1 1 
ATOM   4635  O  OD2 . ASP A 1 589 ? 56.003 31.198  33.984  1.00 37.22  ? 589  ASP A OD2 1 
ATOM   4636  N  N   . ALA A 1 590 ? 54.854 31.979  28.925  1.00 36.20  ? 590  ALA A N   1 
ATOM   4637  C  CA  . ALA A 1 590 ? 55.151 32.606  27.641  1.00 36.11  ? 590  ALA A CA  1 
ATOM   4638  C  C   . ALA A 1 590 ? 55.674 31.635  26.582  1.00 36.06  ? 590  ALA A C   1 
ATOM   4639  O  O   . ALA A 1 590 ? 56.062 30.511  26.896  1.00 36.09  ? 590  ALA A O   1 
ATOM   4640  C  CB  . ALA A 1 590 ? 56.138 33.745  27.838  1.00 36.01  ? 590  ALA A CB  1 
ATOM   4641  N  N   . VAL A 1 591 ? 55.677 32.084  25.327  1.00 35.95  ? 591  VAL A N   1 
ATOM   4642  C  CA  . VAL A 1 591 ? 56.191 31.296  24.209  1.00 35.82  ? 591  VAL A CA  1 
ATOM   4643  C  C   . VAL A 1 591 ? 56.852 32.214  23.184  1.00 35.73  ? 591  VAL A C   1 
ATOM   4644  O  O   . VAL A 1 591 ? 56.265 33.213  22.783  1.00 35.77  ? 591  VAL A O   1 
ATOM   4645  C  CB  . VAL A 1 591 ? 55.080 30.518  23.497  1.00 35.82  ? 591  VAL A CB  1 
ATOM   4646  C  CG1 . VAL A 1 591 ? 55.681 29.453  22.595  1.00 35.92  ? 591  VAL A CG1 1 
ATOM   4647  C  CG2 . VAL A 1 591 ? 54.132 29.894  24.503  1.00 35.85  ? 591  VAL A CG2 1 
ATOM   4648  N  N   . VAL A 1 592 ? 58.060 31.865  22.747  1.00 35.67  ? 592  VAL A N   1 
ATOM   4649  C  CA  . VAL A 1 592 ? 58.805 32.703  21.806  1.00 35.55  ? 592  VAL A CA  1 
ATOM   4650  C  C   . VAL A 1 592 ? 59.493 31.934  20.665  1.00 35.62  ? 592  VAL A C   1 
ATOM   4651  O  O   . VAL A 1 592 ? 60.062 30.858  20.874  1.00 35.61  ? 592  VAL A O   1 
ATOM   4652  C  CB  . VAL A 1 592 ? 59.871 33.545  22.549  1.00 35.48  ? 592  VAL A CB  1 
ATOM   4653  C  CG1 . VAL A 1 592 ? 60.677 34.387  21.575  1.00 35.41  ? 592  VAL A CG1 1 
ATOM   4654  C  CG2 . VAL A 1 592 ? 59.221 34.425  23.597  1.00 35.32  ? 592  VAL A CG2 1 
ATOM   4655  N  N   . ASP A 1 593 ? 59.427 32.501  19.461  1.00 35.59  ? 593  ASP A N   1 
ATOM   4656  C  CA  . ASP A 1 593 ? 60.103 31.956  18.285  1.00 35.57  ? 593  ASP A CA  1 
ATOM   4657  C  C   . ASP A 1 593 ? 61.102 32.986  17.773  1.00 35.68  ? 593  ASP A C   1 
ATOM   4658  O  O   . ASP A 1 593 ? 60.735 34.123  17.470  1.00 35.74  ? 593  ASP A O   1 
ATOM   4659  C  CB  . ASP A 1 593 ? 59.102 31.639  17.178  1.00 35.50  ? 593  ASP A CB  1 
ATOM   4660  C  CG  . ASP A 1 593 ? 58.198 30.482  17.524  1.00 35.35  ? 593  ASP A CG  1 
ATOM   4661  O  OD1 . ASP A 1 593 ? 57.830 30.241  18.691  1.00 35.43  ? 593  ASP A OD1 1 
ATOM   4662  O  OD2 . ASP A 1 593 ? 57.799 29.738  16.601  1.00 34.89  ? 593  ASP A OD2 1 
ATOM   4663  N  N   . LEU A 1 594 ? 62.365 32.591  17.666  1.00 35.79  ? 594  LEU A N   1 
ATOM   4664  C  CA  . LEU A 1 594 ? 63.400 33.516  17.224  1.00 35.96  ? 594  LEU A CA  1 
ATOM   4665  C  C   . LEU A 1 594 ? 63.751 33.349  15.753  1.00 36.09  ? 594  LEU A C   1 
ATOM   4666  O  O   . LEU A 1 594 ? 63.285 32.419  15.095  1.00 36.25  ? 594  LEU A O   1 
ATOM   4667  C  CB  . LEU A 1 594 ? 64.658 33.349  18.074  1.00 35.90  ? 594  LEU A CB  1 
ATOM   4668  C  CG  . LEU A 1 594 ? 64.451 33.517  19.575  1.00 35.78  ? 594  LEU A CG  1 
ATOM   4669  C  CD1 . LEU A 1 594 ? 65.786 33.457  20.284  1.00 35.95  ? 594  LEU A CD1 1 
ATOM   4670  C  CD2 . LEU A 1 594 ? 63.746 34.828  19.868  1.00 35.68  ? 594  LEU A CD2 1 
ATOM   4671  N  N   . GLN A 1 595 ? 64.581 34.258  15.250  1.00 36.14  ? 595  GLN A N   1 
ATOM   4672  C  CA  . GLN A 1 595 ? 65.041 34.216  13.865  1.00 36.11  ? 595  GLN A CA  1 
ATOM   4673  C  C   . GLN A 1 595 ? 65.757 32.901  13.570  1.00 35.98  ? 595  GLN A C   1 
ATOM   4674  O  O   . GLN A 1 595 ? 66.696 32.522  14.273  1.00 35.93  ? 595  GLN A O   1 
ATOM   4675  C  CB  . GLN A 1 595 ? 65.970 35.398  13.581  1.00 36.20  ? 595  GLN A CB  1 
ATOM   4676  C  CG  . GLN A 1 595 ? 66.584 35.402  12.191  1.00 36.35  ? 595  GLN A CG  1 
ATOM   4677  C  CD  . GLN A 1 595 ? 67.570 36.537  11.999  1.00 36.66  ? 595  GLN A CD  1 
ATOM   4678  O  OE1 . GLN A 1 595 ? 67.173 37.698  11.873  1.00 36.87  ? 595  GLN A OE1 1 
ATOM   4679  N  NE2 . GLN A 1 595 ? 68.858 36.210  11.983  1.00 36.62  ? 595  GLN A NE2 1 
ATOM   4680  N  N   . GLY A 1 596 ? 65.305 32.208  12.531  1.00 35.84  ? 596  GLY A N   1 
ATOM   4681  C  CA  . GLY A 1 596 ? 65.882 30.933  12.156  1.00 35.65  ? 596  GLY A CA  1 
ATOM   4682  C  C   . GLY A 1 596 ? 65.773 29.917  13.275  1.00 35.55  ? 596  GLY A C   1 
ATOM   4683  O  O   . GLY A 1 596 ? 64.945 30.055  14.177  1.00 35.48  ? 596  GLY A O   1 
ATOM   4684  N  N   . GLY A 1 597 ? 66.613 28.890  13.211  1.00 35.52  ? 597  GLY A N   1 
ATOM   4685  C  CA  . GLY A 1 597 ? 66.640 27.850  14.223  1.00 35.41  ? 597  GLY A CA  1 
ATOM   4686  C  C   . GLY A 1 597 ? 65.498 26.860  14.113  1.00 35.32  ? 597  GLY A C   1 
ATOM   4687  O  O   . GLY A 1 597 ? 65.715 25.667  13.898  1.00 35.29  ? 597  GLY A O   1 
ATOM   4688  N  N   . GLY A 1 598 ? 64.276 27.359  14.261  1.00 35.24  ? 598  GLY A N   1 
ATOM   4689  C  CA  . GLY A 1 598 ? 63.099 26.517  14.203  1.00 35.15  ? 598  GLY A CA  1 
ATOM   4690  C  C   . GLY A 1 598 ? 62.710 26.076  15.597  1.00 35.08  ? 598  GLY A C   1 
ATOM   4691  O  O   . GLY A 1 598 ? 61.889 25.178  15.773  1.00 35.16  ? 598  GLY A O   1 
ATOM   4692  N  N   . HIS A 1 599 ? 63.317 26.706  16.594  1.00 34.96  ? 599  HIS A N   1 
ATOM   4693  C  CA  . HIS A 1 599 ? 63.014 26.397  17.981  1.00 34.82  ? 599  HIS A CA  1 
ATOM   4694  C  C   . HIS A 1 599 ? 61.991 27.390  18.517  1.00 34.75  ? 599  HIS A C   1 
ATOM   4695  O  O   . HIS A 1 599 ? 62.079 28.586  18.251  1.00 34.70  ? 599  HIS A O   1 
ATOM   4696  C  CB  . HIS A 1 599 ? 64.273 26.467  18.847  1.00 34.83  ? 599  HIS A CB  1 
ATOM   4697  C  CG  . HIS A 1 599 ? 65.506 25.944  18.179  1.00 34.68  ? 599  HIS A CG  1 
ATOM   4698  N  ND1 . HIS A 1 599 ? 66.301 26.726  17.370  1.00 34.57  ? 599  HIS A ND1 1 
ATOM   4699  C  CD2 . HIS A 1 599 ? 66.094 24.726  18.219  1.00 34.63  ? 599  HIS A CD2 1 
ATOM   4700  C  CE1 . HIS A 1 599 ? 67.319 26.010  16.931  1.00 34.56  ? 599  HIS A CE1 1 
ATOM   4701  N  NE2 . HIS A 1 599 ? 67.218 24.792  17.431  1.00 34.68  ? 599  HIS A NE2 1 
ATOM   4702  N  N   . SER A 1 600 ? 61.020 26.888  19.271  1.00 34.70  ? 600  SER A N   1 
ATOM   4703  C  CA  . SER A 1 600 ? 60.014 27.743  19.884  1.00 34.63  ? 600  SER A CA  1 
ATOM   4704  C  C   . SER A 1 600 ? 60.051 27.549  21.395  1.00 34.58  ? 600  SER A C   1 
ATOM   4705  O  O   . SER A 1 600 ? 59.485 26.597  21.926  1.00 34.50  ? 600  SER A O   1 
ATOM   4706  C  CB  . SER A 1 600 ? 58.622 27.442  19.328  1.00 34.61  ? 600  SER A CB  1 
ATOM   4707  O  OG  . SER A 1 600 ? 58.267 26.085  19.520  1.00 34.77  ? 600  SER A OG  1 
ATOM   4708  N  N   . TYR A 1 601 ? 60.732 28.461  22.078  1.00 34.51  ? 601  TYR A N   1 
ATOM   4709  C  CA  . TYR A 1 601 ? 60.898 28.380  23.523  1.00 34.31  ? 601  TYR A CA  1 
ATOM   4710  C  C   . TYR A 1 601 ? 59.587 28.578  24.273  1.00 34.16  ? 601  TYR A C   1 
ATOM   4711  O  O   . TYR A 1 601 ? 58.804 29.470  23.955  1.00 34.06  ? 601  TYR A O   1 
ATOM   4712  C  CB  . TYR A 1 601 ? 61.954 29.387  23.992  1.00 34.28  ? 601  TYR A CB  1 
ATOM   4713  C  CG  . TYR A 1 601 ? 63.316 29.156  23.368  1.00 34.35  ? 601  TYR A CG  1 
ATOM   4714  C  CD1 . TYR A 1 601 ? 63.618 29.656  22.109  1.00 34.32  ? 601  TYR A CD1 1 
ATOM   4715  C  CD2 . TYR A 1 601 ? 64.293 28.426  24.032  1.00 34.52  ? 601  TYR A CD2 1 
ATOM   4716  C  CE1 . TYR A 1 601 ? 64.855 29.442  21.533  1.00 34.26  ? 601  TYR A CE1 1 
ATOM   4717  C  CE2 . TYR A 1 601 ? 65.534 28.207  23.463  1.00 34.49  ? 601  TYR A CE2 1 
ATOM   4718  C  CZ  . TYR A 1 601 ? 65.809 28.717  22.214  1.00 34.40  ? 601  TYR A CZ  1 
ATOM   4719  O  OH  . TYR A 1 601 ? 67.045 28.500  21.648  1.00 34.37  ? 601  TYR A OH  1 
ATOM   4720  N  N   . PHE A 1 602 ? 59.349 27.720  25.258  1.00 34.04  ? 602  PHE A N   1 
ATOM   4721  C  CA  . PHE A 1 602 ? 58.160 27.811  26.092  1.00 33.91  ? 602  PHE A CA  1 
ATOM   4722  C  C   . PHE A 1 602 ? 58.576 28.185  27.504  1.00 34.06  ? 602  PHE A C   1 
ATOM   4723  O  O   . PHE A 1 602 ? 59.553 27.660  28.035  1.00 34.00  ? 602  PHE A O   1 
ATOM   4724  C  CB  . PHE A 1 602 ? 57.393 26.495  26.092  1.00 33.73  ? 602  PHE A CB  1 
ATOM   4725  C  CG  . PHE A 1 602 ? 56.668 26.222  24.811  1.00 33.08  ? 602  PHE A CG  1 
ATOM   4726  C  CD1 . PHE A 1 602 ? 57.342 25.714  23.717  1.00 32.55  ? 602  PHE A CD1 1 
ATOM   4727  C  CD2 . PHE A 1 602 ? 55.314 26.474  24.700  1.00 32.43  ? 602  PHE A CD2 1 
ATOM   4728  C  CE1 . PHE A 1 602 ? 56.682 25.464  22.539  1.00 32.21  ? 602  PHE A CE1 1 
ATOM   4729  C  CE2 . PHE A 1 602 ? 54.649 26.222  23.522  1.00 32.32  ? 602  PHE A CE2 1 
ATOM   4730  C  CZ  . PHE A 1 602 ? 55.336 25.716  22.440  1.00 32.25  ? 602  PHE A CZ  1 
ATOM   4731  N  N   . PHE A 1 603 ? 57.830 29.096  28.114  1.00 34.27  ? 603  PHE A N   1 
ATOM   4732  C  CA  . PHE A 1 603 ? 58.192 29.589  29.430  1.00 34.48  ? 603  PHE A CA  1 
ATOM   4733  C  C   . PHE A 1 603 ? 57.148 29.281  30.488  1.00 34.62  ? 603  PHE A C   1 
ATOM   4734  O  O   . PHE A 1 603 ? 55.951 29.408  30.253  1.00 34.61  ? 603  PHE A O   1 
ATOM   4735  C  CB  . PHE A 1 603 ? 58.440 31.102  29.381  1.00 34.50  ? 603  PHE A CB  1 
ATOM   4736  C  CG  . PHE A 1 603 ? 59.562 31.507  28.465  1.00 34.40  ? 603  PHE A CG  1 
ATOM   4737  C  CD1 . PHE A 1 603 ? 59.358 31.614  27.098  1.00 34.33  ? 603  PHE A CD1 1 
ATOM   4738  C  CD2 . PHE A 1 603 ? 60.820 31.786  28.971  1.00 34.09  ? 603  PHE A CD2 1 
ATOM   4739  C  CE1 . PHE A 1 603 ? 60.390 31.985  26.256  1.00 34.29  ? 603  PHE A CE1 1 
ATOM   4740  C  CE2 . PHE A 1 603 ? 61.856 32.162  28.133  1.00 34.02  ? 603  PHE A CE2 1 
ATOM   4741  C  CZ  . PHE A 1 603 ? 61.641 32.261  26.775  1.00 34.09  ? 603  PHE A CZ  1 
ATOM   4742  N  N   . LYS A 1 604 ? 57.631 28.869  31.653  1.00 34.80  ? 604  LYS A N   1 
ATOM   4743  C  CA  . LYS A 1 604 ? 56.798 28.618  32.818  1.00 35.05  ? 604  LYS A CA  1 
ATOM   4744  C  C   . LYS A 1 604 ? 57.743 28.599  34.007  1.00 35.11  ? 604  LYS A C   1 
ATOM   4745  O  O   . LYS A 1 604 ? 58.947 28.433  33.833  1.00 35.16  ? 604  LYS A O   1 
ATOM   4746  C  CB  . LYS A 1 604 ? 56.065 27.285  32.711  1.00 35.09  ? 604  LYS A CB  1 
ATOM   4747  C  CG  . LYS A 1 604 ? 56.954 26.081  32.975  1.00 35.57  ? 604  LYS A CG  1 
ATOM   4748  C  CD  . LYS A 1 604 ? 56.195 24.950  33.652  1.00 35.81  ? 604  LYS A CD  1 
ATOM   4749  C  CE  . LYS A 1 604 ? 57.126 23.786  33.969  1.00 35.91  ? 604  LYS A CE  1 
ATOM   4750  N  NZ  . LYS A 1 604 ? 56.385 22.574  34.422  1.00 36.25  ? 604  LYS A NZ  1 
ATOM   4751  N  N   . GLY A 1 605 ? 57.211 28.770  35.211  1.00 35.21  ? 605  GLY A N   1 
ATOM   4752  C  CA  . GLY A 1 605 ? 58.050 28.776  36.395  1.00 35.38  ? 605  GLY A CA  1 
ATOM   4753  C  C   . GLY A 1 605 ? 59.306 29.611  36.205  1.00 35.55  ? 605  GLY A C   1 
ATOM   4754  O  O   . GLY A 1 605 ? 59.267 30.683  35.597  1.00 35.54  ? 605  GLY A O   1 
ATOM   4755  N  N   . ALA A 1 606 ? 60.428 29.114  36.716  1.00 35.68  ? 606  ALA A N   1 
ATOM   4756  C  CA  . ALA A 1 606 ? 61.694 29.836  36.620  1.00 35.81  ? 606  ALA A CA  1 
ATOM   4757  C  C   . ALA A 1 606 ? 62.596 29.297  35.515  1.00 35.87  ? 606  ALA A C   1 
ATOM   4758  O  O   . ALA A 1 606 ? 63.762 29.680  35.414  1.00 35.81  ? 606  ALA A O   1 
ATOM   4759  C  CB  . ALA A 1 606 ? 62.425 29.811  37.961  1.00 35.80  ? 606  ALA A CB  1 
ATOM   4760  N  N   . TYR A 1 607 ? 62.061 28.406  34.690  1.00 35.99  ? 607  TYR A N   1 
ATOM   4761  C  CA  . TYR A 1 607 ? 62.854 27.825  33.614  1.00 36.12  ? 607  TYR A CA  1 
ATOM   4762  C  C   . TYR A 1 607 ? 62.086 27.602  32.311  1.00 36.04  ? 607  TYR A C   1 
ATOM   4763  O  O   . TYR A 1 607 ? 60.858 27.531  32.302  1.00 36.15  ? 607  TYR A O   1 
ATOM   4764  C  CB  . TYR A 1 607 ? 63.550 26.544  34.074  1.00 36.19  ? 607  TYR A CB  1 
ATOM   4765  C  CG  . TYR A 1 607 ? 62.847 25.750  35.157  1.00 36.80  ? 607  TYR A CG  1 
ATOM   4766  C  CD1 . TYR A 1 607 ? 61.628 25.123  34.918  1.00 37.46  ? 607  TYR A CD1 1 
ATOM   4767  C  CD2 . TYR A 1 607 ? 63.430 25.591  36.409  1.00 37.30  ? 607  TYR A CD2 1 
ATOM   4768  C  CE1 . TYR A 1 607 ? 61.001 24.371  35.907  1.00 38.02  ? 607  TYR A CE1 1 
ATOM   4769  C  CE2 . TYR A 1 607 ? 62.813 24.845  37.400  1.00 38.04  ? 607  TYR A CE2 1 
ATOM   4770  C  CZ  . TYR A 1 607 ? 61.599 24.236  37.145  1.00 38.27  ? 607  TYR A CZ  1 
ATOM   4771  O  OH  . TYR A 1 607 ? 60.987 23.493  38.133  1.00 38.49  ? 607  TYR A OH  1 
ATOM   4772  N  N   . TYR A 1 608 ? 62.823 27.488  31.210  1.00 35.84  ? 608  TYR A N   1 
ATOM   4773  C  CA  . TYR A 1 608 ? 62.206 27.301  29.900  1.00 35.59  ? 608  TYR A CA  1 
ATOM   4774  C  C   . TYR A 1 608 ? 62.390 25.891  29.360  1.00 35.57  ? 608  TYR A C   1 
ATOM   4775  O  O   . TYR A 1 608 ? 63.084 25.070  29.953  1.00 35.60  ? 608  TYR A O   1 
ATOM   4776  C  CB  . TYR A 1 608 ? 62.749 28.313  28.892  1.00 35.49  ? 608  TYR A CB  1 
ATOM   4777  C  CG  . TYR A 1 608 ? 64.218 28.149  28.594  1.00 35.01  ? 608  TYR A CG  1 
ATOM   4778  C  CD1 . TYR A 1 608 ? 65.175 28.697  29.429  1.00 34.59  ? 608  TYR A CD1 1 
ATOM   4779  C  CD2 . TYR A 1 608 ? 64.648 27.451  27.474  1.00 34.52  ? 608  TYR A CD2 1 
ATOM   4780  C  CE1 . TYR A 1 608 ? 66.513 28.553  29.164  1.00 34.21  ? 608  TYR A CE1 1 
ATOM   4781  C  CE2 . TYR A 1 608 ? 65.990 27.304  27.201  1.00 34.11  ? 608  TYR A CE2 1 
ATOM   4782  C  CZ  . TYR A 1 608 ? 66.917 27.857  28.051  1.00 34.01  ? 608  TYR A CZ  1 
ATOM   4783  O  OH  . TYR A 1 608 ? 68.258 27.718  27.794  1.00 34.07  ? 608  TYR A OH  1 
ATOM   4784  N  N   . LEU A 1 609 ? 61.777 25.637  28.210  1.00 35.55  ? 609  LEU A N   1 
ATOM   4785  C  CA  . LEU A 1 609 ? 61.788 24.326  27.578  1.00 35.50  ? 609  LEU A CA  1 
ATOM   4786  C  C   . LEU A 1 609 ? 61.927 24.513  26.072  1.00 35.50  ? 609  LEU A C   1 
ATOM   4787  O  O   . LEU A 1 609 ? 60.992 24.974  25.425  1.00 35.59  ? 609  LEU A O   1 
ATOM   4788  C  CB  . LEU A 1 609 ? 60.458 23.643  27.872  1.00 35.42  ? 609  LEU A CB  1 
ATOM   4789  C  CG  . LEU A 1 609 ? 60.320 22.135  27.755  1.00 35.42  ? 609  LEU A CG  1 
ATOM   4790  C  CD1 . LEU A 1 609 ? 60.668 21.504  29.082  1.00 35.75  ? 609  LEU A CD1 1 
ATOM   4791  C  CD2 . LEU A 1 609 ? 58.895 21.799  27.372  1.00 35.44  ? 609  LEU A CD2 1 
ATOM   4792  N  N   . LYS A 1 610 ? 63.080 24.166  25.508  1.00 35.46  ? 610  LYS A N   1 
ATOM   4793  C  CA  . LYS A 1 610 ? 63.282 24.341  24.070  1.00 35.46  ? 610  LYS A CA  1 
ATOM   4794  C  C   . LYS A 1 610 ? 62.448 23.366  23.254  1.00 35.54  ? 610  LYS A C   1 
ATOM   4795  O  O   . LYS A 1 610 ? 62.495 22.164  23.477  1.00 35.58  ? 610  LYS A O   1 
ATOM   4796  C  CB  . LYS A 1 610 ? 64.758 24.208  23.689  1.00 35.42  ? 610  LYS A CB  1 
ATOM   4797  C  CG  . LYS A 1 610 ? 64.986 24.115  22.184  1.00 35.26  ? 610  LYS A CG  1 
ATOM   4798  C  CD  . LYS A 1 610 ? 66.457 23.942  21.826  1.00 35.13  ? 610  LYS A CD  1 
ATOM   4799  C  CE  . LYS A 1 610 ? 67.209 25.262  21.840  1.00 35.09  ? 610  LYS A CE  1 
ATOM   4800  N  NZ  . LYS A 1 610 ? 68.588 25.117  21.287  1.00 34.81  ? 610  LYS A NZ  1 
ATOM   4801  N  N   . LEU A 1 611 ? 61.687 23.894  22.304  1.00 35.81  ? 611  LEU A N   1 
ATOM   4802  C  CA  . LEU A 1 611 ? 60.837 23.074  21.451  1.00 35.99  ? 611  LEU A CA  1 
ATOM   4803  C  C   . LEU A 1 611 ? 61.330 23.150  20.011  1.00 36.23  ? 611  LEU A C   1 
ATOM   4804  O  O   . LEU A 1 611 ? 61.781 24.198  19.553  1.00 36.25  ? 611  LEU A O   1 
ATOM   4805  C  CB  . LEU A 1 611 ? 59.390 23.560  21.524  1.00 35.93  ? 611  LEU A CB  1 
ATOM   4806  C  CG  . LEU A 1 611 ? 58.261 22.528  21.542  1.00 35.72  ? 611  LEU A CG  1 
ATOM   4807  C  CD1 . LEU A 1 611 ? 58.327 21.597  20.345  1.00 35.67  ? 611  LEU A CD1 1 
ATOM   4808  C  CD2 . LEU A 1 611 ? 58.298 21.746  22.838  1.00 35.60  ? 611  LEU A CD2 1 
ATOM   4809  N  N   . GLU A 1 612 ? 61.234 22.034  19.300  1.00 36.49  ? 612  GLU A N   1 
ATOM   4810  C  CA  . GLU A 1 612 ? 61.674 21.964  17.916  1.00 36.76  ? 612  GLU A CA  1 
ATOM   4811  C  C   . GLU A 1 612 ? 60.477 21.972  16.967  1.00 36.96  ? 612  GLU A C   1 
ATOM   4812  O  O   . GLU A 1 612 ? 59.624 21.090  17.029  1.00 36.98  ? 612  GLU A O   1 
ATOM   4813  C  CB  . GLU A 1 612 ? 62.515 20.702  17.710  1.00 36.74  ? 612  GLU A CB  1 
ATOM   4814  C  CG  . GLU A 1 612 ? 62.846 20.383  16.261  1.00 36.88  ? 612  GLU A CG  1 
ATOM   4815  C  CD  . GLU A 1 612 ? 63.916 21.289  15.689  1.00 36.87  ? 612  GLU A CD  1 
ATOM   4816  O  OE1 . GLU A 1 612 ? 65.108 21.057  15.986  1.00 36.63  ? 612  GLU A OE1 1 
ATOM   4817  O  OE2 . GLU A 1 612 ? 63.564 22.228  14.942  1.00 36.74  ? 612  GLU A OE2 1 
ATOM   4818  N  N   . ASN A 1 613 ? 60.403 22.978  16.101  1.00 37.23  ? 613  ASN A N   1 
ATOM   4819  C  CA  . ASN A 1 613 ? 59.317 23.055  15.132  1.00 37.52  ? 613  ASN A CA  1 
ATOM   4820  C  C   . ASN A 1 613 ? 59.447 21.966  14.081  1.00 37.71  ? 613  ASN A C   1 
ATOM   4821  O  O   . ASN A 1 613 ? 58.471 21.294  13.751  1.00 37.77  ? 613  ASN A O   1 
ATOM   4822  C  CB  . ASN A 1 613 ? 59.279 24.424  14.452  1.00 37.59  ? 613  ASN A CB  1 
ATOM   4823  C  CG  . ASN A 1 613 ? 58.589 25.478  15.293  1.00 37.75  ? 613  ASN A CG  1 
ATOM   4824  O  OD1 . ASN A 1 613 ? 57.387 25.398  15.546  1.00 38.07  ? 613  ASN A OD1 1 
ATOM   4825  N  ND2 . ASN A 1 613 ? 59.346 26.477  15.726  1.00 37.88  ? 613  ASN A ND2 1 
ATOM   4826  N  N   . GLN A 1 614 ? 60.661 21.795  13.563  1.00 37.96  ? 614  GLN A N   1 
ATOM   4827  C  CA  . GLN A 1 614 ? 60.938 20.787  12.541  1.00 38.21  ? 614  GLN A CA  1 
ATOM   4828  C  C   . GLN A 1 614 ? 60.429 19.425  12.981  1.00 38.23  ? 614  GLN A C   1 
ATOM   4829  O  O   . GLN A 1 614 ? 60.003 18.612  12.163  1.00 38.25  ? 614  GLN A O   1 
ATOM   4830  C  CB  . GLN A 1 614 ? 62.438 20.701  12.253  1.00 38.27  ? 614  GLN A CB  1 
ATOM   4831  C  CG  . GLN A 1 614 ? 63.052 21.984  11.718  1.00 38.76  ? 614  GLN A CG  1 
ATOM   4832  C  CD  . GLN A 1 614 ? 64.540 21.849  11.451  1.00 39.14  ? 614  GLN A CD  1 
ATOM   4833  O  OE1 . GLN A 1 614 ? 65.118 20.781  11.656  1.00 39.21  ? 614  GLN A OE1 1 
ATOM   4834  N  NE2 . GLN A 1 614 ? 65.162 22.930  10.994  1.00 39.34  ? 614  GLN A NE2 1 
ATOM   4835  N  N   . SER A 1 615 ? 60.495 19.185  14.284  1.00 38.34  ? 615  SER A N   1 
ATOM   4836  C  CA  . SER A 1 615 ? 60.008 17.947  14.868  1.00 38.45  ? 615  SER A CA  1 
ATOM   4837  C  C   . SER A 1 615 ? 59.403 18.254  16.228  1.00 38.59  ? 615  SER A C   1 
ATOM   4838  O  O   . SER A 1 615 ? 60.120 18.556  17.182  1.00 38.61  ? 615  SER A O   1 
ATOM   4839  C  CB  . SER A 1 615 ? 61.141 16.929  15.013  1.00 38.41  ? 615  SER A CB  1 
ATOM   4840  O  OG  . SER A 1 615 ? 61.981 17.254  16.107  1.00 38.16  ? 615  SER A OG  1 
ATOM   4841  N  N   . LEU A 1 616 ? 58.078 18.190  16.307  1.00 38.76  ? 616  LEU A N   1 
ATOM   4842  C  CA  . LEU A 1 616 ? 57.366 18.456  17.550  1.00 38.96  ? 616  LEU A CA  1 
ATOM   4843  C  C   . LEU A 1 616 ? 57.737 17.455  18.623  1.00 39.02  ? 616  LEU A C   1 
ATOM   4844  O  O   . LEU A 1 616 ? 57.036 16.459  18.809  1.00 39.14  ? 616  LEU A O   1 
ATOM   4845  C  CB  . LEU A 1 616 ? 55.860 18.366  17.333  1.00 39.02  ? 616  LEU A CB  1 
ATOM   4846  C  CG  . LEU A 1 616 ? 55.125 19.630  16.913  1.00 39.45  ? 616  LEU A CG  1 
ATOM   4847  C  CD1 . LEU A 1 616 ? 53.879 19.744  17.767  1.00 39.89  ? 616  LEU A CD1 1 
ATOM   4848  C  CD2 . LEU A 1 616 ? 56.010 20.855  17.092  1.00 39.84  ? 616  LEU A CD2 1 
ATOM   4849  N  N   . LYS A 1 617 ? 58.824 17.711  19.340  1.00 39.00  ? 617  LYS A N   1 
ATOM   4850  C  CA  . LYS A 1 617 ? 59.242 16.765  20.360  1.00 39.07  ? 617  LYS A CA  1 
ATOM   4851  C  C   . LYS A 1 617 ? 59.736 17.407  21.645  1.00 38.99  ? 617  LYS A C   1 
ATOM   4852  O  O   . LYS A 1 617 ? 59.030 17.395  22.651  1.00 39.06  ? 617  LYS A O   1 
ATOM   4853  C  CB  . LYS A 1 617 ? 60.263 15.771  19.791  1.00 39.18  ? 617  LYS A CB  1 
ATOM   4854  C  CG  . LYS A 1 617 ? 59.702 14.950  18.628  1.00 39.36  ? 617  LYS A CG  1 
ATOM   4855  C  CD  . LYS A 1 617 ? 60.616 13.817  18.202  1.00 39.47  ? 617  LYS A CD  1 
ATOM   4856  C  CE  . LYS A 1 617 ? 60.085 13.161  16.938  1.00 39.42  ? 617  LYS A CE  1 
ATOM   4857  N  NZ  . LYS A 1 617 ? 60.928 12.019  16.505  1.00 39.51  ? 617  LYS A NZ  1 
ATOM   4858  N  N   . SER A 1 618 ? 60.935 17.977  21.617  1.00 38.88  ? 618  SER A N   1 
ATOM   4859  C  CA  . SER A 1 618 ? 61.490 18.598  22.815  1.00 38.76  ? 618  SER A CA  1 
ATOM   4860  C  C   . SER A 1 618 ? 62.932 19.023  22.624  1.00 38.55  ? 618  SER A C   1 
ATOM   4861  O  O   . SER A 1 618 ? 63.461 18.960  21.517  1.00 38.52  ? 618  SER A O   1 
ATOM   4862  C  CB  . SER A 1 618 ? 61.425 17.626  23.993  1.00 38.88  ? 618  SER A CB  1 
ATOM   4863  O  OG  . SER A 1 618 ? 62.039 18.185  25.142  1.00 38.98  ? 618  SER A OG  1 
ATOM   4864  N  N   . VAL A 1 619 ? 63.551 19.453  23.722  1.00 38.24  ? 619  VAL A N   1 
ATOM   4865  C  CA  . VAL A 1 619 ? 64.996 19.692  23.801  1.00 37.96  ? 619  VAL A CA  1 
ATOM   4866  C  C   . VAL A 1 619 ? 65.340 20.488  25.055  1.00 37.81  ? 619  VAL A C   1 
ATOM   4867  O  O   . VAL A 1 619 ? 64.466 21.001  25.758  1.00 37.86  ? 619  VAL A O   1 
ATOM   4868  C  CB  . VAL A 1 619 ? 65.474 20.572  22.607  1.00 37.96  ? 619  VAL A CB  1 
ATOM   4869  C  CG1 . VAL A 1 619 ? 66.991 20.569  22.517  1.00 37.87  ? 619  VAL A CG1 1 
ATOM   4870  C  CG2 . VAL A 1 619 ? 64.889 20.120  21.289  1.00 37.89  ? 619  VAL A CG2 1 
ATOM   4871  N  N   . LYS A 1 620 ? 66.638 20.550  25.325  1.00 37.51  ? 620  LYS A N   1 
ATOM   4872  C  CA  . LYS A 1 620 ? 67.196 21.727  26.117  1.00 37.12  ? 620  LYS A CA  1 
ATOM   4873  C  C   . LYS A 1 620 ? 66.290 22.350  27.172  1.00 36.96  ? 620  LYS A C   1 
ATOM   4874  O  O   . LYS A 1 620 ? 65.496 23.241  26.879  1.00 36.91  ? 620  LYS A O   1 
ATOM   4875  C  CB  . LYS A 1 620 ? 67.755 22.841  25.233  1.00 37.03  ? 620  LYS A CB  1 
ATOM   4876  C  CG  . LYS A 1 620 ? 68.489 23.935  25.961  1.00 36.67  ? 620  LYS A CG  1 
ATOM   4877  C  CD  . LYS A 1 620 ? 69.447 24.626  25.011  1.00 36.32  ? 620  LYS A CD  1 
ATOM   4878  C  CE  . LYS A 1 620 ? 70.336 25.614  25.739  1.00 36.00  ? 620  LYS A CE  1 
ATOM   4879  N  NZ  . LYS A 1 620 ? 71.375 26.188  24.838  1.00 35.78  ? 620  LYS A NZ  1 
ATOM   4880  N  N   . PHE A 1 621 ? 66.439 21.887  28.406  1.00 36.78  ? 621  PHE A N   1 
ATOM   4881  C  CA  . PHE A 1 621 ? 65.717 22.452  29.532  1.00 36.65  ? 621  PHE A CA  1 
ATOM   4882  C  C   . PHE A 1 621 ? 66.687 23.364  30.276  1.00 36.69  ? 621  PHE A C   1 
ATOM   4883  O  O   . PHE A 1 621 ? 67.698 22.895  30.804  1.00 36.70  ? 621  PHE A O   1 
ATOM   4884  C  CB  . PHE A 1 621 ? 65.222 21.337  30.444  1.00 36.59  ? 621  PHE A CB  1 
ATOM   4885  C  CG  . PHE A 1 621 ? 64.610 21.824  31.716  1.00 36.25  ? 621  PHE A CG  1 
ATOM   4886  C  CD1 . PHE A 1 621 ? 65.399 22.073  32.821  1.00 36.11  ? 621  PHE A CD1 1 
ATOM   4887  C  CD2 . PHE A 1 621 ? 63.244 22.023  31.813  1.00 35.81  ? 621  PHE A CD2 1 
ATOM   4888  C  CE1 . PHE A 1 621 ? 64.843 22.519  33.991  1.00 35.94  ? 621  PHE A CE1 1 
ATOM   4889  C  CE2 . PHE A 1 621 ? 62.682 22.466  32.985  1.00 35.60  ? 621  PHE A CE2 1 
ATOM   4890  C  CZ  . PHE A 1 621 ? 63.484 22.714  34.076  1.00 35.71  ? 621  PHE A CZ  1 
ATOM   4891  N  N   . GLY A 1 622 ? 66.386 24.662  30.316  1.00 36.72  ? 622  GLY A N   1 
ATOM   4892  C  CA  . GLY A 1 622 ? 67.290 25.627  30.922  1.00 36.72  ? 622  GLY A CA  1 
ATOM   4893  C  C   . GLY A 1 622 ? 66.716 26.667  31.869  1.00 36.74  ? 622  GLY A C   1 
ATOM   4894  O  O   . GLY A 1 622 ? 65.514 26.928  31.887  1.00 36.59  ? 622  GLY A O   1 
ATOM   4895  N  N   . SER A 1 623 ? 67.607 27.267  32.654  1.00 36.89  ? 623  SER A N   1 
ATOM   4896  C  CA  . SER A 1 623 ? 67.246 28.276  33.645  1.00 37.10  ? 623  SER A CA  1 
ATOM   4897  C  C   . SER A 1 623 ? 66.957 29.607  32.982  1.00 37.10  ? 623  SER A C   1 
ATOM   4898  O  O   . SER A 1 623 ? 67.853 30.222  32.407  1.00 37.28  ? 623  SER A O   1 
ATOM   4899  C  CB  . SER A 1 623 ? 68.380 28.453  34.661  1.00 37.17  ? 623  SER A CB  1 
ATOM   4900  O  OG  . SER A 1 623 ? 68.238 29.668  35.386  1.00 37.52  ? 623  SER A OG  1 
ATOM   4901  N  N   . ILE A 1 624 ? 65.713 30.063  33.072  1.00 37.03  ? 624  ILE A N   1 
ATOM   4902  C  CA  . ILE A 1 624 ? 65.344 31.318  32.432  1.00 36.95  ? 624  ILE A CA  1 
ATOM   4903  C  C   . ILE A 1 624 ? 66.369 32.405  32.733  1.00 36.85  ? 624  ILE A C   1 
ATOM   4904  O  O   . ILE A 1 624 ? 67.008 32.930  31.823  1.00 36.69  ? 624  ILE A O   1 
ATOM   4905  C  CB  . ILE A 1 624 ? 63.923 31.761  32.848  1.00 36.97  ? 624  ILE A CB  1 
ATOM   4906  C  CG1 . ILE A 1 624 ? 63.373 32.792  31.864  1.00 36.70  ? 624  ILE A CG1 1 
ATOM   4907  C  CG2 . ILE A 1 624 ? 63.914 32.317  34.260  1.00 37.09  ? 624  ILE A CG2 1 
ATOM   4908  C  CD1 . ILE A 1 624 ? 61.874 32.950  31.941  1.00 36.65  ? 624  ILE A CD1 1 
ATOM   4909  N  N   . LYS A 1 625 ? 66.548 32.694  34.018  1.00 36.84  ? 625  LYS A N   1 
ATOM   4910  C  CA  . LYS A 1 625 ? 67.435 33.758  34.480  1.00 36.82  ? 625  LYS A CA  1 
ATOM   4911  C  C   . LYS A 1 625 ? 68.853 33.672  33.939  1.00 36.68  ? 625  LYS A C   1 
ATOM   4912  O  O   . LYS A 1 625 ? 69.425 34.678  33.523  1.00 36.65  ? 625  LYS A O   1 
ATOM   4913  C  CB  . LYS A 1 625 ? 67.474 33.784  36.007  1.00 36.86  ? 625  LYS A CB  1 
ATOM   4914  C  CG  . LYS A 1 625 ? 66.104 33.830  36.655  1.00 37.40  ? 625  LYS A CG  1 
ATOM   4915  C  CD  . LYS A 1 625 ? 66.213 34.144  38.136  1.00 38.47  ? 625  LYS A CD  1 
ATOM   4916  C  CE  . LYS A 1 625 ? 64.860 34.057  38.828  1.00 39.19  ? 625  LYS A CE  1 
ATOM   4917  N  NZ  . LYS A 1 625 ? 64.999 34.204  40.307  1.00 39.43  ? 625  LYS A NZ  1 
ATOM   4918  N  N   . SER A 1 626 ? 69.422 32.476  33.954  1.00 36.58  ? 626  SER A N   1 
ATOM   4919  C  CA  . SER A 1 626 ? 70.791 32.298  33.500  1.00 36.56  ? 626  SER A CA  1 
ATOM   4920  C  C   . SER A 1 626 ? 70.919 32.352  31.984  1.00 36.54  ? 626  SER A C   1 
ATOM   4921  O  O   . SER A 1 626 ? 71.930 32.818  31.463  1.00 36.62  ? 626  SER A O   1 
ATOM   4922  C  CB  . SER A 1 626 ? 71.362 30.980  34.024  1.00 36.60  ? 626  SER A CB  1 
ATOM   4923  O  OG  . SER A 1 626 ? 71.509 31.008  35.434  1.00 36.79  ? 626  SER A OG  1 
ATOM   4924  N  N   . ASP A 1 627 ? 69.891 31.883  31.281  1.00 36.47  ? 627  ASP A N   1 
ATOM   4925  C  CA  . ASP A 1 627 ? 69.942 31.805  29.823  1.00 36.31  ? 627  ASP A CA  1 
ATOM   4926  C  C   . ASP A 1 627 ? 69.497 33.097  29.151  1.00 36.25  ? 627  ASP A C   1 
ATOM   4927  O  O   . ASP A 1 627 ? 70.308 33.770  28.522  1.00 36.31  ? 627  ASP A O   1 
ATOM   4928  C  CB  . ASP A 1 627 ? 69.173 30.584  29.314  1.00 36.30  ? 627  ASP A CB  1 
ATOM   4929  C  CG  . ASP A 1 627 ? 69.836 29.270  29.723  1.00 36.39  ? 627  ASP A CG  1 
ATOM   4930  O  OD1 . ASP A 1 627 ? 71.080 29.183  29.647  1.00 36.32  ? 627  ASP A OD1 1 
ATOM   4931  O  OD2 . ASP A 1 627 ? 69.204 28.274  30.139  1.00 36.14  ? 627  ASP A OD2 1 
ATOM   4932  N  N   . TRP A 1 628 ? 68.220 33.446  29.264  1.00 36.20  ? 628  TRP A N   1 
ATOM   4933  C  CA  . TRP A 1 628 ? 67.775 34.733  28.743  1.00 36.12  ? 628  TRP A CA  1 
ATOM   4934  C  C   . TRP A 1 628 ? 67.801 35.720  29.896  1.00 36.24  ? 628  TRP A C   1 
ATOM   4935  O  O   . TRP A 1 628 ? 68.058 35.344  31.035  1.00 36.46  ? 628  TRP A O   1 
ATOM   4936  C  CB  . TRP A 1 628 ? 66.341 34.699  28.231  1.00 36.01  ? 628  TRP A CB  1 
ATOM   4937  C  CG  . TRP A 1 628 ? 65.943 33.587  27.341  1.00 35.42  ? 628  TRP A CG  1 
ATOM   4938  C  CD1 . TRP A 1 628 ? 66.098 32.256  27.562  1.00 34.98  ? 628  TRP A CD1 1 
ATOM   4939  C  CD2 . TRP A 1 628 ? 65.241 33.710  26.103  1.00 35.10  ? 628  TRP A CD2 1 
ATOM   4940  N  NE1 . TRP A 1 628 ? 65.560 31.539  26.521  1.00 34.72  ? 628  TRP A NE1 1 
ATOM   4941  C  CE2 . TRP A 1 628 ? 65.028 32.412  25.611  1.00 35.00  ? 628  TRP A CE2 1 
ATOM   4942  C  CE3 . TRP A 1 628 ? 64.785 34.793  25.347  1.00 34.69  ? 628  TRP A CE3 1 
ATOM   4943  C  CZ2 . TRP A 1 628 ? 64.382 32.170  24.407  1.00 35.29  ? 628  TRP A CZ2 1 
ATOM   4944  C  CZ3 . TRP A 1 628 ? 64.146 34.550  24.155  1.00 34.60  ? 628  TRP A CZ3 1 
ATOM   4945  C  CH2 . TRP A 1 628 ? 63.948 33.252  23.695  1.00 34.74  ? 628  TRP A CH2 1 
ATOM   4946  N  N   . LEU A 1 629 ? 67.492 36.978  29.614  1.00 36.29  ? 629  LEU A N   1 
ATOM   4947  C  CA  . LEU A 1 629 ? 67.458 37.976  30.666  1.00 36.38  ? 629  LEU A CA  1 
ATOM   4948  C  C   . LEU A 1 629 ? 68.789 37.951  31.382  1.00 36.34  ? 629  LEU A C   1 
ATOM   4949  O  O   . LEU A 1 629 ? 68.847 37.940  32.612  1.00 36.37  ? 629  LEU A O   1 
ATOM   4950  C  CB  . LEU A 1 629 ? 66.344 37.669  31.659  1.00 36.38  ? 629  LEU A CB  1 
ATOM   4951  C  CG  . LEU A 1 629 ? 66.151 38.765  32.698  1.00 36.68  ? 629  LEU A CG  1 
ATOM   4952  C  CD1 . LEU A 1 629 ? 65.444 39.950  32.062  1.00 37.05  ? 629  LEU A CD1 1 
ATOM   4953  C  CD2 . LEU A 1 629 ? 65.386 38.234  33.896  1.00 36.89  ? 629  LEU A CD2 1 
ATOM   4954  N  N   . GLY A 1 630 ? 69.853 37.920  30.589  1.00 36.32  ? 630  GLY A N   1 
ATOM   4955  C  CA  . GLY A 1 630 ? 71.209 37.896  31.096  1.00 36.33  ? 630  GLY A CA  1 
ATOM   4956  C  C   . GLY A 1 630 ? 71.347 37.555  32.559  1.00 36.35  ? 630  GLY A C   1 
ATOM   4957  O  O   . GLY A 1 630 ? 72.371 37.859  33.169  1.00 36.23  ? 630  GLY A O   1 
ATOM   4958  N  N   . CYS A 1 631 ? 72.047 36.175  33.903  1.00 39.81  ? 631  CYS A N   1 
ATOM   4959  C  CA  . CYS A 1 631 ? 72.609 36.953  34.997  1.00 39.91  ? 631  CYS A CA  1 
ATOM   4960  C  C   . CYS A 1 631 ? 74.101 36.690  35.114  1.00 39.86  ? 631  CYS A C   1 
ATOM   4961  O  O   . CYS A 1 631 ? 74.810 36.687  34.108  1.00 39.88  ? 631  CYS A O   1 
ATOM   4962  C  CB  . CYS A 1 631 ? 71.887 36.619  36.295  1.00 39.93  ? 631  CYS A CB  1 
ATOM   4963  S  SG  . CYS A 1 631 ? 70.095 36.662  36.096  1.00 40.39  ? 631  CYS A SG  1 
ATOM   4964  N  N   . PRO B 1 2   ? 26.249 128.963 -0.651  1.00 46.14  ? 2    PRO B N   1 
ATOM   4965  C  CA  . PRO B 1 2   ? 26.893 127.684 -1.081  1.00 46.20  ? 2    PRO B CA  1 
ATOM   4966  C  C   . PRO B 1 2   ? 28.350 127.641 -0.642  1.00 46.15  ? 2    PRO B C   1 
ATOM   4967  O  O   . PRO B 1 2   ? 29.243 128.109 -1.347  1.00 46.24  ? 2    PRO B O   1 
ATOM   4968  C  CB  . PRO B 1 2   ? 26.767 127.735 -2.600  1.00 46.09  ? 2    PRO B CB  1 
ATOM   4969  C  CG  . PRO B 1 2   ? 25.497 128.515 -2.816  1.00 46.07  ? 2    PRO B CG  1 
ATOM   4970  C  CD  . PRO B 1 2   ? 25.479 129.582 -1.744  1.00 46.13  ? 2    PRO B CD  1 
ATOM   4971  N  N   . SER B 1 3   ? 28.567 127.039 0.521   1.00 45.95  ? 3    SER B N   1 
ATOM   4972  C  CA  . SER B 1 3   ? 29.850 127.072 1.203   1.00 46.04  ? 3    SER B CA  1 
ATOM   4973  C  C   . SER B 1 3   ? 30.805 125.938 0.878   1.00 45.67  ? 3    SER B C   1 
ATOM   4974  O  O   . SER B 1 3   ? 30.623 125.222 -0.103  1.00 45.64  ? 3    SER B O   1 
ATOM   4975  C  CB  . SER B 1 3   ? 29.590 127.075 2.708   1.00 46.32  ? 3    SER B CB  1 
ATOM   4976  O  OG  . SER B 1 3   ? 28.668 126.046 3.034   1.00 47.42  ? 3    SER B OG  1 
ATOM   4977  N  N   . PRO B 1 4   ? 31.824 125.788 1.729   1.00 45.36  ? 4    PRO B N   1 
ATOM   4978  C  CA  . PRO B 1 4   ? 32.852 124.763 1.565   1.00 45.17  ? 4    PRO B CA  1 
ATOM   4979  C  C   . PRO B 1 4   ? 32.327 123.346 1.720   1.00 45.17  ? 4    PRO B C   1 
ATOM   4980  O  O   . PRO B 1 4   ? 31.143 123.093 1.485   1.00 45.27  ? 4    PRO B O   1 
ATOM   4981  C  CB  . PRO B 1 4   ? 33.835 125.083 2.689   1.00 44.93  ? 4    PRO B CB  1 
ATOM   4982  C  CG  . PRO B 1 4   ? 33.588 126.485 2.986   1.00 44.90  ? 4    PRO B CG  1 
ATOM   4983  C  CD  . PRO B 1 4   ? 32.095 126.621 2.910   1.00 45.29  ? 4    PRO B CD  1 
ATOM   4984  N  N   . ILE B 1 5   ? 33.215 122.440 2.117   1.00 44.92  ? 5    ILE B N   1 
ATOM   4985  C  CA  . ILE B 1 5   ? 32.911 121.025 2.176   1.00 44.94  ? 5    ILE B CA  1 
ATOM   4986  C  C   . ILE B 1 5   ? 33.592 120.405 3.372   1.00 45.18  ? 5    ILE B C   1 
ATOM   4987  O  O   . ILE B 1 5   ? 34.633 120.894 3.811   1.00 45.57  ? 5    ILE B O   1 
ATOM   4988  C  CB  . ILE B 1 5   ? 33.472 120.376 0.925   1.00 44.84  ? 5    ILE B CB  1 
ATOM   4989  C  CG1 . ILE B 1 5   ? 34.931 120.773 0.781   1.00 44.97  ? 5    ILE B CG1 1 
ATOM   4990  C  CG2 . ILE B 1 5   ? 32.731 120.855 -0.307  1.00 45.29  ? 5    ILE B CG2 1 
ATOM   4991  C  CD1 . ILE B 1 5   ? 35.529 120.432 -0.550  1.00 45.85  ? 5    ILE B CD1 1 
ATOM   4992  N  N   . ILE B 1 6   ? 33.037 119.302 3.875   1.00 45.34  ? 6    ILE B N   1 
ATOM   4993  C  CA  . ILE B 1 6   ? 33.577 118.638 5.060   1.00 45.43  ? 6    ILE B CA  1 
ATOM   4994  C  C   . ILE B 1 6   ? 33.531 117.106 4.992   1.00 45.85  ? 6    ILE B C   1 
ATOM   4995  O  O   . ILE B 1 6   ? 32.641 116.560 4.356   1.00 46.24  ? 6    ILE B O   1 
ATOM   4996  C  CB  . ILE B 1 6   ? 32.775 119.106 6.265   1.00 45.10  ? 6    ILE B CB  1 
ATOM   4997  C  CG1 . ILE B 1 6   ? 32.895 120.618 6.411   1.00 44.92  ? 6    ILE B CG1 1 
ATOM   4998  C  CG2 . ILE B 1 6   ? 33.262 118.438 7.515   1.00 45.74  ? 6    ILE B CG2 1 
ATOM   4999  C  CD1 . ILE B 1 6   ? 31.989 121.183 7.447   1.00 44.38  ? 6    ILE B CD1 1 
ATOM   5000  N  N   . LYS B 1 7   ? 34.465 116.420 5.661   1.00 46.28  ? 7    LYS B N   1 
ATOM   5001  C  CA  . LYS B 1 7   ? 34.489 114.947 5.706   1.00 46.70  ? 7    LYS B CA  1 
ATOM   5002  C  C   . LYS B 1 7   ? 35.892 114.496 6.109   1.00 47.30  ? 7    LYS B C   1 
ATOM   5003  O  O   . LYS B 1 7   ? 36.848 115.127 5.648   1.00 47.85  ? 7    LYS B O   1 
ATOM   5004  C  CB  . LYS B 1 7   ? 34.173 114.389 4.314   1.00 46.66  ? 7    LYS B CB  1 
ATOM   5005  C  CG  . LYS B 1 7   ? 33.185 113.199 4.276   1.00 46.28  ? 7    LYS B CG  1 
ATOM   5006  C  CD  . LYS B 1 7   ? 33.135 112.550 2.871   1.00 46.24  ? 7    LYS B CD  1 
ATOM   5007  C  CE  . LYS B 1 7   ? 34.245 111.497 2.674   1.00 45.70  ? 7    LYS B CE  1 
ATOM   5008  N  NZ  . LYS B 1 7   ? 34.738 111.391 1.266   1.00 44.32  ? 7    LYS B NZ  1 
ATOM   5009  N  N   . PHE B 1 8   ? 36.057 113.437 6.925   1.00 47.43  ? 8    PHE B N   1 
ATOM   5010  C  CA  . PHE B 1 8   ? 37.516 113.015 7.142   1.00 47.50  ? 8    PHE B CA  1 
ATOM   5011  C  C   . PHE B 1 8   ? 37.856 111.689 7.834   1.00 48.14  ? 8    PHE B C   1 
ATOM   5012  O  O   . PHE B 1 8   ? 37.657 111.530 9.025   1.00 48.35  ? 8    PHE B O   1 
ATOM   5013  C  CB  . PHE B 1 8   ? 38.343 114.137 7.785   1.00 47.15  ? 8    PHE B CB  1 
ATOM   5014  C  CG  . PHE B 1 8   ? 39.279 114.797 6.828   1.00 45.95  ? 8    PHE B CG  1 
ATOM   5015  C  CD1 . PHE B 1 8   ? 40.283 114.068 6.228   1.00 45.34  ? 8    PHE B CD1 1 
ATOM   5016  C  CD2 . PHE B 1 8   ? 39.134 116.125 6.495   1.00 45.20  ? 8    PHE B CD2 1 
ATOM   5017  C  CE1 . PHE B 1 8   ? 41.130 114.654 5.327   1.00 45.31  ? 8    PHE B CE1 1 
ATOM   5018  C  CE2 . PHE B 1 8   ? 39.983 116.715 5.597   1.00 45.66  ? 8    PHE B CE2 1 
ATOM   5019  C  CZ  . PHE B 1 8   ? 40.983 115.979 5.015   1.00 45.47  ? 8    PHE B CZ  1 
ATOM   5020  N  N   . PRO B 1 9   ? 38.430 110.771 7.059   1.00 48.90  ? 9    PRO B N   1 
ATOM   5021  C  CA  . PRO B 1 9   ? 38.892 109.441 7.512   1.00 49.22  ? 9    PRO B CA  1 
ATOM   5022  C  C   . PRO B 1 9   ? 39.993 109.420 8.542   1.00 49.51  ? 9    PRO B C   1 
ATOM   5023  O  O   . PRO B 1 9   ? 40.790 110.349 8.593   1.00 50.07  ? 9    PRO B O   1 
ATOM   5024  C  CB  . PRO B 1 9   ? 39.514 108.844 6.247   1.00 49.02  ? 9    PRO B CB  1 
ATOM   5025  C  CG  . PRO B 1 9   ? 38.844 109.560 5.118   1.00 49.53  ? 9    PRO B CG  1 
ATOM   5026  C  CD  . PRO B 1 9   ? 38.614 110.957 5.611   1.00 49.25  ? 9    PRO B CD  1 
ATOM   5027  N  N   . GLY B 1 10  ? 40.064 108.329 9.301   1.00 49.83  ? 10   GLY B N   1 
ATOM   5028  C  CA  . GLY B 1 10  ? 41.075 108.129 10.324  1.00 50.03  ? 10   GLY B CA  1 
ATOM   5029  C  C   . GLY B 1 10  ? 40.883 108.989 11.559  1.00 50.51  ? 10   GLY B C   1 
ATOM   5030  O  O   . GLY B 1 10  ? 41.845 109.569 12.061  1.00 50.99  ? 10   GLY B O   1 
ATOM   5031  N  N   . ASP B 1 11  ? 39.647 109.074 12.044  1.00 50.67  ? 11   ASP B N   1 
ATOM   5032  C  CA  . ASP B 1 11  ? 39.287 109.873 13.223  1.00 51.06  ? 11   ASP B CA  1 
ATOM   5033  C  C   . ASP B 1 11  ? 37.810 110.276 13.132  1.00 51.15  ? 11   ASP B C   1 
ATOM   5034  O  O   . ASP B 1 11  ? 37.228 110.271 12.046  1.00 51.05  ? 11   ASP B O   1 
ATOM   5035  C  CB  . ASP B 1 11  ? 40.183 111.122 13.382  1.00 51.30  ? 11   ASP B CB  1 
ATOM   5036  C  CG  . ASP B 1 11  ? 39.577 112.392 12.749  1.00 52.12  ? 11   ASP B CG  1 
ATOM   5037  O  OD1 . ASP B 1 11  ? 38.798 112.275 11.785  1.00 54.61  ? 11   ASP B OD1 1 
ATOM   5038  O  OD2 . ASP B 1 11  ? 39.824 113.557 13.135  1.00 51.80  ? 11   ASP B OD2 1 
ATOM   5039  N  N   . VAL B 1 12  ? 37.196 110.599 14.266  1.00 51.36  ? 12   VAL B N   1 
ATOM   5040  C  CA  . VAL B 1 12  ? 35.805 111.068 14.263  1.00 51.68  ? 12   VAL B CA  1 
ATOM   5041  C  C   . VAL B 1 12  ? 35.748 112.428 14.946  1.00 51.74  ? 12   VAL B C   1 
ATOM   5042  O  O   . VAL B 1 12  ? 36.071 112.544 16.126  1.00 51.88  ? 12   VAL B O   1 
ATOM   5043  C  CB  . VAL B 1 12  ? 34.827 110.090 14.960  1.00 51.69  ? 12   VAL B CB  1 
ATOM   5044  C  CG1 . VAL B 1 12  ? 35.343 109.688 16.340  1.00 51.34  ? 12   VAL B CG1 1 
ATOM   5045  C  CG2 . VAL B 1 12  ? 33.444 110.717 15.059  1.00 51.11  ? 12   VAL B CG2 1 
ATOM   5046  N  N   . ALA B 1 13  ? 35.337 113.458 14.212  1.00 51.66  ? 13   ALA B N   1 
ATOM   5047  C  CA  . ALA B 1 13  ? 35.388 114.807 14.776  1.00 51.51  ? 13   ALA B CA  1 
ATOM   5048  C  C   . ALA B 1 13  ? 34.104 115.641 14.814  1.00 51.04  ? 13   ALA B C   1 
ATOM   5049  O  O   . ALA B 1 13  ? 34.126 116.745 15.361  1.00 51.32  ? 13   ALA B O   1 
ATOM   5050  C  CB  . ALA B 1 13  ? 36.542 115.621 14.149  1.00 51.72  ? 13   ALA B CB  1 
ATOM   5051  N  N   . PRO B 1 14  ? 32.996 115.146 14.267  1.00 50.34  ? 14   PRO B N   1 
ATOM   5052  C  CA  . PRO B 1 14  ? 31.747 115.911 14.319  1.00 49.51  ? 14   PRO B CA  1 
ATOM   5053  C  C   . PRO B 1 14  ? 31.320 116.069 15.774  1.00 48.93  ? 14   PRO B C   1 
ATOM   5054  O  O   . PRO B 1 14  ? 30.758 115.140 16.362  1.00 49.05  ? 14   PRO B O   1 
ATOM   5055  C  CB  . PRO B 1 14  ? 30.741 115.015 13.591  1.00 49.35  ? 14   PRO B CB  1 
ATOM   5056  C  CG  . PRO B 1 14  ? 31.533 114.026 12.861  1.00 49.76  ? 14   PRO B CG  1 
ATOM   5057  C  CD  . PRO B 1 14  ? 32.829 113.847 13.596  1.00 50.38  ? 14   PRO B CD  1 
ATOM   5058  N  N   . LYS B 1 15  ? 31.596 117.229 16.357  1.00 48.01  ? 15   LYS B N   1 
ATOM   5059  C  CA  . LYS B 1 15  ? 31.210 117.493 17.737  1.00 46.95  ? 15   LYS B CA  1 
ATOM   5060  C  C   . LYS B 1 15  ? 30.066 118.502 17.744  1.00 46.07  ? 15   LYS B C   1 
ATOM   5061  O  O   . LYS B 1 15  ? 30.261 119.671 17.436  1.00 45.91  ? 15   LYS B O   1 
ATOM   5062  C  CB  . LYS B 1 15  ? 32.416 118.027 18.507  1.00 47.13  ? 15   LYS B CB  1 
ATOM   5063  C  CG  . LYS B 1 15  ? 33.738 117.446 17.986  1.00 47.33  ? 15   LYS B CG  1 
ATOM   5064  C  CD  . LYS B 1 15  ? 34.960 118.327 18.262  1.00 47.12  ? 15   LYS B CD  1 
ATOM   5065  C  CE  . LYS B 1 15  ? 35.771 117.806 19.447  1.00 46.92  ? 15   LYS B CE  1 
ATOM   5066  N  NZ  . LYS B 1 15  ? 37.230 117.682 19.109  1.00 46.82  ? 15   LYS B NZ  1 
ATOM   5067  N  N   . THR B 1 16  ? 28.864 118.042 18.061  1.00 45.14  ? 16   THR B N   1 
ATOM   5068  C  CA  . THR B 1 16  ? 27.724 118.940 18.115  1.00 44.35  ? 16   THR B CA  1 
ATOM   5069  C  C   . THR B 1 16  ? 28.118 120.141 18.949  1.00 44.04  ? 16   THR B C   1 
ATOM   5070  O  O   . THR B 1 16  ? 28.651 119.990 20.039  1.00 44.19  ? 16   THR B O   1 
ATOM   5071  C  CB  . THR B 1 16  ? 26.498 118.260 18.773  1.00 44.34  ? 16   THR B CB  1 
ATOM   5072  O  OG1 . THR B 1 16  ? 26.670 116.834 18.814  1.00 44.05  ? 16   THR B OG1 1 
ATOM   5073  C  CG2 . THR B 1 16  ? 25.241 118.483 17.930  1.00 43.80  ? 16   THR B CG2 1 
ATOM   5074  N  N   . ASP B 1 17  ? 27.853 121.336 18.446  1.00 43.73  ? 17   ASP B N   1 
ATOM   5075  C  CA  . ASP B 1 17  ? 28.172 122.555 19.181  1.00 43.33  ? 17   ASP B CA  1 
ATOM   5076  C  C   . ASP B 1 17  ? 27.724 122.479 20.642  1.00 42.91  ? 17   ASP B C   1 
ATOM   5077  O  O   . ASP B 1 17  ? 28.527 122.642 21.561  1.00 42.65  ? 17   ASP B O   1 
ATOM   5078  C  CB  . ASP B 1 17  ? 27.520 123.754 18.506  1.00 43.43  ? 17   ASP B CB  1 
ATOM   5079  C  CG  . ASP B 1 17  ? 28.428 124.958 18.470  1.00 43.76  ? 17   ASP B CG  1 
ATOM   5080  O  OD1 . ASP B 1 17  ? 29.652 124.891 18.179  1.00 42.24  ? 17   ASP B OD1 1 
ATOM   5081  O  OD2 . ASP B 1 17  ? 27.915 126.067 18.743  1.00 44.64  ? 17   ASP B OD2 1 
ATOM   5082  N  N   . LYS B 1 18  ? 26.440 122.234 20.865  1.00 42.48  ? 18   LYS B N   1 
ATOM   5083  C  CA  . LYS B 1 18  ? 25.979 122.107 22.235  1.00 42.31  ? 18   LYS B CA  1 
ATOM   5084  C  C   . LYS B 1 18  ? 26.639 120.912 22.911  1.00 41.86  ? 18   LYS B C   1 
ATOM   5085  O  O   . LYS B 1 18  ? 27.140 121.038 24.020  1.00 42.18  ? 18   LYS B O   1 
ATOM   5086  C  CB  . LYS B 1 18  ? 24.449 122.075 22.336  1.00 42.54  ? 18   LYS B CB  1 
ATOM   5087  C  CG  . LYS B 1 18  ? 23.806 123.427 21.997  1.00 43.20  ? 18   LYS B CG  1 
ATOM   5088  C  CD  . LYS B 1 18  ? 22.714 123.835 22.989  1.00 44.04  ? 18   LYS B CD  1 
ATOM   5089  C  CE  . LYS B 1 18  ? 22.662 125.360 23.158  1.00 44.19  ? 18   LYS B CE  1 
ATOM   5090  N  NZ  . LYS B 1 18  ? 21.640 125.806 24.152  1.00 43.56  ? 18   LYS B NZ  1 
ATOM   5091  N  N   . GLU B 1 19  ? 26.678 119.763 22.245  1.00 41.19  ? 19   GLU B N   1 
ATOM   5092  C  CA  . GLU B 1 19  ? 27.337 118.605 22.838  1.00 40.61  ? 19   GLU B CA  1 
ATOM   5093  C  C   . GLU B 1 19  ? 28.703 119.030 23.355  1.00 40.01  ? 19   GLU B C   1 
ATOM   5094  O  O   . GLU B 1 19  ? 29.131 118.590 24.415  1.00 40.22  ? 19   GLU B O   1 
ATOM   5095  C  CB  . GLU B 1 19  ? 27.442 117.430 21.858  1.00 40.50  ? 19   GLU B CB  1 
ATOM   5096  C  CG  . GLU B 1 19  ? 28.619 116.480 22.077  1.00 42.34  ? 19   GLU B CG  1 
ATOM   5097  C  CD  . GLU B 1 19  ? 28.644 115.782 23.445  1.00 44.82  ? 19   GLU B CD  1 
ATOM   5098  O  OE1 . GLU B 1 19  ? 27.624 115.829 24.175  1.00 45.55  ? 19   GLU B OE1 1 
ATOM   5099  O  OE2 . GLU B 1 19  ? 29.700 115.181 23.800  1.00 44.81  ? 19   GLU B OE2 1 
ATOM   5100  N  N   . LEU B 1 20  ? 29.370 119.917 22.628  1.00 39.39  ? 20   LEU B N   1 
ATOM   5101  C  CA  . LEU B 1 20  ? 30.675 120.408 23.053  1.00 38.78  ? 20   LEU B CA  1 
ATOM   5102  C  C   . LEU B 1 20  ? 30.568 121.191 24.359  1.00 38.36  ? 20   LEU B C   1 
ATOM   5103  O  O   . LEU B 1 20  ? 31.397 121.020 25.251  1.00 38.14  ? 20   LEU B O   1 
ATOM   5104  C  CB  . LEU B 1 20  ? 31.321 121.264 21.963  1.00 38.78  ? 20   LEU B CB  1 
ATOM   5105  C  CG  . LEU B 1 20  ? 32.394 122.247 22.436  1.00 39.05  ? 20   LEU B CG  1 
ATOM   5106  C  CD1 . LEU B 1 20  ? 33.582 121.517 23.087  1.00 38.71  ? 20   LEU B CD1 1 
ATOM   5107  C  CD2 . LEU B 1 20  ? 32.847 123.156 21.289  1.00 38.48  ? 20   LEU B CD2 1 
ATOM   5108  N  N   . ALA B 1 21  ? 29.555 122.048 24.470  1.00 37.89  ? 21   ALA B N   1 
ATOM   5109  C  CA  . ALA B 1 21  ? 29.346 122.806 25.700  1.00 37.60  ? 21   ALA B CA  1 
ATOM   5110  C  C   . ALA B 1 21  ? 29.114 121.832 26.832  1.00 37.52  ? 21   ALA B C   1 
ATOM   5111  O  O   . ALA B 1 21  ? 29.787 121.875 27.857  1.00 37.61  ? 21   ALA B O   1 
ATOM   5112  C  CB  . ALA B 1 21  ? 28.162 123.711 25.572  1.00 37.43  ? 21   ALA B CB  1 
ATOM   5113  N  N   . VAL B 1 22  ? 28.157 120.940 26.619  1.00 37.43  ? 22   VAL B N   1 
ATOM   5114  C  CA  . VAL B 1 22  ? 27.773 119.946 27.607  1.00 37.43  ? 22   VAL B CA  1 
ATOM   5115  C  C   . VAL B 1 22  ? 28.937 119.155 28.169  1.00 37.48  ? 22   VAL B C   1 
ATOM   5116  O  O   . VAL B 1 22  ? 28.909 118.717 29.318  1.00 37.50  ? 22   VAL B O   1 
ATOM   5117  C  CB  . VAL B 1 22  ? 26.790 118.964 27.022  1.00 37.35  ? 22   VAL B CB  1 
ATOM   5118  C  CG1 . VAL B 1 22  ? 26.676 117.755 27.932  1.00 37.69  ? 22   VAL B CG1 1 
ATOM   5119  C  CG2 . VAL B 1 22  ? 25.449 119.644 26.821  1.00 37.12  ? 22   VAL B CG2 1 
ATOM   5120  N  N   . GLN B 1 23  ? 29.956 118.955 27.355  1.00 37.58  ? 23   GLN B N   1 
ATOM   5121  C  CA  . GLN B 1 23  ? 31.126 118.250 27.819  1.00 37.80  ? 23   GLN B CA  1 
ATOM   5122  C  C   . GLN B 1 23  ? 31.943 119.264 28.573  1.00 37.35  ? 23   GLN B C   1 
ATOM   5123  O  O   . GLN B 1 23  ? 32.353 119.028 29.702  1.00 37.35  ? 23   GLN B O   1 
ATOM   5124  C  CB  . GLN B 1 23  ? 31.925 117.709 26.634  1.00 38.23  ? 23   GLN B CB  1 
ATOM   5125  C  CG  . GLN B 1 23  ? 32.959 116.644 26.982  1.00 40.73  ? 23   GLN B CG  1 
ATOM   5126  C  CD  . GLN B 1 23  ? 33.584 116.001 25.736  1.00 44.32  ? 23   GLN B CD  1 
ATOM   5127  O  OE1 . GLN B 1 23  ? 34.664 116.411 25.278  1.00 45.05  ? 23   GLN B OE1 1 
ATOM   5128  N  NE2 . GLN B 1 23  ? 32.906 114.988 25.190  1.00 45.83  ? 23   GLN B NE2 1 
ATOM   5129  N  N   . TYR B 1 24  ? 32.148 120.420 27.953  1.00 37.14  ? 24   TYR B N   1 
ATOM   5130  C  CA  . TYR B 1 24  ? 33.018 121.437 28.534  1.00 36.81  ? 24   TYR B CA  1 
ATOM   5131  C  C   . TYR B 1 24  ? 32.409 122.030 29.768  1.00 37.00  ? 24   TYR B C   1 
ATOM   5132  O  O   . TYR B 1 24  ? 33.038 122.834 30.430  1.00 38.02  ? 24   TYR B O   1 
ATOM   5133  C  CB  . TYR B 1 24  ? 33.326 122.547 27.536  1.00 36.56  ? 24   TYR B CB  1 
ATOM   5134  C  CG  . TYR B 1 24  ? 34.430 123.498 27.947  1.00 34.91  ? 24   TYR B CG  1 
ATOM   5135  C  CD1 . TYR B 1 24  ? 34.221 124.472 28.902  1.00 34.02  ? 24   TYR B CD1 1 
ATOM   5136  C  CD2 . TYR B 1 24  ? 35.662 123.447 27.337  1.00 34.74  ? 24   TYR B CD2 1 
ATOM   5137  C  CE1 . TYR B 1 24  ? 35.218 125.341 29.260  1.00 34.22  ? 24   TYR B CE1 1 
ATOM   5138  C  CE2 . TYR B 1 24  ? 36.669 124.320 27.676  1.00 34.65  ? 24   TYR B CE2 1 
ATOM   5139  C  CZ  . TYR B 1 24  ? 36.445 125.263 28.637  1.00 34.48  ? 24   TYR B CZ  1 
ATOM   5140  O  OH  . TYR B 1 24  ? 37.460 126.130 28.964  1.00 34.20  ? 24   TYR B OH  1 
ATOM   5141  N  N   . LEU B 1 25  ? 31.176 121.667 30.078  1.00 36.59  ? 25   LEU B N   1 
ATOM   5142  C  CA  . LEU B 1 25  ? 30.595 122.153 31.309  1.00 35.87  ? 25   LEU B CA  1 
ATOM   5143  C  C   . LEU B 1 25  ? 30.747 121.053 32.331  1.00 35.92  ? 25   LEU B C   1 
ATOM   5144  O  O   . LEU B 1 25  ? 31.121 121.315 33.451  1.00 36.21  ? 25   LEU B O   1 
ATOM   5145  C  CB  . LEU B 1 25  ? 29.147 122.586 31.121  1.00 35.52  ? 25   LEU B CB  1 
ATOM   5146  C  CG  . LEU B 1 25  ? 29.045 123.903 30.349  1.00 34.45  ? 25   LEU B CG  1 
ATOM   5147  C  CD1 . LEU B 1 25  ? 27.611 124.343 30.245  1.00 33.70  ? 25   LEU B CD1 1 
ATOM   5148  C  CD2 . LEU B 1 25  ? 29.880 124.982 30.997  1.00 32.98  ? 25   LEU B CD2 1 
ATOM   5149  N  N   . ASN B 1 26  ? 30.507 119.813 31.927  1.00 35.85  ? 26   ASN B N   1 
ATOM   5150  C  CA  . ASN B 1 26  ? 30.668 118.673 32.823  1.00 35.80  ? 26   ASN B CA  1 
ATOM   5151  C  C   . ASN B 1 26  ? 32.041 118.655 33.483  1.00 35.45  ? 26   ASN B C   1 
ATOM   5152  O  O   . ASN B 1 26  ? 32.198 119.062 34.620  1.00 35.50  ? 26   ASN B O   1 
ATOM   5153  C  CB  . ASN B 1 26  ? 30.459 117.373 32.055  1.00 36.05  ? 26   ASN B CB  1 
ATOM   5154  C  CG  . ASN B 1 26  ? 30.384 116.171 32.964  1.00 36.73  ? 26   ASN B CG  1 
ATOM   5155  O  OD1 . ASN B 1 26  ? 29.462 116.061 33.801  1.00 37.55  ? 26   ASN B OD1 1 
ATOM   5156  N  ND2 . ASN B 1 26  ? 31.350 115.253 32.816  1.00 35.47  ? 26   ASN B ND2 1 
ATOM   5157  N  N   . THR B 1 27  ? 33.030 118.161 32.761  1.00 35.30  ? 27   THR B N   1 
ATOM   5158  C  CA  . THR B 1 27  ? 34.401 118.142 33.244  1.00 35.55  ? 27   THR B CA  1 
ATOM   5159  C  C   . THR B 1 27  ? 34.789 119.319 34.145  1.00 35.69  ? 27   THR B C   1 
ATOM   5160  O  O   . THR B 1 27  ? 35.192 119.133 35.283  1.00 35.71  ? 27   THR B O   1 
ATOM   5161  C  CB  . THR B 1 27  ? 35.338 118.126 32.042  1.00 35.56  ? 27   THR B CB  1 
ATOM   5162  O  OG1 . THR B 1 27  ? 35.230 116.861 31.380  1.00 35.82  ? 27   THR B OG1 1 
ATOM   5163  C  CG2 . THR B 1 27  ? 36.788 118.191 32.494  1.00 35.56  ? 27   THR B CG2 1 
ATOM   5164  N  N   . PHE B 1 28  ? 34.651 120.533 33.627  1.00 36.17  ? 28   PHE B N   1 
ATOM   5165  C  CA  . PHE B 1 28  ? 35.104 121.742 34.315  1.00 36.26  ? 28   PHE B CA  1 
ATOM   5166  C  C   . PHE B 1 28  ? 34.111 122.353 35.303  1.00 36.50  ? 28   PHE B C   1 
ATOM   5167  O  O   . PHE B 1 28  ? 34.511 123.087 36.199  1.00 36.53  ? 28   PHE B O   1 
ATOM   5168  C  CB  . PHE B 1 28  ? 35.585 122.768 33.281  1.00 36.21  ? 28   PHE B CB  1 
ATOM   5169  C  CG  . PHE B 1 28  ? 36.534 122.189 32.262  1.00 35.63  ? 28   PHE B CG  1 
ATOM   5170  C  CD1 . PHE B 1 28  ? 37.846 121.914 32.598  1.00 35.83  ? 28   PHE B CD1 1 
ATOM   5171  C  CD2 . PHE B 1 28  ? 36.109 121.893 30.983  1.00 35.24  ? 28   PHE B CD2 1 
ATOM   5172  C  CE1 . PHE B 1 28  ? 38.727 121.363 31.670  1.00 35.86  ? 28   PHE B CE1 1 
ATOM   5173  C  CE2 . PHE B 1 28  ? 36.990 121.346 30.053  1.00 36.07  ? 28   PHE B CE2 1 
ATOM   5174  C  CZ  . PHE B 1 28  ? 38.296 121.082 30.400  1.00 35.05  ? 28   PHE B CZ  1 
ATOM   5175  N  N   . TYR B 1 29  ? 32.827 122.054 35.122  1.00 37.00  ? 29   TYR B N   1 
ATOM   5176  C  CA  . TYR B 1 29  ? 31.753 122.461 36.035  1.00 37.54  ? 29   TYR B CA  1 
ATOM   5177  C  C   . TYR B 1 29  ? 30.794 121.257 36.057  1.00 38.65  ? 29   TYR B C   1 
ATOM   5178  O  O   . TYR B 1 29  ? 30.202 120.915 35.039  1.00 38.88  ? 29   TYR B O   1 
ATOM   5179  C  CB  . TYR B 1 29  ? 31.033 123.712 35.505  1.00 37.32  ? 29   TYR B CB  1 
ATOM   5180  C  CG  . TYR B 1 29  ? 31.961 124.780 34.971  1.00 36.16  ? 29   TYR B CG  1 
ATOM   5181  C  CD1 . TYR B 1 29  ? 32.702 124.575 33.810  1.00 35.27  ? 29   TYR B CD1 1 
ATOM   5182  C  CD2 . TYR B 1 29  ? 32.107 125.985 35.633  1.00 34.90  ? 29   TYR B CD2 1 
ATOM   5183  C  CE1 . TYR B 1 29  ? 33.566 125.541 33.338  1.00 34.67  ? 29   TYR B CE1 1 
ATOM   5184  C  CE2 . TYR B 1 29  ? 32.965 126.953 35.167  1.00 34.63  ? 29   TYR B CE2 1 
ATOM   5185  C  CZ  . TYR B 1 29  ? 33.692 126.727 34.024  1.00 34.65  ? 29   TYR B CZ  1 
ATOM   5186  O  OH  . TYR B 1 29  ? 34.546 127.700 33.576  1.00 34.83  ? 29   TYR B OH  1 
ATOM   5187  N  N   . GLY B 1 30  ? 30.632 120.591 37.186  1.00 39.95  ? 30   GLY B N   1 
ATOM   5188  C  CA  . GLY B 1 30  ? 29.810 119.385 37.199  1.00 41.98  ? 30   GLY B CA  1 
ATOM   5189  C  C   . GLY B 1 30  ? 28.466 119.494 36.492  1.00 43.42  ? 30   GLY B C   1 
ATOM   5190  O  O   . GLY B 1 30  ? 27.713 120.433 36.766  1.00 43.63  ? 30   GLY B O   1 
ATOM   5191  N  N   . CYS B 1 31  ? 28.128 118.528 35.628  1.00 44.73  ? 31   CYS B N   1 
ATOM   5192  C  CA  . CYS B 1 31  ? 26.881 118.637 34.866  1.00 46.16  ? 31   CYS B CA  1 
ATOM   5193  C  C   . CYS B 1 31  ? 26.547 117.435 33.949  1.00 47.20  ? 31   CYS B C   1 
ATOM   5194  O  O   . CYS B 1 31  ? 26.387 117.641 32.750  1.00 47.67  ? 31   CYS B O   1 
ATOM   5195  C  CB  . CYS B 1 31  ? 27.066 119.857 33.970  1.00 46.05  ? 31   CYS B CB  1 
ATOM   5196  S  SG  . CYS B 1 31  ? 25.713 121.024 33.881  1.00 46.18  ? 31   CYS B SG  1 
ATOM   5197  N  N   . PRO B 1 32  ? 26.374 116.215 34.476  1.00 47.95  ? 32   PRO B N   1 
ATOM   5198  C  CA  . PRO B 1 32  ? 26.328 115.005 33.619  1.00 48.01  ? 32   PRO B CA  1 
ATOM   5199  C  C   . PRO B 1 32  ? 25.070 114.722 32.760  1.00 47.82  ? 32   PRO B C   1 
ATOM   5200  O  O   . PRO B 1 32  ? 24.665 115.562 31.958  1.00 47.88  ? 32   PRO B O   1 
ATOM   5201  C  CB  . PRO B 1 32  ? 26.600 113.854 34.615  1.00 48.32  ? 32   PRO B CB  1 
ATOM   5202  C  CG  . PRO B 1 32  ? 26.966 114.537 35.937  1.00 48.41  ? 32   PRO B CG  1 
ATOM   5203  C  CD  . PRO B 1 32  ? 26.203 115.870 35.899  1.00 48.24  ? 32   PRO B CD  1 
ATOM   5204  N  N   . LYS B 1 33  ? 24.486 113.531 32.920  1.00 47.49  ? 33   LYS B N   1 
ATOM   5205  C  CA  . LYS B 1 33  ? 23.358 113.060 32.094  1.00 46.81  ? 33   LYS B CA  1 
ATOM   5206  C  C   . LYS B 1 33  ? 22.139 113.982 32.030  1.00 46.55  ? 33   LYS B C   1 
ATOM   5207  O  O   . LYS B 1 33  ? 21.259 113.800 31.200  1.00 46.49  ? 33   LYS B O   1 
ATOM   5208  C  CB  . LYS B 1 33  ? 22.934 111.644 32.510  1.00 46.75  ? 33   LYS B CB  1 
ATOM   5209  C  CG  . LYS B 1 33  ? 21.926 110.969 31.578  1.00 46.20  ? 33   LYS B CG  1 
ATOM   5210  C  CD  . LYS B 1 33  ? 22.590 110.343 30.353  1.00 45.23  ? 33   LYS B CD  1 
ATOM   5211  C  CE  . LYS B 1 33  ? 23.262 111.388 29.467  1.00 44.70  ? 33   LYS B CE  1 
ATOM   5212  N  NZ  . LYS B 1 33  ? 24.739 111.200 29.416  1.00 43.72  ? 33   LYS B NZ  1 
ATOM   5213  N  N   . GLU B 1 34  ? 22.064 114.959 32.915  1.00 46.47  ? 34   GLU B N   1 
ATOM   5214  C  CA  . GLU B 1 34  ? 20.975 115.911 32.824  1.00 46.38  ? 34   GLU B CA  1 
ATOM   5215  C  C   . GLU B 1 34  ? 21.437 117.083 31.985  1.00 46.41  ? 34   GLU B C   1 
ATOM   5216  O  O   . GLU B 1 34  ? 20.964 118.201 32.141  1.00 46.03  ? 34   GLU B O   1 
ATOM   5217  C  CB  . GLU B 1 34  ? 20.503 116.387 34.186  1.00 46.14  ? 34   GLU B CB  1 
ATOM   5218  C  CG  . GLU B 1 34  ? 19.168 117.096 34.086  1.00 47.30  ? 34   GLU B CG  1 
ATOM   5219  C  CD  . GLU B 1 34  ? 18.311 116.584 32.919  1.00 48.45  ? 34   GLU B CD  1 
ATOM   5220  O  OE1 . GLU B 1 34  ? 18.860 115.851 32.057  1.00 48.77  ? 34   GLU B OE1 1 
ATOM   5221  O  OE2 . GLU B 1 34  ? 17.088 116.908 32.861  1.00 47.21  ? 34   GLU B OE2 1 
ATOM   5222  N  N   . SER B 1 35  ? 22.377 116.806 31.090  1.00 46.91  ? 35   SER B N   1 
ATOM   5223  C  CA  . SER B 1 35  ? 22.910 117.822 30.201  1.00 47.26  ? 35   SER B CA  1 
ATOM   5224  C  C   . SER B 1 35  ? 23.520 118.885 31.063  1.00 47.54  ? 35   SER B C   1 
ATOM   5225  O  O   . SER B 1 35  ? 24.735 119.105 31.055  1.00 47.71  ? 35   SER B O   1 
ATOM   5226  C  CB  . SER B 1 35  ? 21.801 118.450 29.355  1.00 47.19  ? 35   SER B CB  1 
ATOM   5227  O  OG  . SER B 1 35  ? 22.310 119.462 28.502  1.00 46.68  ? 35   SER B OG  1 
ATOM   5228  N  N   . CYS B 1 36  ? 22.670 119.542 31.829  1.00 47.66  ? 36   CYS B N   1 
ATOM   5229  C  CA  . CYS B 1 36  ? 23.185 120.577 32.683  1.00 48.29  ? 36   CYS B CA  1 
ATOM   5230  C  C   . CYS B 1 36  ? 22.227 121.123 33.727  1.00 48.83  ? 36   CYS B C   1 
ATOM   5231  O  O   . CYS B 1 36  ? 20.997 121.020 33.604  1.00 49.41  ? 36   CYS B O   1 
ATOM   5232  C  CB  . CYS B 1 36  ? 23.777 121.690 31.826  1.00 48.18  ? 36   CYS B CB  1 
ATOM   5233  S  SG  . CYS B 1 36  ? 25.552 121.542 31.921  1.00 47.67  ? 36   CYS B SG  1 
ATOM   5234  N  N   . ASN B 1 37  ? 22.793 121.673 34.789  1.00 48.90  ? 37   ASN B N   1 
ATOM   5235  C  CA  . ASN B 1 37  ? 21.948 122.307 35.775  1.00 48.97  ? 37   ASN B CA  1 
ATOM   5236  C  C   . ASN B 1 37  ? 21.529 123.614 35.104  1.00 48.82  ? 37   ASN B C   1 
ATOM   5237  O  O   . ASN B 1 37  ? 20.408 124.102 35.270  1.00 48.21  ? 37   ASN B O   1 
ATOM   5238  C  CB  . ASN B 1 37  ? 22.729 122.537 37.077  1.00 49.17  ? 37   ASN B CB  1 
ATOM   5239  C  CG  . ASN B 1 37  ? 23.038 121.241 37.811  1.00 49.66  ? 37   ASN B CG  1 
ATOM   5240  O  OD1 . ASN B 1 37  ? 22.199 120.724 38.553  1.00 49.67  ? 37   ASN B OD1 1 
ATOM   5241  N  ND2 . ASN B 1 37  ? 24.244 120.704 37.597  1.00 50.58  ? 37   ASN B ND2 1 
ATOM   5242  N  N   . LEU B 1 38  ? 22.455 124.118 34.286  1.00 48.90  ? 38   LEU B N   1 
ATOM   5243  C  CA  . LEU B 1 38  ? 22.350 125.393 33.579  1.00 48.86  ? 38   LEU B CA  1 
ATOM   5244  C  C   . LEU B 1 38  ? 20.978 125.801 33.040  1.00 49.17  ? 38   LEU B C   1 
ATOM   5245  O  O   . LEU B 1 38  ? 20.454 126.864 33.400  1.00 49.45  ? 38   LEU B O   1 
ATOM   5246  C  CB  . LEU B 1 38  ? 23.374 125.436 32.450  1.00 48.51  ? 38   LEU B CB  1 
ATOM   5247  C  CG  . LEU B 1 38  ? 22.888 125.931 31.093  1.00 47.64  ? 38   LEU B CG  1 
ATOM   5248  C  CD1 . LEU B 1 38  ? 22.633 127.441 31.125  1.00 46.98  ? 38   LEU B CD1 1 
ATOM   5249  C  CD2 . LEU B 1 38  ? 23.899 125.558 30.025  1.00 47.33  ? 38   LEU B CD2 1 
ATOM   5250  N  N   . PHE B 1 39  ? 20.402 124.984 32.162  1.00 49.12  ? 39   PHE B N   1 
ATOM   5251  C  CA  . PHE B 1 39  ? 19.122 125.363 31.558  1.00 48.64  ? 39   PHE B CA  1 
ATOM   5252  C  C   . PHE B 1 39  ? 17.963 125.182 32.516  1.00 48.57  ? 39   PHE B C   1 
ATOM   5253  O  O   . PHE B 1 39  ? 17.783 124.123 33.102  1.00 48.67  ? 39   PHE B O   1 
ATOM   5254  C  CB  . PHE B 1 39  ? 18.875 124.651 30.217  1.00 48.38  ? 39   PHE B CB  1 
ATOM   5255  C  CG  . PHE B 1 39  ? 18.528 123.193 30.342  1.00 47.49  ? 39   PHE B CG  1 
ATOM   5256  C  CD1 . PHE B 1 39  ? 17.285 122.804 30.812  1.00 47.14  ? 39   PHE B CD1 1 
ATOM   5257  C  CD2 . PHE B 1 39  ? 19.439 122.211 29.963  1.00 46.12  ? 39   PHE B CD2 1 
ATOM   5258  C  CE1 . PHE B 1 39  ? 16.963 121.461 30.923  1.00 47.27  ? 39   PHE B CE1 1 
ATOM   5259  C  CE2 . PHE B 1 39  ? 19.125 120.869 30.060  1.00 45.42  ? 39   PHE B CE2 1 
ATOM   5260  C  CZ  . PHE B 1 39  ? 17.892 120.489 30.544  1.00 46.44  ? 39   PHE B CZ  1 
ATOM   5261  N  N   . VAL B 1 40  ? 17.200 126.251 32.682  1.00 48.75  ? 40   VAL B N   1 
ATOM   5262  C  CA  . VAL B 1 40  ? 16.024 126.278 33.554  1.00 48.79  ? 40   VAL B CA  1 
ATOM   5263  C  C   . VAL B 1 40  ? 16.405 126.462 35.016  1.00 48.98  ? 40   VAL B C   1 
ATOM   5264  O  O   . VAL B 1 40  ? 15.538 126.645 35.871  1.00 48.95  ? 40   VAL B O   1 
ATOM   5265  C  CB  . VAL B 1 40  ? 15.124 125.033 33.389  1.00 48.84  ? 40   VAL B CB  1 
ATOM   5266  C  CG1 . VAL B 1 40  ? 15.481 123.951 34.432  1.00 48.45  ? 40   VAL B CG1 1 
ATOM   5267  C  CG2 . VAL B 1 40  ? 13.644 125.436 33.466  1.00 48.06  ? 40   VAL B CG2 1 
ATOM   5268  N  N   . LEU B 1 41  ? 17.701 126.415 35.308  1.00 49.23  ? 41   LEU B N   1 
ATOM   5269  C  CA  . LEU B 1 41  ? 18.143 126.654 36.682  1.00 49.40  ? 41   LEU B CA  1 
ATOM   5270  C  C   . LEU B 1 41  ? 18.884 127.983 36.794  1.00 49.31  ? 41   LEU B C   1 
ATOM   5271  O  O   . LEU B 1 41  ? 18.739 128.707 37.789  1.00 49.58  ? 41   LEU B O   1 
ATOM   5272  C  CB  . LEU B 1 41  ? 19.003 125.506 37.218  1.00 49.25  ? 41   LEU B CB  1 
ATOM   5273  C  CG  . LEU B 1 41  ? 18.332 124.163 37.534  1.00 49.22  ? 41   LEU B CG  1 
ATOM   5274  C  CD1 . LEU B 1 41  ? 19.207 123.318 38.454  1.00 49.45  ? 41   LEU B CD1 1 
ATOM   5275  C  CD2 . LEU B 1 41  ? 16.978 124.368 38.160  1.00 48.76  ? 41   LEU B CD2 1 
ATOM   5276  N  N   . LYS B 1 42  ? 19.628 128.316 35.745  1.00 48.86  ? 42   LYS B N   1 
ATOM   5277  C  CA  . LYS B 1 42  ? 20.443 129.517 35.715  1.00 48.45  ? 42   LYS B CA  1 
ATOM   5278  C  C   . LYS B 1 42  ? 21.709 129.076 36.379  1.00 48.19  ? 42   LYS B C   1 
ATOM   5279  O  O   . LYS B 1 42  ? 22.345 129.832 37.111  1.00 48.57  ? 42   LYS B O   1 
ATOM   5280  C  CB  . LYS B 1 42  ? 19.809 130.674 36.494  1.00 48.46  ? 42   LYS B CB  1 
ATOM   5281  C  CG  . LYS B 1 42  ? 18.633 131.357 35.789  1.00 48.42  ? 42   LYS B CG  1 
ATOM   5282  C  CD  . LYS B 1 42  ? 18.036 132.481 36.646  1.00 48.03  ? 42   LYS B CD  1 
ATOM   5283  C  CE  . LYS B 1 42  ? 16.828 133.127 35.970  1.00 47.74  ? 42   LYS B CE  1 
ATOM   5284  N  NZ  . LYS B 1 42  ? 16.287 134.288 36.737  1.00 48.01  ? 42   LYS B NZ  1 
ATOM   5285  N  N   . ASP B 1 43  ? 22.063 127.824 36.126  1.00 47.65  ? 43   ASP B N   1 
ATOM   5286  C  CA  . ASP B 1 43  ? 23.257 127.244 36.725  1.00 47.12  ? 43   ASP B CA  1 
ATOM   5287  C  C   . ASP B 1 43  ? 24.544 127.533 35.954  1.00 46.00  ? 43   ASP B C   1 
ATOM   5288  O  O   . ASP B 1 43  ? 25.201 128.541 36.202  1.00 46.05  ? 43   ASP B O   1 
ATOM   5289  C  CB  . ASP B 1 43  ? 23.084 125.740 36.928  1.00 47.54  ? 43   ASP B CB  1 
ATOM   5290  C  CG  . ASP B 1 43  ? 21.752 125.392 37.573  1.00 48.57  ? 43   ASP B CG  1 
ATOM   5291  O  OD1 . ASP B 1 43  ? 21.089 126.302 38.119  1.00 48.76  ? 43   ASP B OD1 1 
ATOM   5292  O  OD2 . ASP B 1 43  ? 21.282 124.235 37.571  1.00 49.99  ? 43   ASP B OD2 1 
ATOM   5293  N  N   . THR B 1 44  ? 24.907 126.657 35.025  1.00 44.45  ? 44   THR B N   1 
ATOM   5294  C  CA  . THR B 1 44  ? 26.190 126.794 34.345  1.00 42.98  ? 44   THR B CA  1 
ATOM   5295  C  C   . THR B 1 44  ? 26.093 127.674 33.131  1.00 41.98  ? 44   THR B C   1 
ATOM   5296  O  O   . THR B 1 44  ? 25.009 128.155 32.798  1.00 42.58  ? 44   THR B O   1 
ATOM   5297  C  CB  . THR B 1 44  ? 26.701 125.434 33.910  1.00 42.96  ? 44   THR B CB  1 
ATOM   5298  O  OG1 . THR B 1 44  ? 26.469 124.478 34.949  1.00 43.17  ? 44   THR B OG1 1 
ATOM   5299  C  CG2 . THR B 1 44  ? 28.203 125.470 33.792  1.00 43.20  ? 44   THR B CG2 1 
ATOM   5300  N  N   . LEU B 1 45  ? 27.223 127.880 32.467  1.00 40.24  ? 45   LEU B N   1 
ATOM   5301  C  CA  . LEU B 1 45  ? 27.230 128.612 31.208  1.00 38.80  ? 45   LEU B CA  1 
ATOM   5302  C  C   . LEU B 1 45  ? 26.840 130.038 31.536  1.00 38.09  ? 45   LEU B C   1 
ATOM   5303  O  O   . LEU B 1 45  ? 26.162 130.710 30.766  1.00 38.63  ? 45   LEU B O   1 
ATOM   5304  C  CB  . LEU B 1 45  ? 26.273 128.022 30.176  1.00 38.60  ? 45   LEU B CB  1 
ATOM   5305  C  CG  . LEU B 1 45  ? 26.455 128.450 28.719  1.00 38.53  ? 45   LEU B CG  1 
ATOM   5306  C  CD1 . LEU B 1 45  ? 27.636 127.761 28.060  1.00 38.19  ? 45   LEU B CD1 1 
ATOM   5307  C  CD2 . LEU B 1 45  ? 25.189 128.175 27.934  1.00 38.96  ? 45   LEU B CD2 1 
ATOM   5308  N  N   . LYS B 1 46  ? 27.228 130.464 32.729  1.00 36.76  ? 46   LYS B N   1 
ATOM   5309  C  CA  . LYS B 1 46  ? 27.062 131.824 33.209  1.00 35.14  ? 46   LYS B CA  1 
ATOM   5310  C  C   . LYS B 1 46  ? 28.195 131.830 34.187  1.00 34.53  ? 46   LYS B C   1 
ATOM   5311  O  O   . LYS B 1 46  ? 29.008 132.745 34.217  1.00 34.61  ? 46   LYS B O   1 
ATOM   5312  C  CB  . LYS B 1 46  ? 25.742 132.033 33.938  1.00 34.99  ? 46   LYS B CB  1 
ATOM   5313  C  CG  . LYS B 1 46  ? 24.639 132.696 33.121  1.00 33.83  ? 46   LYS B CG  1 
ATOM   5314  C  CD  . LYS B 1 46  ? 23.598 133.331 34.047  1.00 31.99  ? 46   LYS B CD  1 
ATOM   5315  C  CE  . LYS B 1 46  ? 22.242 133.436 33.381  1.00 31.23  ? 46   LYS B CE  1 
ATOM   5316  N  NZ  . LYS B 1 46  ? 21.139 133.357 34.369  1.00 31.67  ? 46   LYS B NZ  1 
ATOM   5317  N  N   . LYS B 1 47  ? 28.267 130.756 34.962  1.00 33.62  ? 47   LYS B N   1 
ATOM   5318  C  CA  . LYS B 1 47  ? 29.335 130.598 35.917  1.00 32.81  ? 47   LYS B CA  1 
ATOM   5319  C  C   . LYS B 1 47  ? 30.592 130.499 35.101  1.00 32.54  ? 47   LYS B C   1 
ATOM   5320  O  O   . LYS B 1 47  ? 31.576 131.180 35.381  1.00 32.57  ? 47   LYS B O   1 
ATOM   5321  C  CB  . LYS B 1 47  ? 29.116 129.366 36.794  1.00 32.50  ? 47   LYS B CB  1 
ATOM   5322  C  CG  . LYS B 1 47  ? 28.707 129.713 38.235  1.00 32.95  ? 47   LYS B CG  1 
ATOM   5323  C  CD  . LYS B 1 47  ? 27.911 128.591 38.919  1.00 34.33  ? 47   LYS B CD  1 
ATOM   5324  C  CE  . LYS B 1 47  ? 28.185 128.499 40.445  1.00 35.64  ? 47   LYS B CE  1 
ATOM   5325  N  NZ  . LYS B 1 47  ? 29.284 127.522 40.880  1.00 34.84  ? 47   LYS B NZ  1 
ATOM   5326  N  N   . MET B 1 48  ? 30.535 129.676 34.060  1.00 32.41  ? 48   MET B N   1 
ATOM   5327  C  CA  . MET B 1 48  ? 31.664 129.483 33.153  1.00 32.12  ? 48   MET B CA  1 
ATOM   5328  C  C   . MET B 1 48  ? 32.053 130.816 32.543  1.00 32.32  ? 48   MET B C   1 
ATOM   5329  O  O   . MET B 1 48  ? 33.214 131.225 32.615  1.00 32.46  ? 48   MET B O   1 
ATOM   5330  C  CB  . MET B 1 48  ? 31.304 128.474 32.052  1.00 31.99  ? 48   MET B CB  1 
ATOM   5331  C  CG  . MET B 1 48  ? 32.397 128.198 31.023  1.00 30.93  ? 48   MET B CG  1 
ATOM   5332  S  SD  . MET B 1 48  ? 32.383 129.324 29.602  1.00 29.83  ? 48   MET B SD  1 
ATOM   5333  C  CE  . MET B 1 48  ? 33.820 128.748 28.706  1.00 29.02  ? 48   MET B CE  1 
ATOM   5334  N  N   . GLN B 1 49  ? 31.071 131.497 31.958  1.00 32.30  ? 49   GLN B N   1 
ATOM   5335  C  CA  . GLN B 1 49  ? 31.304 132.787 31.330  1.00 32.26  ? 49   GLN B CA  1 
ATOM   5336  C  C   . GLN B 1 49  ? 31.958 133.740 32.311  1.00 32.54  ? 49   GLN B C   1 
ATOM   5337  O  O   . GLN B 1 49  ? 32.995 134.331 32.013  1.00 32.82  ? 49   GLN B O   1 
ATOM   5338  C  CB  . GLN B 1 49  ? 29.996 133.359 30.812  1.00 32.02  ? 49   GLN B CB  1 
ATOM   5339  C  CG  . GLN B 1 49  ? 29.092 132.289 30.269  1.00 31.87  ? 49   GLN B CG  1 
ATOM   5340  C  CD  . GLN B 1 49  ? 28.201 132.780 29.159  1.00 32.02  ? 49   GLN B CD  1 
ATOM   5341  O  OE1 . GLN B 1 49  ? 27.269 133.554 29.394  1.00 31.94  ? 49   GLN B OE1 1 
ATOM   5342  N  NE2 . GLN B 1 49  ? 28.475 132.323 27.938  1.00 32.46  ? 49   GLN B NE2 1 
ATOM   5343  N  N   . LYS B 1 50  ? 31.368 133.867 33.493  1.00 32.76  ? 50   LYS B N   1 
ATOM   5344  C  CA  . LYS B 1 50  ? 31.914 134.745 34.517  1.00 32.96  ? 50   LYS B CA  1 
ATOM   5345  C  C   . LYS B 1 50  ? 33.383 134.427 34.704  1.00 32.89  ? 50   LYS B C   1 
ATOM   5346  O  O   . LYS B 1 50  ? 34.228 135.317 34.737  1.00 33.05  ? 50   LYS B O   1 
ATOM   5347  C  CB  . LYS B 1 50  ? 31.179 134.547 35.840  1.00 33.07  ? 50   LYS B CB  1 
ATOM   5348  C  CG  . LYS B 1 50  ? 31.275 135.728 36.773  1.00 33.69  ? 50   LYS B CG  1 
ATOM   5349  C  CD  . LYS B 1 50  ? 30.382 135.568 37.995  1.00 34.47  ? 50   LYS B CD  1 
ATOM   5350  C  CE  . LYS B 1 50  ? 31.157 134.997 39.167  1.00 34.97  ? 50   LYS B CE  1 
ATOM   5351  N  NZ  . LYS B 1 50  ? 30.795 135.701 40.436  1.00 35.17  ? 50   LYS B NZ  1 
ATOM   5352  N  N   . PHE B 1 51  ? 33.683 133.141 34.804  1.00 32.73  ? 51   PHE B N   1 
ATOM   5353  C  CA  . PHE B 1 51  ? 35.036 132.718 35.070  1.00 32.69  ? 51   PHE B CA  1 
ATOM   5354  C  C   . PHE B 1 51  ? 36.006 133.342 34.087  1.00 32.96  ? 51   PHE B C   1 
ATOM   5355  O  O   . PHE B 1 51  ? 37.028 133.891 34.479  1.00 33.15  ? 51   PHE B O   1 
ATOM   5356  C  CB  . PHE B 1 51  ? 35.141 131.198 35.044  1.00 32.56  ? 51   PHE B CB  1 
ATOM   5357  C  CG  . PHE B 1 51  ? 36.469 130.681 35.494  1.00 32.12  ? 51   PHE B CG  1 
ATOM   5358  C  CD1 . PHE B 1 51  ? 37.605 130.903 34.741  1.00 32.40  ? 51   PHE B CD1 1 
ATOM   5359  C  CD2 . PHE B 1 51  ? 36.583 129.978 36.670  1.00 32.03  ? 51   PHE B CD2 1 
ATOM   5360  C  CE1 . PHE B 1 51  ? 38.835 130.428 35.151  1.00 32.69  ? 51   PHE B CE1 1 
ATOM   5361  C  CE2 . PHE B 1 51  ? 37.802 129.509 37.092  1.00 32.54  ? 51   PHE B CE2 1 
ATOM   5362  C  CZ  . PHE B 1 51  ? 38.936 129.735 36.330  1.00 32.85  ? 51   PHE B CZ  1 
ATOM   5363  N  N   . PHE B 1 52  ? 35.697 133.269 32.805  1.00 33.24  ? 52   PHE B N   1 
ATOM   5364  C  CA  . PHE B 1 52  ? 36.628 133.812 31.827  1.00 33.47  ? 52   PHE B CA  1 
ATOM   5365  C  C   . PHE B 1 52  ? 36.416 135.298 31.653  1.00 34.02  ? 52   PHE B C   1 
ATOM   5366  O  O   . PHE B 1 52  ? 37.282 136.007 31.155  1.00 34.37  ? 52   PHE B O   1 
ATOM   5367  C  CB  . PHE B 1 52  ? 36.522 133.063 30.507  1.00 33.02  ? 52   PHE B CB  1 
ATOM   5368  C  CG  . PHE B 1 52  ? 36.874 131.628 30.629  1.00 31.46  ? 52   PHE B CG  1 
ATOM   5369  C  CD1 . PHE B 1 52  ? 38.184 131.246 30.822  1.00 30.38  ? 52   PHE B CD1 1 
ATOM   5370  C  CD2 . PHE B 1 52  ? 35.899 130.663 30.598  1.00 30.96  ? 52   PHE B CD2 1 
ATOM   5371  C  CE1 . PHE B 1 52  ? 38.527 129.919 30.956  1.00 30.49  ? 52   PHE B CE1 1 
ATOM   5372  C  CE2 . PHE B 1 52  ? 36.231 129.324 30.732  1.00 31.48  ? 52   PHE B CE2 1 
ATOM   5373  C  CZ  . PHE B 1 52  ? 37.551 128.951 30.911  1.00 30.93  ? 52   PHE B CZ  1 
ATOM   5374  N  N   . GLY B 1 53  ? 35.271 135.774 32.104  1.00 34.45  ? 53   GLY B N   1 
ATOM   5375  C  CA  . GLY B 1 53  ? 34.975 137.182 31.995  1.00 35.27  ? 53   GLY B CA  1 
ATOM   5376  C  C   . GLY B 1 53  ? 34.470 137.436 30.599  1.00 35.76  ? 53   GLY B C   1 
ATOM   5377  O  O   . GLY B 1 53  ? 35.251 137.654 29.680  1.00 36.16  ? 53   GLY B O   1 
ATOM   5378  N  N   . LEU B 1 54  ? 33.155 137.386 30.446  1.00 36.05  ? 54   LEU B N   1 
ATOM   5379  C  CA  . LEU B 1 54  ? 32.524 137.558 29.162  1.00 36.30  ? 54   LEU B CA  1 
ATOM   5380  C  C   . LEU B 1 54  ? 31.111 137.983 29.416  1.00 36.67  ? 54   LEU B C   1 
ATOM   5381  O  O   . LEU B 1 54  ? 30.672 138.081 30.558  1.00 36.74  ? 54   LEU B O   1 
ATOM   5382  C  CB  . LEU B 1 54  ? 32.449 136.218 28.448  1.00 36.17  ? 54   LEU B CB  1 
ATOM   5383  C  CG  . LEU B 1 54  ? 33.693 135.531 27.900  1.00 36.59  ? 54   LEU B CG  1 
ATOM   5384  C  CD1 . LEU B 1 54  ? 33.399 134.074 27.649  1.00 35.23  ? 54   LEU B CD1 1 
ATOM   5385  C  CD2 . LEU B 1 54  ? 34.162 136.203 26.616  1.00 38.54  ? 54   LEU B CD2 1 
ATOM   5386  N  N   . PRO B 1 55  ? 30.379 138.195 28.339  1.00 37.03  ? 55   PRO B N   1 
ATOM   5387  C  CA  . PRO B 1 55  ? 28.948 138.466 28.456  1.00 37.10  ? 55   PRO B CA  1 
ATOM   5388  C  C   . PRO B 1 55  ? 28.281 137.247 29.068  1.00 37.17  ? 55   PRO B C   1 
ATOM   5389  O  O   . PRO B 1 55  ? 28.385 136.159 28.503  1.00 36.99  ? 55   PRO B O   1 
ATOM   5390  C  CB  . PRO B 1 55  ? 28.507 138.651 27.001  1.00 37.28  ? 55   PRO B CB  1 
ATOM   5391  C  CG  . PRO B 1 55  ? 29.789 138.774 26.207  1.00 37.54  ? 55   PRO B CG  1 
ATOM   5392  C  CD  . PRO B 1 55  ? 30.805 137.980 26.944  1.00 37.09  ? 55   PRO B CD  1 
ATOM   5393  N  N   . GLN B 1 56  ? 27.651 137.426 30.226  1.00 37.45  ? 56   GLN B N   1 
ATOM   5394  C  CA  . GLN B 1 56  ? 26.937 136.353 30.911  1.00 37.70  ? 56   GLN B CA  1 
ATOM   5395  C  C   . GLN B 1 56  ? 25.545 136.227 30.327  1.00 37.87  ? 56   GLN B C   1 
ATOM   5396  O  O   . GLN B 1 56  ? 24.553 136.410 31.018  1.00 37.90  ? 56   GLN B O   1 
ATOM   5397  C  CB  . GLN B 1 56  ? 26.836 136.640 32.406  1.00 37.63  ? 56   GLN B CB  1 
ATOM   5398  C  CG  . GLN B 1 56  ? 28.156 136.565 33.149  1.00 38.14  ? 56   GLN B CG  1 
ATOM   5399  C  CD  . GLN B 1 56  ? 27.996 136.740 34.645  1.00 38.88  ? 56   GLN B CD  1 
ATOM   5400  O  OE1 . GLN B 1 56  ? 27.107 136.142 35.250  1.00 40.04  ? 56   GLN B OE1 1 
ATOM   5401  N  NE2 . GLN B 1 56  ? 28.849 137.562 35.245  1.00 38.81  ? 56   GLN B NE2 1 
ATOM   5402  N  N   . THR B 1 57  ? 25.482 135.916 29.044  1.00 38.27  ? 57   THR B N   1 
ATOM   5403  C  CA  . THR B 1 57  ? 24.220 135.813 28.349  1.00 38.81  ? 57   THR B CA  1 
ATOM   5404  C  C   . THR B 1 57  ? 23.468 134.565 28.759  1.00 39.17  ? 57   THR B C   1 
ATOM   5405  O  O   . THR B 1 57  ? 22.240 134.546 28.739  1.00 39.20  ? 57   THR B O   1 
ATOM   5406  C  CB  . THR B 1 57  ? 24.478 135.739 26.863  1.00 38.93  ? 57   THR B CB  1 
ATOM   5407  O  OG1 . THR B 1 57  ? 24.856 134.400 26.533  1.00 39.21  ? 57   THR B OG1 1 
ATOM   5408  C  CG2 . THR B 1 57  ? 25.711 136.554 26.501  1.00 39.07  ? 57   THR B CG2 1 
ATOM   5409  N  N   . GLY B 1 58  ? 24.204 133.517 29.111  1.00 39.67  ? 58   GLY B N   1 
ATOM   5410  C  CA  . GLY B 1 58  ? 23.585 132.257 29.485  1.00 40.54  ? 58   GLY B CA  1 
ATOM   5411  C  C   . GLY B 1 58  ? 23.300 131.408 28.262  1.00 41.28  ? 58   GLY B C   1 
ATOM   5412  O  O   . GLY B 1 58  ? 22.752 130.311 28.348  1.00 41.03  ? 58   GLY B O   1 
ATOM   5413  N  N   . ASP B 1 59  ? 23.693 131.934 27.109  1.00 42.35  ? 59   ASP B N   1 
ATOM   5414  C  CA  . ASP B 1 59  ? 23.514 131.276 25.820  1.00 43.24  ? 59   ASP B CA  1 
ATOM   5415  C  C   . ASP B 1 59  ? 24.401 132.028 24.850  1.00 43.87  ? 59   ASP B C   1 
ATOM   5416  O  O   . ASP B 1 59  ? 24.007 132.257 23.705  1.00 44.43  ? 59   ASP B O   1 
ATOM   5417  C  CB  . ASP B 1 59  ? 22.078 131.472 25.336  1.00 43.07  ? 59   ASP B CB  1 
ATOM   5418  C  CG  . ASP B 1 59  ? 21.756 132.933 25.087  1.00 42.58  ? 59   ASP B CG  1 
ATOM   5419  O  OD1 . ASP B 1 59  ? 22.364 133.548 24.181  1.00 41.13  ? 59   ASP B OD1 1 
ATOM   5420  O  OD2 . ASP B 1 59  ? 20.922 133.556 25.768  1.00 43.85  ? 59   ASP B OD2 1 
ATOM   5421  N  N   . LEU B 1 60  ? 25.584 132.435 25.301  1.00 44.22  ? 60   LEU B N   1 
ATOM   5422  C  CA  . LEU B 1 60  ? 26.439 133.315 24.492  1.00 44.55  ? 60   LEU B CA  1 
ATOM   5423  C  C   . LEU B 1 60  ? 27.384 132.528 23.609  1.00 44.39  ? 60   LEU B C   1 
ATOM   5424  O  O   . LEU B 1 60  ? 28.474 132.986 23.262  1.00 44.05  ? 60   LEU B O   1 
ATOM   5425  C  CB  . LEU B 1 60  ? 27.221 134.263 25.409  1.00 44.75  ? 60   LEU B CB  1 
ATOM   5426  C  CG  . LEU B 1 60  ? 28.274 135.209 24.831  1.00 45.44  ? 60   LEU B CG  1 
ATOM   5427  C  CD1 . LEU B 1 60  ? 29.576 134.472 24.623  1.00 45.02  ? 60   LEU B CD1 1 
ATOM   5428  C  CD2 . LEU B 1 60  ? 27.790 135.870 23.538  1.00 46.65  ? 60   LEU B CD2 1 
ATOM   5429  N  N   . ASP B 1 61  ? 26.927 131.349 23.223  1.00 44.33  ? 61   ASP B N   1 
ATOM   5430  C  CA  . ASP B 1 61  ? 27.773 130.399 22.531  1.00 44.42  ? 61   ASP B CA  1 
ATOM   5431  C  C   . ASP B 1 61  ? 28.736 131.028 21.511  1.00 44.35  ? 61   ASP B C   1 
ATOM   5432  O  O   . ASP B 1 61  ? 29.965 130.881 21.621  1.00 44.29  ? 61   ASP B O   1 
ATOM   5433  C  CB  . ASP B 1 61  ? 26.914 129.262 21.983  1.00 44.27  ? 61   ASP B CB  1 
ATOM   5434  C  CG  . ASP B 1 61  ? 25.965 128.702 23.045  1.00 44.37  ? 61   ASP B CG  1 
ATOM   5435  O  OD1 . ASP B 1 61  ? 25.298 129.523 23.727  1.00 42.79  ? 61   ASP B OD1 1 
ATOM   5436  O  OD2 . ASP B 1 61  ? 25.841 127.472 23.286  1.00 44.49  ? 61   ASP B OD2 1 
ATOM   5437  N  N   . GLN B 1 62  ? 28.190 131.766 20.556  1.00 44.05  ? 62   GLN B N   1 
ATOM   5438  C  CA  . GLN B 1 62  ? 29.016 132.393 19.528  1.00 43.74  ? 62   GLN B CA  1 
ATOM   5439  C  C   . GLN B 1 62  ? 30.414 132.758 20.026  1.00 43.42  ? 62   GLN B C   1 
ATOM   5440  O  O   . GLN B 1 62  ? 31.417 132.262 19.537  1.00 43.15  ? 62   GLN B O   1 
ATOM   5441  C  CB  . GLN B 1 62  ? 28.308 133.642 19.006  1.00 43.88  ? 62   GLN B CB  1 
ATOM   5442  C  CG  . GLN B 1 62  ? 27.533 134.406 20.085  1.00 43.67  ? 62   GLN B CG  1 
ATOM   5443  C  CD  . GLN B 1 62  ? 26.556 135.409 19.496  1.00 42.89  ? 62   GLN B CD  1 
ATOM   5444  O  OE1 . GLN B 1 62  ? 26.449 136.542 19.970  1.00 42.14  ? 62   GLN B OE1 1 
ATOM   5445  N  NE2 . GLN B 1 62  ? 25.844 134.993 18.458  1.00 42.67  ? 62   GLN B NE2 1 
ATOM   5446  N  N   . ASN B 1 63  ? 30.464 133.638 21.012  1.00 43.42  ? 63   ASN B N   1 
ATOM   5447  C  CA  . ASN B 1 63  ? 31.728 134.102 21.563  1.00 42.99  ? 63   ASN B CA  1 
ATOM   5448  C  C   . ASN B 1 63  ? 32.252 133.144 22.625  1.00 42.28  ? 63   ASN B C   1 
ATOM   5449  O  O   . ASN B 1 63  ? 33.454 133.011 22.807  1.00 41.99  ? 63   ASN B O   1 
ATOM   5450  C  CB  . ASN B 1 63  ? 31.551 135.515 22.139  1.00 43.26  ? 63   ASN B CB  1 
ATOM   5451  C  CG  . ASN B 1 63  ? 32.856 136.123 22.593  1.00 43.84  ? 63   ASN B CG  1 
ATOM   5452  O  OD1 . ASN B 1 63  ? 32.963 136.642 23.703  1.00 45.18  ? 63   ASN B OD1 1 
ATOM   5453  N  ND2 . ASN B 1 63  ? 33.861 136.061 21.735  1.00 44.26  ? 63   ASN B ND2 1 
ATOM   5454  N  N   . THR B 1 64  ? 31.340 132.473 23.322  1.00 41.71  ? 64   THR B N   1 
ATOM   5455  C  CA  . THR B 1 64  ? 31.742 131.549 24.371  1.00 41.11  ? 64   THR B CA  1 
ATOM   5456  C  C   . THR B 1 64  ? 32.275 130.280 23.771  1.00 40.58  ? 64   THR B C   1 
ATOM   5457  O  O   . THR B 1 64  ? 33.300 129.768 24.210  1.00 40.78  ? 64   THR B O   1 
ATOM   5458  C  CB  . THR B 1 64  ? 30.582 131.195 25.327  1.00 41.14  ? 64   THR B CB  1 
ATOM   5459  O  OG1 . THR B 1 64  ? 31.100 130.409 26.408  1.00 41.77  ? 64   THR B OG1 1 
ATOM   5460  C  CG2 . THR B 1 64  ? 29.635 130.227 24.682  1.00 40.60  ? 64   THR B CG2 1 
ATOM   5461  N  N   . ILE B 1 65  ? 31.576 129.778 22.759  1.00 39.76  ? 65   ILE B N   1 
ATOM   5462  C  CA  . ILE B 1 65  ? 31.941 128.509 22.145  1.00 38.80  ? 65   ILE B CA  1 
ATOM   5463  C  C   . ILE B 1 65  ? 33.355 128.540 21.633  1.00 38.08  ? 65   ILE B C   1 
ATOM   5464  O  O   . ILE B 1 65  ? 34.034 127.544 21.647  1.00 38.18  ? 65   ILE B O   1 
ATOM   5465  C  CB  . ILE B 1 65  ? 30.947 128.126 21.040  1.00 38.76  ? 65   ILE B CB  1 
ATOM   5466  C  CG1 . ILE B 1 65  ? 30.918 126.617 20.872  1.00 38.55  ? 65   ILE B CG1 1 
ATOM   5467  C  CG2 . ILE B 1 65  ? 31.291 128.800 19.739  1.00 39.07  ? 65   ILE B CG2 1 
ATOM   5468  C  CD1 . ILE B 1 65  ? 29.538 126.077 20.886  1.00 38.46  ? 65   ILE B CD1 1 
ATOM   5469  N  N   . GLU B 1 66  ? 33.797 129.704 21.199  1.00 37.69  ? 66   GLU B N   1 
ATOM   5470  C  CA  . GLU B 1 66  ? 35.160 129.877 20.746  1.00 37.50  ? 66   GLU B CA  1 
ATOM   5471  C  C   . GLU B 1 66  ? 36.083 129.560 21.913  1.00 37.00  ? 66   GLU B C   1 
ATOM   5472  O  O   . GLU B 1 66  ? 36.940 128.687 21.809  1.00 37.08  ? 66   GLU B O   1 
ATOM   5473  C  CB  . GLU B 1 66  ? 35.360 131.317 20.276  1.00 37.86  ? 66   GLU B CB  1 
ATOM   5474  C  CG  . GLU B 1 66  ? 36.715 131.649 19.684  1.00 39.28  ? 66   GLU B CG  1 
ATOM   5475  C  CD  . GLU B 1 66  ? 36.952 133.151 19.629  1.00 42.19  ? 66   GLU B CD  1 
ATOM   5476  O  OE1 . GLU B 1 66  ? 36.057 133.888 19.129  1.00 42.56  ? 66   GLU B OE1 1 
ATOM   5477  O  OE2 . GLU B 1 66  ? 38.032 133.598 20.097  1.00 43.37  ? 66   GLU B OE2 1 
ATOM   5478  N  N   . THR B 1 67  ? 35.894 130.253 23.035  1.00 36.40  ? 67   THR B N   1 
ATOM   5479  C  CA  . THR B 1 67  ? 36.720 130.011 24.220  1.00 35.54  ? 67   THR B CA  1 
ATOM   5480  C  C   . THR B 1 67  ? 36.689 128.531 24.523  1.00 34.92  ? 67   THR B C   1 
ATOM   5481  O  O   . THR B 1 67  ? 37.700 127.939 24.894  1.00 35.05  ? 67   THR B O   1 
ATOM   5482  C  CB  . THR B 1 67  ? 36.193 130.777 25.454  1.00 35.51  ? 67   THR B CB  1 
ATOM   5483  O  OG1 . THR B 1 67  ? 35.666 132.049 25.059  1.00 35.61  ? 67   THR B OG1 1 
ATOM   5484  C  CG2 . THR B 1 67  ? 37.338 131.137 26.382  1.00 35.17  ? 67   THR B CG2 1 
ATOM   5485  N  N   . MET B 1 68  ? 35.514 127.938 24.349  1.00 34.05  ? 68   MET B N   1 
ATOM   5486  C  CA  . MET B 1 68  ? 35.332 126.533 24.652  1.00 33.25  ? 68   MET B CA  1 
ATOM   5487  C  C   . MET B 1 68  ? 36.219 125.634 23.804  1.00 33.13  ? 68   MET B C   1 
ATOM   5488  O  O   . MET B 1 68  ? 36.463 124.494 24.171  1.00 33.45  ? 68   MET B O   1 
ATOM   5489  C  CB  . MET B 1 68  ? 33.858 126.131 24.559  1.00 32.79  ? 68   MET B CB  1 
ATOM   5490  C  CG  . MET B 1 68  ? 33.036 126.598 25.750  1.00 32.04  ? 68   MET B CG  1 
ATOM   5491  S  SD  . MET B 1 68  ? 31.443 125.755 25.988  1.00 30.62  ? 68   MET B SD  1 
ATOM   5492  C  CE  . MET B 1 68  ? 30.376 126.786 25.064  1.00 31.40  ? 68   MET B CE  1 
ATOM   5493  N  N   . ARG B 1 69  ? 36.736 126.131 22.692  1.00 32.72  ? 69   ARG B N   1 
ATOM   5494  C  CA  . ARG B 1 69  ? 37.567 125.265 21.874  1.00 32.75  ? 69   ARG B CA  1 
ATOM   5495  C  C   . ARG B 1 69  ? 39.056 125.353 22.197  1.00 32.93  ? 69   ARG B C   1 
ATOM   5496  O  O   . ARG B 1 69  ? 39.784 124.384 22.004  1.00 33.27  ? 69   ARG B O   1 
ATOM   5497  C  CB  . ARG B 1 69  ? 37.302 125.467 20.383  1.00 32.70  ? 69   ARG B CB  1 
ATOM   5498  C  CG  . ARG B 1 69  ? 35.904 125.034 19.945  1.00 33.68  ? 69   ARG B CG  1 
ATOM   5499  C  CD  . ARG B 1 69  ? 35.807 124.531 18.501  1.00 35.39  ? 69   ARG B CD  1 
ATOM   5500  N  NE  . ARG B 1 69  ? 34.480 124.743 17.911  1.00 35.97  ? 69   ARG B NE  1 
ATOM   5501  C  CZ  . ARG B 1 69  ? 33.502 123.840 17.910  1.00 36.28  ? 69   ARG B CZ  1 
ATOM   5502  N  NH1 . ARG B 1 69  ? 33.681 122.652 18.477  1.00 36.21  ? 69   ARG B NH1 1 
ATOM   5503  N  NH2 . ARG B 1 69  ? 32.334 124.127 17.348  1.00 36.27  ? 69   ARG B NH2 1 
ATOM   5504  N  N   . LYS B 1 70  ? 39.512 126.490 22.715  1.00 32.93  ? 70   LYS B N   1 
ATOM   5505  C  CA  . LYS B 1 70  ? 40.934 126.653 23.019  1.00 32.82  ? 70   LYS B CA  1 
ATOM   5506  C  C   . LYS B 1 70  ? 41.462 125.511 23.893  1.00 32.67  ? 70   LYS B C   1 
ATOM   5507  O  O   . LYS B 1 70  ? 40.833 125.118 24.874  1.00 32.66  ? 70   LYS B O   1 
ATOM   5508  C  CB  . LYS B 1 70  ? 41.226 127.990 23.729  1.00 32.87  ? 70   LYS B CB  1 
ATOM   5509  C  CG  . LYS B 1 70  ? 40.124 129.060 23.698  1.00 34.21  ? 70   LYS B CG  1 
ATOM   5510  C  CD  . LYS B 1 70  ? 40.197 130.039 22.502  1.00 36.12  ? 70   LYS B CD  1 
ATOM   5511  C  CE  . LYS B 1 70  ? 41.581 130.706 22.327  1.00 36.88  ? 70   LYS B CE  1 
ATOM   5512  N  NZ  . LYS B 1 70  ? 42.429 130.051 21.262  1.00 36.27  ? 70   LYS B NZ  1 
ATOM   5513  N  N   . PRO B 1 71  ? 42.600 124.950 23.511  1.00 32.54  ? 71   PRO B N   1 
ATOM   5514  C  CA  . PRO B 1 71  ? 43.304 123.967 24.338  1.00 32.76  ? 71   PRO B CA  1 
ATOM   5515  C  C   . PRO B 1 71  ? 43.493 124.424 25.783  1.00 32.64  ? 71   PRO B C   1 
ATOM   5516  O  O   . PRO B 1 71  ? 44.017 125.512 25.962  1.00 32.89  ? 71   PRO B O   1 
ATOM   5517  C  CB  . PRO B 1 71  ? 44.670 123.897 23.654  1.00 32.79  ? 71   PRO B CB  1 
ATOM   5518  C  CG  . PRO B 1 71  ? 44.666 125.092 22.734  1.00 32.43  ? 71   PRO B CG  1 
ATOM   5519  C  CD  . PRO B 1 71  ? 43.277 125.133 22.222  1.00 32.39  ? 71   PRO B CD  1 
ATOM   5520  N  N   . ARG B 1 72  ? 43.109 123.612 26.771  1.00 32.65  ? 72   ARG B N   1 
ATOM   5521  C  CA  . ARG B 1 72  ? 43.226 123.975 28.193  1.00 32.67  ? 72   ARG B CA  1 
ATOM   5522  C  C   . ARG B 1 72  ? 43.685 122.823 29.103  1.00 32.82  ? 72   ARG B C   1 
ATOM   5523  O  O   . ARG B 1 72  ? 43.804 121.691 28.652  1.00 33.42  ? 72   ARG B O   1 
ATOM   5524  C  CB  . ARG B 1 72  ? 41.882 124.479 28.704  1.00 32.67  ? 72   ARG B CB  1 
ATOM   5525  C  CG  . ARG B 1 72  ? 40.811 123.398 28.789  1.00 31.69  ? 72   ARG B CG  1 
ATOM   5526  C  CD  . ARG B 1 72  ? 39.553 123.829 29.509  1.00 29.27  ? 72   ARG B CD  1 
ATOM   5527  N  NE  . ARG B 1 72  ? 39.752 123.827 30.952  1.00 28.86  ? 72   ARG B NE  1 
ATOM   5528  C  CZ  . ARG B 1 72  ? 39.240 124.720 31.789  1.00 28.74  ? 72   ARG B CZ  1 
ATOM   5529  N  NH1 . ARG B 1 72  ? 38.482 125.711 31.334  1.00 29.42  ? 72   ARG B NH1 1 
ATOM   5530  N  NH2 . ARG B 1 72  ? 39.484 124.622 33.087  1.00 28.07  ? 72   ARG B NH2 1 
ATOM   5531  N  N   . CYS B 1 73  ? 43.929 123.124 30.381  1.00 32.57  ? 73   CYS B N   1 
ATOM   5532  C  CA  . CYS B 1 73  ? 44.330 122.135 31.398  1.00 32.15  ? 73   CYS B CA  1 
ATOM   5533  C  C   . CYS B 1 73  ? 43.149 121.221 31.680  1.00 32.22  ? 73   CYS B C   1 
ATOM   5534  O  O   . CYS B 1 73  ? 41.993 121.619 31.494  1.00 32.40  ? 73   CYS B O   1 
ATOM   5535  C  CB  . CYS B 1 73  ? 44.760 122.861 32.683  1.00 32.17  ? 73   CYS B CB  1 
ATOM   5536  S  SG  . CYS B 1 73  ? 44.930 121.900 34.215  1.00 31.87  ? 73   CYS B SG  1 
ATOM   5537  N  N   . GLY B 1 74  ? 43.410 120.002 32.134  1.00 31.95  ? 74   GLY B N   1 
ATOM   5538  C  CA  . GLY B 1 74  ? 42.320 119.058 32.337  1.00 32.10  ? 74   GLY B CA  1 
ATOM   5539  C  C   . GLY B 1 74  ? 41.604 119.121 33.678  1.00 32.25  ? 74   GLY B C   1 
ATOM   5540  O  O   . GLY B 1 74  ? 40.661 118.361 33.912  1.00 32.19  ? 74   GLY B O   1 
ATOM   5541  N  N   . ASN B 1 75  ? 42.059 120.015 34.557  1.00 32.25  ? 75   ASN B N   1 
ATOM   5542  C  CA  . ASN B 1 75  ? 41.507 120.176 35.896  1.00 32.14  ? 75   ASN B CA  1 
ATOM   5543  C  C   . ASN B 1 75  ? 40.232 121.012 35.818  1.00 32.00  ? 75   ASN B C   1 
ATOM   5544  O  O   . ASN B 1 75  ? 40.054 121.753 34.868  1.00 32.20  ? 75   ASN B O   1 
ATOM   5545  C  CB  . ASN B 1 75  ? 42.538 120.876 36.794  1.00 32.54  ? 75   ASN B CB  1 
ATOM   5546  C  CG  . ASN B 1 75  ? 43.654 119.941 37.281  1.00 33.09  ? 75   ASN B CG  1 
ATOM   5547  O  OD1 . ASN B 1 75  ? 44.281 119.240 36.499  1.00 35.02  ? 75   ASN B OD1 1 
ATOM   5548  N  ND2 . ASN B 1 75  ? 43.909 119.952 38.582  1.00 33.27  ? 75   ASN B ND2 1 
ATOM   5549  N  N   . PRO B 1 76  ? 39.352 120.917 36.808  1.00 31.78  ? 76   PRO B N   1 
ATOM   5550  C  CA  . PRO B 1 76  ? 38.100 121.671 36.792  1.00 31.90  ? 76   PRO B CA  1 
ATOM   5551  C  C   . PRO B 1 76  ? 38.348 123.133 37.073  1.00 32.16  ? 76   PRO B C   1 
ATOM   5552  O  O   . PRO B 1 76  ? 39.451 123.487 37.453  1.00 32.30  ? 76   PRO B O   1 
ATOM   5553  C  CB  . PRO B 1 76  ? 37.318 121.066 37.959  1.00 31.79  ? 76   PRO B CB  1 
ATOM   5554  C  CG  . PRO B 1 76  ? 38.041 119.789 38.290  1.00 31.64  ? 76   PRO B CG  1 
ATOM   5555  C  CD  . PRO B 1 76  ? 39.471 120.095 38.019  1.00 31.90  ? 76   PRO B CD  1 
ATOM   5556  N  N   . ASP B 1 77  ? 37.340 123.971 36.876  1.00 32.50  ? 77   ASP B N   1 
ATOM   5557  C  CA  . ASP B 1 77  ? 37.463 125.380 37.185  1.00 32.90  ? 77   ASP B CA  1 
ATOM   5558  C  C   . ASP B 1 77  ? 36.683 125.592 38.447  1.00 33.32  ? 77   ASP B C   1 
ATOM   5559  O  O   . ASP B 1 77  ? 36.971 126.485 39.240  1.00 33.42  ? 77   ASP B O   1 
ATOM   5560  C  CB  . ASP B 1 77  ? 36.837 126.216 36.088  1.00 32.94  ? 77   ASP B CB  1 
ATOM   5561  C  CG  . ASP B 1 77  ? 37.698 126.295 34.869  1.00 33.66  ? 77   ASP B CG  1 
ATOM   5562  O  OD1 . ASP B 1 77  ? 38.898 125.918 34.962  1.00 33.31  ? 77   ASP B OD1 1 
ATOM   5563  O  OD2 . ASP B 1 77  ? 37.254 126.724 33.778  1.00 34.40  ? 77   ASP B OD2 1 
ATOM   5564  N  N   . VAL B 1 78  ? 35.667 124.755 38.605  1.00 33.86  ? 78   VAL B N   1 
ATOM   5565  C  CA  . VAL B 1 78  ? 34.787 124.788 39.756  1.00 34.14  ? 78   VAL B CA  1 
ATOM   5566  C  C   . VAL B 1 78  ? 35.510 124.338 41.019  1.00 34.73  ? 78   VAL B C   1 
ATOM   5567  O  O   . VAL B 1 78  ? 36.063 123.241 41.114  1.00 34.27  ? 78   VAL B O   1 
ATOM   5568  C  CB  . VAL B 1 78  ? 33.557 123.936 39.506  1.00 33.89  ? 78   VAL B CB  1 
ATOM   5569  C  CG1 . VAL B 1 78  ? 33.208 123.135 40.727  1.00 33.89  ? 78   VAL B CG1 1 
ATOM   5570  C  CG2 . VAL B 1 78  ? 32.424 124.807 39.081  1.00 34.13  ? 78   VAL B CG2 1 
ATOM   5571  N  N   . ALA B 1 79  ? 35.509 125.228 41.995  1.00 35.83  ? 79   ALA B N   1 
ATOM   5572  C  CA  . ALA B 1 79  ? 36.176 124.976 43.256  1.00 36.69  ? 79   ALA B CA  1 
ATOM   5573  C  C   . ALA B 1 79  ? 35.728 123.678 43.901  1.00 37.29  ? 79   ALA B C   1 
ATOM   5574  O  O   . ALA B 1 79  ? 34.559 123.292 43.838  1.00 37.50  ? 79   ALA B O   1 
ATOM   5575  C  CB  . ALA B 1 79  ? 35.933 126.135 44.205  1.00 36.49  ? 79   ALA B CB  1 
ATOM   5576  N  N   . ASN B 1 80  ? 36.675 122.999 44.524  1.00 38.05  ? 80   ASN B N   1 
ATOM   5577  C  CA  . ASN B 1 80  ? 36.340 121.818 45.304  1.00 38.48  ? 80   ASN B CA  1 
ATOM   5578  C  C   . ASN B 1 80  ? 35.420 120.826 44.567  1.00 38.45  ? 80   ASN B C   1 
ATOM   5579  O  O   . ASN B 1 80  ? 34.183 120.868 44.672  1.00 37.72  ? 80   ASN B O   1 
ATOM   5580  C  CB  . ASN B 1 80  ? 35.799 122.267 46.668  1.00 38.60  ? 80   ASN B CB  1 
ATOM   5581  C  CG  . ASN B 1 80  ? 34.668 121.428 47.152  1.00 39.43  ? 80   ASN B CG  1 
ATOM   5582  O  OD1 . ASN B 1 80  ? 33.776 121.916 47.855  1.00 39.85  ? 80   ASN B OD1 1 
ATOM   5583  N  ND2 . ASN B 1 80  ? 34.681 120.151 46.783  1.00 40.74  ? 80   ASN B ND2 1 
ATOM   5584  N  N   . TYR B 1 81  ? 36.072 119.921 43.830  1.00 38.72  ? 81   TYR B N   1 
ATOM   5585  C  CA  . TYR B 1 81  ? 35.394 118.918 43.030  1.00 38.58  ? 81   TYR B CA  1 
ATOM   5586  C  C   . TYR B 1 81  ? 36.334 117.833 42.556  1.00 38.81  ? 81   TYR B C   1 
ATOM   5587  O  O   . TYR B 1 81  ? 36.719 117.852 41.394  1.00 39.10  ? 81   TYR B O   1 
ATOM   5588  C  CB  . TYR B 1 81  ? 34.843 119.607 41.802  1.00 38.44  ? 81   TYR B CB  1 
ATOM   5589  C  CG  . TYR B 1 81  ? 34.157 118.737 40.789  1.00 38.39  ? 81   TYR B CG  1 
ATOM   5590  C  CD1 . TYR B 1 81  ? 32.955 118.124 41.074  1.00 39.22  ? 81   TYR B CD1 1 
ATOM   5591  C  CD2 . TYR B 1 81  ? 34.680 118.577 39.518  1.00 38.39  ? 81   TYR B CD2 1 
ATOM   5592  C  CE1 . TYR B 1 81  ? 32.309 117.352 40.126  1.00 38.36  ? 81   TYR B CE1 1 
ATOM   5593  C  CE2 . TYR B 1 81  ? 34.040 117.809 38.572  1.00 37.65  ? 81   TYR B CE2 1 
ATOM   5594  C  CZ  . TYR B 1 81  ? 32.859 117.204 38.879  1.00 37.19  ? 81   TYR B CZ  1 
ATOM   5595  O  OH  . TYR B 1 81  ? 32.227 116.449 37.930  1.00 36.69  ? 81   TYR B OH  1 
ATOM   5596  N  N   . ASN B 1 82  ? 36.752 116.916 43.430  1.00 38.93  ? 82   ASN B N   1 
ATOM   5597  C  CA  . ASN B 1 82  ? 37.497 115.744 42.950  1.00 39.02  ? 82   ASN B CA  1 
ATOM   5598  C  C   . ASN B 1 82  ? 37.005 114.489 43.606  1.00 38.37  ? 82   ASN B C   1 
ATOM   5599  O  O   . ASN B 1 82  ? 36.216 114.545 44.542  1.00 38.52  ? 82   ASN B O   1 
ATOM   5600  C  CB  . ASN B 1 82  ? 39.024 115.844 43.072  1.00 39.76  ? 82   ASN B CB  1 
ATOM   5601  C  CG  . ASN B 1 82  ? 39.751 114.838 42.135  1.00 41.89  ? 82   ASN B CG  1 
ATOM   5602  O  OD1 . ASN B 1 82  ? 39.797 113.626 42.415  1.00 43.93  ? 82   ASN B OD1 1 
ATOM   5603  N  ND2 . ASN B 1 82  ? 40.291 115.341 41.008  1.00 42.57  ? 82   ASN B ND2 1 
ATOM   5604  N  N   . PHE B 1 83  ? 37.466 113.356 43.097  1.00 37.59  ? 83   PHE B N   1 
ATOM   5605  C  CA  . PHE B 1 83  ? 37.046 112.071 43.615  1.00 36.92  ? 83   PHE B CA  1 
ATOM   5606  C  C   . PHE B 1 83  ? 38.062 111.547 44.609  1.00 36.52  ? 83   PHE B C   1 
ATOM   5607  O  O   . PHE B 1 83  ? 37.710 110.872 45.577  1.00 36.31  ? 83   PHE B O   1 
ATOM   5608  C  CB  . PHE B 1 83  ? 36.885 111.084 42.464  1.00 36.94  ? 83   PHE B CB  1 
ATOM   5609  C  CG  . PHE B 1 83  ? 36.790 109.656 42.897  1.00 36.42  ? 83   PHE B CG  1 
ATOM   5610  C  CD1 . PHE B 1 83  ? 37.940 108.920 43.132  1.00 36.43  ? 83   PHE B CD1 1 
ATOM   5611  C  CD2 . PHE B 1 83  ? 35.559 109.050 43.059  1.00 35.72  ? 83   PHE B CD2 1 
ATOM   5612  C  CE1 . PHE B 1 83  ? 37.870 107.614 43.534  1.00 36.90  ? 83   PHE B CE1 1 
ATOM   5613  C  CE2 . PHE B 1 83  ? 35.473 107.742 43.461  1.00 36.52  ? 83   PHE B CE2 1 
ATOM   5614  C  CZ  . PHE B 1 83  ? 36.630 107.017 43.702  1.00 37.56  ? 83   PHE B CZ  1 
ATOM   5615  N  N   . PHE B 1 84  ? 39.326 111.866 44.359  1.00 36.00  ? 84   PHE B N   1 
ATOM   5616  C  CA  . PHE B 1 84  ? 40.412 111.390 45.195  1.00 35.56  ? 84   PHE B CA  1 
ATOM   5617  C  C   . PHE B 1 84  ? 40.595 112.290 46.391  1.00 35.27  ? 84   PHE B C   1 
ATOM   5618  O  O   . PHE B 1 84  ? 40.353 113.493 46.307  1.00 35.30  ? 84   PHE B O   1 
ATOM   5619  C  CB  . PHE B 1 84  ? 41.709 111.348 44.404  1.00 35.69  ? 84   PHE B CB  1 
ATOM   5620  C  CG  . PHE B 1 84  ? 41.677 110.406 43.255  1.00 36.33  ? 84   PHE B CG  1 
ATOM   5621  C  CD1 . PHE B 1 84  ? 41.392 109.069 43.452  1.00 37.16  ? 84   PHE B CD1 1 
ATOM   5622  C  CD2 . PHE B 1 84  ? 41.926 110.856 41.969  1.00 37.28  ? 84   PHE B CD2 1 
ATOM   5623  C  CE1 . PHE B 1 84  ? 41.354 108.187 42.379  1.00 37.90  ? 84   PHE B CE1 1 
ATOM   5624  C  CE2 . PHE B 1 84  ? 41.891 109.984 40.895  1.00 38.14  ? 84   PHE B CE2 1 
ATOM   5625  C  CZ  . PHE B 1 84  ? 41.601 108.646 41.099  1.00 37.72  ? 84   PHE B CZ  1 
ATOM   5626  N  N   . PRO B 1 85  ? 41.055 111.700 47.493  1.00 34.88  ? 85   PRO B N   1 
ATOM   5627  C  CA  . PRO B 1 85  ? 41.275 112.422 48.741  1.00 34.38  ? 85   PRO B CA  1 
ATOM   5628  C  C   . PRO B 1 85  ? 42.367 113.414 48.496  1.00 34.17  ? 85   PRO B C   1 
ATOM   5629  O  O   . PRO B 1 85  ? 43.159 113.192 47.580  1.00 34.24  ? 85   PRO B O   1 
ATOM   5630  C  CB  . PRO B 1 85  ? 41.815 111.344 49.662  1.00 34.36  ? 85   PRO B CB  1 
ATOM   5631  C  CG  . PRO B 1 85  ? 41.357 110.077 49.072  1.00 34.53  ? 85   PRO B CG  1 
ATOM   5632  C  CD  . PRO B 1 85  ? 41.430 110.283 47.610  1.00 34.86  ? 85   PRO B CD  1 
ATOM   5633  N  N   . ARG B 1 86  ? 42.429 114.471 49.296  1.00 33.89  ? 86   ARG B N   1 
ATOM   5634  C  CA  . ARG B 1 86  ? 43.473 115.466 49.128  1.00 33.59  ? 86   ARG B CA  1 
ATOM   5635  C  C   . ARG B 1 86  ? 43.672 116.300 50.381  1.00 33.48  ? 86   ARG B C   1 
ATOM   5636  O  O   . ARG B 1 86  ? 42.828 116.293 51.279  1.00 33.61  ? 86   ARG B O   1 
ATOM   5637  C  CB  . ARG B 1 86  ? 43.148 116.366 47.937  1.00 33.61  ? 86   ARG B CB  1 
ATOM   5638  C  CG  . ARG B 1 86  ? 41.782 117.018 47.979  1.00 33.44  ? 86   ARG B CG  1 
ATOM   5639  C  CD  . ARG B 1 86  ? 41.395 117.733 46.684  1.00 34.38  ? 86   ARG B CD  1 
ATOM   5640  N  NE  . ARG B 1 86  ? 42.198 118.935 46.440  1.00 34.77  ? 86   ARG B NE  1 
ATOM   5641  C  CZ  . ARG B 1 86  ? 41.929 119.842 45.505  1.00 34.29  ? 86   ARG B CZ  1 
ATOM   5642  N  NH1 . ARG B 1 86  ? 40.874 119.691 44.714  1.00 34.38  ? 86   ARG B NH1 1 
ATOM   5643  N  NH2 . ARG B 1 86  ? 42.712 120.906 45.369  1.00 33.57  ? 86   ARG B NH2 1 
ATOM   5644  N  N   . LYS B 1 87  ? 44.802 116.998 50.448  1.00 33.14  ? 87   LYS B N   1 
ATOM   5645  C  CA  . LYS B 1 87  ? 45.067 117.917 51.548  1.00 33.09  ? 87   LYS B CA  1 
ATOM   5646  C  C   . LYS B 1 87  ? 45.384 119.298 50.996  1.00 32.61  ? 87   LYS B C   1 
ATOM   5647  O  O   . LYS B 1 87  ? 45.624 119.455 49.800  1.00 32.97  ? 87   LYS B O   1 
ATOM   5648  C  CB  . LYS B 1 87  ? 46.209 117.422 52.417  1.00 33.26  ? 87   LYS B CB  1 
ATOM   5649  C  CG  . LYS B 1 87  ? 45.738 116.608 53.595  1.00 35.15  ? 87   LYS B CG  1 
ATOM   5650  C  CD  . LYS B 1 87  ? 45.413 115.200 53.155  1.00 39.06  ? 87   LYS B CD  1 
ATOM   5651  C  CE  . LYS B 1 87  ? 44.089 114.691 53.721  1.00 40.17  ? 87   LYS B CE  1 
ATOM   5652  N  NZ  . LYS B 1 87  ? 43.640 113.495 52.936  1.00 41.47  ? 87   LYS B NZ  1 
ATOM   5653  N  N   . PRO B 1 88  ? 45.399 120.306 51.853  1.00 31.88  ? 88   PRO B N   1 
ATOM   5654  C  CA  . PRO B 1 88  ? 45.669 121.658 51.385  1.00 31.53  ? 88   PRO B CA  1 
ATOM   5655  C  C   . PRO B 1 88  ? 47.065 121.768 50.799  1.00 31.49  ? 88   PRO B C   1 
ATOM   5656  O  O   . PRO B 1 88  ? 47.235 122.524 49.854  1.00 31.75  ? 88   PRO B O   1 
ATOM   5657  C  CB  . PRO B 1 88  ? 45.552 122.496 52.655  1.00 31.08  ? 88   PRO B CB  1 
ATOM   5658  C  CG  . PRO B 1 88  ? 44.786 121.674 53.554  1.00 31.26  ? 88   PRO B CG  1 
ATOM   5659  C  CD  . PRO B 1 88  ? 45.188 120.262 53.303  1.00 31.66  ? 88   PRO B CD  1 
ATOM   5660  N  N   . LYS B 1 89  ? 48.024 121.012 51.331  1.00 31.43  ? 89   LYS B N   1 
ATOM   5661  C  CA  . LYS B 1 89  ? 49.416 121.127 50.927  1.00 31.32  ? 89   LYS B CA  1 
ATOM   5662  C  C   . LYS B 1 89  ? 50.266 119.998 51.503  1.00 31.71  ? 89   LYS B C   1 
ATOM   5663  O  O   . LYS B 1 89  ? 49.842 119.306 52.425  1.00 31.67  ? 89   LYS B O   1 
ATOM   5664  C  CB  . LYS B 1 89  ? 49.963 122.442 51.453  1.00 31.29  ? 89   LYS B CB  1 
ATOM   5665  C  CG  . LYS B 1 89  ? 50.092 122.463 52.977  1.00 31.07  ? 89   LYS B CG  1 
ATOM   5666  C  CD  . LYS B 1 89  ? 50.678 123.768 53.466  1.00 30.60  ? 89   LYS B CD  1 
ATOM   5667  C  CE  . LYS B 1 89  ? 51.821 123.515 54.423  1.00 31.78  ? 89   LYS B CE  1 
ATOM   5668  N  NZ  . LYS B 1 89  ? 52.966 122.821 53.768  1.00 31.86  ? 89   LYS B NZ  1 
ATOM   5669  N  N   . TRP B 1 90  ? 51.481 119.843 50.975  1.00 32.02  ? 90   TRP B N   1 
ATOM   5670  C  CA  . TRP B 1 90  ? 52.419 118.810 51.423  1.00 32.34  ? 90   TRP B CA  1 
ATOM   5671  C  C   . TRP B 1 90  ? 52.921 119.001 52.863  1.00 32.51  ? 90   TRP B C   1 
ATOM   5672  O  O   . TRP B 1 90  ? 53.422 120.061 53.222  1.00 32.56  ? 90   TRP B O   1 
ATOM   5673  C  CB  . TRP B 1 90  ? 53.621 118.741 50.481  1.00 32.37  ? 90   TRP B CB  1 
ATOM   5674  C  CG  . TRP B 1 90  ? 53.283 118.310 49.086  1.00 32.97  ? 90   TRP B CG  1 
ATOM   5675  C  CD1 . TRP B 1 90  ? 53.318 119.077 47.954  1.00 33.63  ? 90   TRP B CD1 1 
ATOM   5676  C  CD2 . TRP B 1 90  ? 52.883 117.007 48.667  1.00 32.65  ? 90   TRP B CD2 1 
ATOM   5677  N  NE1 . TRP B 1 90  ? 52.950 118.328 46.862  1.00 32.41  ? 90   TRP B NE1 1 
ATOM   5678  C  CE2 . TRP B 1 90  ? 52.672 117.055 47.279  1.00 32.36  ? 90   TRP B CE2 1 
ATOM   5679  C  CE3 . TRP B 1 90  ? 52.671 115.799 49.328  1.00 33.35  ? 90   TRP B CE3 1 
ATOM   5680  C  CZ2 . TRP B 1 90  ? 52.259 115.953 46.552  1.00 33.21  ? 90   TRP B CZ2 1 
ATOM   5681  C  CZ3 . TRP B 1 90  ? 52.256 114.710 48.603  1.00 33.70  ? 90   TRP B CZ3 1 
ATOM   5682  C  CH2 . TRP B 1 90  ? 52.055 114.791 47.231  1.00 33.49  ? 90   TRP B CH2 1 
ATOM   5683  N  N   . ASP B 1 91  ? 52.806 117.953 53.672  1.00 32.77  ? 91   ASP B N   1 
ATOM   5684  C  CA  . ASP B 1 91  ? 53.241 117.992 55.061  1.00 32.90  ? 91   ASP B CA  1 
ATOM   5685  C  C   . ASP B 1 91  ? 54.745 118.136 55.163  1.00 32.99  ? 91   ASP B C   1 
ATOM   5686  O  O   . ASP B 1 91  ? 55.290 118.226 56.260  1.00 33.03  ? 91   ASP B O   1 
ATOM   5687  C  CB  . ASP B 1 91  ? 52.827 116.714 55.789  1.00 32.97  ? 91   ASP B CB  1 
ATOM   5688  C  CG  . ASP B 1 91  ? 51.327 116.553 55.873  1.00 33.22  ? 91   ASP B CG  1 
ATOM   5689  O  OD1 . ASP B 1 91  ? 50.543 117.460 55.505  1.00 33.46  ? 91   ASP B OD1 1 
ATOM   5690  O  OD2 . ASP B 1 91  ? 50.861 115.477 56.334  1.00 32.28  ? 91   ASP B OD2 1 
ATOM   5691  N  N   . LYS B 1 92  ? 55.414 118.141 54.019  1.00 33.00  ? 92   LYS B N   1 
ATOM   5692  C  CA  . LYS B 1 92  ? 56.865 118.241 53.991  1.00 33.15  ? 92   LYS B CA  1 
ATOM   5693  C  C   . LYS B 1 92  ? 57.287 119.359 53.056  1.00 32.84  ? 92   LYS B C   1 
ATOM   5694  O  O   . LYS B 1 92  ? 56.454 119.954 52.390  1.00 32.89  ? 92   LYS B O   1 
ATOM   5695  C  CB  . LYS B 1 92  ? 57.483 116.901 53.561  1.00 33.38  ? 92   LYS B CB  1 
ATOM   5696  C  CG  . LYS B 1 92  ? 57.124 116.457 52.136  1.00 34.64  ? 92   LYS B CG  1 
ATOM   5697  C  CD  . LYS B 1 92  ? 56.889 114.935 52.004  1.00 35.94  ? 92   LYS B CD  1 
ATOM   5698  C  CE  . LYS B 1 92  ? 55.536 114.518 52.605  1.00 38.20  ? 92   LYS B CE  1 
ATOM   5699  N  NZ  . LYS B 1 92  ? 54.400 115.486 52.327  1.00 39.03  ? 92   LYS B NZ  1 
ATOM   5700  N  N   . ASN B 1 93  ? 58.577 119.660 53.032  1.00 32.70  ? 93   ASN B N   1 
ATOM   5701  C  CA  . ASN B 1 93  ? 59.107 120.681 52.139  1.00 32.69  ? 93   ASN B CA  1 
ATOM   5702  C  C   . ASN B 1 93  ? 60.035 120.024 51.141  1.00 32.61  ? 93   ASN B C   1 
ATOM   5703  O  O   . ASN B 1 93  ? 60.472 120.647 50.173  1.00 32.85  ? 93   ASN B O   1 
ATOM   5704  C  CB  . ASN B 1 93  ? 59.864 121.754 52.915  1.00 32.77  ? 93   ASN B CB  1 
ATOM   5705  C  CG  . ASN B 1 93  ? 59.012 122.971 53.209  1.00 33.41  ? 93   ASN B CG  1 
ATOM   5706  O  OD1 . ASN B 1 93  ? 57.889 123.087 52.714  1.00 34.07  ? 93   ASN B OD1 1 
ATOM   5707  N  ND2 . ASN B 1 93  ? 59.541 123.890 54.018  1.00 33.56  ? 93   ASN B ND2 1 
ATOM   5708  N  N   . GLN B 1 94  ? 60.329 118.755 51.395  1.00 32.07  ? 94   GLN B N   1 
ATOM   5709  C  CA  . GLN B 1 94  ? 61.217 117.991 50.557  1.00 31.79  ? 94   GLN B CA  1 
ATOM   5710  C  C   . GLN B 1 94  ? 60.405 116.981 49.806  1.00 31.48  ? 94   GLN B C   1 
ATOM   5711  O  O   . GLN B 1 94  ? 60.175 115.876 50.277  1.00 31.37  ? 94   GLN B O   1 
ATOM   5712  C  CB  . GLN B 1 94  ? 62.268 117.293 51.396  1.00 32.00  ? 94   GLN B CB  1 
ATOM   5713  C  CG  . GLN B 1 94  ? 63.655 117.836 51.188  1.00 34.00  ? 94   GLN B CG  1 
ATOM   5714  C  CD  . GLN B 1 94  ? 64.678 117.109 52.027  1.00 37.73  ? 94   GLN B CD  1 
ATOM   5715  O  OE1 . GLN B 1 94  ? 64.581 117.102 53.252  1.00 39.28  ? 94   GLN B OE1 1 
ATOM   5716  N  NE2 . GLN B 1 94  ? 65.661 116.491 51.376  1.00 40.02  ? 94   GLN B NE2 1 
ATOM   5717  N  N   . ILE B 1 95  ? 59.983 117.377 48.616  1.00 31.36  ? 95   ILE B N   1 
ATOM   5718  C  CA  . ILE B 1 95  ? 59.111 116.580 47.770  1.00 30.96  ? 95   ILE B CA  1 
ATOM   5719  C  C   . ILE B 1 95  ? 59.928 115.756 46.802  1.00 31.10  ? 95   ILE B C   1 
ATOM   5720  O  O   . ILE B 1 95  ? 61.050 116.138 46.458  1.00 31.25  ? 95   ILE B O   1 
ATOM   5721  C  CB  . ILE B 1 95  ? 58.217 117.527 46.964  1.00 30.64  ? 95   ILE B CB  1 
ATOM   5722  C  CG1 . ILE B 1 95  ? 57.689 118.647 47.854  1.00 30.00  ? 95   ILE B CG1 1 
ATOM   5723  C  CG2 . ILE B 1 95  ? 57.096 116.780 46.327  1.00 30.78  ? 95   ILE B CG2 1 
ATOM   5724  C  CD1 . ILE B 1 95  ? 56.744 118.178 48.894  1.00 29.49  ? 95   ILE B CD1 1 
ATOM   5725  N  N   . THR B 1 96  ? 59.365 114.630 46.363  1.00 31.02  ? 96   THR B N   1 
ATOM   5726  C  CA  . THR B 1 96  ? 60.026 113.759 45.396  1.00 30.79  ? 96   THR B CA  1 
ATOM   5727  C  C   . THR B 1 96  ? 59.083 113.378 44.259  1.00 31.15  ? 96   THR B C   1 
ATOM   5728  O  O   . THR B 1 96  ? 57.936 112.998 44.478  1.00 31.26  ? 96   THR B O   1 
ATOM   5729  C  CB  . THR B 1 96  ? 60.542 112.464 46.050  1.00 30.44  ? 96   THR B CB  1 
ATOM   5730  O  OG1 . THR B 1 96  ? 59.434 111.674 46.474  1.00 29.70  ? 96   THR B OG1 1 
ATOM   5731  C  CG2 . THR B 1 96  ? 61.282 112.743 47.335  1.00 30.78  ? 96   THR B CG2 1 
ATOM   5732  N  N   . TYR B 1 97  ? 59.594 113.454 43.039  1.00 31.26  ? 97   TYR B N   1 
ATOM   5733  C  CA  . TYR B 1 97  ? 58.826 113.109 41.869  1.00 31.15  ? 97   TYR B CA  1 
ATOM   5734  C  C   . TYR B 1 97  ? 59.628 112.138 41.045  1.00 31.26  ? 97   TYR B C   1 
ATOM   5735  O  O   . TYR B 1 97  ? 60.821 111.953 41.275  1.00 31.12  ? 97   TYR B O   1 
ATOM   5736  C  CB  . TYR B 1 97  ? 58.626 114.335 41.027  1.00 31.36  ? 97   TYR B CB  1 
ATOM   5737  C  CG  . TYR B 1 97  ? 59.907 114.787 40.362  1.00 31.83  ? 97   TYR B CG  1 
ATOM   5738  C  CD1 . TYR B 1 97  ? 60.916 115.405 41.090  1.00 31.80  ? 97   TYR B CD1 1 
ATOM   5739  C  CD2 . TYR B 1 97  ? 60.106 114.598 39.012  1.00 32.20  ? 97   TYR B CD2 1 
ATOM   5740  C  CE1 . TYR B 1 97  ? 62.071 115.830 40.486  1.00 31.23  ? 97   TYR B CE1 1 
ATOM   5741  C  CE2 . TYR B 1 97  ? 61.259 115.019 38.404  1.00 32.30  ? 97   TYR B CE2 1 
ATOM   5742  C  CZ  . TYR B 1 97  ? 62.236 115.636 39.143  1.00 31.38  ? 97   TYR B CZ  1 
ATOM   5743  O  OH  . TYR B 1 97  ? 63.376 116.054 38.508  1.00 31.28  ? 97   TYR B OH  1 
ATOM   5744  N  N   . ARG B 1 98  ? 58.972 111.548 40.053  1.00 31.30  ? 98   ARG B N   1 
ATOM   5745  C  CA  . ARG B 1 98  ? 59.602 110.555 39.211  1.00 31.32  ? 98   ARG B CA  1 
ATOM   5746  C  C   . ARG B 1 98  ? 58.930 110.488 37.856  1.00 31.56  ? 98   ARG B C   1 
ATOM   5747  O  O   . ARG B 1 98  ? 57.717 110.638 37.748  1.00 31.87  ? 98   ARG B O   1 
ATOM   5748  C  CB  . ARG B 1 98  ? 59.537 109.207 39.885  1.00 31.11  ? 98   ARG B CB  1 
ATOM   5749  C  CG  . ARG B 1 98  ? 60.001 108.080 39.033  1.00 31.49  ? 98   ARG B CG  1 
ATOM   5750  C  CD  . ARG B 1 98  ? 60.035 106.794 39.803  1.00 32.68  ? 98   ARG B CD  1 
ATOM   5751  N  NE  . ARG B 1 98  ? 59.950 105.620 38.957  1.00 33.25  ? 98   ARG B NE  1 
ATOM   5752  C  CZ  . ARG B 1 98  ? 59.911 104.400 39.442  1.00 33.16  ? 98   ARG B CZ  1 
ATOM   5753  N  NH1 . ARG B 1 98  ? 59.954 104.238 40.756  1.00 33.98  ? 98   ARG B NH1 1 
ATOM   5754  N  NH2 . ARG B 1 98  ? 59.834 103.350 38.633  1.00 32.62  ? 98   ARG B NH2 1 
ATOM   5755  N  N   . ILE B 1 99  ? 59.735 110.254 36.823  1.00 31.72  ? 99   ILE B N   1 
ATOM   5756  C  CA  . ILE B 1 99  ? 59.277 110.231 35.442  1.00 31.50  ? 99   ILE B CA  1 
ATOM   5757  C  C   . ILE B 1 99  ? 59.049 108.793 35.021  1.00 31.56  ? 99   ILE B C   1 
ATOM   5758  O  O   . ILE B 1 99  ? 59.975 108.049 34.804  1.00 31.94  ? 99   ILE B O   1 
ATOM   5759  C  CB  . ILE B 1 99  ? 60.341 110.903 34.567  1.00 31.31  ? 99   ILE B CB  1 
ATOM   5760  C  CG1 . ILE B 1 99  ? 60.764 112.227 35.195  1.00 31.10  ? 99   ILE B CG1 1 
ATOM   5761  C  CG2 . ILE B 1 99  ? 59.831 111.143 33.170  1.00 31.57  ? 99   ILE B CG2 1 
ATOM   5762  C  CD1 . ILE B 1 99  ? 61.851 112.934 34.425  1.00 31.95  ? 99   ILE B CD1 1 
ATOM   5763  N  N   . ILE B 1 100 ? 57.802 108.391 34.923  1.00 31.94  ? 100  ILE B N   1 
ATOM   5764  C  CA  . ILE B 1 100 ? 57.499 107.005 34.602  1.00 32.09  ? 100  ILE B CA  1 
ATOM   5765  C  C   . ILE B 1 100 ? 57.306 106.817 33.117  1.00 32.06  ? 100  ILE B C   1 
ATOM   5766  O  O   . ILE B 1 100 ? 57.357 105.697 32.617  1.00 31.88  ? 100  ILE B O   1 
ATOM   5767  C  CB  . ILE B 1 100 ? 56.221 106.580 35.342  1.00 32.17  ? 100  ILE B CB  1 
ATOM   5768  C  CG1 . ILE B 1 100 ? 56.510 106.444 36.830  1.00 32.46  ? 100  ILE B CG1 1 
ATOM   5769  C  CG2 . ILE B 1 100 ? 55.693 105.284 34.801  1.00 31.63  ? 100  ILE B CG2 1 
ATOM   5770  C  CD1 . ILE B 1 100 ? 55.393 105.806 37.565  1.00 34.16  ? 100  ILE B CD1 1 
ATOM   5771  N  N   . GLY B 1 101 ? 57.069 107.923 32.423  1.00 32.14  ? 101  GLY B N   1 
ATOM   5772  C  CA  . GLY B 1 101 ? 56.828 107.891 30.997  1.00 32.56  ? 101  GLY B CA  1 
ATOM   5773  C  C   . GLY B 1 101 ? 57.397 109.092 30.274  1.00 32.89  ? 101  GLY B C   1 
ATOM   5774  O  O   . GLY B 1 101 ? 57.657 110.133 30.881  1.00 33.09  ? 101  GLY B O   1 
ATOM   5775  N  N   . TYR B 1 102 ? 57.603 108.945 28.971  1.00 32.98  ? 102  TYR B N   1 
ATOM   5776  C  CA  . TYR B 1 102 ? 58.134 110.029 28.167  1.00 32.89  ? 102  TYR B CA  1 
ATOM   5777  C  C   . TYR B 1 102 ? 57.406 110.077 26.847  1.00 33.09  ? 102  TYR B C   1 
ATOM   5778  O  O   . TYR B 1 102 ? 56.830 109.090 26.421  1.00 33.00  ? 102  TYR B O   1 
ATOM   5779  C  CB  . TYR B 1 102 ? 59.591 109.783 27.833  1.00 32.40  ? 102  TYR B CB  1 
ATOM   5780  C  CG  . TYR B 1 102 ? 60.568 109.821 28.960  1.00 31.89  ? 102  TYR B CG  1 
ATOM   5781  C  CD1 . TYR B 1 102 ? 61.143 111.009 29.359  1.00 32.82  ? 102  TYR B CD1 1 
ATOM   5782  C  CD2 . TYR B 1 102 ? 60.989 108.661 29.574  1.00 31.92  ? 102  TYR B CD2 1 
ATOM   5783  C  CE1 . TYR B 1 102 ? 62.093 111.049 30.374  1.00 31.92  ? 102  TYR B CE1 1 
ATOM   5784  C  CE2 . TYR B 1 102 ? 61.932 108.695 30.587  1.00 32.05  ? 102  TYR B CE2 1 
ATOM   5785  C  CZ  . TYR B 1 102 ? 62.475 109.892 30.978  1.00 30.82  ? 102  TYR B CZ  1 
ATOM   5786  O  OH  . TYR B 1 102 ? 63.394 109.921 31.979  1.00 30.42  ? 102  TYR B OH  1 
ATOM   5787  N  N   . THR B 1 103 ? 57.473 111.222 26.181  1.00 33.52  ? 103  THR B N   1 
ATOM   5788  C  CA  . THR B 1 103 ? 56.924 111.338 24.849  1.00 33.89  ? 103  THR B CA  1 
ATOM   5789  C  C   . THR B 1 103 ? 58.015 111.215 23.812  1.00 34.32  ? 103  THR B C   1 
ATOM   5790  O  O   . THR B 1 103 ? 59.100 111.788 23.942  1.00 34.59  ? 103  THR B O   1 
ATOM   5791  C  CB  . THR B 1 103 ? 56.315 112.686 24.648  1.00 34.22  ? 103  THR B CB  1 
ATOM   5792  O  OG1 . THR B 1 103 ? 56.105 112.881 23.237  1.00 34.73  ? 103  THR B OG1 1 
ATOM   5793  C  CG2 . THR B 1 103 ? 57.332 113.755 25.021  1.00 33.59  ? 103  THR B CG2 1 
ATOM   5794  N  N   . PRO B 1 104 ? 57.710 110.472 22.763  1.00 34.38  ? 104  PRO B N   1 
ATOM   5795  C  CA  . PRO B 1 104 ? 58.606 110.304 21.625  1.00 34.32  ? 104  PRO B CA  1 
ATOM   5796  C  C   . PRO B 1 104 ? 58.931 111.611 20.918  1.00 34.55  ? 104  PRO B C   1 
ATOM   5797  O  O   . PRO B 1 104 ? 59.711 111.572 19.982  1.00 35.25  ? 104  PRO B O   1 
ATOM   5798  C  CB  . PRO B 1 104 ? 57.774 109.458 20.678  1.00 33.99  ? 104  PRO B CB  1 
ATOM   5799  C  CG  . PRO B 1 104 ? 56.862 108.748 21.547  1.00 34.24  ? 104  PRO B CG  1 
ATOM   5800  C  CD  . PRO B 1 104 ? 56.474 109.696 22.618  1.00 34.31  ? 104  PRO B CD  1 
ATOM   5801  N  N   . ASP B 1 105 ? 58.347 112.730 21.326  1.00 34.53  ? 105  ASP B N   1 
ATOM   5802  C  CA  . ASP B 1 105 ? 58.568 113.993 20.631  1.00 34.66  ? 105  ASP B CA  1 
ATOM   5803  C  C   . ASP B 1 105 ? 59.732 114.776 21.186  1.00 34.59  ? 105  ASP B C   1 
ATOM   5804  O  O   . ASP B 1 105 ? 59.994 115.900 20.760  1.00 34.93  ? 105  ASP B O   1 
ATOM   5805  C  CB  . ASP B 1 105 ? 57.323 114.863 20.733  1.00 34.73  ? 105  ASP B CB  1 
ATOM   5806  C  CG  . ASP B 1 105 ? 56.218 114.354 19.890  1.00 36.43  ? 105  ASP B CG  1 
ATOM   5807  O  OD1 . ASP B 1 105 ? 56.517 113.509 19.028  1.00 38.98  ? 105  ASP B OD1 1 
ATOM   5808  O  OD2 . ASP B 1 105 ? 55.025 114.711 19.998  1.00 39.26  ? 105  ASP B OD2 1 
ATOM   5809  N  N   . LEU B 1 106 ? 60.411 114.202 22.163  1.00 34.20  ? 106  LEU B N   1 
ATOM   5810  C  CA  . LEU B 1 106 ? 61.462 114.916 22.845  1.00 33.92  ? 106  LEU B CA  1 
ATOM   5811  C  C   . LEU B 1 106 ? 62.377 113.879 23.447  1.00 34.47  ? 106  LEU B C   1 
ATOM   5812  O  O   . LEU B 1 106 ? 61.925 112.976 24.137  1.00 34.75  ? 106  LEU B O   1 
ATOM   5813  C  CB  . LEU B 1 106 ? 60.860 115.788 23.946  1.00 33.27  ? 106  LEU B CB  1 
ATOM   5814  C  CG  . LEU B 1 106 ? 60.132 117.056 23.508  1.00 32.06  ? 106  LEU B CG  1 
ATOM   5815  C  CD1 . LEU B 1 106 ? 59.264 117.606 24.603  1.00 31.50  ? 106  LEU B CD1 1 
ATOM   5816  C  CD2 . LEU B 1 106 ? 61.135 118.083 23.117  1.00 32.57  ? 106  LEU B CD2 1 
ATOM   5817  N  N   . ASP B 1 107 ? 63.667 113.992 23.174  1.00 34.85  ? 107  ASP B N   1 
ATOM   5818  C  CA  . ASP B 1 107 ? 64.624 113.062 23.731  1.00 35.09  ? 107  ASP B CA  1 
ATOM   5819  C  C   . ASP B 1 107 ? 64.549 113.106 25.254  1.00 35.39  ? 107  ASP B C   1 
ATOM   5820  O  O   . ASP B 1 107 ? 64.066 114.079 25.832  1.00 35.27  ? 107  ASP B O   1 
ATOM   5821  C  CB  . ASP B 1 107 ? 66.009 113.447 23.284  1.00 35.06  ? 107  ASP B CB  1 
ATOM   5822  C  CG  . ASP B 1 107 ? 66.571 114.536 24.106  1.00 35.57  ? 107  ASP B CG  1 
ATOM   5823  O  OD1 . ASP B 1 107 ? 66.182 115.697 23.888  1.00 35.77  ? 107  ASP B OD1 1 
ATOM   5824  O  OD2 . ASP B 1 107 ? 67.400 114.319 25.008  1.00 37.98  ? 107  ASP B OD2 1 
ATOM   5825  N  N   . PRO B 1 108 ? 65.008 112.038 25.899  1.00 35.73  ? 108  PRO B N   1 
ATOM   5826  C  CA  . PRO B 1 108 ? 64.969 111.924 27.358  1.00 35.84  ? 108  PRO B CA  1 
ATOM   5827  C  C   . PRO B 1 108 ? 65.696 113.056 28.056  1.00 35.86  ? 108  PRO B C   1 
ATOM   5828  O  O   . PRO B 1 108 ? 65.196 113.569 29.059  1.00 35.66  ? 108  PRO B O   1 
ATOM   5829  C  CB  . PRO B 1 108 ? 65.689 110.608 27.612  1.00 35.86  ? 108  PRO B CB  1 
ATOM   5830  C  CG  . PRO B 1 108 ? 65.441 109.840 26.388  1.00 35.94  ? 108  PRO B CG  1 
ATOM   5831  C  CD  . PRO B 1 108 ? 65.575 110.832 25.276  1.00 35.81  ? 108  PRO B CD  1 
ATOM   5832  N  N   . GLU B 1 109 ? 66.856 113.445 27.543  1.00 35.91  ? 109  GLU B N   1 
ATOM   5833  C  CA  . GLU B 1 109 ? 67.564 114.557 28.158  1.00 36.19  ? 109  GLU B CA  1 
ATOM   5834  C  C   . GLU B 1 109 ? 66.666 115.801 28.208  1.00 35.87  ? 109  GLU B C   1 
ATOM   5835  O  O   . GLU B 1 109 ? 66.620 116.496 29.220  1.00 35.96  ? 109  GLU B O   1 
ATOM   5836  C  CB  . GLU B 1 109 ? 68.922 114.827 27.488  1.00 36.21  ? 109  GLU B CB  1 
ATOM   5837  C  CG  . GLU B 1 109 ? 70.108 114.356 28.320  1.00 38.52  ? 109  GLU B CG  1 
ATOM   5838  C  CD  . GLU B 1 109 ? 71.480 114.715 27.735  1.00 42.07  ? 109  GLU B CD  1 
ATOM   5839  O  OE1 . GLU B 1 109 ? 71.595 115.690 26.954  1.00 42.69  ? 109  GLU B OE1 1 
ATOM   5840  O  OE2 . GLU B 1 109 ? 72.471 114.019 28.074  1.00 43.44  ? 109  GLU B OE2 1 
ATOM   5841  N  N   . THR B 1 110 ? 65.924 116.064 27.140  1.00 35.73  ? 110  THR B N   1 
ATOM   5842  C  CA  . THR B 1 110 ? 65.060 117.239 27.114  1.00 35.64  ? 110  THR B CA  1 
ATOM   5843  C  C   . THR B 1 110 ? 63.884 117.113 28.086  1.00 36.01  ? 110  THR B C   1 
ATOM   5844  O  O   . THR B 1 110 ? 63.755 117.921 29.004  1.00 36.48  ? 110  THR B O   1 
ATOM   5845  C  CB  . THR B 1 110 ? 64.589 117.545 25.693  1.00 35.46  ? 110  THR B CB  1 
ATOM   5846  O  OG1 . THR B 1 110 ? 65.702 118.026 24.932  1.00 34.53  ? 110  THR B OG1 1 
ATOM   5847  C  CG2 . THR B 1 110 ? 63.618 118.716 25.691  1.00 35.01  ? 110  THR B CG2 1 
ATOM   5848  N  N   . VAL B 1 111 ? 63.032 116.110 27.901  1.00 36.06  ? 111  VAL B N   1 
ATOM   5849  C  CA  . VAL B 1 111 ? 61.925 115.899 28.828  1.00 36.13  ? 111  VAL B CA  1 
ATOM   5850  C  C   . VAL B 1 111 ? 62.377 116.091 30.279  1.00 36.63  ? 111  VAL B C   1 
ATOM   5851  O  O   . VAL B 1 111 ? 61.855 116.948 30.994  1.00 36.79  ? 111  VAL B O   1 
ATOM   5852  C  CB  . VAL B 1 111 ? 61.350 114.491 28.709  1.00 35.79  ? 111  VAL B CB  1 
ATOM   5853  C  CG1 . VAL B 1 111 ? 60.408 114.231 29.834  1.00 35.00  ? 111  VAL B CG1 1 
ATOM   5854  C  CG2 . VAL B 1 111 ? 60.657 114.318 27.389  1.00 35.86  ? 111  VAL B CG2 1 
ATOM   5855  N  N   . ASP B 1 112 ? 63.349 115.293 30.715  1.00 37.05  ? 112  ASP B N   1 
ATOM   5856  C  CA  . ASP B 1 112 ? 63.840 115.403 32.086  1.00 37.29  ? 112  ASP B CA  1 
ATOM   5857  C  C   . ASP B 1 112 ? 64.058 116.868 32.419  1.00 37.30  ? 112  ASP B C   1 
ATOM   5858  O  O   . ASP B 1 112 ? 63.392 117.442 33.279  1.00 37.65  ? 112  ASP B O   1 
ATOM   5859  C  CB  . ASP B 1 112 ? 65.141 114.625 32.274  1.00 37.25  ? 112  ASP B CB  1 
ATOM   5860  C  CG  . ASP B 1 112 ? 64.929 113.125 32.248  1.00 37.86  ? 112  ASP B CG  1 
ATOM   5861  O  OD1 . ASP B 1 112 ? 63.772 112.705 32.034  1.00 38.74  ? 112  ASP B OD1 1 
ATOM   5862  O  OD2 . ASP B 1 112 ? 65.847 112.289 32.440  1.00 37.68  ? 112  ASP B OD2 1 
ATOM   5863  N  N   . ASP B 1 113 ? 64.986 117.485 31.715  1.00 37.09  ? 113  ASP B N   1 
ATOM   5864  C  CA  . ASP B 1 113 ? 65.280 118.873 31.980  1.00 36.87  ? 113  ASP B CA  1 
ATOM   5865  C  C   . ASP B 1 113 ? 64.008 119.720 32.019  1.00 36.46  ? 113  ASP B C   1 
ATOM   5866  O  O   . ASP B 1 113 ? 63.818 120.525 32.925  1.00 36.45  ? 113  ASP B O   1 
ATOM   5867  C  CB  . ASP B 1 113 ? 66.242 119.408 30.936  1.00 36.91  ? 113  ASP B CB  1 
ATOM   5868  C  CG  . ASP B 1 113 ? 66.734 120.770 31.275  1.00 37.32  ? 113  ASP B CG  1 
ATOM   5869  O  OD1 . ASP B 1 113 ? 65.924 121.715 31.231  1.00 38.19  ? 113  ASP B OD1 1 
ATOM   5870  O  OD2 . ASP B 1 113 ? 67.910 120.994 31.609  1.00 38.39  ? 113  ASP B OD2 1 
ATOM   5871  N  N   . ALA B 1 114 ? 63.133 119.537 31.042  1.00 35.92  ? 114  ALA B N   1 
ATOM   5872  C  CA  . ALA B 1 114 ? 61.942 120.363 30.980  1.00 35.56  ? 114  ALA B CA  1 
ATOM   5873  C  C   . ALA B 1 114 ? 61.198 120.256 32.300  1.00 35.48  ? 114  ALA B C   1 
ATOM   5874  O  O   . ALA B 1 114 ? 60.698 121.247 32.827  1.00 35.63  ? 114  ALA B O   1 
ATOM   5875  C  CB  . ALA B 1 114 ? 61.061 119.956 29.812  1.00 35.34  ? 114  ALA B CB  1 
ATOM   5876  N  N   . PHE B 1 115 ? 61.135 119.049 32.843  1.00 35.26  ? 115  PHE B N   1 
ATOM   5877  C  CA  . PHE B 1 115 ? 60.469 118.850 34.116  1.00 35.05  ? 115  PHE B CA  1 
ATOM   5878  C  C   . PHE B 1 115 ? 61.259 119.545 35.223  1.00 35.10  ? 115  PHE B C   1 
ATOM   5879  O  O   . PHE B 1 115 ? 60.706 120.298 36.012  1.00 35.05  ? 115  PHE B O   1 
ATOM   5880  C  CB  . PHE B 1 115 ? 60.337 117.362 34.424  1.00 35.02  ? 115  PHE B CB  1 
ATOM   5881  C  CG  . PHE B 1 115 ? 59.272 116.669 33.641  1.00 34.60  ? 115  PHE B CG  1 
ATOM   5882  C  CD1 . PHE B 1 115 ? 58.139 117.340 33.242  1.00 35.24  ? 115  PHE B CD1 1 
ATOM   5883  C  CD2 . PHE B 1 115 ? 59.393 115.339 33.320  1.00 34.08  ? 115  PHE B CD2 1 
ATOM   5884  C  CE1 . PHE B 1 115 ? 57.151 116.695 32.529  1.00 34.58  ? 115  PHE B CE1 1 
ATOM   5885  C  CE2 . PHE B 1 115 ? 58.410 114.696 32.609  1.00 33.80  ? 115  PHE B CE2 1 
ATOM   5886  C  CZ  . PHE B 1 115 ? 57.295 115.378 32.211  1.00 34.07  ? 115  PHE B CZ  1 
ATOM   5887  N  N   . ALA B 1 116 ? 62.561 119.294 35.287  1.00 35.18  ? 116  ALA B N   1 
ATOM   5888  C  CA  . ALA B 1 116 ? 63.366 119.923 36.320  1.00 35.18  ? 116  ALA B CA  1 
ATOM   5889  C  C   . ALA B 1 116 ? 63.010 121.395 36.386  1.00 35.29  ? 116  ALA B C   1 
ATOM   5890  O  O   . ALA B 1 116 ? 62.629 121.899 37.443  1.00 35.83  ? 116  ALA B O   1 
ATOM   5891  C  CB  . ALA B 1 116 ? 64.826 119.753 36.039  1.00 35.10  ? 116  ALA B CB  1 
ATOM   5892  N  N   . ARG B 1 117 ? 63.100 122.072 35.243  1.00 34.99  ? 117  ARG B N   1 
ATOM   5893  C  CA  . ARG B 1 117 ? 62.829 123.501 35.165  1.00 34.40  ? 117  ARG B CA  1 
ATOM   5894  C  C   . ARG B 1 117 ? 61.417 123.880 35.612  1.00 34.08  ? 117  ARG B C   1 
ATOM   5895  O  O   . ARG B 1 117 ? 61.215 124.984 36.091  1.00 34.29  ? 117  ARG B O   1 
ATOM   5896  C  CB  . ARG B 1 117 ? 63.102 124.034 33.755  1.00 34.61  ? 117  ARG B CB  1 
ATOM   5897  C  CG  . ARG B 1 117 ? 64.470 123.690 33.163  1.00 34.43  ? 117  ARG B CG  1 
ATOM   5898  C  CD  . ARG B 1 117 ? 64.877 124.563 31.978  1.00 34.99  ? 117  ARG B CD  1 
ATOM   5899  N  NE  . ARG B 1 117 ? 63.713 125.028 31.231  1.00 36.44  ? 117  ARG B NE  1 
ATOM   5900  C  CZ  . ARG B 1 117 ? 63.252 124.457 30.131  1.00 37.83  ? 117  ARG B CZ  1 
ATOM   5901  N  NH1 . ARG B 1 117 ? 63.867 123.400 29.630  1.00 39.04  ? 117  ARG B NH1 1 
ATOM   5902  N  NH2 . ARG B 1 117 ? 62.174 124.939 29.526  1.00 38.87  ? 117  ARG B NH2 1 
ATOM   5903  N  N   . ALA B 1 118 ? 60.445 122.982 35.458  1.00 33.64  ? 118  ALA B N   1 
ATOM   5904  C  CA  . ALA B 1 118 ? 59.064 123.264 35.894  1.00 33.48  ? 118  ALA B CA  1 
ATOM   5905  C  C   . ALA B 1 118 ? 58.964 123.388 37.408  1.00 33.42  ? 118  ALA B C   1 
ATOM   5906  O  O   . ALA B 1 118 ? 58.280 124.264 37.933  1.00 33.34  ? 118  ALA B O   1 
ATOM   5907  C  CB  . ALA B 1 118 ? 58.115 122.193 35.417  1.00 33.29  ? 118  ALA B CB  1 
ATOM   5908  N  N   . PHE B 1 119 ? 59.638 122.480 38.103  1.00 33.38  ? 119  PHE B N   1 
ATOM   5909  C  CA  . PHE B 1 119 ? 59.689 122.501 39.551  1.00 33.15  ? 119  PHE B CA  1 
ATOM   5910  C  C   . PHE B 1 119 ? 60.430 123.763 40.000  1.00 33.28  ? 119  PHE B C   1 
ATOM   5911  O  O   . PHE B 1 119 ? 60.079 124.388 40.999  1.00 33.73  ? 119  PHE B O   1 
ATOM   5912  C  CB  . PHE B 1 119 ? 60.403 121.259 40.070  1.00 32.91  ? 119  PHE B CB  1 
ATOM   5913  C  CG  . PHE B 1 119 ? 59.544 120.031 40.112  1.00 32.06  ? 119  PHE B CG  1 
ATOM   5914  C  CD1 . PHE B 1 119 ? 58.274 120.073 40.648  1.00 31.50  ? 119  PHE B CD1 1 
ATOM   5915  C  CD2 . PHE B 1 119 ? 60.020 118.822 39.637  1.00 31.79  ? 119  PHE B CD2 1 
ATOM   5916  C  CE1 . PHE B 1 119 ? 57.493 118.935 40.699  1.00 30.76  ? 119  PHE B CE1 1 
ATOM   5917  C  CE2 . PHE B 1 119 ? 59.233 117.684 39.682  1.00 30.77  ? 119  PHE B CE2 1 
ATOM   5918  C  CZ  . PHE B 1 119 ? 57.979 117.741 40.210  1.00 30.27  ? 119  PHE B CZ  1 
ATOM   5919  N  N   . GLN B 1 120 ? 61.459 124.147 39.264  1.00 32.97  ? 120  GLN B N   1 
ATOM   5920  C  CA  . GLN B 1 120 ? 62.166 125.352 39.633  1.00 32.98  ? 120  GLN B CA  1 
ATOM   5921  C  C   . GLN B 1 120 ? 61.160 126.496 39.702  1.00 32.41  ? 120  GLN B C   1 
ATOM   5922  O  O   . GLN B 1 120 ? 61.203 127.326 40.605  1.00 32.38  ? 120  GLN B O   1 
ATOM   5923  C  CB  . GLN B 1 120 ? 63.279 125.670 38.630  1.00 33.37  ? 120  GLN B CB  1 
ATOM   5924  C  CG  . GLN B 1 120 ? 64.504 126.346 39.257  1.00 34.89  ? 120  GLN B CG  1 
ATOM   5925  C  CD  . GLN B 1 120 ? 65.524 126.814 38.222  1.00 37.30  ? 120  GLN B CD  1 
ATOM   5926  O  OE1 . GLN B 1 120 ? 65.779 128.017 38.098  1.00 38.27  ? 120  GLN B OE1 1 
ATOM   5927  N  NE2 . GLN B 1 120 ? 66.110 125.871 37.484  1.00 37.47  ? 120  GLN B NE2 1 
ATOM   5928  N  N   . VAL B 1 121 ? 60.227 126.525 38.762  1.00 31.86  ? 121  VAL B N   1 
ATOM   5929  C  CA  . VAL B 1 121 ? 59.269 127.617 38.738  1.00 31.31  ? 121  VAL B CA  1 
ATOM   5930  C  C   . VAL B 1 121 ? 58.680 127.877 40.116  1.00 30.94  ? 121  VAL B C   1 
ATOM   5931  O  O   . VAL B 1 121 ? 58.460 129.025 40.482  1.00 31.00  ? 121  VAL B O   1 
ATOM   5932  C  CB  . VAL B 1 121 ? 58.162 127.389 37.712  1.00 31.19  ? 121  VAL B CB  1 
ATOM   5933  C  CG1 . VAL B 1 121 ? 57.246 128.581 37.665  1.00 31.15  ? 121  VAL B CG1 1 
ATOM   5934  C  CG2 . VAL B 1 121 ? 58.769 127.179 36.352  1.00 31.38  ? 121  VAL B CG2 1 
ATOM   5935  N  N   . TRP B 1 122 ? 58.470 126.813 40.888  1.00 30.44  ? 122  TRP B N   1 
ATOM   5936  C  CA  . TRP B 1 122 ? 57.872 126.924 42.210  1.00 29.84  ? 122  TRP B CA  1 
ATOM   5937  C  C   . TRP B 1 122 ? 58.882 127.073 43.339  1.00 29.82  ? 122  TRP B C   1 
ATOM   5938  O  O   . TRP B 1 122 ? 58.669 127.861 44.256  1.00 29.84  ? 122  TRP B O   1 
ATOM   5939  C  CB  . TRP B 1 122 ? 56.909 125.769 42.442  1.00 29.64  ? 122  TRP B CB  1 
ATOM   5940  C  CG  . TRP B 1 122 ? 55.811 125.802 41.430  1.00 29.65  ? 122  TRP B CG  1 
ATOM   5941  C  CD1 . TRP B 1 122 ? 55.575 124.896 40.438  1.00 29.28  ? 122  TRP B CD1 1 
ATOM   5942  C  CD2 . TRP B 1 122 ? 54.820 126.824 41.275  1.00 29.70  ? 122  TRP B CD2 1 
ATOM   5943  N  NE1 . TRP B 1 122 ? 54.491 125.282 39.686  1.00 28.03  ? 122  TRP B NE1 1 
ATOM   5944  C  CE2 . TRP B 1 122 ? 54.007 126.462 40.181  1.00 28.66  ? 122  TRP B CE2 1 
ATOM   5945  C  CE3 . TRP B 1 122 ? 54.525 128.010 41.960  1.00 29.65  ? 122  TRP B CE3 1 
ATOM   5946  C  CZ2 . TRP B 1 122 ? 52.928 127.232 39.766  1.00 28.41  ? 122  TRP B CZ2 1 
ATOM   5947  C  CZ3 . TRP B 1 122 ? 53.452 128.775 41.539  1.00 28.87  ? 122  TRP B CZ3 1 
ATOM   5948  C  CH2 . TRP B 1 122 ? 52.667 128.380 40.454  1.00 28.44  ? 122  TRP B CH2 1 
ATOM   5949  N  N   . SER B 1 123 ? 59.986 126.344 43.287  1.00 29.88  ? 123  SER B N   1 
ATOM   5950  C  CA  . SER B 1 123 ? 61.018 126.536 44.310  1.00 30.10  ? 123  SER B CA  1 
ATOM   5951  C  C   . SER B 1 123 ? 61.400 128.014 44.367  1.00 30.05  ? 123  SER B C   1 
ATOM   5952  O  O   . SER B 1 123 ? 61.105 128.701 45.332  1.00 30.04  ? 123  SER B O   1 
ATOM   5953  C  CB  . SER B 1 123 ? 62.267 125.699 44.027  1.00 29.97  ? 123  SER B CB  1 
ATOM   5954  O  OG  . SER B 1 123 ? 61.939 124.332 43.899  1.00 30.27  ? 123  SER B OG  1 
ATOM   5955  N  N   . ASP B 1 124 ? 62.052 128.491 43.316  1.00 30.13  ? 124  ASP B N   1 
ATOM   5956  C  CA  . ASP B 1 124 ? 62.478 129.875 43.224  1.00 30.30  ? 124  ASP B CA  1 
ATOM   5957  C  C   . ASP B 1 124 ? 61.737 130.800 44.169  1.00 30.10  ? 124  ASP B C   1 
ATOM   5958  O  O   . ASP B 1 124 ? 62.304 131.785 44.623  1.00 30.42  ? 124  ASP B O   1 
ATOM   5959  C  CB  . ASP B 1 124 ? 62.298 130.389 41.796  1.00 30.69  ? 124  ASP B CB  1 
ATOM   5960  C  CG  . ASP B 1 124 ? 63.424 129.962 40.870  1.00 31.93  ? 124  ASP B CG  1 
ATOM   5961  O  OD1 . ASP B 1 124 ? 64.385 129.317 41.359  1.00 32.96  ? 124  ASP B OD1 1 
ATOM   5962  O  OD2 . ASP B 1 124 ? 63.427 130.232 39.639  1.00 32.83  ? 124  ASP B OD2 1 
ATOM   5963  N  N   . VAL B 1 125 ? 60.475 130.498 44.465  1.00 29.86  ? 125  VAL B N   1 
ATOM   5964  C  CA  . VAL B 1 125 ? 59.667 131.383 45.309  1.00 29.44  ? 125  VAL B CA  1 
ATOM   5965  C  C   . VAL B 1 125 ? 59.060 130.745 46.567  1.00 29.25  ? 125  VAL B C   1 
ATOM   5966  O  O   . VAL B 1 125 ? 58.059 131.228 47.085  1.00 29.03  ? 125  VAL B O   1 
ATOM   5967  C  CB  . VAL B 1 125 ? 58.552 132.053 44.485  1.00 29.42  ? 125  VAL B CB  1 
ATOM   5968  C  CG1 . VAL B 1 125 ? 59.152 132.884 43.367  1.00 29.54  ? 125  VAL B CG1 1 
ATOM   5969  C  CG2 . VAL B 1 125 ? 57.623 131.017 43.906  1.00 29.41  ? 125  VAL B CG2 1 
ATOM   5970  N  N   . THR B 1 126 ? 59.677 129.671 47.053  1.00 29.32  ? 126  THR B N   1 
ATOM   5971  C  CA  . THR B 1 126 ? 59.236 128.960 48.253  1.00 29.51  ? 126  THR B CA  1 
ATOM   5972  C  C   . THR B 1 126 ? 60.367 128.092 48.804  1.00 29.83  ? 126  THR B C   1 
ATOM   5973  O  O   . THR B 1 126 ? 61.427 127.964 48.180  1.00 29.97  ? 126  THR B O   1 
ATOM   5974  C  CB  . THR B 1 126 ? 58.048 128.031 47.938  1.00 29.58  ? 126  THR B CB  1 
ATOM   5975  O  OG1 . THR B 1 126 ? 58.350 127.243 46.781  1.00 29.36  ? 126  THR B OG1 1 
ATOM   5976  C  CG2 . THR B 1 126 ? 56.814 128.811 47.530  1.00 29.65  ? 126  THR B CG2 1 
ATOM   5977  N  N   . PRO B 1 127 ? 60.133 127.458 49.951  1.00 29.95  ? 127  PRO B N   1 
ATOM   5978  C  CA  . PRO B 1 127 ? 61.125 126.580 50.564  1.00 30.04  ? 127  PRO B CA  1 
ATOM   5979  C  C   . PRO B 1 127 ? 60.945 125.155 50.075  1.00 30.21  ? 127  PRO B C   1 
ATOM   5980  O  O   . PRO B 1 127 ? 61.544 124.236 50.628  1.00 30.64  ? 127  PRO B O   1 
ATOM   5981  C  CB  . PRO B 1 127 ? 60.755 126.659 52.026  1.00 29.96  ? 127  PRO B CB  1 
ATOM   5982  C  CG  . PRO B 1 127 ? 59.272 126.640 51.967  1.00 30.14  ? 127  PRO B CG  1 
ATOM   5983  C  CD  . PRO B 1 127 ? 58.900 127.499 50.755  1.00 30.01  ? 127  PRO B CD  1 
ATOM   5984  N  N   . LEU B 1 128 ? 60.119 124.967 49.055  1.00 30.10  ? 128  LEU B N   1 
ATOM   5985  C  CA  . LEU B 1 128 ? 59.944 123.644 48.474  1.00 30.20  ? 128  LEU B CA  1 
ATOM   5986  C  C   . LEU B 1 128 ? 61.227 123.184 47.747  1.00 30.66  ? 128  LEU B C   1 
ATOM   5987  O  O   . LEU B 1 128 ? 61.887 123.970 47.066  1.00 30.52  ? 128  LEU B O   1 
ATOM   5988  C  CB  . LEU B 1 128 ? 58.764 123.651 47.497  1.00 29.96  ? 128  LEU B CB  1 
ATOM   5989  C  CG  . LEU B 1 128 ? 57.339 123.904 47.980  1.00 28.59  ? 128  LEU B CG  1 
ATOM   5990  C  CD1 . LEU B 1 128 ? 56.502 124.305 46.816  1.00 27.67  ? 128  LEU B CD1 1 
ATOM   5991  C  CD2 . LEU B 1 128 ? 56.764 122.674 48.609  1.00 27.93  ? 128  LEU B CD2 1 
ATOM   5992  N  N   . ARG B 1 129 ? 61.564 121.906 47.893  1.00 31.26  ? 129  ARG B N   1 
ATOM   5993  C  CA  . ARG B 1 129 ? 62.744 121.319 47.255  1.00 31.98  ? 129  ARG B CA  1 
ATOM   5994  C  C   . ARG B 1 129 ? 62.424 119.981 46.585  1.00 31.88  ? 129  ARG B C   1 
ATOM   5995  O  O   . ARG B 1 129 ? 62.138 118.983 47.252  1.00 31.55  ? 129  ARG B O   1 
ATOM   5996  C  CB  . ARG B 1 129 ? 63.859 121.109 48.282  1.00 32.43  ? 129  ARG B CB  1 
ATOM   5997  C  CG  . ARG B 1 129 ? 64.855 122.238 48.372  1.00 34.92  ? 129  ARG B CG  1 
ATOM   5998  C  CD  . ARG B 1 129 ? 65.816 122.107 49.525  1.00 38.94  ? 129  ARG B CD  1 
ATOM   5999  N  NE  . ARG B 1 129 ? 65.171 122.456 50.787  1.00 43.01  ? 129  ARG B NE  1 
ATOM   6000  C  CZ  . ARG B 1 129 ? 65.117 121.659 51.854  1.00 45.03  ? 129  ARG B CZ  1 
ATOM   6001  N  NH1 . ARG B 1 129 ? 65.670 120.447 51.818  1.00 45.06  ? 129  ARG B NH1 1 
ATOM   6002  N  NH2 . ARG B 1 129 ? 64.507 122.076 52.963  1.00 45.61  ? 129  ARG B NH2 1 
ATOM   6003  N  N   . PHE B 1 130 ? 62.496 119.957 45.260  1.00 32.11  ? 130  PHE B N   1 
ATOM   6004  C  CA  . PHE B 1 130 ? 62.179 118.747 44.514  1.00 32.16  ? 130  PHE B CA  1 
ATOM   6005  C  C   . PHE B 1 130 ? 63.406 117.898 44.188  1.00 32.67  ? 130  PHE B C   1 
ATOM   6006  O  O   . PHE B 1 130 ? 64.505 118.415 43.989  1.00 32.69  ? 130  PHE B O   1 
ATOM   6007  C  CB  . PHE B 1 130 ? 61.457 119.105 43.233  1.00 31.73  ? 130  PHE B CB  1 
ATOM   6008  C  CG  . PHE B 1 130 ? 60.247 119.952 43.445  1.00 30.84  ? 130  PHE B CG  1 
ATOM   6009  C  CD1 . PHE B 1 130 ? 59.068 119.393 43.893  1.00 30.01  ? 130  PHE B CD1 1 
ATOM   6010  C  CD2 . PHE B 1 130 ? 60.282 121.304 43.179  1.00 29.27  ? 130  PHE B CD2 1 
ATOM   6011  C  CE1 . PHE B 1 130 ? 57.961 120.159 44.064  1.00 28.65  ? 130  PHE B CE1 1 
ATOM   6012  C  CE2 . PHE B 1 130 ? 59.182 122.067 43.357  1.00 28.15  ? 130  PHE B CE2 1 
ATOM   6013  C  CZ  . PHE B 1 130 ? 58.020 121.496 43.803  1.00 28.59  ? 130  PHE B CZ  1 
ATOM   6014  N  N   . SER B 1 131 ? 63.196 116.588 44.132  1.00 33.16  ? 131  SER B N   1 
ATOM   6015  C  CA  . SER B 1 131 ? 64.263 115.644 43.868  1.00 33.81  ? 131  SER B CA  1 
ATOM   6016  C  C   . SER B 1 131 ? 63.699 114.455 43.103  1.00 34.47  ? 131  SER B C   1 
ATOM   6017  O  O   . SER B 1 131 ? 62.666 113.886 43.481  1.00 34.56  ? 131  SER B O   1 
ATOM   6018  C  CB  . SER B 1 131 ? 64.860 115.144 45.177  1.00 33.59  ? 131  SER B CB  1 
ATOM   6019  O  OG  . SER B 1 131 ? 64.329 115.867 46.270  1.00 34.12  ? 131  SER B OG  1 
ATOM   6020  N  N   . ARG B 1 132 ? 64.392 114.080 42.034  1.00 34.94  ? 132  ARG B N   1 
ATOM   6021  C  CA  . ARG B 1 132 ? 63.987 112.972 41.199  1.00 35.31  ? 132  ARG B CA  1 
ATOM   6022  C  C   . ARG B 1 132 ? 64.529 111.701 41.802  1.00 35.77  ? 132  ARG B C   1 
ATOM   6023  O  O   . ARG B 1 132 ? 65.715 111.601 42.025  1.00 35.97  ? 132  ARG B O   1 
ATOM   6024  C  CB  . ARG B 1 132 ? 64.580 113.167 39.810  1.00 35.08  ? 132  ARG B CB  1 
ATOM   6025  C  CG  . ARG B 1 132 ? 64.127 112.191 38.734  1.00 35.12  ? 132  ARG B CG  1 
ATOM   6026  C  CD  . ARG B 1 132 ? 65.028 112.245 37.515  1.00 35.02  ? 132  ARG B CD  1 
ATOM   6027  N  NE  . ARG B 1 132 ? 64.555 111.479 36.367  1.00 35.54  ? 132  ARG B NE  1 
ATOM   6028  C  CZ  . ARG B 1 132 ? 65.100 111.584 35.158  1.00 35.95  ? 132  ARG B CZ  1 
ATOM   6029  N  NH1 . ARG B 1 132 ? 66.122 112.409 34.968  1.00 36.68  ? 132  ARG B NH1 1 
ATOM   6030  N  NH2 . ARG B 1 132 ? 64.641 110.878 34.138  1.00 35.49  ? 132  ARG B NH2 1 
ATOM   6031  N  N   . ILE B 1 133 ? 63.664 110.738 42.090  1.00 36.72  ? 133  ILE B N   1 
ATOM   6032  C  CA  . ILE B 1 133 ? 64.118 109.441 42.583  1.00 37.61  ? 133  ILE B CA  1 
ATOM   6033  C  C   . ILE B 1 133 ? 63.740 108.402 41.557  1.00 38.31  ? 133  ILE B C   1 
ATOM   6034  O  O   . ILE B 1 133 ? 62.604 108.349 41.131  1.00 38.55  ? 133  ILE B O   1 
ATOM   6035  C  CB  . ILE B 1 133 ? 63.436 109.074 43.896  1.00 37.45  ? 133  ILE B CB  1 
ATOM   6036  C  CG1 . ILE B 1 133 ? 62.218 108.197 43.610  1.00 37.41  ? 133  ILE B CG1 1 
ATOM   6037  C  CG2 . ILE B 1 133 ? 63.077 110.314 44.680  1.00 37.61  ? 133  ILE B CG2 1 
ATOM   6038  C  CD1 . ILE B 1 133 ? 61.146 108.271 44.668  1.00 38.20  ? 133  ILE B CD1 1 
ATOM   6039  N  N   . HIS B 1 134 ? 64.678 107.559 41.170  1.00 39.53  ? 134  HIS B N   1 
ATOM   6040  C  CA  . HIS B 1 134 ? 64.393 106.561 40.156  1.00 41.02  ? 134  HIS B CA  1 
ATOM   6041  C  C   . HIS B 1 134 ? 63.742 105.292 40.693  1.00 41.98  ? 134  HIS B C   1 
ATOM   6042  O  O   . HIS B 1 134 ? 63.533 104.330 39.941  1.00 42.13  ? 134  HIS B O   1 
ATOM   6043  C  CB  . HIS B 1 134 ? 65.675 106.190 39.428  1.00 41.21  ? 134  HIS B CB  1 
ATOM   6044  C  CG  . HIS B 1 134 ? 66.279 107.324 38.672  1.00 41.84  ? 134  HIS B CG  1 
ATOM   6045  N  ND1 . HIS B 1 134 ? 67.291 108.105 39.188  1.00 41.99  ? 134  HIS B ND1 1 
ATOM   6046  C  CD2 . HIS B 1 134 ? 66.006 107.817 37.441  1.00 42.27  ? 134  HIS B CD2 1 
ATOM   6047  C  CE1 . HIS B 1 134 ? 67.613 109.034 38.305  1.00 43.21  ? 134  HIS B CE1 1 
ATOM   6048  N  NE2 . HIS B 1 134 ? 66.848 108.882 37.238  1.00 43.17  ? 134  HIS B NE2 1 
ATOM   6049  N  N   . ASP B 1 135 ? 63.400 105.275 41.977  1.00 42.90  ? 135  ASP B N   1 
ATOM   6050  C  CA  . ASP B 1 135 ? 62.871 104.039 42.535  1.00 43.56  ? 135  ASP B CA  1 
ATOM   6051  C  C   . ASP B 1 135 ? 61.825 104.163 43.634  1.00 43.29  ? 135  ASP B C   1 
ATOM   6052  O  O   . ASP B 1 135 ? 61.953 104.971 44.553  1.00 43.60  ? 135  ASP B O   1 
ATOM   6053  C  CB  . ASP B 1 135 ? 64.022 103.175 43.042  1.00 43.93  ? 135  ASP B CB  1 
ATOM   6054  C  CG  . ASP B 1 135 ? 63.782 101.710 42.786  1.00 46.32  ? 135  ASP B CG  1 
ATOM   6055  O  OD1 . ASP B 1 135 ? 64.079 101.161 41.696  1.00 49.17  ? 135  ASP B OD1 1 
ATOM   6056  O  OD2 . ASP B 1 135 ? 63.237 101.024 43.686  1.00 48.59  ? 135  ASP B OD2 1 
ATOM   6057  N  N   . GLY B 1 136 ? 60.801 103.327 43.554  1.00 42.77  ? 136  GLY B N   1 
ATOM   6058  C  CA  . GLY B 1 136 ? 59.787 103.324 44.583  1.00 42.37  ? 136  GLY B CA  1 
ATOM   6059  C  C   . GLY B 1 136 ? 58.771 104.406 44.338  1.00 41.98  ? 136  GLY B C   1 
ATOM   6060  O  O   . GLY B 1 136 ? 58.773 105.021 43.283  1.00 42.18  ? 136  GLY B O   1 
ATOM   6061  N  N   . GLU B 1 137 ? 57.908 104.649 45.315  1.00 41.50  ? 137  GLU B N   1 
ATOM   6062  C  CA  . GLU B 1 137 ? 56.842 105.614 45.131  1.00 40.98  ? 137  GLU B CA  1 
ATOM   6063  C  C   . GLU B 1 137 ? 57.250 107.027 45.486  1.00 40.57  ? 137  GLU B C   1 
ATOM   6064  O  O   . GLU B 1 137 ? 57.617 107.317 46.626  1.00 40.61  ? 137  GLU B O   1 
ATOM   6065  C  CB  . GLU B 1 137 ? 55.596 105.206 45.913  1.00 41.12  ? 137  GLU B CB  1 
ATOM   6066  C  CG  . GLU B 1 137 ? 54.478 104.639 45.045  1.00 41.50  ? 137  GLU B CG  1 
ATOM   6067  C  CD  . GLU B 1 137 ? 53.604 105.717 44.417  1.00 42.04  ? 137  GLU B CD  1 
ATOM   6068  O  OE1 . GLU B 1 137 ? 53.452 106.813 45.018  1.00 41.83  ? 137  GLU B OE1 1 
ATOM   6069  O  OE2 . GLU B 1 137 ? 53.055 105.461 43.323  1.00 41.70  ? 137  GLU B OE2 1 
ATOM   6070  N  N   . ALA B 1 138 ? 57.187 107.904 44.493  1.00 39.79  ? 138  ALA B N   1 
ATOM   6071  C  CA  . ALA B 1 138 ? 57.472 109.306 44.712  1.00 39.22  ? 138  ALA B CA  1 
ATOM   6072  C  C   . ALA B 1 138 ? 56.174 110.012 45.097  1.00 38.74  ? 138  ALA B C   1 
ATOM   6073  O  O   . ALA B 1 138 ? 55.092 109.444 44.958  1.00 38.66  ? 138  ALA B O   1 
ATOM   6074  C  CB  . ALA B 1 138 ? 58.057 109.917 43.466  1.00 39.23  ? 138  ALA B CB  1 
ATOM   6075  N  N   . ASP B 1 139 ? 56.283 111.236 45.598  1.00 38.14  ? 139  ASP B N   1 
ATOM   6076  C  CA  . ASP B 1 139 ? 55.109 112.012 45.932  1.00 37.70  ? 139  ASP B CA  1 
ATOM   6077  C  C   . ASP B 1 139 ? 54.427 112.352 44.629  1.00 37.31  ? 139  ASP B C   1 
ATOM   6078  O  O   . ASP B 1 139 ? 53.221 112.208 44.490  1.00 37.75  ? 139  ASP B O   1 
ATOM   6079  C  CB  . ASP B 1 139 ? 55.501 113.307 46.620  1.00 37.87  ? 139  ASP B CB  1 
ATOM   6080  C  CG  . ASP B 1 139 ? 56.382 113.083 47.822  1.00 38.61  ? 139  ASP B CG  1 
ATOM   6081  O  OD1 . ASP B 1 139 ? 57.626 112.972 47.756  1.00 38.71  ? 139  ASP B OD1 1 
ATOM   6082  O  OD2 . ASP B 1 139 ? 55.836 113.020 48.940  1.00 40.51  ? 139  ASP B OD2 1 
ATOM   6083  N  N   . ILE B 1 140 ? 55.218 112.796 43.664  1.00 36.72  ? 140  ILE B N   1 
ATOM   6084  C  CA  . ILE B 1 140 ? 54.694 113.189 42.368  1.00 36.01  ? 140  ILE B CA  1 
ATOM   6085  C  C   . ILE B 1 140 ? 55.168 112.254 41.273  1.00 35.71  ? 140  ILE B C   1 
ATOM   6086  O  O   . ILE B 1 140 ? 56.322 112.319 40.863  1.00 36.03  ? 140  ILE B O   1 
ATOM   6087  C  CB  . ILE B 1 140 ? 55.167 114.605 42.031  1.00 35.97  ? 140  ILE B CB  1 
ATOM   6088  C  CG1 . ILE B 1 140 ? 55.018 115.520 43.238  1.00 35.50  ? 140  ILE B CG1 1 
ATOM   6089  C  CG2 . ILE B 1 140 ? 54.394 115.161 40.855  1.00 35.78  ? 140  ILE B CG2 1 
ATOM   6090  C  CD1 . ILE B 1 140 ? 54.977 116.960 42.850  1.00 34.86  ? 140  ILE B CD1 1 
ATOM   6091  N  N   . MET B 1 141 ? 54.282 111.395 40.790  1.00 34.98  ? 141  MET B N   1 
ATOM   6092  C  CA  . MET B 1 141 ? 54.626 110.491 39.708  1.00 34.40  ? 141  MET B CA  1 
ATOM   6093  C  C   . MET B 1 141 ? 54.219 111.110 38.360  1.00 34.28  ? 141  MET B C   1 
ATOM   6094  O  O   . MET B 1 141 ? 53.050 111.410 38.143  1.00 34.52  ? 141  MET B O   1 
ATOM   6095  C  CB  . MET B 1 141 ? 53.924 109.160 39.928  1.00 34.24  ? 141  MET B CB  1 
ATOM   6096  C  CG  . MET B 1 141 ? 54.193 108.572 41.281  1.00 34.13  ? 141  MET B CG  1 
ATOM   6097  S  SD  . MET B 1 141 ? 55.514 107.352 41.301  1.00 33.79  ? 141  MET B SD  1 
ATOM   6098  C  CE  . MET B 1 141 ? 54.647 105.990 40.580  1.00 34.25  ? 141  MET B CE  1 
ATOM   6099  N  N   . ILE B 1 142 ? 55.180 111.309 37.460  1.00 33.91  ? 142  ILE B N   1 
ATOM   6100  C  CA  . ILE B 1 142 ? 54.899 111.936 36.173  1.00 33.46  ? 142  ILE B CA  1 
ATOM   6101  C  C   . ILE B 1 142 ? 54.854 110.907 35.075  1.00 33.52  ? 142  ILE B C   1 
ATOM   6102  O  O   . ILE B 1 142 ? 55.774 110.104 34.952  1.00 33.67  ? 142  ILE B O   1 
ATOM   6103  C  CB  . ILE B 1 142 ? 55.985 112.946 35.819  1.00 33.29  ? 142  ILE B CB  1 
ATOM   6104  C  CG1 . ILE B 1 142 ? 56.329 113.816 37.023  1.00 33.05  ? 142  ILE B CG1 1 
ATOM   6105  C  CG2 . ILE B 1 142 ? 55.541 113.788 34.642  1.00 32.78  ? 142  ILE B CG2 1 
ATOM   6106  C  CD1 . ILE B 1 142 ? 57.336 114.892 36.707  1.00 33.53  ? 142  ILE B CD1 1 
ATOM   6107  N  N   . ASN B 1 143 ? 53.802 110.954 34.264  1.00 33.25  ? 143  ASN B N   1 
ATOM   6108  C  CA  . ASN B 1 143 ? 53.627 110.010 33.168  1.00 33.25  ? 143  ASN B CA  1 
ATOM   6109  C  C   . ASN B 1 143 ? 52.872 110.666 32.033  1.00 33.19  ? 143  ASN B C   1 
ATOM   6110  O  O   . ASN B 1 143 ? 52.308 111.743 32.195  1.00 33.69  ? 143  ASN B O   1 
ATOM   6111  C  CB  . ASN B 1 143 ? 52.852 108.779 33.654  1.00 33.55  ? 143  ASN B CB  1 
ATOM   6112  C  CG  . ASN B 1 143 ? 52.845 107.631 32.647  1.00 33.51  ? 143  ASN B CG  1 
ATOM   6113  O  OD1 . ASN B 1 143 ? 52.310 106.560 32.918  1.00 32.38  ? 143  ASN B OD1 1 
ATOM   6114  N  ND2 . ASN B 1 143 ? 53.444 107.850 31.491  1.00 35.17  ? 143  ASN B ND2 1 
ATOM   6115  N  N   . PHE B 1 144 ? 52.862 110.009 30.884  1.00 32.88  ? 144  PHE B N   1 
ATOM   6116  C  CA  . PHE B 1 144 ? 52.161 110.493 29.713  1.00 32.82  ? 144  PHE B CA  1 
ATOM   6117  C  C   . PHE B 1 144 ? 51.070 109.467 29.385  1.00 32.65  ? 144  PHE B C   1 
ATOM   6118  O  O   . PHE B 1 144 ? 51.163 108.321 29.799  1.00 32.47  ? 144  PHE B O   1 
ATOM   6119  C  CB  . PHE B 1 144 ? 53.147 110.640 28.554  1.00 33.05  ? 144  PHE B CB  1 
ATOM   6120  C  CG  . PHE B 1 144 ? 54.116 111.802 28.702  1.00 33.51  ? 144  PHE B CG  1 
ATOM   6121  C  CD1 . PHE B 1 144 ? 55.225 111.706 29.519  1.00 33.50  ? 144  PHE B CD1 1 
ATOM   6122  C  CD2 . PHE B 1 144 ? 53.929 112.974 27.987  1.00 33.61  ? 144  PHE B CD2 1 
ATOM   6123  C  CE1 . PHE B 1 144 ? 56.112 112.762 29.645  1.00 32.82  ? 144  PHE B CE1 1 
ATOM   6124  C  CE2 . PHE B 1 144 ? 54.814 114.021 28.111  1.00 33.69  ? 144  PHE B CE2 1 
ATOM   6125  C  CZ  . PHE B 1 144 ? 55.903 113.916 28.944  1.00 32.80  ? 144  PHE B CZ  1 
ATOM   6126  N  N   . GLY B 1 145 ? 50.028 109.849 28.659  1.00 32.50  ? 145  GLY B N   1 
ATOM   6127  C  CA  . GLY B 1 145 ? 48.994 108.865 28.398  1.00 32.83  ? 145  GLY B CA  1 
ATOM   6128  C  C   . GLY B 1 145 ? 47.882 109.275 27.463  1.00 32.97  ? 145  GLY B C   1 
ATOM   6129  O  O   . GLY B 1 145 ? 47.640 110.467 27.282  1.00 33.35  ? 145  GLY B O   1 
ATOM   6130  N  N   . ARG B 1 146 ? 47.204 108.285 26.881  1.00 32.79  ? 146  ARG B N   1 
ATOM   6131  C  CA  . ARG B 1 146 ? 46.105 108.527 25.957  1.00 33.12  ? 146  ARG B CA  1 
ATOM   6132  C  C   . ARG B 1 146 ? 44.766 108.431 26.654  1.00 33.58  ? 146  ARG B C   1 
ATOM   6133  O  O   . ARG B 1 146 ? 44.698 108.117 27.836  1.00 34.57  ? 146  ARG B O   1 
ATOM   6134  C  CB  . ARG B 1 146 ? 46.115 107.506 24.843  1.00 33.11  ? 146  ARG B CB  1 
ATOM   6135  C  CG  . ARG B 1 146 ? 47.310 107.593 23.962  1.00 32.96  ? 146  ARG B CG  1 
ATOM   6136  C  CD  . ARG B 1 146 ? 47.291 106.603 22.850  1.00 31.44  ? 146  ARG B CD  1 
ATOM   6137  N  NE  . ARG B 1 146 ? 46.891 107.230 21.615  1.00 32.13  ? 146  ARG B NE  1 
ATOM   6138  C  CZ  . ARG B 1 146 ? 46.120 106.645 20.730  1.00 34.80  ? 146  ARG B CZ  1 
ATOM   6139  N  NH1 . ARG B 1 146 ? 45.661 105.421 20.964  1.00 35.40  ? 146  ARG B NH1 1 
ATOM   6140  N  NH2 . ARG B 1 146 ? 45.795 107.281 19.616  1.00 36.44  ? 146  ARG B NH2 1 
ATOM   6141  N  N   . TRP B 1 147 ? 43.688 108.677 25.925  1.00 33.24  ? 147  TRP B N   1 
ATOM   6142  C  CA  . TRP B 1 147 ? 42.382 108.645 26.540  1.00 32.92  ? 147  TRP B CA  1 
ATOM   6143  C  C   . TRP B 1 147 ? 42.327 107.550 27.568  1.00 33.27  ? 147  TRP B C   1 
ATOM   6144  O  O   . TRP B 1 147 ? 42.846 106.477 27.353  1.00 34.19  ? 147  TRP B O   1 
ATOM   6145  C  CB  . TRP B 1 147 ? 41.329 108.291 25.509  1.00 32.97  ? 147  TRP B CB  1 
ATOM   6146  C  CG  . TRP B 1 147 ? 41.651 108.576 24.093  1.00 31.03  ? 147  TRP B CG  1 
ATOM   6147  C  CD1 . TRP B 1 147 ? 42.756 108.211 23.408  1.00 29.13  ? 147  TRP B CD1 1 
ATOM   6148  C  CD2 . TRP B 1 147 ? 40.816 109.270 23.176  1.00 29.43  ? 147  TRP B CD2 1 
ATOM   6149  N  NE1 . TRP B 1 147 ? 42.674 108.650 22.110  1.00 27.93  ? 147  TRP B NE1 1 
ATOM   6150  C  CE2 . TRP B 1 147 ? 41.483 109.301 21.944  1.00 28.42  ? 147  TRP B CE2 1 
ATOM   6151  C  CE3 . TRP B 1 147 ? 39.572 109.889 23.279  1.00 29.28  ? 147  TRP B CE3 1 
ATOM   6152  C  CZ2 . TRP B 1 147 ? 40.950 109.918 20.827  1.00 28.40  ? 147  TRP B CZ2 1 
ATOM   6153  C  CZ3 . TRP B 1 147 ? 39.042 110.497 22.168  1.00 30.16  ? 147  TRP B CZ3 1 
ATOM   6154  C  CH2 . TRP B 1 147 ? 39.732 110.514 20.960  1.00 29.36  ? 147  TRP B CH2 1 
ATOM   6155  N  N   . GLU B 1 148 ? 41.654 107.778 28.671  1.00 33.50  ? 148  GLU B N   1 
ATOM   6156  C  CA  . GLU B 1 148 ? 41.535 106.733 29.690  1.00 33.88  ? 148  GLU B CA  1 
ATOM   6157  C  C   . GLU B 1 148 ? 42.836 106.055 30.071  1.00 34.09  ? 148  GLU B C   1 
ATOM   6158  O  O   . GLU B 1 148 ? 42.933 104.847 30.053  1.00 34.00  ? 148  GLU B O   1 
ATOM   6159  C  CB  . GLU B 1 148 ? 40.532 105.668 29.294  1.00 33.46  ? 148  GLU B CB  1 
ATOM   6160  C  CG  . GLU B 1 148 ? 40.233 104.729 30.449  1.00 34.63  ? 148  GLU B CG  1 
ATOM   6161  C  CD  . GLU B 1 148 ? 40.557 105.328 31.822  1.00 35.58  ? 148  GLU B CD  1 
ATOM   6162  O  OE1 . GLU B 1 148 ? 40.236 106.510 32.072  1.00 35.57  ? 148  GLU B OE1 1 
ATOM   6163  O  OE2 . GLU B 1 148 ? 41.134 104.606 32.668  1.00 35.72  ? 148  GLU B OE2 1 
ATOM   6164  N  N   . HIS B 1 149 ? 43.826 106.850 30.439  1.00 34.73  ? 149  HIS B N   1 
ATOM   6165  C  CA  . HIS B 1 149 ? 45.115 106.335 30.853  1.00 35.19  ? 149  HIS B CA  1 
ATOM   6166  C  C   . HIS B 1 149 ? 45.089 105.881 32.313  1.00 35.33  ? 149  HIS B C   1 
ATOM   6167  O  O   . HIS B 1 149 ? 45.915 106.314 33.107  1.00 36.13  ? 149  HIS B O   1 
ATOM   6168  C  CB  . HIS B 1 149 ? 46.145 107.451 30.726  1.00 35.27  ? 149  HIS B CB  1 
ATOM   6169  C  CG  . HIS B 1 149 ? 45.826 108.641 31.577  1.00 36.18  ? 149  HIS B CG  1 
ATOM   6170  N  ND1 . HIS B 1 149 ? 44.999 109.656 31.153  1.00 37.22  ? 149  HIS B ND1 1 
ATOM   6171  C  CD2 . HIS B 1 149 ? 46.194 108.957 32.844  1.00 36.58  ? 149  HIS B CD2 1 
ATOM   6172  C  CE1 . HIS B 1 149 ? 44.891 110.558 32.114  1.00 38.54  ? 149  HIS B CE1 1 
ATOM   6173  N  NE2 . HIS B 1 149 ? 45.601 110.154 33.152  1.00 37.19  ? 149  HIS B NE2 1 
ATOM   6174  N  N   . GLY B 1 150 ? 44.135 105.052 32.701  1.00 35.03  ? 150  GLY B N   1 
ATOM   6175  C  CA  . GLY B 1 150 ? 44.140 104.539 34.057  1.00 34.62  ? 150  GLY B CA  1 
ATOM   6176  C  C   . GLY B 1 150 ? 43.562 105.309 35.234  1.00 34.68  ? 150  GLY B C   1 
ATOM   6177  O  O   . GLY B 1 150 ? 43.352 104.701 36.277  1.00 35.10  ? 150  GLY B O   1 
ATOM   6178  N  N   . ASP B 1 151 ? 43.299 106.611 35.128  1.00 34.59  ? 151  ASP B N   1 
ATOM   6179  C  CA  . ASP B 1 151 ? 42.750 107.324 36.300  1.00 34.23  ? 151  ASP B CA  1 
ATOM   6180  C  C   . ASP B 1 151 ? 41.250 107.593 36.301  1.00 34.01  ? 151  ASP B C   1 
ATOM   6181  O  O   . ASP B 1 151 ? 40.740 108.188 37.235  1.00 34.37  ? 151  ASP B O   1 
ATOM   6182  C  CB  . ASP B 1 151 ? 43.517 108.616 36.653  1.00 34.05  ? 151  ASP B CB  1 
ATOM   6183  C  CG  . ASP B 1 151 ? 44.051 109.351 35.438  1.00 34.59  ? 151  ASP B CG  1 
ATOM   6184  O  OD1 . ASP B 1 151 ? 43.539 109.157 34.322  1.00 34.92  ? 151  ASP B OD1 1 
ATOM   6185  O  OD2 . ASP B 1 151 ? 44.999 110.163 35.503  1.00 35.50  ? 151  ASP B OD2 1 
ATOM   6186  N  N   . GLY B 1 152 ? 40.531 107.144 35.285  1.00 33.76  ? 152  GLY B N   1 
ATOM   6187  C  CA  . GLY B 1 152 ? 39.103 107.416 35.240  1.00 33.62  ? 152  GLY B CA  1 
ATOM   6188  C  C   . GLY B 1 152 ? 38.780 108.804 34.703  1.00 33.33  ? 152  GLY B C   1 
ATOM   6189  O  O   . GLY B 1 152 ? 37.619 109.168 34.494  1.00 32.99  ? 152  GLY B O   1 
ATOM   6190  N  N   . TYR B 1 153 ? 39.827 109.584 34.479  1.00 33.07  ? 153  TYR B N   1 
ATOM   6191  C  CA  . TYR B 1 153 ? 39.688 110.890 33.878  1.00 32.94  ? 153  TYR B CA  1 
ATOM   6192  C  C   . TYR B 1 153 ? 40.349 110.862 32.499  1.00 32.80  ? 153  TYR B C   1 
ATOM   6193  O  O   . TYR B 1 153 ? 41.484 111.293 32.354  1.00 33.07  ? 153  TYR B O   1 
ATOM   6194  C  CB  . TYR B 1 153 ? 40.418 111.912 34.728  1.00 33.17  ? 153  TYR B CB  1 
ATOM   6195  C  CG  . TYR B 1 153 ? 39.823 112.214 36.083  1.00 32.49  ? 153  TYR B CG  1 
ATOM   6196  C  CD1 . TYR B 1 153 ? 38.666 112.944 36.198  1.00 30.75  ? 153  TYR B CD1 1 
ATOM   6197  C  CD2 . TYR B 1 153 ? 40.476 111.831 37.243  1.00 33.01  ? 153  TYR B CD2 1 
ATOM   6198  C  CE1 . TYR B 1 153 ? 38.145 113.245 37.412  1.00 32.05  ? 153  TYR B CE1 1 
ATOM   6199  C  CE2 . TYR B 1 153 ? 39.962 112.131 38.473  1.00 33.78  ? 153  TYR B CE2 1 
ATOM   6200  C  CZ  . TYR B 1 153 ? 38.783 112.837 38.555  1.00 33.59  ? 153  TYR B CZ  1 
ATOM   6201  O  OH  . TYR B 1 153 ? 38.248 113.147 39.794  1.00 34.93  ? 153  TYR B OH  1 
ATOM   6202  N  N   . PRO B 1 154 ? 39.652 110.363 31.490  1.00 32.52  ? 154  PRO B N   1 
ATOM   6203  C  CA  . PRO B 1 154 ? 40.216 110.210 30.146  1.00 32.44  ? 154  PRO B CA  1 
ATOM   6204  C  C   . PRO B 1 154 ? 40.638 111.506 29.472  1.00 32.43  ? 154  PRO B C   1 
ATOM   6205  O  O   . PRO B 1 154 ? 40.100 112.563 29.780  1.00 33.09  ? 154  PRO B O   1 
ATOM   6206  C  CB  . PRO B 1 154 ? 39.042 109.632 29.368  1.00 32.38  ? 154  PRO B CB  1 
ATOM   6207  C  CG  . PRO B 1 154 ? 37.877 110.126 30.118  1.00 32.76  ? 154  PRO B CG  1 
ATOM   6208  C  CD  . PRO B 1 154 ? 38.261 109.898 31.542  1.00 32.75  ? 154  PRO B CD  1 
ATOM   6209  N  N   . PHE B 1 155 ? 41.595 111.416 28.556  1.00 32.04  ? 155  PHE B N   1 
ATOM   6210  C  CA  . PHE B 1 155 ? 42.010 112.557 27.761  1.00 31.48  ? 155  PHE B CA  1 
ATOM   6211  C  C   . PHE B 1 155 ? 41.211 112.454 26.476  1.00 31.44  ? 155  PHE B C   1 
ATOM   6212  O  O   . PHE B 1 155 ? 40.472 111.504 26.289  1.00 31.53  ? 155  PHE B O   1 
ATOM   6213  C  CB  . PHE B 1 155 ? 43.502 112.479 27.443  1.00 31.58  ? 155  PHE B CB  1 
ATOM   6214  C  CG  . PHE B 1 155 ? 44.395 112.973 28.548  1.00 30.63  ? 155  PHE B CG  1 
ATOM   6215  C  CD1 . PHE B 1 155 ? 44.088 114.122 29.245  1.00 29.84  ? 155  PHE B CD1 1 
ATOM   6216  C  CD2 . PHE B 1 155 ? 45.551 112.292 28.874  1.00 29.79  ? 155  PHE B CD2 1 
ATOM   6217  C  CE1 . PHE B 1 155 ? 44.916 114.578 30.249  1.00 29.29  ? 155  PHE B CE1 1 
ATOM   6218  C  CE2 . PHE B 1 155 ? 46.375 112.741 29.878  1.00 29.35  ? 155  PHE B CE2 1 
ATOM   6219  C  CZ  . PHE B 1 155 ? 46.057 113.883 30.564  1.00 29.43  ? 155  PHE B CZ  1 
ATOM   6220  N  N   . ASP B 1 156 ? 41.385 113.397 25.563  1.00 31.53  ? 156  ASP B N   1 
ATOM   6221  C  CA  . ASP B 1 156 ? 40.685 113.339 24.299  1.00 31.64  ? 156  ASP B CA  1 
ATOM   6222  C  C   . ASP B 1 156 ? 41.447 113.596 23.020  1.00 31.96  ? 156  ASP B C   1 
ATOM   6223  O  O   . ASP B 1 156 ? 41.246 114.627 22.409  1.00 32.85  ? 156  ASP B O   1 
ATOM   6224  C  CB  . ASP B 1 156 ? 39.708 114.479 24.421  1.00 31.54  ? 156  ASP B CB  1 
ATOM   6225  C  CG  . ASP B 1 156 ? 40.394 115.781 24.745  1.00 32.03  ? 156  ASP B CG  1 
ATOM   6226  O  OD1 . ASP B 1 156 ? 41.643 115.819 24.768  1.00 31.25  ? 156  ASP B OD1 1 
ATOM   6227  O  OD2 . ASP B 1 156 ? 39.766 116.830 25.000  1.00 35.86  ? 156  ASP B OD2 1 
ATOM   6228  N  N   . GLY B 1 157 ? 42.313 112.698 22.590  1.00 31.87  ? 157  GLY B N   1 
ATOM   6229  C  CA  . GLY B 1 157 ? 43.007 112.928 21.341  1.00 31.79  ? 157  GLY B CA  1 
ATOM   6230  C  C   . GLY B 1 157 ? 43.730 114.254 21.254  1.00 32.01  ? 157  GLY B C   1 
ATOM   6231  O  O   . GLY B 1 157 ? 43.916 114.940 22.260  1.00 31.88  ? 157  GLY B O   1 
ATOM   6232  N  N   . LYS B 1 158 ? 44.130 114.611 20.036  1.00 32.35  ? 158  LYS B N   1 
ATOM   6233  C  CA  . LYS B 1 158 ? 44.931 115.812 19.776  1.00 32.84  ? 158  LYS B CA  1 
ATOM   6234  C  C   . LYS B 1 158 ? 44.257 117.126 20.227  1.00 33.13  ? 158  LYS B C   1 
ATOM   6235  O  O   . LYS B 1 158 ? 43.051 117.328 20.008  1.00 33.51  ? 158  LYS B O   1 
ATOM   6236  C  CB  . LYS B 1 158 ? 45.363 115.835 18.300  1.00 32.73  ? 158  LYS B CB  1 
ATOM   6237  C  CG  . LYS B 1 158 ? 45.557 117.206 17.670  1.00 33.86  ? 158  LYS B CG  1 
ATOM   6238  C  CD  . LYS B 1 158 ? 46.453 117.151 16.408  1.00 35.45  ? 158  LYS B CD  1 
ATOM   6239  C  CE  . LYS B 1 158 ? 47.946 117.077 16.798  1.00 36.89  ? 158  LYS B CE  1 
ATOM   6240  N  NZ  . LYS B 1 158 ? 48.885 117.889 15.941  1.00 36.62  ? 158  LYS B NZ  1 
ATOM   6241  N  N   . ASP B 1 159 ? 45.045 117.993 20.876  1.00 32.86  ? 159  ASP B N   1 
ATOM   6242  C  CA  . ASP B 1 159 ? 44.579 119.275 21.406  1.00 32.55  ? 159  ASP B CA  1 
ATOM   6243  C  C   . ASP B 1 159 ? 43.568 119.049 22.512  1.00 32.50  ? 159  ASP B C   1 
ATOM   6244  O  O   . ASP B 1 159 ? 43.479 117.939 23.055  1.00 32.91  ? 159  ASP B O   1 
ATOM   6245  C  CB  . ASP B 1 159 ? 43.942 120.117 20.315  1.00 32.57  ? 159  ASP B CB  1 
ATOM   6246  C  CG  . ASP B 1 159 ? 44.887 120.409 19.194  1.00 33.65  ? 159  ASP B CG  1 
ATOM   6247  O  OD1 . ASP B 1 159 ? 46.056 120.758 19.468  1.00 35.86  ? 159  ASP B OD1 1 
ATOM   6248  O  OD2 . ASP B 1 159 ? 44.554 120.313 18.000  1.00 34.83  ? 159  ASP B OD2 1 
ATOM   6249  N  N   . GLY B 1 160 ? 42.802 120.099 22.831  1.00 31.88  ? 160  GLY B N   1 
ATOM   6250  C  CA  . GLY B 1 160 ? 41.686 119.996 23.763  1.00 30.72  ? 160  GLY B CA  1 
ATOM   6251  C  C   . GLY B 1 160 ? 42.252 119.958 25.155  1.00 30.23  ? 160  GLY B C   1 
ATOM   6252  O  O   . GLY B 1 160 ? 42.828 120.926 25.615  1.00 30.39  ? 160  GLY B O   1 
ATOM   6253  N  N   . LEU B 1 161 ? 42.089 118.840 25.842  1.00 29.85  ? 161  LEU B N   1 
ATOM   6254  C  CA  . LEU B 1 161 ? 42.698 118.705 27.157  1.00 29.16  ? 161  LEU B CA  1 
ATOM   6255  C  C   . LEU B 1 161 ? 44.167 118.428 26.911  1.00 28.72  ? 161  LEU B C   1 
ATOM   6256  O  O   . LEU B 1 161 ? 44.489 117.652 26.023  1.00 28.45  ? 161  LEU B O   1 
ATOM   6257  C  CB  . LEU B 1 161 ? 42.087 117.542 27.936  1.00 29.15  ? 161  LEU B CB  1 
ATOM   6258  C  CG  . LEU B 1 161 ? 40.596 117.521 28.218  1.00 27.44  ? 161  LEU B CG  1 
ATOM   6259  C  CD1 . LEU B 1 161 ? 40.359 116.439 29.212  1.00 27.41  ? 161  LEU B CD1 1 
ATOM   6260  C  CD2 . LEU B 1 161 ? 40.214 118.809 28.790  1.00 27.19  ? 161  LEU B CD2 1 
ATOM   6261  N  N   . LEU B 1 162 ? 45.045 119.051 27.692  1.00 28.39  ? 162  LEU B N   1 
ATOM   6262  C  CA  . LEU B 1 162 ? 46.481 118.886 27.507  1.00 28.54  ? 162  LEU B CA  1 
ATOM   6263  C  C   . LEU B 1 162 ? 47.120 118.013 28.563  1.00 28.56  ? 162  LEU B C   1 
ATOM   6264  O  O   . LEU B 1 162 ? 48.028 117.241 28.263  1.00 28.63  ? 162  LEU B O   1 
ATOM   6265  C  CB  . LEU B 1 162 ? 47.199 120.234 27.484  1.00 28.42  ? 162  LEU B CB  1 
ATOM   6266  C  CG  . LEU B 1 162 ? 46.900 121.137 26.297  1.00 28.44  ? 162  LEU B CG  1 
ATOM   6267  C  CD1 . LEU B 1 162 ? 48.037 122.092 26.079  1.00 28.86  ? 162  LEU B CD1 1 
ATOM   6268  C  CD2 . LEU B 1 162 ? 46.734 120.287 25.087  1.00 29.33  ? 162  LEU B CD2 1 
ATOM   6269  N  N   . ALA B 1 163 ? 46.644 118.136 29.794  1.00 28.56  ? 163  ALA B N   1 
ATOM   6270  C  CA  . ALA B 1 163 ? 47.213 117.395 30.906  1.00 28.76  ? 163  ALA B CA  1 
ATOM   6271  C  C   . ALA B 1 163 ? 46.314 117.514 32.099  1.00 29.14  ? 163  ALA B C   1 
ATOM   6272  O  O   . ALA B 1 163 ? 45.200 118.015 31.993  1.00 29.79  ? 163  ALA B O   1 
ATOM   6273  C  CB  . ALA B 1 163 ? 48.543 117.954 31.250  1.00 28.72  ? 163  ALA B CB  1 
ATOM   6274  N  N   . HIS B 1 164 ? 46.794 117.059 33.245  1.00 29.23  ? 164  HIS B N   1 
ATOM   6275  C  CA  . HIS B 1 164 ? 46.044 117.197 34.492  1.00 29.35  ? 164  HIS B CA  1 
ATOM   6276  C  C   . HIS B 1 164 ? 46.938 116.737 35.603  1.00 29.48  ? 164  HIS B C   1 
ATOM   6277  O  O   . HIS B 1 164 ? 47.925 116.056 35.353  1.00 29.58  ? 164  HIS B O   1 
ATOM   6278  C  CB  . HIS B 1 164 ? 44.700 116.447 34.485  1.00 29.00  ? 164  HIS B CB  1 
ATOM   6279  C  CG  . HIS B 1 164 ? 44.810 114.953 34.395  1.00 30.01  ? 164  HIS B CG  1 
ATOM   6280  N  ND1 . HIS B 1 164 ? 43.734 114.151 34.067  1.00 30.07  ? 164  HIS B ND1 1 
ATOM   6281  C  CD2 . HIS B 1 164 ? 45.856 114.112 34.593  1.00 30.89  ? 164  HIS B CD2 1 
ATOM   6282  C  CE1 . HIS B 1 164 ? 44.111 112.884 34.068  1.00 29.85  ? 164  HIS B CE1 1 
ATOM   6283  N  NE2 . HIS B 1 164 ? 45.395 112.832 34.384  1.00 30.74  ? 164  HIS B NE2 1 
ATOM   6284  N  N   . ALA B 1 165 ? 46.620 117.134 36.824  1.00 29.69  ? 165  ALA B N   1 
ATOM   6285  C  CA  . ALA B 1 165 ? 47.423 116.742 37.964  1.00 30.07  ? 165  ALA B CA  1 
ATOM   6286  C  C   . ALA B 1 165 ? 46.565 116.792 39.204  1.00 30.43  ? 165  ALA B C   1 
ATOM   6287  O  O   . ALA B 1 165 ? 45.798 117.728 39.382  1.00 30.66  ? 165  ALA B O   1 
ATOM   6288  C  CB  . ALA B 1 165 ? 48.583 117.657 38.107  1.00 30.26  ? 165  ALA B CB  1 
ATOM   6289  N  N   . PHE B 1 166 ? 46.689 115.778 40.050  1.00 30.68  ? 166  PHE B N   1 
ATOM   6290  C  CA  . PHE B 1 166 ? 45.887 115.686 41.252  1.00 30.95  ? 166  PHE B CA  1 
ATOM   6291  C  C   . PHE B 1 166 ? 46.548 116.419 42.404  1.00 31.23  ? 166  PHE B C   1 
ATOM   6292  O  O   . PHE B 1 166 ? 47.740 116.304 42.608  1.00 31.24  ? 166  PHE B O   1 
ATOM   6293  C  CB  . PHE B 1 166 ? 45.699 114.217 41.651  1.00 31.20  ? 166  PHE B CB  1 
ATOM   6294  C  CG  . PHE B 1 166 ? 45.166 113.344 40.551  1.00 31.26  ? 166  PHE B CG  1 
ATOM   6295  C  CD1 . PHE B 1 166 ? 43.814 113.278 40.296  1.00 33.06  ? 166  PHE B CD1 1 
ATOM   6296  C  CD2 . PHE B 1 166 ? 46.015 112.582 39.787  1.00 31.66  ? 166  PHE B CD2 1 
ATOM   6297  C  CE1 . PHE B 1 166 ? 43.317 112.483 39.283  1.00 33.45  ? 166  PHE B CE1 1 
ATOM   6298  C  CE2 . PHE B 1 166 ? 45.529 111.774 38.777  1.00 32.59  ? 166  PHE B CE2 1 
ATOM   6299  C  CZ  . PHE B 1 166 ? 44.181 111.726 38.527  1.00 34.07  ? 166  PHE B CZ  1 
ATOM   6300  N  N   . ALA B 1 167 ? 45.754 117.164 43.162  1.00 31.81  ? 167  ALA B N   1 
ATOM   6301  C  CA  . ALA B 1 167 ? 46.214 117.864 44.355  1.00 31.96  ? 167  ALA B CA  1 
ATOM   6302  C  C   . ALA B 1 167 ? 46.966 116.927 45.305  1.00 32.17  ? 167  ALA B C   1 
ATOM   6303  O  O   . ALA B 1 167 ? 46.780 115.710 45.258  1.00 31.86  ? 167  ALA B O   1 
ATOM   6304  C  CB  . ALA B 1 167 ? 45.025 118.461 45.069  1.00 32.08  ? 167  ALA B CB  1 
ATOM   6305  N  N   . PRO B 1 168 ? 47.793 117.511 46.175  1.00 32.44  ? 168  PRO B N   1 
ATOM   6306  C  CA  . PRO B 1 168 ? 48.605 116.751 47.131  1.00 32.65  ? 168  PRO B CA  1 
ATOM   6307  C  C   . PRO B 1 168 ? 47.741 115.897 48.023  1.00 33.05  ? 168  PRO B C   1 
ATOM   6308  O  O   . PRO B 1 168 ? 46.722 116.372 48.532  1.00 33.14  ? 168  PRO B O   1 
ATOM   6309  C  CB  . PRO B 1 168 ? 49.278 117.843 47.961  1.00 32.77  ? 168  PRO B CB  1 
ATOM   6310  C  CG  . PRO B 1 168 ? 49.269 119.051 47.096  1.00 32.38  ? 168  PRO B CG  1 
ATOM   6311  C  CD  . PRO B 1 168 ? 48.009 118.962 46.303  1.00 32.45  ? 168  PRO B CD  1 
ATOM   6312  N  N   . GLY B 1 169 ? 48.155 114.651 48.215  1.00 33.45  ? 169  GLY B N   1 
ATOM   6313  C  CA  . GLY B 1 169 ? 47.400 113.686 48.994  1.00 34.10  ? 169  GLY B CA  1 
ATOM   6314  C  C   . GLY B 1 169 ? 48.103 112.355 48.858  1.00 34.71  ? 169  GLY B C   1 
ATOM   6315  O  O   . GLY B 1 169 ? 49.244 112.315 48.399  1.00 35.21  ? 169  GLY B O   1 
ATOM   6316  N  N   . THR B 1 170 ? 47.447 111.263 49.239  1.00 35.05  ? 170  THR B N   1 
ATOM   6317  C  CA  . THR B 1 170 ? 48.078 109.950 49.136  1.00 35.24  ? 170  THR B CA  1 
ATOM   6318  C  C   . THR B 1 170 ? 47.753 109.271 47.820  1.00 35.21  ? 170  THR B C   1 
ATOM   6319  O  O   . THR B 1 170 ? 47.000 109.800 47.011  1.00 35.62  ? 170  THR B O   1 
ATOM   6320  C  CB  . THR B 1 170 ? 47.641 109.043 50.274  1.00 35.23  ? 170  THR B CB  1 
ATOM   6321  O  OG1 . THR B 1 170 ? 47.423 109.823 51.450  1.00 35.53  ? 170  THR B OG1 1 
ATOM   6322  C  CG2 . THR B 1 170 ? 48.789 108.106 50.665  1.00 35.95  ? 170  THR B CG2 1 
ATOM   6323  N  N   . GLY B 1 171 ? 48.330 108.094 47.614  1.00 35.09  ? 171  GLY B N   1 
ATOM   6324  C  CA  . GLY B 1 171 ? 48.087 107.323 46.413  1.00 34.88  ? 171  GLY B CA  1 
ATOM   6325  C  C   . GLY B 1 171 ? 48.345 108.136 45.170  1.00 34.79  ? 171  GLY B C   1 
ATOM   6326  O  O   . GLY B 1 171 ? 49.475 108.526 44.894  1.00 35.29  ? 171  GLY B O   1 
ATOM   6327  N  N   . VAL B 1 172 ? 47.287 108.419 44.428  1.00 34.51  ? 172  VAL B N   1 
ATOM   6328  C  CA  . VAL B 1 172 ? 47.412 109.158 43.187  1.00 34.06  ? 172  VAL B CA  1 
ATOM   6329  C  C   . VAL B 1 172 ? 47.810 110.606 43.409  1.00 33.86  ? 172  VAL B C   1 
ATOM   6330  O  O   . VAL B 1 172 ? 48.366 111.238 42.516  1.00 34.04  ? 172  VAL B O   1 
ATOM   6331  C  CB  . VAL B 1 172 ? 46.130 109.015 42.350  1.00 34.13  ? 172  VAL B CB  1 
ATOM   6332  C  CG1 . VAL B 1 172 ? 45.633 110.344 41.823  1.00 34.51  ? 172  VAL B CG1 1 
ATOM   6333  C  CG2 . VAL B 1 172 ? 46.350 108.007 41.237  1.00 34.42  ? 172  VAL B CG2 1 
ATOM   6334  N  N   . GLY B 1 173 ? 47.568 111.119 44.610  1.00 33.62  ? 173  GLY B N   1 
ATOM   6335  C  CA  . GLY B 1 173 ? 47.903 112.499 44.938  1.00 33.87  ? 173  GLY B CA  1 
ATOM   6336  C  C   . GLY B 1 173 ? 49.210 113.060 44.382  1.00 33.90  ? 173  GLY B C   1 
ATOM   6337  O  O   . GLY B 1 173 ? 50.263 112.434 44.479  1.00 34.12  ? 173  GLY B O   1 
ATOM   6338  N  N   . GLY B 1 174 ? 49.150 114.250 43.799  1.00 33.80  ? 174  GLY B N   1 
ATOM   6339  C  CA  . GLY B 1 174 ? 50.348 114.880 43.269  1.00 34.20  ? 174  GLY B CA  1 
ATOM   6340  C  C   . GLY B 1 174 ? 50.700 114.472 41.847  1.00 34.51  ? 174  GLY B C   1 
ATOM   6341  O  O   . GLY B 1 174 ? 51.281 115.251 41.076  1.00 34.15  ? 174  GLY B O   1 
ATOM   6342  N  N   . ASP B 1 175 ? 50.336 113.248 41.489  1.00 34.83  ? 175  ASP B N   1 
ATOM   6343  C  CA  . ASP B 1 175 ? 50.650 112.745 40.164  1.00 35.32  ? 175  ASP B CA  1 
ATOM   6344  C  C   . ASP B 1 175 ? 50.250 113.713 39.060  1.00 35.31  ? 175  ASP B C   1 
ATOM   6345  O  O   . ASP B 1 175 ? 49.207 114.365 39.116  1.00 35.39  ? 175  ASP B O   1 
ATOM   6346  C  CB  . ASP B 1 175 ? 50.006 111.390 39.938  1.00 35.43  ? 175  ASP B CB  1 
ATOM   6347  C  CG  . ASP B 1 175 ? 50.532 110.347 40.879  1.00 37.00  ? 175  ASP B CG  1 
ATOM   6348  O  OD1 . ASP B 1 175 ? 51.410 110.683 41.707  1.00 38.47  ? 175  ASP B OD1 1 
ATOM   6349  O  OD2 . ASP B 1 175 ? 50.117 109.170 40.877  1.00 39.17  ? 175  ASP B OD2 1 
ATOM   6350  N  N   . SER B 1 176 ? 51.092 113.792 38.044  1.00 35.08  ? 176  SER B N   1 
ATOM   6351  C  CA  . SER B 1 176 ? 50.836 114.677 36.945  1.00 35.07  ? 176  SER B CA  1 
ATOM   6352  C  C   . SER B 1 176 ? 50.901 113.894 35.660  1.00 35.08  ? 176  SER B C   1 
ATOM   6353  O  O   . SER B 1 176 ? 51.887 113.226 35.381  1.00 35.41  ? 176  SER B O   1 
ATOM   6354  C  CB  . SER B 1 176 ? 51.867 115.784 36.967  1.00 35.09  ? 176  SER B CB  1 
ATOM   6355  O  OG  . SER B 1 176 ? 52.042 116.188 38.308  1.00 35.66  ? 176  SER B OG  1 
ATOM   6356  N  N   . HIS B 1 177 ? 49.831 113.967 34.882  1.00 35.13  ? 177  HIS B N   1 
ATOM   6357  C  CA  . HIS B 1 177 ? 49.739 113.242 33.623  1.00 34.88  ? 177  HIS B CA  1 
ATOM   6358  C  C   . HIS B 1 177 ? 49.685 114.195 32.462  1.00 34.61  ? 177  HIS B C   1 
ATOM   6359  O  O   . HIS B 1 177 ? 49.008 115.228 32.525  1.00 34.98  ? 177  HIS B O   1 
ATOM   6360  C  CB  . HIS B 1 177 ? 48.443 112.437 33.577  1.00 35.05  ? 177  HIS B CB  1 
ATOM   6361  C  CG  . HIS B 1 177 ? 48.321 111.433 34.667  1.00 34.61  ? 177  HIS B CG  1 
ATOM   6362  N  ND1 . HIS B 1 177 ? 47.136 110.803 34.963  1.00 34.86  ? 177  HIS B ND1 1 
ATOM   6363  C  CD2 . HIS B 1 177 ? 49.236 110.951 35.535  1.00 34.20  ? 177  HIS B CD2 1 
ATOM   6364  C  CE1 . HIS B 1 177 ? 47.327 109.968 35.966  1.00 35.71  ? 177  HIS B CE1 1 
ATOM   6365  N  NE2 . HIS B 1 177 ? 48.594 110.038 36.330  1.00 35.54  ? 177  HIS B NE2 1 
ATOM   6366  N  N   . PHE B 1 178 ? 50.355 113.838 31.382  1.00 33.80  ? 178  PHE B N   1 
ATOM   6367  C  CA  . PHE B 1 178 ? 50.270 114.657 30.198  1.00 33.42  ? 178  PHE B CA  1 
ATOM   6368  C  C   . PHE B 1 178 ? 49.695 113.821 29.082  1.00 33.31  ? 178  PHE B C   1 
ATOM   6369  O  O   . PHE B 1 178 ? 49.899 112.607 29.030  1.00 33.14  ? 178  PHE B O   1 
ATOM   6370  C  CB  . PHE B 1 178 ? 51.632 115.230 29.835  1.00 33.55  ? 178  PHE B CB  1 
ATOM   6371  C  CG  . PHE B 1 178 ? 52.272 116.003 30.946  1.00 32.67  ? 178  PHE B CG  1 
ATOM   6372  C  CD1 . PHE B 1 178 ? 53.009 115.352 31.918  1.00 32.40  ? 178  PHE B CD1 1 
ATOM   6373  C  CD2 . PHE B 1 178 ? 52.131 117.370 31.023  1.00 31.50  ? 178  PHE B CD2 1 
ATOM   6374  C  CE1 . PHE B 1 178 ? 53.602 116.048 32.934  1.00 32.47  ? 178  PHE B CE1 1 
ATOM   6375  C  CE2 . PHE B 1 178 ? 52.721 118.072 32.037  1.00 32.27  ? 178  PHE B CE2 1 
ATOM   6376  C  CZ  . PHE B 1 178 ? 53.463 117.409 32.996  1.00 32.67  ? 178  PHE B CZ  1 
ATOM   6377  N  N   . ASP B 1 179 ? 48.960 114.465 28.188  1.00 33.22  ? 179  ASP B N   1 
ATOM   6378  C  CA  . ASP B 1 179 ? 48.319 113.729 27.115  1.00 33.09  ? 179  ASP B CA  1 
ATOM   6379  C  C   . ASP B 1 179 ? 49.307 113.338 26.027  1.00 32.97  ? 179  ASP B C   1 
ATOM   6380  O  O   . ASP B 1 179 ? 50.010 114.177 25.491  1.00 32.64  ? 179  ASP B O   1 
ATOM   6381  C  CB  . ASP B 1 179 ? 47.165 114.521 26.534  1.00 33.00  ? 179  ASP B CB  1 
ATOM   6382  C  CG  . ASP B 1 179 ? 46.496 113.789 25.409  1.00 33.11  ? 179  ASP B CG  1 
ATOM   6383  O  OD1 . ASP B 1 179 ? 47.219 113.020 24.732  1.00 31.80  ? 179  ASP B OD1 1 
ATOM   6384  O  OD2 . ASP B 1 179 ? 45.275 113.912 25.130  1.00 32.80  ? 179  ASP B OD2 1 
ATOM   6385  N  N   . ASP B 1 180 ? 49.343 112.056 25.700  1.00 33.21  ? 180  ASP B N   1 
ATOM   6386  C  CA  . ASP B 1 180 ? 50.305 111.545 24.730  1.00 33.62  ? 180  ASP B CA  1 
ATOM   6387  C  C   . ASP B 1 180 ? 49.969 111.839 23.283  1.00 33.73  ? 180  ASP B C   1 
ATOM   6388  O  O   . ASP B 1 180 ? 50.819 111.726 22.404  1.00 33.43  ? 180  ASP B O   1 
ATOM   6389  C  CB  . ASP B 1 180 ? 50.459 110.041 24.872  1.00 33.67  ? 180  ASP B CB  1 
ATOM   6390  C  CG  . ASP B 1 180 ? 51.741 109.550 24.256  1.00 35.20  ? 180  ASP B CG  1 
ATOM   6391  O  OD1 . ASP B 1 180 ? 52.733 110.323 24.291  1.00 36.07  ? 180  ASP B OD1 1 
ATOM   6392  O  OD2 . ASP B 1 180 ? 51.858 108.427 23.716  1.00 36.20  ? 180  ASP B OD2 1 
ATOM   6393  N  N   . ASP B 1 181 ? 48.719 112.184 23.018  1.00 34.14  ? 181  ASP B N   1 
ATOM   6394  C  CA  . ASP B 1 181 ? 48.333 112.429 21.640  1.00 34.26  ? 181  ASP B CA  1 
ATOM   6395  C  C   . ASP B 1 181 ? 48.627 113.858 21.265  1.00 33.90  ? 181  ASP B C   1 
ATOM   6396  O  O   . ASP B 1 181 ? 48.275 114.300 20.180  1.00 34.42  ? 181  ASP B O   1 
ATOM   6397  C  CB  . ASP B 1 181 ? 46.879 112.029 21.378  1.00 34.17  ? 181  ASP B CB  1 
ATOM   6398  C  CG  . ASP B 1 181 ? 46.737 110.535 21.073  1.00 35.73  ? 181  ASP B CG  1 
ATOM   6399  O  OD1 . ASP B 1 181 ? 47.776 109.852 20.917  1.00 36.08  ? 181  ASP B OD1 1 
ATOM   6400  O  OD2 . ASP B 1 181 ? 45.633 109.946 20.965  1.00 38.49  ? 181  ASP B OD2 1 
ATOM   6401  N  N   . GLU B 1 182 ? 49.286 114.577 22.166  1.00 33.35  ? 182  GLU B N   1 
ATOM   6402  C  CA  . GLU B 1 182 ? 49.659 115.953 21.895  1.00 32.88  ? 182  GLU B CA  1 
ATOM   6403  C  C   . GLU B 1 182 ? 50.964 115.954 21.135  1.00 32.62  ? 182  GLU B C   1 
ATOM   6404  O  O   . GLU B 1 182 ? 51.540 114.901 20.878  1.00 32.93  ? 182  GLU B O   1 
ATOM   6405  C  CB  . GLU B 1 182 ? 49.817 116.763 23.181  1.00 32.84  ? 182  GLU B CB  1 
ATOM   6406  C  CG  . GLU B 1 182 ? 48.513 117.191 23.827  1.00 32.82  ? 182  GLU B CG  1 
ATOM   6407  C  CD  . GLU B 1 182 ? 47.444 117.431 22.802  1.00 33.47  ? 182  GLU B CD  1 
ATOM   6408  O  OE1 . GLU B 1 182 ? 47.829 117.841 21.679  1.00 34.59  ? 182  GLU B OE1 1 
ATOM   6409  O  OE2 . GLU B 1 182 ? 46.244 117.197 23.110  1.00 32.16  ? 182  GLU B OE2 1 
ATOM   6410  N  N   . LEU B 1 183 ? 51.407 117.140 20.748  1.00 31.97  ? 183  LEU B N   1 
ATOM   6411  C  CA  . LEU B 1 183 ? 52.676 117.302 20.075  1.00 31.19  ? 183  LEU B CA  1 
ATOM   6412  C  C   . LEU B 1 183 ? 53.494 118.115 21.017  1.00 31.07  ? 183  LEU B C   1 
ATOM   6413  O  O   . LEU B 1 183 ? 53.480 119.332 20.940  1.00 31.64  ? 183  LEU B O   1 
ATOM   6414  C  CB  . LEU B 1 183 ? 52.504 118.083 18.773  1.00 31.01  ? 183  LEU B CB  1 
ATOM   6415  C  CG  . LEU B 1 183 ? 53.759 118.654 18.115  1.00 29.63  ? 183  LEU B CG  1 
ATOM   6416  C  CD1 . LEU B 1 183 ? 54.899 117.687 18.217  1.00 30.04  ? 183  LEU B CD1 1 
ATOM   6417  C  CD2 . LEU B 1 183 ? 53.479 118.940 16.675  1.00 29.02  ? 183  LEU B CD2 1 
ATOM   6418  N  N   . TRP B 1 184 ? 54.184 117.459 21.933  1.00 30.70  ? 184  TRP B N   1 
ATOM   6419  C  CA  . TRP B 1 184 ? 54.990 118.191 22.901  1.00 30.27  ? 184  TRP B CA  1 
ATOM   6420  C  C   . TRP B 1 184 ? 56.229 118.766 22.269  1.00 30.17  ? 184  TRP B C   1 
ATOM   6421  O  O   . TRP B 1 184 ? 56.880 118.125 21.462  1.00 30.32  ? 184  TRP B O   1 
ATOM   6422  C  CB  . TRP B 1 184 ? 55.329 117.302 24.087  1.00 30.25  ? 184  TRP B CB  1 
ATOM   6423  C  CG  . TRP B 1 184 ? 54.094 116.796 24.679  1.00 28.92  ? 184  TRP B CG  1 
ATOM   6424  C  CD1 . TRP B 1 184 ? 53.590 115.552 24.562  1.00 27.95  ? 184  TRP B CD1 1 
ATOM   6425  C  CD2 . TRP B 1 184 ? 53.161 117.544 25.442  1.00 27.34  ? 184  TRP B CD2 1 
ATOM   6426  N  NE1 . TRP B 1 184 ? 52.397 115.471 25.229  1.00 28.81  ? 184  TRP B NE1 1 
ATOM   6427  C  CE2 . TRP B 1 184 ? 52.116 116.694 25.775  1.00 27.78  ? 184  TRP B CE2 1 
ATOM   6428  C  CE3 . TRP B 1 184 ? 53.108 118.857 25.884  1.00 28.11  ? 184  TRP B CE3 1 
ATOM   6429  C  CZ2 . TRP B 1 184 ? 51.040 117.107 26.528  1.00 27.81  ? 184  TRP B CZ2 1 
ATOM   6430  C  CZ3 . TRP B 1 184 ? 52.040 119.267 26.617  1.00 27.23  ? 184  TRP B CZ3 1 
ATOM   6431  C  CH2 . TRP B 1 184 ? 51.023 118.401 26.936  1.00 27.54  ? 184  TRP B CH2 1 
ATOM   6432  N  N   . THR B 1 185 ? 56.539 119.991 22.647  1.00 30.12  ? 185  THR B N   1 
ATOM   6433  C  CA  . THR B 1 185 ? 57.657 120.702 22.088  1.00 30.57  ? 185  THR B CA  1 
ATOM   6434  C  C   . THR B 1 185 ? 58.145 121.662 23.134  1.00 30.75  ? 185  THR B C   1 
ATOM   6435  O  O   . THR B 1 185 ? 57.594 121.725 24.217  1.00 30.84  ? 185  THR B O   1 
ATOM   6436  C  CB  . THR B 1 185 ? 57.166 121.501 20.907  1.00 30.71  ? 185  THR B CB  1 
ATOM   6437  O  OG1 . THR B 1 185 ? 56.055 122.299 21.326  1.00 31.70  ? 185  THR B OG1 1 
ATOM   6438  C  CG2 . THR B 1 185 ? 56.534 120.586 19.873  1.00 30.83  ? 185  THR B CG2 1 
ATOM   6439  N  N   . LEU B 1 186 ? 59.181 122.426 22.836  1.00 31.33  ? 186  LEU B N   1 
ATOM   6440  C  CA  . LEU B 1 186 ? 59.551 123.462 23.795  1.00 31.78  ? 186  LEU B CA  1 
ATOM   6441  C  C   . LEU B 1 186 ? 58.754 124.742 23.552  1.00 32.63  ? 186  LEU B C   1 
ATOM   6442  O  O   . LEU B 1 186 ? 59.093 125.812 24.056  1.00 32.88  ? 186  LEU B O   1 
ATOM   6443  C  CB  . LEU B 1 186 ? 61.062 123.675 23.783  1.00 31.12  ? 186  LEU B CB  1 
ATOM   6444  C  CG  . LEU B 1 186 ? 61.752 122.460 24.395  1.00 30.25  ? 186  LEU B CG  1 
ATOM   6445  C  CD1 . LEU B 1 186 ? 63.228 122.665 24.569  1.00 30.85  ? 186  LEU B CD1 1 
ATOM   6446  C  CD2 . LEU B 1 186 ? 61.131 122.170 25.716  1.00 29.69  ? 186  LEU B CD2 1 
ATOM   6447  N  N   . GLY B 1 187 ? 57.679 124.614 22.779  1.00 33.37  ? 187  GLY B N   1 
ATOM   6448  C  CA  . GLY B 1 187 ? 56.818 125.742 22.483  1.00 34.34  ? 187  GLY B CA  1 
ATOM   6449  C  C   . GLY B 1 187 ? 56.805 126.265 21.049  1.00 35.16  ? 187  GLY B C   1 
ATOM   6450  O  O   . GLY B 1 187 ? 55.741 126.578 20.525  1.00 35.56  ? 187  GLY B O   1 
ATOM   6451  N  N   . GLU B 1 188 ? 57.956 126.361 20.395  1.00 35.51  ? 188  GLU B N   1 
ATOM   6452  C  CA  . GLU B 1 188 ? 57.971 126.953 19.067  1.00 36.35  ? 188  GLU B CA  1 
ATOM   6453  C  C   . GLU B 1 188 ? 58.133 125.951 17.915  1.00 36.64  ? 188  GLU B C   1 
ATOM   6454  O  O   . GLU B 1 188 ? 59.001 126.097 17.052  1.00 36.59  ? 188  GLU B O   1 
ATOM   6455  C  CB  . GLU B 1 188 ? 59.053 128.025 18.996  1.00 36.80  ? 188  GLU B CB  1 
ATOM   6456  C  CG  . GLU B 1 188 ? 59.003 129.035 20.133  1.00 38.71  ? 188  GLU B CG  1 
ATOM   6457  C  CD  . GLU B 1 188 ? 60.331 129.745 20.335  1.00 40.91  ? 188  GLU B CD  1 
ATOM   6458  O  OE1 . GLU B 1 188 ? 61.235 129.150 20.953  1.00 42.46  ? 188  GLU B OE1 1 
ATOM   6459  O  OE2 . GLU B 1 188 ? 60.483 130.892 19.873  1.00 42.47  ? 188  GLU B OE2 1 
ATOM   6460  N  N   . GLY B 1 189 ? 57.276 124.943 17.882  1.00 37.00  ? 189  GLY B N   1 
ATOM   6461  C  CA  . GLY B 1 189 ? 57.355 123.955 16.825  1.00 37.40  ? 189  GLY B CA  1 
ATOM   6462  C  C   . GLY B 1 189 ? 58.011 122.654 17.250  1.00 37.72  ? 189  GLY B C   1 
ATOM   6463  O  O   . GLY B 1 189 ? 58.540 122.519 18.350  1.00 37.81  ? 189  GLY B O   1 
ATOM   6464  N  N   . GLN B 1 190 ? 57.958 121.678 16.364  1.00 37.97  ? 190  GLN B N   1 
ATOM   6465  C  CA  . GLN B 1 190 ? 58.558 120.388 16.616  1.00 38.38  ? 190  GLN B CA  1 
ATOM   6466  C  C   . GLN B 1 190 ? 60.017 120.538 17.034  1.00 38.10  ? 190  GLN B C   1 
ATOM   6467  O  O   . GLN B 1 190 ? 60.688 121.488 16.649  1.00 38.06  ? 190  GLN B O   1 
ATOM   6468  C  CB  . GLN B 1 190 ? 58.449 119.560 15.339  1.00 38.72  ? 190  GLN B CB  1 
ATOM   6469  C  CG  . GLN B 1 190 ? 59.275 118.303 15.292  1.00 40.89  ? 190  GLN B CG  1 
ATOM   6470  C  CD  . GLN B 1 190 ? 58.697 117.303 14.302  1.00 44.46  ? 190  GLN B CD  1 
ATOM   6471  O  OE1 . GLN B 1 190 ? 58.167 117.708 13.247  1.00 45.11  ? 190  GLN B OE1 1 
ATOM   6472  N  NE2 . GLN B 1 190 ? 58.772 116.000 14.640  1.00 43.94  ? 190  GLN B NE2 1 
ATOM   6473  N  N   . VAL B 1 191 ? 60.496 119.603 17.843  1.00 37.95  ? 191  VAL B N   1 
ATOM   6474  C  CA  . VAL B 1 191 ? 61.887 119.582 18.251  1.00 37.67  ? 191  VAL B CA  1 
ATOM   6475  C  C   . VAL B 1 191 ? 62.486 118.227 17.891  1.00 37.98  ? 191  VAL B C   1 
ATOM   6476  O  O   . VAL B 1 191 ? 61.912 117.193 18.207  1.00 37.90  ? 191  VAL B O   1 
ATOM   6477  C  CB  . VAL B 1 191 ? 62.019 119.748 19.763  1.00 37.40  ? 191  VAL B CB  1 
ATOM   6478  C  CG1 . VAL B 1 191 ? 63.419 119.418 20.209  1.00 37.22  ? 191  VAL B CG1 1 
ATOM   6479  C  CG2 . VAL B 1 191 ? 61.651 121.135 20.182  1.00 37.32  ? 191  VAL B CG2 1 
ATOM   6480  N  N   . VAL B 1 192 ? 63.628 118.224 17.214  1.00 38.45  ? 192  VAL B N   1 
ATOM   6481  C  CA  . VAL B 1 192 ? 64.334 116.982 16.937  1.00 38.69  ? 192  VAL B CA  1 
ATOM   6482  C  C   . VAL B 1 192 ? 65.762 117.123 17.409  1.00 38.99  ? 192  VAL B C   1 
ATOM   6483  O  O   . VAL B 1 192 ? 66.458 118.020 16.964  1.00 38.94  ? 192  VAL B O   1 
ATOM   6484  C  CB  . VAL B 1 192 ? 64.393 116.668 15.445  1.00 38.57  ? 192  VAL B CB  1 
ATOM   6485  C  CG1 . VAL B 1 192 ? 65.090 115.358 15.241  1.00 38.69  ? 192  VAL B CG1 1 
ATOM   6486  C  CG2 . VAL B 1 192 ? 63.006 116.615 14.839  1.00 38.65  ? 192  VAL B CG2 1 
ATOM   6487  N  N   . ARG B 1 193 ? 66.207 116.265 18.317  1.00 39.74  ? 193  ARG B N   1 
ATOM   6488  C  CA  . ARG B 1 193 ? 67.613 116.313 18.722  1.00 40.75  ? 193  ARG B CA  1 
ATOM   6489  C  C   . ARG B 1 193 ? 68.379 115.374 17.803  1.00 41.55  ? 193  ARG B C   1 
ATOM   6490  O  O   . ARG B 1 193 ? 68.115 114.174 17.767  1.00 42.49  ? 193  ARG B O   1 
ATOM   6491  C  CB  . ARG B 1 193 ? 67.798 115.922 20.184  1.00 40.65  ? 193  ARG B CB  1 
ATOM   6492  C  CG  . ARG B 1 193 ? 69.190 116.194 20.719  1.00 39.92  ? 193  ARG B CG  1 
ATOM   6493  C  CD  . ARG B 1 193 ? 69.243 116.324 22.238  1.00 39.82  ? 193  ARG B CD  1 
ATOM   6494  N  NE  . ARG B 1 193 ? 70.594 116.576 22.743  1.00 39.79  ? 193  ARG B NE  1 
ATOM   6495  C  CZ  . ARG B 1 193 ? 71.093 116.001 23.828  1.00 39.52  ? 193  ARG B CZ  1 
ATOM   6496  N  NH1 . ARG B 1 193 ? 70.350 115.140 24.517  1.00 39.35  ? 193  ARG B NH1 1 
ATOM   6497  N  NH2 . ARG B 1 193 ? 72.331 116.275 24.222  1.00 38.48  ? 193  ARG B NH2 1 
ATOM   6498  N  N   . VAL B 1 194 ? 69.305 115.935 17.043  1.00 42.01  ? 194  VAL B N   1 
ATOM   6499  C  CA  . VAL B 1 194 ? 70.049 115.229 16.013  1.00 42.76  ? 194  VAL B CA  1 
ATOM   6500  C  C   . VAL B 1 194 ? 71.219 114.455 16.583  1.00 43.64  ? 194  VAL B C   1 
ATOM   6501  O  O   . VAL B 1 194 ? 71.629 114.729 17.696  1.00 44.01  ? 194  VAL B O   1 
ATOM   6502  C  CB  . VAL B 1 194 ? 70.607 116.288 15.076  1.00 42.72  ? 194  VAL B CB  1 
ATOM   6503  C  CG1 . VAL B 1 194 ? 71.926 115.871 14.467  1.00 42.47  ? 194  VAL B CG1 1 
ATOM   6504  C  CG2 . VAL B 1 194 ? 69.575 116.677 14.047  1.00 42.91  ? 194  VAL B CG2 1 
ATOM   6505  N  N   . LYS B 1 195 ? 71.775 113.489 15.853  1.00 44.74  ? 195  LYS B N   1 
ATOM   6506  C  CA  . LYS B 1 195 ? 72.976 112.834 16.384  1.00 45.70  ? 195  LYS B CA  1 
ATOM   6507  C  C   . LYS B 1 195 ? 74.161 112.465 15.478  1.00 46.78  ? 195  LYS B C   1 
ATOM   6508  O  O   . LYS B 1 195 ? 75.306 112.788 15.801  1.00 47.20  ? 195  LYS B O   1 
ATOM   6509  C  CB  . LYS B 1 195 ? 72.649 111.688 17.338  1.00 45.55  ? 195  LYS B CB  1 
ATOM   6510  C  CG  . LYS B 1 195 ? 71.708 110.632 16.846  1.00 44.87  ? 195  LYS B CG  1 
ATOM   6511  C  CD  . LYS B 1 195 ? 71.688 109.533 17.909  1.00 44.30  ? 195  LYS B CD  1 
ATOM   6512  C  CE  . LYS B 1 195 ? 71.726 110.151 19.315  1.00 43.42  ? 195  LYS B CE  1 
ATOM   6513  N  NZ  . LYS B 1 195 ? 72.758 109.540 20.192  1.00 41.65  ? 195  LYS B NZ  1 
ATOM   6514  N  N   . TYR B 1 196 ? 73.950 111.792 14.362  1.00 47.70  ? 196  TYR B N   1 
ATOM   6515  C  CA  . TYR B 1 196 ? 75.145 111.428 13.596  1.00 48.47  ? 196  TYR B CA  1 
ATOM   6516  C  C   . TYR B 1 196 ? 75.619 112.555 12.669  1.00 47.72  ? 196  TYR B C   1 
ATOM   6517  O  O   . TYR B 1 196 ? 74.843 113.130 11.921  1.00 48.17  ? 196  TYR B O   1 
ATOM   6518  C  CB  . TYR B 1 196 ? 74.985 110.071 12.872  1.00 49.35  ? 196  TYR B CB  1 
ATOM   6519  C  CG  . TYR B 1 196 ? 73.564 109.718 12.432  1.00 53.07  ? 196  TYR B CG  1 
ATOM   6520  C  CD1 . TYR B 1 196 ? 72.514 109.679 13.348  1.00 56.66  ? 196  TYR B CD1 1 
ATOM   6521  C  CD2 . TYR B 1 196 ? 73.282 109.398 11.098  1.00 56.15  ? 196  TYR B CD2 1 
ATOM   6522  C  CE1 . TYR B 1 196 ? 71.213 109.350 12.947  1.00 59.62  ? 196  TYR B CE1 1 
ATOM   6523  C  CE2 . TYR B 1 196 ? 71.987 109.065 10.679  1.00 58.86  ? 196  TYR B CE2 1 
ATOM   6524  C  CZ  . TYR B 1 196 ? 70.950 109.044 11.606  1.00 60.78  ? 196  TYR B CZ  1 
ATOM   6525  O  OH  . TYR B 1 196 ? 69.657 108.725 11.197  1.00 62.07  ? 196  TYR B OH  1 
ATOM   6526  N  N   . GLY B 1 197 ? 76.898 112.877 12.737  1.00 47.04  ? 197  GLY B N   1 
ATOM   6527  C  CA  . GLY B 1 197 ? 77.462 113.913 11.889  1.00 46.05  ? 197  GLY B CA  1 
ATOM   6528  C  C   . GLY B 1 197 ? 77.838 115.084 12.764  1.00 45.50  ? 197  GLY B C   1 
ATOM   6529  O  O   . GLY B 1 197 ? 77.414 115.125 13.926  1.00 46.19  ? 197  GLY B O   1 
ATOM   6530  N  N   . ASN B 1 198 ? 78.630 116.019 12.235  1.00 44.15  ? 198  ASN B N   1 
ATOM   6531  C  CA  . ASN B 1 198 ? 78.999 117.225 12.974  1.00 42.69  ? 198  ASN B CA  1 
ATOM   6532  C  C   . ASN B 1 198 ? 77.763 117.894 13.564  1.00 42.56  ? 198  ASN B C   1 
ATOM   6533  O  O   . ASN B 1 198 ? 76.679 117.849 12.984  1.00 42.71  ? 198  ASN B O   1 
ATOM   6534  C  CB  . ASN B 1 198 ? 79.683 118.205 12.045  1.00 42.30  ? 198  ASN B CB  1 
ATOM   6535  C  CG  . ASN B 1 198 ? 78.818 118.577 10.863  1.00 40.82  ? 198  ASN B CG  1 
ATOM   6536  O  OD1 . ASN B 1 198 ? 77.636 118.301 10.851  1.00 40.03  ? 198  ASN B OD1 1 
ATOM   6537  N  ND2 . ASN B 1 198 ? 79.411 119.201 9.860   1.00 40.11  ? 198  ASN B ND2 1 
ATOM   6538  N  N   . ALA B 1 199 ? 77.902 118.526 14.716  1.00 42.00  ? 199  ALA B N   1 
ATOM   6539  C  CA  . ALA B 1 199 ? 76.734 119.157 15.324  1.00 41.18  ? 199  ALA B CA  1 
ATOM   6540  C  C   . ALA B 1 199 ? 75.821 118.082 15.846  1.00 40.47  ? 199  ALA B C   1 
ATOM   6541  O  O   . ALA B 1 199 ? 74.614 118.243 15.831  1.00 40.61  ? 199  ALA B O   1 
ATOM   6542  C  CB  . ALA B 1 199 ? 75.993 119.996 14.303  1.00 41.15  ? 199  ALA B CB  1 
ATOM   6543  N  N   . ASP B 1 200 ? 76.415 116.992 16.310  1.00 39.90  ? 200  ASP B N   1 
ATOM   6544  C  CA  . ASP B 1 200 ? 75.681 115.838 16.808  1.00 39.51  ? 200  ASP B CA  1 
ATOM   6545  C  C   . ASP B 1 200 ? 74.751 116.094 17.998  1.00 39.57  ? 200  ASP B C   1 
ATOM   6546  O  O   . ASP B 1 200 ? 73.781 115.370 18.205  1.00 39.69  ? 200  ASP B O   1 
ATOM   6547  C  CB  . ASP B 1 200 ? 76.653 114.710 17.157  1.00 39.10  ? 200  ASP B CB  1 
ATOM   6548  C  CG  . ASP B 1 200 ? 76.335 114.069 18.484  1.00 38.38  ? 200  ASP B CG  1 
ATOM   6549  O  OD1 . ASP B 1 200 ? 76.691 114.678 19.511  1.00 38.92  ? 200  ASP B OD1 1 
ATOM   6550  O  OD2 . ASP B 1 200 ? 75.729 112.983 18.610  1.00 36.67  ? 200  ASP B OD2 1 
ATOM   6551  N  N   . GLY B 1 201 ? 75.020 117.114 18.788  1.00 39.31  ? 201  GLY B N   1 
ATOM   6552  C  CA  . GLY B 1 201 ? 74.167 117.306 19.942  1.00 39.20  ? 201  GLY B CA  1 
ATOM   6553  C  C   . GLY B 1 201 ? 72.994 118.256 19.811  1.00 38.84  ? 201  GLY B C   1 
ATOM   6554  O  O   . GLY B 1 201 ? 72.023 118.129 20.548  1.00 38.41  ? 201  GLY B O   1 
ATOM   6555  N  N   . GLU B 1 202 ? 73.069 119.195 18.878  1.00 38.76  ? 202  GLU B N   1 
ATOM   6556  C  CA  . GLU B 1 202 ? 72.079 120.263 18.840  1.00 39.08  ? 202  GLU B CA  1 
ATOM   6557  C  C   . GLU B 1 202 ? 70.697 119.902 18.346  1.00 38.59  ? 202  GLU B C   1 
ATOM   6558  O  O   . GLU B 1 202 ? 70.501 118.929 17.642  1.00 38.66  ? 202  GLU B O   1 
ATOM   6559  C  CB  . GLU B 1 202 ? 72.589 121.475 18.058  1.00 39.53  ? 202  GLU B CB  1 
ATOM   6560  C  CG  . GLU B 1 202 ? 73.486 122.379 18.870  1.00 40.94  ? 202  GLU B CG  1 
ATOM   6561  C  CD  . GLU B 1 202 ? 74.759 121.662 19.208  1.00 43.91  ? 202  GLU B CD  1 
ATOM   6562  O  OE1 . GLU B 1 202 ? 75.254 120.958 18.307  1.00 46.42  ? 202  GLU B OE1 1 
ATOM   6563  O  OE2 . GLU B 1 202 ? 75.246 121.768 20.353  1.00 44.90  ? 202  GLU B OE2 1 
ATOM   6564  N  N   . TYR B 1 203 ? 69.732 120.716 18.736  1.00 38.01  ? 203  TYR B N   1 
ATOM   6565  C  CA  . TYR B 1 203 ? 68.395 120.530 18.259  1.00 37.49  ? 203  TYR B CA  1 
ATOM   6566  C  C   . TYR B 1 203 ? 68.437 120.948 16.805  1.00 37.25  ? 203  TYR B C   1 
ATOM   6567  O  O   . TYR B 1 203 ? 69.238 121.797 16.428  1.00 37.22  ? 203  TYR B O   1 
ATOM   6568  C  CB  . TYR B 1 203 ? 67.451 121.453 19.000  1.00 37.46  ? 203  TYR B CB  1 
ATOM   6569  C  CG  . TYR B 1 203 ? 67.253 121.149 20.457  1.00 36.84  ? 203  TYR B CG  1 
ATOM   6570  C  CD1 . TYR B 1 203 ? 66.541 120.036 20.861  1.00 37.47  ? 203  TYR B CD1 1 
ATOM   6571  C  CD2 . TYR B 1 203 ? 67.733 121.999 21.428  1.00 36.57  ? 203  TYR B CD2 1 
ATOM   6572  C  CE1 . TYR B 1 203 ? 66.325 119.764 22.199  1.00 36.82  ? 203  TYR B CE1 1 
ATOM   6573  C  CE2 . TYR B 1 203 ? 67.525 121.738 22.764  1.00 37.31  ? 203  TYR B CE2 1 
ATOM   6574  C  CZ  . TYR B 1 203 ? 66.815 120.618 23.144  1.00 36.76  ? 203  TYR B CZ  1 
ATOM   6575  O  OH  . TYR B 1 203 ? 66.599 120.352 24.470  1.00 35.97  ? 203  TYR B OH  1 
ATOM   6576  N  N   . CYS B 1 204 ? 67.594 120.333 15.986  1.00 36.95  ? 204  CYS B N   1 
ATOM   6577  C  CA  . CYS B 1 204 ? 67.478 120.718 14.595  1.00 36.43  ? 204  CYS B CA  1 
ATOM   6578  C  C   . CYS B 1 204 ? 67.034 122.159 14.637  1.00 36.14  ? 204  CYS B C   1 
ATOM   6579  O  O   . CYS B 1 204 ? 66.575 122.630 15.672  1.00 35.99  ? 204  CYS B O   1 
ATOM   6580  C  CB  . CYS B 1 204 ? 66.395 119.889 13.898  1.00 36.67  ? 204  CYS B CB  1 
ATOM   6581  S  SG  . CYS B 1 204 ? 66.829 118.190 13.456  1.00 35.80  ? 204  CYS B SG  1 
ATOM   6582  N  N   . LYS B 1 205 ? 67.164 122.860 13.521  1.00 35.96  ? 205  LYS B N   1 
ATOM   6583  C  CA  . LYS B 1 205 ? 66.718 124.240 13.447  1.00 35.98  ? 205  LYS B CA  1 
ATOM   6584  C  C   . LYS B 1 205 ? 65.685 124.417 12.338  1.00 35.96  ? 205  LYS B C   1 
ATOM   6585  O  O   . LYS B 1 205 ? 66.032 124.614 11.184  1.00 36.09  ? 205  LYS B O   1 
ATOM   6586  C  CB  . LYS B 1 205 ? 67.903 125.171 13.212  1.00 35.92  ? 205  LYS B CB  1 
ATOM   6587  C  CG  . LYS B 1 205 ? 67.511 126.578 12.791  1.00 36.60  ? 205  LYS B CG  1 
ATOM   6588  C  CD  . LYS B 1 205 ? 67.041 127.400 13.975  1.00 36.96  ? 205  LYS B CD  1 
ATOM   6589  C  CE  . LYS B 1 205 ? 68.223 127.807 14.836  1.00 37.47  ? 205  LYS B CE  1 
ATOM   6590  N  NZ  . LYS B 1 205 ? 67.806 128.187 16.210  1.00 38.52  ? 205  LYS B NZ  1 
ATOM   6591  N  N   . PHE B 1 206 ? 64.410 124.312 12.673  1.00 35.92  ? 206  PHE B N   1 
ATOM   6592  C  CA  . PHE B 1 206 ? 63.387 124.552 11.677  1.00 36.00  ? 206  PHE B CA  1 
ATOM   6593  C  C   . PHE B 1 206 ? 62.881 125.942 11.959  1.00 36.04  ? 206  PHE B C   1 
ATOM   6594  O  O   . PHE B 1 206 ? 62.658 126.294 13.111  1.00 36.51  ? 206  PHE B O   1 
ATOM   6595  C  CB  . PHE B 1 206 ? 62.235 123.556 11.801  1.00 36.21  ? 206  PHE B CB  1 
ATOM   6596  C  CG  . PHE B 1 206 ? 62.671 122.127 11.925  1.00 35.95  ? 206  PHE B CG  1 
ATOM   6597  C  CD1 . PHE B 1 206 ? 63.548 121.573 11.021  1.00 36.30  ? 206  PHE B CD1 1 
ATOM   6598  C  CD2 . PHE B 1 206 ? 62.191 121.337 12.944  1.00 35.69  ? 206  PHE B CD2 1 
ATOM   6599  C  CE1 . PHE B 1 206 ? 63.948 120.255 11.145  1.00 36.45  ? 206  PHE B CE1 1 
ATOM   6600  C  CE2 . PHE B 1 206 ? 62.590 120.033 13.066  1.00 35.98  ? 206  PHE B CE2 1 
ATOM   6601  C  CZ  . PHE B 1 206 ? 63.466 119.488 12.163  1.00 35.45  ? 206  PHE B CZ  1 
ATOM   6602  N  N   . PRO B 1 207 ? 62.681 126.733 10.922  1.00 35.89  ? 207  PRO B N   1 
ATOM   6603  C  CA  . PRO B 1 207 ? 62.893 126.306 9.548   1.00 35.96  ? 207  PRO B CA  1 
ATOM   6604  C  C   . PRO B 1 207 ? 64.368 126.362 9.210   1.00 35.82  ? 207  PRO B C   1 
ATOM   6605  O  O   . PRO B 1 207 ? 65.107 127.039 9.931   1.00 36.05  ? 207  PRO B O   1 
ATOM   6606  C  CB  . PRO B 1 207 ? 62.189 127.416 8.782   1.00 35.89  ? 207  PRO B CB  1 
ATOM   6607  C  CG  . PRO B 1 207 ? 62.600 128.586 9.573   1.00 35.90  ? 207  PRO B CG  1 
ATOM   6608  C  CD  . PRO B 1 207 ? 62.248 128.138 10.980  1.00 35.99  ? 207  PRO B CD  1 
ATOM   6609  N  N   . PHE B 1 208 ? 64.787 125.646 8.165   1.00 35.40  ? 208  PHE B N   1 
ATOM   6610  C  CA  . PHE B 1 208 ? 66.150 125.764 7.645   1.00 35.08  ? 208  PHE B CA  1 
ATOM   6611  C  C   . PHE B 1 208 ? 66.106 125.957 6.137   1.00 35.09  ? 208  PHE B C   1 
ATOM   6612  O  O   . PHE B 1 208 ? 65.106 125.654 5.491   1.00 35.21  ? 208  PHE B O   1 
ATOM   6613  C  CB  . PHE B 1 208 ? 67.092 124.624 8.085   1.00 35.01  ? 208  PHE B CB  1 
ATOM   6614  C  CG  . PHE B 1 208 ? 66.732 123.253 7.558   1.00 34.28  ? 208  PHE B CG  1 
ATOM   6615  C  CD1 . PHE B 1 208 ? 67.208 122.816 6.339   1.00 33.17  ? 208  PHE B CD1 1 
ATOM   6616  C  CD2 . PHE B 1 208 ? 65.970 122.383 8.316   1.00 34.47  ? 208  PHE B CD2 1 
ATOM   6617  C  CE1 . PHE B 1 208 ? 66.901 121.562 5.862   1.00 32.20  ? 208  PHE B CE1 1 
ATOM   6618  C  CE2 . PHE B 1 208 ? 65.660 121.122 7.843   1.00 33.78  ? 208  PHE B CE2 1 
ATOM   6619  C  CZ  . PHE B 1 208 ? 66.136 120.714 6.610   1.00 33.24  ? 208  PHE B CZ  1 
ATOM   6620  N  N   . LEU B 1 209 ? 67.187 126.469 5.574   1.00 35.08  ? 209  LEU B N   1 
ATOM   6621  C  CA  . LEU B 1 209 ? 67.187 126.803 4.158   1.00 35.15  ? 209  LEU B CA  1 
ATOM   6622  C  C   . LEU B 1 209 ? 68.204 126.010 3.347   1.00 35.12  ? 209  LEU B C   1 
ATOM   6623  O  O   . LEU B 1 209 ? 69.413 126.208 3.475   1.00 35.34  ? 209  LEU B O   1 
ATOM   6624  C  CB  . LEU B 1 209 ? 67.415 128.313 3.988   1.00 35.20  ? 209  LEU B CB  1 
ATOM   6625  C  CG  . LEU B 1 209 ? 67.259 128.992 2.624   1.00 35.00  ? 209  LEU B CG  1 
ATOM   6626  C  CD1 . LEU B 1 209 ? 66.168 128.362 1.770   1.00 34.58  ? 209  LEU B CD1 1 
ATOM   6627  C  CD2 . LEU B 1 209 ? 66.981 130.465 2.845   1.00 35.07  ? 209  LEU B CD2 1 
ATOM   6628  N  N   . PHE B 1 210 ? 67.699 125.124 2.501   1.00 34.88  ? 210  PHE B N   1 
ATOM   6629  C  CA  . PHE B 1 210 ? 68.542 124.333 1.623   1.00 34.85  ? 210  PHE B CA  1 
ATOM   6630  C  C   . PHE B 1 210 ? 67.969 124.470 0.220   1.00 34.83  ? 210  PHE B C   1 
ATOM   6631  O  O   . PHE B 1 210 ? 66.766 124.362 0.039   1.00 35.15  ? 210  PHE B O   1 
ATOM   6632  C  CB  . PHE B 1 210 ? 68.549 122.871 2.092   1.00 34.74  ? 210  PHE B CB  1 
ATOM   6633  C  CG  . PHE B 1 210 ? 69.269 121.916 1.163   1.00 34.70  ? 210  PHE B CG  1 
ATOM   6634  C  CD1 . PHE B 1 210 ? 70.651 121.910 1.078   1.00 34.29  ? 210  PHE B CD1 1 
ATOM   6635  C  CD2 . PHE B 1 210 ? 68.556 121.002 0.398   1.00 34.15  ? 210  PHE B CD2 1 
ATOM   6636  C  CE1 . PHE B 1 210 ? 71.302 121.026 0.240   1.00 33.69  ? 210  PHE B CE1 1 
ATOM   6637  C  CE2 . PHE B 1 210 ? 69.207 120.125 -0.446  1.00 33.84  ? 210  PHE B CE2 1 
ATOM   6638  C  CZ  . PHE B 1 210 ? 70.583 120.136 -0.522  1.00 33.34  ? 210  PHE B CZ  1 
ATOM   6639  N  N   . ASN B 1 211 ? 68.811 124.759 -0.763  1.00 34.71  ? 211  ASN B N   1 
ATOM   6640  C  CA  . ASN B 1 211 ? 68.350 124.857 -2.144  1.00 34.91  ? 211  ASN B CA  1 
ATOM   6641  C  C   . ASN B 1 211 ? 67.169 125.768 -2.442  1.00 35.02  ? 211  ASN B C   1 
ATOM   6642  O  O   . ASN B 1 211 ? 66.269 125.379 -3.177  1.00 34.99  ? 211  ASN B O   1 
ATOM   6643  C  CB  . ASN B 1 211 ? 68.003 123.477 -2.665  1.00 34.91  ? 211  ASN B CB  1 
ATOM   6644  C  CG  . ASN B 1 211 ? 69.103 122.891 -3.480  1.00 35.43  ? 211  ASN B CG  1 
ATOM   6645  O  OD1 . ASN B 1 211 ? 69.687 123.566 -4.331  1.00 35.84  ? 211  ASN B OD1 1 
ATOM   6646  N  ND2 . ASN B 1 211 ? 69.410 121.628 -3.231  1.00 36.43  ? 211  ASN B ND2 1 
ATOM   6647  N  N   . GLY B 1 212 ? 67.172 126.979 -1.909  1.00 35.40  ? 212  GLY B N   1 
ATOM   6648  C  CA  . GLY B 1 212 ? 66.062 127.880 -2.149  1.00 36.05  ? 212  GLY B CA  1 
ATOM   6649  C  C   . GLY B 1 212 ? 64.728 127.243 -1.798  1.00 36.41  ? 212  GLY B C   1 
ATOM   6650  O  O   . GLY B 1 212 ? 63.764 127.335 -2.559  1.00 36.84  ? 212  GLY B O   1 
ATOM   6651  N  N   . LYS B 1 213 ? 64.678 126.578 -0.653  1.00 36.36  ? 213  LYS B N   1 
ATOM   6652  C  CA  . LYS B 1 213 ? 63.458 125.950 -0.188  1.00 36.74  ? 213  LYS B CA  1 
ATOM   6653  C  C   . LYS B 1 213 ? 63.611 125.802 1.304   1.00 36.72  ? 213  LYS B C   1 
ATOM   6654  O  O   . LYS B 1 213 ? 64.668 125.403 1.789   1.00 36.85  ? 213  LYS B O   1 
ATOM   6655  C  CB  . LYS B 1 213 ? 63.237 124.587 -0.843  1.00 36.96  ? 213  LYS B CB  1 
ATOM   6656  C  CG  . LYS B 1 213 ? 61.779 124.121 -0.799  1.00 38.80  ? 213  LYS B CG  1 
ATOM   6657  C  CD  . LYS B 1 213 ? 61.475 122.975 -1.770  1.00 41.47  ? 213  LYS B CD  1 
ATOM   6658  C  CE  . LYS B 1 213 ? 61.255 121.653 -1.031  1.00 43.69  ? 213  LYS B CE  1 
ATOM   6659  N  NZ  . LYS B 1 213 ? 61.119 120.479 -1.967  1.00 45.62  ? 213  LYS B NZ  1 
ATOM   6660  N  N   . GLU B 1 214 ? 62.572 126.149 2.046   1.00 36.58  ? 214  GLU B N   1 
ATOM   6661  C  CA  . GLU B 1 214 ? 62.684 126.086 3.482   1.00 36.71  ? 214  GLU B CA  1 
ATOM   6662  C  C   . GLU B 1 214 ? 62.112 124.783 3.981   1.00 36.60  ? 214  GLU B C   1 
ATOM   6663  O  O   . GLU B 1 214 ? 61.117 124.281 3.460   1.00 36.82  ? 214  GLU B O   1 
ATOM   6664  C  CB  . GLU B 1 214 ? 62.017 127.293 4.137   1.00 36.99  ? 214  GLU B CB  1 
ATOM   6665  C  CG  . GLU B 1 214 ? 62.903 128.534 4.186   1.00 38.56  ? 214  GLU B CG  1 
ATOM   6666  C  CD  . GLU B 1 214 ? 62.229 129.720 4.860   1.00 40.79  ? 214  GLU B CD  1 
ATOM   6667  O  OE1 . GLU B 1 214 ? 60.977 129.771 4.871   1.00 42.31  ? 214  GLU B OE1 1 
ATOM   6668  O  OE2 . GLU B 1 214 ? 62.948 130.603 5.379   1.00 40.70  ? 214  GLU B OE2 1 
ATOM   6669  N  N   . TYR B 1 215 ? 62.761 124.221 4.986   1.00 36.29  ? 215  TYR B N   1 
ATOM   6670  C  CA  . TYR B 1 215 ? 62.355 122.942 5.514   1.00 35.84  ? 215  TYR B CA  1 
ATOM   6671  C  C   . TYR B 1 215 ? 62.012 123.109 6.980   1.00 36.17  ? 215  TYR B C   1 
ATOM   6672  O  O   . TYR B 1 215 ? 62.873 123.469 7.777   1.00 36.23  ? 215  TYR B O   1 
ATOM   6673  C  CB  . TYR B 1 215 ? 63.505 121.951 5.348   1.00 35.60  ? 215  TYR B CB  1 
ATOM   6674  C  CG  . TYR B 1 215 ? 63.698 121.439 3.935   1.00 34.22  ? 215  TYR B CG  1 
ATOM   6675  C  CD1 . TYR B 1 215 ? 62.948 120.378 3.463   1.00 33.34  ? 215  TYR B CD1 1 
ATOM   6676  C  CD2 . TYR B 1 215 ? 64.629 122.011 3.080   1.00 33.10  ? 215  TYR B CD2 1 
ATOM   6677  C  CE1 . TYR B 1 215 ? 63.109 119.900 2.178   1.00 32.92  ? 215  TYR B CE1 1 
ATOM   6678  C  CE2 . TYR B 1 215 ? 64.796 121.543 1.783   1.00 32.21  ? 215  TYR B CE2 1 
ATOM   6679  C  CZ  . TYR B 1 215 ? 64.030 120.481 1.342   1.00 32.57  ? 215  TYR B CZ  1 
ATOM   6680  O  OH  . TYR B 1 215 ? 64.166 119.983 0.065   1.00 31.69  ? 215  TYR B OH  1 
ATOM   6681  N  N   . ASN B 1 216 ? 60.758 122.850 7.340   1.00 36.46  ? 216  ASN B N   1 
ATOM   6682  C  CA  . ASN B 1 216 ? 60.336 122.975 8.739   1.00 36.71  ? 216  ASN B CA  1 
ATOM   6683  C  C   . ASN B 1 216 ? 60.279 121.661 9.519   1.00 36.59  ? 216  ASN B C   1 
ATOM   6684  O  O   . ASN B 1 216 ? 59.856 121.627 10.674  1.00 36.53  ? 216  ASN B O   1 
ATOM   6685  C  CB  . ASN B 1 216 ? 59.019 123.744 8.857   1.00 36.83  ? 216  ASN B CB  1 
ATOM   6686  C  CG  . ASN B 1 216 ? 59.171 125.214 8.492   1.00 37.86  ? 216  ASN B CG  1 
ATOM   6687  O  OD1 . ASN B 1 216 ? 59.723 126.020 9.264   1.00 37.66  ? 216  ASN B OD1 1 
ATOM   6688  N  ND2 . ASN B 1 216 ? 58.689 125.572 7.304   1.00 39.30  ? 216  ASN B ND2 1 
ATOM   6689  N  N   . SER B 1 217 ? 60.711 120.582 8.878   1.00 36.42  ? 217  SER B N   1 
ATOM   6690  C  CA  . SER B 1 217 ? 60.801 119.286 9.525   1.00 36.22  ? 217  SER B CA  1 
ATOM   6691  C  C   . SER B 1 217 ? 61.974 118.562 8.910   1.00 36.60  ? 217  SER B C   1 
ATOM   6692  O  O   . SER B 1 217 ? 62.568 119.043 7.947   1.00 36.95  ? 217  SER B O   1 
ATOM   6693  C  CB  . SER B 1 217 ? 59.560 118.475 9.253   1.00 36.07  ? 217  SER B CB  1 
ATOM   6694  O  OG  . SER B 1 217 ? 59.671 117.864 7.992   1.00 35.30  ? 217  SER B OG  1 
ATOM   6695  N  N   . CYS B 1 218 ? 62.314 117.402 9.452   1.00 36.73  ? 218  CYS B N   1 
ATOM   6696  C  CA  . CYS B 1 218 ? 63.405 116.619 8.902   1.00 37.02  ? 218  CYS B CA  1 
ATOM   6697  C  C   . CYS B 1 218 ? 63.033 116.127 7.531   1.00 37.09  ? 218  CYS B C   1 
ATOM   6698  O  O   . CYS B 1 218 ? 61.865 115.882 7.263   1.00 37.77  ? 218  CYS B O   1 
ATOM   6699  C  CB  . CYS B 1 218 ? 63.663 115.421 9.784   1.00 36.99  ? 218  CYS B CB  1 
ATOM   6700  S  SG  . CYS B 1 218 ? 64.204 115.896 11.423  1.00 38.57  ? 218  CYS B SG  1 
ATOM   6701  N  N   . THR B 1 219 ? 64.023 115.965 6.667   1.00 37.15  ? 219  THR B N   1 
ATOM   6702  C  CA  . THR B 1 219 ? 63.786 115.465 5.321   1.00 37.30  ? 219  THR B CA  1 
ATOM   6703  C  C   . THR B 1 219 ? 64.851 114.461 4.899   1.00 37.54  ? 219  THR B C   1 
ATOM   6704  O  O   . THR B 1 219 ? 65.909 114.349 5.526   1.00 37.77  ? 219  THR B O   1 
ATOM   6705  C  CB  . THR B 1 219 ? 63.778 116.621 4.318   1.00 37.43  ? 219  THR B CB  1 
ATOM   6706  O  OG1 . THR B 1 219 ? 63.638 116.097 2.990   1.00 37.16  ? 219  THR B OG1 1 
ATOM   6707  C  CG2 . THR B 1 219 ? 65.145 117.306 4.287   1.00 36.97  ? 219  THR B CG2 1 
ATOM   6708  N  N   . ASP B 1 220 ? 64.567 113.728 3.830   1.00 37.41  ? 220  ASP B N   1 
ATOM   6709  C  CA  . ASP B 1 220 ? 65.532 112.796 3.286   1.00 37.35  ? 220  ASP B CA  1 
ATOM   6710  C  C   . ASP B 1 220 ? 65.916 113.336 1.936   1.00 37.23  ? 220  ASP B C   1 
ATOM   6711  O  O   . ASP B 1 220 ? 66.490 112.634 1.111   1.00 37.10  ? 220  ASP B O   1 
ATOM   6712  C  CB  . ASP B 1 220 ? 64.937 111.394 3.155   1.00 37.54  ? 220  ASP B CB  1 
ATOM   6713  C  CG  . ASP B 1 220 ? 63.840 111.317 2.113   1.00 38.40  ? 220  ASP B CG  1 
ATOM   6714  O  OD1 . ASP B 1 220 ? 63.019 112.256 2.064   1.00 39.26  ? 220  ASP B OD1 1 
ATOM   6715  O  OD2 . ASP B 1 220 ? 63.711 110.359 1.307   1.00 38.91  ? 220  ASP B OD2 1 
ATOM   6716  N  N   . THR B 1 221 ? 65.566 114.598 1.711   1.00 37.35  ? 221  THR B N   1 
ATOM   6717  C  CA  . THR B 1 221 ? 65.879 115.262 0.458   1.00 37.29  ? 221  THR B CA  1 
ATOM   6718  C  C   . THR B 1 221 ? 67.375 115.214 0.314   1.00 37.15  ? 221  THR B C   1 
ATOM   6719  O  O   . THR B 1 221 ? 68.100 115.391 1.279   1.00 37.33  ? 221  THR B O   1 
ATOM   6720  C  CB  . THR B 1 221 ? 65.398 116.713 0.472   1.00 37.38  ? 221  THR B CB  1 
ATOM   6721  O  OG1 . THR B 1 221 ? 65.252 117.173 -0.875  1.00 38.09  ? 221  THR B OG1 1 
ATOM   6722  C  CG2 . THR B 1 221 ? 66.463 117.641 1.055   1.00 37.00  ? 221  THR B CG2 1 
ATOM   6723  N  N   . GLY B 1 222 ? 67.854 114.953 -0.884  1.00 37.12  ? 222  GLY B N   1 
ATOM   6724  C  CA  . GLY B 1 222 ? 69.282 114.815 -1.045  1.00 37.39  ? 222  GLY B CA  1 
ATOM   6725  C  C   . GLY B 1 222 ? 69.661 113.365 -0.828  1.00 37.33  ? 222  GLY B C   1 
ATOM   6726  O  O   . GLY B 1 222 ? 70.401 112.784 -1.618  1.00 37.73  ? 222  GLY B O   1 
ATOM   6727  N  N   . ARG B 1 223 ? 69.128 112.760 0.224   1.00 37.01  ? 223  ARG B N   1 
ATOM   6728  C  CA  . ARG B 1 223 ? 69.445 111.370 0.521   1.00 36.70  ? 223  ARG B CA  1 
ATOM   6729  C  C   . ARG B 1 223 ? 68.945 110.383 -0.516  1.00 36.73  ? 223  ARG B C   1 
ATOM   6730  O  O   . ARG B 1 223 ? 67.942 110.605 -1.190  1.00 36.72  ? 223  ARG B O   1 
ATOM   6731  C  CB  . ARG B 1 223 ? 68.894 110.963 1.884   1.00 36.59  ? 223  ARG B CB  1 
ATOM   6732  C  CG  . ARG B 1 223 ? 69.580 111.647 3.032   1.00 36.02  ? 223  ARG B CG  1 
ATOM   6733  C  CD  . ARG B 1 223 ? 71.052 111.753 2.823   1.00 35.07  ? 223  ARG B CD  1 
ATOM   6734  N  NE  . ARG B 1 223 ? 71.643 110.432 2.754   1.00 33.33  ? 223  ARG B NE  1 
ATOM   6735  C  CZ  . ARG B 1 223 ? 72.456 109.964 3.671   1.00 32.98  ? 223  ARG B CZ  1 
ATOM   6736  N  NH1 . ARG B 1 223 ? 72.771 110.721 4.711   1.00 32.89  ? 223  ARG B NH1 1 
ATOM   6737  N  NH2 . ARG B 1 223 ? 72.964 108.750 3.548   1.00 32.91  ? 223  ARG B NH2 1 
ATOM   6738  N  N   . SER B 1 224 ? 69.661 109.271 -0.609  1.00 36.93  ? 224  SER B N   1 
ATOM   6739  C  CA  . SER B 1 224 ? 69.313 108.175 -1.505  1.00 36.84  ? 224  SER B CA  1 
ATOM   6740  C  C   . SER B 1 224 ? 68.835 106.998 -0.678  1.00 36.59  ? 224  SER B C   1 
ATOM   6741  O  O   . SER B 1 224 ? 68.103 106.142 -1.167  1.00 36.56  ? 224  SER B O   1 
ATOM   6742  C  CB  . SER B 1 224 ? 70.548 107.716 -2.281  1.00 36.99  ? 224  SER B CB  1 
ATOM   6743  O  OG  . SER B 1 224 ? 71.381 106.896 -1.463  1.00 36.38  ? 224  SER B OG  1 
ATOM   6744  N  N   . ASP B 1 225 ? 69.251 106.976 0.585   1.00 36.08  ? 225  ASP B N   1 
ATOM   6745  C  CA  . ASP B 1 225 ? 69.018 105.827 1.439   1.00 35.71  ? 225  ASP B CA  1 
ATOM   6746  C  C   . ASP B 1 225 ? 67.983 105.966 2.531   1.00 35.54  ? 225  ASP B C   1 
ATOM   6747  O  O   . ASP B 1 225 ? 68.128 105.338 3.567   1.00 35.99  ? 225  ASP B O   1 
ATOM   6748  C  CB  . ASP B 1 225 ? 70.325 105.420 2.102   1.00 35.76  ? 225  ASP B CB  1 
ATOM   6749  C  CG  . ASP B 1 225 ? 70.951 106.548 2.865   1.00 35.54  ? 225  ASP B CG  1 
ATOM   6750  O  OD1 . ASP B 1 225 ? 70.369 107.646 2.868   1.00 35.57  ? 225  ASP B OD1 1 
ATOM   6751  O  OD2 . ASP B 1 225 ? 72.028 106.435 3.480   1.00 36.18  ? 225  ASP B OD2 1 
ATOM   6752  N  N   . GLY B 1 226 ? 66.960 106.783 2.328   1.00 35.15  ? 226  GLY B N   1 
ATOM   6753  C  CA  . GLY B 1 226 ? 65.895 106.904 3.310   1.00 34.54  ? 226  GLY B CA  1 
ATOM   6754  C  C   . GLY B 1 226 ? 66.161 107.675 4.597   1.00 34.35  ? 226  GLY B C   1 
ATOM   6755  O  O   . GLY B 1 226 ? 65.215 108.075 5.288   1.00 34.86  ? 226  GLY B O   1 
ATOM   6756  N  N   . PHE B 1 227 ? 67.423 107.900 4.935   1.00 33.62  ? 227  PHE B N   1 
ATOM   6757  C  CA  . PHE B 1 227 ? 67.740 108.594 6.179   1.00 33.15  ? 227  PHE B CA  1 
ATOM   6758  C  C   . PHE B 1 227 ? 67.218 110.022 6.262   1.00 32.89  ? 227  PHE B C   1 
ATOM   6759  O  O   . PHE B 1 227 ? 67.170 110.743 5.283   1.00 32.85  ? 227  PHE B O   1 
ATOM   6760  C  CB  . PHE B 1 227 ? 69.241 108.543 6.463   1.00 33.22  ? 227  PHE B CB  1 
ATOM   6761  C  CG  . PHE B 1 227 ? 69.687 107.225 6.979   1.00 32.56  ? 227  PHE B CG  1 
ATOM   6762  C  CD1 . PHE B 1 227 ? 69.520 106.900 8.310   1.00 31.99  ? 227  PHE B CD1 1 
ATOM   6763  C  CD2 . PHE B 1 227 ? 70.222 106.289 6.131   1.00 31.88  ? 227  PHE B CD2 1 
ATOM   6764  C  CE1 . PHE B 1 227 ? 69.902 105.679 8.785   1.00 30.76  ? 227  PHE B CE1 1 
ATOM   6765  C  CE2 . PHE B 1 227 ? 70.599 105.067 6.605   1.00 31.41  ? 227  PHE B CE2 1 
ATOM   6766  C  CZ  . PHE B 1 227 ? 70.438 104.761 7.932   1.00 30.65  ? 227  PHE B CZ  1 
ATOM   6767  N  N   . LEU B 1 228 ? 66.818 110.424 7.453   1.00 32.63  ? 228  LEU B N   1 
ATOM   6768  C  CA  . LEU B 1 228 ? 66.306 111.757 7.649   1.00 32.39  ? 228  LEU B CA  1 
ATOM   6769  C  C   . LEU B 1 228 ? 67.450 112.579 8.205   1.00 32.94  ? 228  LEU B C   1 
ATOM   6770  O  O   . LEU B 1 228 ? 68.318 112.050 8.908   1.00 33.52  ? 228  LEU B O   1 
ATOM   6771  C  CB  . LEU B 1 228 ? 65.129 111.720 8.629   1.00 32.22  ? 228  LEU B CB  1 
ATOM   6772  C  CG  . LEU B 1 228 ? 63.695 111.448 8.130   1.00 30.11  ? 228  LEU B CG  1 
ATOM   6773  C  CD1 . LEU B 1 228 ? 63.685 110.758 6.797   1.00 30.17  ? 228  LEU B CD1 1 
ATOM   6774  C  CD2 . LEU B 1 228 ? 62.909 110.645 9.146   1.00 26.97  ? 228  LEU B CD2 1 
ATOM   6775  N  N   . TRP B 1 229 ? 67.479 113.865 7.873   1.00 33.02  ? 229  TRP B N   1 
ATOM   6776  C  CA  . TRP B 1 229 ? 68.506 114.764 8.392   1.00 32.97  ? 229  TRP B CA  1 
ATOM   6777  C  C   . TRP B 1 229 ? 67.915 116.167 8.462   1.00 33.45  ? 229  TRP B C   1 
ATOM   6778  O  O   . TRP B 1 229 ? 66.818 116.395 7.977   1.00 33.77  ? 229  TRP B O   1 
ATOM   6779  C  CB  . TRP B 1 229 ? 69.742 114.755 7.498   1.00 32.46  ? 229  TRP B CB  1 
ATOM   6780  C  CG  . TRP B 1 229 ? 69.493 115.372 6.153   1.00 31.41  ? 229  TRP B CG  1 
ATOM   6781  C  CD1 . TRP B 1 229 ? 68.933 114.765 5.069   1.00 30.71  ? 229  TRP B CD1 1 
ATOM   6782  C  CD2 . TRP B 1 229 ? 69.787 116.720 5.747   1.00 29.65  ? 229  TRP B CD2 1 
ATOM   6783  N  NE1 . TRP B 1 229 ? 68.863 115.644 4.016   1.00 29.89  ? 229  TRP B NE1 1 
ATOM   6784  C  CE2 . TRP B 1 229 ? 69.382 116.851 4.403   1.00 28.71  ? 229  TRP B CE2 1 
ATOM   6785  C  CE3 . TRP B 1 229 ? 70.357 117.827 6.382   1.00 28.21  ? 229  TRP B CE3 1 
ATOM   6786  C  CZ2 . TRP B 1 229 ? 69.520 118.039 3.689   1.00 26.99  ? 229  TRP B CZ2 1 
ATOM   6787  C  CZ3 . TRP B 1 229 ? 70.495 119.002 5.668   1.00 27.62  ? 229  TRP B CZ3 1 
ATOM   6788  C  CH2 . TRP B 1 229 ? 70.077 119.099 4.336   1.00 26.72  ? 229  TRP B CH2 1 
ATOM   6789  N  N   . CYS B 1 230 ? 68.632 117.106 9.061   1.00 33.71  ? 230  CYS B N   1 
ATOM   6790  C  CA  . CYS B 1 230 ? 68.152 118.470 9.139   1.00 33.99  ? 230  CYS B CA  1 
ATOM   6791  C  C   . CYS B 1 230 ? 69.373 119.315 9.406   1.00 33.81  ? 230  CYS B C   1 
ATOM   6792  O  O   . CYS B 1 230 ? 70.352 118.803 9.923   1.00 33.77  ? 230  CYS B O   1 
ATOM   6793  C  CB  . CYS B 1 230 ? 67.199 118.597 10.311  1.00 34.12  ? 230  CYS B CB  1 
ATOM   6794  S  SG  . CYS B 1 230 ? 68.079 118.308 11.850  1.00 35.91  ? 230  CYS B SG  1 
ATOM   6795  N  N   . SER B 1 231 ? 69.334 120.598 9.059   1.00 33.64  ? 231  SER B N   1 
ATOM   6796  C  CA  . SER B 1 231 ? 70.477 121.451 9.331   1.00 33.58  ? 231  SER B CA  1 
ATOM   6797  C  C   . SER B 1 231 ? 70.346 122.018 10.741  1.00 33.65  ? 231  SER B C   1 
ATOM   6798  O  O   . SER B 1 231 ? 69.239 122.217 11.229  1.00 33.96  ? 231  SER B O   1 
ATOM   6799  C  CB  . SER B 1 231 ? 70.578 122.567 8.307   1.00 33.50  ? 231  SER B CB  1 
ATOM   6800  O  OG  . SER B 1 231 ? 70.295 123.811 8.898   1.00 33.73  ? 231  SER B OG  1 
ATOM   6801  N  N   . THR B 1 232 ? 71.472 122.273 11.398  1.00 33.56  ? 232  THR B N   1 
ATOM   6802  C  CA  . THR B 1 232 ? 71.471 122.735 12.787  1.00 33.23  ? 232  THR B CA  1 
ATOM   6803  C  C   . THR B 1 232 ? 71.248 124.230 12.948  1.00 33.23  ? 232  THR B C   1 
ATOM   6804  O  O   . THR B 1 232 ? 71.053 124.721 14.062  1.00 33.28  ? 232  THR B O   1 
ATOM   6805  C  CB  . THR B 1 232 ? 72.793 122.345 13.457  1.00 33.16  ? 232  THR B CB  1 
ATOM   6806  O  OG1 . THR B 1 232 ? 72.631 121.083 14.105  1.00 32.94  ? 232  THR B OG1 1 
ATOM   6807  C  CG2 . THR B 1 232 ? 73.117 123.292 14.609  1.00 33.29  ? 232  THR B CG2 1 
ATOM   6808  N  N   . THR B 1 233 ? 71.308 124.955 11.839  1.00 33.09  ? 233  THR B N   1 
ATOM   6809  C  CA  . THR B 1 233 ? 71.108 126.391 11.863  1.00 33.05  ? 233  THR B CA  1 
ATOM   6810  C  C   . THR B 1 233 ? 70.338 126.759 10.617  1.00 33.23  ? 233  THR B C   1 
ATOM   6811  O  O   . THR B 1 233 ? 70.306 125.983 9.666   1.00 33.43  ? 233  THR B O   1 
ATOM   6812  C  CB  . THR B 1 233 ? 72.445 127.121 11.829  1.00 32.93  ? 233  THR B CB  1 
ATOM   6813  O  OG1 . THR B 1 233 ? 72.958 127.088 10.494  1.00 33.00  ? 233  THR B OG1 1 
ATOM   6814  C  CG2 . THR B 1 233 ? 73.493 126.386 12.636  1.00 32.53  ? 233  THR B CG2 1 
ATOM   6815  N  N   . TYR B 1 234 ? 69.743 127.947 10.604  1.00 33.29  ? 234  TYR B N   1 
ATOM   6816  C  CA  . TYR B 1 234 ? 68.992 128.389 9.432   1.00 33.23  ? 234  TYR B CA  1 
ATOM   6817  C  C   . TYR B 1 234 ? 69.744 128.237 8.098   1.00 33.34  ? 234  TYR B C   1 
ATOM   6818  O  O   . TYR B 1 234 ? 69.297 127.528 7.201   1.00 33.45  ? 234  TYR B O   1 
ATOM   6819  C  CB  . TYR B 1 234 ? 68.498 129.829 9.569   1.00 32.90  ? 234  TYR B CB  1 
ATOM   6820  C  CG  . TYR B 1 234 ? 67.577 130.167 8.434   1.00 31.92  ? 234  TYR B CG  1 
ATOM   6821  C  CD1 . TYR B 1 234 ? 66.330 129.585 8.354   1.00 30.84  ? 234  TYR B CD1 1 
ATOM   6822  C  CD2 . TYR B 1 234 ? 67.972 131.008 7.411   1.00 31.33  ? 234  TYR B CD2 1 
ATOM   6823  C  CE1 . TYR B 1 234 ? 65.489 129.857 7.317   1.00 30.32  ? 234  TYR B CE1 1 
ATOM   6824  C  CE2 . TYR B 1 234 ? 67.131 131.282 6.361   1.00 30.65  ? 234  TYR B CE2 1 
ATOM   6825  C  CZ  . TYR B 1 234 ? 65.891 130.700 6.325   1.00 30.10  ? 234  TYR B CZ  1 
ATOM   6826  O  OH  . TYR B 1 234 ? 65.032 130.951 5.293   1.00 30.59  ? 234  TYR B OH  1 
ATOM   6827  N  N   . ASN B 1 235 ? 70.877 128.900 7.955   1.00 33.35  ? 235  ASN B N   1 
ATOM   6828  C  CA  . ASN B 1 235 ? 71.563 128.842 6.676   1.00 33.84  ? 235  ASN B CA  1 
ATOM   6829  C  C   . ASN B 1 235 ? 72.557 127.694 6.531   1.00 34.19  ? 235  ASN B C   1 
ATOM   6830  O  O   . ASN B 1 235 ? 73.703 127.792 6.970   1.00 34.35  ? 235  ASN B O   1 
ATOM   6831  C  CB  . ASN B 1 235 ? 72.236 130.172 6.351   1.00 33.79  ? 235  ASN B CB  1 
ATOM   6832  C  CG  . ASN B 1 235 ? 72.651 130.250 4.917   1.00 33.66  ? 235  ASN B CG  1 
ATOM   6833  O  OD1 . ASN B 1 235 ? 72.280 131.167 4.196   1.00 34.09  ? 235  ASN B OD1 1 
ATOM   6834  N  ND2 . ASN B 1 235 ? 73.402 129.262 4.480   1.00 34.05  ? 235  ASN B ND2 1 
ATOM   6835  N  N   . PHE B 1 236 ? 72.118 126.616 5.887   1.00 34.46  ? 236  PHE B N   1 
ATOM   6836  C  CA  . PHE B 1 236 ? 72.966 125.447 5.693   1.00 34.51  ? 236  PHE B CA  1 
ATOM   6837  C  C   . PHE B 1 236 ? 74.094 125.760 4.735   1.00 34.85  ? 236  PHE B C   1 
ATOM   6838  O  O   . PHE B 1 236 ? 75.210 125.283 4.908   1.00 35.09  ? 236  PHE B O   1 
ATOM   6839  C  CB  . PHE B 1 236 ? 72.160 124.265 5.162   1.00 34.29  ? 236  PHE B CB  1 
ATOM   6840  C  CG  . PHE B 1 236 ? 72.941 122.991 5.098   1.00 33.78  ? 236  PHE B CG  1 
ATOM   6841  C  CD1 . PHE B 1 236 ? 73.635 122.540 6.197   1.00 33.47  ? 236  PHE B CD1 1 
ATOM   6842  C  CD2 . PHE B 1 236 ? 72.990 122.247 3.940   1.00 33.45  ? 236  PHE B CD2 1 
ATOM   6843  C  CE1 . PHE B 1 236 ? 74.353 121.367 6.145   1.00 33.04  ? 236  PHE B CE1 1 
ATOM   6844  C  CE2 . PHE B 1 236 ? 73.713 121.079 3.889   1.00 33.01  ? 236  PHE B CE2 1 
ATOM   6845  C  CZ  . PHE B 1 236 ? 74.393 120.641 4.993   1.00 32.32  ? 236  PHE B CZ  1 
ATOM   6846  N  N   . GLU B 1 237 ? 73.797 126.556 3.718   1.00 35.19  ? 237  GLU B N   1 
ATOM   6847  C  CA  . GLU B 1 237 ? 74.802 126.944 2.740   1.00 35.62  ? 237  GLU B CA  1 
ATOM   6848  C  C   . GLU B 1 237 ? 76.027 127.506 3.458   1.00 35.64  ? 237  GLU B C   1 
ATOM   6849  O  O   . GLU B 1 237 ? 77.130 126.991 3.314   1.00 35.81  ? 237  GLU B O   1 
ATOM   6850  C  CB  . GLU B 1 237 ? 74.216 127.981 1.777   1.00 35.72  ? 237  GLU B CB  1 
ATOM   6851  C  CG  . GLU B 1 237 ? 74.974 128.177 0.478   1.00 36.71  ? 237  GLU B CG  1 
ATOM   6852  C  CD  . GLU B 1 237 ? 74.254 129.114 -0.484  1.00 38.43  ? 237  GLU B CD  1 
ATOM   6853  O  OE1 . GLU B 1 237 ? 73.002 129.073 -0.541  1.00 38.41  ? 237  GLU B OE1 1 
ATOM   6854  O  OE2 . GLU B 1 237 ? 74.937 129.894 -1.192  1.00 39.66  ? 237  GLU B OE2 1 
ATOM   6855  N  N   . LYS B 1 238 ? 75.816 128.536 4.268   1.00 35.73  ? 238  LYS B N   1 
ATOM   6856  C  CA  . LYS B 1 238 ? 76.907 129.222 4.950   1.00 35.95  ? 238  LYS B CA  1 
ATOM   6857  C  C   . LYS B 1 238 ? 77.496 128.472 6.147   1.00 35.82  ? 238  LYS B C   1 
ATOM   6858  O  O   . LYS B 1 238 ? 78.704 128.456 6.337   1.00 35.93  ? 238  LYS B O   1 
ATOM   6859  C  CB  . LYS B 1 238 ? 76.462 130.630 5.355   1.00 36.08  ? 238  LYS B CB  1 
ATOM   6860  C  CG  . LYS B 1 238 ? 76.888 131.057 6.751   1.00 37.21  ? 238  LYS B CG  1 
ATOM   6861  C  CD  . LYS B 1 238 ? 78.163 131.891 6.711   1.00 39.33  ? 238  LYS B CD  1 
ATOM   6862  C  CE  . LYS B 1 238 ? 77.919 133.277 6.118   1.00 40.36  ? 238  LYS B CE  1 
ATOM   6863  N  NZ  . LYS B 1 238 ? 78.131 133.314 4.633   1.00 40.88  ? 238  LYS B NZ  1 
ATOM   6864  N  N   . ASP B 1 239 ? 76.648 127.846 6.950   1.00 35.85  ? 239  ASP B N   1 
ATOM   6865  C  CA  . ASP B 1 239 ? 77.113 127.116 8.127   1.00 35.85  ? 239  ASP B CA  1 
ATOM   6866  C  C   . ASP B 1 239 ? 77.546 125.678 7.815   1.00 35.67  ? 239  ASP B C   1 
ATOM   6867  O  O   . ASP B 1 239 ? 78.612 125.235 8.239   1.00 35.38  ? 239  ASP B O   1 
ATOM   6868  C  CB  . ASP B 1 239 ? 76.021 127.132 9.191   1.00 35.94  ? 239  ASP B CB  1 
ATOM   6869  C  CG  . ASP B 1 239 ? 75.422 128.511 9.369   1.00 36.81  ? 239  ASP B CG  1 
ATOM   6870  O  OD1 . ASP B 1 239 ? 76.181 129.498 9.230   1.00 38.01  ? 239  ASP B OD1 1 
ATOM   6871  O  OD2 . ASP B 1 239 ? 74.214 128.712 9.628   1.00 37.16  ? 239  ASP B OD2 1 
ATOM   6872  N  N   . GLY B 1 240 ? 76.702 124.951 7.087   1.00 35.63  ? 240  GLY B N   1 
ATOM   6873  C  CA  . GLY B 1 240 ? 76.992 123.585 6.695   1.00 35.44  ? 240  GLY B CA  1 
ATOM   6874  C  C   . GLY B 1 240 ? 76.955 122.590 7.834   1.00 35.48  ? 240  GLY B C   1 
ATOM   6875  O  O   . GLY B 1 240 ? 77.666 121.589 7.811   1.00 35.39  ? 240  GLY B O   1 
ATOM   6876  N  N   . LYS B 1 241 ? 76.113 122.852 8.827   1.00 35.59  ? 241  LYS B N   1 
ATOM   6877  C  CA  . LYS B 1 241 ? 76.043 121.986 9.995   1.00 35.68  ? 241  LYS B CA  1 
ATOM   6878  C  C   . LYS B 1 241 ? 74.739 121.216 10.053  1.00 35.57  ? 241  LYS B C   1 
ATOM   6879  O  O   . LYS B 1 241 ? 73.655 121.792 9.935   1.00 35.69  ? 241  LYS B O   1 
ATOM   6880  C  CB  . LYS B 1 241 ? 76.236 122.795 11.277  1.00 35.85  ? 241  LYS B CB  1 
ATOM   6881  C  CG  . LYS B 1 241 ? 77.682 123.197 11.545  1.00 36.86  ? 241  LYS B CG  1 
ATOM   6882  C  CD  . LYS B 1 241 ? 77.757 124.665 11.919  1.00 39.66  ? 241  LYS B CD  1 
ATOM   6883  C  CE  . LYS B 1 241 ? 78.781 125.426 11.069  1.00 41.44  ? 241  LYS B CE  1 
ATOM   6884  N  NZ  . LYS B 1 241 ? 78.807 126.903 11.386  1.00 42.23  ? 241  LYS B NZ  1 
ATOM   6885  N  N   . TYR B 1 242 ? 74.853 119.908 10.254  1.00 35.27  ? 242  TYR B N   1 
ATOM   6886  C  CA  . TYR B 1 242 ? 73.696 119.040 10.310  1.00 34.78  ? 242  TYR B CA  1 
ATOM   6887  C  C   . TYR B 1 242 ? 74.000 117.810 11.119  1.00 34.48  ? 242  TYR B C   1 
ATOM   6888  O  O   . TYR B 1 242 ? 75.105 117.633 11.592  1.00 34.43  ? 242  TYR B O   1 
ATOM   6889  C  CB  . TYR B 1 242 ? 73.365 118.569 8.916   1.00 34.90  ? 242  TYR B CB  1 
ATOM   6890  C  CG  . TYR B 1 242 ? 74.381 117.596 8.378   1.00 35.17  ? 242  TYR B CG  1 
ATOM   6891  C  CD1 . TYR B 1 242 ? 75.597 118.034 7.886   1.00 35.18  ? 242  TYR B CD1 1 
ATOM   6892  C  CD2 . TYR B 1 242 ? 74.122 116.234 8.355   1.00 35.97  ? 242  TYR B CD2 1 
ATOM   6893  C  CE1 . TYR B 1 242 ? 76.522 117.148 7.389   1.00 35.14  ? 242  TYR B CE1 1 
ATOM   6894  C  CE2 . TYR B 1 242 ? 75.046 115.341 7.856   1.00 35.66  ? 242  TYR B CE2 1 
ATOM   6895  C  CZ  . TYR B 1 242 ? 76.240 115.806 7.377   1.00 35.28  ? 242  TYR B CZ  1 
ATOM   6896  O  OH  . TYR B 1 242 ? 77.162 114.921 6.877   1.00 36.74  ? 242  TYR B OH  1 
ATOM   6897  N  N   . GLY B 1 243 ? 73.003 116.947 11.242  1.00 34.35  ? 243  GLY B N   1 
ATOM   6898  C  CA  . GLY B 1 243 ? 73.130 115.667 11.909  1.00 34.35  ? 243  GLY B CA  1 
ATOM   6899  C  C   . GLY B 1 243 ? 71.958 114.871 11.408  1.00 34.45  ? 243  GLY B C   1 
ATOM   6900  O  O   . GLY B 1 243 ? 71.221 115.380 10.576  1.00 34.75  ? 243  GLY B O   1 
ATOM   6901  N  N   . PHE B 1 244 ? 71.752 113.649 11.887  1.00 34.66  ? 244  PHE B N   1 
ATOM   6902  C  CA  . PHE B 1 244 ? 70.589 112.895 11.407  1.00 34.88  ? 244  PHE B CA  1 
ATOM   6903  C  C   . PHE B 1 244 ? 69.415 112.850 12.387  1.00 35.07  ? 244  PHE B C   1 
ATOM   6904  O  O   . PHE B 1 244 ? 69.587 112.895 13.599  1.00 35.36  ? 244  PHE B O   1 
ATOM   6905  C  CB  . PHE B 1 244 ? 70.973 111.494 10.998  1.00 34.70  ? 244  PHE B CB  1 
ATOM   6906  C  CG  . PHE B 1 244 ? 71.913 111.433 9.848   1.00 34.57  ? 244  PHE B CG  1 
ATOM   6907  C  CD1 . PHE B 1 244 ? 73.276 111.429 10.053  1.00 34.27  ? 244  PHE B CD1 1 
ATOM   6908  C  CD2 . PHE B 1 244 ? 71.438 111.357 8.559   1.00 35.38  ? 244  PHE B CD2 1 
ATOM   6909  C  CE1 . PHE B 1 244 ? 74.158 111.359 8.992   1.00 34.83  ? 244  PHE B CE1 1 
ATOM   6910  C  CE2 . PHE B 1 244 ? 72.318 111.294 7.486   1.00 35.53  ? 244  PHE B CE2 1 
ATOM   6911  C  CZ  . PHE B 1 244 ? 73.679 111.294 7.707   1.00 34.83  ? 244  PHE B CZ  1 
ATOM   6912  N  N   . CYS B 1 245 ? 68.212 112.764 11.845  1.00 35.29  ? 245  CYS B N   1 
ATOM   6913  C  CA  . CYS B 1 245 ? 67.016 112.749 12.667  1.00 35.52  ? 245  CYS B CA  1 
ATOM   6914  C  C   . CYS B 1 245 ? 66.687 111.329 13.049  1.00 35.49  ? 245  CYS B C   1 
ATOM   6915  O  O   . CYS B 1 245 ? 66.595 110.445 12.184  1.00 36.35  ? 245  CYS B O   1 
ATOM   6916  C  CB  . CYS B 1 245 ? 65.853 113.347 11.901  1.00 35.50  ? 245  CYS B CB  1 
ATOM   6917  S  SG  . CYS B 1 245 ? 66.053 115.104 11.630  1.00 36.72  ? 245  CYS B SG  1 
ATOM   6918  N  N   . PRO B 1 246 ? 66.503 111.113 14.342  1.00 34.73  ? 246  PRO B N   1 
ATOM   6919  C  CA  . PRO B 1 246 ? 66.211 109.788 14.873  1.00 34.32  ? 246  PRO B CA  1 
ATOM   6920  C  C   . PRO B 1 246 ? 64.943 109.197 14.270  1.00 34.15  ? 246  PRO B C   1 
ATOM   6921  O  O   . PRO B 1 246 ? 64.084 109.931 13.801  1.00 34.01  ? 246  PRO B O   1 
ATOM   6922  C  CB  . PRO B 1 246 ? 65.997 110.059 16.356  1.00 34.21  ? 246  PRO B CB  1 
ATOM   6923  C  CG  . PRO B 1 246 ? 66.724 111.308 16.613  1.00 34.50  ? 246  PRO B CG  1 
ATOM   6924  C  CD  . PRO B 1 246 ? 66.561 112.137 15.389  1.00 34.54  ? 246  PRO B CD  1 
ATOM   6925  N  N   . HIS B 1 247 ? 64.871 107.869 14.275  1.00 33.97  ? 247  HIS B N   1 
ATOM   6926  C  CA  . HIS B 1 247 ? 63.722 107.087 13.824  1.00 33.43  ? 247  HIS B CA  1 
ATOM   6927  C  C   . HIS B 1 247 ? 64.078 105.592 13.860  1.00 33.88  ? 247  HIS B C   1 
ATOM   6928  O  O   . HIS B 1 247 ? 65.014 105.128 13.195  1.00 33.50  ? 247  HIS B O   1 
ATOM   6929  C  CB  . HIS B 1 247 ? 63.238 107.501 12.449  1.00 32.94  ? 247  HIS B CB  1 
ATOM   6930  C  CG  . HIS B 1 247 ? 61.791 107.213 12.234  1.00 31.83  ? 247  HIS B CG  1 
ATOM   6931  N  ND1 . HIS B 1 247 ? 61.344 106.028 11.695  1.00 30.28  ? 247  HIS B ND1 1 
ATOM   6932  C  CD2 . HIS B 1 247 ? 60.685 107.938 12.523  1.00 30.88  ? 247  HIS B CD2 1 
ATOM   6933  C  CE1 . HIS B 1 247 ? 60.027 106.043 11.642  1.00 30.18  ? 247  HIS B CE1 1 
ATOM   6934  N  NE2 . HIS B 1 247 ? 59.601 107.190 12.143  1.00 30.55  ? 247  HIS B NE2 1 
ATOM   6935  N  N   . GLU B 1 248 ? 63.331 104.837 14.656  1.00 34.25  ? 248  GLU B N   1 
ATOM   6936  C  CA  . GLU B 1 248 ? 63.679 103.445 14.881  1.00 34.52  ? 248  GLU B CA  1 
ATOM   6937  C  C   . GLU B 1 248 ? 63.529 102.614 13.622  1.00 34.74  ? 248  GLU B C   1 
ATOM   6938  O  O   . GLU B 1 248 ? 63.979 101.472 13.564  1.00 35.10  ? 248  GLU B O   1 
ATOM   6939  C  CB  . GLU B 1 248 ? 62.897 102.862 16.057  1.00 34.15  ? 248  GLU B CB  1 
ATOM   6940  C  CG  . GLU B 1 248 ? 61.405 103.053 15.953  1.00 34.98  ? 248  GLU B CG  1 
ATOM   6941  C  CD  . GLU B 1 248 ? 60.933 104.399 16.462  1.00 34.86  ? 248  GLU B CD  1 
ATOM   6942  O  OE1 . GLU B 1 248 ? 61.740 105.328 16.571  1.00 35.49  ? 248  GLU B OE1 1 
ATOM   6943  O  OE2 . GLU B 1 248 ? 59.741 104.526 16.762  1.00 35.31  ? 248  GLU B OE2 1 
ATOM   6944  N  N   . ALA B 1 249 ? 62.909 103.181 12.600  1.00 34.83  ? 249  ALA B N   1 
ATOM   6945  C  CA  . ALA B 1 249 ? 62.831 102.468 11.343  1.00 34.95  ? 249  ALA B CA  1 
ATOM   6946  C  C   . ALA B 1 249 ? 64.132 102.674 10.588  1.00 35.30  ? 249  ALA B C   1 
ATOM   6947  O  O   . ALA B 1 249 ? 64.323 102.097 9.533   1.00 35.79  ? 249  ALA B O   1 
ATOM   6948  C  CB  . ALA B 1 249 ? 61.682 102.943 10.530  1.00 34.90  ? 249  ALA B CB  1 
ATOM   6949  N  N   . LEU B 1 250 ? 65.030 103.492 11.137  1.00 35.53  ? 250  LEU B N   1 
ATOM   6950  C  CA  . LEU B 1 250 ? 66.311 103.782 10.487  1.00 35.10  ? 250  LEU B CA  1 
ATOM   6951  C  C   . LEU B 1 250 ? 67.485 103.331 11.333  1.00 35.04  ? 250  LEU B C   1 
ATOM   6952  O  O   . LEU B 1 250 ? 68.373 102.663 10.838  1.00 35.29  ? 250  LEU B O   1 
ATOM   6953  C  CB  . LEU B 1 250 ? 66.439 105.271 10.182  1.00 35.04  ? 250  LEU B CB  1 
ATOM   6954  C  CG  . LEU B 1 250 ? 65.345 105.802 9.268   1.00 34.43  ? 250  LEU B CG  1 
ATOM   6955  C  CD1 . LEU B 1 250 ? 65.530 107.270 9.009   1.00 34.96  ? 250  LEU B CD1 1 
ATOM   6956  C  CD2 . LEU B 1 250 ? 65.421 105.049 7.989   1.00 34.81  ? 250  LEU B CD2 1 
ATOM   6957  N  N   . PHE B 1 251 ? 67.503 103.716 12.602  1.00 34.95  ? 251  PHE B N   1 
ATOM   6958  C  CA  . PHE B 1 251 ? 68.555 103.270 13.518  1.00 34.88  ? 251  PHE B CA  1 
ATOM   6959  C  C   . PHE B 1 251 ? 68.101 103.441 14.957  1.00 35.75  ? 251  PHE B C   1 
ATOM   6960  O  O   . PHE B 1 251 ? 67.052 104.042 15.222  1.00 36.28  ? 251  PHE B O   1 
ATOM   6961  C  CB  . PHE B 1 251 ? 69.873 104.001 13.292  1.00 34.17  ? 251  PHE B CB  1 
ATOM   6962  C  CG  . PHE B 1 251 ? 69.857 105.421 13.731  1.00 32.11  ? 251  PHE B CG  1 
ATOM   6963  C  CD1 . PHE B 1 251 ? 69.430 106.409 12.878  1.00 30.78  ? 251  PHE B CD1 1 
ATOM   6964  C  CD2 . PHE B 1 251 ? 70.266 105.774 14.987  1.00 30.47  ? 251  PHE B CD2 1 
ATOM   6965  C  CE1 . PHE B 1 251 ? 69.398 107.719 13.275  1.00 29.25  ? 251  PHE B CE1 1 
ATOM   6966  C  CE2 . PHE B 1 251 ? 70.245 107.092 15.378  1.00 30.58  ? 251  PHE B CE2 1 
ATOM   6967  C  CZ  . PHE B 1 251 ? 69.811 108.063 14.515  1.00 28.99  ? 251  PHE B CZ  1 
ATOM   6968  N  N   . THR B 1 252 ? 68.897 102.924 15.885  1.00 36.14  ? 252  THR B N   1 
ATOM   6969  C  CA  . THR B 1 252 ? 68.531 102.926 17.293  1.00 36.50  ? 252  THR B CA  1 
ATOM   6970  C  C   . THR B 1 252 ? 69.720 103.360 18.112  1.00 36.85  ? 252  THR B C   1 
ATOM   6971  O  O   . THR B 1 252 ? 70.839 103.382 17.600  1.00 37.39  ? 252  THR B O   1 
ATOM   6972  C  CB  . THR B 1 252 ? 68.130 101.514 17.700  1.00 36.54  ? 252  THR B CB  1 
ATOM   6973  O  OG1 . THR B 1 252 ? 69.190 100.610 17.365  1.00 36.68  ? 252  THR B OG1 1 
ATOM   6974  C  CG2 . THR B 1 252 ? 66.978 101.023 16.834  1.00 36.21  ? 252  THR B CG2 1 
ATOM   6975  N  N   . MET B 1 253 ? 69.496 103.682 19.383  1.00 36.98  ? 253  MET B N   1 
ATOM   6976  C  CA  . MET B 1 253 ? 70.592 104.129 20.238  1.00 37.47  ? 253  MET B CA  1 
ATOM   6977  C  C   . MET B 1 253 ? 70.997 103.079 21.247  1.00 37.08  ? 253  MET B C   1 
ATOM   6978  O  O   . MET B 1 253 ? 70.213 102.190 21.588  1.00 37.21  ? 253  MET B O   1 
ATOM   6979  C  CB  . MET B 1 253 ? 70.218 105.390 21.013  1.00 37.99  ? 253  MET B CB  1 
ATOM   6980  C  CG  . MET B 1 253 ? 71.322 105.888 21.929  1.00 40.33  ? 253  MET B CG  1 
ATOM   6981  S  SD  . MET B 1 253 ? 72.554 106.776 20.924  1.00 50.58  ? 253  MET B SD  1 
ATOM   6982  C  CE  . MET B 1 253 ? 73.976 105.557 20.668  1.00 48.13  ? 253  MET B CE  1 
ATOM   6983  N  N   . GLY B 1 254 ? 72.220 103.214 21.742  1.00 36.32  ? 254  GLY B N   1 
ATOM   6984  C  CA  . GLY B 1 254 ? 72.720 102.346 22.783  1.00 35.70  ? 254  GLY B CA  1 
ATOM   6985  C  C   . GLY B 1 254 ? 72.319 100.928 22.512  1.00 35.09  ? 254  GLY B C   1 
ATOM   6986  O  O   . GLY B 1 254 ? 72.125 100.572 21.355  1.00 34.91  ? 254  GLY B O   1 
ATOM   6987  N  N   . GLY B 1 255 ? 72.180 100.132 23.571  1.00 34.86  ? 255  GLY B N   1 
ATOM   6988  C  CA  . GLY B 1 255 ? 71.834 98.725  23.438  1.00 34.63  ? 255  GLY B CA  1 
ATOM   6989  C  C   . GLY B 1 255 ? 72.979 97.992  22.771  1.00 34.35  ? 255  GLY B C   1 
ATOM   6990  O  O   . GLY B 1 255 ? 74.052 98.567  22.591  1.00 34.77  ? 255  GLY B O   1 
ATOM   6991  N  N   . ASN B 1 256 ? 72.782 96.739  22.392  1.00 33.86  ? 256  ASN B N   1 
ATOM   6992  C  CA  . ASN B 1 256 ? 73.873 96.027  21.747  1.00 33.78  ? 256  ASN B CA  1 
ATOM   6993  C  C   . ASN B 1 256 ? 73.703 95.939  20.240  1.00 34.01  ? 256  ASN B C   1 
ATOM   6994  O  O   . ASN B 1 256 ? 74.658 95.646  19.519  1.00 34.03  ? 256  ASN B O   1 
ATOM   6995  C  CB  . ASN B 1 256 ? 74.065 94.636  22.351  1.00 33.63  ? 256  ASN B CB  1 
ATOM   6996  C  CG  . ASN B 1 256 ? 72.798 93.821  22.343  1.00 33.50  ? 256  ASN B CG  1 
ATOM   6997  O  OD1 . ASN B 1 256 ? 71.780 94.246  21.809  1.00 34.78  ? 256  ASN B OD1 1 
ATOM   6998  N  ND2 . ASN B 1 256 ? 72.848 92.645  22.942  1.00 32.72  ? 256  ASN B ND2 1 
ATOM   6999  N  N   . ALA B 1 257 ? 72.488 96.210  19.770  1.00 34.08  ? 257  ALA B N   1 
ATOM   7000  C  CA  . ALA B 1 257 ? 72.159 96.126  18.347  1.00 34.18  ? 257  ALA B CA  1 
ATOM   7001  C  C   . ALA B 1 257 ? 73.126 96.859  17.411  1.00 34.51  ? 257  ALA B C   1 
ATOM   7002  O  O   . ALA B 1 257 ? 73.035 96.714  16.189  1.00 34.45  ? 257  ALA B O   1 
ATOM   7003  C  CB  . ALA B 1 257 ? 70.761 96.607  18.119  1.00 34.25  ? 257  ALA B CB  1 
ATOM   7004  N  N   . GLU B 1 258 ? 74.020 97.661  18.001  1.00 34.68  ? 258  GLU B N   1 
ATOM   7005  C  CA  . GLU B 1 258 ? 75.063 98.411  17.292  1.00 34.46  ? 258  GLU B CA  1 
ATOM   7006  C  C   . GLU B 1 258 ? 74.582 99.413  16.250  1.00 34.51  ? 258  GLU B C   1 
ATOM   7007  O  O   . GLU B 1 258 ? 75.221 99.594  15.214  1.00 34.15  ? 258  GLU B O   1 
ATOM   7008  C  CB  . GLU B 1 258 ? 76.060 97.453  16.666  1.00 34.50  ? 258  GLU B CB  1 
ATOM   7009  C  CG  . GLU B 1 258 ? 76.517 96.393  17.642  1.00 34.94  ? 258  GLU B CG  1 
ATOM   7010  C  CD  . GLU B 1 258 ? 77.986 96.069  17.502  1.00 35.48  ? 258  GLU B CD  1 
ATOM   7011  O  OE1 . GLU B 1 258 ? 78.391 95.626  16.397  1.00 35.56  ? 258  GLU B OE1 1 
ATOM   7012  O  OE2 . GLU B 1 258 ? 78.722 96.258  18.502  1.00 34.69  ? 258  GLU B OE2 1 
ATOM   7013  N  N   . GLY B 1 259 ? 73.448 100.050 16.529  1.00 34.89  ? 259  GLY B N   1 
ATOM   7014  C  CA  . GLY B 1 259 ? 72.905 101.075 15.660  1.00 34.86  ? 259  GLY B CA  1 
ATOM   7015  C  C   . GLY B 1 259 ? 71.743 100.605 14.819  1.00 34.94  ? 259  GLY B C   1 
ATOM   7016  O  O   . GLY B 1 259 ? 70.845 101.387 14.510  1.00 35.70  ? 259  GLY B O   1 
ATOM   7017  N  N   . GLN B 1 260 ? 71.748 99.327  14.457  1.00 34.36  ? 260  GLN B N   1 
ATOM   7018  C  CA  . GLN B 1 260 ? 70.696 98.764  13.618  1.00 33.77  ? 260  GLN B CA  1 
ATOM   7019  C  C   . GLN B 1 260 ? 69.272 99.172  14.001  1.00 33.23  ? 260  GLN B C   1 
ATOM   7020  O  O   . GLN B 1 260 ? 68.963 99.392  15.162  1.00 32.89  ? 260  GLN B O   1 
ATOM   7021  C  CB  . GLN B 1 260 ? 70.827 97.248  13.606  1.00 33.94  ? 260  GLN B CB  1 
ATOM   7022  C  CG  . GLN B 1 260 ? 72.133 96.762  12.987  1.00 34.02  ? 260  GLN B CG  1 
ATOM   7023  C  CD  . GLN B 1 260 ? 72.276 97.153  11.525  1.00 33.23  ? 260  GLN B CD  1 
ATOM   7024  O  OE1 . GLN B 1 260 ? 71.485 96.728  10.685  1.00 32.66  ? 260  GLN B OE1 1 
ATOM   7025  N  NE2 . GLN B 1 260 ? 73.286 97.959  11.221  1.00 33.45  ? 260  GLN B NE2 1 
ATOM   7026  N  N   . PRO B 1 261 ? 68.402 99.240  13.010  1.00 33.11  ? 261  PRO B N   1 
ATOM   7027  C  CA  . PRO B 1 261 ? 66.999 99.645  13.205  1.00 33.61  ? 261  PRO B CA  1 
ATOM   7028  C  C   . PRO B 1 261 ? 66.114 98.546  13.800  1.00 33.66  ? 261  PRO B C   1 
ATOM   7029  O  O   . PRO B 1 261 ? 66.456 97.377  13.708  1.00 34.14  ? 261  PRO B O   1 
ATOM   7030  C  CB  . PRO B 1 261 ? 66.517 99.947  11.783  1.00 33.52  ? 261  PRO B CB  1 
ATOM   7031  C  CG  . PRO B 1 261 ? 67.733 99.794  10.914  1.00 33.84  ? 261  PRO B CG  1 
ATOM   7032  C  CD  . PRO B 1 261 ? 68.698 98.905  11.616  1.00 33.07  ? 261  PRO B CD  1 
ATOM   7033  N  N   . CYS B 1 262 ? 64.983 98.901  14.385  1.00 33.42  ? 262  CYS B N   1 
ATOM   7034  C  CA  . CYS B 1 262 ? 64.141 97.874  14.962  1.00 33.90  ? 262  CYS B CA  1 
ATOM   7035  C  C   . CYS B 1 262 ? 63.572 96.920  13.905  1.00 33.82  ? 262  CYS B C   1 
ATOM   7036  O  O   . CYS B 1 262 ? 63.427 97.268  12.741  1.00 33.84  ? 262  CYS B O   1 
ATOM   7037  C  CB  . CYS B 1 262 ? 63.017 98.493  15.794  1.00 33.93  ? 262  CYS B CB  1 
ATOM   7038  S  SG  . CYS B 1 262 ? 63.596 99.556  17.136  1.00 35.46  ? 262  CYS B SG  1 
ATOM   7039  N  N   . LYS B 1 263 ? 63.278 95.698  14.323  1.00 33.80  ? 263  LYS B N   1 
ATOM   7040  C  CA  . LYS B 1 263 ? 62.649 94.732  13.454  1.00 34.10  ? 263  LYS B CA  1 
ATOM   7041  C  C   . LYS B 1 263 ? 61.171 94.646  13.810  1.00 34.22  ? 263  LYS B C   1 
ATOM   7042  O  O   . LYS B 1 263 ? 60.801 94.325  14.940  1.00 34.44  ? 263  LYS B O   1 
ATOM   7043  C  CB  . LYS B 1 263 ? 63.276 93.364  13.648  1.00 34.52  ? 263  LYS B CB  1 
ATOM   7044  C  CG  . LYS B 1 263 ? 62.655 92.289  12.768  1.00 35.05  ? 263  LYS B CG  1 
ATOM   7045  C  CD  . LYS B 1 263 ? 63.201 92.391  11.362  1.00 35.63  ? 263  LYS B CD  1 
ATOM   7046  C  CE  . LYS B 1 263 ? 62.305 91.675  10.387  1.00 36.72  ? 263  LYS B CE  1 
ATOM   7047  N  NZ  . LYS B 1 263 ? 62.547 92.184  9.010   1.00 38.57  ? 263  LYS B NZ  1 
ATOM   7048  N  N   . PHE B 1 264 ? 60.305 94.933  12.856  1.00 33.98  ? 264  PHE B N   1 
ATOM   7049  C  CA  . PHE B 1 264 ? 58.900 94.923  13.175  1.00 33.66  ? 264  PHE B CA  1 
ATOM   7050  C  C   . PHE B 1 264 ? 58.215 93.955  12.257  1.00 33.23  ? 264  PHE B C   1 
ATOM   7051  O  O   . PHE B 1 264 ? 58.329 94.069  11.047  1.00 33.68  ? 264  PHE B O   1 
ATOM   7052  C  CB  . PHE B 1 264 ? 58.320 96.321  13.037  1.00 33.85  ? 264  PHE B CB  1 
ATOM   7053  C  CG  . PHE B 1 264 ? 58.843 97.290  14.049  1.00 35.12  ? 264  PHE B CG  1 
ATOM   7054  C  CD1 . PHE B 1 264 ? 59.025 96.907  15.363  1.00 37.36  ? 264  PHE B CD1 1 
ATOM   7055  C  CD2 . PHE B 1 264 ? 59.158 98.583  13.691  1.00 36.70  ? 264  PHE B CD2 1 
ATOM   7056  C  CE1 . PHE B 1 264 ? 59.508 97.809  16.314  1.00 39.12  ? 264  PHE B CE1 1 
ATOM   7057  C  CE2 . PHE B 1 264 ? 59.644 99.488  14.631  1.00 38.49  ? 264  PHE B CE2 1 
ATOM   7058  C  CZ  . PHE B 1 264 ? 59.817 99.104  15.944  1.00 38.77  ? 264  PHE B CZ  1 
ATOM   7059  N  N   . PRO B 1 265 ? 57.519 92.989  12.838  1.00 32.55  ? 265  PRO B N   1 
ATOM   7060  C  CA  . PRO B 1 265 ? 57.399 92.873  14.289  1.00 32.33  ? 265  PRO B CA  1 
ATOM   7061  C  C   . PRO B 1 265 ? 58.520 92.054  14.918  1.00 32.21  ? 265  PRO B C   1 
ATOM   7062  O  O   . PRO B 1 265 ? 59.163 91.272  14.217  1.00 32.41  ? 265  PRO B O   1 
ATOM   7063  C  CB  . PRO B 1 265 ? 56.101 92.098  14.448  1.00 32.25  ? 265  PRO B CB  1 
ATOM   7064  C  CG  . PRO B 1 265 ? 55.594 91.909  13.058  1.00 32.29  ? 265  PRO B CG  1 
ATOM   7065  C  CD  . PRO B 1 265 ? 56.771 91.938  12.149  1.00 32.23  ? 265  PRO B CD  1 
ATOM   7066  N  N   . PHE B 1 266 ? 58.752 92.239  16.219  1.00 31.78  ? 266  PHE B N   1 
ATOM   7067  C  CA  . PHE B 1 266 ? 59.709 91.411  16.963  1.00 31.05  ? 266  PHE B CA  1 
ATOM   7068  C  C   . PHE B 1 266 ? 58.976 90.714  18.100  1.00 30.82  ? 266  PHE B C   1 
ATOM   7069  O  O   . PHE B 1 266 ? 58.025 91.253  18.650  1.00 31.26  ? 266  PHE B O   1 
ATOM   7070  C  CB  . PHE B 1 266 ? 60.887 92.229  17.488  1.00 30.91  ? 266  PHE B CB  1 
ATOM   7071  C  CG  . PHE B 1 266 ? 60.575 93.069  18.692  1.00 29.83  ? 266  PHE B CG  1 
ATOM   7072  C  CD1 . PHE B 1 266 ? 60.117 94.356  18.550  1.00 29.48  ? 266  PHE B CD1 1 
ATOM   7073  C  CD2 . PHE B 1 266 ? 60.780 92.582  19.970  1.00 29.64  ? 266  PHE B CD2 1 
ATOM   7074  C  CE1 . PHE B 1 266 ? 59.853 95.135  19.665  1.00 30.01  ? 266  PHE B CE1 1 
ATOM   7075  C  CE2 . PHE B 1 266 ? 60.510 93.360  21.090  1.00 28.79  ? 266  PHE B CE2 1 
ATOM   7076  C  CZ  . PHE B 1 266 ? 60.052 94.627  20.938  1.00 28.71  ? 266  PHE B CZ  1 
ATOM   7077  N  N   . ARG B 1 267 ? 59.392 89.510  18.446  1.00 30.26  ? 267  ARG B N   1 
ATOM   7078  C  CA  . ARG B 1 267 ? 58.694 88.775  19.480  1.00 29.97  ? 267  ARG B CA  1 
ATOM   7079  C  C   . ARG B 1 267 ? 59.453 88.804  20.772  1.00 30.05  ? 267  ARG B C   1 
ATOM   7080  O  O   . ARG B 1 267 ? 60.622 88.462  20.805  1.00 30.55  ? 267  ARG B O   1 
ATOM   7081  C  CB  . ARG B 1 267 ? 58.508 87.321  19.072  1.00 29.91  ? 267  ARG B CB  1 
ATOM   7082  C  CG  . ARG B 1 267 ? 58.108 86.434  20.235  1.00 29.77  ? 267  ARG B CG  1 
ATOM   7083  C  CD  . ARG B 1 267 ? 57.564 85.075  19.842  1.00 29.31  ? 267  ARG B CD  1 
ATOM   7084  N  NE  . ARG B 1 267 ? 56.899 84.416  20.962  1.00 29.17  ? 267  ARG B NE  1 
ATOM   7085  C  CZ  . ARG B 1 267 ? 56.697 83.108  21.038  1.00 29.65  ? 267  ARG B CZ  1 
ATOM   7086  N  NH1 . ARG B 1 267 ? 57.109 82.318  20.059  1.00 30.59  ? 267  ARG B NH1 1 
ATOM   7087  N  NH2 . ARG B 1 267 ? 56.085 82.581  22.089  1.00 29.53  ? 267  ARG B NH2 1 
ATOM   7088  N  N   . PHE B 1 268 ? 58.793 89.206  21.847  1.00 30.08  ? 268  PHE B N   1 
ATOM   7089  C  CA  . PHE B 1 268 ? 59.431 89.199  23.150  1.00 29.93  ? 268  PHE B CA  1 
ATOM   7090  C  C   . PHE B 1 268 ? 58.979 87.928  23.867  1.00 30.37  ? 268  PHE B C   1 
ATOM   7091  O  O   . PHE B 1 268 ? 59.499 86.857  23.591  1.00 30.70  ? 268  PHE B O   1 
ATOM   7092  C  CB  . PHE B 1 268 ? 59.143 90.484  23.929  1.00 29.54  ? 268  PHE B CB  1 
ATOM   7093  C  CG  . PHE B 1 268 ? 59.898 90.599  25.218  1.00 28.57  ? 268  PHE B CG  1 
ATOM   7094  C  CD1 . PHE B 1 268 ? 61.065 89.893  25.421  1.00 27.55  ? 268  PHE B CD1 1 
ATOM   7095  C  CD2 . PHE B 1 268 ? 59.429 91.411  26.238  1.00 27.71  ? 268  PHE B CD2 1 
ATOM   7096  C  CE1 . PHE B 1 268 ? 61.743 89.990  26.608  1.00 26.18  ? 268  PHE B CE1 1 
ATOM   7097  C  CE2 . PHE B 1 268 ? 60.108 91.511  27.428  1.00 26.36  ? 268  PHE B CE2 1 
ATOM   7098  C  CZ  . PHE B 1 268 ? 61.265 90.800  27.612  1.00 26.04  ? 268  PHE B CZ  1 
ATOM   7099  N  N   . GLN B 1 269 ? 58.001 87.978  24.749  1.00 30.74  ? 269  GLN B N   1 
ATOM   7100  C  CA  . GLN B 1 269 ? 57.677 86.720  25.408  1.00 31.26  ? 269  GLN B CA  1 
ATOM   7101  C  C   . GLN B 1 269 ? 56.457 86.027  24.837  1.00 31.89  ? 269  GLN B C   1 
ATOM   7102  O  O   . GLN B 1 269 ? 56.593 85.083  24.074  1.00 32.29  ? 269  GLN B O   1 
ATOM   7103  C  CB  . GLN B 1 269 ? 57.603 86.892  26.910  1.00 31.27  ? 269  GLN B CB  1 
ATOM   7104  C  CG  . GLN B 1 269 ? 58.963 86.890  27.531  1.00 30.95  ? 269  GLN B CG  1 
ATOM   7105  C  CD  . GLN B 1 269 ? 59.366 85.512  27.958  1.00 31.80  ? 269  GLN B CD  1 
ATOM   7106  O  OE1 . GLN B 1 269 ? 58.569 84.805  28.574  1.00 32.09  ? 269  GLN B OE1 1 
ATOM   7107  N  NE2 . GLN B 1 269 ? 60.605 85.117  27.650  1.00 32.35  ? 269  GLN B NE2 1 
ATOM   7108  N  N   . GLY B 1 270 ? 55.264 86.474  25.195  1.00 32.44  ? 270  GLY B N   1 
ATOM   7109  C  CA  . GLY B 1 270 ? 54.076 85.885  24.612  1.00 33.18  ? 270  GLY B CA  1 
ATOM   7110  C  C   . GLY B 1 270 ? 53.495 86.848  23.602  1.00 33.69  ? 270  GLY B C   1 
ATOM   7111  O  O   . GLY B 1 270 ? 52.332 86.735  23.221  1.00 34.10  ? 270  GLY B O   1 
ATOM   7112  N  N   . THR B 1 271 ? 54.322 87.783  23.141  1.00 34.03  ? 271  THR B N   1 
ATOM   7113  C  CA  . THR B 1 271 ? 53.837 88.856  22.286  1.00 33.86  ? 271  THR B CA  1 
ATOM   7114  C  C   . THR B 1 271 ? 54.783 89.392  21.219  1.00 34.20  ? 271  THR B C   1 
ATOM   7115  O  O   . THR B 1 271 ? 55.983 89.485  21.439  1.00 34.21  ? 271  THR B O   1 
ATOM   7116  C  CB  . THR B 1 271 ? 53.462 89.987  23.181  1.00 33.55  ? 271  THR B CB  1 
ATOM   7117  O  OG1 . THR B 1 271 ? 52.309 89.594  23.930  1.00 32.42  ? 271  THR B OG1 1 
ATOM   7118  C  CG2 . THR B 1 271 ? 53.019 91.171  22.348  1.00 33.74  ? 271  THR B CG2 1 
ATOM   7119  N  N   . SER B 1 272 ? 54.222 89.755  20.068  1.00 34.59  ? 272  SER B N   1 
ATOM   7120  C  CA  . SER B 1 272 ? 54.996 90.362  18.992  1.00 35.15  ? 272  SER B CA  1 
ATOM   7121  C  C   . SER B 1 272 ? 54.740 91.852  18.986  1.00 35.43  ? 272  SER B C   1 
ATOM   7122  O  O   . SER B 1 272 ? 53.595 92.295  18.909  1.00 35.58  ? 272  SER B O   1 
ATOM   7123  C  CB  . SER B 1 272 ? 54.626 89.781  17.630  1.00 35.26  ? 272  SER B CB  1 
ATOM   7124  O  OG  . SER B 1 272 ? 55.606 88.863  17.167  1.00 35.96  ? 272  SER B OG  1 
ATOM   7125  N  N   . TYR B 1 273 ? 55.810 92.629  19.084  1.00 35.63  ? 273  TYR B N   1 
ATOM   7126  C  CA  . TYR B 1 273 ? 55.679 94.073  19.091  1.00 35.50  ? 273  TYR B CA  1 
ATOM   7127  C  C   . TYR B 1 273 ? 55.935 94.603  17.710  1.00 36.03  ? 273  TYR B C   1 
ATOM   7128  O  O   . TYR B 1 273 ? 56.712 94.040  16.941  1.00 36.10  ? 273  TYR B O   1 
ATOM   7129  C  CB  . TYR B 1 273 ? 56.626 94.692  20.094  1.00 34.96  ? 273  TYR B CB  1 
ATOM   7130  C  CG  . TYR B 1 273 ? 56.307 94.235  21.470  1.00 33.51  ? 273  TYR B CG  1 
ATOM   7131  C  CD1 . TYR B 1 273 ? 56.701 92.985  21.909  1.00 32.22  ? 273  TYR B CD1 1 
ATOM   7132  C  CD2 . TYR B 1 273 ? 55.571 95.031  22.323  1.00 32.38  ? 273  TYR B CD2 1 
ATOM   7133  C  CE1 . TYR B 1 273 ? 56.391 92.554  23.176  1.00 32.13  ? 273  TYR B CE1 1 
ATOM   7134  C  CE2 . TYR B 1 273 ? 55.260 94.611  23.590  1.00 32.36  ? 273  TYR B CE2 1 
ATOM   7135  C  CZ  . TYR B 1 273 ? 55.673 93.376  24.011  1.00 31.83  ? 273  TYR B CZ  1 
ATOM   7136  O  OH  . TYR B 1 273 ? 55.360 92.959  25.271  1.00 31.83  ? 273  TYR B OH  1 
ATOM   7137  N  N   . ASP B 1 274 ? 55.259 95.693  17.406  1.00 36.57  ? 274  ASP B N   1 
ATOM   7138  C  CA  . ASP B 1 274 ? 55.305 96.279  16.093  1.00 37.17  ? 274  ASP B CA  1 
ATOM   7139  C  C   . ASP B 1 274 ? 55.860 97.680  16.234  1.00 37.53  ? 274  ASP B C   1 
ATOM   7140  O  O   . ASP B 1 274 ? 55.778 98.487  15.313  1.00 38.11  ? 274  ASP B O   1 
ATOM   7141  C  CB  . ASP B 1 274 ? 53.888 96.337  15.557  1.00 37.22  ? 274  ASP B CB  1 
ATOM   7142  C  CG  . ASP B 1 274 ? 53.839 96.393  14.077  1.00 37.93  ? 274  ASP B CG  1 
ATOM   7143  O  OD1 . ASP B 1 274 ? 53.973 95.333  13.437  1.00 38.83  ? 274  ASP B OD1 1 
ATOM   7144  O  OD2 . ASP B 1 274 ? 53.663 97.454  13.461  1.00 40.08  ? 274  ASP B OD2 1 
ATOM   7145  N  N   . SER B 1 275 ? 56.439 97.954  17.397  1.00 37.48  ? 275  SER B N   1 
ATOM   7146  C  CA  . SER B 1 275 ? 56.979 99.261  17.690  1.00 37.40  ? 275  SER B CA  1 
ATOM   7147  C  C   . SER B 1 275 ? 57.733 99.148  18.993  1.00 37.65  ? 275  SER B C   1 
ATOM   7148  O  O   . SER B 1 275 ? 57.632 98.144  19.680  1.00 37.92  ? 275  SER B O   1 
ATOM   7149  C  CB  . SER B 1 275 ? 55.841 100.209 17.906  1.00 37.05  ? 275  SER B CB  1 
ATOM   7150  O  OG  . SER B 1 275 ? 55.176 99.782  19.069  1.00 37.46  ? 275  SER B OG  1 
ATOM   7151  N  N   . CYS B 1 276 ? 58.474 100.187 19.344  1.00 37.76  ? 276  CYS B N   1 
ATOM   7152  C  CA  . CYS B 1 276 ? 59.253 100.176 20.561  1.00 38.07  ? 276  CYS B CA  1 
ATOM   7153  C  C   . CYS B 1 276 ? 58.334 100.211 21.762  1.00 37.74  ? 276  CYS B C   1 
ATOM   7154  O  O   . CYS B 1 276 ? 57.461 101.059 21.829  1.00 38.35  ? 276  CYS B O   1 
ATOM   7155  C  CB  . CYS B 1 276 ? 60.181 101.384 20.581  1.00 38.25  ? 276  CYS B CB  1 
ATOM   7156  S  SG  . CYS B 1 276 ? 61.309 101.456 19.163  1.00 41.25  ? 276  CYS B SG  1 
ATOM   7157  N  N   . THR B 1 277 ? 58.509 99.288  22.700  1.00 37.20  ? 277  THR B N   1 
ATOM   7158  C  CA  . THR B 1 277 ? 57.700 99.288  23.906  1.00 36.91  ? 277  THR B CA  1 
ATOM   7159  C  C   . THR B 1 277 ? 58.604 99.313  25.096  1.00 37.11  ? 277  THR B C   1 
ATOM   7160  O  O   . THR B 1 277 ? 59.742 98.877  25.009  1.00 37.78  ? 277  THR B O   1 
ATOM   7161  C  CB  . THR B 1 277 ? 56.887 98.024  24.028  1.00 36.87  ? 277  THR B CB  1 
ATOM   7162  O  OG1 . THR B 1 277 ? 56.192 98.050  25.279  1.00 36.92  ? 277  THR B OG1 1 
ATOM   7163  C  CG2 . THR B 1 277 ? 57.809 96.832  24.201  1.00 36.41  ? 277  THR B CG2 1 
ATOM   7164  N  N   . THR B 1 278 ? 58.086 99.776  26.228  1.00 36.81  ? 278  THR B N   1 
ATOM   7165  C  CA  . THR B 1 278 ? 58.864 99.803  27.449  1.00 36.15  ? 278  THR B CA  1 
ATOM   7166  C  C   . THR B 1 278 ? 58.708 98.498  28.189  1.00 35.96  ? 278  THR B C   1 
ATOM   7167  O  O   . THR B 1 278 ? 59.291 98.309  29.240  1.00 36.06  ? 278  THR B O   1 
ATOM   7168  C  CB  . THR B 1 278 ? 58.369 100.904 28.337  1.00 36.16  ? 278  THR B CB  1 
ATOM   7169  O  OG1 . THR B 1 278 ? 56.942 100.948 28.250  1.00 36.15  ? 278  THR B OG1 1 
ATOM   7170  C  CG2 . THR B 1 278 ? 58.815 102.248 27.808  1.00 35.74  ? 278  THR B CG2 1 
ATOM   7171  N  N   . GLU B 1 279 ? 57.922 97.588  27.647  1.00 36.03  ? 279  GLU B N   1 
ATOM   7172  C  CA  . GLU B 1 279 ? 57.701 96.328  28.340  1.00 36.44  ? 279  GLU B CA  1 
ATOM   7173  C  C   . GLU B 1 279 ? 58.954 95.835  29.036  1.00 36.10  ? 279  GLU B C   1 
ATOM   7174  O  O   . GLU B 1 279 ? 60.021 95.762  28.451  1.00 36.05  ? 279  GLU B O   1 
ATOM   7175  C  CB  . GLU B 1 279 ? 57.178 95.250  27.400  1.00 36.68  ? 279  GLU B CB  1 
ATOM   7176  C  CG  . GLU B 1 279 ? 56.700 94.014  28.130  1.00 38.58  ? 279  GLU B CG  1 
ATOM   7177  C  CD  . GLU B 1 279 ? 55.372 94.235  28.823  1.00 42.30  ? 279  GLU B CD  1 
ATOM   7178  O  OE1 . GLU B 1 279 ? 54.318 94.130  28.154  1.00 43.66  ? 279  GLU B OE1 1 
ATOM   7179  O  OE2 . GLU B 1 279 ? 55.377 94.523  30.037  1.00 44.71  ? 279  GLU B OE2 1 
ATOM   7180  N  N   . GLY B 1 280 ? 58.816 95.504  30.304  1.00 36.08  ? 280  GLY B N   1 
ATOM   7181  C  CA  . GLY B 1 280 ? 59.935 94.990  31.050  1.00 36.31  ? 280  GLY B CA  1 
ATOM   7182  C  C   . GLY B 1 280 ? 60.821 96.053  31.653  1.00 36.41  ? 280  GLY B C   1 
ATOM   7183  O  O   . GLY B 1 280 ? 61.867 95.726  32.196  1.00 36.93  ? 280  GLY B O   1 
ATOM   7184  N  N   . ARG B 1 281 ? 60.416 97.312  31.602  1.00 36.32  ? 281  ARG B N   1 
ATOM   7185  C  CA  . ARG B 1 281 ? 61.274 98.356  32.137  1.00 36.78  ? 281  ARG B CA  1 
ATOM   7186  C  C   . ARG B 1 281 ? 60.621 99.265  33.157  1.00 37.58  ? 281  ARG B C   1 
ATOM   7187  O  O   . ARG B 1 281 ? 59.413 99.437  33.163  1.00 38.09  ? 281  ARG B O   1 
ATOM   7188  C  CB  . ARG B 1 281 ? 61.828 99.225  31.007  1.00 36.58  ? 281  ARG B CB  1 
ATOM   7189  C  CG  . ARG B 1 281 ? 62.822 98.531  30.105  1.00 35.23  ? 281  ARG B CG  1 
ATOM   7190  C  CD  . ARG B 1 281 ? 63.482 99.455  29.127  1.00 32.32  ? 281  ARG B CD  1 
ATOM   7191  N  NE  . ARG B 1 281 ? 64.642 100.102 29.716  1.00 30.87  ? 281  ARG B NE  1 
ATOM   7192  C  CZ  . ARG B 1 281 ? 65.820 99.516  29.850  1.00 29.35  ? 281  ARG B CZ  1 
ATOM   7193  N  NH1 . ARG B 1 281 ? 65.983 98.275  29.434  1.00 28.88  ? 281  ARG B NH1 1 
ATOM   7194  N  NH2 . ARG B 1 281 ? 66.839 100.166 30.394  1.00 28.61  ? 281  ARG B NH2 1 
ATOM   7195  N  N   . THR B 1 282 ? 61.445 99.880  34.000  1.00 38.30  ? 282  THR B N   1 
ATOM   7196  C  CA  . THR B 1 282 ? 60.965 100.836 34.988  1.00 38.65  ? 282  THR B CA  1 
ATOM   7197  C  C   . THR B 1 282 ? 61.393 102.261 34.636  1.00 39.03  ? 282  THR B C   1 
ATOM   7198  O  O   . THR B 1 282 ? 60.692 103.227 34.969  1.00 39.61  ? 282  THR B O   1 
ATOM   7199  C  CB  . THR B 1 282 ? 61.496 100.460 36.344  1.00 38.49  ? 282  THR B CB  1 
ATOM   7200  O  OG1 . THR B 1 282 ? 62.774 99.847  36.174  1.00 38.50  ? 282  THR B OG1 1 
ATOM   7201  C  CG2 . THR B 1 282 ? 60.661 99.341  36.916  1.00 38.77  ? 282  THR B CG2 1 
ATOM   7202  N  N   . ASP B 1 283 ? 62.527 102.389 33.948  1.00 38.69  ? 283  ASP B N   1 
ATOM   7203  C  CA  . ASP B 1 283 ? 63.040 103.696 33.568  1.00 38.58  ? 283  ASP B CA  1 
ATOM   7204  C  C   . ASP B 1 283 ? 62.196 104.447 32.538  1.00 38.45  ? 283  ASP B C   1 
ATOM   7205  O  O   . ASP B 1 283 ? 62.440 105.622 32.288  1.00 39.00  ? 283  ASP B O   1 
ATOM   7206  C  CB  . ASP B 1 283 ? 64.464 103.573 33.058  1.00 38.76  ? 283  ASP B CB  1 
ATOM   7207  C  CG  . ASP B 1 283 ? 64.607 102.490 32.029  1.00 39.79  ? 283  ASP B CG  1 
ATOM   7208  O  OD1 . ASP B 1 283 ? 63.625 102.058 31.384  1.00 40.45  ? 283  ASP B OD1 1 
ATOM   7209  O  OD2 . ASP B 1 283 ? 65.749 102.006 31.821  1.00 40.40  ? 283  ASP B OD2 1 
ATOM   7210  N  N   . GLY B 1 284 ? 61.215 103.794 31.933  1.00 38.05  ? 284  GLY B N   1 
ATOM   7211  C  CA  . GLY B 1 284 ? 60.371 104.478 30.970  1.00 37.70  ? 284  GLY B CA  1 
ATOM   7212  C  C   . GLY B 1 284 ? 60.901 104.589 29.546  1.00 37.60  ? 284  GLY B C   1 
ATOM   7213  O  O   . GLY B 1 284 ? 60.156 104.970 28.646  1.00 37.91  ? 284  GLY B O   1 
ATOM   7214  N  N   . TYR B 1 285 ? 62.167 104.240 29.333  1.00 37.18  ? 285  TYR B N   1 
ATOM   7215  C  CA  . TYR B 1 285 ? 62.803 104.329 28.017  1.00 36.95  ? 285  TYR B CA  1 
ATOM   7216  C  C   . TYR B 1 285 ? 62.340 103.277 27.036  1.00 36.36  ? 285  TYR B C   1 
ATOM   7217  O  O   . TYR B 1 285 ? 62.607 102.113 27.265  1.00 36.78  ? 285  TYR B O   1 
ATOM   7218  C  CB  . TYR B 1 285 ? 64.311 104.140 28.177  1.00 37.33  ? 285  TYR B CB  1 
ATOM   7219  C  CG  . TYR B 1 285 ? 64.936 105.162 29.080  1.00 38.11  ? 285  TYR B CG  1 
ATOM   7220  C  CD1 . TYR B 1 285 ? 64.551 106.483 29.008  1.00 39.31  ? 285  TYR B CD1 1 
ATOM   7221  C  CD2 . TYR B 1 285 ? 65.888 104.808 30.007  1.00 38.88  ? 285  TYR B CD2 1 
ATOM   7222  C  CE1 . TYR B 1 285 ? 65.090 107.429 29.821  1.00 40.43  ? 285  TYR B CE1 1 
ATOM   7223  C  CE2 . TYR B 1 285 ? 66.436 105.747 30.839  1.00 41.11  ? 285  TYR B CE2 1 
ATOM   7224  C  CZ  . TYR B 1 285 ? 66.032 107.071 30.744  1.00 41.63  ? 285  TYR B CZ  1 
ATOM   7225  O  OH  . TYR B 1 285 ? 66.573 108.052 31.567  1.00 42.92  ? 285  TYR B OH  1 
ATOM   7226  N  N   . ARG B 1 286 ? 61.703 103.674 25.932  1.00 35.56  ? 286  ARG B N   1 
ATOM   7227  C  CA  . ARG B 1 286 ? 61.262 102.708 24.912  1.00 34.64  ? 286  ARG B CA  1 
ATOM   7228  C  C   . ARG B 1 286 ? 62.439 101.934 24.358  1.00 34.02  ? 286  ARG B C   1 
ATOM   7229  O  O   . ARG B 1 286 ? 63.546 102.454 24.254  1.00 34.00  ? 286  ARG B O   1 
ATOM   7230  C  CB  . ARG B 1 286 ? 60.584 103.380 23.705  1.00 34.71  ? 286  ARG B CB  1 
ATOM   7231  C  CG  . ARG B 1 286 ? 59.642 104.545 23.973  1.00 34.93  ? 286  ARG B CG  1 
ATOM   7232  C  CD  . ARG B 1 286 ? 58.412 104.597 23.005  1.00 36.15  ? 286  ARG B CD  1 
ATOM   7233  N  NE  . ARG B 1 286 ? 58.713 105.038 21.635  1.00 34.08  ? 286  ARG B NE  1 
ATOM   7234  C  CZ  . ARG B 1 286 ? 59.623 105.951 21.337  1.00 32.55  ? 286  ARG B CZ  1 
ATOM   7235  N  NH1 . ARG B 1 286 ? 60.324 106.519 22.311  1.00 30.78  ? 286  ARG B NH1 1 
ATOM   7236  N  NH2 . ARG B 1 286 ? 59.828 106.296 20.069  1.00 32.35  ? 286  ARG B NH2 1 
ATOM   7237  N  N   . TRP B 1 287 ? 62.183 100.690 23.978  1.00 33.56  ? 287  TRP B N   1 
ATOM   7238  C  CA  . TRP B 1 287 ? 63.190 99.847  23.342  1.00 32.87  ? 287  TRP B CA  1 
ATOM   7239  C  C   . TRP B 1 287 ? 62.515 98.917  22.361  1.00 33.03  ? 287  TRP B C   1 
ATOM   7240  O  O   . TRP B 1 287 ? 61.306 98.912  22.243  1.00 33.25  ? 287  TRP B O   1 
ATOM   7241  C  CB  . TRP B 1 287 ? 63.901 98.994  24.372  1.00 32.51  ? 287  TRP B CB  1 
ATOM   7242  C  CG  . TRP B 1 287 ? 63.006 98.003  25.005  1.00 29.98  ? 287  TRP B CG  1 
ATOM   7243  C  CD1 . TRP B 1 287 ? 62.109 98.245  25.979  1.00 28.36  ? 287  TRP B CD1 1 
ATOM   7244  C  CD2 . TRP B 1 287 ? 62.926 96.596  24.721  1.00 28.32  ? 287  TRP B CD2 1 
ATOM   7245  N  NE1 . TRP B 1 287 ? 61.459 97.084  26.321  1.00 28.96  ? 287  TRP B NE1 1 
ATOM   7246  C  CE2 . TRP B 1 287 ? 61.948 96.055  25.563  1.00 27.71  ? 287  TRP B CE2 1 
ATOM   7247  C  CE3 . TRP B 1 287 ? 63.587 95.738  23.838  1.00 27.49  ? 287  TRP B CE3 1 
ATOM   7248  C  CZ2 . TRP B 1 287 ? 61.614 94.705  25.556  1.00 26.28  ? 287  TRP B CZ2 1 
ATOM   7249  C  CZ3 . TRP B 1 287 ? 63.251 94.394  23.831  1.00 25.75  ? 287  TRP B CZ3 1 
ATOM   7250  C  CH2 . TRP B 1 287 ? 62.279 93.894  24.685  1.00 25.39  ? 287  TRP B CH2 1 
ATOM   7251  N  N   . CYS B 1 288 ? 63.290 98.092  21.682  1.00 33.25  ? 288  CYS B N   1 
ATOM   7252  C  CA  . CYS B 1 288 ? 62.702 97.145  20.761  1.00 33.56  ? 288  CYS B CA  1 
ATOM   7253  C  C   . CYS B 1 288 ? 63.701 96.087  20.422  1.00 33.72  ? 288  CYS B C   1 
ATOM   7254  O  O   . CYS B 1 288 ? 64.889 96.240  20.689  1.00 33.94  ? 288  CYS B O   1 
ATOM   7255  C  CB  . CYS B 1 288 ? 62.427 97.897  19.480  1.00 33.74  ? 288  CYS B CB  1 
ATOM   7256  S  SG  . CYS B 1 288 ? 63.965 98.582  18.863  1.00 33.57  ? 288  CYS B SG  1 
ATOM   7257  N  N   . GLY B 1 289 ? 63.219 95.010  19.816  1.00 33.83  ? 289  GLY B N   1 
ATOM   7258  C  CA  . GLY B 1 289 ? 64.102 93.977  19.325  1.00 33.70  ? 289  GLY B CA  1 
ATOM   7259  C  C   . GLY B 1 289 ? 64.761 94.604  18.123  1.00 33.69  ? 289  GLY B C   1 
ATOM   7260  O  O   . GLY B 1 289 ? 64.490 95.751  17.801  1.00 33.93  ? 289  GLY B O   1 
ATOM   7261  N  N   . THR B 1 290 ? 65.619 93.866  17.447  1.00 33.80  ? 290  THR B N   1 
ATOM   7262  C  CA  . THR B 1 290 ? 66.342 94.416  16.314  1.00 33.70  ? 290  THR B CA  1 
ATOM   7263  C  C   . THR B 1 290 ? 66.462 93.268  15.328  1.00 33.86  ? 290  THR B C   1 
ATOM   7264  O  O   . THR B 1 290 ? 67.004 93.386  14.219  1.00 33.87  ? 290  THR B O   1 
ATOM   7265  C  CB  . THR B 1 290 ? 67.720 94.891  16.785  1.00 33.45  ? 290  THR B CB  1 
ATOM   7266  O  OG1 . THR B 1 290 ? 68.064 96.097  16.103  1.00 33.19  ? 290  THR B OG1 1 
ATOM   7267  C  CG2 . THR B 1 290 ? 68.796 93.905  16.374  1.00 32.87  ? 290  THR B CG2 1 
ATOM   7268  N  N   . THR B 1 291 ? 65.895 92.159  15.776  1.00 33.69  ? 291  THR B N   1 
ATOM   7269  C  CA  . THR B 1 291 ? 65.880 90.906  15.080  1.00 33.49  ? 291  THR B CA  1 
ATOM   7270  C  C   . THR B 1 291 ? 64.405 90.511  15.126  1.00 33.55  ? 291  THR B C   1 
ATOM   7271  O  O   . THR B 1 291 ? 63.600 91.249  15.693  1.00 33.67  ? 291  THR B O   1 
ATOM   7272  C  CB  . THR B 1 291 ? 66.721 89.961  15.903  1.00 33.47  ? 291  THR B CB  1 
ATOM   7273  O  OG1 . THR B 1 291 ? 67.727 89.357  15.088  1.00 33.72  ? 291  THR B OG1 1 
ATOM   7274  C  CG2 . THR B 1 291 ? 65.884 88.824  16.435  1.00 33.47  ? 291  THR B CG2 1 
ATOM   7275  N  N   . GLU B 1 292 ? 64.010 89.387  14.545  1.00 33.48  ? 292  GLU B N   1 
ATOM   7276  C  CA  . GLU B 1 292 ? 62.585 89.038  14.596  1.00 33.77  ? 292  GLU B CA  1 
ATOM   7277  C  C   . GLU B 1 292 ? 62.111 88.369  15.897  1.00 33.41  ? 292  GLU B C   1 
ATOM   7278  O  O   . GLU B 1 292 ? 60.938 88.432  16.233  1.00 33.63  ? 292  GLU B O   1 
ATOM   7279  C  CB  . GLU B 1 292 ? 62.148 88.223  13.372  1.00 33.94  ? 292  GLU B CB  1 
ATOM   7280  C  CG  . GLU B 1 292 ? 62.898 86.921  13.168  1.00 35.64  ? 292  GLU B CG  1 
ATOM   7281  C  CD  . GLU B 1 292 ? 62.158 85.963  12.248  1.00 37.31  ? 292  GLU B CD  1 
ATOM   7282  O  OE1 . GLU B 1 292 ? 61.215 86.426  11.562  1.00 37.83  ? 292  GLU B OE1 1 
ATOM   7283  O  OE2 . GLU B 1 292 ? 62.517 84.753  12.216  1.00 37.38  ? 292  GLU B OE2 1 
ATOM   7284  N  N   . ASP B 1 293 ? 63.026 87.744  16.624  1.00 33.23  ? 293  ASP B N   1 
ATOM   7285  C  CA  . ASP B 1 293 ? 62.718 87.075  17.884  1.00 32.79  ? 293  ASP B CA  1 
ATOM   7286  C  C   . ASP B 1 293 ? 63.701 87.548  18.956  1.00 32.68  ? 293  ASP B C   1 
ATOM   7287  O  O   . ASP B 1 293 ? 64.801 87.008  19.075  1.00 32.73  ? 293  ASP B O   1 
ATOM   7288  C  CB  . ASP B 1 293 ? 62.841 85.563  17.695  1.00 32.83  ? 293  ASP B CB  1 
ATOM   7289  C  CG  . ASP B 1 293 ? 62.667 84.793  18.988  1.00 32.94  ? 293  ASP B CG  1 
ATOM   7290  O  OD1 . ASP B 1 293 ? 62.989 85.341  20.061  1.00 33.15  ? 293  ASP B OD1 1 
ATOM   7291  O  OD2 . ASP B 1 293 ? 62.214 83.630  19.028  1.00 32.43  ? 293  ASP B OD2 1 
ATOM   7292  N  N   . TYR B 1 294 ? 63.309 88.549  19.739  1.00 32.48  ? 294  TYR B N   1 
ATOM   7293  C  CA  . TYR B 1 294 ? 64.177 89.101  20.784  1.00 32.11  ? 294  TYR B CA  1 
ATOM   7294  C  C   . TYR B 1 294 ? 64.712 88.103  21.819  1.00 31.97  ? 294  TYR B C   1 
ATOM   7295  O  O   . TYR B 1 294 ? 65.844 88.218  22.273  1.00 31.68  ? 294  TYR B O   1 
ATOM   7296  C  CB  . TYR B 1 294 ? 63.485 90.230  21.537  1.00 31.83  ? 294  TYR B CB  1 
ATOM   7297  C  CG  . TYR B 1 294 ? 64.299 90.628  22.739  1.00 31.80  ? 294  TYR B CG  1 
ATOM   7298  C  CD1 . TYR B 1 294 ? 65.547 91.206  22.588  1.00 31.10  ? 294  TYR B CD1 1 
ATOM   7299  C  CD2 . TYR B 1 294 ? 63.842 90.383  24.020  1.00 31.82  ? 294  TYR B CD2 1 
ATOM   7300  C  CE1 . TYR B 1 294 ? 66.301 91.552  23.675  1.00 31.46  ? 294  TYR B CE1 1 
ATOM   7301  C  CE2 . TYR B 1 294 ? 64.588 90.724  25.112  1.00 31.46  ? 294  TYR B CE2 1 
ATOM   7302  C  CZ  . TYR B 1 294 ? 65.818 91.307  24.938  1.00 31.74  ? 294  TYR B CZ  1 
ATOM   7303  O  OH  . TYR B 1 294 ? 66.572 91.651  26.035  1.00 32.16  ? 294  TYR B OH  1 
ATOM   7304  N  N   . ASP B 1 295 ? 63.878 87.150  22.217  1.00 31.97  ? 295  ASP B N   1 
ATOM   7305  C  CA  . ASP B 1 295 ? 64.272 86.151  23.200  1.00 31.78  ? 295  ASP B CA  1 
ATOM   7306  C  C   . ASP B 1 295 ? 65.401 85.311  22.689  1.00 31.98  ? 295  ASP B C   1 
ATOM   7307  O  O   . ASP B 1 295 ? 66.272 84.900  23.441  1.00 32.23  ? 295  ASP B O   1 
ATOM   7308  C  CB  . ASP B 1 295 ? 63.131 85.181  23.448  1.00 31.44  ? 295  ASP B CB  1 
ATOM   7309  C  CG  . ASP B 1 295 ? 61.969 85.816  24.111  1.00 30.48  ? 295  ASP B CG  1 
ATOM   7310  O  OD1 . ASP B 1 295 ? 62.171 86.797  24.856  1.00 28.81  ? 295  ASP B OD1 1 
ATOM   7311  O  OD2 . ASP B 1 295 ? 60.811 85.380  23.945  1.00 29.97  ? 295  ASP B OD2 1 
ATOM   7312  N  N   . ARG B 1 296 ? 65.339 85.023  21.400  1.00 32.28  ? 296  ARG B N   1 
ATOM   7313  C  CA  . ARG B 1 296 ? 66.258 84.100  20.764  1.00 32.66  ? 296  ARG B CA  1 
ATOM   7314  C  C   . ARG B 1 296 ? 67.630 84.717  20.548  1.00 32.40  ? 296  ARG B C   1 
ATOM   7315  O  O   . ARG B 1 296 ? 68.632 84.126  20.907  1.00 32.32  ? 296  ARG B O   1 
ATOM   7316  C  CB  . ARG B 1 296 ? 65.652 83.619  19.435  1.00 32.95  ? 296  ARG B CB  1 
ATOM   7317  C  CG  . ARG B 1 296 ? 66.154 82.277  18.925  1.00 34.21  ? 296  ARG B CG  1 
ATOM   7318  C  CD  . ARG B 1 296 ? 65.611 81.901  17.549  1.00 36.47  ? 296  ARG B CD  1 
ATOM   7319  N  NE  . ARG B 1 296 ? 65.447 83.062  16.671  1.00 38.61  ? 296  ARG B NE  1 
ATOM   7320  C  CZ  . ARG B 1 296 ? 64.692 83.076  15.571  1.00 39.43  ? 296  ARG B CZ  1 
ATOM   7321  N  NH1 . ARG B 1 296 ? 64.037 81.985  15.204  1.00 39.33  ? 296  ARG B NH1 1 
ATOM   7322  N  NH2 . ARG B 1 296 ? 64.586 84.182  14.837  1.00 39.72  ? 296  ARG B NH2 1 
ATOM   7323  N  N   . ASP B 1 297 ? 67.663 85.922  19.997  1.00 32.43  ? 297  ASP B N   1 
ATOM   7324  C  CA  . ASP B 1 297 ? 68.919 86.577  19.650  1.00 32.67  ? 297  ASP B CA  1 
ATOM   7325  C  C   . ASP B 1 297 ? 69.378 87.671  20.622  1.00 32.86  ? 297  ASP B C   1 
ATOM   7326  O  O   . ASP B 1 297 ? 70.507 88.146  20.558  1.00 33.03  ? 297  ASP B O   1 
ATOM   7327  C  CB  . ASP B 1 297 ? 68.807 87.123  18.230  1.00 32.53  ? 297  ASP B CB  1 
ATOM   7328  C  CG  . ASP B 1 297 ? 68.065 86.171  17.312  1.00 32.82  ? 297  ASP B CG  1 
ATOM   7329  O  OD1 . ASP B 1 297 ? 68.205 84.939  17.488  1.00 31.83  ? 297  ASP B OD1 1 
ATOM   7330  O  OD2 . ASP B 1 297 ? 67.304 86.559  16.402  1.00 33.11  ? 297  ASP B OD2 1 
ATOM   7331  N  N   . LYS B 1 298 ? 68.503 88.060  21.530  1.00 33.33  ? 298  LYS B N   1 
ATOM   7332  C  CA  . LYS B 1 298 ? 68.823 89.089  22.509  1.00 33.82  ? 298  LYS B CA  1 
ATOM   7333  C  C   . LYS B 1 298 ? 69.516 90.318  21.924  1.00 33.68  ? 298  LYS B C   1 
ATOM   7334  O  O   . LYS B 1 298 ? 70.414 90.877  22.533  1.00 33.90  ? 298  LYS B O   1 
ATOM   7335  C  CB  . LYS B 1 298 ? 69.642 88.500  23.650  1.00 34.11  ? 298  LYS B CB  1 
ATOM   7336  C  CG  . LYS B 1 298 ? 68.946 87.364  24.377  1.00 35.67  ? 298  LYS B CG  1 
ATOM   7337  C  CD  . LYS B 1 298 ? 69.760 86.877  25.570  1.00 39.03  ? 298  LYS B CD  1 
ATOM   7338  C  CE  . LYS B 1 298 ? 69.153 85.618  26.169  1.00 41.44  ? 298  LYS B CE  1 
ATOM   7339  N  NZ  . LYS B 1 298 ? 69.987 85.033  27.268  1.00 44.30  ? 298  LYS B NZ  1 
ATOM   7340  N  N   . LYS B 1 299 ? 69.079 90.750  20.749  1.00 33.57  ? 299  LYS B N   1 
ATOM   7341  C  CA  . LYS B 1 299 ? 69.636 91.936  20.120  1.00 33.45  ? 299  LYS B CA  1 
ATOM   7342  C  C   . LYS B 1 299 ? 68.643 93.094  20.228  1.00 33.78  ? 299  LYS B C   1 
ATOM   7343  O  O   . LYS B 1 299 ? 67.490 92.968  19.797  1.00 33.92  ? 299  LYS B O   1 
ATOM   7344  C  CB  . LYS B 1 299 ? 69.939 91.644  18.655  1.00 33.19  ? 299  LYS B CB  1 
ATOM   7345  C  CG  . LYS B 1 299 ? 71.409 91.492  18.307  1.00 32.92  ? 299  LYS B CG  1 
ATOM   7346  C  CD  . LYS B 1 299 ? 72.217 90.873  19.437  1.00 33.48  ? 299  LYS B CD  1 
ATOM   7347  C  CE  . LYS B 1 299 ? 73.642 90.497  18.989  1.00 33.22  ? 299  LYS B CE  1 
ATOM   7348  N  NZ  . LYS B 1 299 ? 74.586 91.653  18.871  1.00 31.87  ? 299  LYS B NZ  1 
ATOM   7349  N  N   . TYR B 1 300 ? 69.086 94.222  20.786  1.00 33.87  ? 300  TYR B N   1 
ATOM   7350  C  CA  . TYR B 1 300 ? 68.202 95.376  20.965  1.00 34.10  ? 300  TYR B CA  1 
ATOM   7351  C  C   . TYR B 1 300 ? 68.888 96.741  20.959  1.00 34.26  ? 300  TYR B C   1 
ATOM   7352  O  O   . TYR B 1 300 ? 70.103 96.853  21.125  1.00 34.59  ? 300  TYR B O   1 
ATOM   7353  C  CB  . TYR B 1 300 ? 67.469 95.259  22.294  1.00 34.10  ? 300  TYR B CB  1 
ATOM   7354  C  CG  . TYR B 1 300 ? 68.378 95.480  23.474  1.00 34.28  ? 300  TYR B CG  1 
ATOM   7355  C  CD1 . TYR B 1 300 ? 69.572 94.795  23.579  1.00 34.78  ? 300  TYR B CD1 1 
ATOM   7356  C  CD2 . TYR B 1 300 ? 68.052 96.377  24.473  1.00 34.79  ? 300  TYR B CD2 1 
ATOM   7357  C  CE1 . TYR B 1 300 ? 70.409 94.991  24.640  1.00 35.11  ? 300  TYR B CE1 1 
ATOM   7358  C  CE2 . TYR B 1 300 ? 68.888 96.577  25.547  1.00 34.83  ? 300  TYR B CE2 1 
ATOM   7359  C  CZ  . TYR B 1 300 ? 70.061 95.878  25.620  1.00 35.24  ? 300  TYR B CZ  1 
ATOM   7360  O  OH  . TYR B 1 300 ? 70.908 96.061  26.679  1.00 37.45  ? 300  TYR B OH  1 
ATOM   7361  N  N   . GLY B 1 301 ? 68.072 97.777  20.800  1.00 34.25  ? 301  GLY B N   1 
ATOM   7362  C  CA  . GLY B 1 301 ? 68.514 99.155  20.837  1.00 34.27  ? 301  GLY B CA  1 
ATOM   7363  C  C   . GLY B 1 301 ? 67.400 99.949  21.483  1.00 34.48  ? 301  GLY B C   1 
ATOM   7364  O  O   . GLY B 1 301 ? 66.319 99.413  21.698  1.00 34.53  ? 301  GLY B O   1 
ATOM   7365  N  N   . PHE B 1 302 ? 67.648 101.208 21.816  1.00 34.66  ? 302  PHE B N   1 
ATOM   7366  C  CA  . PHE B 1 302 ? 66.606 102.025 22.417  1.00 34.84  ? 302  PHE B CA  1 
ATOM   7367  C  C   . PHE B 1 302 ? 66.128 102.991 21.352  1.00 35.34  ? 302  PHE B C   1 
ATOM   7368  O  O   . PHE B 1 302 ? 66.787 103.166 20.331  1.00 35.44  ? 302  PHE B O   1 
ATOM   7369  C  CB  . PHE B 1 302 ? 67.136 102.789 23.629  1.00 34.80  ? 302  PHE B CB  1 
ATOM   7370  C  CG  . PHE B 1 302 ? 67.567 101.909 24.768  1.00 34.52  ? 302  PHE B CG  1 
ATOM   7371  C  CD1 . PHE B 1 302 ? 68.796 101.291 24.760  1.00 34.02  ? 302  PHE B CD1 1 
ATOM   7372  C  CD2 . PHE B 1 302 ? 66.741 101.700 25.850  1.00 34.20  ? 302  PHE B CD2 1 
ATOM   7373  C  CE1 . PHE B 1 302 ? 69.177 100.480 25.806  1.00 32.87  ? 302  PHE B CE1 1 
ATOM   7374  C  CE2 . PHE B 1 302 ? 67.134 100.891 26.895  1.00 32.80  ? 302  PHE B CE2 1 
ATOM   7375  C  CZ  . PHE B 1 302 ? 68.347 100.294 26.874  1.00 31.61  ? 302  PHE B CZ  1 
ATOM   7376  N  N   . CYS B 1 303 ? 64.981 103.614 21.585  1.00 35.94  ? 303  CYS B N   1 
ATOM   7377  C  CA  . CYS B 1 303 ? 64.407 104.559 20.640  1.00 36.56  ? 303  CYS B CA  1 
ATOM   7378  C  C   . CYS B 1 303 ? 64.129 105.872 21.381  1.00 36.58  ? 303  CYS B C   1 
ATOM   7379  O  O   . CYS B 1 303 ? 62.983 106.196 21.678  1.00 36.79  ? 303  CYS B O   1 
ATOM   7380  C  CB  . CYS B 1 303 ? 63.105 103.991 20.061  1.00 36.71  ? 303  CYS B CB  1 
ATOM   7381  S  SG  . CYS B 1 303 ? 63.153 102.230 19.605  1.00 39.27  ? 303  CYS B SG  1 
ATOM   7382  N  N   . PRO B 1 304 ? 65.176 106.632 21.674  1.00 36.47  ? 304  PRO B N   1 
ATOM   7383  C  CA  . PRO B 1 304 ? 65.039 107.869 22.449  1.00 36.41  ? 304  PRO B CA  1 
ATOM   7384  C  C   . PRO B 1 304 ? 64.068 108.904 21.892  1.00 36.44  ? 304  PRO B C   1 
ATOM   7385  O  O   . PRO B 1 304 ? 63.317 109.461 22.667  1.00 36.97  ? 304  PRO B O   1 
ATOM   7386  C  CB  . PRO B 1 304 ? 66.452 108.441 22.438  1.00 36.15  ? 304  PRO B CB  1 
ATOM   7387  C  CG  . PRO B 1 304 ? 67.306 107.279 22.210  1.00 36.15  ? 304  PRO B CG  1 
ATOM   7388  C  CD  . PRO B 1 304 ? 66.570 106.382 21.280  1.00 36.17  ? 304  PRO B CD  1 
ATOM   7389  N  N   . GLU B 1 305 ? 64.083 109.173 20.597  1.00 36.54  ? 305  GLU B N   1 
ATOM   7390  C  CA  . GLU B 1 305 ? 63.230 110.219 20.037  1.00 36.62  ? 305  GLU B CA  1 
ATOM   7391  C  C   . GLU B 1 305 ? 62.772 109.810 18.653  1.00 36.55  ? 305  GLU B C   1 
ATOM   7392  O  O   . GLU B 1 305 ? 63.518 109.167 17.907  1.00 37.03  ? 305  GLU B O   1 
ATOM   7393  C  CB  . GLU B 1 305 ? 64.003 111.533 19.954  1.00 36.65  ? 305  GLU B CB  1 
ATOM   7394  C  CG  . GLU B 1 305 ? 63.158 112.750 19.641  1.00 38.11  ? 305  GLU B CG  1 
ATOM   7395  C  CD  . GLU B 1 305 ? 63.977 114.018 19.407  1.00 41.99  ? 305  GLU B CD  1 
ATOM   7396  O  OE1 . GLU B 1 305 ? 65.227 113.937 19.187  1.00 42.93  ? 305  GLU B OE1 1 
ATOM   7397  O  OE2 . GLU B 1 305 ? 63.355 115.112 19.442  1.00 42.79  ? 305  GLU B OE2 1 
ATOM   7398  N  N   . THR B 1 306 ? 61.552 110.169 18.292  1.00 35.97  ? 306  THR B N   1 
ATOM   7399  C  CA  . THR B 1 306 ? 61.045 109.768 16.996  1.00 35.62  ? 306  THR B CA  1 
ATOM   7400  C  C   . THR B 1 306 ? 60.700 110.975 16.154  1.00 35.52  ? 306  THR B C   1 
ATOM   7401  O  O   . THR B 1 306 ? 59.716 111.641 16.416  1.00 35.48  ? 306  THR B O   1 
ATOM   7402  C  CB  . THR B 1 306 ? 59.820 108.906 17.187  1.00 35.56  ? 306  THR B CB  1 
ATOM   7403  O  OG1 . THR B 1 306 ? 59.994 107.648 16.527  1.00 35.06  ? 306  THR B OG1 1 
ATOM   7404  C  CG2 . THR B 1 306 ? 58.658 109.515 16.453  1.00 36.48  ? 306  THR B CG2 1 
ATOM   7405  N  N   . ALA B 1 307 ? 61.525 111.267 15.158  1.00 35.57  ? 307  ALA B N   1 
ATOM   7406  C  CA  . ALA B 1 307 ? 61.313 112.417 14.303  1.00 35.66  ? 307  ALA B CA  1 
ATOM   7407  C  C   . ALA B 1 307 ? 60.104 112.159 13.445  1.00 36.06  ? 307  ALA B C   1 
ATOM   7408  O  O   . ALA B 1 307 ? 59.968 111.086 12.888  1.00 36.17  ? 307  ALA B O   1 
ATOM   7409  C  CB  . ALA B 1 307 ? 62.519 112.648 13.446  1.00 35.82  ? 307  ALA B CB  1 
ATOM   7410  N  N   . MET B 1 308 ? 59.222 113.146 13.342  1.00 36.91  ? 308  MET B N   1 
ATOM   7411  C  CA  . MET B 1 308 ? 57.983 112.996 12.581  1.00 37.59  ? 308  MET B CA  1 
ATOM   7412  C  C   . MET B 1 308 ? 57.748 114.159 11.612  1.00 37.72  ? 308  MET B C   1 
ATOM   7413  O  O   . MET B 1 308 ? 57.934 115.324 11.971  1.00 37.93  ? 308  MET B O   1 
ATOM   7414  C  CB  . MET B 1 308 ? 56.802 112.823 13.528  1.00 37.75  ? 308  MET B CB  1 
ATOM   7415  C  CG  . MET B 1 308 ? 56.611 111.389 13.997  1.00 39.29  ? 308  MET B CG  1 
ATOM   7416  S  SD  . MET B 1 308 ? 54.871 111.024 14.419  1.00 44.93  ? 308  MET B SD  1 
ATOM   7417  C  CE  . MET B 1 308 ? 54.745 109.273 13.927  1.00 43.06  ? 308  MET B CE  1 
ATOM   7418  N  N   . SER B 1 309 ? 57.346 113.834 10.384  1.00 37.57  ? 309  SER B N   1 
ATOM   7419  C  CA  . SER B 1 309 ? 57.173 114.833 9.338   1.00 37.39  ? 309  SER B CA  1 
ATOM   7420  C  C   . SER B 1 309 ? 55.761 115.311 9.362   1.00 37.30  ? 309  SER B C   1 
ATOM   7421  O  O   . SER B 1 309 ? 55.482 116.506 9.256   1.00 37.66  ? 309  SER B O   1 
ATOM   7422  C  CB  . SER B 1 309 ? 57.444 114.216 7.974   1.00 37.55  ? 309  SER B CB  1 
ATOM   7423  O  OG  . SER B 1 309 ? 58.714 113.582 7.937   1.00 38.98  ? 309  SER B OG  1 
ATOM   7424  N  N   . THR B 1 310 ? 54.859 114.355 9.482   1.00 36.97  ? 310  THR B N   1 
ATOM   7425  C  CA  . THR B 1 310 ? 53.460 114.660 9.569   1.00 36.73  ? 310  THR B CA  1 
ATOM   7426  C  C   . THR B 1 310 ? 53.086 114.183 10.941  1.00 36.61  ? 310  THR B C   1 
ATOM   7427  O  O   . THR B 1 310 ? 53.802 113.376 11.516  1.00 37.21  ? 310  THR B O   1 
ATOM   7428  C  CB  . THR B 1 310 ? 52.736 113.877 8.506   1.00 36.74  ? 310  THR B CB  1 
ATOM   7429  O  OG1 . THR B 1 310 ? 52.870 114.565 7.254   1.00 37.37  ? 310  THR B OG1 1 
ATOM   7430  C  CG2 . THR B 1 310 ? 51.248 113.893 8.760   1.00 37.41  ? 310  THR B CG2 1 
ATOM   7431  N  N   . VAL B 1 311 ? 51.991 114.673 11.498  1.00 36.34  ? 311  VAL B N   1 
ATOM   7432  C  CA  . VAL B 1 311 ? 51.605 114.230 12.833  1.00 35.84  ? 311  VAL B CA  1 
ATOM   7433  C  C   . VAL B 1 311 ? 50.133 113.827 12.878  1.00 35.44  ? 311  VAL B C   1 
ATOM   7434  O  O   . VAL B 1 311 ? 49.327 114.313 12.090  1.00 35.36  ? 311  VAL B O   1 
ATOM   7435  C  CB  . VAL B 1 311 ? 51.948 115.306 13.882  1.00 35.79  ? 311  VAL B CB  1 
ATOM   7436  C  CG1 . VAL B 1 311 ? 50.737 115.680 14.680  1.00 35.87  ? 311  VAL B CG1 1 
ATOM   7437  C  CG2 . VAL B 1 311 ? 53.066 114.819 14.787  1.00 35.52  ? 311  VAL B CG2 1 
ATOM   7438  N  N   . GLY B 1 312 ? 49.782 112.927 13.782  1.00 35.04  ? 312  GLY B N   1 
ATOM   7439  C  CA  . GLY B 1 312 ? 48.408 112.472 13.845  1.00 35.41  ? 312  GLY B CA  1 
ATOM   7440  C  C   . GLY B 1 312 ? 48.031 111.903 12.496  1.00 35.57  ? 312  GLY B C   1 
ATOM   7441  O  O   . GLY B 1 312 ? 48.901 111.464 11.752  1.00 36.06  ? 312  GLY B O   1 
ATOM   7442  N  N   . GLY B 1 313 ? 46.752 111.911 12.155  1.00 35.53  ? 313  GLY B N   1 
ATOM   7443  C  CA  . GLY B 1 313 ? 46.356 111.387 10.864  1.00 35.75  ? 313  GLY B CA  1 
ATOM   7444  C  C   . GLY B 1 313 ? 46.455 109.874 10.811  1.00 35.86  ? 313  GLY B C   1 
ATOM   7445  O  O   . GLY B 1 313 ? 46.373 109.228 11.844  1.00 35.98  ? 313  GLY B O   1 
ATOM   7446  N  N   . ASN B 1 314 ? 46.631 109.310 9.617   1.00 36.03  ? 314  ASN B N   1 
ATOM   7447  C  CA  . ASN B 1 314 ? 46.685 107.860 9.440   1.00 36.18  ? 314  ASN B CA  1 
ATOM   7448  C  C   . ASN B 1 314 ? 47.896 107.396 8.678   1.00 36.69  ? 314  ASN B C   1 
ATOM   7449  O  O   . ASN B 1 314 ? 47.913 106.270 8.192   1.00 36.76  ? 314  ASN B O   1 
ATOM   7450  C  CB  . ASN B 1 314 ? 45.455 107.355 8.685   1.00 36.02  ? 314  ASN B CB  1 
ATOM   7451  C  CG  . ASN B 1 314 ? 45.385 107.881 7.260   1.00 36.21  ? 314  ASN B CG  1 
ATOM   7452  O  OD1 . ASN B 1 314 ? 44.512 107.498 6.476   1.00 34.20  ? 314  ASN B OD1 1 
ATOM   7453  N  ND2 . ASN B 1 314 ? 46.309 108.774 6.920   1.00 38.42  ? 314  ASN B ND2 1 
ATOM   7454  N  N   . SER B 1 315 ? 48.900 108.256 8.550   1.00 37.35  ? 315  SER B N   1 
ATOM   7455  C  CA  . SER B 1 315 ? 50.090 107.905 7.781   1.00 38.08  ? 315  SER B CA  1 
ATOM   7456  C  C   . SER B 1 315 ? 51.357 107.719 8.640   1.00 38.76  ? 315  SER B C   1 
ATOM   7457  O  O   . SER B 1 315 ? 52.495 107.836 8.160   1.00 38.89  ? 315  SER B O   1 
ATOM   7458  C  CB  . SER B 1 315 ? 50.312 108.935 6.676   1.00 38.05  ? 315  SER B CB  1 
ATOM   7459  O  OG  . SER B 1 315 ? 49.066 109.358 6.141   1.00 37.95  ? 315  SER B OG  1 
ATOM   7460  N  N   . GLU B 1 316 ? 51.153 107.427 9.916   1.00 39.22  ? 316  GLU B N   1 
ATOM   7461  C  CA  . GLU B 1 316 ? 52.268 107.173 10.812  1.00 39.69  ? 316  GLU B CA  1 
ATOM   7462  C  C   . GLU B 1 316 ? 53.453 108.106 10.640  1.00 39.24  ? 316  GLU B C   1 
ATOM   7463  O  O   . GLU B 1 316 ? 54.587 107.701 10.848  1.00 39.93  ? 316  GLU B O   1 
ATOM   7464  C  CB  . GLU B 1 316 ? 52.746 105.730 10.663  1.00 40.01  ? 316  GLU B CB  1 
ATOM   7465  C  CG  . GLU B 1 316 ? 52.167 104.769 11.687  1.00 42.45  ? 316  GLU B CG  1 
ATOM   7466  C  CD  . GLU B 1 316 ? 51.963 103.373 11.118  1.00 46.40  ? 316  GLU B CD  1 
ATOM   7467  O  OE1 . GLU B 1 316 ? 52.942 102.791 10.563  1.00 48.46  ? 316  GLU B OE1 1 
ATOM   7468  O  OE2 . GLU B 1 316 ? 50.821 102.857 11.218  1.00 46.48  ? 316  GLU B OE2 1 
ATOM   7469  N  N   . GLY B 1 317 ? 53.217 109.345 10.250  1.00 38.66  ? 317  GLY B N   1 
ATOM   7470  C  CA  . GLY B 1 317 ? 54.308 110.297 10.218  1.00 38.11  ? 317  GLY B CA  1 
ATOM   7471  C  C   . GLY B 1 317 ? 54.847 110.600 8.848   1.00 37.88  ? 317  GLY B C   1 
ATOM   7472  O  O   . GLY B 1 317 ? 55.588 111.564 8.673   1.00 37.94  ? 317  GLY B O   1 
ATOM   7473  N  N   . ALA B 1 318 ? 54.482 109.769 7.879   1.00 37.61  ? 318  ALA B N   1 
ATOM   7474  C  CA  . ALA B 1 318 ? 54.885 109.978 6.493   1.00 37.40  ? 318  ALA B CA  1 
ATOM   7475  C  C   . ALA B 1 318 ? 54.786 111.461 6.098   1.00 37.23  ? 318  ALA B C   1 
ATOM   7476  O  O   . ALA B 1 318 ? 53.852 112.156 6.504   1.00 37.22  ? 318  ALA B O   1 
ATOM   7477  C  CB  . ALA B 1 318 ? 54.020 109.128 5.583   1.00 37.36  ? 318  ALA B CB  1 
ATOM   7478  N  N   . PRO B 1 319 ? 55.723 111.939 5.286   1.00 36.91  ? 319  PRO B N   1 
ATOM   7479  C  CA  . PRO B 1 319 ? 55.765 113.353 4.916   1.00 36.91  ? 319  PRO B CA  1 
ATOM   7480  C  C   . PRO B 1 319 ? 54.670 113.760 3.954   1.00 36.96  ? 319  PRO B C   1 
ATOM   7481  O  O   . PRO B 1 319 ? 54.076 112.938 3.262   1.00 37.11  ? 319  PRO B O   1 
ATOM   7482  C  CB  . PRO B 1 319 ? 57.107 113.498 4.209   1.00 36.65  ? 319  PRO B CB  1 
ATOM   7483  C  CG  . PRO B 1 319 ? 57.800 112.246 4.441   1.00 37.24  ? 319  PRO B CG  1 
ATOM   7484  C  CD  . PRO B 1 319 ? 56.786 111.173 4.631   1.00 36.95  ? 319  PRO B CD  1 
ATOM   7485  N  N   . CYS B 1 320 ? 54.414 115.057 3.916   1.00 36.89  ? 320  CYS B N   1 
ATOM   7486  C  CA  . CYS B 1 320 ? 53.439 115.603 3.003   1.00 36.57  ? 320  CYS B CA  1 
ATOM   7487  C  C   . CYS B 1 320 ? 53.947 115.335 1.598   1.00 35.79  ? 320  CYS B C   1 
ATOM   7488  O  O   . CYS B 1 320 ? 55.117 115.035 1.407   1.00 35.61  ? 320  CYS B O   1 
ATOM   7489  C  CB  . CYS B 1 320 ? 53.252 117.093 3.287   1.00 36.84  ? 320  CYS B CB  1 
ATOM   7490  S  SG  . CYS B 1 320 ? 52.634 117.377 4.977   1.00 38.64  ? 320  CYS B SG  1 
ATOM   7491  N  N   . VAL B 1 321 ? 53.054 115.406 0.623   1.00 35.19  ? 321  VAL B N   1 
ATOM   7492  C  CA  . VAL B 1 321 ? 53.394 115.128 -0.755  1.00 34.44  ? 321  VAL B CA  1 
ATOM   7493  C  C   . VAL B 1 321 ? 52.715 116.151 -1.620  1.00 34.30  ? 321  VAL B C   1 
ATOM   7494  O  O   . VAL B 1 321 ? 51.500 116.189 -1.681  1.00 34.24  ? 321  VAL B O   1 
ATOM   7495  C  CB  . VAL B 1 321 ? 52.863 113.755 -1.179  1.00 34.31  ? 321  VAL B CB  1 
ATOM   7496  C  CG1 . VAL B 1 321 ? 52.771 113.655 -2.678  1.00 34.17  ? 321  VAL B CG1 1 
ATOM   7497  C  CG2 . VAL B 1 321 ? 53.733 112.649 -0.633  1.00 34.57  ? 321  VAL B CG2 1 
ATOM   7498  N  N   . PHE B 1 322 ? 53.492 116.995 -2.281  1.00 34.36  ? 322  PHE B N   1 
ATOM   7499  C  CA  . PHE B 1 322 ? 52.912 117.980 -3.179  1.00 34.44  ? 322  PHE B CA  1 
ATOM   7500  C  C   . PHE B 1 322 ? 53.360 117.717 -4.615  1.00 34.30  ? 322  PHE B C   1 
ATOM   7501  O  O   . PHE B 1 322 ? 54.424 117.156 -4.856  1.00 34.49  ? 322  PHE B O   1 
ATOM   7502  C  CB  . PHE B 1 322 ? 53.268 119.395 -2.729  1.00 34.70  ? 322  PHE B CB  1 
ATOM   7503  C  CG  . PHE B 1 322 ? 53.018 119.646 -1.261  1.00 35.15  ? 322  PHE B CG  1 
ATOM   7504  C  CD1 . PHE B 1 322 ? 51.768 119.995 -0.806  1.00 35.90  ? 322  PHE B CD1 1 
ATOM   7505  C  CD2 . PHE B 1 322 ? 54.037 119.524 -0.344  1.00 36.01  ? 322  PHE B CD2 1 
ATOM   7506  C  CE1 . PHE B 1 322 ? 51.543 120.221 0.529   1.00 36.59  ? 322  PHE B CE1 1 
ATOM   7507  C  CE2 . PHE B 1 322 ? 53.816 119.745 0.991   1.00 36.34  ? 322  PHE B CE2 1 
ATOM   7508  C  CZ  . PHE B 1 322 ? 52.571 120.091 1.429   1.00 36.83  ? 322  PHE B CZ  1 
ATOM   7509  N  N   . PRO B 1 323 ? 52.501 118.045 -5.566  1.00 34.07  ? 323  PRO B N   1 
ATOM   7510  C  CA  . PRO B 1 323 ? 51.173 118.563 -5.266  1.00 33.74  ? 323  PRO B CA  1 
ATOM   7511  C  C   . PRO B 1 323 ? 50.296 117.362 -4.978  1.00 33.38  ? 323  PRO B C   1 
ATOM   7512  O  O   . PRO B 1 323 ? 50.643 116.249 -5.375  1.00 33.31  ? 323  PRO B O   1 
ATOM   7513  C  CB  . PRO B 1 323 ? 50.776 119.173 -6.597  1.00 33.78  ? 323  PRO B CB  1 
ATOM   7514  C  CG  . PRO B 1 323 ? 51.303 118.150 -7.537  1.00 34.06  ? 323  PRO B CG  1 
ATOM   7515  C  CD  . PRO B 1 323 ? 52.717 117.933 -7.018  1.00 34.10  ? 323  PRO B CD  1 
ATOM   7516  N  N   . PHE B 1 324 ? 49.200 117.564 -4.265  1.00 32.98  ? 324  PHE B N   1 
ATOM   7517  C  CA  . PHE B 1 324 ? 48.281 116.470 -4.014  1.00 32.65  ? 324  PHE B CA  1 
ATOM   7518  C  C   . PHE B 1 324 ? 46.897 116.942 -4.356  1.00 32.27  ? 324  PHE B C   1 
ATOM   7519  O  O   . PHE B 1 324 ? 46.574 118.116 -4.176  1.00 32.36  ? 324  PHE B O   1 
ATOM   7520  C  CB  . PHE B 1 324 ? 48.337 115.998 -2.565  1.00 32.79  ? 324  PHE B CB  1 
ATOM   7521  C  CG  . PHE B 1 324 ? 47.771 116.978 -1.575  1.00 33.36  ? 324  PHE B CG  1 
ATOM   7522  C  CD1 . PHE B 1 324 ? 46.415 116.999 -1.298  1.00 33.89  ? 324  PHE B CD1 1 
ATOM   7523  C  CD2 . PHE B 1 324 ? 48.602 117.857 -0.897  1.00 33.80  ? 324  PHE B CD2 1 
ATOM   7524  C  CE1 . PHE B 1 324 ? 45.895 117.886 -0.376  1.00 34.32  ? 324  PHE B CE1 1 
ATOM   7525  C  CE2 . PHE B 1 324 ? 48.091 118.745 0.027   1.00 34.33  ? 324  PHE B CE2 1 
ATOM   7526  C  CZ  . PHE B 1 324 ? 46.733 118.758 0.292   1.00 34.62  ? 324  PHE B CZ  1 
ATOM   7527  N  N   . THR B 1 325 ? 46.079 116.039 -4.872  1.00 31.73  ? 325  THR B N   1 
ATOM   7528  C  CA  . THR B 1 325 ? 44.732 116.428 -5.222  1.00 31.30  ? 325  THR B CA  1 
ATOM   7529  C  C   . THR B 1 325 ? 43.791 115.926 -4.148  1.00 30.77  ? 325  THR B C   1 
ATOM   7530  O  O   . THR B 1 325 ? 43.905 114.788 -3.686  1.00 30.46  ? 325  THR B O   1 
ATOM   7531  C  CB  . THR B 1 325 ? 44.331 115.905 -6.612  1.00 31.46  ? 325  THR B CB  1 
ATOM   7532  O  OG1 . THR B 1 325 ? 43.483 114.760 -6.476  1.00 31.83  ? 325  THR B OG1 1 
ATOM   7533  C  CG2 . THR B 1 325 ? 45.555 115.379 -7.369  1.00 31.81  ? 325  THR B CG2 1 
ATOM   7534  N  N   . PHE B 1 326 ? 42.885 116.809 -3.737  1.00 30.22  ? 326  PHE B N   1 
ATOM   7535  C  CA  . PHE B 1 326 ? 41.889 116.507 -2.722  1.00 29.52  ? 326  PHE B CA  1 
ATOM   7536  C  C   . PHE B 1 326 ? 40.515 116.965 -3.182  1.00 29.24  ? 326  PHE B C   1 
ATOM   7537  O  O   . PHE B 1 326 ? 40.306 118.139 -3.449  1.00 29.30  ? 326  PHE B O   1 
ATOM   7538  C  CB  . PHE B 1 326 ? 42.232 117.197 -1.414  1.00 29.16  ? 326  PHE B CB  1 
ATOM   7539  C  CG  . PHE B 1 326 ? 41.084 117.268 -0.468  1.00 28.17  ? 326  PHE B CG  1 
ATOM   7540  C  CD1 . PHE B 1 326 ? 40.592 116.122 0.122   1.00 27.49  ? 326  PHE B CD1 1 
ATOM   7541  C  CD2 . PHE B 1 326 ? 40.485 118.475 -0.178  1.00 27.27  ? 326  PHE B CD2 1 
ATOM   7542  C  CE1 . PHE B 1 326 ? 39.529 116.178 0.989   1.00 27.04  ? 326  PHE B CE1 1 
ATOM   7543  C  CE2 . PHE B 1 326 ? 39.421 118.539 0.694   1.00 27.09  ? 326  PHE B CE2 1 
ATOM   7544  C  CZ  . PHE B 1 326 ? 38.942 117.389 1.279   1.00 26.83  ? 326  PHE B CZ  1 
ATOM   7545  N  N   . LEU B 1 327 ? 39.575 116.038 -3.260  1.00 28.95  ? 327  LEU B N   1 
ATOM   7546  C  CA  . LEU B 1 327 ? 38.237 116.364 -3.728  1.00 28.98  ? 327  LEU B CA  1 
ATOM   7547  C  C   . LEU B 1 327 ? 38.267 116.991 -5.116  1.00 29.19  ? 327  LEU B C   1 
ATOM   7548  O  O   . LEU B 1 327 ? 37.398 117.776 -5.461  1.00 28.98  ? 327  LEU B O   1 
ATOM   7549  C  CB  . LEU B 1 327 ? 37.493 117.276 -2.742  1.00 28.81  ? 327  LEU B CB  1 
ATOM   7550  C  CG  . LEU B 1 327 ? 37.005 116.683 -1.419  1.00 27.49  ? 327  LEU B CG  1 
ATOM   7551  C  CD1 . LEU B 1 327 ? 36.420 117.767 -0.562  1.00 26.23  ? 327  LEU B CD1 1 
ATOM   7552  C  CD2 . LEU B 1 327 ? 35.982 115.616 -1.644  1.00 26.48  ? 327  LEU B CD2 1 
ATOM   7553  N  N   . GLY B 1 328 ? 39.288 116.659 -5.898  1.00 29.71  ? 328  GLY B N   1 
ATOM   7554  C  CA  . GLY B 1 328 ? 39.359 117.092 -7.284  1.00 30.18  ? 328  GLY B CA  1 
ATOM   7555  C  C   . GLY B 1 328 ? 40.099 118.376 -7.607  1.00 30.48  ? 328  GLY B C   1 
ATOM   7556  O  O   . GLY B 1 328 ? 39.961 118.895 -8.707  1.00 30.64  ? 328  GLY B O   1 
ATOM   7557  N  N   . ASN B 1 329 ? 40.860 118.904 -6.657  1.00 30.80  ? 329  ASN B N   1 
ATOM   7558  C  CA  . ASN B 1 329 ? 41.680 120.083 -6.903  1.00 31.13  ? 329  ASN B CA  1 
ATOM   7559  C  C   . ASN B 1 329 ? 43.071 119.734 -6.451  1.00 31.56  ? 329  ASN B C   1 
ATOM   7560  O  O   . ASN B 1 329 ? 43.230 118.854 -5.613  1.00 31.69  ? 329  ASN B O   1 
ATOM   7561  C  CB  . ASN B 1 329 ? 41.178 121.284 -6.113  1.00 31.10  ? 329  ASN B CB  1 
ATOM   7562  C  CG  . ASN B 1 329 ? 39.710 121.526 -6.306  1.00 30.76  ? 329  ASN B CG  1 
ATOM   7563  O  OD1 . ASN B 1 329 ? 39.273 121.933 -7.381  1.00 30.10  ? 329  ASN B OD1 1 
ATOM   7564  N  ND2 . ASN B 1 329 ? 38.930 121.270 -5.262  1.00 31.12  ? 329  ASN B ND2 1 
ATOM   7565  N  N   . LYS B 1 330 ? 44.087 120.392 -6.995  1.00 32.04  ? 330  LYS B N   1 
ATOM   7566  C  CA  . LYS B 1 330 ? 45.440 120.071 -6.568  1.00 32.50  ? 330  LYS B CA  1 
ATOM   7567  C  C   . LYS B 1 330 ? 45.869 121.087 -5.541  1.00 32.51  ? 330  LYS B C   1 
ATOM   7568  O  O   . LYS B 1 330 ? 45.459 122.243 -5.594  1.00 32.41  ? 330  LYS B O   1 
ATOM   7569  C  CB  . LYS B 1 330 ? 46.417 119.997 -7.746  1.00 32.79  ? 330  LYS B CB  1 
ATOM   7570  C  CG  . LYS B 1 330 ? 47.039 121.325 -8.159  1.00 34.17  ? 330  LYS B CG  1 
ATOM   7571  C  CD  . LYS B 1 330 ? 48.153 121.120 -9.182  1.00 35.87  ? 330  LYS B CD  1 
ATOM   7572  C  CE  . LYS B 1 330 ? 48.878 122.432 -9.471  1.00 37.19  ? 330  LYS B CE  1 
ATOM   7573  N  NZ  . LYS B 1 330 ? 49.803 122.350 -10.650 1.00 38.41  ? 330  LYS B NZ  1 
ATOM   7574  N  N   . TYR B 1 331 ? 46.660 120.636 -4.581  1.00 32.96  ? 331  TYR B N   1 
ATOM   7575  C  CA  . TYR B 1 331 ? 47.130 121.498 -3.509  1.00 33.67  ? 331  TYR B CA  1 
ATOM   7576  C  C   . TYR B 1 331 ? 48.643 121.442 -3.445  1.00 34.29  ? 331  TYR B C   1 
ATOM   7577  O  O   . TYR B 1 331 ? 49.239 120.369 -3.556  1.00 34.42  ? 331  TYR B O   1 
ATOM   7578  C  CB  . TYR B 1 331 ? 46.524 121.079 -2.165  1.00 33.52  ? 331  TYR B CB  1 
ATOM   7579  C  CG  . TYR B 1 331 ? 45.023 121.230 -2.121  1.00 33.46  ? 331  TYR B CG  1 
ATOM   7580  C  CD1 . TYR B 1 331 ? 44.204 120.352 -2.818  1.00 33.41  ? 331  TYR B CD1 1 
ATOM   7581  C  CD2 . TYR B 1 331 ? 44.420 122.260 -1.400  1.00 32.94  ? 331  TYR B CD2 1 
ATOM   7582  C  CE1 . TYR B 1 331 ? 42.832 120.490 -2.806  1.00 33.01  ? 331  TYR B CE1 1 
ATOM   7583  C  CE2 . TYR B 1 331 ? 43.041 122.405 -1.379  1.00 32.58  ? 331  TYR B CE2 1 
ATOM   7584  C  CZ  . TYR B 1 331 ? 42.256 121.514 -2.086  1.00 32.83  ? 331  TYR B CZ  1 
ATOM   7585  O  OH  . TYR B 1 331 ? 40.887 121.637 -2.086  1.00 33.11  ? 331  TYR B OH  1 
ATOM   7586  N  N   . GLU B 1 332 ? 49.258 122.604 -3.268  1.00 34.97  ? 332  GLU B N   1 
ATOM   7587  C  CA  . GLU B 1 332 ? 50.704 122.704 -3.197  1.00 35.81  ? 332  GLU B CA  1 
ATOM   7588  C  C   . GLU B 1 332 ? 51.140 122.926 -1.747  1.00 35.80  ? 332  GLU B C   1 
ATOM   7589  O  O   . GLU B 1 332 ? 52.323 122.876 -1.417  1.00 35.85  ? 332  GLU B O   1 
ATOM   7590  C  CB  . GLU B 1 332 ? 51.177 123.852 -4.088  1.00 36.07  ? 332  GLU B CB  1 
ATOM   7591  C  CG  . GLU B 1 332 ? 51.008 125.250 -3.483  1.00 38.62  ? 332  GLU B CG  1 
ATOM   7592  C  CD  . GLU B 1 332 ? 49.548 125.715 -3.313  1.00 41.42  ? 332  GLU B CD  1 
ATOM   7593  O  OE1 . GLU B 1 332 ? 48.633 125.128 -3.937  1.00 42.27  ? 332  GLU B OE1 1 
ATOM   7594  O  OE2 . GLU B 1 332 ? 49.305 126.692 -2.555  1.00 41.18  ? 332  GLU B OE2 1 
ATOM   7595  N  N   . SER B 1 333 ? 50.171 123.133 -0.870  1.00 35.91  ? 333  SER B N   1 
ATOM   7596  C  CA  . SER B 1 333 ? 50.486 123.417 0.513   1.00 36.11  ? 333  SER B CA  1 
ATOM   7597  C  C   . SER B 1 333 ? 49.418 122.886 1.448   1.00 36.22  ? 333  SER B C   1 
ATOM   7598  O  O   . SER B 1 333 ? 48.252 122.821 1.090   1.00 36.40  ? 333  SER B O   1 
ATOM   7599  C  CB  . SER B 1 333 ? 50.606 124.918 0.665   1.00 36.18  ? 333  SER B CB  1 
ATOM   7600  O  OG  . SER B 1 333 ? 51.019 125.467 -0.575  1.00 36.27  ? 333  SER B OG  1 
ATOM   7601  N  N   . CYS B 1 334 ? 49.818 122.506 2.652   1.00 36.34  ? 334  CYS B N   1 
ATOM   7602  C  CA  . CYS B 1 334 ? 48.861 122.013 3.627   1.00 36.66  ? 334  CYS B CA  1 
ATOM   7603  C  C   . CYS B 1 334 ? 47.630 122.897 3.637   1.00 36.15  ? 334  CYS B C   1 
ATOM   7604  O  O   . CYS B 1 334 ? 47.730 124.111 3.533   1.00 36.27  ? 334  CYS B O   1 
ATOM   7605  C  CB  . CYS B 1 334 ? 49.493 121.956 5.013   1.00 36.78  ? 334  CYS B CB  1 
ATOM   7606  S  SG  . CYS B 1 334 ? 50.915 120.862 5.012   1.00 39.52  ? 334  CYS B SG  1 
ATOM   7607  N  N   . THR B 1 335 ? 46.464 122.284 3.754   1.00 35.72  ? 335  THR B N   1 
ATOM   7608  C  CA  . THR B 1 335 ? 45.240 123.045 3.767   1.00 35.42  ? 335  THR B CA  1 
ATOM   7609  C  C   . THR B 1 335 ? 44.319 122.578 4.862   1.00 35.34  ? 335  THR B C   1 
ATOM   7610  O  O   . THR B 1 335 ? 44.612 121.636 5.593   1.00 35.57  ? 335  THR B O   1 
ATOM   7611  C  CB  . THR B 1 335 ? 44.516 122.872 2.457   1.00 35.47  ? 335  THR B CB  1 
ATOM   7612  O  OG1 . THR B 1 335 ? 43.332 123.679 2.474   1.00 35.85  ? 335  THR B OG1 1 
ATOM   7613  C  CG2 . THR B 1 335 ? 43.979 121.461 2.362   1.00 35.21  ? 335  THR B CG2 1 
ATOM   7614  N  N   . SER B 1 336 ? 43.191 123.258 4.965   1.00 34.97  ? 336  SER B N   1 
ATOM   7615  C  CA  . SER B 1 336 ? 42.170 122.900 5.916   1.00 34.58  ? 336  SER B CA  1 
ATOM   7616  C  C   . SER B 1 336 ? 41.003 122.360 5.096   1.00 34.16  ? 336  SER B C   1 
ATOM   7617  O  O   . SER B 1 336 ? 39.987 121.933 5.635   1.00 34.35  ? 336  SER B O   1 
ATOM   7618  C  CB  . SER B 1 336 ? 41.755 124.132 6.716   1.00 34.67  ? 336  SER B CB  1 
ATOM   7619  O  OG  . SER B 1 336 ? 41.490 125.222 5.844   1.00 35.23  ? 336  SER B OG  1 
ATOM   7620  N  N   . ALA B 1 337 ? 41.155 122.387 3.781   1.00 33.46  ? 337  ALA B N   1 
ATOM   7621  C  CA  . ALA B 1 337 ? 40.118 121.884 2.900   1.00 33.02  ? 337  ALA B CA  1 
ATOM   7622  C  C   . ALA B 1 337 ? 39.491 120.641 3.500   1.00 32.81  ? 337  ALA B C   1 
ATOM   7623  O  O   . ALA B 1 337 ? 40.191 119.714 3.905   1.00 32.85  ? 337  ALA B O   1 
ATOM   7624  C  CB  . ALA B 1 337 ? 40.690 121.578 1.534   1.00 33.03  ? 337  ALA B CB  1 
ATOM   7625  N  N   . GLY B 1 338 ? 38.169 120.624 3.578   1.00 32.55  ? 338  GLY B N   1 
ATOM   7626  C  CA  . GLY B 1 338 ? 37.490 119.472 4.129   1.00 32.37  ? 338  GLY B CA  1 
ATOM   7627  C  C   . GLY B 1 338 ? 37.284 119.530 5.627   1.00 32.35  ? 338  GLY B C   1 
ATOM   7628  O  O   . GLY B 1 338 ? 36.273 119.054 6.111   1.00 32.40  ? 338  GLY B O   1 
ATOM   7629  N  N   . ARG B 1 339 ? 38.232 120.105 6.364   1.00 32.42  ? 339  ARG B N   1 
ATOM   7630  C  CA  . ARG B 1 339 ? 38.108 120.222 7.818   1.00 32.54  ? 339  ARG B CA  1 
ATOM   7631  C  C   . ARG B 1 339 ? 37.286 121.422 8.265   1.00 32.82  ? 339  ARG B C   1 
ATOM   7632  O  O   . ARG B 1 339 ? 37.330 122.477 7.641   1.00 32.96  ? 339  ARG B O   1 
ATOM   7633  C  CB  . ARG B 1 339 ? 39.478 120.322 8.464   1.00 32.29  ? 339  ARG B CB  1 
ATOM   7634  C  CG  . ARG B 1 339 ? 40.348 119.131 8.214   1.00 32.84  ? 339  ARG B CG  1 
ATOM   7635  C  CD  . ARG B 1 339 ? 41.472 119.004 9.196   1.00 33.08  ? 339  ARG B CD  1 
ATOM   7636  N  NE  . ARG B 1 339 ? 40.944 118.830 10.533  1.00 32.88  ? 339  ARG B NE  1 
ATOM   7637  C  CZ  . ARG B 1 339 ? 40.751 117.651 11.080  1.00 33.26  ? 339  ARG B CZ  1 
ATOM   7638  N  NH1 . ARG B 1 339 ? 41.055 116.551 10.403  1.00 32.89  ? 339  ARG B NH1 1 
ATOM   7639  N  NH2 . ARG B 1 339 ? 40.255 117.569 12.303  1.00 34.11  ? 339  ARG B NH2 1 
ATOM   7640  N  N   . SER B 1 340 ? 36.571 121.261 9.375   1.00 33.11  ? 340  SER B N   1 
ATOM   7641  C  CA  . SER B 1 340 ? 35.743 122.327 9.928   1.00 33.31  ? 340  SER B CA  1 
ATOM   7642  C  C   . SER B 1 340 ? 36.389 123.056 11.107  1.00 33.37  ? 340  SER B C   1 
ATOM   7643  O  O   . SER B 1 340 ? 35.720 123.835 11.790  1.00 33.75  ? 340  SER B O   1 
ATOM   7644  C  CB  . SER B 1 340 ? 34.422 121.751 10.433  1.00 33.43  ? 340  SER B CB  1 
ATOM   7645  O  OG  . SER B 1 340 ? 34.548 121.336 11.794  1.00 33.58  ? 340  SER B OG  1 
ATOM   7646  N  N   . ASP B 1 341 ? 37.665 122.818 11.374  1.00 32.94  ? 341  ASP B N   1 
ATOM   7647  C  CA  . ASP B 1 341 ? 38.262 123.443 12.543  1.00 32.91  ? 341  ASP B CA  1 
ATOM   7648  C  C   . ASP B 1 341 ? 39.578 124.176 12.305  1.00 33.07  ? 341  ASP B C   1 
ATOM   7649  O  O   . ASP B 1 341 ? 40.347 124.387 13.233  1.00 33.04  ? 341  ASP B O   1 
ATOM   7650  C  CB  . ASP B 1 341 ? 38.446 122.397 13.631  1.00 32.72  ? 341  ASP B CB  1 
ATOM   7651  C  CG  . ASP B 1 341 ? 39.333 121.276 13.198  1.00 32.80  ? 341  ASP B CG  1 
ATOM   7652  O  OD1 . ASP B 1 341 ? 40.215 121.522 12.349  1.00 34.65  ? 341  ASP B OD1 1 
ATOM   7653  O  OD2 . ASP B 1 341 ? 39.239 120.119 13.645  1.00 32.33  ? 341  ASP B OD2 1 
ATOM   7654  N  N   . GLY B 1 342 ? 39.838 124.565 11.067  1.00 33.46  ? 342  GLY B N   1 
ATOM   7655  C  CA  . GLY B 1 342 ? 41.067 125.263 10.737  1.00 33.88  ? 342  GLY B CA  1 
ATOM   7656  C  C   . GLY B 1 342 ? 42.363 124.459 10.813  1.00 34.29  ? 342  GLY B C   1 
ATOM   7657  O  O   . GLY B 1 342 ? 43.434 124.984 10.476  1.00 34.54  ? 342  GLY B O   1 
ATOM   7658  N  N   . LYS B 1 343 ? 42.304 123.197 11.234  1.00 34.22  ? 343  LYS B N   1 
ATOM   7659  C  CA  . LYS B 1 343 ? 43.542 122.428 11.368  1.00 34.39  ? 343  LYS B CA  1 
ATOM   7660  C  C   . LYS B 1 343 ? 44.174 122.112 10.016  1.00 34.43  ? 343  LYS B C   1 
ATOM   7661  O  O   . LYS B 1 343 ? 43.587 121.399 9.225   1.00 34.86  ? 343  LYS B O   1 
ATOM   7662  C  CB  . LYS B 1 343 ? 43.304 121.146 12.161  1.00 34.31  ? 343  LYS B CB  1 
ATOM   7663  C  CG  . LYS B 1 343 ? 43.392 121.330 13.672  1.00 34.54  ? 343  LYS B CG  1 
ATOM   7664  C  CD  . LYS B 1 343 ? 42.246 120.619 14.381  1.00 34.94  ? 343  LYS B CD  1 
ATOM   7665  C  CE  . LYS B 1 343 ? 42.632 120.152 15.759  1.00 35.34  ? 343  LYS B CE  1 
ATOM   7666  N  NZ  . LYS B 1 343 ? 43.862 119.307 15.695  1.00 37.00  ? 343  LYS B NZ  1 
ATOM   7667  N  N   . MET B 1 344 ? 45.365 122.641 9.749   1.00 34.34  ? 344  MET B N   1 
ATOM   7668  C  CA  . MET B 1 344 ? 46.038 122.399 8.465   1.00 34.34  ? 344  MET B CA  1 
ATOM   7669  C  C   . MET B 1 344 ? 46.440 120.940 8.262   1.00 34.03  ? 344  MET B C   1 
ATOM   7670  O  O   . MET B 1 344 ? 47.196 120.385 9.053   1.00 34.08  ? 344  MET B O   1 
ATOM   7671  C  CB  . MET B 1 344 ? 47.306 123.250 8.340   1.00 34.64  ? 344  MET B CB  1 
ATOM   7672  C  CG  . MET B 1 344 ? 47.163 124.690 8.727   1.00 35.34  ? 344  MET B CG  1 
ATOM   7673  S  SD  . MET B 1 344 ? 46.392 125.578 7.422   1.00 37.88  ? 344  MET B SD  1 
ATOM   7674  C  CE  . MET B 1 344 ? 47.621 125.367 6.181   1.00 37.42  ? 344  MET B CE  1 
ATOM   7675  N  N   . TRP B 1 345 ? 45.963 120.331 7.186   1.00 33.76  ? 345  TRP B N   1 
ATOM   7676  C  CA  . TRP B 1 345 ? 46.302 118.943 6.885   1.00 33.55  ? 345  TRP B CA  1 
ATOM   7677  C  C   . TRP B 1 345 ? 46.861 118.849 5.475   1.00 34.04  ? 345  TRP B C   1 
ATOM   7678  O  O   . TRP B 1 345 ? 46.513 119.647 4.615   1.00 34.34  ? 345  TRP B O   1 
ATOM   7679  C  CB  . TRP B 1 345 ? 45.066 118.035 6.993   1.00 33.21  ? 345  TRP B CB  1 
ATOM   7680  C  CG  . TRP B 1 345 ? 44.077 118.222 5.878   1.00 30.45  ? 345  TRP B CG  1 
ATOM   7681  C  CD1 . TRP B 1 345 ? 43.113 119.182 5.788   1.00 29.19  ? 345  TRP B CD1 1 
ATOM   7682  C  CD2 . TRP B 1 345 ? 43.968 117.439 4.695   1.00 27.71  ? 345  TRP B CD2 1 
ATOM   7683  N  NE1 . TRP B 1 345 ? 42.409 119.042 4.618   1.00 27.71  ? 345  TRP B NE1 1 
ATOM   7684  C  CE2 . TRP B 1 345 ? 42.918 117.978 3.926   1.00 27.32  ? 345  TRP B CE2 1 
ATOM   7685  C  CE3 . TRP B 1 345 ? 44.654 116.333 4.198   1.00 27.23  ? 345  TRP B CE3 1 
ATOM   7686  C  CZ2 . TRP B 1 345 ? 42.544 117.452 2.699   1.00 26.61  ? 345  TRP B CZ2 1 
ATOM   7687  C  CZ3 . TRP B 1 345 ? 44.279 115.808 2.980   1.00 26.49  ? 345  TRP B CZ3 1 
ATOM   7688  C  CH2 . TRP B 1 345 ? 43.237 116.368 2.244   1.00 26.79  ? 345  TRP B CH2 1 
ATOM   7689  N  N   . CYS B 1 346 ? 47.731 117.879 5.242   1.00 34.20  ? 346  CYS B N   1 
ATOM   7690  C  CA  . CYS B 1 346 ? 48.270 117.641 3.913   1.00 34.55  ? 346  CYS B CA  1 
ATOM   7691  C  C   . CYS B 1 346 ? 48.036 116.171 3.642   1.00 34.19  ? 346  CYS B C   1 
ATOM   7692  O  O   . CYS B 1 346 ? 47.576 115.456 4.523   1.00 34.11  ? 346  CYS B O   1 
ATOM   7693  C  CB  . CYS B 1 346 ? 49.761 117.924 3.882   1.00 34.83  ? 346  CYS B CB  1 
ATOM   7694  S  SG  . CYS B 1 346 ? 50.697 116.780 4.917   1.00 36.99  ? 346  CYS B SG  1 
ATOM   7695  N  N   . ALA B 1 347 ? 48.356 115.711 2.439   1.00 33.94  ? 347  ALA B N   1 
ATOM   7696  C  CA  . ALA B 1 347 ? 48.123 114.308 2.091   1.00 33.66  ? 347  ALA B CA  1 
ATOM   7697  C  C   . ALA B 1 347 ? 49.441 113.588 1.888   1.00 33.50  ? 347  ALA B C   1 
ATOM   7698  O  O   . ALA B 1 347 ? 50.432 114.201 1.510   1.00 33.79  ? 347  ALA B O   1 
ATOM   7699  C  CB  . ALA B 1 347 ? 47.271 114.206 0.847   1.00 33.63  ? 347  ALA B CB  1 
ATOM   7700  N  N   . THR B 1 348 ? 49.457 112.283 2.118   1.00 32.99  ? 348  THR B N   1 
ATOM   7701  C  CA  . THR B 1 348 ? 50.710 111.540 2.043   1.00 32.57  ? 348  THR B CA  1 
ATOM   7702  C  C   . THR B 1 348 ? 50.962 110.802 0.727   1.00 32.29  ? 348  THR B C   1 
ATOM   7703  O  O   . THR B 1 348 ? 51.886 109.999 0.621   1.00 32.46  ? 348  THR B O   1 
ATOM   7704  C  CB  . THR B 1 348 ? 50.797 110.586 3.217   1.00 32.53  ? 348  THR B CB  1 
ATOM   7705  O  OG1 . THR B 1 348 ? 49.488 110.407 3.762   1.00 32.63  ? 348  THR B OG1 1 
ATOM   7706  C  CG2 . THR B 1 348 ? 51.511 111.253 4.348   1.00 33.02  ? 348  THR B CG2 1 
ATOM   7707  N  N   . THR B 1 349 ? 50.131 111.073 -0.267  1.00 31.56  ? 349  THR B N   1 
ATOM   7708  C  CA  . THR B 1 349 ? 50.313 110.526 -1.588  1.00 30.97  ? 349  THR B CA  1 
ATOM   7709  C  C   . THR B 1 349 ? 49.799 111.615 -2.491  1.00 31.01  ? 349  THR B C   1 
ATOM   7710  O  O   . THR B 1 349 ? 49.275 112.600 -2.003  1.00 30.97  ? 349  THR B O   1 
ATOM   7711  C  CB  . THR B 1 349 ? 49.504 109.247 -1.771  1.00 30.98  ? 349  THR B CB  1 
ATOM   7712  O  OG1 . THR B 1 349 ? 48.159 109.573 -2.143  1.00 31.15  ? 349  THR B OG1 1 
ATOM   7713  C  CG2 . THR B 1 349 ? 49.357 108.517 -0.462  1.00 30.23  ? 349  THR B CG2 1 
ATOM   7714  N  N   . ALA B 1 350 ? 49.929 111.460 -3.800  1.00 31.26  ? 350  ALA B N   1 
ATOM   7715  C  CA  . ALA B 1 350 ? 49.503 112.524 -4.701  1.00 31.43  ? 350  ALA B CA  1 
ATOM   7716  C  C   . ALA B 1 350 ? 47.989 112.627 -4.816  1.00 31.65  ? 350  ALA B C   1 
ATOM   7717  O  O   . ALA B 1 350 ? 47.457 113.641 -5.270  1.00 31.84  ? 350  ALA B O   1 
ATOM   7718  C  CB  . ALA B 1 350 ? 50.122 112.345 -6.068  1.00 31.34  ? 350  ALA B CB  1 
ATOM   7719  N  N   . ASN B 1 351 ? 47.282 111.589 -4.399  1.00 31.67  ? 351  ASN B N   1 
ATOM   7720  C  CA  . ASN B 1 351 ? 45.841 111.624 -4.548  1.00 31.84  ? 351  ASN B CA  1 
ATOM   7721  C  C   . ASN B 1 351 ? 45.057 111.200 -3.302  1.00 31.98  ? 351  ASN B C   1 
ATOM   7722  O  O   . ASN B 1 351 ? 45.016 110.023 -2.943  1.00 32.18  ? 351  ASN B O   1 
ATOM   7723  C  CB  . ASN B 1 351 ? 45.431 110.798 -5.760  1.00 31.72  ? 351  ASN B CB  1 
ATOM   7724  C  CG  . ASN B 1 351 ? 43.972 110.926 -6.072  1.00 32.06  ? 351  ASN B CG  1 
ATOM   7725  O  OD1 . ASN B 1 351 ? 43.125 110.709 -5.209  1.00 32.62  ? 351  ASN B OD1 1 
ATOM   7726  N  ND2 . ASN B 1 351 ? 43.661 111.282 -7.311  1.00 32.32  ? 351  ASN B ND2 1 
ATOM   7727  N  N   . TYR B 1 352 ? 44.424 112.164 -2.644  1.00 31.83  ? 352  TYR B N   1 
ATOM   7728  C  CA  . TYR B 1 352 ? 43.652 111.832 -1.464  1.00 31.54  ? 352  TYR B CA  1 
ATOM   7729  C  C   . TYR B 1 352 ? 42.409 111.029 -1.827  1.00 31.59  ? 352  TYR B C   1 
ATOM   7730  O  O   . TYR B 1 352 ? 42.031 110.091 -1.131  1.00 31.67  ? 352  TYR B O   1 
ATOM   7731  C  CB  . TYR B 1 352 ? 43.218 113.074 -0.699  1.00 31.25  ? 352  TYR B CB  1 
ATOM   7732  C  CG  . TYR B 1 352 ? 42.481 112.676 0.546   1.00 30.79  ? 352  TYR B CG  1 
ATOM   7733  C  CD1 . TYR B 1 352 ? 43.186 112.246 1.659   1.00 30.63  ? 352  TYR B CD1 1 
ATOM   7734  C  CD2 . TYR B 1 352 ? 41.090 112.665 0.595   1.00 30.05  ? 352  TYR B CD2 1 
ATOM   7735  C  CE1 . TYR B 1 352 ? 42.550 111.856 2.798   1.00 30.75  ? 352  TYR B CE1 1 
ATOM   7736  C  CE2 . TYR B 1 352 ? 40.430 112.273 1.739   1.00 30.55  ? 352  TYR B CE2 1 
ATOM   7737  C  CZ  . TYR B 1 352 ? 41.175 111.868 2.847   1.00 31.12  ? 352  TYR B CZ  1 
ATOM   7738  O  OH  . TYR B 1 352 ? 40.577 111.462 4.017   1.00 29.97  ? 352  TYR B OH  1 
ATOM   7739  N  N   . ASP B 1 353 ? 41.760 111.411 -2.914  1.00 31.48  ? 353  ASP B N   1 
ATOM   7740  C  CA  . ASP B 1 353 ? 40.538 110.740 -3.304  1.00 31.38  ? 353  ASP B CA  1 
ATOM   7741  C  C   . ASP B 1 353 ? 40.743 109.232 -3.451  1.00 31.83  ? 353  ASP B C   1 
ATOM   7742  O  O   . ASP B 1 353 ? 39.953 108.437 -2.947  1.00 31.70  ? 353  ASP B O   1 
ATOM   7743  C  CB  . ASP B 1 353 ? 39.986 111.355 -4.585  1.00 30.99  ? 353  ASP B CB  1 
ATOM   7744  C  CG  . ASP B 1 353 ? 39.641 112.812 -4.415  1.00 29.76  ? 353  ASP B CG  1 
ATOM   7745  O  OD1 . ASP B 1 353 ? 39.733 113.307 -3.280  1.00 27.36  ? 353  ASP B OD1 1 
ATOM   7746  O  OD2 . ASP B 1 353 ? 39.263 113.540 -5.351  1.00 29.40  ? 353  ASP B OD2 1 
ATOM   7747  N  N   . ASP B 1 354 ? 41.820 108.836 -4.112  1.00 32.37  ? 354  ASP B N   1 
ATOM   7748  C  CA  . ASP B 1 354 ? 42.059 107.421 -4.329  1.00 33.04  ? 354  ASP B CA  1 
ATOM   7749  C  C   . ASP B 1 354 ? 42.567 106.702 -3.083  1.00 33.43  ? 354  ASP B C   1 
ATOM   7750  O  O   . ASP B 1 354 ? 41.987 105.703 -2.649  1.00 33.71  ? 354  ASP B O   1 
ATOM   7751  C  CB  . ASP B 1 354 ? 43.054 107.223 -5.466  1.00 33.14  ? 354  ASP B CB  1 
ATOM   7752  C  CG  . ASP B 1 354 ? 42.699 108.020 -6.684  1.00 33.77  ? 354  ASP B CG  1 
ATOM   7753  O  OD1 . ASP B 1 354 ? 41.494 108.128 -6.997  1.00 34.81  ? 354  ASP B OD1 1 
ATOM   7754  O  OD2 . ASP B 1 354 ? 43.556 108.582 -7.389  1.00 34.84  ? 354  ASP B OD2 1 
ATOM   7755  N  N   . ASP B 1 355 ? 43.640 107.212 -2.497  1.00 33.51  ? 355  ASP B N   1 
ATOM   7756  C  CA  . ASP B 1 355 ? 44.269 106.505 -1.401  1.00 33.93  ? 355  ASP B CA  1 
ATOM   7757  C  C   . ASP B 1 355 ? 43.646 106.797 -0.043  1.00 34.20  ? 355  ASP B C   1 
ATOM   7758  O  O   . ASP B 1 355 ? 43.568 105.915 0.808   1.00 34.74  ? 355  ASP B O   1 
ATOM   7759  C  CB  . ASP B 1 355 ? 45.774 106.793 -1.381  1.00 34.10  ? 355  ASP B CB  1 
ATOM   7760  C  CG  . ASP B 1 355 ? 46.427 106.612 -2.752  1.00 34.58  ? 355  ASP B CG  1 
ATOM   7761  O  OD1 . ASP B 1 355 ? 45.879 105.844 -3.575  1.00 34.80  ? 355  ASP B OD1 1 
ATOM   7762  O  OD2 . ASP B 1 355 ? 47.485 107.194 -3.099  1.00 34.20  ? 355  ASP B OD2 1 
ATOM   7763  N  N   . ARG B 1 356 ? 43.196 108.029 0.161   1.00 34.24  ? 356  ARG B N   1 
ATOM   7764  C  CA  . ARG B 1 356 ? 42.653 108.442 1.453   1.00 34.15  ? 356  ARG B CA  1 
ATOM   7765  C  C   . ARG B 1 356 ? 43.719 108.296 2.545   1.00 34.04  ? 356  ARG B C   1 
ATOM   7766  O  O   . ARG B 1 356 ? 43.498 107.672 3.576   1.00 34.01  ? 356  ARG B O   1 
ATOM   7767  C  CB  . ARG B 1 356 ? 41.381 107.663 1.792   1.00 34.15  ? 356  ARG B CB  1 
ATOM   7768  C  CG  . ARG B 1 356 ? 40.371 107.565 0.640   1.00 35.22  ? 356  ARG B CG  1 
ATOM   7769  C  CD  . ARG B 1 356 ? 39.410 108.743 0.495   1.00 36.94  ? 356  ARG B CD  1 
ATOM   7770  N  NE  . ARG B 1 356 ? 38.570 108.636 -0.702  1.00 38.67  ? 356  ARG B NE  1 
ATOM   7771  C  CZ  . ARG B 1 356 ? 37.759 109.603 -1.161  1.00 41.17  ? 356  ARG B CZ  1 
ATOM   7772  N  NH1 . ARG B 1 356 ? 37.655 110.778 -0.538  1.00 41.88  ? 356  ARG B NH1 1 
ATOM   7773  N  NH2 . ARG B 1 356 ? 37.046 109.404 -2.265  1.00 42.36  ? 356  ARG B NH2 1 
ATOM   7774  N  N   . LYS B 1 357 ? 44.892 108.864 2.292   1.00 34.00  ? 357  LYS B N   1 
ATOM   7775  C  CA  . LYS B 1 357 ? 45.991 108.824 3.243   1.00 33.96  ? 357  LYS B CA  1 
ATOM   7776  C  C   . LYS B 1 357 ? 46.404 110.251 3.516   1.00 33.78  ? 357  LYS B C   1 
ATOM   7777  O  O   . LYS B 1 357 ? 46.601 111.037 2.584   1.00 33.72  ? 357  LYS B O   1 
ATOM   7778  C  CB  . LYS B 1 357 ? 47.161 108.056 2.663   1.00 34.02  ? 357  LYS B CB  1 
ATOM   7779  C  CG  . LYS B 1 357 ? 46.757 106.738 2.043   1.00 35.09  ? 357  LYS B CG  1 
ATOM   7780  C  CD  . LYS B 1 357 ? 46.260 105.766 3.098   1.00 36.64  ? 357  LYS B CD  1 
ATOM   7781  C  CE  . LYS B 1 357 ? 47.263 105.665 4.232   1.00 37.01  ? 357  LYS B CE  1 
ATOM   7782  N  NZ  . LYS B 1 357 ? 47.588 107.029 4.728   1.00 37.25  ? 357  LYS B NZ  1 
ATOM   7783  N  N   . TRP B 1 358 ? 46.568 110.583 4.789   1.00 33.44  ? 358  TRP B N   1 
ATOM   7784  C  CA  . TRP B 1 358 ? 46.794 111.965 5.157   1.00 33.13  ? 358  TRP B CA  1 
ATOM   7785  C  C   . TRP B 1 358 ? 47.400 112.092 6.549   1.00 33.07  ? 358  TRP B C   1 
ATOM   7786  O  O   . TRP B 1 358 ? 47.587 111.097 7.249   1.00 32.79  ? 358  TRP B O   1 
ATOM   7787  C  CB  . TRP B 1 358 ? 45.449 112.661 5.176   1.00 32.86  ? 358  TRP B CB  1 
ATOM   7788  C  CG  . TRP B 1 358 ? 44.693 112.178 6.331   1.00 32.28  ? 358  TRP B CG  1 
ATOM   7789  C  CD1 . TRP B 1 358 ? 44.189 110.928 6.512   1.00 31.75  ? 358  TRP B CD1 1 
ATOM   7790  C  CD2 . TRP B 1 358 ? 44.403 112.905 7.518   1.00 32.13  ? 358  TRP B CD2 1 
ATOM   7791  N  NE1 . TRP B 1 358 ? 43.580 110.837 7.739   1.00 31.63  ? 358  TRP B NE1 1 
ATOM   7792  C  CE2 . TRP B 1 358 ? 43.693 112.044 8.374   1.00 32.34  ? 358  TRP B CE2 1 
ATOM   7793  C  CE3 . TRP B 1 358 ? 44.653 114.211 7.942   1.00 31.95  ? 358  TRP B CE3 1 
ATOM   7794  C  CZ2 . TRP B 1 358 ? 43.239 112.444 9.622   1.00 33.02  ? 358  TRP B CZ2 1 
ATOM   7795  C  CZ3 . TRP B 1 358 ? 44.206 114.603 9.181   1.00 32.58  ? 358  TRP B CZ3 1 
ATOM   7796  C  CH2 . TRP B 1 358 ? 43.514 113.724 10.010  1.00 33.11  ? 358  TRP B CH2 1 
ATOM   7797  N  N   . GLY B 1 359 ? 47.669 113.337 6.938   1.00 33.08  ? 359  GLY B N   1 
ATOM   7798  C  CA  . GLY B 1 359 ? 48.258 113.671 8.221   1.00 33.23  ? 359  GLY B CA  1 
ATOM   7799  C  C   . GLY B 1 359 ? 48.198 115.166 8.494   1.00 33.46  ? 359  GLY B C   1 
ATOM   7800  O  O   . GLY B 1 359 ? 47.904 115.966 7.605   1.00 33.55  ? 359  GLY B O   1 
ATOM   7801  N  N   . PHE B 1 360 ? 48.455 115.554 9.734   1.00 33.54  ? 360  PHE B N   1 
ATOM   7802  C  CA  . PHE B 1 360 ? 48.401 116.959 10.084  1.00 33.79  ? 360  PHE B CA  1 
ATOM   7803  C  C   . PHE B 1 360 ? 49.771 117.557 9.825   1.00 34.05  ? 360  PHE B C   1 
ATOM   7804  O  O   . PHE B 1 360 ? 50.753 116.833 9.791   1.00 34.28  ? 360  PHE B O   1 
ATOM   7805  C  CB  . PHE B 1 360 ? 48.037 117.127 11.557  1.00 33.82  ? 360  PHE B CB  1 
ATOM   7806  C  CG  . PHE B 1 360 ? 46.580 116.963 11.848  1.00 33.03  ? 360  PHE B CG  1 
ATOM   7807  C  CD1 . PHE B 1 360 ? 45.638 117.710 11.175  1.00 33.06  ? 360  PHE B CD1 1 
ATOM   7808  C  CD2 . PHE B 1 360 ? 46.156 116.072 12.812  1.00 33.40  ? 360  PHE B CD2 1 
ATOM   7809  C  CE1 . PHE B 1 360 ? 44.288 117.566 11.443  1.00 33.11  ? 360  PHE B CE1 1 
ATOM   7810  C  CE2 . PHE B 1 360 ? 44.814 115.919 13.086  1.00 34.06  ? 360  PHE B CE2 1 
ATOM   7811  C  CZ  . PHE B 1 360 ? 43.875 116.671 12.396  1.00 33.54  ? 360  PHE B CZ  1 
ATOM   7812  N  N   . CYS B 1 361 ? 49.836 118.868 9.625   1.00 34.22  ? 361  CYS B N   1 
ATOM   7813  C  CA  . CYS B 1 361 ? 51.107 119.534 9.423   1.00 34.74  ? 361  CYS B CA  1 
ATOM   7814  C  C   . CYS B 1 361 ? 51.475 120.128 10.750  1.00 34.51  ? 361  CYS B C   1 
ATOM   7815  O  O   . CYS B 1 361 ? 50.784 121.017 11.233  1.00 35.01  ? 361  CYS B O   1 
ATOM   7816  C  CB  . CYS B 1 361 ? 50.999 120.583 8.321   1.00 34.90  ? 361  CYS B CB  1 
ATOM   7817  S  SG  . CYS B 1 361 ? 51.102 119.754 6.718   1.00 38.67  ? 361  CYS B SG  1 
ATOM   7818  N  N   . PRO B 1 362 ? 52.554 119.631 11.349  1.00 34.35  ? 362  PRO B N   1 
ATOM   7819  C  CA  . PRO B 1 362 ? 52.911 120.002 12.717  1.00 34.29  ? 362  PRO B CA  1 
ATOM   7820  C  C   . PRO B 1 362 ? 52.858 121.487 12.970  1.00 34.58  ? 362  PRO B C   1 
ATOM   7821  O  O   . PRO B 1 362 ? 53.505 122.281 12.280  1.00 34.59  ? 362  PRO B O   1 
ATOM   7822  C  CB  . PRO B 1 362 ? 54.329 119.470 12.863  1.00 34.13  ? 362  PRO B CB  1 
ATOM   7823  C  CG  . PRO B 1 362 ? 54.358 118.327 11.972  1.00 34.15  ? 362  PRO B CG  1 
ATOM   7824  C  CD  . PRO B 1 362 ? 53.535 118.702 10.767  1.00 34.30  ? 362  PRO B CD  1 
ATOM   7825  N  N   . ASP B 1 363 ? 52.054 121.851 13.960  1.00 34.84  ? 363  ASP B N   1 
ATOM   7826  C  CA  . ASP B 1 363 ? 51.945 123.228 14.393  1.00 35.18  ? 363  ASP B CA  1 
ATOM   7827  C  C   . ASP B 1 363 ? 53.037 123.522 15.431  1.00 35.22  ? 363  ASP B C   1 
ATOM   7828  O  O   . ASP B 1 363 ? 54.056 122.826 15.495  1.00 35.14  ? 363  ASP B O   1 
ATOM   7829  C  CB  . ASP B 1 363 ? 50.560 123.480 14.984  1.00 35.30  ? 363  ASP B CB  1 
ATOM   7830  C  CG  . ASP B 1 363 ? 50.238 122.550 16.138  1.00 35.65  ? 363  ASP B CG  1 
ATOM   7831  O  OD1 . ASP B 1 363 ? 50.961 121.593 16.487  1.00 35.02  ? 363  ASP B OD1 1 
ATOM   7832  O  OD2 . ASP B 1 363 ? 49.187 122.759 16.771  1.00 37.27  ? 363  ASP B OD2 1 
ATOM   7833  N  N   . GLN B 1 364 ? 52.818 124.554 16.238  1.00 35.21  ? 364  GLN B N   1 
ATOM   7834  C  CA  . GLN B 1 364 ? 53.773 124.946 17.262  1.00 35.12  ? 364  GLN B CA  1 
ATOM   7835  C  C   . GLN B 1 364 ? 53.893 123.925 18.371  1.00 34.78  ? 364  GLN B C   1 
ATOM   7836  O  O   . GLN B 1 364 ? 54.874 123.913 19.105  1.00 34.42  ? 364  GLN B O   1 
ATOM   7837  C  CB  . GLN B 1 364 ? 53.357 126.275 17.891  1.00 35.37  ? 364  GLN B CB  1 
ATOM   7838  C  CG  . GLN B 1 364 ? 54.288 127.396 17.584  1.00 35.71  ? 364  GLN B CG  1 
ATOM   7839  C  CD  . GLN B 1 364 ? 54.383 127.608 16.117  1.00 37.11  ? 364  GLN B CD  1 
ATOM   7840  O  OE1 . GLN B 1 364 ? 53.478 128.193 15.529  1.00 38.69  ? 364  GLN B OE1 1 
ATOM   7841  N  NE2 . GLN B 1 364 ? 55.457 127.111 15.499  1.00 37.75  ? 364  GLN B NE2 1 
ATOM   7842  N  N   . GLY B 1 365 ? 52.880 123.084 18.509  1.00 34.65  ? 365  GLY B N   1 
ATOM   7843  C  CA  . GLY B 1 365 ? 52.865 122.136 19.601  1.00 34.57  ? 365  GLY B CA  1 
ATOM   7844  C  C   . GLY B 1 365 ? 52.652 122.872 20.913  1.00 34.32  ? 365  GLY B C   1 
ATOM   7845  O  O   . GLY B 1 365 ? 52.315 124.058 20.922  1.00 34.42  ? 365  GLY B O   1 
ATOM   7846  N  N   . TYR B 1 366 ? 52.849 122.172 22.023  1.00 33.83  ? 366  TYR B N   1 
ATOM   7847  C  CA  . TYR B 1 366 ? 52.654 122.763 23.330  1.00 33.45  ? 366  TYR B CA  1 
ATOM   7848  C  C   . TYR B 1 366 ? 53.910 122.615 24.137  1.00 33.26  ? 366  TYR B C   1 
ATOM   7849  O  O   . TYR B 1 366 ? 54.468 121.533 24.220  1.00 33.33  ? 366  TYR B O   1 
ATOM   7850  C  CB  . TYR B 1 366 ? 51.510 122.071 24.037  1.00 33.47  ? 366  TYR B CB  1 
ATOM   7851  C  CG  . TYR B 1 366 ? 50.225 122.295 23.331  1.00 33.22  ? 366  TYR B CG  1 
ATOM   7852  C  CD1 . TYR B 1 366 ? 49.663 123.548 23.290  1.00 33.83  ? 366  TYR B CD1 1 
ATOM   7853  C  CD2 . TYR B 1 366 ? 49.585 121.263 22.686  1.00 33.58  ? 366  TYR B CD2 1 
ATOM   7854  C  CE1 . TYR B 1 366 ? 48.483 123.770 22.635  1.00 35.17  ? 366  TYR B CE1 1 
ATOM   7855  C  CE2 . TYR B 1 366 ? 48.403 121.466 22.026  1.00 34.27  ? 366  TYR B CE2 1 
ATOM   7856  C  CZ  . TYR B 1 366 ? 47.854 122.723 22.000  1.00 35.30  ? 366  TYR B CZ  1 
ATOM   7857  O  OH  . TYR B 1 366 ? 46.674 122.943 21.327  1.00 36.80  ? 366  TYR B OH  1 
ATOM   7858  N  N   . SER B 1 367 ? 54.354 123.704 24.742  1.00 33.03  ? 367  SER B N   1 
ATOM   7859  C  CA  . SER B 1 367 ? 55.585 123.676 25.500  1.00 32.92  ? 367  SER B CA  1 
ATOM   7860  C  C   . SER B 1 367 ? 55.483 122.779 26.723  1.00 32.90  ? 367  SER B C   1 
ATOM   7861  O  O   . SER B 1 367 ? 54.797 123.113 27.681  1.00 33.23  ? 367  SER B O   1 
ATOM   7862  C  CB  . SER B 1 367 ? 55.954 125.079 25.933  1.00 32.71  ? 367  SER B CB  1 
ATOM   7863  O  OG  . SER B 1 367 ? 56.770 125.016 27.080  1.00 33.23  ? 367  SER B OG  1 
ATOM   7864  N  N   . LEU B 1 368 ? 56.170 121.645 26.706  1.00 32.81  ? 368  LEU B N   1 
ATOM   7865  C  CA  . LEU B 1 368 ? 56.146 120.763 27.858  1.00 32.77  ? 368  LEU B CA  1 
ATOM   7866  C  C   . LEU B 1 368 ? 56.516 121.546 29.110  1.00 32.82  ? 368  LEU B C   1 
ATOM   7867  O  O   . LEU B 1 368 ? 55.919 121.353 30.159  1.00 33.37  ? 368  LEU B O   1 
ATOM   7868  C  CB  . LEU B 1 368 ? 57.079 119.575 27.673  1.00 32.78  ? 368  LEU B CB  1 
ATOM   7869  C  CG  . LEU B 1 368 ? 56.941 118.410 28.657  1.00 33.18  ? 368  LEU B CG  1 
ATOM   7870  C  CD1 . LEU B 1 368 ? 55.495 118.011 28.800  1.00 33.57  ? 368  LEU B CD1 1 
ATOM   7871  C  CD2 . LEU B 1 368 ? 57.779 117.211 28.204  1.00 33.20  ? 368  LEU B CD2 1 
ATOM   7872  N  N   . PHE B 1 369 ? 57.468 122.460 29.006  1.00 32.60  ? 369  PHE B N   1 
ATOM   7873  C  CA  . PHE B 1 369 ? 57.866 123.233 30.179  1.00 32.70  ? 369  PHE B CA  1 
ATOM   7874  C  C   . PHE B 1 369 ? 56.701 123.975 30.832  1.00 32.33  ? 369  PHE B C   1 
ATOM   7875  O  O   . PHE B 1 369 ? 56.425 123.789 32.012  1.00 32.47  ? 369  PHE B O   1 
ATOM   7876  C  CB  . PHE B 1 369 ? 58.968 124.220 29.817  1.00 33.15  ? 369  PHE B CB  1 
ATOM   7877  C  CG  . PHE B 1 369 ? 59.194 125.279 30.852  1.00 34.17  ? 369  PHE B CG  1 
ATOM   7878  C  CD1 . PHE B 1 369 ? 59.980 125.024 31.959  1.00 34.64  ? 369  PHE B CD1 1 
ATOM   7879  C  CD2 . PHE B 1 369 ? 58.627 126.536 30.708  1.00 35.27  ? 369  PHE B CD2 1 
ATOM   7880  C  CE1 . PHE B 1 369 ? 60.193 125.996 32.905  1.00 35.33  ? 369  PHE B CE1 1 
ATOM   7881  C  CE2 . PHE B 1 369 ? 58.837 127.521 31.655  1.00 35.77  ? 369  PHE B CE2 1 
ATOM   7882  C  CZ  . PHE B 1 369 ? 59.622 127.251 32.752  1.00 36.12  ? 369  PHE B CZ  1 
ATOM   7883  N  N   . LEU B 1 370 ? 56.019 124.815 30.062  1.00 31.75  ? 370  LEU B N   1 
ATOM   7884  C  CA  . LEU B 1 370 ? 54.906 125.592 30.587  1.00 30.93  ? 370  LEU B CA  1 
ATOM   7885  C  C   . LEU B 1 370 ? 53.741 124.711 30.986  1.00 31.02  ? 370  LEU B C   1 
ATOM   7886  O  O   . LEU B 1 370 ? 53.139 124.937 32.037  1.00 31.37  ? 370  LEU B O   1 
ATOM   7887  C  CB  . LEU B 1 370 ? 54.418 126.610 29.574  1.00 30.61  ? 370  LEU B CB  1 
ATOM   7888  C  CG  . LEU B 1 370 ? 55.399 127.653 29.079  1.00 29.70  ? 370  LEU B CG  1 
ATOM   7889  C  CD1 . LEU B 1 370 ? 54.930 128.154 27.743  1.00 28.86  ? 370  LEU B CD1 1 
ATOM   7890  C  CD2 . LEU B 1 370 ? 55.497 128.776 30.064  1.00 29.41  ? 370  LEU B CD2 1 
ATOM   7891  N  N   . VAL B 1 371 ? 53.391 123.720 30.171  1.00 30.59  ? 371  VAL B N   1 
ATOM   7892  C  CA  . VAL B 1 371 ? 52.270 122.876 30.573  1.00 30.68  ? 371  VAL B CA  1 
ATOM   7893  C  C   . VAL B 1 371 ? 52.621 122.161 31.859  1.00 30.70  ? 371  VAL B C   1 
ATOM   7894  O  O   . VAL B 1 371 ? 51.757 121.921 32.710  1.00 30.68  ? 371  VAL B O   1 
ATOM   7895  C  CB  . VAL B 1 371 ? 51.886 121.801 29.556  1.00 30.62  ? 371  VAL B CB  1 
ATOM   7896  C  CG1 . VAL B 1 371 ? 50.798 120.933 30.144  1.00 30.78  ? 371  VAL B CG1 1 
ATOM   7897  C  CG2 . VAL B 1 371 ? 51.380 122.418 28.278  1.00 31.30  ? 371  VAL B CG2 1 
ATOM   7898  N  N   . ALA B 1 372 ? 53.897 121.817 31.999  1.00 30.45  ? 372  ALA B N   1 
ATOM   7899  C  CA  . ALA B 1 372 ? 54.326 121.095 33.169  1.00 30.22  ? 372  ALA B CA  1 
ATOM   7900  C  C   . ALA B 1 372 ? 54.269 122.008 34.361  1.00 30.25  ? 372  ALA B C   1 
ATOM   7901  O  O   . ALA B 1 372 ? 53.806 121.613 35.435  1.00 30.28  ? 372  ALA B O   1 
ATOM   7902  C  CB  . ALA B 1 372 ? 55.695 120.555 32.985  1.00 30.30  ? 372  ALA B CB  1 
ATOM   7903  N  N   . ALA B 1 373 ? 54.719 123.241 34.171  1.00 30.31  ? 373  ALA B N   1 
ATOM   7904  C  CA  . ALA B 1 373 ? 54.715 124.202 35.268  1.00 30.75  ? 373  ALA B CA  1 
ATOM   7905  C  C   . ALA B 1 373 ? 53.297 124.434 35.810  1.00 31.12  ? 373  ALA B C   1 
ATOM   7906  O  O   . ALA B 1 373 ? 53.117 124.674 37.005  1.00 31.00  ? 373  ALA B O   1 
ATOM   7907  C  CB  . ALA B 1 373 ? 55.358 125.499 34.848  1.00 30.60  ? 373  ALA B CB  1 
ATOM   7908  N  N   . HIS B 1 374 ? 52.299 124.336 34.930  1.00 31.49  ? 374  HIS B N   1 
ATOM   7909  C  CA  . HIS B 1 374 ? 50.903 124.509 35.322  1.00 31.71  ? 374  HIS B CA  1 
ATOM   7910  C  C   . HIS B 1 374 ? 50.438 123.315 36.118  1.00 31.88  ? 374  HIS B C   1 
ATOM   7911  O  O   . HIS B 1 374 ? 49.661 123.457 37.058  1.00 32.14  ? 374  HIS B O   1 
ATOM   7912  C  CB  . HIS B 1 374 ? 49.998 124.680 34.097  1.00 31.65  ? 374  HIS B CB  1 
ATOM   7913  C  CG  . HIS B 1 374 ? 48.532 124.667 34.415  1.00 31.91  ? 374  HIS B CG  1 
ATOM   7914  N  ND1 . HIS B 1 374 ? 47.747 125.798 34.354  1.00 32.33  ? 374  HIS B ND1 1 
ATOM   7915  C  CD2 . HIS B 1 374 ? 47.706 123.658 34.787  1.00 32.26  ? 374  HIS B CD2 1 
ATOM   7916  C  CE1 . HIS B 1 374 ? 46.502 125.488 34.679  1.00 32.39  ? 374  HIS B CE1 1 
ATOM   7917  N  NE2 . HIS B 1 374 ? 46.451 124.196 34.949  1.00 32.02  ? 374  HIS B NE2 1 
ATOM   7918  N  N   . ALA B 1 375 ? 50.904 122.132 35.734  1.00 32.00  ? 375  ALA B N   1 
ATOM   7919  C  CA  . ALA B 1 375 ? 50.472 120.922 36.405  1.00 32.06  ? 375  ALA B CA  1 
ATOM   7920  C  C   . ALA B 1 375 ? 51.079 120.850 37.789  1.00 32.37  ? 375  ALA B C   1 
ATOM   7921  O  O   . ALA B 1 375 ? 50.363 120.734 38.773  1.00 32.90  ? 375  ALA B O   1 
ATOM   7922  C  CB  . ALA B 1 375 ? 50.826 119.698 35.603  1.00 31.91  ? 375  ALA B CB  1 
ATOM   7923  N  N   . PHE B 1 376 ? 52.393 120.935 37.891  1.00 32.37  ? 376  PHE B N   1 
ATOM   7924  C  CA  . PHE B 1 376 ? 52.989 120.845 39.214  1.00 32.42  ? 376  PHE B CA  1 
ATOM   7925  C  C   . PHE B 1 376 ? 52.358 121.858 40.191  1.00 32.47  ? 376  PHE B C   1 
ATOM   7926  O  O   . PHE B 1 376 ? 52.258 121.601 41.399  1.00 32.49  ? 376  PHE B O   1 
ATOM   7927  C  CB  . PHE B 1 376 ? 54.500 120.993 39.128  1.00 32.43  ? 376  PHE B CB  1 
ATOM   7928  C  CG  . PHE B 1 376 ? 55.148 119.950 38.288  1.00 32.25  ? 376  PHE B CG  1 
ATOM   7929  C  CD1 . PHE B 1 376 ? 54.421 118.880 37.824  1.00 33.01  ? 376  PHE B CD1 1 
ATOM   7930  C  CD2 . PHE B 1 376 ? 56.482 120.038 37.958  1.00 32.73  ? 376  PHE B CD2 1 
ATOM   7931  C  CE1 . PHE B 1 376 ? 55.017 117.910 37.050  1.00 33.38  ? 376  PHE B CE1 1 
ATOM   7932  C  CE2 . PHE B 1 376 ? 57.085 119.073 37.187  1.00 33.25  ? 376  PHE B CE2 1 
ATOM   7933  C  CZ  . PHE B 1 376 ? 56.356 118.012 36.733  1.00 33.74  ? 376  PHE B CZ  1 
ATOM   7934  N  N   . GLY B 1 377 ? 51.925 123.002 39.666  1.00 32.18  ? 377  GLY B N   1 
ATOM   7935  C  CA  . GLY B 1 377 ? 51.242 123.986 40.483  1.00 32.00  ? 377  GLY B CA  1 
ATOM   7936  C  C   . GLY B 1 377 ? 50.053 123.305 41.119  1.00 32.08  ? 377  GLY B C   1 
ATOM   7937  O  O   . GLY B 1 377 ? 49.784 123.466 42.300  1.00 31.98  ? 377  GLY B O   1 
ATOM   7938  N  N   . HIS B 1 378 ? 49.333 122.526 40.322  1.00 32.49  ? 378  HIS B N   1 
ATOM   7939  C  CA  . HIS B 1 378 ? 48.212 121.756 40.840  1.00 32.65  ? 378  HIS B CA  1 
ATOM   7940  C  C   . HIS B 1 378 ? 48.784 120.788 41.840  1.00 33.13  ? 378  HIS B C   1 
ATOM   7941  O  O   . HIS B 1 378 ? 48.236 120.601 42.920  1.00 33.73  ? 378  HIS B O   1 
ATOM   7942  C  CB  . HIS B 1 378 ? 47.520 120.963 39.737  1.00 32.12  ? 378  HIS B CB  1 
ATOM   7943  C  CG  . HIS B 1 378 ? 46.560 121.765 38.919  1.00 31.82  ? 378  HIS B CG  1 
ATOM   7944  N  ND1 . HIS B 1 378 ? 45.487 122.426 39.468  1.00 31.26  ? 378  HIS B ND1 1 
ATOM   7945  C  CD2 . HIS B 1 378 ? 46.501 121.997 37.586  1.00 32.03  ? 378  HIS B CD2 1 
ATOM   7946  C  CE1 . HIS B 1 378 ? 44.813 123.036 38.510  1.00 31.46  ? 378  HIS B CE1 1 
ATOM   7947  N  NE2 . HIS B 1 378 ? 45.404 122.788 37.358  1.00 30.88  ? 378  HIS B NE2 1 
ATOM   7948  N  N   . ALA B 1 379 ? 49.903 120.174 41.481  1.00 33.40  ? 379  ALA B N   1 
ATOM   7949  C  CA  . ALA B 1 379 ? 50.528 119.197 42.352  1.00 33.69  ? 379  ALA B CA  1 
ATOM   7950  C  C   . ALA B 1 379 ? 50.956 119.773 43.707  1.00 33.85  ? 379  ALA B C   1 
ATOM   7951  O  O   . ALA B 1 379 ? 51.105 119.025 44.672  1.00 33.93  ? 379  ALA B O   1 
ATOM   7952  C  CB  . ALA B 1 379 ? 51.694 118.518 41.647  1.00 33.79  ? 379  ALA B CB  1 
ATOM   7953  N  N   . MET B 1 380 ? 51.155 121.087 43.793  1.00 33.87  ? 380  MET B N   1 
ATOM   7954  C  CA  . MET B 1 380 ? 51.491 121.687 45.086  1.00 34.15  ? 380  MET B CA  1 
ATOM   7955  C  C   . MET B 1 380 ? 50.249 122.098 45.873  1.00 34.33  ? 380  MET B C   1 
ATOM   7956  O  O   . MET B 1 380 ? 50.348 122.525 47.012  1.00 34.58  ? 380  MET B O   1 
ATOM   7957  C  CB  . MET B 1 380 ? 52.417 122.889 44.936  1.00 33.96  ? 380  MET B CB  1 
ATOM   7958  C  CG  . MET B 1 380 ? 53.676 122.576 44.192  1.00 34.36  ? 380  MET B CG  1 
ATOM   7959  S  SD  . MET B 1 380 ? 54.280 120.941 44.564  1.00 34.53  ? 380  MET B SD  1 
ATOM   7960  C  CE  . MET B 1 380 ? 55.031 120.575 43.002  1.00 34.33  ? 380  MET B CE  1 
ATOM   7961  N  N   . GLY B 1 381 ? 49.080 121.984 45.261  1.00 34.47  ? 381  GLY B N   1 
ATOM   7962  C  CA  . GLY B 1 381 ? 47.857 122.357 45.932  1.00 34.57  ? 381  GLY B CA  1 
ATOM   7963  C  C   . GLY B 1 381 ? 47.116 123.511 45.296  1.00 34.94  ? 381  GLY B C   1 
ATOM   7964  O  O   . GLY B 1 381 ? 46.005 123.811 45.700  1.00 35.27  ? 381  GLY B O   1 
ATOM   7965  N  N   . LEU B 1 382 ? 47.712 124.160 44.301  1.00 35.20  ? 382  LEU B N   1 
ATOM   7966  C  CA  . LEU B 1 382 ? 47.073 125.308 43.659  1.00 35.26  ? 382  LEU B CA  1 
ATOM   7967  C  C   . LEU B 1 382 ? 45.787 124.953 42.914  1.00 35.64  ? 382  LEU B C   1 
ATOM   7968  O  O   . LEU B 1 382 ? 45.522 123.789 42.639  1.00 36.17  ? 382  LEU B O   1 
ATOM   7969  C  CB  . LEU B 1 382 ? 48.040 126.015 42.723  1.00 35.10  ? 382  LEU B CB  1 
ATOM   7970  C  CG  . LEU B 1 382 ? 49.159 126.796 43.394  1.00 34.46  ? 382  LEU B CG  1 
ATOM   7971  C  CD1 . LEU B 1 382 ? 49.815 127.653 42.360  1.00 34.93  ? 382  LEU B CD1 1 
ATOM   7972  C  CD2 . LEU B 1 382 ? 48.609 127.655 44.485  1.00 34.52  ? 382  LEU B CD2 1 
ATOM   7973  N  N   . GLU B 1 383 ? 45.017 125.979 42.571  1.00 35.75  ? 383  GLU B N   1 
ATOM   7974  C  CA  . GLU B 1 383 ? 43.699 125.847 41.965  1.00 35.69  ? 383  GLU B CA  1 
ATOM   7975  C  C   . GLU B 1 383 ? 43.668 126.823 40.794  1.00 35.11  ? 383  GLU B C   1 
ATOM   7976  O  O   . GLU B 1 383 ? 44.349 127.837 40.835  1.00 35.08  ? 383  GLU B O   1 
ATOM   7977  C  CB  . GLU B 1 383 ? 42.679 126.271 43.027  1.00 36.27  ? 383  GLU B CB  1 
ATOM   7978  C  CG  . GLU B 1 383 ? 41.259 125.754 42.884  1.00 38.48  ? 383  GLU B CG  1 
ATOM   7979  C  CD  . GLU B 1 383 ? 41.122 124.294 43.268  1.00 41.36  ? 383  GLU B CD  1 
ATOM   7980  O  OE1 . GLU B 1 383 ? 42.134 123.551 43.175  1.00 41.18  ? 383  GLU B OE1 1 
ATOM   7981  O  OE2 . GLU B 1 383 ? 39.992 123.896 43.655  1.00 42.60  ? 383  GLU B OE2 1 
ATOM   7982  N  N   . HIS B 1 384 ? 42.889 126.541 39.754  1.00 34.71  ? 384  HIS B N   1 
ATOM   7983  C  CA  . HIS B 1 384 ? 42.864 127.418 38.571  1.00 34.38  ? 384  HIS B CA  1 
ATOM   7984  C  C   . HIS B 1 384 ? 42.537 128.874 38.887  1.00 33.98  ? 384  HIS B C   1 
ATOM   7985  O  O   . HIS B 1 384 ? 41.708 129.161 39.765  1.00 33.94  ? 384  HIS B O   1 
ATOM   7986  C  CB  . HIS B 1 384 ? 41.909 126.892 37.492  1.00 34.61  ? 384  HIS B CB  1 
ATOM   7987  C  CG  . HIS B 1 384 ? 42.478 125.777 36.667  1.00 35.71  ? 384  HIS B CG  1 
ATOM   7988  N  ND1 . HIS B 1 384 ? 41.694 124.949 35.893  1.00 36.53  ? 384  HIS B ND1 1 
ATOM   7989  C  CD2 . HIS B 1 384 ? 43.756 125.357 36.490  1.00 36.56  ? 384  HIS B CD2 1 
ATOM   7990  C  CE1 . HIS B 1 384 ? 42.463 124.062 35.284  1.00 37.19  ? 384  HIS B CE1 1 
ATOM   7991  N  NE2 . HIS B 1 384 ? 43.719 124.289 35.627  1.00 36.85  ? 384  HIS B NE2 1 
ATOM   7992  N  N   . SER B 1 385 ? 43.177 129.784 38.148  1.00 33.22  ? 385  SER B N   1 
ATOM   7993  C  CA  . SER B 1 385 ? 43.034 131.224 38.370  1.00 32.66  ? 385  SER B CA  1 
ATOM   7994  C  C   . SER B 1 385 ? 42.275 131.947 37.273  1.00 32.60  ? 385  SER B C   1 
ATOM   7995  O  O   . SER B 1 385 ? 42.255 131.503 36.134  1.00 32.72  ? 385  SER B O   1 
ATOM   7996  C  CB  . SER B 1 385 ? 44.405 131.871 38.521  1.00 32.48  ? 385  SER B CB  1 
ATOM   7997  O  OG  . SER B 1 385 ? 44.321 133.266 38.320  1.00 31.97  ? 385  SER B OG  1 
ATOM   7998  N  N   . GLN B 1 386 ? 41.659 133.073 37.622  1.00 32.55  ? 386  GLN B N   1 
ATOM   7999  C  CA  . GLN B 1 386 ? 40.913 133.861 36.650  1.00 32.53  ? 386  GLN B CA  1 
ATOM   8000  C  C   . GLN B 1 386 ? 41.792 134.908 35.970  1.00 32.64  ? 386  GLN B C   1 
ATOM   8001  O  O   . GLN B 1 386 ? 41.418 135.469 34.951  1.00 32.75  ? 386  GLN B O   1 
ATOM   8002  C  CB  . GLN B 1 386 ? 39.696 134.521 37.297  1.00 32.28  ? 386  GLN B CB  1 
ATOM   8003  C  CG  . GLN B 1 386 ? 38.508 133.590 37.469  1.00 32.66  ? 386  GLN B CG  1 
ATOM   8004  C  CD  . GLN B 1 386 ? 37.281 134.285 38.062  1.00 32.86  ? 386  GLN B CD  1 
ATOM   8005  O  OE1 . GLN B 1 386 ? 36.983 134.131 39.248  1.00 33.13  ? 386  GLN B OE1 1 
ATOM   8006  N  NE2 . GLN B 1 386 ? 36.571 135.042 37.236  1.00 32.63  ? 386  GLN B NE2 1 
ATOM   8007  N  N   . ASP B 1 387 ? 42.965 135.161 36.532  1.00 32.83  ? 387  ASP B N   1 
ATOM   8008  C  CA  . ASP B 1 387 ? 43.876 136.162 35.990  1.00 32.99  ? 387  ASP B CA  1 
ATOM   8009  C  C   . ASP B 1 387 ? 44.531 135.691 34.701  1.00 32.96  ? 387  ASP B C   1 
ATOM   8010  O  O   . ASP B 1 387 ? 45.494 134.938 34.729  1.00 33.07  ? 387  ASP B O   1 
ATOM   8011  C  CB  . ASP B 1 387 ? 44.948 136.496 37.024  1.00 33.12  ? 387  ASP B CB  1 
ATOM   8012  C  CG  . ASP B 1 387 ? 45.852 137.619 36.580  1.00 34.07  ? 387  ASP B CG  1 
ATOM   8013  O  OD1 . ASP B 1 387 ? 45.877 137.928 35.370  1.00 35.08  ? 387  ASP B OD1 1 
ATOM   8014  O  OD2 . ASP B 1 387 ? 46.579 138.253 37.371  1.00 35.51  ? 387  ASP B OD2 1 
ATOM   8015  N  N   . PRO B 1 388 ? 44.062 136.209 33.576  1.00 33.01  ? 388  PRO B N   1 
ATOM   8016  C  CA  . PRO B 1 388 ? 44.520 135.764 32.255  1.00 32.96  ? 388  PRO B CA  1 
ATOM   8017  C  C   . PRO B 1 388 ? 46.027 135.772 32.133  1.00 33.20  ? 388  PRO B C   1 
ATOM   8018  O  O   . PRO B 1 388 ? 46.574 135.121 31.253  1.00 33.53  ? 388  PRO B O   1 
ATOM   8019  C  CB  . PRO B 1 388 ? 43.966 136.823 31.312  1.00 32.82  ? 388  PRO B CB  1 
ATOM   8020  C  CG  . PRO B 1 388 ? 42.836 137.455 32.037  1.00 33.33  ? 388  PRO B CG  1 
ATOM   8021  C  CD  . PRO B 1 388 ? 43.111 137.330 33.503  1.00 33.08  ? 388  PRO B CD  1 
ATOM   8022  N  N   . GLY B 1 389 ? 46.704 136.510 32.997  1.00 33.38  ? 389  GLY B N   1 
ATOM   8023  C  CA  . GLY B 1 389 ? 48.142 136.608 32.885  1.00 33.65  ? 389  GLY B CA  1 
ATOM   8024  C  C   . GLY B 1 389 ? 48.879 135.699 33.834  1.00 33.85  ? 389  GLY B C   1 
ATOM   8025  O  O   . GLY B 1 389 ? 50.105 135.783 33.943  1.00 33.94  ? 389  GLY B O   1 
ATOM   8026  N  N   . ALA B 1 390 ? 48.135 134.822 34.504  1.00 33.94  ? 390  ALA B N   1 
ATOM   8027  C  CA  . ALA B 1 390 ? 48.708 133.936 35.519  1.00 34.12  ? 390  ALA B CA  1 
ATOM   8028  C  C   . ALA B 1 390 ? 48.787 132.460 35.136  1.00 34.27  ? 390  ALA B C   1 
ATOM   8029  O  O   . ALA B 1 390 ? 47.774 131.834 34.821  1.00 34.56  ? 390  ALA B O   1 
ATOM   8030  C  CB  . ALA B 1 390 ? 47.951 134.078 36.804  1.00 34.26  ? 390  ALA B CB  1 
ATOM   8031  N  N   . LEU B 1 391 ? 49.998 131.909 35.214  1.00 34.15  ? 391  LEU B N   1 
ATOM   8032  C  CA  . LEU B 1 391 ? 50.275 130.509 34.889  1.00 33.68  ? 391  LEU B CA  1 
ATOM   8033  C  C   . LEU B 1 391 ? 49.141 129.551 35.223  1.00 33.53  ? 391  LEU B C   1 
ATOM   8034  O  O   . LEU B 1 391 ? 48.753 128.722 34.400  1.00 33.40  ? 391  LEU B O   1 
ATOM   8035  C  CB  . LEU B 1 391 ? 51.537 130.047 35.617  1.00 33.63  ? 391  LEU B CB  1 
ATOM   8036  C  CG  . LEU B 1 391 ? 52.079 128.692 35.159  1.00 33.53  ? 391  LEU B CG  1 
ATOM   8037  C  CD1 . LEU B 1 391 ? 52.188 128.630 33.642  1.00 32.94  ? 391  LEU B CD1 1 
ATOM   8038  C  CD2 . LEU B 1 391 ? 53.424 128.419 35.807  1.00 33.70  ? 391  LEU B CD2 1 
ATOM   8039  N  N   . MET B 1 392 ? 48.607 129.662 36.434  1.00 33.07  ? 392  MET B N   1 
ATOM   8040  C  CA  . MET B 1 392 ? 47.560 128.751 36.847  1.00 32.46  ? 392  MET B CA  1 
ATOM   8041  C  C   . MET B 1 392 ? 46.262 128.939 36.100  1.00 32.28  ? 392  MET B C   1 
ATOM   8042  O  O   . MET B 1 392 ? 45.326 128.201 36.327  1.00 32.71  ? 392  MET B O   1 
ATOM   8043  C  CB  . MET B 1 392 ? 47.328 128.827 38.344  1.00 32.41  ? 392  MET B CB  1 
ATOM   8044  C  CG  . MET B 1 392 ? 48.446 128.216 39.116  1.00 32.64  ? 392  MET B CG  1 
ATOM   8045  S  SD  . MET B 1 392 ? 48.900 126.663 38.366  1.00 33.29  ? 392  MET B SD  1 
ATOM   8046  C  CE  . MET B 1 392 ? 47.526 125.624 38.874  1.00 33.21  ? 392  MET B CE  1 
ATOM   8047  N  N   . ALA B 1 393 ? 46.172 129.928 35.227  1.00 32.04  ? 393  ALA B N   1 
ATOM   8048  C  CA  . ALA B 1 393 ? 44.966 130.039 34.427  1.00 32.05  ? 393  ALA B CA  1 
ATOM   8049  C  C   . ALA B 1 393 ? 44.994 128.777 33.583  1.00 32.19  ? 393  ALA B C   1 
ATOM   8050  O  O   . ALA B 1 393 ? 46.079 128.271 33.300  1.00 32.55  ? 393  ALA B O   1 
ATOM   8051  C  CB  . ALA B 1 393 ? 45.009 131.270 33.564  1.00 31.99  ? 393  ALA B CB  1 
ATOM   8052  N  N   . PRO B 1 394 ? 43.840 128.254 33.183  1.00 31.95  ? 394  PRO B N   1 
ATOM   8053  C  CA  . PRO B 1 394 ? 43.789 126.997 32.440  1.00 32.10  ? 394  PRO B CA  1 
ATOM   8054  C  C   . PRO B 1 394 ? 44.087 127.096 30.933  1.00 32.43  ? 394  PRO B C   1 
ATOM   8055  O  O   . PRO B 1 394 ? 44.771 126.234 30.372  1.00 32.29  ? 394  PRO B O   1 
ATOM   8056  C  CB  . PRO B 1 394 ? 42.347 126.572 32.653  1.00 31.69  ? 394  PRO B CB  1 
ATOM   8057  C  CG  . PRO B 1 394 ? 41.674 127.821 32.511  1.00 31.99  ? 394  PRO B CG  1 
ATOM   8058  C  CD  . PRO B 1 394 ? 42.487 128.779 33.396  1.00 32.20  ? 394  PRO B CD  1 
ATOM   8059  N  N   . ILE B 1 395 ? 43.579 128.115 30.259  1.00 32.65  ? 395  ILE B N   1 
ATOM   8060  C  CA  . ILE B 1 395 ? 43.796 128.148 28.823  1.00 32.79  ? 395  ILE B CA  1 
ATOM   8061  C  C   . ILE B 1 395 ? 45.268 128.318 28.485  1.00 33.20  ? 395  ILE B C   1 
ATOM   8062  O  O   . ILE B 1 395 ? 45.864 129.351 28.768  1.00 33.75  ? 395  ILE B O   1 
ATOM   8063  C  CB  . ILE B 1 395 ? 42.928 129.207 28.175  1.00 32.64  ? 395  ILE B CB  1 
ATOM   8064  C  CG1 . ILE B 1 395 ? 41.465 128.882 28.479  1.00 32.13  ? 395  ILE B CG1 1 
ATOM   8065  C  CG2 . ILE B 1 395 ? 43.219 129.286 26.688  1.00 32.31  ? 395  ILE B CG2 1 
ATOM   8066  C  CD1 . ILE B 1 395 ? 40.533 129.082 27.341  1.00 31.90  ? 395  ILE B CD1 1 
ATOM   8067  N  N   . TYR B 1 396 ? 45.860 127.290 27.897  1.00 33.48  ? 396  TYR B N   1 
ATOM   8068  C  CA  . TYR B 1 396 ? 47.273 127.334 27.534  1.00 33.74  ? 396  TYR B CA  1 
ATOM   8069  C  C   . TYR B 1 396 ? 47.590 128.492 26.587  1.00 34.38  ? 396  TYR B C   1 
ATOM   8070  O  O   . TYR B 1 396 ? 46.849 128.761 25.640  1.00 34.76  ? 396  TYR B O   1 
ATOM   8071  C  CB  . TYR B 1 396 ? 47.700 126.008 26.932  1.00 33.25  ? 396  TYR B CB  1 
ATOM   8072  C  CG  . TYR B 1 396 ? 48.992 126.055 26.172  1.00 33.18  ? 396  TYR B CG  1 
ATOM   8073  C  CD1 . TYR B 1 396 ? 49.047 126.574 24.906  1.00 32.47  ? 396  TYR B CD1 1 
ATOM   8074  C  CD2 . TYR B 1 396 ? 50.161 125.549 26.719  1.00 34.21  ? 396  TYR B CD2 1 
ATOM   8075  C  CE1 . TYR B 1 396 ? 50.222 126.600 24.214  1.00 33.62  ? 396  TYR B CE1 1 
ATOM   8076  C  CE2 . TYR B 1 396 ? 51.351 125.577 26.028  1.00 33.33  ? 396  TYR B CE2 1 
ATOM   8077  C  CZ  . TYR B 1 396 ? 51.373 126.100 24.775  1.00 33.53  ? 396  TYR B CZ  1 
ATOM   8078  O  OH  . TYR B 1 396 ? 52.552 126.130 24.064  1.00 34.69  ? 396  TYR B OH  1 
ATOM   8079  N  N   . THR B 1 397 ? 48.699 129.170 26.862  1.00 34.97  ? 397  THR B N   1 
ATOM   8080  C  CA  . THR B 1 397 ? 49.125 130.341 26.115  1.00 35.38  ? 397  THR B CA  1 
ATOM   8081  C  C   . THR B 1 397 ? 50.640 130.416 26.096  1.00 35.75  ? 397  THR B C   1 
ATOM   8082  O  O   . THR B 1 397 ? 51.289 130.368 27.139  1.00 35.84  ? 397  THR B O   1 
ATOM   8083  C  CB  . THR B 1 397 ? 48.581 131.595 26.777  1.00 35.32  ? 397  THR B CB  1 
ATOM   8084  O  OG1 . THR B 1 397 ? 47.179 131.698 26.509  1.00 36.19  ? 397  THR B OG1 1 
ATOM   8085  C  CG2 . THR B 1 397 ? 49.161 132.829 26.113  1.00 35.31  ? 397  THR B CG2 1 
ATOM   8086  N  N   . TYR B 1 398 ? 51.207 130.561 24.908  1.00 36.22  ? 398  TYR B N   1 
ATOM   8087  C  CA  . TYR B 1 398 ? 52.647 130.566 24.783  1.00 36.44  ? 398  TYR B CA  1 
ATOM   8088  C  C   . TYR B 1 398 ? 53.273 131.903 25.035  1.00 37.06  ? 398  TYR B C   1 
ATOM   8089  O  O   . TYR B 1 398 ? 52.807 132.912 24.540  1.00 37.35  ? 398  TYR B O   1 
ATOM   8090  C  CB  . TYR B 1 398 ? 53.065 130.115 23.409  1.00 36.16  ? 398  TYR B CB  1 
ATOM   8091  C  CG  . TYR B 1 398 ? 54.550 129.981 23.325  1.00 35.59  ? 398  TYR B CG  1 
ATOM   8092  C  CD1 . TYR B 1 398 ? 55.255 129.328 24.318  1.00 34.15  ? 398  TYR B CD1 1 
ATOM   8093  C  CD2 . TYR B 1 398 ? 55.249 130.514 22.263  1.00 35.38  ? 398  TYR B CD2 1 
ATOM   8094  C  CE1 . TYR B 1 398 ? 56.606 129.206 24.255  1.00 34.82  ? 398  TYR B CE1 1 
ATOM   8095  C  CE2 . TYR B 1 398 ? 56.603 130.396 22.186  1.00 35.94  ? 398  TYR B CE2 1 
ATOM   8096  C  CZ  . TYR B 1 398 ? 57.282 129.740 23.184  1.00 36.17  ? 398  TYR B CZ  1 
ATOM   8097  O  OH  . TYR B 1 398 ? 58.654 129.626 23.099  1.00 37.63  ? 398  TYR B OH  1 
ATOM   8098  N  N   . THR B 1 399 ? 54.364 131.887 25.784  1.00 37.98  ? 399  THR B N   1 
ATOM   8099  C  CA  . THR B 1 399 ? 55.114 133.085 26.108  1.00 38.88  ? 399  THR B CA  1 
ATOM   8100  C  C   . THR B 1 399 ? 56.603 132.789 25.941  1.00 39.51  ? 399  THR B C   1 
ATOM   8101  O  O   . THR B 1 399 ? 57.116 131.815 26.499  1.00 39.59  ? 399  THR B O   1 
ATOM   8102  C  CB  . THR B 1 399 ? 54.826 133.453 27.546  1.00 38.97  ? 399  THR B CB  1 
ATOM   8103  O  OG1 . THR B 1 399 ? 55.214 132.358 28.387  1.00 38.84  ? 399  THR B OG1 1 
ATOM   8104  C  CG2 . THR B 1 399 ? 53.318 133.545 27.774  1.00 39.21  ? 399  THR B CG2 1 
ATOM   8105  N  N   . LYS B 1 400 ? 57.309 133.610 25.174  1.00 40.25  ? 400  LYS B N   1 
ATOM   8106  C  CA  . LYS B 1 400 ? 58.726 133.342 24.967  1.00 41.10  ? 400  LYS B CA  1 
ATOM   8107  C  C   . LYS B 1 400 ? 59.471 133.449 26.286  1.00 41.27  ? 400  LYS B C   1 
ATOM   8108  O  O   . LYS B 1 400 ? 60.306 132.611 26.595  1.00 41.45  ? 400  LYS B O   1 
ATOM   8109  C  CB  . LYS B 1 400 ? 59.351 134.284 23.929  1.00 41.49  ? 400  LYS B CB  1 
ATOM   8110  C  CG  . LYS B 1 400 ? 58.489 134.553 22.702  1.00 42.75  ? 400  LYS B CG  1 
ATOM   8111  C  CD  . LYS B 1 400 ? 58.034 136.012 22.638  1.00 44.66  ? 400  LYS B CD  1 
ATOM   8112  C  CE  . LYS B 1 400 ? 59.095 136.885 21.958  1.00 46.11  ? 400  LYS B CE  1 
ATOM   8113  N  NZ  . LYS B 1 400 ? 58.616 138.267 21.615  1.00 46.92  ? 400  LYS B NZ  1 
ATOM   8114  N  N   . ASN B 1 401 ? 59.161 134.483 27.064  1.00 41.46  ? 401  ASN B N   1 
ATOM   8115  C  CA  . ASN B 1 401 ? 59.820 134.697 28.350  1.00 41.61  ? 401  ASN B CA  1 
ATOM   8116  C  C   . ASN B 1 401 ? 58.819 134.565 29.475  1.00 41.24  ? 401  ASN B C   1 
ATOM   8117  O  O   . ASN B 1 401 ? 58.195 135.544 29.891  1.00 41.80  ? 401  ASN B O   1 
ATOM   8118  C  CB  . ASN B 1 401 ? 60.466 136.077 28.396  1.00 41.88  ? 401  ASN B CB  1 
ATOM   8119  C  CG  . ASN B 1 401 ? 61.004 136.494 27.055  1.00 43.14  ? 401  ASN B CG  1 
ATOM   8120  O  OD1 . ASN B 1 401 ? 60.345 137.235 26.313  1.00 44.40  ? 401  ASN B OD1 1 
ATOM   8121  N  ND2 . ASN B 1 401 ? 62.193 135.996 26.711  1.00 43.71  ? 401  ASN B ND2 1 
ATOM   8122  N  N   . PHE B 1 402 ? 58.661 133.346 29.964  1.00 40.34  ? 402  PHE B N   1 
ATOM   8123  C  CA  . PHE B 1 402 ? 57.714 133.092 31.022  1.00 39.33  ? 402  PHE B CA  1 
ATOM   8124  C  C   . PHE B 1 402 ? 58.239 133.660 32.315  1.00 39.16  ? 402  PHE B C   1 
ATOM   8125  O  O   . PHE B 1 402 ? 59.434 133.589 32.587  1.00 38.96  ? 402  PHE B O   1 
ATOM   8126  C  CB  . PHE B 1 402 ? 57.497 131.592 31.183  1.00 39.09  ? 402  PHE B CB  1 
ATOM   8127  C  CG  . PHE B 1 402 ? 56.659 131.235 32.348  1.00 37.70  ? 402  PHE B CG  1 
ATOM   8128  C  CD1 . PHE B 1 402 ? 55.325 131.583 32.389  1.00 36.61  ? 402  PHE B CD1 1 
ATOM   8129  C  CD2 . PHE B 1 402 ? 57.196 130.562 33.408  1.00 37.63  ? 402  PHE B CD2 1 
ATOM   8130  C  CE1 . PHE B 1 402 ? 54.541 131.266 33.463  1.00 35.24  ? 402  PHE B CE1 1 
ATOM   8131  C  CE2 . PHE B 1 402 ? 56.406 130.237 34.492  1.00 37.70  ? 402  PHE B CE2 1 
ATOM   8132  C  CZ  . PHE B 1 402 ? 55.075 130.596 34.512  1.00 35.85  ? 402  PHE B CZ  1 
ATOM   8133  N  N   . ARG B 1 403 ? 57.331 134.248 33.086  1.00 38.92  ? 403  ARG B N   1 
ATOM   8134  C  CA  . ARG B 1 403 ? 57.621 134.746 34.419  1.00 38.73  ? 403  ARG B CA  1 
ATOM   8135  C  C   . ARG B 1 403 ? 56.418 134.413 35.281  1.00 38.15  ? 403  ARG B C   1 
ATOM   8136  O  O   . ARG B 1 403 ? 55.283 134.717 34.900  1.00 38.34  ? 403  ARG B O   1 
ATOM   8137  C  CB  . ARG B 1 403 ? 57.792 136.261 34.425  1.00 38.85  ? 403  ARG B CB  1 
ATOM   8138  C  CG  . ARG B 1 403 ? 58.887 136.790 33.532  1.00 40.51  ? 403  ARG B CG  1 
ATOM   8139  C  CD  . ARG B 1 403 ? 59.069 138.318 33.596  1.00 42.89  ? 403  ARG B CD  1 
ATOM   8140  N  NE  . ARG B 1 403 ? 59.537 138.802 34.900  1.00 44.08  ? 403  ARG B NE  1 
ATOM   8141  C  CZ  . ARG B 1 403 ? 60.364 138.139 35.707  1.00 44.97  ? 403  ARG B CZ  1 
ATOM   8142  N  NH1 . ARG B 1 403 ? 60.829 136.942 35.365  1.00 45.45  ? 403  ARG B NH1 1 
ATOM   8143  N  NH2 . ARG B 1 403 ? 60.727 138.674 36.865  1.00 45.16  ? 403  ARG B NH2 1 
ATOM   8144  N  N   . LEU B 1 404 ? 56.644 133.788 36.431  1.00 37.14  ? 404  LEU B N   1 
ATOM   8145  C  CA  . LEU B 1 404 ? 55.546 133.575 37.354  1.00 35.93  ? 404  LEU B CA  1 
ATOM   8146  C  C   . LEU B 1 404 ? 54.922 134.933 37.598  1.00 35.61  ? 404  LEU B C   1 
ATOM   8147  O  O   . LEU B 1 404 ? 55.626 135.881 37.934  1.00 35.57  ? 404  LEU B O   1 
ATOM   8148  C  CB  . LEU B 1 404 ? 56.049 133.030 38.684  1.00 35.64  ? 404  LEU B CB  1 
ATOM   8149  C  CG  . LEU B 1 404 ? 55.808 131.564 39.010  1.00 34.49  ? 404  LEU B CG  1 
ATOM   8150  C  CD1 . LEU B 1 404 ? 55.913 131.354 40.507  1.00 33.80  ? 404  LEU B CD1 1 
ATOM   8151  C  CD2 . LEU B 1 404 ? 54.450 131.145 38.510  1.00 34.02  ? 404  LEU B CD2 1 
ATOM   8152  N  N   . SER B 1 405 ? 53.612 135.032 37.402  1.00 35.24  ? 405  SER B N   1 
ATOM   8153  C  CA  . SER B 1 405 ? 52.883 136.250 37.719  1.00 34.96  ? 405  SER B CA  1 
ATOM   8154  C  C   . SER B 1 405 ? 52.770 136.333 39.228  1.00 34.85  ? 405  SER B C   1 
ATOM   8155  O  O   . SER B 1 405 ? 52.979 135.339 39.926  1.00 34.74  ? 405  SER B O   1 
ATOM   8156  C  CB  . SER B 1 405 ? 51.478 136.215 37.116  1.00 35.13  ? 405  SER B CB  1 
ATOM   8157  O  OG  . SER B 1 405 ? 50.614 135.372 37.864  1.00 34.84  ? 405  SER B OG  1 
ATOM   8158  N  N   . GLN B 1 406 ? 52.430 137.507 39.742  1.00 34.85  ? 406  GLN B N   1 
ATOM   8159  C  CA  . GLN B 1 406 ? 52.296 137.654 41.185  1.00 35.02  ? 406  GLN B CA  1 
ATOM   8160  C  C   . GLN B 1 406 ? 51.142 136.795 41.667  1.00 34.78  ? 406  GLN B C   1 
ATOM   8161  O  O   . GLN B 1 406 ? 51.227 136.150 42.701  1.00 34.79  ? 406  GLN B O   1 
ATOM   8162  C  CB  . GLN B 1 406 ? 52.085 139.108 41.577  1.00 34.83  ? 406  GLN B CB  1 
ATOM   8163  C  CG  . GLN B 1 406 ? 51.749 139.285 43.023  1.00 36.58  ? 406  GLN B CG  1 
ATOM   8164  C  CD  . GLN B 1 406 ? 52.965 139.175 43.915  1.00 38.38  ? 406  GLN B CD  1 
ATOM   8165  O  OE1 . GLN B 1 406 ? 52.849 139.068 45.142  1.00 39.76  ? 406  GLN B OE1 1 
ATOM   8166  N  NE2 . GLN B 1 406 ? 54.134 139.215 43.309  1.00 38.53  ? 406  GLN B NE2 1 
ATOM   8167  N  N   . ASP B 1 407 ? 50.076 136.764 40.883  1.00 34.83  ? 407  ASP B N   1 
ATOM   8168  C  CA  . ASP B 1 407 ? 48.903 135.971 41.214  1.00 34.90  ? 407  ASP B CA  1 
ATOM   8169  C  C   . ASP B 1 407 ? 49.263 134.540 41.558  1.00 34.93  ? 407  ASP B C   1 
ATOM   8170  O  O   . ASP B 1 407 ? 48.617 133.916 42.387  1.00 35.04  ? 407  ASP B O   1 
ATOM   8171  C  CB  . ASP B 1 407 ? 47.905 135.974 40.060  1.00 34.85  ? 407  ASP B CB  1 
ATOM   8172  C  CG  . ASP B 1 407 ? 46.687 135.133 40.354  1.00 35.14  ? 407  ASP B CG  1 
ATOM   8173  O  OD1 . ASP B 1 407 ? 45.841 135.445 41.220  1.00 36.18  ? 407  ASP B OD1 1 
ATOM   8174  O  OD2 . ASP B 1 407 ? 46.527 134.070 39.722  1.00 35.09  ? 407  ASP B OD2 1 
ATOM   8175  N  N   . ASP B 1 408 ? 50.285 134.012 40.903  1.00 35.26  ? 408  ASP B N   1 
ATOM   8176  C  CA  . ASP B 1 408 ? 50.718 132.647 41.160  1.00 35.36  ? 408  ASP B CA  1 
ATOM   8177  C  C   . ASP B 1 408 ? 51.537 132.590 42.445  1.00 35.24  ? 408  ASP B C   1 
ATOM   8178  O  O   . ASP B 1 408 ? 51.380 131.667 43.241  1.00 35.21  ? 408  ASP B O   1 
ATOM   8179  C  CB  . ASP B 1 408 ? 51.552 132.122 39.995  1.00 35.48  ? 408  ASP B CB  1 
ATOM   8180  C  CG  . ASP B 1 408 ? 50.785 132.103 38.681  1.00 36.38  ? 408  ASP B CG  1 
ATOM   8181  O  OD1 . ASP B 1 408 ? 49.684 131.513 38.624  1.00 37.70  ? 408  ASP B OD1 1 
ATOM   8182  O  OD2 . ASP B 1 408 ? 51.213 132.642 37.642  1.00 37.16  ? 408  ASP B OD2 1 
ATOM   8183  N  N   . ILE B 1 409 ? 52.408 133.579 42.642  1.00 34.99  ? 409  ILE B N   1 
ATOM   8184  C  CA  . ILE B 1 409 ? 53.259 133.620 43.824  1.00 34.71  ? 409  ILE B CA  1 
ATOM   8185  C  C   . ILE B 1 409 ? 52.428 133.783 45.082  1.00 34.79  ? 409  ILE B C   1 
ATOM   8186  O  O   . ILE B 1 409 ? 52.554 133.005 46.017  1.00 34.97  ? 409  ILE B O   1 
ATOM   8187  C  CB  . ILE B 1 409 ? 54.276 134.747 43.727  1.00 34.64  ? 409  ILE B CB  1 
ATOM   8188  C  CG1 . ILE B 1 409 ? 54.860 134.804 42.317  1.00 34.49  ? 409  ILE B CG1 1 
ATOM   8189  C  CG2 . ILE B 1 409 ? 55.371 134.536 44.744  1.00 34.46  ? 409  ILE B CG2 1 
ATOM   8190  C  CD1 . ILE B 1 409 ? 56.128 135.617 42.218  1.00 33.96  ? 409  ILE B CD1 1 
ATOM   8191  N  N   . LYS B 1 410 ? 51.578 134.801 45.105  1.00 34.80  ? 410  LYS B N   1 
ATOM   8192  C  CA  . LYS B 1 410 ? 50.688 135.007 46.234  1.00 34.64  ? 410  LYS B CA  1 
ATOM   8193  C  C   . LYS B 1 410 ? 50.061 133.658 46.535  1.00 34.35  ? 410  LYS B C   1 
ATOM   8194  O  O   . LYS B 1 410 ? 50.052 133.205 47.679  1.00 34.32  ? 410  LYS B O   1 
ATOM   8195  C  CB  . LYS B 1 410 ? 49.604 136.025 45.888  1.00 34.70  ? 410  LYS B CB  1 
ATOM   8196  C  CG  . LYS B 1 410 ? 48.763 136.455 47.077  1.00 36.43  ? 410  LYS B CG  1 
ATOM   8197  C  CD  . LYS B 1 410 ? 47.465 137.159 46.657  1.00 39.31  ? 410  LYS B CD  1 
ATOM   8198  C  CE  . LYS B 1 410 ? 46.264 136.197 46.629  1.00 40.47  ? 410  LYS B CE  1 
ATOM   8199  N  NZ  . LYS B 1 410 ? 44.977 136.857 46.202  1.00 40.80  ? 410  LYS B NZ  1 
ATOM   8200  N  N   . GLY B 1 411 ? 49.552 133.017 45.484  1.00 34.20  ? 411  GLY B N   1 
ATOM   8201  C  CA  . GLY B 1 411 ? 48.918 131.718 45.598  1.00 33.95  ? 411  GLY B CA  1 
ATOM   8202  C  C   . GLY B 1 411 ? 49.844 130.750 46.298  1.00 33.95  ? 411  GLY B C   1 
ATOM   8203  O  O   . GLY B 1 411 ? 49.682 130.445 47.480  1.00 33.99  ? 411  GLY B O   1 
ATOM   8204  N  N   . ILE B 1 412 ? 50.850 130.290 45.569  1.00 33.90  ? 412  ILE B N   1 
ATOM   8205  C  CA  . ILE B 1 412 ? 51.798 129.329 46.106  1.00 33.62  ? 412  ILE B CA  1 
ATOM   8206  C  C   . ILE B 1 412 ? 52.389 129.730 47.454  1.00 33.75  ? 412  ILE B C   1 
ATOM   8207  O  O   . ILE B 1 412 ? 52.621 128.873 48.291  1.00 34.01  ? 412  ILE B O   1 
ATOM   8208  C  CB  . ILE B 1 412 ? 52.914 129.056 45.101  1.00 33.39  ? 412  ILE B CB  1 
ATOM   8209  C  CG1 . ILE B 1 412 ? 53.650 127.785 45.495  1.00 33.19  ? 412  ILE B CG1 1 
ATOM   8210  C  CG2 . ILE B 1 412 ? 53.862 130.224 45.034  1.00 33.20  ? 412  ILE B CG2 1 
ATOM   8211  C  CD1 . ILE B 1 412 ? 52.722 126.638 45.765  1.00 32.69  ? 412  ILE B CD1 1 
ATOM   8212  N  N   . GLN B 1 413 ? 52.622 131.021 47.676  1.00 33.84  ? 413  GLN B N   1 
ATOM   8213  C  CA  . GLN B 1 413 ? 53.214 131.462 48.939  1.00 34.00  ? 413  GLN B CA  1 
ATOM   8214  C  C   . GLN B 1 413 ? 52.255 131.321 50.110  1.00 34.44  ? 413  GLN B C   1 
ATOM   8215  O  O   . GLN B 1 413 ? 52.689 131.191 51.250  1.00 34.56  ? 413  GLN B O   1 
ATOM   8216  C  CB  . GLN B 1 413 ? 53.732 132.901 48.854  1.00 33.76  ? 413  GLN B CB  1 
ATOM   8217  C  CG  . GLN B 1 413 ? 55.087 133.034 48.174  1.00 33.29  ? 413  GLN B CG  1 
ATOM   8218  C  CD  . GLN B 1 413 ? 55.588 134.466 48.127  1.00 32.50  ? 413  GLN B CD  1 
ATOM   8219  O  OE1 . GLN B 1 413 ? 54.913 135.388 48.587  1.00 31.80  ? 413  GLN B OE1 1 
ATOM   8220  N  NE2 . GLN B 1 413 ? 56.780 134.652 47.580  1.00 32.16  ? 413  GLN B NE2 1 
ATOM   8221  N  N   . GLU B 1 414 ? 50.955 131.324 49.825  1.00 34.91  ? 414  GLU B N   1 
ATOM   8222  C  CA  . GLU B 1 414 ? 49.938 131.250 50.875  1.00 35.25  ? 414  GLU B CA  1 
ATOM   8223  C  C   . GLU B 1 414 ? 49.946 129.898 51.574  1.00 34.82  ? 414  GLU B C   1 
ATOM   8224  O  O   . GLU B 1 414 ? 49.446 129.753 52.686  1.00 34.73  ? 414  GLU B O   1 
ATOM   8225  C  CB  . GLU B 1 414 ? 48.551 131.530 50.291  1.00 35.40  ? 414  GLU B CB  1 
ATOM   8226  C  CG  . GLU B 1 414 ? 47.525 131.974 51.321  1.00 38.32  ? 414  GLU B CG  1 
ATOM   8227  C  CD  . GLU B 1 414 ? 46.159 132.271 50.709  1.00 42.41  ? 414  GLU B CD  1 
ATOM   8228  O  OE1 . GLU B 1 414 ? 45.992 133.343 50.071  1.00 43.21  ? 414  GLU B OE1 1 
ATOM   8229  O  OE2 . GLU B 1 414 ? 45.239 131.430 50.869  1.00 44.21  ? 414  GLU B OE2 1 
ATOM   8230  N  N   . LEU B 1 415 ? 50.538 128.912 50.919  1.00 34.56  ? 415  LEU B N   1 
ATOM   8231  C  CA  . LEU B 1 415 ? 50.538 127.561 51.432  1.00 34.35  ? 415  LEU B CA  1 
ATOM   8232  C  C   . LEU B 1 415 ? 51.903 127.104 51.890  1.00 34.84  ? 415  LEU B C   1 
ATOM   8233  O  O   . LEU B 1 415 ? 52.010 126.112 52.608  1.00 34.65  ? 415  LEU B O   1 
ATOM   8234  C  CB  . LEU B 1 415 ? 50.119 126.610 50.325  1.00 34.12  ? 415  LEU B CB  1 
ATOM   8235  C  CG  . LEU B 1 415 ? 48.741 126.655 49.716  1.00 32.91  ? 415  LEU B CG  1 
ATOM   8236  C  CD1 . LEU B 1 415 ? 48.869 126.073 48.347  1.00 32.69  ? 415  LEU B CD1 1 
ATOM   8237  C  CD2 . LEU B 1 415 ? 47.815 125.835 50.569  1.00 31.86  ? 415  LEU B CD2 1 
ATOM   8238  N  N   . TYR B 1 416 ? 52.951 127.803 51.471  1.00 35.46  ? 416  TYR B N   1 
ATOM   8239  C  CA  . TYR B 1 416 ? 54.292 127.314 51.747  1.00 36.38  ? 416  TYR B CA  1 
ATOM   8240  C  C   . TYR B 1 416 ? 55.292 128.298 52.344  1.00 37.88  ? 416  TYR B C   1 
ATOM   8241  O  O   . TYR B 1 416 ? 56.096 127.917 53.193  1.00 37.77  ? 416  TYR B O   1 
ATOM   8242  C  CB  . TYR B 1 416 ? 54.858 126.705 50.470  1.00 35.83  ? 416  TYR B CB  1 
ATOM   8243  C  CG  . TYR B 1 416 ? 54.091 125.495 50.020  1.00 34.14  ? 416  TYR B CG  1 
ATOM   8244  C  CD1 . TYR B 1 416 ? 54.279 124.280 50.638  1.00 33.46  ? 416  TYR B CD1 1 
ATOM   8245  C  CD2 . TYR B 1 416 ? 53.172 125.570 48.993  1.00 32.74  ? 416  TYR B CD2 1 
ATOM   8246  C  CE1 . TYR B 1 416 ? 53.584 123.173 50.255  1.00 33.06  ? 416  TYR B CE1 1 
ATOM   8247  C  CE2 . TYR B 1 416 ? 52.471 124.461 48.592  1.00 32.31  ? 416  TYR B CE2 1 
ATOM   8248  C  CZ  . TYR B 1 416 ? 52.684 123.262 49.232  1.00 32.58  ? 416  TYR B CZ  1 
ATOM   8249  O  OH  . TYR B 1 416 ? 52.013 122.127 48.861  1.00 32.35  ? 416  TYR B OH  1 
ATOM   8250  N  N   . GLY B 1 417 ? 55.251 129.548 51.894  1.00 39.60  ? 417  GLY B N   1 
ATOM   8251  C  CA  . GLY B 1 417 ? 56.196 130.549 52.344  1.00 42.07  ? 417  GLY B CA  1 
ATOM   8252  C  C   . GLY B 1 417 ? 56.945 131.105 51.155  1.00 44.09  ? 417  GLY B C   1 
ATOM   8253  O  O   . GLY B 1 417 ? 57.246 130.375 50.219  1.00 44.35  ? 417  GLY B O   1 
ATOM   8254  N  N   . ALA B 1 418 ? 57.267 132.393 51.209  1.00 46.19  ? 418  ALA B N   1 
ATOM   8255  C  CA  . ALA B 1 418 ? 57.890 133.105 50.097  1.00 48.29  ? 418  ALA B CA  1 
ATOM   8256  C  C   . ALA B 1 418 ? 59.317 132.713 49.744  1.00 49.97  ? 418  ALA B C   1 
ATOM   8257  O  O   . ALA B 1 418 ? 59.704 132.752 48.571  1.00 50.57  ? 418  ALA B O   1 
ATOM   8258  C  CB  . ALA B 1 418 ? 57.827 134.596 50.344  1.00 48.26  ? 418  ALA B CB  1 
ATOM   8259  N  N   . SER B 1 419 ? 60.123 132.360 50.733  1.00 51.79  ? 419  SER B N   1 
ATOM   8260  C  CA  . SER B 1 419 ? 61.520 132.104 50.411  1.00 53.63  ? 419  SER B CA  1 
ATOM   8261  C  C   . SER B 1 419 ? 62.175 130.957 51.189  1.00 55.07  ? 419  SER B C   1 
ATOM   8262  O  O   . SER B 1 419 ? 61.539 129.939 51.470  1.00 55.27  ? 419  SER B O   1 
ATOM   8263  C  CB  . SER B 1 419 ? 62.321 133.403 50.548  1.00 53.58  ? 419  SER B CB  1 
ATOM   8264  O  OG  . SER B 1 419 ? 61.675 134.483 49.888  1.00 53.70  ? 419  SER B OG  1 
ATOM   8265  N  N   . PRO B 1 420 ? 63.435 131.152 51.563  1.00 56.48  ? 420  PRO B N   1 
ATOM   8266  C  CA  . PRO B 1 420 ? 64.261 130.104 52.176  1.00 57.73  ? 420  PRO B CA  1 
ATOM   8267  C  C   . PRO B 1 420 ? 63.732 129.486 53.462  1.00 59.02  ? 420  PRO B C   1 
ATOM   8268  O  O   . PRO B 1 420 ? 63.225 130.203 54.322  1.00 59.29  ? 420  PRO B O   1 
ATOM   8269  C  CB  . PRO B 1 420 ? 65.562 130.845 52.512  1.00 57.78  ? 420  PRO B CB  1 
ATOM   8270  C  CG  . PRO B 1 420 ? 65.584 132.038 51.632  1.00 57.31  ? 420  PRO B CG  1 
ATOM   8271  C  CD  . PRO B 1 420 ? 64.155 132.432 51.463  1.00 56.74  ? 420  PRO B CD  1 
ATOM   8272  N  N   . ASP B 1 421 ? 63.894 128.170 53.591  1.00 60.60  ? 421  ASP B N   1 
ATOM   8273  C  CA  . ASP B 1 421 ? 63.538 127.437 54.814  1.00 61.92  ? 421  ASP B CA  1 
ATOM   8274  C  C   . ASP B 1 421 ? 62.037 127.305 55.045  1.00 62.12  ? 421  ASP B C   1 
ATOM   8275  O  O   . ASP B 1 421 ? 61.605 126.964 56.149  1.00 62.50  ? 421  ASP B O   1 
ATOM   8276  C  CB  . ASP B 1 421 ? 64.176 128.098 56.039  1.00 62.69  ? 421  ASP B CB  1 
ATOM   8277  C  CG  . ASP B 1 421 ? 65.679 127.885 56.103  1.00 64.91  ? 421  ASP B CG  1 
ATOM   8278  O  OD1 . ASP B 1 421 ? 66.263 127.504 55.058  1.00 66.60  ? 421  ASP B OD1 1 
ATOM   8279  O  OD2 . ASP B 1 421 ? 66.349 128.066 57.157  1.00 66.75  ? 421  ASP B OD2 1 
ATOM   8280  N  N   . THR B 1 429 ? 59.759 148.168 39.219  1.00 81.23  ? 429  THR B N   1 
ATOM   8281  C  CA  . THR B 1 429 ? 58.364 147.940 38.835  1.00 81.33  ? 429  THR B CA  1 
ATOM   8282  C  C   . THR B 1 429 ? 57.691 146.888 39.761  1.00 80.81  ? 429  THR B C   1 
ATOM   8283  O  O   . THR B 1 429 ? 58.201 146.667 40.860  1.00 81.24  ? 429  THR B O   1 
ATOM   8284  C  CB  . THR B 1 429 ? 58.262 147.720 37.284  1.00 81.55  ? 429  THR B CB  1 
ATOM   8285  O  OG1 . THR B 1 429 ? 57.605 148.852 36.689  1.00 82.06  ? 429  THR B OG1 1 
ATOM   8286  C  CG2 . THR B 1 429 ? 57.365 146.572 36.902  1.00 82.00  ? 429  THR B CG2 1 
ATOM   8287  N  N   . PRO B 1 430 ? 56.586 146.247 39.370  1.00 80.07  ? 430  PRO B N   1 
ATOM   8288  C  CA  . PRO B 1 430 ? 55.834 145.381 40.296  1.00 79.36  ? 430  PRO B CA  1 
ATOM   8289  C  C   . PRO B 1 430 ? 56.662 144.465 41.195  1.00 78.45  ? 430  PRO B C   1 
ATOM   8290  O  O   . PRO B 1 430 ? 57.619 143.828 40.735  1.00 78.37  ? 430  PRO B O   1 
ATOM   8291  C  CB  . PRO B 1 430 ? 54.959 144.547 39.364  1.00 79.46  ? 430  PRO B CB  1 
ATOM   8292  C  CG  . PRO B 1 430 ? 54.713 145.440 38.212  1.00 80.01  ? 430  PRO B CG  1 
ATOM   8293  C  CD  . PRO B 1 430 ? 55.980 146.244 38.030  1.00 80.21  ? 430  PRO B CD  1 
ATOM   8294  N  N   . THR B 1 431 ? 56.260 144.400 42.465  1.00 77.18  ? 431  THR B N   1 
ATOM   8295  C  CA  . THR B 1 431 ? 56.949 143.607 43.488  1.00 75.92  ? 431  THR B CA  1 
ATOM   8296  C  C   . THR B 1 431 ? 57.017 142.123 43.147  1.00 74.56  ? 431  THR B C   1 
ATOM   8297  O  O   . THR B 1 431 ? 56.197 141.632 42.376  1.00 74.59  ? 431  THR B O   1 
ATOM   8298  C  CB  . THR B 1 431 ? 56.239 143.752 44.838  1.00 76.18  ? 431  THR B CB  1 
ATOM   8299  O  OG1 . THR B 1 431 ? 56.926 142.965 45.821  1.00 76.47  ? 431  THR B OG1 1 
ATOM   8300  C  CG2 . THR B 1 431 ? 54.861 143.099 44.773  1.00 75.79  ? 431  THR B CG2 1 
ATOM   8301  N  N   . LEU B 1 432 ? 57.975 141.416 43.752  1.00 72.52  ? 432  LEU B N   1 
ATOM   8302  C  CA  . LEU B 1 432 ? 58.172 139.989 43.497  1.00 70.45  ? 432  LEU B CA  1 
ATOM   8303  C  C   . LEU B 1 432 ? 56.980 139.384 42.774  1.00 68.71  ? 432  LEU B C   1 
ATOM   8304  O  O   . LEU B 1 432 ? 56.013 138.982 43.420  1.00 69.00  ? 432  LEU B O   1 
ATOM   8305  C  CB  . LEU B 1 432 ? 58.422 139.213 44.797  1.00 70.61  ? 432  LEU B CB  1 
ATOM   8306  C  CG  . LEU B 1 432 ? 58.755 137.734 44.556  1.00 70.59  ? 432  LEU B CG  1 
ATOM   8307  C  CD1 . LEU B 1 432 ? 59.743 137.623 43.403  1.00 71.40  ? 432  LEU B CD1 1 
ATOM   8308  C  CD2 . LEU B 1 432 ? 59.291 137.001 45.797  1.00 70.36  ? 432  LEU B CD2 1 
ATOM   8309  N  N   . GLY B 1 433 ? 57.056 139.325 41.445  1.00 66.31  ? 433  GLY B N   1 
ATOM   8310  C  CA  . GLY B 1 433 ? 55.982 138.799 40.617  1.00 63.18  ? 433  GLY B CA  1 
ATOM   8311  C  C   . GLY B 1 433 ? 55.186 139.900 39.937  1.00 60.80  ? 433  GLY B C   1 
ATOM   8312  O  O   . GLY B 1 433 ? 54.745 140.841 40.591  1.00 60.93  ? 433  GLY B O   1 
ATOM   8313  N  N   . PRO B 1 434 ? 55.008 139.793 38.623  1.00 58.76  ? 434  PRO B N   1 
ATOM   8314  C  CA  . PRO B 1 434 ? 54.255 140.787 37.847  1.00 57.02  ? 434  PRO B CA  1 
ATOM   8315  C  C   . PRO B 1 434 ? 52.815 140.932 38.318  1.00 55.32  ? 434  PRO B C   1 
ATOM   8316  O  O   . PRO B 1 434 ? 52.349 140.132 39.117  1.00 55.28  ? 434  PRO B O   1 
ATOM   8317  C  CB  . PRO B 1 434 ? 54.269 140.208 36.432  1.00 56.98  ? 434  PRO B CB  1 
ATOM   8318  C  CG  . PRO B 1 434 ? 55.443 139.318 36.404  1.00 57.72  ? 434  PRO B CG  1 
ATOM   8319  C  CD  . PRO B 1 434 ? 55.538 138.717 37.774  1.00 58.60  ? 434  PRO B CD  1 
ATOM   8320  N  N   . VAL B 1 435 ? 52.122 141.952 37.825  1.00 53.29  ? 435  VAL B N   1 
ATOM   8321  C  CA  . VAL B 1 435 ? 50.727 142.181 38.183  1.00 51.26  ? 435  VAL B CA  1 
ATOM   8322  C  C   . VAL B 1 435 ? 49.968 142.735 36.985  1.00 49.97  ? 435  VAL B C   1 
ATOM   8323  O  O   . VAL B 1 435 ? 50.344 143.755 36.412  1.00 49.78  ? 435  VAL B O   1 
ATOM   8324  C  CB  . VAL B 1 435 ? 50.582 143.114 39.401  1.00 51.19  ? 435  VAL B CB  1 
ATOM   8325  C  CG1 . VAL B 1 435 ? 51.706 144.116 39.438  1.00 51.18  ? 435  VAL B CG1 1 
ATOM   8326  C  CG2 . VAL B 1 435 ? 49.232 143.812 39.388  1.00 50.85  ? 435  VAL B CG2 1 
ATOM   8327  N  N   . THR B 1 436 ? 48.896 142.046 36.613  1.00 48.34  ? 436  THR B N   1 
ATOM   8328  C  CA  . THR B 1 436 ? 48.126 142.390 35.427  1.00 46.75  ? 436  THR B CA  1 
ATOM   8329  C  C   . THR B 1 436 ? 47.245 143.618 35.604  1.00 45.73  ? 436  THR B C   1 
ATOM   8330  O  O   . THR B 1 436 ? 46.476 143.720 36.554  1.00 45.53  ? 436  THR B O   1 
ATOM   8331  C  CB  . THR B 1 436 ? 47.301 141.168 34.951  1.00 46.80  ? 436  THR B CB  1 
ATOM   8332  O  OG1 . THR B 1 436 ? 46.095 141.052 35.711  1.00 46.67  ? 436  THR B OG1 1 
ATOM   8333  C  CG2 . THR B 1 436 ? 48.042 139.878 35.267  1.00 46.52  ? 436  THR B CG2 1 
ATOM   8334  N  N   . PRO B 1 437 ? 47.380 144.551 34.672  1.00 44.85  ? 437  PRO B N   1 
ATOM   8335  C  CA  . PRO B 1 437 ? 46.621 145.799 34.668  1.00 44.34  ? 437  PRO B CA  1 
ATOM   8336  C  C   . PRO B 1 437 ? 45.150 145.644 35.004  1.00 43.97  ? 437  PRO B C   1 
ATOM   8337  O  O   . PRO B 1 437 ? 44.613 144.543 35.019  1.00 43.88  ? 437  PRO B O   1 
ATOM   8338  C  CB  . PRO B 1 437 ? 46.758 146.267 33.220  1.00 44.18  ? 437  PRO B CB  1 
ATOM   8339  C  CG  . PRO B 1 437 ? 48.088 145.777 32.804  1.00 44.30  ? 437  PRO B CG  1 
ATOM   8340  C  CD  . PRO B 1 437 ? 48.316 144.480 33.539  1.00 44.77  ? 437  PRO B CD  1 
ATOM   8341  N  N   . GLU B 1 438 ? 44.516 146.777 35.281  1.00 43.76  ? 438  GLU B N   1 
ATOM   8342  C  CA  . GLU B 1 438 ? 43.089 146.856 35.562  1.00 43.44  ? 438  GLU B CA  1 
ATOM   8343  C  C   . GLU B 1 438 ? 42.625 148.227 35.065  1.00 43.36  ? 438  GLU B C   1 
ATOM   8344  O  O   . GLU B 1 438 ? 43.047 149.264 35.576  1.00 43.27  ? 438  GLU B O   1 
ATOM   8345  C  CB  . GLU B 1 438 ? 42.826 146.684 37.048  1.00 43.30  ? 438  GLU B CB  1 
ATOM   8346  C  CG  . GLU B 1 438 ? 41.408 146.264 37.369  1.00 43.34  ? 438  GLU B CG  1 
ATOM   8347  C  CD  . GLU B 1 438 ? 41.284 145.687 38.765  1.00 43.31  ? 438  GLU B CD  1 
ATOM   8348  O  OE1 . GLU B 1 438 ? 42.306 145.216 39.310  1.00 43.31  ? 438  GLU B OE1 1 
ATOM   8349  O  OE2 . GLU B 1 438 ? 40.166 145.701 39.316  1.00 42.82  ? 438  GLU B OE2 1 
ATOM   8350  N  N   . ILE B 1 439 ? 41.755 148.222 34.061  1.00 43.21  ? 439  ILE B N   1 
ATOM   8351  C  CA  . ILE B 1 439 ? 41.377 149.445 33.357  1.00 42.80  ? 439  ILE B CA  1 
ATOM   8352  C  C   . ILE B 1 439 ? 40.590 150.525 34.099  1.00 42.69  ? 439  ILE B C   1 
ATOM   8353  O  O   . ILE B 1 439 ? 41.069 151.656 34.201  1.00 43.04  ? 439  ILE B O   1 
ATOM   8354  C  CB  . ILE B 1 439 ? 40.695 149.110 32.017  1.00 42.77  ? 439  ILE B CB  1 
ATOM   8355  C  CG1 . ILE B 1 439 ? 39.765 147.909 32.181  1.00 42.20  ? 439  ILE B CG1 1 
ATOM   8356  C  CG2 . ILE B 1 439 ? 41.745 148.830 30.956  1.00 42.81  ? 439  ILE B CG2 1 
ATOM   8357  C  CD1 . ILE B 1 439 ? 38.785 147.749 31.054  1.00 41.44  ? 439  ILE B CD1 1 
ATOM   8358  N  N   . CYS B 1 440 ? 39.394 150.229 34.594  1.00 42.16  ? 440  CYS B N   1 
ATOM   8359  C  CA  . CYS B 1 440 ? 38.631 151.315 35.212  1.00 41.74  ? 440  CYS B CA  1 
ATOM   8360  C  C   . CYS B 1 440 ? 38.931 151.529 36.689  1.00 41.41  ? 440  CYS B C   1 
ATOM   8361  O  O   . CYS B 1 440 ? 38.691 152.606 37.223  1.00 41.40  ? 440  CYS B O   1 
ATOM   8362  C  CB  . CYS B 1 440 ? 37.126 151.203 34.934  1.00 41.75  ? 440  CYS B CB  1 
ATOM   8363  S  SG  . CYS B 1 440 ? 36.690 151.632 33.225  1.00 41.78  ? 440  CYS B SG  1 
ATOM   8364  N  N   . LYS B 1 441 ? 39.481 150.512 37.339  1.00 41.08  ? 441  LYS B N   1 
ATOM   8365  C  CA  . LYS B 1 441 ? 39.808 150.615 38.753  1.00 40.77  ? 441  LYS B CA  1 
ATOM   8366  C  C   . LYS B 1 441 ? 41.158 151.284 38.967  1.00 40.54  ? 441  LYS B C   1 
ATOM   8367  O  O   . LYS B 1 441 ? 41.423 151.827 40.039  1.00 40.74  ? 441  LYS B O   1 
ATOM   8368  C  CB  . LYS B 1 441 ? 39.790 149.239 39.424  1.00 40.78  ? 441  LYS B CB  1 
ATOM   8369  C  CG  . LYS B 1 441 ? 38.438 148.549 39.385  1.00 40.90  ? 441  LYS B CG  1 
ATOM   8370  C  CD  . LYS B 1 441 ? 38.451 147.275 40.217  1.00 41.65  ? 441  LYS B CD  1 
ATOM   8371  C  CE  . LYS B 1 441 ? 37.202 146.427 39.983  1.00 41.84  ? 441  LYS B CE  1 
ATOM   8372  N  NZ  . LYS B 1 441 ? 37.287 145.099 40.655  1.00 41.39  ? 441  LYS B NZ  1 
ATOM   8373  N  N   . GLN B 1 442 ? 42.014 151.247 37.953  1.00 40.16  ? 442  GLN B N   1 
ATOM   8374  C  CA  . GLN B 1 442 ? 43.330 151.867 38.068  1.00 39.85  ? 442  GLN B CA  1 
ATOM   8375  C  C   . GLN B 1 442 ? 43.631 152.724 36.850  1.00 39.45  ? 442  GLN B C   1 
ATOM   8376  O  O   . GLN B 1 442 ? 43.492 152.275 35.717  1.00 39.41  ? 442  GLN B O   1 
ATOM   8377  C  CB  . GLN B 1 442 ? 44.428 150.811 38.270  1.00 39.94  ? 442  GLN B CB  1 
ATOM   8378  C  CG  . GLN B 1 442 ? 45.188 150.424 37.009  1.00 40.30  ? 442  GLN B CG  1 
ATOM   8379  C  CD  . GLN B 1 442 ? 46.041 149.169 37.186  1.00 41.16  ? 442  GLN B CD  1 
ATOM   8380  O  OE1 . GLN B 1 442 ? 47.084 149.018 36.537  1.00 41.05  ? 442  GLN B OE1 1 
ATOM   8381  N  NE2 . GLN B 1 442 ? 45.596 148.265 38.056  1.00 41.11  ? 442  GLN B NE2 1 
ATOM   8382  N  N   . ASP B 1 443 ? 44.034 153.967 37.086  1.00 38.99  ? 443  ASP B N   1 
ATOM   8383  C  CA  . ASP B 1 443 ? 44.353 154.863 35.987  1.00 38.45  ? 443  ASP B CA  1 
ATOM   8384  C  C   . ASP B 1 443 ? 45.475 154.271 35.145  1.00 37.93  ? 443  ASP B C   1 
ATOM   8385  O  O   . ASP B 1 443 ? 46.569 154.003 35.645  1.00 37.85  ? 443  ASP B O   1 
ATOM   8386  C  CB  . ASP B 1 443 ? 44.727 156.244 36.513  1.00 38.55  ? 443  ASP B CB  1 
ATOM   8387  C  CG  . ASP B 1 443 ? 43.582 156.908 37.249  1.00 39.09  ? 443  ASP B CG  1 
ATOM   8388  O  OD1 . ASP B 1 443 ? 42.405 156.879 36.834  1.00 39.65  ? 443  ASP B OD1 1 
ATOM   8389  O  OD2 . ASP B 1 443 ? 43.820 157.508 38.319  1.00 39.78  ? 443  ASP B OD2 1 
ATOM   8390  N  N   . ILE B 1 444 ? 45.183 154.048 33.868  1.00 37.24  ? 444  ILE B N   1 
ATOM   8391  C  CA  . ILE B 1 444 ? 46.152 153.470 32.955  1.00 36.72  ? 444  ILE B CA  1 
ATOM   8392  C  C   . ILE B 1 444 ? 46.513 154.416 31.823  1.00 36.45  ? 444  ILE B C   1 
ATOM   8393  O  O   . ILE B 1 444 ? 45.680 155.187 31.349  1.00 36.60  ? 444  ILE B O   1 
ATOM   8394  C  CB  . ILE B 1 444 ? 45.601 152.171 32.347  1.00 36.72  ? 444  ILE B CB  1 
ATOM   8395  C  CG1 . ILE B 1 444 ? 45.456 151.086 33.417  1.00 36.98  ? 444  ILE B CG1 1 
ATOM   8396  C  CG2 . ILE B 1 444 ? 46.514 151.683 31.247  1.00 36.43  ? 444  ILE B CG2 1 
ATOM   8397  C  CD1 . ILE B 1 444 ? 44.873 149.779 32.900  1.00 35.94  ? 444  ILE B CD1 1 
ATOM   8398  N  N   . VAL B 1 445 ? 47.768 154.357 31.396  1.00 35.93  ? 445  VAL B N   1 
ATOM   8399  C  CA  . VAL B 1 445 ? 48.216 155.117 30.241  1.00 35.39  ? 445  VAL B CA  1 
ATOM   8400  C  C   . VAL B 1 445 ? 48.681 154.071 29.234  1.00 34.86  ? 445  VAL B C   1 
ATOM   8401  O  O   . VAL B 1 445 ? 49.780 153.529 29.342  1.00 34.76  ? 445  VAL B O   1 
ATOM   8402  C  CB  . VAL B 1 445 ? 49.328 156.138 30.597  1.00 35.42  ? 445  VAL B CB  1 
ATOM   8403  C  CG1 . VAL B 1 445 ? 50.584 155.436 31.102  1.00 35.89  ? 445  VAL B CG1 1 
ATOM   8404  C  CG2 . VAL B 1 445 ? 49.644 157.026 29.405  1.00 35.32  ? 445  VAL B CG2 1 
ATOM   8405  N  N   . PHE B 1 446 ? 47.814 153.763 28.276  1.00 34.27  ? 446  PHE B N   1 
ATOM   8406  C  CA  . PHE B 1 446 ? 48.083 152.711 27.305  1.00 33.82  ? 446  PHE B CA  1 
ATOM   8407  C  C   . PHE B 1 446 ? 49.340 152.953 26.495  1.00 33.72  ? 446  PHE B C   1 
ATOM   8408  O  O   . PHE B 1 446 ? 50.013 153.967 26.662  1.00 33.78  ? 446  PHE B O   1 
ATOM   8409  C  CB  . PHE B 1 446 ? 46.884 152.508 26.382  1.00 33.69  ? 446  PHE B CB  1 
ATOM   8410  C  CG  . PHE B 1 446 ? 45.625 152.162 27.110  1.00 33.47  ? 446  PHE B CG  1 
ATOM   8411  C  CD1 . PHE B 1 446 ? 45.550 151.016 27.879  1.00 33.53  ? 446  PHE B CD1 1 
ATOM   8412  C  CD2 . PHE B 1 446 ? 44.523 152.991 27.047  1.00 33.52  ? 446  PHE B CD2 1 
ATOM   8413  C  CE1 . PHE B 1 446 ? 44.397 150.697 28.569  1.00 33.24  ? 446  PHE B CE1 1 
ATOM   8414  C  CE2 . PHE B 1 446 ? 43.372 152.679 27.731  1.00 33.61  ? 446  PHE B CE2 1 
ATOM   8415  C  CZ  . PHE B 1 446 ? 43.310 151.526 28.493  1.00 33.55  ? 446  PHE B CZ  1 
ATOM   8416  N  N   . ASP B 1 447 ? 49.652 152.006 25.619  1.00 33.53  ? 447  ASP B N   1 
ATOM   8417  C  CA  . ASP B 1 447 ? 50.828 152.099 24.769  1.00 33.30  ? 447  ASP B CA  1 
ATOM   8418  C  C   . ASP B 1 447 ? 50.403 152.281 23.325  1.00 33.17  ? 447  ASP B C   1 
ATOM   8419  O  O   . ASP B 1 447 ? 51.138 152.830 22.507  1.00 33.11  ? 447  ASP B O   1 
ATOM   8420  C  CB  . ASP B 1 447 ? 51.683 150.851 24.924  1.00 33.28  ? 447  ASP B CB  1 
ATOM   8421  C  CG  . ASP B 1 447 ? 52.203 150.684 26.332  1.00 33.35  ? 447  ASP B CG  1 
ATOM   8422  O  OD1 . ASP B 1 447 ? 52.151 151.597 27.182  1.00 32.81  ? 447  ASP B OD1 1 
ATOM   8423  O  OD2 . ASP B 1 447 ? 52.701 149.587 26.660  1.00 33.90  ? 447  ASP B OD2 1 
ATOM   8424  N  N   . GLY B 1 448 ? 49.198 151.821 23.024  1.00 33.07  ? 448  GLY B N   1 
ATOM   8425  C  CA  . GLY B 1 448 ? 48.641 151.973 21.699  1.00 33.01  ? 448  GLY B CA  1 
ATOM   8426  C  C   . GLY B 1 448 ? 47.165 151.659 21.711  1.00 33.00  ? 448  GLY B C   1 
ATOM   8427  O  O   . GLY B 1 448 ? 46.675 150.967 22.598  1.00 33.04  ? 448  GLY B O   1 
ATOM   8428  N  N   . ILE B 1 449 ? 46.451 152.203 20.737  1.00 33.03  ? 449  ILE B N   1 
ATOM   8429  C  CA  . ILE B 1 449 ? 45.037 151.922 20.551  1.00 33.20  ? 449  ILE B CA  1 
ATOM   8430  C  C   . ILE B 1 449 ? 44.864 151.932 19.053  1.00 33.55  ? 449  ILE B C   1 
ATOM   8431  O  O   . ILE B 1 449 ? 45.602 152.632 18.366  1.00 33.74  ? 449  ILE B O   1 
ATOM   8432  C  CB  . ILE B 1 449 ? 44.152 153.006 21.187  1.00 33.09  ? 449  ILE B CB  1 
ATOM   8433  C  CG1 . ILE B 1 449 ? 44.458 153.155 22.676  1.00 32.55  ? 449  ILE B CG1 1 
ATOM   8434  C  CG2 . ILE B 1 449 ? 42.676 152.682 20.979  1.00 32.92  ? 449  ILE B CG2 1 
ATOM   8435  C  CD1 . ILE B 1 449 ? 43.566 154.128 23.371  1.00 31.47  ? 449  ILE B CD1 1 
ATOM   8436  N  N   . ALA B 1 450 ? 43.917 151.158 18.535  1.00 33.88  ? 450  ALA B N   1 
ATOM   8437  C  CA  . ALA B 1 450 ? 43.711 151.105 17.091  1.00 34.32  ? 450  ALA B CA  1 
ATOM   8438  C  C   . ALA B 1 450 ? 42.620 150.131 16.690  1.00 34.62  ? 450  ALA B C   1 
ATOM   8439  O  O   . ALA B 1 450 ? 42.499 149.050 17.264  1.00 34.82  ? 450  ALA B O   1 
ATOM   8440  C  CB  . ALA B 1 450 ? 45.019 150.761 16.370  1.00 34.22  ? 450  ALA B CB  1 
ATOM   8441  N  N   . GLN B 1 451 ? 41.819 150.522 15.706  1.00 34.93  ? 451  GLN B N   1 
ATOM   8442  C  CA  . GLN B 1 451 ? 40.790 149.641 15.184  1.00 35.26  ? 451  GLN B CA  1 
ATOM   8443  C  C   . GLN B 1 451 ? 41.443 148.696 14.201  1.00 35.36  ? 451  GLN B C   1 
ATOM   8444  O  O   . GLN B 1 451 ? 42.292 149.101 13.411  1.00 35.49  ? 451  GLN B O   1 
ATOM   8445  C  CB  . GLN B 1 451 ? 39.691 150.431 14.476  1.00 35.32  ? 451  GLN B CB  1 
ATOM   8446  C  CG  . GLN B 1 451 ? 38.676 151.056 15.410  1.00 35.85  ? 451  GLN B CG  1 
ATOM   8447  C  CD  . GLN B 1 451 ? 37.427 151.511 14.686  1.00 36.32  ? 451  GLN B CD  1 
ATOM   8448  O  OE1 . GLN B 1 451 ? 37.241 151.201 13.509  1.00 36.44  ? 451  GLN B OE1 1 
ATOM   8449  N  NE2 . GLN B 1 451 ? 36.565 152.246 15.386  1.00 36.53  ? 451  GLN B NE2 1 
ATOM   8450  N  N   . ILE B 1 452 ? 41.051 147.432 14.258  1.00 35.49  ? 452  ILE B N   1 
ATOM   8451  C  CA  . ILE B 1 452 ? 41.584 146.436 13.350  1.00 35.66  ? 452  ILE B CA  1 
ATOM   8452  C  C   . ILE B 1 452 ? 40.443 145.486 13.005  1.00 35.92  ? 452  ILE B C   1 
ATOM   8453  O  O   . ILE B 1 452 ? 40.043 144.657 13.816  1.00 35.99  ? 452  ILE B O   1 
ATOM   8454  C  CB  . ILE B 1 452 ? 42.785 145.716 13.998  1.00 35.57  ? 452  ILE B CB  1 
ATOM   8455  C  CG1 . ILE B 1 452 ? 43.835 145.357 12.949  1.00 35.39  ? 452  ILE B CG1 1 
ATOM   8456  C  CG2 . ILE B 1 452 ? 42.342 144.498 14.775  1.00 35.59  ? 452  ILE B CG2 1 
ATOM   8457  C  CD1 . ILE B 1 452 ? 45.181 145.043 13.550  1.00 35.07  ? 452  ILE B CD1 1 
ATOM   8458  N  N   . ARG B 1 453 ? 39.903 145.641 11.801  1.00 36.24  ? 453  ARG B N   1 
ATOM   8459  C  CA  . ARG B 1 453 ? 38.739 144.875 11.362  1.00 36.49  ? 453  ARG B CA  1 
ATOM   8460  C  C   . ARG B 1 453 ? 37.582 144.985 12.356  1.00 36.55  ? 453  ARG B C   1 
ATOM   8461  O  O   . ARG B 1 453 ? 37.227 144.011 13.021  1.00 36.53  ? 453  ARG B O   1 
ATOM   8462  C  CB  . ARG B 1 453 ? 39.081 143.402 11.115  1.00 36.56  ? 453  ARG B CB  1 
ATOM   8463  C  CG  . ARG B 1 453 ? 37.897 142.589 10.586  1.00 36.99  ? 453  ARG B CG  1 
ATOM   8464  C  CD  . ARG B 1 453 ? 36.848 142.245 11.644  1.00 37.58  ? 453  ARG B CD  1 
ATOM   8465  N  NE  . ARG B 1 453 ? 35.521 142.752 11.292  1.00 38.02  ? 453  ARG B NE  1 
ATOM   8466  C  CZ  . ARG B 1 453 ? 34.380 142.168 11.635  1.00 38.25  ? 453  ARG B CZ  1 
ATOM   8467  N  NH1 . ARG B 1 453 ? 34.391 141.045 12.339  1.00 38.52  ? 453  ARG B NH1 1 
ATOM   8468  N  NH2 . ARG B 1 453 ? 33.223 142.705 11.271  1.00 38.21  ? 453  ARG B NH2 1 
ATOM   8469  N  N   . GLY B 1 454 ? 37.007 146.178 12.467  1.00 36.61  ? 454  GLY B N   1 
ATOM   8470  C  CA  . GLY B 1 454 ? 35.860 146.390 13.333  1.00 36.64  ? 454  GLY B CA  1 
ATOM   8471  C  C   . GLY B 1 454 ? 36.121 146.418 14.829  1.00 36.63  ? 454  GLY B C   1 
ATOM   8472  O  O   . GLY B 1 454 ? 35.359 147.025 15.580  1.00 36.60  ? 454  GLY B O   1 
ATOM   8473  N  N   . GLU B 1 455 ? 37.184 145.764 15.279  1.00 36.65  ? 455  GLU B N   1 
ATOM   8474  C  CA  . GLU B 1 455 ? 37.469 145.744 16.708  1.00 36.75  ? 455  GLU B CA  1 
ATOM   8475  C  C   . GLU B 1 455 ? 38.587 146.691 17.130  1.00 36.79  ? 455  GLU B C   1 
ATOM   8476  O  O   . GLU B 1 455 ? 39.641 146.757 16.498  1.00 36.93  ? 455  GLU B O   1 
ATOM   8477  C  CB  . GLU B 1 455 ? 37.731 144.318 17.211  1.00 36.75  ? 455  GLU B CB  1 
ATOM   8478  C  CG  . GLU B 1 455 ? 38.432 143.396 16.229  1.00 36.77  ? 455  GLU B CG  1 
ATOM   8479  C  CD  . GLU B 1 455 ? 38.752 142.047 16.842  1.00 36.88  ? 455  GLU B CD  1 
ATOM   8480  O  OE1 . GLU B 1 455 ? 38.733 141.950 18.088  1.00 36.87  ? 455  GLU B OE1 1 
ATOM   8481  O  OE2 . GLU B 1 455 ? 39.024 141.087 16.087  1.00 36.74  ? 455  GLU B OE2 1 
ATOM   8482  N  N   . ILE B 1 456 ? 38.325 147.430 18.203  1.00 36.73  ? 456  ILE B N   1 
ATOM   8483  C  CA  . ILE B 1 456 ? 39.269 148.387 18.761  1.00 36.64  ? 456  ILE B CA  1 
ATOM   8484  C  C   . ILE B 1 456 ? 40.125 147.692 19.806  1.00 36.55  ? 456  ILE B C   1 
ATOM   8485  O  O   . ILE B 1 456 ? 39.592 147.096 20.738  1.00 36.58  ? 456  ILE B O   1 
ATOM   8486  C  CB  . ILE B 1 456 ? 38.490 149.531 19.427  1.00 36.65  ? 456  ILE B CB  1 
ATOM   8487  C  CG1 . ILE B 1 456 ? 37.492 150.134 18.437  1.00 36.60  ? 456  ILE B CG1 1 
ATOM   8488  C  CG2 . ILE B 1 456 ? 39.443 150.582 19.970  1.00 36.76  ? 456  ILE B CG2 1 
ATOM   8489  C  CD1 . ILE B 1 456 ? 36.354 150.880 19.089  1.00 36.70  ? 456  ILE B CD1 1 
ATOM   8490  N  N   . PHE B 1 457 ? 41.445 147.763 19.659  1.00 36.41  ? 457  PHE B N   1 
ATOM   8491  C  CA  . PHE B 1 457 ? 42.336 147.138 20.634  1.00 36.45  ? 457  PHE B CA  1 
ATOM   8492  C  C   . PHE B 1 457 ? 43.063 148.162 21.511  1.00 36.49  ? 457  PHE B C   1 
ATOM   8493  O  O   . PHE B 1 457 ? 43.492 149.210 21.028  1.00 36.63  ? 457  PHE B O   1 
ATOM   8494  C  CB  . PHE B 1 457 ? 43.335 146.200 19.951  1.00 36.35  ? 457  PHE B CB  1 
ATOM   8495  C  CG  . PHE B 1 457 ? 42.729 144.902 19.485  1.00 36.70  ? 457  PHE B CG  1 
ATOM   8496  C  CD1 . PHE B 1 457 ? 42.129 144.807 18.239  1.00 36.66  ? 457  PHE B CD1 1 
ATOM   8497  C  CD2 . PHE B 1 457 ? 42.758 143.774 20.294  1.00 37.11  ? 457  PHE B CD2 1 
ATOM   8498  C  CE1 . PHE B 1 457 ? 41.571 143.617 17.810  1.00 36.25  ? 457  PHE B CE1 1 
ATOM   8499  C  CE2 . PHE B 1 457 ? 42.200 142.577 19.866  1.00 36.63  ? 457  PHE B CE2 1 
ATOM   8500  C  CZ  . PHE B 1 457 ? 41.607 142.503 18.624  1.00 36.45  ? 457  PHE B CZ  1 
ATOM   8501  N  N   . PHE B 1 458 ? 43.182 147.851 22.801  1.00 36.33  ? 458  PHE B N   1 
ATOM   8502  C  CA  . PHE B 1 458 ? 43.854 148.708 23.771  1.00 36.07  ? 458  PHE B CA  1 
ATOM   8503  C  C   . PHE B 1 458 ? 45.086 148.007 24.324  1.00 36.15  ? 458  PHE B C   1 
ATOM   8504  O  O   . PHE B 1 458 ? 44.972 147.016 25.041  1.00 36.01  ? 458  PHE B O   1 
ATOM   8505  C  CB  . PHE B 1 458 ? 42.915 149.015 24.927  1.00 36.10  ? 458  PHE B CB  1 
ATOM   8506  C  CG  . PHE B 1 458 ? 41.882 150.047 24.610  1.00 35.75  ? 458  PHE B CG  1 
ATOM   8507  C  CD1 . PHE B 1 458 ? 40.804 149.741 23.802  1.00 35.55  ? 458  PHE B CD1 1 
ATOM   8508  C  CD2 . PHE B 1 458 ? 41.988 151.322 25.125  1.00 35.00  ? 458  PHE B CD2 1 
ATOM   8509  C  CE1 . PHE B 1 458 ? 39.855 150.688 23.514  1.00 35.15  ? 458  PHE B CE1 1 
ATOM   8510  C  CE2 . PHE B 1 458 ? 41.046 152.270 24.840  1.00 34.90  ? 458  PHE B CE2 1 
ATOM   8511  C  CZ  . PHE B 1 458 ? 39.975 151.954 24.034  1.00 35.18  ? 458  PHE B CZ  1 
ATOM   8512  N  N   . PHE B 1 459 ? 46.264 148.541 24.027  1.00 36.26  ? 459  PHE B N   1 
ATOM   8513  C  CA  . PHE B 1 459 ? 47.500 147.882 24.433  1.00 36.51  ? 459  PHE B CA  1 
ATOM   8514  C  C   . PHE B 1 459 ? 48.128 148.351 25.740  1.00 36.82  ? 459  PHE B C   1 
ATOM   8515  O  O   . PHE B 1 459 ? 47.860 149.442 26.232  1.00 37.06  ? 459  PHE B O   1 
ATOM   8516  C  CB  . PHE B 1 459 ? 48.539 147.962 23.310  1.00 36.47  ? 459  PHE B CB  1 
ATOM   8517  C  CG  . PHE B 1 459 ? 48.219 147.095 22.135  1.00 35.96  ? 459  PHE B CG  1 
ATOM   8518  C  CD1 . PHE B 1 459 ? 47.080 147.323 21.385  1.00 35.46  ? 459  PHE B CD1 1 
ATOM   8519  C  CD2 . PHE B 1 459 ? 49.041 146.043 21.790  1.00 35.59  ? 459  PHE B CD2 1 
ATOM   8520  C  CE1 . PHE B 1 459 ? 46.772 146.530 20.312  1.00 35.14  ? 459  PHE B CE1 1 
ATOM   8521  C  CE2 . PHE B 1 459 ? 48.738 145.243 20.712  1.00 35.56  ? 459  PHE B CE2 1 
ATOM   8522  C  CZ  . PHE B 1 459 ? 47.601 145.489 19.971  1.00 35.41  ? 459  PHE B CZ  1 
ATOM   8523  N  N   . LYS B 1 460 ? 48.970 147.484 26.284  1.00 37.15  ? 460  LYS B N   1 
ATOM   8524  C  CA  . LYS B 1 460 ? 49.760 147.745 27.474  1.00 37.49  ? 460  LYS B CA  1 
ATOM   8525  C  C   . LYS B 1 460 ? 50.633 146.525 27.704  1.00 37.92  ? 460  LYS B C   1 
ATOM   8526  O  O   . LYS B 1 460 ? 50.254 145.405 27.352  1.00 38.23  ? 460  LYS B O   1 
ATOM   8527  C  CB  . LYS B 1 460 ? 48.896 148.014 28.698  1.00 37.36  ? 460  LYS B CB  1 
ATOM   8528  C  CG  . LYS B 1 460 ? 49.734 148.206 29.951  1.00 37.36  ? 460  LYS B CG  1 
ATOM   8529  C  CD  . LYS B 1 460 ? 49.349 149.471 30.712  1.00 36.57  ? 460  LYS B CD  1 
ATOM   8530  C  CE  . LYS B 1 460 ? 50.573 150.132 31.361  1.00 36.21  ? 460  LYS B CE  1 
ATOM   8531  N  NZ  . LYS B 1 460 ? 51.303 151.068 30.445  1.00 35.15  ? 460  LYS B NZ  1 
ATOM   8532  N  N   . ASP B 1 461 ? 51.813 146.738 28.271  1.00 38.17  ? 461  ASP B N   1 
ATOM   8533  C  CA  . ASP B 1 461 ? 52.737 145.639 28.504  1.00 38.34  ? 461  ASP B CA  1 
ATOM   8534  C  C   . ASP B 1 461 ? 51.995 144.404 28.981  1.00 38.30  ? 461  ASP B C   1 
ATOM   8535  O  O   . ASP B 1 461 ? 51.291 144.452 29.989  1.00 38.58  ? 461  ASP B O   1 
ATOM   8536  C  CB  . ASP B 1 461 ? 53.776 146.045 29.543  1.00 38.46  ? 461  ASP B CB  1 
ATOM   8537  C  CG  . ASP B 1 461 ? 53.198 146.945 30.610  1.00 38.40  ? 461  ASP B CG  1 
ATOM   8538  O  OD1 . ASP B 1 461 ? 52.376 146.549 31.465  1.00 37.34  ? 461  ASP B OD1 1 
ATOM   8539  O  OD2 . ASP B 1 461 ? 53.556 148.144 30.617  1.00 39.12  ? 461  ASP B OD2 1 
ATOM   8540  N  N   . ARG B 1 462 ? 52.131 143.313 28.238  1.00 38.02  ? 462  ARG B N   1 
ATOM   8541  C  CA  . ARG B 1 462 ? 51.543 142.038 28.633  1.00 37.94  ? 462  ARG B CA  1 
ATOM   8542  C  C   . ARG B 1 462 ? 50.016 141.966 28.586  1.00 37.65  ? 462  ARG B C   1 
ATOM   8543  O  O   . ARG B 1 462 ? 49.460 141.120 29.285  1.00 37.91  ? 462  ARG B O   1 
ATOM   8544  C  CB  . ARG B 1 462 ? 51.962 141.681 30.073  1.00 38.08  ? 462  ARG B CB  1 
ATOM   8545  C  CG  . ARG B 1 462 ? 53.427 141.342 30.317  1.00 38.50  ? 462  ARG B CG  1 
ATOM   8546  C  CD  . ARG B 1 462 ? 53.691 139.891 30.721  1.00 38.56  ? 462  ARG B CD  1 
ATOM   8547  N  NE  . ARG B 1 462 ? 52.744 139.402 31.721  1.00 39.40  ? 462  ARG B NE  1 
ATOM   8548  C  CZ  . ARG B 1 462 ? 52.850 138.229 32.339  1.00 40.21  ? 462  ARG B CZ  1 
ATOM   8549  N  NH1 . ARG B 1 462 ? 53.868 137.430 32.065  1.00 41.07  ? 462  ARG B NH1 1 
ATOM   8550  N  NH2 . ARG B 1 462 ? 51.942 137.848 33.232  1.00 40.52  ? 462  ARG B NH2 1 
ATOM   8551  N  N   . PHE B 1 463 ? 49.326 142.810 27.810  1.00 37.03  ? 463  PHE B N   1 
ATOM   8552  C  CA  . PHE B 1 463 ? 47.845 142.758 27.804  1.00 36.31  ? 463  PHE B CA  1 
ATOM   8553  C  C   . PHE B 1 463 ? 47.126 143.618 26.751  1.00 35.97  ? 463  PHE B C   1 
ATOM   8554  O  O   . PHE B 1 463 ? 47.554 144.732 26.465  1.00 36.12  ? 463  PHE B O   1 
ATOM   8555  C  CB  . PHE B 1 463 ? 47.308 143.089 29.210  1.00 36.12  ? 463  PHE B CB  1 
ATOM   8556  C  CG  . PHE B 1 463 ? 47.974 142.304 30.300  1.00 35.44  ? 463  PHE B CG  1 
ATOM   8557  C  CD1 . PHE B 1 463 ? 49.138 142.766 30.880  1.00 34.60  ? 463  PHE B CD1 1 
ATOM   8558  C  CD2 . PHE B 1 463 ? 47.470 141.078 30.707  1.00 35.22  ? 463  PHE B CD2 1 
ATOM   8559  C  CE1 . PHE B 1 463 ? 49.787 142.029 31.856  1.00 34.69  ? 463  PHE B CE1 1 
ATOM   8560  C  CE2 . PHE B 1 463 ? 48.113 140.339 31.684  1.00 34.82  ? 463  PHE B CE2 1 
ATOM   8561  C  CZ  . PHE B 1 463 ? 49.275 140.818 32.258  1.00 34.47  ? 463  PHE B CZ  1 
ATOM   8562  N  N   . ILE B 1 464 ? 46.026 143.108 26.193  1.00 35.39  ? 464  ILE B N   1 
ATOM   8563  C  CA  . ILE B 1 464 ? 45.233 143.865 25.213  1.00 35.02  ? 464  ILE B CA  1 
ATOM   8564  C  C   . ILE B 1 464 ? 43.726 143.821 25.474  1.00 34.80  ? 464  ILE B C   1 
ATOM   8565  O  O   . ILE B 1 464 ? 43.148 142.752 25.633  1.00 34.92  ? 464  ILE B O   1 
ATOM   8566  C  CB  . ILE B 1 464 ? 45.494 143.367 23.784  1.00 34.94  ? 464  ILE B CB  1 
ATOM   8567  C  CG1 . ILE B 1 464 ? 45.582 141.844 23.755  1.00 35.09  ? 464  ILE B CG1 1 
ATOM   8568  C  CG2 . ILE B 1 464 ? 46.756 143.978 23.229  1.00 35.19  ? 464  ILE B CG2 1 
ATOM   8569  C  CD1 . ILE B 1 464 ? 44.278 141.166 23.412  1.00 35.05  ? 464  ILE B CD1 1 
ATOM   8570  N  N   . TRP B 1 465 ? 43.087 144.983 25.502  1.00 34.57  ? 465  TRP B N   1 
ATOM   8571  C  CA  . TRP B 1 465 ? 41.642 145.048 25.695  1.00 34.23  ? 465  TRP B CA  1 
ATOM   8572  C  C   . TRP B 1 465 ? 40.960 145.324 24.364  1.00 34.54  ? 465  TRP B C   1 
ATOM   8573  O  O   . TRP B 1 465 ? 41.312 146.271 23.666  1.00 34.57  ? 465  TRP B O   1 
ATOM   8574  C  CB  . TRP B 1 465 ? 41.279 146.137 26.698  1.00 33.93  ? 465  TRP B CB  1 
ATOM   8575  C  CG  . TRP B 1 465 ? 41.712 145.837 28.079  1.00 32.40  ? 465  TRP B CG  1 
ATOM   8576  C  CD1 . TRP B 1 465 ? 40.946 145.336 29.076  1.00 31.52  ? 465  TRP B CD1 1 
ATOM   8577  C  CD2 . TRP B 1 465 ? 43.023 146.017 28.629  1.00 31.29  ? 465  TRP B CD2 1 
ATOM   8578  N  NE1 . TRP B 1 465 ? 41.694 145.191 30.219  1.00 31.65  ? 465  TRP B NE1 1 
ATOM   8579  C  CE2 . TRP B 1 465 ? 42.975 145.603 29.969  1.00 30.75  ? 465  TRP B CE2 1 
ATOM   8580  C  CE3 . TRP B 1 465 ? 44.236 146.490 28.122  1.00 30.72  ? 465  TRP B CE3 1 
ATOM   8581  C  CZ2 . TRP B 1 465 ? 44.083 145.645 30.805  1.00 29.69  ? 465  TRP B CZ2 1 
ATOM   8582  C  CZ3 . TRP B 1 465 ? 45.332 146.533 28.955  1.00 29.80  ? 465  TRP B CZ3 1 
ATOM   8583  C  CH2 . TRP B 1 465 ? 45.249 146.113 30.279  1.00 29.31  ? 465  TRP B CH2 1 
ATOM   8584  N  N   . ARG B 1 466 ? 39.974 144.503 24.023  1.00 34.80  ? 466  ARG B N   1 
ATOM   8585  C  CA  . ARG B 1 466 ? 39.285 144.634 22.745  1.00 35.12  ? 466  ARG B CA  1 
ATOM   8586  C  C   . ARG B 1 466 ? 37.796 144.919 22.907  1.00 35.31  ? 466  ARG B C   1 
ATOM   8587  O  O   . ARG B 1 466 ? 37.130 144.342 23.768  1.00 35.31  ? 466  ARG B O   1 
ATOM   8588  C  CB  . ARG B 1 466 ? 39.487 143.367 21.915  1.00 35.10  ? 466  ARG B CB  1 
ATOM   8589  C  CG  . ARG B 1 466 ? 39.107 142.103 22.652  1.00 35.41  ? 466  ARG B CG  1 
ATOM   8590  C  CD  . ARG B 1 466 ? 40.014 140.913 22.373  1.00 35.91  ? 466  ARG B CD  1 
ATOM   8591  N  NE  . ARG B 1 466 ? 39.520 140.075 21.288  1.00 36.47  ? 466  ARG B NE  1 
ATOM   8592  C  CZ  . ARG B 1 466 ? 38.376 139.404 21.324  1.00 36.43  ? 466  ARG B CZ  1 
ATOM   8593  N  NH1 . ARG B 1 466 ? 37.591 139.473 22.394  1.00 36.34  ? 466  ARG B NH1 1 
ATOM   8594  N  NH2 . ARG B 1 466 ? 38.013 138.664 20.286  1.00 36.12  ? 466  ARG B NH2 1 
ATOM   8595  N  N   . THR B 1 467 ? 37.279 145.805 22.061  1.00 35.52  ? 467  THR B N   1 
ATOM   8596  C  CA  . THR B 1 467 ? 35.870 146.168 22.105  1.00 35.71  ? 467  THR B CA  1 
ATOM   8597  C  C   . THR B 1 467 ? 35.351 146.495 20.712  1.00 35.83  ? 467  THR B C   1 
ATOM   8598  O  O   . THR B 1 467 ? 36.110 146.926 19.844  1.00 35.82  ? 467  THR B O   1 
ATOM   8599  C  CB  . THR B 1 467 ? 35.659 147.366 23.049  1.00 35.69  ? 467  THR B CB  1 
ATOM   8600  O  OG1 . THR B 1 467 ? 34.293 147.791 22.989  1.00 35.69  ? 467  THR B OG1 1 
ATOM   8601  C  CG2 . THR B 1 467 ? 36.429 148.575 22.551  1.00 35.89  ? 467  THR B CG2 1 
ATOM   8602  N  N   . VAL B 1 468 ? 34.057 146.276 20.502  1.00 36.07  ? 468  VAL B N   1 
ATOM   8603  C  CA  . VAL B 1 468 ? 33.423 146.571 19.220  1.00 36.25  ? 468  VAL B CA  1 
ATOM   8604  C  C   . VAL B 1 468 ? 32.699 147.910 19.298  1.00 36.46  ? 468  VAL B C   1 
ATOM   8605  O  O   . VAL B 1 468 ? 32.833 148.753 18.413  1.00 36.48  ? 468  VAL B O   1 
ATOM   8606  C  CB  . VAL B 1 468 ? 32.437 145.462 18.794  1.00 36.18  ? 468  VAL B CB  1 
ATOM   8607  C  CG1 . VAL B 1 468 ? 31.352 145.265 19.844  1.00 36.14  ? 468  VAL B CG1 1 
ATOM   8608  C  CG2 . VAL B 1 468 ? 31.828 145.782 17.444  1.00 36.07  ? 468  VAL B CG2 1 
ATOM   8609  N  N   . THR B 1 469 ? 31.944 148.103 20.374  1.00 36.75  ? 469  THR B N   1 
ATOM   8610  C  CA  . THR B 1 469 ? 31.221 149.349 20.592  1.00 37.02  ? 469  THR B CA  1 
ATOM   8611  C  C   . THR B 1 469 ? 31.224 149.724 22.079  1.00 37.22  ? 469  THR B C   1 
ATOM   8612  O  O   . THR B 1 469 ? 30.862 148.916 22.934  1.00 37.20  ? 469  THR B O   1 
ATOM   8613  C  CB  . THR B 1 469 ? 29.789 149.240 20.037  1.00 37.01  ? 469  THR B CB  1 
ATOM   8614  O  OG1 . THR B 1 469 ? 29.052 150.423 20.371  1.00 37.05  ? 469  THR B OG1 1 
ATOM   8615  C  CG2 . THR B 1 469 ? 29.025 148.117 20.729  1.00 36.95  ? 469  THR B CG2 1 
ATOM   8616  N  N   . PRO B 1 470 ? 31.642 150.952 22.378  1.00 37.39  ? 470  PRO B N   1 
ATOM   8617  C  CA  . PRO B 1 470 ? 31.761 151.440 23.760  1.00 37.51  ? 470  PRO B CA  1 
ATOM   8618  C  C   . PRO B 1 470 ? 30.584 151.107 24.682  1.00 37.67  ? 470  PRO B C   1 
ATOM   8619  O  O   . PRO B 1 470 ? 30.779 151.088 25.898  1.00 37.68  ? 470  PRO B O   1 
ATOM   8620  C  CB  . PRO B 1 470 ? 31.875 152.954 23.578  1.00 37.51  ? 470  PRO B CB  1 
ATOM   8621  C  CG  . PRO B 1 470 ? 32.539 153.109 22.250  1.00 37.50  ? 470  PRO B CG  1 
ATOM   8622  C  CD  . PRO B 1 470 ? 32.036 151.976 21.393  1.00 37.39  ? 470  PRO B CD  1 
ATOM   8623  N  N   . ARG B 1 471 ? 29.400 150.862 24.123  1.00 37.88  ? 471  ARG B N   1 
ATOM   8624  C  CA  . ARG B 1 471 ? 28.233 150.483 24.918  1.00 38.06  ? 471  ARG B CA  1 
ATOM   8625  C  C   . ARG B 1 471 ? 28.647 149.340 25.822  1.00 38.16  ? 471  ARG B C   1 
ATOM   8626  O  O   . ARG B 1 471 ? 28.730 149.491 27.042  1.00 38.26  ? 471  ARG B O   1 
ATOM   8627  C  CB  . ARG B 1 471 ? 27.103 150.007 24.011  1.00 38.07  ? 471  ARG B CB  1 
ATOM   8628  C  CG  . ARG B 1 471 ? 26.938 150.818 22.745  1.00 38.06  ? 471  ARG B CG  1 
ATOM   8629  C  CD  . ARG B 1 471 ? 26.727 149.971 21.501  1.00 37.96  ? 471  ARG B CD  1 
ATOM   8630  N  NE  . ARG B 1 471 ? 25.603 149.052 21.622  1.00 37.94  ? 471  ARG B NE  1 
ATOM   8631  C  CZ  . ARG B 1 471 ? 24.432 149.247 21.038  1.00 37.91  ? 471  ARG B CZ  1 
ATOM   8632  N  NH1 . ARG B 1 471 ? 24.239 150.328 20.296  1.00 38.01  ? 471  ARG B NH1 1 
ATOM   8633  N  NH2 . ARG B 1 471 ? 23.452 148.368 21.192  1.00 37.86  ? 471  ARG B NH2 1 
ATOM   8634  N  N   . ASP B 1 472 ? 28.892 148.184 25.216  1.00 38.23  ? 472  ASP B N   1 
ATOM   8635  C  CA  . ASP B 1 472 ? 29.441 147.067 25.958  1.00 38.34  ? 472  ASP B CA  1 
ATOM   8636  C  C   . ASP B 1 472 ? 30.850 147.502 26.344  1.00 38.27  ? 472  ASP B C   1 
ATOM   8637  O  O   . ASP B 1 472 ? 31.400 148.431 25.754  1.00 38.27  ? 472  ASP B O   1 
ATOM   8638  C  CB  . ASP B 1 472 ? 29.461 145.788 25.111  1.00 38.45  ? 472  ASP B CB  1 
ATOM   8639  C  CG  . ASP B 1 472 ? 29.835 146.044 23.657  1.00 38.63  ? 472  ASP B CG  1 
ATOM   8640  O  OD1 . ASP B 1 472 ? 30.845 146.735 23.405  1.00 38.75  ? 472  ASP B OD1 1 
ATOM   8641  O  OD2 . ASP B 1 472 ? 29.180 145.581 22.698  1.00 38.57  ? 472  ASP B OD2 1 
ATOM   8642  N  N   . LYS B 1 473 ? 31.434 146.859 27.342  1.00 38.17  ? 473  LYS B N   1 
ATOM   8643  C  CA  . LYS B 1 473 ? 32.770 147.244 27.766  1.00 38.02  ? 473  LYS B CA  1 
ATOM   8644  C  C   . LYS B 1 473 ? 33.791 146.426 26.986  1.00 38.04  ? 473  LYS B C   1 
ATOM   8645  O  O   . LYS B 1 473 ? 33.422 145.482 26.288  1.00 38.05  ? 473  LYS B O   1 
ATOM   8646  C  CB  . LYS B 1 473 ? 32.926 147.032 29.274  1.00 37.96  ? 473  LYS B CB  1 
ATOM   8647  C  CG  . LYS B 1 473 ? 34.022 147.871 29.910  1.00 37.28  ? 473  LYS B CG  1 
ATOM   8648  C  CD  . LYS B 1 473 ? 33.997 147.772 31.421  1.00 36.19  ? 473  LYS B CD  1 
ATOM   8649  C  CE  . LYS B 1 473 ? 35.194 148.474 32.033  1.00 35.37  ? 473  LYS B CE  1 
ATOM   8650  N  NZ  . LYS B 1 473 ? 35.263 148.254 33.500  1.00 34.93  ? 473  LYS B NZ  1 
ATOM   8651  N  N   . PRO B 1 474 ? 35.063 146.803 27.068  1.00 38.02  ? 474  PRO B N   1 
ATOM   8652  C  CA  . PRO B 1 474 ? 36.125 146.020 26.440  1.00 38.10  ? 474  PRO B CA  1 
ATOM   8653  C  C   . PRO B 1 474 ? 36.101 144.611 27.024  1.00 38.06  ? 474  PRO B C   1 
ATOM   8654  O  O   . PRO B 1 474 ? 35.829 144.469 28.216  1.00 38.28  ? 474  PRO B O   1 
ATOM   8655  C  CB  . PRO B 1 474 ? 37.394 146.757 26.867  1.00 38.13  ? 474  PRO B CB  1 
ATOM   8656  C  CG  . PRO B 1 474 ? 36.952 148.138 27.117  1.00 38.10  ? 474  PRO B CG  1 
ATOM   8657  C  CD  . PRO B 1 474 ? 35.589 148.006 27.730  1.00 38.13  ? 474  PRO B CD  1 
ATOM   8658  N  N   . MET B 1 475 ? 36.379 143.598 26.208  1.00 37.75  ? 475  MET B N   1 
ATOM   8659  C  CA  . MET B 1 475 ? 36.297 142.211 26.650  1.00 37.44  ? 475  MET B CA  1 
ATOM   8660  C  C   . MET B 1 475 ? 37.522 141.705 27.406  1.00 37.07  ? 475  MET B C   1 
ATOM   8661  O  O   . MET B 1 475 ? 37.506 140.592 27.916  1.00 37.55  ? 475  MET B O   1 
ATOM   8662  C  CB  . MET B 1 475 ? 36.050 141.290 25.450  1.00 37.61  ? 475  MET B CB  1 
ATOM   8663  C  CG  . MET B 1 475 ? 34.723 141.504 24.740  1.00 37.95  ? 475  MET B CG  1 
ATOM   8664  S  SD  . MET B 1 475 ? 33.484 140.238 25.105  1.00 38.19  ? 475  MET B SD  1 
ATOM   8665  C  CE  . MET B 1 475 ? 32.096 140.850 24.133  1.00 37.82  ? 475  MET B CE  1 
ATOM   8666  N  N   . GLY B 1 476 ? 38.582 142.496 27.481  1.00 36.34  ? 476  GLY B N   1 
ATOM   8667  C  CA  . GLY B 1 476 ? 39.804 142.025 28.116  1.00 35.66  ? 476  GLY B CA  1 
ATOM   8668  C  C   . GLY B 1 476 ? 39.758 141.877 29.626  1.00 35.11  ? 476  GLY B C   1 
ATOM   8669  O  O   . GLY B 1 476 ? 38.687 141.959 30.226  1.00 34.98  ? 476  GLY B O   1 
ATOM   8670  N  N   . PRO B 1 477 ? 40.921 141.669 30.247  1.00 34.70  ? 477  PRO B N   1 
ATOM   8671  C  CA  . PRO B 1 477 ? 42.201 141.563 29.545  1.00 34.50  ? 477  PRO B CA  1 
ATOM   8672  C  C   . PRO B 1 477 ? 42.458 140.207 28.902  1.00 34.50  ? 477  PRO B C   1 
ATOM   8673  O  O   . PRO B 1 477 ? 41.830 139.201 29.233  1.00 34.66  ? 477  PRO B O   1 
ATOM   8674  C  CB  . PRO B 1 477 ? 43.230 141.761 30.664  1.00 34.27  ? 477  PRO B CB  1 
ATOM   8675  C  CG  . PRO B 1 477 ? 42.470 142.191 31.824  1.00 34.42  ? 477  PRO B CG  1 
ATOM   8676  C  CD  . PRO B 1 477 ? 41.106 141.581 31.699  1.00 34.82  ? 477  PRO B CD  1 
ATOM   8677  N  N   . LEU B 1 478 ? 43.400 140.209 27.969  1.00 34.30  ? 478  LEU B N   1 
ATOM   8678  C  CA  . LEU B 1 478 ? 43.863 139.012 27.296  1.00 34.09  ? 478  LEU B CA  1 
ATOM   8679  C  C   . LEU B 1 478 ? 45.314 139.296 26.986  1.00 34.09  ? 478  LEU B C   1 
ATOM   8680  O  O   . LEU B 1 478 ? 45.699 140.456 26.830  1.00 34.08  ? 478  LEU B O   1 
ATOM   8681  C  CB  . LEU B 1 478 ? 43.085 138.758 26.008  1.00 34.10  ? 478  LEU B CB  1 
ATOM   8682  C  CG  . LEU B 1 478 ? 41.734 138.044 26.130  1.00 33.92  ? 478  LEU B CG  1 
ATOM   8683  C  CD1 . LEU B 1 478 ? 41.069 137.867 24.764  1.00 33.47  ? 478  LEU B CD1 1 
ATOM   8684  C  CD2 . LEU B 1 478 ? 41.890 136.709 26.820  1.00 33.05  ? 478  LEU B CD2 1 
ATOM   8685  N  N   . LEU B 1 479 ? 46.130 138.253 26.932  1.00 34.01  ? 479  LEU B N   1 
ATOM   8686  C  CA  . LEU B 1 479 ? 47.541 138.439 26.643  1.00 33.99  ? 479  LEU B CA  1 
ATOM   8687  C  C   . LEU B 1 479 ? 47.666 138.781 25.174  1.00 34.05  ? 479  LEU B C   1 
ATOM   8688  O  O   . LEU B 1 479 ? 46.857 138.329 24.365  1.00 34.19  ? 479  LEU B O   1 
ATOM   8689  C  CB  . LEU B 1 479 ? 48.327 137.166 26.956  1.00 33.98  ? 479  LEU B CB  1 
ATOM   8690  C  CG  . LEU B 1 479 ? 48.190 136.606 28.375  1.00 33.92  ? 479  LEU B CG  1 
ATOM   8691  C  CD1 . LEU B 1 479 ? 48.711 135.201 28.442  1.00 33.83  ? 479  LEU B CD1 1 
ATOM   8692  C  CD2 . LEU B 1 479 ? 48.925 137.474 29.375  1.00 34.76  ? 479  LEU B CD2 1 
ATOM   8693  N  N   . VAL B 1 480 ? 48.650 139.607 24.830  1.00 33.99  ? 480  VAL B N   1 
ATOM   8694  C  CA  . VAL B 1 480 ? 48.886 139.935 23.433  1.00 33.74  ? 480  VAL B CA  1 
ATOM   8695  C  C   . VAL B 1 480 ? 49.365 138.658 22.767  1.00 33.60  ? 480  VAL B C   1 
ATOM   8696  O  O   . VAL B 1 480 ? 48.821 138.235 21.750  1.00 33.57  ? 480  VAL B O   1 
ATOM   8697  C  CB  . VAL B 1 480 ? 49.950 141.029 23.272  1.00 33.74  ? 480  VAL B CB  1 
ATOM   8698  C  CG1 . VAL B 1 480 ? 49.671 142.176 24.215  1.00 33.74  ? 480  VAL B CG1 1 
ATOM   8699  C  CG2 . VAL B 1 480 ? 51.339 140.467 23.530  1.00 34.05  ? 480  VAL B CG2 1 
ATOM   8700  N  N   . ALA B 1 481 ? 50.366 138.031 23.378  1.00 33.41  ? 481  ALA B N   1 
ATOM   8701  C  CA  . ALA B 1 481 ? 50.934 136.785 22.882  1.00 33.25  ? 481  ALA B CA  1 
ATOM   8702  C  C   . ALA B 1 481 ? 49.870 135.901 22.259  1.00 33.12  ? 481  ALA B C   1 
ATOM   8703  O  O   . ALA B 1 481 ? 50.166 135.040 21.442  1.00 33.29  ? 481  ALA B O   1 
ATOM   8704  C  CB  . ALA B 1 481 ? 51.644 136.040 24.007  1.00 33.14  ? 481  ALA B CB  1 
ATOM   8705  N  N   . THR B 1 482 ? 48.623 136.120 22.641  1.00 32.98  ? 482  THR B N   1 
ATOM   8706  C  CA  . THR B 1 482 ? 47.539 135.309 22.123  1.00 32.92  ? 482  THR B CA  1 
ATOM   8707  C  C   . THR B 1 482 ? 47.255 135.549 20.646  1.00 33.05  ? 482  THR B C   1 
ATOM   8708  O  O   . THR B 1 482 ? 46.663 134.706 19.991  1.00 33.11  ? 482  THR B O   1 
ATOM   8709  C  CB  . THR B 1 482 ? 46.281 135.534 22.943  1.00 32.85  ? 482  THR B CB  1 
ATOM   8710  O  OG1 . THR B 1 482 ? 46.568 135.269 24.322  1.00 32.56  ? 482  THR B OG1 1 
ATOM   8711  C  CG2 . THR B 1 482 ? 45.232 134.497 22.581  1.00 32.79  ? 482  THR B CG2 1 
ATOM   8712  N  N   . PHE B 1 483 ? 47.671 136.696 20.122  1.00 33.29  ? 483  PHE B N   1 
ATOM   8713  C  CA  . PHE B 1 483 ? 47.458 137.004 18.710  1.00 33.46  ? 483  PHE B CA  1 
ATOM   8714  C  C   . PHE B 1 483 ? 48.773 137.328 18.020  1.00 33.72  ? 483  PHE B C   1 
ATOM   8715  O  O   . PHE B 1 483 ? 48.916 137.139 16.816  1.00 33.80  ? 483  PHE B O   1 
ATOM   8716  C  CB  . PHE B 1 483 ? 46.524 138.203 18.543  1.00 33.43  ? 483  PHE B CB  1 
ATOM   8717  C  CG  . PHE B 1 483 ? 45.214 138.068 19.262  1.00 33.06  ? 483  PHE B CG  1 
ATOM   8718  C  CD1 . PHE B 1 483 ? 44.439 136.932 19.121  1.00 32.80  ? 483  PHE B CD1 1 
ATOM   8719  C  CD2 . PHE B 1 483 ? 44.748 139.092 20.066  1.00 32.18  ? 483  PHE B CD2 1 
ATOM   8720  C  CE1 . PHE B 1 483 ? 43.227 136.822 19.784  1.00 32.62  ? 483  PHE B CE1 1 
ATOM   8721  C  CE2 . PHE B 1 483 ? 43.541 138.985 20.724  1.00 31.68  ? 483  PHE B CE2 1 
ATOM   8722  C  CZ  . PHE B 1 483 ? 42.780 137.854 20.586  1.00 31.60  ? 483  PHE B CZ  1 
ATOM   8723  N  N   . TRP B 1 484 ? 49.728 137.834 18.791  1.00 34.01  ? 484  TRP B N   1 
ATOM   8724  C  CA  . TRP B 1 484 ? 51.022 138.224 18.253  1.00 34.27  ? 484  TRP B CA  1 
ATOM   8725  C  C   . TRP B 1 484 ? 52.135 137.760 19.190  1.00 34.38  ? 484  TRP B C   1 
ATOM   8726  O  O   . TRP B 1 484 ? 52.803 138.569 19.832  1.00 34.42  ? 484  TRP B O   1 
ATOM   8727  C  CB  . TRP B 1 484 ? 51.062 139.743 18.054  1.00 34.37  ? 484  TRP B CB  1 
ATOM   8728  C  CG  . TRP B 1 484 ? 49.901 140.269 17.250  1.00 34.61  ? 484  TRP B CG  1 
ATOM   8729  C  CD1 . TRP B 1 484 ? 49.704 140.127 15.908  1.00 34.58  ? 484  TRP B CD1 1 
ATOM   8730  C  CD2 . TRP B 1 484 ? 48.774 141.008 17.740  1.00 34.73  ? 484  TRP B CD2 1 
ATOM   8731  N  NE1 . TRP B 1 484 ? 48.530 140.734 15.531  1.00 34.55  ? 484  TRP B NE1 1 
ATOM   8732  C  CE2 . TRP B 1 484 ? 47.940 141.283 16.638  1.00 34.70  ? 484  TRP B CE2 1 
ATOM   8733  C  CE3 . TRP B 1 484 ? 48.386 141.470 19.000  1.00 35.02  ? 484  TRP B CE3 1 
ATOM   8734  C  CZ2 . TRP B 1 484 ? 46.748 141.991 16.758  1.00 34.94  ? 484  TRP B CZ2 1 
ATOM   8735  C  CZ3 . TRP B 1 484 ? 47.200 142.176 19.117  1.00 35.32  ? 484  TRP B CZ3 1 
ATOM   8736  C  CH2 . TRP B 1 484 ? 46.396 142.428 18.003  1.00 35.33  ? 484  TRP B CH2 1 
ATOM   8737  N  N   . PRO B 1 485 ? 52.340 136.450 19.253  1.00 34.54  ? 485  PRO B N   1 
ATOM   8738  C  CA  . PRO B 1 485 ? 53.331 135.862 20.161  1.00 34.78  ? 485  PRO B CA  1 
ATOM   8739  C  C   . PRO B 1 485 ? 54.730 136.388 19.889  1.00 35.12  ? 485  PRO B C   1 
ATOM   8740  O  O   . PRO B 1 485 ? 55.501 136.591 20.828  1.00 35.27  ? 485  PRO B O   1 
ATOM   8741  C  CB  . PRO B 1 485 ? 53.266 134.370 19.831  1.00 34.63  ? 485  PRO B CB  1 
ATOM   8742  C  CG  . PRO B 1 485 ? 51.947 134.177 19.186  1.00 34.56  ? 485  PRO B CG  1 
ATOM   8743  C  CD  . PRO B 1 485 ? 51.659 135.434 18.434  1.00 34.49  ? 485  PRO B CD  1 
ATOM   8744  N  N   . GLU B 1 486 ? 55.044 136.603 18.614  1.00 35.35  ? 486  GLU B N   1 
ATOM   8745  C  CA  . GLU B 1 486 ? 56.345 137.110 18.208  1.00 35.45  ? 486  GLU B CA  1 
ATOM   8746  C  C   . GLU B 1 486 ? 56.514 138.586 18.580  1.00 35.61  ? 486  GLU B C   1 
ATOM   8747  O  O   . GLU B 1 486 ? 57.630 139.100 18.624  1.00 35.69  ? 486  GLU B O   1 
ATOM   8748  C  CB  . GLU B 1 486 ? 56.538 136.915 16.705  1.00 35.42  ? 486  GLU B CB  1 
ATOM   8749  C  CG  . GLU B 1 486 ? 55.287 137.168 15.879  1.00 35.46  ? 486  GLU B CG  1 
ATOM   8750  C  CD  . GLU B 1 486 ? 54.719 135.913 15.245  1.00 35.81  ? 486  GLU B CD  1 
ATOM   8751  O  OE1 . GLU B 1 486 ? 55.454 134.908 15.121  1.00 36.13  ? 486  GLU B OE1 1 
ATOM   8752  O  OE2 . GLU B 1 486 ? 53.535 135.941 14.851  1.00 35.87  ? 486  GLU B OE2 1 
ATOM   8753  N  N   . LEU B 1 487 ? 55.402 139.258 18.855  1.00 35.71  ? 487  LEU B N   1 
ATOM   8754  C  CA  . LEU B 1 487 ? 55.420 140.673 19.217  1.00 35.93  ? 487  LEU B CA  1 
ATOM   8755  C  C   . LEU B 1 487 ? 55.914 140.854 20.653  1.00 36.27  ? 487  LEU B C   1 
ATOM   8756  O  O   . LEU B 1 487 ? 55.416 140.204 21.571  1.00 36.36  ? 487  LEU B O   1 
ATOM   8757  C  CB  . LEU B 1 487 ? 54.017 141.255 19.044  1.00 35.73  ? 487  LEU B CB  1 
ATOM   8758  C  CG  . LEU B 1 487 ? 53.769 142.746 18.835  1.00 35.32  ? 487  LEU B CG  1 
ATOM   8759  C  CD1 . LEU B 1 487 ? 54.919 143.440 18.140  1.00 34.88  ? 487  LEU B CD1 1 
ATOM   8760  C  CD2 . LEU B 1 487 ? 52.488 142.915 18.045  1.00 34.82  ? 487  LEU B CD2 1 
ATOM   8761  N  N   . PRO B 1 488 ? 56.900 141.727 20.839  1.00 36.59  ? 488  PRO B N   1 
ATOM   8762  C  CA  . PRO B 1 488 ? 57.505 141.973 22.152  1.00 36.82  ? 488  PRO B CA  1 
ATOM   8763  C  C   . PRO B 1 488 ? 56.576 142.698 23.098  1.00 37.08  ? 488  PRO B C   1 
ATOM   8764  O  O   . PRO B 1 488 ? 55.542 143.216 22.683  1.00 37.32  ? 488  PRO B O   1 
ATOM   8765  C  CB  . PRO B 1 488 ? 58.683 142.894 21.831  1.00 36.84  ? 488  PRO B CB  1 
ATOM   8766  C  CG  . PRO B 1 488 ? 58.887 142.764 20.378  1.00 37.00  ? 488  PRO B CG  1 
ATOM   8767  C  CD  . PRO B 1 488 ? 57.529 142.538 19.789  1.00 36.76  ? 488  PRO B CD  1 
ATOM   8768  N  N   . GLU B 1 489 ? 56.969 142.747 24.365  1.00 37.28  ? 489  GLU B N   1 
ATOM   8769  C  CA  . GLU B 1 489 ? 56.190 143.401 25.410  1.00 37.38  ? 489  GLU B CA  1 
ATOM   8770  C  C   . GLU B 1 489 ? 56.306 144.934 25.383  1.00 37.37  ? 489  GLU B C   1 
ATOM   8771  O  O   . GLU B 1 489 ? 57.383 145.491 25.155  1.00 37.47  ? 489  GLU B O   1 
ATOM   8772  C  CB  . GLU B 1 489 ? 56.627 142.857 26.770  1.00 37.39  ? 489  GLU B CB  1 
ATOM   8773  C  CG  . GLU B 1 489 ? 56.472 143.829 27.925  1.00 37.95  ? 489  GLU B CG  1 
ATOM   8774  C  CD  . GLU B 1 489 ? 57.519 143.606 28.997  1.00 38.68  ? 489  GLU B CD  1 
ATOM   8775  O  OE1 . GLU B 1 489 ? 58.162 142.527 28.980  1.00 38.68  ? 489  GLU B OE1 1 
ATOM   8776  O  OE2 . GLU B 1 489 ? 57.703 144.512 29.845  1.00 38.50  ? 489  GLU B OE2 1 
ATOM   8777  N  N   . LYS B 1 490 ? 55.185 145.607 25.611  1.00 37.33  ? 490  LYS B N   1 
ATOM   8778  C  CA  . LYS B 1 490 ? 55.159 147.061 25.645  1.00 37.26  ? 490  LYS B CA  1 
ATOM   8779  C  C   . LYS B 1 490 ? 55.298 147.666 24.249  1.00 37.18  ? 490  LYS B C   1 
ATOM   8780  O  O   . LYS B 1 490 ? 56.129 148.545 24.026  1.00 37.27  ? 490  LYS B O   1 
ATOM   8781  C  CB  . LYS B 1 490 ? 56.265 147.593 26.565  1.00 37.32  ? 490  LYS B CB  1 
ATOM   8782  C  CG  . LYS B 1 490 ? 56.135 149.073 26.928  1.00 37.43  ? 490  LYS B CG  1 
ATOM   8783  C  CD  . LYS B 1 490 ? 57.498 149.728 27.097  1.00 37.28  ? 490  LYS B CD  1 
ATOM   8784  C  CE  . LYS B 1 490 ? 58.198 149.883 25.753  1.00 37.50  ? 490  LYS B CE  1 
ATOM   8785  N  NZ  . LYS B 1 490 ? 59.567 150.460 25.875  1.00 37.60  ? 490  LYS B NZ  1 
ATOM   8786  N  N   . ILE B 1 491 ? 54.478 147.206 23.311  1.00 37.00  ? 491  ILE B N   1 
ATOM   8787  C  CA  . ILE B 1 491 ? 54.524 147.730 21.948  1.00 36.96  ? 491  ILE B CA  1 
ATOM   8788  C  C   . ILE B 1 491 ? 54.230 149.232 21.902  1.00 37.06  ? 491  ILE B C   1 
ATOM   8789  O  O   . ILE B 1 491 ? 53.603 149.778 22.811  1.00 37.17  ? 491  ILE B O   1 
ATOM   8790  C  CB  . ILE B 1 491 ? 53.535 146.986 21.052  1.00 36.92  ? 491  ILE B CB  1 
ATOM   8791  C  CG1 . ILE B 1 491 ? 52.118 147.487 21.308  1.00 36.67  ? 491  ILE B CG1 1 
ATOM   8792  C  CG2 . ILE B 1 491 ? 53.630 145.493 21.288  1.00 36.91  ? 491  ILE B CG2 1 
ATOM   8793  C  CD1 . ILE B 1 491 ? 51.308 147.613 20.054  1.00 36.50  ? 491  ILE B CD1 1 
ATOM   8794  N  N   . ASP B 1 492 ? 54.664 149.896 20.834  1.00 37.08  ? 492  ASP B N   1 
ATOM   8795  C  CA  . ASP B 1 492 ? 54.510 151.350 20.737  1.00 37.02  ? 492  ASP B CA  1 
ATOM   8796  C  C   . ASP B 1 492 ? 53.525 151.876 19.691  1.00 37.10  ? 492  ASP B C   1 
ATOM   8797  O  O   . ASP B 1 492 ? 53.230 153.069 19.686  1.00 37.12  ? 492  ASP B O   1 
ATOM   8798  C  CB  . ASP B 1 492 ? 55.872 152.018 20.517  1.00 36.88  ? 492  ASP B CB  1 
ATOM   8799  C  CG  . ASP B 1 492 ? 56.837 151.766 21.656  1.00 36.61  ? 492  ASP B CG  1 
ATOM   8800  O  OD1 . ASP B 1 492 ? 56.402 151.796 22.826  1.00 36.64  ? 492  ASP B OD1 1 
ATOM   8801  O  OD2 . ASP B 1 492 ? 58.049 151.529 21.477  1.00 36.03  ? 492  ASP B OD2 1 
ATOM   8802  N  N   . ALA B 1 493 ? 53.021 151.020 18.805  1.00 37.25  ? 493  ALA B N   1 
ATOM   8803  C  CA  . ALA B 1 493 ? 52.091 151.499 17.780  1.00 37.43  ? 493  ALA B CA  1 
ATOM   8804  C  C   . ALA B 1 493 ? 51.443 150.410 16.940  1.00 37.59  ? 493  ALA B C   1 
ATOM   8805  O  O   . ALA B 1 493 ? 51.938 149.289 16.856  1.00 37.71  ? 493  ALA B O   1 
ATOM   8806  C  CB  . ALA B 1 493 ? 52.773 152.508 16.877  1.00 37.44  ? 493  ALA B CB  1 
ATOM   8807  N  N   . VAL B 1 494 ? 50.334 150.767 16.304  1.00 37.75  ? 494  VAL B N   1 
ATOM   8808  C  CA  . VAL B 1 494 ? 49.583 149.832 15.486  1.00 37.94  ? 494  VAL B CA  1 
ATOM   8809  C  C   . VAL B 1 494 ? 48.858 150.558 14.375  1.00 38.10  ? 494  VAL B C   1 
ATOM   8810  O  O   . VAL B 1 494 ? 47.977 151.373 14.649  1.00 38.26  ? 494  VAL B O   1 
ATOM   8811  C  CB  . VAL B 1 494 ? 48.479 149.155 16.308  1.00 37.96  ? 494  VAL B CB  1 
ATOM   8812  C  CG1 . VAL B 1 494 ? 48.140 147.791 15.726  1.00 37.89  ? 494  VAL B CG1 1 
ATOM   8813  C  CG2 . VAL B 1 494 ? 48.879 149.047 17.765  1.00 38.05  ? 494  VAL B CG2 1 
ATOM   8814  N  N   . TYR B 1 495 ? 49.206 150.277 13.125  1.00 38.20  ? 495  TYR B N   1 
ATOM   8815  C  CA  . TYR B 1 495 ? 48.444 150.878 12.039  1.00 38.40  ? 495  TYR B CA  1 
ATOM   8816  C  C   . TYR B 1 495 ? 47.657 149.908 11.170  1.00 38.58  ? 495  TYR B C   1 
ATOM   8817  O  O   . TYR B 1 495 ? 48.082 148.785 10.885  1.00 38.64  ? 495  TYR B O   1 
ATOM   8818  C  CB  . TYR B 1 495 ? 49.236 151.869 11.160  1.00 38.44  ? 495  TYR B CB  1 
ATOM   8819  C  CG  . TYR B 1 495 ? 50.744 151.750 11.095  1.00 38.39  ? 495  TYR B CG  1 
ATOM   8820  C  CD1 . TYR B 1 495 ? 51.507 151.598 12.242  1.00 38.43  ? 495  TYR B CD1 1 
ATOM   8821  C  CD2 . TYR B 1 495 ? 51.408 151.860 9.879   1.00 38.25  ? 495  TYR B CD2 1 
ATOM   8822  C  CE1 . TYR B 1 495 ? 52.880 151.523 12.177  1.00 38.35  ? 495  TYR B CE1 1 
ATOM   8823  C  CE2 . TYR B 1 495 ? 52.781 151.791 9.806   1.00 38.43  ? 495  TYR B CE2 1 
ATOM   8824  C  CZ  . TYR B 1 495 ? 53.513 151.621 10.958  1.00 38.46  ? 495  TYR B CZ  1 
ATOM   8825  O  OH  . TYR B 1 495 ? 54.883 151.546 10.883  1.00 38.82  ? 495  TYR B OH  1 
ATOM   8826  N  N   . GLU B 1 496 ? 46.478 150.376 10.783  1.00 38.77  ? 496  GLU B N   1 
ATOM   8827  C  CA  . GLU B 1 496 ? 45.627 149.699 9.832   1.00 38.93  ? 496  GLU B CA  1 
ATOM   8828  C  C   . GLU B 1 496 ? 46.346 149.934 8.510   1.00 38.86  ? 496  GLU B C   1 
ATOM   8829  O  O   . GLU B 1 496 ? 46.685 151.070 8.174   1.00 38.76  ? 496  GLU B O   1 
ATOM   8830  C  CB  . GLU B 1 496 ? 44.264 150.392 9.825   1.00 39.06  ? 496  GLU B CB  1 
ATOM   8831  C  CG  . GLU B 1 496 ? 43.143 149.674 9.092   1.00 39.30  ? 496  GLU B CG  1 
ATOM   8832  C  CD  . GLU B 1 496 ? 41.903 150.545 8.970   1.00 39.42  ? 496  GLU B CD  1 
ATOM   8833  O  OE1 . GLU B 1 496 ? 41.724 151.443 9.824   1.00 39.41  ? 496  GLU B OE1 1 
ATOM   8834  O  OE2 . GLU B 1 496 ? 41.115 150.340 8.020   1.00 39.18  ? 496  GLU B OE2 1 
ATOM   8835  N  N   . ALA B 1 497 ? 46.618 148.863 7.775   1.00 38.83  ? 497  ALA B N   1 
ATOM   8836  C  CA  . ALA B 1 497 ? 47.327 149.007 6.512   1.00 38.89  ? 497  ALA B CA  1 
ATOM   8837  C  C   . ALA B 1 497 ? 46.674 150.093 5.675   1.00 38.91  ? 497  ALA B C   1 
ATOM   8838  O  O   . ALA B 1 497 ? 45.451 150.232 5.653   1.00 38.94  ? 497  ALA B O   1 
ATOM   8839  C  CB  . ALA B 1 497 ? 47.367 147.706 5.760   1.00 38.84  ? 497  ALA B CB  1 
ATOM   8840  N  N   . PRO B 1 498 ? 47.506 150.862 4.988   1.00 38.91  ? 498  PRO B N   1 
ATOM   8841  C  CA  . PRO B 1 498 ? 47.043 152.000 4.195   1.00 38.88  ? 498  PRO B CA  1 
ATOM   8842  C  C   . PRO B 1 498 ? 46.159 151.536 3.050   1.00 38.85  ? 498  PRO B C   1 
ATOM   8843  O  O   . PRO B 1 498 ? 44.968 151.839 3.027   1.00 38.87  ? 498  PRO B O   1 
ATOM   8844  C  CB  . PRO B 1 498 ? 48.348 152.599 3.671   1.00 38.93  ? 498  PRO B CB  1 
ATOM   8845  C  CG  . PRO B 1 498 ? 49.382 152.095 4.627   1.00 38.89  ? 498  PRO B CG  1 
ATOM   8846  C  CD  . PRO B 1 498 ? 48.964 150.685 4.910   1.00 38.91  ? 498  PRO B CD  1 
ATOM   8847  N  N   . GLN B 1 499 ? 46.745 150.802 2.114   1.00 38.80  ? 499  GLN B N   1 
ATOM   8848  C  CA  . GLN B 1 499 ? 46.010 150.255 0.986   1.00 38.74  ? 499  GLN B CA  1 
ATOM   8849  C  C   . GLN B 1 499 ? 46.436 148.803 0.867   1.00 38.69  ? 499  GLN B C   1 
ATOM   8850  O  O   . GLN B 1 499 ? 46.671 148.291 -0.226  1.00 38.71  ? 499  GLN B O   1 
ATOM   8851  C  CB  . GLN B 1 499 ? 46.343 151.029 -0.287  1.00 38.71  ? 499  GLN B CB  1 
ATOM   8852  C  CG  . GLN B 1 499 ? 46.131 152.531 -0.159  1.00 38.78  ? 499  GLN B CG  1 
ATOM   8853  C  CD  . GLN B 1 499 ? 47.057 153.322 -1.055  1.00 38.91  ? 499  GLN B CD  1 
ATOM   8854  O  OE1 . GLN B 1 499 ? 48.271 153.308 -0.859  1.00 38.99  ? 499  GLN B OE1 1 
ATOM   8855  N  NE2 . GLN B 1 499 ? 46.492 154.011 -2.040  1.00 38.90  ? 499  GLN B NE2 1 
ATOM   8856  N  N   . GLU B 1 500 ? 46.533 148.150 2.020   1.00 38.64  ? 500  GLU B N   1 
ATOM   8857  C  CA  . GLU B 1 500 ? 47.007 146.780 2.109   1.00 38.60  ? 500  GLU B CA  1 
ATOM   8858  C  C   . GLU B 1 500 ? 46.309 146.088 3.279   1.00 38.47  ? 500  GLU B C   1 
ATOM   8859  O  O   . GLU B 1 500 ? 46.329 146.593 4.396   1.00 38.40  ? 500  GLU B O   1 
ATOM   8860  C  CB  . GLU B 1 500 ? 48.519 146.802 2.331   1.00 38.65  ? 500  GLU B CB  1 
ATOM   8861  C  CG  . GLU B 1 500 ? 49.245 145.510 2.013   1.00 39.02  ? 500  GLU B CG  1 
ATOM   8862  C  CD  . GLU B 1 500 ? 50.733 145.608 2.289   1.00 39.43  ? 500  GLU B CD  1 
ATOM   8863  O  OE1 . GLU B 1 500 ? 51.175 146.661 2.801   1.00 39.34  ? 500  GLU B OE1 1 
ATOM   8864  O  OE2 . GLU B 1 500 ? 51.459 144.635 1.994   1.00 39.74  ? 500  GLU B OE2 1 
ATOM   8865  N  N   . GLU B 1 501 ? 45.698 144.935 3.028   1.00 38.33  ? 501  GLU B N   1 
ATOM   8866  C  CA  . GLU B 1 501 ? 44.948 144.218 4.062   1.00 38.22  ? 501  GLU B CA  1 
ATOM   8867  C  C   . GLU B 1 501 ? 45.821 143.665 5.199   1.00 38.18  ? 501  GLU B C   1 
ATOM   8868  O  O   . GLU B 1 501 ? 45.523 142.611 5.760   1.00 38.23  ? 501  GLU B O   1 
ATOM   8869  C  CB  . GLU B 1 501 ? 44.142 143.078 3.428   1.00 38.15  ? 501  GLU B CB  1 
ATOM   8870  C  CG  . GLU B 1 501 ? 43.549 143.406 2.065   1.00 37.97  ? 501  GLU B CG  1 
ATOM   8871  C  CD  . GLU B 1 501 ? 42.596 144.586 2.098   1.00 37.83  ? 501  GLU B CD  1 
ATOM   8872  O  OE1 . GLU B 1 501 ? 41.459 144.424 2.588   1.00 37.75  ? 501  GLU B OE1 1 
ATOM   8873  O  OE2 . GLU B 1 501 ? 42.979 145.677 1.625   1.00 37.78  ? 501  GLU B OE2 1 
ATOM   8874  N  N   . LYS B 1 502 ? 46.880 144.391 5.547   1.00 38.06  ? 502  LYS B N   1 
ATOM   8875  C  CA  . LYS B 1 502 ? 47.832 143.952 6.568   1.00 37.92  ? 502  LYS B CA  1 
ATOM   8876  C  C   . LYS B 1 502 ? 47.764 144.777 7.848   1.00 37.87  ? 502  LYS B C   1 
ATOM   8877  O  O   . LYS B 1 502 ? 47.434 145.956 7.814   1.00 38.07  ? 502  LYS B O   1 
ATOM   8878  C  CB  . LYS B 1 502 ? 49.257 144.046 6.016   1.00 37.88  ? 502  LYS B CB  1 
ATOM   8879  C  CG  . LYS B 1 502 ? 49.739 142.827 5.259   1.00 37.75  ? 502  LYS B CG  1 
ATOM   8880  C  CD  . LYS B 1 502 ? 49.035 142.642 3.930   1.00 37.32  ? 502  LYS B CD  1 
ATOM   8881  C  CE  . LYS B 1 502 ? 49.437 141.317 3.310   1.00 37.21  ? 502  LYS B CE  1 
ATOM   8882  N  NZ  . LYS B 1 502 ? 50.884 141.037 3.536   1.00 36.91  ? 502  LYS B NZ  1 
ATOM   8883  N  N   . ALA B 1 503 ? 48.096 144.166 8.978   1.00 37.76  ? 503  ALA B N   1 
ATOM   8884  C  CA  . ALA B 1 503 ? 48.140 144.899 10.242  1.00 37.68  ? 503  ALA B CA  1 
ATOM   8885  C  C   . ALA B 1 503 ? 49.576 145.345 10.505  1.00 37.57  ? 503  ALA B C   1 
ATOM   8886  O  O   . ALA B 1 503 ? 50.485 144.518 10.551  1.00 37.54  ? 503  ALA B O   1 
ATOM   8887  C  CB  . ALA B 1 503 ? 47.634 144.032 11.383  1.00 37.67  ? 503  ALA B CB  1 
ATOM   8888  N  N   . VAL B 1 504 ? 49.791 146.646 10.670  1.00 37.38  ? 504  VAL B N   1 
ATOM   8889  C  CA  . VAL B 1 504 ? 51.146 147.136 10.901  1.00 37.25  ? 504  VAL B CA  1 
ATOM   8890  C  C   . VAL B 1 504 ? 51.408 147.473 12.364  1.00 37.23  ? 504  VAL B C   1 
ATOM   8891  O  O   . VAL B 1 504 ? 50.651 148.219 12.982  1.00 37.27  ? 504  VAL B O   1 
ATOM   8892  C  CB  . VAL B 1 504 ? 51.472 148.355 10.039  1.00 37.17  ? 504  VAL B CB  1 
ATOM   8893  C  CG1 . VAL B 1 504 ? 52.974 148.563 9.998   1.00 37.07  ? 504  VAL B CG1 1 
ATOM   8894  C  CG2 . VAL B 1 504 ? 50.925 148.169 8.639   1.00 37.20  ? 504  VAL B CG2 1 
ATOM   8895  N  N   . PHE B 1 505 ? 52.494 146.926 12.904  1.00 37.17  ? 505  PHE B N   1 
ATOM   8896  C  CA  . PHE B 1 505 ? 52.848 147.138 14.306  1.00 37.07  ? 505  PHE B CA  1 
ATOM   8897  C  C   . PHE B 1 505 ? 54.163 147.883 14.520  1.00 37.03  ? 505  PHE B C   1 
ATOM   8898  O  O   . PHE B 1 505 ? 54.957 148.059 13.593  1.00 37.09  ? 505  PHE B O   1 
ATOM   8899  C  CB  . PHE B 1 505 ? 52.890 145.805 15.052  1.00 37.04  ? 505  PHE B CB  1 
ATOM   8900  C  CG  . PHE B 1 505 ? 51.603 145.452 15.727  1.00 36.95  ? 505  PHE B CG  1 
ATOM   8901  C  CD1 . PHE B 1 505 ? 51.360 145.859 17.026  1.00 37.00  ? 505  PHE B CD1 1 
ATOM   8902  C  CD2 . PHE B 1 505 ? 50.634 144.720 15.066  1.00 36.90  ? 505  PHE B CD2 1 
ATOM   8903  C  CE1 . PHE B 1 505 ? 50.178 145.540 17.655  1.00 36.91  ? 505  PHE B CE1 1 
ATOM   8904  C  CE2 . PHE B 1 505 ? 49.448 144.395 15.694  1.00 36.98  ? 505  PHE B CE2 1 
ATOM   8905  C  CZ  . PHE B 1 505 ? 49.220 144.806 16.990  1.00 36.97  ? 505  PHE B CZ  1 
ATOM   8906  N  N   . PHE B 1 506 ? 54.374 148.301 15.765  1.00 36.85  ? 506  PHE B N   1 
ATOM   8907  C  CA  . PHE B 1 506 ? 55.545 149.068 16.172  1.00 36.75  ? 506  PHE B CA  1 
ATOM   8908  C  C   . PHE B 1 506 ? 55.940 148.673 17.586  1.00 36.76  ? 506  PHE B C   1 
ATOM   8909  O  O   . PHE B 1 506 ? 55.080 148.552 18.452  1.00 36.85  ? 506  PHE B O   1 
ATOM   8910  C  CB  . PHE B 1 506 ? 55.207 150.558 16.178  1.00 36.58  ? 506  PHE B CB  1 
ATOM   8911  C  CG  . PHE B 1 506 ? 55.794 151.335 15.035  1.00 36.18  ? 506  PHE B CG  1 
ATOM   8912  C  CD1 . PHE B 1 506 ? 57.147 151.291 14.771  1.00 35.90  ? 506  PHE B CD1 1 
ATOM   8913  C  CD2 . PHE B 1 506 ? 54.993 152.140 14.248  1.00 35.82  ? 506  PHE B CD2 1 
ATOM   8914  C  CE1 . PHE B 1 506 ? 57.684 152.020 13.729  1.00 35.95  ? 506  PHE B CE1 1 
ATOM   8915  C  CE2 . PHE B 1 506 ? 55.526 152.872 13.210  1.00 35.75  ? 506  PHE B CE2 1 
ATOM   8916  C  CZ  . PHE B 1 506 ? 56.873 152.809 12.947  1.00 35.84  ? 506  PHE B CZ  1 
ATOM   8917  N  N   . ALA B 1 507 ? 57.233 148.493 17.833  1.00 36.79  ? 507  ALA B N   1 
ATOM   8918  C  CA  . ALA B 1 507 ? 57.696 148.152 19.175  1.00 36.84  ? 507  ALA B CA  1 
ATOM   8919  C  C   . ALA B 1 507 ? 59.187 148.404 19.361  1.00 36.94  ? 507  ALA B C   1 
ATOM   8920  O  O   . ALA B 1 507 ? 60.015 147.634 18.879  1.00 37.00  ? 507  ALA B O   1 
ATOM   8921  C  CB  . ALA B 1 507 ? 57.363 146.711 19.497  1.00 36.85  ? 507  ALA B CB  1 
ATOM   8922  N  N   . GLY B 1 508 ? 59.521 149.483 20.065  1.00 37.06  ? 508  GLY B N   1 
ATOM   8923  C  CA  . GLY B 1 508 ? 60.907 149.833 20.328  1.00 37.17  ? 508  GLY B CA  1 
ATOM   8924  C  C   . GLY B 1 508 ? 61.676 150.310 19.107  1.00 37.23  ? 508  GLY B C   1 
ATOM   8925  O  O   . GLY B 1 508 ? 61.261 151.249 18.429  1.00 37.26  ? 508  GLY B O   1 
ATOM   8926  N  N   . ASN B 1 509 ? 62.801 149.656 18.827  1.00 37.26  ? 509  ASN B N   1 
ATOM   8927  C  CA  . ASN B 1 509 ? 63.652 150.026 17.700  1.00 37.34  ? 509  ASN B CA  1 
ATOM   8928  C  C   . ASN B 1 509 ? 63.440 149.133 16.479  1.00 37.33  ? 509  ASN B C   1 
ATOM   8929  O  O   . ASN B 1 509 ? 64.191 149.203 15.509  1.00 37.25  ? 509  ASN B O   1 
ATOM   8930  C  CB  . ASN B 1 509 ? 65.126 150.001 18.118  1.00 37.39  ? 509  ASN B CB  1 
ATOM   8931  C  CG  . ASN B 1 509 ? 66.016 150.815 17.189  1.00 37.61  ? 509  ASN B CG  1 
ATOM   8932  O  OD1 . ASN B 1 509 ? 67.170 151.100 17.510  1.00 37.71  ? 509  ASN B OD1 1 
ATOM   8933  N  ND2 . ASN B 1 509 ? 65.481 151.196 16.033  1.00 37.89  ? 509  ASN B ND2 1 
ATOM   8934  N  N   . GLU B 1 510 ? 62.416 148.292 16.528  1.00 37.37  ? 510  GLU B N   1 
ATOM   8935  C  CA  . GLU B 1 510 ? 62.126 147.399 15.417  1.00 37.39  ? 510  GLU B CA  1 
ATOM   8936  C  C   . GLU B 1 510 ? 60.687 147.573 14.957  1.00 37.36  ? 510  GLU B C   1 
ATOM   8937  O  O   . GLU B 1 510 ? 59.850 148.082 15.702  1.00 37.39  ? 510  GLU B O   1 
ATOM   8938  C  CB  . GLU B 1 510 ? 62.360 145.947 15.839  1.00 37.41  ? 510  GLU B CB  1 
ATOM   8939  C  CG  . GLU B 1 510 ? 63.758 145.671 16.372  1.00 37.67  ? 510  GLU B CG  1 
ATOM   8940  C  CD  . GLU B 1 510 ? 63.868 144.322 17.058  1.00 37.74  ? 510  GLU B CD  1 
ATOM   8941  O  OE1 . GLU B 1 510 ? 62.976 143.998 17.868  1.00 37.83  ? 510  GLU B OE1 1 
ATOM   8942  O  OE2 . GLU B 1 510 ? 64.845 143.589 16.791  1.00 37.65  ? 510  GLU B OE2 1 
ATOM   8943  N  N   . TYR B 1 511 ? 60.400 147.169 13.725  1.00 37.31  ? 511  TYR B N   1 
ATOM   8944  C  CA  . TYR B 1 511 ? 59.029 147.213 13.228  1.00 37.33  ? 511  TYR B CA  1 
ATOM   8945  C  C   . TYR B 1 511 ? 58.506 145.792 12.952  1.00 37.32  ? 511  TYR B C   1 
ATOM   8946  O  O   . TYR B 1 511 ? 59.287 144.858 12.755  1.00 37.25  ? 511  TYR B O   1 
ATOM   8947  C  CB  . TYR B 1 511 ? 58.888 148.149 12.016  1.00 37.27  ? 511  TYR B CB  1 
ATOM   8948  C  CG  . TYR B 1 511 ? 59.634 147.727 10.768  1.00 37.63  ? 511  TYR B CG  1 
ATOM   8949  C  CD1 . TYR B 1 511 ? 61.024 147.744 10.714  1.00 37.90  ? 511  TYR B CD1 1 
ATOM   8950  C  CD2 . TYR B 1 511 ? 58.945 147.332 9.632   1.00 38.01  ? 511  TYR B CD2 1 
ATOM   8951  C  CE1 . TYR B 1 511 ? 61.705 147.356 9.562   1.00 37.94  ? 511  TYR B CE1 1 
ATOM   8952  C  CE2 . TYR B 1 511 ? 59.617 146.949 8.478   1.00 38.05  ? 511  TYR B CE2 1 
ATOM   8953  C  CZ  . TYR B 1 511 ? 60.993 146.958 8.450   1.00 37.83  ? 511  TYR B CZ  1 
ATOM   8954  O  OH  . TYR B 1 511 ? 61.651 146.571 7.304   1.00 37.40  ? 511  TYR B OH  1 
ATOM   8955  N  N   . TRP B 1 512 ? 57.186 145.630 12.979  1.00 37.30  ? 512  TRP B N   1 
ATOM   8956  C  CA  . TRP B 1 512 ? 56.565 144.328 12.753  1.00 37.24  ? 512  TRP B CA  1 
ATOM   8957  C  C   . TRP B 1 512 ? 55.268 144.464 11.964  1.00 37.28  ? 512  TRP B C   1 
ATOM   8958  O  O   . TRP B 1 512 ? 54.331 145.122 12.412  1.00 37.17  ? 512  TRP B O   1 
ATOM   8959  C  CB  . TRP B 1 512 ? 56.260 143.640 14.089  1.00 37.25  ? 512  TRP B CB  1 
ATOM   8960  C  CG  . TRP B 1 512 ? 57.358 142.774 14.628  1.00 36.94  ? 512  TRP B CG  1 
ATOM   8961  C  CD1 . TRP B 1 512 ? 57.698 141.524 14.203  1.00 37.02  ? 512  TRP B CD1 1 
ATOM   8962  C  CD2 . TRP B 1 512 ? 58.245 143.082 15.709  1.00 36.64  ? 512  TRP B CD2 1 
ATOM   8963  N  NE1 . TRP B 1 512 ? 58.748 141.040 14.945  1.00 37.10  ? 512  TRP B NE1 1 
ATOM   8964  C  CE2 . TRP B 1 512 ? 59.102 141.978 15.879  1.00 36.82  ? 512  TRP B CE2 1 
ATOM   8965  C  CE3 . TRP B 1 512 ? 58.408 144.186 16.551  1.00 36.49  ? 512  TRP B CE3 1 
ATOM   8966  C  CZ2 . TRP B 1 512 ? 60.102 141.947 16.850  1.00 36.68  ? 512  TRP B CZ2 1 
ATOM   8967  C  CZ3 . TRP B 1 512 ? 59.400 144.154 17.511  1.00 36.22  ? 512  TRP B CZ3 1 
ATOM   8968  C  CH2 . TRP B 1 512 ? 60.233 143.043 17.653  1.00 36.39  ? 512  TRP B CH2 1 
ATOM   8969  N  N   . ILE B 1 513 ? 55.211 143.844 10.792  1.00 37.37  ? 513  ILE B N   1 
ATOM   8970  C  CA  . ILE B 1 513 ? 53.994 143.870 9.989   1.00 37.53  ? 513  ILE B CA  1 
ATOM   8971  C  C   . ILE B 1 513 ? 53.282 142.528 10.089  1.00 37.67  ? 513  ILE B C   1 
ATOM   8972  O  O   . ILE B 1 513 ? 53.898 141.474 9.932   1.00 37.63  ? 513  ILE B O   1 
ATOM   8973  C  CB  . ILE B 1 513 ? 54.296 144.221 8.520   1.00 37.52  ? 513  ILE B CB  1 
ATOM   8974  C  CG1 . ILE B 1 513 ? 54.911 145.617 8.426   1.00 37.61  ? 513  ILE B CG1 1 
ATOM   8975  C  CG2 . ILE B 1 513 ? 53.028 144.153 7.681   1.00 37.43  ? 513  ILE B CG2 1 
ATOM   8976  C  CD1 . ILE B 1 513 ? 54.843 146.223 7.042   1.00 38.02  ? 513  ILE B CD1 1 
ATOM   8977  N  N   . TYR B 1 514 ? 51.984 142.573 10.368  1.00 37.91  ? 514  TYR B N   1 
ATOM   8978  C  CA  . TYR B 1 514 ? 51.188 141.361 10.515  1.00 38.10  ? 514  TYR B CA  1 
ATOM   8979  C  C   . TYR B 1 514 ? 50.015 141.350 9.546   1.00 38.14  ? 514  TYR B C   1 
ATOM   8980  O  O   . TYR B 1 514 ? 49.441 142.389 9.226   1.00 38.19  ? 514  TYR B O   1 
ATOM   8981  C  CB  . TYR B 1 514 ? 50.656 141.230 11.943  1.00 38.12  ? 514  TYR B CB  1 
ATOM   8982  C  CG  . TYR B 1 514 ? 51.679 140.816 12.975  1.00 38.33  ? 514  TYR B CG  1 
ATOM   8983  C  CD1 . TYR B 1 514 ? 52.727 141.656 13.329  1.00 38.47  ? 514  TYR B CD1 1 
ATOM   8984  C  CD2 . TYR B 1 514 ? 51.583 139.588 13.612  1.00 38.86  ? 514  TYR B CD2 1 
ATOM   8985  C  CE1 . TYR B 1 514 ? 53.655 141.279 14.280  1.00 38.81  ? 514  TYR B CE1 1 
ATOM   8986  C  CE2 . TYR B 1 514 ? 52.503 139.203 14.567  1.00 39.20  ? 514  TYR B CE2 1 
ATOM   8987  C  CZ  . TYR B 1 514 ? 53.535 140.051 14.898  1.00 39.23  ? 514  TYR B CZ  1 
ATOM   8988  O  OH  . TYR B 1 514 ? 54.449 139.663 15.851  1.00 39.44  ? 514  TYR B OH  1 
ATOM   8989  N  N   . SER B 1 515 ? 49.658 140.158 9.090   1.00 38.18  ? 515  SER B N   1 
ATOM   8990  C  CA  . SER B 1 515 ? 48.551 139.987 8.166   1.00 38.22  ? 515  SER B CA  1 
ATOM   8991  C  C   . SER B 1 515 ? 47.916 138.638 8.405   1.00 38.26  ? 515  SER B C   1 
ATOM   8992  O  O   . SER B 1 515 ? 48.596 137.617 8.348   1.00 38.33  ? 515  SER B O   1 
ATOM   8993  C  CB  . SER B 1 515 ? 49.051 140.051 6.724   1.00 38.26  ? 515  SER B CB  1 
ATOM   8994  O  OG  . SER B 1 515 ? 48.199 139.325 5.853   1.00 38.17  ? 515  SER B OG  1 
ATOM   8995  N  N   . ALA B 1 516 ? 46.616 138.628 8.674   1.00 38.22  ? 516  ALA B N   1 
ATOM   8996  C  CA  . ALA B 1 516 ? 45.905 137.373 8.879   1.00 38.23  ? 516  ALA B CA  1 
ATOM   8997  C  C   . ALA B 1 516 ? 46.601 136.490 9.913   1.00 38.16  ? 516  ALA B C   1 
ATOM   8998  O  O   . ALA B 1 516 ? 46.647 135.266 9.766   1.00 38.20  ? 516  ALA B O   1 
ATOM   8999  C  CB  . ALA B 1 516 ? 45.754 136.625 7.549   1.00 38.22  ? 516  ALA B CB  1 
ATOM   9000  N  N   . SER B 1 517 ? 47.146 137.122 10.948  1.00 37.99  ? 517  SER B N   1 
ATOM   9001  C  CA  . SER B 1 517 ? 47.828 136.418 12.030  1.00 37.93  ? 517  SER B CA  1 
ATOM   9002  C  C   . SER B 1 517 ? 49.044 135.620 11.564  1.00 37.85  ? 517  SER B C   1 
ATOM   9003  O  O   . SER B 1 517 ? 49.334 134.556 12.105  1.00 37.94  ? 517  SER B O   1 
ATOM   9004  C  CB  . SER B 1 517 ? 46.861 135.494 12.776  1.00 37.92  ? 517  SER B CB  1 
ATOM   9005  O  OG  . SER B 1 517 ? 46.781 134.224 12.148  1.00 38.17  ? 517  SER B OG  1 
ATOM   9006  N  N   . THR B 1 518 ? 49.752 136.128 10.561  1.00 37.72  ? 518  THR B N   1 
ATOM   9007  C  CA  . THR B 1 518 ? 50.948 135.451 10.072  1.00 37.61  ? 518  THR B CA  1 
ATOM   9008  C  C   . THR B 1 518 ? 52.104 136.432 9.906   1.00 37.59  ? 518  THR B C   1 
ATOM   9009  O  O   . THR B 1 518 ? 52.001 137.414 9.167   1.00 37.58  ? 518  THR B O   1 
ATOM   9010  C  CB  . THR B 1 518 ? 50.666 134.695 8.755   1.00 37.57  ? 518  THR B CB  1 
ATOM   9011  O  OG1 . THR B 1 518 ? 51.885 134.128 8.261   1.00 37.48  ? 518  THR B OG1 1 
ATOM   9012  C  CG2 . THR B 1 518 ? 50.254 135.655 7.649   1.00 37.52  ? 518  THR B CG2 1 
ATOM   9013  N  N   . LEU B 1 519 ? 53.202 136.171 10.608  1.00 37.55  ? 519  LEU B N   1 
ATOM   9014  C  CA  . LEU B 1 519 ? 54.364 137.047 10.531  1.00 37.54  ? 519  LEU B CA  1 
ATOM   9015  C  C   . LEU B 1 519 ? 55.118 136.834 9.223   1.00 37.64  ? 519  LEU B C   1 
ATOM   9016  O  O   . LEU B 1 519 ? 55.372 135.699 8.811   1.00 37.67  ? 519  LEU B O   1 
ATOM   9017  C  CB  . LEU B 1 519 ? 55.295 136.843 11.729  1.00 37.44  ? 519  LEU B CB  1 
ATOM   9018  C  CG  . LEU B 1 519 ? 56.398 137.896 11.862  1.00 37.18  ? 519  LEU B CG  1 
ATOM   9019  C  CD1 . LEU B 1 519 ? 55.800 139.292 11.965  1.00 37.07  ? 519  LEU B CD1 1 
ATOM   9020  C  CD2 . LEU B 1 519 ? 57.297 137.606 13.052  1.00 36.88  ? 519  LEU B CD2 1 
ATOM   9021  N  N   . GLU B 1 520 ? 55.470 137.936 8.572   1.00 37.67  ? 520  GLU B N   1 
ATOM   9022  C  CA  . GLU B 1 520 ? 56.171 137.880 7.300   1.00 37.73  ? 520  GLU B CA  1 
ATOM   9023  C  C   . GLU B 1 520 ? 57.668 137.670 7.493   1.00 37.79  ? 520  GLU B C   1 
ATOM   9024  O  O   . GLU B 1 520 ? 58.253 138.142 8.469   1.00 37.76  ? 520  GLU B O   1 
ATOM   9025  C  CB  . GLU B 1 520 ? 55.933 139.173 6.520   1.00 37.75  ? 520  GLU B CB  1 
ATOM   9026  C  CG  . GLU B 1 520 ? 54.491 139.656 6.534   1.00 37.64  ? 520  GLU B CG  1 
ATOM   9027  C  CD  . GLU B 1 520 ? 53.667 139.108 5.384   1.00 37.72  ? 520  GLU B CD  1 
ATOM   9028  O  OE1 . GLU B 1 520 ? 54.125 138.156 4.710   1.00 37.77  ? 520  GLU B OE1 1 
ATOM   9029  O  OE2 . GLU B 1 520 ? 52.559 139.637 5.151   1.00 37.37  ? 520  GLU B OE2 1 
ATOM   9030  N  N   . ARG B 1 521 ? 58.282 136.954 6.556   1.00 37.87  ? 521  ARG B N   1 
ATOM   9031  C  CA  . ARG B 1 521 ? 59.717 136.723 6.586   1.00 37.91  ? 521  ARG B CA  1 
ATOM   9032  C  C   . ARG B 1 521 ? 60.381 138.077 6.365   1.00 37.92  ? 521  ARG B C   1 
ATOM   9033  O  O   . ARG B 1 521 ? 59.904 138.876 5.561   1.00 37.94  ? 521  ARG B O   1 
ATOM   9034  C  CB  . ARG B 1 521 ? 60.106 135.742 5.482   1.00 37.89  ? 521  ARG B CB  1 
ATOM   9035  C  CG  . ARG B 1 521 ? 61.024 134.614 5.925   1.00 38.20  ? 521  ARG B CG  1 
ATOM   9036  C  CD  . ARG B 1 521 ? 61.041 133.411 4.974   1.00 38.58  ? 521  ARG B CD  1 
ATOM   9037  N  NE  . ARG B 1 521 ? 61.922 133.596 3.820   1.00 38.73  ? 521  ARG B NE  1 
ATOM   9038  C  CZ  . ARG B 1 521 ? 61.886 132.846 2.720   1.00 39.14  ? 521  ARG B CZ  1 
ATOM   9039  N  NH1 . ARG B 1 521 ? 61.006 131.860 2.613   1.00 39.36  ? 521  ARG B NH1 1 
ATOM   9040  N  NH2 . ARG B 1 521 ? 62.730 133.078 1.721   1.00 39.07  ? 521  ARG B NH2 1 
ATOM   9041  N  N   . GLY B 1 522 ? 61.462 138.349 7.088   1.00 37.95  ? 522  GLY B N   1 
ATOM   9042  C  CA  . GLY B 1 522 ? 62.147 139.624 6.960   1.00 37.98  ? 522  GLY B CA  1 
ATOM   9043  C  C   . GLY B 1 522 ? 61.982 140.458 8.214   1.00 37.95  ? 522  GLY B C   1 
ATOM   9044  O  O   . GLY B 1 522 ? 62.957 140.945 8.782   1.00 38.01  ? 522  GLY B O   1 
ATOM   9045  N  N   . TYR B 1 523 ? 60.736 140.641 8.631   1.00 37.90  ? 523  TYR B N   1 
ATOM   9046  C  CA  . TYR B 1 523 ? 60.441 141.327 9.878   1.00 37.84  ? 523  TYR B CA  1 
ATOM   9047  C  C   . TYR B 1 523 ? 60.579 140.224 10.922  1.00 37.96  ? 523  TYR B C   1 
ATOM   9048  O  O   . TYR B 1 523 ? 60.087 139.117 10.706  1.00 38.08  ? 523  TYR B O   1 
ATOM   9049  C  CB  . TYR B 1 523 ? 59.023 141.893 9.847   1.00 37.71  ? 523  TYR B CB  1 
ATOM   9050  C  CG  . TYR B 1 523 ? 58.746 142.751 8.631   1.00 37.23  ? 523  TYR B CG  1 
ATOM   9051  C  CD1 . TYR B 1 523 ? 58.508 142.181 7.388   1.00 37.15  ? 523  TYR B CD1 1 
ATOM   9052  C  CD2 . TYR B 1 523 ? 58.729 144.128 8.725   1.00 36.68  ? 523  TYR B CD2 1 
ATOM   9053  C  CE1 . TYR B 1 523 ? 58.260 142.967 6.274   1.00 36.91  ? 523  TYR B CE1 1 
ATOM   9054  C  CE2 . TYR B 1 523 ? 58.479 144.915 7.619   1.00 36.54  ? 523  TYR B CE2 1 
ATOM   9055  C  CZ  . TYR B 1 523 ? 58.248 144.336 6.399   1.00 36.51  ? 523  TYR B CZ  1 
ATOM   9056  O  OH  . TYR B 1 523 ? 58.003 145.132 5.306   1.00 36.28  ? 523  TYR B OH  1 
ATOM   9057  N  N   . PRO B 1 524 ? 61.220 140.511 12.054  1.00 37.97  ? 524  PRO B N   1 
ATOM   9058  C  CA  . PRO B 1 524 ? 61.674 141.855 12.414  1.00 37.87  ? 524  PRO B CA  1 
ATOM   9059  C  C   . PRO B 1 524 ? 63.028 142.269 11.864  1.00 37.78  ? 524  PRO B C   1 
ATOM   9060  O  O   . PRO B 1 524 ? 63.903 141.447 11.593  1.00 37.81  ? 524  PRO B O   1 
ATOM   9061  C  CB  . PRO B 1 524 ? 61.758 141.765 13.933  1.00 37.86  ? 524  PRO B CB  1 
ATOM   9062  C  CG  . PRO B 1 524 ? 62.238 140.370 14.170  1.00 38.04  ? 524  PRO B CG  1 
ATOM   9063  C  CD  . PRO B 1 524 ? 61.619 139.519 13.068  1.00 38.08  ? 524  PRO B CD  1 
ATOM   9064  N  N   . LYS B 1 525 ? 63.166 143.579 11.709  1.00 37.66  ? 525  LYS B N   1 
ATOM   9065  C  CA  . LYS B 1 525 ? 64.381 144.228 11.257  1.00 37.57  ? 525  LYS B CA  1 
ATOM   9066  C  C   . LYS B 1 525 ? 64.384 145.543 12.009  1.00 37.50  ? 525  LYS B C   1 
ATOM   9067  O  O   . LYS B 1 525 ? 63.325 146.018 12.408  1.00 37.54  ? 525  LYS B O   1 
ATOM   9068  C  CB  . LYS B 1 525 ? 64.324 144.493 9.752   1.00 37.58  ? 525  LYS B CB  1 
ATOM   9069  C  CG  . LYS B 1 525 ? 64.708 143.308 8.876   1.00 37.56  ? 525  LYS B CG  1 
ATOM   9070  C  CD  . LYS B 1 525 ? 64.550 143.652 7.400   1.00 37.65  ? 525  LYS B CD  1 
ATOM   9071  C  CE  . LYS B 1 525 ? 65.103 142.558 6.500   1.00 37.66  ? 525  LYS B CE  1 
ATOM   9072  N  NZ  . LYS B 1 525 ? 65.158 142.998 5.076   1.00 37.67  ? 525  LYS B NZ  1 
ATOM   9073  N  N   . PRO B 1 526 ? 65.552 146.137 12.220  1.00 37.46  ? 526  PRO B N   1 
ATOM   9074  C  CA  . PRO B 1 526 ? 65.631 147.410 12.943  1.00 37.43  ? 526  PRO B CA  1 
ATOM   9075  C  C   . PRO B 1 526 ? 64.786 148.509 12.293  1.00 37.36  ? 526  PRO B C   1 
ATOM   9076  O  O   . PRO B 1 526 ? 64.706 148.595 11.067  1.00 37.35  ? 526  PRO B O   1 
ATOM   9077  C  CB  . PRO B 1 526 ? 67.117 147.766 12.861  1.00 37.39  ? 526  PRO B CB  1 
ATOM   9078  C  CG  . PRO B 1 526 ? 67.805 146.463 12.656  1.00 37.42  ? 526  PRO B CG  1 
ATOM   9079  C  CD  . PRO B 1 526 ? 66.878 145.650 11.800  1.00 37.47  ? 526  PRO B CD  1 
ATOM   9080  N  N   . LEU B 1 527 ? 64.163 149.338 13.123  1.00 37.24  ? 527  LEU B N   1 
ATOM   9081  C  CA  . LEU B 1 527 ? 63.340 150.445 12.657  1.00 37.11  ? 527  LEU B CA  1 
ATOM   9082  C  C   . LEU B 1 527 ? 64.243 151.538 12.103  1.00 37.00  ? 527  LEU B C   1 
ATOM   9083  O  O   . LEU B 1 527 ? 63.774 152.593 11.681  1.00 36.93  ? 527  LEU B O   1 
ATOM   9084  C  CB  . LEU B 1 527 ? 62.538 151.004 13.831  1.00 37.17  ? 527  LEU B CB  1 
ATOM   9085  C  CG  . LEU B 1 527 ? 61.087 151.455 13.675  1.00 37.18  ? 527  LEU B CG  1 
ATOM   9086  C  CD1 . LEU B 1 527 ? 60.431 151.472 15.045  1.00 37.16  ? 527  LEU B CD1 1 
ATOM   9087  C  CD2 . LEU B 1 527 ? 60.983 152.814 13.008  1.00 37.13  ? 527  LEU B CD2 1 
ATOM   9088  N  N   . THR B 1 528 ? 65.545 151.273 12.105  1.00 36.89  ? 528  THR B N   1 
ATOM   9089  C  CA  . THR B 1 528 ? 66.529 152.247 11.652  1.00 36.83  ? 528  THR B CA  1 
ATOM   9090  C  C   . THR B 1 528 ? 66.504 152.472 10.143  1.00 36.77  ? 528  THR B C   1 
ATOM   9091  O  O   . THR B 1 528 ? 67.215 153.335 9.635   1.00 36.78  ? 528  THR B O   1 
ATOM   9092  C  CB  . THR B 1 528 ? 67.948 151.827 12.093  1.00 36.84  ? 528  THR B CB  1 
ATOM   9093  O  OG1 . THR B 1 528 ? 68.457 150.820 11.207  1.00 36.77  ? 528  THR B OG1 1 
ATOM   9094  C  CG2 . THR B 1 528 ? 67.901 151.132 13.449  1.00 36.80  ? 528  THR B CG2 1 
ATOM   9095  N  N   . SER B 1 529 ? 65.686 151.704 9.430   1.00 36.73  ? 529  SER B N   1 
ATOM   9096  C  CA  . SER B 1 529 ? 65.616 151.830 7.976   1.00 36.69  ? 529  SER B CA  1 
ATOM   9097  C  C   . SER B 1 529 ? 64.326 152.471 7.462   1.00 36.71  ? 529  SER B C   1 
ATOM   9098  O  O   . SER B 1 529 ? 64.330 153.112 6.414   1.00 36.77  ? 529  SER B O   1 
ATOM   9099  C  CB  . SER B 1 529 ? 65.854 150.479 7.296   1.00 36.69  ? 529  SER B CB  1 
ATOM   9100  O  OG  . SER B 1 529 ? 67.240 150.200 7.194   1.00 36.60  ? 529  SER B OG  1 
ATOM   9101  N  N   . LEU B 1 530 ? 63.228 152.289 8.188   1.00 36.73  ? 530  LEU B N   1 
ATOM   9102  C  CA  . LEU B 1 530 ? 61.953 152.881 7.791   1.00 36.80  ? 530  LEU B CA  1 
ATOM   9103  C  C   . LEU B 1 530 ? 62.141 154.345 7.406   1.00 36.91  ? 530  LEU B C   1 
ATOM   9104  O  O   . LEU B 1 530 ? 62.739 155.112 8.152   1.00 36.95  ? 530  LEU B O   1 
ATOM   9105  C  CB  . LEU B 1 530 ? 60.920 152.753 8.912   1.00 36.75  ? 530  LEU B CB  1 
ATOM   9106  C  CG  . LEU B 1 530 ? 59.895 151.619 8.799   1.00 36.80  ? 530  LEU B CG  1 
ATOM   9107  C  CD1 . LEU B 1 530 ? 60.520 150.349 8.247   1.00 37.00  ? 530  LEU B CD1 1 
ATOM   9108  C  CD2 . LEU B 1 530 ? 59.235 151.355 10.137  1.00 36.58  ? 530  LEU B CD2 1 
ATOM   9109  N  N   . GLY B 1 531 ? 61.629 154.715 6.236   1.00 37.02  ? 531  GLY B N   1 
ATOM   9110  C  CA  . GLY B 1 531 ? 61.748 156.059 5.685   1.00 37.06  ? 531  GLY B CA  1 
ATOM   9111  C  C   . GLY B 1 531 ? 62.273 157.202 6.541   1.00 37.14  ? 531  GLY B C   1 
ATOM   9112  O  O   . GLY B 1 531 ? 62.296 158.350 6.092   1.00 37.17  ? 531  GLY B O   1 
ATOM   9113  N  N   . LEU B 1 532 ? 62.702 156.904 7.761   1.00 37.16  ? 532  LEU B N   1 
ATOM   9114  C  CA  . LEU B 1 532 ? 63.214 157.931 8.663   1.00 37.22  ? 532  LEU B CA  1 
ATOM   9115  C  C   . LEU B 1 532 ? 64.706 157.742 8.943   1.00 37.28  ? 532  LEU B C   1 
ATOM   9116  O  O   . LEU B 1 532 ? 65.287 156.720 8.575   1.00 37.25  ? 532  LEU B O   1 
ATOM   9117  C  CB  . LEU B 1 532 ? 62.403 157.940 9.966   1.00 37.20  ? 532  LEU B CB  1 
ATOM   9118  C  CG  . LEU B 1 532 ? 62.812 157.094 11.180  1.00 37.23  ? 532  LEU B CG  1 
ATOM   9119  C  CD1 . LEU B 1 532 ? 61.608 156.845 12.080  1.00 37.08  ? 532  LEU B CD1 1 
ATOM   9120  C  CD2 . LEU B 1 532 ? 63.460 155.775 10.796  1.00 37.38  ? 532  LEU B CD2 1 
ATOM   9121  N  N   . PRO B 1 533 ? 65.332 158.740 9.559   1.00 37.35  ? 533  PRO B N   1 
ATOM   9122  C  CA  . PRO B 1 533 ? 66.743 158.649 9.945   1.00 37.40  ? 533  PRO B CA  1 
ATOM   9123  C  C   . PRO B 1 533 ? 66.920 157.639 11.076  1.00 37.45  ? 533  PRO B C   1 
ATOM   9124  O  O   . PRO B 1 533 ? 66.015 157.478 11.894  1.00 37.44  ? 533  PRO B O   1 
ATOM   9125  C  CB  . PRO B 1 533 ? 67.037 160.056 10.465  1.00 37.41  ? 533  PRO B CB  1 
ATOM   9126  C  CG  . PRO B 1 533 ? 65.713 160.515 10.955  1.00 37.36  ? 533  PRO B CG  1 
ATOM   9127  C  CD  . PRO B 1 533 ? 64.761 160.058 9.892   1.00 37.32  ? 533  PRO B CD  1 
ATOM   9128  N  N   . PRO B 1 534 ? 68.066 156.968 11.122  1.00 37.50  ? 534  PRO B N   1 
ATOM   9129  C  CA  . PRO B 1 534 ? 68.341 155.971 12.164  1.00 37.56  ? 534  PRO B CA  1 
ATOM   9130  C  C   . PRO B 1 534 ? 68.606 156.567 13.551  1.00 37.62  ? 534  PRO B C   1 
ATOM   9131  O  O   . PRO B 1 534 ? 69.500 156.088 14.246  1.00 37.65  ? 534  PRO B O   1 
ATOM   9132  C  CB  . PRO B 1 534 ? 69.611 155.276 11.653  1.00 37.56  ? 534  PRO B CB  1 
ATOM   9133  C  CG  . PRO B 1 534 ? 69.753 155.712 10.222  1.00 37.51  ? 534  PRO B CG  1 
ATOM   9134  C  CD  . PRO B 1 534 ? 69.174 157.088 10.162  1.00 37.49  ? 534  PRO B CD  1 
ATOM   9135  N  N   . ASP B 1 535 ? 67.844 157.582 13.952  1.00 37.69  ? 535  ASP B N   1 
ATOM   9136  C  CA  . ASP B 1 535 ? 68.035 158.196 15.266  1.00 37.75  ? 535  ASP B CA  1 
ATOM   9137  C  C   . ASP B 1 535 ? 66.739 158.329 16.066  1.00 37.80  ? 535  ASP B C   1 
ATOM   9138  O  O   . ASP B 1 535 ? 66.757 158.306 17.296  1.00 37.80  ? 535  ASP B O   1 
ATOM   9139  C  CB  . ASP B 1 535 ? 68.714 159.561 15.142  1.00 37.77  ? 535  ASP B CB  1 
ATOM   9140  C  CG  . ASP B 1 535 ? 68.634 160.365 16.425  1.00 37.79  ? 535  ASP B CG  1 
ATOM   9141  O  OD1 . ASP B 1 535 ? 69.155 159.896 17.460  1.00 37.84  ? 535  ASP B OD1 1 
ATOM   9142  O  OD2 . ASP B 1 535 ? 68.057 161.468 16.499  1.00 37.81  ? 535  ASP B OD2 1 
ATOM   9143  N  N   . VAL B 1 536 ? 65.618 158.484 15.368  1.00 37.87  ? 536  VAL B N   1 
ATOM   9144  C  CA  . VAL B 1 536 ? 64.317 158.572 16.026  1.00 37.91  ? 536  VAL B CA  1 
ATOM   9145  C  C   . VAL B 1 536 ? 63.668 157.192 16.014  1.00 37.93  ? 536  VAL B C   1 
ATOM   9146  O  O   . VAL B 1 536 ? 62.616 156.985 15.411  1.00 37.93  ? 536  VAL B O   1 
ATOM   9147  C  CB  . VAL B 1 536 ? 63.396 159.613 15.356  1.00 37.90  ? 536  VAL B CB  1 
ATOM   9148  C  CG1 . VAL B 1 536 ? 63.688 161.009 15.891  1.00 37.85  ? 536  VAL B CG1 1 
ATOM   9149  C  CG2 . VAL B 1 536 ? 63.551 159.574 13.846  1.00 38.08  ? 536  VAL B CG2 1 
ATOM   9150  N  N   . GLN B 1 537 ? 64.312 156.262 16.712  1.00 38.01  ? 537  GLN B N   1 
ATOM   9151  C  CA  . GLN B 1 537 ? 63.925 154.850 16.740  1.00 38.10  ? 537  GLN B CA  1 
ATOM   9152  C  C   . GLN B 1 537 ? 62.513 154.481 17.225  1.00 38.19  ? 537  GLN B C   1 
ATOM   9153  O  O   . GLN B 1 537 ? 61.853 153.654 16.600  1.00 38.19  ? 537  GLN B O   1 
ATOM   9154  C  CB  . GLN B 1 537 ? 64.978 154.039 17.505  1.00 38.05  ? 537  GLN B CB  1 
ATOM   9155  C  CG  . GLN B 1 537 ? 65.353 154.618 18.858  1.00 37.99  ? 537  GLN B CG  1 
ATOM   9156  C  CD  . GLN B 1 537 ? 66.813 154.397 19.200  1.00 37.72  ? 537  GLN B CD  1 
ATOM   9157  O  OE1 . GLN B 1 537 ? 67.595 153.973 18.351  1.00 37.55  ? 537  GLN B OE1 1 
ATOM   9158  N  NE2 . GLN B 1 537 ? 67.185 154.691 20.439  1.00 37.73  ? 537  GLN B NE2 1 
ATOM   9159  N  N   . ARG B 1 538 ? 62.052 155.061 18.330  1.00 38.28  ? 538  ARG B N   1 
ATOM   9160  C  CA  . ARG B 1 538 ? 60.725 154.710 18.843  1.00 38.34  ? 538  ARG B CA  1 
ATOM   9161  C  C   . ARG B 1 538 ? 59.617 155.661 18.379  1.00 38.31  ? 538  ARG B C   1 
ATOM   9162  O  O   . ARG B 1 538 ? 59.600 156.843 18.731  1.00 38.40  ? 538  ARG B O   1 
ATOM   9163  C  CB  . ARG B 1 538 ? 60.730 154.541 20.371  1.00 38.37  ? 538  ARG B CB  1 
ATOM   9164  C  CG  . ARG B 1 538 ? 61.508 155.594 21.152  1.00 38.90  ? 538  ARG B CG  1 
ATOM   9165  C  CD  . ARG B 1 538 ? 61.423 155.421 22.672  1.00 39.43  ? 538  ARG B CD  1 
ATOM   9166  N  NE  . ARG B 1 538 ? 62.123 156.478 23.403  1.00 39.65  ? 538  ARG B NE  1 
ATOM   9167  C  CZ  . ARG B 1 538 ? 62.183 156.558 24.728  1.00 39.52  ? 538  ARG B CZ  1 
ATOM   9168  N  NH1 . ARG B 1 538 ? 61.584 155.642 25.478  1.00 39.44  ? 538  ARG B NH1 1 
ATOM   9169  N  NH2 . ARG B 1 538 ? 62.843 157.552 25.307  1.00 39.39  ? 538  ARG B NH2 1 
ATOM   9170  N  N   . VAL B 1 539 ? 58.695 155.123 17.583  1.00 38.17  ? 539  VAL B N   1 
ATOM   9171  C  CA  . VAL B 1 539 ? 57.583 155.890 17.024  1.00 38.09  ? 539  VAL B CA  1 
ATOM   9172  C  C   . VAL B 1 539 ? 56.364 155.883 17.949  1.00 38.00  ? 539  VAL B C   1 
ATOM   9173  O  O   . VAL B 1 539 ? 55.583 154.936 17.948  1.00 37.90  ? 539  VAL B O   1 
ATOM   9174  C  CB  . VAL B 1 539 ? 57.199 155.342 15.636  1.00 38.08  ? 539  VAL B CB  1 
ATOM   9175  C  CG1 . VAL B 1 539 ? 55.824 155.827 15.221  1.00 38.12  ? 539  VAL B CG1 1 
ATOM   9176  C  CG2 . VAL B 1 539 ? 58.257 155.727 14.604  1.00 37.98  ? 539  VAL B CG2 1 
ATOM   9177  N  N   . ASP B 1 540 ? 56.200 156.959 18.718  1.00 37.94  ? 540  ASP B N   1 
ATOM   9178  C  CA  . ASP B 1 540 ? 55.144 157.065 19.732  1.00 37.88  ? 540  ASP B CA  1 
ATOM   9179  C  C   . ASP B 1 540 ? 53.694 156.930 19.264  1.00 37.73  ? 540  ASP B C   1 
ATOM   9180  O  O   . ASP B 1 540 ? 52.804 156.700 20.080  1.00 37.55  ? 540  ASP B O   1 
ATOM   9181  C  CB  . ASP B 1 540 ? 55.299 158.361 20.532  1.00 38.04  ? 540  ASP B CB  1 
ATOM   9182  C  CG  . ASP B 1 540 ? 56.022 158.151 21.847  1.00 38.30  ? 540  ASP B CG  1 
ATOM   9183  O  OD1 . ASP B 1 540 ? 55.758 157.121 22.509  1.00 38.18  ? 540  ASP B OD1 1 
ATOM   9184  O  OD2 . ASP B 1 540 ? 56.862 158.961 22.297  1.00 38.50  ? 540  ASP B OD2 1 
ATOM   9185  N  N   . ALA B 1 541 ? 53.448 157.078 17.968  1.00 37.70  ? 541  ALA B N   1 
ATOM   9186  C  CA  . ALA B 1 541 ? 52.088 156.944 17.453  1.00 37.68  ? 541  ALA B CA  1 
ATOM   9187  C  C   . ALA B 1 541 ? 52.055 156.629 15.959  1.00 37.64  ? 541  ALA B C   1 
ATOM   9188  O  O   . ALA B 1 541 ? 53.084 156.645 15.288  1.00 37.71  ? 541  ALA B O   1 
ATOM   9189  C  CB  . ALA B 1 541 ? 51.275 158.191 17.758  1.00 37.76  ? 541  ALA B CB  1 
ATOM   9190  N  N   . ALA B 1 542 ? 50.863 156.338 15.449  1.00 37.52  ? 542  ALA B N   1 
ATOM   9191  C  CA  . ALA B 1 542 ? 50.682 156.007 14.042  1.00 37.41  ? 542  ALA B CA  1 
ATOM   9192  C  C   . ALA B 1 542 ? 49.198 155.899 13.726  1.00 37.36  ? 542  ALA B C   1 
ATOM   9193  O  O   . ALA B 1 542 ? 48.372 155.826 14.636  1.00 37.33  ? 542  ALA B O   1 
ATOM   9194  C  CB  . ALA B 1 542 ? 51.392 154.708 13.708  1.00 37.35  ? 542  ALA B CB  1 
ATOM   9195  N  N   . PHE B 1 543 ? 48.862 155.895 12.440  1.00 37.35  ? 543  PHE B N   1 
ATOM   9196  C  CA  . PHE B 1 543 ? 47.469 155.786 12.024  1.00 37.32  ? 543  PHE B CA  1 
ATOM   9197  C  C   . PHE B 1 543 ? 47.271 156.203 10.572  1.00 37.29  ? 543  PHE B C   1 
ATOM   9198  O  O   . PHE B 1 543 ? 48.039 156.999 10.033  1.00 37.30  ? 543  PHE B O   1 
ATOM   9199  C  CB  . PHE B 1 543 ? 46.589 156.679 12.890  1.00 37.31  ? 543  PHE B CB  1 
ATOM   9200  C  CG  . PHE B 1 543 ? 46.436 158.061 12.345  1.00 37.34  ? 543  PHE B CG  1 
ATOM   9201  C  CD1 . PHE B 1 543 ? 47.444 158.996 12.499  1.00 37.40  ? 543  PHE B CD1 1 
ATOM   9202  C  CD2 . PHE B 1 543 ? 45.297 158.416 11.651  1.00 37.50  ? 543  PHE B CD2 1 
ATOM   9203  C  CE1 . PHE B 1 543 ? 47.308 160.264 11.984  1.00 37.63  ? 543  PHE B CE1 1 
ATOM   9204  C  CE2 . PHE B 1 543 ? 45.158 159.679 11.134  1.00 37.71  ? 543  PHE B CE2 1 
ATOM   9205  C  CZ  . PHE B 1 543 ? 46.165 160.607 11.299  1.00 37.74  ? 543  PHE B CZ  1 
ATOM   9206  N  N   . ASN B 1 544 ? 46.212 155.678 9.963   1.00 37.26  ? 544  ASN B N   1 
ATOM   9207  C  CA  . ASN B 1 544 ? 45.836 156.011 8.593   1.00 37.24  ? 544  ASN B CA  1 
ATOM   9208  C  C   . ASN B 1 544 ? 44.368 156.431 8.538   1.00 37.27  ? 544  ASN B C   1 
ATOM   9209  O  O   . ASN B 1 544 ? 43.514 155.743 9.102   1.00 37.33  ? 544  ASN B O   1 
ATOM   9210  C  CB  . ASN B 1 544 ? 46.071 154.803 7.683   1.00 37.18  ? 544  ASN B CB  1 
ATOM   9211  C  CG  . ASN B 1 544 ? 45.287 154.884 6.389   1.00 36.87  ? 544  ASN B CG  1 
ATOM   9212  O  OD1 . ASN B 1 544 ? 44.140 154.443 6.312   1.00 36.43  ? 544  ASN B OD1 1 
ATOM   9213  N  ND2 . ASN B 1 544 ? 45.906 155.441 5.364   1.00 36.75  ? 544  ASN B ND2 1 
ATOM   9214  N  N   . TRP B 1 545 ? 44.065 157.547 7.872   1.00 37.20  ? 545  TRP B N   1 
ATOM   9215  C  CA  . TRP B 1 545 ? 42.674 158.012 7.801   1.00 37.16  ? 545  TRP B CA  1 
ATOM   9216  C  C   . TRP B 1 545 ? 42.162 158.518 6.447   1.00 37.06  ? 545  TRP B C   1 
ATOM   9217  O  O   . TRP B 1 545 ? 42.928 158.947 5.585   1.00 36.99  ? 545  TRP B O   1 
ATOM   9218  C  CB  . TRP B 1 545 ? 42.373 159.040 8.899   1.00 37.21  ? 545  TRP B CB  1 
ATOM   9219  C  CG  . TRP B 1 545 ? 42.929 160.413 8.656   1.00 37.51  ? 545  TRP B CG  1 
ATOM   9220  C  CD1 . TRP B 1 545 ? 44.171 160.863 8.983   1.00 37.67  ? 545  TRP B CD1 1 
ATOM   9221  C  CD2 . TRP B 1 545 ? 42.249 161.522 8.058   1.00 37.77  ? 545  TRP B CD2 1 
ATOM   9222  N  NE1 . TRP B 1 545 ? 44.313 162.181 8.622   1.00 37.73  ? 545  TRP B NE1 1 
ATOM   9223  C  CE2 . TRP B 1 545 ? 43.145 162.610 8.050   1.00 37.84  ? 545  TRP B CE2 1 
ATOM   9224  C  CE3 . TRP B 1 545 ? 40.972 161.708 7.522   1.00 37.98  ? 545  TRP B CE3 1 
ATOM   9225  C  CZ2 . TRP B 1 545 ? 42.805 163.858 7.529   1.00 38.01  ? 545  TRP B CZ2 1 
ATOM   9226  C  CZ3 . TRP B 1 545 ? 40.639 162.946 7.002   1.00 38.06  ? 545  TRP B CZ3 1 
ATOM   9227  C  CH2 . TRP B 1 545 ? 41.551 164.004 7.010   1.00 38.05  ? 545  TRP B CH2 1 
ATOM   9228  N  N   . SER B 1 546 ? 40.840 158.459 6.312   1.00 37.00  ? 546  SER B N   1 
ATOM   9229  C  CA  . SER B 1 546 ? 40.074 158.851 5.124   1.00 37.03  ? 546  SER B CA  1 
ATOM   9230  C  C   . SER B 1 546 ? 40.792 159.489 3.930   1.00 37.05  ? 546  SER B C   1 
ATOM   9231  O  O   . SER B 1 546 ? 41.218 158.801 3.003   1.00 37.10  ? 546  SER B O   1 
ATOM   9232  C  CB  . SER B 1 546 ? 38.890 159.735 5.535   1.00 37.06  ? 546  SER B CB  1 
ATOM   9233  O  OG  . SER B 1 546 ? 38.239 160.279 4.398   1.00 37.01  ? 546  SER B OG  1 
ATOM   9234  N  N   . LYS B 1 547 ? 40.885 160.815 3.957   1.00 37.00  ? 547  LYS B N   1 
ATOM   9235  C  CA  . LYS B 1 547 ? 41.411 161.607 2.843   1.00 36.95  ? 547  LYS B CA  1 
ATOM   9236  C  C   . LYS B 1 547 ? 42.834 161.274 2.393   1.00 36.84  ? 547  LYS B C   1 
ATOM   9237  O  O   . LYS B 1 547 ? 43.040 160.748 1.302   1.00 36.85  ? 547  LYS B O   1 
ATOM   9238  C  CB  . LYS B 1 547 ? 41.310 163.097 3.175   1.00 37.03  ? 547  LYS B CB  1 
ATOM   9239  C  CG  . LYS B 1 547 ? 41.542 164.022 1.992   1.00 37.23  ? 547  LYS B CG  1 
ATOM   9240  C  CD  . LYS B 1 547 ? 41.662 165.465 2.451   1.00 37.58  ? 547  LYS B CD  1 
ATOM   9241  C  CE  . LYS B 1 547 ? 41.913 166.394 1.277   1.00 38.10  ? 547  LYS B CE  1 
ATOM   9242  N  NZ  . LYS B 1 547 ? 42.491 167.697 1.714   1.00 38.66  ? 547  LYS B NZ  1 
ATOM   9243  N  N   . ASN B 1 548 ? 43.810 161.607 3.230   1.00 36.73  ? 548  ASN B N   1 
ATOM   9244  C  CA  . ASN B 1 548 ? 45.221 161.405 2.907   1.00 36.61  ? 548  ASN B CA  1 
ATOM   9245  C  C   . ASN B 1 548 ? 45.632 159.956 2.672   1.00 36.55  ? 548  ASN B C   1 
ATOM   9246  O  O   . ASN B 1 548 ? 46.610 159.690 1.974   1.00 36.49  ? 548  ASN B O   1 
ATOM   9247  C  CB  . ASN B 1 548 ? 46.096 162.025 3.994   1.00 36.62  ? 548  ASN B CB  1 
ATOM   9248  C  CG  . ASN B 1 548 ? 45.399 162.069 5.337   1.00 36.62  ? 548  ASN B CG  1 
ATOM   9249  O  OD1 . ASN B 1 548 ? 44.501 162.880 5.552   1.00 36.61  ? 548  ASN B OD1 1 
ATOM   9250  N  ND2 . ASN B 1 548 ? 45.805 161.192 6.246   1.00 36.35  ? 548  ASN B ND2 1 
ATOM   9251  N  N   . LYS B 1 549 ? 44.887 159.024 3.255   1.00 36.50  ? 549  LYS B N   1 
ATOM   9252  C  CA  . LYS B 1 549 ? 45.190 157.604 3.107   1.00 36.46  ? 549  LYS B CA  1 
ATOM   9253  C  C   . LYS B 1 549 ? 46.679 157.307 3.266   1.00 36.45  ? 549  LYS B C   1 
ATOM   9254  O  O   . LYS B 1 549 ? 47.281 156.623 2.439   1.00 36.45  ? 549  LYS B O   1 
ATOM   9255  C  CB  . LYS B 1 549 ? 44.672 157.067 1.770   1.00 36.46  ? 549  LYS B CB  1 
ATOM   9256  C  CG  . LYS B 1 549 ? 43.240 156.570 1.828   1.00 36.34  ? 549  LYS B CG  1 
ATOM   9257  C  CD  . LYS B 1 549 ? 43.103 155.488 2.882   1.00 36.25  ? 549  LYS B CD  1 
ATOM   9258  C  CE  . LYS B 1 549 ? 41.657 155.288 3.300   1.00 36.40  ? 549  LYS B CE  1 
ATOM   9259  N  NZ  . LYS B 1 549 ? 41.554 154.425 4.517   1.00 36.38  ? 549  LYS B NZ  1 
ATOM   9260  N  N   . LYS B 1 550 ? 47.264 157.828 4.338   1.00 36.44  ? 550  LYS B N   1 
ATOM   9261  C  CA  . LYS B 1 550 ? 48.673 157.608 4.636   1.00 36.40  ? 550  LYS B CA  1 
ATOM   9262  C  C   . LYS B 1 550 ? 48.853 157.323 6.118   1.00 36.38  ? 550  LYS B C   1 
ATOM   9263  O  O   . LYS B 1 550 ? 47.892 157.337 6.882   1.00 36.37  ? 550  LYS B O   1 
ATOM   9264  C  CB  . LYS B 1 550 ? 49.502 158.835 4.259   1.00 36.43  ? 550  LYS B CB  1 
ATOM   9265  C  CG  . LYS B 1 550 ? 49.578 159.114 2.776   1.00 36.29  ? 550  LYS B CG  1 
ATOM   9266  C  CD  . LYS B 1 550 ? 50.558 160.233 2.493   1.00 36.31  ? 550  LYS B CD  1 
ATOM   9267  C  CE  . LYS B 1 550 ? 50.620 160.540 1.005   1.00 36.53  ? 550  LYS B CE  1 
ATOM   9268  N  NZ  . LYS B 1 550 ? 51.701 161.507 0.667   1.00 36.26  ? 550  LYS B NZ  1 
ATOM   9269  N  N   . THR B 1 551 ? 50.091 157.068 6.521   1.00 36.37  ? 551  THR B N   1 
ATOM   9270  C  CA  . THR B 1 551 ? 50.390 156.830 7.923   1.00 36.43  ? 551  THR B CA  1 
ATOM   9271  C  C   . THR B 1 551 ? 51.180 158.004 8.480   1.00 36.45  ? 551  THR B C   1 
ATOM   9272  O  O   . THR B 1 551 ? 52.126 158.476 7.849   1.00 36.42  ? 551  THR B O   1 
ATOM   9273  C  CB  . THR B 1 551 ? 51.183 155.530 8.107   1.00 36.44  ? 551  THR B CB  1 
ATOM   9274  O  OG1 . THR B 1 551 ? 50.533 154.462 7.405   1.00 36.48  ? 551  THR B OG1 1 
ATOM   9275  C  CG2 . THR B 1 551 ? 51.133 155.090 9.565   1.00 36.51  ? 551  THR B CG2 1 
ATOM   9276  N  N   . TYR B 1 552 ? 50.786 158.477 9.658   1.00 36.46  ? 552  TYR B N   1 
ATOM   9277  C  CA  . TYR B 1 552 ? 51.469 159.594 10.293  1.00 36.40  ? 552  TYR B CA  1 
ATOM   9278  C  C   . TYR B 1 552 ? 52.268 159.115 11.496  1.00 36.44  ? 552  TYR B C   1 
ATOM   9279  O  O   . TYR B 1 552 ? 51.705 158.802 12.543  1.00 36.45  ? 552  TYR B O   1 
ATOM   9280  C  CB  . TYR B 1 552 ? 50.468 160.659 10.725  1.00 36.37  ? 552  TYR B CB  1 
ATOM   9281  C  CG  . TYR B 1 552 ? 49.764 161.361 9.588   1.00 36.19  ? 552  TYR B CG  1 
ATOM   9282  C  CD1 . TYR B 1 552 ? 48.703 160.761 8.924   1.00 35.95  ? 552  TYR B CD1 1 
ATOM   9283  C  CD2 . TYR B 1 552 ? 50.151 162.633 9.189   1.00 36.19  ? 552  TYR B CD2 1 
ATOM   9284  C  CE1 . TYR B 1 552 ? 48.054 161.404 7.894   1.00 35.88  ? 552  TYR B CE1 1 
ATOM   9285  C  CE2 . TYR B 1 552 ? 49.506 163.284 8.161   1.00 35.98  ? 552  TYR B CE2 1 
ATOM   9286  C  CZ  . TYR B 1 552 ? 48.460 162.666 7.516   1.00 35.93  ? 552  TYR B CZ  1 
ATOM   9287  O  OH  . TYR B 1 552 ? 47.820 163.317 6.491   1.00 35.96  ? 552  TYR B OH  1 
ATOM   9288  N  N   . ILE B 1 553 ? 53.583 159.052 11.333  1.00 36.48  ? 553  ILE B N   1 
ATOM   9289  C  CA  . ILE B 1 553 ? 54.466 158.615 12.404  1.00 36.52  ? 553  ILE B CA  1 
ATOM   9290  C  C   . ILE B 1 553 ? 54.829 159.797 13.297  1.00 36.49  ? 553  ILE B C   1 
ATOM   9291  O  O   . ILE B 1 553 ? 55.536 160.709 12.871  1.00 36.47  ? 553  ILE B O   1 
ATOM   9292  C  CB  . ILE B 1 553 ? 55.741 157.968 11.823  1.00 36.59  ? 553  ILE B CB  1 
ATOM   9293  C  CG1 . ILE B 1 553 ? 55.498 156.493 11.484  1.00 36.48  ? 553  ILE B CG1 1 
ATOM   9294  C  CG2 . ILE B 1 553 ? 56.900 158.100 12.795  1.00 36.73  ? 553  ILE B CG2 1 
ATOM   9295  C  CD1 . ILE B 1 553 ? 54.788 156.263 10.162  1.00 36.30  ? 553  ILE B CD1 1 
ATOM   9296  N  N   . PHE B 1 554 ? 54.337 159.772 14.533  1.00 36.46  ? 554  PHE B N   1 
ATOM   9297  C  CA  . PHE B 1 554 ? 54.588 160.851 15.484  1.00 36.39  ? 554  PHE B CA  1 
ATOM   9298  C  C   . PHE B 1 554 ? 55.738 160.512 16.432  1.00 36.43  ? 554  PHE B C   1 
ATOM   9299  O  O   . PHE B 1 554 ? 55.916 159.354 16.818  1.00 36.29  ? 554  PHE B O   1 
ATOM   9300  C  CB  . PHE B 1 554 ? 53.319 161.161 16.278  1.00 36.32  ? 554  PHE B CB  1 
ATOM   9301  C  CG  . PHE B 1 554 ? 52.125 161.471 15.418  1.00 36.09  ? 554  PHE B CG  1 
ATOM   9302  C  CD1 . PHE B 1 554 ? 51.876 162.765 14.995  1.00 36.11  ? 554  PHE B CD1 1 
ATOM   9303  C  CD2 . PHE B 1 554 ? 51.251 160.470 15.036  1.00 35.68  ? 554  PHE B CD2 1 
ATOM   9304  C  CE1 . PHE B 1 554 ? 50.777 163.052 14.207  1.00 35.91  ? 554  PHE B CE1 1 
ATOM   9305  C  CE2 . PHE B 1 554 ? 50.151 160.751 14.250  1.00 35.53  ? 554  PHE B CE2 1 
ATOM   9306  C  CZ  . PHE B 1 554 ? 49.914 162.042 13.834  1.00 35.66  ? 554  PHE B CZ  1 
ATOM   9307  N  N   . ALA B 1 555 ? 56.514 161.529 16.805  1.00 36.49  ? 555  ALA B N   1 
ATOM   9308  C  CA  . ALA B 1 555 ? 57.667 161.334 17.682  1.00 36.57  ? 555  ALA B CA  1 
ATOM   9309  C  C   . ALA B 1 555 ? 57.867 162.471 18.680  1.00 36.60  ? 555  ALA B C   1 
ATOM   9310  O  O   . ALA B 1 555 ? 58.947 162.617 19.255  1.00 36.58  ? 555  ALA B O   1 
ATOM   9311  C  CB  . ALA B 1 555 ? 58.932 161.129 16.860  1.00 36.60  ? 555  ALA B CB  1 
ATOM   9312  N  N   . GLY B 1 556 ? 56.831 163.279 18.876  1.00 36.67  ? 556  GLY B N   1 
ATOM   9313  C  CA  . GLY B 1 556 ? 56.892 164.365 19.835  1.00 36.69  ? 556  GLY B CA  1 
ATOM   9314  C  C   . GLY B 1 556 ? 56.996 165.744 19.219  1.00 36.76  ? 556  GLY B C   1 
ATOM   9315  O  O   . GLY B 1 556 ? 55.998 166.452 19.093  1.00 36.84  ? 556  GLY B O   1 
ATOM   9316  N  N   . ASP B 1 557 ? 58.208 166.129 18.836  1.00 36.78  ? 557  ASP B N   1 
ATOM   9317  C  CA  . ASP B 1 557 ? 58.450 167.452 18.272  1.00 36.80  ? 557  ASP B CA  1 
ATOM   9318  C  C   . ASP B 1 557 ? 58.195 167.483 16.770  1.00 36.76  ? 557  ASP B C   1 
ATOM   9319  O  O   . ASP B 1 557 ? 57.732 168.489 16.229  1.00 36.82  ? 557  ASP B O   1 
ATOM   9320  C  CB  . ASP B 1 557 ? 59.885 167.890 18.565  1.00 36.87  ? 557  ASP B CB  1 
ATOM   9321  C  CG  . ASP B 1 557 ? 60.296 167.615 19.998  1.00 37.02  ? 557  ASP B CG  1 
ATOM   9322  O  OD1 . ASP B 1 557 ? 60.268 166.434 20.409  1.00 37.01  ? 557  ASP B OD1 1 
ATOM   9323  O  OD2 . ASP B 1 557 ? 60.660 168.514 20.785  1.00 37.26  ? 557  ASP B OD2 1 
ATOM   9324  N  N   . LYS B 1 558 ? 58.507 166.375 16.105  1.00 36.62  ? 558  LYS B N   1 
ATOM   9325  C  CA  . LYS B 1 558 ? 58.334 166.263 14.662  1.00 36.44  ? 558  LYS B CA  1 
ATOM   9326  C  C   . LYS B 1 558 ? 57.552 164.998 14.312  1.00 36.35  ? 558  LYS B C   1 
ATOM   9327  O  O   . LYS B 1 558 ? 57.502 164.054 15.097  1.00 36.30  ? 558  LYS B O   1 
ATOM   9328  C  CB  . LYS B 1 558 ? 59.698 166.249 13.969  1.00 36.44  ? 558  LYS B CB  1 
ATOM   9329  C  CG  . LYS B 1 558 ? 60.629 167.374 14.393  1.00 36.21  ? 558  LYS B CG  1 
ATOM   9330  C  CD  . LYS B 1 558 ? 62.051 167.123 13.913  1.00 36.09  ? 558  LYS B CD  1 
ATOM   9331  C  CE  . LYS B 1 558 ? 62.929 168.345 14.121  1.00 36.07  ? 558  LYS B CE  1 
ATOM   9332  N  NZ  . LYS B 1 558 ? 64.338 168.095 13.714  1.00 35.85  ? 558  LYS B NZ  1 
ATOM   9333  N  N   . PHE B 1 559 ? 56.940 164.984 13.132  1.00 36.28  ? 559  PHE B N   1 
ATOM   9334  C  CA  . PHE B 1 559 ? 56.162 163.832 12.696  1.00 36.29  ? 559  PHE B CA  1 
ATOM   9335  C  C   . PHE B 1 559 ? 56.425 163.506 11.229  1.00 36.40  ? 559  PHE B C   1 
ATOM   9336  O  O   . PHE B 1 559 ? 56.779 164.378 10.441  1.00 36.43  ? 559  PHE B O   1 
ATOM   9337  C  CB  . PHE B 1 559 ? 54.676 164.083 12.903  1.00 36.25  ? 559  PHE B CB  1 
ATOM   9338  C  CG  . PHE B 1 559 ? 54.060 164.903 11.826  1.00 36.09  ? 559  PHE B CG  1 
ATOM   9339  C  CD1 . PHE B 1 559 ? 54.308 166.261 11.750  1.00 36.45  ? 559  PHE B CD1 1 
ATOM   9340  C  CD2 . PHE B 1 559 ? 53.250 164.314 10.875  1.00 35.86  ? 559  PHE B CD2 1 
ATOM   9341  C  CE1 . PHE B 1 559 ? 53.750 167.017 10.755  1.00 36.49  ? 559  PHE B CE1 1 
ATOM   9342  C  CE2 . PHE B 1 559 ? 52.692 165.060 9.880   1.00 36.08  ? 559  PHE B CE2 1 
ATOM   9343  C  CZ  . PHE B 1 559 ? 52.946 166.415 9.818   1.00 36.50  ? 559  PHE B CZ  1 
ATOM   9344  N  N   . TRP B 1 560 ? 56.226 162.244 10.866  1.00 36.58  ? 560  TRP B N   1 
ATOM   9345  C  CA  . TRP B 1 560 ? 56.509 161.782 9.513   1.00 36.66  ? 560  TRP B CA  1 
ATOM   9346  C  C   . TRP B 1 560 ? 55.271 161.294 8.776   1.00 36.74  ? 560  TRP B C   1 
ATOM   9347  O  O   . TRP B 1 560 ? 54.193 161.175 9.358   1.00 36.73  ? 560  TRP B O   1 
ATOM   9348  C  CB  . TRP B 1 560 ? 57.543 160.659 9.561   1.00 36.67  ? 560  TRP B CB  1 
ATOM   9349  C  CG  . TRP B 1 560 ? 58.907 161.123 9.946   1.00 36.69  ? 560  TRP B CG  1 
ATOM   9350  C  CD1 . TRP B 1 560 ? 59.975 161.297 9.118   1.00 36.64  ? 560  TRP B CD1 1 
ATOM   9351  C  CD2 . TRP B 1 560 ? 59.357 161.479 11.258  1.00 36.78  ? 560  TRP B CD2 1 
ATOM   9352  N  NE1 . TRP B 1 560 ? 61.063 161.737 9.833   1.00 36.68  ? 560  TRP B NE1 1 
ATOM   9353  C  CE2 . TRP B 1 560 ? 60.709 161.858 11.151  1.00 36.69  ? 560  TRP B CE2 1 
ATOM   9354  C  CE3 . TRP B 1 560 ? 58.754 161.512 12.519  1.00 36.99  ? 560  TRP B CE3 1 
ATOM   9355  C  CZ2 . TRP B 1 560 ? 61.462 162.267 12.249  1.00 36.70  ? 560  TRP B CZ2 1 
ATOM   9356  C  CZ3 . TRP B 1 560 ? 59.503 161.921 13.606  1.00 37.06  ? 560  TRP B CZ3 1 
ATOM   9357  C  CH2 . TRP B 1 560 ? 60.842 162.292 13.465  1.00 36.88  ? 560  TRP B CH2 1 
ATOM   9358  N  N   . ARG B 1 561 ? 55.439 161.012 7.487   1.00 36.82  ? 561  ARG B N   1 
ATOM   9359  C  CA  . ARG B 1 561 ? 54.354 160.490 6.664   1.00 36.89  ? 561  ARG B CA  1 
ATOM   9360  C  C   . ARG B 1 561 ? 54.840 159.375 5.747   1.00 36.94  ? 561  ARG B C   1 
ATOM   9361  O  O   . ARG B 1 561 ? 55.735 159.567 4.926   1.00 36.96  ? 561  ARG B O   1 
ATOM   9362  C  CB  . ARG B 1 561 ? 53.690 161.599 5.857   1.00 36.82  ? 561  ARG B CB  1 
ATOM   9363  C  CG  . ARG B 1 561 ? 53.233 162.757 6.708   1.00 36.95  ? 561  ARG B CG  1 
ATOM   9364  C  CD  . ARG B 1 561 ? 52.064 163.506 6.135   1.00 37.24  ? 561  ARG B CD  1 
ATOM   9365  N  NE  . ARG B 1 561 ? 52.284 163.888 4.745   1.00 37.47  ? 561  ARG B NE  1 
ATOM   9366  C  CZ  . ARG B 1 561 ? 51.356 163.808 3.804   1.00 37.52  ? 561  ARG B CZ  1 
ATOM   9367  N  NH1 . ARG B 1 561 ? 50.145 163.358 4.108   1.00 37.49  ? 561  ARG B NH1 1 
ATOM   9368  N  NH2 . ARG B 1 561 ? 51.631 164.182 2.561   1.00 37.26  ? 561  ARG B NH2 1 
ATOM   9369  N  N   . TYR B 1 562 ? 54.226 158.211 5.894   1.00 36.99  ? 562  TYR B N   1 
ATOM   9370  C  CA  . TYR B 1 562 ? 54.606 157.032 5.139   1.00 37.07  ? 562  TYR B CA  1 
ATOM   9371  C  C   . TYR B 1 562 ? 53.631 156.770 3.990   1.00 37.13  ? 562  TYR B C   1 
ATOM   9372  O  O   . TYR B 1 562 ? 52.498 157.248 4.005   1.00 37.08  ? 562  TYR B O   1 
ATOM   9373  C  CB  . TYR B 1 562 ? 54.663 155.843 6.100   1.00 37.07  ? 562  TYR B CB  1 
ATOM   9374  C  CG  . TYR B 1 562 ? 54.853 154.502 5.452   1.00 37.04  ? 562  TYR B CG  1 
ATOM   9375  C  CD1 . TYR B 1 562 ? 55.887 154.279 4.552   1.00 36.89  ? 562  TYR B CD1 1 
ATOM   9376  C  CD2 . TYR B 1 562 ? 54.005 153.450 5.751   1.00 37.20  ? 562  TYR B CD2 1 
ATOM   9377  C  CE1 . TYR B 1 562 ? 56.062 153.050 3.960   1.00 36.92  ? 562  TYR B CE1 1 
ATOM   9378  C  CE2 . TYR B 1 562 ? 54.177 152.223 5.171   1.00 37.22  ? 562  TYR B CE2 1 
ATOM   9379  C  CZ  . TYR B 1 562 ? 55.204 152.025 4.271   1.00 37.07  ? 562  TYR B CZ  1 
ATOM   9380  O  OH  . TYR B 1 562 ? 55.375 150.793 3.683   1.00 37.02  ? 562  TYR B OH  1 
ATOM   9381  N  N   . ASN B 1 563 ? 54.087 156.036 2.979   1.00 37.27  ? 563  ASN B N   1 
ATOM   9382  C  CA  . ASN B 1 563 ? 53.231 155.673 1.855   1.00 37.37  ? 563  ASN B CA  1 
ATOM   9383  C  C   . ASN B 1 563 ? 53.502 154.246 1.370   1.00 37.45  ? 563  ASN B C   1 
ATOM   9384  O  O   . ASN B 1 563 ? 54.546 153.962 0.787   1.00 37.54  ? 563  ASN B O   1 
ATOM   9385  C  CB  . ASN B 1 563 ? 53.335 156.696 0.714   1.00 37.31  ? 563  ASN B CB  1 
ATOM   9386  C  CG  . ASN B 1 563 ? 54.661 156.640 -0.011  1.00 37.33  ? 563  ASN B CG  1 
ATOM   9387  O  OD1 . ASN B 1 563 ? 55.234 157.670 -0.362  1.00 37.66  ? 563  ASN B OD1 1 
ATOM   9388  N  ND2 . ASN B 1 563 ? 55.149 155.437 -0.253  1.00 37.34  ? 563  ASN B ND2 1 
ATOM   9389  N  N   . GLU B 1 564 ? 52.553 153.350 1.620   1.00 37.49  ? 564  GLU B N   1 
ATOM   9390  C  CA  . GLU B 1 564 ? 52.701 151.947 1.245   1.00 37.51  ? 564  GLU B CA  1 
ATOM   9391  C  C   . GLU B 1 564 ? 52.736 151.708 -0.257  1.00 37.47  ? 564  GLU B C   1 
ATOM   9392  O  O   . GLU B 1 564 ? 53.122 150.631 -0.705  1.00 37.41  ? 564  GLU B O   1 
ATOM   9393  C  CB  . GLU B 1 564 ? 51.573 151.119 1.853   1.00 37.57  ? 564  GLU B CB  1 
ATOM   9394  C  CG  . GLU B 1 564 ? 51.423 151.300 3.349   1.00 37.80  ? 564  GLU B CG  1 
ATOM   9395  C  CD  . GLU B 1 564 ? 52.489 150.582 4.146   1.00 38.10  ? 564  GLU B CD  1 
ATOM   9396  O  OE1 . GLU B 1 564 ? 53.402 149.994 3.528   1.00 38.35  ? 564  GLU B OE1 1 
ATOM   9397  O  OE2 . GLU B 1 564 ? 52.415 150.611 5.394   1.00 38.22  ? 564  GLU B OE2 1 
ATOM   9398  N  N   . VAL B 1 565 ? 52.326 152.707 -1.032  1.00 37.49  ? 565  VAL B N   1 
ATOM   9399  C  CA  . VAL B 1 565 ? 52.303 152.576 -2.486  1.00 37.54  ? 565  VAL B CA  1 
ATOM   9400  C  C   . VAL B 1 565 ? 53.574 153.090 -3.151  1.00 37.59  ? 565  VAL B C   1 
ATOM   9401  O  O   . VAL B 1 565 ? 53.726 152.994 -4.367  1.00 37.64  ? 565  VAL B O   1 
ATOM   9402  C  CB  . VAL B 1 565 ? 51.076 153.264 -3.107  1.00 37.52  ? 565  VAL B CB  1 
ATOM   9403  C  CG1 . VAL B 1 565 ? 49.855 152.367 -2.992  1.00 37.50  ? 565  VAL B CG1 1 
ATOM   9404  C  CG2 . VAL B 1 565 ? 50.835 154.617 -2.457  1.00 37.53  ? 565  VAL B CG2 1 
ATOM   9405  N  N   . LYS B 1 566 ? 54.471 153.657 -2.354  1.00 37.64  ? 566  LYS B N   1 
ATOM   9406  C  CA  . LYS B 1 566 ? 55.765 154.109 -2.852  1.00 37.71  ? 566  LYS B CA  1 
ATOM   9407  C  C   . LYS B 1 566 ? 56.838 153.615 -1.892  1.00 37.76  ? 566  LYS B C   1 
ATOM   9408  O  O   . LYS B 1 566 ? 58.033 153.698 -2.177  1.00 37.80  ? 566  LYS B O   1 
ATOM   9409  C  CB  . LYS B 1 566 ? 55.827 155.634 -2.963  1.00 37.70  ? 566  LYS B CB  1 
ATOM   9410  C  CG  . LYS B 1 566 ? 54.779 156.268 -3.862  1.00 37.72  ? 566  LYS B CG  1 
ATOM   9411  C  CD  . LYS B 1 566 ? 55.105 157.737 -4.096  1.00 37.75  ? 566  LYS B CD  1 
ATOM   9412  C  CE  . LYS B 1 566 ? 53.930 158.492 -4.690  1.00 37.76  ? 566  LYS B CE  1 
ATOM   9413  N  NZ  . LYS B 1 566 ? 53.562 158.012 -6.050  1.00 37.79  ? 566  LYS B NZ  1 
ATOM   9414  N  N   . LYS B 1 567 ? 56.388 153.097 -0.752  1.00 37.81  ? 567  LYS B N   1 
ATOM   9415  C  CA  . LYS B 1 567 ? 57.264 152.585 0.301   1.00 37.87  ? 567  LYS B CA  1 
ATOM   9416  C  C   . LYS B 1 567 ? 58.344 153.576 0.720   1.00 37.90  ? 567  LYS B C   1 
ATOM   9417  O  O   . LYS B 1 567 ? 59.076 153.336 1.681   1.00 37.92  ? 567  LYS B O   1 
ATOM   9418  C  CB  . LYS B 1 567 ? 57.888 151.247 -0.104  1.00 37.87  ? 567  LYS B CB  1 
ATOM   9419  C  CG  . LYS B 1 567 ? 56.896 150.094 -0.166  1.00 38.03  ? 567  LYS B CG  1 
ATOM   9420  C  CD  . LYS B 1 567 ? 57.589 148.785 -0.533  1.00 38.29  ? 567  LYS B CD  1 
ATOM   9421  C  CE  . LYS B 1 567 ? 58.186 148.088 0.689   1.00 38.32  ? 567  LYS B CE  1 
ATOM   9422  N  NZ  . LYS B 1 567 ? 57.214 147.178 1.367   1.00 38.03  ? 567  LYS B NZ  1 
ATOM   9423  N  N   . LYS B 1 568 ? 58.437 154.691 0.001   1.00 37.92  ? 568  LYS B N   1 
ATOM   9424  C  CA  . LYS B 1 568 ? 59.416 155.722 0.312   1.00 37.98  ? 568  LYS B CA  1 
ATOM   9425  C  C   . LYS B 1 568 ? 58.795 156.818 1.177   1.00 38.04  ? 568  LYS B C   1 
ATOM   9426  O  O   . LYS B 1 568 ? 57.675 157.261 0.925   1.00 38.09  ? 568  LYS B O   1 
ATOM   9427  C  CB  . LYS B 1 568 ? 60.003 156.321 -0.972  1.00 37.98  ? 568  LYS B CB  1 
ATOM   9428  C  CG  . LYS B 1 568 ? 59.014 157.114 -1.822  1.00 38.00  ? 568  LYS B CG  1 
ATOM   9429  C  CD  . LYS B 1 568 ? 59.666 157.638 -3.099  1.00 38.06  ? 568  LYS B CD  1 
ATOM   9430  C  CE  . LYS B 1 568 ? 58.698 158.491 -3.911  1.00 38.11  ? 568  LYS B CE  1 
ATOM   9431  N  NZ  . LYS B 1 568 ? 59.311 159.023 -5.163  1.00 38.00  ? 568  LYS B NZ  1 
ATOM   9432  N  N   . MET B 1 569 ? 59.516 157.239 2.211   1.00 38.07  ? 569  MET B N   1 
ATOM   9433  C  CA  . MET B 1 569 ? 59.036 158.315 3.066   1.00 38.07  ? 569  MET B CA  1 
ATOM   9434  C  C   . MET B 1 569 ? 59.536 159.640 2.504   1.00 38.14  ? 569  MET B C   1 
ATOM   9435  O  O   . MET B 1 569 ? 60.721 159.800 2.215   1.00 38.16  ? 569  MET B O   1 
ATOM   9436  C  CB  . MET B 1 569 ? 59.488 158.118 4.510   1.00 38.03  ? 569  MET B CB  1 
ATOM   9437  C  CG  . MET B 1 569 ? 58.670 158.895 5.524   1.00 37.88  ? 569  MET B CG  1 
ATOM   9438  S  SD  . MET B 1 569 ? 58.879 158.283 7.208   1.00 37.31  ? 569  MET B SD  1 
ATOM   9439  C  CE  . MET B 1 569 ? 58.372 156.587 7.016   1.00 37.62  ? 569  MET B CE  1 
ATOM   9440  N  N   . ASP B 1 570 ? 58.615 160.584 2.364   1.00 38.21  ? 570  ASP B N   1 
ATOM   9441  C  CA  . ASP B 1 570 ? 58.869 161.859 1.690   1.00 38.34  ? 570  ASP B CA  1 
ATOM   9442  C  C   . ASP B 1 570 ? 60.092 162.670 2.118   1.00 38.41  ? 570  ASP B C   1 
ATOM   9443  O  O   . ASP B 1 570 ? 60.546 162.596 3.263   1.00 38.41  ? 570  ASP B O   1 
ATOM   9444  C  CB  . ASP B 1 570 ? 57.592 162.692 1.695   1.00 38.34  ? 570  ASP B CB  1 
ATOM   9445  C  CG  . ASP B 1 570 ? 56.413 161.913 1.154   1.00 38.29  ? 570  ASP B CG  1 
ATOM   9446  O  OD1 . ASP B 1 570 ? 56.641 160.827 0.577   1.00 38.24  ? 570  ASP B OD1 1 
ATOM   9447  O  OD2 . ASP B 1 570 ? 55.231 162.288 1.263   1.00 38.10  ? 570  ASP B OD2 1 
ATOM   9448  N  N   . PRO B 1 571 ? 60.597 163.459 1.170   1.00 38.47  ? 571  PRO B N   1 
ATOM   9449  C  CA  . PRO B 1 571 ? 61.830 164.231 1.340   1.00 38.56  ? 571  PRO B CA  1 
ATOM   9450  C  C   . PRO B 1 571 ? 61.822 165.162 2.526   1.00 38.68  ? 571  PRO B C   1 
ATOM   9451  O  O   . PRO B 1 571 ? 61.132 166.182 2.549   1.00 38.66  ? 571  PRO B O   1 
ATOM   9452  C  CB  . PRO B 1 571 ? 61.916 165.046 0.050   1.00 38.52  ? 571  PRO B CB  1 
ATOM   9453  C  CG  . PRO B 1 571 ? 61.142 164.266 -0.927  1.00 38.47  ? 571  PRO B CG  1 
ATOM   9454  C  CD  . PRO B 1 571 ? 59.999 163.678 -0.157  1.00 38.44  ? 571  PRO B CD  1 
ATOM   9455  N  N   . GLY B 1 572 ? 62.613 164.781 3.512   1.00 38.85  ? 572  GLY B N   1 
ATOM   9456  C  CA  . GLY B 1 572 ? 62.820 165.584 4.684   1.00 39.05  ? 572  GLY B CA  1 
ATOM   9457  C  C   . GLY B 1 572 ? 61.672 166.421 5.196   1.00 39.21  ? 572  GLY B C   1 
ATOM   9458  O  O   . GLY B 1 572 ? 61.654 167.643 5.004   1.00 39.15  ? 572  GLY B O   1 
ATOM   9459  N  N   . PHE B 1 573 ? 60.679 165.775 5.798   1.00 39.39  ? 573  PHE B N   1 
ATOM   9460  C  CA  . PHE B 1 573 ? 59.849 166.563 6.669   1.00 39.51  ? 573  PHE B CA  1 
ATOM   9461  C  C   . PHE B 1 573 ? 61.176 166.943 7.368   1.00 39.74  ? 573  PHE B C   1 
ATOM   9462  O  O   . PHE B 1 573 ? 62.211 166.631 6.792   1.00 39.87  ? 573  PHE B O   1 
ATOM   9463  C  CB  . PHE B 1 573 ? 58.807 165.674 7.365   1.00 39.31  ? 573  PHE B CB  1 
ATOM   9464  C  CG  . PHE B 1 573 ? 57.690 165.245 6.422   1.00 38.91  ? 573  PHE B CG  1 
ATOM   9465  C  CD1 . PHE B 1 573 ? 56.994 166.195 5.689   1.00 38.78  ? 573  PHE B CD1 1 
ATOM   9466  C  CD2 . PHE B 1 573 ? 57.385 163.913 6.213   1.00 38.65  ? 573  PHE B CD2 1 
ATOM   9467  C  CE1 . PHE B 1 573 ? 55.995 165.829 4.797   1.00 38.60  ? 573  PHE B CE1 1 
ATOM   9468  C  CE2 . PHE B 1 573 ? 56.384 163.545 5.316   1.00 38.51  ? 573  PHE B CE2 1 
ATOM   9469  C  CZ  . PHE B 1 573 ? 55.690 164.507 4.611   1.00 38.25  ? 573  PHE B CZ  1 
ATOM   9470  N  N   . PRO B 1 574 ? 61.274 167.490 8.565   1.00 39.88  ? 574  PRO B N   1 
ATOM   9471  C  CA  . PRO B 1 574 ? 60.249 167.539 9.581   1.00 39.93  ? 574  PRO B CA  1 
ATOM   9472  C  C   . PRO B 1 574 ? 59.303 168.678 9.435   1.00 39.99  ? 574  PRO B C   1 
ATOM   9473  O  O   . PRO B 1 574 ? 59.195 169.379 8.425   1.00 39.99  ? 574  PRO B O   1 
ATOM   9474  C  CB  . PRO B 1 574 ? 61.080 167.772 10.834  1.00 39.93  ? 574  PRO B CB  1 
ATOM   9475  C  CG  . PRO B 1 574 ? 62.120 168.755 10.353  1.00 39.97  ? 574  PRO B CG  1 
ATOM   9476  C  CD  . PRO B 1 574 ? 62.452 168.292 8.947   1.00 39.87  ? 574  PRO B CD  1 
ATOM   9477  N  N   . LYS B 1 575 ? 58.613 168.848 10.542  1.00 40.00  ? 575  LYS B N   1 
ATOM   9478  C  CA  . LYS B 1 575 ? 57.579 169.812 10.683  1.00 40.02  ? 575  LYS B CA  1 
ATOM   9479  C  C   . LYS B 1 575 ? 57.561 170.013 12.165  1.00 39.98  ? 575  LYS B C   1 
ATOM   9480  O  O   . LYS B 1 575 ? 58.504 169.671 12.881  1.00 40.06  ? 575  LYS B O   1 
ATOM   9481  C  CB  . LYS B 1 575 ? 56.251 169.161 10.308  1.00 40.03  ? 575  LYS B CB  1 
ATOM   9482  C  CG  . LYS B 1 575 ? 56.253 168.383 9.009   1.00 39.82  ? 575  LYS B CG  1 
ATOM   9483  C  CD  . LYS B 1 575 ? 56.070 169.332 7.847   1.00 39.75  ? 575  LYS B CD  1 
ATOM   9484  C  CE  . LYS B 1 575 ? 55.379 168.653 6.690   1.00 39.59  ? 575  LYS B CE  1 
ATOM   9485  N  NZ  . LYS B 1 575 ? 54.876 169.645 5.706   1.00 39.41  ? 575  LYS B NZ  1 
ATOM   9486  N  N   . LEU B 1 576 ? 56.454 170.563 12.617  1.00 39.80  ? 576  LEU B N   1 
ATOM   9487  C  CA  . LEU B 1 576 ? 56.163 170.666 14.015  1.00 39.56  ? 576  LEU B CA  1 
ATOM   9488  C  C   . LEU B 1 576 ? 54.722 170.207 13.958  1.00 39.37  ? 576  LEU B C   1 
ATOM   9489  O  O   . LEU B 1 576 ? 53.897 170.831 13.299  1.00 39.40  ? 576  LEU B O   1 
ATOM   9490  C  CB  . LEU B 1 576 ? 56.327 172.108 14.486  1.00 39.64  ? 576  LEU B CB  1 
ATOM   9491  C  CG  . LEU B 1 576 ? 57.745 172.633 14.206  1.00 39.60  ? 576  LEU B CG  1 
ATOM   9492  C  CD1 . LEU B 1 576 ? 57.876 174.123 14.481  1.00 39.28  ? 576  LEU B CD1 1 
ATOM   9493  C  CD2 . LEU B 1 576 ? 58.792 171.838 14.993  1.00 39.78  ? 576  LEU B CD2 1 
ATOM   9494  N  N   . ILE B 1 577 ? 54.435 169.073 14.579  1.00 39.09  ? 577  ILE B N   1 
ATOM   9495  C  CA  . ILE B 1 577 ? 53.097 168.504 14.514  1.00 38.81  ? 577  ILE B CA  1 
ATOM   9496  C  C   . ILE B 1 577 ? 52.001 169.567 14.555  1.00 38.63  ? 577  ILE B C   1 
ATOM   9497  O  O   . ILE B 1 577 ? 51.061 169.528 13.760  1.00 38.60  ? 577  ILE B O   1 
ATOM   9498  C  CB  . ILE B 1 577 ? 52.899 167.468 15.635  1.00 38.83  ? 577  ILE B CB  1 
ATOM   9499  C  CG1 . ILE B 1 577 ? 53.999 166.405 15.566  1.00 38.64  ? 577  ILE B CG1 1 
ATOM   9500  C  CG2 . ILE B 1 577 ? 51.526 166.824 15.529  1.00 38.90  ? 577  ILE B CG2 1 
ATOM   9501  C  CD1 . ILE B 1 577 ? 53.897 165.337 16.631  1.00 38.02  ? 577  ILE B CD1 1 
ATOM   9502  N  N   . ALA B 1 578 ? 52.138 170.528 15.461  1.00 38.41  ? 578  ALA B N   1 
ATOM   9503  C  CA  . ALA B 1 578 ? 51.126 171.569 15.633  1.00 38.25  ? 578  ALA B CA  1 
ATOM   9504  C  C   . ALA B 1 578 ? 51.050 172.558 14.468  1.00 38.11  ? 578  ALA B C   1 
ATOM   9505  O  O   . ALA B 1 578 ? 50.212 173.457 14.462  1.00 38.13  ? 578  ALA B O   1 
ATOM   9506  C  CB  . ALA B 1 578 ? 51.340 172.302 16.949  1.00 38.26  ? 578  ALA B CB  1 
ATOM   9507  N  N   . ASP B 1 579 ? 51.925 172.383 13.485  1.00 37.96  ? 579  ASP B N   1 
ATOM   9508  C  CA  . ASP B 1 579 ? 51.948 173.242 12.307  1.00 37.81  ? 579  ASP B CA  1 
ATOM   9509  C  C   . ASP B 1 579 ? 50.810 172.879 11.351  1.00 37.81  ? 579  ASP B C   1 
ATOM   9510  O  O   . ASP B 1 579 ? 50.311 173.727 10.614  1.00 37.64  ? 579  ASP B O   1 
ATOM   9511  C  CB  . ASP B 1 579 ? 53.318 173.134 11.625  1.00 37.74  ? 579  ASP B CB  1 
ATOM   9512  C  CG  . ASP B 1 579 ? 53.284 173.500 10.158  1.00 37.61  ? 579  ASP B CG  1 
ATOM   9513  O  OD1 . ASP B 1 579 ? 52.465 172.926 9.411   1.00 37.33  ? 579  ASP B OD1 1 
ATOM   9514  O  OD2 . ASP B 1 579 ? 54.059 174.340 9.657   1.00 37.67  ? 579  ASP B OD2 1 
ATOM   9515  N  N   . ALA B 1 580 ? 50.389 171.617 11.383  1.00 37.87  ? 580  ALA B N   1 
ATOM   9516  C  CA  . ALA B 1 580 ? 49.309 171.141 10.520  1.00 37.90  ? 580  ALA B CA  1 
ATOM   9517  C  C   . ALA B 1 580 ? 47.996 171.035 11.276  1.00 37.88  ? 580  ALA B C   1 
ATOM   9518  O  O   . ALA B 1 580 ? 47.051 171.782 11.021  1.00 38.01  ? 580  ALA B O   1 
ATOM   9519  C  CB  . ALA B 1 580 ? 49.663 169.804 9.937   1.00 37.83  ? 580  ALA B CB  1 
ATOM   9520  N  N   . TRP B 1 581 ? 47.944 170.085 12.201  1.00 37.81  ? 581  TRP B N   1 
ATOM   9521  C  CA  . TRP B 1 581 ? 46.760 169.871 13.017  1.00 37.78  ? 581  TRP B CA  1 
ATOM   9522  C  C   . TRP B 1 581 ? 46.574 171.033 13.989  1.00 37.80  ? 581  TRP B C   1 
ATOM   9523  O  O   . TRP B 1 581 ? 47.486 171.836 14.196  1.00 37.78  ? 581  TRP B O   1 
ATOM   9524  C  CB  . TRP B 1 581 ? 46.881 168.553 13.786  1.00 37.72  ? 581  TRP B CB  1 
ATOM   9525  C  CG  . TRP B 1 581 ? 47.596 167.485 13.018  1.00 37.48  ? 581  TRP B CG  1 
ATOM   9526  C  CD1 . TRP B 1 581 ? 48.942 167.256 12.990  1.00 37.31  ? 581  TRP B CD1 1 
ATOM   9527  C  CD2 . TRP B 1 581 ? 47.008 166.503 12.159  1.00 37.32  ? 581  TRP B CD2 1 
ATOM   9528  N  NE1 . TRP B 1 581 ? 49.226 166.194 12.167  1.00 37.14  ? 581  TRP B NE1 1 
ATOM   9529  C  CE2 . TRP B 1 581 ? 48.055 165.714 11.643  1.00 37.15  ? 581  TRP B CE2 1 
ATOM   9530  C  CE3 . TRP B 1 581 ? 45.697 166.209 11.768  1.00 37.27  ? 581  TRP B CE3 1 
ATOM   9531  C  CZ2 . TRP B 1 581 ? 47.832 164.657 10.767  1.00 37.03  ? 581  TRP B CZ2 1 
ATOM   9532  C  CZ3 . TRP B 1 581 ? 45.479 165.160 10.898  1.00 37.13  ? 581  TRP B CZ3 1 
ATOM   9533  C  CH2 . TRP B 1 581 ? 46.540 164.397 10.407  1.00 37.03  ? 581  TRP B CH2 1 
ATOM   9534  N  N   . ASN B 1 582 ? 45.387 171.127 14.576  1.00 37.78  ? 582  ASN B N   1 
ATOM   9535  C  CA  . ASN B 1 582 ? 45.105 172.179 15.539  1.00 37.76  ? 582  ASN B CA  1 
ATOM   9536  C  C   . ASN B 1 582 ? 44.782 171.588 16.905  1.00 37.71  ? 582  ASN B C   1 
ATOM   9537  O  O   . ASN B 1 582 ? 43.895 170.743 17.032  1.00 37.73  ? 582  ASN B O   1 
ATOM   9538  C  CB  . ASN B 1 582 ? 43.969 173.079 15.047  1.00 37.83  ? 582  ASN B CB  1 
ATOM   9539  C  CG  . ASN B 1 582 ? 44.131 173.484 13.588  1.00 37.95  ? 582  ASN B CG  1 
ATOM   9540  O  OD1 . ASN B 1 582 ? 43.152 173.592 12.850  1.00 38.18  ? 582  ASN B OD1 1 
ATOM   9541  N  ND2 . ASN B 1 582 ? 45.372 173.713 13.168  1.00 37.93  ? 582  ASN B ND2 1 
ATOM   9542  N  N   . ALA B 1 583 ? 45.523 172.028 17.916  1.00 37.64  ? 583  ALA B N   1 
ATOM   9543  C  CA  . ALA B 1 583 ? 45.345 171.555 19.287  1.00 37.54  ? 583  ALA B CA  1 
ATOM   9544  C  C   . ALA B 1 583 ? 45.870 170.142 19.482  1.00 37.48  ? 583  ALA B C   1 
ATOM   9545  O  O   . ALA B 1 583 ? 45.245 169.336 20.161  1.00 37.52  ? 583  ALA B O   1 
ATOM   9546  C  CB  . ALA B 1 583 ? 43.882 171.643 19.707  1.00 37.50  ? 583  ALA B CB  1 
ATOM   9547  N  N   . ILE B 1 584 ? 47.013 169.838 18.876  1.00 37.45  ? 584  ILE B N   1 
ATOM   9548  C  CA  . ILE B 1 584 ? 47.628 168.523 19.033  1.00 37.42  ? 584  ILE B CA  1 
ATOM   9549  C  C   . ILE B 1 584 ? 49.017 168.706 19.623  1.00 37.50  ? 584  ILE B C   1 
ATOM   9550  O  O   . ILE B 1 584 ? 49.944 169.142 18.941  1.00 37.61  ? 584  ILE B O   1 
ATOM   9551  C  CB  . ILE B 1 584 ? 47.692 167.780 17.699  1.00 37.35  ? 584  ILE B CB  1 
ATOM   9552  C  CG1 . ILE B 1 584 ? 46.306 167.729 17.057  1.00 37.21  ? 584  ILE B CG1 1 
ATOM   9553  C  CG2 . ILE B 1 584 ? 48.207 166.377 17.913  1.00 37.20  ? 584  ILE B CG2 1 
ATOM   9554  C  CD1 . ILE B 1 584 ? 45.363 166.753 17.716  1.00 36.77  ? 584  ILE B CD1 1 
ATOM   9555  N  N   . PRO B 1 585 ? 49.155 168.347 20.894  1.00 37.50  ? 585  PRO B N   1 
ATOM   9556  C  CA  . PRO B 1 585 ? 50.374 168.617 21.661  1.00 37.42  ? 585  PRO B CA  1 
ATOM   9557  C  C   . PRO B 1 585 ? 51.518 167.664 21.369  1.00 37.25  ? 585  PRO B C   1 
ATOM   9558  O  O   . PRO B 1 585 ? 51.378 166.726 20.589  1.00 37.10  ? 585  PRO B O   1 
ATOM   9559  C  CB  . PRO B 1 585 ? 49.920 168.428 23.113  1.00 37.50  ? 585  PRO B CB  1 
ATOM   9560  C  CG  . PRO B 1 585 ? 48.430 168.185 23.045  1.00 37.66  ? 585  PRO B CG  1 
ATOM   9561  C  CD  . PRO B 1 585 ? 48.152 167.623 21.689  1.00 37.49  ? 585  PRO B CD  1 
ATOM   9562  N  N   . ASP B 1 586 ? 52.648 167.928 22.016  1.00 37.15  ? 586  ASP B N   1 
ATOM   9563  C  CA  . ASP B 1 586 ? 53.839 167.108 21.878  1.00 36.96  ? 586  ASP B CA  1 
ATOM   9564  C  C   . ASP B 1 586 ? 53.706 165.883 22.764  1.00 36.75  ? 586  ASP B C   1 
ATOM   9565  O  O   . ASP B 1 586 ? 53.218 165.971 23.890  1.00 36.64  ? 586  ASP B O   1 
ATOM   9566  C  CB  . ASP B 1 586 ? 55.085 167.897 22.291  1.00 37.04  ? 586  ASP B CB  1 
ATOM   9567  C  CG  . ASP B 1 586 ? 55.181 169.245 21.604  1.00 37.13  ? 586  ASP B CG  1 
ATOM   9568  O  OD1 . ASP B 1 586 ? 54.760 169.350 20.434  1.00 37.39  ? 586  ASP B OD1 1 
ATOM   9569  O  OD2 . ASP B 1 586 ? 55.664 170.256 22.157  1.00 37.47  ? 586  ASP B OD2 1 
ATOM   9570  N  N   . ASN B 1 587 ? 54.137 164.743 22.239  1.00 36.61  ? 587  ASN B N   1 
ATOM   9571  C  CA  . ASN B 1 587 ? 54.134 163.488 22.983  1.00 36.50  ? 587  ASN B CA  1 
ATOM   9572  C  C   . ASN B 1 587 ? 52.768 162.798 23.079  1.00 36.39  ? 587  ASN B C   1 
ATOM   9573  O  O   . ASN B 1 587 ? 52.315 162.450 24.167  1.00 36.22  ? 587  ASN B O   1 
ATOM   9574  C  CB  . ASN B 1 587 ? 54.746 163.684 24.379  1.00 36.54  ? 587  ASN B CB  1 
ATOM   9575  C  CG  . ASN B 1 587 ? 56.112 164.365 24.334  1.00 36.40  ? 587  ASN B CG  1 
ATOM   9576  O  OD1 . ASN B 1 587 ? 56.676 164.717 25.369  1.00 36.22  ? 587  ASN B OD1 1 
ATOM   9577  N  ND2 . ASN B 1 587 ? 56.644 164.551 23.132  1.00 36.20  ? 587  ASN B ND2 1 
ATOM   9578  N  N   . LEU B 1 588 ? 52.124 162.600 21.933  1.00 36.40  ? 588  LEU B N   1 
ATOM   9579  C  CA  . LEU B 1 588 ? 50.848 161.897 21.871  1.00 36.50  ? 588  LEU B CA  1 
ATOM   9580  C  C   . LEU B 1 588 ? 51.045 160.421 22.184  1.00 36.80  ? 588  LEU B C   1 
ATOM   9581  O  O   . LEU B 1 588 ? 52.158 159.902 22.093  1.00 36.93  ? 588  LEU B O   1 
ATOM   9582  C  CB  . LEU B 1 588 ? 50.257 162.003 20.473  1.00 36.39  ? 588  LEU B CB  1 
ATOM   9583  C  CG  . LEU B 1 588 ? 49.827 163.363 19.952  1.00 36.18  ? 588  LEU B CG  1 
ATOM   9584  C  CD1 . LEU B 1 588 ? 50.018 163.394 18.449  1.00 36.02  ? 588  LEU B CD1 1 
ATOM   9585  C  CD2 . LEU B 1 588 ? 48.382 163.624 20.334  1.00 36.05  ? 588  LEU B CD2 1 
ATOM   9586  N  N   . ASP B 1 589 ? 49.961 159.733 22.522  1.00 37.04  ? 589  ASP B N   1 
ATOM   9587  C  CA  . ASP B 1 589 ? 50.045 158.308 22.831  1.00 37.11  ? 589  ASP B CA  1 
ATOM   9588  C  C   . ASP B 1 589 ? 49.365 157.426 21.786  1.00 37.27  ? 589  ASP B C   1 
ATOM   9589  O  O   . ASP B 1 589 ? 49.674 156.244 21.684  1.00 37.39  ? 589  ASP B O   1 
ATOM   9590  C  CB  . ASP B 1 589 ? 49.478 158.023 24.221  1.00 37.06  ? 589  ASP B CB  1 
ATOM   9591  C  CG  . ASP B 1 589 ? 50.452 158.371 25.327  1.00 36.94  ? 589  ASP B CG  1 
ATOM   9592  O  OD1 . ASP B 1 589 ? 51.641 157.987 25.323  1.00 36.83  ? 589  ASP B OD1 1 
ATOM   9593  O  OD2 . ASP B 1 589 ? 50.050 159.069 26.283  1.00 36.46  ? 589  ASP B OD2 1 
ATOM   9594  N  N   . ALA B 1 590 ? 48.448 158.001 21.013  1.00 37.47  ? 590  ALA B N   1 
ATOM   9595  C  CA  . ALA B 1 590 ? 47.736 157.246 19.985  1.00 37.63  ? 590  ALA B CA  1 
ATOM   9596  C  C   . ALA B 1 590 ? 46.746 158.107 19.213  1.00 37.85  ? 590  ALA B C   1 
ATOM   9597  O  O   . ALA B 1 590 ? 46.581 159.293 19.499  1.00 38.02  ? 590  ALA B O   1 
ATOM   9598  C  CB  . ALA B 1 590 ? 47.011 156.071 20.606  1.00 37.52  ? 590  ALA B CB  1 
ATOM   9599  N  N   . VAL B 1 591 ? 46.095 157.487 18.233  1.00 38.03  ? 591  VAL B N   1 
ATOM   9600  C  CA  . VAL B 1 591 ? 45.066 158.118 17.410  1.00 38.29  ? 591  VAL B CA  1 
ATOM   9601  C  C   . VAL B 1 591 ? 44.580 157.092 16.404  1.00 38.40  ? 591  VAL B C   1 
ATOM   9602  O  O   . VAL B 1 591 ? 45.392 156.495 15.700  1.00 38.42  ? 591  VAL B O   1 
ATOM   9603  C  CB  . VAL B 1 591 ? 45.581 159.362 16.656  1.00 38.35  ? 591  VAL B CB  1 
ATOM   9604  C  CG1 . VAL B 1 591 ? 47.087 159.302 16.463  1.00 38.46  ? 591  VAL B CG1 1 
ATOM   9605  C  CG2 . VAL B 1 591 ? 44.864 159.514 15.315  1.00 38.50  ? 591  VAL B CG2 1 
ATOM   9606  N  N   . VAL B 1 592 ? 43.267 156.873 16.335  1.00 38.62  ? 592  VAL B N   1 
ATOM   9607  C  CA  . VAL B 1 592 ? 42.747 155.847 15.435  1.00 38.91  ? 592  VAL B CA  1 
ATOM   9608  C  C   . VAL B 1 592 ? 41.238 155.866 15.197  1.00 39.04  ? 592  VAL B C   1 
ATOM   9609  O  O   . VAL B 1 592 ? 40.450 155.664 16.122  1.00 39.03  ? 592  VAL B O   1 
ATOM   9610  C  CB  . VAL B 1 592 ? 43.076 154.453 15.977  1.00 38.94  ? 592  VAL B CB  1 
ATOM   9611  C  CG1 . VAL B 1 592 ? 44.210 154.538 16.977  1.00 38.95  ? 592  VAL B CG1 1 
ATOM   9612  C  CG2 . VAL B 1 592 ? 41.852 153.848 16.645  1.00 39.04  ? 592  VAL B CG2 1 
ATOM   9613  N  N   . ASP B 1 593 ? 40.844 156.080 13.945  1.00 39.21  ? 593  ASP B N   1 
ATOM   9614  C  CA  . ASP B 1 593 ? 39.438 156.004 13.566  1.00 39.42  ? 593  ASP B CA  1 
ATOM   9615  C  C   . ASP B 1 593 ? 39.286 156.043 12.054  1.00 39.42  ? 593  ASP B C   1 
ATOM   9616  O  O   . ASP B 1 593 ? 40.067 156.697 11.366  1.00 39.56  ? 593  ASP B O   1 
ATOM   9617  C  CB  . ASP B 1 593 ? 38.618 157.118 14.216  1.00 39.55  ? 593  ASP B CB  1 
ATOM   9618  C  CG  . ASP B 1 593 ? 37.277 156.623 14.722  1.00 39.92  ? 593  ASP B CG  1 
ATOM   9619  O  OD1 . ASP B 1 593 ? 36.503 156.065 13.916  1.00 40.27  ? 593  ASP B OD1 1 
ATOM   9620  O  OD2 . ASP B 1 593 ? 36.919 156.724 15.915  1.00 40.21  ? 593  ASP B OD2 1 
ATOM   9621  N  N   . LEU B 1 594 ? 38.283 155.340 11.537  1.00 39.37  ? 594  LEU B N   1 
ATOM   9622  C  CA  . LEU B 1 594 ? 38.044 155.309 10.096  1.00 39.32  ? 594  LEU B CA  1 
ATOM   9623  C  C   . LEU B 1 594 ? 36.573 155.521 9.726   1.00 39.25  ? 594  LEU B C   1 
ATOM   9624  O  O   . LEU B 1 594 ? 35.733 154.650 9.960   1.00 39.28  ? 594  LEU B O   1 
ATOM   9625  C  CB  . LEU B 1 594 ? 38.567 154.006 9.481   1.00 39.32  ? 594  LEU B CB  1 
ATOM   9626  C  CG  . LEU B 1 594 ? 38.158 152.683 10.132  1.00 39.25  ? 594  LEU B CG  1 
ATOM   9627  C  CD1 . LEU B 1 594 ? 38.080 151.569 9.094   1.00 39.27  ? 594  LEU B CD1 1 
ATOM   9628  C  CD2 . LEU B 1 594 ? 39.113 152.316 11.253  1.00 39.15  ? 594  LEU B CD2 1 
ATOM   9629  N  N   . GLN B 1 595 ? 36.273 156.681 9.148   1.00 39.13  ? 595  GLN B N   1 
ATOM   9630  C  CA  . GLN B 1 595 ? 34.915 157.016 8.722   1.00 38.99  ? 595  GLN B CA  1 
ATOM   9631  C  C   . GLN B 1 595 ? 33.926 157.093 9.882   1.00 38.89  ? 595  GLN B C   1 
ATOM   9632  O  O   . GLN B 1 595 ? 32.739 156.814 9.714   1.00 38.85  ? 595  GLN B O   1 
ATOM   9633  C  CB  . GLN B 1 595 ? 34.413 156.013 7.681   1.00 39.00  ? 595  GLN B CB  1 
ATOM   9634  C  CG  . GLN B 1 595 ? 35.135 156.083 6.348   1.00 39.06  ? 595  GLN B CG  1 
ATOM   9635  C  CD  . GLN B 1 595 ? 34.602 155.075 5.348   1.00 39.08  ? 595  GLN B CD  1 
ATOM   9636  O  OE1 . GLN B 1 595 ? 34.936 155.132 4.163   1.00 38.98  ? 595  GLN B OE1 1 
ATOM   9637  N  NE2 . GLN B 1 595 ? 33.773 154.151 5.821   1.00 39.05  ? 595  GLN B NE2 1 
ATOM   9638  N  N   . GLY B 1 596 ? 34.418 157.470 11.057  1.00 38.78  ? 596  GLY B N   1 
ATOM   9639  C  CA  . GLY B 1 596 ? 33.572 157.588 12.229  1.00 38.65  ? 596  GLY B CA  1 
ATOM   9640  C  C   . GLY B 1 596 ? 32.971 158.975 12.314  1.00 38.56  ? 596  GLY B C   1 
ATOM   9641  O  O   . GLY B 1 596 ? 33.641 159.922 12.723  1.00 38.58  ? 596  GLY B O   1 
ATOM   9642  N  N   . GLY B 1 597 ? 31.708 159.097 11.920  1.00 38.43  ? 597  GLY B N   1 
ATOM   9643  C  CA  . GLY B 1 597 ? 31.041 160.385 11.920  1.00 38.25  ? 597  GLY B CA  1 
ATOM   9644  C  C   . GLY B 1 597 ? 31.927 161.419 11.257  1.00 38.16  ? 597  GLY B C   1 
ATOM   9645  O  O   . GLY B 1 597 ? 31.742 162.622 11.436  1.00 38.20  ? 597  GLY B O   1 
ATOM   9646  N  N   . GLY B 1 598 ? 32.900 160.940 10.488  1.00 38.05  ? 598  GLY B N   1 
ATOM   9647  C  CA  . GLY B 1 598 ? 33.840 161.809 9.808   1.00 37.91  ? 598  GLY B CA  1 
ATOM   9648  C  C   . GLY B 1 598 ? 34.826 162.426 10.779  1.00 37.76  ? 598  GLY B C   1 
ATOM   9649  O  O   . GLY B 1 598 ? 35.078 163.632 10.741  1.00 37.80  ? 598  GLY B O   1 
ATOM   9650  N  N   . HIS B 1 599 ? 35.384 161.596 11.655  1.00 37.54  ? 599  HIS B N   1 
ATOM   9651  C  CA  . HIS B 1 599 ? 36.332 162.069 12.655  1.00 37.36  ? 599  HIS B CA  1 
ATOM   9652  C  C   . HIS B 1 599 ? 37.595 161.219 12.709  1.00 37.29  ? 599  HIS B C   1 
ATOM   9653  O  O   . HIS B 1 599 ? 37.667 160.140 12.122  1.00 37.36  ? 599  HIS B O   1 
ATOM   9654  C  CB  . HIS B 1 599 ? 35.703 162.052 14.053  1.00 37.36  ? 599  HIS B CB  1 
ATOM   9655  C  CG  . HIS B 1 599 ? 34.356 162.699 14.136  1.00 37.14  ? 599  HIS B CG  1 
ATOM   9656  N  ND1 . HIS B 1 599 ? 33.183 161.975 14.129  1.00 36.95  ? 599  HIS B ND1 1 
ATOM   9657  C  CD2 . HIS B 1 599 ? 33.996 163.997 14.264  1.00 36.95  ? 599  HIS B CD2 1 
ATOM   9658  C  CE1 . HIS B 1 599 ? 32.158 162.801 14.235  1.00 36.82  ? 599  HIS B CE1 1 
ATOM   9659  N  NE2 . HIS B 1 599 ? 32.623 164.034 14.316  1.00 36.92  ? 599  HIS B NE2 1 
ATOM   9660  N  N   . SER B 1 600 ? 38.583 161.724 13.440  1.00 37.12  ? 600  SER B N   1 
ATOM   9661  C  CA  . SER B 1 600 ? 39.821 161.008 13.710  1.00 36.87  ? 600  SER B CA  1 
ATOM   9662  C  C   . SER B 1 600 ? 40.221 161.394 15.133  1.00 36.72  ? 600  SER B C   1 
ATOM   9663  O  O   . SER B 1 600 ? 40.809 162.452 15.357  1.00 36.74  ? 600  SER B O   1 
ATOM   9664  C  CB  . SER B 1 600 ? 40.909 161.395 12.706  1.00 36.91  ? 600  SER B CB  1 
ATOM   9665  O  OG  . SER B 1 600 ? 41.836 160.337 12.521  1.00 36.76  ? 600  SER B OG  1 
ATOM   9666  N  N   . TYR B 1 601 ? 39.872 160.545 16.094  1.00 36.48  ? 601  TYR B N   1 
ATOM   9667  C  CA  . TYR B 1 601 ? 40.124 160.825 17.506  1.00 36.22  ? 601  TYR B CA  1 
ATOM   9668  C  C   . TYR B 1 601 ? 41.608 160.766 17.858  1.00 36.04  ? 601  TYR B C   1 
ATOM   9669  O  O   . TYR B 1 601 ? 42.320 159.873 17.408  1.00 36.07  ? 601  TYR B O   1 
ATOM   9670  C  CB  . TYR B 1 601 ? 39.363 159.836 18.396  1.00 36.24  ? 601  TYR B CB  1 
ATOM   9671  C  CG  . TYR B 1 601 ? 37.875 159.725 18.126  1.00 36.26  ? 601  TYR B CG  1 
ATOM   9672  C  CD1 . TYR B 1 601 ? 37.401 159.174 16.945  1.00 36.34  ? 601  TYR B CD1 1 
ATOM   9673  C  CD2 . TYR B 1 601 ? 36.944 160.146 19.067  1.00 36.22  ? 601  TYR B CD2 1 
ATOM   9674  C  CE1 . TYR B 1 601 ? 36.045 159.061 16.700  1.00 36.31  ? 601  TYR B CE1 1 
ATOM   9675  C  CE2 . TYR B 1 601 ? 35.585 160.032 18.830  1.00 36.24  ? 601  TYR B CE2 1 
ATOM   9676  C  CZ  . TYR B 1 601 ? 35.143 159.489 17.645  1.00 36.28  ? 601  TYR B CZ  1 
ATOM   9677  O  OH  . TYR B 1 601 ? 33.795 159.372 17.398  1.00 36.26  ? 601  TYR B OH  1 
ATOM   9678  N  N   . PHE B 1 602 ? 42.067 161.709 18.676  1.00 35.78  ? 602  PHE B N   1 
ATOM   9679  C  CA  . PHE B 1 602 ? 43.465 161.735 19.103  1.00 35.61  ? 602  PHE B CA  1 
ATOM   9680  C  C   . PHE B 1 602 ? 43.619 161.492 20.602  1.00 35.46  ? 602  PHE B C   1 
ATOM   9681  O  O   . PHE B 1 602 ? 43.008 162.182 21.416  1.00 35.47  ? 602  PHE B O   1 
ATOM   9682  C  CB  . PHE B 1 602 ? 44.124 163.059 18.724  1.00 35.69  ? 602  PHE B CB  1 
ATOM   9683  C  CG  . PHE B 1 602 ? 44.720 163.066 17.349  1.00 35.90  ? 602  PHE B CG  1 
ATOM   9684  C  CD1 . PHE B 1 602 ? 43.928 162.859 16.234  1.00 35.93  ? 602  PHE B CD1 1 
ATOM   9685  C  CD2 . PHE B 1 602 ? 46.076 163.281 17.173  1.00 36.16  ? 602  PHE B CD2 1 
ATOM   9686  C  CE1 . PHE B 1 602 ? 44.477 162.867 14.971  1.00 35.96  ? 602  PHE B CE1 1 
ATOM   9687  C  CE2 . PHE B 1 602 ? 46.631 163.292 15.911  1.00 36.11  ? 602  PHE B CE2 1 
ATOM   9688  C  CZ  . PHE B 1 602 ? 45.831 163.083 14.809  1.00 36.12  ? 602  PHE B CZ  1 
ATOM   9689  N  N   . PHE B 1 603 ? 44.449 160.514 20.956  1.00 35.22  ? 603  PHE B N   1 
ATOM   9690  C  CA  . PHE B 1 603 ? 44.686 160.167 22.354  1.00 34.92  ? 603  PHE B CA  1 
ATOM   9691  C  C   . PHE B 1 603 ? 46.022 160.711 22.850  1.00 35.01  ? 603  PHE B C   1 
ATOM   9692  O  O   . PHE B 1 603 ? 47.027 160.661 22.144  1.00 34.93  ? 603  PHE B O   1 
ATOM   9693  C  CB  . PHE B 1 603 ? 44.666 158.648 22.549  1.00 34.75  ? 603  PHE B CB  1 
ATOM   9694  C  CG  . PHE B 1 603 ? 43.347 158.001 22.226  1.00 34.00  ? 603  PHE B CG  1 
ATOM   9695  C  CD1 . PHE B 1 603 ? 43.061 157.587 20.938  1.00 33.28  ? 603  PHE B CD1 1 
ATOM   9696  C  CD2 . PHE B 1 603 ? 42.403 157.785 23.216  1.00 33.26  ? 603  PHE B CD2 1 
ATOM   9697  C  CE1 . PHE B 1 603 ? 41.856 156.988 20.641  1.00 32.74  ? 603  PHE B CE1 1 
ATOM   9698  C  CE2 . PHE B 1 603 ? 41.195 157.185 22.922  1.00 32.69  ? 603  PHE B CE2 1 
ATOM   9699  C  CZ  . PHE B 1 603 ? 40.925 156.786 21.634  1.00 32.57  ? 603  PHE B CZ  1 
ATOM   9700  N  N   . LYS B 1 604 ? 46.017 161.222 24.076  1.00 35.15  ? 604  LYS B N   1 
ATOM   9701  C  CA  . LYS B 1 604 ? 47.213 161.746 24.723  1.00 35.36  ? 604  LYS B CA  1 
ATOM   9702  C  C   . LYS B 1 604 ? 46.955 161.715 26.221  1.00 35.47  ? 604  LYS B C   1 
ATOM   9703  O  O   . LYS B 1 604 ? 45.828 161.932 26.660  1.00 35.59  ? 604  LYS B O   1 
ATOM   9704  C  CB  . LYS B 1 604 ? 47.493 163.179 24.262  1.00 35.37  ? 604  LYS B CB  1 
ATOM   9705  C  CG  . LYS B 1 604 ? 48.965 163.598 24.294  1.00 35.53  ? 604  LYS B CG  1 
ATOM   9706  C  CD  . LYS B 1 604 ? 49.296 164.579 25.415  1.00 35.50  ? 604  LYS B CD  1 
ATOM   9707  C  CE  . LYS B 1 604 ? 49.652 163.866 26.710  1.00 35.76  ? 604  LYS B CE  1 
ATOM   9708  N  NZ  . LYS B 1 604 ? 50.758 162.884 26.546  1.00 35.64  ? 604  LYS B NZ  1 
ATOM   9709  N  N   . GLY B 1 605 ? 47.989 161.430 27.005  1.00 35.57  ? 605  GLY B N   1 
ATOM   9710  C  CA  . GLY B 1 605 ? 47.857 161.389 28.451  1.00 35.57  ? 605  GLY B CA  1 
ATOM   9711  C  C   . GLY B 1 605 ? 46.682 160.564 28.937  1.00 35.54  ? 605  GLY B C   1 
ATOM   9712  O  O   . GLY B 1 605 ? 46.810 159.367 29.153  1.00 35.58  ? 605  GLY B O   1 
ATOM   9713  N  N   . ALA B 1 606 ? 45.532 161.208 29.108  1.00 35.64  ? 606  ALA B N   1 
ATOM   9714  C  CA  . ALA B 1 606 ? 44.335 160.525 29.585  1.00 35.65  ? 606  ALA B CA  1 
ATOM   9715  C  C   . ALA B 1 606 ? 43.062 161.203 29.088  1.00 35.66  ? 606  ALA B C   1 
ATOM   9716  O  O   . ALA B 1 606 ? 42.023 161.142 29.745  1.00 35.72  ? 606  ALA B O   1 
ATOM   9717  C  CB  . ALA B 1 606 ? 44.336 160.457 31.102  1.00 35.72  ? 606  ALA B CB  1 
ATOM   9718  N  N   . TYR B 1 607 ? 43.151 161.852 27.932  1.00 35.55  ? 607  TYR B N   1 
ATOM   9719  C  CA  . TYR B 1 607 ? 42.008 162.530 27.334  1.00 35.35  ? 607  TYR B CA  1 
ATOM   9720  C  C   . TYR B 1 607 ? 42.090 162.444 25.820  1.00 35.23  ? 607  TYR B C   1 
ATOM   9721  O  O   . TYR B 1 607 ? 43.168 162.579 25.249  1.00 35.30  ? 607  TYR B O   1 
ATOM   9722  C  CB  . TYR B 1 607 ? 41.983 163.996 27.750  1.00 35.42  ? 607  TYR B CB  1 
ATOM   9723  C  CG  . TYR B 1 607 ? 41.907 164.213 29.238  1.00 35.31  ? 607  TYR B CG  1 
ATOM   9724  C  CD1 . TYR B 1 607 ? 40.706 164.080 29.914  1.00 35.16  ? 607  TYR B CD1 1 
ATOM   9725  C  CD2 . TYR B 1 607 ? 43.037 164.555 29.967  1.00 35.19  ? 607  TYR B CD2 1 
ATOM   9726  C  CE1 . TYR B 1 607 ? 40.634 164.275 31.272  1.00 35.16  ? 607  TYR B CE1 1 
ATOM   9727  C  CE2 . TYR B 1 607 ? 42.973 164.755 31.326  1.00 35.01  ? 607  TYR B CE2 1 
ATOM   9728  C  CZ  . TYR B 1 607 ? 41.768 164.613 31.974  1.00 35.08  ? 607  TYR B CZ  1 
ATOM   9729  O  OH  . TYR B 1 607 ? 41.692 164.809 33.332  1.00 35.37  ? 607  TYR B OH  1 
ATOM   9730  N  N   . TYR B 1 608 ? 40.958 162.227 25.165  1.00 35.03  ? 608  TYR B N   1 
ATOM   9731  C  CA  . TYR B 1 608 ? 40.961 162.128 23.713  1.00 34.94  ? 608  TYR B CA  1 
ATOM   9732  C  C   . TYR B 1 608 ? 40.466 163.407 23.054  1.00 35.05  ? 608  TYR B C   1 
ATOM   9733  O  O   . TYR B 1 608 ? 39.609 164.103 23.598  1.00 35.10  ? 608  TYR B O   1 
ATOM   9734  C  CB  . TYR B 1 608 ? 40.138 160.926 23.233  1.00 34.77  ? 608  TYR B CB  1 
ATOM   9735  C  CG  . TYR B 1 608 ? 38.648 161.046 23.464  1.00 34.38  ? 608  TYR B CG  1 
ATOM   9736  C  CD1 . TYR B 1 608 ? 38.093 160.756 24.700  1.00 33.90  ? 608  TYR B CD1 1 
ATOM   9737  C  CD2 . TYR B 1 608 ? 37.792 161.431 22.441  1.00 34.19  ? 608  TYR B CD2 1 
ATOM   9738  C  CE1 . TYR B 1 608 ? 36.730 160.859 24.917  1.00 33.67  ? 608  TYR B CE1 1 
ATOM   9739  C  CE2 . TYR B 1 608 ? 36.425 161.538 22.650  1.00 33.84  ? 608  TYR B CE2 1 
ATOM   9740  C  CZ  . TYR B 1 608 ? 35.902 161.251 23.892  1.00 33.54  ? 608  TYR B CZ  1 
ATOM   9741  O  OH  . TYR B 1 608 ? 34.548 161.350 24.115  1.00 33.08  ? 608  TYR B OH  1 
ATOM   9742  N  N   . LEU B 1 609 ? 41.028 163.714 21.890  1.00 35.07  ? 609  LEU B N   1 
ATOM   9743  C  CA  . LEU B 1 609 ? 40.604 164.864 21.109  1.00 35.15  ? 609  LEU B CA  1 
ATOM   9744  C  C   . LEU B 1 609 ? 39.849 164.354 19.894  1.00 35.21  ? 609  LEU B C   1 
ATOM   9745  O  O   . LEU B 1 609 ? 40.290 163.416 19.234  1.00 35.21  ? 609  LEU B O   1 
ATOM   9746  C  CB  . LEU B 1 609 ? 41.803 165.703 20.667  1.00 35.15  ? 609  LEU B CB  1 
ATOM   9747  C  CG  . LEU B 1 609 ? 42.430 166.637 21.703  1.00 35.29  ? 609  LEU B CG  1 
ATOM   9748  C  CD1 . LEU B 1 609 ? 43.256 165.862 22.727  1.00 35.51  ? 609  LEU B CD1 1 
ATOM   9749  C  CD2 . LEU B 1 609 ? 43.280 167.683 21.011  1.00 34.98  ? 609  LEU B CD2 1 
ATOM   9750  N  N   . LYS B 1 610 ? 38.703 164.962 19.607  1.00 35.30  ? 610  LYS B N   1 
ATOM   9751  C  CA  . LYS B 1 610 ? 37.904 164.552 18.460  1.00 35.32  ? 610  LYS B CA  1 
ATOM   9752  C  C   . LYS B 1 610 ? 38.204 165.441 17.264  1.00 35.40  ? 610  LYS B C   1 
ATOM   9753  O  O   . LYS B 1 610 ? 37.622 166.510 17.123  1.00 35.45  ? 610  LYS B O   1 
ATOM   9754  C  CB  . LYS B 1 610 ? 36.411 164.598 18.792  1.00 35.24  ? 610  LYS B CB  1 
ATOM   9755  C  CG  . LYS B 1 610 ? 35.510 164.210 17.632  1.00 35.10  ? 610  LYS B CG  1 
ATOM   9756  C  CD  . LYS B 1 610 ? 34.041 164.255 18.014  1.00 34.94  ? 610  LYS B CD  1 
ATOM   9757  C  CE  . LYS B 1 610 ? 33.641 163.041 18.831  1.00 35.01  ? 610  LYS B CE  1 
ATOM   9758  N  NZ  . LYS B 1 610 ? 32.168 162.978 19.041  1.00 35.12  ? 610  LYS B NZ  1 
ATOM   9759  N  N   . LEU B 1 611 ? 39.117 164.994 16.408  1.00 35.47  ? 611  LEU B N   1 
ATOM   9760  C  CA  . LEU B 1 611 ? 39.496 165.754 15.220  1.00 35.58  ? 611  LEU B CA  1 
ATOM   9761  C  C   . LEU B 1 611 ? 38.511 165.506 14.077  1.00 35.61  ? 611  LEU B C   1 
ATOM   9762  O  O   . LEU B 1 611 ? 37.989 164.404 13.932  1.00 35.61  ? 611  LEU B O   1 
ATOM   9763  C  CB  . LEU B 1 611 ? 40.924 165.388 14.796  1.00 35.61  ? 611  LEU B CB  1 
ATOM   9764  C  CG  . LEU B 1 611 ? 41.658 166.208 13.728  1.00 35.57  ? 611  LEU B CG  1 
ATOM   9765  C  CD1 . LEU B 1 611 ? 43.151 166.222 14.011  1.00 35.65  ? 611  LEU B CD1 1 
ATOM   9766  C  CD2 . LEU B 1 611 ? 41.394 165.675 12.333  1.00 35.38  ? 611  LEU B CD2 1 
ATOM   9767  N  N   . GLU B 1 612 ? 38.252 166.536 13.277  1.00 35.66  ? 612  GLU B N   1 
ATOM   9768  C  CA  . GLU B 1 612 ? 37.343 166.406 12.143  1.00 35.73  ? 612  GLU B CA  1 
ATOM   9769  C  C   . GLU B 1 612 ? 38.132 166.050 10.892  1.00 35.76  ? 612  GLU B C   1 
ATOM   9770  O  O   . GLU B 1 612 ? 39.304 166.399 10.768  1.00 35.77  ? 612  GLU B O   1 
ATOM   9771  C  CB  . GLU B 1 612 ? 36.564 167.703 11.919  1.00 35.75  ? 612  GLU B CB  1 
ATOM   9772  C  CG  . GLU B 1 612 ? 35.306 167.535 11.082  1.00 35.89  ? 612  GLU B CG  1 
ATOM   9773  C  CD  . GLU B 1 612 ? 34.586 168.847 10.829  1.00 35.98  ? 612  GLU B CD  1 
ATOM   9774  O  OE1 . GLU B 1 612 ? 35.265 169.887 10.708  1.00 36.08  ? 612  GLU B OE1 1 
ATOM   9775  O  OE2 . GLU B 1 612 ? 33.339 168.838 10.749  1.00 35.97  ? 612  GLU B OE2 1 
ATOM   9776  N  N   . ASN B 1 613 ? 37.491 165.356 9.960   1.00 35.81  ? 613  ASN B N   1 
ATOM   9777  C  CA  . ASN B 1 613 ? 38.172 164.940 8.740   1.00 35.88  ? 613  ASN B CA  1 
ATOM   9778  C  C   . ASN B 1 613 ? 38.368 166.065 7.716   1.00 35.90  ? 613  ASN B C   1 
ATOM   9779  O  O   . ASN B 1 613 ? 39.349 166.805 7.795   1.00 35.91  ? 613  ASN B O   1 
ATOM   9780  C  CB  . ASN B 1 613 ? 37.495 163.707 8.131   1.00 35.91  ? 613  ASN B CB  1 
ATOM   9781  C  CG  . ASN B 1 613 ? 37.816 162.427 8.902   1.00 36.08  ? 613  ASN B CG  1 
ATOM   9782  O  OD1 . ASN B 1 613 ? 37.209 161.379 8.674   1.00 36.29  ? 613  ASN B OD1 1 
ATOM   9783  N  ND2 . ASN B 1 613 ? 38.777 162.512 9.817   1.00 35.92  ? 613  ASN B ND2 1 
ATOM   9784  N  N   . GLN B 1 614 ? 37.447 166.200 6.765   1.00 35.89  ? 614  GLN B N   1 
ATOM   9785  C  CA  . GLN B 1 614 ? 37.572 167.230 5.731   1.00 35.89  ? 614  GLN B CA  1 
ATOM   9786  C  C   . GLN B 1 614 ? 38.319 168.476 6.206   1.00 35.88  ? 614  GLN B C   1 
ATOM   9787  O  O   . GLN B 1 614 ? 39.350 168.836 5.638   1.00 35.94  ? 614  GLN B O   1 
ATOM   9788  C  CB  . GLN B 1 614 ? 36.208 167.589 5.134   1.00 35.91  ? 614  GLN B CB  1 
ATOM   9789  C  CG  . GLN B 1 614 ? 36.004 167.070 3.714   1.00 35.88  ? 614  GLN B CG  1 
ATOM   9790  C  CD  . GLN B 1 614 ? 36.648 165.713 3.485   1.00 35.81  ? 614  GLN B CD  1 
ATOM   9791  O  OE1 . GLN B 1 614 ? 37.726 165.623 2.897   1.00 35.77  ? 614  GLN B OE1 1 
ATOM   9792  N  NE2 . GLN B 1 614 ? 35.988 164.658 3.945   1.00 35.69  ? 614  GLN B NE2 1 
ATOM   9793  N  N   . SER B 1 615 ? 37.800 169.136 7.238   1.00 35.81  ? 615  SER B N   1 
ATOM   9794  C  CA  . SER B 1 615 ? 38.467 170.308 7.803   1.00 35.73  ? 615  SER B CA  1 
ATOM   9795  C  C   . SER B 1 615 ? 38.769 170.098 9.282   1.00 35.64  ? 615  SER B C   1 
ATOM   9796  O  O   . SER B 1 615 ? 37.886 170.214 10.128  1.00 35.62  ? 615  SER B O   1 
ATOM   9797  C  CB  . SER B 1 615 ? 37.636 171.580 7.595   1.00 35.78  ? 615  SER B CB  1 
ATOM   9798  O  OG  . SER B 1 615 ? 37.915 172.181 6.340   1.00 35.69  ? 615  SER B OG  1 
ATOM   9799  N  N   . LEU B 1 616 ? 40.026 169.787 9.581   1.00 35.55  ? 616  LEU B N   1 
ATOM   9800  C  CA  . LEU B 1 616 ? 40.468 169.524 10.947  1.00 35.51  ? 616  LEU B CA  1 
ATOM   9801  C  C   . LEU B 1 616 ? 40.128 170.649 11.917  1.00 35.54  ? 616  LEU B C   1 
ATOM   9802  O  O   . LEU B 1 616 ? 41.020 171.224 12.538  1.00 35.50  ? 616  LEU B O   1 
ATOM   9803  C  CB  . LEU B 1 616 ? 41.978 169.290 10.972  1.00 35.50  ? 616  LEU B CB  1 
ATOM   9804  C  CG  . LEU B 1 616 ? 42.837 170.477 10.533  1.00 35.44  ? 616  LEU B CG  1 
ATOM   9805  C  CD1 . LEU B 1 616 ? 43.996 170.681 11.484  1.00 35.44  ? 616  LEU B CD1 1 
ATOM   9806  C  CD2 . LEU B 1 616 ? 43.325 170.312 9.105   1.00 35.44  ? 616  LEU B CD2 1 
ATOM   9807  N  N   . LYS B 1 617 ? 38.842 170.948 12.069  1.00 35.63  ? 617  LYS B N   1 
ATOM   9808  C  CA  . LYS B 1 617 ? 38.430 172.050 12.934  1.00 35.72  ? 617  LYS B CA  1 
ATOM   9809  C  C   . LYS B 1 617 ? 37.413 171.651 13.999  1.00 35.72  ? 617  LYS B C   1 
ATOM   9810  O  O   . LYS B 1 617 ? 37.089 172.445 14.884  1.00 35.78  ? 617  LYS B O   1 
ATOM   9811  C  CB  . LYS B 1 617 ? 37.882 173.214 12.102  1.00 35.67  ? 617  LYS B CB  1 
ATOM   9812  C  CG  . LYS B 1 617 ? 36.526 172.948 11.475  1.00 35.69  ? 617  LYS B CG  1 
ATOM   9813  C  CD  . LYS B 1 617 ? 36.085 174.116 10.612  1.00 36.00  ? 617  LYS B CD  1 
ATOM   9814  C  CE  . LYS B 1 617 ? 34.780 173.814 9.894   1.00 36.01  ? 617  LYS B CE  1 
ATOM   9815  N  NZ  . LYS B 1 617 ? 34.436 174.868 8.899   1.00 35.66  ? 617  LYS B NZ  1 
ATOM   9816  N  N   . SER B 1 618 ? 36.896 170.432 13.907  1.00 35.64  ? 618  SER B N   1 
ATOM   9817  C  CA  . SER B 1 618 ? 35.955 169.957 14.908  1.00 35.57  ? 618  SER B CA  1 
ATOM   9818  C  C   . SER B 1 618 ? 36.739 169.334 16.038  1.00 35.49  ? 618  SER B C   1 
ATOM   9819  O  O   . SER B 1 618 ? 37.679 168.580 15.805  1.00 35.51  ? 618  SER B O   1 
ATOM   9820  C  CB  . SER B 1 618 ? 34.985 168.930 14.331  1.00 35.62  ? 618  SER B CB  1 
ATOM   9821  O  OG  . SER B 1 618 ? 34.375 168.175 15.366  1.00 35.60  ? 618  SER B OG  1 
ATOM   9822  N  N   . VAL B 1 619 ? 36.361 169.660 17.264  1.00 35.37  ? 619  VAL B N   1 
ATOM   9823  C  CA  . VAL B 1 619 ? 37.037 169.097 18.414  1.00 35.29  ? 619  VAL B CA  1 
ATOM   9824  C  C   . VAL B 1 619 ? 36.069 168.798 19.541  1.00 35.33  ? 619  VAL B C   1 
ATOM   9825  O  O   . VAL B 1 619 ? 35.132 169.554 19.802  1.00 35.20  ? 619  VAL B O   1 
ATOM   9826  C  CB  . VAL B 1 619 ? 38.157 170.017 18.940  1.00 35.27  ? 619  VAL B CB  1 
ATOM   9827  C  CG1 . VAL B 1 619 ? 39.413 169.892 18.083  1.00 35.11  ? 619  VAL B CG1 1 
ATOM   9828  C  CG2 . VAL B 1 619 ? 37.675 171.454 19.011  1.00 35.39  ? 619  VAL B CG2 1 
ATOM   9829  N  N   . LYS B 1 620 ? 36.296 167.657 20.179  1.00 35.38  ? 620  LYS B N   1 
ATOM   9830  C  CA  . LYS B 1 620 ? 35.565 167.262 21.363  1.00 35.37  ? 620  LYS B CA  1 
ATOM   9831  C  C   . LYS B 1 620 ? 36.606 166.604 22.232  1.00 35.49  ? 620  LYS B C   1 
ATOM   9832  O  O   . LYS B 1 620 ? 37.091 165.522 21.922  1.00 35.66  ? 620  LYS B O   1 
ATOM   9833  C  CB  . LYS B 1 620 ? 34.443 166.282 21.045  1.00 35.28  ? 620  LYS B CB  1 
ATOM   9834  C  CG  . LYS B 1 620 ? 33.679 165.840 22.279  1.00 35.15  ? 620  LYS B CG  1 
ATOM   9835  C  CD  . LYS B 1 620 ? 33.022 164.488 22.081  1.00 35.01  ? 620  LYS B CD  1 
ATOM   9836  C  CE  . LYS B 1 620 ? 32.424 163.970 23.376  1.00 34.66  ? 620  LYS B CE  1 
ATOM   9837  N  NZ  . LYS B 1 620 ? 31.485 162.843 23.131  1.00 34.43  ? 620  LYS B NZ  1 
ATOM   9838  N  N   . PHE B 1 621 ? 36.973 167.286 23.305  1.00 35.67  ? 621  PHE B N   1 
ATOM   9839  C  CA  . PHE B 1 621 ? 37.991 166.812 24.225  1.00 35.91  ? 621  PHE B CA  1 
ATOM   9840  C  C   . PHE B 1 621 ? 37.295 166.119 25.393  1.00 36.05  ? 621  PHE B C   1 
ATOM   9841  O  O   . PHE B 1 621 ? 36.625 166.772 26.189  1.00 36.01  ? 621  PHE B O   1 
ATOM   9842  C  CB  . PHE B 1 621 ? 38.820 168.021 24.666  1.00 35.91  ? 621  PHE B CB  1 
ATOM   9843  C  CG  . PHE B 1 621 ? 39.719 167.782 25.844  1.00 35.99  ? 621  PHE B CG  1 
ATOM   9844  C  CD1 . PHE B 1 621 ? 39.210 167.787 27.128  1.00 36.02  ? 621  PHE B CD1 1 
ATOM   9845  C  CD2 . PHE B 1 621 ? 41.084 167.623 25.671  1.00 36.17  ? 621  PHE B CD2 1 
ATOM   9846  C  CE1 . PHE B 1 621 ? 40.034 167.594 28.216  1.00 36.19  ? 621  PHE B CE1 1 
ATOM   9847  C  CE2 . PHE B 1 621 ? 41.916 167.434 26.758  1.00 36.17  ? 621  PHE B CE2 1 
ATOM   9848  C  CZ  . PHE B 1 621 ? 41.389 167.420 28.032  1.00 36.17  ? 621  PHE B CZ  1 
ATOM   9849  N  N   . GLY B 1 622 ? 37.433 164.796 25.477  1.00 36.21  ? 622  GLY B N   1 
ATOM   9850  C  CA  . GLY B 1 622 ? 36.761 164.030 26.514  1.00 36.49  ? 622  GLY B CA  1 
ATOM   9851  C  C   . GLY B 1 622 ? 37.512 162.831 27.060  1.00 36.69  ? 622  GLY B C   1 
ATOM   9852  O  O   . GLY B 1 622 ? 38.438 162.331 26.429  1.00 36.78  ? 622  GLY B O   1 
ATOM   9853  N  N   . SER B 1 623 ? 37.085 162.355 28.227  1.00 36.95  ? 623  SER B N   1 
ATOM   9854  C  CA  . SER B 1 623 ? 37.733 161.237 28.923  1.00 37.22  ? 623  SER B CA  1 
ATOM   9855  C  C   . SER B 1 623 ? 37.661 159.880 28.212  1.00 37.39  ? 623  SER B C   1 
ATOM   9856  O  O   . SER B 1 623 ? 36.574 159.355 27.960  1.00 37.35  ? 623  SER B O   1 
ATOM   9857  C  CB  . SER B 1 623 ? 37.159 161.102 30.340  1.00 37.20  ? 623  SER B CB  1 
ATOM   9858  O  OG  . SER B 1 623 ? 37.732 160.004 31.030  1.00 37.39  ? 623  SER B OG  1 
ATOM   9859  N  N   . ILE B 1 624 ? 38.831 159.312 27.911  1.00 37.66  ? 624  ILE B N   1 
ATOM   9860  C  CA  . ILE B 1 624 ? 38.920 157.994 27.281  1.00 37.82  ? 624  ILE B CA  1 
ATOM   9861  C  C   . ILE B 1 624 ? 38.567 156.954 28.321  1.00 37.75  ? 624  ILE B C   1 
ATOM   9862  O  O   . ILE B 1 624 ? 38.142 155.851 28.000  1.00 37.66  ? 624  ILE B O   1 
ATOM   9863  C  CB  . ILE B 1 624 ? 40.339 157.725 26.733  1.00 37.85  ? 624  ILE B CB  1 
ATOM   9864  C  CG1 . ILE B 1 624 ? 41.255 157.188 27.831  1.00 38.02  ? 624  ILE B CG1 1 
ATOM   9865  C  CG2 . ILE B 1 624 ? 40.927 158.984 26.125  1.00 38.04  ? 624  ILE B CG2 1 
ATOM   9866  C  CD1 . ILE B 1 624 ? 42.725 157.259 27.475  1.00 38.44  ? 624  ILE B CD1 1 
ATOM   9867  N  N   . LYS B 1 625 ? 38.743 157.335 29.579  1.00 37.88  ? 625  LYS B N   1 
ATOM   9868  C  CA  . LYS B 1 625 ? 38.426 156.471 30.698  1.00 38.08  ? 625  LYS B CA  1 
ATOM   9869  C  C   . LYS B 1 625 ? 36.916 156.375 30.860  1.00 38.05  ? 625  LYS B C   1 
ATOM   9870  O  O   . LYS B 1 625 ? 36.426 155.646 31.714  1.00 38.16  ? 625  LYS B O   1 
ATOM   9871  C  CB  . LYS B 1 625 ? 39.058 157.033 31.973  1.00 38.19  ? 625  LYS B CB  1 
ATOM   9872  C  CG  . LYS B 1 625 ? 39.270 156.013 33.078  1.00 38.56  ? 625  LYS B CG  1 
ATOM   9873  C  CD  . LYS B 1 625 ? 40.484 156.378 33.923  1.00 39.40  ? 625  LYS B CD  1 
ATOM   9874  C  CE  . LYS B 1 625 ? 40.777 155.320 34.976  1.00 39.69  ? 625  LYS B CE  1 
ATOM   9875  N  NZ  . LYS B 1 625 ? 40.057 155.601 36.253  1.00 40.57  ? 625  LYS B NZ  1 
ATOM   9876  N  N   . SER B 1 626 ? 36.178 157.104 30.028  1.00 38.00  ? 626  SER B N   1 
ATOM   9877  C  CA  . SER B 1 626 ? 34.722 157.124 30.134  1.00 37.91  ? 626  SER B CA  1 
ATOM   9878  C  C   . SER B 1 626 ? 33.981 156.920 28.809  1.00 37.81  ? 626  SER B C   1 
ATOM   9879  O  O   . SER B 1 626 ? 32.834 156.471 28.805  1.00 37.73  ? 626  SER B O   1 
ATOM   9880  C  CB  . SER B 1 626 ? 34.264 158.432 30.783  1.00 37.99  ? 626  SER B CB  1 
ATOM   9881  O  OG  . SER B 1 626 ? 35.020 158.717 31.947  1.00 38.19  ? 626  SER B OG  1 
ATOM   9882  N  N   . ASP B 1 627 ? 34.624 157.252 27.691  1.00 37.71  ? 627  ASP B N   1 
ATOM   9883  C  CA  . ASP B 1 627 ? 33.987 157.108 26.380  1.00 37.59  ? 627  ASP B CA  1 
ATOM   9884  C  C   . ASP B 1 627 ? 34.511 155.901 25.609  1.00 37.40  ? 627  ASP B C   1 
ATOM   9885  O  O   . ASP B 1 627 ? 33.832 155.374 24.729  1.00 37.37  ? 627  ASP B O   1 
ATOM   9886  C  CB  . ASP B 1 627 ? 34.154 158.378 25.542  1.00 37.71  ? 627  ASP B CB  1 
ATOM   9887  C  CG  . ASP B 1 627 ? 33.271 158.382 24.302  1.00 37.88  ? 627  ASP B CG  1 
ATOM   9888  O  OD1 . ASP B 1 627 ? 32.034 158.297 24.453  1.00 38.15  ? 627  ASP B OD1 1 
ATOM   9889  O  OD2 . ASP B 1 627 ? 33.719 158.466 23.139  1.00 38.06  ? 627  ASP B OD2 1 
ATOM   9890  N  N   . TRP B 1 628 ? 35.725 155.475 25.936  1.00 37.21  ? 628  TRP B N   1 
ATOM   9891  C  CA  . TRP B 1 628 ? 36.323 154.309 25.294  1.00 37.04  ? 628  TRP B CA  1 
ATOM   9892  C  C   . TRP B 1 628 ? 36.338 153.146 26.278  1.00 36.93  ? 628  TRP B C   1 
ATOM   9893  O  O   . TRP B 1 628 ? 35.736 152.103 26.031  1.00 36.79  ? 628  TRP B O   1 
ATOM   9894  C  CB  . TRP B 1 628 ? 37.727 154.638 24.780  1.00 36.98  ? 628  TRP B CB  1 
ATOM   9895  C  CG  . TRP B 1 628 ? 37.728 155.799 23.829  1.00 36.57  ? 628  TRP B CG  1 
ATOM   9896  C  CD1 . TRP B 1 628 ? 37.633 157.119 24.150  1.00 36.33  ? 628  TRP B CD1 1 
ATOM   9897  C  CD2 . TRP B 1 628 ? 37.801 155.740 22.401  1.00 36.03  ? 628  TRP B CD2 1 
ATOM   9898  N  NE1 . TRP B 1 628 ? 37.655 157.887 23.011  1.00 36.21  ? 628  TRP B NE1 1 
ATOM   9899  C  CE2 . TRP B 1 628 ? 37.756 157.062 21.923  1.00 35.97  ? 628  TRP B CE2 1 
ATOM   9900  C  CE3 . TRP B 1 628 ? 37.907 154.701 21.474  1.00 35.79  ? 628  TRP B CE3 1 
ATOM   9901  C  CZ2 . TRP B 1 628 ? 37.813 157.368 20.571  1.00 35.93  ? 628  TRP B CZ2 1 
ATOM   9902  C  CZ3 . TRP B 1 628 ? 37.964 155.008 20.134  1.00 35.60  ? 628  TRP B CZ3 1 
ATOM   9903  C  CH2 . TRP B 1 628 ? 37.917 156.330 19.694  1.00 35.75  ? 628  TRP B CH2 1 
ATOM   9904  N  N   . LEU B 1 629 ? 37.023 153.339 27.399  1.00 36.92  ? 629  LEU B N   1 
ATOM   9905  C  CA  . LEU B 1 629 ? 37.033 152.346 28.458  1.00 36.96  ? 629  LEU B CA  1 
ATOM   9906  C  C   . LEU B 1 629 ? 35.730 152.492 29.214  1.00 37.08  ? 629  LEU B C   1 
ATOM   9907  O  O   . LEU B 1 629 ? 35.195 153.594 29.325  1.00 37.06  ? 629  LEU B O   1 
ATOM   9908  C  CB  . LEU B 1 629 ? 38.185 152.585 29.429  1.00 36.92  ? 629  LEU B CB  1 
ATOM   9909  C  CG  . LEU B 1 629 ? 39.560 152.895 28.851  1.00 36.65  ? 629  LEU B CG  1 
ATOM   9910  C  CD1 . LEU B 1 629 ? 40.609 152.704 29.926  1.00 36.57  ? 629  LEU B CD1 1 
ATOM   9911  C  CD2 . LEU B 1 629 ? 39.834 151.995 27.681  1.00 36.77  ? 629  LEU B CD2 1 
ATOM   9912  N  N   . GLY B 1 630 ? 35.225 151.384 29.740  1.00 37.20  ? 630  GLY B N   1 
ATOM   9913  C  CA  . GLY B 1 630 ? 33.986 151.403 30.494  1.00 37.31  ? 630  GLY B CA  1 
ATOM   9914  C  C   . GLY B 1 630 ? 33.196 152.677 30.287  1.00 37.28  ? 630  GLY B C   1 
ATOM   9915  O  O   . GLY B 1 630 ? 32.041 152.772 30.700  1.00 37.39  ? 630  GLY B O   1 
ATOM   9916  N  N   . CYS B 1 631 ? 32.481 153.454 32.151  1.00 41.25  ? 631  CYS B N   1 
ATOM   9917  C  CA  . CYS B 1 631 ? 32.697 153.797 33.545  1.00 41.18  ? 631  CYS B CA  1 
ATOM   9918  C  C   . CYS B 1 631 ? 32.819 155.305 33.670  1.00 41.14  ? 631  CYS B C   1 
ATOM   9919  O  O   . CYS B 1 631 ? 32.165 156.042 32.931  1.00 41.15  ? 631  CYS B O   1 
ATOM   9920  C  CB  . CYS B 1 631 ? 33.947 153.094 34.087  1.00 41.21  ? 631  CYS B CB  1 
ATOM   9921  S  SG  . CYS B 1 631 ? 35.417 153.211 33.036  1.00 41.43  ? 631  CYS B SG  1 
ATOM   9922  N  N   . CYS C 2 1   ? 71.936 -0.922  50.632  1.00 36.27  ? 1    CYS C N   1 
ATOM   9923  C  CA  . CYS C 2 1   ? 71.015 -0.642  49.497  1.00 36.23  ? 1    CYS C CA  1 
ATOM   9924  C  C   . CYS C 2 1   ? 71.118 0.826   49.107  1.00 36.28  ? 1    CYS C C   1 
ATOM   9925  O  O   . CYS C 2 1   ? 70.727 1.714   49.864  1.00 36.26  ? 1    CYS C O   1 
ATOM   9926  C  CB  . CYS C 2 1   ? 69.571 -0.997  49.873  1.00 36.22  ? 1    CYS C CB  1 
ATOM   9927  S  SG  . CYS C 2 1   ? 68.481 -1.461  48.498  1.00 36.08  ? 1    CYS C SG  1 
ATOM   9928  N  N   . SER C 2 2   ? 71.678 1.067   47.928  1.00 36.34  ? 2    SER C N   1 
ATOM   9929  C  CA  . SER C 2 2   ? 71.793 2.407   47.378  1.00 36.31  ? 2    SER C CA  1 
ATOM   9930  C  C   . SER C 2 2   ? 71.227 2.331   45.973  1.00 36.37  ? 2    SER C C   1 
ATOM   9931  O  O   . SER C 2 2   ? 71.948 2.034   45.023  1.00 36.30  ? 2    SER C O   1 
ATOM   9932  C  CB  . SER C 2 2   ? 73.253 2.852   47.332  1.00 36.29  ? 2    SER C CB  1 
ATOM   9933  O  OG  . SER C 2 2   ? 73.949 2.208   46.278  1.00 36.20  ? 2    SER C OG  1 
ATOM   9934  N  N   . CYS C 2 3   ? 69.930 2.588   45.841  1.00 36.49  ? 3    CYS C N   1 
ATOM   9935  C  CA  . CYS C 2 3   ? 69.278 2.469   44.543  1.00 36.66  ? 3    CYS C CA  1 
ATOM   9936  C  C   . CYS C 2 3   ? 69.255 3.732   43.698  1.00 36.63  ? 3    CYS C C   1 
ATOM   9937  O  O   . CYS C 2 3   ? 68.823 4.792   44.150  1.00 36.64  ? 3    CYS C O   1 
ATOM   9938  C  CB  . CYS C 2 3   ? 67.853 1.961   44.689  1.00 36.75  ? 3    CYS C CB  1 
ATOM   9939  S  SG  . CYS C 2 3   ? 67.277 1.244   43.141  1.00 37.24  ? 3    CYS C SG  1 
ATOM   9940  N  N   . SER C 2 4   ? 69.689 3.591   42.451  1.00 36.63  ? 4    SER C N   1 
ATOM   9941  C  CA  . SER C 2 4   ? 69.722 4.702   41.509  1.00 36.67  ? 4    SER C CA  1 
ATOM   9942  C  C   . SER C 2 4   ? 68.321 5.094   41.027  1.00 36.68  ? 4    SER C C   1 
ATOM   9943  O  O   . SER C 2 4   ? 67.395 4.283   41.038  1.00 36.72  ? 4    SER C O   1 
ATOM   9944  C  CB  . SER C 2 4   ? 70.635 4.369   40.327  1.00 36.67  ? 4    SER C CB  1 
ATOM   9945  O  OG  . SER C 2 4   ? 71.991 4.317   40.739  1.00 36.55  ? 4    SER C OG  1 
ATOM   9946  N  N   . PRO C 2 5   ? 68.178 6.351   40.622  1.00 36.64  ? 5    PRO C N   1 
ATOM   9947  C  CA  . PRO C 2 5   ? 66.896 6.901   40.165  1.00 36.62  ? 5    PRO C CA  1 
ATOM   9948  C  C   . PRO C 2 5   ? 66.486 6.464   38.759  1.00 36.62  ? 5    PRO C C   1 
ATOM   9949  O  O   . PRO C 2 5   ? 67.347 6.314   37.891  1.00 36.65  ? 5    PRO C O   1 
ATOM   9950  C  CB  . PRO C 2 5   ? 67.155 8.412   40.171  1.00 36.64  ? 5    PRO C CB  1 
ATOM   9951  C  CG  . PRO C 2 5   ? 68.454 8.583   40.920  1.00 36.64  ? 5    PRO C CG  1 
ATOM   9952  C  CD  . PRO C 2 5   ? 69.246 7.361   40.616  1.00 36.59  ? 5    PRO C CD  1 
ATOM   9953  N  N   . VAL C 2 6   ? 65.182 6.277   38.549  1.00 36.60  ? 6    VAL C N   1 
ATOM   9954  C  CA  . VAL C 2 6   ? 64.629 5.899   37.244  1.00 36.54  ? 6    VAL C CA  1 
ATOM   9955  C  C   . VAL C 2 6   ? 63.141 6.242   37.105  1.00 36.55  ? 6    VAL C C   1 
ATOM   9956  O  O   . VAL C 2 6   ? 62.410 6.321   38.093  1.00 36.53  ? 6    VAL C O   1 
ATOM   9957  C  CB  . VAL C 2 6   ? 64.795 4.397   36.955  1.00 36.46  ? 6    VAL C CB  1 
ATOM   9958  C  CG1 . VAL C 2 6   ? 66.256 4.047   36.727  1.00 36.36  ? 6    VAL C CG1 1 
ATOM   9959  C  CG2 . VAL C 2 6   ? 64.197 3.574   38.079  1.00 36.42  ? 6    VAL C CG2 1 
ATOM   9960  N  N   . HIS C 2 7   ? 62.701 6.426   35.863  1.00 36.55  ? 7    HIS C N   1 
ATOM   9961  C  CA  . HIS C 2 7   ? 61.314 6.768   35.565  1.00 36.56  ? 7    HIS C CA  1 
ATOM   9962  C  C   . HIS C 2 7   ? 60.438 5.525   35.537  1.00 36.51  ? 7    HIS C C   1 
ATOM   9963  O  O   . HIS C 2 7   ? 60.787 4.532   34.903  1.00 36.53  ? 7    HIS C O   1 
ATOM   9964  C  CB  . HIS C 2 7   ? 61.235 7.486   34.216  1.00 36.62  ? 7    HIS C CB  1 
ATOM   9965  C  CG  . HIS C 2 7   ? 59.860 7.959   33.852  1.00 36.79  ? 7    HIS C CG  1 
ATOM   9966  N  ND1 . HIS C 2 7   ? 59.286 9.082   34.409  1.00 36.98  ? 7    HIS C ND1 1 
ATOM   9967  C  CD2 . HIS C 2 7   ? 58.953 7.471   32.973  1.00 36.91  ? 7    HIS C CD2 1 
ATOM   9968  C  CE1 . HIS C 2 7   ? 58.082 9.258   33.896  1.00 36.85  ? 7    HIS C CE1 1 
ATOM   9969  N  NE2 . HIS C 2 7   ? 57.855 8.295   33.022  1.00 36.82  ? 7    HIS C NE2 1 
ATOM   9970  N  N   . PRO C 2 8   ? 59.304 5.584   36.229  1.00 36.47  ? 8    PRO C N   1 
ATOM   9971  C  CA  . PRO C 2 8   ? 58.348 4.474   36.280  1.00 36.50  ? 8    PRO C CA  1 
ATOM   9972  C  C   . PRO C 2 8   ? 58.067 3.802   34.935  1.00 36.55  ? 8    PRO C C   1 
ATOM   9973  O  O   . PRO C 2 8   ? 57.284 2.853   34.904  1.00 36.57  ? 8    PRO C O   1 
ATOM   9974  C  CB  . PRO C 2 8   ? 57.084 5.140   36.820  1.00 36.45  ? 8    PRO C CB  1 
ATOM   9975  C  CG  . PRO C 2 8   ? 57.604 6.205   37.713  1.00 36.40  ? 8    PRO C CG  1 
ATOM   9976  C  CD  . PRO C 2 8   ? 58.862 6.721   37.053  1.00 36.47  ? 8    PRO C CD  1 
ATOM   9977  N  N   . GLN C 2 9   ? 58.670 4.278   33.849  1.00 36.58  ? 9    GLN C N   1 
ATOM   9978  C  CA  . GLN C 2 9   ? 58.517 3.591   32.571  1.00 36.65  ? 9    GLN C CA  1 
ATOM   9979  C  C   . GLN C 2 9   ? 59.580 2.510   32.484  1.00 36.76  ? 9    GLN C C   1 
ATOM   9980  O  O   . GLN C 2 9   ? 59.275 1.343   32.234  1.00 36.75  ? 9    GLN C O   1 
ATOM   9981  C  CB  . GLN C 2 9   ? 58.654 4.534   31.379  1.00 36.58  ? 9    GLN C CB  1 
ATOM   9982  C  CG  . GLN C 2 9   ? 58.268 3.864   30.067  1.00 36.44  ? 9    GLN C CG  1 
ATOM   9983  C  CD  . GLN C 2 9   ? 58.780 4.597   28.849  1.00 36.44  ? 9    GLN C CD  1 
ATOM   9984  O  OE1 . GLN C 2 9   ? 58.278 5.667   28.501  1.00 36.58  ? 9    GLN C OE1 1 
ATOM   9985  N  NE2 . GLN C 2 9   ? 59.776 4.021   28.189  1.00 36.29  ? 9    GLN C NE2 1 
ATOM   9986  N  N   . GLN C 2 10  ? 60.830 2.911   32.691  1.00 36.87  ? 10   GLN C N   1 
ATOM   9987  C  CA  . GLN C 2 10  ? 61.944 1.976   32.689  1.00 37.02  ? 10   GLN C CA  1 
ATOM   9988  C  C   . GLN C 2 10  ? 61.602 0.761   33.545  1.00 37.16  ? 10   GLN C C   1 
ATOM   9989  O  O   . GLN C 2 10  ? 61.920 -0.372  33.185  1.00 37.25  ? 10   GLN C O   1 
ATOM   9990  C  CB  . GLN C 2 10  ? 63.217 2.650   33.206  1.00 36.99  ? 10   GLN C CB  1 
ATOM   9991  C  CG  . GLN C 2 10  ? 64.005 3.405   32.146  1.00 36.98  ? 10   GLN C CG  1 
ATOM   9992  C  CD  . GLN C 2 10  ? 64.695 2.478   31.156  1.00 37.06  ? 10   GLN C CD  1 
ATOM   9993  O  OE1 . GLN C 2 10  ? 65.787 1.974   31.424  1.00 36.91  ? 10   GLN C OE1 1 
ATOM   9994  N  NE2 . GLN C 2 10  ? 64.060 2.255   30.012  1.00 37.11  ? 10   GLN C NE2 1 
ATOM   9995  N  N   . ALA C 2 11  ? 60.952 1.005   34.679  1.00 37.23  ? 11   ALA C N   1 
ATOM   9996  C  CA  . ALA C 2 11  ? 60.526 -0.070  35.565  1.00 37.30  ? 11   ALA C CA  1 
ATOM   9997  C  C   . ALA C 2 11  ? 59.839 -1.156  34.749  1.00 37.38  ? 11   ALA C C   1 
ATOM   9998  O  O   . ALA C 2 11  ? 60.327 -2.280  34.652  1.00 37.37  ? 11   ALA C O   1 
ATOM   9999  C  CB  . ALA C 2 11  ? 59.584 0.466   36.622  1.00 37.27  ? 11   ALA C CB  1 
ATOM   10000 N  N   . PHE C 2 12  ? 58.713 -0.792  34.144  1.00 37.50  ? 12   PHE C N   1 
ATOM   10001 C  CA  . PHE C 2 12  ? 57.925 -1.697  33.313  1.00 37.57  ? 12   PHE C CA  1 
ATOM   10002 C  C   . PHE C 2 12  ? 58.703 -2.182  32.084  1.00 37.57  ? 12   PHE C C   1 
ATOM   10003 O  O   . PHE C 2 12  ? 58.200 -2.986  31.300  1.00 37.61  ? 12   PHE C O   1 
ATOM   10004 C  CB  . PHE C 2 12  ? 56.631 -0.997  32.876  1.00 37.60  ? 12   PHE C CB  1 
ATOM   10005 C  CG  . PHE C 2 12  ? 55.533 -1.939  32.464  1.00 37.67  ? 12   PHE C CG  1 
ATOM   10006 C  CD1 . PHE C 2 12  ? 54.768 -2.590  33.417  1.00 37.75  ? 12   PHE C CD1 1 
ATOM   10007 C  CD2 . PHE C 2 12  ? 55.259 -2.164  31.125  1.00 37.65  ? 12   PHE C CD2 1 
ATOM   10008 C  CE1 . PHE C 2 12  ? 53.758 -3.453  33.042  1.00 37.69  ? 12   PHE C CE1 1 
ATOM   10009 C  CE2 . PHE C 2 12  ? 54.249 -3.028  30.745  1.00 37.74  ? 12   PHE C CE2 1 
ATOM   10010 C  CZ  . PHE C 2 12  ? 53.499 -3.673  31.706  1.00 37.70  ? 12   PHE C CZ  1 
ATOM   10011 N  N   . CYS C 2 13  ? 59.929 -1.692  31.920  1.00 37.51  ? 13   CYS C N   1 
ATOM   10012 C  CA  . CYS C 2 13  ? 60.766 -2.093  30.793  1.00 37.48  ? 13   CYS C CA  1 
ATOM   10013 C  C   . CYS C 2 13  ? 61.920 -2.980  31.240  1.00 37.50  ? 13   CYS C C   1 
ATOM   10014 O  O   . CYS C 2 13  ? 62.157 -4.041  30.665  1.00 37.53  ? 13   CYS C O   1 
ATOM   10015 C  CB  . CYS C 2 13  ? 61.312 -0.868  30.061  1.00 37.44  ? 13   CYS C CB  1 
ATOM   10016 S  SG  . CYS C 2 13  ? 60.056 0.094   29.195  1.00 37.35  ? 13   CYS C SG  1 
ATOM   10017 N  N   . ASN C 2 14  ? 62.638 -2.541  32.266  1.00 37.53  ? 14   ASN C N   1 
ATOM   10018 C  CA  . ASN C 2 14  ? 63.770 -3.300  32.782  1.00 37.56  ? 14   ASN C CA  1 
ATOM   10019 C  C   . ASN C 2 14  ? 63.340 -4.458  33.675  1.00 37.56  ? 14   ASN C C   1 
ATOM   10020 O  O   . ASN C 2 14  ? 64.114 -5.384  33.914  1.00 37.58  ? 14   ASN C O   1 
ATOM   10021 C  CB  . ASN C 2 14  ? 64.725 -2.383  33.550  1.00 37.59  ? 14   ASN C CB  1 
ATOM   10022 C  CG  . ASN C 2 14  ? 65.313 -1.292  32.679  1.00 37.52  ? 14   ASN C CG  1 
ATOM   10023 O  OD1 . ASN C 2 14  ? 64.656 -0.791  31.768  1.00 37.52  ? 14   ASN C OD1 1 
ATOM   10024 N  ND2 . ASN C 2 14  ? 66.557 -0.918  32.955  1.00 37.49  ? 14   ASN C ND2 1 
ATOM   10025 N  N   . ALA C 2 15  ? 62.105 -4.403  34.165  1.00 37.58  ? 15   ALA C N   1 
ATOM   10026 C  CA  . ALA C 2 15  ? 61.590 -5.434  35.064  1.00 37.61  ? 15   ALA C CA  1 
ATOM   10027 C  C   . ALA C 2 15  ? 61.056 -6.657  34.324  1.00 37.59  ? 15   ALA C C   1 
ATOM   10028 O  O   . ALA C 2 15  ? 60.329 -6.533  33.339  1.00 37.57  ? 15   ALA C O   1 
ATOM   10029 C  CB  . ALA C 2 15  ? 60.519 -4.856  35.973  1.00 37.62  ? 15   ALA C CB  1 
ATOM   10030 N  N   . ASP C 2 16  ? 61.421 -7.837  34.815  1.00 37.56  ? 16   ASP C N   1 
ATOM   10031 C  CA  . ASP C 2 16  ? 60.976 -9.091  34.219  1.00 37.57  ? 16   ASP C CA  1 
ATOM   10032 C  C   . ASP C 2 16  ? 59.462 -9.241  34.314  1.00 37.52  ? 16   ASP C C   1 
ATOM   10033 O  O   . ASP C 2 16  ? 58.790 -9.470  33.310  1.00 37.53  ? 16   ASP C O   1 
ATOM   10034 C  CB  . ASP C 2 16  ? 61.654 -10.281 34.902  1.00 37.59  ? 16   ASP C CB  1 
ATOM   10035 C  CG  . ASP C 2 16  ? 63.164 -10.245 34.777  1.00 37.71  ? 16   ASP C CG  1 
ATOM   10036 O  OD1 . ASP C 2 16  ? 63.667 -9.825  33.714  1.00 37.93  ? 16   ASP C OD1 1 
ATOM   10037 O  OD2 . ASP C 2 16  ? 63.927 -10.620 35.692  1.00 37.73  ? 16   ASP C OD2 1 
ATOM   10038 N  N   . VAL C 2 17  ? 58.932 -9.107  35.527  1.00 37.45  ? 17   VAL C N   1 
ATOM   10039 C  CA  . VAL C 2 17  ? 57.498 -9.246  35.765  1.00 37.32  ? 17   VAL C CA  1 
ATOM   10040 C  C   . VAL C 2 17  ? 56.969 -8.137  36.677  1.00 37.26  ? 17   VAL C C   1 
ATOM   10041 O  O   . VAL C 2 17  ? 57.640 -7.732  37.623  1.00 37.29  ? 17   VAL C O   1 
ATOM   10042 C  CB  . VAL C 2 17  ? 57.172 -10.624 36.382  1.00 37.30  ? 17   VAL C CB  1 
ATOM   10043 C  CG1 . VAL C 2 17  ? 57.871 -10.789 37.721  1.00 37.23  ? 17   VAL C CG1 1 
ATOM   10044 C  CG2 . VAL C 2 17  ? 55.671 -10.812 36.526  1.00 37.26  ? 17   VAL C CG2 1 
ATOM   10045 N  N   . VAL C 2 18  ? 55.767 -7.647  36.381  1.00 37.13  ? 18   VAL C N   1 
ATOM   10046 C  CA  . VAL C 2 18  ? 55.139 -6.592  37.172  1.00 37.02  ? 18   VAL C CA  1 
ATOM   10047 C  C   . VAL C 2 18  ? 53.683 -6.940  37.454  1.00 36.98  ? 18   VAL C C   1 
ATOM   10048 O  O   . VAL C 2 18  ? 52.912 -7.163  36.530  1.00 36.99  ? 18   VAL C O   1 
ATOM   10049 C  CB  . VAL C 2 18  ? 55.155 -5.250  36.426  1.00 37.00  ? 18   VAL C CB  1 
ATOM   10050 C  CG1 . VAL C 2 18  ? 54.993 -4.102  37.406  1.00 37.02  ? 18   VAL C CG1 1 
ATOM   10051 C  CG2 . VAL C 2 18  ? 56.432 -5.098  35.611  1.00 37.02  ? 18   VAL C CG2 1 
ATOM   10052 N  N   . ILE C 2 19  ? 53.304 -6.985  38.727  1.00 36.93  ? 19   ILE C N   1 
ATOM   10053 C  CA  . ILE C 2 19  ? 51.929 -7.320  39.101  1.00 36.90  ? 19   ILE C CA  1 
ATOM   10054 C  C   . ILE C 2 19  ? 51.596 -6.739  40.468  1.00 36.90  ? 19   ILE C C   1 
ATOM   10055 O  O   . ILE C 2 19  ? 52.496 -6.390  41.224  1.00 36.92  ? 19   ILE C O   1 
ATOM   10056 C  CB  . ILE C 2 19  ? 51.725 -8.859  39.142  1.00 36.88  ? 19   ILE C CB  1 
ATOM   10057 C  CG1 . ILE C 2 19  ? 52.033 -9.422  40.535  1.00 36.78  ? 19   ILE C CG1 1 
ATOM   10058 C  CG2 . ILE C 2 19  ? 52.573 -9.555  38.096  1.00 36.84  ? 19   ILE C CG2 1 
ATOM   10059 C  CD1 . ILE C 2 19  ? 53.511 -9.559  40.839  1.00 36.54  ? 19   ILE C CD1 1 
ATOM   10060 N  N   . ARG C 2 20  ? 50.313 -6.638  40.799  1.00 36.90  ? 20   ARG C N   1 
ATOM   10061 C  CA  . ARG C 2 20  ? 49.958 -6.173  42.137  1.00 36.89  ? 20   ARG C CA  1 
ATOM   10062 C  C   . ARG C 2 20  ? 49.621 -7.313  43.093  1.00 36.95  ? 20   ARG C C   1 
ATOM   10063 O  O   . ARG C 2 20  ? 48.567 -7.947  42.999  1.00 36.91  ? 20   ARG C O   1 
ATOM   10064 C  CB  . ARG C 2 20  ? 48.879 -5.081  42.128  1.00 36.84  ? 20   ARG C CB  1 
ATOM   10065 C  CG  . ARG C 2 20  ? 47.596 -5.390  41.383  1.00 36.70  ? 20   ARG C CG  1 
ATOM   10066 C  CD  . ARG C 2 20  ? 46.606 -4.232  41.436  1.00 36.47  ? 20   ARG C CD  1 
ATOM   10067 N  NE  . ARG C 2 20  ? 45.332 -4.525  40.790  1.00 36.36  ? 20   ARG C NE  1 
ATOM   10068 C  CZ  . ARG C 2 20  ? 44.289 -3.706  40.806  1.00 36.14  ? 20   ARG C CZ  1 
ATOM   10069 N  NH1 . ARG C 2 20  ? 44.370 -2.546  41.437  1.00 35.93  ? 20   ARG C NH1 1 
ATOM   10070 N  NH2 . ARG C 2 20  ? 43.162 -4.043  40.196  1.00 36.13  ? 20   ARG C NH2 1 
ATOM   10071 N  N   . ALA C 2 21  ? 50.555 -7.579  43.999  1.00 37.01  ? 21   ALA C N   1 
ATOM   10072 C  CA  . ALA C 2 21  ? 50.404 -8.633  44.987  1.00 37.08  ? 21   ALA C CA  1 
ATOM   10073 C  C   . ALA C 2 21  ? 50.258 -8.036  46.381  1.00 37.15  ? 21   ALA C C   1 
ATOM   10074 O  O   . ALA C 2 21  ? 50.329 -6.819  46.561  1.00 37.17  ? 21   ALA C O   1 
ATOM   10075 C  CB  . ALA C 2 21  ? 51.592 -9.577  44.933  1.00 37.08  ? 21   ALA C CB  1 
ATOM   10076 N  N   . LYS C 2 22  ? 50.066 -8.905  47.366  1.00 37.19  ? 22   LYS C N   1 
ATOM   10077 C  CA  . LYS C 2 22  ? 49.858 -8.486  48.744  1.00 37.25  ? 22   LYS C CA  1 
ATOM   10078 C  C   . LYS C 2 22  ? 50.338 -9.601  49.663  1.00 37.31  ? 22   LYS C C   1 
ATOM   10079 O  O   . LYS C 2 22  ? 50.561 -10.718 49.212  1.00 37.34  ? 22   LYS C O   1 
ATOM   10080 C  CB  . LYS C 2 22  ? 48.370 -8.208  48.960  1.00 37.23  ? 22   LYS C CB  1 
ATOM   10081 C  CG  . LYS C 2 22  ? 47.875 -8.350  50.385  1.00 37.24  ? 22   LYS C CG  1 
ATOM   10082 C  CD  . LYS C 2 22  ? 46.370 -8.558  50.399  1.00 37.18  ? 22   LYS C CD  1 
ATOM   10083 C  CE  . LYS C 2 22  ? 45.683 -7.613  49.426  1.00 37.17  ? 22   LYS C CE  1 
ATOM   10084 N  NZ  . LYS C 2 22  ? 44.203 -7.755  49.452  1.00 37.09  ? 22   LYS C NZ  1 
ATOM   10085 N  N   . ALA C 2 23  ? 50.504 -9.306  50.947  1.00 37.38  ? 23   ALA C N   1 
ATOM   10086 C  CA  . ALA C 2 23  ? 50.966 -10.321 51.887  1.00 37.44  ? 23   ALA C CA  1 
ATOM   10087 C  C   . ALA C 2 23  ? 49.842 -10.876 52.763  1.00 37.47  ? 23   ALA C C   1 
ATOM   10088 O  O   . ALA C 2 23  ? 49.248 -10.147 53.556  1.00 37.49  ? 23   ALA C O   1 
ATOM   10089 C  CB  . ALA C 2 23  ? 52.092 -9.771  52.749  1.00 37.46  ? 23   ALA C CB  1 
ATOM   10090 N  N   . VAL C 2 24  ? 49.552 -12.166 52.609  1.00 37.49  ? 24   VAL C N   1 
ATOM   10091 C  CA  . VAL C 2 24  ? 48.534 -12.835 53.418  1.00 37.48  ? 24   VAL C CA  1 
ATOM   10092 C  C   . VAL C 2 24  ? 49.172 -13.317 54.714  1.00 37.47  ? 24   VAL C C   1 
ATOM   10093 O  O   . VAL C 2 24  ? 48.740 -12.960 55.810  1.00 37.46  ? 24   VAL C O   1 
ATOM   10094 C  CB  . VAL C 2 24  ? 47.921 -14.040 52.683  1.00 37.48  ? 24   VAL C CB  1 
ATOM   10095 C  CG1 . VAL C 2 24  ? 47.008 -14.829 53.613  1.00 37.46  ? 24   VAL C CG1 1 
ATOM   10096 C  CG2 . VAL C 2 24  ? 47.166 -13.580 51.445  1.00 37.52  ? 24   VAL C CG2 1 
ATOM   10097 N  N   . SER C 2 25  ? 50.202 -14.141 54.570  1.00 37.48  ? 25   SER C N   1 
ATOM   10098 C  CA  . SER C 2 25  ? 50.978 -14.627 55.701  1.00 37.47  ? 25   SER C CA  1 
ATOM   10099 C  C   . SER C 2 25  ? 52.428 -14.715 55.248  1.00 37.49  ? 25   SER C C   1 
ATOM   10100 O  O   . SER C 2 25  ? 52.759 -15.476 54.342  1.00 37.50  ? 25   SER C O   1 
ATOM   10101 C  CB  . SER C 2 25  ? 50.461 -15.980 56.199  1.00 37.46  ? 25   SER C CB  1 
ATOM   10102 O  OG  . SER C 2 25  ? 50.120 -16.836 55.125  1.00 37.39  ? 25   SER C OG  1 
ATOM   10103 N  N   . GLU C 2 26  ? 53.284 -13.912 55.866  1.00 37.50  ? 26   GLU C N   1 
ATOM   10104 C  CA  . GLU C 2 26  ? 54.687 -13.862 55.482  1.00 37.51  ? 26   GLU C CA  1 
ATOM   10105 C  C   . GLU C 2 26  ? 55.345 -15.225 55.590  1.00 37.54  ? 26   GLU C C   1 
ATOM   10106 O  O   . GLU C 2 26  ? 55.267 -15.885 56.625  1.00 37.57  ? 26   GLU C O   1 
ATOM   10107 C  CB  . GLU C 2 26  ? 55.448 -12.876 56.363  1.00 37.49  ? 26   GLU C CB  1 
ATOM   10108 C  CG  . GLU C 2 26  ? 55.831 -13.449 57.716  1.00 37.43  ? 26   GLU C CG  1 
ATOM   10109 C  CD  . GLU C 2 26  ? 56.740 -12.532 58.501  1.00 37.43  ? 26   GLU C CD  1 
ATOM   10110 O  OE1 . GLU C 2 26  ? 57.712 -12.014 57.914  1.00 37.47  ? 26   GLU C OE1 1 
ATOM   10111 O  OE2 . GLU C 2 26  ? 56.482 -12.333 59.706  1.00 37.35  ? 26   GLU C OE2 1 
ATOM   10112 N  N   . LYS C 2 27  ? 55.992 -15.649 54.516  1.00 37.57  ? 27   LYS C N   1 
ATOM   10113 C  CA  . LYS C 2 27  ? 56.714 -16.905 54.542  1.00 37.62  ? 27   LYS C CA  1 
ATOM   10114 C  C   . LYS C 2 27  ? 57.966 -16.694 55.375  1.00 37.65  ? 27   LYS C C   1 
ATOM   10115 O  O   . LYS C 2 27  ? 59.071 -16.563 54.853  1.00 37.68  ? 27   LYS C O   1 
ATOM   10116 C  CB  . LYS C 2 27  ? 57.057 -17.344 53.132  1.00 37.62  ? 27   LYS C CB  1 
ATOM   10117 C  CG  . LYS C 2 27  ? 55.890 -17.936 52.386  1.00 37.66  ? 27   LYS C CG  1 
ATOM   10118 C  CD  . LYS C 2 27  ? 55.529 -19.280 52.978  1.00 37.82  ? 27   LYS C CD  1 
ATOM   10119 C  CE  . LYS C 2 27  ? 54.431 -19.944 52.185  1.00 37.85  ? 27   LYS C CE  1 
ATOM   10120 N  NZ  . LYS C 2 27  ? 54.059 -21.283 52.709  1.00 37.67  ? 27   LYS C NZ  1 
ATOM   10121 N  N   . GLU C 2 28  ? 57.761 -16.649 56.686  1.00 37.67  ? 28   GLU C N   1 
ATOM   10122 C  CA  . GLU C 2 28  ? 58.829 -16.407 57.641  1.00 37.66  ? 28   GLU C CA  1 
ATOM   10123 C  C   . GLU C 2 28  ? 60.216 -16.773 57.135  1.00 37.65  ? 28   GLU C C   1 
ATOM   10124 O  O   . GLU C 2 28  ? 60.604 -17.940 57.115  1.00 37.63  ? 28   GLU C O   1 
ATOM   10125 C  CB  . GLU C 2 28  ? 58.549 -17.129 58.959  1.00 37.67  ? 28   GLU C CB  1 
ATOM   10126 C  CG  . GLU C 2 28  ? 59.424 -16.658 60.109  1.00 37.70  ? 28   GLU C CG  1 
ATOM   10127 C  CD  . GLU C 2 28  ? 59.132 -15.226 60.515  1.00 37.73  ? 28   GLU C CD  1 
ATOM   10128 O  OE1 . GLU C 2 28  ? 58.140 -14.653 60.020  1.00 37.64  ? 28   GLU C OE1 1 
ATOM   10129 O  OE2 . GLU C 2 28  ? 59.894 -14.671 61.334  1.00 37.82  ? 28   GLU C OE2 1 
ATOM   10130 N  N   . VAL C 2 29  ? 60.939 -15.749 56.706  1.00 37.65  ? 29   VAL C N   1 
ATOM   10131 C  CA  . VAL C 2 29  ? 62.335 -15.853 56.323  1.00 37.66  ? 29   VAL C CA  1 
ATOM   10132 C  C   . VAL C 2 29  ? 63.026 -17.046 56.950  1.00 37.60  ? 29   VAL C C   1 
ATOM   10133 O  O   . VAL C 2 29  ? 63.378 -16.994 58.126  1.00 37.57  ? 29   VAL C O   1 
ATOM   10134 C  CB  . VAL C 2 29  ? 63.076 -14.651 56.895  1.00 37.71  ? 29   VAL C CB  1 
ATOM   10135 C  CG1 . VAL C 2 29  ? 64.511 -14.624 56.415  1.00 37.81  ? 29   VAL C CG1 1 
ATOM   10136 C  CG2 . VAL C 2 29  ? 62.336 -13.381 56.563  1.00 37.69  ? 29   VAL C CG2 1 
ATOM   10137 N  N   . ASP C 2 30  ? 63.262 -18.104 56.182  1.00 37.59  ? 30   ASP C N   1 
ATOM   10138 C  CA  . ASP C 2 30  ? 63.911 -19.277 56.760  1.00 37.59  ? 30   ASP C CA  1 
ATOM   10139 C  C   . ASP C 2 30  ? 65.417 -19.403 56.474  1.00 37.59  ? 30   ASP C C   1 
ATOM   10140 O  O   . ASP C 2 30  ? 66.031 -18.508 55.891  1.00 37.60  ? 30   ASP C O   1 
ATOM   10141 C  CB  . ASP C 2 30  ? 63.166 -20.566 56.399  1.00 37.57  ? 30   ASP C CB  1 
ATOM   10142 C  CG  . ASP C 2 30  ? 63.358 -21.653 57.439  1.00 37.58  ? 30   ASP C CG  1 
ATOM   10143 O  OD1 . ASP C 2 30  ? 63.183 -21.460 58.661  1.00 37.53  ? 30   ASP C OD1 1 
ATOM   10144 O  OD2 . ASP C 2 30  ? 63.720 -22.786 57.061  1.00 37.68  ? 30   ASP C OD2 1 
ATOM   10145 N  N   . SER C 2 31  ? 65.977 -20.538 56.892  1.00 37.58  ? 31   SER C N   1 
ATOM   10146 C  CA  . SER C 2 31  ? 67.415 -20.854 56.849  1.00 37.56  ? 31   SER C CA  1 
ATOM   10147 C  C   . SER C 2 31  ? 68.245 -20.546 55.594  1.00 37.55  ? 31   SER C C   1 
ATOM   10148 O  O   . SER C 2 31  ? 67.722 -20.158 54.548  1.00 37.53  ? 31   SER C O   1 
ATOM   10149 C  CB  . SER C 2 31  ? 67.628 -22.327 57.225  1.00 37.55  ? 31   SER C CB  1 
ATOM   10150 O  OG  . SER C 2 31  ? 67.348 -23.183 56.131  1.00 37.50  ? 31   SER C OG  1 
ATOM   10151 N  N   . GLY C 2 32  ? 69.556 -20.752 55.737  1.00 37.54  ? 32   GLY C N   1 
ATOM   10152 C  CA  . GLY C 2 32  ? 70.536 -20.551 54.678  1.00 37.53  ? 32   GLY C CA  1 
ATOM   10153 C  C   . GLY C 2 32  ? 71.964 -20.680 55.201  1.00 37.51  ? 32   GLY C C   1 
ATOM   10154 O  O   . GLY C 2 32  ? 72.168 -21.124 56.328  1.00 37.53  ? 32   GLY C O   1 
ATOM   10155 N  N   . ASN C 2 33  ? 72.947 -20.297 54.383  1.00 37.48  ? 33   ASN C N   1 
ATOM   10156 C  CA  . ASN C 2 33  ? 74.372 -20.312 54.758  1.00 37.43  ? 33   ASN C CA  1 
ATOM   10157 C  C   . ASN C 2 33  ? 75.225 -19.512 53.762  1.00 37.41  ? 33   ASN C C   1 
ATOM   10158 O  O   . ASN C 2 33  ? 74.771 -19.229 52.659  1.00 37.40  ? 33   ASN C O   1 
ATOM   10159 C  CB  . ASN C 2 33  ? 74.905 -21.743 54.906  1.00 37.43  ? 33   ASN C CB  1 
ATOM   10160 C  CG  . ASN C 2 33  ? 75.196 -22.118 56.356  1.00 37.39  ? 33   ASN C CG  1 
ATOM   10161 O  OD1 . ASN C 2 33  ? 74.285 -22.289 57.166  1.00 37.32  ? 33   ASN C OD1 1 
ATOM   10162 N  ND2 . ASN C 2 33  ? 76.477 -22.249 56.684  1.00 37.32  ? 33   ASN C ND2 1 
ATOM   10163 N  N   . ASP C 2 34  ? 76.456 -19.161 54.135  1.00 37.41  ? 34   ASP C N   1 
ATOM   10164 C  CA  . ASP C 2 34  ? 77.295 -18.322 53.271  1.00 37.48  ? 34   ASP C CA  1 
ATOM   10165 C  C   . ASP C 2 34  ? 78.777 -18.333 53.677  1.00 37.48  ? 34   ASP C C   1 
ATOM   10166 O  O   . ASP C 2 34  ? 79.207 -19.186 54.446  1.00 37.52  ? 34   ASP C O   1 
ATOM   10167 C  CB  . ASP C 2 34  ? 76.746 -16.887 53.278  1.00 37.56  ? 34   ASP C CB  1 
ATOM   10168 C  CG  . ASP C 2 34  ? 77.395 -15.988 52.231  1.00 37.71  ? 34   ASP C CG  1 
ATOM   10169 O  OD1 . ASP C 2 34  ? 78.480 -16.335 51.726  1.00 38.04  ? 34   ASP C OD1 1 
ATOM   10170 O  OD2 . ASP C 2 34  ? 76.891 -14.904 51.859  1.00 37.54  ? 34   ASP C OD2 1 
ATOM   10171 N  N   . ILE C 2 35  ? 79.543 -17.375 53.153  1.00 37.52  ? 35   ILE C N   1 
ATOM   10172 C  CA  . ILE C 2 35  ? 80.984 -17.253 53.419  1.00 37.58  ? 35   ILE C CA  1 
ATOM   10173 C  C   . ILE C 2 35  ? 81.392 -17.468 54.878  1.00 37.62  ? 35   ILE C C   1 
ATOM   10174 O  O   . ILE C 2 35  ? 82.054 -18.456 55.198  1.00 37.63  ? 35   ILE C O   1 
ATOM   10175 C  CB  . ILE C 2 35  ? 81.522 -15.884 52.935  1.00 37.59  ? 35   ILE C CB  1 
ATOM   10176 C  CG1 . ILE C 2 35  ? 81.369 -15.739 51.418  1.00 37.62  ? 35   ILE C CG1 1 
ATOM   10177 C  CG2 . ILE C 2 35  ? 82.982 -15.723 53.329  1.00 37.58  ? 35   ILE C CG2 1 
ATOM   10178 C  CD1 . ILE C 2 35  ? 81.806 -14.385 50.881  1.00 37.42  ? 35   ILE C CD1 1 
ATOM   10179 N  N   . TYR C 2 36  ? 81.016 -16.539 55.755  1.00 37.68  ? 36   TYR C N   1 
ATOM   10180 C  CA  . TYR C 2 36  ? 81.361 -16.647 57.172  1.00 37.74  ? 36   TYR C CA  1 
ATOM   10181 C  C   . TYR C 2 36  ? 80.884 -17.976 57.735  1.00 37.77  ? 36   TYR C C   1 
ATOM   10182 O  O   . TYR C 2 36  ? 81.398 -18.462 58.742  1.00 37.76  ? 36   TYR C O   1 
ATOM   10183 C  CB  . TYR C 2 36  ? 80.744 -15.503 57.982  1.00 37.76  ? 36   TYR C CB  1 
ATOM   10184 C  CG  . TYR C 2 36  ? 81.448 -14.175 57.833  1.00 37.78  ? 36   TYR C CG  1 
ATOM   10185 C  CD1 . TYR C 2 36  ? 82.824 -14.109 57.673  1.00 37.79  ? 36   TYR C CD1 1 
ATOM   10186 C  CD2 . TYR C 2 36  ? 80.734 -12.984 57.860  1.00 37.81  ? 36   TYR C CD2 1 
ATOM   10187 C  CE1 . TYR C 2 36  ? 83.466 -12.897 57.543  1.00 37.82  ? 36   TYR C CE1 1 
ATOM   10188 C  CE2 . TYR C 2 36  ? 81.368 -11.766 57.727  1.00 37.86  ? 36   TYR C CE2 1 
ATOM   10189 C  CZ  . TYR C 2 36  ? 82.733 -11.727 57.569  1.00 37.86  ? 36   TYR C CZ  1 
ATOM   10190 O  OH  . TYR C 2 36  ? 83.366 -10.512 57.435  1.00 37.95  ? 36   TYR C OH  1 
ATOM   10191 N  N   . GLY C 2 37  ? 79.894 -18.558 57.067  1.00 37.81  ? 37   GLY C N   1 
ATOM   10192 C  CA  . GLY C 2 37  ? 79.307 -19.811 57.494  1.00 37.86  ? 37   GLY C CA  1 
ATOM   10193 C  C   . GLY C 2 37  ? 77.831 -19.614 57.763  1.00 37.88  ? 37   GLY C C   1 
ATOM   10194 O  O   . GLY C 2 37  ? 76.988 -20.009 56.961  1.00 37.94  ? 37   GLY C O   1 
ATOM   10195 N  N   . ASN C 2 38  ? 77.531 -18.977 58.890  1.00 37.86  ? 38   ASN C N   1 
ATOM   10196 C  CA  . ASN C 2 38  ? 76.161 -18.706 59.329  1.00 37.80  ? 38   ASN C CA  1 
ATOM   10197 C  C   . ASN C 2 38  ? 75.083 -18.636 58.243  1.00 37.79  ? 38   ASN C C   1 
ATOM   10198 O  O   . ASN C 2 38  ? 75.322 -18.173 57.127  1.00 37.72  ? 38   ASN C O   1 
ATOM   10199 C  CB  . ASN C 2 38  ? 76.130 -17.435 60.178  1.00 37.77  ? 38   ASN C CB  1 
ATOM   10200 C  CG  . ASN C 2 38  ? 76.973 -16.334 59.593  1.00 37.68  ? 38   ASN C CG  1 
ATOM   10201 O  OD1 . ASN C 2 38  ? 78.143 -16.180 59.942  1.00 37.54  ? 38   ASN C OD1 1 
ATOM   10202 N  ND2 . ASN C 2 38  ? 76.386 -15.559 58.689  1.00 37.69  ? 38   ASN C ND2 1 
ATOM   10203 N  N   . PRO C 2 39  ? 73.889 -19.094 58.609  1.00 37.81  ? 39   PRO C N   1 
ATOM   10204 C  CA  . PRO C 2 39  ? 72.730 -19.151 57.711  1.00 37.82  ? 39   PRO C CA  1 
ATOM   10205 C  C   . PRO C 2 39  ? 72.331 -17.853 57.013  1.00 37.81  ? 39   PRO C C   1 
ATOM   10206 O  O   . PRO C 2 39  ? 72.389 -16.773 57.600  1.00 37.83  ? 39   PRO C O   1 
ATOM   10207 C  CB  . PRO C 2 39  ? 71.592 -19.602 58.641  1.00 37.84  ? 39   PRO C CB  1 
ATOM   10208 C  CG  . PRO C 2 39  ? 72.103 -19.382 60.023  1.00 37.85  ? 39   PRO C CG  1 
ATOM   10209 C  CD  . PRO C 2 39  ? 73.571 -19.625 59.943  1.00 37.83  ? 39   PRO C CD  1 
ATOM   10210 N  N   . ILE C 2 40  ? 71.916 -17.987 55.756  1.00 37.80  ? 40   ILE C N   1 
ATOM   10211 C  CA  . ILE C 2 40  ? 71.415 -16.875 54.962  1.00 37.80  ? 40   ILE C CA  1 
ATOM   10212 C  C   . ILE C 2 40  ? 70.007 -16.534 55.423  1.00 37.83  ? 40   ILE C C   1 
ATOM   10213 O  O   . ILE C 2 40  ? 69.165 -17.416 55.593  1.00 37.85  ? 40   ILE C O   1 
ATOM   10214 C  CB  . ILE C 2 40  ? 71.384 -17.245 53.464  1.00 37.78  ? 40   ILE C CB  1 
ATOM   10215 C  CG1 . ILE C 2 40  ? 72.792 -17.242 52.874  1.00 37.71  ? 40   ILE C CG1 1 
ATOM   10216 C  CG2 . ILE C 2 40  ? 70.506 -16.275 52.688  1.00 37.76  ? 40   ILE C CG2 1 
ATOM   10217 C  CD1 . ILE C 2 40  ? 72.826 -17.605 51.403  1.00 37.54  ? 40   ILE C CD1 1 
ATOM   10218 N  N   . LYS C 2 41  ? 69.756 -15.247 55.619  1.00 37.85  ? 41   LYS C N   1 
ATOM   10219 C  CA  . LYS C 2 41  ? 68.457 -14.778 56.073  1.00 37.87  ? 41   LYS C CA  1 
ATOM   10220 C  C   . LYS C 2 41  ? 67.732 -14.092 54.933  1.00 37.88  ? 41   LYS C C   1 
ATOM   10221 O  O   . LYS C 2 41  ? 68.300 -13.244 54.252  1.00 37.88  ? 41   LYS C O   1 
ATOM   10222 C  CB  . LYS C 2 41  ? 68.659 -13.805 57.216  1.00 37.89  ? 41   LYS C CB  1 
ATOM   10223 C  CG  . LYS C 2 41  ? 69.753 -14.251 58.133  1.00 37.88  ? 41   LYS C CG  1 
ATOM   10224 C  CD  . LYS C 2 41  ? 70.041 -13.221 59.171  1.00 37.95  ? 41   LYS C CD  1 
ATOM   10225 C  CE  . LYS C 2 41  ? 70.297 -13.923 60.467  1.00 38.09  ? 41   LYS C CE  1 
ATOM   10226 N  NZ  . LYS C 2 41  ? 71.025 -15.214 60.282  1.00 38.17  ? 41   LYS C NZ  1 
ATOM   10227 N  N   . ARG C 2 42  ? 66.469 -14.447 54.735  1.00 37.86  ? 42   ARG C N   1 
ATOM   10228 C  CA  . ARG C 2 42  ? 65.701 -13.927 53.613  1.00 37.80  ? 42   ARG C CA  1 
ATOM   10229 C  C   . ARG C 2 42  ? 64.215 -13.835 53.919  1.00 37.74  ? 42   ARG C C   1 
ATOM   10230 O  O   . ARG C 2 42  ? 63.589 -14.843 54.231  1.00 37.74  ? 42   ARG C O   1 
ATOM   10231 C  CB  . ARG C 2 42  ? 65.901 -14.854 52.416  1.00 37.81  ? 42   ARG C CB  1 
ATOM   10232 C  CG  . ARG C 2 42  ? 67.219 -14.650 51.716  1.00 37.89  ? 42   ARG C CG  1 
ATOM   10233 C  CD  . ARG C 2 42  ? 67.225 -13.385 50.904  1.00 38.10  ? 42   ARG C CD  1 
ATOM   10234 N  NE  . ARG C 2 42  ? 68.541 -12.778 50.755  1.00 38.24  ? 42   ARG C NE  1 
ATOM   10235 C  CZ  . ARG C 2 42  ? 68.971 -12.253 49.620  1.00 38.18  ? 42   ARG C CZ  1 
ATOM   10236 N  NH1 . ARG C 2 42  ? 68.192 -12.288 48.549  1.00 38.13  ? 42   ARG C NH1 1 
ATOM   10237 N  NH2 . ARG C 2 42  ? 70.174 -11.699 49.545  1.00 38.12  ? 42   ARG C NH2 1 
ATOM   10238 N  N   . ILE C 2 43  ? 63.641 -12.639 53.822  1.00 37.71  ? 43   ILE C N   1 
ATOM   10239 C  CA  . ILE C 2 43  ? 62.211 -12.482 54.078  1.00 37.69  ? 43   ILE C CA  1 
ATOM   10240 C  C   . ILE C 2 43  ? 61.408 -13.121 52.943  1.00 37.67  ? 43   ILE C C   1 
ATOM   10241 O  O   . ILE C 2 43  ? 61.844 -13.122 51.792  1.00 37.66  ? 43   ILE C O   1 
ATOM   10242 C  CB  . ILE C 2 43  ? 61.826 -10.992 54.263  1.00 37.69  ? 43   ILE C CB  1 
ATOM   10243 C  CG1 . ILE C 2 43  ? 62.993 -10.190 54.855  1.00 37.70  ? 43   ILE C CG1 1 
ATOM   10244 C  CG2 . ILE C 2 43  ? 60.572 -10.862 55.127  1.00 37.70  ? 43   ILE C CG2 1 
ATOM   10245 C  CD1 . ILE C 2 43  ? 63.166 -10.337 56.353  1.00 37.80  ? 43   ILE C CD1 1 
ATOM   10246 N  N   . GLN C 2 44  ? 60.243 -13.671 53.272  1.00 37.61  ? 44   GLN C N   1 
ATOM   10247 C  CA  . GLN C 2 44  ? 59.401 -14.344 52.287  1.00 37.52  ? 44   GLN C CA  1 
ATOM   10248 C  C   . GLN C 2 44  ? 57.925 -14.027 52.538  1.00 37.51  ? 44   GLN C C   1 
ATOM   10249 O  O   . GLN C 2 44  ? 57.442 -14.153 53.660  1.00 37.48  ? 44   GLN C O   1 
ATOM   10250 C  CB  . GLN C 2 44  ? 59.661 -15.851 52.338  1.00 37.51  ? 44   GLN C CB  1 
ATOM   10251 C  CG  . GLN C 2 44  ? 58.861 -16.690 51.361  1.00 37.41  ? 44   GLN C CG  1 
ATOM   10252 C  CD  . GLN C 2 44  ? 59.082 -18.186 51.570  1.00 37.33  ? 44   GLN C CD  1 
ATOM   10253 O  OE1 . GLN C 2 44  ? 58.242 -19.001 51.191  1.00 37.28  ? 44   GLN C OE1 1 
ATOM   10254 N  NE2 . GLN C 2 44  ? 60.213 -18.543 52.168  1.00 37.25  ? 44   GLN C NE2 1 
ATOM   10255 N  N   . TYR C 2 45  ? 57.214 -13.611 51.492  1.00 37.50  ? 45   TYR C N   1 
ATOM   10256 C  CA  . TYR C 2 45  ? 55.814 -13.202 51.625  1.00 37.50  ? 45   TYR C CA  1 
ATOM   10257 C  C   . TYR C 2 45  ? 54.822 -14.122 50.910  1.00 37.44  ? 45   TYR C C   1 
ATOM   10258 O  O   . TYR C 2 45  ? 55.042 -14.508 49.768  1.00 37.44  ? 45   TYR C O   1 
ATOM   10259 C  CB  . TYR C 2 45  ? 55.629 -11.772 51.093  1.00 37.53  ? 45   TYR C CB  1 
ATOM   10260 C  CG  . TYR C 2 45  ? 56.370 -10.709 51.875  1.00 37.57  ? 45   TYR C CG  1 
ATOM   10261 C  CD1 . TYR C 2 45  ? 57.669 -10.349 51.540  1.00 37.57  ? 45   TYR C CD1 1 
ATOM   10262 C  CD2 . TYR C 2 45  ? 55.767 -10.063 52.946  1.00 37.62  ? 45   TYR C CD2 1 
ATOM   10263 C  CE1 . TYR C 2 45  ? 58.346 -9.380  52.253  1.00 37.61  ? 45   TYR C CE1 1 
ATOM   10264 C  CE2 . TYR C 2 45  ? 56.437 -9.093  53.664  1.00 37.66  ? 45   TYR C CE2 1 
ATOM   10265 C  CZ  . TYR C 2 45  ? 57.726 -8.755  53.313  1.00 37.67  ? 45   TYR C CZ  1 
ATOM   10266 O  OH  . TYR C 2 45  ? 58.396 -7.790  54.027  1.00 37.77  ? 45   TYR C OH  1 
ATOM   10267 N  N   . GLU C 2 46  ? 53.730 -14.468 51.586  1.00 37.36  ? 46   GLU C N   1 
ATOM   10268 C  CA  . GLU C 2 46  ? 52.665 -15.241 50.956  1.00 37.29  ? 46   GLU C CA  1 
ATOM   10269 C  C   . GLU C 2 46  ? 51.781 -14.238 50.243  1.00 37.27  ? 46   GLU C C   1 
ATOM   10270 O  O   . GLU C 2 46  ? 51.192 -13.366 50.878  1.00 37.26  ? 46   GLU C O   1 
ATOM   10271 C  CB  . GLU C 2 46  ? 51.856 -16.018 51.990  1.00 37.29  ? 46   GLU C CB  1 
ATOM   10272 C  CG  . GLU C 2 46  ? 50.672 -16.774 51.412  1.00 37.24  ? 46   GLU C CG  1 
ATOM   10273 C  CD  . GLU C 2 46  ? 50.029 -17.704 52.421  1.00 37.20  ? 46   GLU C CD  1 
ATOM   10274 O  OE1 . GLU C 2 46  ? 50.583 -17.855 53.529  1.00 37.15  ? 46   GLU C OE1 1 
ATOM   10275 O  OE2 . GLU C 2 46  ? 48.969 -18.284 52.107  1.00 37.26  ? 46   GLU C OE2 1 
ATOM   10276 N  N   . ILE C 2 47  ? 51.678 -14.353 48.925  1.00 37.24  ? 47   ILE C N   1 
ATOM   10277 C  CA  . ILE C 2 47  ? 50.973 -13.327 48.167  1.00 37.19  ? 47   ILE C CA  1 
ATOM   10278 C  C   . ILE C 2 47  ? 49.779 -13.763 47.317  1.00 37.21  ? 47   ILE C C   1 
ATOM   10279 O  O   . ILE C 2 47  ? 49.667 -14.915 46.896  1.00 37.25  ? 47   ILE C O   1 
ATOM   10280 C  CB  . ILE C 2 47  ? 51.985 -12.517 47.323  1.00 37.17  ? 47   ILE C CB  1 
ATOM   10281 C  CG1 . ILE C 2 47  ? 52.483 -13.325 46.124  1.00 37.09  ? 47   ILE C CG1 1 
ATOM   10282 C  CG2 . ILE C 2 47  ? 53.150 -12.085 48.191  1.00 37.11  ? 47   ILE C CG2 1 
ATOM   10283 C  CD1 . ILE C 2 47  ? 51.631 -13.173 44.888  1.00 36.98  ? 47   ILE C CD1 1 
ATOM   10284 N  N   . LYS C 2 48  ? 48.892 -12.802 47.083  1.00 37.21  ? 48   LYS C N   1 
ATOM   10285 C  CA  . LYS C 2 48  ? 47.698 -12.982 46.271  1.00 37.19  ? 48   LYS C CA  1 
ATOM   10286 C  C   . LYS C 2 48  ? 47.736 -11.962 45.131  1.00 37.18  ? 48   LYS C C   1 
ATOM   10287 O  O   . LYS C 2 48  ? 47.463 -10.777 45.333  1.00 37.19  ? 48   LYS C O   1 
ATOM   10288 C  CB  . LYS C 2 48  ? 46.447 -12.788 47.132  1.00 37.19  ? 48   LYS C CB  1 
ATOM   10289 C  CG  . LYS C 2 48  ? 45.188 -12.427 46.360  1.00 37.17  ? 48   LYS C CG  1 
ATOM   10290 C  CD  . LYS C 2 48  ? 44.545 -13.640 45.717  1.00 37.16  ? 48   LYS C CD  1 
ATOM   10291 C  CE  . LYS C 2 48  ? 43.490 -13.215 44.710  1.00 37.09  ? 48   LYS C CE  1 
ATOM   10292 N  NZ  . LYS C 2 48  ? 42.655 -12.096 45.229  1.00 37.04  ? 48   LYS C NZ  1 
ATOM   10293 N  N   . GLN C 2 49  ? 48.092 -12.428 43.939  1.00 37.15  ? 49   GLN C N   1 
ATOM   10294 C  CA  . GLN C 2 49  ? 48.210 -11.565 42.766  1.00 37.09  ? 49   GLN C CA  1 
ATOM   10295 C  C   . GLN C 2 49  ? 46.863 -11.273 42.113  1.00 37.05  ? 49   GLN C C   1 
ATOM   10296 O  O   . GLN C 2 49  ? 46.139 -12.193 41.728  1.00 37.06  ? 49   GLN C O   1 
ATOM   10297 C  CB  . GLN C 2 49  ? 49.135 -12.209 41.732  1.00 37.09  ? 49   GLN C CB  1 
ATOM   10298 C  CG  . GLN C 2 49  ? 49.057 -11.573 40.352  1.00 37.10  ? 49   GLN C CG  1 
ATOM   10299 C  CD  . GLN C 2 49  ? 49.105 -12.598 39.235  1.00 36.99  ? 49   GLN C CD  1 
ATOM   10300 O  OE1 . GLN C 2 49  ? 50.050 -13.383 39.146  1.00 36.89  ? 49   GLN C OE1 1 
ATOM   10301 N  NE2 . GLN C 2 49  ? 48.084 -12.597 38.385  1.00 36.83  ? 49   GLN C NE2 1 
ATOM   10302 N  N   . ILE C 2 50  ? 46.532 -9.991  41.982  1.00 36.96  ? 50   ILE C N   1 
ATOM   10303 C  CA  . ILE C 2 50  ? 45.295 -9.597  41.321  1.00 36.85  ? 50   ILE C CA  1 
ATOM   10304 C  C   . ILE C 2 50  ? 45.425 -9.858  39.826  1.00 36.83  ? 50   ILE C C   1 
ATOM   10305 O  O   . ILE C 2 50  ? 44.716 -10.696 39.265  1.00 36.83  ? 50   ILE C O   1 
ATOM   10306 C  CB  . ILE C 2 50  ? 44.982 -8.112  41.576  1.00 36.81  ? 50   ILE C CB  1 
ATOM   10307 C  CG1 . ILE C 2 50  ? 44.875 -7.840  43.076  1.00 36.74  ? 50   ILE C CG1 1 
ATOM   10308 C  CG2 . ILE C 2 50  ? 43.697 -7.708  40.869  1.00 36.73  ? 50   ILE C CG2 1 
ATOM   10309 C  CD1 . ILE C 2 50  ? 44.251 -6.505  43.410  1.00 36.60  ? 50   ILE C CD1 1 
ATOM   10310 N  N   . LYS C 2 51  ? 46.343 -9.138  39.189  1.00 36.75  ? 51   LYS C N   1 
ATOM   10311 C  CA  . LYS C 2 51  ? 46.600 -9.303  37.765  1.00 36.67  ? 51   LYS C CA  1 
ATOM   10312 C  C   . LYS C 2 51  ? 48.095 -9.187  37.490  1.00 36.62  ? 51   LYS C C   1 
ATOM   10313 O  O   . LYS C 2 51  ? 48.855 -8.722  38.337  1.00 36.59  ? 51   LYS C O   1 
ATOM   10314 C  CB  . LYS C 2 51  ? 45.832 -8.263  36.948  1.00 36.63  ? 51   LYS C CB  1 
ATOM   10315 C  CG  . LYS C 2 51  ? 45.802 -8.551  35.453  1.00 36.63  ? 51   LYS C CG  1 
ATOM   10316 C  CD  . LYS C 2 51  ? 45.466 -7.308  34.645  1.00 36.57  ? 51   LYS C CD  1 
ATOM   10317 C  CE  . LYS C 2 51  ? 45.614 -7.565  33.153  1.00 36.40  ? 51   LYS C CE  1 
ATOM   10318 N  NZ  . LYS C 2 51  ? 45.528 -6.308  32.362  1.00 36.14  ? 51   LYS C NZ  1 
ATOM   10319 N  N   . MET C 2 52  ? 48.507 -9.611  36.301  1.00 36.57  ? 52   MET C N   1 
ATOM   10320 C  CA  . MET C 2 52  ? 49.909 -9.570  35.910  1.00 36.52  ? 52   MET C CA  1 
ATOM   10321 C  C   . MET C 2 52  ? 50.146 -8.526  34.820  1.00 36.55  ? 52   MET C C   1 
ATOM   10322 O  O   . MET C 2 52  ? 49.336 -8.374  33.907  1.00 36.56  ? 52   MET C O   1 
ATOM   10323 C  CB  . MET C 2 52  ? 50.360 -10.958 35.431  1.00 36.50  ? 52   MET C CB  1 
ATOM   10324 C  CG  . MET C 2 52  ? 51.835 -11.061 35.062  1.00 36.30  ? 52   MET C CG  1 
ATOM   10325 S  SD  . MET C 2 52  ? 52.320 -12.698 34.460  1.00 35.57  ? 52   MET C SD  1 
ATOM   10326 C  CE  . MET C 2 52  ? 52.181 -13.666 35.948  1.00 35.67  ? 52   MET C CE  1 
ATOM   10327 N  N   . PHE C 2 53  ? 51.252 -7.798  34.934  1.00 36.58  ? 53   PHE C N   1 
ATOM   10328 C  CA  . PHE C 2 53  ? 51.632 -6.803  33.936  1.00 36.62  ? 53   PHE C CA  1 
ATOM   10329 C  C   . PHE C 2 53  ? 53.021 -7.179  33.424  1.00 36.65  ? 53   PHE C C   1 
ATOM   10330 O  O   . PHE C 2 53  ? 53.999 -7.092  34.163  1.00 36.67  ? 53   PHE C O   1 
ATOM   10331 C  CB  . PHE C 2 53  ? 51.659 -5.395  34.547  1.00 36.62  ? 53   PHE C CB  1 
ATOM   10332 C  CG  . PHE C 2 53  ? 50.392 -5.010  35.269  1.00 36.59  ? 53   PHE C CG  1 
ATOM   10333 C  CD1 . PHE C 2 53  ? 50.143 -5.462  36.553  1.00 36.72  ? 53   PHE C CD1 1 
ATOM   10334 C  CD2 . PHE C 2 53  ? 49.460 -4.185  34.668  1.00 36.47  ? 53   PHE C CD2 1 
ATOM   10335 C  CE1 . PHE C 2 53  ? 48.983 -5.107  37.218  1.00 36.70  ? 53   PHE C CE1 1 
ATOM   10336 C  CE2 . PHE C 2 53  ? 48.298 -3.826  35.330  1.00 36.43  ? 53   PHE C CE2 1 
ATOM   10337 C  CZ  . PHE C 2 53  ? 48.061 -4.285  36.606  1.00 36.50  ? 53   PHE C CZ  1 
ATOM   10338 N  N   . LYS C 2 54  ? 53.106 -7.610  32.169  1.00 36.71  ? 54   LYS C N   1 
ATOM   10339 C  CA  . LYS C 2 54  ? 54.373 -8.073  31.603  1.00 36.77  ? 54   LYS C CA  1 
ATOM   10340 C  C   . LYS C 2 54  ? 54.784 -9.376  32.306  1.00 36.85  ? 54   LYS C C   1 
ATOM   10341 O  O   . LYS C 2 54  ? 53.971 -9.988  32.994  1.00 36.90  ? 54   LYS C O   1 
ATOM   10342 C  CB  . LYS C 2 54  ? 55.458 -7.004  31.764  1.00 36.74  ? 54   LYS C CB  1 
ATOM   10343 C  CG  . LYS C 2 54  ? 56.556 -7.054  30.715  1.00 36.60  ? 54   LYS C CG  1 
ATOM   10344 C  CD  . LYS C 2 54  ? 57.843 -6.428  31.225  1.00 36.35  ? 54   LYS C CD  1 
ATOM   10345 C  CE  . LYS C 2 54  ? 58.918 -6.439  30.152  1.00 36.21  ? 54   LYS C CE  1 
ATOM   10346 N  NZ  . LYS C 2 54  ? 60.293 -6.465  30.724  1.00 36.11  ? 54   LYS C NZ  1 
ATOM   10347 N  N   . GLY C 2 55  ? 56.026 -9.814  32.113  1.00 36.93  ? 55   GLY C N   1 
ATOM   10348 C  CA  . GLY C 2 55  ? 56.513 -11.046 32.721  1.00 37.06  ? 55   GLY C CA  1 
ATOM   10349 C  C   . GLY C 2 55  ? 56.028 -12.438 32.333  1.00 37.15  ? 55   GLY C C   1 
ATOM   10350 O  O   . GLY C 2 55  ? 54.986 -12.602 31.697  1.00 37.15  ? 55   GLY C O   1 
ATOM   10351 N  N   . PRO C 2 56  ? 56.809 -13.443 32.731  1.00 37.21  ? 56   PRO C N   1 
ATOM   10352 C  CA  . PRO C 2 56  ? 56.508 -14.860 32.477  1.00 37.28  ? 56   PRO C CA  1 
ATOM   10353 C  C   . PRO C 2 56  ? 55.273 -15.380 33.227  1.00 37.39  ? 56   PRO C C   1 
ATOM   10354 O  O   . PRO C 2 56  ? 54.955 -14.894 34.313  1.00 37.37  ? 56   PRO C O   1 
ATOM   10355 C  CB  . PRO C 2 56  ? 57.770 -15.576 32.973  1.00 37.28  ? 56   PRO C CB  1 
ATOM   10356 C  CG  . PRO C 2 56  ? 58.818 -14.513 33.037  1.00 37.17  ? 56   PRO C CG  1 
ATOM   10357 C  CD  . PRO C 2 56  ? 58.088 -13.273 33.439  1.00 37.22  ? 56   PRO C CD  1 
ATOM   10358 N  N   . GLU C 2 57  ? 54.626 -16.396 32.654  1.00 37.50  ? 57   GLU C N   1 
ATOM   10359 C  CA  . GLU C 2 57  ? 53.345 -16.930 33.138  1.00 37.63  ? 57   GLU C CA  1 
ATOM   10360 C  C   . GLU C 2 57  ? 53.294 -17.611 34.516  1.00 37.68  ? 57   GLU C C   1 
ATOM   10361 O  O   . GLU C 2 57  ? 52.251 -17.580 35.165  1.00 37.71  ? 57   GLU C O   1 
ATOM   10362 C  CB  . GLU C 2 57  ? 52.756 -17.896 32.100  1.00 37.63  ? 57   GLU C CB  1 
ATOM   10363 C  CG  . GLU C 2 57  ? 53.328 -17.757 30.697  1.00 37.88  ? 57   GLU C CG  1 
ATOM   10364 C  CD  . GLU C 2 57  ? 52.440 -16.962 29.757  1.00 38.28  ? 57   GLU C CD  1 
ATOM   10365 O  OE1 . GLU C 2 57  ? 51.710 -16.064 30.229  1.00 38.44  ? 57   GLU C OE1 1 
ATOM   10366 O  OE2 . GLU C 2 57  ? 52.477 -17.238 28.538  1.00 38.42  ? 57   GLU C OE2 1 
ATOM   10367 N  N   . LYS C 2 58  ? 54.380 -18.249 34.952  1.00 37.75  ? 58   LYS C N   1 
ATOM   10368 C  CA  . LYS C 2 58  ? 54.382 -18.944 36.249  1.00 37.76  ? 58   LYS C CA  1 
ATOM   10369 C  C   . LYS C 2 58  ? 54.130 -17.984 37.416  1.00 37.79  ? 58   LYS C C   1 
ATOM   10370 O  O   . LYS C 2 58  ? 55.060 -17.568 38.109  1.00 37.76  ? 58   LYS C O   1 
ATOM   10371 C  CB  . LYS C 2 58  ? 55.686 -19.720 36.457  1.00 37.77  ? 58   LYS C CB  1 
ATOM   10372 C  CG  . LYS C 2 58  ? 55.890 -20.875 35.487  1.00 37.74  ? 58   LYS C CG  1 
ATOM   10373 C  CD  . LYS C 2 58  ? 57.023 -21.782 35.946  1.00 37.82  ? 58   LYS C CD  1 
ATOM   10374 C  CE  . LYS C 2 58  ? 57.415 -22.784 34.869  1.00 37.97  ? 58   LYS C CE  1 
ATOM   10375 N  NZ  . LYS C 2 58  ? 58.055 -24.007 35.438  1.00 37.91  ? 58   LYS C NZ  1 
ATOM   10376 N  N   . ASP C 2 59  ? 52.855 -17.666 37.630  1.00 37.80  ? 59   ASP C N   1 
ATOM   10377 C  CA  . ASP C 2 59  ? 52.405 -16.678 38.619  1.00 37.78  ? 59   ASP C CA  1 
ATOM   10378 C  C   . ASP C 2 59  ? 53.041 -16.726 40.012  1.00 37.74  ? 59   ASP C C   1 
ATOM   10379 O  O   . ASP C 2 59  ? 53.216 -17.794 40.600  1.00 37.77  ? 59   ASP C O   1 
ATOM   10380 C  CB  . ASP C 2 59  ? 50.878 -16.707 38.734  1.00 37.80  ? 59   ASP C CB  1 
ATOM   10381 C  CG  . ASP C 2 59  ? 50.191 -16.541 37.392  1.00 37.84  ? 59   ASP C CG  1 
ATOM   10382 O  OD1 . ASP C 2 59  ? 50.091 -17.538 36.647  1.00 37.87  ? 59   ASP C OD1 1 
ATOM   10383 O  OD2 . ASP C 2 59  ? 49.722 -15.453 36.996  1.00 37.89  ? 59   ASP C OD2 1 
ATOM   10384 N  N   . ILE C 2 60  ? 53.351 -15.542 40.532  1.00 37.70  ? 60   ILE C N   1 
ATOM   10385 C  CA  . ILE C 2 60  ? 53.994 -15.378 41.834  1.00 37.63  ? 60   ILE C CA  1 
ATOM   10386 C  C   . ILE C 2 60  ? 53.102 -15.768 43.011  1.00 37.55  ? 60   ILE C C   1 
ATOM   10387 O  O   . ILE C 2 60  ? 52.007 -15.235 43.174  1.00 37.53  ? 60   ILE C O   1 
ATOM   10388 C  CB  . ILE C 2 60  ? 54.466 -13.921 42.001  1.00 37.64  ? 60   ILE C CB  1 
ATOM   10389 C  CG1 . ILE C 2 60  ? 55.257 -13.469 40.768  1.00 37.61  ? 60   ILE C CG1 1 
ATOM   10390 C  CG2 . ILE C 2 60  ? 55.272 -13.768 43.279  1.00 37.69  ? 60   ILE C CG2 1 
ATOM   10391 C  CD1 . ILE C 2 60  ? 56.518 -14.266 40.508  1.00 37.68  ? 60   ILE C CD1 1 
ATOM   10392 N  N   . GLU C 2 61  ? 53.588 -16.693 43.834  1.00 37.48  ? 61   GLU C N   1 
ATOM   10393 C  CA  . GLU C 2 61  ? 52.841 -17.160 44.998  1.00 37.40  ? 61   GLU C CA  1 
ATOM   10394 C  C   . GLU C 2 61  ? 53.408 -16.577 46.289  1.00 37.36  ? 61   GLU C C   1 
ATOM   10395 O  O   . GLU C 2 61  ? 52.676 -16.354 47.254  1.00 37.31  ? 61   GLU C O   1 
ATOM   10396 C  CB  . GLU C 2 61  ? 52.878 -18.685 45.078  1.00 37.40  ? 61   GLU C CB  1 
ATOM   10397 C  CG  . GLU C 2 61  ? 52.736 -19.397 43.744  1.00 37.34  ? 61   GLU C CG  1 
ATOM   10398 C  CD  . GLU C 2 61  ? 52.736 -20.904 43.900  1.00 37.31  ? 61   GLU C CD  1 
ATOM   10399 O  OE1 . GLU C 2 61  ? 53.563 -21.419 44.681  1.00 37.19  ? 61   GLU C OE1 1 
ATOM   10400 O  OE2 . GLU C 2 61  ? 51.905 -21.572 43.251  1.00 37.30  ? 61   GLU C OE2 1 
ATOM   10401 N  N   . PHE C 2 62  ? 54.718 -16.349 46.300  1.00 37.34  ? 62   PHE C N   1 
ATOM   10402 C  CA  . PHE C 2 62  ? 55.407 -15.805 47.466  1.00 37.34  ? 62   PHE C CA  1 
ATOM   10403 C  C   . PHE C 2 62  ? 56.489 -14.808 47.052  1.00 37.34  ? 62   PHE C C   1 
ATOM   10404 O  O   . PHE C 2 62  ? 57.229 -15.050 46.099  1.00 37.38  ? 62   PHE C O   1 
ATOM   10405 C  CB  . PHE C 2 62  ? 56.054 -16.929 48.285  1.00 37.31  ? 62   PHE C CB  1 
ATOM   10406 C  CG  . PHE C 2 62  ? 55.101 -18.016 48.696  1.00 37.35  ? 62   PHE C CG  1 
ATOM   10407 C  CD1 . PHE C 2 62  ? 54.076 -17.759 49.587  1.00 37.36  ? 62   PHE C CD1 1 
ATOM   10408 C  CD2 . PHE C 2 62  ? 55.240 -19.301 48.197  1.00 37.24  ? 62   PHE C CD2 1 
ATOM   10409 C  CE1 . PHE C 2 62  ? 53.201 -18.760 49.966  1.00 37.24  ? 62   PHE C CE1 1 
ATOM   10410 C  CE2 . PHE C 2 62  ? 54.369 -20.305 48.573  1.00 37.18  ? 62   PHE C CE2 1 
ATOM   10411 C  CZ  . PHE C 2 62  ? 53.348 -20.034 49.458  1.00 37.21  ? 62   PHE C CZ  1 
ATOM   10412 N  N   . ILE C 2 63  ? 56.588 -13.691 47.766  1.00 37.30  ? 63   ILE C N   1 
ATOM   10413 C  CA  . ILE C 2 63  ? 57.630 -12.711 47.478  1.00 37.28  ? 63   ILE C CA  1 
ATOM   10414 C  C   . ILE C 2 63  ? 58.824 -12.931 48.401  1.00 37.24  ? 63   ILE C C   1 
ATOM   10415 O  O   . ILE C 2 63  ? 58.676 -13.465 49.497  1.00 37.26  ? 63   ILE C O   1 
ATOM   10416 C  CB  . ILE C 2 63  ? 57.110 -11.280 47.645  1.00 37.31  ? 63   ILE C CB  1 
ATOM   10417 C  CG1 . ILE C 2 63  ? 55.689 -11.150 47.099  1.00 37.45  ? 63   ILE C CG1 1 
ATOM   10418 C  CG2 . ILE C 2 63  ? 58.028 -10.312 46.934  1.00 37.34  ? 63   ILE C CG2 1 
ATOM   10419 C  CD1 . ILE C 2 63  ? 55.610 -11.096 45.596  1.00 37.57  ? 63   ILE C CD1 1 
ATOM   10420 N  N   . TYR C 2 64  ? 60.006 -12.520 47.955  1.00 37.19  ? 64   TYR C N   1 
ATOM   10421 C  CA  . TYR C 2 64  ? 61.218 -12.691 48.749  1.00 37.11  ? 64   TYR C CA  1 
ATOM   10422 C  C   . TYR C 2 64  ? 62.054 -11.420 48.763  1.00 37.07  ? 64   TYR C C   1 
ATOM   10423 O  O   . TYR C 2 64  ? 62.043 -10.652 47.803  1.00 37.02  ? 64   TYR C O   1 
ATOM   10424 C  CB  . TYR C 2 64  ? 62.052 -13.860 48.220  1.00 37.12  ? 64   TYR C CB  1 
ATOM   10425 C  CG  . TYR C 2 64  ? 61.422 -15.218 48.431  1.00 36.96  ? 64   TYR C CG  1 
ATOM   10426 C  CD1 . TYR C 2 64  ? 60.397 -15.668 47.607  1.00 36.84  ? 64   TYR C CD1 1 
ATOM   10427 C  CD2 . TYR C 2 64  ? 61.855 -16.052 49.449  1.00 36.84  ? 64   TYR C CD2 1 
ATOM   10428 C  CE1 . TYR C 2 64  ? 59.818 -16.908 47.797  1.00 36.67  ? 64   TYR C CE1 1 
ATOM   10429 C  CE2 . TYR C 2 64  ? 61.288 -17.295 49.641  1.00 36.70  ? 64   TYR C CE2 1 
ATOM   10430 C  CZ  . TYR C 2 64  ? 60.268 -17.717 48.814  1.00 36.59  ? 64   TYR C CZ  1 
ATOM   10431 O  OH  . TYR C 2 64  ? 59.695 -18.952 49.006  1.00 36.52  ? 64   TYR C OH  1 
ATOM   10432 N  N   . THR C 2 65  ? 62.783 -11.207 49.852  1.00 37.03  ? 65   THR C N   1 
ATOM   10433 C  CA  . THR C 2 65  ? 63.596 -10.005 49.992  1.00 37.04  ? 65   THR C CA  1 
ATOM   10434 C  C   . THR C 2 65  ? 64.807 -10.202 50.896  1.00 36.99  ? 65   THR C C   1 
ATOM   10435 O  O   . THR C 2 65  ? 64.757 -10.965 51.862  1.00 37.00  ? 65   THR C O   1 
ATOM   10436 C  CB  . THR C 2 65  ? 62.737 -8.843  50.521  1.00 37.05  ? 65   THR C CB  1 
ATOM   10437 O  OG1 . THR C 2 65  ? 63.553 -7.963  51.304  1.00 37.17  ? 65   THR C OG1 1 
ATOM   10438 C  CG2 . THR C 2 65  ? 61.724 -9.352  51.526  1.00 37.08  ? 65   THR C CG2 1 
ATOM   10439 N  N   . ALA C 2 66  ? 65.891 -9.502  50.572  1.00 36.93  ? 66   ALA C N   1 
ATOM   10440 C  CA  . ALA C 2 66  ? 67.113 -9.545  51.365  1.00 36.87  ? 66   ALA C CA  1 
ATOM   10441 C  C   . ALA C 2 66  ? 66.766 -9.383  52.840  1.00 36.83  ? 66   ALA C C   1 
ATOM   10442 O  O   . ALA C 2 66  ? 65.757 -8.768  53.183  1.00 36.87  ? 66   ALA C O   1 
ATOM   10443 C  CB  . ALA C 2 66  ? 68.074 -8.455  50.916  1.00 36.88  ? 66   ALA C CB  1 
ATOM   10444 N  N   . PRO C 2 67  ? 67.614 -9.918  53.710  1.00 36.77  ? 67   PRO C N   1 
ATOM   10445 C  CA  . PRO C 2 67  ? 67.351 -9.914  55.151  1.00 36.75  ? 67   PRO C CA  1 
ATOM   10446 C  C   . PRO C 2 67  ? 66.994 -8.539  55.689  1.00 36.77  ? 67   PRO C C   1 
ATOM   10447 O  O   . PRO C 2 67  ? 65.838 -8.272  56.023  1.00 36.78  ? 67   PRO C O   1 
ATOM   10448 C  CB  . PRO C 2 67  ? 68.692 -10.337 55.753  1.00 36.74  ? 67   PRO C CB  1 
ATOM   10449 C  CG  . PRO C 2 67  ? 69.394 -11.068 54.682  1.00 36.76  ? 67   PRO C CG  1 
ATOM   10450 C  CD  . PRO C 2 67  ? 68.911 -10.527 53.375  1.00 36.75  ? 67   PRO C CD  1 
ATOM   10451 N  N   . SER C 2 68  ? 67.998 -7.673  55.757  1.00 36.79  ? 68   SER C N   1 
ATOM   10452 C  CA  . SER C 2 68  ? 67.849 -6.360  56.370  1.00 36.78  ? 68   SER C CA  1 
ATOM   10453 C  C   . SER C 2 68  ? 67.619 -5.201  55.415  1.00 36.75  ? 68   SER C C   1 
ATOM   10454 O  O   . SER C 2 68  ? 68.172 -5.153  54.317  1.00 36.75  ? 68   SER C O   1 
ATOM   10455 C  CB  . SER C 2 68  ? 69.080 -6.048  57.223  1.00 36.81  ? 68   SER C CB  1 
ATOM   10456 O  OG  . SER C 2 68  ? 69.217 -4.651  57.413  1.00 36.77  ? 68   SER C OG  1 
ATOM   10457 N  N   . SER C 2 69  ? 66.800 -4.257  55.867  1.00 36.74  ? 69   SER C N   1 
ATOM   10458 C  CA  . SER C 2 69  ? 66.570 -3.025  55.138  1.00 36.72  ? 69   SER C CA  1 
ATOM   10459 C  C   . SER C 2 69  ? 67.916 -2.457  54.723  1.00 36.70  ? 69   SER C C   1 
ATOM   10460 O  O   . SER C 2 69  ? 68.090 -2.002  53.594  1.00 36.69  ? 69   SER C O   1 
ATOM   10461 C  CB  . SER C 2 69  ? 65.828 -2.024  56.022  1.00 36.72  ? 69   SER C CB  1 
ATOM   10462 O  OG  . SER C 2 69  ? 66.297 -0.705  55.805  1.00 36.76  ? 69   SER C OG  1 
ATOM   10463 N  N   . ALA C 2 70  ? 68.870 -2.508  55.650  1.00 36.71  ? 70   ALA C N   1 
ATOM   10464 C  CA  . ALA C 2 70  ? 70.223 -2.022  55.410  1.00 36.68  ? 70   ALA C CA  1 
ATOM   10465 C  C   . ALA C 2 70  ? 70.728 -2.448  54.037  1.00 36.64  ? 70   ALA C C   1 
ATOM   10466 O  O   . ALA C 2 70  ? 71.281 -1.637  53.296  1.00 36.68  ? 70   ALA C O   1 
ATOM   10467 C  CB  . ALA C 2 70  ? 71.167 -2.511  56.499  1.00 36.69  ? 70   ALA C CB  1 
ATOM   10468 N  N   . VAL C 2 71  ? 70.540 -3.721  53.702  1.00 36.53  ? 71   VAL C N   1 
ATOM   10469 C  CA  . VAL C 2 71  ? 70.948 -4.214  52.392  1.00 36.43  ? 71   VAL C CA  1 
ATOM   10470 C  C   . VAL C 2 71  ? 69.889 -3.918  51.331  1.00 36.35  ? 71   VAL C C   1 
ATOM   10471 O  O   . VAL C 2 71  ? 70.227 -3.522  50.224  1.00 36.38  ? 71   VAL C O   1 
ATOM   10472 C  CB  . VAL C 2 71  ? 71.326 -5.710  52.408  1.00 36.45  ? 71   VAL C CB  1 
ATOM   10473 C  CG1 . VAL C 2 71  ? 72.838 -5.874  52.324  1.00 36.43  ? 71   VAL C CG1 1 
ATOM   10474 C  CG2 . VAL C 2 71  ? 70.775 -6.392  53.647  1.00 36.46  ? 71   VAL C CG2 1 
ATOM   10475 N  N   . CYS C 2 72  ? 68.617 -4.111  51.676  1.00 36.26  ? 72   CYS C N   1 
ATOM   10476 C  CA  . CYS C 2 72  ? 67.496 -3.807  50.779  1.00 36.23  ? 72   CYS C CA  1 
ATOM   10477 C  C   . CYS C 2 72  ? 66.172 -4.223  51.404  1.00 36.18  ? 72   CYS C C   1 
ATOM   10478 O  O   . CYS C 2 72  ? 65.587 -5.235  51.025  1.00 36.14  ? 72   CYS C O   1 
ATOM   10479 C  CB  . CYS C 2 72  ? 67.658 -4.477  49.414  1.00 36.20  ? 72   CYS C CB  1 
ATOM   10480 S  SG  . CYS C 2 72  ? 68.441 -3.466  48.125  1.00 36.43  ? 72   CYS C SG  1 
ATOM   10481 N  N   . GLY C 2 73  ? 65.694 -3.423  52.347  1.00 36.21  ? 73   GLY C N   1 
ATOM   10482 C  CA  . GLY C 2 73  ? 64.486 -3.749  53.079  1.00 36.30  ? 73   GLY C CA  1 
ATOM   10483 C  C   . GLY C 2 73  ? 63.173 -3.403  52.415  1.00 36.33  ? 73   GLY C C   1 
ATOM   10484 O  O   . GLY C 2 73  ? 62.737 -2.253  52.432  1.00 36.29  ? 73   GLY C O   1 
ATOM   10485 N  N   . VAL C 2 74  ? 62.532 -4.409  51.833  1.00 36.40  ? 74   VAL C N   1 
ATOM   10486 C  CA  . VAL C 2 74  ? 61.221 -4.211  51.238  1.00 36.52  ? 74   VAL C CA  1 
ATOM   10487 C  C   . VAL C 2 74  ? 60.160 -4.676  52.220  1.00 36.59  ? 74   VAL C C   1 
ATOM   10488 O  O   . VAL C 2 74  ? 59.205 -5.362  51.855  1.00 36.60  ? 74   VAL C O   1 
ATOM   10489 C  CB  . VAL C 2 74  ? 61.059 -4.961  49.919  1.00 36.53  ? 74   VAL C CB  1 
ATOM   10490 C  CG1 . VAL C 2 74  ? 59.765 -4.543  49.236  1.00 36.60  ? 74   VAL C CG1 1 
ATOM   10491 C  CG2 . VAL C 2 74  ? 62.229 -4.679  49.024  1.00 36.53  ? 74   VAL C CG2 1 
ATOM   10492 N  N   . SER C 2 75  ? 60.351 -4.308  53.480  1.00 36.68  ? 75   SER C N   1 
ATOM   10493 C  CA  . SER C 2 75  ? 59.397 -4.638  54.521  1.00 36.74  ? 75   SER C CA  1 
ATOM   10494 C  C   . SER C 2 75  ? 58.039 -4.046  54.176  1.00 36.79  ? 75   SER C C   1 
ATOM   10495 O  O   . SER C 2 75  ? 57.885 -2.827  54.096  1.00 36.84  ? 75   SER C O   1 
ATOM   10496 C  CB  . SER C 2 75  ? 59.878 -4.102  55.871  1.00 36.73  ? 75   SER C CB  1 
ATOM   10497 O  OG  . SER C 2 75  ? 58.842 -4.138  56.836  1.00 36.73  ? 75   SER C OG  1 
ATOM   10498 N  N   . LEU C 2 76  ? 57.064 -4.914  53.934  1.00 36.82  ? 76   LEU C N   1 
ATOM   10499 C  CA  . LEU C 2 76  ? 55.704 -4.468  53.677  1.00 36.86  ? 76   LEU C CA  1 
ATOM   10500 C  C   . LEU C 2 76  ? 54.786 -5.160  54.670  1.00 36.91  ? 76   LEU C C   1 
ATOM   10501 O  O   . LEU C 2 76  ? 55.209 -6.071  55.382  1.00 36.95  ? 76   LEU C O   1 
ATOM   10502 C  CB  . LEU C 2 76  ? 55.266 -4.758  52.240  1.00 36.85  ? 76   LEU C CB  1 
ATOM   10503 C  CG  . LEU C 2 76  ? 55.284 -6.209  51.763  1.00 36.79  ? 76   LEU C CG  1 
ATOM   10504 C  CD1 . LEU C 2 76  ? 53.931 -6.606  51.195  1.00 36.79  ? 76   LEU C CD1 1 
ATOM   10505 C  CD2 . LEU C 2 76  ? 56.392 -6.426  50.745  1.00 36.76  ? 76   LEU C CD2 1 
ATOM   10506 N  N   . ASP C 2 77  ? 53.529 -4.736  54.713  1.00 36.95  ? 77   ASP C N   1 
ATOM   10507 C  CA  . ASP C 2 77  ? 52.593 -5.278  55.690  1.00 36.97  ? 77   ASP C CA  1 
ATOM   10508 C  C   . ASP C 2 77  ? 51.782 -6.469  55.206  1.00 36.99  ? 77   ASP C C   1 
ATOM   10509 O  O   . ASP C 2 77  ? 51.720 -6.774  54.014  1.00 36.99  ? 77   ASP C O   1 
ATOM   10510 C  CB  . ASP C 2 77  ? 51.643 -4.186  56.187  1.00 36.96  ? 77   ASP C CB  1 
ATOM   10511 C  CG  . ASP C 2 77  ? 52.371 -3.043  56.859  1.00 36.92  ? 77   ASP C CG  1 
ATOM   10512 O  OD1 . ASP C 2 77  ? 52.839 -2.074  56.228  1.00 36.91  ? 77   ASP C OD1 1 
ATOM   10513 O  OD2 . ASP C 2 77  ? 52.510 -3.072  58.100  1.00 36.84  ? 77   ASP C OD2 1 
ATOM   10514 N  N   . VAL C 2 78  ? 51.167 -7.133  56.176  1.00 36.99  ? 78   VAL C N   1 
ATOM   10515 C  CA  . VAL C 2 78  ? 50.309 -8.277  55.949  1.00 36.98  ? 78   VAL C CA  1 
ATOM   10516 C  C   . VAL C 2 78  ? 48.990 -7.910  56.608  1.00 36.95  ? 78   VAL C C   1 
ATOM   10517 O  O   . VAL C 2 78  ? 48.894 -6.864  57.250  1.00 36.96  ? 78   VAL C O   1 
ATOM   10518 C  CB  . VAL C 2 78  ? 50.892 -9.530  56.623  1.00 37.00  ? 78   VAL C CB  1 
ATOM   10519 C  CG1 . VAL C 2 78  ? 50.254 -10.779 56.076  1.00 37.05  ? 78   VAL C CG1 1 
ATOM   10520 C  CG2 . VAL C 2 78  ? 52.399 -9.588  56.428  1.00 37.01  ? 78   VAL C CG2 1 
ATOM   10521 N  N   . GLY C 2 79  ? 47.974 -8.752  56.467  1.00 36.92  ? 79   GLY C N   1 
ATOM   10522 C  CA  . GLY C 2 79  ? 46.684 -8.442  57.050  1.00 36.89  ? 79   GLY C CA  1 
ATOM   10523 C  C   . GLY C 2 79  ? 46.144 -7.192  56.389  1.00 36.88  ? 79   GLY C C   1 
ATOM   10524 O  O   . GLY C 2 79  ? 45.345 -7.284  55.468  1.00 36.89  ? 79   GLY C O   1 
ATOM   10525 N  N   . GLY C 2 80  ? 46.605 -6.030  56.847  1.00 36.88  ? 80   GLY C N   1 
ATOM   10526 C  CA  . GLY C 2 80  ? 46.196 -4.749  56.294  1.00 36.88  ? 80   GLY C CA  1 
ATOM   10527 C  C   . GLY C 2 80  ? 45.374 -4.861  55.027  1.00 36.87  ? 80   GLY C C   1 
ATOM   10528 O  O   . GLY C 2 80  ? 44.195 -4.508  55.014  1.00 36.87  ? 80   GLY C O   1 
ATOM   10529 N  N   . LYS C 2 81  ? 46.002 -5.353  53.962  1.00 36.86  ? 81   LYS C N   1 
ATOM   10530 C  CA  . LYS C 2 81  ? 45.343 -5.546  52.672  1.00 36.86  ? 81   LYS C CA  1 
ATOM   10531 C  C   . LYS C 2 81  ? 45.529 -4.338  51.754  1.00 36.87  ? 81   LYS C C   1 
ATOM   10532 O  O   . LYS C 2 81  ? 44.565 -3.788  51.217  1.00 36.88  ? 81   LYS C O   1 
ATOM   10533 C  CB  . LYS C 2 81  ? 43.859 -5.901  52.846  1.00 36.86  ? 81   LYS C CB  1 
ATOM   10534 C  CG  . LYS C 2 81  ? 43.601 -7.002  53.876  1.00 36.92  ? 81   LYS C CG  1 
ATOM   10535 C  CD  . LYS C 2 81  ? 42.254 -6.816  54.563  1.00 36.90  ? 81   LYS C CD  1 
ATOM   10536 C  CE  . LYS C 2 81  ? 42.402 -6.789  56.082  1.00 36.80  ? 81   LYS C CE  1 
ATOM   10537 N  NZ  . LYS C 2 81  ? 41.097 -6.595  56.770  1.00 36.76  ? 81   LYS C NZ  1 
ATOM   10538 N  N   . LYS C 2 82  ? 46.784 -3.918  51.617  1.00 36.86  ? 82   LYS C N   1 
ATOM   10539 C  CA  . LYS C 2 82  ? 47.183 -2.891  50.665  1.00 36.85  ? 82   LYS C CA  1 
ATOM   10540 C  C   . LYS C 2 82  ? 47.775 -3.657  49.488  1.00 36.83  ? 82   LYS C C   1 
ATOM   10541 O  O   . LYS C 2 82  ? 48.244 -4.782  49.661  1.00 36.81  ? 82   LYS C O   1 
ATOM   10542 C  CB  . LYS C 2 82  ? 48.277 -1.992  51.247  1.00 36.88  ? 82   LYS C CB  1 
ATOM   10543 C  CG  . LYS C 2 82  ? 47.832 -0.846  52.146  1.00 36.84  ? 82   LYS C CG  1 
ATOM   10544 C  CD  . LYS C 2 82  ? 49.028 0.069   52.417  1.00 36.63  ? 82   LYS C CD  1 
ATOM   10545 C  CE  . LYS C 2 82  ? 48.880 0.864   53.703  1.00 36.57  ? 82   LYS C CE  1 
ATOM   10546 N  NZ  . LYS C 2 82  ? 50.153 1.554   54.061  1.00 36.47  ? 82   LYS C NZ  1 
ATOM   10547 N  N   . GLU C 2 83  ? 47.779 -3.058  48.301  1.00 36.79  ? 83   GLU C N   1 
ATOM   10548 C  CA  . GLU C 2 83  ? 48.333 -3.730  47.126  1.00 36.77  ? 83   GLU C CA  1 
ATOM   10549 C  C   . GLU C 2 83  ? 49.675 -3.138  46.707  1.00 36.76  ? 83   GLU C C   1 
ATOM   10550 O  O   . GLU C 2 83  ? 49.940 -1.960  46.935  1.00 36.75  ? 83   GLU C O   1 
ATOM   10551 C  CB  . GLU C 2 83  ? 47.354 -3.677  45.953  1.00 36.75  ? 83   GLU C CB  1 
ATOM   10552 C  CG  . GLU C 2 83  ? 45.924 -4.047  46.308  1.00 36.79  ? 83   GLU C CG  1 
ATOM   10553 C  CD  . GLU C 2 83  ? 45.180 -2.912  46.984  1.00 36.83  ? 83   GLU C CD  1 
ATOM   10554 O  OE1 . GLU C 2 83  ? 45.841 -2.016  47.549  1.00 36.82  ? 83   GLU C OE1 1 
ATOM   10555 O  OE2 . GLU C 2 83  ? 43.932 -2.916  46.948  1.00 36.88  ? 83   GLU C OE2 1 
ATOM   10556 N  N   . TYR C 2 84  ? 50.516 -3.964  46.091  1.00 36.79  ? 84   TYR C N   1 
ATOM   10557 C  CA  . TYR C 2 84  ? 51.836 -3.531  45.641  1.00 36.82  ? 84   TYR C CA  1 
ATOM   10558 C  C   . TYR C 2 84  ? 52.189 -4.169  44.297  1.00 36.86  ? 84   TYR C C   1 
ATOM   10559 O  O   . TYR C 2 84  ? 52.246 -5.391  44.176  1.00 36.87  ? 84   TYR C O   1 
ATOM   10560 C  CB  . TYR C 2 84  ? 52.901 -3.878  46.684  1.00 36.82  ? 84   TYR C CB  1 
ATOM   10561 C  CG  . TYR C 2 84  ? 52.639 -3.301  48.059  1.00 36.74  ? 84   TYR C CG  1 
ATOM   10562 C  CD1 . TYR C 2 84  ? 51.726 -3.894  48.922  1.00 36.67  ? 84   TYR C CD1 1 
ATOM   10563 C  CD2 . TYR C 2 84  ? 53.311 -2.168  48.497  1.00 36.72  ? 84   TYR C CD2 1 
ATOM   10564 C  CE1 . TYR C 2 84  ? 51.484 -3.372  50.177  1.00 36.66  ? 84   TYR C CE1 1 
ATOM   10565 C  CE2 . TYR C 2 84  ? 53.077 -1.639  49.753  1.00 36.71  ? 84   TYR C CE2 1 
ATOM   10566 C  CZ  . TYR C 2 84  ? 52.163 -2.244  50.589  1.00 36.69  ? 84   TYR C CZ  1 
ATOM   10567 O  OH  . TYR C 2 84  ? 51.928 -1.719  51.839  1.00 36.62  ? 84   TYR C OH  1 
ATOM   10568 N  N   . LEU C 2 85  ? 52.440 -3.330  43.298  1.00 36.91  ? 85   LEU C N   1 
ATOM   10569 C  CA  . LEU C 2 85  ? 52.731 -3.789  41.942  1.00 36.96  ? 85   LEU C CA  1 
ATOM   10570 C  C   . LEU C 2 85  ? 54.151 -4.330  41.805  1.00 36.97  ? 85   LEU C C   1 
ATOM   10571 O  O   . LEU C 2 85  ? 54.447 -5.130  40.918  1.00 36.90  ? 85   LEU C O   1 
ATOM   10572 C  CB  . LEU C 2 85  ? 52.525 -2.640  40.957  1.00 36.98  ? 85   LEU C CB  1 
ATOM   10573 C  CG  . LEU C 2 85  ? 52.015 -2.987  39.561  1.00 37.02  ? 85   LEU C CG  1 
ATOM   10574 C  CD1 . LEU C 2 85  ? 50.544 -3.334  39.618  1.00 37.12  ? 85   LEU C CD1 1 
ATOM   10575 C  CD2 . LEU C 2 85  ? 52.239 -1.811  38.639  1.00 37.15  ? 85   LEU C CD2 1 
ATOM   10576 N  N   . ILE C 2 86  ? 55.019 -3.867  42.693  1.00 37.06  ? 86   ILE C N   1 
ATOM   10577 C  CA  . ILE C 2 86  ? 56.429 -4.247  42.732  1.00 37.17  ? 86   ILE C CA  1 
ATOM   10578 C  C   . ILE C 2 86  ? 56.900 -5.292  41.722  1.00 37.18  ? 86   ILE C C   1 
ATOM   10579 O  O   . ILE C 2 86  ? 56.658 -6.489  41.879  1.00 37.22  ? 86   ILE C O   1 
ATOM   10580 C  CB  . ILE C 2 86  ? 56.789 -4.697  44.141  1.00 37.19  ? 86   ILE C CB  1 
ATOM   10581 C  CG1 . ILE C 2 86  ? 56.242 -3.684  45.146  1.00 37.36  ? 86   ILE C CG1 1 
ATOM   10582 C  CG2 . ILE C 2 86  ? 58.288 -4.883  44.257  1.00 37.12  ? 86   ILE C CG2 1 
ATOM   10583 C  CD1 . ILE C 2 86  ? 56.728 -3.894  46.555  1.00 37.40  ? 86   ILE C CD1 1 
ATOM   10584 N  N   . ALA C 2 87  ? 57.617 -4.814  40.711  1.00 37.20  ? 87   ALA C N   1 
ATOM   10585 C  CA  . ALA C 2 87  ? 58.139 -5.650  39.640  1.00 37.23  ? 87   ALA C CA  1 
ATOM   10586 C  C   . ALA C 2 87  ? 59.541 -6.170  39.928  1.00 37.26  ? 87   ALA C C   1 
ATOM   10587 O  O   . ALA C 2 87  ? 60.493 -5.813  39.234  1.00 37.26  ? 87   ALA C O   1 
ATOM   10588 C  CB  . ALA C 2 87  ? 58.151 -4.866  38.354  1.00 37.21  ? 87   ALA C CB  1 
ATOM   10589 N  N   . GLY C 2 88  ? 59.669 -7.017  40.942  1.00 37.30  ? 88   GLY C N   1 
ATOM   10590 C  CA  . GLY C 2 88  ? 60.956 -7.595  41.277  1.00 37.32  ? 88   GLY C CA  1 
ATOM   10591 C  C   . GLY C 2 88  ? 61.426 -8.609  40.248  1.00 37.30  ? 88   GLY C C   1 
ATOM   10592 O  O   . GLY C 2 88  ? 60.682 -8.983  39.339  1.00 37.29  ? 88   GLY C O   1 
ATOM   10593 N  N   . LYS C 2 89  ? 62.670 -9.052  40.395  1.00 37.27  ? 89   LYS C N   1 
ATOM   10594 C  CA  . LYS C 2 89  ? 63.264 -10.032 39.492  1.00 37.21  ? 89   LYS C CA  1 
ATOM   10595 C  C   . LYS C 2 89  ? 62.518 -11.362 39.519  1.00 37.17  ? 89   LYS C C   1 
ATOM   10596 O  O   . LYS C 2 89  ? 62.490 -12.047 40.542  1.00 37.14  ? 89   LYS C O   1 
ATOM   10597 C  CB  . LYS C 2 89  ? 64.727 -10.258 39.863  1.00 37.23  ? 89   LYS C CB  1 
ATOM   10598 C  CG  . LYS C 2 89  ? 65.260 -11.607 39.444  1.00 37.18  ? 89   LYS C CG  1 
ATOM   10599 C  CD  . LYS C 2 89  ? 66.558 -11.930 40.157  1.00 37.11  ? 89   LYS C CD  1 
ATOM   10600 C  CE  . LYS C 2 89  ? 66.356 -12.157 41.636  1.00 36.99  ? 89   LYS C CE  1 
ATOM   10601 N  NZ  . LYS C 2 89  ? 67.570 -12.763 42.243  1.00 36.86  ? 89   LYS C NZ  1 
ATOM   10602 N  N   . ALA C 2 90  ? 61.928 -11.727 38.384  1.00 37.14  ? 90   ALA C N   1 
ATOM   10603 C  CA  . ALA C 2 90  ? 61.159 -12.965 38.269  1.00 37.12  ? 90   ALA C CA  1 
ATOM   10604 C  C   . ALA C 2 90  ? 62.004 -14.234 38.411  1.00 37.07  ? 90   ALA C C   1 
ATOM   10605 O  O   . ALA C 2 90  ? 62.956 -14.450 37.660  1.00 37.00  ? 90   ALA C O   1 
ATOM   10606 C  CB  . ALA C 2 90  ? 60.395 -12.989 36.953  1.00 37.13  ? 90   ALA C CB  1 
ATOM   10607 N  N   . GLU C 2 91  ? 61.642 -15.070 39.379  1.00 37.07  ? 91   GLU C N   1 
ATOM   10608 C  CA  . GLU C 2 91  ? 62.321 -16.342 39.592  1.00 37.11  ? 91   GLU C CA  1 
ATOM   10609 C  C   . GLU C 2 91  ? 61.338 -17.491 39.374  1.00 37.08  ? 91   GLU C C   1 
ATOM   10610 O  O   . GLU C 2 91  ? 60.150 -17.369 39.669  1.00 37.07  ? 91   GLU C O   1 
ATOM   10611 C  CB  . GLU C 2 91  ? 62.926 -16.413 40.995  1.00 37.15  ? 91   GLU C CB  1 
ATOM   10612 C  CG  . GLU C 2 91  ? 63.744 -15.192 41.385  1.00 37.19  ? 91   GLU C CG  1 
ATOM   10613 C  CD  . GLU C 2 91  ? 64.474 -15.379 42.700  1.00 37.25  ? 91   GLU C CD  1 
ATOM   10614 O  OE1 . GLU C 2 91  ? 64.382 -16.481 43.283  1.00 37.25  ? 91   GLU C OE1 1 
ATOM   10615 O  OE2 . GLU C 2 91  ? 65.141 -14.425 43.151  1.00 37.26  ? 91   GLU C OE2 1 
ATOM   10616 N  N   . GLY C 2 92  ? 61.841 -18.602 38.851  1.00 37.05  ? 92   GLY C N   1 
ATOM   10617 C  CA  . GLY C 2 92  ? 61.011 -19.756 38.553  1.00 37.06  ? 92   GLY C CA  1 
ATOM   10618 C  C   . GLY C 2 92  ? 59.923 -20.057 39.567  1.00 37.05  ? 92   GLY C C   1 
ATOM   10619 O  O   . GLY C 2 92  ? 60.178 -20.103 40.769  1.00 37.11  ? 92   GLY C O   1 
ATOM   10620 N  N   . ASP C 2 93  ? 58.680 -20.241 39.109  1.00 37.00  ? 93   ASP C N   1 
ATOM   10621 C  CA  . ASP C 2 93  ? 57.538 -20.621 39.876  1.00 36.94  ? 93   ASP C CA  1 
ATOM   10622 C  C   . ASP C 2 93  ? 57.229 -19.608 40.958  1.00 36.87  ? 93   ASP C C   1 
ATOM   10623 O  O   . ASP C 2 93  ? 57.593 -19.767 42.140  1.00 36.90  ? 93   ASP C O   1 
ATOM   10624 C  CB  . ASP C 2 93  ? 57.627 -22.027 40.455  1.00 36.96  ? 93   ASP C CB  1 
ATOM   10625 C  CG  . ASP C 2 93  ? 57.601 -23.046 39.325  1.00 37.01  ? 93   ASP C CG  1 
ATOM   10626 O  OD1 . ASP C 2 93  ? 56.520 -23.227 38.720  1.00 37.13  ? 93   ASP C OD1 1 
ATOM   10627 O  OD2 . ASP C 2 93  ? 58.651 -23.654 39.035  1.00 20.00  ? 93   ASP C OD2 1 
ATOM   10628 N  N   . GLY C 2 94  ? 56.444 -18.580 40.614  1.00 36.79  ? 94   GLY C N   1 
ATOM   10629 C  CA  . GLY C 2 94  ? 55.964 -17.677 41.709  1.00 36.70  ? 94   GLY C CA  1 
ATOM   10630 C  C   . GLY C 2 94  ? 57.055 -17.041 42.543  1.00 36.62  ? 94   GLY C C   1 
ATOM   10631 O  O   . GLY C 2 94  ? 56.774 -16.406 43.557  1.00 36.59  ? 94   GLY C O   1 
ATOM   10632 N  N   . LYS C 2 95  ? 58.303 -17.211 42.130  1.00 36.57  ? 95   LYS C N   1 
ATOM   10633 C  CA  . LYS C 2 95  ? 59.404 -16.614 42.863  1.00 36.55  ? 95   LYS C CA  1 
ATOM   10634 C  C   . LYS C 2 95  ? 59.800 -15.296 42.215  1.00 36.56  ? 95   LYS C C   1 
ATOM   10635 O  O   . LYS C 2 95  ? 60.013 -15.222 41.009  1.00 36.54  ? 95   LYS C O   1 
ATOM   10636 C  CB  . LYS C 2 95  ? 60.586 -17.580 42.952  1.00 36.49  ? 95   LYS C CB  1 
ATOM   10637 C  CG  . LYS C 2 95  ? 60.228 -18.886 43.639  1.00 36.52  ? 95   LYS C CG  1 
ATOM   10638 C  CD  . LYS C 2 95  ? 61.445 -19.737 43.960  1.00 36.48  ? 95   LYS C CD  1 
ATOM   10639 C  CE  . LYS C 2 95  ? 61.024 -21.046 44.614  1.00 36.21  ? 95   LYS C CE  1 
ATOM   10640 N  NZ  . LYS C 2 95  ? 62.181 -21.816 45.143  1.00 36.19  ? 95   LYS C NZ  1 
ATOM   10641 N  N   . MET C 2 96  ? 59.852 -14.246 43.022  1.00 36.59  ? 96   MET C N   1 
ATOM   10642 C  CA  . MET C 2 96  ? 60.246 -12.934 42.536  1.00 36.67  ? 96   MET C CA  1 
ATOM   10643 C  C   . MET C 2 96  ? 60.853 -12.157 43.689  1.00 36.68  ? 96   MET C C   1 
ATOM   10644 O  O   . MET C 2 96  ? 60.292 -12.112 44.785  1.00 36.63  ? 96   MET C O   1 
ATOM   10645 C  CB  . MET C 2 96  ? 59.054 -12.180 41.937  1.00 36.69  ? 96   MET C CB  1 
ATOM   10646 C  CG  . MET C 2 96  ? 58.099 -11.592 42.960  1.00 36.84  ? 96   MET C CG  1 
ATOM   10647 S  SD  . MET C 2 96  ? 56.611 -10.889 42.219  1.00 37.09  ? 96   MET C SD  1 
ATOM   10648 C  CE  . MET C 2 96  ? 57.315 -9.825  40.974  1.00 37.18  ? 96   MET C CE  1 
ATOM   10649 N  N   . HIS C 2 97  ? 62.012 -11.560 43.451  1.00 36.76  ? 97   HIS C N   1 
ATOM   10650 C  CA  . HIS C 2 97  ? 62.683 -10.823 44.507  1.00 36.85  ? 97   HIS C CA  1 
ATOM   10651 C  C   . HIS C 2 97  ? 62.439 -9.325  44.429  1.00 36.88  ? 97   HIS C C   1 
ATOM   10652 O  O   . HIS C 2 97  ? 62.497 -8.722  43.359  1.00 36.85  ? 97   HIS C O   1 
ATOM   10653 C  CB  . HIS C 2 97  ? 64.183 -11.108 44.515  1.00 36.86  ? 97   HIS C CB  1 
ATOM   10654 C  CG  . HIS C 2 97  ? 64.890 -10.540 45.705  1.00 36.99  ? 97   HIS C CG  1 
ATOM   10655 N  ND1 . HIS C 2 97  ? 64.985 -9.184  45.936  1.00 37.05  ? 97   HIS C ND1 1 
ATOM   10656 C  CD2 . HIS C 2 97  ? 65.522 -11.143 46.739  1.00 37.12  ? 97   HIS C CD2 1 
ATOM   10657 C  CE1 . HIS C 2 97  ? 65.651 -8.977  47.058  1.00 37.01  ? 97   HIS C CE1 1 
ATOM   10658 N  NE2 . HIS C 2 97  ? 65.990 -10.149 47.563  1.00 37.13  ? 97   HIS C NE2 1 
ATOM   10659 N  N   . ILE C 2 98  ? 62.174 -8.733  45.585  1.00 36.92  ? 98   ILE C N   1 
ATOM   10660 C  CA  . ILE C 2 98  ? 61.951 -7.307  45.684  1.00 36.96  ? 98   ILE C CA  1 
ATOM   10661 C  C   . ILE C 2 98  ? 63.083 -6.677  46.481  1.00 37.05  ? 98   ILE C C   1 
ATOM   10662 O  O   . ILE C 2 98  ? 63.243 -6.948  47.669  1.00 37.08  ? 98   ILE C O   1 
ATOM   10663 C  CB  . ILE C 2 98  ? 60.600 -7.035  46.362  1.00 36.94  ? 98   ILE C CB  1 
ATOM   10664 C  CG1 . ILE C 2 98  ? 60.507 -7.796  47.685  1.00 36.93  ? 98   ILE C CG1 1 
ATOM   10665 C  CG2 . ILE C 2 98  ? 59.465 -7.462  45.455  1.00 36.95  ? 98   ILE C CG2 1 
ATOM   10666 C  CD1 . ILE C 2 98  ? 59.178 -7.648  48.392  1.00 36.88  ? 98   ILE C CD1 1 
ATOM   10667 N  N   . THR C 2 99  ? 63.892 -5.862  45.815  1.00 37.16  ? 99   THR C N   1 
ATOM   10668 C  CA  . THR C 2 99  ? 64.966 -5.146  46.488  1.00 37.26  ? 99   THR C CA  1 
ATOM   10669 C  C   . THR C 2 99  ? 64.453 -3.742  46.770  1.00 37.30  ? 99   THR C C   1 
ATOM   10670 O  O   . THR C 2 99  ? 63.921 -3.096  45.871  1.00 37.28  ? 99   THR C O   1 
ATOM   10671 C  CB  . THR C 2 99  ? 66.222 -5.074  45.597  1.00 37.27  ? 99   THR C CB  1 
ATOM   10672 O  OG1 . THR C 2 99  ? 65.919 -4.353  44.396  1.00 37.32  ? 99   THR C OG1 1 
ATOM   10673 C  CG2 . THR C 2 99  ? 66.607 -6.454  45.089  1.00 37.21  ? 99   THR C CG2 1 
ATOM   10674 N  N   . LEU C 2 100 ? 64.584 -3.273  48.008  1.00 37.38  ? 100  LEU C N   1 
ATOM   10675 C  CA  . LEU C 2 100 ? 64.121 -1.932  48.348  1.00 37.48  ? 100  LEU C CA  1 
ATOM   10676 C  C   . LEU C 2 100 ? 64.347 -1.079  47.110  1.00 37.56  ? 100  LEU C C   1 
ATOM   10677 O  O   . LEU C 2 100 ? 63.546 -0.208  46.763  1.00 37.52  ? 100  LEU C O   1 
ATOM   10678 C  CB  . LEU C 2 100 ? 64.926 -1.370  49.522  1.00 37.51  ? 100  LEU C CB  1 
ATOM   10679 C  CG  . LEU C 2 100 ? 64.262 -0.411  50.519  1.00 37.58  ? 100  LEU C CG  1 
ATOM   10680 C  CD1 . LEU C 2 100 ? 65.310 0.482   51.176  1.00 37.52  ? 100  LEU C CD1 1 
ATOM   10681 C  CD2 . LEU C 2 100 ? 63.176 0.436   49.870  1.00 37.67  ? 100  LEU C CD2 1 
ATOM   10682 N  N   . CYS C 2 101 ? 65.451 -1.383  46.438  1.00 37.66  ? 101  CYS C N   1 
ATOM   10683 C  CA  . CYS C 2 101 ? 65.898 -0.706  45.230  1.00 37.71  ? 101  CYS C CA  1 
ATOM   10684 C  C   . CYS C 2 101 ? 64.948 -0.800  44.027  1.00 37.76  ? 101  CYS C C   1 
ATOM   10685 O  O   . CYS C 2 101 ? 65.193 -0.179  42.994  1.00 37.80  ? 101  CYS C O   1 
ATOM   10686 C  CB  . CYS C 2 101 ? 67.269 -1.268  44.833  1.00 37.70  ? 101  CYS C CB  1 
ATOM   10687 S  SG  . CYS C 2 101 ? 67.876 -0.685  43.241  1.00 37.60  ? 101  CYS C SG  1 
ATOM   10688 N  N   . ASP C 2 102 ? 63.865 -1.560  44.146  1.00 37.77  ? 102  ASP C N   1 
ATOM   10689 C  CA  . ASP C 2 102 ? 62.972 -1.744  43.002  1.00 37.74  ? 102  ASP C CA  1 
ATOM   10690 C  C   . ASP C 2 102 ? 61.737 -0.838  43.016  1.00 37.69  ? 102  ASP C C   1 
ATOM   10691 O  O   . ASP C 2 102 ? 61.317 -0.359  44.070  1.00 37.67  ? 102  ASP C O   1 
ATOM   10692 C  CB  . ASP C 2 102 ? 62.560 -3.213  42.875  1.00 37.77  ? 102  ASP C CB  1 
ATOM   10693 C  CG  . ASP C 2 102 ? 62.236 -3.604  41.446  1.00 37.87  ? 102  ASP C CG  1 
ATOM   10694 O  OD1 . ASP C 2 102 ? 61.662 -2.770  40.711  1.00 37.92  ? 102  ASP C OD1 1 
ATOM   10695 O  OD2 . ASP C 2 102 ? 62.524 -4.723  40.971  1.00 37.77  ? 102  ASP C OD2 1 
ATOM   10696 N  N   . PHE C 2 103 ? 61.171 -0.612  41.831  1.00 37.64  ? 103  PHE C N   1 
ATOM   10697 C  CA  . PHE C 2 103 ? 59.972 0.211   41.675  1.00 37.60  ? 103  PHE C CA  1 
ATOM   10698 C  C   . PHE C 2 103 ? 58.826 -0.406  42.464  1.00 37.57  ? 103  PHE C C   1 
ATOM   10699 O  O   . PHE C 2 103 ? 58.113 -1.286  41.979  1.00 37.46  ? 103  PHE C O   1 
ATOM   10700 C  CB  . PHE C 2 103 ? 59.602 0.349   40.198  1.00 37.63  ? 103  PHE C CB  1 
ATOM   10701 C  CG  . PHE C 2 103 ? 58.309 1.078   39.959  1.00 37.47  ? 103  PHE C CG  1 
ATOM   10702 C  CD1 . PHE C 2 103 ? 58.147 2.388   40.372  1.00 37.30  ? 103  PHE C CD1 1 
ATOM   10703 C  CD2 . PHE C 2 103 ? 57.255 0.448   39.320  1.00 37.42  ? 103  PHE C CD2 1 
ATOM   10704 C  CE1 . PHE C 2 103 ? 56.956 3.055   40.153  1.00 37.25  ? 103  PHE C CE1 1 
ATOM   10705 C  CE2 . PHE C 2 103 ? 56.064 1.111   39.098  1.00 37.33  ? 103  PHE C CE2 1 
ATOM   10706 C  CZ  . PHE C 2 103 ? 55.914 2.415   39.515  1.00 37.14  ? 103  PHE C CZ  1 
ATOM   10707 N  N   . ILE C 2 104 ? 58.651 0.091   43.682  1.00 37.59  ? 104  ILE C N   1 
ATOM   10708 C  CA  . ILE C 2 104 ? 57.723 -0.492  44.635  1.00 37.61  ? 104  ILE C CA  1 
ATOM   10709 C  C   . ILE C 2 104 ? 56.865 0.542   45.356  1.00 37.57  ? 104  ILE C C   1 
ATOM   10710 O  O   . ILE C 2 104 ? 57.371 1.306   46.178  1.00 37.56  ? 104  ILE C O   1 
ATOM   10711 C  CB  . ILE C 2 104 ? 58.554 -1.250  45.672  1.00 37.65  ? 104  ILE C CB  1 
ATOM   10712 C  CG1 . ILE C 2 104 ? 59.310 -2.399  44.995  1.00 37.80  ? 104  ILE C CG1 1 
ATOM   10713 C  CG2 . ILE C 2 104 ? 57.682 -1.690  46.835  1.00 37.72  ? 104  ILE C CG2 1 
ATOM   10714 C  CD1 . ILE C 2 104 ? 60.294 -3.121  45.889  1.00 37.92  ? 104  ILE C CD1 1 
ATOM   10715 N  N   . VAL C 2 105 ? 55.564 0.546   45.075  1.00 37.52  ? 105  VAL C N   1 
ATOM   10716 C  CA  . VAL C 2 105 ? 54.656 1.510   45.695  1.00 37.43  ? 105  VAL C CA  1 
ATOM   10717 C  C   . VAL C 2 105 ? 53.258 0.964   45.994  1.00 37.34  ? 105  VAL C C   1 
ATOM   10718 O  O   . VAL C 2 105 ? 52.672 0.250   45.178  1.00 37.36  ? 105  VAL C O   1 
ATOM   10719 C  CB  . VAL C 2 105 ? 54.501 2.778   44.820  1.00 37.42  ? 105  VAL C CB  1 
ATOM   10720 C  CG1 . VAL C 2 105 ? 55.416 3.892   45.307  1.00 37.48  ? 105  VAL C CG1 1 
ATOM   10721 C  CG2 . VAL C 2 105 ? 54.756 2.455   43.355  1.00 37.43  ? 105  VAL C CG2 1 
ATOM   10722 N  N   . PRO C 2 106 ? 52.737 1.293   47.175  1.00 37.24  ? 106  PRO C N   1 
ATOM   10723 C  CA  . PRO C 2 106 ? 51.363 0.942   47.543  1.00 37.16  ? 106  PRO C CA  1 
ATOM   10724 C  C   . PRO C 2 106 ? 50.416 1.371   46.430  1.00 37.12  ? 106  PRO C C   1 
ATOM   10725 O  O   . PRO C 2 106 ? 50.599 2.443   45.858  1.00 37.14  ? 106  PRO C O   1 
ATOM   10726 C  CB  . PRO C 2 106 ? 51.117 1.784   48.793  1.00 37.15  ? 106  PRO C CB  1 
ATOM   10727 C  CG  . PRO C 2 106 ? 52.468 1.939   49.404  1.00 37.19  ? 106  PRO C CG  1 
ATOM   10728 C  CD  . PRO C 2 106 ? 53.440 2.002   48.259  1.00 37.22  ? 106  PRO C CD  1 
ATOM   10729 N  N   . TRP C 2 107 ? 49.421 0.546   46.131  1.00 37.09  ? 107  TRP C N   1 
ATOM   10730 C  CA  . TRP C 2 107 ? 48.501 0.814   45.029  1.00 37.07  ? 107  TRP C CA  1 
ATOM   10731 C  C   . TRP C 2 107 ? 47.939 2.235   45.002  1.00 37.08  ? 107  TRP C C   1 
ATOM   10732 O  O   . TRP C 2 107 ? 47.847 2.856   43.943  1.00 37.05  ? 107  TRP C O   1 
ATOM   10733 C  CB  . TRP C 2 107 ? 47.348 -0.194  45.038  1.00 37.06  ? 107  TRP C CB  1 
ATOM   10734 C  CG  . TRP C 2 107 ? 46.463 -0.087  43.838  1.00 36.95  ? 107  TRP C CG  1 
ATOM   10735 C  CD1 . TRP C 2 107 ? 45.175 0.363   43.804  1.00 36.94  ? 107  TRP C CD1 1 
ATOM   10736 C  CD2 . TRP C 2 107 ? 46.801 -0.431  42.490  1.00 36.78  ? 107  TRP C CD2 1 
ATOM   10737 N  NE1 . TRP C 2 107 ? 44.691 0.319   42.518  1.00 36.92  ? 107  TRP C NE1 1 
ATOM   10738 C  CE2 . TRP C 2 107 ? 45.672 -0.163  41.691  1.00 36.81  ? 107  TRP C CE2 1 
ATOM   10739 C  CE3 . TRP C 2 107 ? 47.949 -0.939  41.872  1.00 36.60  ? 107  TRP C CE3 1 
ATOM   10740 C  CZ2 . TRP C 2 107 ? 45.657 -0.388  40.316  1.00 36.73  ? 107  TRP C CZ2 1 
ATOM   10741 C  CZ3 . TRP C 2 107 ? 47.931 -1.160  40.508  1.00 36.53  ? 107  TRP C CZ3 1 
ATOM   10742 C  CH2 . TRP C 2 107 ? 46.793 -0.888  39.746  1.00 36.58  ? 107  TRP C CH2 1 
ATOM   10743 N  N   . ASP C 2 108 ? 47.576 2.744   46.172  1.00 37.10  ? 108  ASP C N   1 
ATOM   10744 C  CA  . ASP C 2 108 ? 46.941 4.052   46.283  1.00 37.17  ? 108  ASP C CA  1 
ATOM   10745 C  C   . ASP C 2 108 ? 47.809 5.240   45.865  1.00 37.22  ? 108  ASP C C   1 
ATOM   10746 O  O   . ASP C 2 108 ? 47.289 6.305   45.533  1.00 37.27  ? 108  ASP C O   1 
ATOM   10747 C  CB  . ASP C 2 108 ? 46.426 4.250   47.706  1.00 37.17  ? 108  ASP C CB  1 
ATOM   10748 C  CG  . ASP C 2 108 ? 45.531 3.116   48.155  1.00 37.22  ? 108  ASP C CG  1 
ATOM   10749 O  OD1 . ASP C 2 108 ? 44.913 2.469   47.283  1.00 37.26  ? 108  ASP C OD1 1 
ATOM   10750 O  OD2 . ASP C 2 108 ? 45.385 2.794   49.352  1.00 37.29  ? 108  ASP C OD2 1 
ATOM   10751 N  N   . THR C 2 109 ? 49.125 5.056   45.875  1.00 37.26  ? 109  THR C N   1 
ATOM   10752 C  CA  . THR C 2 109 ? 50.048 6.134   45.530  1.00 37.28  ? 109  THR C CA  1 
ATOM   10753 C  C   . THR C 2 109 ? 49.917 6.611   44.083  1.00 37.30  ? 109  THR C C   1 
ATOM   10754 O  O   . THR C 2 109 ? 49.785 7.808   43.825  1.00 37.29  ? 109  THR C O   1 
ATOM   10755 C  CB  . THR C 2 109 ? 51.499 5.701   45.809  1.00 37.30  ? 109  THR C CB  1 
ATOM   10756 O  OG1 . THR C 2 109 ? 51.758 4.450   45.161  1.00 37.25  ? 109  THR C OG1 1 
ATOM   10757 C  CG2 . THR C 2 109 ? 51.683 5.375   47.283  1.00 37.28  ? 109  THR C CG2 1 
ATOM   10758 N  N   . LEU C 2 110 ? 49.951 5.666   43.149  1.00 37.34  ? 110  LEU C N   1 
ATOM   10759 C  CA  . LEU C 2 110 ? 49.882 5.963   41.717  1.00 37.34  ? 110  LEU C CA  1 
ATOM   10760 C  C   . LEU C 2 110 ? 48.658 6.788   41.312  1.00 37.36  ? 110  LEU C C   1 
ATOM   10761 O  O   . LEU C 2 110 ? 47.594 6.677   41.920  1.00 37.38  ? 110  LEU C O   1 
ATOM   10762 C  CB  . LEU C 2 110 ? 49.938 4.667   40.902  1.00 37.32  ? 110  LEU C CB  1 
ATOM   10763 C  CG  . LEU C 2 110 ? 51.315 4.029   40.697  1.00 37.17  ? 110  LEU C CG  1 
ATOM   10764 C  CD1 . LEU C 2 110 ? 52.074 3.903   42.005  1.00 37.00  ? 110  LEU C CD1 1 
ATOM   10765 C  CD2 . LEU C 2 110 ? 51.182 2.674   40.021  1.00 37.03  ? 110  LEU C CD2 1 
ATOM   10766 N  N   . SER C 2 111 ? 48.818 7.603   40.273  1.00 37.38  ? 111  SER C N   1 
ATOM   10767 C  CA  . SER C 2 111 ? 47.739 8.463   39.794  1.00 37.42  ? 111  SER C CA  1 
ATOM   10768 C  C   . SER C 2 111 ? 46.905 7.800   38.703  1.00 37.45  ? 111  SER C C   1 
ATOM   10769 O  O   . SER C 2 111 ? 47.310 6.791   38.124  1.00 37.44  ? 111  SER C O   1 
ATOM   10770 C  CB  . SER C 2 111 ? 48.301 9.791   39.280  1.00 37.42  ? 111  SER C CB  1 
ATOM   10771 O  OG  . SER C 2 111 ? 49.192 9.580   38.199  1.00 37.39  ? 111  SER C OG  1 
ATOM   10772 N  N   . THR C 2 112 ? 45.741 8.385   38.428  1.00 37.50  ? 112  THR C N   1 
ATOM   10773 C  CA  . THR C 2 112 ? 44.827 7.892   37.399  1.00 37.55  ? 112  THR C CA  1 
ATOM   10774 C  C   . THR C 2 112 ? 45.559 7.568   36.100  1.00 37.57  ? 112  THR C C   1 
ATOM   10775 O  O   . THR C 2 112 ? 45.136 6.700   35.334  1.00 37.59  ? 112  THR C O   1 
ATOM   10776 C  CB  . THR C 2 112 ? 43.717 8.933   37.133  1.00 37.55  ? 112  THR C CB  1 
ATOM   10777 O  OG1 . THR C 2 112 ? 42.749 8.882   38.187  1.00 37.59  ? 112  THR C OG1 1 
ATOM   10778 C  CG2 . THR C 2 112 ? 42.905 8.560   35.899  1.00 37.54  ? 112  THR C CG2 1 
ATOM   10779 N  N   . THR C 2 113 ? 46.663 8.268   35.864  1.00 37.56  ? 113  THR C N   1 
ATOM   10780 C  CA  . THR C 2 113 ? 47.460 8.068   34.662  1.00 37.52  ? 113  THR C CA  1 
ATOM   10781 C  C   . THR C 2 113 ? 48.471 6.934   34.825  1.00 37.48  ? 113  THR C C   1 
ATOM   10782 O  O   . THR C 2 113 ? 48.625 6.099   33.932  1.00 37.47  ? 113  THR C O   1 
ATOM   10783 C  CB  . THR C 2 113 ? 48.186 9.375   34.281  1.00 37.51  ? 113  THR C CB  1 
ATOM   10784 O  OG1 . THR C 2 113 ? 48.891 9.882   35.420  1.00 37.57  ? 113  THR C OG1 1 
ATOM   10785 C  CG2 . THR C 2 113 ? 47.181 10.477  33.981  1.00 37.46  ? 113  THR C CG2 1 
ATOM   10786 N  N   . GLN C 2 114 ? 49.150 6.908   35.970  1.00 37.42  ? 114  GLN C N   1 
ATOM   10787 C  CA  . GLN C 2 114 ? 50.184 5.911   36.246  1.00 37.38  ? 114  GLN C CA  1 
ATOM   10788 C  C   . GLN C 2 114 ? 49.705 4.466   36.098  1.00 37.38  ? 114  GLN C C   1 
ATOM   10789 O  O   . GLN C 2 114 ? 50.406 3.628   35.530  1.00 37.38  ? 114  GLN C O   1 
ATOM   10790 C  CB  . GLN C 2 114 ? 50.787 6.134   37.635  1.00 37.35  ? 114  GLN C CB  1 
ATOM   10791 C  CG  . GLN C 2 114 ? 51.722 7.329   37.716  1.00 37.30  ? 114  GLN C CG  1 
ATOM   10792 C  CD  . GLN C 2 114 ? 52.272 7.557   39.113  1.00 37.31  ? 114  GLN C CD  1 
ATOM   10793 O  OE1 . GLN C 2 114 ? 51.539 7.967   40.013  1.00 37.36  ? 114  GLN C OE1 1 
ATOM   10794 N  NE2 . GLN C 2 114 ? 53.563 7.298   39.295  1.00 37.06  ? 114  GLN C NE2 1 
ATOM   10795 N  N   . LYS C 2 115 ? 48.516 4.177   36.613  1.00 37.36  ? 115  LYS C N   1 
ATOM   10796 C  CA  . LYS C 2 115 ? 47.960 2.835   36.516  1.00 37.36  ? 115  LYS C CA  1 
ATOM   10797 C  C   . LYS C 2 115 ? 47.720 2.444   35.060  1.00 37.42  ? 115  LYS C C   1 
ATOM   10798 O  O   . LYS C 2 115 ? 48.220 1.426   34.593  1.00 37.43  ? 115  LYS C O   1 
ATOM   10799 C  CB  . LYS C 2 115 ? 46.650 2.745   37.298  1.00 37.32  ? 115  LYS C CB  1 
ATOM   10800 C  CG  . LYS C 2 115 ? 46.751 3.216   38.737  1.00 37.23  ? 115  LYS C CG  1 
ATOM   10801 C  CD  . LYS C 2 115 ? 45.373 3.377   39.358  1.00 37.11  ? 115  LYS C CD  1 
ATOM   10802 C  CE  . LYS C 2 115 ? 45.454 4.039   40.723  1.00 37.04  ? 115  LYS C CE  1 
ATOM   10803 N  NZ  . LYS C 2 115 ? 44.103 4.356   41.269  1.00 36.97  ? 115  LYS C NZ  1 
ATOM   10804 N  N   . LYS C 2 116 ? 46.969 3.274   34.344  1.00 37.51  ? 116  LYS C N   1 
ATOM   10805 C  CA  . LYS C 2 116 ? 46.599 2.999   32.954  1.00 37.59  ? 116  LYS C CA  1 
ATOM   10806 C  C   . LYS C 2 116 ? 47.774 2.853   31.981  1.00 37.59  ? 116  LYS C C   1 
ATOM   10807 O  O   . LYS C 2 116 ? 47.580 2.502   30.818  1.00 37.59  ? 116  LYS C O   1 
ATOM   10808 C  CB  . LYS C 2 116 ? 45.617 4.060   32.450  1.00 37.65  ? 116  LYS C CB  1 
ATOM   10809 C  CG  . LYS C 2 116 ? 44.244 3.985   33.107  1.00 37.80  ? 116  LYS C CG  1 
ATOM   10810 C  CD  . LYS C 2 116 ? 43.326 3.012   32.380  1.00 37.94  ? 116  LYS C CD  1 
ATOM   10811 C  CE  . LYS C 2 116 ? 42.565 3.703   31.255  1.00 37.93  ? 116  LYS C CE  1 
ATOM   10812 N  NZ  . LYS C 2 116 ? 41.500 4.607   31.779  1.00 37.82  ? 116  LYS C NZ  1 
ATOM   10813 N  N   . SER C 2 117 ? 48.985 3.128   32.453  1.00 37.61  ? 117  SER C N   1 
ATOM   10814 C  CA  . SER C 2 117 ? 50.175 3.002   31.619  1.00 37.64  ? 117  SER C CA  1 
ATOM   10815 C  C   . SER C 2 117 ? 50.693 1.571   31.660  1.00 37.68  ? 117  SER C C   1 
ATOM   10816 O  O   . SER C 2 117 ? 51.656 1.220   30.978  1.00 37.70  ? 117  SER C O   1 
ATOM   10817 C  CB  . SER C 2 117 ? 51.263 3.954   32.107  1.00 37.64  ? 117  SER C CB  1 
ATOM   10818 O  OG  . SER C 2 117 ? 51.510 3.763   33.488  1.00 37.64  ? 117  SER C OG  1 
ATOM   10819 N  N   . LEU C 2 118 ? 50.028 0.750   32.463  1.00 37.68  ? 118  LEU C N   1 
ATOM   10820 C  CA  . LEU C 2 118 ? 50.425 -0.634  32.680  1.00 37.69  ? 118  LEU C CA  1 
ATOM   10821 C  C   . LEU C 2 118 ? 50.159 -1.572  31.501  1.00 37.65  ? 118  LEU C C   1 
ATOM   10822 O  O   . LEU C 2 118 ? 50.923 -2.506  31.262  1.00 37.66  ? 118  LEU C O   1 
ATOM   10823 C  CB  . LEU C 2 118 ? 49.724 -1.168  33.929  1.00 37.74  ? 118  LEU C CB