data_1H4R
# 
_entry.id   1H4R 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.308 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1H4R         
PDBE  EBI-8033     
WWPDB D_1290008033 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1H4R 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2001-05-14 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Cooper, D.R.'    1 
'Kang, B.S.'      2 
'Sheffield, P.'   3 
'Devedjiev, Y.'   4 
'Derewenda, Z.S.' 5 
# 
_citation.id                        primary 
_citation.title                     'The Structure of the Ferm Domain of Merlin, the Neurofibromatosis Type 2 Gene Product.' 
_citation.journal_abbrev            'Acta Crystallogr.,Sect.D' 
_citation.journal_volume            58 
_citation.page_first                381 
_citation.page_last                 ? 
_citation.year                      2002 
_citation.journal_id_ASTM           ABCRE6 
_citation.country                   DK 
_citation.journal_id_ISSN           0907-4449 
_citation.journal_id_CSD            0766 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   11856822 
_citation.pdbx_database_id_DOI      10.1107/S0907444901021175 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Kang, B.S.'      1 ? 
primary 'Cooper, D.R.'    2 ? 
primary 'Devedjiev, Y.'   3 ? 
primary 'Derewenda, U.'   4 ? 
primary 'Derewenda, Z.S.' 5 ? 
# 
_cell.entry_id           1H4R 
_cell.length_a           87.018 
_cell.length_b           89.328 
_cell.length_c           96.764 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1H4R 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man MERLIN        36987.848 2   ? ? 'FERM DOMAIN RESIDUES 1-313' ? 
2 non-polymer syn 'SULFATE ION' 96.063    6   ? ? ?                            ? 
3 water       nat water         18.015    861 ? ? ?                            ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GMAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDK
KVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKIYCPPEASVLLASYAVQAKYGDYDPSVHK
RGFLAQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFAIRNKKGTELLLGVDAL
GLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRKA
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GMAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDK
KVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKIYCPPEASVLLASYAVQAKYGDYDPSVHK
RGFLAQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFAIRNKKGTELLLGVDAL
GLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRKA
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   MET n 
1 3   ALA n 
1 4   GLY n 
1 5   ALA n 
1 6   ILE n 
1 7   ALA n 
1 8   SER n 
1 9   ARG n 
1 10  MET n 
1 11  SER n 
1 12  PHE n 
1 13  SER n 
1 14  SER n 
1 15  LEU n 
1 16  LYS n 
1 17  ARG n 
1 18  LYS n 
1 19  GLN n 
1 20  PRO n 
1 21  LYS n 
1 22  THR n 
1 23  PHE n 
1 24  THR n 
1 25  VAL n 
1 26  ARG n 
1 27  ILE n 
1 28  VAL n 
1 29  THR n 
1 30  MET n 
1 31  ASP n 
1 32  ALA n 
1 33  GLU n 
1 34  MET n 
1 35  GLU n 
1 36  PHE n 
1 37  ASN n 
1 38  CYS n 
1 39  GLU n 
1 40  MET n 
1 41  LYS n 
1 42  TRP n 
1 43  LYS n 
1 44  GLY n 
1 45  LYS n 
1 46  ASP n 
1 47  LEU n 
1 48  PHE n 
1 49  ASP n 
1 50  LEU n 
1 51  VAL n 
1 52  CYS n 
1 53  ARG n 
1 54  THR n 
1 55  LEU n 
1 56  GLY n 
1 57  LEU n 
1 58  ARG n 
1 59  GLU n 
1 60  THR n 
1 61  TRP n 
1 62  PHE n 
1 63  PHE n 
1 64  GLY n 
1 65  LEU n 
1 66  GLN n 
1 67  TYR n 
1 68  THR n 
1 69  ILE n 
1 70  LYS n 
1 71  ASP n 
1 72  THR n 
1 73  VAL n 
1 74  ALA n 
1 75  TRP n 
1 76  LEU n 
1 77  LYS n 
1 78  MET n 
1 79  ASP n 
1 80  LYS n 
1 81  LYS n 
1 82  VAL n 
1 83  LEU n 
1 84  ASP n 
1 85  HIS n 
1 86  ASP n 
1 87  VAL n 
1 88  SER n 
1 89  LYS n 
1 90  GLU n 
1 91  GLU n 
1 92  PRO n 
1 93  VAL n 
1 94  THR n 
1 95  PHE n 
1 96  HIS n 
1 97  PHE n 
1 98  LEU n 
1 99  ALA n 
1 100 LYS n 
1 101 PHE n 
1 102 TYR n 
1 103 PRO n 
1 104 GLU n 
1 105 ASN n 
1 106 ALA n 
1 107 GLU n 
1 108 GLU n 
1 109 GLU n 
1 110 LEU n 
1 111 VAL n 
1 112 GLN n 
1 113 GLU n 
1 114 ILE n 
1 115 THR n 
1 116 GLN n 
1 117 HIS n 
1 118 LEU n 
1 119 PHE n 
1 120 PHE n 
1 121 LEU n 
1 122 GLN n 
1 123 VAL n 
1 124 LYS n 
1 125 LYS n 
1 126 GLN n 
1 127 ILE n 
1 128 LEU n 
1 129 ASP n 
1 130 GLU n 
1 131 LYS n 
1 132 ILE n 
1 133 TYR n 
1 134 CYS n 
1 135 PRO n 
1 136 PRO n 
1 137 GLU n 
1 138 ALA n 
1 139 SER n 
1 140 VAL n 
1 141 LEU n 
1 142 LEU n 
1 143 ALA n 
1 144 SER n 
1 145 TYR n 
1 146 ALA n 
1 147 VAL n 
1 148 GLN n 
1 149 ALA n 
1 150 LYS n 
1 151 TYR n 
1 152 GLY n 
1 153 ASP n 
1 154 TYR n 
1 155 ASP n 
1 156 PRO n 
1 157 SER n 
1 158 VAL n 
1 159 HIS n 
1 160 LYS n 
1 161 ARG n 
1 162 GLY n 
1 163 PHE n 
1 164 LEU n 
1 165 ALA n 
1 166 GLN n 
1 167 GLU n 
1 168 GLU n 
1 169 LEU n 
1 170 LEU n 
1 171 PRO n 
1 172 LYS n 
1 173 ARG n 
1 174 VAL n 
1 175 ILE n 
1 176 ASN n 
1 177 LEU n 
1 178 TYR n 
1 179 GLN n 
1 180 MET n 
1 181 THR n 
1 182 PRO n 
1 183 GLU n 
1 184 MET n 
1 185 TRP n 
1 186 GLU n 
1 187 GLU n 
1 188 ARG n 
1 189 ILE n 
1 190 THR n 
1 191 ALA n 
1 192 TRP n 
1 193 TYR n 
1 194 ALA n 
1 195 GLU n 
1 196 HIS n 
1 197 ARG n 
1 198 GLY n 
1 199 ARG n 
1 200 ALA n 
1 201 ARG n 
1 202 ASP n 
1 203 GLU n 
1 204 ALA n 
1 205 GLU n 
1 206 MET n 
1 207 GLU n 
1 208 TYR n 
1 209 LEU n 
1 210 LYS n 
1 211 ILE n 
1 212 ALA n 
1 213 GLN n 
1 214 ASP n 
1 215 LEU n 
1 216 GLU n 
1 217 MET n 
1 218 TYR n 
1 219 GLY n 
1 220 VAL n 
1 221 ASN n 
1 222 TYR n 
1 223 PHE n 
1 224 ALA n 
1 225 ILE n 
1 226 ARG n 
1 227 ASN n 
1 228 LYS n 
1 229 LYS n 
1 230 GLY n 
1 231 THR n 
1 232 GLU n 
1 233 LEU n 
1 234 LEU n 
1 235 LEU n 
1 236 GLY n 
1 237 VAL n 
1 238 ASP n 
1 239 ALA n 
1 240 LEU n 
1 241 GLY n 
1 242 LEU n 
1 243 HIS n 
1 244 ILE n 
1 245 TYR n 
1 246 ASP n 
1 247 PRO n 
1 248 GLU n 
1 249 ASN n 
1 250 ARG n 
1 251 LEU n 
1 252 THR n 
1 253 PRO n 
1 254 LYS n 
1 255 ILE n 
1 256 SER n 
1 257 PHE n 
1 258 PRO n 
1 259 TRP n 
1 260 ASN n 
1 261 GLU n 
1 262 ILE n 
1 263 ARG n 
1 264 ASN n 
1 265 ILE n 
1 266 SER n 
1 267 TYR n 
1 268 SER n 
1 269 ASP n 
1 270 LYS n 
1 271 GLU n 
1 272 PHE n 
1 273 THR n 
1 274 ILE n 
1 275 LYS n 
1 276 PRO n 
1 277 LEU n 
1 278 ASP n 
1 279 LYS n 
1 280 LYS n 
1 281 ILE n 
1 282 ASP n 
1 283 VAL n 
1 284 PHE n 
1 285 LYS n 
1 286 PHE n 
1 287 ASN n 
1 288 SER n 
1 289 SER n 
1 290 LYS n 
1 291 LEU n 
1 292 ARG n 
1 293 VAL n 
1 294 ASN n 
1 295 LYS n 
1 296 LEU n 
1 297 ILE n 
1 298 LEU n 
1 299 GLN n 
1 300 LEU n 
1 301 CYS n 
1 302 ILE n 
1 303 GLY n 
1 304 ASN n 
1 305 HIS n 
1 306 ASP n 
1 307 LEU n 
1 308 PHE n 
1 309 MET n 
1 310 ARG n 
1 311 ARG n 
1 312 ARG n 
1 313 LYS n 
1 314 ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               'GATEWAY PDEST15' 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PHGM313 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   
'RECOMBINANTLY EXPRESSED IN BL21-RIL CELLS AS A HEXA-HISTIDINE AND GST TAGGED PROTEIN. THE TAG WAS REMOVED BY RTEV CLEAVAGE.' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 PDB 1H4R       1 ? ? 1H4R   ? 
2 UNP MERL_HUMAN 1 ? ? P35240 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1H4R A 1 ? 1   ? 1H4R   -1 ? -1  ? -1 -1  
2 2 1H4R A 2 ? 314 ? P35240 1  ? 313 ? 1  313 
3 1 1H4R B 1 ? 1   ? 1H4R   -1 ? -1  ? -1 -1  
4 2 1H4R B 2 ? 314 ? P35240 1  ? 313 ? 1  313 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'   ? 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1H4R 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.5 
_exptl_crystal.density_percent_sol   51.4 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.50 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;THE PROTEIN WAS CRYSTALLIZED USING HANGING-DROP VAPOR DIFFUSION WIHTH 56% AMMONIUM SULFATE, 2% DIOXANE, 100 MM CACODYLATE, PH 6.5. A 1:1 RATIO OF PROTEIN TO WELL SOLUTION WAS USED.
;
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC CCD' 
_diffrn_detector.pdbx_collection_date   2001-03-15 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   .9200 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X9B' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X9B 
_diffrn_source.pdbx_wavelength             .9200 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     1H4R 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             25.000 
_reflns.d_resolution_high            1.800 
_reflns.number_obs                   68182 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         95.5 
_reflns.pdbx_Rmerge_I_obs            0.06500 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        16.8000 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.500 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             1.80 
_reflns_shell.d_res_low              1.86 
_reflns_shell.percent_possible_all   97.2 
_reflns_shell.Rmerge_I_obs           0.66200 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.330 
_reflns_shell.pdbx_redundancy        3.40 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 1H4R 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     66303 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             25.00 
_refine.ls_d_res_high                            1.80 
_refine.ls_percent_reflns_obs                    95.5 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.193 
_refine.ls_R_factor_R_free                       0.227 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 1.500 
_refine.ls_number_reflns_R_free                  985 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.960 
_refine.correlation_coeff_Fo_to_Fc_free          0.943 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'BABINET MODEL PLUS MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 1GC6.PDB' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.130 
_refine.pdbx_overall_ESU_R_Free                  0.123 
_refine.overall_SU_ML                            0.116 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             3.675 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4912 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         30 
_refine_hist.number_atoms_solvent             861 
_refine_hist.number_atoms_total               5803 
_refine_hist.d_res_high                       1.80 
_refine_hist.d_res_low                        25.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.011 0.022 ? 5040  'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.001 0.020 ? 4555  'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_angle_other_deg            1.390 1.960 ? 6803  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       0.759 3.000 ? 10620 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.123 0.200 ? 726   'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.005 0.020 ? 5465  'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.002 0.020 ? 1050  'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.225 0.300 ? 1069  'X-RAY DIFFRACTION' ? 
r_nbd_other                  0.209 0.300 ? 4442  'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.239 0.500 ? 687   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.251 0.300 ? 28    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         0.244 0.300 ? 73    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.346 0.500 ? 55    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.805 1.500 ? 2940  'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.510 2.000 ? 4759  'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_scbond_it                  2.220 3.000 ? 2100  'X-RAY DIFFRACTION' ? 
r_scbond_other               ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_scangle_it                 3.706 4.500 ? 2044  'X-RAY DIFFRACTION' ? 
r_scangle_other              ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.80 
_refine_ls_shell.d_res_low                        1.85 
_refine_ls_shell.number_reflns_R_work             4917 
_refine_ls_shell.R_factor_R_work                  0.2600 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.2680 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             77 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1H4R 
_struct.title                     
'Crystal Structure of the FERM domain of Merlin, the Neurofibromatosis 2 Tumor Suppressor Protein.' 
_struct.pdbx_descriptor           MERLIN 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1H4R 
_struct_keywords.pdbx_keywords   'STRUCTURAL PROTEIN' 
_struct_keywords.text            'FERM, NEUROFIBROMATOSIS, NF2, STRUCTURAL PROTEIN, CYTOSKELETON, ANTI-ONCOGENE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
H N N 2 ? 
I N N 3 ? 
J N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LYS A 43  ? GLY A 56  ? LYS A 42  GLY A 55  1 ? 14 
HELX_P HELX_P2  2  GLU A 59  ? TRP A 61  ? GLU A 58  TRP A 60  5 ? 3  
HELX_P HELX_P3  3  VAL A 82  ? HIS A 85  ? VAL A 81  HIS A 84  5 ? 4  
HELX_P HELX_P4  4  ASN A 105 ? LEU A 110 ? ASN A 104 LEU A 109 1 ? 6  
HELX_P HELX_P5  5  GLN A 112 ? ASP A 129 ? GLN A 111 ASP A 128 1 ? 18 
HELX_P HELX_P6  6  PRO A 135 ? GLY A 152 ? PRO A 134 GLY A 151 1 ? 18 
HELX_P HELX_P7  7  PRO A 171 ? ASN A 176 ? PRO A 170 ASN A 175 1 ? 6  
HELX_P HELX_P8  8  THR A 181 ? GLU A 195 ? THR A 180 GLU A 194 1 ? 15 
HELX_P HELX_P9  9  ALA A 200 ? GLN A 213 ? ALA A 199 GLN A 212 1 ? 14 
HELX_P HELX_P10 10 LYS A 290 ? ARG A 312 ? LYS A 289 ARG A 311 1 ? 23 
HELX_P HELX_P11 11 LYS B 43  ? GLY B 56  ? LYS B 42  GLY B 55  1 ? 14 
HELX_P HELX_P12 12 GLU B 59  ? TRP B 61  ? GLU B 58  TRP B 60  5 ? 3  
HELX_P HELX_P13 13 VAL B 82  ? HIS B 85  ? VAL B 81  HIS B 84  5 ? 4  
HELX_P HELX_P14 14 ASN B 105 ? LEU B 110 ? ASN B 104 LEU B 109 1 ? 6  
HELX_P HELX_P15 15 GLN B 112 ? ASP B 129 ? GLN B 111 ASP B 128 1 ? 18 
HELX_P HELX_P16 16 PRO B 135 ? GLY B 152 ? PRO B 134 GLY B 151 1 ? 18 
HELX_P HELX_P17 17 PRO B 171 ? TYR B 178 ? PRO B 170 TYR B 177 1 ? 8  
HELX_P HELX_P18 18 THR B 181 ? GLU B 195 ? THR B 180 GLU B 194 1 ? 15 
HELX_P HELX_P19 19 ALA B 200 ? GLN B 213 ? ALA B 199 GLN B 212 1 ? 14 
HELX_P HELX_P20 20 LYS B 290 ? LYS B 313 ? LYS B 289 LYS B 312 1 ? 24 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 91 A . ? GLU 90 A PRO 92 A ? PRO 91 A 1 -0.37 
2 GLU 91 B . ? GLU 90 B PRO 92 B ? PRO 91 B 1 0.12  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 5 ? 
AB ? 7 ? 
BA ? 5 ? 
BB ? 7 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? parallel      
AA 3 4 ? anti-parallel 
AA 4 5 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? anti-parallel 
AB 4 5 ? anti-parallel 
AB 5 6 ? anti-parallel 
AB 6 7 ? anti-parallel 
BA 1 2 ? anti-parallel 
BA 2 3 ? parallel      
BA 3 4 ? anti-parallel 
BA 4 5 ? anti-parallel 
BB 1 2 ? anti-parallel 
BB 2 3 ? anti-parallel 
BB 3 4 ? anti-parallel 
BB 4 5 ? anti-parallel 
BB 5 6 ? anti-parallel 
BB 6 7 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 GLU A 33  ? GLU A 39  ? GLU A 32  GLU A 38  
AA 2 THR A 22  ? VAL A 28  ? THR A 21  VAL A 27  
AA 3 VAL A 93  ? ALA A 99  ? VAL A 92  ALA A 98  
AA 4 PHE A 63  ? ILE A 69  ? PHE A 62  ILE A 68  
AA 5 THR A 72  ? TRP A 75  ? THR A 71  TRP A 74  
AB 1 ILE A 255 ? PRO A 258 ? ILE A 254 PRO A 257 
AB 2 GLY A 241 ? TYR A 245 ? GLY A 240 TYR A 244 
AB 3 GLU A 232 ? VAL A 237 ? GLU A 231 VAL A 236 
AB 4 ASN A 221 ? ASN A 227 ? ASN A 220 ASN A 226 
AB 5 PHE A 284 ? ASN A 287 ? PHE A 283 ASN A 286 
AB 6 GLU A 271 ? PRO A 276 ? GLU A 270 PRO A 275 
AB 7 ILE A 262 ? SER A 268 ? ILE A 261 SER A 267 
BA 1 GLU B 33  ? GLU B 39  ? GLU B 32  GLU B 38  
BA 2 THR B 22  ? VAL B 28  ? THR B 21  VAL B 27  
BA 3 VAL B 93  ? ALA B 99  ? VAL B 92  ALA B 98  
BA 4 PHE B 63  ? ILE B 69  ? PHE B 62  ILE B 68  
BA 5 THR B 72  ? TRP B 75  ? THR B 71  TRP B 74  
BB 1 ILE B 255 ? PRO B 258 ? ILE B 254 PRO B 257 
BB 2 GLY B 241 ? TYR B 245 ? GLY B 240 TYR B 244 
BB 3 GLU B 232 ? VAL B 237 ? GLU B 231 VAL B 236 
BB 4 ASN B 221 ? ASN B 227 ? ASN B 220 ASN B 226 
BB 5 PHE B 284 ? ASN B 287 ? PHE B 283 ASN B 286 
BB 6 GLU B 271 ? PRO B 276 ? GLU B 270 PRO B 275 
BB 7 ILE B 262 ? SER B 268 ? ILE B 261 SER B 267 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N CYS A 38  ? N CYS A 37  O PHE A 23  ? O PHE A 22  
AA 2 3 N ARG A 26  ? N ARG A 25  O VAL A 93  ? O VAL A 92  
AA 3 4 N LEU A 98  ? N LEU A 97  O GLY A 64  ? O GLY A 63  
AA 4 5 N ILE A 69  ? N ILE A 68  O THR A 72  ? O THR A 71  
AB 1 2 N PHE A 257 ? N PHE A 256 O LEU A 242 ? O LEU A 241 
AB 2 3 N TYR A 245 ? N TYR A 244 O LEU A 234 ? O LEU A 233 
AB 3 4 N VAL A 237 ? N VAL A 236 O ASN A 221 ? O ASN A 220 
AB 4 5 N ARG A 226 ? N ARG A 225 O ASN A 287 ? O ASN A 286 
AB 5 6 N PHE A 286 ? N PHE A 285 O PHE A 272 ? O PHE A 271 
AB 6 7 O LYS A 275 ? O LYS A 274 N ARG A 263 ? N ARG A 262 
BA 1 2 N CYS B 38  ? N CYS B 37  O PHE B 23  ? O PHE B 22  
BA 2 3 N ARG B 26  ? N ARG B 25  O VAL B 93  ? O VAL B 92  
BA 3 4 N LEU B 98  ? N LEU B 97  O GLY B 64  ? O GLY B 63  
BA 4 5 N ILE B 69  ? N ILE B 68  O THR B 72  ? O THR B 71  
BB 1 2 N PHE B 257 ? N PHE B 256 O LEU B 242 ? O LEU B 241 
BB 2 3 N TYR B 245 ? N TYR B 244 O LEU B 234 ? O LEU B 233 
BB 3 4 N VAL B 237 ? N VAL B 236 O ASN B 221 ? O ASN B 220 
BB 4 5 N ARG B 226 ? N ARG B 225 O ASN B 287 ? O ASN B 286 
BB 5 6 N PHE B 286 ? N PHE B 285 O PHE B 272 ? O PHE B 271 
BB 6 7 O LYS B 275 ? O LYS B 274 N ARG B 263 ? N ARG B 262 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SO4 A1314' 
AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SO4 A1315' 
AC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SO4 A1316' 
AC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SO4 A1317' 
AC5 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SO4 B1314' 
AC6 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SO4 B1315' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 ASP A 238 ? ASP A 237  . ? 1_555 ? 
2  AC1 5 HIS A 243 ? HIS A 242  . ? 1_555 ? 
3  AC1 5 TYR A 245 ? TYR A 244  . ? 1_555 ? 
4  AC1 5 HOH I .   ? HOH A 2439 . ? 1_555 ? 
5  AC1 5 HOH I .   ? HOH A 2440 . ? 1_555 ? 
6  AC2 6 TYR A 145 ? TYR A 144  . ? 1_555 ? 
7  AC2 6 GLU A 195 ? GLU A 194  . ? 1_555 ? 
8  AC2 6 HIS A 196 ? HIS A 195  . ? 1_555 ? 
9  AC2 6 ARG A 199 ? ARG A 198  . ? 1_555 ? 
10 AC2 6 HOH I .   ? HOH A 2441 . ? 1_555 ? 
11 AC2 6 HOH I .   ? HOH A 2442 . ? 1_555 ? 
12 AC3 6 TYR A 133 ? TYR A 132  . ? 1_555 ? 
13 AC3 6 ARG A 173 ? ARG A 172  . ? 1_555 ? 
14 AC3 6 HOH I .   ? HOH A 2443 . ? 1_555 ? 
15 AC3 6 HOH I .   ? HOH A 2444 . ? 1_555 ? 
16 AC3 6 ALA B 314 ? ALA B 313  . ? 1_555 ? 
17 AC3 6 HOH J .   ? HOH B 2415 . ? 1_555 ? 
18 AC4 4 LYS A 41  ? LYS A 40   . ? 1_555 ? 
19 AC4 4 LYS A 81  ? LYS A 80   . ? 1_555 ? 
20 AC4 4 GLY B 152 ? GLY B 151  . ? 1_555 ? 
21 AC4 4 ASP B 153 ? ASP B 152  . ? 1_555 ? 
22 AC5 5 TYR B 145 ? TYR B 144  . ? 1_555 ? 
23 AC5 5 GLU B 195 ? GLU B 194  . ? 1_555 ? 
24 AC5 5 HIS B 196 ? HIS B 195  . ? 1_555 ? 
25 AC5 5 ARG B 199 ? ARG B 198  . ? 1_555 ? 
26 AC5 5 HOH J .   ? HOH B 2416 . ? 1_555 ? 
27 AC6 5 GLY A 152 ? GLY A 151  . ? 1_555 ? 
28 AC6 5 ASP A 153 ? ASP A 152  . ? 1_555 ? 
29 AC6 5 LYS B 41  ? LYS B 40   . ? 1_555 ? 
30 AC6 5 LYS B 81  ? LYS B 80   . ? 1_555 ? 
31 AC6 5 HOH J .   ? HOH B 2417 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1H4R 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1H4R 
_atom_sites.fract_transf_matrix[1][1]   0.011492 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011195 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010334 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . LYS A 1 21  ? 9.508  52.463 64.690 1.00   25.51 ? 20   LYS A N   1 
ATOM   2    C CA  . LYS A 1 21  ? 9.652  51.003 64.832 1.00   26.58 ? 20   LYS A CA  1 
ATOM   3    C C   . LYS A 1 21  ? 10.511 50.558 63.648 1.00   26.14 ? 20   LYS A C   1 
ATOM   4    O O   . LYS A 1 21  ? 10.917 51.376 62.823 1.00   27.56 ? 20   LYS A O   1 
ATOM   5    C CB  . LYS A 1 21  ? 8.289  50.292 64.800 1.00   27.14 ? 20   LYS A CB  1 
ATOM   6    C CG  . LYS A 1 21  ? 7.318  50.600 65.911 0.0000 20.00 ? 20   LYS A CG  1 
ATOM   7    C CD  . LYS A 1 21  ? 7.844  50.078 67.238 0.0000 20.00 ? 20   LYS A CD  1 
ATOM   8    C CE  . LYS A 1 21  ? 6.890  50.400 68.377 0.0000 20.00 ? 20   LYS A CE  1 
ATOM   9    N NZ  . LYS A 1 21  ? 6.775  51.868 68.607 0.0000 20.00 ? 20   LYS A NZ  1 
ATOM   10   N N   . THR A 1 22  ? 10.866 49.290 63.633 1.00   26.73 ? 21   THR A N   1 
ATOM   11   C CA  . THR A 1 22  ? 11.528 48.714 62.476 1.00   25.83 ? 21   THR A CA  1 
ATOM   12   C C   . THR A 1 22  ? 10.957 47.347 62.143 1.00   25.56 ? 21   THR A C   1 
ATOM   13   O O   . THR A 1 22  ? 10.277 46.696 62.960 1.00   26.41 ? 21   THR A O   1 
ATOM   14   C CB  . THR A 1 22  ? 13.011 48.532 62.819 1.00   26.01 ? 21   THR A CB  1 
ATOM   15   O OG1 . THR A 1 22  ? 13.106 47.656 63.952 1.00   25.35 ? 21   THR A OG1 1 
ATOM   16   C CG2 . THR A 1 22  ? 13.640 49.817 63.297 1.00   25.02 ? 21   THR A CG2 1 
ATOM   17   N N   . PHE A 1 23  ? 11.281 46.878 60.946 1.00   23.46 ? 22   PHE A N   1 
ATOM   18   C CA  . PHE A 1 23  ? 10.936 45.542 60.548 1.00   23.03 ? 22   PHE A CA  1 
ATOM   19   C C   . PHE A 1 23  ? 12.240 44.968 60.058 1.00   22.11 ? 22   PHE A C   1 
ATOM   20   O O   . PHE A 1 23  ? 13.102 45.709 59.575 1.00   21.48 ? 22   PHE A O   1 
ATOM   21   C CB  . PHE A 1 23  ? 9.859  45.506 59.460 1.00   22.88 ? 22   PHE A CB  1 
ATOM   22   C CG  . PHE A 1 23  ? 10.242 46.193 58.195 1.00   22.41 ? 22   PHE A CG  1 
ATOM   23   C CD1 . PHE A 1 23  ? 10.162 47.558 58.082 1.00   20.19 ? 22   PHE A CD1 1 
ATOM   24   C CD2 . PHE A 1 23  ? 10.648 45.462 57.097 1.00   22.04 ? 22   PHE A CD2 1 
ATOM   25   C CE1 . PHE A 1 23  ? 10.488 48.195 56.907 1.00   22.62 ? 22   PHE A CE1 1 
ATOM   26   C CE2 . PHE A 1 23  ? 10.982 46.098 55.915 1.00   21.49 ? 22   PHE A CE2 1 
ATOM   27   C CZ  . PHE A 1 23  ? 10.923 47.460 55.819 1.00   20.23 ? 22   PHE A CZ  1 
ATOM   28   N N   . THR A 1 24  ? 12.393 43.666 60.197 1.00   22.32 ? 23   THR A N   1 
ATOM   29   C CA  . THR A 1 24  ? 13.638 43.016 59.837 1.00   22.64 ? 23   THR A CA  1 
ATOM   30   C C   . THR A 1 24  ? 13.735 42.840 58.336 1.00   22.46 ? 23   THR A C   1 
ATOM   31   O O   . THR A 1 24  ? 12.787 42.390 57.695 1.00   21.49 ? 23   THR A O   1 
ATOM   32   C CB  . THR A 1 24  ? 13.717 41.680 60.522 1.00   23.25 ? 23   THR A CB  1 
ATOM   33   O OG1 . THR A 1 24  ? 13.651 41.878 61.944 1.00   24.00 ? 23   THR A OG1 1 
ATOM   34   C CG2 . THR A 1 24  ? 15.064 40.989 60.275 1.00   23.62 ? 23   THR A CG2 1 
ATOM   35   N N   . VAL A 1 25  ? 14.885 43.200 57.765 1.00   21.63 ? 24   VAL A N   1 
ATOM   36   C CA  . VAL A 1 25  ? 15.087 42.976 56.345 1.00   21.50 ? 24   VAL A CA  1 
ATOM   37   C C   . VAL A 1 25  ? 16.259 42.019 56.241 1.00   20.70 ? 24   VAL A C   1 
ATOM   38   O O   . VAL A 1 25  ? 17.236 42.144 56.976 1.00   19.41 ? 24   VAL A O   1 
ATOM   39   C CB  . VAL A 1 25  ? 15.340 44.261 55.546 1.00   21.83 ? 24   VAL A CB  1 
ATOM   40   C CG1 . VAL A 1 25  ? 15.806 43.941 54.145 1.00   24.28 ? 24   VAL A CG1 1 
ATOM   41   C CG2 . VAL A 1 25  ? 14.080 45.088 55.462 1.00   23.75 ? 24   VAL A CG2 1 
ATOM   42   N N   . ARG A 1 26  ? 16.130 41.036 55.360 1.00   19.73 ? 25   ARG A N   1 
ATOM   43   C CA  . ARG A 1 26  ? 17.199 40.086 55.120 1.00   20.23 ? 25   ARG A CA  1 
ATOM   44   C C   . ARG A 1 26  ? 17.831 40.456 53.798 1.00   19.27 ? 25   ARG A C   1 
ATOM   45   O O   . ARG A 1 26  ? 17.132 40.583 52.792 1.00   18.91 ? 25   ARG A O   1 
ATOM   46   C CB  . ARG A 1 26  ? 16.648 38.678 55.024 1.00   20.11 ? 25   ARG A CB  1 
ATOM   47   C CG  . ARG A 1 26  ? 17.686 37.605 54.917 1.00   24.74 ? 25   ARG A CG  1 
ATOM   48   C CD  . ARG A 1 26  ? 17.729 36.771 56.161 1.00   29.63 ? 25   ARG A CD  1 
ATOM   49   N NE  . ARG A 1 26  ? 18.603 35.640 56.015 1.00   33.47 ? 25   ARG A NE  1 
ATOM   50   C CZ  . ARG A 1 26  ? 18.855 34.775 56.966 1.00   33.41 ? 25   ARG A CZ  1 
ATOM   51   N NH1 . ARG A 1 26  ? 18.286 34.898 58.161 1.00   34.64 ? 25   ARG A NH1 1 
ATOM   52   N NH2 . ARG A 1 26  ? 19.675 33.776 56.710 1.00   34.03 ? 25   ARG A NH2 1 
ATOM   53   N N   . ILE A 1 27  ? 19.149 40.632 53.809 1.00   19.09 ? 26   ILE A N   1 
ATOM   54   C CA  . ILE A 1 27  ? 19.907 41.013 52.621 1.00   18.70 ? 26   ILE A CA  1 
ATOM   55   C C   . ILE A 1 27  ? 20.797 39.843 52.239 1.00   18.69 ? 26   ILE A C   1 
ATOM   56   O O   . ILE A 1 27  ? 21.606 39.380 53.036 1.00   18.50 ? 26   ILE A O   1 
ATOM   57   C CB  . ILE A 1 27  ? 20.780 42.260 52.897 1.00   17.97 ? 26   ILE A CB  1 
ATOM   58   C CG1 . ILE A 1 27  ? 19.919 43.448 53.340 1.00   18.71 ? 26   ILE A CG1 1 
ATOM   59   C CG2 . ILE A 1 27  ? 21.620 42.597 51.656 1.00   19.09 ? 26   ILE A CG2 1 
ATOM   60   C CD1 . ILE A 1 27  ? 18.865 43.861 52.344 1.00   20.15 ? 26   ILE A CD1 1 
ATOM   61   N N   . VAL A 1 28  ? 20.634 39.370 51.014 1.00   18.84 ? 27   VAL A N   1 
ATOM   62   C CA  . VAL A 1 28  ? 21.388 38.245 50.526 1.00   19.33 ? 27   VAL A CA  1 
ATOM   63   C C   . VAL A 1 28  ? 22.404 38.755 49.518 1.00   19.12 ? 27   VAL A C   1 
ATOM   64   O O   . VAL A 1 28  ? 22.028 39.247 48.455 1.00   17.99 ? 27   VAL A O   1 
ATOM   65   C CB  . VAL A 1 28  ? 20.490 37.188 49.851 1.00   19.85 ? 27   VAL A CB  1 
ATOM   66   C CG1 . VAL A 1 28  ? 21.370 36.013 49.372 1.00   21.42 ? 27   VAL A CG1 1 
ATOM   67   C CG2 . VAL A 1 28  ? 19.391 36.722 50.803 1.00   20.98 ? 27   VAL A CG2 1 
ATOM   68   N N   . THR A 1 29  ? 23.686 38.685 49.880 1.00   19.36 ? 28   THR A N   1 
ATOM   69   C CA  . THR A 1 29  ? 24.770 39.023 48.958 1.00   19.65 ? 28   THR A CA  1 
ATOM   70   C C   . THR A 1 29  ? 25.304 37.707 48.436 1.00   19.91 ? 28   THR A C   1 
ATOM   71   O O   . THR A 1 29  ? 24.930 36.644 48.921 1.00   18.93 ? 28   THR A O   1 
ATOM   72   C CB  . THR A 1 29  ? 25.938 39.781 49.632 1.00   19.71 ? 28   THR A CB  1 
ATOM   73   O OG1 . THR A 1 29  ? 26.719 38.880 50.437 1.00   21.63 ? 28   THR A OG1 1 
ATOM   74   C CG2 . THR A 1 29  ? 25.474 40.873 50.587 1.00   19.77 ? 28   THR A CG2 1 
ATOM   75   N N   . MET A 1 30  ? 26.226 37.774 47.494 1.00   21.00 ? 29   MET A N   1 
ATOM   76   C CA  . MET A 1 30  ? 26.830 36.553 46.963 1.00   22.60 ? 29   MET A CA  1 
ATOM   77   C C   . MET A 1 30  ? 27.720 35.892 48.010 1.00   23.73 ? 29   MET A C   1 
ATOM   78   O O   . MET A 1 30  ? 27.906 34.685 47.985 1.00   24.69 ? 29   MET A O   1 
ATOM   79   C CB  . MET A 1 30  ? 27.603 36.859 45.690 1.00   22.62 ? 29   MET A CB  1 
ATOM   80   C CG  . MET A 1 30  ? 26.711 37.231 44.534 1.00   23.49 ? 29   MET A CG  1 
ATOM   81   S SD  . MET A 1 30  ? 25.485 35.986 44.049 1.00   24.08 ? 29   MET A SD  1 
ATOM   82   C CE  . MET A 1 30  ? 26.425 34.583 44.049 1.00   25.34 ? 29   MET A CE  1 
ATOM   83   N N   . ASP A 1 31  ? 28.222 36.687 48.956 1.00   24.80 ? 30   ASP A N   1 
ATOM   84   C CA  . ASP A 1 31  ? 29.065 36.204 50.052 1.00   26.11 ? 30   ASP A CA  1 
ATOM   85   C C   . ASP A 1 31  ? 28.325 35.518 51.196 1.00   26.44 ? 30   ASP A C   1 
ATOM   86   O O   . ASP A 1 31  ? 28.759 34.480 51.729 1.00   28.02 ? 30   ASP A O   1 
ATOM   87   C CB  . ASP A 1 31  ? 29.774 37.394 50.703 1.00   27.00 ? 30   ASP A CB  1 
ATOM   88   C CG  . ASP A 1 31  ? 31.206 37.533 50.306 1.00   28.28 ? 30   ASP A CG  1 
ATOM   89   O OD1 . ASP A 1 31  ? 31.936 36.525 50.125 1.00   28.39 ? 30   ASP A OD1 1 
ATOM   90   O OD2 . ASP A 1 31  ? 31.747 38.654 50.211 1.00   32.53 ? 30   ASP A OD2 1 
ATOM   91   N N   . ALA A 1 32  ? 27.262 36.161 51.660 1.00   25.35 ? 31   ALA A N   1 
ATOM   92   C CA  . ALA A 1 32  ? 26.538 35.678 52.816 1.00   24.82 ? 31   ALA A CA  1 
ATOM   93   C C   . ALA A 1 32  ? 25.245 36.456 52.946 1.00   24.17 ? 31   ALA A C   1 
ATOM   94   O O   . ALA A 1 32  ? 24.938 37.316 52.136 1.00   23.47 ? 31   ALA A O   1 
ATOM   95   C CB  . ALA A 1 32  ? 27.375 35.868 54.096 1.00   24.81 ? 31   ALA A CB  1 
ATOM   96   N N   . GLU A 1 33  ? 24.516 36.154 54.004 1.00   23.95 ? 32   GLU A N   1 
ATOM   97   C CA  . GLU A 1 33  ? 23.268 36.831 54.295 1.00   23.95 ? 32   GLU A CA  1 
ATOM   98   C C   . GLU A 1 33  ? 23.433 37.607 55.583 1.00   23.76 ? 32   GLU A C   1 
ATOM   99   O O   . GLU A 1 33  ? 24.257 37.265 56.432 1.00   23.46 ? 32   GLU A O   1 
ATOM   100  C CB  . GLU A 1 33  ? 22.136 35.817 54.395 1.00   24.64 ? 32   GLU A CB  1 
ATOM   101  C CG  . GLU A 1 33  ? 22.036 34.982 53.123 1.00   26.31 ? 32   GLU A CG  1 
ATOM   102  C CD  . GLU A 1 33  ? 20.810 34.096 53.029 1.00   28.38 ? 32   GLU A CD  1 
ATOM   103  O OE1 . GLU A 1 33  ? 19.875 34.231 53.846 1.00   27.49 ? 32   GLU A OE1 1 
ATOM   104  O OE2 . GLU A 1 33  ? 20.787 33.274 52.084 1.00   27.89 ? 32   GLU A OE2 1 
ATOM   105  N N   . MET A 1 34  ? 22.695 38.694 55.706 1.00   23.33 ? 33   MET A N   1 
ATOM   106  C CA  . MET A 1 34  ? 22.749 39.479 56.921 1.00   22.98 ? 33   MET A CA  1 
ATOM   107  C C   . MET A 1 34  ? 21.380 40.096 57.120 1.00   22.79 ? 33   MET A C   1 
ATOM   108  O O   . MET A 1 34  ? 20.559 40.133 56.190 1.00   22.69 ? 33   MET A O   1 
ATOM   109  C CB  . MET A 1 34  ? 23.827 40.550 56.823 1.00   23.89 ? 33   MET A CB  1 
ATOM   110  C CG  . MET A 1 34  ? 23.532 41.636 55.831 1.00   24.83 ? 33   MET A CG  1 
ATOM   111  S SD  . MET A 1 34  ? 25.018 42.542 55.333 1.00   32.59 ? 33   MET A SD  1 
ATOM   112  C CE  . MET A 1 34  ? 25.821 41.313 54.460 1.00   31.95 ? 33   MET A CE  1 
ATOM   113  N N   . GLU A 1 35  ? 21.144 40.601 58.318 1.00   21.42 ? 34   GLU A N   1 
ATOM   114  C CA  . GLU A 1 35  ? 19.875 41.217 58.622 1.00   21.25 ? 34   GLU A CA  1 
ATOM   115  C C   . GLU A 1 35  ? 20.111 42.594 59.173 1.00   20.46 ? 34   GLU A C   1 
ATOM   116  O O   . GLU A 1 35  ? 21.129 42.832 59.825 1.00   19.72 ? 34   GLU A O   1 
ATOM   117  C CB  . GLU A 1 35  ? 19.087 40.365 59.614 1.00   21.12 ? 34   GLU A CB  1 
ATOM   118  C CG  . GLU A 1 35  ? 18.705 39.008 59.043 1.00   23.30 ? 34   GLU A CG  1 
ATOM   119  C CD  . GLU A 1 35  ? 17.655 38.262 59.839 1.00   24.60 ? 34   GLU A CD  1 
ATOM   120  O OE1 . GLU A 1 35  ? 17.467 38.554 61.045 1.00   24.68 ? 34   GLU A OE1 1 
ATOM   121  O OE2 . GLU A 1 35  ? 17.010 37.369 59.244 1.00   27.29 ? 34   GLU A OE2 1 
ATOM   122  N N   . PHE A 1 36  ? 19.182 43.493 58.858 1.00   19.38 ? 35   PHE A N   1 
ATOM   123  C CA  . PHE A 1 36  ? 19.167 44.834 59.379 1.00   18.93 ? 35   PHE A CA  1 
ATOM   124  C C   . PHE A 1 36  ? 17.754 45.171 59.860 1.00   18.77 ? 35   PHE A C   1 
ATOM   125  O O   . PHE A 1 36  ? 16.765 44.555 59.436 1.00   17.86 ? 35   PHE A O   1 
ATOM   126  C CB  . PHE A 1 36  ? 19.517 45.866 58.314 1.00   18.98 ? 35   PHE A CB  1 
ATOM   127  C CG  . PHE A 1 36  ? 20.889 45.708 57.713 1.00   18.54 ? 35   PHE A CG  1 
ATOM   128  C CD1 . PHE A 1 36  ? 22.003 46.263 58.319 1.00   17.72 ? 35   PHE A CD1 1 
ATOM   129  C CD2 . PHE A 1 36  ? 21.045 45.044 56.529 1.00   18.60 ? 35   PHE A CD2 1 
ATOM   130  C CE1 . PHE A 1 36  ? 23.264 46.128 57.739 1.00   19.74 ? 35   PHE A CE1 1 
ATOM   131  C CE2 . PHE A 1 36  ? 22.299 44.896 55.963 1.00   18.89 ? 35   PHE A CE2 1 
ATOM   132  C CZ  . PHE A 1 36  ? 23.398 45.444 56.578 1.00   19.45 ? 35   PHE A CZ  1 
ATOM   133  N N   . ASN A 1 37  ? 17.689 46.161 60.741 1.00   19.03 ? 36   ASN A N   1 
ATOM   134  C CA  . ASN A 1 37  ? 16.452 46.749 61.190 1.00   19.47 ? 36   ASN A CA  1 
ATOM   135  C C   . ASN A 1 37  ? 16.175 47.918 60.253 1.00   20.10 ? 36   ASN A C   1 
ATOM   136  O O   . ASN A 1 37  ? 16.924 48.881 60.217 1.00   21.22 ? 36   ASN A O   1 
ATOM   137  C CB  . ASN A 1 37  ? 16.579 47.252 62.632 1.00   19.19 ? 36   ASN A CB  1 
ATOM   138  C CG  . ASN A 1 37  ? 16.957 46.153 63.606 1.00   19.00 ? 36   ASN A CG  1 
ATOM   139  O OD1 . ASN A 1 37  ? 16.407 45.042 63.582 1.00   19.61 ? 36   ASN A OD1 1 
ATOM   140  N ND2 . ASN A 1 37  ? 17.940 46.445 64.450 1.00   19.28 ? 36   ASN A ND2 1 
ATOM   141  N N   . CYS A 1 38  ? 15.129 47.812 59.449 1.00   20.61 ? 37   CYS A N   1 
ATOM   142  C CA  . CYS A 1 38  ? 14.810 48.861 58.498 1.00   21.22 ? 37   CYS A CA  1 
ATOM   143  C C   . CYS A 1 38  ? 13.730 49.732 59.127 1.00   21.87 ? 37   CYS A C   1 
ATOM   144  O O   . CYS A 1 38  ? 12.711 49.221 59.558 1.00   21.32 ? 37   CYS A O   1 
ATOM   145  C CB  . CYS A 1 38  ? 14.263 48.232 57.234 1.00   21.66 ? 37   CYS A CB  1 
ATOM   146  S SG  . CYS A 1 38  ? 13.975 49.369 55.884 1.00   20.75 ? 37   CYS A SG  1 
ATOM   147  N N   . GLU A 1 39  ? 13.959 51.030 59.199 1.00   23.13 ? 38   GLU A N   1 
ATOM   148  C CA  . GLU A 1 39  ? 12.915 51.910 59.752 1.00   24.95 ? 38   GLU A CA  1 
ATOM   149  C C   . GLU A 1 39  ? 11.617 51.764 58.923 1.00   26.21 ? 38   GLU A C   1 
ATOM   150  O O   . GLU A 1 39  ? 11.658 51.597 57.693 1.00   26.14 ? 38   GLU A O   1 
ATOM   151  C CB  . GLU A 1 39  ? 13.420 53.339 59.817 1.00   24.41 ? 38   GLU A CB  1 
ATOM   152  C CG  . GLU A 1 39  ? 14.619 53.492 60.733 1.00   24.74 ? 38   GLU A CG  1 
ATOM   153  C CD  . GLU A 1 39  ? 15.011 54.925 60.991 1.00   24.51 ? 38   GLU A CD  1 
ATOM   154  O OE1 . GLU A 1 39  ? 14.223 55.842 60.651 1.00   25.38 ? 38   GLU A OE1 1 
ATOM   155  O OE2 . GLU A 1 39  ? 16.104 55.141 61.545 1.00   24.48 ? 38   GLU A OE2 1 
ATOM   156  N N   . MET A 1 40  ? 10.462 51.836 59.579 1.00   27.63 ? 39   MET A N   1 
ATOM   157  C CA  . MET A 1 40  ? 9.202  51.567 58.889 1.00   28.89 ? 39   MET A CA  1 
ATOM   158  C C   . MET A 1 40  ? 8.999  52.439 57.649 1.00   28.90 ? 39   MET A C   1 
ATOM   159  O O   . MET A 1 40  ? 8.380  51.992 56.677 1.00   29.61 ? 39   MET A O   1 
ATOM   160  C CB  . MET A 1 40  ? 8.013  51.715 59.840 1.00   29.81 ? 39   MET A CB  1 
ATOM   161  C CG  . MET A 1 40  ? 6.845  50.825 59.516 1.00   32.03 ? 39   MET A CG  1 
ATOM   162  S SD  . MET A 1 40  ? 7.023  49.093 59.999 1.00   38.49 ? 39   MET A SD  1 
ATOM   163  C CE  . MET A 1 40  ? 8.327  49.181 61.068 1.00   34.05 ? 39   MET A CE  1 
ATOM   164  N N   . LYS A 1 41  ? 9.542  53.650 57.659 1.00   28.62 ? 40   LYS A N   1 
ATOM   165  C CA  . LYS A 1 41  ? 9.355  54.561 56.536 1.00   28.94 ? 40   LYS A CA  1 
ATOM   166  C C   . LYS A 1 41  ? 10.602 54.825 55.718 1.00   27.90 ? 40   LYS A C   1 
ATOM   167  O O   . LYS A 1 41  ? 10.622 55.761 54.927 1.00   27.55 ? 40   LYS A O   1 
ATOM   168  C CB  . LYS A 1 41  ? 8.843  55.905 57.035 1.00   29.80 ? 40   LYS A CB  1 
ATOM   169  C CG  . LYS A 1 41  ? 7.483  55.838 57.675 1.00   31.61 ? 40   LYS A CG  1 
ATOM   170  C CD  . LYS A 1 41  ? 7.188  57.147 58.365 1.00   34.17 ? 40   LYS A CD  1 
ATOM   171  C CE  . LYS A 1 41  ? 5.794  57.177 58.899 1.00   35.15 ? 40   LYS A CE  1 
ATOM   172  N NZ  . LYS A 1 41  ? 4.806  57.209 57.788 1.00   37.83 ? 40   LYS A NZ  1 
ATOM   173  N N   . TRP A 1 42  ? 11.649 54.024 55.891 1.00   26.63 ? 41   TRP A N   1 
ATOM   174  C CA  . TRP A 1 42  ? 12.854 54.245 55.107 1.00   26.26 ? 41   TRP A CA  1 
ATOM   175  C C   . TRP A 1 42  ? 12.544 54.045 53.637 1.00   25.37 ? 41   TRP A C   1 
ATOM   176  O O   . TRP A 1 42  ? 11.691 53.245 53.291 1.00   25.43 ? 41   TRP A O   1 
ATOM   177  C CB  . TRP A 1 42  ? 13.975 53.282 55.507 1.00   25.99 ? 41   TRP A CB  1 
ATOM   178  C CG  . TRP A 1 42  ? 15.016 53.882 56.429 1.00   25.92 ? 41   TRP A CG  1 
ATOM   179  C CD1 . TRP A 1 42  ? 15.116 55.177 56.827 1.00   24.42 ? 41   TRP A CD1 1 
ATOM   180  C CD2 . TRP A 1 42  ? 16.099 53.187 57.061 1.00   24.49 ? 41   TRP A CD2 1 
ATOM   181  N NE1 . TRP A 1 42  ? 16.182 55.332 57.678 1.00   25.77 ? 41   TRP A NE1 1 
ATOM   182  C CE2 . TRP A 1 42  ? 16.798 54.121 57.844 1.00   24.41 ? 41   TRP A CE2 1 
ATOM   183  C CE3 . TRP A 1 42  ? 16.532 51.859 57.064 1.00   25.39 ? 41   TRP A CE3 1 
ATOM   184  C CZ2 . TRP A 1 42  ? 17.918 53.780 58.600 1.00   24.72 ? 41   TRP A CZ2 1 
ATOM   185  C CZ3 . TRP A 1 42  ? 17.646 51.522 57.836 1.00   23.32 ? 41   TRP A CZ3 1 
ATOM   186  C CH2 . TRP A 1 42  ? 18.317 52.477 58.580 1.00   23.46 ? 41   TRP A CH2 1 
ATOM   187  N N   . LYS A 1 43  ? 13.249 54.785 52.801 1.00   25.54 ? 42   LYS A N   1 
ATOM   188  C CA  . LYS A 1 43  ? 13.172 54.622 51.361 1.00   26.16 ? 42   LYS A CA  1 
ATOM   189  C C   . LYS A 1 43  ? 14.240 53.628 50.905 1.00   25.54 ? 42   LYS A C   1 
ATOM   190  O O   . LYS A 1 43  ? 15.092 53.166 51.703 1.00   25.03 ? 42   LYS A O   1 
ATOM   191  C CB  . LYS A 1 43  ? 13.361 55.973 50.672 1.00   26.60 ? 42   LYS A CB  1 
ATOM   192  C CG  . LYS A 1 43  ? 12.213 56.943 50.955 1.00   29.02 ? 42   LYS A CG  1 
ATOM   193  C CD  . LYS A 1 43  ? 12.404 58.265 50.239 1.00   32.08 ? 42   LYS A CD  1 
ATOM   194  C CE  . LYS A 1 43  ? 11.165 59.154 50.378 1.00   34.64 ? 42   LYS A CE  1 
ATOM   195  N NZ  . LYS A 1 43  ? 11.485 60.529 49.897 1.00   37.39 ? 42   LYS A NZ  1 
ATOM   196  N N   . GLY A 1 44  ? 14.162 53.261 49.630 1.00   24.93 ? 43   GLY A N   1 
ATOM   197  C CA  . GLY A 1 44  ? 15.205 52.432 49.027 1.00   23.77 ? 43   GLY A CA  1 
ATOM   198  C C   . GLY A 1 44  ? 16.618 52.937 49.295 1.00   23.61 ? 43   GLY A C   1 
ATOM   199  O O   . GLY A 1 44  ? 17.485 52.163 49.694 1.00   22.67 ? 43   GLY A O   1 
ATOM   200  N N   . LYS A 1 45  ? 16.841 54.234 49.081 1.00   23.16 ? 44   LYS A N   1 
ATOM   201  C CA  . LYS A 1 45  ? 18.134 54.852 49.247 1.00   23.62 ? 44   LYS A CA  1 
ATOM   202  C C   . LYS A 1 45  ? 18.739 54.631 50.631 1.00   22.61 ? 44   LYS A C   1 
ATOM   203  O O   . LYS A 1 45  ? 19.958 54.424 50.761 1.00   22.38 ? 44   LYS A O   1 
ATOM   204  C CB  . LYS A 1 45  ? 18.061 56.357 48.970 1.00   24.56 ? 44   LYS A CB  1 
ATOM   205  C CG  . LYS A 1 45  ? 19.399 57.048 48.948 1.00   27.71 ? 44   LYS A CG  1 
ATOM   206  C CD  . LYS A 1 45  ? 19.311 58.563 49.057 1.00   32.44 ? 44   LYS A CD  1 
ATOM   207  C CE  . LYS A 1 45  ? 20.511 59.259 48.401 1.00   34.27 ? 44   LYS A CE  1 
ATOM   208  N NZ  . LYS A 1 45  ? 21.845 58.689 48.779 1.00   36.77 ? 44   LYS A NZ  1 
ATOM   209  N N   . ASP A 1 46  ? 17.904 54.689 51.659 1.00   22.02 ? 45   ASP A N   1 
ATOM   210  C CA  . ASP A 1 46  ? 18.357 54.550 53.053 1.00   21.84 ? 45   ASP A CA  1 
ATOM   211  C C   . ASP A 1 46  ? 18.861 53.133 53.336 1.00   20.94 ? 45   ASP A C   1 
ATOM   212  O O   . ASP A 1 46  ? 19.905 52.923 53.991 1.00   21.16 ? 45   ASP A O   1 
ATOM   213  C CB  . ASP A 1 46  ? 17.199 54.856 54.016 1.00   21.87 ? 45   ASP A CB  1 
ATOM   214  C CG  . ASP A 1 46  ? 16.651 56.266 53.857 1.00   23.28 ? 45   ASP A CG  1 
ATOM   215  O OD1 . ASP A 1 46  ? 17.403 57.233 54.101 1.00   26.38 ? 45   ASP A OD1 1 
ATOM   216  O OD2 . ASP A 1 46  ? 15.479 56.484 53.499 1.00   26.60 ? 45   ASP A OD2 1 
ATOM   217  N N   . LEU A 1 47  ? 18.100 52.162 52.858 1.00   20.09 ? 46   LEU A N   1 
ATOM   218  C CA  . LEU A 1 47  ? 18.448 50.783 53.093 1.00   19.35 ? 46   LEU A CA  1 
ATOM   219  C C   . LEU A 1 47  ? 19.661 50.429 52.223 1.00   19.13 ? 46   LEU A C   1 
ATOM   220  O O   . LEU A 1 47  ? 20.589 49.786 52.683 1.00   18.96 ? 46   LEU A O   1 
ATOM   221  C CB  . LEU A 1 47  ? 17.260 49.899 52.805 1.00   19.05 ? 46   LEU A CB  1 
ATOM   222  C CG  . LEU A 1 47  ? 17.515 48.402 52.889 1.00   19.73 ? 46   LEU A CG  1 
ATOM   223  C CD1 . LEU A 1 47  ? 17.894 47.994 54.299 1.00   19.88 ? 46   LEU A CD1 1 
ATOM   224  C CD2 . LEU A 1 47  ? 16.320 47.607 52.371 1.00   20.04 ? 46   LEU A CD2 1 
ATOM   225  N N   . PHE A 1 48  ? 19.657 50.884 50.978 1.00   18.84 ? 47   PHE A N   1 
ATOM   226  C CA  . PHE A 1 48  ? 20.776 50.644 50.061 1.00   18.30 ? 47   PHE A CA  1 
ATOM   227  C C   . PHE A 1 48  ? 22.052 51.238 50.615 1.00   18.87 ? 47   PHE A C   1 
ATOM   228  O O   . PHE A 1 48  ? 23.097 50.578 50.594 1.00   17.01 ? 47   PHE A O   1 
ATOM   229  C CB  . PHE A 1 48  ? 20.444 51.215 48.672 1.00   18.18 ? 47   PHE A CB  1 
ATOM   230  C CG  . PHE A 1 48  ? 21.529 50.972 47.644 1.00   18.18 ? 47   PHE A CG  1 
ATOM   231  C CD1 . PHE A 1 48  ? 21.693 49.726 47.087 1.00   17.59 ? 47   PHE A CD1 1 
ATOM   232  C CD2 . PHE A 1 48  ? 22.400 51.983 47.259 1.00   17.97 ? 47   PHE A CD2 1 
ATOM   233  C CE1 . PHE A 1 48  ? 22.706 49.497 46.156 1.00   17.02 ? 47   PHE A CE1 1 
ATOM   234  C CE2 . PHE A 1 48  ? 23.390 51.762 46.327 1.00   17.97 ? 47   PHE A CE2 1 
ATOM   235  C CZ  . PHE A 1 48  ? 23.532 50.518 45.753 1.00   17.87 ? 47   PHE A CZ  1 
ATOM   236  N N   . ASP A 1 49  ? 22.004 52.470 51.117 1.00   19.07 ? 48   ASP A N   1 
ATOM   237  C CA  . ASP A 1 49  ? 23.194 53.094 51.673 1.00   19.69 ? 48   ASP A CA  1 
ATOM   238  C C   . ASP A 1 49  ? 23.735 52.354 52.895 1.00   18.48 ? 48   ASP A C   1 
ATOM   239  O O   . ASP A 1 49  ? 24.939 52.247 53.055 1.00   18.49 ? 48   ASP A O   1 
ATOM   240  C CB  . ASP A 1 49  ? 22.915 54.557 52.049 1.00   20.55 ? 48   ASP A CB  1 
ATOM   241  C CG  . ASP A 1 49  ? 22.835 55.464 50.834 1.00   24.24 ? 48   ASP A CG  1 
ATOM   242  O OD1 . ASP A 1 49  ? 23.119 54.996 49.713 1.00   25.00 ? 48   ASP A OD1 1 
ATOM   243  O OD2 . ASP A 1 49  ? 22.417 56.641 50.898 1.00   28.50 ? 48   ASP A OD2 1 
ATOM   244  N N   . LEU A 1 50  ? 22.847 51.855 53.747 1.00   17.57 ? 49   LEU A N   1 
ATOM   245  C CA  . LEU A 1 50  ? 23.244 51.108 54.932 1.00   17.40 ? 49   LEU A CA  1 
ATOM   246  C C   . LEU A 1 50  ? 23.955 49.813 54.525 1.00   16.93 ? 49   LEU A C   1 
ATOM   247  O O   . LEU A 1 50  ? 24.981 49.434 55.100 1.00   17.20 ? 49   LEU A O   1 
ATOM   248  C CB  . LEU A 1 50  ? 22.023 50.778 55.776 1.00   17.18 ? 49   LEU A CB  1 
ATOM   249  C CG  . LEU A 1 50  ? 22.231 49.854 56.973 1.00   17.76 ? 49   LEU A CG  1 
ATOM   250  C CD1 . LEU A 1 50  ? 23.261 50.408 57.937 1.00   20.34 ? 49   LEU A CD1 1 
ATOM   251  C CD2 . LEU A 1 50  ? 20.900 49.553 57.672 1.00   19.00 ? 49   LEU A CD2 1 
ATOM   252  N N   . VAL A 1 51  ? 23.394 49.133 53.538 1.00   16.83 ? 50   VAL A N   1 
ATOM   253  C CA  . VAL A 1 51  ? 24.022 47.911 53.048 1.00   16.70 ? 50   VAL A CA  1 
ATOM   254  C C   . VAL A 1 51  ? 25.408 48.206 52.492 1.00   16.11 ? 50   VAL A C   1 
ATOM   255  O O   . VAL A 1 51  ? 26.367 47.542 52.843 1.00   16.82 ? 50   VAL A O   1 
ATOM   256  C CB  . VAL A 1 51  ? 23.183 47.234 51.964 1.00   16.67 ? 50   VAL A CB  1 
ATOM   257  C CG1 . VAL A 1 51  ? 23.946 46.044 51.379 1.00   16.91 ? 50   VAL A CG1 1 
ATOM   258  C CG2 . VAL A 1 51  ? 21.874 46.770 52.532 1.00   18.43 ? 50   VAL A CG2 1 
ATOM   259  N N   . CYS A 1 52  ? 25.527 49.215 51.642 1.00   16.22 ? 51   CYS A N   1 
ATOM   260  C CA  . CYS A 1 52  ? 26.825 49.578 51.041 1.00   16.59 ? 51   CYS A CA  1 
ATOM   261  C C   . CYS A 1 52  ? 27.856 49.968 52.110 1.00   17.60 ? 51   CYS A C   1 
ATOM   262  O O   . CYS A 1 52  ? 29.004 49.512 52.070 1.00   17.69 ? 51   CYS A O   1 
ATOM   263  C CB  . CYS A 1 52  ? 26.658 50.705 50.028 1.00   17.16 ? 51   CYS A CB  1 
ATOM   264  S SG  . CYS A 1 52  ? 25.781 50.189 48.536 1.00   18.40 ? 51   CYS A SG  1 
ATOM   265  N N   . ARG A 1 53  ? 27.443 50.775 53.091 1.00   18.39 ? 52   ARG A N   1 
ATOM   266  C CA  . ARG A 1 53  ? 28.353 51.154 54.167 1.00   19.04 ? 52   ARG A CA  1 
ATOM   267  C C   . ARG A 1 53  ? 28.839 49.925 54.945 1.00   18.35 ? 52   ARG A C   1 
ATOM   268  O O   . ARG A 1 53  ? 30.026 49.810 55.288 1.00   18.32 ? 52   ARG A O   1 
ATOM   269  C CB  . ARG A 1 53  ? 27.672 52.119 55.139 1.00   20.34 ? 52   ARG A CB  1 
ATOM   270  C CG  . ARG A 1 53  ? 27.459 53.532 54.628 1.00   23.42 ? 52   ARG A CG  1 
ATOM   271  C CD  . ARG A 1 53  ? 27.222 54.534 55.760 1.00   27.10 ? 52   ARG A CD  1 
ATOM   272  N NE  . ARG A 1 53  ? 26.272 54.049 56.762 1.00   30.16 ? 52   ARG A NE  1 
ATOM   273  C CZ  . ARG A 1 53  ? 24.945 54.167 56.678 1.00   32.58 ? 52   ARG A CZ  1 
ATOM   274  N NH1 . ARG A 1 53  ? 24.373 54.747 55.623 1.00   32.30 ? 52   ARG A NH1 1 
ATOM   275  N NH2 . ARG A 1 53  ? 24.178 53.694 57.659 1.00   33.89 ? 52   ARG A NH2 1 
ATOM   276  N N   . THR A 1 54  ? 27.923 49.020 55.251 1.00   17.93 ? 53   THR A N   1 
ATOM   277  C CA  . THR A 1 54  ? 28.247 47.804 56.000 1.00   18.13 ? 53   THR A CA  1 
ATOM   278  C C   . THR A 1 54  ? 29.290 46.966 55.251 1.00   18.04 ? 53   THR A C   1 
ATOM   279  O O   . THR A 1 54  ? 30.178 46.366 55.863 1.00   19.11 ? 53   THR A O   1 
ATOM   280  C CB  . THR A 1 54  ? 26.972 46.979 56.243 1.00   18.44 ? 53   THR A CB  1 
ATOM   281  O OG1 . THR A 1 54  ? 26.052 47.741 57.026 1.00   17.49 ? 53   THR A OG1 1 
ATOM   282  C CG2 . THR A 1 54  ? 27.216 45.764 57.109 1.00   18.08 ? 53   THR A CG2 1 
ATOM   283  N N   . LEU A 1 55  ? 29.181 46.923 53.934 1.00   17.49 ? 54   LEU A N   1 
ATOM   284  C CA  . LEU A 1 55  ? 30.134 46.183 53.105 1.00   18.38 ? 54   LEU A CA  1 
ATOM   285  C C   . LEU A 1 55  ? 31.425 46.952 52.860 1.00   18.50 ? 54   LEU A C   1 
ATOM   286  O O   . LEU A 1 55  ? 32.422 46.401 52.364 1.00   18.77 ? 54   LEU A O   1 
ATOM   287  C CB  . LEU A 1 55  ? 29.461 45.830 51.757 1.00   18.12 ? 54   LEU A CB  1 
ATOM   288  C CG  . LEU A 1 55  ? 28.225 44.944 51.883 1.00   19.14 ? 54   LEU A CG  1 
ATOM   289  C CD1 . LEU A 1 55  ? 27.471 44.890 50.564 1.00   20.06 ? 54   LEU A CD1 1 
ATOM   290  C CD2 . LEU A 1 55  ? 28.642 43.546 52.321 1.00   21.68 ? 54   LEU A CD2 1 
ATOM   291  N N   . GLY A 1 56  ? 31.435 48.244 53.181 1.00   18.55 ? 55   GLY A N   1 
ATOM   292  C CA  . GLY A 1 56  ? 32.601 49.064 52.898 1.00   18.37 ? 55   GLY A CA  1 
ATOM   293  C C   . GLY A 1 56  ? 32.703 49.347 51.407 1.00   19.14 ? 55   GLY A C   1 
ATOM   294  O O   . GLY A 1 56  ? 33.788 49.561 50.872 1.00   19.91 ? 55   GLY A O   1 
ATOM   295  N N   . LEU A 1 57  ? 31.558 49.322 50.735 1.00   19.13 ? 56   LEU A N   1 
ATOM   296  C CA  . LEU A 1 57  ? 31.502 49.492 49.289 1.00   19.82 ? 56   LEU A CA  1 
ATOM   297  C C   . LEU A 1 57  ? 31.194 50.929 48.868 1.00   20.47 ? 56   LEU A C   1 
ATOM   298  O O   . LEU A 1 57  ? 30.161 51.493 49.245 1.00   20.85 ? 56   LEU A O   1 
ATOM   299  C CB  . LEU A 1 57  ? 30.464 48.532 48.704 1.00   19.86 ? 56   LEU A CB  1 
ATOM   300  C CG  . LEU A 1 57  ? 30.182 48.693 47.217 1.00   21.81 ? 56   LEU A CG  1 
ATOM   301  C CD1 . LEU A 1 57  ? 31.331 48.136 46.460 1.00   23.44 ? 56   LEU A CD1 1 
ATOM   302  C CD2 . LEU A 1 57  ? 28.880 47.999 46.822 1.00   24.88 ? 56   LEU A CD2 1 
ATOM   303  N N   . ARG A 1 58  ? 32.101 51.518 48.089 1.00   20.76 ? 57   ARG A N   1 
ATOM   304  C CA  . ARG A 1 58  ? 31.909 52.875 47.572 1.00   21.52 ? 57   ARG A CA  1 
ATOM   305  C C   . ARG A 1 58  ? 31.606 52.915 46.072 1.00   20.69 ? 57   ARG A C   1 
ATOM   306  O O   . ARG A 1 58  ? 31.101 53.918 45.555 1.00   20.28 ? 57   ARG A O   1 
ATOM   307  C CB  . ARG A 1 58  ? 33.144 53.721 47.885 1.00   22.64 ? 57   ARG A CB  1 
ATOM   308  C CG  . ARG A 1 58  ? 33.294 53.983 49.380 1.00   25.72 ? 57   ARG A CG  1 
ATOM   309  C CD  . ARG A 1 58  ? 34.494 54.877 49.760 1.00   31.47 ? 57   ARG A CD  1 
ATOM   310  N NE  . ARG A 1 58  ? 35.772 54.457 49.190 1.00   35.64 ? 57   ARG A NE  1 
ATOM   311  C CZ  . ARG A 1 58  ? 36.532 53.479 49.670 1.00   39.35 ? 57   ARG A CZ  1 
ATOM   312  N NH1 . ARG A 1 58  ? 36.133 52.775 50.726 1.00   40.01 ? 57   ARG A NH1 1 
ATOM   313  N NH2 . ARG A 1 58  ? 37.687 53.192 49.082 1.00   40.15 ? 57   ARG A NH2 1 
ATOM   314  N N   . GLU A 1 59  ? 31.921 51.829 45.369 1.00   20.01 ? 58   GLU A N   1 
ATOM   315  C CA  . GLU A 1 59  ? 31.632 51.722 43.936 1.00   19.87 ? 58   GLU A CA  1 
ATOM   316  C C   . GLU A 1 59  ? 30.199 51.222 43.818 1.00   20.07 ? 58   GLU A C   1 
ATOM   317  O O   . GLU A 1 59  ? 29.915 50.154 43.255 1.00   19.53 ? 58   GLU A O   1 
ATOM   318  C CB  . GLU A 1 59  ? 32.645 50.782 43.254 1.00   19.96 ? 58   GLU A CB  1 
ATOM   319  C CG  . GLU A 1 59  ? 34.055 51.366 43.304 1.00   20.52 ? 58   GLU A CG  1 
ATOM   320  C CD  . GLU A 1 59  ? 35.181 50.435 42.874 1.00   21.48 ? 58   GLU A CD  1 
ATOM   321  O OE1 . GLU A 1 59  ? 35.285 49.271 43.328 1.00   21.16 ? 58   GLU A OE1 1 
ATOM   322  O OE2 . GLU A 1 59  ? 36.032 50.912 42.112 1.00   23.96 ? 58   GLU A OE2 1 
ATOM   323  N N   . THR A 1 60  ? 29.278 52.029 44.334 1.00   19.50 ? 59   THR A N   1 
ATOM   324  C CA  . THR A 1 60  ? 27.882 51.632 44.468 1.00   19.70 ? 59   THR A CA  1 
ATOM   325  C C   . THR A 1 60  ? 27.002 51.659 43.223 1.00   19.20 ? 59   THR A C   1 
ATOM   326  O O   . THR A 1 60  ? 25.945 51.036 43.219 1.00   19.27 ? 59   THR A O   1 
ATOM   327  C CB  . THR A 1 60  ? 27.198 52.538 45.525 1.00   19.98 ? 59   THR A CB  1 
ATOM   328  O OG1 . THR A 1 60  ? 27.124 53.885 45.042 1.00   21.29 ? 59   THR A OG1 1 
ATOM   329  C CG2 . THR A 1 60  ? 28.024 52.622 46.797 1.00   21.17 ? 59   THR A CG2 1 
ATOM   330  N N   . TRP A 1 61  ? 27.420 52.393 42.194 1.00   19.48 ? 60   TRP A N   1 
ATOM   331  C CA  . TRP A 1 61  ? 26.600 52.597 41.007 1.00   19.33 ? 60   TRP A CA  1 
ATOM   332  C C   . TRP A 1 61  ? 26.320 51.330 40.199 1.00   18.71 ? 60   TRP A C   1 
ATOM   333  O O   . TRP A 1 61  ? 25.408 51.324 39.387 1.00   18.56 ? 60   TRP A O   1 
ATOM   334  C CB  . TRP A 1 61  ? 27.220 53.668 40.107 1.00   19.50 ? 60   TRP A CB  1 
ATOM   335  C CG  . TRP A 1 61  ? 28.692 53.517 39.908 1.00   21.02 ? 60   TRP A CG  1 
ATOM   336  C CD1 . TRP A 1 61  ? 29.316 52.823 38.925 1.00   22.54 ? 60   TRP A CD1 1 
ATOM   337  C CD2 . TRP A 1 61  ? 29.728 54.066 40.730 1.00   23.65 ? 60   TRP A CD2 1 
ATOM   338  N NE1 . TRP A 1 61  ? 30.677 52.891 39.086 1.00   23.37 ? 60   TRP A NE1 1 
ATOM   339  C CE2 . TRP A 1 61  ? 30.959 53.663 40.178 1.00   25.04 ? 60   TRP A CE2 1 
ATOM   340  C CE3 . TRP A 1 61  ? 29.739 54.856 41.884 1.00   25.44 ? 60   TRP A CE3 1 
ATOM   341  C CZ2 . TRP A 1 61  ? 32.186 54.021 40.735 1.00   25.72 ? 60   TRP A CZ2 1 
ATOM   342  C CZ3 . TRP A 1 61  ? 30.963 55.217 42.434 1.00   26.22 ? 60   TRP A CZ3 1 
ATOM   343  C CH2 . TRP A 1 61  ? 32.165 54.799 41.854 1.00   26.07 ? 60   TRP A CH2 1 
ATOM   344  N N   . PHE A 1 62  ? 27.099 50.276 40.420 1.00   18.20 ? 61   PHE A N   1 
ATOM   345  C CA  . PHE A 1 62  ? 26.867 49.009 39.723 1.00   17.57 ? 61   PHE A CA  1 
ATOM   346  C C   . PHE A 1 62  ? 25.764 48.174 40.370 1.00   17.75 ? 61   PHE A C   1 
ATOM   347  O O   . PHE A 1 62  ? 25.215 47.250 39.727 1.00   17.67 ? 61   PHE A O   1 
ATOM   348  C CB  . PHE A 1 62  ? 28.136 48.141 39.760 1.00   18.07 ? 61   PHE A CB  1 
ATOM   349  C CG  . PHE A 1 62  ? 29.298 48.712 39.032 1.00   17.97 ? 61   PHE A CG  1 
ATOM   350  C CD1 . PHE A 1 62  ? 29.301 48.775 37.651 1.00   17.64 ? 61   PHE A CD1 1 
ATOM   351  C CD2 . PHE A 1 62  ? 30.425 49.133 39.723 1.00   19.26 ? 61   PHE A CD2 1 
ATOM   352  C CE1 . PHE A 1 62  ? 30.388 49.290 36.976 1.00   18.43 ? 61   PHE A CE1 1 
ATOM   353  C CE2 . PHE A 1 62  ? 31.539 49.643 39.038 1.00   19.11 ? 61   PHE A CE2 1 
ATOM   354  C CZ  . PHE A 1 62  ? 31.510 49.718 37.669 1.00   17.94 ? 61   PHE A CZ  1 
ATOM   355  N N   . PHE A 1 63  ? 25.420 48.502 41.620 1.00   17.26 ? 62   PHE A N   1 
ATOM   356  C CA  . PHE A 1 63  ? 24.599 47.621 42.444 1.00   17.16 ? 62   PHE A CA  1 
ATOM   357  C C   . PHE A 1 63  ? 23.171 48.081 42.730 1.00   17.03 ? 62   PHE A C   1 
ATOM   358  O O   . PHE A 1 63  ? 22.829 49.243 42.584 1.00   17.27 ? 62   PHE A O   1 
ATOM   359  C CB  . PHE A 1 63  ? 25.315 47.335 43.767 1.00   16.99 ? 62   PHE A CB  1 
ATOM   360  C CG  . PHE A 1 63  ? 26.660 46.657 43.587 1.00   16.09 ? 62   PHE A CG  1 
ATOM   361  C CD1 . PHE A 1 63  ? 26.752 45.274 43.518 1.00   15.56 ? 62   PHE A CD1 1 
ATOM   362  C CD2 . PHE A 1 63  ? 27.801 47.407 43.437 1.00   16.96 ? 62   PHE A CD2 1 
ATOM   363  C CE1 . PHE A 1 63  ? 27.985 44.657 43.332 1.00   18.19 ? 62   PHE A CE1 1 
ATOM   364  C CE2 . PHE A 1 63  ? 29.043 46.794 43.230 1.00   15.24 ? 62   PHE A CE2 1 
ATOM   365  C CZ  . PHE A 1 63  ? 29.130 45.431 43.183 1.00   15.12 ? 62   PHE A CZ  1 
ATOM   366  N N   . GLY A 1 64  ? 22.348 47.127 43.131 1.00   16.51 ? 63   GLY A N   1 
ATOM   367  C CA  . GLY A 1 64  ? 20.977 47.405 43.526 1.00   16.15 ? 63   GLY A CA  1 
ATOM   368  C C   . GLY A 1 64  ? 20.497 46.342 44.473 1.00   17.05 ? 63   GLY A C   1 
ATOM   369  O O   . GLY A 1 64  ? 21.226 45.404 44.802 1.00   16.15 ? 63   GLY A O   1 
ATOM   370  N N   . LEU A 1 65  ? 19.260 46.498 44.933 1.00   17.75 ? 64   LEU A N   1 
ATOM   371  C CA  . LEU A 1 65  ? 18.641 45.529 45.799 1.00   17.94 ? 64   LEU A CA  1 
ATOM   372  C C   . LEU A 1 65  ? 17.461 44.945 45.037 1.00   18.78 ? 64   LEU A C   1 
ATOM   373  O O   . LEU A 1 65  ? 16.493 45.651 44.725 1.00   19.13 ? 64   LEU A O   1 
ATOM   374  C CB  . LEU A 1 65  ? 18.172 46.207 47.088 1.00   18.56 ? 64   LEU A CB  1 
ATOM   375  C CG  . LEU A 1 65  ? 19.255 46.485 48.119 1.00   19.43 ? 64   LEU A CG  1 
ATOM   376  C CD1 . LEU A 1 65  ? 18.716 47.431 49.190 1.00   21.05 ? 64   LEU A CD1 1 
ATOM   377  C CD2 . LEU A 1 65  ? 19.687 45.162 48.713 1.00   18.44 ? 64   LEU A CD2 1 
ATOM   378  N N   . GLN A 1 66  ? 17.548 43.643 44.757 1.00   19.30 ? 65   GLN A N   1 
ATOM   379  C CA  . GLN A 1 66  ? 16.594 42.942 43.899 1.00   19.84 ? 65   GLN A CA  1 
ATOM   380  C C   . GLN A 1 66  ? 15.550 42.120 44.641 1.00   20.39 ? 65   GLN A C   1 
ATOM   381  O O   . GLN A 1 66  ? 15.819 41.521 45.700 1.00   19.90 ? 65   GLN A O   1 
ATOM   382  C CB  . GLN A 1 66  ? 17.368 41.989 42.965 1.00   19.23 ? 65   GLN A CB  1 
ATOM   383  C CG  . GLN A 1 66  ? 16.588 41.464 41.784 1.00   21.15 ? 65   GLN A CG  1 
ATOM   384  C CD  . GLN A 1 66  ? 17.377 40.453 40.989 1.00   23.22 ? 65   GLN A CD  1 
ATOM   385  O OE1 . GLN A 1 66  ? 18.145 40.826 40.089 1.00   24.07 ? 65   GLN A OE1 1 
ATOM   386  N NE2 . GLN A 1 66  ? 17.199 39.179 41.305 1.00   20.36 ? 65   GLN A NE2 1 
ATOM   387  N N   . TYR A 1 67  ? 14.357 42.088 44.057 1.00   21.79 ? 66   TYR A N   1 
ATOM   388  C CA  . TYR A 1 67  ? 13.267 41.232 44.519 1.00   23.84 ? 66   TYR A CA  1 
ATOM   389  C C   . TYR A 1 67  ? 12.574 40.637 43.285 1.00   24.96 ? 66   TYR A C   1 
ATOM   390  O O   . TYR A 1 67  ? 12.980 40.898 42.158 1.00   24.62 ? 66   TYR A O   1 
ATOM   391  C CB  . TYR A 1 67  ? 12.275 41.968 45.440 1.00   23.50 ? 66   TYR A CB  1 
ATOM   392  C CG  . TYR A 1 67  ? 11.590 43.192 44.862 1.00   25.00 ? 66   TYR A CG  1 
ATOM   393  C CD1 . TYR A 1 67  ? 12.288 44.353 44.636 1.00   24.26 ? 66   TYR A CD1 1 
ATOM   394  C CD2 . TYR A 1 67  ? 10.221 43.194 44.578 1.00   27.53 ? 66   TYR A CD2 1 
ATOM   395  C CE1 . TYR A 1 67  ? 11.679 45.474 44.101 1.00   26.26 ? 66   TYR A CE1 1 
ATOM   396  C CE2 . TYR A 1 67  ? 9.595  44.332 44.060 1.00   27.38 ? 66   TYR A CE2 1 
ATOM   397  C CZ  . TYR A 1 67  ? 10.326 45.460 43.823 1.00   27.36 ? 66   TYR A CZ  1 
ATOM   398  O OH  . TYR A 1 67  ? 9.751  46.593 43.290 1.00   28.24 ? 66   TYR A OH  1 
ATOM   399  N N   . THR A 1 68  ? 11.536 39.838 43.494 1.00   27.23 ? 67   THR A N   1 
ATOM   400  C CA  . THR A 1 68  ? 10.839 39.198 42.372 1.00   29.26 ? 67   THR A CA  1 
ATOM   401  C C   . THR A 1 68  ? 9.324  39.458 42.407 1.00   30.68 ? 67   THR A C   1 
ATOM   402  O O   . THR A 1 68  ? 8.678  39.298 43.448 1.00   31.01 ? 67   THR A O   1 
ATOM   403  C CB  . THR A 1 68  ? 11.152 37.694 42.388 1.00   29.71 ? 67   THR A CB  1 
ATOM   404  O OG1 . THR A 1 68  ? 12.525 37.486 42.025 1.00   29.89 ? 67   THR A OG1 1 
ATOM   405  C CG2 . THR A 1 68  ? 10.372 36.919 41.319 1.00   31.05 ? 67   THR A CG2 1 
ATOM   406  N N   . ILE A 1 69  ? 8.782  39.907 41.277 1.00   31.87 ? 68   ILE A N   1 
ATOM   407  C CA  . ILE A 1 69  ? 7.342  40.124 41.128 1.00   33.05 ? 68   ILE A CA  1 
ATOM   408  C C   . ILE A 1 69  ? 6.883  39.025 40.198 1.00   33.80 ? 68   ILE A C   1 
ATOM   409  O O   . ILE A 1 69  ? 7.236  39.022 39.022 1.00   33.78 ? 68   ILE A O   1 
ATOM   410  C CB  . ILE A 1 69  ? 7.033  41.494 40.526 1.00   33.23 ? 68   ILE A CB  1 
ATOM   411  C CG1 . ILE A 1 69  ? 7.531  42.610 41.446 1.00   33.66 ? 68   ILE A CG1 1 
ATOM   412  C CG2 . ILE A 1 69  ? 5.520  41.658 40.311 1.00   34.34 ? 68   ILE A CG2 1 
ATOM   413  C CD1 . ILE A 1 69  ? 7.532  44.008 40.812 1.00   34.52 ? 68   ILE A CD1 1 
ATOM   414  N N   . LYS A 1 70  ? 6.120  38.081 40.735 1.00   34.86 ? 69   LYS A N   1 
ATOM   415  C CA  . LYS A 1 70  ? 5.692  36.925 39.975 1.00   35.99 ? 69   LYS A CA  1 
ATOM   416  C C   . LYS A 1 70  ? 6.967  36.224 39.531 1.00   36.21 ? 69   LYS A C   1 
ATOM   417  O O   . LYS A 1 70  ? 7.808  35.909 40.357 1.00   37.83 ? 69   LYS A O   1 
ATOM   418  C CB  . LYS A 1 70  ? 4.810  37.351 38.801 1.00   36.33 ? 69   LYS A CB  1 
ATOM   419  C CG  . LYS A 1 70  ? 3.509  38.018 39.250 1.00   37.38 ? 69   LYS A CG  1 
ATOM   420  C CD  . LYS A 1 70  ? 2.741  38.619 38.094 1.00   39.51 ? 69   LYS A CD  1 
ATOM   421  C CE  . LYS A 1 70  ? 1.355  39.089 38.513 1.00   40.36 ? 69   LYS A CE  1 
ATOM   422  N NZ  . LYS A 1 70  ? 0.602  39.694 37.368 1.00   40.28 ? 69   LYS A NZ  1 
ATOM   423  N N   . ASP A 1 71  ? 7.097  35.956 38.242 1.00   35.88 ? 70   ASP A N   1 
ATOM   424  C CA  . ASP A 1 71  ? 8.311  35.381 37.674 1.00   35.41 ? 70   ASP A CA  1 
ATOM   425  C C   . ASP A 1 71  ? 9.362  36.393 37.159 1.00   33.44 ? 70   ASP A C   1 
ATOM   426  O O   . ASP A 1 71  ? 10.266 36.001 36.417 1.00   33.23 ? 70   ASP A O   1 
ATOM   427  C CB  . ASP A 1 71  ? 7.882  34.558 36.464 1.00   36.18 ? 70   ASP A CB  1 
ATOM   428  C CG  . ASP A 1 71  ? 7.161  35.411 35.427 1.00   39.01 ? 70   ASP A CG  1 
ATOM   429  O OD1 . ASP A 1 71  ? 6.474  36.369 35.848 1.00   44.25 ? 70   ASP A OD1 1 
ATOM   430  O OD2 . ASP A 1 71  ? 7.230  35.234 34.188 1.00   43.38 ? 70   ASP A OD2 1 
ATOM   431  N N   . THR A 1 72  ? 9.254  37.669 37.514 1.00   31.11 ? 71   THR A N   1 
ATOM   432  C CA  . THR A 1 72  ? 10.157 38.679 36.945 1.00   30.01 ? 71   THR A CA  1 
ATOM   433  C C   . THR A 1 72  ? 10.960 39.447 37.977 1.00   28.27 ? 71   THR A C   1 
ATOM   434  O O   . THR A 1 72  ? 10.485 39.718 39.063 1.00   27.76 ? 71   THR A O   1 
ATOM   435  C CB  . THR A 1 72  ? 9.361  39.681 36.129 1.00   30.08 ? 71   THR A CB  1 
ATOM   436  O OG1 . THR A 1 72  ? 8.612  38.987 35.120 1.00   30.97 ? 71   THR A OG1 1 
ATOM   437  C CG2 . THR A 1 72  ? 10.271 40.626 35.356 1.00   30.51 ? 71   THR A CG2 1 
ATOM   438  N N   . VAL A 1 73  ? 12.173 39.823 37.591 1.00   26.74 ? 72   VAL A N   1 
ATOM   439  C CA  . VAL A 1 73  ? 13.074 40.562 38.458 1.00   25.69 ? 72   VAL A CA  1 
ATOM   440  C C   . VAL A 1 73  ? 12.640 42.015 38.602 1.00   24.60 ? 72   VAL A C   1 
ATOM   441  O O   . VAL A 1 73  ? 12.108 42.615 37.661 1.00   23.11 ? 72   VAL A O   1 
ATOM   442  C CB  . VAL A 1 73  ? 14.505 40.474 37.886 1.00   26.35 ? 72   VAL A CB  1 
ATOM   443  C CG1 . VAL A 1 73  ? 15.316 41.731 38.161 1.00   27.79 ? 72   VAL A CG1 1 
ATOM   444  C CG2 . VAL A 1 73  ? 15.168 39.211 38.392 1.00   26.81 ? 72   VAL A CG2 1 
ATOM   445  N N   . ALA A 1 74  ? 12.861 42.581 39.791 1.00   24.02 ? 73   ALA A N   1 
ATOM   446  C CA  . ALA A 1 74  ? 12.562 43.980 40.050 1.00   23.17 ? 73   ALA A CA  1 
ATOM   447  C C   . ALA A 1 74  ? 13.598 44.554 40.991 1.00   22.64 ? 73   ALA A C   1 
ATOM   448  O O   . ALA A 1 74  ? 14.119 43.842 41.846 1.00   21.90 ? 73   ALA A O   1 
ATOM   449  C CB  . ALA A 1 74  ? 11.183 44.121 40.667 1.00   24.04 ? 73   ALA A CB  1 
ATOM   450  N N   . TRP A 1 75  ? 13.882 45.841 40.842 1.00   21.91 ? 74   TRP A N   1 
ATOM   451  C CA  . TRP A 1 75  ? 14.896 46.490 41.660 1.00   22.10 ? 74   TRP A CA  1 
ATOM   452  C C   . TRP A 1 75  ? 14.249 47.524 42.565 1.00   23.04 ? 74   TRP A C   1 
ATOM   453  O O   . TRP A 1 75  ? 13.315 48.196 42.161 1.00   23.71 ? 74   TRP A O   1 
ATOM   454  C CB  . TRP A 1 75  ? 15.941 47.145 40.770 1.00   21.79 ? 74   TRP A CB  1 
ATOM   455  C CG  . TRP A 1 75  ? 16.707 46.120 39.932 1.00   20.26 ? 74   TRP A CG  1 
ATOM   456  C CD1 . TRP A 1 75  ? 16.396 45.691 38.676 1.00   21.27 ? 74   TRP A CD1 1 
ATOM   457  C CD2 . TRP A 1 75  ? 17.884 45.412 40.311 1.00   19.96 ? 74   TRP A CD2 1 
ATOM   458  N NE1 . TRP A 1 75  ? 17.315 44.763 38.244 1.00   19.64 ? 74   TRP A NE1 1 
ATOM   459  C CE2 . TRP A 1 75  ? 18.240 44.568 39.232 1.00   19.52 ? 74   TRP A CE2 1 
ATOM   460  C CE3 . TRP A 1 75  ? 18.689 45.404 41.451 1.00   18.45 ? 74   TRP A CE3 1 
ATOM   461  C CZ2 . TRP A 1 75  ? 19.370 43.739 39.257 1.00   19.57 ? 74   TRP A CZ2 1 
ATOM   462  C CZ3 . TRP A 1 75  ? 19.807 44.570 41.483 1.00   17.94 ? 74   TRP A CZ3 1 
ATOM   463  C CH2 . TRP A 1 75  ? 20.142 43.755 40.387 1.00   20.70 ? 74   TRP A CH2 1 
ATOM   464  N N   . LEU A 1 76  ? 14.730 47.624 43.799 1.00   23.63 ? 75   LEU A N   1 
ATOM   465  C CA  . LEU A 1 76  ? 14.268 48.647 44.724 1.00   24.05 ? 75   LEU A CA  1 
ATOM   466  C C   . LEU A 1 76  ? 14.537 50.015 44.144 1.00   24.22 ? 75   LEU A C   1 
ATOM   467  O O   . LEU A 1 76  ? 15.630 50.294 43.665 1.00   23.65 ? 75   LEU A O   1 
ATOM   468  C CB  . LEU A 1 76  ? 15.029 48.557 46.044 1.00   24.07 ? 75   LEU A CB  1 
ATOM   469  C CG  . LEU A 1 76  ? 14.435 47.851 47.252 1.00   26.34 ? 75   LEU A CG  1 
ATOM   470  C CD1 . LEU A 1 76  ? 15.157 48.373 48.499 1.00   28.03 ? 75   LEU A CD1 1 
ATOM   471  C CD2 . LEU A 1 76  ? 12.934 48.024 47.409 1.00   26.65 ? 75   LEU A CD2 1 
ATOM   472  N N   . LYS A 1 77  ? 13.546 50.885 44.217 1.00   25.14 ? 76   LYS A N   1 
ATOM   473  C CA  . LYS A 1 77  ? 13.679 52.240 43.731 1.00   25.97 ? 76   LYS A CA  1 
ATOM   474  C C   . LYS A 1 77  ? 14.169 53.103 44.903 1.00   26.22 ? 76   LYS A C   1 
ATOM   475  O O   . LYS A 1 77  ? 13.685 52.964 46.041 1.00   26.04 ? 76   LYS A O   1 
ATOM   476  C CB  . LYS A 1 77  ? 12.345 52.724 43.161 1.00   27.02 ? 76   LYS A CB  1 
ATOM   477  C CG  . LYS A 1 77  ? 11.862 51.890 41.951 1.00   29.76 ? 76   LYS A CG  1 
ATOM   478  C CD  . LYS A 1 77  ? 11.356 50.513 42.376 1.00   31.54 ? 76   LYS A CD  1 
ATOM   479  C CE  . LYS A 1 77  ? 11.106 49.553 41.227 1.00   32.15 ? 76   LYS A CE  1 
ATOM   480  N NZ  . LYS A 1 77  ? 10.656 48.215 41.746 1.00   29.73 ? 76   LYS A NZ  1 
ATOM   481  N N   . MET A 1 78  ? 15.129 53.976 44.621 1.00   26.26 ? 77   MET A N   1 
ATOM   482  C CA  . MET A 1 78  ? 15.806 54.743 45.667 1.00   27.05 ? 77   MET A CA  1 
ATOM   483  C C   . MET A 1 78  ? 14.890 55.741 46.398 1.00   28.43 ? 77   MET A C   1 
ATOM   484  O O   . MET A 1 78  ? 14.992 55.898 47.621 1.00   27.25 ? 77   MET A O   1 
ATOM   485  C CB  . MET A 1 78  ? 17.024 55.450 45.089 1.00   26.59 ? 77   MET A CB  1 
ATOM   486  C CG  . MET A 1 78  ? 18.133 54.505 44.596 1.00   26.88 ? 77   MET A CG  1 
ATOM   487  S SD  . MET A 1 78  ? 18.889 53.521 45.918 1.00   26.38 ? 77   MET A SD  1 
ATOM   488  C CE  . MET A 1 78  ? 17.867 52.130 45.985 1.00   26.79 ? 77   MET A CE  1 
ATOM   489  N N   . ASP A 1 79  ? 13.975 56.363 45.651 1.00   29.69 ? 78   ASP A N   1 
ATOM   490  C CA  . ASP A 1 79  ? 13.091 57.398 46.196 1.00   30.90 ? 78   ASP A CA  1 
ATOM   491  C C   . ASP A 1 79  ? 11.742 56.924 46.692 1.00   30.69 ? 78   ASP A C   1 
ATOM   492  O O   . ASP A 1 79  ? 10.876 57.756 46.975 1.00   31.41 ? 78   ASP A O   1 
ATOM   493  C CB  . ASP A 1 79  ? 12.854 58.470 45.128 1.00   31.78 ? 78   ASP A CB  1 
ATOM   494  C CG  . ASP A 1 79  ? 14.129 59.127 44.687 1.00   35.25 ? 78   ASP A CG  1 
ATOM   495  O OD1 . ASP A 1 79  ? 15.140 58.400 44.542 1.00   43.00 ? 78   ASP A OD1 1 
ATOM   496  O OD2 . ASP A 1 79  ? 14.232 60.354 44.463 1.00   41.61 ? 78   ASP A OD2 1 
ATOM   497  N N   . LYS A 1 80  ? 11.548 55.617 46.812 1.00   30.07 ? 79   LYS A N   1 
ATOM   498  C CA  . LYS A 1 80  ? 10.279 55.066 47.250 1.00   30.21 ? 79   LYS A CA  1 
ATOM   499  C C   . LYS A 1 80  ? 10.448 54.290 48.553 1.00   30.03 ? 79   LYS A C   1 
ATOM   500  O O   . LYS A 1 80  ? 11.449 53.612 48.741 1.00   29.79 ? 79   LYS A O   1 
ATOM   501  C CB  . LYS A 1 80  ? 9.724  54.130 46.181 1.00   30.38 ? 79   LYS A CB  1 
ATOM   502  C CG  . LYS A 1 80  ? 8.388  53.513 46.536 1.00   31.67 ? 79   LYS A CG  1 
ATOM   503  C CD  . LYS A 1 80  ? 8.005  52.334 45.635 1.00   35.12 ? 79   LYS A CD  1 
ATOM   504  C CE  . LYS A 1 80  ? 7.394  52.764 44.333 1.00   36.26 ? 79   LYS A CE  1 
ATOM   505  N NZ  . LYS A 1 80  ? 6.798  51.585 43.617 1.00   37.86 ? 79   LYS A NZ  1 
ATOM   506  N N   . LYS A 1 81  ? 9.463  54.380 49.443 1.00   29.47 ? 80   LYS A N   1 
ATOM   507  C CA  . LYS A 1 81  ? 9.510  53.642 50.701 1.00   29.27 ? 80   LYS A CA  1 
ATOM   508  C C   . LYS A 1 81  ? 9.616  52.143 50.419 1.00   28.82 ? 80   LYS A C   1 
ATOM   509  O O   . LYS A 1 81  ? 8.921  51.627 49.555 1.00   28.18 ? 80   LYS A O   1 
ATOM   510  C CB  . LYS A 1 81  ? 8.263  53.941 51.545 1.00   29.91 ? 80   LYS A CB  1 
ATOM   511  C CG  . LYS A 1 81  ? 8.311  55.308 52.205 1.00   30.36 ? 80   LYS A CG  1 
ATOM   512  C CD  . LYS A 1 81  ? 6.923  55.836 52.582 1.00   33.39 ? 80   LYS A CD  1 
ATOM   513  C CE  . LYS A 1 81  ? 6.496  55.520 53.988 1.00   34.87 ? 80   LYS A CE  1 
ATOM   514  N NZ  . LYS A 1 81  ? 5.142  56.112 54.227 1.00   36.48 ? 80   LYS A NZ  1 
ATOM   515  N N   . VAL A 1 82  ? 10.521 51.459 51.116 1.00   28.36 ? 81   VAL A N   1 
ATOM   516  C CA  . VAL A 1 82  ? 10.665 50.016 50.979 1.00   28.46 ? 81   VAL A CA  1 
ATOM   517  C C   . VAL A 1 82  ? 9.358  49.256 51.005 1.00   28.61 ? 81   VAL A C   1 
ATOM   518  O O   . VAL A 1 82  ? 9.128  48.399 50.155 1.00   28.45 ? 81   VAL A O   1 
ATOM   519  C CB  . VAL A 1 82  ? 11.571 49.439 52.100 1.00   27.97 ? 81   VAL A CB  1 
ATOM   520  C CG1 . VAL A 1 82  ? 11.672 47.939 51.971 1.00   28.72 ? 81   VAL A CG1 1 
ATOM   521  C CG2 . VAL A 1 82  ? 12.924 50.063 52.037 1.00   26.73 ? 81   VAL A CG2 1 
ATOM   522  N N   . LEU A 1 83  ? 8.494  49.569 51.970 1.00   29.36 ? 82   LEU A N   1 
ATOM   523  C CA  . LEU A 1 83  ? 7.237  48.852 52.127 1.00   29.88 ? 82   LEU A CA  1 
ATOM   524  C C   . LEU A 1 83  ? 6.155  49.228 51.093 1.00   30.52 ? 82   LEU A C   1 
ATOM   525  O O   . LEU A 1 83  ? 5.150  48.534 50.981 1.00   31.07 ? 82   LEU A O   1 
ATOM   526  C CB  . LEU A 1 83  ? 6.707  49.033 53.553 1.00   29.87 ? 82   LEU A CB  1 
ATOM   527  C CG  . LEU A 1 83  ? 7.500  48.318 54.655 1.00   29.88 ? 82   LEU A CG  1 
ATOM   528  C CD1 . LEU A 1 83  ? 6.899  48.636 56.003 1.00   30.99 ? 82   LEU A CD1 1 
ATOM   529  C CD2 . LEU A 1 83  ? 7.523  46.830 54.461 1.00   29.97 ? 82   LEU A CD2 1 
ATOM   530  N N   . ASP A 1 84  ? 6.364  50.308 50.340 1.00   31.24 ? 83   ASP A N   1 
ATOM   531  C CA  . ASP A 1 84  ? 5.431  50.691 49.275 1.00   32.16 ? 83   ASP A CA  1 
ATOM   532  C C   . ASP A 1 84  ? 5.750  49.881 48.015 1.00   32.71 ? 83   ASP A C   1 
ATOM   533  O O   . ASP A 1 84  ? 5.022  49.928 47.018 1.00   32.49 ? 83   ASP A O   1 
ATOM   534  C CB  . ASP A 1 84  ? 5.538  52.182 48.965 1.00   32.07 ? 83   ASP A CB  1 
ATOM   535  C CG  . ASP A 1 84  ? 4.865  53.052 50.011 1.00   33.88 ? 83   ASP A CG  1 
ATOM   536  O OD1 . ASP A 1 84  ? 4.187  52.507 50.908 1.00   36.50 ? 83   ASP A OD1 1 
ATOM   537  O OD2 . ASP A 1 84  ? 4.959  54.298 50.007 1.00   35.02 ? 83   ASP A OD2 1 
ATOM   538  N N   . HIS A 1 85  ? 6.864  49.153 48.045 1.00   32.69 ? 84   HIS A N   1 
ATOM   539  C CA  . HIS A 1 85  ? 7.196  48.276 46.930 1.00   33.26 ? 84   HIS A CA  1 
ATOM   540  C C   . HIS A 1 85  ? 6.339  47.029 46.993 1.00   34.70 ? 84   HIS A C   1 
ATOM   541  O O   . HIS A 1 85  ? 5.909  46.607 48.063 1.00   34.62 ? 84   HIS A O   1 
ATOM   542  C CB  . HIS A 1 85  ? 8.669  47.875 46.949 1.00   32.45 ? 84   HIS A CB  1 
ATOM   543  C CG  . HIS A 1 85  ? 9.591  48.948 46.472 1.00   29.52 ? 84   HIS A CG  1 
ATOM   544  N ND1 . HIS A 1 85  ? 10.002 49.994 47.273 1.00   25.74 ? 84   HIS A ND1 1 
ATOM   545  C CD2 . HIS A 1 85  ? 10.195 49.128 45.276 1.00   26.96 ? 84   HIS A CD2 1 
ATOM   546  C CE1 . HIS A 1 85  ? 10.827 50.768 46.589 1.00   26.73 ? 84   HIS A CE1 1 
ATOM   547  N NE2 . HIS A 1 85  ? 10.950 50.270 45.370 1.00   26.86 ? 84   HIS A NE2 1 
ATOM   548  N N   . ASP A 1 86  ? 6.115  46.427 45.831 1.00   36.67 ? 85   ASP A N   1 
ATOM   549  C CA  . ASP A 1 86  ? 5.312  45.221 45.722 1.00   38.14 ? 85   ASP A CA  1 
ATOM   550  C C   . ASP A 1 86  ? 6.127  44.011 46.182 1.00   38.94 ? 85   ASP A C   1 
ATOM   551  O O   . ASP A 1 86  ? 6.314  43.040 45.448 1.00   38.55 ? 85   ASP A O   1 
ATOM   552  C CB  . ASP A 1 86  ? 4.847  45.062 44.269 1.00   38.65 ? 85   ASP A CB  1 
ATOM   553  C CG  . ASP A 1 86  ? 3.789  43.999 44.102 1.00   40.54 ? 85   ASP A CG  1 
ATOM   554  O OD1 . ASP A 1 86  ? 3.187  43.582 45.113 1.00   42.70 ? 85   ASP A OD1 1 
ATOM   555  O OD2 . ASP A 1 86  ? 3.486  43.523 42.982 1.00   44.71 ? 85   ASP A OD2 1 
ATOM   556  N N   . VAL A 1 87  ? 6.620  44.071 47.412 1.00   40.11 ? 86   VAL A N   1 
ATOM   557  C CA  . VAL A 1 87  ? 7.426  42.983 47.947 1.00   41.10 ? 86   VAL A CA  1 
ATOM   558  C C   . VAL A 1 87  ? 6.650  42.260 49.033 1.00   41.81 ? 86   VAL A C   1 
ATOM   559  O O   . VAL A 1 87  ? 5.882  42.881 49.755 1.00   41.70 ? 86   VAL A O   1 
ATOM   560  C CB  . VAL A 1 87  ? 8.768  43.501 48.519 1.00   40.96 ? 86   VAL A CB  1 
ATOM   561  C CG1 . VAL A 1 87  ? 8.529  44.434 49.707 1.00   41.13 ? 86   VAL A CG1 1 
ATOM   562  C CG2 . VAL A 1 87  ? 9.671  42.343 48.911 1.00   41.86 ? 86   VAL A CG2 1 
ATOM   563  N N   . SER A 1 88  ? 6.848  40.951 49.146 1.00   43.09 ? 87   SER A N   1 
ATOM   564  C CA  . SER A 1 88  ? 6.184  40.180 50.191 1.00   44.05 ? 87   SER A CA  1 
ATOM   565  C C   . SER A 1 88  ? 6.558  40.784 51.541 1.00   44.73 ? 87   SER A C   1 
ATOM   566  O O   . SER A 1 88  ? 7.726  41.107 51.782 1.00   44.83 ? 87   SER A O   1 
ATOM   567  C CB  . SER A 1 88  ? 6.612  38.714 50.134 1.00   44.32 ? 87   SER A CB  1 
ATOM   568  O OG  . SER A 1 88  ? 6.088  37.989 51.234 1.00   45.21 ? 87   SER A OG  1 
ATOM   569  N N   . LYS A 1 89  ? 5.568  40.930 52.416 1.00   45.17 ? 88   LYS A N   1 
ATOM   570  C CA  . LYS A 1 89  ? 5.765  41.538 53.732 1.00   45.48 ? 88   LYS A CA  1 
ATOM   571  C C   . LYS A 1 89  ? 6.010  40.520 54.851 1.00   45.44 ? 88   LYS A C   1 
ATOM   572  O O   . LYS A 1 89  ? 6.176  40.886 56.013 1.00   45.60 ? 88   LYS A O   1 
ATOM   573  C CB  . LYS A 1 89  ? 4.563  42.413 54.075 1.00   45.72 ? 88   LYS A CB  1 
ATOM   574  C CG  . LYS A 1 89  ? 4.661  43.846 53.556 1.00   46.79 ? 88   LYS A CG  1 
ATOM   575  C CD  . LYS A 1 89  ? 5.086  43.904 52.104 1.00   47.85 ? 88   LYS A CD  1 
ATOM   576  C CE  . LYS A 1 89  ? 5.281  45.337 51.625 1.00   48.11 ? 88   LYS A CE  1 
ATOM   577  N NZ  . LYS A 1 89  ? 4.086  46.183 51.873 1.00   48.58 ? 88   LYS A NZ  1 
ATOM   578  N N   . GLU A 1 90  ? 6.030  39.244 54.497 1.00   45.48 ? 89   GLU A N   1 
ATOM   579  C CA  . GLU A 1 90  ? 6.336  38.193 55.453 1.00   45.40 ? 89   GLU A CA  1 
ATOM   580  C C   . GLU A 1 90  ? 7.775  38.425 55.931 1.00   44.54 ? 89   GLU A C   1 
ATOM   581  O O   . GLU A 1 90  ? 8.712  38.269 55.143 1.00   44.48 ? 89   GLU A O   1 
ATOM   582  C CB  . GLU A 1 90  ? 6.196  36.829 54.762 1.00   46.04 ? 89   GLU A CB  1 
ATOM   583  C CG  . GLU A 1 90  ? 6.421  35.603 55.637 1.00   47.99 ? 89   GLU A CG  1 
ATOM   584  C CD  . GLU A 1 90  ? 5.183  35.197 56.412 1.00   50.62 ? 89   GLU A CD  1 
ATOM   585  O OE1 . GLU A 1 90  ? 4.624  36.061 57.120 1.00   52.67 ? 89   GLU A OE1 1 
ATOM   586  O OE2 . GLU A 1 90  ? 4.775  34.013 56.321 1.00   52.37 ? 89   GLU A OE2 1 
ATOM   587  N N   . GLU A 1 91  ? 7.947  38.830 57.196 1.00   43.20 ? 90   GLU A N   1 
ATOM   588  C CA  . GLU A 1 91  ? 9.286  39.049 57.768 1.00   41.75 ? 90   GLU A CA  1 
ATOM   589  C C   . GLU A 1 91  ? 10.049 37.717 57.790 1.00   40.01 ? 90   GLU A C   1 
ATOM   590  O O   . GLU A 1 91  ? 9.475  36.682 58.123 1.00   41.21 ? 90   GLU A O   1 
ATOM   591  C CB  . GLU A 1 91  ? 9.211  39.656 59.191 1.00   41.86 ? 90   GLU A CB  1 
ATOM   592  C CG  . GLU A 1 91  ? 9.528  41.150 59.278 1.00   41.44 ? 90   GLU A CG  1 
ATOM   593  C CD  . GLU A 1 91  ? 9.286  41.758 60.667 1.00   41.22 ? 90   GLU A CD  1 
ATOM   594  O OE1 . GLU A 1 91  ? 8.112  41.765 61.125 1.00   43.64 ? 90   GLU A OE1 1 
ATOM   595  O OE2 . GLU A 1 91  ? 10.252 42.247 61.308 1.00   35.54 ? 90   GLU A OE2 1 
ATOM   596  N N   . PRO A 1 92  ? 11.328 37.722 57.415 1.00   36.97 ? 91   PRO A N   1 
ATOM   597  C CA  . PRO A 1 92  ? 12.028 38.923 56.981 1.00   34.84 ? 91   PRO A CA  1 
ATOM   598  C C   . PRO A 1 92  ? 11.765 39.263 55.523 1.00   32.64 ? 91   PRO A C   1 
ATOM   599  O O   . PRO A 1 92  ? 11.765 38.398 54.648 1.00   31.48 ? 91   PRO A O   1 
ATOM   600  C CB  . PRO A 1 92  ? 13.488 38.521 57.168 1.00   35.04 ? 91   PRO A CB  1 
ATOM   601  C CG  . PRO A 1 92  ? 13.475 37.105 56.741 1.00   36.40 ? 91   PRO A CG  1 
ATOM   602  C CD  . PRO A 1 92  ? 12.229 36.558 57.412 1.00   37.05 ? 91   PRO A CD  1 
ATOM   603  N N   . VAL A 1 93  ? 11.537 40.544 55.289 1.00   30.44 ? 92   VAL A N   1 
ATOM   604  C CA  . VAL A 1 93  ? 11.412 41.072 53.946 1.00   28.63 ? 92   VAL A CA  1 
ATOM   605  C C   . VAL A 1 93  ? 12.811 40.890 53.361 1.00   27.04 ? 92   VAL A C   1 
ATOM   606  O O   . VAL A 1 93  ? 13.805 41.339 53.955 1.00   26.17 ? 92   VAL A O   1 
ATOM   607  C CB  . VAL A 1 93  ? 11.020 42.538 54.002 1.00   28.65 ? 92   VAL A CB  1 
ATOM   608  C CG1 . VAL A 1 93  ? 11.051 43.182 52.599 1.00   29.57 ? 92   VAL A CG1 1 
ATOM   609  C CG2 . VAL A 1 93  ? 9.644  42.686 54.631 1.00   29.07 ? 92   VAL A CG2 1 
ATOM   610  N N   . THR A 1 94  ? 12.899 40.230 52.211 1.00   24.66 ? 93   THR A N   1 
ATOM   611  C CA  . THR A 1 94  ? 14.199 39.839 51.675 1.00   23.47 ? 93   THR A CA  1 
ATOM   612  C C   . THR A 1 94  ? 14.557 40.494 50.343 1.00   21.98 ? 93   THR A C   1 
ATOM   613  O O   . THR A 1 94  ? 13.719 40.595 49.443 1.00   21.30 ? 93   THR A O   1 
ATOM   614  C CB  . THR A 1 94  ? 14.173 38.318 51.521 1.00   23.78 ? 93   THR A CB  1 
ATOM   615  O OG1 . THR A 1 94  ? 13.975 37.702 52.818 1.00   24.60 ? 93   THR A OG1 1 
ATOM   616  C CG2 . THR A 1 94  ? 15.499 37.773 50.999 1.00   24.20 ? 93   THR A CG2 1 
ATOM   617  N N   . PHE A 1 95  ? 15.795 40.955 50.237 1.00   19.66 ? 94   PHE A N   1 
ATOM   618  C CA  . PHE A 1 95  ? 16.311 41.520 48.998 1.00   19.32 ? 94   PHE A CA  1 
ATOM   619  C C   . PHE A 1 95  ? 17.647 40.866 48.701 1.00   18.98 ? 94   PHE A C   1 
ATOM   620  O O   . PHE A 1 95  ? 18.378 40.483 49.615 1.00   18.67 ? 94   PHE A O   1 
ATOM   621  C CB  . PHE A 1 95  ? 16.521 43.034 49.106 1.00   19.08 ? 94   PHE A CB  1 
ATOM   622  C CG  . PHE A 1 95  ? 15.241 43.808 49.375 1.00   21.21 ? 94   PHE A CG  1 
ATOM   623  C CD1 . PHE A 1 95  ? 14.356 44.122 48.357 1.00   22.85 ? 94   PHE A CD1 1 
ATOM   624  C CD2 . PHE A 1 95  ? 14.968 44.243 50.647 1.00   22.04 ? 94   PHE A CD2 1 
ATOM   625  C CE1 . PHE A 1 95  ? 13.188 44.829 48.622 1.00   24.44 ? 94   PHE A CE1 1 
ATOM   626  C CE2 . PHE A 1 95  ? 13.831 44.941 50.908 1.00   22.36 ? 94   PHE A CE2 1 
ATOM   627  C CZ  . PHE A 1 95  ? 12.949 45.247 49.901 1.00   22.85 ? 94   PHE A CZ  1 
ATOM   628  N N   . HIS A 1 96  ? 17.962 40.732 47.421 1.00   18.57 ? 95   HIS A N   1 
ATOM   629  C CA  . HIS A 1 96  ? 19.255 40.209 47.021 1.00   18.32 ? 95   HIS A CA  1 
ATOM   630  C C   . HIS A 1 96  ? 20.116 41.373 46.566 1.00   17.50 ? 95   HIS A C   1 
ATOM   631  O O   . HIS A 1 96  ? 19.745 42.089 45.658 1.00   17.38 ? 95   HIS A O   1 
ATOM   632  C CB  . HIS A 1 96  ? 19.084 39.176 45.900 1.00   18.85 ? 95   HIS A CB  1 
ATOM   633  C CG  . HIS A 1 96  ? 18.543 37.862 46.380 1.00   20.95 ? 95   HIS A CG  1 
ATOM   634  N ND1 . HIS A 1 96  ? 17.281 37.729 46.922 1.00   25.41 ? 95   HIS A ND1 1 
ATOM   635  C CD2 . HIS A 1 96  ? 19.102 36.630 46.427 1.00   22.13 ? 95   HIS A CD2 1 
ATOM   636  C CE1 . HIS A 1 96  ? 17.086 36.469 47.273 1.00   24.31 ? 95   HIS A CE1 1 
ATOM   637  N NE2 . HIS A 1 96  ? 18.168 35.779 46.968 1.00   24.51 ? 95   HIS A NE2 1 
ATOM   638  N N   . PHE A 1 97  ? 21.278 41.559 47.188 1.00   16.83 ? 96   PHE A N   1 
ATOM   639  C CA  . PHE A 1 97  ? 22.210 42.623 46.791 1.00   16.52 ? 96   PHE A CA  1 
ATOM   640  C C   . PHE A 1 97  ? 23.042 42.056 45.643 1.00   16.11 ? 96   PHE A C   1 
ATOM   641  O O   . PHE A 1 97  ? 23.763 41.084 45.814 1.00   16.29 ? 96   PHE A O   1 
ATOM   642  C CB  . PHE A 1 97  ? 23.111 43.036 47.975 1.00   16.90 ? 96   PHE A CB  1 
ATOM   643  C CG  . PHE A 1 97  ? 24.032 44.199 47.685 1.00   16.63 ? 96   PHE A CG  1 
ATOM   644  C CD1 . PHE A 1 97  ? 23.597 45.504 47.838 1.00   17.10 ? 96   PHE A CD1 1 
ATOM   645  C CD2 . PHE A 1 97  ? 25.338 43.982 47.303 1.00   15.87 ? 96   PHE A CD2 1 
ATOM   646  C CE1 . PHE A 1 97  ? 24.450 46.565 47.583 1.00   18.52 ? 96   PHE A CE1 1 
ATOM   647  C CE2 . PHE A 1 97  ? 26.188 45.028 47.063 1.00   18.11 ? 96   PHE A CE2 1 
ATOM   648  C CZ  . PHE A 1 97  ? 25.748 46.324 47.196 1.00   18.29 ? 96   PHE A CZ  1 
ATOM   649  N N   . LEU A 1 98  ? 22.944 42.693 44.486 1.00   15.25 ? 97   LEU A N   1 
ATOM   650  C CA  . LEU A 1 98  ? 23.515 42.174 43.268 1.00   15.70 ? 97   LEU A CA  1 
ATOM   651  C C   . LEU A 1 98  ? 23.941 43.306 42.372 1.00   15.56 ? 97   LEU A C   1 
ATOM   652  O O   . LEU A 1 98  ? 23.417 44.432 42.468 1.00   15.79 ? 97   LEU A O   1 
ATOM   653  C CB  . LEU A 1 98  ? 22.450 41.365 42.525 1.00   15.97 ? 97   LEU A CB  1 
ATOM   654  C CG  . LEU A 1 98  ? 22.015 40.013 43.067 1.00   17.63 ? 97   LEU A CG  1 
ATOM   655  C CD1 . LEU A 1 98  ? 20.752 39.533 42.330 1.00   18.86 ? 97   LEU A CD1 1 
ATOM   656  C CD2 . LEU A 1 98  ? 23.126 39.010 42.945 1.00   19.85 ? 97   LEU A CD2 1 
ATOM   657  N N   . ALA A 1 99  ? 24.884 43.025 41.478 1.00   14.94 ? 98   ALA A N   1 
ATOM   658  C CA  . ALA A 1 99  ? 25.233 43.976 40.460 1.00   14.72 ? 98   ALA A CA  1 
ATOM   659  C C   . ALA A 1 99  ? 24.087 43.988 39.455 1.00   15.36 ? 98   ALA A C   1 
ATOM   660  O O   . ALA A 1 99  ? 23.669 42.924 38.994 1.00   15.34 ? 98   ALA A O   1 
ATOM   661  C CB  . ALA A 1 99  ? 26.510 43.545 39.743 1.00   14.95 ? 98   ALA A CB  1 
ATOM   662  N N   . LYS A 1 100 ? 23.591 45.185 39.145 1.00   15.17 ? 99   LYS A N   1 
ATOM   663  C CA  . LYS A 1 100 ? 22.558 45.438 38.134 1.00   16.25 ? 99   LYS A CA  1 
ATOM   664  C C   . LYS A 1 100 ? 23.195 45.886 36.813 1.00   15.52 ? 99   LYS A C   1 
ATOM   665  O O   . LYS A 1 100 ? 22.617 45.709 35.748 1.00   14.99 ? 99   LYS A O   1 
ATOM   666  C CB  . LYS A 1 100 ? 21.618 46.537 38.649 1.00   16.81 ? 99   LYS A CB  1 
ATOM   667  C CG  . LYS A 1 100 ? 20.514 46.975 37.713 1.00   18.53 ? 99   LYS A CG  1 
ATOM   668  C CD  . LYS A 1 100 ? 19.762 48.148 38.349 1.00   23.19 ? 99   LYS A CD  1 
ATOM   669  C CE  . LYS A 1 100 ? 18.538 48.543 37.573 1.00   26.03 ? 99   LYS A CE  1 
ATOM   670  N NZ  . LYS A 1 100 ? 17.830 49.668 38.273 1.00   29.59 ? 99   LYS A NZ  1 
ATOM   671  N N   . PHE A 1 101 ? 24.392 46.462 36.908 1.00   14.79 ? 100  PHE A N   1 
ATOM   672  C CA  . PHE A 1 101 ? 25.137 46.953 35.759 1.00   15.26 ? 100  PHE A CA  1 
ATOM   673  C C   . PHE A 1 101 ? 26.541 46.397 35.821 1.00   14.85 ? 100  PHE A C   1 
ATOM   674  O O   . PHE A 1 101 ? 27.036 46.148 36.898 1.00   14.93 ? 100  PHE A O   1 
ATOM   675  C CB  . PHE A 1 101 ? 25.196 48.497 35.747 1.00   14.89 ? 100  PHE A CB  1 
ATOM   676  C CG  . PHE A 1 101 ? 23.843 49.131 35.747 1.00   15.36 ? 100  PHE A CG  1 
ATOM   677  C CD1 . PHE A 1 101 ? 23.039 49.054 34.622 1.00   14.28 ? 100  PHE A CD1 1 
ATOM   678  C CD2 . PHE A 1 101 ? 23.347 49.751 36.888 1.00   16.96 ? 100  PHE A CD2 1 
ATOM   679  C CE1 . PHE A 1 101 ? 21.779 49.599 34.607 1.00   16.24 ? 100  PHE A CE1 1 
ATOM   680  C CE2 . PHE A 1 101 ? 22.065 50.296 36.884 1.00   18.50 ? 100  PHE A CE2 1 
ATOM   681  C CZ  . PHE A 1 101 ? 21.290 50.229 35.752 1.00   17.12 ? 100  PHE A CZ  1 
ATOM   682  N N   . TYR A 1 102 ? 27.158 46.185 34.665 1.00   14.73 ? 101  TYR A N   1 
ATOM   683  C CA  . TYR A 1 102 ? 28.508 45.626 34.570 1.00   15.32 ? 101  TYR A CA  1 
ATOM   684  C C   . TYR A 1 102 ? 29.450 46.644 33.947 1.00   15.42 ? 101  TYR A C   1 
ATOM   685  O O   . TYR A 1 102 ? 29.070 47.391 33.056 1.00   14.78 ? 101  TYR A O   1 
ATOM   686  C CB  . TYR A 1 102 ? 28.538 44.381 33.671 1.00   15.43 ? 101  TYR A CB  1 
ATOM   687  C CG  . TYR A 1 102 ? 27.680 43.278 34.226 1.00   15.53 ? 101  TYR A CG  1 
ATOM   688  C CD1 . TYR A 1 102 ? 26.301 43.351 34.154 1.00   15.75 ? 101  TYR A CD1 1 
ATOM   689  C CD2 . TYR A 1 102 ? 28.245 42.217 34.883 1.00   16.41 ? 101  TYR A CD2 1 
ATOM   690  C CE1 . TYR A 1 102 ? 25.503 42.371 34.722 1.00   16.27 ? 101  TYR A CE1 1 
ATOM   691  C CE2 . TYR A 1 102 ? 27.476 41.253 35.451 1.00   16.98 ? 101  TYR A CE2 1 
ATOM   692  C CZ  . TYR A 1 102 ? 26.108 41.331 35.363 1.00   16.65 ? 101  TYR A CZ  1 
ATOM   693  O OH  . TYR A 1 102 ? 25.354 40.350 35.929 1.00   18.46 ? 101  TYR A OH  1 
ATOM   694  N N   . PRO A 1 103 ? 30.697 46.659 34.385 1.00   15.67 ? 102  PRO A N   1 
ATOM   695  C CA  . PRO A 1 103 ? 31.653 47.585 33.799 1.00   16.44 ? 102  PRO A CA  1 
ATOM   696  C C   . PRO A 1 103 ? 32.001 47.176 32.373 1.00   16.76 ? 102  PRO A C   1 
ATOM   697  O O   . PRO A 1 103 ? 31.808 46.008 31.959 1.00   16.19 ? 102  PRO A O   1 
ATOM   698  C CB  . PRO A 1 103 ? 32.870 47.434 34.702 1.00   16.96 ? 102  PRO A CB  1 
ATOM   699  C CG  . PRO A 1 103 ? 32.738 46.108 35.293 1.00   16.20 ? 102  PRO A CG  1 
ATOM   700  C CD  . PRO A 1 103 ? 31.307 45.806 35.416 1.00   16.33 ? 102  PRO A CD  1 
ATOM   701  N N   . GLU A 1 104 ? 32.507 48.122 31.606 1.00   17.03 ? 103  GLU A N   1 
ATOM   702  C CA  . GLU A 1 104 ? 32.972 47.817 30.257 1.00   17.81 ? 103  GLU A CA  1 
ATOM   703  C C   . GLU A 1 104 ? 34.338 47.129 30.320 1.00   18.99 ? 103  GLU A C   1 
ATOM   704  O O   . GLU A 1 104 ? 34.661 46.319 29.453 1.00   19.66 ? 103  GLU A O   1 
ATOM   705  C CB  . GLU A 1 104 ? 33.028 49.100 29.416 1.00   17.93 ? 103  GLU A CB  1 
ATOM   706  C CG  . GLU A 1 104 ? 31.662 49.670 29.077 1.00   18.97 ? 103  GLU A CG  1 
ATOM   707  C CD  . GLU A 1 104 ? 31.742 50.922 28.219 1.00   20.16 ? 103  GLU A CD  1 
ATOM   708  O OE1 . GLU A 1 104 ? 32.557 50.922 27.288 1.00   20.30 ? 103  GLU A OE1 1 
ATOM   709  O OE2 . GLU A 1 104 ? 30.990 51.882 28.488 1.00   21.29 ? 103  GLU A OE2 1 
ATOM   710  N N   . ASN A 1 105 ? 35.113 47.441 31.362 1.00   19.20 ? 104  ASN A N   1 
ATOM   711  C CA  . ASN A 1 105 ? 36.465 46.935 31.567 1.00   20.39 ? 104  ASN A CA  1 
ATOM   712  C C   . ASN A 1 105 ? 36.665 46.671 33.053 1.00   19.69 ? 104  ASN A C   1 
ATOM   713  O O   . ASN A 1 105 ? 36.885 47.586 33.842 1.00   19.59 ? 104  ASN A O   1 
ATOM   714  C CB  . ASN A 1 105 ? 37.515 47.940 31.053 1.00   21.61 ? 104  ASN A CB  1 
ATOM   715  C CG  . ASN A 1 105 ? 38.944 47.420 31.182 1.00   23.15 ? 104  ASN A CG  1 
ATOM   716  O OD1 . ASN A 1 105 ? 39.313 46.818 32.189 1.00   23.72 ? 104  ASN A OD1 1 
ATOM   717  N ND2 . ASN A 1 105 ? 39.778 47.706 30.169 1.00   26.55 ? 104  ASN A ND2 1 
ATOM   718  N N   . ALA A 1 106 ? 36.531 45.415 33.451 1.00   18.34 ? 105  ALA A N   1 
ATOM   719  C CA  . ALA A 1 106 ? 36.547 45.079 34.861 1.00   18.54 ? 105  ALA A CA  1 
ATOM   720  C C   . ALA A 1 106 ? 37.856 45.447 35.555 1.00   18.80 ? 105  ALA A C   1 
ATOM   721  O O   . ALA A 1 106 ? 37.848 46.005 36.655 1.00   18.15 ? 105  ALA A O   1 
ATOM   722  C CB  . ALA A 1 106 ? 36.226 43.573 35.048 1.00   18.65 ? 105  ALA A CB  1 
ATOM   723  N N   . GLU A 1 107 ? 38.983 45.147 34.932 1.00   20.10 ? 106  GLU A N   1 
ATOM   724  C CA  . GLU A 1 107 ? 40.273 45.408 35.584 1.00   22.16 ? 106  GLU A CA  1 
ATOM   725  C C   . GLU A 1 107 ? 40.456 46.910 35.844 1.00   22.85 ? 106  GLU A C   1 
ATOM   726  O O   . GLU A 1 107 ? 41.001 47.298 36.873 1.00   24.11 ? 106  GLU A O   1 
ATOM   727  C CB  . GLU A 1 107 ? 41.450 44.851 34.785 1.00   22.61 ? 106  GLU A CB  1 
ATOM   728  C CG  . GLU A 1 107 ? 42.751 44.847 35.585 1.00   25.69 ? 106  GLU A CG  1 
ATOM   729  C CD  . GLU A 1 107 ? 43.860 44.026 34.951 1.00   28.31 ? 106  GLU A CD  1 
ATOM   730  O OE1 . GLU A 1 107 ? 43.861 43.872 33.717 1.00   31.64 ? 106  GLU A OE1 1 
ATOM   731  O OE2 . GLU A 1 107 ? 44.738 43.558 35.697 1.00   32.73 ? 106  GLU A OE2 1 
ATOM   732  N N   . GLU A 1 108 ? 39.962 47.739 34.947 1.00   23.93 ? 107  GLU A N   1 
ATOM   733  C CA  . GLU A 1 108 ? 40.066 49.195 35.124 1.00   25.35 ? 107  GLU A CA  1 
ATOM   734  C C   . GLU A 1 108 ? 39.040 49.792 36.098 1.00   24.44 ? 107  GLU A C   1 
ATOM   735  O O   . GLU A 1 108 ? 39.359 50.695 36.883 1.00   24.39 ? 107  GLU A O   1 
ATOM   736  C CB  . GLU A 1 108 ? 39.923 49.886 33.782 1.00   26.25 ? 107  GLU A CB  1 
ATOM   737  C CG  . GLU A 1 108 ? 40.897 49.397 32.738 1.00   30.96 ? 107  GLU A CG  1 
ATOM   738  C CD  . GLU A 1 108 ? 41.629 50.516 32.056 1.00   36.79 ? 107  GLU A CD  1 
ATOM   739  O OE1 . GLU A 1 108 ? 40.955 51.434 31.531 1.00   42.47 ? 107  GLU A OE1 1 
ATOM   740  O OE2 . GLU A 1 108 ? 42.878 50.467 32.046 1.00   40.78 ? 107  GLU A OE2 1 
ATOM   741  N N   . GLU A 1 109 ? 37.808 49.307 36.040 1.00   23.30 ? 108  GLU A N   1 
ATOM   742  C CA  . GLU A 1 109 ? 36.718 49.913 36.794 1.00   22.40 ? 108  GLU A CA  1 
ATOM   743  C C   . GLU A 1 109 ? 36.432 49.366 38.190 1.00   22.24 ? 108  GLU A C   1 
ATOM   744  O O   . GLU A 1 109 ? 35.871 50.083 39.023 1.00   22.55 ? 108  GLU A O   1 
ATOM   745  C CB  . GLU A 1 109 ? 35.434 49.865 35.954 1.00   22.05 ? 108  GLU A CB  1 
ATOM   746  C CG  . GLU A 1 109 ? 35.540 50.530 34.598 1.00   20.48 ? 108  GLU A CG  1 
ATOM   747  C CD  . GLU A 1 109 ? 34.242 50.469 33.822 1.00   19.76 ? 108  GLU A CD  1 
ATOM   748  O OE1 . GLU A 1 109 ? 33.205 50.897 34.378 1.00   20.90 ? 108  GLU A OE1 1 
ATOM   749  O OE2 . GLU A 1 109 ? 34.242 49.957 32.679 1.00   19.53 ? 108  GLU A OE2 1 
ATOM   750  N N   . LEU A 1 110 ? 36.790 48.117 38.464 1.00   21.40 ? 109  LEU A N   1 
ATOM   751  C CA  . LEU A 1 110 ? 36.487 47.524 39.761 1.00   21.90 ? 109  LEU A CA  1 
ATOM   752  C C   . LEU A 1 110 ? 37.732 47.651 40.628 1.00   22.45 ? 109  LEU A C   1 
ATOM   753  O O   . LEU A 1 110 ? 38.565 46.750 40.656 1.00   23.72 ? 109  LEU A O   1 
ATOM   754  C CB  . LEU A 1 110 ? 36.051 46.066 39.608 1.00   21.10 ? 109  LEU A CB  1 
ATOM   755  C CG  . LEU A 1 110 ? 34.892 45.813 38.606 1.00   20.31 ? 109  LEU A CG  1 
ATOM   756  C CD1 . LEU A 1 110 ? 34.531 44.364 38.677 1.00   21.14 ? 109  LEU A CD1 1 
ATOM   757  C CD2 . LEU A 1 110 ? 33.649 46.691 38.827 1.00   22.37 ? 109  LEU A CD2 1 
ATOM   758  N N   . VAL A 1 111 ? 37.834 48.770 41.336 1.00   23.06 ? 110  VAL A N   1 
ATOM   759  C CA  . VAL A 1 111 ? 39.045 49.115 42.074 1.00   23.59 ? 110  VAL A CA  1 
ATOM   760  C C   . VAL A 1 111 ? 39.113 48.526 43.473 1.00   22.96 ? 110  VAL A C   1 
ATOM   761  O O   . VAL A 1 111 ? 40.175 48.077 43.897 1.00   23.76 ? 110  VAL A O   1 
ATOM   762  C CB  . VAL A 1 111 ? 39.205 50.653 42.142 1.00   24.41 ? 110  VAL A CB  1 
ATOM   763  C CG1 . VAL A 1 111 ? 40.386 51.041 43.004 1.00   25.72 ? 110  VAL A CG1 1 
ATOM   764  C CG2 . VAL A 1 111 ? 39.374 51.211 40.752 1.00   25.23 ? 110  VAL A CG2 1 
ATOM   765  N N   . GLN A 1 112 ? 37.996 48.507 44.188 1.00   21.56 ? 111  GLN A N   1 
ATOM   766  C CA  . GLN A 1 112 ? 37.979 47.975 45.540 1.00   21.24 ? 111  GLN A CA  1 
ATOM   767  C C   . GLN A 1 112 ? 37.956 46.454 45.523 1.00   20.94 ? 111  GLN A C   1 
ATOM   768  O O   . GLN A 1 112 ? 37.317 45.870 44.654 1.00   19.83 ? 111  GLN A O   1 
ATOM   769  C CB  . GLN A 1 112 ? 36.721 48.421 46.294 1.00   21.08 ? 111  GLN A CB  1 
ATOM   770  C CG  . GLN A 1 112 ? 36.556 49.905 46.474 1.00   21.56 ? 111  GLN A CG  1 
ATOM   771  C CD  . GLN A 1 112 ? 35.432 50.210 47.410 1.00   21.07 ? 111  GLN A CD  1 
ATOM   772  O OE1 . GLN A 1 112 ? 34.308 50.394 46.975 1.00   21.00 ? 111  GLN A OE1 1 
ATOM   773  N NE2 . GLN A 1 112 ? 35.721 50.230 48.704 1.00   21.19 ? 111  GLN A NE2 1 
ATOM   774  N N   . GLU A 1 113 ? 38.613 45.826 46.506 1.00   20.58 ? 112  GLU A N   1 
ATOM   775  C CA  . GLU A 1 113 ? 38.569 44.369 46.647 1.00   20.97 ? 112  GLU A CA  1 
ATOM   776  C C   . GLU A 1 113 ? 37.135 43.857 46.829 1.00   20.29 ? 112  GLU A C   1 
ATOM   777  O O   . GLU A 1 113 ? 36.734 42.878 46.187 1.00   19.86 ? 112  GLU A O   1 
ATOM   778  C CB  . GLU A 1 113 ? 39.447 43.922 47.818 1.00   21.69 ? 112  GLU A CB  1 
ATOM   779  C CG  . GLU A 1 113 ? 39.376 42.440 48.123 1.00   24.86 ? 112  GLU A CG  1 
ATOM   780  C CD  . GLU A 1 113 ? 40.676 41.921 48.710 1.00   30.85 ? 112  GLU A CD  1 
ATOM   781  O OE1 . GLU A 1 113 ? 41.681 42.674 48.713 1.00   35.37 ? 112  GLU A OE1 1 
ATOM   782  O OE2 . GLU A 1 113 ? 40.725 40.756 49.158 1.00   33.52 ? 112  GLU A OE2 1 
ATOM   783  N N   . ILE A 1 114 ? 36.337 44.520 47.672 1.00   18.90 ? 113  ILE A N   1 
ATOM   784  C CA  . ILE A 1 114 ? 34.961 44.061 47.862 1.00   18.32 ? 113  ILE A CA  1 
ATOM   785  C C   . ILE A 1 114 ? 34.173 44.026 46.550 1.00   17.13 ? 113  ILE A C   1 
ATOM   786  O O   . ILE A 1 114 ? 33.440 43.070 46.276 1.00   16.51 ? 113  ILE A O   1 
ATOM   787  C CB  . ILE A 1 114 ? 34.215 44.918 48.941 1.00   18.63 ? 113  ILE A CB  1 
ATOM   788  C CG1 . ILE A 1 114 ? 32.832 44.336 49.198 1.00   18.30 ? 113  ILE A CG1 1 
ATOM   789  C CG2 . ILE A 1 114 ? 34.117 46.409 48.544 1.00   18.96 ? 113  ILE A CG2 1 
ATOM   790  C CD1 . ILE A 1 114 ? 32.864 42.919 49.747 1.00   20.53 ? 113  ILE A CD1 1 
ATOM   791  N N   . THR A 1 115 ? 34.326 45.053 45.733 1.00   16.81 ? 114  THR A N   1 
ATOM   792  C CA  . THR A 1 115 ? 33.579 45.146 44.477 1.00   17.48 ? 114  THR A CA  1 
ATOM   793  C C   . THR A 1 115 ? 33.992 44.021 43.529 1.00   17.21 ? 114  THR A C   1 
ATOM   794  O O   . THR A 1 115 ? 33.138 43.366 42.924 1.00   17.10 ? 114  THR A O   1 
ATOM   795  C CB  . THR A 1 115 ? 33.886 46.465 43.799 1.00   17.59 ? 114  THR A CB  1 
ATOM   796  O OG1 . THR A 1 115 ? 33.591 47.526 44.708 1.00   20.83 ? 114  THR A OG1 1 
ATOM   797  C CG2 . THR A 1 115 ? 32.979 46.691 42.574 1.00   18.32 ? 114  THR A CG2 1 
ATOM   798  N N   . GLN A 1 116 ? 35.297 43.799 43.431 1.00   16.72 ? 115  GLN A N   1 
ATOM   799  C CA  . GLN A 1 116 ? 35.826 42.748 42.571 1.00   16.41 ? 115  GLN A CA  1 
ATOM   800  C C   . GLN A 1 116 ? 35.300 41.403 43.024 1.00   16.23 ? 115  GLN A C   1 
ATOM   801  O O   . GLN A 1 116 ? 34.905 40.544 42.215 1.00   14.78 ? 115  GLN A O   1 
ATOM   802  C CB  . GLN A 1 116 ? 37.361 42.715 42.641 1.00   17.29 ? 115  GLN A CB  1 
ATOM   803  C CG  . GLN A 1 116 ? 38.043 43.968 42.178 1.00   20.00 ? 115  GLN A CG  1 
ATOM   804  C CD  . GLN A 1 116 ? 39.535 43.936 42.448 1.00   23.40 ? 115  GLN A CD  1 
ATOM   805  O OE1 . GLN A 1 116 ? 40.090 42.882 42.775 1.00   28.61 ? 115  GLN A OE1 1 
ATOM   806  N NE2 . GLN A 1 116 ? 40.189 45.077 42.295 1.00   24.98 ? 115  GLN A NE2 1 
ATOM   807  N N   . HIS A 1 117 ? 35.331 41.209 44.329 1.00   15.92 ? 116  HIS A N   1 
ATOM   808  C CA  . HIS A 1 117 ? 34.902 39.963 44.922 1.00   15.99 ? 116  HIS A CA  1 
ATOM   809  C C   . HIS A 1 117 ? 33.427 39.666 44.667 1.00   15.51 ? 116  HIS A C   1 
ATOM   810  O O   . HIS A 1 117 ? 33.064 38.533 44.340 1.00   14.97 ? 116  HIS A O   1 
ATOM   811  C CB  . HIS A 1 117 ? 35.157 39.987 46.425 1.00   16.46 ? 116  HIS A CB  1 
ATOM   812  C CG  . HIS A 1 117 ? 34.818 38.709 47.110 1.00   17.90 ? 116  HIS A CG  1 
ATOM   813  N ND1 . HIS A 1 117 ? 35.438 37.517 46.807 1.00   19.21 ? 116  HIS A ND1 1 
ATOM   814  C CD2 . HIS A 1 117 ? 33.920 38.432 48.081 1.00   20.19 ? 116  HIS A CD2 1 
ATOM   815  C CE1 . HIS A 1 117 ? 34.937 36.562 47.565 1.00   20.15 ? 116  HIS A CE1 1 
ATOM   816  N NE2 . HIS A 1 117 ? 34.019 37.092 48.351 1.00   20.49 ? 116  HIS A NE2 1 
ATOM   817  N N   . LEU A 1 118 ? 32.567 40.661 44.841 1.00   15.68 ? 117  LEU A N   1 
ATOM   818  C CA  . LEU A 1 118 ? 31.148 40.444 44.625 1.00   15.39 ? 117  LEU A CA  1 
ATOM   819  C C   . LEU A 1 118 ? 30.841 40.176 43.151 1.00   14.93 ? 117  LEU A C   1 
ATOM   820  O O   . LEU A 1 118 ? 29.978 39.356 42.845 1.00   15.45 ? 117  LEU A O   1 
ATOM   821  C CB  . LEU A 1 118 ? 30.312 41.590 45.191 1.00   15.84 ? 117  LEU A CB  1 
ATOM   822  C CG  . LEU A 1 118 ? 30.378 41.630 46.734 1.00   17.34 ? 117  LEU A CG  1 
ATOM   823  C CD1 . LEU A 1 118 ? 29.597 42.833 47.270 1.00   17.82 ? 117  LEU A CD1 1 
ATOM   824  C CD2 . LEU A 1 118 ? 29.859 40.381 47.350 1.00   19.06 ? 117  LEU A CD2 1 
ATOM   825  N N   . PHE A 1 119 ? 31.527 40.870 42.258 1.00   15.13 ? 118  PHE A N   1 
ATOM   826  C CA  . PHE A 1 119 ? 31.397 40.610 40.825 1.00   14.25 ? 118  PHE A CA  1 
ATOM   827  C C   . PHE A 1 119 ? 31.856 39.191 40.521 1.00   14.44 ? 118  PHE A C   1 
ATOM   828  O O   . PHE A 1 119 ? 31.152 38.436 39.836 1.00   15.10 ? 118  PHE A O   1 
ATOM   829  C CB  . PHE A 1 119 ? 32.141 41.654 39.987 1.00   14.64 ? 118  PHE A CB  1 
ATOM   830  C CG  . PHE A 1 119 ? 31.254 42.781 39.511 1.00   12.95 ? 118  PHE A CG  1 
ATOM   831  C CD1 . PHE A 1 119 ? 30.435 42.632 38.401 1.00   14.95 ? 118  PHE A CD1 1 
ATOM   832  C CD2 . PHE A 1 119 ? 31.217 43.980 40.203 1.00   15.14 ? 118  PHE A CD2 1 
ATOM   833  C CE1 . PHE A 1 119 ? 29.637 43.659 37.976 1.00   15.65 ? 118  PHE A CE1 1 
ATOM   834  C CE2 . PHE A 1 119 ? 30.399 45.009 39.790 1.00   14.69 ? 118  PHE A CE2 1 
ATOM   835  C CZ  . PHE A 1 119 ? 29.616 44.856 38.662 1.00   15.24 ? 118  PHE A CZ  1 
ATOM   836  N N   . PHE A 1 120 ? 33.022 38.812 41.034 1.00   15.03 ? 119  PHE A N   1 
ATOM   837  C CA  . PHE A 1 120 ? 33.539 37.460 40.822 1.00   14.28 ? 119  PHE A CA  1 
ATOM   838  C C   . PHE A 1 120 ? 32.540 36.383 41.223 1.00   14.77 ? 119  PHE A C   1 
ATOM   839  O O   . PHE A 1 120 ? 32.295 35.444 40.462 1.00   14.34 ? 119  PHE A O   1 
ATOM   840  C CB  . PHE A 1 120 ? 34.840 37.283 41.576 1.00   14.75 ? 119  PHE A CB  1 
ATOM   841  C CG  . PHE A 1 120 ? 35.221 35.843 41.803 1.00   14.49 ? 119  PHE A CG  1 
ATOM   842  C CD1 . PHE A 1 120 ? 35.741 35.075 40.766 1.00   14.89 ? 119  PHE A CD1 1 
ATOM   843  C CD2 . PHE A 1 120 ? 35.108 35.283 43.041 1.00   14.52 ? 119  PHE A CD2 1 
ATOM   844  C CE1 . PHE A 1 120 ? 36.112 33.754 40.991 1.00   15.21 ? 119  PHE A CE1 1 
ATOM   845  C CE2 . PHE A 1 120 ? 35.472 33.969 43.271 1.00   17.16 ? 119  PHE A CE2 1 
ATOM   846  C CZ  . PHE A 1 120 ? 35.987 33.208 42.227 1.00   14.29 ? 119  PHE A CZ  1 
ATOM   847  N N   . LEU A 1 121 ? 31.950 36.508 42.407 1.00   14.05 ? 120  LEU A N   1 
ATOM   848  C CA  . LEU A 1 121 ? 31.036 35.481 42.881 1.00   14.91 ? 120  LEU A CA  1 
ATOM   849  C C   . LEU A 1 121 ? 29.755 35.427 42.061 1.00   15.15 ? 120  LEU A C   1 
ATOM   850  O O   . LEU A 1 121 ? 29.223 34.345 41.790 1.00   14.65 ? 120  LEU A O   1 
ATOM   851  C CB  . LEU A 1 121 ? 30.685 35.690 44.340 1.00   14.64 ? 120  LEU A CB  1 
ATOM   852  C CG  . LEU A 1 121 ? 31.783 35.337 45.349 1.00   17.37 ? 120  LEU A CG  1 
ATOM   853  C CD1 . LEU A 1 121 ? 31.303 35.675 46.732 1.00   19.91 ? 120  LEU A CD1 1 
ATOM   854  C CD2 . LEU A 1 121 ? 32.207 33.870 45.245 1.00   17.64 ? 120  LEU A CD2 1 
ATOM   855  N N   . GLN A 1 122 ? 29.256 36.594 41.666 1.00   14.42 ? 121  GLN A N   1 
ATOM   856  C CA  . GLN A 1 122 ? 28.004 36.657 40.921 1.00   14.28 ? 121  GLN A CA  1 
ATOM   857  C C   . GLN A 1 122 ? 28.169 36.114 39.497 1.00   14.35 ? 121  GLN A C   1 
ATOM   858  O O   . GLN A 1 122 ? 27.303 35.400 39.006 1.00   15.36 ? 121  GLN A O   1 
ATOM   859  C CB  . GLN A 1 122 ? 27.480 38.084 40.871 1.00   14.36 ? 121  GLN A CB  1 
ATOM   860  C CG  . GLN A 1 122 ? 26.137 38.247 40.169 1.00   13.43 ? 121  GLN A CG  1 
ATOM   861  C CD  . GLN A 1 122 ? 25.609 39.675 40.256 1.00   14.67 ? 121  GLN A CD  1 
ATOM   862  O OE1 . GLN A 1 122 ? 25.892 40.369 41.220 1.00   14.88 ? 121  GLN A OE1 1 
ATOM   863  N NE2 . GLN A 1 122 ? 24.803 40.096 39.271 1.00   17.96 ? 121  GLN A NE2 1 
ATOM   864  N N   . VAL A 1 123 ? 29.263 36.459 38.844 1.00   14.24 ? 122  VAL A N   1 
ATOM   865  C CA  . VAL A 1 123 ? 29.514 36.001 37.474 1.00   15.04 ? 122  VAL A CA  1 
ATOM   866  C C   . VAL A 1 123 ? 29.823 34.479 37.474 1.00   14.85 ? 122  VAL A C   1 
ATOM   867  O O   . VAL A 1 123 ? 29.332 33.731 36.622 1.00   15.26 ? 122  VAL A O   1 
ATOM   868  C CB  . VAL A 1 123 ? 30.657 36.816 36.853 1.00   14.54 ? 122  VAL A CB  1 
ATOM   869  C CG1 . VAL A 1 123 ? 31.120 36.224 35.506 1.00   14.36 ? 122  VAL A CG1 1 
ATOM   870  C CG2 . VAL A 1 123 ? 30.238 38.287 36.677 1.00   14.06 ? 122  VAL A CG2 1 
ATOM   871  N N   . LYS A 1 124 ? 30.593 34.032 38.454 1.00   15.33 ? 123  LYS A N   1 
ATOM   872  C CA  . LYS A 1 124 ? 30.899 32.607 38.610 1.00   15.77 ? 123  LYS A CA  1 
ATOM   873  C C   . LYS A 1 124 ? 29.608 31.811 38.731 1.00   16.27 ? 123  LYS A C   1 
ATOM   874  O O   . LYS A 1 124 ? 29.445 30.748 38.119 1.00   16.47 ? 123  LYS A O   1 
ATOM   875  C CB  . LYS A 1 124 ? 31.801 32.350 39.825 1.00   15.73 ? 123  LYS A CB  1 
ATOM   876  C CG  . LYS A 1 124 ? 32.130 30.860 39.988 1.00   15.67 ? 123  LYS A CG  1 
ATOM   877  C CD  . LYS A 1 124 ? 33.344 30.558 40.805 1.00   15.07 ? 123  LYS A CD  1 
ATOM   878  C CE  . LYS A 1 124 ? 33.156 30.806 42.276 1.00   15.50 ? 123  LYS A CE  1 
ATOM   879  N NZ  . LYS A 1 124 ? 32.194 29.883 42.928 1.00   17.33 ? 123  LYS A NZ  1 
ATOM   880  N N   . LYS A 1 125 ? 28.672 32.296 39.545 1.00   16.58 ? 124  LYS A N   1 
ATOM   881  C CA  . LYS A 1 125 ? 27.418 31.588 39.680 1.00   17.05 ? 124  LYS A CA  1 
ATOM   882  C C   . LYS A 1 125 ? 26.643 31.574 38.353 1.00   16.73 ? 124  LYS A C   1 
ATOM   883  O O   . LYS A 1 125 ? 26.012 30.563 38.024 1.00   16.94 ? 124  LYS A O   1 
ATOM   884  C CB  . LYS A 1 125 ? 26.591 32.172 40.831 1.00   17.95 ? 124  LYS A CB  1 
ATOM   885  C CG  . LYS A 1 125 ? 25.279 31.412 41.122 1.00   21.32 ? 124  LYS A CG  1 
ATOM   886  C CD  . LYS A 1 125 ? 25.531 29.969 41.581 1.00   24.87 ? 124  LYS A CD  1 
ATOM   887  C CE  . LYS A 1 125 ? 24.280 29.341 42.228 1.00   28.71 ? 124  LYS A CE  1 
ATOM   888  N NZ  . LYS A 1 125 ? 24.463 27.894 42.511 1.00   31.02 ? 124  LYS A NZ  1 
ATOM   889  N N   . GLN A 1 126 ? 26.681 32.684 37.605 1.00   16.53 ? 125  GLN A N   1 
ATOM   890  C CA  . GLN A 1 126 ? 26.073 32.737 36.269 1.00   17.18 ? 125  GLN A CA  1 
ATOM   891  C C   . GLN A 1 126 ? 26.677 31.692 35.319 1.00   17.35 ? 125  GLN A C   1 
ATOM   892  O O   . GLN A 1 126 ? 25.972 31.081 34.513 1.00   17.81 ? 125  GLN A O   1 
ATOM   893  C CB  . GLN A 1 126 ? 26.173 34.132 35.646 1.00   17.29 ? 125  GLN A CB  1 
ATOM   894  C CG  . GLN A 1 126 ? 25.262 35.145 36.291 1.00   18.47 ? 125  GLN A CG  1 
ATOM   895  C CD  . GLN A 1 126 ? 25.678 36.575 35.988 1.00   23.68 ? 125  GLN A CD  1 
ATOM   896  O OE1 . GLN A 1 126 ? 26.657 36.800 35.283 1.00   28.16 ? 125  GLN A OE1 1 
ATOM   897  N NE2 . GLN A 1 126 ? 24.962 37.541 36.560 1.00   24.18 ? 125  GLN A NE2 1 
ATOM   898  N N   . ILE A 1 127 ? 27.977 31.473 35.430 1.00   16.02 ? 126  ILE A N   1 
ATOM   899  C CA  . ILE A 1 127 ? 28.645 30.482 34.603 1.00   16.84 ? 126  ILE A CA  1 
ATOM   900  C C   . ILE A 1 127 ? 28.228 29.091 35.029 1.00   16.14 ? 126  ILE A C   1 
ATOM   901  O O   . ILE A 1 127 ? 27.874 28.256 34.188 1.00   15.57 ? 126  ILE A O   1 
ATOM   902  C CB  . ILE A 1 127 ? 30.163 30.643 34.690 1.00   17.19 ? 126  ILE A CB  1 
ATOM   903  C CG1 . ILE A 1 127 ? 30.600 31.979 34.096 1.00   20.02 ? 126  ILE A CG1 1 
ATOM   904  C CG2 . ILE A 1 127 ? 30.890 29.472 33.991 1.00   17.27 ? 126  ILE A CG2 1 
ATOM   905  C CD1 . ILE A 1 127 ? 30.470 32.057 32.624 1.00   23.83 ? 126  ILE A CD1 1 
ATOM   906  N N   . LEU A 1 128 ? 28.257 28.852 36.330 1.00   16.54 ? 127  LEU A N   1 
ATOM   907  C CA  . LEU A 1 128 ? 27.954 27.522 36.863 1.00   16.83 ? 127  LEU A CA  1 
ATOM   908  C C   . LEU A 1 128 ? 26.484 27.182 36.623 1.00   18.13 ? 127  LEU A C   1 
ATOM   909  O O   . LEU A 1 128 ? 26.158 26.013 36.372 1.00   18.17 ? 127  LEU A O   1 
ATOM   910  C CB  . LEU A 1 128 ? 28.297 27.439 38.349 1.00   16.90 ? 127  LEU A CB  1 
ATOM   911  C CG  . LEU A 1 128 ? 29.805 27.420 38.623 1.00   17.62 ? 127  LEU A CG  1 
ATOM   912  C CD1 . LEU A 1 128 ? 30.041 27.414 40.112 1.00   17.89 ? 127  LEU A CD1 1 
ATOM   913  C CD2 . LEU A 1 128 ? 30.469 26.220 37.951 1.00   18.62 ? 127  LEU A CD2 1 
ATOM   914  N N   . ASP A 1 129 ? 25.609 28.181 36.702 1.00   17.75 ? 128  ASP A N   1 
ATOM   915  C CA  . ASP A 1 129 ? 24.178 27.972 36.435 1.00   19.51 ? 128  ASP A CA  1 
ATOM   916  C C   . ASP A 1 129 ? 23.790 27.988 34.949 1.00   19.11 ? 128  ASP A C   1 
ATOM   917  O O   . ASP A 1 129 ? 22.589 27.895 34.616 1.00   18.05 ? 128  ASP A O   1 
ATOM   918  C CB  . ASP A 1 129 ? 23.347 29.016 37.156 1.00   19.75 ? 128  ASP A CB  1 
ATOM   919  C CG  . ASP A 1 129 ? 23.289 28.786 38.648 1.00   23.02 ? 128  ASP A CG  1 
ATOM   920  O OD1 . ASP A 1 129 ? 23.650 27.687 39.129 1.00   27.77 ? 128  ASP A OD1 1 
ATOM   921  O OD2 . ASP A 1 129 ? 22.895 29.678 39.425 1.00   27.81 ? 128  ASP A OD2 1 
ATOM   922  N N   . GLU A 1 130 ? 24.788 28.122 34.080 1.00   18.68 ? 129  GLU A N   1 
ATOM   923  C CA  . GLU A 1 130 ? 24.593 28.107 32.630 1.00   19.85 ? 129  GLU A CA  1 
ATOM   924  C C   . GLU A 1 130 ? 23.840 29.331 32.099 1.00   20.48 ? 129  GLU A C   1 
ATOM   925  O O   . GLU A 1 130 ? 23.318 29.309 30.988 1.00   21.00 ? 129  GLU A O   1 
ATOM   926  C CB  . GLU A 1 130 ? 23.908 26.791 32.194 1.00   20.31 ? 129  GLU A CB  1 
ATOM   927  C CG  . GLU A 1 130 ? 24.750 25.572 32.550 1.00   21.91 ? 129  GLU A CG  1 
ATOM   928  C CD  . GLU A 1 130 ? 24.055 24.251 32.264 1.00   25.38 ? 129  GLU A CD  1 
ATOM   929  O OE1 . GLU A 1 130 ? 23.191 24.214 31.353 1.00   25.64 ? 129  GLU A OE1 1 
ATOM   930  O OE2 . GLU A 1 130 ? 24.358 23.271 32.980 1.00   23.64 ? 129  GLU A OE2 1 
ATOM   931  N N   . LYS A 1 131 ? 23.803 30.418 32.864 1.00   20.21 ? 130  LYS A N   1 
ATOM   932  C CA  . LYS A 1 131 ? 23.186 31.649 32.347 1.00   20.69 ? 130  LYS A CA  1 
ATOM   933  C C   . LYS A 1 131 ? 24.115 32.320 31.336 1.00   19.91 ? 130  LYS A C   1 
ATOM   934  O O   . LYS A 1 131 ? 23.673 33.021 30.422 1.00   21.38 ? 130  LYS A O   1 
ATOM   935  C CB  . LYS A 1 131 ? 22.839 32.594 33.499 1.00   21.24 ? 130  LYS A CB  1 
ATOM   936  C CG  . LYS A 1 131 ? 21.917 31.967 34.551 1.00   23.72 ? 130  LYS A CG  1 
ATOM   937  C CD  . LYS A 1 131 ? 20.530 31.706 33.995 1.00   29.07 ? 130  LYS A CD  1 
ATOM   938  C CE  . LYS A 1 131 ? 19.811 30.640 34.803 1.00   32.71 ? 130  LYS A CE  1 
ATOM   939  N NZ  . LYS A 1 131 ? 18.623 30.073 34.064 1.00   35.51 ? 130  LYS A NZ  1 
ATOM   940  N N   . ILE A 1 132 ? 25.411 32.113 31.481 1.00   18.42 ? 131  ILE A N   1 
ATOM   941  C CA  . ILE A 1 132 ? 26.376 32.592 30.502 1.00   17.83 ? 131  ILE A CA  1 
ATOM   942  C C   . ILE A 1 132 ? 26.953 31.340 29.880 1.00   16.91 ? 131  ILE A C   1 
ATOM   943  O O   . ILE A 1 132 ? 27.533 30.520 30.595 1.00   16.11 ? 131  ILE A O   1 
ATOM   944  C CB  . ILE A 1 132 ? 27.517 33.378 31.150 1.00   17.90 ? 131  ILE A CB  1 
ATOM   945  C CG1 . ILE A 1 132 ? 27.046 34.725 31.702 1.00   19.56 ? 131  ILE A CG1 1 
ATOM   946  C CG2 . ILE A 1 132 ? 28.628 33.642 30.141 1.00   19.15 ? 131  ILE A CG2 1 
ATOM   947  C CD1 . ILE A 1 132 ? 28.108 35.346 32.576 1.00   21.32 ? 131  ILE A CD1 1 
ATOM   948  N N   . TYR A 1 133 ? 26.776 31.176 28.575 1.00   16.30 ? 132  TYR A N   1 
ATOM   949  C CA  . TYR A 1 133 ? 27.379 30.038 27.882 1.00   15.98 ? 132  TYR A CA  1 
ATOM   950  C C   . TYR A 1 133 ? 28.901 30.053 28.075 1.00   14.94 ? 132  TYR A C   1 
ATOM   951  O O   . TYR A 1 133 ? 29.552 31.077 27.942 1.00   15.55 ? 132  TYR A O   1 
ATOM   952  C CB  . TYR A 1 133 ? 27.050 30.059 26.393 1.00   15.76 ? 132  TYR A CB  1 
ATOM   953  C CG  . TYR A 1 133 ? 27.915 29.122 25.593 1.00   16.13 ? 132  TYR A CG  1 
ATOM   954  C CD1 . TYR A 1 133 ? 27.700 27.757 25.607 1.00   18.43 ? 132  TYR A CD1 1 
ATOM   955  C CD2 . TYR A 1 133 ? 28.957 29.605 24.825 1.00   15.50 ? 132  TYR A CD2 1 
ATOM   956  C CE1 . TYR A 1 133 ? 28.504 26.915 24.866 1.00   18.58 ? 132  TYR A CE1 1 
ATOM   957  C CE2 . TYR A 1 133 ? 29.757 28.776 24.089 1.00   18.34 ? 132  TYR A CE2 1 
ATOM   958  C CZ  . TYR A 1 133 ? 29.533 27.435 24.119 1.00   17.43 ? 132  TYR A CZ  1 
ATOM   959  O OH  . TYR A 1 133 ? 30.327 26.586 23.384 1.00   21.56 ? 132  TYR A OH  1 
ATOM   960  N N   . CYS A 1 134 ? 29.484 28.911 28.383 1.00   15.03 ? 133  CYS A N   1 
ATOM   961  C CA  . CYS A 1 134 ? 30.928 28.856 28.516 1.00   15.36 ? 133  CYS A CA  1 
ATOM   962  C C   . CYS A 1 134 ? 31.393 27.511 27.947 1.00   15.67 ? 133  CYS A C   1 
ATOM   963  O O   . CYS A 1 134 ? 30.883 26.479 28.373 1.00   16.01 ? 133  CYS A O   1 
ATOM   964  C CB  . CYS A 1 134 ? 31.325 28.965 29.985 1.00   15.22 ? 133  CYS A CB  1 
ATOM   965  S SG  . CYS A 1 134 ? 33.139 28.964 30.231 1.00   17.34 ? 133  CYS A SG  1 
ATOM   966  N N   . PRO A 1 135 ? 32.304 27.511 26.984 1.00   15.90 ? 134  PRO A N   1 
ATOM   967  C CA  . PRO A 1 135 ? 32.794 26.242 26.427 1.00   15.79 ? 134  PRO A CA  1 
ATOM   968  C C   . PRO A 1 135 ? 33.671 25.478 27.428 1.00   15.52 ? 134  PRO A C   1 
ATOM   969  O O   . PRO A 1 135 ? 34.142 26.048 28.410 1.00   14.75 ? 134  PRO A O   1 
ATOM   970  C CB  . PRO A 1 135 ? 33.578 26.685 25.209 1.00   16.42 ? 134  PRO A CB  1 
ATOM   971  C CG  . PRO A 1 135 ? 34.061 27.992 25.553 1.00   17.52 ? 134  PRO A CG  1 
ATOM   972  C CD  . PRO A 1 135 ? 32.921 28.657 26.306 1.00   16.66 ? 134  PRO A CD  1 
ATOM   973  N N   . PRO A 1 136 ? 33.911 24.192 27.186 1.00   15.19 ? 135  PRO A N   1 
ATOM   974  C CA  . PRO A 1 136 ? 34.563 23.350 28.193 1.00   15.22 ? 135  PRO A CA  1 
ATOM   975  C C   . PRO A 1 136 ? 35.964 23.711 28.596 1.00   14.14 ? 135  PRO A C   1 
ATOM   976  O O   . PRO A 1 136 ? 36.228 23.730 29.795 1.00   13.64 ? 135  PRO A O   1 
ATOM   977  C CB  . PRO A 1 136 ? 34.548 21.952 27.549 1.00   15.57 ? 135  PRO A CB  1 
ATOM   978  C CG  . PRO A 1 136 ? 33.524 22.046 26.535 1.00   16.45 ? 135  PRO A CG  1 
ATOM   979  C CD  . PRO A 1 136 ? 33.547 23.425 25.993 1.00   16.47 ? 135  PRO A CD  1 
ATOM   980  N N   . GLU A 1 137 ? 36.833 24.034 27.652 1.00   14.22 ? 136  GLU A N   1 
ATOM   981  C CA  . GLU A 1 137 ? 38.230 24.307 28.023 1.00   13.87 ? 136  GLU A CA  1 
ATOM   982  C C   . GLU A 1 137 ? 38.299 25.629 28.807 1.00   13.86 ? 136  GLU A C   1 
ATOM   983  O O   . GLU A 1 137 ? 39.018 25.753 29.798 1.00   13.84 ? 136  GLU A O   1 
ATOM   984  C CB  . GLU A 1 137 ? 39.103 24.363 26.800 1.00   14.60 ? 136  GLU A CB  1 
ATOM   985  C CG  . GLU A 1 137 ? 39.290 23.011 26.120 1.00   13.12 ? 136  GLU A CG  1 
ATOM   986  C CD  . GLU A 1 137 ? 39.997 22.017 27.026 1.00   16.24 ? 136  GLU A CD  1 
ATOM   987  O OE1 . GLU A 1 137 ? 41.043 22.360 27.589 1.00   15.37 ? 136  GLU A OE1 1 
ATOM   988  O OE2 . GLU A 1 137 ? 39.479 20.890 27.181 1.00   16.85 ? 136  GLU A OE2 1 
ATOM   989  N N   . ALA A 1 138 ? 37.517 26.590 28.369 1.00   12.82 ? 137  ALA A N   1 
ATOM   990  C CA  . ALA A 1 138 ? 37.429 27.844 29.113 1.00   14.15 ? 137  ALA A CA  1 
ATOM   991  C C   . ALA A 1 138 ? 36.931 27.568 30.524 1.00   13.81 ? 137  ALA A C   1 
ATOM   992  O O   . ALA A 1 138 ? 37.380 28.215 31.468 1.00   13.27 ? 137  ALA A O   1 
ATOM   993  C CB  . ALA A 1 138 ? 36.493 28.816 28.395 1.00   13.96 ? 137  ALA A CB  1 
ATOM   994  N N   . SER A 1 139 ? 35.934 26.679 30.652 1.00   14.03 ? 138  SER A N   1 
ATOM   995  C CA  . SER A 1 139 ? 35.334 26.337 31.931 1.00   15.01 ? 138  SER A CA  1 
ATOM   996  C C   . SER A 1 139 ? 36.364 25.793 32.891 1.00   13.96 ? 138  SER A C   1 
ATOM   997  O O   . SER A 1 139 ? 36.367 26.103 34.062 1.00   13.93 ? 138  SER A O   1 
ATOM   998  C CB  . SER A 1 139 ? 34.222 25.262 31.752 1.00   15.96 ? 138  SER A CB  1 
ATOM   999  O OG  . SER A 1 139 ? 33.089 25.898 31.172 1.00   23.32 ? 138  SER A OG  1 
ATOM   1000 N N   . VAL A 1 140 ? 37.253 24.962 32.376 1.00   13.69 ? 139  VAL A N   1 
ATOM   1001 C CA  . VAL A 1 140 ? 38.305 24.402 33.191 1.00   14.20 ? 139  VAL A CA  1 
ATOM   1002 C C   . VAL A 1 140 ? 39.302 25.491 33.643 1.00   13.35 ? 139  VAL A C   1 
ATOM   1003 O O   . VAL A 1 140 ? 39.686 25.524 34.798 1.00   14.57 ? 139  VAL A O   1 
ATOM   1004 C CB  . VAL A 1 140 ? 39.037 23.271 32.419 1.00   14.08 ? 139  VAL A CB  1 
ATOM   1005 C CG1 . VAL A 1 140 ? 40.303 22.832 33.147 1.00   15.75 ? 139  VAL A CG1 1 
ATOM   1006 C CG2 . VAL A 1 140 ? 38.093 22.114 32.194 1.00   15.97 ? 139  VAL A CG2 1 
ATOM   1007 N N   . LEU A 1 141 ? 39.730 26.349 32.731 1.00   13.47 ? 140  LEU A N   1 
ATOM   1008 C CA  . LEU A 1 141 ? 40.654 27.437 33.065 1.00   13.28 ? 140  LEU A CA  1 
ATOM   1009 C C   . LEU A 1 141 ? 39.988 28.341 34.132 1.00   13.00 ? 140  LEU A C   1 
ATOM   1010 O O   . LEU A 1 141 ? 40.598 28.690 35.143 1.00   13.04 ? 140  LEU A O   1 
ATOM   1011 C CB  . LEU A 1 141 ? 41.009 28.217 31.807 1.00   13.41 ? 140  LEU A CB  1 
ATOM   1012 C CG  . LEU A 1 141 ? 41.875 29.461 31.988 1.00   14.57 ? 140  LEU A CG  1 
ATOM   1013 C CD1 . LEU A 1 141 ? 43.203 29.056 32.560 1.00   16.08 ? 140  LEU A CD1 1 
ATOM   1014 C CD2 . LEU A 1 141 ? 42.083 30.168 30.671 1.00   15.21 ? 140  LEU A CD2 1 
ATOM   1015 N N   . LEU A 1 142 ? 38.724 28.685 33.916 1.00   13.28 ? 141  LEU A N   1 
ATOM   1016 C CA  . LEU A 1 142 ? 37.975 29.456 34.927 1.00   13.67 ? 141  LEU A CA  1 
ATOM   1017 C C   . LEU A 1 142 ? 37.981 28.747 36.284 1.00   13.72 ? 141  LEU A C   1 
ATOM   1018 O O   . LEU A 1 142 ? 38.295 29.358 37.333 1.00   14.16 ? 141  LEU A O   1 
ATOM   1019 C CB  . LEU A 1 142 ? 36.539 29.724 34.457 1.00   13.47 ? 141  LEU A CB  1 
ATOM   1020 C CG  . LEU A 1 142 ? 36.378 30.809 33.377 1.00   14.81 ? 141  LEU A CG  1 
ATOM   1021 C CD1 . LEU A 1 142 ? 34.952 30.818 32.839 1.00   16.27 ? 141  LEU A CD1 1 
ATOM   1022 C CD2 . LEU A 1 142 ? 36.769 32.224 33.902 1.00   14.55 ? 141  LEU A CD2 1 
ATOM   1023 N N   . ALA A 1 143 ? 37.644 27.453 36.292 1.00   12.49 ? 142  ALA A N   1 
ATOM   1024 C CA  . ALA A 1 143 ? 37.627 26.698 37.529 1.00   12.38 ? 142  ALA A CA  1 
ATOM   1025 C C   . ALA A 1 143 ? 38.972 26.779 38.243 1.00   12.31 ? 142  ALA A C   1 
ATOM   1026 O O   . ALA A 1 143 ? 39.024 26.905 39.464 1.00   12.17 ? 142  ALA A O   1 
ATOM   1027 C CB  . ALA A 1 143 ? 37.248 25.257 37.254 1.00   12.03 ? 142  ALA A CB  1 
ATOM   1028 N N   . SER A 1 144 ? 40.045 26.768 37.468 1.00   12.73 ? 143  SER A N   1 
ATOM   1029 C CA  . SER A 1 144 ? 41.377 26.750 38.047 1.00   13.60 ? 143  SER A CA  1 
ATOM   1030 C C   . SER A 1 144 ? 41.663 28.041 38.823 1.00   14.49 ? 143  SER A C   1 
ATOM   1031 O O   . SER A 1 144 ? 42.384 28.022 39.828 1.00   15.20 ? 143  SER A O   1 
ATOM   1032 C CB  . SER A 1 144 ? 42.443 26.487 36.990 1.00   12.79 ? 143  SER A CB  1 
ATOM   1033 O OG  . SER A 1 144 ? 42.636 27.548 36.101 1.00   12.83 ? 143  SER A OG  1 
ATOM   1034 N N   . TYR A 1 145 ? 41.091 29.150 38.370 1.00   14.15 ? 144  TYR A N   1 
ATOM   1035 C CA  . TYR A 1 145 ? 41.256 30.421 39.078 1.00   14.60 ? 144  TYR A CA  1 
ATOM   1036 C C   . TYR A 1 145 ? 40.348 30.444 40.307 1.00   14.67 ? 144  TYR A C   1 
ATOM   1037 O O   . TYR A 1 145 ? 40.726 30.982 41.343 1.00   15.21 ? 144  TYR A O   1 
ATOM   1038 C CB  . TYR A 1 145 ? 41.017 31.623 38.159 1.00   13.92 ? 144  TYR A CB  1 
ATOM   1039 C CG  . TYR A 1 145 ? 42.200 31.939 37.256 1.00   14.58 ? 144  TYR A CG  1 
ATOM   1040 C CD1 . TYR A 1 145 ? 43.416 32.352 37.784 1.00   18.60 ? 144  TYR A CD1 1 
ATOM   1041 C CD2 . TYR A 1 145 ? 42.114 31.776 35.877 1.00   14.72 ? 144  TYR A CD2 1 
ATOM   1042 C CE1 . TYR A 1 145 ? 44.484 32.628 36.978 1.00   16.77 ? 144  TYR A CE1 1 
ATOM   1043 C CE2 . TYR A 1 145 ? 43.169 32.043 35.071 1.00   17.00 ? 144  TYR A CE2 1 
ATOM   1044 C CZ  . TYR A 1 145 ? 44.363 32.470 35.616 1.00   18.64 ? 144  TYR A CZ  1 
ATOM   1045 O OH  . TYR A 1 145 ? 45.439 32.744 34.808 1.00   22.54 ? 144  TYR A OH  1 
ATOM   1046 N N   . ALA A 1 146 ? 39.143 29.873 40.201 1.00   15.26 ? 145  ALA A N   1 
ATOM   1047 C CA  . ALA A 1 146 ? 38.259 29.768 41.352 1.00   14.97 ? 145  ALA A CA  1 
ATOM   1048 C C   . ALA A 1 146 ? 38.922 28.920 42.448 1.00   16.11 ? 145  ALA A C   1 
ATOM   1049 O O   . ALA A 1 146 ? 38.814 29.225 43.652 1.00   16.87 ? 145  ALA A O   1 
ATOM   1050 C CB  . ALA A 1 146 ? 36.928 29.182 40.962 1.00   14.81 ? 145  ALA A CB  1 
ATOM   1051 N N   . VAL A 1 147 ? 39.656 27.891 42.043 1.00   16.25 ? 146  VAL A N   1 
ATOM   1052 C CA  . VAL A 1 147 ? 40.364 27.066 43.022 1.00   17.30 ? 146  VAL A CA  1 
ATOM   1053 C C   . VAL A 1 147 ? 41.516 27.864 43.662 1.00   17.87 ? 146  VAL A C   1 
ATOM   1054 O O   . VAL A 1 147 ? 41.660 27.900 44.897 1.00   18.35 ? 146  VAL A O   1 
ATOM   1055 C CB  . VAL A 1 147 ? 40.843 25.737 42.384 1.00   17.50 ? 146  VAL A CB  1 
ATOM   1056 C CG1 . VAL A 1 147 ? 41.723 24.964 43.348 1.00   18.08 ? 146  VAL A CG1 1 
ATOM   1057 C CG2 . VAL A 1 147 ? 39.633 24.881 41.976 1.00   18.34 ? 146  VAL A CG2 1 
ATOM   1058 N N   . GLN A 1 148 ? 42.305 28.554 42.852 1.00   18.07 ? 147  GLN A N   1 
ATOM   1059 C CA  . GLN A 1 148 ? 43.376 29.386 43.395 1.00   18.44 ? 147  GLN A CA  1 
ATOM   1060 C C   . GLN A 1 148 ? 42.820 30.403 44.400 1.00   19.24 ? 147  GLN A C   1 
ATOM   1061 O O   . GLN A 1 148 ? 43.440 30.663 45.432 1.00   18.62 ? 147  GLN A O   1 
ATOM   1062 C CB  . GLN A 1 148 ? 44.080 30.131 42.275 1.00   18.08 ? 147  GLN A CB  1 
ATOM   1063 C CG  . GLN A 1 148 ? 45.300 30.956 42.689 1.00   18.00 ? 147  GLN A CG  1 
ATOM   1064 C CD  . GLN A 1 148 ? 46.470 30.130 43.198 1.00   19.86 ? 147  GLN A CD  1 
ATOM   1065 O OE1 . GLN A 1 148 ? 46.642 28.971 42.817 1.00   20.90 ? 147  GLN A OE1 1 
ATOM   1066 N NE2 . GLN A 1 148 ? 47.321 30.759 44.020 1.00   21.01 ? 147  GLN A NE2 1 
ATOM   1067 N N   . ALA A 1 149 ? 41.675 31.006 44.076 1.00   18.98 ? 148  ALA A N   1 
ATOM   1068 C CA  . ALA A 1 149 ? 41.073 31.993 44.965 1.00   20.36 ? 148  ALA A CA  1 
ATOM   1069 C C   . ALA A 1 149 ? 40.602 31.365 46.273 1.00   20.98 ? 148  ALA A C   1 
ATOM   1070 O O   . ALA A 1 149 ? 40.700 31.989 47.326 1.00   21.96 ? 148  ALA A O   1 
ATOM   1071 C CB  . ALA A 1 149 ? 39.897 32.739 44.274 1.00   19.89 ? 148  ALA A CB  1 
ATOM   1072 N N   . LYS A 1 150 ? 40.119 30.133 46.225 1.00   21.20 ? 149  LYS A N   1 
ATOM   1073 C CA  . LYS A 1 150 ? 39.580 29.502 47.417 1.00   22.39 ? 149  LYS A CA  1 
ATOM   1074 C C   . LYS A 1 150 ? 40.607 28.783 48.295 1.00   22.96 ? 149  LYS A C   1 
ATOM   1075 O O   . LYS A 1 150 ? 40.527 28.855 49.521 1.00   22.96 ? 149  LYS A O   1 
ATOM   1076 C CB  . LYS A 1 150 ? 38.474 28.506 47.039 1.00   22.74 ? 149  LYS A CB  1 
ATOM   1077 C CG  . LYS A 1 150 ? 37.761 27.888 48.244 1.00   25.08 ? 149  LYS A CG  1 
ATOM   1078 C CD  . LYS A 1 150 ? 36.463 27.180 47.829 1.00   28.19 ? 149  LYS A CD  1 
ATOM   1079 C CE  . LYS A 1 150 ? 35.608 26.722 49.016 1.00   30.50 ? 149  LYS A CE  1 
ATOM   1080 N NZ  . LYS A 1 150 ? 36.311 25.671 49.808 1.00   33.12 ? 149  LYS A NZ  1 
ATOM   1081 N N   . TYR A 1 151 ? 41.563 28.102 47.677 1.00   22.93 ? 150  TYR A N   1 
ATOM   1082 C CA  . TYR A 1 151 ? 42.526 27.266 48.401 1.00   24.27 ? 150  TYR A CA  1 
ATOM   1083 C C   . TYR A 1 151 ? 43.926 27.855 48.507 1.00   24.12 ? 150  TYR A C   1 
ATOM   1084 O O   . TYR A 1 151 ? 44.752 27.358 49.278 1.00   25.39 ? 150  TYR A O   1 
ATOM   1085 C CB  . TYR A 1 151 ? 42.642 25.907 47.702 1.00   24.38 ? 150  TYR A CB  1 
ATOM   1086 C CG  . TYR A 1 151 ? 41.404 25.055 47.770 1.00   26.55 ? 150  TYR A CG  1 
ATOM   1087 C CD1 . TYR A 1 151 ? 40.358 25.229 46.869 1.00   27.75 ? 150  TYR A CD1 1 
ATOM   1088 C CD2 . TYR A 1 151 ? 41.285 24.050 48.722 1.00   31.09 ? 150  TYR A CD2 1 
ATOM   1089 C CE1 . TYR A 1 151 ? 39.202 24.437 46.940 1.00   30.02 ? 150  TYR A CE1 1 
ATOM   1090 C CE2 . TYR A 1 151 ? 40.134 23.256 48.796 1.00   32.40 ? 150  TYR A CE2 1 
ATOM   1091 C CZ  . TYR A 1 151 ? 39.113 23.449 47.905 1.00   31.58 ? 150  TYR A CZ  1 
ATOM   1092 O OH  . TYR A 1 151 ? 38.012 22.639 48.014 1.00   34.02 ? 150  TYR A OH  1 
ATOM   1093 N N   . GLY A 1 152 ? 44.214 28.906 47.747 1.00   24.32 ? 151  GLY A N   1 
ATOM   1094 C CA  . GLY A 1 152 ? 45.562 29.458 47.700 1.00   24.22 ? 151  GLY A CA  1 
ATOM   1095 C C   . GLY A 1 152 ? 46.428 28.588 46.799 1.00   23.58 ? 151  GLY A C   1 
ATOM   1096 O O   . GLY A 1 152 ? 45.901 27.862 45.970 1.00   23.67 ? 151  GLY A O   1 
ATOM   1097 N N   . ASP A 1 153 ? 47.750 28.632 46.957 1.00   23.47 ? 152  ASP A N   1 
ATOM   1098 C CA  . ASP A 1 153 ? 48.639 27.837 46.102 1.00   23.34 ? 152  ASP A CA  1 
ATOM   1099 C C   . ASP A 1 153 ? 48.416 26.330 46.187 1.00   23.29 ? 152  ASP A C   1 
ATOM   1100 O O   . ASP A 1 153 ? 48.187 25.782 47.263 1.00   23.43 ? 152  ASP A O   1 
ATOM   1101 C CB  . ASP A 1 153 ? 50.103 28.061 46.469 1.00   23.60 ? 152  ASP A CB  1 
ATOM   1102 C CG  . ASP A 1 153 ? 50.652 29.361 45.968 1.00   24.23 ? 152  ASP A CG  1 
ATOM   1103 O OD1 . ASP A 1 153 ? 49.953 30.107 45.227 1.00   21.00 ? 152  ASP A OD1 1 
ATOM   1104 O OD2 . ASP A 1 153 ? 51.825 29.703 46.265 1.00   25.20 ? 152  ASP A OD2 1 
ATOM   1105 N N   . TYR A 1 154 ? 48.511 25.675 45.040 1.00   23.38 ? 153  TYR A N   1 
ATOM   1106 C CA  . TYR A 1 154 ? 48.506 24.218 44.968 1.00   23.86 ? 153  TYR A CA  1 
ATOM   1107 C C   . TYR A 1 154 ? 49.671 23.658 45.798 1.00   25.52 ? 153  TYR A C   1 
ATOM   1108 O O   . TYR A 1 154 ? 50.821 24.081 45.631 1.00   24.95 ? 153  TYR A O   1 
ATOM   1109 C CB  . TYR A 1 154 ? 48.660 23.777 43.517 1.00   24.65 ? 153  TYR A CB  1 
ATOM   1110 C CG  . TYR A 1 154 ? 48.647 22.269 43.294 1.00   23.24 ? 153  TYR A CG  1 
ATOM   1111 C CD1 . TYR A 1 154 ? 47.690 21.468 43.893 1.00   24.58 ? 153  TYR A CD1 1 
ATOM   1112 C CD2 . TYR A 1 154 ? 49.595 21.660 42.483 1.00   26.98 ? 153  TYR A CD2 1 
ATOM   1113 C CE1 . TYR A 1 154 ? 47.664 20.100 43.677 1.00   26.59 ? 153  TYR A CE1 1 
ATOM   1114 C CE2 . TYR A 1 154 ? 49.590 20.284 42.277 1.00   26.61 ? 153  TYR A CE2 1 
ATOM   1115 C CZ  . TYR A 1 154 ? 48.619 19.520 42.869 1.00   27.31 ? 153  TYR A CZ  1 
ATOM   1116 O OH  . TYR A 1 154 ? 48.590 18.156 42.669 1.00   28.53 ? 153  TYR A OH  1 
ATOM   1117 N N   . ASP A 1 155 ? 49.356 22.711 46.678 1.00   27.74 ? 154  ASP A N   1 
ATOM   1118 C CA  . ASP A 1 155 ? 50.338 22.007 47.527 1.00   30.04 ? 154  ASP A CA  1 
ATOM   1119 C C   . ASP A 1 155 ? 49.938 20.524 47.492 1.00   31.13 ? 154  ASP A C   1 
ATOM   1120 O O   . ASP A 1 155 ? 48.977 20.120 48.144 1.00   31.30 ? 154  ASP A O   1 
ATOM   1121 C CB  . ASP A 1 155 ? 50.278 22.533 48.959 1.00   30.19 ? 154  ASP A CB  1 
ATOM   1122 C CG  . ASP A 1 155 ? 51.420 22.009 49.838 1.00   31.94 ? 154  ASP A CG  1 
ATOM   1123 O OD1 . ASP A 1 155 ? 52.008 20.953 49.523 1.00   32.14 ? 154  ASP A OD1 1 
ATOM   1124 O OD2 . ASP A 1 155 ? 51.758 22.585 50.891 1.00   35.48 ? 154  ASP A OD2 1 
ATOM   1125 N N   . PRO A 1 156 ? 50.643 19.719 46.710 1.00   33.50 ? 155  PRO A N   1 
ATOM   1126 C CA  . PRO A 1 156 ? 50.291 18.300 46.554 1.00   34.90 ? 155  PRO A CA  1 
ATOM   1127 C C   . PRO A 1 156 ? 50.331 17.489 47.854 1.00   36.45 ? 155  PRO A C   1 
ATOM   1128 O O   . PRO A 1 156 ? 49.759 16.394 47.901 1.00   36.69 ? 155  PRO A O   1 
ATOM   1129 C CB  . PRO A 1 156 ? 51.364 17.778 45.601 1.00   35.18 ? 155  PRO A CB  1 
ATOM   1130 C CG  . PRO A 1 156 ? 51.923 18.955 44.945 1.00   34.94 ? 155  PRO A CG  1 
ATOM   1131 C CD  . PRO A 1 156 ? 51.830 20.072 45.922 1.00   33.84 ? 155  PRO A CD  1 
ATOM   1132 N N   . SER A 1 157 ? 51.000 18.023 48.874 1.00   37.56 ? 156  SER A N   1 
ATOM   1133 C CA  . SER A 1 157 ? 51.148 17.346 50.160 1.00   38.58 ? 156  SER A CA  1 
ATOM   1134 C C   . SER A 1 157 ? 49.896 17.526 50.994 1.00   38.87 ? 156  SER A C   1 
ATOM   1135 O O   . SER A 1 157 ? 49.654 16.783 51.947 1.00   38.98 ? 156  SER A O   1 
ATOM   1136 C CB  . SER A 1 157 ? 52.358 17.898 50.926 1.00   38.94 ? 156  SER A CB  1 
ATOM   1137 O OG  . SER A 1 157 ? 52.126 19.211 51.421 1.00   39.59 ? 156  SER A OG  1 
ATOM   1138 N N   . VAL A 1 158 ? 49.096 18.519 50.619 1.00   38.83 ? 157  VAL A N   1 
ATOM   1139 C CA  . VAL A 1 158 ? 47.853 18.834 51.304 1.00   38.57 ? 157  VAL A CA  1 
ATOM   1140 C C   . VAL A 1 158 ? 46.675 18.577 50.366 1.00   38.09 ? 157  VAL A C   1 
ATOM   1141 O O   . VAL A 1 158 ? 45.639 18.053 50.781 1.00   38.22 ? 157  VAL A O   1 
ATOM   1142 C CB  . VAL A 1 158 ? 47.844 20.309 51.753 1.00   38.77 ? 157  VAL A CB  1 
ATOM   1143 C CG1 . VAL A 1 158 ? 46.505 20.697 52.381 1.00   38.97 ? 157  VAL A CG1 1 
ATOM   1144 C CG2 . VAL A 1 158 ? 48.982 20.575 52.732 1.00   39.70 ? 157  VAL A CG2 1 
ATOM   1145 N N   . HIS A 1 159 ? 46.842 18.951 49.099 1.00   37.18 ? 158  HIS A N   1 
ATOM   1146 C CA  . HIS A 1 159 ? 45.800 18.790 48.091 1.00   36.51 ? 158  HIS A CA  1 
ATOM   1147 C C   . HIS A 1 159 ? 45.991 17.472 47.351 1.00   36.72 ? 158  HIS A C   1 
ATOM   1148 O O   . HIS A 1 159 ? 46.556 17.422 46.256 1.00   36.51 ? 158  HIS A O   1 
ATOM   1149 C CB  . HIS A 1 159 ? 45.825 19.986 47.134 1.00   36.11 ? 158  HIS A CB  1 
ATOM   1150 C CG  . HIS A 1 159 ? 45.711 21.303 47.839 1.00   34.85 ? 158  HIS A CG  1 
ATOM   1151 N ND1 . HIS A 1 159 ? 46.538 22.373 47.572 1.00   30.19 ? 158  HIS A ND1 1 
ATOM   1152 C CD2 . HIS A 1 159 ? 44.876 21.710 48.826 1.00   33.06 ? 158  HIS A CD2 1 
ATOM   1153 C CE1 . HIS A 1 159 ? 46.214 23.382 48.361 1.00   32.09 ? 158  HIS A CE1 1 
ATOM   1154 N NE2 . HIS A 1 159 ? 45.203 23.009 49.125 1.00   33.06 ? 158  HIS A NE2 1 
ATOM   1155 N N   . LYS A 1 160 ? 45.508 16.399 47.972 1.00   37.05 ? 159  LYS A N   1 
ATOM   1156 C CA  . LYS A 1 160 ? 45.632 15.062 47.415 1.00   37.32 ? 159  LYS A CA  1 
ATOM   1157 C C   . LYS A 1 160 ? 44.531 14.777 46.414 1.00   36.58 ? 159  LYS A C   1 
ATOM   1158 O O   . LYS A 1 160 ? 43.466 15.395 46.462 1.00   36.64 ? 159  LYS A O   1 
ATOM   1159 C CB  . LYS A 1 160 ? 45.565 14.036 48.547 1.00   37.90 ? 159  LYS A CB  1 
ATOM   1160 C CG  . LYS A 1 160 ? 46.678 14.217 49.561 1.00   40.08 ? 159  LYS A CG  1 
ATOM   1161 C CD  . LYS A 1 160 ? 46.308 13.666 50.916 1.00   42.14 ? 159  LYS A CD  1 
ATOM   1162 C CE  . LYS A 1 160 ? 47.398 14.020 51.916 1.00   43.76 ? 159  LYS A CE  1 
ATOM   1163 N NZ  . LYS A 1 160 ? 48.744 13.544 51.454 1.00   44.20 ? 159  LYS A NZ  1 
ATOM   1164 N N   . ARG A 1 161 ? 44.785 13.829 45.517 1.00   35.87 ? 160  ARG A N   1 
ATOM   1165 C CA  . ARG A 1 161 ? 43.777 13.416 44.555 1.00   35.41 ? 160  ARG A CA  1 
ATOM   1166 C C   . ARG A 1 161 ? 42.452 13.283 45.289 1.00   34.70 ? 160  ARG A C   1 
ATOM   1167 O O   . ARG A 1 161 ? 42.383 12.646 46.344 1.00   34.52 ? 160  ARG A O   1 
ATOM   1168 C CB  . ARG A 1 161 ? 44.157 12.089 43.898 1.00   35.73 ? 160  ARG A CB  1 
ATOM   1169 C CG  . ARG A 1 161 ? 44.915 12.135 42.592 0.0000 40.99 ? 160  ARG A CG  1 
ATOM   1170 C CD  . ARG A 1 161 ? 44.956 10.776 41.911 0.0000 42.70 ? 160  ARG A CD  1 
ATOM   1171 N NE  . ARG A 1 161 ? 45.442 10.858 40.537 0.0000 44.18 ? 160  ARG A NE  1 
ATOM   1172 C CZ  . ARG A 1 161 ? 45.492 9.825  39.701 0.0000 44.90 ? 160  ARG A CZ  1 
ATOM   1173 N NH1 . ARG A 1 161 ? 45.086 8.627  40.099 0.0000 45.37 ? 160  ARG A NH1 1 
ATOM   1174 N NH2 . ARG A 1 161 ? 45.947 9.990  38.467 0.0000 45.37 ? 160  ARG A NH2 1 
ATOM   1175 N N   . GLY A 1 162 ? 41.417 13.927 44.755 1.00   33.32 ? 161  GLY A N   1 
ATOM   1176 C CA  . GLY A 1 162 ? 40.097 13.919 45.353 1.00   32.60 ? 161  GLY A CA  1 
ATOM   1177 C C   . GLY A 1 162 ? 39.772 15.165 46.163 1.00   31.87 ? 161  GLY A C   1 
ATOM   1178 O O   . GLY A 1 162 ? 38.629 15.344 46.600 1.00   31.83 ? 161  GLY A O   1 
ATOM   1179 N N   . PHE A 1 163 ? 40.743 16.054 46.355 1.00   30.91 ? 162  PHE A N   1 
ATOM   1180 C CA  . PHE A 1 163 ? 40.506 17.232 47.192 1.00   30.71 ? 162  PHE A CA  1 
ATOM   1181 C C   . PHE A 1 163 ? 39.402 18.164 46.676 1.00   30.82 ? 162  PHE A C   1 
ATOM   1182 O O   . PHE A 1 163 ? 38.845 18.950 47.449 1.00   30.39 ? 162  PHE A O   1 
ATOM   1183 C CB  . PHE A 1 163 ? 41.809 18.007 47.464 1.00   30.82 ? 162  PHE A CB  1 
ATOM   1184 C CG  . PHE A 1 163 ? 42.253 18.917 46.343 1.00   30.49 ? 162  PHE A CG  1 
ATOM   1185 C CD1 . PHE A 1 163 ? 42.792 18.403 45.180 1.00   31.10 ? 162  PHE A CD1 1 
ATOM   1186 C CD2 . PHE A 1 163 ? 42.160 20.289 46.481 1.00   31.66 ? 162  PHE A CD2 1 
ATOM   1187 C CE1 . PHE A 1 163 ? 43.214 19.242 44.160 1.00   31.29 ? 162  PHE A CE1 1 
ATOM   1188 C CE2 . PHE A 1 163 ? 42.582 21.140 45.464 1.00   30.54 ? 162  PHE A CE2 1 
ATOM   1189 C CZ  . PHE A 1 163 ? 43.109 20.615 44.307 1.00   31.03 ? 162  PHE A CZ  1 
ATOM   1190 N N   . LEU A 1 164 ? 39.087 18.075 45.383 1.00   30.57 ? 163  LEU A N   1 
ATOM   1191 C CA  . LEU A 1 164 ? 38.036 18.907 44.794 1.00   30.56 ? 163  LEU A CA  1 
ATOM   1192 C C   . LEU A 1 164 ? 36.704 18.170 44.605 1.00   31.35 ? 163  LEU A C   1 
ATOM   1193 O O   . LEU A 1 164 ? 35.755 18.705 44.040 1.00   30.69 ? 163  LEU A O   1 
ATOM   1194 C CB  . LEU A 1 164 ? 38.512 19.462 43.448 1.00   30.72 ? 163  LEU A CB  1 
ATOM   1195 C CG  . LEU A 1 164 ? 39.733 20.382 43.533 1.00   29.12 ? 163  LEU A CG  1 
ATOM   1196 C CD1 . LEU A 1 164 ? 40.177 20.832 42.144 1.00   28.57 ? 163  LEU A CD1 1 
ATOM   1197 C CD2 . LEU A 1 164 ? 39.454 21.570 44.418 1.00   28.79 ? 163  LEU A CD2 1 
ATOM   1198 N N   . ALA A 1 165 ? 36.615 16.955 45.116 1.00   32.22 ? 164  ALA A N   1 
ATOM   1199 C CA  . ALA A 1 165 ? 35.441 16.127 44.888 1.00   32.82 ? 164  ALA A CA  1 
ATOM   1200 C C   . ALA A 1 165 ? 34.107 16.758 45.290 1.00   33.15 ? 164  ALA A C   1 
ATOM   1201 O O   . ALA A 1 165 ? 33.092 16.504 44.653 1.00   34.03 ? 164  ALA A O   1 
ATOM   1202 C CB  . ALA A 1 165 ? 35.623 14.788 45.581 1.00   33.36 ? 164  ALA A CB  1 
ATOM   1203 N N   . GLN A 1 166 ? 34.089 17.576 46.331 1.00   33.53 ? 165  GLN A N   1 
ATOM   1204 C CA  . GLN A 1 166 ? 32.820 18.132 46.797 1.00   34.22 ? 165  GLN A CA  1 
ATOM   1205 C C   . GLN A 1 166 ? 32.596 19.565 46.355 1.00   33.71 ? 165  GLN A C   1 
ATOM   1206 O O   . GLN A 1 166 ? 31.663 20.215 46.799 1.00   33.94 ? 165  GLN A O   1 
ATOM   1207 C CB  . GLN A 1 166 ? 32.720 18.036 48.318 1.00   34.77 ? 165  GLN A CB  1 
ATOM   1208 C CG  . GLN A 1 166 ? 32.868 16.622 48.842 1.00   37.04 ? 165  GLN A CG  1 
ATOM   1209 C CD  . GLN A 1 166 ? 32.011 15.626 48.080 1.00   40.27 ? 165  GLN A CD  1 
ATOM   1210 O OE1 . GLN A 1 166 ? 32.528 14.628 47.561 1.00   44.16 ? 165  GLN A OE1 1 
ATOM   1211 N NE2 . GLN A 1 166 ? 30.701 15.883 48.010 1.00   40.53 ? 165  GLN A NE2 1 
ATOM   1212 N N   . GLU A 1 167 ? 33.454 20.053 45.473 1.00   33.07 ? 166  GLU A N   1 
ATOM   1213 C CA  . GLU A 1 167 ? 33.331 21.410 44.966 1.00   32.50 ? 166  GLU A CA  1 
ATOM   1214 C C   . GLU A 1 167 ? 32.514 21.446 43.687 1.00   30.85 ? 166  GLU A C   1 
ATOM   1215 O O   . GLU A 1 167 ? 32.644 20.563 42.838 1.00   31.55 ? 166  GLU A O   1 
ATOM   1216 C CB  . GLU A 1 167 ? 34.728 21.949 44.646 1.00   32.94 ? 166  GLU A CB  1 
ATOM   1217 C CG  . GLU A 1 167 ? 35.630 22.068 45.862 1.00   35.56 ? 166  GLU A CG  1 
ATOM   1218 C CD  . GLU A 1 167 ? 35.067 23.034 46.885 1.00   39.17 ? 166  GLU A CD  1 
ATOM   1219 O OE1 . GLU A 1 167 ? 34.898 24.221 46.542 1.00   41.02 ? 166  GLU A OE1 1 
ATOM   1220 O OE2 . GLU A 1 167 ? 34.765 22.600 48.020 1.00   43.39 ? 166  GLU A OE2 1 
ATOM   1221 N N   . GLU A 1 168 ? 31.684 22.467 43.536 1.00   28.99 ? 167  GLU A N   1 
ATOM   1222 C CA  . GLU A 1 168 ? 30.998 22.662 42.272 1.00   28.04 ? 167  GLU A CA  1 
ATOM   1223 C C   . GLU A 1 168 ? 31.915 23.588 41.468 1.00   25.51 ? 167  GLU A C   1 
ATOM   1224 O O   . GLU A 1 168 ? 32.037 24.769 41.793 1.00   24.29 ? 167  GLU A O   1 
ATOM   1225 C CB  . GLU A 1 168 ? 29.627 23.295 42.465 1.00   29.08 ? 167  GLU A CB  1 
ATOM   1226 C CG  . GLU A 1 168 ? 28.870 23.463 41.156 1.00   32.20 ? 167  GLU A CG  1 
ATOM   1227 C CD  . GLU A 1 168 ? 27.529 24.153 41.322 1.00   35.87 ? 167  GLU A CD  1 
ATOM   1228 O OE1 . GLU A 1 168 ? 27.266 24.743 42.400 1.00   39.89 ? 167  GLU A OE1 1 
ATOM   1229 O OE2 . GLU A 1 168 ? 26.742 24.115 40.359 1.00   37.16 ? 167  GLU A OE2 1 
ATOM   1230 N N   . LEU A 1 169 ? 32.576 23.030 40.458 1.00   23.33 ? 168  LEU A N   1 
ATOM   1231 C CA  . LEU A 1 169 ? 33.572 23.763 39.688 1.00   21.89 ? 168  LEU A CA  1 
ATOM   1232 C C   . LEU A 1 169 ? 33.253 23.985 38.208 1.00   19.87 ? 168  LEU A C   1 
ATOM   1233 O O   . LEU A 1 169 ? 33.718 24.955 37.637 1.00   19.49 ? 168  LEU A O   1 
ATOM   1234 C CB  . LEU A 1 169 ? 34.925 23.068 39.813 1.00   21.95 ? 168  LEU A CB  1 
ATOM   1235 C CG  . LEU A 1 169 ? 35.529 23.107 41.233 1.00   23.32 ? 168  LEU A CG  1 
ATOM   1236 C CD1 . LEU A 1 169 ? 36.756 22.260 41.308 1.00   25.24 ? 168  LEU A CD1 1 
ATOM   1237 C CD2 . LEU A 1 169 ? 35.855 24.518 41.677 1.00   24.89 ? 168  LEU A CD2 1 
ATOM   1238 N N   . LEU A 1 170 ? 32.460 23.099 37.609 1.00   18.43 ? 169  LEU A N   1 
ATOM   1239 C CA  . LEU A 1 170 ? 32.098 23.184 36.187 1.00   17.54 ? 169  LEU A CA  1 
ATOM   1240 C C   . LEU A 1 170 ? 30.591 23.184 35.940 1.00   17.38 ? 169  LEU A C   1 
ATOM   1241 O O   . LEU A 1 170 ? 29.835 22.611 36.726 1.00   17.40 ? 169  LEU A O   1 
ATOM   1242 C CB  . LEU A 1 170 ? 32.703 22.012 35.415 1.00   17.33 ? 169  LEU A CB  1 
ATOM   1243 C CG  . LEU A 1 170 ? 34.206 21.795 35.589 1.00   17.10 ? 169  LEU A CG  1 
ATOM   1244 C CD1 . LEU A 1 170 ? 34.590 20.445 35.022 1.00   18.19 ? 169  LEU A CD1 1 
ATOM   1245 C CD2 . LEU A 1 170 ? 35.016 22.871 34.913 1.00   17.24 ? 169  LEU A CD2 1 
ATOM   1246 N N   . PRO A 1 171 ? 30.142 23.810 34.851 1.00   17.05 ? 170  PRO A N   1 
ATOM   1247 C CA  . PRO A 1 171 ? 28.718 23.754 34.510 1.00   17.58 ? 170  PRO A CA  1 
ATOM   1248 C C   . PRO A 1 171 ? 28.353 22.293 34.248 1.00   17.74 ? 170  PRO A C   1 
ATOM   1249 O O   . PRO A 1 171 ? 29.154 21.537 33.718 1.00   17.22 ? 170  PRO A O   1 
ATOM   1250 C CB  . PRO A 1 171 ? 28.616 24.590 33.230 1.00   17.57 ? 170  PRO A CB  1 
ATOM   1251 C CG  . PRO A 1 171 ? 29.846 25.440 33.224 1.00   17.08 ? 170  PRO A CG  1 
ATOM   1252 C CD  . PRO A 1 171 ? 30.900 24.616 33.879 1.00   17.05 ? 170  PRO A CD  1 
ATOM   1253 N N   . LYS A 1 172 ? 27.173 21.898 34.673 1.00   19.35 ? 171  LYS A N   1 
ATOM   1254 C CA  . LYS A 1 172 ? 26.688 20.529 34.439 1.00   20.85 ? 171  LYS A CA  1 
ATOM   1255 C C   . LYS A 1 172 ? 26.673 20.200 32.948 1.00   20.92 ? 171  LYS A C   1 
ATOM   1256 O O   . LYS A 1 172 ? 27.040 19.088 32.531 1.00   20.51 ? 171  LYS A O   1 
ATOM   1257 C CB  . LYS A 1 172 ? 25.307 20.349 35.055 1.00   21.67 ? 171  LYS A CB  1 
ATOM   1258 C CG  . LYS A 1 172 ? 25.362 20.059 36.532 1.00   26.43 ? 171  LYS A CG  1 
ATOM   1259 C CD  . LYS A 1 172 ? 23.970 19.941 37.128 1.00   31.77 ? 171  LYS A CD  1 
ATOM   1260 C CE  . LYS A 1 172 ? 23.997 19.994 38.640 1.00   33.87 ? 171  LYS A CE  1 
ATOM   1261 N NZ  . LYS A 1 172 ? 22.694 20.524 39.168 1.00   38.03 ? 171  LYS A NZ  1 
ATOM   1262 N N   . ARG A 1 173 ? 26.283 21.183 32.144 1.00   21.63 ? 172  ARG A N   1 
ATOM   1263 C CA  . ARG A 1 173 ? 26.319 21.071 30.690 1.00   22.25 ? 172  ARG A CA  1 
ATOM   1264 C C   . ARG A 1 173 ? 27.673 20.553 30.196 1.00   22.26 ? 172  ARG A C   1 
ATOM   1265 O O   . ARG A 1 173 ? 27.754 19.692 29.309 1.00   22.54 ? 172  ARG A O   1 
ATOM   1266 C CB  . ARG A 1 173 ? 26.035 22.445 30.071 1.00   23.36 ? 172  ARG A CB  1 
ATOM   1267 C CG  . ARG A 1 173 ? 25.748 22.450 28.588 1.00   25.78 ? 172  ARG A CG  1 
ATOM   1268 C CD  . ARG A 1 173 ? 25.844 23.829 27.958 1.00   28.27 ? 172  ARG A CD  1 
ATOM   1269 N NE  . ARG A 1 173 ? 27.245 24.241 27.813 1.00   29.54 ? 172  ARG A NE  1 
ATOM   1270 C CZ  . ARG A 1 173 ? 28.004 23.894 26.783 1.00   31.57 ? 172  ARG A CZ  1 
ATOM   1271 N NH1 . ARG A 1 173 ? 27.493 23.144 25.807 1.00   31.16 ? 172  ARG A NH1 1 
ATOM   1272 N NH2 . ARG A 1 173 ? 29.270 24.288 26.716 1.00   32.10 ? 172  ARG A NH2 1 
ATOM   1273 N N   . VAL A 1 174 ? 28.747 21.079 30.761 1.00   21.28 ? 173  VAL A N   1 
ATOM   1274 C CA  . VAL A 1 174 ? 30.074 20.700 30.336 1.00   21.47 ? 173  VAL A CA  1 
ATOM   1275 C C   . VAL A 1 174 ? 30.403 19.285 30.769 1.00   22.25 ? 173  VAL A C   1 
ATOM   1276 O O   . VAL A 1 174 ? 30.936 18.496 29.991 1.00   21.94 ? 173  VAL A O   1 
ATOM   1277 C CB  . VAL A 1 174 ? 31.120 21.665 30.909 1.00   21.14 ? 173  VAL A CB  1 
ATOM   1278 C CG1 . VAL A 1 174 ? 32.523 21.126 30.718 1.00   21.74 ? 173  VAL A CG1 1 
ATOM   1279 C CG2 . VAL A 1 174 ? 30.938 23.009 30.257 1.00   19.31 ? 173  VAL A CG2 1 
ATOM   1280 N N   . ILE A 1 175 ? 30.130 18.985 32.023 1.00   23.41 ? 174  ILE A N   1 
ATOM   1281 C CA  . ILE A 1 175 ? 30.353 17.631 32.530 1.00   25.11 ? 174  ILE A CA  1 
ATOM   1282 C C   . ILE A 1 175 ? 29.652 16.577 31.649 1.00   25.64 ? 174  ILE A C   1 
ATOM   1283 O O   . ILE A 1 175 ? 30.202 15.491 31.364 1.00   27.26 ? 174  ILE A O   1 
ATOM   1284 C CB  . ILE A 1 175 ? 29.854 17.542 33.989 1.00   25.68 ? 174  ILE A CB  1 
ATOM   1285 C CG1 . ILE A 1 175 ? 30.802 18.307 34.919 1.00   27.12 ? 174  ILE A CG1 1 
ATOM   1286 C CG2 . ILE A 1 175 ? 29.761 16.074 34.438 1.00   25.72 ? 174  ILE A CG2 1 
ATOM   1287 C CD1 . ILE A 1 175 ? 30.216 18.643 36.281 1.00   27.43 ? 174  ILE A CD1 1 
ATOM   1288 N N   . ASN A 1 176 ? 28.452 16.897 31.196 1.00   25.83 ? 175  ASN A N   1 
ATOM   1289 C CA  . ASN A 1 176 ? 27.643 15.947 30.442 1.00   26.34 ? 175  ASN A CA  1 
ATOM   1290 C C   . ASN A 1 176 ? 27.963 15.834 28.959 1.00   25.65 ? 175  ASN A C   1 
ATOM   1291 O O   . ASN A 1 176 ? 27.316 15.055 28.248 1.00   26.14 ? 175  ASN A O   1 
ATOM   1292 C CB  . ASN A 1 176 ? 26.169 16.276 30.611 1.00   27.08 ? 175  ASN A CB  1 
ATOM   1293 C CG  . ASN A 1 176 ? 25.675 16.000 32.006 1.00   28.85 ? 175  ASN A CG  1 
ATOM   1294 O OD1 . ASN A 1 176 ? 26.217 15.155 32.723 1.00   34.38 ? 175  ASN A OD1 1 
ATOM   1295 N ND2 . ASN A 1 176 ? 24.649 16.720 32.407 1.00   32.21 ? 175  ASN A ND2 1 
ATOM   1296 N N   . LEU A 1 177 ? 28.922 16.616 28.484 1.00   23.98 ? 176  LEU A N   1 
ATOM   1297 C CA  . LEU A 1 177 ? 29.340 16.561 27.095 1.00   24.57 ? 176  LEU A CA  1 
ATOM   1298 C C   . LEU A 1 177 ? 30.402 15.498 26.881 1.00   23.10 ? 176  LEU A C   1 
ATOM   1299 O O   . LEU A 1 177 ? 30.720 15.179 25.756 1.00   23.45 ? 176  LEU A O   1 
ATOM   1300 C CB  . LEU A 1 177 ? 29.952 17.889 26.649 1.00   25.00 ? 176  LEU A CB  1 
ATOM   1301 C CG  . LEU A 1 177 ? 29.071 19.115 26.514 1.00   28.30 ? 176  LEU A CG  1 
ATOM   1302 C CD1 . LEU A 1 177 ? 29.991 20.317 26.293 1.00   30.72 ? 176  LEU A CD1 1 
ATOM   1303 C CD2 . LEU A 1 177 ? 28.095 18.973 25.388 1.00   30.64 ? 176  LEU A CD2 1 
ATOM   1304 N N   . TYR A 1 178 ? 30.945 14.940 27.957 1.00   22.84 ? 177  TYR A N   1 
ATOM   1305 C CA  . TYR A 1 178 ? 32.047 13.990 27.836 1.00   22.85 ? 177  TYR A CA  1 
ATOM   1306 C C   . TYR A 1 178 ? 31.831 12.755 28.675 1.00   22.31 ? 177  TYR A C   1 
ATOM   1307 O O   . TYR A 1 178 ? 30.947 12.738 29.514 1.00   23.03 ? 177  TYR A O   1 
ATOM   1308 C CB  . TYR A 1 178 ? 33.338 14.643 28.310 1.00   23.26 ? 177  TYR A CB  1 
ATOM   1309 C CG  . TYR A 1 178 ? 33.732 15.846 27.490 1.00   23.94 ? 177  TYR A CG  1 
ATOM   1310 C CD1 . TYR A 1 178 ? 34.538 15.709 26.380 1.00   26.08 ? 177  TYR A CD1 1 
ATOM   1311 C CD2 . TYR A 1 178 ? 33.268 17.112 27.819 1.00   25.51 ? 177  TYR A CD2 1 
ATOM   1312 C CE1 . TYR A 1 178 ? 34.899 16.818 25.604 1.00   27.02 ? 177  TYR A CE1 1 
ATOM   1313 C CE2 . TYR A 1 178 ? 33.598 18.222 27.051 1.00   25.29 ? 177  TYR A CE2 1 
ATOM   1314 C CZ  . TYR A 1 178 ? 34.425 18.075 25.954 1.00   26.66 ? 177  TYR A CZ  1 
ATOM   1315 O OH  . TYR A 1 178 ? 34.762 19.186 25.208 1.00   25.99 ? 177  TYR A OH  1 
ATOM   1316 N N   . GLN A 1 179 ? 32.671 11.748 28.451 1.00   22.51 ? 178  GLN A N   1 
ATOM   1317 C CA  . GLN A 1 179 ? 32.718 10.568 29.325 1.00   22.34 ? 178  GLN A CA  1 
ATOM   1318 C C   . GLN A 1 179 ? 33.877 10.738 30.290 1.00   22.85 ? 178  GLN A C   1 
ATOM   1319 O O   . GLN A 1 179 ? 34.837 9.976  30.262 1.00   23.39 ? 178  GLN A O   1 
ATOM   1320 C CB  . GLN A 1 179 ? 32.912 9.276  28.516 1.00   22.04 ? 178  GLN A CB  1 
ATOM   1321 C CG  . GLN A 1 179 ? 31.658 8.845  27.833 1.00   20.83 ? 178  GLN A CG  1 
ATOM   1322 C CD  . GLN A 1 179 ? 31.803 7.536  27.063 1.00   18.93 ? 178  GLN A CD  1 
ATOM   1323 O OE1 . GLN A 1 179 ? 32.919 7.002  26.907 1.00   23.20 ? 178  GLN A OE1 1 
ATOM   1324 N NE2 . GLN A 1 179 ? 30.692 7.036  26.577 1.00   14.95 ? 178  GLN A NE2 1 
ATOM   1325 N N   . MET A 1 180 ? 33.800 11.734 31.161 1.00   23.10 ? 179  MET A N   1 
ATOM   1326 C CA  . MET A 1 180 ? 34.905 11.965 32.085 1.00   23.43 ? 179  MET A CA  1 
ATOM   1327 C C   . MET A 1 180 ? 34.422 11.906 33.511 1.00   22.51 ? 179  MET A C   1 
ATOM   1328 O O   . MET A 1 180 ? 33.377 12.456 33.816 1.00   22.62 ? 179  MET A O   1 
ATOM   1329 C CB  . MET A 1 180 ? 35.557 13.313 31.794 1.00   23.85 ? 179  MET A CB  1 
ATOM   1330 C CG  . MET A 1 180 ? 36.303 13.302 30.505 1.00   28.60 ? 179  MET A CG  1 
ATOM   1331 S SD  . MET A 1 180 ? 37.078 14.840 30.114 1.00   36.70 ? 179  MET A SD  1 
ATOM   1332 C CE  . MET A 1 180 ? 38.080 15.198 31.604 1.00   34.04 ? 179  MET A CE  1 
ATOM   1333 N N   . THR A 1 181 ? 35.161 11.204 34.371 1.00   22.31 ? 180  THR A N   1 
ATOM   1334 C CA  . THR A 1 181 ? 34.822 11.088 35.778 1.00   22.84 ? 180  THR A CA  1 
ATOM   1335 C C   . THR A 1 181 ? 35.224 12.370 36.485 1.00   23.59 ? 180  THR A C   1 
ATOM   1336 O O   . THR A 1 181 ? 36.029 13.138 35.956 1.00   22.79 ? 180  THR A O   1 
ATOM   1337 C CB  . THR A 1 181 ? 35.590 9.952  36.455 1.00   22.85 ? 180  THR A CB  1 
ATOM   1338 O OG1 . THR A 1 181 ? 36.996 10.106 36.238 1.00   24.05 ? 180  THR A OG1 1 
ATOM   1339 C CG2 . THR A 1 181 ? 35.243 8.608  35.833 1.00   23.51 ? 180  THR A CG2 1 
ATOM   1340 N N   . PRO A 1 182 ? 34.704 12.561 37.686 1.00   23.96 ? 181  PRO A N   1 
ATOM   1341 C CA  . PRO A 1 182 ? 35.058 13.724 38.501 1.00   24.65 ? 181  PRO A CA  1 
ATOM   1342 C C   . PRO A 1 182 ? 36.551 13.798 38.720 1.00   24.78 ? 181  PRO A C   1 
ATOM   1343 O O   . PRO A 1 182 ? 37.093 14.905 38.655 1.00   24.89 ? 181  PRO A O   1 
ATOM   1344 C CB  . PRO A 1 182 ? 34.306 13.468 39.806 1.00   24.21 ? 181  PRO A CB  1 
ATOM   1345 C CG  . PRO A 1 182 ? 33.135 12.683 39.377 1.00   24.76 ? 181  PRO A CG  1 
ATOM   1346 C CD  . PRO A 1 182 ? 33.702 11.721 38.367 1.00   24.70 ? 181  PRO A CD  1 
ATOM   1347 N N   . GLU A 1 183 ? 37.217 12.663 38.946 1.00   25.08 ? 182  GLU A N   1 
ATOM   1348 C CA  . GLU A 1 183 ? 38.670 12.673 39.111 1.00   25.74 ? 182  GLU A CA  1 
ATOM   1349 C C   . GLU A 1 183 ? 39.417 13.117 37.831 1.00   24.88 ? 182  GLU A C   1 
ATOM   1350 O O   . GLU A 1 183 ? 40.488 13.766 37.904 1.00   24.17 ? 182  GLU A O   1 
ATOM   1351 C CB  . GLU A 1 183 ? 39.168 11.302 39.589 1.00   27.17 ? 182  GLU A CB  1 
ATOM   1352 C CG  . GLU A 1 183 ? 40.645 11.263 39.947 1.00   30.49 ? 182  GLU A CG  1 
ATOM   1353 C CD  . GLU A 1 183 ? 41.118 9.869  40.353 1.00   36.28 ? 182  GLU A CD  1 
ATOM   1354 O OE1 . GLU A 1 183 ? 40.272 9.060  40.809 1.00   40.11 ? 182  GLU A OE1 1 
ATOM   1355 O OE2 . GLU A 1 183 ? 42.332 9.578  40.201 1.00   38.92 ? 182  GLU A OE2 1 
ATOM   1356 N N   . MET A 1 184 ? 38.877 12.773 36.663 1.00   23.66 ? 183  MET A N   1 
ATOM   1357 C CA  . MET A 1 184 ? 39.487 13.197 35.407 1.00   22.95 ? 183  MET A CA  1 
ATOM   1358 C C   . MET A 1 184 ? 39.359 14.733 35.240 1.00   21.93 ? 183  MET A C   1 
ATOM   1359 O O   . MET A 1 184 ? 40.305 15.395 34.812 1.00   21.37 ? 183  MET A O   1 
ATOM   1360 C CB  . MET A 1 184 ? 38.855 12.467 34.223 1.00   23.04 ? 183  MET A CB  1 
ATOM   1361 C CG  . MET A 1 184 ? 39.187 10.964 34.215 1.00   26.97 ? 183  MET A CG  1 
ATOM   1362 S SD  . MET A 1 184 ? 38.209 10.041 33.052 1.00   32.66 ? 183  MET A SD  1 
ATOM   1363 C CE  . MET A 1 184 ? 38.975 10.501 31.578 1.00   31.78 ? 183  MET A CE  1 
ATOM   1364 N N   . TRP A 1 185 ? 38.202 15.288 35.576 1.00   20.83 ? 184  TRP A N   1 
ATOM   1365 C CA  . TRP A 1 185 ? 38.040 16.738 35.514 1.00   20.86 ? 184  TRP A CA  1 
ATOM   1366 C C   . TRP A 1 185 ? 38.959 17.414 36.552 1.00   21.14 ? 184  TRP A C   1 
ATOM   1367 O O   . TRP A 1 185 ? 39.567 18.455 36.295 1.00   19.38 ? 184  TRP A O   1 
ATOM   1368 C CB  . TRP A 1 185 ? 36.595 17.123 35.773 1.00   20.00 ? 184  TRP A CB  1 
ATOM   1369 C CG  . TRP A 1 185 ? 35.658 16.899 34.615 1.00   20.28 ? 184  TRP A CG  1 
ATOM   1370 C CD1 . TRP A 1 185 ? 34.575 16.051 34.578 1.00   21.53 ? 184  TRP A CD1 1 
ATOM   1371 C CD2 . TRP A 1 185 ? 35.705 17.534 33.347 1.00   19.92 ? 184  TRP A CD2 1 
ATOM   1372 N NE1 . TRP A 1 185 ? 33.948 16.141 33.358 1.00   21.85 ? 184  TRP A NE1 1 
ATOM   1373 C CE2 . TRP A 1 185 ? 34.624 17.042 32.583 1.00   20.85 ? 184  TRP A CE2 1 
ATOM   1374 C CE3 . TRP A 1 185 ? 36.535 18.496 32.778 1.00   21.44 ? 184  TRP A CE3 1 
ATOM   1375 C CZ2 . TRP A 1 185 ? 34.374 17.474 31.289 1.00   20.39 ? 184  TRP A CZ2 1 
ATOM   1376 C CZ3 . TRP A 1 185 ? 36.289 18.910 31.503 1.00   20.55 ? 184  TRP A CZ3 1 
ATOM   1377 C CH2 . TRP A 1 185 ? 35.221 18.408 30.769 1.00   21.20 ? 184  TRP A CH2 1 
ATOM   1378 N N   . GLU A 1 186 ? 39.064 16.808 37.730 1.00   21.89 ? 185  GLU A N   1 
ATOM   1379 C CA  . GLU A 1 186 ? 39.926 17.340 38.763 1.00   22.05 ? 185  GLU A CA  1 
ATOM   1380 C C   . GLU A 1 186 ? 41.367 17.423 38.258 1.00   21.57 ? 185  GLU A C   1 
ATOM   1381 O O   . GLU A 1 186 ? 42.069 18.395 38.538 1.00   21.09 ? 185  GLU A O   1 
ATOM   1382 C CB  . GLU A 1 186 ? 39.843 16.492 40.041 1.00   23.37 ? 185  GLU A CB  1 
ATOM   1383 C CG  . GLU A 1 186 ? 40.844 16.934 41.101 1.00   25.10 ? 185  GLU A CG  1 
ATOM   1384 C CD  . GLU A 1 186 ? 40.798 16.074 42.356 1.00   29.42 ? 185  GLU A CD  1 
ATOM   1385 O OE1 . GLU A 1 186 ? 39.854 16.216 43.158 1.00   30.19 ? 185  GLU A OE1 1 
ATOM   1386 O OE2 . GLU A 1 186 ? 41.723 15.264 42.533 1.00   33.10 ? 185  GLU A OE2 1 
ATOM   1387 N N   . GLU A 1 187 ? 41.799 16.412 37.501 1.00   20.42 ? 186  GLU A N   1 
ATOM   1388 C CA  . GLU A 1 187 ? 43.118 16.394 36.917 1.00   20.55 ? 186  GLU A CA  1 
ATOM   1389 C C   . GLU A 1 187 ? 43.303 17.575 35.954 1.00   19.54 ? 186  GLU A C   1 
ATOM   1390 O O   . GLU A 1 187 ? 44.310 18.267 36.007 1.00   20.83 ? 186  GLU A O   1 
ATOM   1391 C CB  . GLU A 1 187 ? 43.365 15.069 36.197 1.00   21.16 ? 186  GLU A CB  1 
ATOM   1392 C CG  . GLU A 1 187 ? 44.721 14.927 35.550 1.00   24.53 ? 186  GLU A CG  1 
ATOM   1393 C CD  . GLU A 1 187 ? 45.147 13.462 35.414 1.00   31.83 ? 186  GLU A CD  1 
ATOM   1394 O OE1 . GLU A 1 187 ? 44.262 12.577 35.393 1.00   35.28 ? 186  GLU A OE1 1 
ATOM   1395 O OE2 . GLU A 1 187 ? 46.366 13.198 35.334 1.00   34.83 ? 186  GLU A OE2 1 
ATOM   1396 N N   . ARG A 1 188 ? 42.327 17.802 35.086 1.00   18.42 ? 187  ARG A N   1 
ATOM   1397 C CA  . ARG A 1 188 ? 42.401 18.912 34.136 1.00   17.84 ? 187  ARG A CA  1 
ATOM   1398 C C   . ARG A 1 188 ? 42.491 20.243 34.912 1.00   17.04 ? 187  ARG A C   1 
ATOM   1399 O O   . ARG A 1 188 ? 43.306 21.088 34.603 1.00   16.64 ? 187  ARG A O   1 
ATOM   1400 C CB  . ARG A 1 188 ? 41.160 18.911 33.232 1.00   18.34 ? 187  ARG A CB  1 
ATOM   1401 C CG  . ARG A 1 188 ? 41.070 17.705 32.269 1.00   18.84 ? 187  ARG A CG  1 
ATOM   1402 C CD  . ARG A 1 188 ? 42.206 17.647 31.220 1.00   20.17 ? 187  ARG A CD  1 
ATOM   1403 N NE  . ARG A 1 188 ? 42.476 19.008 30.770 1.00   20.38 ? 187  ARG A NE  1 
ATOM   1404 C CZ  . ARG A 1 188 ? 41.760 19.681 29.854 1.00   23.34 ? 187  ARG A CZ  1 
ATOM   1405 N NH1 . ARG A 1 188 ? 40.782 19.105 29.153 1.00   24.40 ? 187  ARG A NH1 1 
ATOM   1406 N NH2 . ARG A 1 188 ? 42.059 20.945 29.617 1.00   23.35 ? 187  ARG A NH2 1 
ATOM   1407 N N   . ILE A 1 189 ? 41.654 20.403 35.916 1.00   16.83 ? 188  ILE A N   1 
ATOM   1408 C CA  . ILE A 1 189 ? 41.595 21.665 36.675 1.00   17.15 ? 188  ILE A CA  1 
ATOM   1409 C C   . ILE A 1 189 ? 42.906 21.863 37.440 1.00   17.20 ? 188  ILE A C   1 
ATOM   1410 O O   . ILE A 1 189 ? 43.500 22.961 37.456 1.00   16.71 ? 188  ILE A O   1 
ATOM   1411 C CB  . ILE A 1 189 ? 40.401 21.649 37.627 1.00   16.78 ? 188  ILE A CB  1 
ATOM   1412 C CG1 . ILE A 1 189 ? 39.106 21.658 36.817 1.00   17.04 ? 188  ILE A CG1 1 
ATOM   1413 C CG2 . ILE A 1 189 ? 40.422 22.869 38.537 1.00   18.66 ? 188  ILE A CG2 1 
ATOM   1414 C CD1 . ILE A 1 189 ? 37.934 21.376 37.573 1.00   16.74 ? 188  ILE A CD1 1 
ATOM   1415 N N   . THR A 1 190 ? 43.388 20.794 38.057 1.00   17.25 ? 189  THR A N   1 
ATOM   1416 C CA  . THR A 1 190 ? 44.649 20.857 38.812 1.00   17.56 ? 189  THR A CA  1 
ATOM   1417 C C   . THR A 1 190 ? 45.858 21.218 37.964 1.00   17.78 ? 189  THR A C   1 
ATOM   1418 O O   . THR A 1 190 ? 46.743 21.969 38.412 1.00   18.83 ? 189  THR A O   1 
ATOM   1419 C CB  . THR A 1 190 ? 44.899 19.524 39.533 1.00   18.07 ? 189  THR A CB  1 
ATOM   1420 O OG1 . THR A 1 190 ? 43.885 19.316 40.524 1.00   18.76 ? 189  THR A OG1 1 
ATOM   1421 C CG2 . THR A 1 190 ? 46.220 19.563 40.314 1.00   18.76 ? 189  THR A CG2 1 
ATOM   1422 N N   . ALA A 1 191 ? 45.922 20.697 36.741 1.00   16.97 ? 190  ALA A N   1 
ATOM   1423 C CA  . ALA A 1 191 ? 47.021 21.032 35.841 1.00   16.64 ? 190  ALA A CA  1 
ATOM   1424 C C   . ALA A 1 191 ? 47.154 22.569 35.671 1.00   16.16 ? 190  ALA A C   1 
ATOM   1425 O O   . ALA A 1 191 ? 48.256 23.139 35.711 1.00   15.98 ? 190  ALA A O   1 
ATOM   1426 C CB  . ALA A 1 191 ? 46.818 20.386 34.513 1.00   17.50 ? 190  ALA A CB  1 
ATOM   1427 N N   . TRP A 1 192 ? 46.029 23.222 35.444 1.00   14.58 ? 191  TRP A N   1 
ATOM   1428 C CA  . TRP A 1 192 ? 46.017 24.685 35.336 1.00   14.06 ? 191  TRP A CA  1 
ATOM   1429 C C   . TRP A 1 192 ? 46.319 25.355 36.681 1.00   14.34 ? 191  TRP A C   1 
ATOM   1430 O O   . TRP A 1 192 ? 47.063 26.323 36.731 1.00   14.42 ? 191  TRP A O   1 
ATOM   1431 C CB  . TRP A 1 192 ? 44.674 25.183 34.815 1.00   13.91 ? 191  TRP A CB  1 
ATOM   1432 C CG  . TRP A 1 192 ? 44.523 25.292 33.306 1.00   12.78 ? 191  TRP A CG  1 
ATOM   1433 C CD1 . TRP A 1 192 ? 43.645 24.587 32.515 1.00   14.99 ? 191  TRP A CD1 1 
ATOM   1434 C CD2 . TRP A 1 192 ? 45.245 26.153 32.415 1.00   12.95 ? 191  TRP A CD2 1 
ATOM   1435 N NE1 . TRP A 1 192 ? 43.772 24.969 31.206 1.00   14.10 ? 191  TRP A NE1 1 
ATOM   1436 C CE2 . TRP A 1 192 ? 44.734 25.942 31.117 1.00   13.41 ? 191  TRP A CE2 1 
ATOM   1437 C CE3 . TRP A 1 192 ? 46.248 27.119 32.587 1.00   13.91 ? 191  TRP A CE3 1 
ATOM   1438 C CZ2 . TRP A 1 192 ? 45.230 26.609 30.001 1.00   12.78 ? 191  TRP A CZ2 1 
ATOM   1439 C CZ3 . TRP A 1 192 ? 46.722 27.783 31.493 1.00   13.59 ? 191  TRP A CZ3 1 
ATOM   1440 C CH2 . TRP A 1 192 ? 46.211 27.539 30.218 1.00   13.30 ? 191  TRP A CH2 1 
ATOM   1441 N N   . TYR A 1 193 ? 45.700 24.853 37.747 1.00   14.63 ? 192  TYR A N   1 
ATOM   1442 C CA  . TYR A 1 193 ? 45.817 25.391 39.100 1.00   14.89 ? 192  TYR A CA  1 
ATOM   1443 C C   . TYR A 1 193 ? 47.297 25.441 39.463 1.00   16.49 ? 192  TYR A C   1 
ATOM   1444 O O   . TYR A 1 193 ? 47.810 26.456 39.968 1.00   16.03 ? 192  TYR A O   1 
ATOM   1445 C CB  . TYR A 1 193 ? 45.017 24.482 40.025 1.00   15.15 ? 192  TYR A CB  1 
ATOM   1446 C CG  . TYR A 1 193 ? 45.125 24.694 41.520 1.00   13.90 ? 192  TYR A CG  1 
ATOM   1447 C CD1 . TYR A 1 193 ? 44.976 23.617 42.383 1.00   17.07 ? 192  TYR A CD1 1 
ATOM   1448 C CD2 . TYR A 1 193 ? 45.307 25.943 42.074 1.00   16.26 ? 192  TYR A CD2 1 
ATOM   1449 C CE1 . TYR A 1 193 ? 45.062 23.760 43.750 1.00   16.98 ? 192  TYR A CE1 1 
ATOM   1450 C CE2 . TYR A 1 193 ? 45.394 26.097 43.463 1.00   17.36 ? 192  TYR A CE2 1 
ATOM   1451 C CZ  . TYR A 1 193 ? 45.267 25.011 44.289 1.00   18.37 ? 192  TYR A CZ  1 
ATOM   1452 O OH  . TYR A 1 193 ? 45.322 25.160 45.670 1.00   21.18 ? 192  TYR A OH  1 
ATOM   1453 N N   . ALA A 1 194 ? 48.008 24.371 39.125 1.00   17.05 ? 193  ALA A N   1 
ATOM   1454 C CA  . ALA A 1 194 ? 49.442 24.325 39.399 1.00   18.39 ? 193  ALA A CA  1 
ATOM   1455 C C   . ALA A 1 194 ? 50.227 25.479 38.754 1.00   18.66 ? 193  ALA A C   1 
ATOM   1456 O O   . ALA A 1 194 ? 51.257 25.895 39.289 1.00   20.21 ? 193  ALA A O   1 
ATOM   1457 C CB  . ALA A 1 194 ? 50.015 23.007 38.956 1.00   18.51 ? 193  ALA A CB  1 
ATOM   1458 N N   . GLU A 1 195 ? 49.752 25.989 37.620 1.00   17.71 ? 194  GLU A N   1 
ATOM   1459 C CA  . GLU A 1 195 ? 50.426 27.079 36.926 1.00   17.44 ? 194  GLU A CA  1 
ATOM   1460 C C   . GLU A 1 195 ? 50.139 28.445 37.534 1.00   17.66 ? 194  GLU A C   1 
ATOM   1461 O O   . GLU A 1 195 ? 50.781 29.409 37.149 1.00   18.68 ? 194  GLU A O   1 
ATOM   1462 C CB  . GLU A 1 195 ? 50.083 27.079 35.424 1.00   17.79 ? 194  GLU A CB  1 
ATOM   1463 C CG  . GLU A 1 195 ? 50.548 25.767 34.806 1.00   16.83 ? 194  GLU A CG  1 
ATOM   1464 C CD  . GLU A 1 195 ? 50.459 25.619 33.310 1.00   15.43 ? 194  GLU A CD  1 
ATOM   1465 O OE1 . GLU A 1 195 ? 50.152 26.578 32.556 1.00   13.55 ? 194  GLU A OE1 1 
ATOM   1466 O OE2 . GLU A 1 195 ? 50.724 24.451 32.922 1.00   14.89 ? 194  GLU A OE2 1 
ATOM   1467 N N   . HIS A 1 196 ? 49.177 28.530 38.454 1.00   17.37 ? 195  HIS A N   1 
ATOM   1468 C CA  . HIS A 1 196 ? 48.836 29.822 39.077 1.00   17.73 ? 195  HIS A CA  1 
ATOM   1469 C C   . HIS A 1 196 ? 49.587 30.044 40.399 1.00   18.36 ? 195  HIS A C   1 
ATOM   1470 O O   . HIS A 1 196 ? 49.302 31.018 41.084 1.00   18.52 ? 195  HIS A O   1 
ATOM   1471 C CB  . HIS A 1 196 ? 47.337 29.927 39.374 1.00   17.20 ? 195  HIS A CB  1 
ATOM   1472 C CG  . HIS A 1 196 ? 46.475 29.670 38.183 1.00   15.47 ? 195  HIS A CG  1 
ATOM   1473 N ND1 . HIS A 1 196 ? 46.865 29.984 36.901 1.00   16.14 ? 195  HIS A ND1 1 
ATOM   1474 C CD2 . HIS A 1 196 ? 45.247 29.111 38.082 1.00   16.92 ? 195  HIS A CD2 1 
ATOM   1475 C CE1 . HIS A 1 196 ? 45.908 29.631 36.061 1.00   16.41 ? 195  HIS A CE1 1 
ATOM   1476 N NE2 . HIS A 1 196 ? 44.925 29.085 36.752 1.00   15.33 ? 195  HIS A NE2 1 
ATOM   1477 N N   . ARG A 1 197 ? 50.526 29.166 40.737 1.00   19.81 ? 196  ARG A N   1 
ATOM   1478 C CA  . ARG A 1 197 ? 51.276 29.285 41.990 1.00   20.80 ? 196  ARG A CA  1 
ATOM   1479 C C   . ARG A 1 197 ? 51.842 30.711 42.157 1.00   20.88 ? 196  ARG A C   1 
ATOM   1480 O O   . ARG A 1 197 ? 52.472 31.259 41.242 1.00   21.21 ? 196  ARG A O   1 
ATOM   1481 C CB  . ARG A 1 197 ? 52.415 28.262 42.049 1.00   22.20 ? 196  ARG A CB  1 
ATOM   1482 C CG  . ARG A 1 197 ? 51.990 26.820 42.224 1.00   26.05 ? 196  ARG A CG  1 
ATOM   1483 C CD  . ARG A 1 197 ? 53.186 25.830 42.131 1.00   32.55 ? 196  ARG A CD  1 
ATOM   1484 N NE  . ARG A 1 197 ? 52.802 24.441 41.846 1.00   36.11 ? 196  ARG A NE  1 
ATOM   1485 C CZ  . ARG A 1 197 ? 53.671 23.431 41.788 1.00   40.29 ? 196  ARG A CZ  1 
ATOM   1486 N NH1 . ARG A 1 197 ? 54.965 23.656 41.990 1.00   41.19 ? 196  ARG A NH1 1 
ATOM   1487 N NH2 . ARG A 1 197 ? 53.255 22.192 41.530 1.00   42.09 ? 196  ARG A NH2 1 
ATOM   1488 N N   . GLY A 1 198 ? 51.599 31.308 43.319 1.00   20.57 ? 197  GLY A N   1 
ATOM   1489 C CA  . GLY A 1 198 ? 52.087 32.638 43.624 1.00   20.88 ? 197  GLY A CA  1 
ATOM   1490 C C   . GLY A 1 198 ? 51.064 33.751 43.459 1.00   21.71 ? 197  GLY A C   1 
ATOM   1491 O O   . GLY A 1 198 ? 51.288 34.879 43.902 1.00   21.66 ? 197  GLY A O   1 
ATOM   1492 N N   . ARG A 1 199 ? 49.945 33.448 42.803 1.00   21.50 ? 198  ARG A N   1 
ATOM   1493 C CA  . ARG A 1 199 ? 48.911 34.431 42.569 1.00   21.95 ? 198  ARG A CA  1 
ATOM   1494 C C   . ARG A 1 199 ? 48.064 34.626 43.822 1.00   21.58 ? 198  ARG A C   1 
ATOM   1495 O O   . ARG A 1 199 ? 47.538 33.676 44.392 1.00   21.52 ? 198  ARG A O   1 
ATOM   1496 C CB  . ARG A 1 199 ? 48.059 33.993 41.360 1.00   22.01 ? 198  ARG A CB  1 
ATOM   1497 C CG  . ARG A 1 199 ? 46.993 34.974 40.896 1.00   24.52 ? 198  ARG A CG  1 
ATOM   1498 C CD  . ARG A 1 199 ? 47.533 36.262 40.288 1.00   26.18 ? 198  ARG A CD  1 
ATOM   1499 N NE  . ARG A 1 199 ? 48.364 36.088 39.103 1.00   28.71 ? 198  ARG A NE  1 
ATOM   1500 C CZ  . ARG A 1 199 ? 49.003 37.089 38.514 1.00   31.87 ? 198  ARG A CZ  1 
ATOM   1501 N NH1 . ARG A 1 199 ? 48.908 38.320 39.015 1.00   32.57 ? 198  ARG A NH1 1 
ATOM   1502 N NH2 . ARG A 1 199 ? 49.749 36.872 37.440 1.00   32.91 ? 198  ARG A NH2 1 
ATOM   1503 N N   . ALA A 1 200 ? 47.956 35.875 44.271 1.00   21.92 ? 199  ALA A N   1 
ATOM   1504 C CA  . ALA A 1 200 ? 47.098 36.189 45.412 1.00   21.87 ? 199  ALA A CA  1 
ATOM   1505 C C   . ALA A 1 200 ? 45.639 35.868 45.112 1.00   22.84 ? 199  ALA A C   1 
ATOM   1506 O O   . ALA A 1 200 ? 45.203 35.921 43.969 1.00   20.76 ? 199  ALA A O   1 
ATOM   1507 C CB  . ALA A 1 200 ? 47.223 37.645 45.789 1.00   22.69 ? 199  ALA A CB  1 
ATOM   1508 N N   . ARG A 1 201 ? 44.890 35.575 46.166 1.00   23.90 ? 200  ARG A N   1 
ATOM   1509 C CA  . ARG A 1 201 ? 43.491 35.191 46.036 1.00   25.23 ? 200  ARG A CA  1 
ATOM   1510 C C   . ARG A 1 201 ? 42.658 36.258 45.336 1.00   24.40 ? 200  ARG A C   1 
ATOM   1511 O O   . ARG A 1 201 ? 41.865 35.923 44.451 1.00   23.71 ? 200  ARG A O   1 
ATOM   1512 C CB  . ARG A 1 201 ? 42.914 34.788 47.405 1.00   26.65 ? 200  ARG A CB  1 
ATOM   1513 C CG  . ARG A 1 201 ? 43.702 33.643 48.081 1.00   30.82 ? 200  ARG A CG  1 
ATOM   1514 C CD  . ARG A 1 201 ? 43.034 32.997 49.291 1.00   36.49 ? 200  ARG A CD  1 
ATOM   1515 N NE  . ARG A 1 201 ? 42.783 33.940 50.379 1.00   41.01 ? 200  ARG A NE  1 
ATOM   1516 C CZ  . ARG A 1 201 ? 41.744 33.879 51.211 1.00   44.53 ? 200  ARG A CZ  1 
ATOM   1517 N NH1 . ARG A 1 201 ? 40.827 32.920 51.095 1.00   46.31 ? 200  ARG A NH1 1 
ATOM   1518 N NH2 . ARG A 1 201 ? 41.616 34.789 52.168 1.00   46.39 ? 200  ARG A NH2 1 
ATOM   1519 N N   . ASP A 1 202 ? 42.842 37.535 45.685 1.00   23.38 ? 201  ASP A N   1 
ATOM   1520 C CA  . ASP A 1 202 ? 42.086 38.606 45.028 1.00   23.48 ? 201  ASP A CA  1 
ATOM   1521 C C   . ASP A 1 202 ? 42.483 38.756 43.566 1.00   22.44 ? 201  ASP A C   1 
ATOM   1522 O O   . ASP A 1 202 ? 41.651 39.097 42.714 1.00   22.55 ? 201  ASP A O   1 
ATOM   1523 C CB  . ASP A 1 202 ? 42.201 39.948 45.767 1.00   24.02 ? 201  ASP A CB  1 
ATOM   1524 C CG  . ASP A 1 202 ? 43.592 40.543 45.708 1.00   27.26 ? 201  ASP A CG  1 
ATOM   1525 O OD1 . ASP A 1 202 ? 44.594 39.784 45.713 1.00   27.83 ? 201  ASP A OD1 1 
ATOM   1526 O OD2 . ASP A 1 202 ? 43.774 41.774 45.649 1.00   31.27 ? 201  ASP A OD2 1 
ATOM   1527 N N   . GLU A 1 203 ? 43.743 38.460 43.259 1.00   20.83 ? 202  GLU A N   1 
ATOM   1528 C CA  . GLU A 1 203 ? 44.218 38.557 41.903 1.00   20.21 ? 202  GLU A CA  1 
ATOM   1529 C C   . GLU A 1 203 ? 43.656 37.414 41.067 1.00   18.39 ? 202  GLU A C   1 
ATOM   1530 O O   . GLU A 1 203 ? 43.361 37.614 39.902 1.00   17.01 ? 202  GLU A O   1 
ATOM   1531 C CB  . GLU A 1 203 ? 45.747 38.583 41.869 1.00   21.59 ? 202  GLU A CB  1 
ATOM   1532 C CG  . GLU A 1 203 ? 46.265 39.864 42.502 1.00   24.85 ? 202  GLU A CG  1 
ATOM   1533 C CD  . GLU A 1 203 ? 47.761 40.060 42.359 1.00   29.77 ? 202  GLU A CD  1 
ATOM   1534 O OE1 . GLU A 1 203 ? 48.406 39.322 41.571 1.00   31.78 ? 202  GLU A OE1 1 
ATOM   1535 O OE2 . GLU A 1 203 ? 48.278 40.972 43.047 1.00   33.42 ? 202  GLU A OE2 1 
ATOM   1536 N N   . ALA A 1 204 ? 43.468 36.247 41.676 1.00   16.44 ? 203  ALA A N   1 
ATOM   1537 C CA  . ALA A 1 204 ? 42.914 35.111 40.957 1.00   16.31 ? 203  ALA A CA  1 
ATOM   1538 C C   . ALA A 1 204 ? 41.452 35.391 40.598 1.00   16.40 ? 203  ALA A C   1 
ATOM   1539 O O   . ALA A 1 204 ? 40.973 35.022 39.531 1.00   15.89 ? 203  ALA A O   1 
ATOM   1540 C CB  . ALA A 1 204 ? 43.012 33.881 41.770 1.00   16.37 ? 203  ALA A CB  1 
ATOM   1541 N N   . GLU A 1 205 ? 40.752 36.097 41.478 1.00   15.88 ? 204  GLU A N   1 
ATOM   1542 C CA  . GLU A 1 205 ? 39.361 36.426 41.199 1.00   15.91 ? 204  GLU A CA  1 
ATOM   1543 C C   . GLU A 1 205 ? 39.300 37.409 40.041 1.00   15.93 ? 204  GLU A C   1 
ATOM   1544 O O   . GLU A 1 205 ? 38.411 37.320 39.197 1.00   16.05 ? 204  GLU A O   1 
ATOM   1545 C CB  . GLU A 1 205 ? 38.652 36.954 42.470 1.00   15.75 ? 204  GLU A CB  1 
ATOM   1546 C CG  . GLU A 1 205 ? 38.549 35.875 43.544 1.00   16.25 ? 204  GLU A CG  1 
ATOM   1547 C CD  . GLU A 1 205 ? 37.755 36.277 44.784 1.00   19.31 ? 204  GLU A CD  1 
ATOM   1548 O OE1 . GLU A 1 205 ? 37.283 37.416 44.872 1.00   19.42 ? 204  GLU A OE1 1 
ATOM   1549 O OE2 . GLU A 1 205 ? 37.594 35.424 45.671 1.00   21.02 ? 204  GLU A OE2 1 
ATOM   1550 N N   . MET A 1 206 ? 40.245 38.345 39.984 1.00   15.57 ? 205  MET A N   1 
ATOM   1551 C CA  . MET A 1 206 ? 40.284 39.284 38.874 1.00   16.45 ? 205  MET A CA  1 
ATOM   1552 C C   . MET A 1 206 ? 40.654 38.561 37.573 1.00   16.15 ? 205  MET A C   1 
ATOM   1553 O O   . MET A 1 206 ? 40.112 38.882 36.515 1.00   15.13 ? 205  MET A O   1 
ATOM   1554 C CB  . MET A 1 206 ? 41.230 40.451 39.129 1.00   17.18 ? 205  MET A CB  1 
ATOM   1555 C CG  . MET A 1 206 ? 41.280 41.420 37.965 1.00   18.45 ? 205  MET A CG  1 
ATOM   1556 S SD  . MET A 1 206 ? 39.715 42.123 37.433 1.00   23.77 ? 205  MET A SD  1 
ATOM   1557 C CE  . MET A 1 206 ? 39.322 43.158 38.822 1.00   24.51 ? 205  MET A CE  1 
ATOM   1558 N N   . GLU A 1 207 ? 41.548 37.573 37.637 1.00   15.84 ? 206  GLU A N   1 
ATOM   1559 C CA  . GLU A 1 207 ? 41.897 36.830 36.415 1.00   16.49 ? 206  GLU A CA  1 
ATOM   1560 C C   . GLU A 1 207 ? 40.666 36.078 35.889 1.00   15.14 ? 206  GLU A C   1 
ATOM   1561 O O   . GLU A 1 207 ? 40.462 35.976 34.662 1.00   14.98 ? 206  GLU A O   1 
ATOM   1562 C CB  . GLU A 1 207 ? 43.113 35.906 36.652 1.00   17.13 ? 206  GLU A CB  1 
ATOM   1563 C CG  . GLU A 1 207 ? 44.431 36.670 36.843 1.00   20.98 ? 206  GLU A CG  1 
ATOM   1564 C CD  . GLU A 1 207 ? 44.774 37.618 35.700 1.00   24.35 ? 206  GLU A CD  1 
ATOM   1565 O OE1 . GLU A 1 207 ? 44.547 37.266 34.524 1.00   23.45 ? 206  GLU A OE1 1 
ATOM   1566 O OE2 . GLU A 1 207 ? 45.255 38.738 35.980 1.00   30.78 ? 206  GLU A OE2 1 
ATOM   1567 N N   . TYR A 1 208 ? 39.844 35.582 36.813 1.00   14.78 ? 207  TYR A N   1 
ATOM   1568 C CA  . TYR A 1 208 ? 38.594 34.893 36.489 1.00   14.71 ? 207  TYR A CA  1 
ATOM   1569 C C   . TYR A 1 208 ? 37.686 35.862 35.736 1.00   14.32 ? 207  TYR A C   1 
ATOM   1570 O O   . TYR A 1 208 ? 37.199 35.575 34.633 1.00   12.83 ? 207  TYR A O   1 
ATOM   1571 C CB  . TYR A 1 208 ? 37.879 34.394 37.747 1.00   15.03 ? 207  TYR A CB  1 
ATOM   1572 C CG  . TYR A 1 208 ? 36.636 33.577 37.478 1.00   15.85 ? 207  TYR A CG  1 
ATOM   1573 C CD1 . TYR A 1 208 ? 35.461 34.168 37.047 1.00   14.23 ? 207  TYR A CD1 1 
ATOM   1574 C CD2 . TYR A 1 208 ? 36.643 32.191 37.672 1.00   14.70 ? 207  TYR A CD2 1 
ATOM   1575 C CE1 . TYR A 1 208 ? 34.333 33.418 36.824 1.00   15.68 ? 207  TYR A CE1 1 
ATOM   1576 C CE2 . TYR A 1 208 ? 35.519 31.441 37.454 1.00   15.58 ? 207  TYR A CE2 1 
ATOM   1577 C CZ  . TYR A 1 208 ? 34.370 32.053 37.005 1.00   13.32 ? 207  TYR A CZ  1 
ATOM   1578 O OH  . TYR A 1 208 ? 33.271 31.299 36.740 1.00   14.98 ? 207  TYR A OH  1 
ATOM   1579 N N   . LEU A 1 209 ? 37.456 37.030 36.324 1.00   14.67 ? 208  LEU A N   1 
ATOM   1580 C CA  . LEU A 1 209 ? 36.641 38.048 35.676 1.00   14.28 ? 208  LEU A CA  1 
ATOM   1581 C C   . LEU A 1 209 ? 37.134 38.458 34.297 1.00   15.23 ? 208  LEU A C   1 
ATOM   1582 O O   . LEU A 1 209 ? 36.340 38.723 33.401 1.00   14.75 ? 208  LEU A O   1 
ATOM   1583 C CB  . LEU A 1 209 ? 36.522 39.304 36.567 1.00   14.70 ? 208  LEU A CB  1 
ATOM   1584 C CG  . LEU A 1 209 ? 35.595 39.132 37.751 1.00   15.65 ? 208  LEU A CG  1 
ATOM   1585 C CD1 . LEU A 1 209 ? 35.737 40.296 38.681 1.00   17.46 ? 208  LEU A CD1 1 
ATOM   1586 C CD2 . LEU A 1 209 ? 34.155 39.005 37.310 1.00   17.80 ? 208  LEU A CD2 1 
ATOM   1587 N N   . LYS A 1 210 ? 38.446 38.546 34.111 1.00   15.50 ? 209  LYS A N   1 
ATOM   1588 C CA  . LYS A 1 210 ? 38.974 38.993 32.830 1.00   16.54 ? 209  LYS A CA  1 
ATOM   1589 C C   . LYS A 1 210 ? 38.627 37.976 31.739 1.00   15.85 ? 209  LYS A C   1 
ATOM   1590 O O   . LYS A 1 210 ? 38.325 38.356 30.597 1.00   17.55 ? 209  LYS A O   1 
ATOM   1591 C CB  . LYS A 1 210 ? 40.482 39.237 32.926 1.00   16.76 ? 209  LYS A CB  1 
ATOM   1592 C CG  . LYS A 1 210 ? 40.870 40.512 33.667 1.00   20.32 ? 209  LYS A CG  1 
ATOM   1593 C CD  . LYS A 1 210 ? 42.324 40.478 34.182 1.00   24.06 ? 209  LYS A CD  1 
ATOM   1594 C CE  . LYS A 1 210 ? 43.328 40.216 33.082 1.00   26.32 ? 209  LYS A CE  1 
ATOM   1595 N NZ  . LYS A 1 210 ? 44.717 40.413 33.580 1.00   28.62 ? 209  LYS A NZ  1 
ATOM   1596 N N   . ILE A 1 211 ? 38.690 36.699 32.074 1.00   14.81 ? 210  ILE A N   1 
ATOM   1597 C CA  . ILE A 1 211 ? 38.303 35.652 31.116 1.00   16.19 ? 210  ILE A CA  1 
ATOM   1598 C C   . ILE A 1 211 ? 36.788 35.675 30.885 1.00   15.31 ? 210  ILE A C   1 
ATOM   1599 O O   . ILE A 1 211 ? 36.314 35.687 29.744 1.00   16.21 ? 210  ILE A O   1 
ATOM   1600 C CB  . ILE A 1 211 ? 38.748 34.292 31.665 1.00   15.52 ? 210  ILE A CB  1 
ATOM   1601 C CG1 . ILE A 1 211 ? 40.267 34.181 31.571 1.00   17.93 ? 210  ILE A CG1 1 
ATOM   1602 C CG2 . ILE A 1 211 ? 38.120 33.145 30.921 1.00   17.11 ? 210  ILE A CG2 1 
ATOM   1603 C CD1 . ILE A 1 211 ? 40.837 33.176 32.517 1.00   17.77 ? 210  ILE A CD1 1 
ATOM   1604 N N   . ALA A 1 212 ? 36.045 35.774 31.976 1.00   14.83 ? 211  ALA A N   1 
ATOM   1605 C CA  . ALA A 1 212 ? 34.581 35.741 31.911 1.00   14.90 ? 211  ALA A CA  1 
ATOM   1606 C C   . ALA A 1 212 ? 33.976 36.895 31.120 1.00   15.53 ? 211  ALA A C   1 
ATOM   1607 O O   . ALA A 1 212 ? 33.012 36.682 30.375 1.00   15.13 ? 211  ALA A O   1 
ATOM   1608 C CB  . ALA A 1 212 ? 33.981 35.674 33.281 1.00   15.06 ? 211  ALA A CB  1 
ATOM   1609 N N   . GLN A 1 213 ? 34.576 38.079 31.237 1.00   15.03 ? 212  GLN A N   1 
ATOM   1610 C CA  . GLN A 1 213 ? 34.023 39.279 30.614 1.00   16.81 ? 212  GLN A CA  1 
ATOM   1611 C C   . GLN A 1 213 ? 34.092 39.206 29.100 1.00   17.50 ? 212  GLN A C   1 
ATOM   1612 O O   . GLN A 1 213 ? 33.360 39.930 28.419 1.00   17.67 ? 212  GLN A O   1 
ATOM   1613 C CB  . GLN A 1 213 ? 34.648 40.591 31.166 1.00   17.38 ? 212  GLN A CB  1 
ATOM   1614 C CG  . GLN A 1 213 ? 36.038 40.827 30.791 1.00   19.50 ? 212  GLN A CG  1 
ATOM   1615 C CD  . GLN A 1 213 ? 36.526 42.233 31.135 1.00   20.76 ? 212  GLN A CD  1 
ATOM   1616 O OE1 . GLN A 1 213 ? 35.770 43.080 31.678 1.00   23.31 ? 212  GLN A OE1 1 
ATOM   1617 N NE2 . GLN A 1 213 ? 37.799 42.476 30.852 1.00   22.92 ? 212  GLN A NE2 1 
ATOM   1618 N N   . ASP A 1 214 ? 34.955 38.343 28.573 1.00   17.20 ? 213  ASP A N   1 
ATOM   1619 C CA  . ASP A 1 214 ? 35.054 38.184 27.142 1.00   18.48 ? 213  ASP A CA  1 
ATOM   1620 C C   . ASP A 1 214 ? 34.073 37.151 26.584 1.00   17.73 ? 213  ASP A C   1 
ATOM   1621 O O   . ASP A 1 214 ? 33.948 37.034 25.355 1.00   18.06 ? 213  ASP A O   1 
ATOM   1622 C CB  . ASP A 1 214 ? 36.473 37.843 26.731 1.00   19.80 ? 213  ASP A CB  1 
ATOM   1623 C CG  . ASP A 1 214 ? 37.420 39.029 26.849 1.00   22.35 ? 213  ASP A CG  1 
ATOM   1624 O OD1 . ASP A 1 214 ? 36.982 40.196 26.922 1.00   27.69 ? 213  ASP A OD1 1 
ATOM   1625 O OD2 . ASP A 1 214 ? 38.638 38.868 26.855 1.00   27.46 ? 213  ASP A OD2 1 
ATOM   1626 N N   . LEU A 1 215 ? 33.368 36.416 27.446 1.00   16.56 ? 214  LEU A N   1 
ATOM   1627 C CA  . LEU A 1 215 ? 32.354 35.467 26.956 1.00   16.09 ? 214  LEU A CA  1 
ATOM   1628 C C   . LEU A 1 215 ? 31.203 36.262 26.329 1.00   16.30 ? 214  LEU A C   1 
ATOM   1629 O O   . LEU A 1 215 ? 30.816 37.320 26.821 1.00   15.25 ? 214  LEU A O   1 
ATOM   1630 C CB  . LEU A 1 215 ? 31.855 34.550 28.064 1.00   15.81 ? 214  LEU A CB  1 
ATOM   1631 C CG  . LEU A 1 215 ? 32.946 33.615 28.638 1.00   16.17 ? 214  LEU A CG  1 
ATOM   1632 C CD1 . LEU A 1 215 ? 32.464 32.971 29.905 1.00   18.73 ? 214  LEU A CD1 1 
ATOM   1633 C CD2 . LEU A 1 215 ? 33.359 32.556 27.634 1.00   17.87 ? 214  LEU A CD2 1 
ATOM   1634 N N   . GLU A 1 216 ? 30.683 35.763 25.213 1.00   16.91 ? 215  GLU A N   1 
ATOM   1635 C CA  . GLU A 1 216 ? 29.641 36.464 24.448 1.00   17.52 ? 215  GLU A CA  1 
ATOM   1636 C C   . GLU A 1 216 ? 28.369 36.847 25.222 1.00   17.01 ? 215  GLU A C   1 
ATOM   1637 O O   . GLU A 1 216 ? 27.778 37.902 24.980 1.00   18.02 ? 215  GLU A O   1 
ATOM   1638 C CB  . GLU A 1 216 ? 29.265 35.606 23.229 1.00   18.00 ? 215  GLU A CB  1 
ATOM   1639 C CG  . GLU A 1 216 ? 30.402 35.430 22.224 1.00   22.38 ? 215  GLU A CG  1 
ATOM   1640 C CD  . GLU A 1 216 ? 30.305 34.138 21.406 1.00   28.12 ? 215  GLU A CD  1 
ATOM   1641 O OE1 . GLU A 1 216 ? 30.353 33.004 21.978 1.00   32.44 ? 215  GLU A OE1 1 
ATOM   1642 O OE2 . GLU A 1 216 ? 30.207 34.244 20.156 1.00   31.63 ? 215  GLU A OE2 1 
ATOM   1643 N N   . MET A 1 217 ? 27.948 36.018 26.167 1.00   16.34 ? 216  MET A N   1 
ATOM   1644 C CA  . MET A 1 217 ? 26.729 36.312 26.913 1.00   14.99 ? 216  MET A CA  1 
ATOM   1645 C C   . MET A 1 217 ? 26.963 37.134 28.191 1.00   15.18 ? 216  MET A C   1 
ATOM   1646 O O   . MET A 1 217 ? 26.026 37.505 28.868 1.00   13.68 ? 216  MET A O   1 
ATOM   1647 C CB  . MET A 1 217 ? 26.024 35.008 27.267 1.00   13.95 ? 216  MET A CB  1 
ATOM   1648 C CG  . MET A 1 217 ? 25.545 34.253 26.037 1.00   14.00 ? 216  MET A CG  1 
ATOM   1649 S SD  . MET A 1 217 ? 24.663 32.737 26.427 1.00   15.98 ? 216  MET A SD  1 
ATOM   1650 C CE  . MET A 1 217 ? 23.122 33.342 27.142 1.00   15.58 ? 216  MET A CE  1 
ATOM   1651 N N   . TYR A 1 218 ? 28.219 37.381 28.529 1.00   14.43 ? 217  TYR A N   1 
ATOM   1652 C CA  . TYR A 1 218 ? 28.531 38.093 29.747 1.00   14.43 ? 217  TYR A CA  1 
ATOM   1653 C C   . TYR A 1 218 ? 27.890 39.465 29.753 1.00   14.94 ? 217  TYR A C   1 
ATOM   1654 O O   . TYR A 1 218 ? 27.993 40.221 28.772 1.00   15.60 ? 217  TYR A O   1 
ATOM   1655 C CB  . TYR A 1 218 ? 30.044 38.222 29.906 1.00   14.39 ? 217  TYR A CB  1 
ATOM   1656 C CG  . TYR A 1 218 ? 30.507 39.109 31.022 1.00   13.98 ? 217  TYR A CG  1 
ATOM   1657 C CD1 . TYR A 1 218 ? 30.650 40.489 30.818 1.00   14.35 ? 217  TYR A CD1 1 
ATOM   1658 C CD2 . TYR A 1 218 ? 30.837 38.603 32.254 1.00   13.65 ? 217  TYR A CD2 1 
ATOM   1659 C CE1 . TYR A 1 218 ? 31.099 41.333 31.819 1.00   15.07 ? 217  TYR A CE1 1 
ATOM   1660 C CE2 . TYR A 1 218 ? 31.308 39.450 33.272 1.00   15.56 ? 217  TYR A CE2 1 
ATOM   1661 C CZ  . TYR A 1 218 ? 31.424 40.832 33.030 1.00   16.16 ? 217  TYR A CZ  1 
ATOM   1662 O OH  . TYR A 1 218 ? 31.886 41.687 34.012 1.00   17.90 ? 217  TYR A OH  1 
ATOM   1663 N N   . GLY A 1 219 ? 27.212 39.765 30.846 1.00   14.55 ? 218  GLY A N   1 
ATOM   1664 C CA  . GLY A 1 219 ? 26.698 41.108 31.056 1.00   15.48 ? 218  GLY A CA  1 
ATOM   1665 C C   . GLY A 1 219 ? 25.459 41.478 30.273 1.00   15.33 ? 218  GLY A C   1 
ATOM   1666 O O   . GLY A 1 219 ? 25.057 42.648 30.273 1.00   16.89 ? 218  GLY A O   1 
ATOM   1667 N N   . VAL A 1 220 ? 24.882 40.514 29.558 1.00   14.31 ? 219  VAL A N   1 
ATOM   1668 C CA  . VAL A 1 220 ? 23.707 40.769 28.735 1.00   14.33 ? 219  VAL A CA  1 
ATOM   1669 C C   . VAL A 1 220 ? 22.413 40.341 29.435 1.00   15.33 ? 219  VAL A C   1 
ATOM   1670 O O   . VAL A 1 220 ? 22.285 39.215 29.921 1.00   14.84 ? 219  VAL A O   1 
ATOM   1671 C CB  . VAL A 1 220 ? 23.797 40.007 27.379 1.00   13.24 ? 219  VAL A CB  1 
ATOM   1672 C CG1 . VAL A 1 220 ? 22.577 40.298 26.507 1.00   12.97 ? 219  VAL A CG1 1 
ATOM   1673 C CG2 . VAL A 1 220 ? 25.102 40.323 26.678 1.00   14.77 ? 219  VAL A CG2 1 
ATOM   1674 N N   . ASN A 1 221 ? 21.448 41.261 29.470 1.00   16.00 ? 220  ASN A N   1 
ATOM   1675 C CA  . ASN A 1 221 ? 20.125 40.996 29.983 1.00   16.49 ? 220  ASN A CA  1 
ATOM   1676 C C   . ASN A 1 221 ? 19.268 40.691 28.737 1.00   16.16 ? 220  ASN A C   1 
ATOM   1677 O O   . ASN A 1 221 ? 19.164 41.530 27.848 1.00   15.29 ? 220  ASN A O   1 
ATOM   1678 C CB  . ASN A 1 221 ? 19.554 42.225 30.705 1.00   17.01 ? 220  ASN A CB  1 
ATOM   1679 C CG  . ASN A 1 221 ? 20.493 42.795 31.770 1.00   18.16 ? 220  ASN A CG  1 
ATOM   1680 O OD1 . ASN A 1 221 ? 20.490 42.335 32.891 1.00   16.01 ? 220  ASN A OD1 1 
ATOM   1681 N ND2 . ASN A 1 221 ? 21.274 43.842 31.415 1.00   18.84 ? 220  ASN A ND2 1 
ATOM   1682 N N   . TYR A 1 222 ? 18.690 39.495 28.659 1.00   15.23 ? 221  TYR A N   1 
ATOM   1683 C CA  . TYR A 1 222 ? 17.861 39.105 27.505 1.00   15.10 ? 221  TYR A CA  1 
ATOM   1684 C C   . TYR A 1 222 ? 16.343 39.144 27.766 1.00   16.01 ? 221  TYR A C   1 
ATOM   1685 O O   . TYR A 1 222 ? 15.878 38.755 28.834 1.00   16.62 ? 221  TYR A O   1 
ATOM   1686 C CB  . TYR A 1 222 ? 18.189 37.667 27.071 1.00   15.19 ? 221  TYR A CB  1 
ATOM   1687 C CG  . TYR A 1 222 ? 19.603 37.445 26.572 1.00   14.23 ? 221  TYR A CG  1 
ATOM   1688 C CD1 . TYR A 1 222 ? 20.624 37.117 27.458 1.00   14.44 ? 221  TYR A CD1 1 
ATOM   1689 C CD2 . TYR A 1 222 ? 19.906 37.564 25.230 1.00   13.54 ? 221  TYR A CD2 1 
ATOM   1690 C CE1 . TYR A 1 222 ? 21.909 36.899 27.038 1.00   14.21 ? 221  TYR A CE1 1 
ATOM   1691 C CE2 . TYR A 1 222 ? 21.212 37.342 24.778 1.00   14.72 ? 221  TYR A CE2 1 
ATOM   1692 C CZ  . TYR A 1 222 ? 22.206 37.002 25.691 1.00   15.22 ? 221  TYR A CZ  1 
ATOM   1693 O OH  . TYR A 1 222 ? 23.500 36.794 25.244 1.00   14.98 ? 221  TYR A OH  1 
ATOM   1694 N N   . PHE A 1 223 ? 15.590 39.559 26.752 1.00   16.72 ? 222  PHE A N   1 
ATOM   1695 C CA  . PHE A 1 223 ? 14.130 39.682 26.841 1.00   17.45 ? 222  PHE A CA  1 
ATOM   1696 C C   . PHE A 1 223 ? 13.473 39.197 25.560 1.00   18.78 ? 222  PHE A C   1 
ATOM   1697 O O   . PHE A 1 223 ? 13.958 39.486 24.467 1.00   18.72 ? 222  PHE A O   1 
ATOM   1698 C CB  . PHE A 1 223 ? 13.767 41.143 27.118 1.00   17.49 ? 222  PHE A CB  1 
ATOM   1699 C CG  . PHE A 1 223 ? 14.379 41.679 28.376 1.00   17.73 ? 222  PHE A CG  1 
ATOM   1700 C CD1 . PHE A 1 223 ? 13.829 41.387 29.614 1.00   19.46 ? 222  PHE A CD1 1 
ATOM   1701 C CD2 . PHE A 1 223 ? 15.558 42.415 28.336 1.00   17.68 ? 222  PHE A CD2 1 
ATOM   1702 C CE1 . PHE A 1 223 ? 14.408 41.860 30.752 1.00   19.45 ? 222  PHE A CE1 1 
ATOM   1703 C CE2 . PHE A 1 223 ? 16.135 42.893 29.490 1.00   17.38 ? 222  PHE A CE2 1 
ATOM   1704 C CZ  . PHE A 1 223 ? 15.568 42.610 30.693 1.00   17.14 ? 222  PHE A CZ  1 
ATOM   1705 N N   . ALA A 1 224 ? 12.394 38.433 25.696 1.00   20.00 ? 223  ALA A N   1 
ATOM   1706 C CA  . ALA A 1 224 ? 11.671 37.906 24.546 1.00   20.59 ? 223  ALA A CA  1 
ATOM   1707 C C   . ALA A 1 224 ? 10.853 39.040 23.944 1.00   20.72 ? 223  ALA A C   1 
ATOM   1708 O O   . ALA A 1 224 ? 10.169 39.802 24.661 1.00   20.21 ? 223  ALA A O   1 
ATOM   1709 C CB  . ALA A 1 224 ? 10.775 36.736 24.947 1.00   21.56 ? 223  ALA A CB  1 
ATOM   1710 N N   . ILE A 1 225 ? 10.969 39.209 22.632 1.00   20.91 ? 224  ILE A N   1 
ATOM   1711 C CA  . ILE A 1 225 ? 10.275 40.298 21.946 1.00   20.65 ? 224  ILE A CA  1 
ATOM   1712 C C   . ILE A 1 225 ? 9.781  39.817 20.587 1.00   20.93 ? 224  ILE A C   1 
ATOM   1713 O O   . ILE A 1 225 ? 10.138 38.746 20.133 1.00   19.36 ? 224  ILE A O   1 
ATOM   1714 C CB  . ILE A 1 225 ? 11.203 41.546 21.751 1.00   20.92 ? 224  ILE A CB  1 
ATOM   1715 C CG1 . ILE A 1 225 ? 12.393 41.194 20.850 1.00   20.08 ? 224  ILE A CG1 1 
ATOM   1716 C CG2 . ILE A 1 225 ? 11.670 42.092 23.097 1.00   19.75 ? 224  ILE A CG2 1 
ATOM   1717 C CD1 . ILE A 1 225 ? 13.106 42.387 20.239 1.00   21.46 ? 224  ILE A CD1 1 
ATOM   1718 N N   . ARG A 1 226 ? 8.940  40.628 19.963 1.00   21.69 ? 225  ARG A N   1 
ATOM   1719 C CA  . ARG A 1 226 ? 8.475  40.385 18.604 1.00   23.06 ? 225  ARG A CA  1 
ATOM   1720 C C   . ARG A 1 226 ? 8.707  41.651 17.789 1.00   23.07 ? 225  ARG A C   1 
ATOM   1721 O O   . ARG A 1 226 ? 8.389  42.743 18.244 1.00   22.92 ? 225  ARG A O   1 
ATOM   1722 C CB  . ARG A 1 226 ? 6.982  40.025 18.610 1.00   23.70 ? 225  ARG A CB  1 
ATOM   1723 C CG  . ARG A 1 226 ? 6.699  38.634 19.118 1.00   27.12 ? 225  ARG A CG  1 
ATOM   1724 C CD  . ARG A 1 226 ? 5.215  38.246 19.116 1.00   32.78 ? 225  ARG A CD  1 
ATOM   1725 N NE  . ARG A 1 226 ? 5.068  36.801 19.232 1.00   36.13 ? 225  ARG A NE  1 
ATOM   1726 C CZ  . ARG A 1 226 ? 3.914  36.146 19.254 1.00   40.33 ? 225  ARG A CZ  1 
ATOM   1727 N NH1 . ARG A 1 226 ? 2.752  36.796 19.169 1.00   41.90 ? 225  ARG A NH1 1 
ATOM   1728 N NH2 . ARG A 1 226 ? 3.924  34.823 19.358 1.00   41.98 ? 225  ARG A NH2 1 
ATOM   1729 N N   . ASN A 1 227 ? 9.297  41.520 16.603 1.00   24.37 ? 226  ASN A N   1 
ATOM   1730 C CA  . ASN A 1 227 ? 9.420  42.668 15.725 1.00   24.75 ? 226  ASN A CA  1 
ATOM   1731 C C   . ASN A 1 227 ? 8.084  42.880 15.014 1.00   26.20 ? 226  ASN A C   1 
ATOM   1732 O O   . ASN A 1 227 ? 7.124  42.152 15.256 1.00   26.08 ? 226  ASN A O   1 
ATOM   1733 C CB  . ASN A 1 227 ? 10.601 42.553 14.747 1.00   24.75 ? 226  ASN A CB  1 
ATOM   1734 C CG  . ASN A 1 227 ? 10.380 41.549 13.627 1.00   24.55 ? 226  ASN A CG  1 
ATOM   1735 O OD1 . ASN A 1 227 ? 9.259  41.106 13.362 1.00   23.42 ? 226  ASN A OD1 1 
ATOM   1736 N ND2 . ASN A 1 227 ? 11.484 41.198 12.929 1.00   21.58 ? 226  ASN A ND2 1 
ATOM   1737 N N   . LYS A 1 228 ? 8.027  43.883 14.152 1.00   28.01 ? 227  LYS A N   1 
ATOM   1738 C CA  . LYS A 1 228 ? 6.769  44.267 13.499 1.00   29.89 ? 227  LYS A CA  1 
ATOM   1739 C C   . LYS A 1 228 ? 6.237  43.287 12.450 1.00   30.32 ? 227  LYS A C   1 
ATOM   1740 O O   . LYS A 1 228 ? 5.083  43.410 12.034 1.00   31.64 ? 227  LYS A O   1 
ATOM   1741 C CB  . LYS A 1 228 ? 6.898  45.664 12.917 1.00   29.93 ? 227  LYS A CB  1 
ATOM   1742 C CG  . LYS A 1 228 ? 6.934  46.726 13.994 1.00   32.32 ? 227  LYS A CG  1 
ATOM   1743 C CD  . LYS A 1 228 ? 5.658  46.680 14.835 1.00   34.12 ? 227  LYS A CD  1 
ATOM   1744 C CE  . LYS A 1 228 ? 5.753  47.507 16.083 1.00   34.69 ? 227  LYS A CE  1 
ATOM   1745 N NZ  . LYS A 1 228 ? 4.404  47.735 16.695 1.00   34.88 ? 227  LYS A NZ  1 
ATOM   1746 N N   . LYS A 1 229 ? 7.060  42.334 12.026 1.00   30.29 ? 228  LYS A N   1 
ATOM   1747 C CA  . LYS A 1 229 ? 6.617  41.283 11.117 1.00   30.99 ? 228  LYS A CA  1 
ATOM   1748 C C   . LYS A 1 229 ? 6.066  40.118 11.951 1.00   30.31 ? 228  LYS A C   1 
ATOM   1749 O O   . LYS A 1 229 ? 5.602  39.113 11.412 1.00   30.83 ? 228  LYS A O   1 
ATOM   1750 C CB  . LYS A 1 229 ? 7.774  40.791 10.242 1.00   31.57 ? 228  LYS A CB  1 
ATOM   1751 C CG  . LYS A 1 229 ? 8.282  41.794 9.202  1.00   34.06 ? 228  LYS A CG  1 
ATOM   1752 C CD  . LYS A 1 229 ? 9.782  41.628 8.916  1.00   37.48 ? 228  LYS A CD  1 
ATOM   1753 C CE  . LYS A 1 229 ? 10.266 40.151 8.890  1.00   39.11 ? 228  LYS A CE  1 
ATOM   1754 N NZ  . LYS A 1 229 ? 11.071 39.716 10.114 1.00   39.94 ? 228  LYS A NZ  1 
ATOM   1755 N N   . GLY A 1 230 ? 6.140  40.261 13.274 1.00   28.91 ? 229  GLY A N   1 
ATOM   1756 C CA  . GLY A 1 230 ? 5.675  39.250 14.200 1.00   28.17 ? 229  GLY A CA  1 
ATOM   1757 C C   . GLY A 1 230 ? 6.722  38.187 14.495 1.00   27.23 ? 229  GLY A C   1 
ATOM   1758 O O   . GLY A 1 230 ? 6.420  37.135 15.066 1.00   27.50 ? 229  GLY A O   1 
ATOM   1759 N N   . THR A 1 231 ? 7.962  38.463 14.125 1.00   25.79 ? 230  THR A N   1 
ATOM   1760 C CA  . THR A 1 231 ? 9.033  37.498 14.337 1.00   25.40 ? 230  THR A CA  1 
ATOM   1761 C C   . THR A 1 231 ? 9.484  37.478 15.787 1.00   24.16 ? 230  THR A C   1 
ATOM   1762 O O   . THR A 1 231 ? 9.742  38.525 16.336 1.00   23.21 ? 230  THR A O   1 
ATOM   1763 C CB  . THR A 1 231 ? 10.230 37.892 13.493 1.00   25.48 ? 230  THR A CB  1 
ATOM   1764 O OG1 . THR A 1 231 ? 9.858  37.968 12.106 1.00   27.10 ? 230  THR A OG1 1 
ATOM   1765 C CG2 . THR A 1 231 ? 11.297 36.819 13.551 1.00   27.50 ? 230  THR A CG2 1 
ATOM   1766 N N   . GLU A 1 232 ? 9.586  36.287 16.378 1.00   23.78 ? 231  GLU A N   1 
ATOM   1767 C CA  . GLU A 1 232 ? 10.132 36.127 17.727 1.00   23.46 ? 231  GLU A CA  1 
ATOM   1768 C C   . GLU A 1 232 ? 11.628 36.402 17.706 1.00   21.76 ? 231  GLU A C   1 
ATOM   1769 O O   . GLU A 1 232 ? 12.373 35.795 16.940 1.00   20.62 ? 231  GLU A O   1 
ATOM   1770 C CB  . GLU A 1 232 ? 9.915  34.703 18.235 1.00   24.34 ? 231  GLU A CB  1 
ATOM   1771 C CG  . GLU A 1 232 ? 8.462  34.305 18.346 1.00   28.78 ? 231  GLU A CG  1 
ATOM   1772 C CD  . GLU A 1 232 ? 7.835  34.817 19.610 1.00   33.83 ? 231  GLU A CD  1 
ATOM   1773 O OE1 . GLU A 1 232 ? 8.579  35.359 20.456 1.00   39.78 ? 231  GLU A OE1 1 
ATOM   1774 O OE2 . GLU A 1 232 ? 6.600  34.694 19.744 1.00   38.95 ? 231  GLU A OE2 1 
ATOM   1775 N N   . LEU A 1 233 ? 12.065 37.313 18.564 1.00   21.05 ? 232  LEU A N   1 
ATOM   1776 C CA  . LEU A 1 233 ? 13.473 37.666 18.671 1.00   19.45 ? 232  LEU A CA  1 
ATOM   1777 C C   . LEU A 1 233 ? 13.813 37.891 20.148 1.00   18.70 ? 232  LEU A C   1 
ATOM   1778 O O   . LEU A 1 233 ? 12.931 37.799 21.006 1.00   17.45 ? 232  LEU A O   1 
ATOM   1779 C CB  . LEU A 1 233 ? 13.748 38.948 17.885 1.00   19.59 ? 232  LEU A CB  1 
ATOM   1780 C CG  . LEU A 1 233 ? 13.479 38.945 16.372 1.00   19.13 ? 232  LEU A CG  1 
ATOM   1781 C CD1 . LEU A 1 233 ? 13.469 40.393 15.838 1.00   20.64 ? 232  LEU A CD1 1 
ATOM   1782 C CD2 . LEU A 1 233 ? 14.495 38.101 15.622 1.00   20.87 ? 232  LEU A CD2 1 
ATOM   1783 N N   . LEU A 1 234 ? 15.090 38.165 20.431 1.00   17.60 ? 233  LEU A N   1 
ATOM   1784 C CA  . LEU A 1 234 ? 15.531 38.514 21.767 1.00   17.32 ? 233  LEU A CA  1 
ATOM   1785 C C   . LEU A 1 234 ? 16.165 39.902 21.749 1.00   16.45 ? 233  LEU A C   1 
ATOM   1786 O O   . LEU A 1 234 ? 16.961 40.214 20.847 1.00   15.10 ? 233  LEU A O   1 
ATOM   1787 C CB  . LEU A 1 234 ? 16.573 37.540 22.289 1.00   18.68 ? 233  LEU A CB  1 
ATOM   1788 C CG  . LEU A 1 234 ? 16.080 36.127 22.515 1.00   21.00 ? 233  LEU A CG  1 
ATOM   1789 C CD1 . LEU A 1 234 ? 17.259 35.219 22.843 1.00   22.81 ? 233  LEU A CD1 1 
ATOM   1790 C CD2 . LEU A 1 234 ? 15.033 36.068 23.617 1.00   24.30 ? 233  LEU A CD2 1 
ATOM   1791 N N   . LEU A 1 235 ? 15.801 40.714 22.739 1.00   16.04 ? 234  LEU A N   1 
ATOM   1792 C CA  . LEU A 1 235 ? 16.414 42.006 22.981 1.00   16.72 ? 234  LEU A CA  1 
ATOM   1793 C C   . LEU A 1 235 ? 17.499 41.734 24.024 1.00   16.47 ? 234  LEU A C   1 
ATOM   1794 O O   . LEU A 1 235 ? 17.250 41.062 25.030 1.00   17.47 ? 234  LEU A O   1 
ATOM   1795 C CB  . LEU A 1 235 ? 15.386 42.957 23.551 1.00   16.45 ? 234  LEU A CB  1 
ATOM   1796 C CG  . LEU A 1 235 ? 16.032 44.251 24.036 1.00   18.01 ? 234  LEU A CG  1 
ATOM   1797 C CD1 . LEU A 1 235 ? 16.539 45.034 22.843 1.00   18.96 ? 234  LEU A CD1 1 
ATOM   1798 C CD2 . LEU A 1 235 ? 15.069 45.064 24.879 1.00   18.84 ? 234  LEU A CD2 1 
ATOM   1799 N N   . GLY A 1 236 ? 18.707 42.213 23.743 1.00   16.15 ? 235  GLY A N   1 
ATOM   1800 C CA  . GLY A 1 236 ? 19.808 42.198 24.692 1.00   16.13 ? 235  GLY A CA  1 
ATOM   1801 C C   . GLY A 1 236 ? 20.187 43.624 25.094 1.00   15.92 ? 235  GLY A C   1 
ATOM   1802 O O   . GLY A 1 236 ? 20.426 44.497 24.261 1.00   16.03 ? 235  GLY A O   1 
ATOM   1803 N N   . VAL A 1 237 ? 20.201 43.870 26.399 1.00   16.00 ? 236  VAL A N   1 
ATOM   1804 C CA  . VAL A 1 237 ? 20.562 45.155 26.941 1.00   15.42 ? 236  VAL A CA  1 
ATOM   1805 C C   . VAL A 1 237 ? 21.861 44.949 27.704 1.00   15.86 ? 236  VAL A C   1 
ATOM   1806 O O   . VAL A 1 237 ? 21.932 44.109 28.613 1.00   15.61 ? 236  VAL A O   1 
ATOM   1807 C CB  . VAL A 1 237 ? 19.510 45.644 27.945 1.00   15.61 ? 236  VAL A CB  1 
ATOM   1808 C CG1 . VAL A 1 237 ? 19.877 47.037 28.465 1.00   16.20 ? 236  VAL A CG1 1 
ATOM   1809 C CG2 . VAL A 1 237 ? 18.111 45.600 27.312 1.00   16.49 ? 236  VAL A CG2 1 
ATOM   1810 N N   . ASP A 1 238 ? 22.899 45.684 27.326 1.00   14.93 ? 237  ASP A N   1 
ATOM   1811 C CA  . ASP A 1 238 ? 24.168 45.578 28.039 1.00   15.60 ? 237  ASP A CA  1 
ATOM   1812 C C   . ASP A 1 238 ? 24.876 46.931 28.127 1.00   14.71 ? 237  ASP A C   1 
ATOM   1813 O O   . ASP A 1 238 ? 24.305 47.974 27.786 1.00   15.95 ? 237  ASP A O   1 
ATOM   1814 C CB  . ASP A 1 238 ? 25.065 44.451 27.482 1.00   15.46 ? 237  ASP A CB  1 
ATOM   1815 C CG  . ASP A 1 238 ? 25.666 44.761 26.129 1.00   17.30 ? 237  ASP A CG  1 
ATOM   1816 O OD1 . ASP A 1 238 ? 25.539 45.909 25.625 1.00   15.71 ? 237  ASP A OD1 1 
ATOM   1817 O OD2 . ASP A 1 238 ? 26.314 43.887 25.500 1.00   18.83 ? 237  ASP A OD2 1 
ATOM   1818 N N   . ALA A 1 239 ? 26.091 46.905 28.642 1.00   15.12 ? 238  ALA A N   1 
ATOM   1819 C CA  . ALA A 1 239 ? 26.868 48.110 28.912 1.00   15.76 ? 238  ALA A CA  1 
ATOM   1820 C C   . ALA A 1 239 ? 27.225 48.879 27.660 1.00   16.56 ? 238  ALA A C   1 
ATOM   1821 O O   . ALA A 1 239 ? 27.472 50.085 27.721 1.00   17.64 ? 238  ALA A O   1 
ATOM   1822 C CB  . ALA A 1 239 ? 28.128 47.742 29.681 1.00   16.16 ? 238  ALA A CB  1 
ATOM   1823 N N   . LEU A 1 240 ? 27.264 48.189 26.529 1.00   17.77 ? 239  LEU A N   1 
ATOM   1824 C CA  . LEU A 1 240 ? 27.624 48.803 25.264 1.00   18.95 ? 239  LEU A CA  1 
ATOM   1825 C C   . LEU A 1 240 ? 26.458 49.309 24.438 1.00   18.16 ? 239  LEU A C   1 
ATOM   1826 O O   . LEU A 1 240 ? 26.622 50.238 23.644 1.00   19.77 ? 239  LEU A O   1 
ATOM   1827 C CB  . LEU A 1 240 ? 28.425 47.825 24.417 1.00   20.14 ? 239  LEU A CB  1 
ATOM   1828 C CG  . LEU A 1 240 ? 29.941 47.800 24.572 1.00   24.45 ? 239  LEU A CG  1 
ATOM   1829 C CD1 . LEU A 1 240 ? 30.450 48.322 25.886 1.00   27.52 ? 239  LEU A CD1 1 
ATOM   1830 C CD2 . LEU A 1 240 ? 30.417 46.384 24.300 1.00   26.74 ? 239  LEU A CD2 1 
ATOM   1831 N N   . GLY A 1 241 ? 25.293 48.702 24.585 1.00   17.76 ? 240  GLY A N   1 
ATOM   1832 C CA  . GLY A 1 241 ? 24.133 49.128 23.825 1.00   17.18 ? 240  GLY A CA  1 
ATOM   1833 C C   . GLY A 1 241 ? 22.979 48.142 23.842 1.00   16.59 ? 240  GLY A C   1 
ATOM   1834 O O   . GLY A 1 241 ? 22.842 47.369 24.776 1.00   15.55 ? 240  GLY A O   1 
ATOM   1835 N N   . LEU A 1 242 ? 22.132 48.232 22.813 1.00   17.12 ? 241  LEU A N   1 
ATOM   1836 C CA  . LEU A 1 242 ? 20.973 47.361 22.639 1.00   16.68 ? 241  LEU A CA  1 
ATOM   1837 C C   . LEU A 1 242 ? 21.233 46.446 21.448 1.00   16.17 ? 241  LEU A C   1 
ATOM   1838 O O   . LEU A 1 242 ? 21.796 46.860 20.447 1.00   16.56 ? 241  LEU A O   1 
ATOM   1839 C CB  . LEU A 1 242 ? 19.686 48.151 22.413 1.00   17.16 ? 241  LEU A CB  1 
ATOM   1840 C CG  . LEU A 1 242 ? 19.218 49.040 23.567 1.00   18.72 ? 241  LEU A CG  1 
ATOM   1841 C CD1 . LEU A 1 242 ? 17.974 49.823 23.149 1.00   21.44 ? 241  LEU A CD1 1 
ATOM   1842 C CD2 . LEU A 1 242 ? 18.950 48.280 24.839 1.00   20.60 ? 241  LEU A CD2 1 
ATOM   1843 N N   . HIS A 1 243 ? 20.798 45.211 21.552 1.00   16.33 ? 242  HIS A N   1 
ATOM   1844 C CA  . HIS A 1 243 ? 21.148 44.219 20.552 1.00   16.08 ? 242  HIS A CA  1 
ATOM   1845 C C   . HIS A 1 243 ? 19.959 43.331 20.224 1.00   15.77 ? 242  HIS A C   1 
ATOM   1846 O O   . HIS A 1 243 ? 19.130 43.046 21.089 1.00   15.20 ? 242  HIS A O   1 
ATOM   1847 C CB  . HIS A 1 243 ? 22.302 43.370 21.098 1.00   17.18 ? 242  HIS A CB  1 
ATOM   1848 C CG  . HIS A 1 243 ? 23.434 44.171 21.654 1.00   16.64 ? 242  HIS A CG  1 
ATOM   1849 N ND1 . HIS A 1 243 ? 24.437 44.691 20.868 1.00   15.26 ? 242  HIS A ND1 1 
ATOM   1850 C CD2 . HIS A 1 243 ? 23.695 44.585 22.917 1.00   15.76 ? 242  HIS A CD2 1 
ATOM   1851 C CE1 . HIS A 1 243 ? 25.288 45.353 21.627 1.00   15.27 ? 242  HIS A CE1 1 
ATOM   1852 N NE2 . HIS A 1 243 ? 24.866 45.298 22.877 1.00   16.15 ? 242  HIS A NE2 1 
ATOM   1853 N N   . ILE A 1 244 ? 19.820 42.963 18.956 1.00   15.07 ? 243  ILE A N   1 
ATOM   1854 C CA  . ILE A 1 244 ? 18.732 42.099 18.529 1.00   15.60 ? 243  ILE A CA  1 
ATOM   1855 C C   . ILE A 1 244 ? 19.311 40.756 18.121 1.00   15.27 ? 243  ILE A C   1 
ATOM   1856 O O   . ILE A 1 244 ? 20.187 40.665 17.221 1.00   15.26 ? 243  ILE A O   1 
ATOM   1857 C CB  . ILE A 1 244 ? 17.984 42.712 17.352 1.00   15.34 ? 243  ILE A CB  1 
ATOM   1858 C CG1 . ILE A 1 244 ? 17.642 44.196 17.623 1.00   16.51 ? 243  ILE A CG1 1 
ATOM   1859 C CG2 . ILE A 1 244 ? 16.783 41.873 16.992 1.00   16.59 ? 243  ILE A CG2 1 
ATOM   1860 C CD1 . ILE A 1 244 ? 16.707 44.449 18.795 1.00   18.69 ? 243  ILE A CD1 1 
ATOM   1861 N N   . TYR A 1 245 ? 18.837 39.714 18.791 1.00   15.57 ? 244  TYR A N   1 
ATOM   1862 C CA  . TYR A 1 245 ? 19.267 38.352 18.548 1.00   15.66 ? 244  TYR A CA  1 
ATOM   1863 C C   . TYR A 1 245 ? 18.150 37.463 17.977 1.00   17.39 ? 244  TYR A C   1 
ATOM   1864 O O   . TYR A 1 245 ? 16.976 37.614 18.321 1.00   16.25 ? 244  TYR A O   1 
ATOM   1865 C CB  . TYR A 1 245 ? 19.657 37.679 19.868 1.00   16.73 ? 244  TYR A CB  1 
ATOM   1866 C CG  . TYR A 1 245 ? 20.815 38.271 20.640 1.00   14.82 ? 244  TYR A CG  1 
ATOM   1867 C CD1 . TYR A 1 245 ? 20.632 39.372 21.465 1.00   15.34 ? 244  TYR A CD1 1 
ATOM   1868 C CD2 . TYR A 1 245 ? 22.098 37.699 20.578 1.00   16.71 ? 244  TYR A CD2 1 
ATOM   1869 C CE1 . TYR A 1 245 ? 21.678 39.919 22.164 1.00   15.33 ? 244  TYR A CE1 1 
ATOM   1870 C CE2 . TYR A 1 245 ? 23.138 38.227 21.297 1.00   15.93 ? 244  TYR A CE2 1 
ATOM   1871 C CZ  . TYR A 1 245 ? 22.930 39.332 22.087 1.00   16.53 ? 244  TYR A CZ  1 
ATOM   1872 O OH  . TYR A 1 245 ? 23.983 39.857 22.798 1.00   16.34 ? 244  TYR A OH  1 
ATOM   1873 N N   . ASP A 1 246 ? 18.531 36.511 17.141 1.00   18.24 ? 245  ASP A N   1 
ATOM   1874 C CA  . ASP A 1 246 ? 17.633 35.420 16.802 1.00   19.76 ? 245  ASP A CA  1 
ATOM   1875 C C   . ASP A 1 246 ? 17.544 34.539 18.051 1.00   20.04 ? 245  ASP A C   1 
ATOM   1876 O O   . ASP A 1 246 ? 18.554 34.282 18.685 1.00   18.63 ? 245  ASP A O   1 
ATOM   1877 C CB  . ASP A 1 246 ? 18.211 34.585 15.678 1.00   19.80 ? 245  ASP A CB  1 
ATOM   1878 C CG  . ASP A 1 246 ? 18.115 35.259 14.336 1.00   23.34 ? 245  ASP A CG  1 
ATOM   1879 O OD1 . ASP A 1 246 ? 17.394 36.274 14.190 1.00   26.93 ? 245  ASP A OD1 1 
ATOM   1880 O OD2 . ASP A 1 246 ? 18.731 34.818 13.356 1.00   28.30 ? 245  ASP A OD2 1 
ATOM   1881 N N   . PRO A 1 247 ? 16.362 34.036 18.401 1.00   21.56 ? 246  PRO A N   1 
ATOM   1882 C CA  . PRO A 1 247 ? 16.211 33.254 19.637 1.00   22.03 ? 246  PRO A CA  1 
ATOM   1883 C C   . PRO A 1 247 ? 17.123 32.036 19.760 1.00   22.89 ? 246  PRO A C   1 
ATOM   1884 O O   . PRO A 1 247 ? 17.509 31.668 20.888 1.00   23.02 ? 246  PRO A O   1 
ATOM   1885 C CB  . PRO A 1 247 ? 14.734 32.858 19.619 1.00   23.06 ? 246  PRO A CB  1 
ATOM   1886 C CG  . PRO A 1 247 ? 14.096 33.911 18.774 1.00   22.88 ? 246  PRO A CG  1 
ATOM   1887 C CD  . PRO A 1 247 ? 15.078 34.184 17.687 1.00   21.74 ? 246  PRO A CD  1 
ATOM   1888 N N   . GLU A 1 248 ? 17.506 31.445 18.634 1.00   23.21 ? 247  GLU A N   1 
ATOM   1889 C CA  . GLU A 1 248 ? 18.359 30.267 18.650 1.00   24.29 ? 247  GLU A CA  1 
ATOM   1890 C C   . GLU A 1 248 ? 19.855 30.604 18.715 1.00   23.05 ? 247  GLU A C   1 
ATOM   1891 O O   . GLU A 1 248 ? 20.702 29.720 18.739 1.00   23.11 ? 247  GLU A O   1 
ATOM   1892 C CB  . GLU A 1 248 ? 18.037 29.397 17.438 1.00   25.65 ? 247  GLU A CB  1 
ATOM   1893 C CG  . GLU A 1 248 ? 16.562 29.015 17.377 1.00   29.70 ? 247  GLU A CG  1 
ATOM   1894 C CD  . GLU A 1 248 ? 16.059 28.398 18.674 1.00   36.42 ? 247  GLU A CD  1 
ATOM   1895 O OE1 . GLU A 1 248 ? 16.753 27.500 19.206 1.00   42.11 ? 247  GLU A OE1 1 
ATOM   1896 O OE2 . GLU A 1 248 ? 14.970 28.800 19.162 1.00   40.10 ? 247  GLU A OE2 1 
ATOM   1897 N N   . ASN A 1 249 ? 20.179 31.887 18.794 1.00   21.79 ? 248  ASN A N   1 
ATOM   1898 C CA  . ASN A 1 249 ? 21.574 32.300 18.879 1.00   19.94 ? 248  ASN A CA  1 
ATOM   1899 C C   . ASN A 1 249 ? 21.757 33.468 19.831 1.00   18.44 ? 248  ASN A C   1 
ATOM   1900 O O   . ASN A 1 249 ? 21.655 34.614 19.423 1.00   17.74 ? 248  ASN A O   1 
ATOM   1901 C CB  . ASN A 1 249 ? 22.105 32.648 17.500 1.00   20.49 ? 248  ASN A CB  1 
ATOM   1902 C CG  . ASN A 1 249 ? 23.579 33.011 17.500 1.00   21.65 ? 248  ASN A CG  1 
ATOM   1903 O OD1 . ASN A 1 249 ? 24.228 33.089 18.550 1.00   22.37 ? 248  ASN A OD1 1 
ATOM   1904 N ND2 . ASN A 1 249 ? 24.139 33.161 16.298 1.00   23.77 ? 248  ASN A ND2 1 
ATOM   1905 N N   . ARG A 1 250 ? 22.042 33.164 21.096 1.00   16.82 ? 249  ARG A N   1 
ATOM   1906 C CA  . ARG A 1 250 ? 22.231 34.215 22.096 1.00   16.59 ? 249  ARG A CA  1 
ATOM   1907 C C   . ARG A 1 250 ? 23.664 34.699 22.159 1.00   15.64 ? 249  ARG A C   1 
ATOM   1908 O O   . ARG A 1 250 ? 23.994 35.571 22.963 1.00   16.05 ? 249  ARG A O   1 
ATOM   1909 C CB  . ARG A 1 250 ? 21.835 33.728 23.494 1.00   16.38 ? 249  ARG A CB  1 
ATOM   1910 C CG  . ARG A 1 250 ? 20.373 33.388 23.644 1.00   18.06 ? 249  ARG A CG  1 
ATOM   1911 C CD  . ARG A 1 250 ? 19.951 32.967 25.054 1.00   21.10 ? 249  ARG A CD  1 
ATOM   1912 N NE  . ARG A 1 250 ? 18.521 32.665 25.050 1.00   22.77 ? 249  ARG A NE  1 
ATOM   1913 C CZ  . ARG A 1 250 ? 17.591 33.270 25.775 1.00   23.53 ? 249  ARG A CZ  1 
ATOM   1914 N NH1 . ARG A 1 250 ? 17.892 34.209 26.659 1.00   23.97 ? 249  ARG A NH1 1 
ATOM   1915 N NH2 . ARG A 1 250 ? 16.327 32.902 25.623 1.00   26.01 ? 249  ARG A NH2 1 
ATOM   1916 N N   . LEU A 1 251 ? 24.522 34.145 21.309 1.00   15.32 ? 250  LEU A N   1 
ATOM   1917 C CA  . LEU A 1 251 ? 25.936 34.507 21.308 1.00   16.11 ? 250  LEU A CA  1 
ATOM   1918 C C   . LEU A 1 251 ? 26.278 35.726 20.454 1.00   16.51 ? 250  LEU A C   1 
ATOM   1919 O O   . LEU A 1 251 ? 27.040 36.592 20.876 1.00   17.35 ? 250  LEU A O   1 
ATOM   1920 C CB  . LEU A 1 251 ? 26.760 33.329 20.825 1.00   16.52 ? 250  LEU A CB  1 
ATOM   1921 C CG  . LEU A 1 251 ? 26.616 32.044 21.637 1.00   19.15 ? 250  LEU A CG  1 
ATOM   1922 C CD1 . LEU A 1 251 ? 27.617 31.019 21.092 1.00   20.56 ? 250  LEU A CD1 1 
ATOM   1923 C CD2 . LEU A 1 251 ? 26.806 32.249 23.133 1.00   20.68 ? 250  LEU A CD2 1 
ATOM   1924 N N   . THR A 1 252 ? 25.700 35.799 19.261 1.00   17.05 ? 251  THR A N   1 
ATOM   1925 C CA  . THR A 1 252 ? 26.038 36.842 18.313 1.00   17.78 ? 251  THR A CA  1 
ATOM   1926 C C   . THR A 1 252 ? 24.770 37.549 17.835 1.00   17.17 ? 251  THR A C   1 
ATOM   1927 O O   . THR A 1 252 ? 24.006 36.977 17.069 1.00   17.73 ? 251  THR A O   1 
ATOM   1928 C CB  . THR A 1 252 ? 26.727 36.233 17.122 1.00   18.80 ? 251  THR A CB  1 
ATOM   1929 O OG1 . THR A 1 252 ? 27.810 35.387 17.551 1.00   22.20 ? 251  THR A OG1 1 
ATOM   1930 C CG2 . THR A 1 252 ? 27.380 37.310 16.288 1.00   20.48 ? 251  THR A CG2 1 
ATOM   1931 N N   . PRO A 1 253 ? 24.557 38.794 18.249 1.00   16.93 ? 252  PRO A N   1 
ATOM   1932 C CA  . PRO A 1 253 ? 23.358 39.509 17.803 1.00   16.20 ? 252  PRO A CA  1 
ATOM   1933 C C   . PRO A 1 253 ? 23.514 39.893 16.341 1.00   15.84 ? 252  PRO A C   1 
ATOM   1934 O O   . PRO A 1 253 ? 24.638 40.103 15.866 1.00   15.80 ? 252  PRO A O   1 
ATOM   1935 C CB  . PRO A 1 253 ? 23.314 40.739 18.710 1.00   16.29 ? 252  PRO A CB  1 
ATOM   1936 C CG  . PRO A 1 253 ? 24.745 40.962 19.160 1.00   16.89 ? 252  PRO A CG  1 
ATOM   1937 C CD  . PRO A 1 253 ? 25.419 39.628 19.099 1.00   17.43 ? 252  PRO A CD  1 
ATOM   1938 N N   . LYS A 1 254 ? 22.401 39.927 15.621 1.00   15.31 ? 253  LYS A N   1 
ATOM   1939 C CA  . LYS A 1 254 ? 22.399 40.296 14.203 1.00   15.78 ? 253  LYS A CA  1 
ATOM   1940 C C   . LYS A 1 254 ? 22.500 41.820 14.026 1.00   15.72 ? 253  LYS A C   1 
ATOM   1941 O O   . LYS A 1 254 ? 23.062 42.310 13.045 1.00   16.68 ? 253  LYS A O   1 
ATOM   1942 C CB  . LYS A 1 254 ? 21.122 39.760 13.546 1.00   15.45 ? 253  LYS A CB  1 
ATOM   1943 C CG  . LYS A 1 254 ? 20.897 38.247 13.671 1.00   17.90 ? 253  LYS A CG  1 
ATOM   1944 C CD  . LYS A 1 254 ? 22.000 37.397 13.087 1.00   18.29 ? 253  LYS A CD  1 
ATOM   1945 C CE  . LYS A 1 254 ? 21.707 35.927 13.322 1.00   19.68 ? 253  LYS A CE  1 
ATOM   1946 N NZ  . LYS A 1 254 ? 22.771 35.055 12.767 1.00   21.17 ? 253  LYS A NZ  1 
ATOM   1947 N N   . ILE A 1 255 ? 21.958 42.568 14.985 1.00   16.18 ? 254  ILE A N   1 
ATOM   1948 C CA  . ILE A 1 255 ? 21.963 44.030 14.946 1.00   16.32 ? 254  ILE A CA  1 
ATOM   1949 C C   . ILE A 1 255 ? 22.387 44.583 16.293 1.00   16.71 ? 254  ILE A C   1 
ATOM   1950 O O   . ILE A 1 255 ? 21.966 44.071 17.344 1.00   16.39 ? 254  ILE A O   1 
ATOM   1951 C CB  . ILE A 1 255 ? 20.548 44.563 14.634 1.00   16.38 ? 254  ILE A CB  1 
ATOM   1952 C CG1 . ILE A 1 255 ? 20.059 44.079 13.273 1.00   19.09 ? 254  ILE A CG1 1 
ATOM   1953 C CG2 . ILE A 1 255 ? 20.504 46.092 14.711 1.00   17.76 ? 254  ILE A CG2 1 
ATOM   1954 C CD1 . ILE A 1 255 ? 18.565 44.298 13.052 1.00   19.08 ? 254  ILE A CD1 1 
ATOM   1955 N N   . SER A 1 256 ? 23.218 45.617 16.271 1.00   16.93 ? 255  SER A N   1 
ATOM   1956 C CA  . SER A 1 256 ? 23.617 46.296 17.496 1.00   17.17 ? 255  SER A CA  1 
ATOM   1957 C C   . SER A 1 256 ? 23.408 47.805 17.368 1.00   18.35 ? 255  SER A C   1 
ATOM   1958 O O   . SER A 1 256 ? 23.673 48.384 16.301 1.00   18.10 ? 255  SER A O   1 
ATOM   1959 C CB  . SER A 1 256 ? 25.070 45.979 17.890 1.00   17.19 ? 255  SER A CB  1 
ATOM   1960 O OG  . SER A 1 256 ? 25.228 44.622 18.267 1.00   16.81 ? 255  SER A OG  1 
ATOM   1961 N N   . PHE A 1 257 ? 22.881 48.418 18.438 1.00   18.01 ? 256  PHE A N   1 
ATOM   1962 C CA  . PHE A 1 257 ? 22.715 49.874 18.543 1.00   19.34 ? 256  PHE A CA  1 
ATOM   1963 C C   . PHE A 1 257 ? 23.577 50.364 19.719 1.00   19.24 ? 256  PHE A C   1 
ATOM   1964 O O   . PHE A 1 257 ? 23.138 50.318 20.879 1.00   18.34 ? 256  PHE A O   1 
ATOM   1965 C CB  . PHE A 1 257 ? 21.259 50.271 18.808 1.00   19.07 ? 256  PHE A CB  1 
ATOM   1966 C CG  . PHE A 1 257 ? 20.303 49.875 17.734 1.00   21.01 ? 256  PHE A CG  1 
ATOM   1967 C CD1 . PHE A 1 257 ? 20.171 50.644 16.587 1.00   24.13 ? 256  PHE A CD1 1 
ATOM   1968 C CD2 . PHE A 1 257 ? 19.507 48.752 17.878 1.00   21.56 ? 256  PHE A CD2 1 
ATOM   1969 C CE1 . PHE A 1 257 ? 19.272 50.301 15.604 1.00   22.91 ? 256  PHE A CE1 1 
ATOM   1970 C CE2 . PHE A 1 257 ? 18.619 48.402 16.879 1.00   23.79 ? 256  PHE A CE2 1 
ATOM   1971 C CZ  . PHE A 1 257 ? 18.512 49.184 15.740 1.00   23.26 ? 256  PHE A CZ  1 
ATOM   1972 N N   . PRO A 1 258 ? 24.806 50.822 19.460 1.00   19.95 ? 257  PRO A N   1 
ATOM   1973 C CA  . PRO A 1 258 ? 25.613 51.364 20.551 1.00   20.41 ? 257  PRO A CA  1 
ATOM   1974 C C   . PRO A 1 258 ? 24.904 52.512 21.231 1.00   20.72 ? 257  PRO A C   1 
ATOM   1975 O O   . PRO A 1 258 ? 24.144 53.235 20.582 1.00   21.20 ? 257  PRO A O   1 
ATOM   1976 C CB  . PRO A 1 258 ? 26.899 51.827 19.851 1.00   20.84 ? 257  PRO A CB  1 
ATOM   1977 C CG  . PRO A 1 258 ? 26.976 51.009 18.657 1.00   21.17 ? 257  PRO A CG  1 
ATOM   1978 C CD  . PRO A 1 258 ? 25.551 50.818 18.191 1.00   20.05 ? 257  PRO A CD  1 
ATOM   1979 N N   . TRP A 1 259 ? 25.154 52.678 22.525 1.00   21.07 ? 258  TRP A N   1 
ATOM   1980 C CA  . TRP A 1 259 ? 24.471 53.684 23.310 1.00   21.95 ? 258  TRP A CA  1 
ATOM   1981 C C   . TRP A 1 259 ? 24.704 55.088 22.761 1.00   23.28 ? 258  TRP A C   1 
ATOM   1982 O O   . TRP A 1 259 ? 23.818 55.929 22.840 1.00   24.24 ? 258  TRP A O   1 
ATOM   1983 C CB  . TRP A 1 259 ? 24.920 53.642 24.762 1.00   21.23 ? 258  TRP A CB  1 
ATOM   1984 C CG  . TRP A 1 259 ? 24.315 52.507 25.518 1.00   18.94 ? 258  TRP A CG  1 
ATOM   1985 C CD1 . TRP A 1 259 ? 24.979 51.534 26.194 1.00   17.81 ? 258  TRP A CD1 1 
ATOM   1986 C CD2 . TRP A 1 259 ? 22.924 52.229 25.672 1.00   18.23 ? 258  TRP A CD2 1 
ATOM   1987 N NE1 . TRP A 1 259 ? 24.083 50.667 26.770 1.00   18.81 ? 258  TRP A NE1 1 
ATOM   1988 C CE2 . TRP A 1 259 ? 22.812 51.070 26.460 1.00   18.26 ? 258  TRP A CE2 1 
ATOM   1989 C CE3 . TRP A 1 259 ? 21.752 52.849 25.232 1.00   19.81 ? 258  TRP A CE3 1 
ATOM   1990 C CZ2 . TRP A 1 259 ? 21.586 50.518 26.802 1.00   18.82 ? 258  TRP A CZ2 1 
ATOM   1991 C CZ3 . TRP A 1 259 ? 20.539 52.294 25.573 1.00   20.25 ? 258  TRP A CZ3 1 
ATOM   1992 C CH2 . TRP A 1 259 ? 20.463 51.133 26.335 1.00   19.38 ? 258  TRP A CH2 1 
ATOM   1993 N N   . ASN A 1 260 ? 25.881 55.313 22.181 1.00   25.10 ? 259  ASN A N   1 
ATOM   1994 C CA  . ASN A 1 260 ? 26.204 56.665 21.668 1.00   27.11 ? 259  ASN A CA  1 
ATOM   1995 C C   . ASN A 1 260 ? 25.608 56.929 20.282 1.00   28.12 ? 259  ASN A C   1 
ATOM   1996 O O   . ASN A 1 260 ? 25.887 57.967 19.664 1.00   28.97 ? 259  ASN A O   1 
ATOM   1997 C CB  . ASN A 1 260 ? 27.722 56.922 21.680 1.00   27.48 ? 259  ASN A CB  1 
ATOM   1998 C CG  . ASN A 1 260 ? 28.503 56.015 20.733 1.00   28.51 ? 259  ASN A CG  1 
ATOM   1999 O OD1 . ASN A 1 260 ? 28.208 54.829 20.592 1.00   30.89 ? 259  ASN A OD1 1 
ATOM   2000 N ND2 . ASN A 1 260 ? 29.533 56.573 20.107 1.00   29.41 ? 259  ASN A ND2 1 
ATOM   2001 N N   . GLU A 1 261 ? 24.778 56.006 19.807 1.00   28.69 ? 260  GLU A N   1 
ATOM   2002 C CA  . GLU A 1 261 ? 24.155 56.111 18.499 1.00   29.76 ? 260  GLU A CA  1 
ATOM   2003 C C   . GLU A 1 261 ? 22.633 56.111 18.614 1.00   30.03 ? 260  GLU A C   1 
ATOM   2004 O O   . GLU A 1 261 ? 21.925 56.202 17.612 1.00   29.24 ? 260  GLU A O   1 
ATOM   2005 C CB  . GLU A 1 261 ? 24.676 54.985 17.603 1.00   30.47 ? 260  GLU A CB  1 
ATOM   2006 C CG  . GLU A 1 261 ? 26.183 55.118 17.395 1.00   32.82 ? 260  GLU A CG  1 
ATOM   2007 C CD  . GLU A 1 261 ? 26.792 54.058 16.502 1.00   36.69 ? 260  GLU A CD  1 
ATOM   2008 O OE1 . GLU A 1 261 ? 26.045 53.391 15.765 1.00   37.54 ? 260  GLU A OE1 1 
ATOM   2009 O OE2 . GLU A 1 261 ? 28.044 53.908 16.535 1.00   39.73 ? 260  GLU A OE2 1 
ATOM   2010 N N   . ILE A 1 262 ? 22.151 56.049 19.852 1.00   30.75 ? 261  ILE A N   1 
ATOM   2011 C CA  . ILE A 1 262 ? 20.728 56.027 20.160 1.00   32.39 ? 261  ILE A CA  1 
ATOM   2012 C C   . ILE A 1 262 ? 20.308 57.339 20.765 1.00   34.09 ? 261  ILE A C   1 
ATOM   2013 O O   . ILE A 1 262 ? 20.910 57.793 21.731 1.00   33.33 ? 261  ILE A O   1 
ATOM   2014 C CB  . ILE A 1 262 ? 20.414 54.954 21.203 1.00   32.16 ? 261  ILE A CB  1 
ATOM   2015 C CG1 . ILE A 1 262 ? 20.647 53.573 20.629 1.00   32.18 ? 261  ILE A CG1 1 
ATOM   2016 C CG2 . ILE A 1 262 ? 18.969 55.104 21.692 1.00   33.18 ? 261  ILE A CG2 1 
ATOM   2017 C CD1 . ILE A 1 262 ? 20.441 52.471 21.643 1.00   30.52 ? 261  ILE A CD1 1 
ATOM   2018 N N   . ARG A 1 263 ? 19.235 57.901 20.225 1.00   36.57 ? 262  ARG A N   1 
ATOM   2019 C CA  . ARG A 1 263 ? 18.725 59.186 20.667 1.00   38.96 ? 262  ARG A CA  1 
ATOM   2020 C C   . ARG A 1 263 ? 17.986 58.984 21.967 1.00   40.16 ? 262  ARG A C   1 
ATOM   2021 O O   . ARG A 1 263 ? 18.269 59.637 22.975 1.00   41.24 ? 262  ARG A O   1 
ATOM   2022 C CB  . ARG A 1 263 ? 17.777 59.738 19.606 1.00   39.38 ? 262  ARG A CB  1 
ATOM   2023 C CG  . ARG A 1 263 ? 17.001 60.981 19.984 1.00   41.32 ? 262  ARG A CG  1 
ATOM   2024 C CD  . ARG A 1 263 ? 16.033 61.411 18.881 1.00   43.78 ? 262  ARG A CD  1 
ATOM   2025 N NE  . ARG A 1 263 ? 15.548 62.782 19.022 1.00   46.55 ? 262  ARG A NE  1 
ATOM   2026 C CZ  . ARG A 1 263 ? 16.303 63.868 18.885 1.00   47.65 ? 262  ARG A CZ  1 
ATOM   2027 N NH1 . ARG A 1 263 ? 17.607 63.758 18.618 1.00   48.44 ? 262  ARG A NH1 1 
ATOM   2028 N NH2 . ARG A 1 263 ? 15.755 65.070 19.031 1.00   47.17 ? 262  ARG A NH2 1 
ATOM   2029 N N   . ASN A 1 264 ? 17.024 58.077 21.929 1.00   41.26 ? 263  ASN A N   1 
ATOM   2030 C CA  . ASN A 1 264 ? 16.217 57.786 23.090 1.00   42.57 ? 263  ASN A CA  1 
ATOM   2031 C C   . ASN A 1 264 ? 15.604 56.407 23.001 1.00   42.45 ? 263  ASN A C   1 
ATOM   2032 O O   . ASN A 1 264 ? 15.618 55.742 21.954 1.00   42.47 ? 263  ASN A O   1 
ATOM   2033 C CB  . ASN A 1 264 ? 15.114 58.837 23.217 1.00   43.09 ? 263  ASN A CB  1 
ATOM   2034 C CG  . ASN A 1 264 ? 14.614 58.990 24.637 1.00   45.21 ? 263  ASN A CG  1 
ATOM   2035 O OD1 . ASN A 1 264 ? 14.063 58.052 25.219 1.00   48.60 ? 263  ASN A OD1 1 
ATOM   2036 N ND2 . ASN A 1 264 ? 14.800 60.179 25.208 1.00   48.20 ? 263  ASN A ND2 1 
ATOM   2037 N N   . ILE A 1 265 ? 15.091 55.950 24.128 1.00   42.46 ? 264  ILE A N   1 
ATOM   2038 C CA  . ILE A 1 265 ? 14.375 54.681 24.157 1.00   42.37 ? 264  ILE A CA  1 
ATOM   2039 C C   . ILE A 1 265 ? 13.096 54.882 24.957 1.00   41.93 ? 264  ILE A C   1 
ATOM   2040 O O   . ILE A 1 265 ? 13.147 55.368 26.080 1.00   41.24 ? 264  ILE A O   1 
ATOM   2041 C CB  . ILE A 1 265 ? 15.229 53.574 24.769 1.00   42.50 ? 264  ILE A CB  1 
ATOM   2042 C CG1 . ILE A 1 265 ? 14.396 52.306 24.940 1.00   42.66 ? 264  ILE A CG1 1 
ATOM   2043 C CG2 . ILE A 1 265 ? 15.798 54.007 26.105 1.00   43.95 ? 264  ILE A CG2 1 
ATOM   2044 C CD1 . ILE A 1 265 ? 13.893 51.730 23.619 1.00   41.82 ? 264  ILE A CD1 1 
ATOM   2045 N N   . SER A 1 266 ? 11.955 54.519 24.370 1.00   41.49 ? 265  SER A N   1 
ATOM   2046 C CA  . SER A 1 266 ? 10.665 54.689 25.030 1.00   41.05 ? 265  SER A CA  1 
ATOM   2047 C C   . SER A 1 266 ? 9.683  53.588 24.650 1.00   40.72 ? 265  SER A C   1 
ATOM   2048 O O   . SER A 1 266 ? 9.922  52.832 23.707 1.00   39.78 ? 265  SER A O   1 
ATOM   2049 C CB  . SER A 1 266 ? 10.077 56.042 24.644 1.00   41.34 ? 265  SER A CB  1 
ATOM   2050 O OG  . SER A 1 266 ? 9.894  56.134 23.241 1.00   41.21 ? 265  SER A OG  1 
ATOM   2051 N N   . TYR A 1 267 ? 8.589  53.481 25.396 1.00   40.34 ? 266  TYR A N   1 
ATOM   2052 C CA  . TYR A 1 267 ? 7.551  52.523 25.047 1.00   40.51 ? 266  TYR A CA  1 
ATOM   2053 C C   . TYR A 1 267 ? 6.160  53.053 25.375 1.00   40.35 ? 266  TYR A C   1 
ATOM   2054 O O   . TYR A 1 267 ? 5.989  53.874 26.270 1.00   39.66 ? 266  TYR A O   1 
ATOM   2055 C CB  . TYR A 1 267 ? 7.772  51.161 25.718 1.00   40.85 ? 266  TYR A CB  1 
ATOM   2056 C CG  . TYR A 1 267 ? 7.353  51.094 27.158 1.00   41.16 ? 266  TYR A CG  1 
ATOM   2057 C CD1 . TYR A 1 267 ? 8.205  51.516 28.155 1.00   42.85 ? 266  TYR A CD1 1 
ATOM   2058 C CD2 . TYR A 1 267 ? 6.116  50.582 27.526 1.00   42.88 ? 266  TYR A CD2 1 
ATOM   2059 C CE1 . TYR A 1 267 ? 7.840  51.450 29.478 1.00   43.47 ? 266  TYR A CE1 1 
ATOM   2060 C CE2 . TYR A 1 267 ? 5.735  50.524 28.852 1.00   43.41 ? 266  TYR A CE2 1 
ATOM   2061 C CZ  . TYR A 1 267 ? 6.612  50.965 29.827 1.00   44.58 ? 266  TYR A CZ  1 
ATOM   2062 O OH  . TYR A 1 267 ? 6.294  50.925 31.172 1.00   46.51 ? 266  TYR A OH  1 
ATOM   2063 N N   . SER A 1 268 ? 5.179  52.577 24.624 1.00   40.54 ? 267  SER A N   1 
ATOM   2064 C CA  . SER A 1 268 ? 3.786  52.928 24.857 1.00   40.91 ? 267  SER A CA  1 
ATOM   2065 C C   . SER A 1 268 ? 2.931  51.673 24.731 1.00   40.76 ? 267  SER A C   1 
ATOM   2066 O O   . SER A 1 268 ? 2.756  51.158 23.638 1.00   41.03 ? 267  SER A O   1 
ATOM   2067 C CB  . SER A 1 268 ? 3.334  53.986 23.847 1.00   41.22 ? 267  SER A CB  1 
ATOM   2068 O OG  . SER A 1 268 ? 2.067  54.522 24.202 1.00   41.93 ? 267  SER A OG  1 
ATOM   2069 N N   . ASP A 1 269 ? 2.410  51.181 25.851 1.00   40.74 ? 268  ASP A N   1 
ATOM   2070 C CA  . ASP A 1 269 ? 1.600  49.972 25.860 1.00   41.14 ? 268  ASP A CA  1 
ATOM   2071 C C   . ASP A 1 269 ? 2.589  48.794 25.767 1.00   40.43 ? 268  ASP A C   1 
ATOM   2072 O O   . ASP A 1 269 ? 3.511  48.694 26.570 1.00   41.23 ? 268  ASP A O   1 
ATOM   2073 C CB  . ASP A 1 269 ? 0.582  49.989 24.705 1.00   41.47 ? 268  ASP A CB  1 
ATOM   2074 C CG  . ASP A 1 269 ? -0.707 50.739 25.062 1.00   43.08 ? 268  ASP A CG  1 
ATOM   2075 O OD1 . ASP A 1 269 ? -1.261 51.457 24.191 1.00   44.03 ? 268  ASP A OD1 1 
ATOM   2076 O OD2 . ASP A 1 269 ? -1.245 50.663 26.192 1.00   43.87 ? 268  ASP A OD2 1 
ATOM   2077 N N   . LYS A 1 270 ? 2.377  47.885 24.830 1.00   39.39 ? 269  LYS A N   1 
ATOM   2078 C CA  . LYS A 1 270 ? 3.356  46.846 24.528 1.00   38.12 ? 269  LYS A CA  1 
ATOM   2079 C C   . LYS A 1 270 ? 4.439  47.216 23.484 1.00   36.64 ? 269  LYS A C   1 
ATOM   2080 O O   . LYS A 1 270 ? 5.211  46.351 23.097 1.00   35.74 ? 269  LYS A O   1 
ATOM   2081 C CB  . LYS A 1 270 ? 2.616  45.622 24.006 1.00   38.29 ? 269  LYS A CB  1 
ATOM   2082 C CG  . LYS A 1 270 ? 2.033  45.824 22.613 1.00   40.13 ? 269  LYS A CG  1 
ATOM   2083 C CD  . LYS A 1 270 ? 1.254  44.612 22.134 1.00   41.57 ? 269  LYS A CD  1 
ATOM   2084 C CE  . LYS A 1 270 ? 0.848  44.771 20.677 1.00   43.10 ? 269  LYS A CE  1 
ATOM   2085 N NZ  . LYS A 1 270 ? -0.181 43.770 20.250 1.00   44.44 ? 269  LYS A NZ  1 
ATOM   2086 N N   . GLU A 1 271 ? 4.524  48.461 23.023 1.00   35.10 ? 270  GLU A N   1 
ATOM   2087 C CA  . GLU A 1 271 ? 5.501  48.817 21.963 1.00   34.20 ? 270  GLU A CA  1 
ATOM   2088 C C   . GLU A 1 271 ? 6.688  49.732 22.342 1.00   32.31 ? 270  GLU A C   1 
ATOM   2089 O O   . GLU A 1 271 ? 6.502  50.864 22.804 1.00   32.14 ? 270  GLU A O   1 
ATOM   2090 C CB  . GLU A 1 271 ? 4.780  49.468 20.775 1.00   34.34 ? 270  GLU A CB  1 
ATOM   2091 C CG  . GLU A 1 271 ? 5.694  49.809 19.596 1.00   36.10 ? 270  GLU A CG  1 
ATOM   2092 C CD  . GLU A 1 271 ? 4.985  50.549 18.482 1.00   37.52 ? 270  GLU A CD  1 
ATOM   2093 O OE1 . GLU A 1 271 ? 4.732  51.755 18.639 1.00   40.82 ? 270  GLU A OE1 1 
ATOM   2094 O OE2 . GLU A 1 271 ? 4.692  49.931 17.442 1.00   39.97 ? 270  GLU A OE2 1 
ATOM   2095 N N   . PHE A 1 272 ? 7.900  49.237 22.075 1.00   30.32 ? 271  PHE A N   1 
ATOM   2096 C CA  . PHE A 1 272 ? 9.149  49.976 22.303 1.00   28.31 ? 271  PHE A CA  1 
ATOM   2097 C C   . PHE A 1 272 ? 9.635  50.604 21.000 1.00   27.92 ? 271  PHE A C   1 
ATOM   2098 O O   . PHE A 1 272 ? 9.476  50.013 19.938 1.00   26.63 ? 271  PHE A O   1 
ATOM   2099 C CB  . PHE A 1 272 ? 10.245 49.014 22.800 1.00   28.06 ? 271  PHE A CB  1 
ATOM   2100 C CG  . PHE A 1 272 ? 10.275 48.838 24.288 1.00   26.57 ? 271  PHE A CG  1 
ATOM   2101 C CD1 . PHE A 1 272 ? 9.574  47.817 24.890 1.00   27.69 ? 271  PHE A CD1 1 
ATOM   2102 C CD2 . PHE A 1 272 ? 11.022 49.681 25.078 1.00   26.07 ? 271  PHE A CD2 1 
ATOM   2103 C CE1 . PHE A 1 272 ? 9.603  47.654 26.257 1.00   27.08 ? 271  PHE A CE1 1 
ATOM   2104 C CE2 . PHE A 1 272 ? 11.046 49.526 26.453 1.00   26.44 ? 271  PHE A CE2 1 
ATOM   2105 C CZ  . PHE A 1 272 ? 10.333 48.521 27.038 1.00   25.62 ? 271  PHE A CZ  1 
ATOM   2106 N N   . THR A 1 273 ? 10.227 51.792 21.073 1.00   27.22 ? 272  THR A N   1 
ATOM   2107 C CA  . THR A 1 273 ? 10.814 52.400 19.892 1.00   27.57 ? 272  THR A CA  1 
ATOM   2108 C C   . THR A 1 273 ? 12.243 52.816 20.176 1.00   27.72 ? 272  THR A C   1 
ATOM   2109 O O   . THR A 1 273 ? 12.478 53.561 21.119 1.00   27.41 ? 272  THR A O   1 
ATOM   2110 C CB  . THR A 1 273 ? 10.047 53.669 19.471 1.00   28.12 ? 272  THR A CB  1 
ATOM   2111 O OG1 . THR A 1 273 ? 8.718  53.334 19.055 1.00   27.44 ? 272  THR A OG1 1 
ATOM   2112 C CG2 . THR A 1 273 ? 10.705 54.284 18.241 1.00   29.09 ? 272  THR A CG2 1 
ATOM   2113 N N   . ILE A 1 274 ? 13.183 52.328 19.364 1.00   26.89 ? 273  ILE A N   1 
ATOM   2114 C CA  . ILE A 1 274 ? 14.580 52.739 19.446 1.00   27.45 ? 273  ILE A CA  1 
ATOM   2115 C C   . ILE A 1 274 ? 14.771 53.759 18.341 1.00   27.74 ? 273  ILE A C   1 
ATOM   2116 O O   . ILE A 1 274 ? 14.511 53.464 17.177 1.00   27.78 ? 273  ILE A O   1 
ATOM   2117 C CB  . ILE A 1 274 ? 15.564 51.577 19.194 1.00   26.88 ? 273  ILE A CB  1 
ATOM   2118 C CG1 . ILE A 1 274 ? 15.408 50.476 20.234 1.00   26.03 ? 273  ILE A CG1 1 
ATOM   2119 C CG2 . ILE A 1 274 ? 16.998 52.092 19.194 1.00   27.16 ? 273  ILE A CG2 1 
ATOM   2120 C CD1 . ILE A 1 274 ? 16.133 49.182 19.828 1.00   25.16 ? 273  ILE A CD1 1 
ATOM   2121 N N   . LYS A 1 275 ? 15.258 54.932 18.706 1.00   28.54 ? 274  LYS A N   1 
ATOM   2122 C CA  . LYS A 1 275 ? 15.440 56.022 17.758 1.00   29.62 ? 274  LYS A CA  1 
ATOM   2123 C C   . LYS A 1 275 ? 16.901 56.317 17.578 1.00   29.08 ? 274  LYS A C   1 
ATOM   2124 O O   . LYS A 1 275 ? 17.541 56.878 18.467 1.00   28.50 ? 274  LYS A O   1 
ATOM   2125 C CB  . LYS A 1 275 ? 14.719 57.278 18.252 1.00   30.06 ? 274  LYS A CB  1 
ATOM   2126 C CG  . LYS A 1 275 ? 13.259 57.040 18.451 1.00   33.23 ? 274  LYS A CG  1 
ATOM   2127 C CD  . LYS A 1 275 ? 12.488 58.296 18.847 1.00   37.61 ? 274  LYS A CD  1 
ATOM   2128 C CE  . LYS A 1 275 ? 12.599 58.596 20.321 1.00   38.92 ? 274  LYS A CE  1 
ATOM   2129 N NZ  . LYS A 1 275 ? 11.463 59.475 20.748 1.00   40.73 ? 274  LYS A NZ  1 
ATOM   2130 N N   . PRO A 1 276 ? 17.436 55.921 16.427 1.00   29.17 ? 275  PRO A N   1 
ATOM   2131 C CA  . PRO A 1 276 ? 18.825 56.210 16.076 1.00   29.09 ? 275  PRO A CA  1 
ATOM   2132 C C   . PRO A 1 276 ? 19.103 57.719 15.907 1.00   29.54 ? 275  PRO A C   1 
ATOM   2133 O O   . PRO A 1 276 ? 18.234 58.474 15.464 1.00   28.74 ? 275  PRO A O   1 
ATOM   2134 C CB  . PRO A 1 276 ? 18.998 55.496 14.726 1.00   29.42 ? 275  PRO A CB  1 
ATOM   2135 C CG  . PRO A 1 276 ? 17.883 54.540 14.628 1.00   29.82 ? 275  PRO A CG  1 
ATOM   2136 C CD  . PRO A 1 276 ? 16.755 55.137 15.385 1.00   29.71 ? 275  PRO A CD  1 
ATOM   2137 N N   . LEU A 1 277 ? 20.304 58.145 16.266 1.00   29.71 ? 276  LEU A N   1 
ATOM   2138 C CA  . LEU A 1 277 ? 20.709 59.532 16.076 1.00   30.56 ? 276  LEU A CA  1 
ATOM   2139 C C   . LEU A 1 277 ? 20.989 59.796 14.599 1.00   30.93 ? 276  LEU A C   1 
ATOM   2140 O O   . LEU A 1 277 ? 20.871 60.928 14.122 1.00   31.23 ? 276  LEU A O   1 
ATOM   2141 C CB  . LEU A 1 277 ? 21.936 59.839 16.915 1.00   30.27 ? 276  LEU A CB  1 
ATOM   2142 C CG  . LEU A 1 277 ? 21.643 60.055 18.398 1.00   31.41 ? 276  LEU A CG  1 
ATOM   2143 C CD1 . LEU A 1 277 ? 22.941 60.126 19.176 1.00   31.25 ? 276  LEU A CD1 1 
ATOM   2144 C CD2 . LEU A 1 277 ? 20.808 61.319 18.634 1.00   32.51 ? 276  LEU A CD2 1 
ATOM   2145 N N   . ASP A 1 278 ? 21.366 58.748 13.873 1.00   31.51 ? 277  ASP A N   1 
ATOM   2146 C CA  . ASP A 1 278 ? 21.584 58.856 12.432 1.00   31.50 ? 277  ASP A CA  1 
ATOM   2147 C C   . ASP A 1 278 ? 20.234 58.689 11.757 1.00   31.90 ? 277  ASP A C   1 
ATOM   2148 O O   . ASP A 1 278 ? 19.720 57.594 11.608 1.00   31.54 ? 277  ASP A O   1 
ATOM   2149 C CB  . ASP A 1 278 ? 22.609 57.815 11.957 1.00   31.66 ? 277  ASP A CB  1 
ATOM   2150 C CG  . ASP A 1 278 ? 22.941 57.934 10.479 1.00   32.03 ? 277  ASP A CG  1 
ATOM   2151 O OD1 . ASP A 1 278 ? 22.214 58.625 9.735  1.00   31.00 ? 277  ASP A OD1 1 
ATOM   2152 O OD2 . ASP A 1 278 ? 23.909 57.332 9.968  1.00   31.22 ? 277  ASP A OD2 1 
ATOM   2153 N N   . LYS A 1 279 ? 19.660 59.822 11.369 1.00   32.35 ? 278  LYS A N   1 
ATOM   2154 C CA  . LYS A 1 279 ? 18.355 59.910 10.725 1.00   32.44 ? 278  LYS A CA  1 
ATOM   2155 C C   . LYS A 1 279 ? 18.230 59.035 9.481  1.00   31.74 ? 278  LYS A C   1 
ATOM   2156 O O   . LYS A 1 279 ? 17.120 58.733 9.051  1.00   31.98 ? 278  LYS A O   1 
ATOM   2157 C CB  . LYS A 1 279 ? 18.088 61.372 10.350 1.00   33.34 ? 278  LYS A CB  1 
ATOM   2158 C CG  . LYS A 1 279 ? 19.353 62.128 9.957  1.00   35.32 ? 278  LYS A CG  1 
ATOM   2159 C CD  . LYS A 1 279 ? 20.157 62.564 11.193 1.00   37.44 ? 278  LYS A CD  1 
ATOM   2160 C CE  . LYS A 1 279 ? 21.673 62.539 10.948 1.00   38.51 ? 278  LYS A CE  1 
ATOM   2161 N NZ  . LYS A 1 279 ? 22.135 61.302 10.243 1.00   39.92 ? 278  LYS A NZ  1 
ATOM   2162 N N   . LYS A 1 280 ? 19.360 58.633 8.909  1.00   30.98 ? 279  LYS A N   1 
ATOM   2163 C CA  . LYS A 1 280 ? 19.350 57.767 7.743  1.00   30.58 ? 279  LYS A CA  1 
ATOM   2164 C C   . LYS A 1 280 ? 18.897 56.353 8.113  1.00   29.41 ? 279  LYS A C   1 
ATOM   2165 O O   . LYS A 1 280 ? 18.463 55.607 7.243  1.00   28.18 ? 279  LYS A O   1 
ATOM   2166 C CB  . LYS A 1 280 ? 20.723 57.722 7.069  1.00   30.93 ? 279  LYS A CB  1 
ATOM   2167 C CG  . LYS A 1 280 ? 21.037 58.945 6.193  1.00   33.68 ? 279  LYS A CG  1 
ATOM   2168 C CD  . LYS A 1 280 ? 22.439 58.853 5.603  1.00   36.67 ? 279  LYS A CD  1 
ATOM   2169 C CE  . LYS A 1 280 ? 22.898 60.165 4.982  1.00   39.22 ? 279  LYS A CE  1 
ATOM   2170 N NZ  . LYS A 1 280 ? 24.400 60.248 4.915  1.00   40.89 ? 279  LYS A NZ  1 
ATOM   2171 N N   . ILE A 1 281 ? 19.009 55.997 9.393  1.00   28.59 ? 280  ILE A N   1 
ATOM   2172 C CA  . ILE A 1 281 ? 18.513 54.690 9.894  1.00   28.30 ? 280  ILE A CA  1 
ATOM   2173 C C   . ILE A 1 281 ? 17.098 54.861 10.473 1.00   28.18 ? 280  ILE A C   1 
ATOM   2174 O O   . ILE A 1 281 ? 16.879 55.721 11.320 1.00   28.66 ? 280  ILE A O   1 
ATOM   2175 C CB  . ILE A 1 281 ? 19.474 54.115 10.954 1.00   28.46 ? 280  ILE A CB  1 
ATOM   2176 C CG1 . ILE A 1 281 ? 20.868 53.910 10.348 1.00   28.75 ? 280  ILE A CG1 1 
ATOM   2177 C CG2 . ILE A 1 281 ? 18.950 52.767 11.501 1.00   27.91 ? 280  ILE A CG2 1 
ATOM   2178 C CD1 . ILE A 1 281 ? 21.966 53.618 11.380 1.00   28.87 ? 280  ILE A CD1 1 
ATOM   2179 N N   . ASP A 1 282 ? 16.144 54.050 10.019 1.00   28.13 ? 281  ASP A N   1 
ATOM   2180 C CA  . ASP A 1 282 ? 14.765 54.137 10.504 1.00   28.20 ? 281  ASP A CA  1 
ATOM   2181 C C   . ASP A 1 282 ? 14.681 53.692 11.959 1.00   27.69 ? 281  ASP A C   1 
ATOM   2182 O O   . ASP A 1 282 ? 15.534 52.926 12.442 1.00   27.37 ? 281  ASP A O   1 
ATOM   2183 C CB  . ASP A 1 282 ? 13.835 53.254 9.677  1.00   28.78 ? 281  ASP A CB  1 
ATOM   2184 C CG  . ASP A 1 282 ? 13.489 53.849 8.315  1.00   30.52 ? 281  ASP A CG  1 
ATOM   2185 O OD1 . ASP A 1 282 ? 13.775 55.041 8.043  1.00   32.82 ? 281  ASP A OD1 1 
ATOM   2186 O OD2 . ASP A 1 282 ? 12.909 53.168 7.452  1.00   32.62 ? 281  ASP A OD2 1 
ATOM   2187 N N   . VAL A 1 283 ? 13.648 54.152 12.659 1.00   26.92 ? 282  VAL A N   1 
ATOM   2188 C CA  . VAL A 1 283 ? 13.473 53.764 14.049 1.00   26.23 ? 282  VAL A CA  1 
ATOM   2189 C C   . VAL A 1 283 ? 13.219 52.275 14.087 1.00   25.52 ? 282  VAL A C   1 
ATOM   2190 O O   . VAL A 1 283 ? 12.686 51.703 13.124 1.00   25.18 ? 282  VAL A O   1 
ATOM   2191 C CB  . VAL A 1 283 ? 12.336 54.526 14.745 1.00   26.56 ? 282  VAL A CB  1 
ATOM   2192 C CG1 . VAL A 1 283 ? 12.592 56.042 14.679 1.00   26.81 ? 282  VAL A CG1 1 
ATOM   2193 C CG2 . VAL A 1 283 ? 10.986 54.156 14.151 1.00   27.93 ? 282  VAL A CG2 1 
ATOM   2194 N N   . PHE A 1 284 ? 13.624 51.641 15.184 1.00   24.35 ? 283  PHE A N   1 
ATOM   2195 C CA  . PHE A 1 284 ? 13.462 50.201 15.318 1.00   24.04 ? 283  PHE A CA  1 
ATOM   2196 C C   . PHE A 1 284 ? 12.385 49.972 16.348 1.00   24.17 ? 283  PHE A C   1 
ATOM   2197 O O   . PHE A 1 284 ? 12.538 50.386 17.498 1.00   24.80 ? 283  PHE A O   1 
ATOM   2198 C CB  . PHE A 1 284 ? 14.760 49.515 15.760 1.00   23.37 ? 283  PHE A CB  1 
ATOM   2199 C CG  . PHE A 1 284 ? 14.657 48.032 15.769 1.00   22.11 ? 283  PHE A CG  1 
ATOM   2200 C CD1 . PHE A 1 284 ? 14.136 47.374 16.868 1.00   21.57 ? 283  PHE A CD1 1 
ATOM   2201 C CD2 . PHE A 1 284 ? 15.050 47.288 14.668 1.00   21.82 ? 283  PHE A CD2 1 
ATOM   2202 C CE1 . PHE A 1 284 ? 14.005 46.006 16.875 1.00   22.08 ? 283  PHE A CE1 1 
ATOM   2203 C CE2 . PHE A 1 284 ? 14.918 45.913 14.668 1.00   22.28 ? 283  PHE A CE2 1 
ATOM   2204 C CZ  . PHE A 1 284 ? 14.397 45.271 15.781 1.00   21.66 ? 283  PHE A CZ  1 
ATOM   2205 N N   . LYS A 1 285 ? 11.295 49.338 15.935 1.00   24.33 ? 284  LYS A N   1 
ATOM   2206 C CA  . LYS A 1 285 ? 10.165 49.081 16.827 1.00   24.42 ? 284  LYS A CA  1 
ATOM   2207 C C   . LYS A 1 285 ? 9.984  47.600 17.151 1.00   23.86 ? 284  LYS A C   1 
ATOM   2208 O O   . LYS A 1 285 ? 10.202 46.727 16.298 1.00   24.17 ? 284  LYS A O   1 
ATOM   2209 C CB  . LYS A 1 285 ? 8.873  49.603 16.188 1.00   24.85 ? 284  LYS A CB  1 
ATOM   2210 C CG  . LYS A 1 285 ? 8.806  51.114 16.094 1.00   26.76 ? 284  LYS A CG  1 
ATOM   2211 C CD  . LYS A 1 285 ? 7.570  51.550 15.301 1.00   29.74 ? 284  LYS A CD  1 
ATOM   2212 C CE  . LYS A 1 285 ? 7.465  53.057 15.198 1.00   32.13 ? 284  LYS A CE  1 
ATOM   2213 N NZ  . LYS A 1 285 ? 6.277  53.393 14.353 1.00   34.69 ? 284  LYS A NZ  1 
ATOM   2214 N N   . PHE A 1 286 ? 9.580  47.309 18.386 1.00   23.39 ? 285  PHE A N   1 
ATOM   2215 C CA  . PHE A 1 286 ? 9.329  45.932 18.789 1.00   23.29 ? 285  PHE A CA  1 
ATOM   2216 C C   . PHE A 1 286 ? 8.285  45.905 19.898 1.00   23.94 ? 285  PHE A C   1 
ATOM   2217 O O   . PHE A 1 286 ? 8.086  46.890 20.570 1.00   24.51 ? 285  PHE A O   1 
ATOM   2218 C CB  . PHE A 1 286 ? 10.618 45.195 19.209 1.00   22.77 ? 285  PHE A CB  1 
ATOM   2219 C CG  . PHE A 1 286 ? 11.315 45.780 20.404 1.00   22.29 ? 285  PHE A CG  1 
ATOM   2220 C CD1 . PHE A 1 286 ? 11.006 45.352 21.688 1.00   22.21 ? 285  PHE A CD1 1 
ATOM   2221 C CD2 . PHE A 1 286 ? 12.316 46.718 20.239 1.00   20.24 ? 285  PHE A CD2 1 
ATOM   2222 C CE1 . PHE A 1 286 ? 11.655 45.906 22.780 1.00   21.94 ? 285  PHE A CE1 1 
ATOM   2223 C CE2 . PHE A 1 286 ? 12.956 47.265 21.315 1.00   21.75 ? 285  PHE A CE2 1 
ATOM   2224 C CZ  . PHE A 1 286 ? 12.637 46.857 22.590 1.00   21.59 ? 285  PHE A CZ  1 
ATOM   2225 N N   . ASN A 1 287 ? 7.629  44.770 20.064 1.00   24.64 ? 286  ASN A N   1 
ATOM   2226 C CA  . ASN A 1 287 ? 6.603  44.609 21.086 1.00   26.02 ? 286  ASN A CA  1 
ATOM   2227 C C   . ASN A 1 287 ? 7.062  43.712 22.211 1.00   26.37 ? 286  ASN A C   1 
ATOM   2228 O O   . ASN A 1 287 ? 7.807  42.756 21.988 1.00   25.38 ? 286  ASN A O   1 
ATOM   2229 C CB  . ASN A 1 287 ? 5.358  43.950 20.495 1.00   26.71 ? 286  ASN A CB  1 
ATOM   2230 C CG  . ASN A 1 287 ? 4.638  44.831 19.520 1.00   28.69 ? 286  ASN A CG  1 
ATOM   2231 O OD1 . ASN A 1 287 ? 4.763  46.037 19.557 1.00   32.27 ? 286  ASN A OD1 1 
ATOM   2232 N ND2 . ASN A 1 287 ? 3.866  44.219 18.636 1.00   32.39 ? 286  ASN A ND2 1 
ATOM   2233 N N   . SER A 1 288 ? 6.561  43.995 23.407 1.00   27.79 ? 287  SER A N   1 
ATOM   2234 C CA  . SER A 1 288 ? 6.804  43.190 24.594 1.00   28.76 ? 287  SER A CA  1 
ATOM   2235 C C   . SER A 1 288 ? 5.565  43.424 25.452 1.00   30.19 ? 287  SER A C   1 
ATOM   2236 O O   . SER A 1 288 ? 5.276  44.567 25.787 1.00   30.24 ? 287  SER A O   1 
ATOM   2237 C CB  . SER A 1 288 ? 8.046  43.686 25.319 1.00   28.50 ? 287  SER A CB  1 
ATOM   2238 O OG  . SER A 1 288 ? 8.143  43.088 26.587 1.00   28.20 ? 287  SER A OG  1 
ATOM   2239 N N   . SER A 1 289 ? 4.856  42.351 25.803 1.00   32.41 ? 288  SER A N   1 
ATOM   2240 C CA  . SER A 1 289 ? 3.549  42.447 26.471 1.00   34.24 ? 288  SER A CA  1 
ATOM   2241 C C   . SER A 1 289 ? 3.551  42.597 27.998 1.00   34.52 ? 288  SER A C   1 
ATOM   2242 O O   . SER A 1 289 ? 2.712  43.328 28.562 1.00   35.12 ? 288  SER A O   1 
ATOM   2243 C CB  . SER A 1 289 ? 2.719  41.216 26.104 1.00   34.65 ? 288  SER A CB  1 
ATOM   2244 O OG  . SER A 1 289 ? 3.494  40.027 26.255 1.00   38.44 ? 288  SER A OG  1 
ATOM   2245 N N   . LYS A 1 290 ? 4.472  41.918 28.673 1.00   34.31 ? 289  LYS A N   1 
ATOM   2246 C CA  . LYS A 1 290 ? 4.503  41.960 30.132 1.00   33.93 ? 289  LYS A CA  1 
ATOM   2247 C C   . LYS A 1 290 ? 4.989  43.316 30.675 1.00   33.30 ? 289  LYS A C   1 
ATOM   2248 O O   . LYS A 1 290 ? 6.159  43.688 30.526 1.00   33.01 ? 289  LYS A O   1 
ATOM   2249 C CB  . LYS A 1 290 ? 5.367  40.824 30.665 1.00   34.66 ? 289  LYS A CB  1 
ATOM   2250 C CG  . LYS A 1 290 ? 5.014  39.453 30.103 1.00   36.19 ? 289  LYS A CG  1 
ATOM   2251 C CD  . LYS A 1 290 ? 5.652  38.339 30.926 1.00   38.33 ? 289  LYS A CD  1 
ATOM   2252 C CE  . LYS A 1 290 ? 5.200  36.957 30.475 1.00   39.85 ? 289  LYS A CE  1 
ATOM   2253 N NZ  . LYS A 1 290 ? 5.778  35.873 31.337 1.00   41.77 ? 289  LYS A NZ  1 
ATOM   2254 N N   . LEU A 1 291 ? 4.082  44.047 31.321 1.00   31.72 ? 290  LEU A N   1 
ATOM   2255 C CA  . LEU A 1 291 ? 4.375  45.363 31.866 1.00   31.22 ? 290  LEU A CA  1 
ATOM   2256 C C   . LEU A 1 291 ? 5.526  45.368 32.868 1.00   29.70 ? 290  LEU A C   1 
ATOM   2257 O O   . LEU A 1 291 ? 6.293  46.323 32.945 1.00   28.79 ? 290  LEU A O   1 
ATOM   2258 C CB  . LEU A 1 291 ? 3.117  45.914 32.559 1.00   31.73 ? 290  LEU A CB  1 
ATOM   2259 C CG  . LEU A 1 291 ? 3.281  47.193 33.373 1.00   34.37 ? 290  LEU A CG  1 
ATOM   2260 C CD1 . LEU A 1 291 ? 3.781  48.331 32.497 1.00   36.20 ? 290  LEU A CD1 1 
ATOM   2261 C CD2 . LEU A 1 291 ? 1.957  47.574 34.055 1.00   36.93 ? 290  LEU A CD2 1 
ATOM   2262 N N   . ARG A 1 292 ? 5.623  44.299 33.644 1.00   28.38 ? 291  ARG A N   1 
ATOM   2263 C CA  . ARG A 1 292 ? 6.646  44.193 34.681 1.00   27.95 ? 291  ARG A CA  1 
ATOM   2264 C C   . ARG A 1 292 ? 8.006  44.062 34.020 1.00   27.14 ? 291  ARG A C   1 
ATOM   2265 O O   . ARG A 1 292 ? 9.022  44.537 34.537 1.00   26.82 ? 291  ARG A O   1 
ATOM   2266 C CB  . ARG A 1 292 ? 6.370  42.996 35.593 1.00   28.38 ? 291  ARG A CB  1 
ATOM   2267 C CG  . ARG A 1 292 ? 6.081  41.656 34.894 1.00   29.66 ? 291  ARG A CG  1 
ATOM   2268 C CD  . ARG A 1 292 ? 5.535  40.594 35.855 1.00   31.90 ? 291  ARG A CD  1 
ATOM   2269 N NE  . ARG A 1 292 ? 5.562  39.226 35.336 1.00   35.94 ? 291  ARG A NE  1 
ATOM   2270 C CZ  . ARG A 1 292 ? 4.592  38.664 34.615 1.00   38.87 ? 291  ARG A CZ  1 
ATOM   2271 N NH1 . ARG A 1 292 ? 3.505  39.351 34.286 1.00   39.66 ? 291  ARG A NH1 1 
ATOM   2272 N NH2 . ARG A 1 292 ? 4.714  37.407 34.210 1.00   39.91 ? 291  ARG A NH2 1 
ATOM   2273 N N   . VAL A 1 293 ? 7.996  43.420 32.859 1.00   26.24 ? 292  VAL A N   1 
ATOM   2274 C CA  . VAL A 1 293 ? 9.204  43.214 32.076 1.00   25.25 ? 292  VAL A CA  1 
ATOM   2275 C C   . VAL A 1 293 ? 9.597  44.520 31.439 1.00   24.66 ? 292  VAL A C   1 
ATOM   2276 O O   . VAL A 1 293 ? 10.773 44.904 31.462 1.00   22.84 ? 292  VAL A O   1 
ATOM   2277 C CB  . VAL A 1 293 ? 8.975  42.134 30.983 1.00   25.52 ? 292  VAL A CB  1 
ATOM   2278 C CG1 . VAL A 1 293 ? 10.158 42.036 30.040 1.00   25.94 ? 292  VAL A CG1 1 
ATOM   2279 C CG2 . VAL A 1 293 ? 8.709  40.793 31.605 1.00   26.28 ? 292  VAL A CG2 1 
ATOM   2280 N N   . ASN A 1 294 ? 8.614  45.217 30.866 1.00   23.90 ? 293  ASN A N   1 
ATOM   2281 C CA  . ASN A 1 294 ? 8.875  46.485 30.199 1.00   24.04 ? 293  ASN A CA  1 
ATOM   2282 C C   . ASN A 1 294 ? 9.460  47.524 31.150 1.00   23.92 ? 293  ASN A C   1 
ATOM   2283 O O   . ASN A 1 294 ? 10.312 48.322 30.772 1.00   23.85 ? 293  ASN A O   1 
ATOM   2284 C CB  . ASN A 1 294 ? 7.606  47.010 29.512 1.00   23.97 ? 293  ASN A CB  1 
ATOM   2285 C CG  . ASN A 1 294 ? 7.133  46.098 28.415 1.00   26.20 ? 293  ASN A CG  1 
ATOM   2286 O OD1 . ASN A 1 294 ? 7.838  45.167 28.020 1.00   25.00 ? 293  ASN A OD1 1 
ATOM   2287 N ND2 . ASN A 1 294 ? 5.914  46.338 27.922 1.00   28.02 ? 293  ASN A ND2 1 
ATOM   2288 N N   . LYS A 1 295 ? 9.020  47.503 32.401 1.00   23.90 ? 294  LYS A N   1 
ATOM   2289 C CA  . LYS A 1 295 ? 9.550  48.439 33.378 1.00   24.22 ? 294  LYS A CA  1 
ATOM   2290 C C   . LYS A 1 295 ? 11.031 48.147 33.625 1.00   23.17 ? 294  LYS A C   1 
ATOM   2291 O O   . LYS A 1 295 ? 11.862 49.061 33.694 1.00   23.50 ? 294  LYS A O   1 
ATOM   2292 C CB  . LYS A 1 295 ? 8.743  48.359 34.672 1.00   24.73 ? 294  LYS A CB  1 
ATOM   2293 C CG  . LYS A 1 295 ? 7.370  49.001 34.502 1.00   28.01 ? 294  LYS A CG  1 
ATOM   2294 C CD  . LYS A 1 295 ? 6.607  49.137 35.820 1.00   31.55 ? 294  LYS A CD  1 
ATOM   2295 C CE  . LYS A 1 295 ? 5.304  49.883 35.589 1.00   34.80 ? 294  LYS A CE  1 
ATOM   2296 N NZ  . LYS A 1 295 ? 4.355  49.815 36.733 1.00   37.27 ? 294  LYS A NZ  1 
ATOM   2297 N N   . LEU A 1 296 ? 11.341 46.869 33.727 1.00   22.28 ? 295  LEU A N   1 
ATOM   2298 C CA  . LEU A 1 296 ? 12.711 46.416 33.940 1.00   21.79 ? 295  LEU A CA  1 
ATOM   2299 C C   . LEU A 1 296 ? 13.591 46.794 32.747 1.00   21.35 ? 295  LEU A C   1 
ATOM   2300 O O   . LEU A 1 296 ? 14.680 47.341 32.935 1.00   19.94 ? 295  LEU A O   1 
ATOM   2301 C CB  . LEU A 1 296 ? 12.735 44.924 34.195 1.00   21.64 ? 295  LEU A CB  1 
ATOM   2302 C CG  . LEU A 1 296 ? 14.112 44.287 34.407 1.00   22.11 ? 295  LEU A CG  1 
ATOM   2303 C CD1 . LEU A 1 296 ? 14.822 44.891 35.614 1.00   23.48 ? 295  LEU A CD1 1 
ATOM   2304 C CD2 . LEU A 1 296 ? 13.971 42.805 34.552 1.00   21.92 ? 295  LEU A CD2 1 
ATOM   2305 N N   . ILE A 1 297 ? 13.117 46.546 31.525 1.00   20.49 ? 296  ILE A N   1 
ATOM   2306 C CA  . ILE A 1 297 ? 13.868 46.941 30.334 1.00   20.50 ? 296  ILE A CA  1 
ATOM   2307 C C   . ILE A 1 297 ? 14.210 48.435 30.380 1.00   21.62 ? 296  ILE A C   1 
ATOM   2308 O O   . ILE A 1 297 ? 15.350 48.856 30.160 1.00   19.67 ? 296  ILE A O   1 
ATOM   2309 C CB  . ILE A 1 297 ? 13.053 46.626 29.070 1.00   20.47 ? 296  ILE A CB  1 
ATOM   2310 C CG1 . ILE A 1 297 ? 12.974 45.104 28.879 1.00   19.74 ? 296  ILE A CG1 1 
ATOM   2311 C CG2 . ILE A 1 297 ? 13.649 47.348 27.853 1.00   20.84 ? 296  ILE A CG2 1 
ATOM   2312 C CD1 . ILE A 1 297 ? 12.020 44.668 27.789 1.00   19.22 ? 296  ILE A CD1 1 
ATOM   2313 N N   . LEU A 1 298 ? 13.222 49.254 30.707 1.00   21.80 ? 297  LEU A N   1 
ATOM   2314 C CA  . LEU A 1 298 ? 13.456 50.688 30.743 1.00   23.37 ? 297  LEU A CA  1 
ATOM   2315 C C   . LEU A 1 298 ? 14.529 51.108 31.705 1.00   23.14 ? 297  LEU A C   1 
ATOM   2316 O O   . LEU A 1 298 ? 15.398 51.929 31.364 1.00   24.24 ? 297  LEU A O   1 
ATOM   2317 C CB  . LEU A 1 298 ? 12.169 51.434 31.094 1.00   24.41 ? 297  LEU A CB  1 
ATOM   2318 C CG  . LEU A 1 298 ? 11.486 52.153 29.952 1.00   27.68 ? 297  LEU A CG  1 
ATOM   2319 C CD1 . LEU A 1 298 ? 10.339 52.953 30.584 1.00   30.67 ? 297  LEU A CD1 1 
ATOM   2320 C CD2 . LEU A 1 298 ? 12.391 53.105 29.177 1.00   29.38 ? 297  LEU A CD2 1 
ATOM   2321 N N   . GLN A 1 299 ? 14.471 50.559 32.907 1.00   23.03 ? 298  GLN A N   1 
ATOM   2322 C CA  . GLN A 1 299 ? 15.438 50.872 33.927 1.00   23.43 ? 298  GLN A CA  1 
ATOM   2323 C C   . GLN A 1 299 ? 16.823 50.499 33.465 1.00   21.89 ? 298  GLN A C   1 
ATOM   2324 O O   . GLN A 1 299 ? 17.770 51.253 33.666 1.00   21.07 ? 298  GLN A O   1 
ATOM   2325 C CB  . GLN A 1 299 ? 15.176 50.074 35.188 1.00   23.72 ? 298  GLN A CB  1 
ATOM   2326 C CG  . GLN A 1 299 ? 14.050 50.531 36.027 1.00   27.39 ? 298  GLN A CG  1 
ATOM   2327 C CD  . GLN A 1 299 ? 13.628 49.445 36.987 1.00   30.17 ? 298  GLN A CD  1 
ATOM   2328 O OE1 . GLN A 1 299 ? 14.474 48.746 37.545 1.00   28.01 ? 298  GLN A OE1 1 
ATOM   2329 N NE2 . GLN A 1 299 ? 12.315 49.300 37.190 1.00   35.71 ? 298  GLN A NE2 1 
ATOM   2330 N N   . LEU A 1 300 ? 16.941 49.314 32.875 1.00   20.57 ? 299  LEU A N   1 
ATOM   2331 C CA  . LEU A 1 300 ? 18.256 48.840 32.436 1.00   19.55 ? 299  LEU A CA  1 
ATOM   2332 C C   . LEU A 1 300 ? 18.788 49.680 31.280 1.00   19.59 ? 299  LEU A C   1 
ATOM   2333 O O   . LEU A 1 300 ? 19.988 49.912 31.187 1.00   18.51 ? 299  LEU A O   1 
ATOM   2334 C CB  . LEU A 1 300 ? 18.220 47.353 32.084 1.00   18.93 ? 299  LEU A CB  1 
ATOM   2335 C CG  . LEU A 1 300 ? 17.958 46.365 33.222 1.00   18.38 ? 299  LEU A CG  1 
ATOM   2336 C CD1 . LEU A 1 300 ? 17.691 44.929 32.702 1.00   18.62 ? 299  LEU A CD1 1 
ATOM   2337 C CD2 . LEU A 1 300 ? 19.118 46.352 34.214 1.00   18.68 ? 299  LEU A CD2 1 
ATOM   2338 N N   . CYS A 1 301 ? 17.903 50.132 30.395 1.00   19.41 ? 300  CYS A N   1 
ATOM   2339 C CA  . CYS A 1 301 ? 18.314 50.969 29.291 1.00   20.57 ? 300  CYS A CA  1 
ATOM   2340 C C   . CYS A 1 301 ? 18.812 52.326 29.802 1.00   21.07 ? 300  CYS A C   1 
ATOM   2341 O O   . CYS A 1 301 ? 19.879 52.780 29.435 1.00   20.74 ? 300  CYS A O   1 
ATOM   2342 C CB  . CYS A 1 301 ? 17.175 51.159 28.300 1.00   20.64 ? 300  CYS A CB  1 
ATOM   2343 S SG  . CYS A 1 301 ? 16.805 49.723 27.281 1.00   21.75 ? 300  CYS A SG  1 
ATOM   2344 N N   . ILE A 1 302 ? 18.031 52.969 30.661 1.00   21.96 ? 301  ILE A N   1 
ATOM   2345 C CA  . ILE A 1 302 ? 18.417 54.273 31.186 1.00   21.96 ? 301  ILE A CA  1 
ATOM   2346 C C   . ILE A 1 302 ? 19.745 54.212 31.955 1.00   20.37 ? 301  ILE A C   1 
ATOM   2347 O O   . ILE A 1 302 ? 20.632 55.036 31.755 1.00   21.00 ? 301  ILE A O   1 
ATOM   2348 C CB  . ILE A 1 302 ? 17.279 54.846 32.081 1.00   22.33 ? 301  ILE A CB  1 
ATOM   2349 C CG1 . ILE A 1 302 ? 16.098 55.249 31.194 1.00   24.85 ? 301  ILE A CG1 1 
ATOM   2350 C CG2 . ILE A 1 302 ? 17.765 56.051 32.867 1.00   24.09 ? 301  ILE A CG2 1 
ATOM   2351 C CD1 . ILE A 1 302 ? 14.780 55.404 31.958 1.00   26.32 ? 301  ILE A CD1 1 
ATOM   2352 N N   . GLY A 1 303 ? 19.885 53.231 32.828 1.00   19.50 ? 302  GLY A N   1 
ATOM   2353 C CA  . GLY A 1 303 ? 21.078 53.114 33.639 1.00   18.09 ? 302  GLY A CA  1 
ATOM   2354 C C   . GLY A 1 303 ? 22.322 52.798 32.826 1.00   17.96 ? 302  GLY A C   1 
ATOM   2355 O O   . GLY A 1 303 ? 23.394 53.349 33.095 1.00   16.36 ? 302  GLY A O   1 
ATOM   2356 N N   . ASN A 1 304 ? 22.189 51.895 31.854 1.00   17.32 ? 303  ASN A N   1 
ATOM   2357 C CA  . ASN A 1 304 ? 23.333 51.520 31.020 1.00   17.09 ? 303  ASN A CA  1 
ATOM   2358 C C   . ASN A 1 304 ? 23.743 52.684 30.141 1.00   17.62 ? 303  ASN A C   1 
ATOM   2359 O O   . ASN A 1 304 ? 24.917 52.998 30.009 1.00   17.73 ? 303  ASN A O   1 
ATOM   2360 C CB  . ASN A 1 304 ? 23.049 50.278 30.169 1.00   16.37 ? 303  ASN A CB  1 
ATOM   2361 C CG  . ASN A 1 304 ? 23.339 49.003 30.919 1.00   15.99 ? 303  ASN A CG  1 
ATOM   2362 O OD1 . ASN A 1 304 ? 24.497 48.708 31.258 1.00   16.69 ? 303  ASN A OD1 1 
ATOM   2363 N ND2 . ASN A 1 304 ? 22.292 48.251 31.217 1.00   14.91 ? 303  ASN A ND2 1 
ATOM   2364 N N   . HIS A 1 305 ? 22.757 53.341 29.549 1.00   18.42 ? 304  HIS A N   1 
ATOM   2365 C CA  . HIS A 1 305 ? 23.068 54.477 28.692 1.00   19.66 ? 304  HIS A CA  1 
ATOM   2366 C C   . HIS A 1 305 ? 23.776 55.543 29.516 1.00   19.62 ? 304  HIS A C   1 
ATOM   2367 O O   . HIS A 1 305 ? 24.805 56.067 29.101 1.00   19.93 ? 304  HIS A O   1 
ATOM   2368 C CB  . HIS A 1 305 ? 21.818 55.055 28.043 1.00   19.65 ? 304  HIS A CB  1 
ATOM   2369 C CG  . HIS A 1 305 ? 22.076 56.321 27.279 1.00   23.94 ? 304  HIS A CG  1 
ATOM   2370 N ND1 . HIS A 1 305 ? 21.982 57.576 27.856 1.00   29.36 ? 304  HIS A ND1 1 
ATOM   2371 C CD2 . HIS A 1 305 ? 22.408 56.526 25.984 1.00   26.49 ? 304  HIS A CD2 1 
ATOM   2372 C CE1 . HIS A 1 305 ? 22.248 58.495 26.944 1.00   30.08 ? 304  HIS A CE1 1 
ATOM   2373 N NE2 . HIS A 1 305 ? 22.508 57.884 25.800 1.00   30.19 ? 304  HIS A NE2 1 
ATOM   2374 N N   . ASP A 1 306 ? 23.263 55.815 30.714 1.00   20.32 ? 305  ASP A N   1 
ATOM   2375 C CA  . ASP A 1 306 ? 23.845 56.858 31.566 1.00   21.35 ? 305  ASP A CA  1 
ATOM   2376 C C   . ASP A 1 306 ? 25.274 56.531 31.991 1.00   20.55 ? 305  ASP A C   1 
ATOM   2377 O O   . ASP A 1 306 ? 26.145 57.386 31.967 1.00   19.90 ? 305  ASP A O   1 
ATOM   2378 C CB  . ASP A 1 306 ? 22.966 57.117 32.786 1.00   22.22 ? 305  ASP A CB  1 
ATOM   2379 C CG  . ASP A 1 306 ? 21.755 57.960 32.454 1.00   26.93 ? 305  ASP A CG  1 
ATOM   2380 O OD1 . ASP A 1 306 ? 21.599 58.341 31.276 1.00   32.51 ? 305  ASP A OD1 1 
ATOM   2381 O OD2 . ASP A 1 306 ? 20.885 58.253 33.290 1.00   33.16 ? 305  ASP A OD2 1 
ATOM   2382 N N   . LEU A 1 307 ? 25.543 55.283 32.366 1.00   19.19 ? 306  LEU A N   1 
ATOM   2383 C CA  . LEU A 1 307 ? 26.895 54.945 32.766 1.00   18.60 ? 306  LEU A CA  1 
ATOM   2384 C C   . LEU A 1 307 ? 27.882 55.014 31.596 1.00   17.82 ? 306  LEU A C   1 
ATOM   2385 O O   . LEU A 1 307 ? 29.037 55.397 31.781 1.00   17.51 ? 306  LEU A O   1 
ATOM   2386 C CB  . LEU A 1 307 ? 26.951 53.554 33.427 1.00   18.65 ? 306  LEU A CB  1 
ATOM   2387 C CG  . LEU A 1 307 ? 26.264 53.424 34.787 1.00   19.76 ? 306  LEU A CG  1 
ATOM   2388 C CD1 . LEU A 1 307 ? 26.380 51.979 35.284 1.00   20.10 ? 306  LEU A CD1 1 
ATOM   2389 C CD2 . LEU A 1 307 ? 26.867 54.379 35.783 1.00   21.04 ? 306  LEU A CD2 1 
ATOM   2390 N N   . PHE A 1 308 ? 27.416 54.619 30.414 1.00   17.71 ? 307  PHE A N   1 
ATOM   2391 C CA  . PHE A 1 308 ? 28.212 54.625 29.191 1.00   18.11 ? 307  PHE A CA  1 
ATOM   2392 C C   . PHE A 1 308 ? 28.661 56.069 28.893 1.00   18.27 ? 307  PHE A C   1 
ATOM   2393 O O   . PHE A 1 308 ? 29.816 56.314 28.593 1.00   17.77 ? 307  PHE A O   1 
ATOM   2394 C CB  . PHE A 1 308 ? 27.357 54.058 28.049 1.00   17.64 ? 307  PHE A CB  1 
ATOM   2395 C CG  . PHE A 1 308 ? 28.028 54.036 26.698 1.00   20.00 ? 307  PHE A CG  1 
ATOM   2396 C CD1 . PHE A 1 308 ? 28.099 55.185 25.924 1.00   22.52 ? 307  PHE A CD1 1 
ATOM   2397 C CD2 . PHE A 1 308 ? 28.541 52.861 26.177 1.00   20.14 ? 307  PHE A CD2 1 
ATOM   2398 C CE1 . PHE A 1 308 ? 28.681 55.158 24.667 1.00   21.98 ? 307  PHE A CE1 1 
ATOM   2399 C CE2 . PHE A 1 308 ? 29.111 52.829 24.925 1.00   22.09 ? 307  PHE A CE2 1 
ATOM   2400 C CZ  . PHE A 1 308 ? 29.179 53.991 24.163 1.00   23.51 ? 307  PHE A CZ  1 
ATOM   2401 N N   . MET A 1 309 ? 27.722 57.003 28.976 1.00   19.17 ? 308  MET A N   1 
ATOM   2402 C CA  . MET A 1 309 ? 28.030 58.409 28.733 1.00   20.31 ? 308  MET A CA  1 
ATOM   2403 C C   . MET A 1 309 ? 29.023 58.929 29.766 1.00   20.78 ? 308  MET A C   1 
ATOM   2404 O O   . MET A 1 309 ? 30.049 59.554 29.422 1.00   21.29 ? 308  MET A O   1 
ATOM   2405 C CB  . MET A 1 309 ? 26.736 59.230 28.725 1.00   20.79 ? 308  MET A CB  1 
ATOM   2406 C CG  . MET A 1 309 ? 25.798 58.862 27.593 1.00   22.31 ? 308  MET A CG  1 
ATOM   2407 S SD  . MET A 1 309 ? 26.569 58.779 25.982 1.00   30.52 ? 308  MET A SD  1 
ATOM   2408 C CE  . MET A 1 309 ? 26.924 60.435 25.710 1.00   28.99 ? 308  MET A CE  1 
ATOM   2409 N N   . ARG A 1 310 ? 28.754 58.641 31.030 1.00   21.13 ? 309  ARG A N   1 
ATOM   2410 C CA  . ARG A 1 310 ? 29.618 59.078 32.120 1.00   22.37 ? 309  ARG A CA  1 
ATOM   2411 C C   . ARG A 1 310 ? 31.047 58.542 32.013 1.00   21.87 ? 309  ARG A C   1 
ATOM   2412 O O   . ARG A 1 310 ? 32.017 59.257 32.308 1.00   22.04 ? 309  ARG A O   1 
ATOM   2413 C CB  . ARG A 1 310 ? 28.997 58.694 33.465 1.00   22.98 ? 309  ARG A CB  1 
ATOM   2414 C CG  . ARG A 1 310 ? 27.688 59.402 33.791 1.00   27.34 ? 309  ARG A CG  1 
ATOM   2415 C CD  . ARG A 1 310 ? 27.211 59.243 35.248 1.00   33.79 ? 309  ARG A CD  1 
ATOM   2416 N NE  . ARG A 1 310 ? 27.661 58.015 35.899 1.00   38.89 ? 309  ARG A NE  1 
ATOM   2417 C CZ  . ARG A 1 310 ? 28.893 57.811 36.376 1.00   41.88 ? 309  ARG A CZ  1 
ATOM   2418 N NH1 . ARG A 1 310 ? 29.825 58.750 36.267 1.00   44.04 ? 309  ARG A NH1 1 
ATOM   2419 N NH2 . ARG A 1 310 ? 29.198 56.655 36.956 1.00   42.46 ? 309  ARG A NH2 1 
ATOM   2420 N N   . ARG A 1 311 ? 31.214 57.293 31.569 1.00   20.77 ? 310  ARG A N   1 
ATOM   2421 C CA  . ARG A 1 311 ? 32.550 56.750 31.385 1.00   20.41 ? 310  ARG A CA  1 
ATOM   2422 C C   . ARG A 1 311 ? 33.302 57.562 30.345 1.00   20.70 ? 310  ARG A C   1 
ATOM   2423 O O   . ARG A 1 311 ? 34.518 57.629 30.363 1.00   21.81 ? 310  ARG A O   1 
ATOM   2424 C CB  . ARG A 1 311 ? 32.494 55.310 30.873 1.00   20.16 ? 310  ARG A CB  1 
ATOM   2425 C CG  . ARG A 1 311 ? 32.298 54.279 31.935 1.00   19.68 ? 310  ARG A CG  1 
ATOM   2426 C CD  . ARG A 1 311 ? 32.346 52.814 31.397 1.00   19.20 ? 310  ARG A CD  1 
ATOM   2427 N NE  . ARG A 1 311 ? 31.589 52.026 32.353 1.00   18.94 ? 310  ARG A NE  1 
ATOM   2428 C CZ  . ARG A 1 311 ? 30.346 51.611 32.208 1.00   15.43 ? 310  ARG A CZ  1 
ATOM   2429 N NH1 . ARG A 1 311 ? 29.700 51.753 31.064 1.00   16.33 ? 310  ARG A NH1 1 
ATOM   2430 N NH2 . ARG A 1 311 ? 29.770 51.016 33.243 1.00   16.45 ? 310  ARG A NH2 1 
ATOM   2431 N N   . ARG A 1 312 ? 32.558 58.192 29.455 1.00   20.93 ? 311  ARG A N   1 
ATOM   2432 C CA  . ARG A 1 312 ? 33.147 58.995 28.385 1.00   21.39 ? 311  ARG A CA  1 
ATOM   2433 C C   . ARG A 1 312 ? 33.095 60.506 28.660 1.00   21.61 ? 311  ARG A C   1 
ATOM   2434 O O   . ARG A 1 312 ? 33.184 61.312 27.727 1.00   21.13 ? 311  ARG A O   1 
ATOM   2435 C CB  . ARG A 1 312 ? 32.461 58.660 27.076 1.00   21.24 ? 311  ARG A CB  1 
ATOM   2436 C CG  . ARG A 1 312 ? 32.741 57.215 26.643 1.00   22.05 ? 311  ARG A CG  1 
ATOM   2437 C CD  . ARG A 1 312 ? 31.821 56.674 25.603 1.00   22.29 ? 311  ARG A CD  1 
ATOM   2438 N NE  . ARG A 1 312 ? 32.245 55.334 25.184 1.00   24.31 ? 311  ARG A NE  1 
ATOM   2439 C CZ  . ARG A 1 312 ? 32.088 54.212 25.908 1.00   22.26 ? 311  ARG A CZ  1 
ATOM   2440 N NH1 . ARG A 1 312 ? 31.502 54.235 27.093 1.00   19.65 ? 311  ARG A NH1 1 
ATOM   2441 N NH2 . ARG A 1 312 ? 32.532 53.052 25.426 1.00   21.10 ? 311  ARG A NH2 1 
ATOM   2442 N N   . LYS A 1 313 ? 32.929 60.857 29.928 1.00   22.35 ? 312  LYS A N   1 
ATOM   2443 C CA  . LYS A 1 313 ? 32.967 62.248 30.412 1.00   22.80 ? 312  LYS A CA  1 
ATOM   2444 C C   . LYS A 1 313 ? 31.870 63.163 29.827 1.00   22.82 ? 312  LYS A C   1 
ATOM   2445 O O   . LYS A 1 313 ? 32.047 64.388 29.692 1.00   22.25 ? 312  LYS A O   1 
ATOM   2446 C CB  . LYS A 1 313 ? 34.376 62.790 30.205 1.00   23.02 ? 312  LYS A CB  1 
ATOM   2447 C CG  . LYS A 1 313 ? 35.374 62.180 31.214 1.00   25.34 ? 312  LYS A CG  1 
ATOM   2448 C CD  . LYS A 1 313 ? 36.509 61.391 30.599 1.00   27.85 ? 312  LYS A CD  1 
ATOM   2449 C CE  . LYS A 1 313 ? 36.081 60.229 29.766 1.00   27.07 ? 312  LYS A CE  1 
ATOM   2450 N NZ  . LYS A 1 313 ? 36.947 59.047 29.946 1.00   23.78 ? 312  LYS A NZ  1 
ATOM   2451 N N   . ALA A 1 314 ? 30.706 62.572 29.562 1.00   22.45 ? 313  ALA A N   1 
ATOM   2452 C CA  . ALA A 1 314 ? 29.569 63.301 29.008 1.00   23.78 ? 313  ALA A CA  1 
ATOM   2453 C C   . ALA A 1 314 ? 28.287 63.029 29.782 1.00   24.59 ? 313  ALA A C   1 
ATOM   2454 O O   . ALA A 1 314 ? 27.233 63.555 29.440 1.00   25.44 ? 313  ALA A O   1 
ATOM   2455 C CB  . ALA A 1 314 ? 29.376 62.933 27.569 1.00   23.48 ? 313  ALA A CB  1 
ATOM   2456 O OXT . ALA A 1 314 ? 28.289 62.291 30.770 1.00   26.59 ? 313  ALA A OXT 1 
ATOM   2457 N N   . LYS B 1 21  ? 78.666 51.938 -7.074 1.00   32.55 ? 20   LYS B N   1 
ATOM   2458 C CA  . LYS B 1 21  ? 77.324 51.385 -7.400 1.00   31.75 ? 20   LYS B CA  1 
ATOM   2459 C C   . LYS B 1 21  ? 76.595 50.884 -6.136 1.00   31.39 ? 20   LYS B C   1 
ATOM   2460 O O   . LYS B 1 21  ? 76.439 51.606 -5.155 1.00   33.33 ? 20   LYS B O   1 
ATOM   2461 C CB  . LYS B 1 21  ? 77.467 50.252 -8.431 1.00   31.82 ? 20   LYS B CB  1 
ATOM   2462 C CG  . LYS B 1 21  ? 78.262 49.062 -7.918 0.0000 20.00 ? 20   LYS B CG  1 
ATOM   2463 C CD  . LYS B 1 21  ? 78.353 47.975 -8.977 0.0000 20.00 ? 20   LYS B CD  1 
ATOM   2464 C CE  . LYS B 1 21  ? 79.154 46.784 -8.477 0.0000 20.00 ? 20   LYS B CE  1 
ATOM   2465 N NZ  . LYS B 1 21  ? 78.479 46.099 -7.339 0.0000 20.00 ? 20   LYS B NZ  1 
ATOM   2466 N N   . THR B 1 22  ? 76.033 49.705 -6.201 1.00   29.88 ? 21   THR B N   1 
ATOM   2467 C CA  . THR B 1 22  ? 75.403 49.123 -5.033 1.00   29.34 ? 21   THR B CA  1 
ATOM   2468 C C   . THR B 1 22  ? 76.009 47.777 -4.705 1.00   28.70 ? 21   THR B C   1 
ATOM   2469 O O   . THR B 1 22  ? 76.796 47.239 -5.478 1.00   29.09 ? 21   THR B O   1 
ATOM   2470 C CB  . THR B 1 22  ? 73.923 48.925 -5.364 1.00   29.51 ? 21   THR B CB  1 
ATOM   2471 O OG1 . THR B 1 22  ? 73.823 48.200 -6.601 1.00   29.82 ? 21   THR B OG1 1 
ATOM   2472 C CG2 . THR B 1 22  ? 73.272 50.238 -5.671 1.00   28.30 ? 21   THR B CG2 1 
ATOM   2473 N N   . PHE B 1 23  ? 75.648 47.237 -3.546 1.00   27.62 ? 22   PHE B N   1 
ATOM   2474 C CA  . PHE B 1 23  ? 76.003 45.880 -3.187 1.00   26.92 ? 22   PHE B CA  1 
ATOM   2475 C C   . PHE B 1 23  ? 74.743 45.208 -2.680 1.00   26.72 ? 22   PHE B C   1 
ATOM   2476 O O   . PHE B 1 23  ? 73.885 45.846 -2.073 1.00   26.12 ? 22   PHE B O   1 
ATOM   2477 C CB  . PHE B 1 23  ? 77.116 45.791 -2.131 1.00   26.99 ? 22   PHE B CB  1 
ATOM   2478 C CG  . PHE B 1 23  ? 76.759 46.382 -0.799 1.00   25.15 ? 22   PHE B CG  1 
ATOM   2479 C CD1 . PHE B 1 23  ? 76.909 47.730 -0.575 1.00   25.71 ? 22   PHE B CD1 1 
ATOM   2480 C CD2 . PHE B 1 23  ? 76.332 45.581 0.236  1.00   26.52 ? 22   PHE B CD2 1 
ATOM   2481 C CE1 . PHE B 1 23  ? 76.629 48.284 0.651  1.00   25.18 ? 22   PHE B CE1 1 
ATOM   2482 C CE2 . PHE B 1 23  ? 76.050 46.128 1.474  1.00   24.03 ? 22   PHE B CE2 1 
ATOM   2483 C CZ  . PHE B 1 23  ? 76.163 47.486 1.672  1.00   25.88 ? 22   PHE B CZ  1 
ATOM   2484 N N   . THR B 1 24  ? 74.662 43.917 -2.919 1.00   26.59 ? 23   THR B N   1 
ATOM   2485 C CA  . THR B 1 24  ? 73.502 43.138 -2.544 1.00   26.57 ? 23   THR B CA  1 
ATOM   2486 C C   . THR B 1 24  ? 73.453 42.849 -1.037 1.00   26.48 ? 23   THR B C   1 
ATOM   2487 O O   . THR B 1 24  ? 74.448 42.461 -0.412 1.00   24.80 ? 23   THR B O   1 
ATOM   2488 C CB  . THR B 1 24  ? 73.497 41.841 -3.316 1.00   27.29 ? 23   THR B CB  1 
ATOM   2489 O OG1 . THR B 1 24  ? 73.601 42.110 -4.726 1.00   26.53 ? 23   THR B OG1 1 
ATOM   2490 C CG2 . THR B 1 24  ? 72.167 41.129 -3.182 1.00   27.71 ? 23   THR B CG2 1 
ATOM   2491 N N   . VAL B 1 25  ? 72.263 43.044 -0.477 1.00   25.36 ? 24   VAL B N   1 
ATOM   2492 C CA  . VAL B 1 25  ? 72.021 42.762 0.920  1.00   25.50 ? 24   VAL B CA  1 
ATOM   2493 C C   . VAL B 1 25  ? 70.884 41.737 0.962  1.00   24.99 ? 24   VAL B C   1 
ATOM   2494 O O   . VAL B 1 25  ? 69.946 41.818 0.165  1.00   24.59 ? 24   VAL B O   1 
ATOM   2495 C CB  . VAL B 1 25  ? 71.679 44.063 1.675  1.00   25.69 ? 24   VAL B CB  1 
ATOM   2496 C CG1 . VAL B 1 25  ? 71.167 43.781 3.067  1.00   27.03 ? 24   VAL B CG1 1 
ATOM   2497 C CG2 . VAL B 1 25  ? 72.863 44.980 1.734  1.00   27.49 ? 24   VAL B CG2 1 
ATOM   2498 N N   . ARG B 1 26  ? 70.978 40.748 1.842  1.00   24.43 ? 25   ARG B N   1 
ATOM   2499 C CA  . ARG B 1 26  ? 69.919 39.770 1.996  1.00   24.53 ? 25   ARG B CA  1 
ATOM   2500 C C   . ARG B 1 26  ? 69.285 40.028 3.350  1.00   23.32 ? 25   ARG B C   1 
ATOM   2501 O O   . ARG B 1 26  ? 69.987 40.207 4.342  1.00   23.37 ? 25   ARG B O   1 
ATOM   2502 C CB  . ARG B 1 26  ? 70.398 38.323 1.878  1.00   24.96 ? 25   ARG B CB  1 
ATOM   2503 C CG  . ARG B 1 26  ? 69.379 37.304 2.341  1.00   28.69 ? 25   ARG B CG  1 
ATOM   2504 C CD  . ARG B 1 26  ? 69.542 35.883 1.811  1.00   31.98 ? 25   ARG B CD  1 
ATOM   2505 N NE  . ARG B 1 26  ? 69.478 35.779 0.353  1.00   34.19 ? 25   ARG B NE  1 
ATOM   2506 C CZ  . ARG B 1 26  ? 68.835 34.838 -0.328 1.00   33.09 ? 25   ARG B CZ  1 
ATOM   2507 N NH1 . ARG B 1 26  ? 68.126 33.902 0.287  1.00   33.53 ? 25   ARG B NH1 1 
ATOM   2508 N NH2 . ARG B 1 26  ? 68.901 34.842 -1.650 1.00   34.16 ? 25   ARG B NH2 1 
ATOM   2509 N N   . ILE B 1 27  ? 67.967 40.129 3.350  1.00   22.66 ? 26   ILE B N   1 
ATOM   2510 C CA  . ILE B 1 27  ? 67.230 40.406 4.581  1.00   21.94 ? 26   ILE B CA  1 
ATOM   2511 C C   . ILE B 1 27  ? 66.387 39.178 4.870  1.00   21.75 ? 26   ILE B C   1 
ATOM   2512 O O   . ILE B 1 27  ? 65.623 38.725 4.018  1.00   22.25 ? 26   ILE B O   1 
ATOM   2513 C CB  . ILE B 1 27  ? 66.342 41.644 4.405  1.00   22.03 ? 26   ILE B CB  1 
ATOM   2514 C CG1 . ILE B 1 27  ? 67.167 42.845 3.944  1.00   22.62 ? 26   ILE B CG1 1 
ATOM   2515 C CG2 . ILE B 1 27  ? 65.560 41.909 5.694  1.00   22.83 ? 26   ILE B CG2 1 
ATOM   2516 C CD1 . ILE B 1 27  ? 68.231 43.297 4.931  1.00   22.38 ? 26   ILE B CD1 1 
ATOM   2517 N N   . VAL B 1 28  ? 66.530 38.645 6.078  1.00   20.76 ? 27   VAL B N   1 
ATOM   2518 C CA  . VAL B 1 28  ? 65.814 37.476 6.493  1.00   20.78 ? 27   VAL B CA  1 
ATOM   2519 C C   . VAL B 1 28  ? 64.777 37.908 7.529  1.00   19.63 ? 27   VAL B C   1 
ATOM   2520 O O   . VAL B 1 28  ? 65.139 38.422 8.583  1.00   19.72 ? 27   VAL B O   1 
ATOM   2521 C CB  . VAL B 1 28  ? 66.767 36.464 7.153  1.00   20.94 ? 27   VAL B CB  1 
ATOM   2522 C CG1 . VAL B 1 28  ? 65.997 35.217 7.574  1.00   21.71 ? 27   VAL B CG1 1 
ATOM   2523 C CG2 . VAL B 1 28  ? 67.925 36.130 6.218  1.00   22.29 ? 27   VAL B CG2 1 
ATOM   2524 N N   . THR B 1 29  ? 63.502 37.789 7.190  1.00   19.83 ? 28   THR B N   1 
ATOM   2525 C CA  . THR B 1 29  ? 62.437 38.027 8.169  1.00   20.03 ? 28   THR B CA  1 
ATOM   2526 C C   . THR B 1 29  ? 61.976 36.689 8.696  1.00   20.33 ? 28   THR B C   1 
ATOM   2527 O O   . THR B 1 29  ? 62.446 35.649 8.256  1.00   20.21 ? 28   THR B O   1 
ATOM   2528 C CB  . THR B 1 29  ? 61.222 38.752 7.569  1.00   20.19 ? 28   THR B CB  1 
ATOM   2529 O OG1 . THR B 1 29  ? 60.436 37.850 6.767  1.00   19.60 ? 28   THR B OG1 1 
ATOM   2530 C CG2 . THR B 1 29  ? 61.650 39.882 6.637  1.00   20.61 ? 28   THR B CG2 1 
ATOM   2531 N N   . MET B 1 30  ? 61.052 36.696 9.642  1.00   21.15 ? 29   MET B N   1 
ATOM   2532 C CA  . MET B 1 30  ? 60.503 35.432 10.118 1.00   22.09 ? 29   MET B CA  1 
ATOM   2533 C C   . MET B 1 30  ? 59.660 34.758 9.031  1.00   23.70 ? 29   MET B C   1 
ATOM   2534 O O   . MET B 1 30  ? 59.400 33.557 9.121  1.00   24.63 ? 29   MET B O   1 
ATOM   2535 C CB  . MET B 1 30  ? 59.643 35.654 11.359 1.00   21.74 ? 29   MET B CB  1 
ATOM   2536 C CG  . MET B 1 30  ? 60.422 36.110 12.573 1.00   21.49 ? 29   MET B CG  1 
ATOM   2537 S SD  . MET B 1 30  ? 61.697 34.988 13.203 1.00   24.60 ? 29   MET B SD  1 
ATOM   2538 C CE  . MET B 1 30  ? 60.781 33.491 13.259 1.00   26.07 ? 29   MET B CE  1 
ATOM   2539 N N   . ASP B 1 31  ? 59.239 35.528 8.022  1.00   24.92 ? 30   ASP B N   1 
ATOM   2540 C CA  . ASP B 1 31  ? 58.385 35.035 6.931  1.00   26.44 ? 30   ASP B CA  1 
ATOM   2541 C C   . ASP B 1 31  ? 59.141 34.477 5.740  1.00   27.06 ? 30   ASP B C   1 
ATOM   2542 O O   . ASP B 1 31  ? 58.762 33.450 5.158  1.00   27.64 ? 30   ASP B O   1 
ATOM   2543 C CB  . ASP B 1 31  ? 57.615 36.196 6.297  1.00   26.74 ? 30   ASP B CB  1 
ATOM   2544 C CG  . ASP B 1 31  ? 56.217 36.373 6.808  1.00   28.90 ? 30   ASP B CG  1 
ATOM   2545 O OD1 . ASP B 1 31  ? 55.528 35.369 7.128  1.00   30.72 ? 30   ASP B OD1 1 
ATOM   2546 O OD2 . ASP B 1 31  ? 55.704 37.534 6.849  1.00   28.88 ? 30   ASP B OD2 1 
ATOM   2547 N N   . ALA B 1 32  ? 60.164 35.209 5.320  1.00   26.72 ? 31   ALA B N   1 
ATOM   2548 C CA  . ALA B 1 32  ? 60.821 34.919 4.071  1.00   26.80 ? 31   ALA B CA  1 
ATOM   2549 C C   . ALA B 1 32  ? 62.129 35.678 4.002  1.00   26.49 ? 31   ALA B C   1 
ATOM   2550 O O   . ALA B 1 32  ? 62.497 36.372 4.945  1.00   26.35 ? 31   ALA B O   1 
ATOM   2551 C CB  . ALA B 1 32  ? 59.906 35.345 2.919  1.00   27.17 ? 31   ALA B CB  1 
ATOM   2552 N N   . GLU B 1 33  ? 62.825 35.546 2.878  1.00   26.69 ? 32   GLU B N   1 
ATOM   2553 C CA  . GLU B 1 33  ? 64.087 36.240 2.672  1.00   26.37 ? 32   GLU B CA  1 
ATOM   2554 C C   . GLU B 1 33  ? 63.912 37.097 1.437  1.00   26.35 ? 32   GLU B C   1 
ATOM   2555 O O   . GLU B 1 33  ? 63.102 36.776 0.572  1.00   26.35 ? 32   GLU B O   1 
ATOM   2556 C CB  . GLU B 1 33  ? 65.265 35.255 2.525  1.00   26.98 ? 32   GLU B CB  1 
ATOM   2557 C CG  . GLU B 1 33  ? 65.330 34.230 3.653  1.00   27.70 ? 32   GLU B CG  1 
ATOM   2558 C CD  . GLU B 1 33  ? 66.636 33.460 3.723  1.00   30.67 ? 32   GLU B CD  1 
ATOM   2559 O OE1 . GLU B 1 33  ? 67.544 33.705 2.902  1.00   31.80 ? 32   GLU B OE1 1 
ATOM   2560 O OE2 . GLU B 1 33  ? 66.761 32.598 4.623  1.00   32.88 ? 32   GLU B OE2 1 
ATOM   2561 N N   . MET B 1 34  ? 64.610 38.222 1.392  1.00   26.21 ? 33   MET B N   1 
ATOM   2562 C CA  . MET B 1 34  ? 64.590 39.095 0.227  1.00   26.56 ? 33   MET B CA  1 
ATOM   2563 C C   . MET B 1 34  ? 65.905 39.837 0.070  1.00   25.45 ? 33   MET B C   1 
ATOM   2564 O O   . MET B 1 34  ? 66.669 39.978 1.024  1.00   25.02 ? 33   MET B O   1 
ATOM   2565 C CB  . MET B 1 34  ? 63.414 40.076 0.325  1.00   26.92 ? 33   MET B CB  1 
ATOM   2566 C CG  . MET B 1 34  ? 63.570 41.156 1.380  1.00   29.37 ? 33   MET B CG  1 
ATOM   2567 S SD  . MET B 1 34  ? 61.942 41.890 1.764  1.00   34.15 ? 33   MET B SD  1 
ATOM   2568 C CE  . MET B 1 34  ? 61.370 40.749 2.969  1.00   35.69 ? 33   MET B CE  1 
ATOM   2569 N N   . GLU B 1 35  ? 66.130 40.340 -1.139 1.00   24.81 ? 34   GLU B N   1 
ATOM   2570 C CA  . GLU B 1 35  ? 67.353 41.027 -1.450 1.00   24.56 ? 34   GLU B CA  1 
ATOM   2571 C C   . GLU B 1 35  ? 67.063 42.421 -1.963 1.00   23.37 ? 34   GLU B C   1 
ATOM   2572 O O   . GLU B 1 35  ? 66.030 42.676 -2.594 1.00   23.02 ? 34   GLU B O   1 
ATOM   2573 C CB  . GLU B 1 35  ? 68.190 40.233 -2.460 1.00   25.08 ? 34   GLU B CB  1 
ATOM   2574 C CG  . GLU B 1 35  ? 68.778 38.960 -1.875 1.00   26.98 ? 34   GLU B CG  1 
ATOM   2575 C CD  . GLU B 1 35  ? 69.716 38.223 -2.819 1.00   29.18 ? 34   GLU B CD  1 
ATOM   2576 O OE1 . GLU B 1 35  ? 69.641 38.429 -4.054 1.00   28.52 ? 34   GLU B OE1 1 
ATOM   2577 O OE2 . GLU B 1 35  ? 70.541 37.435 -2.308 1.00   30.29 ? 34   GLU B OE2 1 
ATOM   2578 N N   . PHE B 1 36  ? 67.976 43.319 -1.630 1.00   22.10 ? 35   PHE B N   1 
ATOM   2579 C CA  . PHE B 1 36  ? 67.936 44.690 -2.066 1.00   22.07 ? 35   PHE B CA  1 
ATOM   2580 C C   . PHE B 1 36  ? 69.312 45.127 -2.524 1.00   21.37 ? 35   PHE B C   1 
ATOM   2581 O O   . PHE B 1 36  ? 70.323 44.596 -2.079 1.00   21.83 ? 35   PHE B O   1 
ATOM   2582 C CB  . PHE B 1 36  ? 67.568 45.595 -0.909 1.00   22.08 ? 35   PHE B CB  1 
ATOM   2583 C CG  . PHE B 1 36  ? 66.234 45.306 -0.301 1.00   20.85 ? 35   PHE B CG  1 
ATOM   2584 C CD1 . PHE B 1 36  ? 65.069 45.822 -0.852 1.00   20.98 ? 35   PHE B CD1 1 
ATOM   2585 C CD2 . PHE B 1 36  ? 66.150 44.571 0.864  1.00   22.12 ? 35   PHE B CD2 1 
ATOM   2586 C CE1 . PHE B 1 36  ? 63.852 45.580 -0.250 1.00   21.64 ? 35   PHE B CE1 1 
ATOM   2587 C CE2 . PHE B 1 36  ? 64.952 44.327 1.455  1.00   20.72 ? 35   PHE B CE2 1 
ATOM   2588 C CZ  . PHE B 1 36  ? 63.813 44.823 0.906  1.00   20.74 ? 35   PHE B CZ  1 
ATOM   2589 N N   . ASN B 1 37  ? 69.332 46.134 -3.387 1.00   21.28 ? 36   ASN B N   1 
ATOM   2590 C CA  . ASN B 1 37  ? 70.561 46.753 -3.810 1.00   21.45 ? 36   ASN B CA  1 
ATOM   2591 C C   . ASN B 1 37  ? 70.846 47.879 -2.826 1.00   22.06 ? 36   ASN B C   1 
ATOM   2592 O O   . ASN B 1 37  ? 70.120 48.879 -2.798 1.00   22.27 ? 36   ASN B O   1 
ATOM   2593 C CB  . ASN B 1 37  ? 70.420 47.309 -5.228 1.00   20.25 ? 36   ASN B CB  1 
ATOM   2594 C CG  . ASN B 1 37  ? 70.024 46.243 -6.237 1.00   20.82 ? 36   ASN B CG  1 
ATOM   2595 O OD1 . ASN B 1 37  ? 70.595 45.164 -6.268 1.00   21.60 ? 36   ASN B OD1 1 
ATOM   2596 N ND2 . ASN B 1 37  ? 69.021 46.547 -7.071 1.00   21.93 ? 36   ASN B ND2 1 
ATOM   2597 N N   . CYS B 1 38  ? 71.870 47.699 -1.989 1.00   22.36 ? 37   CYS B N   1 
ATOM   2598 C CA  . CYS B 1 38  ? 72.271 48.718 -1.016 1.00   23.54 ? 37   CYS B CA  1 
ATOM   2599 C C   . CYS B 1 38  ? 73.286 49.684 -1.626 1.00   24.94 ? 37   CYS B C   1 
ATOM   2600 O O   . CYS B 1 38  ? 74.296 49.255 -2.165 1.00   25.99 ? 37   CYS B O   1 
ATOM   2601 C CB  . CYS B 1 38  ? 72.914 48.059 0.208  1.00   23.14 ? 37   CYS B CB  1 
ATOM   2602 S SG  . CYS B 1 38  ? 72.957 49.131 1.664  1.00   21.76 ? 37   CYS B SG  1 
ATOM   2603 N N   . GLU B 1 39  ? 73.014 50.979 -1.575 1.00   27.33 ? 38   GLU B N   1 
ATOM   2604 C CA  . GLU B 1 39  ? 73.988 51.927 -2.096 1.00   29.35 ? 38   GLU B CA  1 
ATOM   2605 C C   . GLU B 1 39  ? 75.241 51.793 -1.194 1.00   31.64 ? 38   GLU B C   1 
ATOM   2606 O O   . GLU B 1 39  ? 75.121 51.886 0.038  1.00   31.72 ? 38   GLU B O   1 
ATOM   2607 C CB  . GLU B 1 39  ? 73.391 53.320 -2.132 1.00   29.35 ? 38   GLU B CB  1 
ATOM   2608 C CG  . GLU B 1 39  ? 72.264 53.466 -3.165 1.00   29.03 ? 38   GLU B CG  1 
ATOM   2609 C CD  . GLU B 1 39  ? 71.863 54.900 -3.397 1.00   29.28 ? 38   GLU B CD  1 
ATOM   2610 O OE1 . GLU B 1 39  ? 72.707 55.786 -3.169 1.00   29.79 ? 38   GLU B OE1 1 
ATOM   2611 O OE2 . GLU B 1 39  ? 70.704 55.163 -3.793 1.00   28.06 ? 38   GLU B OE2 1 
ATOM   2612 N N   . MET B 1 40  ? 76.416 51.529 -1.803 1.00   33.31 ? 39   MET B N   1 
ATOM   2613 C CA  . MET B 1 40  ? 77.683 51.276 -1.065 1.00   34.51 ? 39   MET B CA  1 
ATOM   2614 C C   . MET B 1 40  ? 77.886 52.172 0.139  1.00   34.27 ? 39   MET B C   1 
ATOM   2615 O O   . MET B 1 40  ? 78.546 51.784 1.110  1.00   34.83 ? 39   MET B O   1 
ATOM   2616 C CB  . MET B 1 40  ? 78.930 51.423 -1.962 1.00   34.89 ? 39   MET B CB  1 
ATOM   2617 C CG  . MET B 1 40  ? 78.985 50.495 -3.158 1.00   37.79 ? 39   MET B CG  1 
ATOM   2618 S SD  . MET B 1 40  ? 79.580 48.840 -2.800 1.00   44.26 ? 39   MET B SD  1 
ATOM   2619 C CE  . MET B 1 40  ? 79.534 48.176 -4.412 1.00   44.25 ? 39   MET B CE  1 
ATOM   2620 N N   . LYS B 1 41  ? 77.376 53.387 0.046  1.00   34.21 ? 40   LYS B N   1 
ATOM   2621 C CA  . LYS B 1 41  ? 77.491 54.361 1.128  1.00   33.92 ? 40   LYS B CA  1 
ATOM   2622 C C   . LYS B 1 41  ? 76.220 54.651 1.977  1.00   33.56 ? 40   LYS B C   1 
ATOM   2623 O O   . LYS B 1 41  ? 76.260 55.534 2.831  1.00   33.83 ? 40   LYS B O   1 
ATOM   2624 C CB  . LYS B 1 41  ? 78.017 55.664 0.535  1.00   34.99 ? 40   LYS B CB  1 
ATOM   2625 C CG  . LYS B 1 41  ? 79.448 55.499 -0.015 1.00   36.09 ? 40   LYS B CG  1 
ATOM   2626 C CD  . LYS B 1 41  ? 79.789 56.568 -1.021 1.00   37.83 ? 40   LYS B CD  1 
ATOM   2627 C CE  . LYS B 1 41  ? 81.215 56.404 -1.531 1.00   36.83 ? 40   LYS B CE  1 
ATOM   2628 N NZ  . LYS B 1 41  ? 82.183 56.861 -0.516 1.00   37.94 ? 40   LYS B NZ  1 
ATOM   2629 N N   . TRP B 1 42  ? 75.097 53.949 1.767  1.00   31.82 ? 41   TRP B N   1 
ATOM   2630 C CA  . TRP B 1 42  ? 73.912 54.166 2.604  1.00   30.79 ? 41   TRP B CA  1 
ATOM   2631 C C   . TRP B 1 42  ? 74.213 53.898 4.090  1.00   29.90 ? 41   TRP B C   1 
ATOM   2632 O O   . TRP B 1 42  ? 75.074 53.100 4.413  1.00   30.33 ? 41   TRP B O   1 
ATOM   2633 C CB  . TRP B 1 42  ? 72.766 53.221 2.195  1.00   30.24 ? 41   TRP B CB  1 
ATOM   2634 C CG  . TRP B 1 42  ? 71.727 53.773 1.235  1.00   28.25 ? 41   TRP B CG  1 
ATOM   2635 C CD1 . TRP B 1 42  ? 71.541 55.075 0.862  1.00   27.31 ? 41   TRP B CD1 1 
ATOM   2636 C CD2 . TRP B 1 42  ? 70.712 53.022 0.555  1.00   25.83 ? 41   TRP B CD2 1 
ATOM   2637 N NE1 . TRP B 1 42  ? 70.497 55.170 -0.024 1.00   25.59 ? 41   TRP B NE1 1 
ATOM   2638 C CE2 . TRP B 1 42  ? 69.977 53.925 -0.235 1.00   23.46 ? 41   TRP B CE2 1 
ATOM   2639 C CE3 . TRP B 1 42  ? 70.362 51.669 0.518  1.00   23.41 ? 41   TRP B CE3 1 
ATOM   2640 C CZ2 . TRP B 1 42  ? 68.900 53.529 -1.025 1.00   23.71 ? 41   TRP B CZ2 1 
ATOM   2641 C CZ3 . TRP B 1 42  ? 69.292 51.278 -0.282 1.00   22.17 ? 41   TRP B CZ3 1 
ATOM   2642 C CH2 . TRP B 1 42  ? 68.586 52.208 -1.045 1.00   21.92 ? 41   TRP B CH2 1 
ATOM   2643 N N   . LYS B 1 43  ? 73.460 54.538 4.974  1.00   30.22 ? 42   LYS B N   1 
ATOM   2644 C CA  . LYS B 1 43  ? 73.582 54.302 6.418  1.00   30.37 ? 42   LYS B CA  1 
ATOM   2645 C C   . LYS B 1 43  ? 72.536 53.252 6.831  1.00   29.92 ? 42   LYS B C   1 
ATOM   2646 O O   . LYS B 1 43  ? 71.689 52.858 6.017  1.00   28.46 ? 42   LYS B O   1 
ATOM   2647 C CB  . LYS B 1 43  ? 73.395 55.603 7.189  1.00   30.96 ? 42   LYS B CB  1 
ATOM   2648 C CG  . LYS B 1 43  ? 74.565 56.603 7.014  1.00   32.74 ? 42   LYS B CG  1 
ATOM   2649 C CD  . LYS B 1 43  ? 74.230 57.953 7.625  1.00   35.06 ? 42   LYS B CD  1 
ATOM   2650 C CE  . LYS B 1 43  ? 75.398 58.944 7.470  1.00   36.97 ? 42   LYS B CE  1 
ATOM   2651 N NZ  . LYS B 1 43  ? 75.142 60.228 8.193  1.00   38.94 ? 42   LYS B NZ  1 
ATOM   2652 N N   . GLY B 1 44  ? 72.605 52.776 8.073  1.00   29.12 ? 43   GLY B N   1 
ATOM   2653 C CA  . GLY B 1 44  ? 71.631 51.807 8.546  1.00   28.23 ? 43   GLY B CA  1 
ATOM   2654 C C   . GLY B 1 44  ? 70.207 52.282 8.328  1.00   27.76 ? 43   GLY B C   1 
ATOM   2655 O O   . GLY B 1 44  ? 69.337 51.503 7.935  1.00   27.93 ? 43   GLY B O   1 
ATOM   2656 N N   . LYS B 1 45  ? 69.969 53.564 8.576  1.00   27.20 ? 44   LYS B N   1 
ATOM   2657 C CA  . LYS B 1 45  ? 68.649 54.155 8.458  1.00   27.45 ? 44   LYS B CA  1 
ATOM   2658 C C   . LYS B 1 45  ? 68.070 53.996 7.052  1.00   26.65 ? 44   LYS B C   1 
ATOM   2659 O O   . LYS B 1 45  ? 66.897 53.685 6.906  1.00   25.70 ? 44   LYS B O   1 
ATOM   2660 C CB  . LYS B 1 45  ? 68.687 55.635 8.830  1.00   28.08 ? 44   LYS B CB  1 
ATOM   2661 C CG  . LYS B 1 45  ? 67.330 56.308 8.830  1.00   30.51 ? 44   LYS B CG  1 
ATOM   2662 C CD  . LYS B 1 45  ? 67.408 57.711 9.409  1.00   34.76 ? 44   LYS B CD  1 
ATOM   2663 C CE  . LYS B 1 45  ? 66.379 58.644 8.791  1.00   36.42 ? 44   LYS B CE  1 
ATOM   2664 N NZ  . LYS B 1 45  ? 65.003 58.076 8.759  1.00   37.26 ? 44   LYS B NZ  1 
ATOM   2665 N N   . ASP B 1 46  ? 68.887 54.240 6.030  1.00   26.11 ? 45   ASP B N   1 
ATOM   2666 C CA  . ASP B 1 46  ? 68.431 54.111 4.641  1.00   25.47 ? 45   ASP B CA  1 
ATOM   2667 C C   . ASP B 1 46  ? 67.977 52.674 4.352  1.00   24.43 ? 45   ASP B C   1 
ATOM   2668 O O   . ASP B 1 46  ? 66.862 52.436 3.847  1.00   24.39 ? 45   ASP B O   1 
ATOM   2669 C CB  . ASP B 1 46  ? 69.572 54.487 3.691  1.00   26.28 ? 45   ASP B CB  1 
ATOM   2670 C CG  . ASP B 1 46  ? 70.106 55.885 3.945  1.00   27.13 ? 45   ASP B CG  1 
ATOM   2671 O OD1 . ASP B 1 46  ? 69.302 56.832 3.946  1.00   29.03 ? 45   ASP B OD1 1 
ATOM   2672 O OD2 . ASP B 1 46  ? 71.314 56.110 4.161  1.00   30.24 ? 45   ASP B OD2 1 
ATOM   2673 N N   . LEU B 1 47  ? 68.836 51.717 4.681  1.00   23.34 ? 46   LEU B N   1 
ATOM   2674 C CA  . LEU B 1 47  ? 68.547 50.315 4.415  1.00   22.59 ? 46   LEU B CA  1 
ATOM   2675 C C   . LEU B 1 47  ? 67.339 49.868 5.242  1.00   22.19 ? 46   LEU B C   1 
ATOM   2676 O O   . LEU B 1 47  ? 66.429 49.214 4.727  1.00   22.00 ? 46   LEU B O   1 
ATOM   2677 C CB  . LEU B 1 47  ? 69.757 49.435 4.685  1.00   22.20 ? 46   LEU B CB  1 
ATOM   2678 C CG  . LEU B 1 47  ? 69.550 47.918 4.521  1.00   22.09 ? 46   LEU B CG  1 
ATOM   2679 C CD1 . LEU B 1 47  ? 69.119 47.509 3.110  1.00   21.73 ? 46   LEU B CD1 1 
ATOM   2680 C CD2 . LEU B 1 47  ? 70.806 47.214 4.932  1.00   21.48 ? 46   LEU B CD2 1 
ATOM   2681 N N   . PHE B 1 48  ? 67.326 50.249 6.517  1.00   21.66 ? 47   PHE B N   1 
ATOM   2682 C CA  . PHE B 1 48  ? 66.211 49.903 7.410  1.00   20.68 ? 47   PHE B CA  1 
ATOM   2683 C C   . PHE B 1 48  ? 64.886 50.472 6.901  1.00   21.08 ? 47   PHE B C   1 
ATOM   2684 O O   . PHE B 1 48  ? 63.874 49.769 6.860  1.00   20.13 ? 47   PHE B O   1 
ATOM   2685 C CB  . PHE B 1 48  ? 66.507 50.406 8.826  1.00   20.47 ? 47   PHE B CB  1 
ATOM   2686 C CG  . PHE B 1 48  ? 65.406 50.149 9.814  1.00   20.18 ? 47   PHE B CG  1 
ATOM   2687 C CD1 . PHE B 1 48  ? 65.196 48.883 10.310 1.00   20.69 ? 47   PHE B CD1 1 
ATOM   2688 C CD2 . PHE B 1 48  ? 64.592 51.171 10.263 1.00   21.33 ? 47   PHE B CD2 1 
ATOM   2689 C CE1 . PHE B 1 48  ? 64.187 48.637 11.225 1.00   18.70 ? 47   PHE B CE1 1 
ATOM   2690 C CE2 . PHE B 1 48  ? 63.581 50.925 11.185 1.00   21.15 ? 47   PHE B CE2 1 
ATOM   2691 C CZ  . PHE B 1 48  ? 63.397 49.633 11.671 1.00   18.99 ? 47   PHE B CZ  1 
ATOM   2692 N N   . ASP B 1 49  ? 64.886 51.736 6.483  1.00   20.72 ? 48   ASP B N   1 
ATOM   2693 C CA  . ASP B 1 49  ? 63.669 52.352 5.974  1.00   21.60 ? 48   ASP B CA  1 
ATOM   2694 C C   . ASP B 1 49  ? 63.154 51.662 4.705  1.00   20.20 ? 48   ASP B C   1 
ATOM   2695 O O   . ASP B 1 49  ? 61.956 51.513 4.540  1.00   19.64 ? 48   ASP B O   1 
ATOM   2696 C CB  . ASP B 1 49  ? 63.865 53.847 5.718  1.00   21.83 ? 48   ASP B CB  1 
ATOM   2697 C CG  . ASP B 1 49  ? 63.887 54.666 7.005  1.00   25.18 ? 48   ASP B CG  1 
ATOM   2698 O OD1 . ASP B 1 49  ? 63.710 54.086 8.110  1.00   25.40 ? 48   ASP B OD1 1 
ATOM   2699 O OD2 . ASP B 1 49  ? 64.067 55.917 7.008  1.00   29.51 ? 48   ASP B OD2 1 
ATOM   2700 N N   . LEU B 1 50  ? 64.059 51.266 3.825  1.00   19.46 ? 49   LEU B N   1 
ATOM   2701 C CA  . LEU B 1 50  ? 63.707 50.561 2.604  1.00   19.06 ? 49   LEU B CA  1 
ATOM   2702 C C   . LEU B 1 50  ? 63.031 49.217 2.949  1.00   18.31 ? 49   LEU B C   1 
ATOM   2703 O O   . LEU B 1 50  ? 62.005 48.865 2.382  1.00   18.31 ? 49   LEU B O   1 
ATOM   2704 C CB  . LEU B 1 50  ? 64.956 50.314 1.745  1.00   19.11 ? 49   LEU B CB  1 
ATOM   2705 C CG  . LEU B 1 50  ? 64.780 49.338 0.573  1.00   20.06 ? 49   LEU B CG  1 
ATOM   2706 C CD1 . LEU B 1 50  ? 63.697 49.841 -0.356 1.00   21.09 ? 49   LEU B CD1 1 
ATOM   2707 C CD2 . LEU B 1 50  ? 66.062 49.098 -0.204 1.00   19.82 ? 49   LEU B CD2 1 
ATOM   2708 N N   . VAL B 1 51  ? 63.631 48.456 3.851  1.00   17.48 ? 50   VAL B N   1 
ATOM   2709 C CA  . VAL B 1 51  ? 63.025 47.192 4.274  1.00   17.42 ? 50   VAL B CA  1 
ATOM   2710 C C   . VAL B 1 51  ? 61.617 47.437 4.837  1.00   17.48 ? 50   VAL B C   1 
ATOM   2711 O O   . VAL B 1 51  ? 60.661 46.739 4.475  1.00   18.00 ? 50   VAL B O   1 
ATOM   2712 C CB  . VAL B 1 51  ? 63.902 46.456 5.327  1.00   17.45 ? 50   VAL B CB  1 
ATOM   2713 C CG1 . VAL B 1 51  ? 63.224 45.186 5.815  1.00   16.79 ? 50   VAL B CG1 1 
ATOM   2714 C CG2 . VAL B 1 51  ? 65.252 46.092 4.730  1.00   16.26 ? 50   VAL B CG2 1 
ATOM   2715 N N   . CYS B 1 52  ? 61.473 48.408 5.735  1.00   17.71 ? 51   CYS B N   1 
ATOM   2716 C CA  . CYS B 1 52  ? 60.157 48.663 6.345  1.00   18.08 ? 51   CYS B CA  1 
ATOM   2717 C C   . CYS B 1 52  ? 59.113 49.066 5.295  1.00   18.34 ? 51   CYS B C   1 
ATOM   2718 O O   . CYS B 1 52  ? 57.989 48.562 5.315  1.00   17.68 ? 51   CYS B O   1 
ATOM   2719 C CB  . CYS B 1 52  ? 60.242 49.716 7.461  1.00   18.27 ? 51   CYS B CB  1 
ATOM   2720 S SG  . CYS B 1 52  ? 61.192 49.147 8.889  1.00   20.24 ? 51   CYS B SG  1 
ATOM   2721 N N   . ARG B 1 53  ? 59.481 49.960 4.382  1.00   19.14 ? 52   ARG B N   1 
ATOM   2722 C CA  . ARG B 1 53  ? 58.576 50.345 3.296  1.00   19.28 ? 52   ARG B CA  1 
ATOM   2723 C C   . ARG B 1 53  ? 58.139 49.125 2.462  1.00   18.87 ? 52   ARG B C   1 
ATOM   2724 O O   . ARG B 1 53  ? 56.960 48.978 2.135  1.00   17.60 ? 52   ARG B O   1 
ATOM   2725 C CB  . ARG B 1 53  ? 59.228 51.390 2.383  1.00   20.35 ? 52   ARG B CB  1 
ATOM   2726 C CG  . ARG B 1 53  ? 59.410 52.750 3.014  1.00   23.73 ? 52   ARG B CG  1 
ATOM   2727 C CD  . ARG B 1 53  ? 59.743 53.896 2.025  1.00   25.82 ? 52   ARG B CD  1 
ATOM   2728 N NE  . ARG B 1 53  ? 60.744 53.600 0.990  1.00   28.68 ? 52   ARG B NE  1 
ATOM   2729 C CZ  . ARG B 1 53  ? 62.076 53.810 1.109  1.00   31.50 ? 52   ARG B CZ  1 
ATOM   2730 N NH1 . ARG B 1 53  ? 62.588 54.290 2.236  1.00   32.45 ? 52   ARG B NH1 1 
ATOM   2731 N NH2 . ARG B 1 53  ? 62.897 53.535 0.096  1.00   34.69 ? 52   ARG B NH2 1 
ATOM   2732 N N   . THR B 1 54  ? 59.086 48.247 2.141  1.00   18.24 ? 53   THR B N   1 
ATOM   2733 C CA  . THR B 1 54  ? 58.793 47.078 1.326  1.00   18.75 ? 53   THR B CA  1 
ATOM   2734 C C   . THR B 1 54  ? 57.795 46.155 2.008  1.00   18.25 ? 53   THR B C   1 
ATOM   2735 O O   . THR B 1 54  ? 56.926 45.583 1.356  1.00   18.60 ? 53   THR B O   1 
ATOM   2736 C CB  . THR B 1 54  ? 60.107 46.327 1.047  1.00   19.02 ? 53   THR B CB  1 
ATOM   2737 O OG1 . THR B 1 54  ? 60.995 47.165 0.289  1.00   20.11 ? 53   THR B OG1 1 
ATOM   2738 C CG2 . THR B 1 54  ? 59.881 45.123 0.154  1.00   19.63 ? 53   THR B CG2 1 
ATOM   2739 N N   . LEU B 1 55  ? 57.939 45.999 3.322  1.00   18.04 ? 54   LEU B N   1 
ATOM   2740 C CA  . LEU B 1 55  ? 57.032 45.170 4.101  1.00   18.13 ? 54   LEU B CA  1 
ATOM   2741 C C   . LEU B 1 55  ? 55.708 45.873 4.400  1.00   18.34 ? 54   LEU B C   1 
ATOM   2742 O O   . LEU B 1 55  ? 54.764 45.250 4.884  1.00   18.74 ? 54   LEU B O   1 
ATOM   2743 C CB  . LEU B 1 55  ? 57.696 44.777 5.429  1.00   17.76 ? 54   LEU B CB  1 
ATOM   2744 C CG  . LEU B 1 55  ? 58.982 43.951 5.378  1.00   17.79 ? 54   LEU B CG  1 
ATOM   2745 C CD1 . LEU B 1 55  ? 59.705 43.892 6.751  1.00   18.54 ? 54   LEU B CD1 1 
ATOM   2746 C CD2 . LEU B 1 55  ? 58.679 42.545 4.881  1.00   19.53 ? 54   LEU B CD2 1 
ATOM   2747 N N   . GLY B 1 56  ? 55.644 47.171 4.152  1.00   18.54 ? 55   GLY B N   1 
ATOM   2748 C CA  . GLY B 1 56  ? 54.457 47.952 4.464  1.00   18.84 ? 55   GLY B CA  1 
ATOM   2749 C C   . GLY B 1 56  ? 54.328 48.154 5.971  1.00   19.13 ? 55   GLY B C   1 
ATOM   2750 O O   . GLY B 1 56  ? 53.238 48.305 6.490  1.00   19.94 ? 55   GLY B O   1 
ATOM   2751 N N   . LEU B 1 57  ? 55.455 48.148 6.664  1.00   19.31 ? 56   LEU B N   1 
ATOM   2752 C CA  . LEU B 1 57  ? 55.478 48.203 8.122  1.00   19.79 ? 56   LEU B CA  1 
ATOM   2753 C C   . LEU B 1 57  ? 55.809 49.615 8.557  1.00   20.40 ? 56   LEU B C   1 
ATOM   2754 O O   . LEU B 1 57  ? 56.853 50.142 8.206  1.00   19.42 ? 56   LEU B O   1 
ATOM   2755 C CB  . LEU B 1 57  ? 56.507 47.213 8.660  1.00   20.11 ? 56   LEU B CB  1 
ATOM   2756 C CG  . LEU B 1 57  ? 56.504 46.893 10.159 1.00   22.01 ? 56   LEU B CG  1 
ATOM   2757 C CD1 . LEU B 1 57  ? 56.900 45.424 10.422 1.00   23.49 ? 56   LEU B CD1 1 
ATOM   2758 C CD2 . LEU B 1 57  ? 57.449 47.818 10.866 1.00   23.48 ? 56   LEU B CD2 1 
ATOM   2759 N N   . ARG B 1 58  ? 54.911 50.226 9.323  1.00   21.26 ? 57   ARG B N   1 
ATOM   2760 C CA  . ARG B 1 58  ? 55.130 51.597 9.743  1.00   22.46 ? 57   ARG B CA  1 
ATOM   2761 C C   . ARG B 1 58  ? 55.429 51.722 11.251 1.00   21.71 ? 57   ARG B C   1 
ATOM   2762 O O   . ARG B 1 58  ? 55.922 52.757 11.714 1.00   21.03 ? 57   ARG B O   1 
ATOM   2763 C CB  . ARG B 1 58  ? 53.962 52.456 9.254  1.00   23.31 ? 57   ARG B CB  1 
ATOM   2764 C CG  . ARG B 1 58  ? 53.964 52.505 7.701  1.00   27.37 ? 57   ARG B CG  1 
ATOM   2765 C CD  . ARG B 1 58  ? 52.837 53.265 7.042  1.00   31.91 ? 57   ARG B CD  1 
ATOM   2766 N NE  . ARG B 1 58  ? 51.562 52.547 7.054  1.00   34.30 ? 57   ARG B NE  1 
ATOM   2767 C CZ  . ARG B 1 58  ? 51.242 51.563 6.226  1.00   35.62 ? 57   ARG B CZ  1 
ATOM   2768 N NH1 . ARG B 1 58  ? 52.103 51.135 5.312  1.00   37.18 ? 57   ARG B NH1 1 
ATOM   2769 N NH2 . ARG B 1 58  ? 50.056 50.995 6.320  1.00   36.42 ? 57   ARG B NH2 1 
ATOM   2770 N N   . GLU B 1 59  ? 55.193 50.644 11.999 1.00   21.31 ? 58   GLU B N   1 
ATOM   2771 C CA  . GLU B 1 59  ? 55.490 50.601 13.438 1.00   21.11 ? 58   GLU B CA  1 
ATOM   2772 C C   . GLU B 1 59  ? 56.935 50.189 13.622 1.00   20.60 ? 58   GLU B C   1 
ATOM   2773 O O   . GLU B 1 59  ? 57.270 49.154 14.229 1.00   20.62 ? 58   GLU B O   1 
ATOM   2774 C CB  . GLU B 1 59  ? 54.507 49.660 14.146 1.00   21.11 ? 58   GLU B CB  1 
ATOM   2775 C CG  . GLU B 1 59  ? 53.079 50.151 14.026 1.00   22.34 ? 58   GLU B CG  1 
ATOM   2776 C CD  . GLU B 1 59  ? 52.039 49.187 14.537 1.00   25.09 ? 58   GLU B CD  1 
ATOM   2777 O OE1 . GLU B 1 59  ? 51.754 48.145 13.898 1.00   22.47 ? 58   GLU B OE1 1 
ATOM   2778 O OE2 . GLU B 1 59  ? 51.459 49.510 15.586 1.00   30.77 ? 58   GLU B OE2 1 
ATOM   2779 N N   . THR B 1 60  ? 57.816 51.042 13.138 1.00   19.50 ? 59   THR B N   1 
ATOM   2780 C CA  . THR B 1 60  ? 59.224 50.715 12.984 1.00   18.91 ? 59   THR B CA  1 
ATOM   2781 C C   . THR B 1 60  ? 60.068 50.731 14.238 1.00   18.27 ? 59   THR B C   1 
ATOM   2782 O O   . THR B 1 60  ? 61.128 50.132 14.251 1.00   17.95 ? 59   THR B O   1 
ATOM   2783 C CB  . THR B 1 60  ? 59.838 51.684 11.976 1.00   19.37 ? 59   THR B CB  1 
ATOM   2784 O OG1 . THR B 1 60  ? 59.726 53.015 12.500 1.00   21.01 ? 59   THR B OG1 1 
ATOM   2785 C CG2 . THR B 1 60  ? 59.033 51.692 10.665 1.00   20.31 ? 59   THR B CG2 1 
ATOM   2786 N N   . TRP B 1 61  ? 59.565 51.367 15.292 1.00   17.87 ? 60   TRP B N   1 
ATOM   2787 C CA  . TRP B 1 61  ? 60.324 51.565 16.502 1.00   18.26 ? 60   TRP B CA  1 
ATOM   2788 C C   . TRP B 1 61  ? 60.675 50.262 17.210 1.00   18.39 ? 60   TRP B C   1 
ATOM   2789 O O   . TRP B 1 61  ? 61.625 50.232 17.996 1.00   17.98 ? 60   TRP B O   1 
ATOM   2790 C CB  . TRP B 1 61  ? 59.546 52.475 17.453 1.00   18.70 ? 60   TRP B CB  1 
ATOM   2791 C CG  . TRP B 1 61  ? 58.096 52.265 17.388 1.00   18.25 ? 60   TRP B CG  1 
ATOM   2792 C CD1 . TRP B 1 61  ? 57.367 51.386 18.116 1.00   19.26 ? 60   TRP B CD1 1 
ATOM   2793 C CD2 . TRP B 1 61  ? 57.158 52.976 16.564 1.00   18.67 ? 60   TRP B CD2 1 
ATOM   2794 N NE1 . TRP B 1 61  ? 56.040 51.473 17.776 1.00   17.66 ? 60   TRP B NE1 1 
ATOM   2795 C CE2 . TRP B 1 61  ? 55.889 52.437 16.813 1.00   18.85 ? 60   TRP B CE2 1 
ATOM   2796 C CE3 . TRP B 1 61  ? 57.274 53.988 15.607 1.00   20.10 ? 60   TRP B CE3 1 
ATOM   2797 C CZ2 . TRP B 1 61  ? 54.730 52.912 16.175 1.00   18.70 ? 60   TRP B CZ2 1 
ATOM   2798 C CZ3 . TRP B 1 61  ? 56.129 54.439 14.971 1.00   19.29 ? 60   TRP B CZ3 1 
ATOM   2799 C CH2 . TRP B 1 61  ? 54.888 53.902 15.246 1.00   18.44 ? 60   TRP B CH2 1 
ATOM   2800 N N   . PHE B 1 62  ? 59.920 49.199 16.935 1.00   18.02 ? 61   PHE B N   1 
ATOM   2801 C CA  . PHE B 1 62  ? 60.201 47.901 17.572 1.00   17.60 ? 61   PHE B CA  1 
ATOM   2802 C C   . PHE B 1 62  ? 61.297 47.103 16.863 1.00   17.17 ? 61   PHE B C   1 
ATOM   2803 O O   . PHE B 1 62  ? 61.871 46.167 17.444 1.00   17.14 ? 61   PHE B O   1 
ATOM   2804 C CB  . PHE B 1 62  ? 58.953 47.009 17.569 1.00   17.68 ? 61   PHE B CB  1 
ATOM   2805 C CG  . PHE B 1 62  ? 57.805 47.534 18.369 1.00   17.32 ? 61   PHE B CG  1 
ATOM   2806 C CD1 . PHE B 1 62  ? 57.883 47.653 19.742 1.00   18.53 ? 61   PHE B CD1 1 
ATOM   2807 C CD2 . PHE B 1 62  ? 56.645 47.931 17.740 1.00   18.25 ? 61   PHE B CD2 1 
ATOM   2808 C CE1 . PHE B 1 62  ? 56.815 48.156 20.469 1.00   19.91 ? 61   PHE B CE1 1 
ATOM   2809 C CE2 . PHE B 1 62  ? 55.582 48.419 18.462 1.00   19.72 ? 61   PHE B CE2 1 
ATOM   2810 C CZ  . PHE B 1 62  ? 55.668 48.538 19.826 1.00   18.03 ? 61   PHE B CZ  1 
ATOM   2811 N N   . PHE B 1 63  ? 61.621 47.472 15.629 1.00   15.69 ? 62   PHE B N   1 
ATOM   2812 C CA  . PHE B 1 63  ? 62.443 46.610 14.789 1.00   15.77 ? 62   PHE B CA  1 
ATOM   2813 C C   . PHE B 1 63  ? 63.881 47.057 14.539 1.00   15.99 ? 62   PHE B C   1 
ATOM   2814 O O   . PHE B 1 63  ? 64.249 48.211 14.797 1.00   16.97 ? 62   PHE B O   1 
ATOM   2815 C CB  . PHE B 1 63  ? 61.705 46.363 13.460 1.00   15.01 ? 62   PHE B CB  1 
ATOM   2816 C CG  . PHE B 1 63  ? 60.406 45.625 13.641 1.00   15.46 ? 62   PHE B CG  1 
ATOM   2817 C CD1 . PHE B 1 63  ? 60.366 44.246 13.664 1.00   14.64 ? 62   PHE B CD1 1 
ATOM   2818 C CD2 . PHE B 1 63  ? 59.241 46.315 13.832 1.00   16.25 ? 62   PHE B CD2 1 
ATOM   2819 C CE1 . PHE B 1 63  ? 59.171 43.592 13.868 1.00   17.29 ? 62   PHE B CE1 1 
ATOM   2820 C CE2 . PHE B 1 63  ? 58.048 45.654 14.049 1.00   16.59 ? 62   PHE B CE2 1 
ATOM   2821 C CZ  . PHE B 1 63  ? 58.022 44.301 14.058 1.00   17.59 ? 62   PHE B CZ  1 
ATOM   2822 N N   . GLY B 1 64  ? 64.690 46.110 14.084 1.00   16.78 ? 63   GLY B N   1 
ATOM   2823 C CA  . GLY B 1 64  ? 66.080 46.377 13.721 1.00   16.88 ? 63   GLY B CA  1 
ATOM   2824 C C   . GLY B 1 64  ? 66.594 45.324 12.765 1.00   17.62 ? 63   GLY B C   1 
ATOM   2825 O O   . GLY B 1 64  ? 65.898 44.356 12.432 1.00   16.49 ? 63   GLY B O   1 
ATOM   2826 N N   . LEU B 1 65  ? 67.814 45.527 12.299 1.00   18.34 ? 64   LEU B N   1 
ATOM   2827 C CA  . LEU B 1 65  ? 68.472 44.588 11.418 1.00   18.65 ? 64   LEU B CA  1 
ATOM   2828 C C   . LEU B 1 65  ? 69.623 43.992 12.191 1.00   19.51 ? 64   LEU B C   1 
ATOM   2829 O O   . LEU B 1 65  ? 70.597 44.693 12.540 1.00   19.59 ? 64   LEU B O   1 
ATOM   2830 C CB  . LEU B 1 65  ? 68.974 45.337 10.179 1.00   19.96 ? 64   LEU B CB  1 
ATOM   2831 C CG  . LEU B 1 65  ? 67.819 45.777 9.271  1.00   20.61 ? 64   LEU B CG  1 
ATOM   2832 C CD1 . LEU B 1 65  ? 68.268 46.831 8.256  1.00   22.62 ? 64   LEU B CD1 1 
ATOM   2833 C CD2 . LEU B 1 65  ? 67.245 44.567 8.595  1.00   21.59 ? 64   LEU B CD2 1 
ATOM   2834 N N   . GLN B 1 66  ? 69.539 42.691 12.444 1.00   19.63 ? 65   GLN B N   1 
ATOM   2835 C CA  . GLN B 1 66  ? 70.503 42.037 13.314 1.00   20.42 ? 65   GLN B CA  1 
ATOM   2836 C C   . GLN B 1 66  ? 71.572 41.262 12.558 1.00   21.18 ? 65   GLN B C   1 
ATOM   2837 O O   . GLN B 1 66  ? 71.315 40.651 11.514 1.00   20.29 ? 65   GLN B O   1 
ATOM   2838 C CB  . GLN B 1 66  ? 69.759 41.080 14.237 1.00   20.43 ? 65   GLN B CB  1 
ATOM   2839 C CG  . GLN B 1 66  ? 70.582 40.553 15.389 1.00   22.07 ? 65   GLN B CG  1 
ATOM   2840 C CD  . GLN B 1 66  ? 69.830 39.519 16.185 1.00   23.04 ? 65   GLN B CD  1 
ATOM   2841 O OE1 . GLN B 1 66  ? 69.142 39.854 17.162 1.00   27.52 ? 65   GLN B OE1 1 
ATOM   2842 N NE2 . GLN B 1 66  ? 69.950 38.267 15.785 1.00   19.65 ? 65   GLN B NE2 1 
ATOM   2843 N N   . TYR B 1 67  ? 72.770 41.309 13.129 1.00   22.63 ? 66   TYR B N   1 
ATOM   2844 C CA  . TYR B 1 67  ? 73.925 40.564 12.668 1.00   24.59 ? 66   TYR B CA  1 
ATOM   2845 C C   . TYR B 1 67  ? 74.609 40.030 13.940 1.00   25.80 ? 66   TYR B C   1 
ATOM   2846 O O   . TYR B 1 67  ? 74.157 40.297 15.058 1.00   24.76 ? 66   TYR B O   1 
ATOM   2847 C CB  . TYR B 1 67  ? 74.872 41.425 11.798 1.00   24.58 ? 66   TYR B CB  1 
ATOM   2848 C CG  . TYR B 1 67  ? 75.510 42.626 12.461 1.00   25.17 ? 66   TYR B CG  1 
ATOM   2849 C CD1 . TYR B 1 67  ? 74.778 43.761 12.746 1.00   22.65 ? 66   TYR B CD1 1 
ATOM   2850 C CD2 . TYR B 1 67  ? 76.873 42.634 12.782 1.00   26.96 ? 66   TYR B CD2 1 
ATOM   2851 C CE1 . TYR B 1 67  ? 75.359 44.858 13.367 1.00   24.63 ? 66   TYR B CE1 1 
ATOM   2852 C CE2 . TYR B 1 67  ? 77.463 43.736 13.393 1.00   26.10 ? 66   TYR B CE2 1 
ATOM   2853 C CZ  . TYR B 1 67  ? 76.710 44.841 13.675 1.00   25.79 ? 66   TYR B CZ  1 
ATOM   2854 O OH  . TYR B 1 67  ? 77.275 45.938 14.289 1.00   27.98 ? 66   TYR B OH  1 
ATOM   2855 N N   . THR B 1 68  ? 75.682 39.271 13.784 1.00   27.74 ? 67   THR B N   1 
ATOM   2856 C CA  . THR B 1 68  ? 76.348 38.698 14.954 1.00   29.50 ? 67   THR B CA  1 
ATOM   2857 C C   . THR B 1 68  ? 77.841 38.966 14.912 1.00   30.32 ? 67   THR B C   1 
ATOM   2858 O O   . THR B 1 68  ? 78.460 38.896 13.840 1.00   30.45 ? 67   THR B O   1 
ATOM   2859 C CB  . THR B 1 68  ? 76.130 37.182 15.021 1.00   29.77 ? 67   THR B CB  1 
ATOM   2860 O OG1 . THR B 1 68  ? 76.565 36.582 13.800 1.00   34.18 ? 67   THR B OG1 1 
ATOM   2861 C CG2 . THR B 1 68  ? 74.681 36.819 15.102 1.00   29.90 ? 67   THR B CG2 1 
ATOM   2862 N N   . ILE B 1 69  ? 78.394 39.298 16.075 1.00   30.88 ? 68   ILE B N   1 
ATOM   2863 C CA  . ILE B 1 69  ? 79.827 39.548 16.233 1.00   32.10 ? 68   ILE B CA  1 
ATOM   2864 C C   . ILE B 1 69  ? 80.309 38.510 17.214 1.00   32.85 ? 68   ILE B C   1 
ATOM   2865 O O   . ILE B 1 69  ? 79.943 38.557 18.386 1.00   32.27 ? 68   ILE B O   1 
ATOM   2866 C CB  . ILE B 1 69  ? 80.105 40.928 16.807 1.00   32.20 ? 68   ILE B CB  1 
ATOM   2867 C CG1 . ILE B 1 69  ? 79.515 42.016 15.910 1.00   32.76 ? 68   ILE B CG1 1 
ATOM   2868 C CG2 . ILE B 1 69  ? 81.641 41.143 17.003 1.00   32.62 ? 68   ILE B CG2 1 
ATOM   2869 C CD1 . ILE B 1 69  ? 79.503 43.369 16.553 1.00   32.76 ? 68   ILE B CD1 1 
ATOM   2870 N N   . LYS B 1 70  ? 81.131 37.579 16.732 1.00   33.88 ? 69   LYS B N   1 
ATOM   2871 C CA  . LYS B 1 70  ? 81.603 36.483 17.563 1.00   34.85 ? 69   LYS B CA  1 
ATOM   2872 C C   . LYS B 1 70  ? 80.346 35.703 17.908 1.00   35.25 ? 69   LYS B C   1 
ATOM   2873 O O   . LYS B 1 70  ? 79.601 35.319 17.010 1.00   35.36 ? 69   LYS B O   1 
ATOM   2874 C CB  . LYS B 1 70  ? 82.347 36.993 18.804 1.00   35.13 ? 69   LYS B CB  1 
ATOM   2875 C CG  . LYS B 1 70  ? 83.744 37.506 18.508 1.00   36.33 ? 69   LYS B CG  1 
ATOM   2876 C CD  . LYS B 1 70  ? 84.429 38.073 19.743 1.00   38.22 ? 69   LYS B CD  1 
ATOM   2877 C CE  . LYS B 1 70  ? 85.773 38.709 19.378 1.00   39.21 ? 69   LYS B CE  1 
ATOM   2878 N NZ  . LYS B 1 70  ? 86.511 39.288 20.544 1.00   39.60 ? 69   LYS B NZ  1 
ATOM   2879 N N   . ASP B 1 71  ? 80.102 35.434 19.180 1.00   35.26 ? 70   ASP B N   1 
ATOM   2880 C CA  . ASP B 1 71  ? 78.858 34.788 19.542 1.00   35.45 ? 70   ASP B CA  1 
ATOM   2881 C C   . ASP B 1 71  ? 77.856 35.748 20.213 1.00   33.96 ? 70   ASP B C   1 
ATOM   2882 O O   . ASP B 1 71  ? 77.026 35.313 21.005 1.00   33.75 ? 70   ASP B O   1 
ATOM   2883 C CB  . ASP B 1 71  ? 79.153 33.566 20.408 1.00   36.57 ? 70   ASP B CB  1 
ATOM   2884 C CG  . ASP B 1 71  ? 79.825 32.444 19.615 1.00   39.71 ? 70   ASP B CG  1 
ATOM   2885 O OD1 . ASP B 1 71  ? 79.100 31.663 18.955 1.00   45.55 ? 70   ASP B OD1 1 
ATOM   2886 O OD2 . ASP B 1 71  ? 81.066 32.271 19.571 1.00   44.61 ? 70   ASP B OD2 1 
ATOM   2887 N N   . THR B 1 72  ? 77.914 37.034 19.859 1.00   32.19 ? 71   THR B N   1 
ATOM   2888 C CA  . THR B 1 72  ? 77.015 38.041 20.432 1.00   31.10 ? 71   THR B CA  1 
ATOM   2889 C C   . THR B 1 72  ? 76.193 38.816 19.397 1.00   29.89 ? 71   THR B C   1 
ATOM   2890 O O   . THR B 1 72  ? 76.704 39.255 18.378 1.00   29.40 ? 71   THR B O   1 
ATOM   2891 C CB  . THR B 1 72  ? 77.807 39.043 21.262 1.00   31.25 ? 71   THR B CB  1 
ATOM   2892 O OG1 . THR B 1 72  ? 78.392 38.378 22.390 1.00   32.27 ? 71   THR B OG1 1 
ATOM   2893 C CG2 . THR B 1 72  ? 76.886 40.099 21.882 1.00   31.36 ? 71   THR B CG2 1 
ATOM   2894 N N   . VAL B 1 73  ? 74.912 38.995 19.696 1.00   28.51 ? 72   VAL B N   1 
ATOM   2895 C CA  . VAL B 1 73  ? 74.007 39.719 18.822 1.00   28.04 ? 72   VAL B CA  1 
ATOM   2896 C C   . VAL B 1 73  ? 74.358 41.191 18.730 1.00   26.98 ? 72   VAL B C   1 
ATOM   2897 O O   . VAL B 1 73  ? 74.840 41.783 19.679 1.00   25.55 ? 72   VAL B O   1 
ATOM   2898 C CB  . VAL B 1 73  ? 72.560 39.541 19.333 1.00   28.70 ? 72   VAL B CB  1 
ATOM   2899 C CG1 . VAL B 1 73  ? 71.745 40.816 19.223 1.00   29.56 ? 72   VAL B CG1 1 
ATOM   2900 C CG2 . VAL B 1 73  ? 71.917 38.374 18.618 1.00   29.01 ? 72   VAL B CG2 1 
ATOM   2901 N N   . ALA B 1 74  ? 74.134 41.787 17.564 1.00   26.54 ? 73   ALA B N   1 
ATOM   2902 C CA  . ALA B 1 74  ? 74.339 43.215 17.410 1.00   26.22 ? 73   ALA B CA  1 
ATOM   2903 C C   . ALA B 1 74  ? 73.341 43.758 16.397 1.00   25.76 ? 73   ALA B C   1 
ATOM   2904 O O   . ALA B 1 74  ? 72.882 43.025 15.522 1.00   24.74 ? 73   ALA B O   1 
ATOM   2905 C CB  . ALA B 1 74  ? 75.756 43.521 16.982 1.00   26.60 ? 73   ALA B CB  1 
ATOM   2906 N N   . TRP B 1 75  ? 73.023 45.039 16.535 1.00   25.33 ? 74   TRP B N   1 
ATOM   2907 C CA  . TRP B 1 75  ? 72.054 45.698 15.676 1.00   25.18 ? 74   TRP B CA  1 
ATOM   2908 C C   . TRP B 1 75  ? 72.666 46.822 14.854 1.00   25.89 ? 74   TRP B C   1 
ATOM   2909 O O   . TRP B 1 75  ? 73.454 47.620 15.372 1.00   26.14 ? 74   TRP B O   1 
ATOM   2910 C CB  . TRP B 1 75  ? 70.955 46.266 16.543 1.00   24.99 ? 74   TRP B CB  1 
ATOM   2911 C CG  . TRP B 1 75  ? 70.271 45.219 17.384 1.00   23.55 ? 74   TRP B CG  1 
ATOM   2912 C CD1 . TRP B 1 75  ? 70.595 44.836 18.653 1.00   22.97 ? 74   TRP B CD1 1 
ATOM   2913 C CD2 . TRP B 1 75  ? 69.161 44.428 16.999 1.00   21.59 ? 74   TRP B CD2 1 
ATOM   2914 N NE1 . TRP B 1 75  ? 69.735 43.855 19.086 1.00   21.36 ? 74   TRP B NE1 1 
ATOM   2915 C CE2 . TRP B 1 75  ? 68.830 43.598 18.089 1.00   20.69 ? 74   TRP B CE2 1 
ATOM   2916 C CE3 . TRP B 1 75  ? 68.365 44.366 15.850 1.00   19.82 ? 74   TRP B CE3 1 
ATOM   2917 C CZ2 . TRP B 1 75  ? 67.763 42.699 18.047 1.00   19.46 ? 74   TRP B CZ2 1 
ATOM   2918 C CZ3 . TRP B 1 75  ? 67.331 43.454 15.800 1.00   19.89 ? 74   TRP B CZ3 1 
ATOM   2919 C CH2 . TRP B 1 75  ? 67.021 42.653 16.903 1.00   20.34 ? 74   TRP B CH2 1 
ATOM   2920 N N   . LEU B 1 76  ? 72.276 46.901 13.582 1.00   25.82 ? 75   LEU B N   1 
ATOM   2921 C CA  . LEU B 1 76  ? 72.751 47.956 12.695 1.00   26.01 ? 75   LEU B CA  1 
ATOM   2922 C C   . LEU B 1 76  ? 72.392 49.293 13.303 1.00   25.70 ? 75   LEU B C   1 
ATOM   2923 O O   . LEU B 1 76  ? 71.267 49.483 13.760 1.00   25.50 ? 75   LEU B O   1 
ATOM   2924 C CB  . LEU B 1 76  ? 72.094 47.865 11.306 1.00   26.38 ? 75   LEU B CB  1 
ATOM   2925 C CG  . LEU B 1 76  ? 72.764 47.068 10.186 1.00   28.24 ? 75   LEU B CG  1 
ATOM   2926 C CD1 . LEU B 1 76  ? 72.027 47.329 8.873  1.00   29.49 ? 75   LEU B CD1 1 
ATOM   2927 C CD2 . LEU B 1 76  ? 74.219 47.413 10.009 1.00   27.67 ? 75   LEU B CD2 1 
ATOM   2928 N N   . LYS B 1 77  ? 73.344 50.227 13.292 1.00   26.56 ? 76   LYS B N   1 
ATOM   2929 C CA  . LYS B 1 77  ? 73.142 51.577 13.811 1.00   27.44 ? 76   LYS B CA  1 
ATOM   2930 C C   . LYS B 1 77  ? 72.584 52.487 12.720 1.00   27.60 ? 76   LYS B C   1 
ATOM   2931 O O   . LYS B 1 77  ? 73.017 52.426 11.582 1.00   27.88 ? 76   LYS B O   1 
ATOM   2932 C CB  . LYS B 1 77  ? 74.459 52.148 14.339 1.00   27.90 ? 76   LYS B CB  1 
ATOM   2933 C CG  . LYS B 1 77  ? 74.979 51.421 15.572 1.00   30.14 ? 76   LYS B CG  1 
ATOM   2934 C CD  . LYS B 1 77  ? 75.703 50.136 15.209 1.00   32.27 ? 76   LYS B CD  1 
ATOM   2935 C CE  . LYS B 1 77  ? 75.703 49.130 16.355 1.00   31.74 ? 76   LYS B CE  1 
ATOM   2936 N NZ  . LYS B 1 77  ? 76.177 47.798 15.911 1.00   27.84 ? 76   LYS B NZ  1 
ATOM   2937 N N   . MET B 1 78  ? 71.628 53.333 13.070 1.00   28.58 ? 77   MET B N   1 
ATOM   2938 C CA  . MET B 1 78  ? 70.925 54.153 12.070 1.00   29.41 ? 77   MET B CA  1 
ATOM   2939 C C   . MET B 1 78  ? 71.804 55.204 11.405 1.00   30.56 ? 77   MET B C   1 
ATOM   2940 O O   . MET B 1 78  ? 71.674 55.450 10.193 1.00   29.70 ? 77   MET B O   1 
ATOM   2941 C CB  . MET B 1 78  ? 69.713 54.824 12.702 1.00   28.97 ? 77   MET B CB  1 
ATOM   2942 C CG  . MET B 1 78  ? 68.650 53.844 13.166 1.00   29.67 ? 77   MET B CG  1 
ATOM   2943 S SD  . MET B 1 78  ? 67.929 52.837 11.847 1.00   29.49 ? 77   MET B SD  1 
ATOM   2944 C CE  . MET B 1 78  ? 69.004 51.542 11.716 1.00   29.60 ? 77   MET B CE  1 
ATOM   2945 N N   . ASP B 1 79  ? 72.707 55.804 12.185 1.00   31.96 ? 78   ASP B N   1 
ATOM   2946 C CA  . ASP B 1 79  ? 73.560 56.890 11.674 1.00   33.18 ? 78   ASP B CA  1 
ATOM   2947 C C   . ASP B 1 79  ? 74.934 56.469 11.168 1.00   33.17 ? 78   ASP B C   1 
ATOM   2948 O O   . ASP B 1 79  ? 75.800 57.324 10.938 1.00   33.78 ? 78   ASP B O   1 
ATOM   2949 C CB  . ASP B 1 79  ? 73.739 57.947 12.761 1.00   34.02 ? 78   ASP B CB  1 
ATOM   2950 C CG  . ASP B 1 79  ? 72.414 58.407 13.345 1.00   37.93 ? 78   ASP B CG  1 
ATOM   2951 O OD1 . ASP B 1 79  ? 71.423 58.483 12.577 1.00   42.46 ? 78   ASP B OD1 1 
ATOM   2952 O OD2 . ASP B 1 79  ? 72.255 58.698 14.558 1.00   42.68 ? 78   ASP B OD2 1 
ATOM   2953 N N   . LYS B 1 80  ? 75.145 55.178 10.958 1.00   32.76 ? 79   LYS B N   1 
ATOM   2954 C CA  . LYS B 1 80  ? 76.443 54.677 10.542 1.00   32.82 ? 79   LYS B CA  1 
ATOM   2955 C C   . LYS B 1 80  ? 76.333 53.941 9.219  1.00   32.96 ? 79   LYS B C   1 
ATOM   2956 O O   . LYS B 1 80  ? 75.348 53.236 8.987  1.00   32.24 ? 79   LYS B O   1 
ATOM   2957 C CB  . LYS B 1 80  ? 76.991 53.746 11.623 1.00   32.89 ? 79   LYS B CB  1 
ATOM   2958 C CG  . LYS B 1 80  ? 78.339 53.123 11.351 1.00   33.74 ? 79   LYS B CG  1 
ATOM   2959 C CD  . LYS B 1 80  ? 78.790 52.353 12.586 1.00   35.93 ? 79   LYS B CD  1 
ATOM   2960 C CE  . LYS B 1 80  ? 80.255 51.995 12.551 1.00   36.83 ? 79   LYS B CE  1 
ATOM   2961 N NZ  . LYS B 1 80  ? 80.529 50.787 11.718 1.00   38.04 ? 79   LYS B NZ  1 
ATOM   2962 N N   . LYS B 1 81  ? 77.326 54.118 8.344  1.00   33.05 ? 80   LYS B N   1 
ATOM   2963 C CA  . LYS B 1 81  ? 77.325 53.434 7.060  1.00   32.93 ? 80   LYS B CA  1 
ATOM   2964 C C   . LYS B 1 81  ? 77.224 51.933 7.275  1.00   32.89 ? 80   LYS B C   1 
ATOM   2965 O O   . LYS B 1 81  ? 77.867 51.371 8.169  1.00   32.28 ? 80   LYS B O   1 
ATOM   2966 C CB  . LYS B 1 81  ? 78.564 53.769 6.228  1.00   33.50 ? 80   LYS B CB  1 
ATOM   2967 C CG  . LYS B 1 81  ? 78.557 55.176 5.679  1.00   34.31 ? 80   LYS B CG  1 
ATOM   2968 C CD  . LYS B 1 81  ? 79.907 55.586 5.064  1.00   37.58 ? 80   LYS B CD  1 
ATOM   2969 C CE  . LYS B 1 81  ? 80.210 54.891 3.741  1.00   38.52 ? 80   LYS B CE  1 
ATOM   2970 N NZ  . LYS B 1 81  ? 81.551 55.322 3.195  1.00   39.82 ? 80   LYS B NZ  1 
ATOM   2971 N N   . VAL B 1 82  ? 76.408 51.284 6.452  1.00   32.10 ? 81   VAL B N   1 
ATOM   2972 C CA  . VAL B 1 82  ? 76.216 49.845 6.550  1.00   31.87 ? 81   VAL B CA  1 
ATOM   2973 C C   . VAL B 1 82  ? 77.538 49.069 6.517  1.00   32.94 ? 81   VAL B C   1 
ATOM   2974 O O   . VAL B 1 82  ? 77.773 48.187 7.357  1.00   32.98 ? 81   VAL B O   1 
ATOM   2975 C CB  . VAL B 1 82  ? 75.299 49.329 5.428  1.00   31.68 ? 81   VAL B CB  1 
ATOM   2976 C CG1 . VAL B 1 82  ? 75.185 47.829 5.482  1.00   31.33 ? 81   VAL B CG1 1 
ATOM   2977 C CG2 . VAL B 1 82  ? 73.922 49.971 5.530  1.00   29.64 ? 81   VAL B CG2 1 
ATOM   2978 N N   . LEU B 1 83  ? 78.400 49.384 5.549  1.00   33.76 ? 82   LEU B N   1 
ATOM   2979 C CA  . LEU B 1 83  ? 79.662 48.654 5.390  1.00   34.45 ? 82   LEU B CA  1 
ATOM   2980 C C   . LEU B 1 83  ? 80.707 49.019 6.462  1.00   34.87 ? 82   LEU B C   1 
ATOM   2981 O O   . LEU B 1 83  ? 81.754 48.383 6.533  1.00   35.64 ? 82   LEU B O   1 
ATOM   2982 C CB  . LEU B 1 83  ? 80.231 48.837 3.969  1.00   34.53 ? 82   LEU B CB  1 
ATOM   2983 C CG  . LEU B 1 83  ? 79.443 48.167 2.839  1.00   35.09 ? 82   LEU B CG  1 
ATOM   2984 C CD1 . LEU B 1 83  ? 80.050 48.454 1.478  1.00   36.26 ? 82   LEU B CD1 1 
ATOM   2985 C CD2 . LEU B 1 83  ? 79.337 46.666 3.054  1.00   36.13 ? 82   LEU B CD2 1 
ATOM   2986 N N   . ASP B 1 84  ? 80.434 50.029 7.281  1.00   35.35 ? 83   ASP B N   1 
ATOM   2987 C CA  . ASP B 1 84  ? 81.338 50.388 8.386  1.00   35.94 ? 83   ASP B CA  1 
ATOM   2988 C C   . ASP B 1 84  ? 81.119 49.505 9.625  1.00   36.52 ? 83   ASP B C   1 
ATOM   2989 O O   . ASP B 1 84  ? 81.896 49.572 10.584 1.00   35.72 ? 83   ASP B O   1 
ATOM   2990 C CB  . ASP B 1 84  ? 81.170 51.858 8.787  1.00   36.04 ? 83   ASP B CB  1 
ATOM   2991 C CG  . ASP B 1 84  ? 81.842 52.806 7.818  1.00   36.25 ? 83   ASP B CG  1 
ATOM   2992 O OD1 . ASP B 1 84  ? 82.531 52.317 6.906  1.00   37.27 ? 83   ASP B OD1 1 
ATOM   2993 O OD2 . ASP B 1 84  ? 81.723 54.049 7.885  1.00   36.79 ? 83   ASP B OD2 1 
ATOM   2994 N N   . HIS B 1 85  ? 80.049 48.711 9.623  1.00   36.94 ? 84   HIS B N   1 
ATOM   2995 C CA  . HIS B 1 85  ? 79.759 47.806 10.731 1.00   37.53 ? 84   HIS B CA  1 
ATOM   2996 C C   . HIS B 1 85  ? 80.644 46.577 10.643 1.00   39.22 ? 84   HIS B C   1 
ATOM   2997 O O   . HIS B 1 85  ? 81.137 46.231 9.572  1.00   39.51 ? 84   HIS B O   1 
ATOM   2998 C CB  . HIS B 1 85  ? 78.292 47.363 10.710 1.00   36.60 ? 84   HIS B CB  1 
ATOM   2999 C CG  . HIS B 1 85  ? 77.337 48.451 11.074 1.00   34.71 ? 84   HIS B CG  1 
ATOM   3000 N ND1 . HIS B 1 85  ? 77.062 49.507 10.235 1.00   30.76 ? 84   HIS B ND1 1 
ATOM   3001 C CD2 . HIS B 1 85  ? 76.605 48.659 12.193 1.00   33.41 ? 84   HIS B CD2 1 
ATOM   3002 C CE1 . HIS B 1 85  ? 76.205 50.324 10.820 1.00   33.09 ? 84   HIS B CE1 1 
ATOM   3003 N NE2 . HIS B 1 85  ? 75.911 49.832 12.011 1.00   32.95 ? 84   HIS B NE2 1 
ATOM   3004 N N   . ASP B 1 86  ? 80.815 45.903 11.774 1.00   41.04 ? 85   ASP B N   1 
ATOM   3005 C CA  . ASP B 1 86  ? 81.651 44.714 11.849 1.00   42.42 ? 85   ASP B CA  1 
ATOM   3006 C C   . ASP B 1 86  ? 80.901 43.523 11.274 1.00   43.43 ? 85   ASP B C   1 
ATOM   3007 O O   . ASP B 1 86  ? 80.516 42.602 11.992 1.00   43.40 ? 85   ASP B O   1 
ATOM   3008 C CB  . ASP B 1 86  ? 82.043 44.452 13.302 1.00   42.69 ? 85   ASP B CB  1 
ATOM   3009 C CG  . ASP B 1 86  ? 83.251 43.552 13.433 1.00   43.87 ? 85   ASP B CG  1 
ATOM   3010 O OD1 . ASP B 1 86  ? 83.625 42.874 12.447 1.00   45.57 ? 85   ASP B OD1 1 
ATOM   3011 O OD2 . ASP B 1 86  ? 83.890 43.458 14.503 1.00   45.21 ? 85   ASP B OD2 1 
ATOM   3012 N N   . VAL B 1 87  ? 80.683 43.554 9.966  1.00   44.79 ? 86   VAL B N   1 
ATOM   3013 C CA  . VAL B 1 87  ? 79.964 42.486 9.297  1.00   45.69 ? 86   VAL B CA  1 
ATOM   3014 C C   . VAL B 1 87  ? 80.754 42.024 8.082  1.00   46.41 ? 86   VAL B C   1 
ATOM   3015 O O   . VAL B 1 87  ? 81.527 42.786 7.501  1.00   46.66 ? 86   VAL B O   1 
ATOM   3016 C CB  . VAL B 1 87  ? 78.543 42.951 8.873  1.00   45.78 ? 86   VAL B CB  1 
ATOM   3017 C CG1 . VAL B 1 87  ? 78.619 44.063 7.825  1.00   45.49 ? 86   VAL B CG1 1 
ATOM   3018 C CG2 . VAL B 1 87  ? 77.730 41.780 8.367  1.00   46.13 ? 86   VAL B CG2 1 
ATOM   3019 N N   . SER B 1 88  ? 80.568 40.764 7.717  1.00   47.37 ? 87   SER B N   1 
ATOM   3020 C CA  . SER B 1 88  ? 81.220 40.212 6.548  1.00   48.11 ? 87   SER B CA  1 
ATOM   3021 C C   . SER B 1 88  ? 80.941 41.127 5.361  1.00   48.48 ? 87   SER B C   1 
ATOM   3022 O O   . SER B 1 88  ? 79.820 41.611 5.175  1.00   48.30 ? 87   SER B O   1 
ATOM   3023 C CB  . SER B 1 88  ? 80.680 38.812 6.268  1.00   48.36 ? 87   SER B CB  1 
ATOM   3024 O OG  . SER B 1 88  ? 80.382 38.138 7.480  1.00   49.17 ? 87   SER B OG  1 
ATOM   3025 N N   . LYS B 1 89  ? 81.972 41.379 4.569  1.00   48.70 ? 88   LYS B N   1 
ATOM   3026 C CA  . LYS B 1 89  ? 81.835 42.221 3.396  1.00   48.62 ? 88   LYS B CA  1 
ATOM   3027 C C   . LYS B 1 89  ? 81.359 41.385 2.212  1.00   47.96 ? 88   LYS B C   1 
ATOM   3028 O O   . LYS B 1 89  ? 80.931 41.922 1.188  1.00   48.08 ? 88   LYS B O   1 
ATOM   3029 C CB  . LYS B 1 89  ? 83.161 42.908 3.081  1.00   49.22 ? 88   LYS B CB  1 
ATOM   3030 C CG  . LYS B 1 89  ? 84.377 41.979 3.031  1.00   50.38 ? 88   LYS B CG  1 
ATOM   3031 C CD  . LYS B 1 89  ? 85.652 42.753 2.733  1.00   51.55 ? 88   LYS B CD  1 
ATOM   3032 C CE  . LYS B 1 89  ? 86.852 41.833 2.701  1.00   52.24 ? 88   LYS B CE  1 
ATOM   3033 N NZ  . LYS B 1 89  ? 88.124 42.556 2.391  1.00   52.96 ? 88   LYS B NZ  1 
ATOM   3034 N N   . GLU B 1 90  ? 81.401 40.065 2.377  1.00   46.96 ? 89   GLU B N   1 
ATOM   3035 C CA  . GLU B 1 90  ? 80.985 39.131 1.339  1.00   46.15 ? 89   GLU B CA  1 
ATOM   3036 C C   . GLU B 1 90  ? 79.518 39.334 0.956  1.00   44.90 ? 89   GLU B C   1 
ATOM   3037 O O   . GLU B 1 90  ? 78.646 39.424 1.824  1.00   44.53 ? 89   GLU B O   1 
ATOM   3038 C CB  . GLU B 1 90  ? 81.193 37.695 1.823  1.00   46.63 ? 89   GLU B CB  1 
ATOM   3039 C CG  . GLU B 1 90  ? 80.941 36.626 0.771  1.00   48.17 ? 89   GLU B CG  1 
ATOM   3040 C CD  . GLU B 1 90  ? 81.518 35.281 1.172  1.00   50.25 ? 89   GLU B CD  1 
ATOM   3041 O OE1 . GLU B 1 90  ? 81.758 34.441 0.279  1.00   51.35 ? 89   GLU B OE1 1 
ATOM   3042 O OE2 . GLU B 1 90  ? 81.732 35.064 2.383  1.00   51.87 ? 89   GLU B OE2 1 
ATOM   3043 N N   . GLU B 1 91  ? 79.257 39.412 -0.347 1.00   43.30 ? 90   GLU B N   1 
ATOM   3044 C CA  . GLU B 1 91  ? 77.893 39.569 -0.851 1.00   41.99 ? 90   GLU B CA  1 
ATOM   3045 C C   . GLU B 1 91  ? 77.264 38.198 -0.945 1.00   40.33 ? 90   GLU B C   1 
ATOM   3046 O O   . GLU B 1 91  ? 77.931 37.252 -1.361 1.00   40.34 ? 90   GLU B O   1 
ATOM   3047 C CB  . GLU B 1 91  ? 77.889 40.205 -2.237 1.00   41.90 ? 90   GLU B CB  1 
ATOM   3048 C CG  . GLU B 1 91  ? 77.861 41.714 -2.231 1.00   41.91 ? 90   GLU B CG  1 
ATOM   3049 C CD  . GLU B 1 91  ? 77.872 42.276 -3.635 1.00   41.85 ? 90   GLU B CD  1 
ATOM   3050 O OE1 . GLU B 1 91  ? 78.961 42.687 -4.098 1.00   42.16 ? 90   GLU B OE1 1 
ATOM   3051 O OE2 . GLU B 1 91  ? 76.799 42.278 -4.272 1.00   38.72 ? 90   GLU B OE2 1 
ATOM   3052 N N   . PRO B 1 92  ? 75.997 38.068 -0.555 1.00   38.50 ? 91   PRO B N   1 
ATOM   3053 C CA  . PRO B 1 92  ? 75.191 39.178 -0.047 1.00   37.05 ? 91   PRO B CA  1 
ATOM   3054 C C   . PRO B 1 92  ? 75.406 39.439 1.436  1.00   35.21 ? 91   PRO B C   1 
ATOM   3055 O O   . PRO B 1 92  ? 75.521 38.495 2.219  1.00   34.96 ? 91   PRO B O   1 
ATOM   3056 C CB  . PRO B 1 92  ? 73.765 38.686 -0.280 1.00   37.14 ? 91   PRO B CB  1 
ATOM   3057 C CG  . PRO B 1 92  ? 73.840 37.227 -0.116 1.00   38.09 ? 91   PRO B CG  1 
ATOM   3058 C CD  . PRO B 1 92  ? 75.226 36.814 -0.596 1.00   38.48 ? 91   PRO B CD  1 
ATOM   3059 N N   . VAL B 1 93  ? 75.472 40.712 1.808  1.00   33.31 ? 92   VAL B N   1 
ATOM   3060 C CA  . VAL B 1 93  ? 75.640 41.081 3.204  1.00   31.74 ? 92   VAL B CA  1 
ATOM   3061 C C   . VAL B 1 93  ? 74.287 40.781 3.831  1.00   30.53 ? 92   VAL B C   1 
ATOM   3062 O O   . VAL B 1 93  ? 73.274 41.296 3.367  1.00   30.06 ? 92   VAL B O   1 
ATOM   3063 C CB  . VAL B 1 93  ? 76.023 42.552 3.364  1.00   31.29 ? 92   VAL B CB  1 
ATOM   3064 C CG1 . VAL B 1 93  ? 76.103 42.928 4.824  1.00   31.42 ? 92   VAL B CG1 1 
ATOM   3065 C CG2 . VAL B 1 93  ? 77.373 42.831 2.675  1.00   32.15 ? 92   VAL B CG2 1 
ATOM   3066 N N   . THR B 1 94  ? 74.271 39.950 4.872  1.00   28.53 ? 93   THR B N   1 
ATOM   3067 C CA  . THR B 1 94  ? 73.012 39.441 5.410  1.00   27.23 ? 93   THR B CA  1 
ATOM   3068 C C   . THR B 1 94  ? 72.639 39.997 6.775  1.00   25.02 ? 93   THR B C   1 
ATOM   3069 O O   . THR B 1 94  ? 73.479 40.095 7.667  1.00   24.83 ? 93   THR B O   1 
ATOM   3070 C CB  . THR B 1 94  ? 73.079 37.921 5.470  1.00   27.23 ? 93   THR B CB  1 
ATOM   3071 O OG1 . THR B 1 94  ? 73.186 37.399 4.139  1.00   29.31 ? 93   THR B OG1 1 
ATOM   3072 C CG2 . THR B 1 94  ? 71.766 37.316 5.981  1.00   28.12 ? 93   THR B CG2 1 
ATOM   3073 N N   . PHE B 1 95  ? 71.375 40.385 6.921  1.00   23.02 ? 94   PHE B N   1 
ATOM   3074 C CA  . PHE B 1 95  ? 70.850 40.858 8.203  1.00   21.44 ? 94   PHE B CA  1 
ATOM   3075 C C   . PHE B 1 95  ? 69.540 40.160 8.471  1.00   20.58 ? 94   PHE B C   1 
ATOM   3076 O O   . PHE B 1 95  ? 68.825 39.771 7.549  1.00   19.87 ? 94   PHE B O   1 
ATOM   3077 C CB  . PHE B 1 95  ? 70.609 42.359 8.210  1.00   21.38 ? 94   PHE B CB  1 
ATOM   3078 C CG  . PHE B 1 95  ? 71.849 43.157 8.001  1.00   21.16 ? 94   PHE B CG  1 
ATOM   3079 C CD1 . PHE B 1 95  ? 72.773 43.270 9.005  1.00   21.27 ? 94   PHE B CD1 1 
ATOM   3080 C CD2 . PHE B 1 95  ? 72.099 43.763 6.779  1.00   22.10 ? 94   PHE B CD2 1 
ATOM   3081 C CE1 . PHE B 1 95  ? 73.935 43.993 8.807  1.00   23.55 ? 94   PHE B CE1 1 
ATOM   3082 C CE2 . PHE B 1 95  ? 73.252 44.482 6.571  1.00   22.18 ? 94   PHE B CE2 1 
ATOM   3083 C CZ  . PHE B 1 95  ? 74.170 44.592 7.573  1.00   22.14 ? 94   PHE B CZ  1 
ATOM   3084 N N   . HIS B 1 96  ? 69.235 39.987 9.750  1.00   18.71 ? 95   HIS B N   1 
ATOM   3085 C CA  . HIS B 1 96  ? 67.960 39.410 10.134 1.00   18.94 ? 95   HIS B CA  1 
ATOM   3086 C C   . HIS B 1 96  ? 67.067 40.521 10.649 1.00   17.50 ? 95   HIS B C   1 
ATOM   3087 O O   . HIS B 1 96  ? 67.437 41.216 11.583 1.00   17.40 ? 95   HIS B O   1 
ATOM   3088 C CB  . HIS B 1 96  ? 68.162 38.352 11.217 1.00   19.05 ? 95   HIS B CB  1 
ATOM   3089 C CG  . HIS B 1 96  ? 68.659 37.049 10.684 1.00   21.52 ? 95   HIS B CG  1 
ATOM   3090 N ND1 . HIS B 1 96  ? 69.905 36.912 10.113 1.00   25.69 ? 95   HIS B ND1 1 
ATOM   3091 C CD2 . HIS B 1 96  ? 68.062 35.839 10.581 1.00   23.15 ? 95   HIS B CD2 1 
ATOM   3092 C CE1 . HIS B 1 96  ? 70.061 35.667 9.700  1.00   24.38 ? 95   HIS B CE1 1 
ATOM   3093 N NE2 . HIS B 1 96  ? 68.959 34.995 9.970  1.00   27.10 ? 95   HIS B NE2 1 
ATOM   3094 N N   . PHE B 1 97  ? 65.910 40.700 10.015 1.00   16.69 ? 96   PHE B N   1 
ATOM   3095 C CA  . PHE B 1 97  ? 64.945 41.731 10.399 1.00   15.90 ? 96   PHE B CA  1 
ATOM   3096 C C   . PHE B 1 97  ? 64.109 41.112 11.525 1.00   15.58 ? 96   PHE B C   1 
ATOM   3097 O O   . PHE B 1 97  ? 63.433 40.104 11.317 1.00   14.14 ? 96   PHE B O   1 
ATOM   3098 C CB  . PHE B 1 97  ? 64.028 42.082 9.222  1.00   15.92 ? 96   PHE B CB  1 
ATOM   3099 C CG  . PHE B 1 97  ? 63.063 43.204 9.512  1.00   16.26 ? 96   PHE B CG  1 
ATOM   3100 C CD1 . PHE B 1 97  ? 63.466 44.520 9.412  1.00   17.56 ? 96   PHE B CD1 1 
ATOM   3101 C CD2 . PHE B 1 97  ? 61.755 42.933 9.866  1.00   16.97 ? 96   PHE B CD2 1 
ATOM   3102 C CE1 . PHE B 1 97  ? 62.590 45.559 9.682  1.00   16.83 ? 96   PHE B CE1 1 
ATOM   3103 C CE2 . PHE B 1 97  ? 60.868 43.953 10.156 1.00   15.14 ? 96   PHE B CE2 1 
ATOM   3104 C CZ  . PHE B 1 97  ? 61.274 45.272 10.048 1.00   16.61 ? 96   PHE B CZ  1 
ATOM   3105 N N   . LEU B 1 98  ? 64.232 41.692 12.710 1.00   14.07 ? 97   LEU B N   1 
ATOM   3106 C CA  . LEU B 1 98  ? 63.620 41.151 13.904 1.00   14.96 ? 97   LEU B CA  1 
ATOM   3107 C C   . LEU B 1 98  ? 63.184 42.267 14.834 1.00   15.12 ? 97   LEU B C   1 
ATOM   3108 O O   . LEU B 1 98  ? 63.705 43.400 14.753 1.00   16.16 ? 97   LEU B O   1 
ATOM   3109 C CB  . LEU B 1 98  ? 64.665 40.326 14.639 1.00   15.35 ? 97   LEU B CB  1 
ATOM   3110 C CG  . LEU B 1 98  ? 65.098 38.982 14.040 1.00   17.00 ? 97   LEU B CG  1 
ATOM   3111 C CD1 . LEU B 1 98  ? 66.373 38.510 14.723 1.00   17.64 ? 97   LEU B CD1 1 
ATOM   3112 C CD2 . LEU B 1 98  ? 63.988 37.960 14.174 1.00   18.57 ? 97   LEU B CD2 1 
ATOM   3113 N N   . ALA B 1 99  ? 62.246 41.956 15.723 1.00   15.38 ? 98   ALA B N   1 
ATOM   3114 C CA  . ALA B 1 99  ? 61.888 42.868 16.791 1.00   15.42 ? 98   ALA B CA  1 
ATOM   3115 C C   . ALA B 1 99  ? 63.030 42.930 17.805 1.00   16.07 ? 98   ALA B C   1 
ATOM   3116 O O   . ALA B 1 99  ? 63.508 41.895 18.276 1.00   15.15 ? 98   ALA B O   1 
ATOM   3117 C CB  . ALA B 1 99  ? 60.629 42.422 17.499 1.00   15.57 ? 98   ALA B CB  1 
ATOM   3118 N N   . LYS B 1 100 ? 63.469 44.147 18.112 1.00   16.06 ? 99   LYS B N   1 
ATOM   3119 C CA  . LYS B 1 100 ? 64.560 44.406 19.050 1.00   17.05 ? 99   LYS B CA  1 
ATOM   3120 C C   . LYS B 1 100 ? 63.931 44.763 20.387 1.00   15.71 ? 99   LYS B C   1 
ATOM   3121 O O   . LYS B 1 100 ? 64.515 44.532 21.449 1.00   15.95 ? 99   LYS B O   1 
ATOM   3122 C CB  . LYS B 1 100 ? 65.371 45.597 18.530 1.00   17.44 ? 99   LYS B CB  1 
ATOM   3123 C CG  . LYS B 1 100 ? 66.526 46.060 19.354 1.00   20.79 ? 99   LYS B CG  1 
ATOM   3124 C CD  . LYS B 1 100 ? 67.161 47.229 18.590 1.00   25.72 ? 99   LYS B CD  1 
ATOM   3125 C CE  . LYS B 1 100 ? 68.358 47.823 19.278 1.00   29.96 ? 99   LYS B CE  1 
ATOM   3126 N NZ  . LYS B 1 100 ? 68.607 49.203 18.717 1.00   32.89 ? 99   LYS B NZ  1 
ATOM   3127 N N   . PHE B 1 101 ? 62.727 45.337 20.296 1.00   15.48 ? 100  PHE B N   1 
ATOM   3128 C CA  . PHE B 1 101 ? 61.956 45.789 21.461 1.00   15.21 ? 100  PHE B CA  1 
ATOM   3129 C C   . PHE B 1 101 ? 60.570 45.187 21.383 1.00   15.97 ? 100  PHE B C   1 
ATOM   3130 O O   . PHE B 1 101 ? 60.086 44.908 20.291 1.00   14.82 ? 100  PHE B O   1 
ATOM   3131 C CB  . PHE B 1 101 ? 61.842 47.314 21.505 1.00   15.64 ? 100  PHE B CB  1 
ATOM   3132 C CG  . PHE B 1 101 ? 63.165 48.000 21.456 1.00   15.64 ? 100  PHE B CG  1 
ATOM   3133 C CD1 . PHE B 1 101 ? 64.062 47.867 22.500 1.00   16.77 ? 100  PHE B CD1 1 
ATOM   3134 C CD2 . PHE B 1 101 ? 63.554 48.704 20.345 1.00   16.90 ? 100  PHE B CD2 1 
ATOM   3135 C CE1 . PHE B 1 101 ? 65.306 48.436 22.437 1.00   18.91 ? 100  PHE B CE1 1 
ATOM   3136 C CE2 . PHE B 1 101 ? 64.799 49.278 20.286 1.00   17.75 ? 100  PHE B CE2 1 
ATOM   3137 C CZ  . PHE B 1 101 ? 65.671 49.149 21.320 1.00   18.57 ? 100  PHE B CZ  1 
ATOM   3138 N N   . TYR B 1 102 ? 59.930 45.034 22.537 1.00   16.00 ? 101  TYR B N   1 
ATOM   3139 C CA  . TYR B 1 102 ? 58.606 44.431 22.628 1.00   16.95 ? 101  TYR B CA  1 
ATOM   3140 C C   . TYR B 1 102 ? 57.632 45.407 23.263 1.00   17.36 ? 101  TYR B C   1 
ATOM   3141 O O   . TYR B 1 102 ? 57.992 46.110 24.181 1.00   16.74 ? 101  TYR B O   1 
ATOM   3142 C CB  . TYR B 1 102 ? 58.683 43.188 23.500 1.00   16.79 ? 101  TYR B CB  1 
ATOM   3143 C CG  . TYR B 1 102 ? 59.586 42.150 22.918 1.00   18.01 ? 101  TYR B CG  1 
ATOM   3144 C CD1 . TYR B 1 102 ? 60.968 42.235 23.036 1.00   17.20 ? 101  TYR B CD1 1 
ATOM   3145 C CD2 . TYR B 1 102 ? 59.059 41.051 22.249 1.00   18.12 ? 101  TYR B CD2 1 
ATOM   3146 C CE1 . TYR B 1 102 ? 61.795 41.267 22.492 1.00   18.55 ? 101  TYR B CE1 1 
ATOM   3147 C CE2 . TYR B 1 102 ? 59.881 40.087 21.717 1.00   19.05 ? 101  TYR B CE2 1 
ATOM   3148 C CZ  . TYR B 1 102 ? 61.247 40.216 21.827 1.00   17.41 ? 101  TYR B CZ  1 
ATOM   3149 O OH  . TYR B 1 102 ? 62.073 39.274 21.278 1.00   21.28 ? 101  TYR B OH  1 
ATOM   3150 N N   . PRO B 1 103 ? 56.378 45.388 22.830 1.00   18.77 ? 102  PRO B N   1 
ATOM   3151 C CA  . PRO B 1 103 ? 55.376 46.238 23.458 1.00   18.89 ? 102  PRO B CA  1 
ATOM   3152 C C   . PRO B 1 103 ? 55.020 45.689 24.831 1.00   19.65 ? 102  PRO B C   1 
ATOM   3153 O O   . PRO B 1 103 ? 55.285 44.506 25.132 1.00   18.44 ? 102  PRO B O   1 
ATOM   3154 C CB  . PRO B 1 103 ? 54.178 46.122 22.515 1.00   19.72 ? 102  PRO B CB  1 
ATOM   3155 C CG  . PRO B 1 103 ? 54.328 44.809 21.868 1.00   19.55 ? 102  PRO B CG  1 
ATOM   3156 C CD  . PRO B 1 103 ? 55.800 44.546 21.768 1.00   19.24 ? 102  PRO B CD  1 
ATOM   3157 N N   . GLU B 1 104 ? 54.437 46.535 25.654 1.00   19.94 ? 103  GLU B N   1 
ATOM   3158 C CA  . GLU B 1 104 ? 53.949 46.112 26.956 1.00   21.81 ? 103  GLU B CA  1 
ATOM   3159 C C   . GLU B 1 104 ? 52.607 45.424 26.799 1.00   22.02 ? 103  GLU B C   1 
ATOM   3160 O O   . GLU B 1 104 ? 52.336 44.411 27.453 1.00   22.41 ? 103  GLU B O   1 
ATOM   3161 C CB  . GLU B 1 104 ? 53.853 47.304 27.890 1.00   22.33 ? 103  GLU B CB  1 
ATOM   3162 C CG  . GLU B 1 104 ? 55.220 47.876 28.186 1.00   25.18 ? 103  GLU B CG  1 
ATOM   3163 C CD  . GLU B 1 104 ? 55.184 49.092 29.090 1.00   29.15 ? 103  GLU B CD  1 
ATOM   3164 O OE1 . GLU B 1 104 ? 54.282 49.158 29.981 1.00   30.34 ? 103  GLU B OE1 1 
ATOM   3165 O OE2 . GLU B 1 104 ? 56.080 49.962 28.904 1.00   28.93 ? 103  GLU B OE2 1 
ATOM   3166 N N   . ASN B 1 105 ? 51.770 45.951 25.916 1.00   22.07 ? 104  ASN B N   1 
ATOM   3167 C CA  . ASN B 1 105 ? 50.506 45.283 25.594 1.00   22.90 ? 104  ASN B CA  1 
ATOM   3168 C C   . ASN B 1 105 ? 50.340 45.248 24.120 1.00   22.08 ? 104  ASN B C   1 
ATOM   3169 O O   . ASN B 1 105 ? 50.028 46.262 23.503 1.00   21.87 ? 104  ASN B O   1 
ATOM   3170 C CB  . ASN B 1 105 ? 49.266 45.944 26.163 1.00   24.32 ? 104  ASN B CB  1 
ATOM   3171 C CG  . ASN B 1 105 ? 47.967 45.249 25.661 1.00   27.60 ? 104  ASN B CG  1 
ATOM   3172 O OD1 . ASN B 1 105 ? 47.929 44.012 25.409 1.00   32.60 ? 104  ASN B OD1 1 
ATOM   3173 N ND2 . ASN B 1 105 ? 46.920 46.026 25.510 1.00   31.76 ? 104  ASN B ND2 1 
ATOM   3174 N N   . ALA B 1 106 ? 50.550 44.072 23.555 1.00   21.76 ? 105  ALA B N   1 
ATOM   3175 C CA  . ALA B 1 106 ? 50.472 43.877 22.123 1.00   21.90 ? 105  ALA B CA  1 
ATOM   3176 C C   . ALA B 1 106 ? 49.120 44.264 21.548 1.00   22.18 ? 105  ALA B C   1 
ATOM   3177 O O   . ALA B 1 106 ? 49.070 44.775 20.451 1.00   21.40 ? 105  ALA B O   1 
ATOM   3178 C CB  . ALA B 1 106 ? 50.779 42.446 21.781 1.00   21.64 ? 105  ALA B CB  1 
ATOM   3179 N N   . GLU B 1 107 ? 48.037 43.999 22.272 1.00   23.59 ? 106  GLU B N   1 
ATOM   3180 C CA  . GLU B 1 107 ? 46.702 44.240 21.738 1.00   25.60 ? 106  GLU B CA  1 
ATOM   3181 C C   . GLU B 1 107 ? 46.499 45.754 21.581 1.00   26.26 ? 106  GLU B C   1 
ATOM   3182 O O   . GLU B 1 107 ? 45.871 46.206 20.627 1.00   27.06 ? 106  GLU B O   1 
ATOM   3183 C CB  . GLU B 1 107 ? 45.610 43.630 22.624 1.00   26.07 ? 106  GLU B CB  1 
ATOM   3184 C CG  . GLU B 1 107 ? 44.211 43.787 22.039 1.00   30.18 ? 106  GLU B CG  1 
ATOM   3185 C CD  . GLU B 1 107 ? 43.161 42.934 22.723 1.00   33.82 ? 106  GLU B CD  1 
ATOM   3186 O OE1 . GLU B 1 107 ? 43.094 42.931 23.970 1.00   38.48 ? 106  GLU B OE1 1 
ATOM   3187 O OE2 . GLU B 1 107 ? 42.391 42.259 22.007 1.00   37.79 ? 106  GLU B OE2 1 
ATOM   3188 N N   . GLU B 1 108 ? 47.061 46.511 22.505 1.00   26.68 ? 107  GLU B N   1 
ATOM   3189 C CA  . GLU B 1 108 ? 46.947 47.963 22.469 1.00   28.70 ? 107  GLU B CA  1 
ATOM   3190 C C   . GLU B 1 108 ? 47.900 48.605 21.458 1.00   28.51 ? 107  GLU B C   1 
ATOM   3191 O O   . GLU B 1 108 ? 47.522 49.494 20.696 1.00   29.69 ? 107  GLU B O   1 
ATOM   3192 C CB  . GLU B 1 108 ? 47.245 48.528 23.861 1.00   29.35 ? 107  GLU B CB  1 
ATOM   3193 C CG  . GLU B 1 108 ? 46.058 48.545 24.814 1.00   34.00 ? 107  GLU B CG  1 
ATOM   3194 C CD  . GLU B 1 108 ? 46.366 49.261 26.125 1.00   38.95 ? 107  GLU B CD  1 
ATOM   3195 O OE1 . GLU B 1 108 ? 47.018 48.648 27.009 1.00   41.31 ? 107  GLU B OE1 1 
ATOM   3196 O OE2 . GLU B 1 108 ? 45.962 50.443 26.272 1.00   41.65 ? 107  GLU B OE2 1 
ATOM   3197 N N   . GLU B 1 109 ? 49.138 48.137 21.437 1.00   27.44 ? 108  GLU B N   1 
ATOM   3198 C CA  . GLU B 1 109 ? 50.191 48.812 20.703 1.00   27.51 ? 108  GLU B CA  1 
ATOM   3199 C C   . GLU B 1 109 ? 50.437 48.411 19.263 1.00   28.06 ? 108  GLU B C   1 
ATOM   3200 O O   . GLU B 1 109 ? 50.890 49.246 18.473 1.00   29.26 ? 108  GLU B O   1 
ATOM   3201 C CB  . GLU B 1 109 ? 51.498 48.671 21.479 1.00   27.14 ? 108  GLU B CB  1 
ATOM   3202 C CG  . GLU B 1 109 ? 51.389 49.118 22.924 1.00   25.53 ? 108  GLU B CG  1 
ATOM   3203 C CD  . GLU B 1 109 ? 52.667 48.903 23.692 1.00   22.11 ? 108  GLU B CD  1 
ATOM   3204 O OE1 . GLU B 1 109 ? 53.757 49.192 23.160 1.00   23.18 ? 108  GLU B OE1 1 
ATOM   3205 O OE2 . GLU B 1 109 ? 52.584 48.421 24.822 1.00   21.72 ? 108  GLU B OE2 1 
ATOM   3206 N N   . LEU B 1 110 ? 50.199 47.151 18.916 1.00   27.81 ? 109  LEU B N   1 
ATOM   3207 C CA  . LEU B 1 110 ? 50.458 46.677 17.565 1.00   28.36 ? 109  LEU B CA  1 
ATOM   3208 C C   . LEU B 1 110 ? 49.228 46.836 16.658 1.00   29.47 ? 109  LEU B C   1 
ATOM   3209 O O   . LEU B 1 110 ? 48.388 45.934 16.590 1.00   30.65 ? 109  LEU B O   1 
ATOM   3210 C CB  . LEU B 1 110 ? 50.903 45.214 17.579 1.00   28.14 ? 109  LEU B CB  1 
ATOM   3211 C CG  . LEU B 1 110 ? 52.052 44.853 18.527 1.00   25.97 ? 109  LEU B CG  1 
ATOM   3212 C CD1 . LEU B 1 110 ? 52.474 43.396 18.343 1.00   25.87 ? 109  LEU B CD1 1 
ATOM   3213 C CD2 . LEU B 1 110 ? 53.226 45.775 18.310 1.00   25.08 ? 109  LEU B CD2 1 
ATOM   3214 N N   . VAL B 1 111 ? 49.166 47.949 15.931 1.00   29.62 ? 110  VAL B N   1 
ATOM   3215 C CA  . VAL B 1 111 ? 47.988 48.253 15.092 1.00   30.25 ? 110  VAL B CA  1 
ATOM   3216 C C   . VAL B 1 111 ? 47.972 47.572 13.710 1.00   29.29 ? 110  VAL B C   1 
ATOM   3217 O O   . VAL B 1 111 ? 46.905 47.224 13.208 1.00   30.14 ? 110  VAL B O   1 
ATOM   3218 C CB  . VAL B 1 111 ? 47.817 49.755 14.929 1.00   30.63 ? 110  VAL B CB  1 
ATOM   3219 C CG1 . VAL B 1 111 ? 46.573 50.082 14.095 1.00   32.18 ? 110  VAL B CG1 1 
ATOM   3220 C CG2 . VAL B 1 111 ? 47.719 50.437 16.305 1.00   31.88 ? 110  VAL B CG2 1 
ATOM   3221 N N   . GLN B 1 112 ? 49.132 47.360 13.090 1.00   27.84 ? 111  GLN B N   1 
ATOM   3222 C CA  . GLN B 1 112 ? 49.172 46.742 11.772 1.00   26.65 ? 111  GLN B CA  1 
ATOM   3223 C C   . GLN B 1 112 ? 49.246 45.212 11.788 1.00   26.84 ? 111  GLN B C   1 
ATOM   3224 O O   . GLN B 1 112 ? 49.906 44.623 12.650 1.00   25.96 ? 111  GLN B O   1 
ATOM   3225 C CB  . GLN B 1 112 ? 50.391 47.218 10.996 1.00   26.58 ? 111  GLN B CB  1 
ATOM   3226 C CG  . GLN B 1 112 ? 50.550 48.711 10.841 1.00   26.22 ? 111  GLN B CG  1 
ATOM   3227 C CD  . GLN B 1 112 ? 51.670 49.018 9.878  1.00   25.25 ? 111  GLN B CD  1 
ATOM   3228 O OE1 . GLN B 1 112 ? 52.789 49.300 10.294 1.00   23.33 ? 111  GLN B OE1 1 
ATOM   3229 N NE2 . GLN B 1 112 ? 51.380 48.918 8.582  1.00   25.83 ? 111  GLN B NE2 1 
ATOM   3230 N N   . GLU B 1 113 ? 48.631 44.595 10.778 1.00   25.81 ? 112  GLU B N   1 
ATOM   3231 C CA  . GLU B 1 113 ? 48.662 43.139 10.629 1.00   25.42 ? 112  GLU B CA  1 
ATOM   3232 C C   . GLU B 1 113 ? 50.078 42.637 10.410 1.00   24.21 ? 112  GLU B C   1 
ATOM   3233 O O   . GLU B 1 113 ? 50.465 41.616 10.988 1.00   23.30 ? 112  GLU B O   1 
ATOM   3234 C CB  . GLU B 1 113 ? 47.771 42.668 9.485  1.00   26.15 ? 112  GLU B CB  1 
ATOM   3235 C CG  . GLU B 1 113 ? 47.723 41.155 9.347  1.00   28.57 ? 112  GLU B CG  1 
ATOM   3236 C CD  . GLU B 1 113 ? 46.594 40.665 8.463  1.00   33.64 ? 112  GLU B CD  1 
ATOM   3237 O OE1 . GLU B 1 113 ? 45.711 41.479 8.105  1.00   36.91 ? 112  GLU B OE1 1 
ATOM   3238 O OE2 . GLU B 1 113 ? 46.580 39.458 8.146  1.00   36.04 ? 112  GLU B OE2 1 
ATOM   3239 N N   . ILE B 1 114 ? 50.859 43.320 9.565  1.00   22.56 ? 113  ILE B N   1 
ATOM   3240 C CA  . ILE B 1 114 ? 52.219 42.842 9.329  1.00   21.80 ? 113  ILE B CA  1 
ATOM   3241 C C   . ILE B 1 114 ? 53.012 42.818 10.643 1.00   20.30 ? 113  ILE B C   1 
ATOM   3242 O O   . ILE B 1 114 ? 53.753 41.864 10.930 1.00   20.48 ? 113  ILE B O   1 
ATOM   3243 C CB  . ILE B 1 114 ? 52.955 43.670 8.253  1.00   21.81 ? 113  ILE B CB  1 
ATOM   3244 C CG1 . ILE B 1 114 ? 54.365 43.128 8.034  1.00   21.97 ? 113  ILE B CG1 1 
ATOM   3245 C CG2 . ILE B 1 114 ? 53.048 45.111 8.646  1.00   22.02 ? 113  ILE B CG2 1 
ATOM   3246 C CD1 . ILE B 1 114 ? 54.443 41.725 7.535  1.00   22.94 ? 113  ILE B CD1 1 
ATOM   3247 N N   . THR B 1 115 ? 52.849 43.856 11.446 1.00   19.03 ? 114  THR B N   1 
ATOM   3248 C CA  . THR B 1 115 ? 53.584 43.980 12.696 1.00   18.68 ? 114  THR B CA  1 
ATOM   3249 C C   . THR B 1 115 ? 53.185 42.861 13.650 1.00   18.42 ? 114  THR B C   1 
ATOM   3250 O O   . THR B 1 115 ? 54.043 42.191 14.235 1.00   17.15 ? 114  THR B O   1 
ATOM   3251 C CB  . THR B 1 115 ? 53.302 45.344 13.317 1.00   19.05 ? 114  THR B CB  1 
ATOM   3252 O OG1 . THR B 1 115 ? 53.652 46.374 12.378 1.00   20.35 ? 114  THR B OG1 1 
ATOM   3253 C CG2 . THR B 1 115 ? 54.190 45.622 14.538 1.00   20.07 ? 114  THR B CG2 1 
ATOM   3254 N N   . GLN B 1 116 ? 51.880 42.658 13.785 1.00   17.40 ? 115  GLN B N   1 
ATOM   3255 C CA  . GLN B 1 116 ? 51.365 41.593 14.635 1.00   18.20 ? 115  GLN B CA  1 
ATOM   3256 C C   . GLN B 1 116 ? 51.917 40.233 14.201 1.00   17.65 ? 115  GLN B C   1 
ATOM   3257 O O   . GLN B 1 116 ? 52.346 39.435 15.039 1.00   18.00 ? 115  GLN B O   1 
ATOM   3258 C CB  . GLN B 1 116 ? 49.834 41.604 14.612 1.00   18.79 ? 115  GLN B CB  1 
ATOM   3259 C CG  . GLN B 1 116 ? 49.230 42.890 15.147 1.00   21.57 ? 115  GLN B CG  1 
ATOM   3260 C CD  . GLN B 1 116 ? 47.739 42.979 14.820 1.00   25.22 ? 115  GLN B CD  1 
ATOM   3261 O OE1 . GLN B 1 116 ? 47.172 42.011 14.330 1.00   27.81 ? 115  GLN B OE1 1 
ATOM   3262 N NE2 . GLN B 1 116 ? 47.121 44.135 15.079 1.00   24.95 ? 115  GLN B NE2 1 
ATOM   3263 N N   . HIS B 1 117 ? 51.924 39.986 12.891 1.00   17.21 ? 116  HIS B N   1 
ATOM   3264 C CA  . HIS B 1 117 ? 52.329 38.730 12.299 1.00   17.29 ? 116  HIS B CA  1 
ATOM   3265 C C   . HIS B 1 117 ? 53.787 38.423 12.568 1.00   16.63 ? 116  HIS B C   1 
ATOM   3266 O O   . HIS B 1 117 ? 54.139 37.300 12.945 1.00   16.28 ? 116  HIS B O   1 
ATOM   3267 C CB  . HIS B 1 117 ? 52.066 38.750 10.781 1.00   18.11 ? 116  HIS B CB  1 
ATOM   3268 C CG  . HIS B 1 117 ? 52.489 37.510 10.069 1.00   18.29 ? 116  HIS B CG  1 
ATOM   3269 N ND1 . HIS B 1 117 ? 51.931 36.270 10.321 1.00   19.52 ? 116  HIS B ND1 1 
ATOM   3270 C CD2 . HIS B 1 117 ? 53.411 37.318 9.098  1.00   19.08 ? 116  HIS B CD2 1 
ATOM   3271 C CE1 . HIS B 1 117 ? 52.514 35.368 9.554  1.00   19.97 ? 116  HIS B CE1 1 
ATOM   3272 N NE2 . HIS B 1 117 ? 53.402 35.983 8.787  1.00   19.74 ? 116  HIS B NE2 1 
ATOM   3273 N N   . LEU B 1 118 ? 54.646 39.413 12.367 1.00   16.47 ? 117  LEU B N   1 
ATOM   3274 C CA  . LEU B 1 118 ? 56.076 39.190 12.558 1.00   15.63 ? 117  LEU B CA  1 
ATOM   3275 C C   . LEU B 1 118 ? 56.439 38.965 14.039 1.00   14.95 ? 117  LEU B C   1 
ATOM   3276 O O   . LEU B 1 118 ? 57.328 38.163 14.360 1.00   15.10 ? 117  LEU B O   1 
ATOM   3277 C CB  . LEU B 1 118 ? 56.875 40.349 11.939 1.00   15.97 ? 117  LEU B CB  1 
ATOM   3278 C CG  . LEU B 1 118 ? 56.818 40.388 10.404 1.00   16.03 ? 117  LEU B CG  1 
ATOM   3279 C CD1 . LEU B 1 118 ? 57.591 41.620 9.938  1.00   19.17 ? 117  LEU B CD1 1 
ATOM   3280 C CD2 . LEU B 1 118 ? 57.389 39.113 9.764  1.00   18.45 ? 117  LEU B CD2 1 
ATOM   3281 N N   . PHE B 1 119 ? 55.761 39.669 14.942 1.00   14.60 ? 118  PHE B N   1 
ATOM   3282 C CA  . PHE B 1 119 ? 55.896 39.403 16.374 1.00   14.12 ? 118  PHE B CA  1 
ATOM   3283 C C   . PHE B 1 119 ? 55.435 37.974 16.695 1.00   14.62 ? 118  PHE B C   1 
ATOM   3284 O O   . PHE B 1 119 ? 56.092 37.236 17.402 1.00   12.93 ? 118  PHE B O   1 
ATOM   3285 C CB  . PHE B 1 119 ? 55.109 40.389 17.212 1.00   14.12 ? 118  PHE B CB  1 
ATOM   3286 C CG  . PHE B 1 119 ? 55.930 41.542 17.720 1.00   14.04 ? 118  PHE B CG  1 
ATOM   3287 C CD1 . PHE B 1 119 ? 56.783 41.388 18.809 1.00   15.83 ? 118  PHE B CD1 1 
ATOM   3288 C CD2 . PHE B 1 119 ? 55.863 42.775 17.096 1.00   17.01 ? 118  PHE B CD2 1 
ATOM   3289 C CE1 . PHE B 1 119 ? 57.530 42.423 19.274 1.00   16.96 ? 118  PHE B CE1 1 
ATOM   3290 C CE2 . PHE B 1 119 ? 56.621 43.823 17.545 1.00   17.73 ? 118  PHE B CE2 1 
ATOM   3291 C CZ  . PHE B 1 119 ? 57.473 43.656 18.632 1.00   16.42 ? 118  PHE B CZ  1 
ATOM   3292 N N   . PHE B 1 120 ? 54.296 37.595 16.152 1.00   14.81 ? 119  PHE B N   1 
ATOM   3293 C CA  . PHE B 1 120 ? 53.772 36.260 16.389 1.00   14.37 ? 119  PHE B CA  1 
ATOM   3294 C C   . PHE B 1 120 ? 54.791 35.181 16.004 1.00   15.12 ? 119  PHE B C   1 
ATOM   3295 O O   . PHE B 1 120 ? 55.043 34.241 16.772 1.00   14.31 ? 119  PHE B O   1 
ATOM   3296 C CB  . PHE B 1 120 ? 52.460 36.087 15.626 1.00   15.47 ? 119  PHE B CB  1 
ATOM   3297 C CG  . PHE B 1 120 ? 52.041 34.652 15.455 1.00   15.13 ? 119  PHE B CG  1 
ATOM   3298 C CD1 . PHE B 1 120 ? 51.471 33.945 16.508 1.00   16.04 ? 119  PHE B CD1 1 
ATOM   3299 C CD2 . PHE B 1 120 ? 52.186 34.029 14.243 1.00   16.54 ? 119  PHE B CD2 1 
ATOM   3300 C CE1 . PHE B 1 120 ? 51.107 32.615 16.343 1.00   13.79 ? 119  PHE B CE1 1 
ATOM   3301 C CE2 . PHE B 1 120 ? 51.815 32.729 14.065 1.00   15.05 ? 119  PHE B CE2 1 
ATOM   3302 C CZ  . PHE B 1 120 ? 51.250 32.015 15.139 1.00   15.20 ? 119  PHE B CZ  1 
ATOM   3303 N N   . LEU B 1 121 ? 55.351 35.278 14.810 1.00   14.62 ? 120  LEU B N   1 
ATOM   3304 C CA  . LEU B 1 121 ? 56.295 34.248 14.383 1.00   15.61 ? 120  LEU B CA  1 
ATOM   3305 C C   . LEU B 1 121 ? 57.566 34.247 15.222 1.00   15.55 ? 120  LEU B C   1 
ATOM   3306 O O   . LEU B 1 121 ? 58.116 33.183 15.546 1.00   14.39 ? 120  LEU B O   1 
ATOM   3307 C CB  . LEU B 1 121 ? 56.634 34.423 12.922 1.00   16.51 ? 120  LEU B CB  1 
ATOM   3308 C CG  . LEU B 1 121 ? 55.490 34.233 11.940 1.00   17.81 ? 120  LEU B CG  1 
ATOM   3309 C CD1 . LEU B 1 121 ? 56.002 34.535 10.543 1.00   19.42 ? 120  LEU B CD1 1 
ATOM   3310 C CD2 . LEU B 1 121 ? 55.007 32.817 12.034 1.00   20.80 ? 120  LEU B CD2 1 
ATOM   3311 N N   . GLN B 1 122 ? 58.071 35.436 15.540 1.00   14.72 ? 121  GLN B N   1 
ATOM   3312 C CA  . GLN B 1 122 ? 59.292 35.527 16.320 1.00   15.04 ? 121  GLN B CA  1 
ATOM   3313 C C   . GLN B 1 122 ? 59.088 34.974 17.736 1.00   14.93 ? 121  GLN B C   1 
ATOM   3314 O O   . GLN B 1 122 ? 59.929 34.224 18.231 1.00   15.09 ? 121  GLN B O   1 
ATOM   3315 C CB  . GLN B 1 122 ? 59.780 36.961 16.427 1.00   15.29 ? 121  GLN B CB  1 
ATOM   3316 C CG  . GLN B 1 122 ? 61.102 37.118 17.147 1.00   15.54 ? 121  GLN B CG  1 
ATOM   3317 C CD  . GLN B 1 122 ? 61.648 38.537 17.003 1.00   16.43 ? 121  GLN B CD  1 
ATOM   3318 O OE1 . GLN B 1 122 ? 61.277 39.226 16.071 1.00   16.04 ? 121  GLN B OE1 1 
ATOM   3319 N NE2 . GLN B 1 122 ? 62.487 38.970 17.936 1.00   18.68 ? 121  GLN B NE2 1 
ATOM   3320 N N   . VAL B 1 123 ? 57.984 35.346 18.373 1.00   14.24 ? 122  VAL B N   1 
ATOM   3321 C CA  . VAL B 1 123 ? 57.712 34.920 19.757 1.00   14.44 ? 122  VAL B CA  1 
ATOM   3322 C C   . VAL B 1 123 ? 57.398 33.397 19.779 1.00   14.76 ? 122  VAL B C   1 
ATOM   3323 O O   . VAL B 1 123 ? 57.840 32.688 20.689 1.00   14.40 ? 122  VAL B O   1 
ATOM   3324 C CB  . VAL B 1 123 ? 56.577 35.742 20.371 1.00   14.71 ? 122  VAL B CB  1 
ATOM   3325 C CG1 . VAL B 1 123 ? 56.093 35.170 21.736 1.00   14.87 ? 122  VAL B CG1 1 
ATOM   3326 C CG2 . VAL B 1 123 ? 57.034 37.193 20.570 1.00   15.07 ? 122  VAL B CG2 1 
ATOM   3327 N N   . LYS B 1 124 ? 56.665 32.918 18.782 1.00   14.68 ? 123  LYS B N   1 
ATOM   3328 C CA  . LYS B 1 124 ? 56.343 31.484 18.726 1.00   15.68 ? 123  LYS B CA  1 
ATOM   3329 C C   . LYS B 1 124 ? 57.632 30.655 18.661 1.00   15.74 ? 123  LYS B C   1 
ATOM   3330 O O   . LYS B 1 124 ? 57.769 29.617 19.328 1.00   15.33 ? 123  LYS B O   1 
ATOM   3331 C CB  . LYS B 1 124 ? 55.434 31.170 17.538 1.00   15.77 ? 123  LYS B CB  1 
ATOM   3332 C CG  . LYS B 1 124 ? 54.935 29.702 17.513 1.00   16.52 ? 123  LYS B CG  1 
ATOM   3333 C CD  . LYS B 1 124 ? 53.740 29.516 16.565 1.00   16.38 ? 123  LYS B CD  1 
ATOM   3334 C CE  . LYS B 1 124 ? 54.153 29.584 15.093 1.00   18.32 ? 123  LYS B CE  1 
ATOM   3335 N NZ  . LYS B 1 124 ? 55.096 28.471 14.668 1.00   19.30 ? 123  LYS B NZ  1 
ATOM   3336 N N   . LYS B 1 125 ? 58.578 31.102 17.841 1.00   15.81 ? 124  LYS B N   1 
ATOM   3337 C CA  . LYS B 1 125 ? 59.848 30.413 17.717 1.00   16.41 ? 124  LYS B CA  1 
ATOM   3338 C C   . LYS B 1 125 ? 60.597 30.397 19.045 1.00   16.08 ? 124  LYS B C   1 
ATOM   3339 O O   . LYS B 1 125 ? 61.216 29.386 19.395 1.00   15.01 ? 124  LYS B O   1 
ATOM   3340 C CB  . LYS B 1 125 ? 60.694 31.054 16.621 1.00   17.52 ? 124  LYS B CB  1 
ATOM   3341 C CG  . LYS B 1 125 ? 61.975 30.296 16.296 1.00   20.60 ? 124  LYS B CG  1 
ATOM   3342 C CD  . LYS B 1 125 ? 61.653 28.927 15.718 1.00   26.84 ? 124  LYS B CD  1 
ATOM   3343 C CE  . LYS B 1 125 ? 62.871 28.244 15.095 1.00   30.18 ? 124  LYS B CE  1 
ATOM   3344 N NZ  . LYS B 1 125 ? 62.549 26.858 14.649 1.00   32.93 ? 124  LYS B NZ  1 
ATOM   3345 N N   . GLN B 1 126 ? 60.572 31.521 19.765 1.00   14.68 ? 125  GLN B N   1 
ATOM   3346 C CA  . GLN B 1 126 ? 61.173 31.591 21.097 1.00   14.79 ? 125  GLN B CA  1 
ATOM   3347 C C   . GLN B 1 126 ? 60.539 30.564 22.043 1.00   15.19 ? 125  GLN B C   1 
ATOM   3348 O O   . GLN B 1 126 ? 61.237 29.933 22.837 1.00   15.20 ? 125  GLN B O   1 
ATOM   3349 C CB  . GLN B 1 126 ? 60.985 32.988 21.718 1.00   15.13 ? 125  GLN B CB  1 
ATOM   3350 C CG  . GLN B 1 126 ? 61.823 34.065 21.063 1.00   17.12 ? 125  GLN B CG  1 
ATOM   3351 C CD  . GLN B 1 126 ? 61.387 35.481 21.461 1.00   19.60 ? 125  GLN B CD  1 
ATOM   3352 O OE1 . GLN B 1 126 ? 60.516 35.660 22.312 1.00   23.86 ? 125  GLN B OE1 1 
ATOM   3353 N NE2 . GLN B 1 126 ? 61.996 36.491 20.823 1.00   21.74 ? 125  GLN B NE2 1 
ATOM   3354 N N   . ILE B 1 127 ? 59.222 30.410 21.960 1.00   14.04 ? 126  ILE B N   1 
ATOM   3355 C CA  . ILE B 1 127 ? 58.504 29.458 22.800 1.00   14.87 ? 126  ILE B CA  1 
ATOM   3356 C C   . ILE B 1 127 ? 58.870 28.042 22.433 1.00   16.25 ? 126  ILE B C   1 
ATOM   3357 O O   . ILE B 1 127 ? 59.179 27.211 23.298 1.00   16.00 ? 126  ILE B O   1 
ATOM   3358 C CB  . ILE B 1 127 ? 56.980 29.665 22.639 1.00   15.49 ? 126  ILE B CB  1 
ATOM   3359 C CG1 . ILE B 1 127 ? 56.540 30.993 23.223 1.00   18.12 ? 126  ILE B CG1 1 
ATOM   3360 C CG2 . ILE B 1 127 ? 56.220 28.519 23.322 1.00   15.75 ? 126  ILE B CG2 1 
ATOM   3361 C CD1 . ILE B 1 127 ? 56.830 31.121 24.674 1.00   21.50 ? 126  ILE B CD1 1 
ATOM   3362 N N   . LEU B 1 128 ? 58.839 27.753 21.140 1.00   16.28 ? 127  LEU B N   1 
ATOM   3363 C CA  . LEU B 1 128 ? 59.088 26.393 20.685 1.00   17.64 ? 127  LEU B CA  1 
ATOM   3364 C C   . LEU B 1 128 ? 60.553 25.990 20.934 1.00   19.01 ? 127  LEU B C   1 
ATOM   3365 O O   . LEU B 1 128 ? 60.837 24.816 21.168 1.00   20.19 ? 127  LEU B O   1 
ATOM   3366 C CB  . LEU B 1 128 ? 58.718 26.239 19.212 1.00   17.61 ? 127  LEU B CB  1 
ATOM   3367 C CG  . LEU B 1 128 ? 57.223 26.346 18.907 1.00   17.74 ? 127  LEU B CG  1 
ATOM   3368 C CD1 . LEU B 1 128 ? 56.955 26.222 17.417 1.00   19.65 ? 127  LEU B CD1 1 
ATOM   3369 C CD2 . LEU B 1 128 ? 56.439 25.285 19.669 1.00   19.25 ? 127  LEU B CD2 1 
ATOM   3370 N N   . ASP B 1 129 ? 61.461 26.956 20.876 1.00   19.54 ? 128  ASP B N   1 
ATOM   3371 C CA  . ASP B 1 129 ? 62.883 26.693 21.126 1.00   21.14 ? 128  ASP B CA  1 
ATOM   3372 C C   . ASP B 1 129 ? 63.283 26.821 22.618 1.00   21.41 ? 128  ASP B C   1 
ATOM   3373 O O   . ASP B 1 129 ? 64.456 26.661 22.956 1.00   21.20 ? 128  ASP B O   1 
ATOM   3374 C CB  . ASP B 1 129 ? 63.749 27.604 20.257 1.00   22.26 ? 128  ASP B CB  1 
ATOM   3375 C CG  . ASP B 1 129 ? 63.706 27.239 18.782 1.00   23.38 ? 128  ASP B CG  1 
ATOM   3376 O OD1 . ASP B 1 129 ? 63.118 26.197 18.398 1.00   26.84 ? 128  ASP B OD1 1 
ATOM   3377 O OD2 . ASP B 1 129 ? 64.227 27.964 17.913 1.00   29.38 ? 128  ASP B OD2 1 
ATOM   3378 N N   . GLU B 1 130 ? 62.307 27.067 23.497 1.00   20.77 ? 129  GLU B N   1 
ATOM   3379 C CA  . GLU B 1 130 ? 62.525 27.162 24.956 1.00   22.00 ? 129  GLU B CA  1 
ATOM   3380 C C   . GLU B 1 130 ? 63.382 28.334 25.383 1.00   22.82 ? 129  GLU B C   1 
ATOM   3381 O O   . GLU B 1 130 ? 64.111 28.256 26.361 1.00   22.77 ? 129  GLU B O   1 
ATOM   3382 C CB  . GLU B 1 130 ? 63.117 25.860 25.526 1.00   22.43 ? 129  GLU B CB  1 
ATOM   3383 C CG  . GLU B 1 130 ? 62.195 24.682 25.309 1.00   23.68 ? 129  GLU B CG  1 
ATOM   3384 C CD  . GLU B 1 130 ? 62.819 23.378 25.740 1.00   27.33 ? 129  GLU B CD  1 
ATOM   3385 O OE1 . GLU B 1 130 ? 63.792 23.410 26.525 1.00   31.42 ? 129  GLU B OE1 1 
ATOM   3386 O OE2 . GLU B 1 130 ? 62.339 22.334 25.293 1.00   26.02 ? 129  GLU B OE2 1 
ATOM   3387 N N   . LYS B 1 131 ? 63.279 29.438 24.652 1.00   23.13 ? 130  LYS B N   1 
ATOM   3388 C CA  . LYS B 1 131 ? 63.965 30.670 25.043 1.00   23.76 ? 130  LYS B CA  1 
ATOM   3389 C C   . LYS B 1 131 ? 63.154 31.365 26.117 1.00   23.15 ? 130  LYS B C   1 
ATOM   3390 O O   . LYS B 1 131 ? 63.691 32.044 27.011 1.00   23.99 ? 130  LYS B O   1 
ATOM   3391 C CB  . LYS B 1 131 ? 64.149 31.599 23.837 1.00   24.21 ? 130  LYS B CB  1 
ATOM   3392 C CG  . LYS B 1 131 ? 65.048 31.045 22.737 1.00   27.44 ? 130  LYS B CG  1 
ATOM   3393 C CD  . LYS B 1 131 ? 66.470 30.788 23.220 1.00   33.70 ? 130  LYS B CD  1 
ATOM   3394 C CE  . LYS B 1 131 ? 67.311 30.124 22.136 1.00   36.92 ? 130  LYS B CE  1 
ATOM   3395 N NZ  . LYS B 1 131 ? 66.694 28.857 21.631 1.00   39.12 ? 130  LYS B NZ  1 
ATOM   3396 N N   . ILE B 1 132 ? 61.844 31.199 26.042 1.00   21.95 ? 131  ILE B N   1 
ATOM   3397 C CA  . ILE B 1 132 ? 60.937 31.747 27.037 1.00   21.67 ? 131  ILE B CA  1 
ATOM   3398 C C   . ILE B 1 132 ? 60.362 30.502 27.687 1.00   20.54 ? 131  ILE B C   1 
ATOM   3399 O O   . ILE B 1 132 ? 59.775 29.701 26.979 1.00   19.64 ? 131  ILE B O   1 
ATOM   3400 C CB  . ILE B 1 132 ? 59.749 32.489 26.360 1.00   22.01 ? 131  ILE B CB  1 
ATOM   3401 C CG1 . ILE B 1 132 ? 60.190 33.808 25.747 1.00   25.33 ? 131  ILE B CG1 1 
ATOM   3402 C CG2 . ILE B 1 132 ? 58.614 32.791 27.366 1.00   23.54 ? 131  ILE B CG2 1 
ATOM   3403 C CD1 . ILE B 1 132 ? 59.077 34.489 25.008 1.00   24.93 ? 131  ILE B CD1 1 
ATOM   3404 N N   . TYR B 1 133 ? 60.526 30.342 28.995 1.00   18.50 ? 132  TYR B N   1 
ATOM   3405 C CA  . TYR B 1 133 ? 59.864 29.255 29.697 1.00   18.06 ? 132  TYR B CA  1 
ATOM   3406 C C   . TYR B 1 133 ? 58.342 29.346 29.492 1.00   18.04 ? 132  TYR B C   1 
ATOM   3407 O O   . TYR B 1 133 ? 57.762 30.409 29.594 1.00   17.14 ? 132  TYR B O   1 
ATOM   3408 C CB  . TYR B 1 133 ? 60.149 29.336 31.198 1.00   18.47 ? 132  TYR B CB  1 
ATOM   3409 C CG  . TYR B 1 133 ? 59.265 28.415 31.999 1.00   19.41 ? 132  TYR B CG  1 
ATOM   3410 C CD1 . TYR B 1 133 ? 59.484 27.050 32.004 1.00   24.63 ? 132  TYR B CD1 1 
ATOM   3411 C CD2 . TYR B 1 133 ? 58.202 28.902 32.738 1.00   21.15 ? 132  TYR B CD2 1 
ATOM   3412 C CE1 . TYR B 1 133 ? 58.664 26.203 32.729 1.00   23.89 ? 132  TYR B CE1 1 
ATOM   3413 C CE2 . TYR B 1 133 ? 57.383 28.058 33.473 1.00   24.25 ? 132  TYR B CE2 1 
ATOM   3414 C CZ  . TYR B 1 133 ? 57.621 26.706 33.451 1.00   25.67 ? 132  TYR B CZ  1 
ATOM   3415 O OH  . TYR B 1 133 ? 56.806 25.837 34.159 1.00   28.45 ? 132  TYR B OH  1 
ATOM   3416 N N   . CYS B 1 134 ? 57.702 28.223 29.195 1.00   16.98 ? 133  CYS B N   1 
ATOM   3417 C CA  . CYS B 1 134 ? 56.261 28.188 29.011 1.00   16.52 ? 133  CYS B CA  1 
ATOM   3418 C C   . CYS B 1 134 ? 55.745 26.902 29.644 1.00   16.47 ? 133  CYS B C   1 
ATOM   3419 O O   . CYS B 1 134 ? 56.186 25.836 29.256 1.00   17.41 ? 133  CYS B O   1 
ATOM   3420 C CB  . CYS B 1 134 ? 55.914 28.222 27.526 1.00   16.28 ? 133  CYS B CB  1 
ATOM   3421 S SG  . CYS B 1 134 ? 54.109 28.314 27.279 1.00   17.64 ? 133  CYS B SG  1 
ATOM   3422 N N   . PRO B 1 135 ? 54.865 26.982 30.633 1.00   15.95 ? 134  PRO B N   1 
ATOM   3423 C CA  . PRO B 1 135 ? 54.383 25.769 31.295 1.00   16.54 ? 134  PRO B CA  1 
ATOM   3424 C C   . PRO B 1 135 ? 53.440 25.008 30.362 1.00   15.83 ? 134  PRO B C   1 
ATOM   3425 O O   . PRO B 1 135 ? 53.000 25.544 29.338 1.00   15.51 ? 134  PRO B O   1 
ATOM   3426 C CB  . PRO B 1 135 ? 53.688 26.311 32.526 1.00   17.03 ? 134  PRO B CB  1 
ATOM   3427 C CG  . PRO B 1 135 ? 53.227 27.630 32.116 1.00   16.99 ? 134  PRO B CG  1 
ATOM   3428 C CD  . PRO B 1 135 ? 54.292 28.180 31.259 1.00   16.50 ? 134  PRO B CD  1 
ATOM   3429 N N   . PRO B 1 136 ? 53.164 23.750 30.678 1.00   15.74 ? 135  PRO B N   1 
ATOM   3430 C CA  . PRO B 1 136 ? 52.434 22.889 29.748 1.00   15.25 ? 135  PRO B CA  1 
ATOM   3431 C C   . PRO B 1 136 ? 51.029 23.326 29.361 1.00   14.08 ? 135  PRO B C   1 
ATOM   3432 O O   . PRO B 1 136 ? 50.701 23.264 28.183 1.00   14.94 ? 135  PRO B O   1 
ATOM   3433 C CB  . PRO B 1 136 ? 52.386 21.508 30.467 1.00   15.71 ? 135  PRO B CB  1 
ATOM   3434 C CG  . PRO B 1 136 ? 52.990 21.693 31.807 1.00   18.03 ? 135  PRO B CG  1 
ATOM   3435 C CD  . PRO B 1 136 ? 53.508 23.084 31.941 1.00   16.20 ? 135  PRO B CD  1 
ATOM   3436 N N   . GLU B 1 137 ? 50.197 23.736 30.297 1.00   13.53 ? 136  GLU B N   1 
ATOM   3437 C CA  . GLU B 1 137 ? 48.829 24.068 29.942 1.00   13.03 ? 136  GLU B CA  1 
ATOM   3438 C C   . GLU B 1 137 ? 48.819 25.331 29.050 1.00   12.57 ? 136  GLU B C   1 
ATOM   3439 O O   . GLU B 1 137 ? 48.126 25.410 28.046 1.00   12.12 ? 136  GLU B O   1 
ATOM   3440 C CB  . GLU B 1 137 ? 48.007 24.277 31.192 1.00   13.58 ? 136  GLU B CB  1 
ATOM   3441 C CG  . GLU B 1 137 ? 47.728 22.998 31.980 1.00   15.80 ? 136  GLU B CG  1 
ATOM   3442 C CD  . GLU B 1 137 ? 47.049 21.933 31.132 1.00   17.79 ? 136  GLU B CD  1 
ATOM   3443 O OE1 . GLU B 1 137 ? 46.001 22.238 30.518 1.00   17.68 ? 136  GLU B OE1 1 
ATOM   3444 O OE2 . GLU B 1 137 ? 47.557 20.779 31.066 1.00   19.09 ? 136  GLU B OE2 1 
ATOM   3445 N N   . ALA B 1 138 ? 49.618 26.299 29.426 1.00   13.50 ? 137  ALA B N   1 
ATOM   3446 C CA  . ALA B 1 138 ? 49.805 27.479 28.556 1.00   14.00 ? 137  ALA B CA  1 
ATOM   3447 C C   . ALA B 1 138 ? 50.297 27.101 27.168 1.00   13.43 ? 137  ALA B C   1 
ATOM   3448 O O   . ALA B 1 138 ? 49.847 27.685 26.159 1.00   12.57 ? 137  ALA B O   1 
ATOM   3449 C CB  . ALA B 1 138 ? 50.770 28.467 29.198 1.00   14.25 ? 137  ALA B CB  1 
ATOM   3450 N N   . SER B 1 139 ? 51.210 26.125 27.079 1.00   13.22 ? 138  SER B N   1 
ATOM   3451 C CA  . SER B 1 139 ? 51.757 25.726 25.792 1.00   12.69 ? 138  SER B CA  1 
ATOM   3452 C C   . SER B 1 139 ? 50.686 25.124 24.900 1.00   13.47 ? 138  SER B C   1 
ATOM   3453 O O   . SER B 1 139 ? 50.734 25.268 23.679 1.00   12.32 ? 138  SER B O   1 
ATOM   3454 C CB  . SER B 1 139 ? 52.962 24.773 25.909 1.00   13.80 ? 138  SER B CB  1 
ATOM   3455 O OG  . SER B 1 139 ? 52.576 23.444 26.182 1.00   15.76 ? 138  SER B OG  1 
ATOM   3456 N N   . VAL B 1 140 ? 49.732 24.426 25.506 1.00   13.12 ? 139  VAL B N   1 
ATOM   3457 C CA  . VAL B 1 140 ? 48.699 23.777 24.723 1.00   13.50 ? 139  VAL B CA  1 
ATOM   3458 C C   . VAL B 1 140 ? 47.718 24.838 24.198 1.00   13.38 ? 139  VAL B C   1 
ATOM   3459 O O   . VAL B 1 140 ? 47.279 24.779 23.049 1.00   13.60 ? 139  VAL B O   1 
ATOM   3460 C CB  . VAL B 1 140 ? 47.959 22.718 25.537 1.00   13.69 ? 139  VAL B CB  1 
ATOM   3461 C CG1 . VAL B 1 140 ? 46.738 22.174 24.757 1.00   15.31 ? 139  VAL B CG1 1 
ATOM   3462 C CG2 . VAL B 1 140 ? 48.900 21.584 25.919 1.00   15.29 ? 139  VAL B CG2 1 
ATOM   3463 N N   . LEU B 1 141 ? 47.391 25.800 25.054 1.00   13.25 ? 140  LEU B N   1 
ATOM   3464 C CA  . LEU B 1 141 ? 46.506 26.910 24.691 1.00   12.76 ? 140  LEU B CA  1 
ATOM   3465 C C   . LEU B 1 141 ? 47.142 27.696 23.544 1.00   13.50 ? 140  LEU B C   1 
ATOM   3466 O O   . LEU B 1 141 ? 46.477 27.991 22.553 1.00   13.01 ? 140  LEU B O   1 
ATOM   3467 C CB  . LEU B 1 141 ? 46.215 27.769 25.897 1.00   13.88 ? 140  LEU B CB  1 
ATOM   3468 C CG  . LEU B 1 141 ? 45.390 29.040 25.617 1.00   13.73 ? 140  LEU B CG  1 
ATOM   3469 C CD1 . LEU B 1 141 ? 44.070 28.700 24.994 1.00   13.92 ? 140  LEU B CD1 1 
ATOM   3470 C CD2 . LEU B 1 141 ? 45.180 29.774 26.910 1.00   15.95 ? 140  LEU B CD2 1 
ATOM   3471 N N   . LEU B 1 142 ? 48.437 27.989 23.660 1.00   12.61 ? 141  LEU B N   1 
ATOM   3472 C CA  . LEU B 1 142 ? 49.173 28.668 22.591 1.00   13.47 ? 141  LEU B CA  1 
ATOM   3473 C C   . LEU B 1 142 ? 49.140 27.879 21.277 1.00   13.41 ? 141  LEU B C   1 
ATOM   3474 O O   . LEU B 1 142 ? 48.825 28.418 20.209 1.00   12.79 ? 141  LEU B O   1 
ATOM   3475 C CB  . LEU B 1 142 ? 50.625 28.933 23.015 1.00   13.47 ? 141  LEU B CB  1 
ATOM   3476 C CG  . LEU B 1 142 ? 50.831 29.980 24.110 1.00   14.44 ? 141  LEU B CG  1 
ATOM   3477 C CD1 . LEU B 1 142 ? 52.281 30.019 24.641 1.00   15.69 ? 141  LEU B CD1 1 
ATOM   3478 C CD2 . LEU B 1 142 ? 50.454 31.418 23.603 1.00   15.34 ? 141  LEU B CD2 1 
ATOM   3479 N N   . ALA B 1 143 ? 49.408 26.566 21.355 1.00   13.64 ? 142  ALA B N   1 
ATOM   3480 C CA  . ALA B 1 143 ? 49.419 25.734 20.171 1.00   13.62 ? 142  ALA B CA  1 
ATOM   3481 C C   . ALA B 1 143 ? 48.053 25.797 19.461 1.00   13.59 ? 142  ALA B C   1 
ATOM   3482 O O   . ALA B 1 143 ? 47.987 25.847 18.233 1.00   13.24 ? 142  ALA B O   1 
ATOM   3483 C CB  . ALA B 1 143 ? 49.788 24.279 20.530 1.00   13.32 ? 142  ALA B CB  1 
ATOM   3484 N N   . SER B 1 144 ? 46.984 25.844 20.240 1.00   13.78 ? 143  SER B N   1 
ATOM   3485 C CA  . SER B 1 144 ? 45.653 25.889 19.668 1.00   14.35 ? 143  SER B CA  1 
ATOM   3486 C C   . SER B 1 144 ? 45.435 27.160 18.818 1.00   14.02 ? 143  SER B C   1 
ATOM   3487 O O   . SER B 1 144 ? 44.734 27.101 17.810 1.00   14.97 ? 143  SER B O   1 
ATOM   3488 C CB  . SER B 1 144 ? 44.589 25.756 20.777 1.00   13.74 ? 143  SER B CB  1 
ATOM   3489 O OG  . SER B 1 144 ? 44.454 26.914 21.554 1.00   13.70 ? 143  SER B OG  1 
ATOM   3490 N N   . TYR B 1 145 ? 46.048 28.281 19.202 1.00   14.62 ? 144  TYR B N   1 
ATOM   3491 C CA  . TYR B 1 145 ? 45.944 29.517 18.427 1.00   14.90 ? 144  TYR B CA  1 
ATOM   3492 C C   . TYR B 1 145 ? 46.863 29.467 17.201 1.00   15.42 ? 144  TYR B C   1 
ATOM   3493 O O   . TYR B 1 145 ? 46.505 29.943 16.119 1.00   14.54 ? 144  TYR B O   1 
ATOM   3494 C CB  . TYR B 1 145 ? 46.227 30.744 19.294 1.00   15.65 ? 144  TYR B CB  1 
ATOM   3495 C CG  . TYR B 1 145 ? 45.062 31.137 20.175 1.00   14.81 ? 144  TYR B CG  1 
ATOM   3496 C CD1 . TYR B 1 145 ? 43.817 31.470 19.628 1.00   17.88 ? 144  TYR B CD1 1 
ATOM   3497 C CD2 . TYR B 1 145 ? 45.196 31.154 21.550 1.00   16.19 ? 144  TYR B CD2 1 
ATOM   3498 C CE1 . TYR B 1 145 ? 42.775 31.832 20.431 1.00   19.52 ? 144  TYR B CE1 1 
ATOM   3499 C CE2 . TYR B 1 145 ? 44.152 31.486 22.362 1.00   18.92 ? 144  TYR B CE2 1 
ATOM   3500 C CZ  . TYR B 1 145 ? 42.947 31.832 21.804 1.00   19.50 ? 144  TYR B CZ  1 
ATOM   3501 O OH  . TYR B 1 145 ? 41.890 32.221 22.605 1.00   25.10 ? 144  TYR B OH  1 
ATOM   3502 N N   . ALA B 1 146 ? 48.030 28.832 17.345 1.00   15.67 ? 145  ALA B N   1 
ATOM   3503 C CA  . ALA B 1 146 ? 48.899 28.641 16.201 1.00   16.14 ? 145  ALA B CA  1 
ATOM   3504 C C   . ALA B 1 146 ? 48.188 27.784 15.144 1.00   15.89 ? 145  ALA B C   1 
ATOM   3505 O O   . ALA B 1 146 ? 48.283 28.056 13.954 1.00   16.40 ? 145  ALA B O   1 
ATOM   3506 C CB  . ALA B 1 146 ? 50.198 28.011 16.604 1.00   15.71 ? 145  ALA B CB  1 
ATOM   3507 N N   . VAL B 1 147 ? 47.457 26.768 15.588 1.00   15.69 ? 146  VAL B N   1 
ATOM   3508 C CA  . VAL B 1 147 ? 46.695 25.914 14.685 1.00   16.31 ? 146  VAL B CA  1 
ATOM   3509 C C   . VAL B 1 147 ? 45.558 26.715 14.013 1.00   16.80 ? 146  VAL B C   1 
ATOM   3510 O O   . VAL B 1 147 ? 45.364 26.629 12.807 1.00   18.93 ? 146  VAL B O   1 
ATOM   3511 C CB  . VAL B 1 147 ? 46.161 24.656 15.401 1.00   15.59 ? 146  VAL B CB  1 
ATOM   3512 C CG1 . VAL B 1 147 ? 45.197 23.915 14.516 1.00   16.09 ? 146  VAL B CG1 1 
ATOM   3513 C CG2 . VAL B 1 147 ? 47.351 23.742 15.821 1.00   15.20 ? 146  VAL B CG2 1 
ATOM   3514 N N   . GLN B 1 148 ? 44.830 27.517 14.779 1.00   18.16 ? 147  GLN B N   1 
ATOM   3515 C CA  . GLN B 1 148 ? 43.788 28.381 14.208 1.00   18.12 ? 147  GLN B CA  1 
ATOM   3516 C C   . GLN B 1 148 ? 44.357 29.326 13.129 1.00   19.33 ? 147  GLN B C   1 
ATOM   3517 O O   . GLN B 1 148 ? 43.786 29.496 12.036 1.00   19.27 ? 147  GLN B O   1 
ATOM   3518 C CB  . GLN B 1 148 ? 43.099 29.183 15.325 1.00   18.27 ? 147  GLN B CB  1 
ATOM   3519 C CG  . GLN B 1 148 ? 41.908 30.046 14.868 1.00   17.68 ? 147  GLN B CG  1 
ATOM   3520 C CD  . GLN B 1 148 ? 40.697 29.252 14.429 1.00   17.50 ? 147  GLN B CD  1 
ATOM   3521 O OE1 . GLN B 1 148 ? 40.509 28.076 14.823 1.00   17.60 ? 147  GLN B OE1 1 
ATOM   3522 N NE2 . GLN B 1 148 ? 39.832 29.898 13.624 1.00   18.06 ? 147  GLN B NE2 1 
ATOM   3523 N N   . ALA B 1 149 ? 45.505 29.903 13.427 1.00   19.67 ? 148  ALA B N   1 
ATOM   3524 C CA  . ALA B 1 149 ? 46.166 30.837 12.525 1.00   21.11 ? 148  ALA B CA  1 
ATOM   3525 C C   . ALA B 1 149 ? 46.584 30.165 11.223 1.00   22.03 ? 148  ALA B C   1 
ATOM   3526 O O   . ALA B 1 149 ? 46.527 30.787 10.160 1.00   23.86 ? 148  ALA B O   1 
ATOM   3527 C CB  . ALA B 1 149 ? 47.375 31.437 13.196 1.00   20.80 ? 148  ALA B CB  1 
ATOM   3528 N N   . LYS B 1 150 ? 47.002 28.908 11.298 1.00   22.80 ? 149  LYS B N   1 
ATOM   3529 C CA  . LYS B 1 150 ? 47.501 28.211 10.133 1.00   24.10 ? 149  LYS B CA  1 
ATOM   3530 C C   . LYS B 1 150 ? 46.416 27.505 9.330  1.00   24.28 ? 149  LYS B C   1 
ATOM   3531 O O   . LYS B 1 150 ? 46.396 27.601 8.099  1.00   25.10 ? 149  LYS B O   1 
ATOM   3532 C CB  . LYS B 1 150 ? 48.581 27.202 10.552 1.00   24.26 ? 149  LYS B CB  1 
ATOM   3533 C CG  . LYS B 1 150 ? 49.206 26.453 9.408  1.00   26.95 ? 149  LYS B CG  1 
ATOM   3534 C CD  . LYS B 1 150 ? 50.485 25.757 9.874  1.00   30.15 ? 149  LYS B CD  1 
ATOM   3535 C CE  . LYS B 1 150 ? 51.246 25.150 8.724  1.00   32.94 ? 149  LYS B CE  1 
ATOM   3536 N NZ  . LYS B 1 150 ? 50.603 23.893 8.289  1.00   33.69 ? 149  LYS B NZ  1 
ATOM   3537 N N   . TYR B 1 151 ? 45.521 26.814 10.026 1.00   24.34 ? 150  TYR B N   1 
ATOM   3538 C CA  . TYR B 1 151 ? 44.500 25.968 9.398  1.00   24.84 ? 150  TYR B CA  1 
ATOM   3539 C C   . TYR B 1 151 ? 43.111 26.589 9.235  1.00   24.44 ? 150  TYR B C   1 
ATOM   3540 O O   . TYR B 1 151 ? 42.297 26.061 8.495  1.00   25.37 ? 150  TYR B O   1 
ATOM   3541 C CB  . TYR B 1 151 ? 44.307 24.703 10.237 1.00   25.13 ? 150  TYR B CB  1 
ATOM   3542 C CG  . TYR B 1 151 ? 45.452 23.742 10.170 1.00   29.26 ? 150  TYR B CG  1 
ATOM   3543 C CD1 . TYR B 1 151 ? 46.684 24.058 10.724 1.00   31.24 ? 150  TYR B CD1 1 
ATOM   3544 C CD2 . TYR B 1 151 ? 45.301 22.508 9.560  1.00   32.86 ? 150  TYR B CD2 1 
ATOM   3545 C CE1 . TYR B 1 151 ? 47.738 23.193 10.650 1.00   33.59 ? 150  TYR B CE1 1 
ATOM   3546 C CE2 . TYR B 1 151 ? 46.355 21.619 9.488  1.00   34.71 ? 150  TYR B CE2 1 
ATOM   3547 C CZ  . TYR B 1 151 ? 47.568 21.966 10.034 1.00   35.35 ? 150  TYR B CZ  1 
ATOM   3548 O OH  . TYR B 1 151 ? 48.616 21.085 9.962  1.00   37.78 ? 150  TYR B OH  1 
ATOM   3549 N N   . GLY B 1 152 ? 42.842 27.689 9.923  1.00   23.49 ? 151  GLY B N   1 
ATOM   3550 C CA  . GLY B 1 152 ? 41.500 28.243 9.959  1.00   23.62 ? 151  GLY B CA  1 
ATOM   3551 C C   . GLY B 1 152 ? 40.630 27.409 10.882 1.00   23.05 ? 151  GLY B C   1 
ATOM   3552 O O   . GLY B 1 152 ? 41.137 26.659 11.730 1.00   21.47 ? 151  GLY B O   1 
ATOM   3553 N N   . ASP B 1 153 ? 39.317 27.513 10.712 1.00   23.69 ? 152  ASP B N   1 
ATOM   3554 C CA  . ASP B 1 153 ? 38.379 26.837 11.613 1.00   23.91 ? 152  ASP B CA  1 
ATOM   3555 C C   . ASP B 1 153 ? 38.520 25.322 11.661 1.00   24.60 ? 152  ASP B C   1 
ATOM   3556 O O   . ASP B 1 153 ? 38.710 24.687 10.640 1.00   23.76 ? 152  ASP B O   1 
ATOM   3557 C CB  . ASP B 1 153 ? 36.933 27.149 11.217 1.00   24.45 ? 152  ASP B CB  1 
ATOM   3558 C CG  . ASP B 1 153 ? 36.483 28.537 11.627 1.00   24.20 ? 152  ASP B CG  1 
ATOM   3559 O OD1 . ASP B 1 153 ? 37.192 29.247 12.358 1.00   25.51 ? 152  ASP B OD1 1 
ATOM   3560 O OD2 . ASP B 1 153 ? 35.383 29.011 11.274 1.00   26.94 ? 152  ASP B OD2 1 
ATOM   3561 N N   . TYR B 1 154 ? 38.414 24.764 12.865 1.00   24.96 ? 153  TYR B N   1 
ATOM   3562 C CA  . TYR B 1 154 ? 38.378 23.321 13.073 1.00   25.93 ? 153  TYR B CA  1 
ATOM   3563 C C   . TYR B 1 154 ? 37.157 22.772 12.340 1.00   27.34 ? 153  TYR B C   1 
ATOM   3564 O O   . TYR B 1 154 ? 36.071 23.349 12.424 1.00   26.52 ? 153  TYR B O   1 
ATOM   3565 C CB  . TYR B 1 154 ? 38.194 23.010 14.546 1.00   25.41 ? 153  TYR B CB  1 
ATOM   3566 C CG  . TYR B 1 154 ? 38.031 21.538 14.879 1.00   26.19 ? 153  TYR B CG  1 
ATOM   3567 C CD1 . TYR B 1 154 ? 38.957 20.596 14.441 1.00   28.74 ? 153  TYR B CD1 1 
ATOM   3568 C CD2 . TYR B 1 154 ? 36.979 21.095 15.651 1.00   28.78 ? 153  TYR B CD2 1 
ATOM   3569 C CE1 . TYR B 1 154 ? 38.826 19.249 14.760 1.00   28.87 ? 153  TYR B CE1 1 
ATOM   3570 C CE2 . TYR B 1 154 ? 36.845 19.746 15.972 1.00   29.48 ? 153  TYR B CE2 1 
ATOM   3571 C CZ  . TYR B 1 154 ? 37.777 18.837 15.522 1.00   29.37 ? 153  TYR B CZ  1 
ATOM   3572 O OH  . TYR B 1 154 ? 37.637 17.498 15.840 1.00   32.09 ? 153  TYR B OH  1 
ATOM   3573 N N   . ASP B 1 155 ? 37.345 21.652 11.662 1.00   29.57 ? 154  ASP B N   1 
ATOM   3574 C CA  . ASP B 1 155 ? 36.279 20.975 10.922 1.00   32.47 ? 154  ASP B CA  1 
ATOM   3575 C C   . ASP B 1 155 ? 36.553 19.481 11.053 1.00   33.68 ? 154  ASP B C   1 
ATOM   3576 O O   . ASP B 1 155 ? 37.430 18.963 10.379 1.00   34.14 ? 154  ASP B O   1 
ATOM   3577 C CB  . ASP B 1 155 ? 36.314 21.382 9.454  1.00   32.78 ? 154  ASP B CB  1 
ATOM   3578 C CG  . ASP B 1 155 ? 35.195 20.742 8.638  1.00   34.50 ? 154  ASP B CG  1 
ATOM   3579 O OD1 . ASP B 1 155 ? 34.721 19.641 9.007  1.00   37.57 ? 154  ASP B OD1 1 
ATOM   3580 O OD2 . ASP B 1 155 ? 34.725 21.286 7.619  1.00   37.55 ? 154  ASP B OD2 1 
ATOM   3581 N N   . PRO B 1 156 ? 35.829 18.792 11.921 1.00   36.17 ? 155  PRO B N   1 
ATOM   3582 C CA  . PRO B 1 156 ? 36.064 17.363 12.143 1.00   38.00 ? 155  PRO B CA  1 
ATOM   3583 C C   . PRO B 1 156 ? 35.937 16.496 10.880 1.00   39.58 ? 155  PRO B C   1 
ATOM   3584 O O   . PRO B 1 156 ? 36.396 15.351 10.914 1.00   40.23 ? 155  PRO B O   1 
ATOM   3585 C CB  . PRO B 1 156 ? 34.982 16.997 13.160 1.00   38.07 ? 155  PRO B CB  1 
ATOM   3586 C CG  . PRO B 1 156 ? 33.942 18.042 12.984 1.00   37.48 ? 155  PRO B CG  1 
ATOM   3587 C CD  . PRO B 1 156 ? 34.716 19.285 12.754 1.00   36.51 ? 155  PRO B CD  1 
ATOM   3588 N N   . SER B 1 157 ? 35.338 17.018 9.810  1.00   41.28 ? 156  SER B N   1 
ATOM   3589 C CA  . SER B 1 157 ? 35.201 16.272 8.556  1.00   42.47 ? 156  SER B CA  1 
ATOM   3590 C C   . SER B 1 157 ? 36.484 16.321 7.738  1.00   42.95 ? 156  SER B C   1 
ATOM   3591 O O   . SER B 1 157 ? 36.743 15.420 6.930  1.00   43.13 ? 156  SER B O   1 
ATOM   3592 C CB  . SER B 1 157 ? 34.053 16.832 7.711  1.00   42.70 ? 156  SER B CB  1 
ATOM   3593 O OG  . SER B 1 157 ? 34.427 18.059 7.110  1.00   43.13 ? 156  SER B OG  1 
ATOM   3594 N N   . VAL B 1 158 ? 37.282 17.370 7.941  1.00   43.49 ? 157  VAL B N   1 
ATOM   3595 C CA  . VAL B 1 158 ? 38.559 17.525 7.232  1.00   43.86 ? 157  VAL B CA  1 
ATOM   3596 C C   . VAL B 1 158 ? 39.735 17.219 8.168  1.00   43.89 ? 157  VAL B C   1 
ATOM   3597 O O   . VAL B 1 158 ? 40.691 16.545 7.785  1.00   43.63 ? 157  VAL B O   1 
ATOM   3598 C CB  . VAL B 1 158 ? 38.739 18.953 6.668  1.00   44.24 ? 157  VAL B CB  1 
ATOM   3599 C CG1 . VAL B 1 158 ? 40.050 19.065 5.888  1.00   44.70 ? 157  VAL B CG1 1 
ATOM   3600 C CG2 . VAL B 1 158 ? 37.550 19.352 5.788  1.00   44.74 ? 157  VAL B CG2 1 
ATOM   3601 N N   . HIS B 1 159 ? 39.643 17.717 9.399  1.00   43.84 ? 158  HIS B N   1 
ATOM   3602 C CA  . HIS B 1 159 ? 40.676 17.522 10.407 1.00   43.44 ? 158  HIS B CA  1 
ATOM   3603 C C   . HIS B 1 159 ? 40.389 16.283 11.256 1.00   43.78 ? 158  HIS B C   1 
ATOM   3604 O O   . HIS B 1 159 ? 39.926 16.386 12.387 1.00   43.86 ? 158  HIS B O   1 
ATOM   3605 C CB  . HIS B 1 159 ? 40.763 18.772 11.282 1.00   43.28 ? 158  HIS B CB  1 
ATOM   3606 C CG  . HIS B 1 159 ? 40.991 20.030 10.502 1.00   41.66 ? 158  HIS B CG  1 
ATOM   3607 N ND1 . HIS B 1 159 ? 40.132 21.105 10.554 1.00   39.86 ? 158  HIS B ND1 1 
ATOM   3608 C CD2 . HIS B 1 159 ? 41.969 20.372 9.630  1.00   40.26 ? 158  HIS B CD2 1 
ATOM   3609 C CE1 . HIS B 1 159 ? 40.577 22.061 9.757  1.00   38.61 ? 158  HIS B CE1 1 
ATOM   3610 N NE2 . HIS B 1 159 ? 41.689 21.641 9.183  1.00   39.62 ? 158  HIS B NE2 1 
ATOM   3611 N N   . LYS B 1 160 ? 40.680 15.107 10.705 1.00   43.94 ? 159  LYS B N   1 
ATOM   3612 C CA  . LYS B 1 160 ? 40.447 13.854 11.420 1.00   44.10 ? 159  LYS B CA  1 
ATOM   3613 C C   . LYS B 1 160 ? 41.636 13.513 12.328 1.00   43.45 ? 159  LYS B C   1 
ATOM   3614 O O   . LYS B 1 160 ? 42.717 14.092 12.199 1.00   43.30 ? 159  LYS B O   1 
ATOM   3615 C CB  . LYS B 1 160 ? 40.192 12.715 10.421 1.00   44.57 ? 159  LYS B CB  1 
ATOM   3616 C CG  . LYS B 1 160 ? 39.789 11.371 11.050 1.00   45.97 ? 159  LYS B CG  1 
ATOM   3617 C CD  . LYS B 1 160 ? 38.547 11.483 11.947 1.00   47.74 ? 159  LYS B CD  1 
ATOM   3618 C CE  . LYS B 1 160 ? 38.168 10.135 12.554 1.00   48.63 ? 159  LYS B CE  1 
ATOM   3619 N NZ  . LYS B 1 160 ? 37.030 10.240 13.516 1.00   48.94 ? 159  LYS B NZ  1 
ATOM   3620 N N   . ARG B 1 161 ? 41.415 12.589 13.257 1.00   42.90 ? 160  ARG B N   1 
ATOM   3621 C CA  . ARG B 1 161 ? 42.459 12.137 14.164 1.00   42.44 ? 160  ARG B CA  1 
ATOM   3622 C C   . ARG B 1 161 ? 43.773 11.971 13.407 1.00   40.98 ? 160  ARG B C   1 
ATOM   3623 O O   . ARG B 1 161 ? 43.835 11.259 12.397 1.00   40.84 ? 160  ARG B O   1 
ATOM   3624 C CB  . ARG B 1 161 ? 42.063 10.811 14.819 1.00   42.96 ? 160  ARG B CB  1 
ATOM   3625 C CG  . ARG B 1 161 ? 43.068 10.299 15.853 1.00   45.38 ? 160  ARG B CG  1 
ATOM   3626 C CD  . ARG B 1 161 ? 42.932 8.812  16.189 1.00   48.33 ? 160  ARG B CD  1 
ATOM   3627 N NE  . ARG B 1 161 ? 41.601 8.458  16.689 1.00   51.15 ? 160  ARG B NE  1 
ATOM   3628 C CZ  . ARG B 1 161 ? 41.277 8.337  17.978 1.00   53.35 ? 160  ARG B CZ  1 
ATOM   3629 N NH1 . ARG B 1 161 ? 42.185 8.541  18.931 1.00   53.18 ? 160  ARG B NH1 1 
ATOM   3630 N NH2 . ARG B 1 161 ? 40.032 8.011  18.319 1.00   54.27 ? 160  ARG B NH2 1 
ATOM   3631 N N   . GLY B 1 162 ? 44.811 12.647 13.892 1.00   39.17 ? 161  GLY B N   1 
ATOM   3632 C CA  . GLY B 1 162 ? 46.140 12.547 13.320 1.00   37.90 ? 161  GLY B CA  1 
ATOM   3633 C C   . GLY B 1 162 ? 46.510 13.702 12.409 1.00   36.52 ? 161  GLY B C   1 
ATOM   3634 O O   . GLY B 1 162 ? 47.638 13.750 11.913 1.00   36.06 ? 161  GLY B O   1 
ATOM   3635 N N   . PHE B 1 163 ? 45.593 14.651 12.221 1.00   34.78 ? 162  PHE B N   1 
ATOM   3636 C CA  . PHE B 1 163 ? 45.837 15.768 11.303 1.00   33.73 ? 162  PHE B CA  1 
ATOM   3637 C C   . PHE B 1 163 ? 46.998 16.676 11.720 1.00   32.46 ? 162  PHE B C   1 
ATOM   3638 O O   . PHE B 1 163 ? 47.522 17.421 10.894 1.00   32.03 ? 162  PHE B O   1 
ATOM   3639 C CB  . PHE B 1 163 ? 44.551 16.577 11.046 1.00   33.84 ? 162  PHE B CB  1 
ATOM   3640 C CG  . PHE B 1 163 ? 44.158 17.501 12.161 1.00   33.64 ? 162  PHE B CG  1 
ATOM   3641 C CD1 . PHE B 1 163 ? 43.677 17.008 13.365 1.00   34.30 ? 162  PHE B CD1 1 
ATOM   3642 C CD2 . PHE B 1 163 ? 44.234 18.879 11.987 1.00   34.70 ? 162  PHE B CD2 1 
ATOM   3643 C CE1 . PHE B 1 163 ? 43.292 17.872 14.382 1.00   34.07 ? 162  PHE B CE1 1 
ATOM   3644 C CE2 . PHE B 1 163 ? 43.858 19.742 13.003 1.00   33.78 ? 162  PHE B CE2 1 
ATOM   3645 C CZ  . PHE B 1 163 ? 43.390 19.232 14.202 1.00   34.09 ? 162  PHE B CZ  1 
ATOM   3646 N N   . LEU B 1 164 ? 47.410 16.611 12.981 1.00   31.86 ? 163  LEU B N   1 
ATOM   3647 C CA  . LEU B 1 164 ? 48.529 17.433 13.450 1.00   31.36 ? 163  LEU B CA  1 
ATOM   3648 C C   . LEU B 1 164 ? 49.841 16.650 13.625 1.00   31.61 ? 163  LEU B C   1 
ATOM   3649 O O   . LEU B 1 164 ? 50.814 17.192 14.123 1.00   30.94 ? 163  LEU B O   1 
ATOM   3650 C CB  . LEU B 1 164 ? 48.165 18.116 14.765 1.00   31.10 ? 163  LEU B CB  1 
ATOM   3651 C CG  . LEU B 1 164 ? 46.977 19.086 14.761 1.00   29.24 ? 163  LEU B CG  1 
ATOM   3652 C CD1 . LEU B 1 164 ? 46.773 19.606 16.170 1.00   28.99 ? 163  LEU B CD1 1 
ATOM   3653 C CD2 . LEU B 1 164 ? 47.170 20.234 13.788 1.00   29.19 ? 163  LEU B CD2 1 
ATOM   3654 N N   . ALA B 1 165 ? 49.874 15.389 13.189 1.00   31.82 ? 164  ALA B N   1 
ATOM   3655 C CA  . ALA B 1 165 ? 51.059 14.524 13.362 1.00   31.88 ? 164  ALA B CA  1 
ATOM   3656 C C   . ALA B 1 165 ? 52.404 15.054 12.827 1.00   31.89 ? 164  ALA B C   1 
ATOM   3657 O O   . ALA B 1 165 ? 53.456 14.602 13.270 1.00   31.61 ? 164  ALA B O   1 
ATOM   3658 C CB  . ALA B 1 165 ? 50.776 13.127 12.772 1.00   32.47 ? 164  ALA B CB  1 
ATOM   3659 N N   . GLN B 1 166 ? 52.394 15.974 11.869 1.00   31.60 ? 165  GLN B N   1 
ATOM   3660 C CA  . GLN B 1 166 ? 53.657 16.496 11.348 1.00   32.19 ? 165  GLN B CA  1 
ATOM   3661 C C   . GLN B 1 166 ? 53.922 17.982 11.660 1.00   31.23 ? 165  GLN B C   1 
ATOM   3662 O O   . GLN B 1 166 ? 54.851 18.595 11.123 1.00   30.92 ? 165  GLN B O   1 
ATOM   3663 C CB  . GLN B 1 166 ? 53.757 16.204 9.850  1.00   33.23 ? 165  GLN B CB  1 
ATOM   3664 C CG  . GLN B 1 166 ? 53.715 14.689 9.563  1.00   35.78 ? 165  GLN B CG  1 
ATOM   3665 C CD  . GLN B 1 166 ? 53.822 14.349 8.093  1.00   39.92 ? 165  GLN B CD  1 
ATOM   3666 O OE1 . GLN B 1 166 ? 54.372 15.129 7.312  1.00   44.01 ? 165  GLN B OE1 1 
ATOM   3667 N NE2 . GLN B 1 166 ? 53.303 13.180 7.709  1.00   40.45 ? 165  GLN B NE2 1 
ATOM   3668 N N   . GLU B 1 167 ? 53.157 18.539 12.586 1.00   29.84 ? 166  GLU B N   1 
ATOM   3669 C CA  . GLU B 1 167 ? 53.312 19.941 12.955 1.00   29.03 ? 166  GLU B CA  1 
ATOM   3670 C C   . GLU B 1 167 ? 54.156 20.094 14.230 1.00   26.93 ? 166  GLU B C   1 
ATOM   3671 O O   . GLU B 1 167 ? 53.990 19.329 15.161 1.00   26.78 ? 166  GLU B O   1 
ATOM   3672 C CB  . GLU B 1 167 ? 51.926 20.548 13.173 1.00   29.27 ? 166  GLU B CB  1 
ATOM   3673 C CG  . GLU B 1 167 ? 51.104 20.710 11.895 1.00   32.45 ? 166  GLU B CG  1 
ATOM   3674 C CD  . GLU B 1 167 ? 51.416 21.983 11.116 1.00   34.34 ? 166  GLU B CD  1 
ATOM   3675 O OE1 . GLU B 1 167 ? 52.272 22.778 11.543 1.00   36.92 ? 166  GLU B OE1 1 
ATOM   3676 O OE2 . GLU B 1 167 ? 50.771 22.201 10.067 1.00   38.16 ? 166  GLU B OE2 1 
ATOM   3677 N N   . GLU B 1 168 ? 55.072 21.061 14.269 1.00   24.41 ? 167  GLU B N   1 
ATOM   3678 C CA  . GLU B 1 168 ? 55.808 21.322 15.506 1.00   23.02 ? 167  GLU B CA  1 
ATOM   3679 C C   . GLU B 1 168 ? 54.996 22.363 16.269 1.00   20.73 ? 167  GLU B C   1 
ATOM   3680 O O   . GLU B 1 168 ? 54.978 23.548 15.893 1.00   19.66 ? 167  GLU B O   1 
ATOM   3681 C CB  . GLU B 1 168 ? 57.232 21.835 15.257 1.00   23.27 ? 167  GLU B CB  1 
ATOM   3682 C CG  . GLU B 1 168 ? 58.014 22.067 16.548 1.00   24.55 ? 167  GLU B CG  1 
ATOM   3683 C CD  . GLU B 1 168 ? 59.346 22.782 16.345 1.00   29.28 ? 167  GLU B CD  1 
ATOM   3684 O OE1 . GLU B 1 168 ? 59.714 23.063 15.183 1.00   33.85 ? 167  GLU B OE1 1 
ATOM   3685 O OE2 . GLU B 1 168 ? 60.034 23.057 17.349 1.00   30.44 ? 167  GLU B OE2 1 
ATOM   3686 N N   . LEU B 1 169 ? 54.305 21.914 17.306 1.00   18.76 ? 168  LEU B N   1 
ATOM   3687 C CA  . LEU B 1 169 ? 53.409 22.785 18.057 1.00   17.68 ? 168  LEU B CA  1 
ATOM   3688 C C   . LEU B 1 169 ? 53.769 23.008 19.506 1.00   16.45 ? 168  LEU B C   1 
ATOM   3689 O O   . LEU B 1 169 ? 53.287 23.958 20.075 1.00   15.51 ? 168  LEU B O   1 
ATOM   3690 C CB  . LEU B 1 169 ? 51.969 22.273 17.999 1.00   17.11 ? 168  LEU B CB  1 
ATOM   3691 C CG  . LEU B 1 169 ? 51.377 22.093 16.610 1.00   19.12 ? 168  LEU B CG  1 
ATOM   3692 C CD1 . LEU B 1 169 ? 50.068 21.322 16.707 1.00   20.88 ? 168  LEU B CD1 1 
ATOM   3693 C CD2 . LEU B 1 169 ? 51.199 23.454 15.942 1.00   20.54 ? 168  LEU B CD2 1 
ATOM   3694 N N   . LEU B 1 170 ? 54.617 22.172 20.099 1.00   15.20 ? 169  LEU B N   1 
ATOM   3695 C CA  . LEU B 1 170 ? 54.885 22.262 21.541 1.00   16.25 ? 169  LEU B CA  1 
ATOM   3696 C C   . LEU B 1 170 ? 56.371 22.248 21.832 1.00   16.03 ? 169  LEU B C   1 
ATOM   3697 O O   . LEU B 1 170 ? 57.125 21.648 21.065 1.00   15.48 ? 169  LEU B O   1 
ATOM   3698 C CB  . LEU B 1 170 ? 54.271 21.049 22.262 1.00   16.45 ? 169  LEU B CB  1 
ATOM   3699 C CG  . LEU B 1 170 ? 52.872 21.001 22.891 1.00   20.74 ? 169  LEU B CG  1 
ATOM   3700 C CD1 . LEU B 1 170 ? 51.872 21.962 22.344 1.00   23.14 ? 169  LEU B CD1 1 
ATOM   3701 C CD2 . LEU B 1 170 ? 52.353 19.500 22.736 1.00   19.17 ? 169  LEU B CD2 1 
ATOM   3702 N N   . PRO B 1 171 ? 56.787 22.887 22.925 1.00   16.35 ? 170  PRO B N   1 
ATOM   3703 C CA  . PRO B 1 171 ? 58.181 22.816 23.372 1.00   16.78 ? 170  PRO B CA  1 
ATOM   3704 C C   . PRO B 1 171 ? 58.536 21.363 23.797 1.00   17.34 ? 170  PRO B C   1 
ATOM   3705 O O   . PRO B 1 171 ? 57.728 20.761 24.470 1.00   17.59 ? 170  PRO B O   1 
ATOM   3706 C CB  . PRO B 1 171 ? 58.196 23.702 24.611 1.00   17.68 ? 170  PRO B CB  1 
ATOM   3707 C CG  . PRO B 1 171 ? 56.975 24.581 24.513 1.00   17.20 ? 170  PRO B CG  1 
ATOM   3708 C CD  . PRO B 1 171 ? 55.969 23.750 23.799 1.00   16.15 ? 170  PRO B CD  1 
ATOM   3709 N N   . LYS B 1 172 ? 59.736 20.899 23.490 1.00   18.61 ? 171  LYS B N   1 
ATOM   3710 C CA  . LYS B 1 172 ? 60.121 19.545 23.862 1.00   19.90 ? 171  LYS B CA  1 
ATOM   3711 C C   . LYS B 1 172 ? 60.016 19.325 25.363 1.00   20.07 ? 171  LYS B C   1 
ATOM   3712 O O   . LYS B 1 172 ? 59.612 18.251 25.819 1.00   19.82 ? 171  LYS B O   1 
ATOM   3713 C CB  . LYS B 1 172 ? 61.531 19.240 23.362 1.00   20.67 ? 171  LYS B CB  1 
ATOM   3714 C CG  . LYS B 1 172 ? 61.598 19.142 21.848 1.00   23.01 ? 171  LYS B CG  1 
ATOM   3715 C CD  . LYS B 1 172 ? 62.914 18.569 21.351 1.00   28.00 ? 171  LYS B CD  1 
ATOM   3716 C CE  . LYS B 1 172 ? 62.976 18.615 19.837 1.00   30.70 ? 171  LYS B CE  1 
ATOM   3717 N NZ  . LYS B 1 172 ? 63.281 19.994 19.419 1.00   33.76 ? 171  LYS B NZ  1 
ATOM   3718 N N   . ARG B 1 173 ? 60.366 20.347 26.134 1.00   20.55 ? 172  ARG B N   1 
ATOM   3719 C CA  . ARG B 1 173 ? 60.350 20.258 27.582 1.00   21.56 ? 172  ARG B CA  1 
ATOM   3720 C C   . ARG B 1 173 ? 58.969 19.888 28.090 1.00   20.68 ? 172  ARG B C   1 
ATOM   3721 O O   . ARG B 1 173 ? 58.839 19.223 29.103 1.00   20.31 ? 172  ARG B O   1 
ATOM   3722 C CB  . ARG B 1 173 ? 60.805 21.593 28.201 1.00   22.83 ? 172  ARG B CB  1 
ATOM   3723 C CG  . ARG B 1 173 ? 60.979 21.584 29.693 1.00   27.71 ? 172  ARG B CG  1 
ATOM   3724 C CD  . ARG B 1 173 ? 61.351 22.959 30.273 1.00   33.90 ? 172  ARG B CD  1 
ATOM   3725 N NE  . ARG B 1 173 ? 60.202 23.819 30.107 1.00   39.45 ? 172  ARG B NE  1 
ATOM   3726 C CZ  . ARG B 1 173 ? 59.092 23.699 30.809 1.00   43.41 ? 172  ARG B CZ  1 
ATOM   3727 N NH1 . ARG B 1 173 ? 59.013 22.793 31.778 1.00   45.47 ? 172  ARG B NH1 1 
ATOM   3728 N NH2 . ARG B 1 173 ? 58.063 24.502 30.572 1.00   45.52 ? 172  ARG B NH2 1 
ATOM   3729 N N   . VAL B 1 174 ? 57.931 20.323 27.385 1.00   19.86 ? 173  VAL B N   1 
ATOM   3730 C CA  . VAL B 1 174 ? 56.571 20.059 27.800 1.00   19.89 ? 173  VAL B CA  1 
ATOM   3731 C C   . VAL B 1 174 ? 56.196 18.580 27.633 1.00   20.58 ? 173  VAL B C   1 
ATOM   3732 O O   . VAL B 1 174 ? 55.479 18.024 28.464 1.00   20.00 ? 173  VAL B O   1 
ATOM   3733 C CB  . VAL B 1 174 ? 55.599 20.978 27.034 1.00   20.21 ? 173  VAL B CB  1 
ATOM   3734 C CG1 . VAL B 1 174 ? 54.218 20.430 27.016 1.00   21.23 ? 173  VAL B CG1 1 
ATOM   3735 C CG2 . VAL B 1 174 ? 55.653 22.397 27.640 1.00   19.89 ? 173  VAL B CG2 1 
ATOM   3736 N N   . ILE B 1 175 ? 56.707 17.963 26.581 1.00   21.77 ? 174  ILE B N   1 
ATOM   3737 C CA  . ILE B 1 175 ? 56.502 16.528 26.351 1.00   24.18 ? 174  ILE B CA  1 
ATOM   3738 C C   . ILE B 1 175 ? 57.148 15.724 27.461 1.00   26.36 ? 174  ILE B C   1 
ATOM   3739 O O   . ILE B 1 175 ? 56.657 14.661 27.857 1.00   25.24 ? 174  ILE B O   1 
ATOM   3740 C CB  . ILE B 1 175 ? 57.115 16.104 25.015 1.00   24.33 ? 174  ILE B CB  1 
ATOM   3741 C CG1 . ILE B 1 175 ? 56.459 16.828 23.848 1.00   24.34 ? 174  ILE B CG1 1 
ATOM   3742 C CG2 . ILE B 1 175 ? 56.999 14.583 24.814 1.00   25.54 ? 174  ILE B CG2 1 
ATOM   3743 C CD1 . ILE B 1 175 ? 55.017 17.221 24.067 1.00   23.93 ? 174  ILE B CD1 1 
ATOM   3744 N N   . ASN B 1 176 ? 58.273 16.231 27.942 1.00   29.53 ? 175  ASN B N   1 
ATOM   3745 C CA  . ASN B 1 176 ? 58.993 15.566 29.002 1.00   32.30 ? 175  ASN B CA  1 
ATOM   3746 C C   . ASN B 1 176 ? 58.209 15.600 30.316 1.00   34.01 ? 175  ASN B C   1 
ATOM   3747 O O   . ASN B 1 176 ? 58.303 14.674 31.126 1.00   34.72 ? 175  ASN B O   1 
ATOM   3748 C CB  . ASN B 1 176 ? 60.380 16.193 29.153 1.00   33.09 ? 175  ASN B CB  1 
ATOM   3749 C CG  . ASN B 1 176 ? 61.127 16.346 27.807 1.00   34.99 ? 175  ASN B CG  1 
ATOM   3750 O OD1 . ASN B 1 176 ? 60.998 15.529 26.873 1.00   37.18 ? 175  ASN B OD1 1 
ATOM   3751 N ND2 . ASN B 1 176 ? 61.917 17.406 27.712 1.00   38.69 ? 175  ASN B ND2 1 
ATOM   3752 N N   . LEU B 1 177 ? 57.400 16.640 30.517 1.00   35.58 ? 176  LEU B N   1 
ATOM   3753 C CA  . LEU B 1 177 ? 56.634 16.799 31.748 1.00   36.93 ? 176  LEU B CA  1 
ATOM   3754 C C   . LEU B 1 177 ? 55.334 15.988 31.793 1.00   37.84 ? 176  LEU B C   1 
ATOM   3755 O O   . LEU B 1 177 ? 54.866 15.619 32.874 1.00   38.86 ? 176  LEU B O   1 
ATOM   3756 C CB  . LEU B 1 177 ? 56.272 18.272 31.965 1.00   37.17 ? 176  LEU B CB  1 
ATOM   3757 C CG  . LEU B 1 177 ? 57.368 19.306 32.154 1.00   38.17 ? 176  LEU B CG  1 
ATOM   3758 C CD1 . LEU B 1 177 ? 56.719 20.676 32.085 1.00   38.54 ? 176  LEU B CD1 1 
ATOM   3759 C CD2 . LEU B 1 177 ? 58.123 19.141 33.467 1.00   38.83 ? 176  LEU B CD2 1 
ATOM   3760 N N   . TYR B 1 178 ? 54.723 15.735 30.644 1.00   38.52 ? 177  TYR B N   1 
ATOM   3761 C CA  . TYR B 1 178 ? 53.489 14.956 30.604 1.00   38.73 ? 177  TYR B CA  1 
ATOM   3762 C C   . TYR B 1 178 ? 53.740 13.617 29.947 1.00   39.43 ? 177  TYR B C   1 
ATOM   3763 O O   . TYR B 1 178 ? 54.479 13.521 28.969 1.00   39.71 ? 177  TYR B O   1 
ATOM   3764 C CB  . TYR B 1 178 ? 52.396 15.676 29.822 1.00   38.63 ? 177  TYR B CB  1 
ATOM   3765 C CG  . TYR B 1 178 ? 51.692 16.802 30.545 1.00   37.57 ? 177  TYR B CG  1 
ATOM   3766 C CD1 . TYR B 1 178 ? 51.999 17.123 31.857 1.00   36.23 ? 177  TYR B CD1 1 
ATOM   3767 C CD2 . TYR B 1 178 ? 50.716 17.554 29.893 1.00   35.49 ? 177  TYR B CD2 1 
ATOM   3768 C CE1 . TYR B 1 178 ? 51.348 18.159 32.513 1.00   36.99 ? 177  TYR B CE1 1 
ATOM   3769 C CE2 . TYR B 1 178 ? 50.062 18.583 30.532 1.00   34.77 ? 177  TYR B CE2 1 
ATOM   3770 C CZ  . TYR B 1 178 ? 50.377 18.888 31.844 1.00   35.66 ? 177  TYR B CZ  1 
ATOM   3771 O OH  . TYR B 1 178 ? 49.740 19.921 32.486 1.00   31.22 ? 177  TYR B OH  1 
ATOM   3772 N N   . GLN B 1 179 ? 53.099 12.583 30.467 1.00   40.11 ? 178  GLN B N   1 
ATOM   3773 C CA  . GLN B 1 179 ? 53.282 11.250 29.920 1.00   40.55 ? 178  GLN B CA  1 
ATOM   3774 C C   . GLN B 1 179 ? 52.048 10.864 29.120 1.00   39.87 ? 178  GLN B C   1 
ATOM   3775 O O   . GLN B 1 179 ? 51.288 9.976  29.497 1.00   39.85 ? 178  GLN B O   1 
ATOM   3776 C CB  . GLN B 1 179 ? 53.594 10.238 31.030 1.00   41.11 ? 178  GLN B CB  1 
ATOM   3777 C CG  . GLN B 1 179 ? 55.099 10.108 31.320 1.00   42.80 ? 178  GLN B CG  1 
ATOM   3778 C CD  . GLN B 1 179 ? 55.617 11.166 32.286 1.00   45.12 ? 178  GLN B CD  1 
ATOM   3779 O OE1 . GLN B 1 179 ? 55.217 11.191 33.454 1.00   48.13 ? 178  GLN B OE1 1 
ATOM   3780 N NE2 . GLN B 1 179 ? 56.519 12.027 31.810 1.00   44.28 ? 178  GLN B NE2 1 
ATOM   3781 N N   . MET B 1 180 ? 51.859 11.553 27.998 1.00   39.00 ? 179  MET B N   1 
ATOM   3782 C CA  . MET B 1 180 ? 50.698 11.314 27.158 1.00   37.97 ? 179  MET B CA  1 
ATOM   3783 C C   . MET B 1 180 ? 51.110 10.729 25.822 1.00   36.19 ? 179  MET B C   1 
ATOM   3784 O O   . MET B 1 180 ? 52.216 10.935 25.335 1.00   35.79 ? 179  MET B O   1 
ATOM   3785 C CB  . MET B 1 180 ? 49.892 12.611 26.948 1.00   38.09 ? 179  MET B CB  1 
ATOM   3786 C CG  . MET B 1 180 ? 48.970 12.998 28.106 1.00   39.41 ? 179  MET B CG  1 
ATOM   3787 S SD  . MET B 1 180 ? 47.812 14.372 27.721 1.00   42.71 ? 179  MET B SD  1 
ATOM   3788 C CE  . MET B 1 180 ? 48.938 15.627 27.377 1.00   39.75 ? 179  MET B CE  1 
ATOM   3789 N N   . THR B 1 181 ? 50.178 9.990  25.246 1.00   34.12 ? 180  THR B N   1 
ATOM   3790 C CA  . THR B 1 181 ? 50.326 9.370  23.965 1.00   32.71 ? 180  THR B CA  1 
ATOM   3791 C C   . THR B 1 181 ? 50.140 10.443 22.907 1.00   31.29 ? 180  THR B C   1 
ATOM   3792 O O   . THR B 1 181 ? 49.603 11.516 23.192 1.00   29.44 ? 180  THR B O   1 
ATOM   3793 C CB  . THR B 1 181 ? 49.197 8.403  23.801 1.00   32.85 ? 180  THR B CB  1 
ATOM   3794 O OG1 . THR B 1 181 ? 47.973 9.120  24.002 1.00   31.89 ? 180  THR B OG1 1 
ATOM   3795 C CG2 . THR B 1 181 ? 49.215 7.308  24.893 1.00   33.80 ? 180  THR B CG2 1 
ATOM   3796 N N   . PRO B 1 182 ? 50.584 10.160 21.689 1.00   29.85 ? 181  PRO B N   1 
ATOM   3797 C CA  . PRO B 1 182 ? 50.398 11.080 20.554 1.00   29.16 ? 181  PRO B CA  1 
ATOM   3798 C C   . PRO B 1 182 ? 48.956 11.542 20.383 1.00   28.39 ? 181  PRO B C   1 
ATOM   3799 O O   . PRO B 1 182 ? 48.671 12.722 20.239 1.00   27.85 ? 181  PRO B O   1 
ATOM   3800 C CB  . PRO B 1 182 ? 50.832 10.237 19.356 1.00   29.41 ? 181  PRO B CB  1 
ATOM   3801 C CG  . PRO B 1 182 ? 51.877 9.320  19.933 1.00   30.43 ? 181  PRO B CG  1 
ATOM   3802 C CD  . PRO B 1 182 ? 51.392 8.982  21.315 1.00   30.21 ? 181  PRO B CD  1 
ATOM   3803 N N   . GLU B 1 183 ? 48.042 10.589 20.429 1.00   28.02 ? 182  GLU B N   1 
ATOM   3804 C CA  . GLU B 1 183 ? 46.611 10.874 20.313 1.00   27.81 ? 182  GLU B CA  1 
ATOM   3805 C C   . GLU B 1 183 ? 46.123 11.834 21.405 1.00   26.37 ? 182  GLU B C   1 
ATOM   3806 O O   . GLU B 1 183 ? 45.370 12.763 21.120 1.00   25.71 ? 182  GLU B O   1 
ATOM   3807 C CB  . GLU B 1 183 ? 45.824 9.552  20.362 1.00   28.47 ? 182  GLU B CB  1 
ATOM   3808 C CG  . GLU B 1 183 ? 46.379 8.470  19.435 1.00   31.97 ? 182  GLU B CG  1 
ATOM   3809 C CD  . GLU B 1 183 ? 47.694 7.850  19.910 1.00   34.89 ? 182  GLU B CD  1 
ATOM   3810 O OE1 . GLU B 1 183 ? 47.807 7.462  21.094 1.00   39.45 ? 182  GLU B OE1 1 
ATOM   3811 O OE2 . GLU B 1 183 ? 48.628 7.746  19.094 1.00   39.69 ? 182  GLU B OE2 1 
ATOM   3812 N N   . MET B 1 184 ? 46.564 11.635 22.644 1.00   25.43 ? 183  MET B N   1 
ATOM   3813 C CA  . MET B 1 184 ? 46.132 12.516 23.736 1.00   25.89 ? 183  MET B CA  1 
ATOM   3814 C C   . MET B 1 184 ? 46.701 13.937 23.614 1.00   23.86 ? 183  MET B C   1 
ATOM   3815 O O   . MET B 1 184 ? 46.026 14.893 23.965 1.00   22.95 ? 183  MET B O   1 
ATOM   3816 C CB  . MET B 1 184 ? 46.464 11.913 25.093 1.00   26.47 ? 183  MET B CB  1 
ATOM   3817 C CG  . MET B 1 184 ? 45.749 10.570 25.284 1.00   31.65 ? 183  MET B CG  1 
ATOM   3818 S SD  . MET B 1 184 ? 45.903 9.786  26.866 1.00   42.27 ? 183  MET B SD  1 
ATOM   3819 C CE  . MET B 1 184 ? 47.611 9.520  27.043 1.00   38.73 ? 183  MET B CE  1 
ATOM   3820 N N   . TRP B 1 185 ? 47.937 14.065 23.142 1.00   22.37 ? 184  TRP B N   1 
ATOM   3821 C CA  . TRP B 1 185 ? 48.476 15.426 22.951 1.00   21.70 ? 184  TRP B CA  1 
ATOM   3822 C C   . TRP B 1 185 ? 47.655 16.118 21.877 1.00   20.88 ? 184  TRP B C   1 
ATOM   3823 O O   . TRP B 1 185 ? 47.274 17.289 22.015 1.00   19.01 ? 184  TRP B O   1 
ATOM   3824 C CB  . TRP B 1 185 ? 49.939 15.423 22.521 1.00   21.47 ? 184  TRP B CB  1 
ATOM   3825 C CG  . TRP B 1 185 ? 50.921 15.228 23.628 1.00   22.80 ? 184  TRP B CG  1 
ATOM   3826 C CD1 . TRP B 1 185 ? 51.713 14.135 23.826 1.00   24.85 ? 184  TRP B CD1 1 
ATOM   3827 C CD2 . TRP B 1 185 ? 51.227 16.138 24.684 1.00   22.44 ? 184  TRP B CD2 1 
ATOM   3828 N NE1 . TRP B 1 185 ? 52.499 14.311 24.939 1.00   25.43 ? 184  TRP B NE1 1 
ATOM   3829 C CE2 . TRP B 1 185 ? 52.223 15.539 25.482 1.00   24.12 ? 184  TRP B CE2 1 
ATOM   3830 C CE3 . TRP B 1 185 ? 50.783 17.411 25.025 1.00   21.65 ? 184  TRP B CE3 1 
ATOM   3831 C CZ2 . TRP B 1 185 ? 52.764 16.164 26.598 1.00   23.62 ? 184  TRP B CZ2 1 
ATOM   3832 C CZ3 . TRP B 1 185 ? 51.320 18.025 26.148 1.00   22.74 ? 184  TRP B CZ3 1 
ATOM   3833 C CH2 . TRP B 1 185 ? 52.308 17.405 26.906 1.00   23.32 ? 184  TRP B CH2 1 
ATOM   3834 N N   . GLU B 1 186 ? 47.365 15.396 20.795 1.00   20.37 ? 185  GLU B N   1 
ATOM   3835 C CA  . GLU B 1 186 ? 46.586 15.990 19.729 1.00   20.75 ? 185  GLU B CA  1 
ATOM   3836 C C   . GLU B 1 186 ? 45.201 16.400 20.244 1.00   20.50 ? 185  GLU B C   1 
ATOM   3837 O O   . GLU B 1 186 ? 44.709 17.476 19.910 1.00   20.34 ? 185  GLU B O   1 
ATOM   3838 C CB  . GLU B 1 186 ? 46.452 15.067 18.511 1.00   21.08 ? 185  GLU B CB  1 
ATOM   3839 C CG  . GLU B 1 186 ? 45.867 15.796 17.302 1.00   24.75 ? 185  GLU B CG  1 
ATOM   3840 C CD  . GLU B 1 186 ? 45.742 14.914 16.078 1.00   28.43 ? 185  GLU B CD  1 
ATOM   3841 O OE1 . GLU B 1 186 ? 44.739 14.173 15.997 1.00   34.34 ? 185  GLU B OE1 1 
ATOM   3842 O OE2 . GLU B 1 186 ? 46.639 14.953 15.218 1.00   30.16 ? 185  GLU B OE2 1 
ATOM   3843 N N   . GLU B 1 187 ? 44.586 15.552 21.066 1.00   20.59 ? 186  GLU B N   1 
ATOM   3844 C CA  . GLU B 1 187 ? 43.257 15.823 21.597 1.00   20.85 ? 186  GLU B CA  1 
ATOM   3845 C C   . GLU B 1 187 ? 43.247 17.099 22.459 1.00   20.10 ? 186  GLU B C   1 
ATOM   3846 O O   . GLU B 1 187 ? 42.327 17.911 22.369 1.00   19.00 ? 186  GLU B O   1 
ATOM   3847 C CB  . GLU B 1 187 ? 42.768 14.619 22.413 1.00   22.43 ? 186  GLU B CB  1 
ATOM   3848 C CG  . GLU B 1 187 ? 41.461 14.860 23.149 1.00   26.41 ? 186  GLU B CG  1 
ATOM   3849 C CD  . GLU B 1 187 ? 41.035 13.656 23.964 1.00   33.23 ? 186  GLU B CD  1 
ATOM   3850 O OE1 . GLU B 1 187 ? 40.703 12.629 23.349 1.00   37.37 ? 186  GLU B OE1 1 
ATOM   3851 O OE2 . GLU B 1 187 ? 41.047 13.728 25.214 1.00   35.30 ? 186  GLU B OE2 1 
ATOM   3852 N N   . ARG B 1 188 ? 44.265 17.244 23.304 1.00   19.42 ? 187  ARG B N   1 
ATOM   3853 C CA  . ARG B 1 188 ? 44.399 18.429 24.161 1.00   18.83 ? 187  ARG B CA  1 
ATOM   3854 C C   . ARG B 1 188 ? 44.456 19.719 23.322 1.00   17.42 ? 187  ARG B C   1 
ATOM   3855 O O   . ARG B 1 188 ? 43.764 20.674 23.642 1.00   15.86 ? 187  ARG B O   1 
ATOM   3856 C CB  . ARG B 1 188 ? 45.639 18.286 25.046 1.00   19.30 ? 187  ARG B CB  1 
ATOM   3857 C CG  . ARG B 1 188 ? 45.497 17.200 26.164 1.00   21.69 ? 187  ARG B CG  1 
ATOM   3858 C CD  . ARG B 1 188 ? 44.411 17.491 27.143 1.00   24.29 ? 187  ARG B CD  1 
ATOM   3859 N NE  . ARG B 1 188 ? 44.438 18.905 27.457 1.00   24.98 ? 187  ARG B NE  1 
ATOM   3860 C CZ  . ARG B 1 188 ? 45.248 19.477 28.343 1.00   25.42 ? 187  ARG B CZ  1 
ATOM   3861 N NH1 . ARG B 1 188 ? 46.079 18.766 29.092 1.00   26.58 ? 187  ARG B NH1 1 
ATOM   3862 N NH2 . ARG B 1 188 ? 45.206 20.775 28.483 1.00   24.04 ? 187  ARG B NH2 1 
ATOM   3863 N N   . ILE B 1 189 ? 45.248 19.727 22.246 1.00   16.63 ? 188  ILE B N   1 
ATOM   3864 C CA  . ILE B 1 189 ? 45.324 20.905 21.364 1.00   16.71 ? 188  ILE B CA  1 
ATOM   3865 C C   . ILE B 1 189 ? 43.981 21.132 20.643 1.00   17.44 ? 188  ILE B C   1 
ATOM   3866 O O   . ILE B 1 189 ? 43.428 22.235 20.670 1.00   16.79 ? 188  ILE B O   1 
ATOM   3867 C CB  . ILE B 1 189 ? 46.474 20.768 20.352 1.00   16.51 ? 188  ILE B CB  1 
ATOM   3868 C CG1 . ILE B 1 189 ? 47.806 20.641 21.096 1.00   16.34 ? 188  ILE B CG1 1 
ATOM   3869 C CG2 . ILE B 1 189 ? 46.501 21.964 19.394 1.00   16.87 ? 188  ILE B CG2 1 
ATOM   3870 C CD1 . ILE B 1 189 ? 48.977 20.269 20.228 1.00   18.91 ? 188  ILE B CD1 1 
ATOM   3871 N N   . THR B 1 190 ? 43.427 20.063 20.071 1.00   17.61 ? 189  THR B N   1 
ATOM   3872 C CA  . THR B 1 190 ? 42.153 20.125 19.369 1.00   18.16 ? 189  THR B CA  1 
ATOM   3873 C C   . THR B 1 190 ? 41.014 20.646 20.222 1.00   17.43 ? 189  THR B C   1 
ATOM   3874 O O   . THR B 1 190 ? 40.161 21.389 19.733 1.00   17.89 ? 189  THR B O   1 
ATOM   3875 C CB  . THR B 1 190 ? 41.795 18.742 18.810 1.00   18.50 ? 189  THR B CB  1 
ATOM   3876 O OG1 . THR B 1 190 ? 42.791 18.376 17.858 1.00   20.16 ? 189  THR B OG1 1 
ATOM   3877 C CG2 . THR B 1 190 ? 40.488 18.789 18.012 1.00   20.50 ? 189  THR B CG2 1 
ATOM   3878 N N   . ALA B 1 191 ? 40.986 20.250 21.483 1.00   17.01 ? 190  ALA B N   1 
ATOM   3879 C CA  . ALA B 1 191 ? 39.951 20.694 22.408 1.00   16.43 ? 190  ALA B CA  1 
ATOM   3880 C C   . ALA B 1 191 ? 39.894 22.227 22.459 1.00   15.67 ? 190  ALA B C   1 
ATOM   3881 O O   . ALA B 1 191 ? 38.826 22.822 22.374 1.00   14.41 ? 190  ALA B O   1 
ATOM   3882 C CB  . ALA B 1 191 ? 40.210 20.129 23.789 1.00   16.10 ? 190  ALA B CB  1 
ATOM   3883 N N   . TRP B 1 192 ? 41.049 22.858 22.600 1.00   14.09 ? 191  TRP B N   1 
ATOM   3884 C CA  . TRP B 1 192 ? 41.096 24.295 22.622 1.00   13.88 ? 191  TRP B CA  1 
ATOM   3885 C C   . TRP B 1 192 ? 40.781 24.869 21.232 1.00   14.93 ? 191  TRP B C   1 
ATOM   3886 O O   . TRP B 1 192 ? 40.043 25.845 21.118 1.00   15.53 ? 191  TRP B O   1 
ATOM   3887 C CB  . TRP B 1 192 ? 42.467 24.790 23.087 1.00   13.58 ? 191  TRP B CB  1 
ATOM   3888 C CG  . TRP B 1 192 ? 42.609 25.010 24.571 1.00   13.74 ? 191  TRP B CG  1 
ATOM   3889 C CD1 . TRP B 1 192 ? 43.514 24.411 25.418 1.00   14.06 ? 191  TRP B CD1 1 
ATOM   3890 C CD2 . TRP B 1 192 ? 41.914 25.988 25.367 1.00   13.30 ? 191  TRP B CD2 1 
ATOM   3891 N NE1 . TRP B 1 192 ? 43.362 24.917 26.682 1.00   13.52 ? 191  TRP B NE1 1 
ATOM   3892 C CE2 . TRP B 1 192 ? 42.396 25.891 26.675 1.00   13.63 ? 191  TRP B CE2 1 
ATOM   3893 C CE3 . TRP B 1 192 ? 40.911 26.923 25.098 1.00   12.25 ? 191  TRP B CE3 1 
ATOM   3894 C CZ2 . TRP B 1 192 ? 41.920 26.694 27.718 1.00   14.23 ? 191  TRP B CZ2 1 
ATOM   3895 C CZ3 . TRP B 1 192 ? 40.454 27.741 26.136 1.00   13.68 ? 191  TRP B CZ3 1 
ATOM   3896 C CH2 . TRP B 1 192 ? 40.937 27.603 27.422 1.00   13.96 ? 191  TRP B CH2 1 
ATOM   3897 N N   . TYR B 1 193 ? 41.370 24.261 20.206 1.00   15.24 ? 192  TYR B N   1 
ATOM   3898 C CA  . TYR B 1 193 ? 41.212 24.663 18.810 1.00   16.27 ? 192  TYR B CA  1 
ATOM   3899 C C   . TYR B 1 193 ? 39.739 24.756 18.409 1.00   16.64 ? 192  TYR B C   1 
ATOM   3900 O O   . TYR B 1 193 ? 39.316 25.713 17.740 1.00   16.61 ? 192  TYR B O   1 
ATOM   3901 C CB  . TYR B 1 193 ? 41.987 23.664 17.928 1.00   16.84 ? 192  TYR B CB  1 
ATOM   3902 C CG  . TYR B 1 193 ? 41.868 23.811 16.413 1.00   15.72 ? 192  TYR B CG  1 
ATOM   3903 C CD1 . TYR B 1 193 ? 41.782 25.068 15.801 1.00   16.58 ? 192  TYR B CD1 1 
ATOM   3904 C CD2 . TYR B 1 193 ? 41.876 22.696 15.601 1.00   18.53 ? 192  TYR B CD2 1 
ATOM   3905 C CE1 . TYR B 1 193 ? 41.674 25.181 14.435 1.00   17.14 ? 192  TYR B CE1 1 
ATOM   3906 C CE2 . TYR B 1 193 ? 41.794 22.803 14.220 1.00   18.60 ? 192  TYR B CE2 1 
ATOM   3907 C CZ  . TYR B 1 193 ? 41.681 24.051 13.642 1.00   17.97 ? 192  TYR B CZ  1 
ATOM   3908 O OH  . TYR B 1 193 ? 41.613 24.149 12.277 1.00   21.05 ? 192  TYR B OH  1 
ATOM   3909 N N   . ALA B 1 194 ? 38.969 23.760 18.825 1.00   17.86 ? 193  ALA B N   1 
ATOM   3910 C CA  . ALA B 1 194 ? 37.530 23.715 18.548 1.00   18.13 ? 193  ALA B CA  1 
ATOM   3911 C C   . ALA B 1 194 ? 36.772 24.939 19.096 1.00   18.86 ? 193  ALA B C   1 
ATOM   3912 O O   . ALA B 1 194 ? 35.759 25.353 18.519 1.00   19.92 ? 193  ALA B O   1 
ATOM   3913 C CB  . ALA B 1 194 ? 36.939 22.412 19.091 1.00   18.69 ? 193  ALA B CB  1 
ATOM   3914 N N   . GLU B 1 195 ? 37.277 25.551 20.164 1.00   18.10 ? 194  GLU B N   1 
ATOM   3915 C CA  . GLU B 1 195 ? 36.639 26.710 20.769 1.00   18.51 ? 194  GLU B CA  1 
ATOM   3916 C C   . GLU B 1 195 ? 37.003 28.039 20.113 1.00   18.35 ? 194  GLU B C   1 
ATOM   3917 O O   . GLU B 1 195 ? 36.456 29.076 20.488 1.00   19.95 ? 194  GLU B O   1 
ATOM   3918 C CB  . GLU B 1 195 ? 36.949 26.779 22.271 1.00   18.66 ? 194  GLU B CB  1 
ATOM   3919 C CG  . GLU B 1 195 ? 36.385 25.577 22.992 1.00   19.53 ? 194  GLU B CG  1 
ATOM   3920 C CD  . GLU B 1 195 ? 36.600 25.531 24.493 1.00   16.57 ? 194  GLU B CD  1 
ATOM   3921 O OE1 . GLU B 1 195 ? 36.980 26.542 25.148 1.00   14.15 ? 194  GLU B OE1 1 
ATOM   3922 O OE2 . GLU B 1 195 ? 36.339 24.454 25.031 1.00   16.69 ? 194  GLU B OE2 1 
ATOM   3923 N N   . HIS B 1 196 ? 37.899 28.017 19.131 1.00   18.53 ? 195  HIS B N   1 
ATOM   3924 C CA  . HIS B 1 196 ? 38.307 29.251 18.468 1.00   18.78 ? 195  HIS B CA  1 
ATOM   3925 C C   . HIS B 1 196 ? 37.562 29.437 17.140 1.00   20.06 ? 195  HIS B C   1 
ATOM   3926 O O   . HIS B 1 196 ? 37.884 30.354 16.395 1.00   19.85 ? 195  HIS B O   1 
ATOM   3927 C CB  . HIS B 1 196 ? 39.830 29.287 18.196 1.00   18.63 ? 195  HIS B CB  1 
ATOM   3928 C CG  . HIS B 1 196 ? 40.675 29.011 19.404 1.00   17.87 ? 195  HIS B CG  1 
ATOM   3929 N ND1 . HIS B 1 196 ? 40.273 29.320 20.685 1.00   15.02 ? 195  HIS B ND1 1 
ATOM   3930 C CD2 . HIS B 1 196 ? 41.906 28.453 19.517 1.00   16.60 ? 195  HIS B CD2 1 
ATOM   3931 C CE1 . HIS B 1 196 ? 41.210 28.930 21.537 1.00   16.96 ? 195  HIS B CE1 1 
ATOM   3932 N NE2 . HIS B 1 196 ? 42.215 28.413 20.852 1.00   17.12 ? 195  HIS B NE2 1 
ATOM   3933 N N   . ARG B 1 197 ? 36.577 28.578 16.853 1.00   20.93 ? 196  ARG B N   1 
ATOM   3934 C CA  . ARG B 1 197 ? 35.833 28.657 15.601 1.00   22.31 ? 196  ARG B CA  1 
ATOM   3935 C C   . ARG B 1 197 ? 35.279 30.057 15.405 1.00   21.90 ? 196  ARG B C   1 
ATOM   3936 O O   . ARG B 1 197 ? 34.694 30.630 16.309 1.00   20.77 ? 196  ARG B O   1 
ATOM   3937 C CB  . ARG B 1 197 ? 34.671 27.663 15.575 1.00   23.27 ? 196  ARG B CB  1 
ATOM   3938 C CG  . ARG B 1 197 ? 34.962 26.370 14.864 1.00   27.40 ? 196  ARG B CG  1 
ATOM   3939 C CD  . ARG B 1 197 ? 33.876 25.293 15.000 1.00   32.18 ? 196  ARG B CD  1 
ATOM   3940 N NE  . ARG B 1 197 ? 32.515 25.829 14.953 1.00   37.12 ? 196  ARG B NE  1 
ATOM   3941 C CZ  . ARG B 1 197 ? 31.408 25.103 15.107 1.00   40.41 ? 196  ARG B CZ  1 
ATOM   3942 N NH1 . ARG B 1 197 ? 31.485 23.798 15.334 1.00   43.44 ? 196  ARG B NH1 1 
ATOM   3943 N NH2 . ARG B 1 197 ? 30.214 25.685 15.054 1.00   41.98 ? 196  ARG B NH2 1 
ATOM   3944 N N   . GLY B 1 198 ? 35.486 30.590 14.213 1.00   22.46 ? 197  GLY B N   1 
ATOM   3945 C CA  . GLY B 1 198 ? 35.025 31.909 13.870 1.00   22.93 ? 197  GLY B CA  1 
ATOM   3946 C C   . GLY B 1 198 ? 36.091 32.974 13.959 1.00   23.75 ? 197  GLY B C   1 
ATOM   3947 O O   . GLY B 1 198 ? 35.823 34.134 13.636 1.00   23.56 ? 197  GLY B O   1 
ATOM   3948 N N   . ARG B 1 199 ? 37.288 32.601 14.427 1.00   23.44 ? 198  ARG B N   1 
ATOM   3949 C CA  . ARG B 1 199 ? 38.374 33.560 14.579 1.00   23.53 ? 198  ARG B CA  1 
ATOM   3950 C C   . ARG B 1 199 ? 39.237 33.630 13.333 1.00   22.62 ? 198  ARG B C   1 
ATOM   3951 O O   . ARG B 1 199 ? 39.743 32.619 12.851 1.00   22.57 ? 198  ARG B O   1 
ATOM   3952 C CB  . ARG B 1 199 ? 39.261 33.194 15.773 1.00   23.73 ? 198  ARG B CB  1 
ATOM   3953 C CG  . ARG B 1 199 ? 38.561 33.275 17.101 1.00   27.84 ? 198  ARG B CG  1 
ATOM   3954 C CD  . ARG B 1 199 ? 39.293 34.151 18.104 1.00   34.45 ? 198  ARG B CD  1 
ATOM   3955 N NE  . ARG B 1 199 ? 38.949 35.554 17.963 1.00   38.29 ? 198  ARG B NE  1 
ATOM   3956 C CZ  . ARG B 1 199 ? 38.135 36.203 18.774 1.00   43.17 ? 198  ARG B CZ  1 
ATOM   3957 N NH1 . ARG B 1 199 ? 37.557 35.578 19.791 1.00   44.60 ? 198  ARG B NH1 1 
ATOM   3958 N NH2 . ARG B 1 199 ? 37.886 37.487 18.564 1.00   44.72 ? 198  ARG B NH2 1 
ATOM   3959 N N   . ALA B 1 200 ? 39.432 34.837 12.813 1.00   22.57 ? 199  ALA B N   1 
ATOM   3960 C CA  . ALA B 1 200 ? 40.256 34.995 11.636 1.00   22.67 ? 199  ALA B CA  1 
ATOM   3961 C C   . ALA B 1 200 ? 41.724 34.728 11.973 1.00   22.84 ? 199  ALA B C   1 
ATOM   3962 O O   . ALA B 1 200 ? 42.125 34.806 13.133 1.00   22.29 ? 199  ALA B O   1 
ATOM   3963 C CB  . ALA B 1 200 ? 40.094 36.380 11.061 1.00   23.12 ? 199  ALA B CB  1 
ATOM   3964 N N   . ARG B 1 201 ? 42.515 34.435 10.954 1.00   23.61 ? 200  ARG B N   1 
ATOM   3965 C CA  . ARG B 1 201 ? 43.935 34.177 11.154 1.00   24.30 ? 200  ARG B CA  1 
ATOM   3966 C C   . ARG B 1 201 ? 44.629 35.240 11.981 1.00   23.78 ? 200  ARG B C   1 
ATOM   3967 O O   . ARG B 1 201 ? 45.348 34.916 12.930 1.00   23.38 ? 200  ARG B O   1 
ATOM   3968 C CB  . ARG B 1 201 ? 44.699 34.064 9.843  1.00   25.46 ? 200  ARG B CB  1 
ATOM   3969 C CG  . ARG B 1 201 ? 46.214 34.062 10.085 1.00   28.69 ? 200  ARG B CG  1 
ATOM   3970 C CD  . ARG B 1 201 ? 47.062 34.009 8.845  1.00   34.55 ? 200  ARG B CD  1 
ATOM   3971 N NE  . ARG B 1 201 ? 46.868 35.209 8.034  1.00   38.60 ? 200  ARG B NE  1 
ATOM   3972 C CZ  . ARG B 1 201 ? 46.283 35.221 6.842  1.00   43.22 ? 200  ARG B CZ  1 
ATOM   3973 N NH1 . ARG B 1 201 ? 45.829 34.092 6.296  1.00   44.99 ? 200  ARG B NH1 1 
ATOM   3974 N NH2 . ARG B 1 201 ? 46.156 36.366 6.185  1.00   44.87 ? 200  ARG B NH2 1 
ATOM   3975 N N   . ASP B 1 202 ? 44.456 36.503 11.611 1.00   22.88 ? 201  ASP B N   1 
ATOM   3976 C CA  . ASP B 1 202 ? 45.154 37.575 12.296 1.00   23.01 ? 201  ASP B CA  1 
ATOM   3977 C C   . ASP B 1 202 ? 44.721 37.708 13.742 1.00   22.18 ? 201  ASP B C   1 
ATOM   3978 O O   . ASP B 1 202 ? 45.514 38.063 14.627 1.00   21.72 ? 201  ASP B O   1 
ATOM   3979 C CB  . ASP B 1 202 ? 45.020 38.908 11.551 1.00   24.36 ? 201  ASP B CB  1 
ATOM   3980 C CG  . ASP B 1 202 ? 43.606 39.444 11.533 1.00   26.38 ? 201  ASP B CG  1 
ATOM   3981 O OD1 . ASP B 1 202 ? 42.664 38.674 11.308 1.00   28.43 ? 201  ASP B OD1 1 
ATOM   3982 O OD2 . ASP B 1 202 ? 43.356 40.651 11.689 1.00   33.29 ? 201  ASP B OD2 1 
ATOM   3983 N N   . GLU B 1 203 ? 43.461 37.402 13.995 1.00   20.18 ? 202  GLU B N   1 
ATOM   3984 C CA  . GLU B 1 203 ? 42.953 37.430 15.350 1.00   20.18 ? 202  GLU B CA  1 
ATOM   3985 C C   . GLU B 1 203 ? 43.611 36.362 16.197 1.00   17.90 ? 202  GLU B C   1 
ATOM   3986 O O   . GLU B 1 203 ? 43.904 36.594 17.368 1.00   18.00 ? 202  GLU B O   1 
ATOM   3987 C CB  . GLU B 1 203 ? 41.451 37.158 15.355 1.00   20.66 ? 202  GLU B CB  1 
ATOM   3988 C CG  . GLU B 1 203 ? 40.603 38.227 14.703 1.00   25.66 ? 202  GLU B CG  1 
ATOM   3989 C CD  . GLU B 1 203 ? 39.117 37.974 14.939 1.00   28.64 ? 202  GLU B CD  1 
ATOM   3990 O OE1 . GLU B 1 203 ? 38.514 37.136 14.230 1.00   30.67 ? 202  GLU B OE1 1 
ATOM   3991 O OE2 . GLU B 1 203 ? 38.557 38.602 15.862 1.00   34.25 ? 202  GLU B OE2 1 
ATOM   3992 N N   . ALA B 1 204 ? 43.772 35.186 15.620 1.00   16.62 ? 203  ALA B N   1 
ATOM   3993 C CA  . ALA B 1 204 ? 44.377 34.059 16.339 1.00   16.38 ? 203  ALA B CA  1 
ATOM   3994 C C   . ALA B 1 204 ? 45.815 34.387 16.737 1.00   16.09 ? 203  ALA B C   1 
ATOM   3995 O O   . ALA B 1 204 ? 46.239 34.093 17.837 1.00   14.43 ? 203  ALA B O   1 
ATOM   3996 C CB  . ALA B 1 204 ? 44.362 32.836 15.493 1.00   17.29 ? 203  ALA B CB  1 
ATOM   3997 N N   . GLU B 1 205 ? 46.542 35.025 15.829 1.00   16.10 ? 204  GLU B N   1 
ATOM   3998 C CA  . GLU B 1 205 ? 47.941 35.391 16.106 1.00   16.60 ? 204  GLU B CA  1 
ATOM   3999 C C   . GLU B 1 205 ? 47.998 36.417 17.241 1.00   16.65 ? 204  GLU B C   1 
ATOM   4000 O O   . GLU B 1 205 ? 48.889 36.379 18.080 1.00   16.25 ? 204  GLU B O   1 
ATOM   4001 C CB  . GLU B 1 205 ? 48.616 35.859 14.814 1.00   16.75 ? 204  GLU B CB  1 
ATOM   4002 C CG  . GLU B 1 205 ? 48.909 34.713 13.868 1.00   18.51 ? 204  GLU B CG  1 
ATOM   4003 C CD  . GLU B 1 205 ? 49.561 35.102 12.559 1.00   21.01 ? 204  GLU B CD  1 
ATOM   4004 O OE1 . GLU B 1 205 ? 49.997 36.245 12.407 1.00   24.19 ? 204  GLU B OE1 1 
ATOM   4005 O OE2 . GLU B 1 205 ? 49.624 34.245 11.672 1.00   22.65 ? 204  GLU B OE2 1 
ATOM   4006 N N   . MET B 1 206 ? 47.039 37.345 17.286 1.00   16.49 ? 205  MET B N   1 
ATOM   4007 C CA  . MET B 1 206 ? 46.989 38.300 18.372 1.00   16.57 ? 205  MET B CA  1 
ATOM   4008 C C   . MET B 1 206 ? 46.641 37.629 19.710 1.00   16.41 ? 205  MET B C   1 
ATOM   4009 O O   . MET B 1 206 ? 47.247 37.930 20.744 1.00   16.40 ? 205  MET B O   1 
ATOM   4010 C CB  . MET B 1 206 ? 46.042 39.473 18.077 1.00   17.62 ? 205  MET B CB  1 
ATOM   4011 C CG  . MET B 1 206 ? 45.936 40.457 19.243 1.00   19.72 ? 205  MET B CG  1 
ATOM   4012 S SD  . MET B 1 206 ? 47.442 41.291 19.770 1.00   26.64 ? 205  MET B SD  1 
ATOM   4013 C CE  . MET B 1 206 ? 48.108 41.730 18.230 1.00   27.15 ? 205  MET B CE  1 
ATOM   4014 N N   . GLU B 1 207 ? 45.695 36.702 19.688 1.00   16.37 ? 206  GLU B N   1 
ATOM   4015 C CA  . GLU B 1 207 ? 45.340 35.956 20.892 1.00   15.78 ? 206  GLU B CA  1 
ATOM   4016 C C   . GLU B 1 207 ? 46.574 35.208 21.414 1.00   14.89 ? 206  GLU B C   1 
ATOM   4017 O O   . GLU B 1 207 ? 46.800 35.146 22.623 1.00   14.79 ? 206  GLU B O   1 
ATOM   4018 C CB  . GLU B 1 207 ? 44.188 35.007 20.615 1.00   16.87 ? 206  GLU B CB  1 
ATOM   4019 C CG  . GLU B 1 207 ? 42.859 35.685 20.340 1.00   19.73 ? 206  GLU B CG  1 
ATOM   4020 C CD  . GLU B 1 207 ? 42.417 36.617 21.454 1.00   23.09 ? 206  GLU B CD  1 
ATOM   4021 O OE1 . GLU B 1 207 ? 42.683 36.332 22.638 1.00   22.46 ? 206  GLU B OE1 1 
ATOM   4022 O OE2 . GLU B 1 207 ? 41.804 37.672 21.133 1.00   29.22 ? 206  GLU B OE2 1 
ATOM   4023 N N   . TYR B 1 208 ? 47.374 34.678 20.499 1.00   14.03 ? 207  TYR B N   1 
ATOM   4024 C CA  . TYR B 1 208 ? 48.618 33.999 20.855 1.00   14.19 ? 207  TYR B CA  1 
ATOM   4025 C C   . TYR B 1 208 ? 49.510 34.981 21.618 1.00   14.61 ? 207  TYR B C   1 
ATOM   4026 O O   . TYR B 1 208 ? 50.010 34.654 22.694 1.00   13.17 ? 207  TYR B O   1 
ATOM   4027 C CB  . TYR B 1 208 ? 49.323 33.447 19.583 1.00   14.13 ? 207  TYR B CB  1 
ATOM   4028 C CG  . TYR B 1 208 ? 50.550 32.608 19.864 1.00   14.89 ? 207  TYR B CG  1 
ATOM   4029 C CD1 . TYR B 1 208 ? 51.726 33.192 20.276 1.00   14.37 ? 207  TYR B CD1 1 
ATOM   4030 C CD2 . TYR B 1 208 ? 50.526 31.218 19.732 1.00   12.78 ? 207  TYR B CD2 1 
ATOM   4031 C CE1 . TYR B 1 208 ? 52.846 32.439 20.534 1.00   14.85 ? 207  TYR B CE1 1 
ATOM   4032 C CE2 . TYR B 1 208 ? 51.649 30.460 19.983 1.00   15.34 ? 207  TYR B CE2 1 
ATOM   4033 C CZ  . TYR B 1 208 ? 52.808 31.077 20.400 1.00   14.29 ? 207  TYR B CZ  1 
ATOM   4034 O OH  . TYR B 1 208 ? 53.951 30.354 20.691 1.00   14.46 ? 207  TYR B OH  1 
ATOM   4035 N N   . LEU B 1 209 ? 49.711 36.189 21.068 1.00   13.60 ? 208  LEU B N   1 
ATOM   4036 C CA  . LEU B 1 209 ? 50.556 37.189 21.709 1.00   14.28 ? 208  LEU B CA  1 
ATOM   4037 C C   . LEU B 1 209 ? 50.030 37.594 23.079 1.00   13.89 ? 208  LEU B C   1 
ATOM   4038 O O   . LEU B 1 209 ? 50.803 37.811 24.013 1.00   14.22 ? 208  LEU B O   1 
ATOM   4039 C CB  . LEU B 1 209 ? 50.739 38.405 20.784 1.00   14.84 ? 208  LEU B CB  1 
ATOM   4040 C CG  . LEU B 1 209 ? 51.617 38.157 19.566 1.00   16.00 ? 208  LEU B CG  1 
ATOM   4041 C CD1 . LEU B 1 209 ? 51.564 39.362 18.620 1.00   17.50 ? 208  LEU B CD1 1 
ATOM   4042 C CD2 . LEU B 1 209 ? 53.076 37.850 19.881 1.00   19.02 ? 208  LEU B CD2 1 
ATOM   4043 N N   . LYS B 1 210 ? 48.713 37.688 23.196 1.00   14.42 ? 209  LYS B N   1 
ATOM   4044 C CA  . LYS B 1 210 ? 48.082 38.075 24.450 1.00   15.87 ? 209  LYS B CA  1 
ATOM   4045 C C   . LYS B 1 210 ? 48.422 37.107 25.573 1.00   15.67 ? 209  LYS B C   1 
ATOM   4046 O O   . LYS B 1 210 ? 48.658 37.506 26.712 1.00   17.82 ? 209  LYS B O   1 
ATOM   4047 C CB  . LYS B 1 210 ? 46.568 38.192 24.248 1.00   16.34 ? 209  LYS B CB  1 
ATOM   4048 C CG  . LYS B 1 210 ? 46.178 39.453 23.493 1.00   18.83 ? 209  LYS B CG  1 
ATOM   4049 C CD  . LYS B 1 210 ? 44.744 39.405 23.013 1.00   19.06 ? 209  LYS B CD  1 
ATOM   4050 C CE  . LYS B 1 210 ? 43.770 39.506 24.168 1.00   21.98 ? 209  LYS B CE  1 
ATOM   4051 N NZ  . LYS B 1 210 ? 42.362 39.500 23.696 1.00   21.25 ? 209  LYS B NZ  1 
ATOM   4052 N N   . ILE B 1 211 ? 48.479 35.824 25.250 1.00   16.05 ? 210  ILE B N   1 
ATOM   4053 C CA  . ILE B 1 211 ? 48.863 34.815 26.229 1.00   16.10 ? 210  ILE B CA  1 
ATOM   4054 C C   . ILE B 1 211 ? 50.390 34.828 26.482 1.00   15.53 ? 210  ILE B C   1 
ATOM   4055 O O   . ILE B 1 211 ? 50.845 34.832 27.623 1.00   16.78 ? 210  ILE B O   1 
ATOM   4056 C CB  . ILE B 1 211 ? 48.430 33.458 25.720 1.00   16.19 ? 210  ILE B CB  1 
ATOM   4057 C CG1 . ILE B 1 211 ? 46.904 33.384 25.689 1.00   17.92 ? 210  ILE B CG1 1 
ATOM   4058 C CG2 . ILE B 1 211 ? 48.983 32.344 26.586 1.00   16.13 ? 210  ILE B CG2 1 
ATOM   4059 C CD1 . ILE B 1 211 ? 46.390 32.384 24.705 1.00   20.45 ? 210  ILE B CD1 1 
ATOM   4060 N N   . ALA B 1 212 ? 51.164 34.814 25.403 1.00   15.44 ? 211  ALA B N   1 
ATOM   4061 C CA  . ALA B 1 212 ? 52.625 34.777 25.484 1.00   14.93 ? 211  ALA B CA  1 
ATOM   4062 C C   . ALA B 1 212 ? 53.227 35.957 26.251 1.00   14.94 ? 211  ALA B C   1 
ATOM   4063 O O   . ALA B 1 212 ? 54.180 35.779 27.012 1.00   14.48 ? 211  ALA B O   1 
ATOM   4064 C CB  . ALA B 1 212 ? 53.218 34.716 24.098 1.00   15.19 ? 211  ALA B CB  1 
ATOM   4065 N N   . GLN B 1 213 ? 52.654 37.146 26.088 1.00   14.94 ? 212  GLN B N   1 
ATOM   4066 C CA  . GLN B 1 213 ? 53.242 38.325 26.699 1.00   15.25 ? 212  GLN B CA  1 
ATOM   4067 C C   . GLN B 1 213 ? 53.117 38.312 28.221 1.00   16.61 ? 212  GLN B C   1 
ATOM   4068 O O   . GLN B 1 213 ? 53.786 39.073 28.891 1.00   17.46 ? 212  GLN B O   1 
ATOM   4069 C CB  . GLN B 1 213 ? 52.632 39.616 26.120 1.00   15.28 ? 212  GLN B CB  1 
ATOM   4070 C CG  . GLN B 1 213 ? 51.219 39.886 26.574 1.00   16.15 ? 212  GLN B CG  1 
ATOM   4071 C CD  . GLN B 1 213 ? 50.595 41.128 25.941 1.00   19.26 ? 212  GLN B CD  1 
ATOM   4072 O OE1 . GLN B 1 213 ? 51.246 41.824 25.176 1.00   20.24 ? 212  GLN B OE1 1 
ATOM   4073 N NE2 . GLN B 1 213 ? 49.308 41.358 26.211 1.00   20.32 ? 212  GLN B NE2 1 
ATOM   4074 N N   . ASP B 1 214 ? 52.281 37.445 28.766 1.00   16.62 ? 213  ASP B N   1 
ATOM   4075 C CA  . ASP B 1 214 ? 52.146 37.359 30.204 1.00   17.89 ? 213  ASP B CA  1 
ATOM   4076 C C   . ASP B 1 214 ? 53.172 36.407 30.802 1.00   17.31 ? 213  ASP B C   1 
ATOM   4077 O O   . ASP B 1 214 ? 53.348 36.377 32.026 1.00   17.60 ? 213  ASP B O   1 
ATOM   4078 C CB  . ASP B 1 214 ? 50.759 36.861 30.589 1.00   18.85 ? 213  ASP B CB  1 
ATOM   4079 C CG  . ASP B 1 214 ? 49.661 37.894 30.383 1.00   22.14 ? 213  ASP B CG  1 
ATOM   4080 O OD1 . ASP B 1 214 ? 49.914 39.122 30.313 1.00   25.64 ? 213  ASP B OD1 1 
ATOM   4081 O OD2 . ASP B 1 214 ? 48.480 37.520 30.331 1.00   26.42 ? 213  ASP B OD2 1 
ATOM   4082 N N   . LEU B 1 215 ? 53.840 35.620 29.975 1.00   16.54 ? 214  LEU B N   1 
ATOM   4083 C CA  . LEU B 1 215 ? 54.892 34.731 30.493 1.00   17.63 ? 214  LEU B CA  1 
ATOM   4084 C C   . LEU B 1 215 ? 56.027 35.555 31.099 1.00   17.13 ? 214  LEU B C   1 
ATOM   4085 O O   . LEU B 1 215 ? 56.462 36.558 30.538 1.00   16.66 ? 214  LEU B O   1 
ATOM   4086 C CB  . LEU B 1 215 ? 55.430 33.826 29.399 1.00   17.26 ? 214  LEU B CB  1 
ATOM   4087 C CG  . LEU B 1 215 ? 54.379 32.886 28.772 1.00   18.33 ? 214  LEU B CG  1 
ATOM   4088 C CD1 . LEU B 1 215 ? 54.946 32.234 27.533 1.00   18.73 ? 214  LEU B CD1 1 
ATOM   4089 C CD2 . LEU B 1 215 ? 53.903 31.813 29.764 1.00   19.46 ? 214  LEU B CD2 1 
ATOM   4090 N N   . GLU B 1 216 ? 56.525 35.110 32.239 1.00   17.50 ? 215  GLU B N   1 
ATOM   4091 C CA  . GLU B 1 216 ? 57.539 35.832 32.983 1.00   18.19 ? 215  GLU B CA  1 
ATOM   4092 C C   . GLU B 1 216 ? 58.816 36.166 32.203 1.00   17.77 ? 215  GLU B C   1 
ATOM   4093 O O   . GLU B 1 216 ? 59.386 37.208 32.447 1.00   18.17 ? 215  GLU B O   1 
ATOM   4094 C CB  . GLU B 1 216 ? 57.890 35.046 34.251 1.00   19.85 ? 215  GLU B CB  1 
ATOM   4095 C CG  . GLU B 1 216 ? 56.750 35.002 35.267 1.00   22.59 ? 215  GLU B CG  1 
ATOM   4096 C CD  . GLU B 1 216 ? 56.733 33.741 36.129 1.00   29.06 ? 215  GLU B CD  1 
ATOM   4097 O OE1 . GLU B 1 216 ? 56.560 32.610 35.594 1.00   31.86 ? 215  GLU B OE1 1 
ATOM   4098 O OE2 . GLU B 1 216 ? 56.851 33.873 37.371 1.00   34.30 ? 215  GLU B OE2 1 
ATOM   4099 N N   . MET B 1 217 ? 59.249 35.305 31.280 1.00   16.17 ? 216  MET B N   1 
ATOM   4100 C CA  . MET B 1 217 ? 60.483 35.545 30.526 1.00   15.17 ? 216  MET B CA  1 
ATOM   4101 C C   . MET B 1 217 ? 60.255 36.292 29.211 1.00   15.54 ? 216  MET B C   1 
ATOM   4102 O O   . MET B 1 217 ? 61.216 36.618 28.529 1.00   14.45 ? 216  MET B O   1 
ATOM   4103 C CB  . MET B 1 217 ? 61.218 34.232 30.224 1.00   14.83 ? 216  MET B CB  1 
ATOM   4104 C CG  . MET B 1 217 ? 61.727 33.512 31.465 1.00   15.14 ? 216  MET B CG  1 
ATOM   4105 S SD  . MET B 1 217 ? 62.597 31.979 31.178 1.00   17.25 ? 216  MET B SD  1 
ATOM   4106 C CE  . MET B 1 217 ? 64.085 32.618 30.472 1.00   17.15 ? 216  MET B CE  1 
ATOM   4107 N N   . TYR B 1 218 ? 58.998 36.544 28.861 1.00   15.23 ? 217  TYR B N   1 
ATOM   4108 C CA  . TYR B 1 218 ? 58.668 37.188 27.592 1.00   15.39 ? 217  TYR B CA  1 
ATOM   4109 C C   . TYR B 1 218 ? 59.314 38.571 27.486 1.00   16.06 ? 217  TYR B C   1 
ATOM   4110 O O   . TYR B 1 218 ? 59.219 39.381 28.399 1.00   17.46 ? 217  TYR B O   1 
ATOM   4111 C CB  . TYR B 1 218 ? 57.157 37.279 27.399 1.00   16.22 ? 217  TYR B CB  1 
ATOM   4112 C CG  . TYR B 1 218 ? 56.700 38.126 26.221 1.00   15.95 ? 217  TYR B CG  1 
ATOM   4113 C CD1 . TYR B 1 218 ? 56.584 39.493 26.338 1.00   16.26 ? 217  TYR B CD1 1 
ATOM   4114 C CD2 . TYR B 1 218 ? 56.408 37.550 25.001 1.00   15.41 ? 217  TYR B CD2 1 
ATOM   4115 C CE1 . TYR B 1 218 ? 56.149 40.265 25.283 1.00   15.62 ? 217  TYR B CE1 1 
ATOM   4116 C CE2 . TYR B 1 218 ? 55.966 38.311 23.941 1.00   17.47 ? 217  TYR B CE2 1 
ATOM   4117 C CZ  . TYR B 1 218 ? 55.854 39.695 24.093 1.00   16.62 ? 217  TYR B CZ  1 
ATOM   4118 O OH  . TYR B 1 218 ? 55.432 40.469 23.038 1.00   17.83 ? 217  TYR B OH  1 
ATOM   4119 N N   . GLY B 1 219 ? 60.019 38.791 26.398 1.00   15.61 ? 218  GLY B N   1 
ATOM   4120 C CA  . GLY B 1 219 ? 60.613 40.090 26.118 1.00   16.10 ? 218  GLY B CA  1 
ATOM   4121 C C   . GLY B 1 219 ? 61.787 40.500 26.998 1.00   16.16 ? 218  GLY B C   1 
ATOM   4122 O O   . GLY B 1 219 ? 62.200 41.657 26.982 1.00   16.33 ? 218  GLY B O   1 
ATOM   4123 N N   . VAL B 1 220 ? 62.338 39.575 27.774 1.00   15.69 ? 219  VAL B N   1 
ATOM   4124 C CA  . VAL B 1 220 ? 63.470 39.916 28.622 1.00   16.51 ? 219  VAL B CA  1 
ATOM   4125 C C   . VAL B 1 220 ? 64.789 39.503 27.990 1.00   16.31 ? 219  VAL B C   1 
ATOM   4126 O O   . VAL B 1 220 ? 64.948 38.356 27.564 1.00   17.58 ? 219  VAL B O   1 
ATOM   4127 C CB  . VAL B 1 220 ? 63.359 39.255 30.014 1.00   15.96 ? 219  VAL B CB  1 
ATOM   4128 C CG1 . VAL B 1 220 ? 64.537 39.675 30.909 1.00   15.99 ? 219  VAL B CG1 1 
ATOM   4129 C CG2 . VAL B 1 220 ? 62.015 39.585 30.669 1.00   16.84 ? 219  VAL B CG2 1 
ATOM   4130 N N   . ASN B 1 221 ? 65.730 40.456 27.917 1.00   17.39 ? 220  ASN B N   1 
ATOM   4131 C CA  . ASN B 1 221 ? 67.103 40.207 27.471 1.00   17.42 ? 220  ASN B CA  1 
ATOM   4132 C C   . ASN B 1 221 ? 67.966 39.960 28.731 1.00   16.70 ? 220  ASN B C   1 
ATOM   4133 O O   . ASN B 1 221 ? 68.076 40.851 29.577 1.00   17.21 ? 220  ASN B O   1 
ATOM   4134 C CB  . ASN B 1 221 ? 67.649 41.430 26.709 1.00   17.34 ? 220  ASN B CB  1 
ATOM   4135 C CG  . ASN B 1 221 ? 66.747 41.902 25.562 1.00   19.90 ? 220  ASN B CG  1 
ATOM   4136 O OD1 . ASN B 1 221 ? 66.794 41.340 24.477 1.00   18.37 ? 220  ASN B OD1 1 
ATOM   4137 N ND2 . ASN B 1 221 ? 65.931 42.959 25.805 1.00   21.71 ? 220  ASN B ND2 1 
ATOM   4138 N N   . TYR B 1 222 ? 68.524 38.761 28.902 1.00   16.63 ? 221  TYR B N   1 
ATOM   4139 C CA  . TYR B 1 222 ? 69.340 38.450 30.078 1.00   16.58 ? 221  TYR B CA  1 
ATOM   4140 C C   . TYR B 1 222 ? 70.846 38.528 29.823 1.00   17.12 ? 221  TYR B C   1 
ATOM   4141 O O   . TYR B 1 222 ? 71.327 38.089 28.768 1.00   17.99 ? 221  TYR B O   1 
ATOM   4142 C CB  . TYR B 1 222 ? 69.041 37.029 30.575 1.00   16.74 ? 221  TYR B CB  1 
ATOM   4143 C CG  . TYR B 1 222 ? 67.623 36.795 31.019 1.00   15.12 ? 221  TYR B CG  1 
ATOM   4144 C CD1 . TYR B 1 222 ? 66.640 36.388 30.124 1.00   16.15 ? 221  TYR B CD1 1 
ATOM   4145 C CD2 . TYR B 1 222 ? 67.269 36.945 32.349 1.00   15.31 ? 221  TYR B CD2 1 
ATOM   4146 C CE1 . TYR B 1 222 ? 65.340 36.158 30.548 1.00   14.83 ? 221  TYR B CE1 1 
ATOM   4147 C CE2 . TYR B 1 222 ? 65.975 36.717 32.779 1.00   16.08 ? 221  TYR B CE2 1 
ATOM   4148 C CZ  . TYR B 1 222 ? 65.020 36.304 31.887 1.00   15.38 ? 221  TYR B CZ  1 
ATOM   4149 O OH  . TYR B 1 222 ? 63.723 36.096 32.335 1.00   14.93 ? 221  TYR B OH  1 
ATOM   4150 N N   . PHE B 1 223 ? 71.569 39.051 30.813 1.00   17.98 ? 222  PHE B N   1 
ATOM   4151 C CA  . PHE B 1 223 ? 73.030 39.191 30.759 1.00   18.71 ? 222  PHE B CA  1 
ATOM   4152 C C   . PHE B 1 223 ? 73.692 38.784 32.079 1.00   19.00 ? 222  PHE B C   1 
ATOM   4153 O O   . PHE B 1 223 ? 73.218 39.140 33.142 1.00   19.26 ? 222  PHE B O   1 
ATOM   4154 C CB  . PHE B 1 223 ? 73.401 40.632 30.429 1.00   18.84 ? 222  PHE B CB  1 
ATOM   4155 C CG  . PHE B 1 223 ? 72.788 41.114 29.167 1.00   18.08 ? 222  PHE B CG  1 
ATOM   4156 C CD1 . PHE B 1 223 ? 73.409 40.893 27.963 1.00   18.46 ? 222  PHE B CD1 1 
ATOM   4157 C CD2 . PHE B 1 223 ? 71.552 41.744 29.178 1.00   17.74 ? 222  PHE B CD2 1 
ATOM   4158 C CE1 . PHE B 1 223 ? 72.817 41.299 26.790 1.00   18.26 ? 222  PHE B CE1 1 
ATOM   4159 C CE2 . PHE B 1 223 ? 70.964 42.148 28.016 1.00   17.52 ? 222  PHE B CE2 1 
ATOM   4160 C CZ  . PHE B 1 223 ? 71.590 41.939 26.827 1.00   16.96 ? 222  PHE B CZ  1 
ATOM   4161 N N   . ALA B 1 224 ? 74.800 38.054 31.998 1.00   20.69 ? 223  ALA B N   1 
ATOM   4162 C CA  . ALA B 1 224 ? 75.528 37.640 33.195 1.00   20.93 ? 223  ALA B CA  1 
ATOM   4163 C C   . ALA B 1 224 ? 76.323 38.835 33.701 1.00   20.89 ? 223  ALA B C   1 
ATOM   4164 O O   . ALA B 1 224 ? 77.019 39.502 32.932 1.00   20.94 ? 223  ALA B O   1 
ATOM   4165 C CB  . ALA B 1 224 ? 76.451 36.478 32.882 1.00   21.64 ? 223  ALA B CB  1 
ATOM   4166 N N   . ILE B 1 225 ? 76.157 39.145 34.979 1.00   20.10 ? 224  ILE B N   1 
ATOM   4167 C CA  . ILE B 1 225 ? 76.858 40.257 35.615 1.00   20.43 ? 224  ILE B CA  1 
ATOM   4168 C C   . ILE B 1 225 ? 77.350 39.814 36.986 1.00   20.59 ? 224  ILE B C   1 
ATOM   4169 O O   . ILE B 1 225 ? 77.043 38.717 37.442 1.00   19.92 ? 224  ILE B O   1 
ATOM   4170 C CB  . ILE B 1 225 ? 75.920 41.486 35.809 1.00   19.99 ? 224  ILE B CB  1 
ATOM   4171 C CG1 . ILE B 1 225 ? 74.734 41.144 36.700 1.00   19.62 ? 224  ILE B CG1 1 
ATOM   4172 C CG2 . ILE B 1 225 ? 75.421 42.032 34.449 1.00   20.67 ? 224  ILE B CG2 1 
ATOM   4173 C CD1 . ILE B 1 225 ? 73.916 42.350 37.108 1.00   20.35 ? 224  ILE B CD1 1 
ATOM   4174 N N   . ARG B 1 226 ? 78.099 40.693 37.637 1.00   22.26 ? 225  ARG B N   1 
ATOM   4175 C CA  . ARG B 1 226 ? 78.517 40.494 39.014 1.00   23.80 ? 225  ARG B CA  1 
ATOM   4176 C C   . ARG B 1 226 ? 78.268 41.795 39.751 1.00   23.64 ? 225  ARG B C   1 
ATOM   4177 O O   . ARG B 1 226 ? 78.562 42.858 39.216 1.00   23.39 ? 225  ARG B O   1 
ATOM   4178 C CB  . ARG B 1 226 ? 80.003 40.117 39.107 1.00   24.80 ? 225  ARG B CB  1 
ATOM   4179 C CG  . ARG B 1 226 ? 80.310 38.688 38.688 1.00   28.50 ? 225  ARG B CG  1 
ATOM   4180 C CD  . ARG B 1 226 ? 81.797 38.402 38.431 1.00   33.71 ? 225  ARG B CD  1 
ATOM   4181 N NE  . ARG B 1 226 ? 81.973 37.038 37.932 1.00   38.76 ? 225  ARG B NE  1 
ATOM   4182 C CZ  . ARG B 1 226 ? 83.131 36.494 37.571 1.00   42.86 ? 225  ARG B CZ  1 
ATOM   4183 N NH1 . ARG B 1 226 ? 84.263 37.194 37.639 1.00   44.74 ? 225  ARG B NH1 1 
ATOM   4184 N NH2 . ARG B 1 226 ? 83.155 35.235 37.135 1.00   43.83 ? 225  ARG B NH2 1 
ATOM   4185 N N   . ASN B 1 227 ? 77.719 41.718 40.964 1.00   24.34 ? 226  ASN B N   1 
ATOM   4186 C CA  . ASN B 1 227 ? 77.580 42.919 41.774 1.00   25.11 ? 226  ASN B CA  1 
ATOM   4187 C C   . ASN B 1 227 ? 78.931 43.248 42.412 1.00   26.28 ? 226  ASN B C   1 
ATOM   4188 O O   . ASN B 1 227 ? 79.923 42.536 42.187 1.00   25.47 ? 226  ASN B O   1 
ATOM   4189 C CB  . ASN B 1 227 ? 76.433 42.840 42.784 1.00   25.13 ? 226  ASN B CB  1 
ATOM   4190 C CG  . ASN B 1 227 ? 76.647 41.808 43.873 1.00   24.33 ? 226  ASN B CG  1 
ATOM   4191 O OD1 . ASN B 1 227 ? 77.755 41.345 44.105 1.00   24.59 ? 226  ASN B OD1 1 
ATOM   4192 N ND2 . ASN B 1 227 ? 75.555 41.458 44.568 1.00   23.95 ? 226  ASN B ND2 1 
ATOM   4193 N N   . LYS B 1 228 ? 78.962 44.329 43.179 1.00   27.80 ? 227  LYS B N   1 
ATOM   4194 C CA  . LYS B 1 228 ? 80.193 44.818 43.790 1.00   29.62 ? 227  LYS B CA  1 
ATOM   4195 C C   . LYS B 1 228 ? 80.783 43.854 44.814 1.00   30.14 ? 227  LYS B C   1 
ATOM   4196 O O   . LYS B 1 228 ? 81.973 43.950 45.120 1.00   30.75 ? 227  LYS B O   1 
ATOM   4197 C CB  . LYS B 1 228 ? 79.951 46.187 44.432 1.00   29.89 ? 227  LYS B CB  1 
ATOM   4198 C CG  . LYS B 1 228 ? 79.472 47.256 43.458 1.00   32.00 ? 227  LYS B CG  1 
ATOM   4199 C CD  . LYS B 1 228 ? 80.613 47.921 42.723 1.00   34.50 ? 227  LYS B CD  1 
ATOM   4200 C CE  . LYS B 1 228 ? 81.213 47.055 41.635 1.00   34.73 ? 227  LYS B CE  1 
ATOM   4201 N NZ  . LYS B 1 228 ? 82.268 47.823 40.904 1.00   37.72 ? 227  LYS B NZ  1 
ATOM   4202 N N   . LYS B 1 229 ? 79.969 42.941 45.353 1.00   30.41 ? 228  LYS B N   1 
ATOM   4203 C CA  . LYS B 1 229 ? 80.476 41.918 46.280 1.00   30.81 ? 228  LYS B CA  1 
ATOM   4204 C C   . LYS B 1 229 ? 80.983 40.689 45.525 1.00   30.29 ? 228  LYS B C   1 
ATOM   4205 O O   . LYS B 1 229 ? 81.400 39.705 46.139 1.00   30.24 ? 228  LYS B O   1 
ATOM   4206 C CB  . LYS B 1 229 ? 79.410 41.500 47.299 1.00   31.27 ? 228  LYS B CB  1 
ATOM   4207 C CG  . LYS B 1 229 ? 78.731 42.675 47.997 1.00   33.43 ? 228  LYS B CG  1 
ATOM   4208 C CD  . LYS B 1 229 ? 77.828 42.244 49.140 1.00   36.80 ? 228  LYS B CD  1 
ATOM   4209 C CE  . LYS B 1 229 ? 76.476 41.686 48.671 1.00   37.91 ? 228  LYS B CE  1 
ATOM   4210 N NZ  . LYS B 1 229 ? 75.534 42.658 48.008 1.00   38.74 ? 228  LYS B NZ  1 
ATOM   4211 N N   . GLY B 1 230 ? 80.929 40.738 44.193 1.00   29.20 ? 229  GLY B N   1 
ATOM   4212 C CA  . GLY B 1 230 ? 81.412 39.652 43.354 1.00   28.14 ? 229  GLY B CA  1 
ATOM   4213 C C   . GLY B 1 230 ? 80.406 38.541 43.099 1.00   27.35 ? 229  GLY B C   1 
ATOM   4214 O O   . GLY B 1 230 ? 80.750 37.498 42.532 1.00   27.36 ? 229  GLY B O   1 
ATOM   4215 N N   . THR B 1 231 ? 79.156 38.763 43.499 1.00   26.32 ? 230  THR B N   1 
ATOM   4216 C CA  . THR B 1 231 ? 78.116 37.756 43.344 1.00   25.82 ? 230  THR B CA  1 
ATOM   4217 C C   . THR B 1 231 ? 77.653 37.678 41.901 1.00   24.90 ? 230  THR B C   1 
ATOM   4218 O O   . THR B 1 231 ? 77.404 38.711 41.278 1.00   23.72 ? 230  THR B O   1 
ATOM   4219 C CB  . THR B 1 231 ? 76.926 38.113 44.244 1.00   26.32 ? 230  THR B CB  1 
ATOM   4220 O OG1 . THR B 1 231 ? 77.372 38.225 45.604 1.00   27.95 ? 230  THR B OG1 1 
ATOM   4221 C CG2 . THR B 1 231 ? 75.885 37.005 44.260 1.00   26.04 ? 230  THR B CG2 1 
ATOM   4222 N N   . GLU B 1 232 ? 77.552 36.460 41.381 1.00   23.63 ? 231  GLU B N   1 
ATOM   4223 C CA  . GLU B 1 232 ? 77.050 36.244 40.032 1.00   24.07 ? 231  GLU B CA  1 
ATOM   4224 C C   . GLU B 1 232 ? 75.543 36.442 40.001 1.00   22.30 ? 231  GLU B C   1 
ATOM   4225 O O   . GLU B 1 232 ? 74.806 35.822 40.757 1.00   21.55 ? 231  GLU B O   1 
ATOM   4226 C CB  . GLU B 1 232 ? 77.359 34.841 39.553 1.00   24.93 ? 231  GLU B CB  1 
ATOM   4227 C CG  . GLU B 1 232 ? 78.833 34.555 39.439 1.00   29.64 ? 231  GLU B CG  1 
ATOM   4228 C CD  . GLU B 1 232 ? 79.448 35.100 38.170 1.00   33.74 ? 231  GLU B CD  1 
ATOM   4229 O OE1 . GLU B 1 232 ? 78.749 35.775 37.388 1.00   38.30 ? 231  GLU B OE1 1 
ATOM   4230 O OE2 . GLU B 1 232 ? 80.645 34.836 37.944 1.00   38.72 ? 231  GLU B OE2 1 
ATOM   4231 N N   . LEU B 1 233 ? 75.106 37.311 39.109 1.00   21.39 ? 232  LEU B N   1 
ATOM   4232 C CA  . LEU B 1 233 ? 73.699 37.620 38.956 1.00   20.19 ? 232  LEU B CA  1 
ATOM   4233 C C   . LEU B 1 233 ? 73.352 37.738 37.483 1.00   19.71 ? 232  LEU B C   1 
ATOM   4234 O O   . LEU B 1 233 ? 74.206 37.583 36.613 1.00   19.06 ? 232  LEU B O   1 
ATOM   4235 C CB  . LEU B 1 233 ? 73.379 38.935 39.673 1.00   20.57 ? 232  LEU B CB  1 
ATOM   4236 C CG  . LEU B 1 233 ? 73.610 38.960 41.188 1.00   20.18 ? 232  LEU B CG  1 
ATOM   4237 C CD1 . LEU B 1 233 ? 73.632 40.383 41.709 1.00   22.49 ? 232  LEU B CD1 1 
ATOM   4238 C CD2 . LEU B 1 233 ? 72.584 38.126 41.946 1.00   22.06 ? 232  LEU B CD2 1 
ATOM   4239 N N   . LEU B 1 234 ? 72.075 37.966 37.211 1.00   19.26 ? 233  LEU B N   1 
ATOM   4240 C CA  . LEU B 1 234 ? 71.639 38.254 35.864 1.00   19.16 ? 233  LEU B CA  1 
ATOM   4241 C C   . LEU B 1 234 ? 70.984 39.606 35.819 1.00   18.52 ? 233  LEU B C   1 
ATOM   4242 O O   . LEU B 1 234 ? 70.161 39.955 36.677 1.00   18.86 ? 233  LEU B O   1 
ATOM   4243 C CB  . LEU B 1 234 ? 70.645 37.216 35.354 1.00   19.09 ? 233  LEU B CB  1 
ATOM   4244 C CG  . LEU B 1 234 ? 71.141 35.778 35.170 1.00   20.98 ? 233  LEU B CG  1 
ATOM   4245 C CD1 . LEU B 1 234 ? 69.936 34.885 34.917 1.00   20.48 ? 233  LEU B CD1 1 
ATOM   4246 C CD2 . LEU B 1 234 ? 72.096 35.684 34.033 1.00   22.78 ? 233  LEU B CD2 1 
ATOM   4247 N N   . LEU B 1 235 ? 71.358 40.371 34.808 1.00   17.68 ? 234  LEU B N   1 
ATOM   4248 C CA  . LEU B 1 235 ? 70.687 41.609 34.491 1.00   17.06 ? 234  LEU B CA  1 
ATOM   4249 C C   . LEU B 1 235 ? 69.612 41.285 33.454 1.00   17.10 ? 234  LEU B C   1 
ATOM   4250 O O   . LEU B 1 235 ? 69.886 40.612 32.479 1.00   17.29 ? 234  LEU B O   1 
ATOM   4251 C CB  . LEU B 1 235 ? 71.657 42.624 33.897 1.00   17.44 ? 234  LEU B CB  1 
ATOM   4252 C CG  . LEU B 1 235 ? 70.988 43.917 33.424 1.00   17.78 ? 234  LEU B CG  1 
ATOM   4253 C CD1 . LEU B 1 235 ? 70.596 44.750 34.598 1.00   19.67 ? 234  LEU B CD1 1 
ATOM   4254 C CD2 . LEU B 1 235 ? 71.902 44.719 32.497 1.00   17.17 ? 234  LEU B CD2 1 
ATOM   4255 N N   . GLY B 1 236 ? 68.382 41.724 33.701 1.00   17.41 ? 235  GLY B N   1 
ATOM   4256 C CA  . GLY B 1 236 ? 67.321 41.590 32.725 1.00   17.19 ? 235  GLY B CA  1 
ATOM   4257 C C   . GLY B 1 236 ? 66.947 42.970 32.230 1.00   17.24 ? 235  GLY B C   1 
ATOM   4258 O O   . GLY B 1 236 ? 66.685 43.883 33.025 1.00   16.62 ? 235  GLY B O   1 
ATOM   4259 N N   . VAL B 1 237 ? 66.947 43.146 30.916 1.00   17.23 ? 236  VAL B N   1 
ATOM   4260 C CA  . VAL B 1 237 ? 66.570 44.414 30.343 1.00   17.31 ? 236  VAL B CA  1 
ATOM   4261 C C   . VAL B 1 237 ? 65.287 44.140 29.562 1.00   17.05 ? 236  VAL B C   1 
ATOM   4262 O O   . VAL B 1 237 ? 65.256 43.249 28.687 1.00   16.05 ? 236  VAL B O   1 
ATOM   4263 C CB  . VAL B 1 237 ? 67.640 44.937 29.367 1.00   17.70 ? 236  VAL B CB  1 
ATOM   4264 C CG1 . VAL B 1 237 ? 67.209 46.276 28.795 1.00   17.18 ? 236  VAL B CG1 1 
ATOM   4265 C CG2 . VAL B 1 237 ? 68.989 45.059 30.038 1.00   18.78 ? 236  VAL B CG2 1 
ATOM   4266 N N   . ASP B 1 238 ? 64.236 44.898 29.866 1.00   16.49 ? 237  ASP B N   1 
ATOM   4267 C CA  . ASP B 1 238 ? 62.937 44.691 29.206 1.00   16.76 ? 237  ASP B CA  1 
ATOM   4268 C C   . ASP B 1 238 ? 62.180 45.996 29.065 1.00   15.93 ? 237  ASP B C   1 
ATOM   4269 O O   . ASP B 1 238 ? 62.699 47.071 29.384 1.00   16.11 ? 237  ASP B O   1 
ATOM   4270 C CB  . ASP B 1 238 ? 62.090 43.586 29.868 1.00   16.22 ? 237  ASP B CB  1 
ATOM   4271 C CG  . ASP B 1 238 ? 61.458 43.987 31.171 1.00   17.08 ? 237  ASP B CG  1 
ATOM   4272 O OD1 . ASP B 1 238 ? 61.570 45.141 31.655 1.00   17.16 ? 237  ASP B OD1 1 
ATOM   4273 O OD2 . ASP B 1 238 ? 60.792 43.143 31.816 1.00   20.99 ? 237  ASP B OD2 1 
ATOM   4274 N N   . ALA B 1 239 ? 60.957 45.904 28.578 1.00   16.59 ? 238  ALA B N   1 
ATOM   4275 C CA  . ALA B 1 239 ? 60.209 47.099 28.260 1.00   16.88 ? 238  ALA B CA  1 
ATOM   4276 C C   . ALA B 1 239 ? 59.818 47.891 29.494 1.00   17.77 ? 238  ALA B C   1 
ATOM   4277 O O   . ALA B 1 239 ? 59.500 49.074 29.379 1.00   17.94 ? 238  ALA B O   1 
ATOM   4278 C CB  . ALA B 1 239 ? 58.977 46.733 27.464 1.00   16.59 ? 238  ALA B CB  1 
ATOM   4279 N N   . LEU B 1 240 ? 59.793 47.213 30.650 1.00   18.54 ? 239  LEU B N   1 
ATOM   4280 C CA  . LEU B 1 240 ? 59.425 47.819 31.918 1.00   19.46 ? 239  LEU B CA  1 
ATOM   4281 C C   . LEU B 1 240 ? 60.556 48.463 32.694 1.00   19.46 ? 239  LEU B C   1 
ATOM   4282 O O   . LEU B 1 240 ? 60.304 49.387 33.448 1.00   19.66 ? 239  LEU B O   1 
ATOM   4283 C CB  . LEU B 1 240 ? 58.720 46.800 32.815 1.00   20.12 ? 239  LEU B CB  1 
ATOM   4284 C CG  . LEU B 1 240 ? 57.288 46.478 32.343 1.00   23.80 ? 239  LEU B CG  1 
ATOM   4285 C CD1 . LEU B 1 240 ? 56.582 45.467 33.201 1.00   27.53 ? 239  LEU B CD1 1 
ATOM   4286 C CD2 . LEU B 1 240 ? 56.478 47.770 32.310 1.00   26.48 ? 239  LEU B CD2 1 
ATOM   4287 N N   . GLY B 1 241 ? 61.775 47.949 32.576 1.00   19.25 ? 240  GLY B N   1 
ATOM   4288 C CA  . GLY B 1 241 ? 62.902 48.499 33.298 1.00   18.70 ? 240  GLY B CA  1 
ATOM   4289 C C   . GLY B 1 241 ? 64.114 47.589 33.290 1.00   19.12 ? 240  GLY B C   1 
ATOM   4290 O O   . GLY B 1 241 ? 64.302 46.755 32.383 1.00   18.37 ? 240  GLY B O   1 
ATOM   4291 N N   . LEU B 1 242 ? 64.930 47.752 34.323 1.00   19.37 ? 241  LEU B N   1 
ATOM   4292 C CA  . LEU B 1 242 ? 66.134 46.962 34.523 1.00   18.89 ? 241  LEU B CA  1 
ATOM   4293 C C   . LEU B 1 242 ? 65.851 46.102 35.739 1.00   17.94 ? 241  LEU B C   1 
ATOM   4294 O O   . LEU B 1 242 ? 65.239 46.558 36.684 1.00   18.30 ? 241  LEU B O   1 
ATOM   4295 C CB  . LEU B 1 242 ? 67.331 47.886 34.762 1.00   19.41 ? 241  LEU B CB  1 
ATOM   4296 C CG  . LEU B 1 242 ? 67.903 48.573 33.506 1.00   20.77 ? 241  LEU B CG  1 
ATOM   4297 C CD1 . LEU B 1 242 ? 69.130 49.386 33.869 1.00   21.53 ? 241  LEU B CD1 1 
ATOM   4298 C CD2 . LEU B 1 242 ? 68.265 47.572 32.444 1.00   22.93 ? 241  LEU B CD2 1 
ATOM   4299 N N   . HIS B 1 243 ? 66.284 44.859 35.721 1.00   17.56 ? 242  HIS B N   1 
ATOM   4300 C CA  . HIS B 1 243 ? 65.896 43.948 36.781 1.00   17.73 ? 242  HIS B CA  1 
ATOM   4301 C C   . HIS B 1 243 ? 67.091 43.109 37.178 1.00   17.44 ? 242  HIS B C   1 
ATOM   4302 O O   . HIS B 1 243 ? 67.912 42.769 36.332 1.00   16.88 ? 242  HIS B O   1 
ATOM   4303 C CB  . HIS B 1 243 ? 64.807 43.019 36.265 1.00   17.63 ? 242  HIS B CB  1 
ATOM   4304 C CG  . HIS B 1 243 ? 63.655 43.729 35.624 1.00   19.06 ? 242  HIS B CG  1 
ATOM   4305 N ND1 . HIS B 1 243 ? 62.612 44.247 36.357 1.00   18.05 ? 242  HIS B ND1 1 
ATOM   4306 C CD2 . HIS B 1 243 ? 63.390 44.020 34.327 1.00   16.88 ? 242  HIS B CD2 1 
ATOM   4307 C CE1 . HIS B 1 243 ? 61.748 44.827 35.539 1.00   20.14 ? 242  HIS B CE1 1 
ATOM   4308 N NE2 . HIS B 1 243 ? 62.193 44.700 34.301 1.00   18.66 ? 242  HIS B NE2 1 
ATOM   4309 N N   . ILE B 1 244 ? 67.209 42.817 38.469 1.00   16.60 ? 243  ILE B N   1 
ATOM   4310 C CA  . ILE B 1 244 ? 68.278 41.963 38.938 1.00   17.29 ? 243  ILE B CA  1 
ATOM   4311 C C   . ILE B 1 244 ? 67.737 40.597 39.349 1.00   16.46 ? 243  ILE B C   1 
ATOM   4312 O O   . ILE B 1 244 ? 66.877 40.502 40.235 1.00   16.81 ? 243  ILE B O   1 
ATOM   4313 C CB  . ILE B 1 244 ? 69.021 42.637 40.100 1.00   17.25 ? 243  ILE B CB  1 
ATOM   4314 C CG1 . ILE B 1 244 ? 69.371 44.085 39.723 1.00   18.69 ? 243  ILE B CG1 1 
ATOM   4315 C CG2 . ILE B 1 244 ? 70.251 41.857 40.445 1.00   18.59 ? 243  ILE B CG2 1 
ATOM   4316 C CD1 . ILE B 1 244 ? 70.314 44.222 38.548 1.00   21.40 ? 243  ILE B CD1 1 
ATOM   4317 N N   . TYR B 1 245 ? 68.241 39.541 38.711 1.00   16.38 ? 244  TYR B N   1 
ATOM   4318 C CA  . TYR B 1 245 ? 67.819 38.193 39.031 1.00   16.99 ? 244  TYR B CA  1 
ATOM   4319 C C   . TYR B 1 245 ? 68.919 37.361 39.666 1.00   18.09 ? 244  TYR B C   1 
ATOM   4320 O O   . TYR B 1 245 ? 70.104 37.506 39.324 1.00   18.34 ? 244  TYR B O   1 
ATOM   4321 C CB  . TYR B 1 245 ? 67.444 37.421 37.760 1.00   16.58 ? 244  TYR B CB  1 
ATOM   4322 C CG  . TYR B 1 245 ? 66.305 37.957 36.927 1.00   16.42 ? 244  TYR B CG  1 
ATOM   4323 C CD1 . TYR B 1 245 ? 66.485 39.035 36.068 1.00   16.89 ? 244  TYR B CD1 1 
ATOM   4324 C CD2 . TYR B 1 245 ? 65.060 37.354 36.967 1.00   16.09 ? 244  TYR B CD2 1 
ATOM   4325 C CE1 . TYR B 1 245 ? 65.457 39.500 35.294 1.00   18.03 ? 244  TYR B CE1 1 
ATOM   4326 C CE2 . TYR B 1 245 ? 64.013 37.818 36.182 1.00   17.34 ? 244  TYR B CE2 1 
ATOM   4327 C CZ  . TYR B 1 245 ? 64.221 38.898 35.357 1.00   17.10 ? 244  TYR B CZ  1 
ATOM   4328 O OH  . TYR B 1 245 ? 63.176 39.348 34.598 1.00   18.31 ? 244  TYR B OH  1 
ATOM   4329 N N   . ASP B 1 246 ? 68.530 36.442 40.537 1.00   19.31 ? 245  ASP B N   1 
ATOM   4330 C CA  . ASP B 1 246 ? 69.460 35.389 40.944 1.00   21.40 ? 245  ASP B CA  1 
ATOM   4331 C C   . ASP B 1 246 ? 69.589 34.450 39.735 1.00   21.51 ? 245  ASP B C   1 
ATOM   4332 O O   . ASP B 1 246 ? 68.593 34.165 39.083 1.00   21.39 ? 245  ASP B O   1 
ATOM   4333 C CB  . ASP B 1 246 ? 68.919 34.622 42.137 1.00   22.16 ? 245  ASP B CB  1 
ATOM   4334 C CG  . ASP B 1 246 ? 68.995 35.417 43.427 1.00   24.95 ? 245  ASP B CG  1 
ATOM   4335 O OD1 . ASP B 1 246 ? 69.689 36.453 43.465 1.00   28.05 ? 245  ASP B OD1 1 
ATOM   4336 O OD2 . ASP B 1 246 ? 68.383 35.067 44.461 1.00   29.32 ? 245  ASP B OD2 1 
ATOM   4337 N N   . PRO B 1 247 ? 70.789 33.957 39.429 1.00   22.87 ? 246  PRO B N   1 
ATOM   4338 C CA  . PRO B 1 247 ? 70.999 33.114 38.231 1.00   23.48 ? 246  PRO B CA  1 
ATOM   4339 C C   . PRO B 1 247 ? 70.115 31.887 38.093 1.00   24.25 ? 246  PRO B C   1 
ATOM   4340 O O   . PRO B 1 247 ? 69.834 31.447 36.957 1.00   24.49 ? 246  PRO B O   1 
ATOM   4341 C CB  . PRO B 1 247 ? 72.462 32.669 38.364 1.00   24.36 ? 246  PRO B CB  1 
ATOM   4342 C CG  . PRO B 1 247 ? 73.104 33.719 39.215 1.00   24.42 ? 246  PRO B CG  1 
ATOM   4343 C CD  . PRO B 1 247 ? 72.043 34.186 40.166 1.00   23.22 ? 246  PRO B CD  1 
ATOM   4344 N N   . GLU B 1 248 ? 69.684 31.334 39.220 1.00   24.05 ? 247  GLU B N   1 
ATOM   4345 C CA  . GLU B 1 248 ? 68.884 30.122 39.222 1.00   24.87 ? 247  GLU B CA  1 
ATOM   4346 C C   . GLU B 1 248 ? 67.395 30.402 39.049 1.00   23.87 ? 247  GLU B C   1 
ATOM   4347 O O   . GLU B 1 248 ? 66.570 29.471 38.991 1.00   23.41 ? 247  GLU B O   1 
ATOM   4348 C CB  . GLU B 1 248 ? 69.094 29.387 40.549 1.00   25.84 ? 247  GLU B CB  1 
ATOM   4349 C CG  . GLU B 1 248 ? 70.553 29.115 40.883 1.00   29.12 ? 247  GLU B CG  1 
ATOM   4350 C CD  . GLU B 1 248 ? 71.317 30.326 41.411 1.00   33.10 ? 247  GLU B CD  1 
ATOM   4351 O OE1 . GLU B 1 248 ? 70.709 31.412 41.643 1.00   31.32 ? 247  GLU B OE1 1 
ATOM   4352 O OE2 . GLU B 1 248 ? 72.551 30.186 41.596 1.00   36.58 ? 247  GLU B OE2 1 
ATOM   4353 N N   . ASN B 1 249 ? 67.037 31.680 38.960 1.00   21.93 ? 248  ASN B N   1 
ATOM   4354 C CA  . ASN B 1 249 ? 65.645 32.042 38.874 1.00   21.02 ? 248  ASN B CA  1 
ATOM   4355 C C   . ASN B 1 249 ? 65.425 33.185 37.882 1.00   20.09 ? 248  ASN B C   1 
ATOM   4356 O O   . ASN B 1 249 ? 65.517 34.351 38.231 1.00   19.94 ? 248  ASN B O   1 
ATOM   4357 C CB  . ASN B 1 249 ? 65.118 32.386 40.270 1.00   21.32 ? 248  ASN B CB  1 
ATOM   4358 C CG  . ASN B 1 249 ? 63.646 32.752 40.267 1.00   21.49 ? 248  ASN B CG  1 
ATOM   4359 O OD1 . ASN B 1 249 ? 63.017 32.826 39.221 1.00   23.49 ? 248  ASN B OD1 1 
ATOM   4360 N ND2 . ASN B 1 249 ? 63.090 32.999 41.451 1.00   23.44 ? 248  ASN B ND2 1 
ATOM   4361 N N   . ARG B 1 250 ? 65.154 32.823 36.635 1.00   19.28 ? 249  ARG B N   1 
ATOM   4362 C CA  . ARG B 1 250 ? 64.950 33.800 35.578 1.00   18.99 ? 249  ARG B CA  1 
ATOM   4363 C C   . ARG B 1 250 ? 63.497 34.266 35.522 1.00   18.62 ? 249  ARG B C   1 
ATOM   4364 O O   . ARG B 1 250 ? 63.152 35.105 34.712 1.00   17.00 ? 249  ARG B O   1 
ATOM   4365 C CB  . ARG B 1 250 ? 65.375 33.208 34.224 1.00   19.87 ? 249  ARG B CB  1 
ATOM   4366 C CG  . ARG B 1 250 ? 66.847 32.936 34.132 1.00   19.98 ? 249  ARG B CG  1 
ATOM   4367 C CD  . ARG B 1 250 ? 67.307 32.401 32.796 1.00   22.65 ? 249  ARG B CD  1 
ATOM   4368 N NE  . ARG B 1 250 ? 68.736 32.116 32.839 1.00   24.04 ? 249  ARG B NE  1 
ATOM   4369 C CZ  . ARG B 1 250 ? 69.644 32.679 32.054 1.00   26.75 ? 249  ARG B CZ  1 
ATOM   4370 N NH1 . ARG B 1 250 ? 69.276 33.517 31.097 1.00   26.23 ? 249  ARG B NH1 1 
ATOM   4371 N NH2 . ARG B 1 250 ? 70.928 32.372 32.202 1.00   28.53 ? 249  ARG B NH2 1 
ATOM   4372 N N   . LEU B 1 251 ? 62.647 33.729 36.395 1.00   18.65 ? 250  LEU B N   1 
ATOM   4373 C CA  . LEU B 1 251 ? 61.225 34.079 36.379 1.00   19.44 ? 250  LEU B CA  1 
ATOM   4374 C C   . LEU B 1 251 ? 60.857 35.343 37.142 1.00   19.26 ? 250  LEU B C   1 
ATOM   4375 O O   . LEU B 1 251 ? 60.069 36.176 36.682 1.00   19.51 ? 250  LEU B O   1 
ATOM   4376 C CB  . LEU B 1 251 ? 60.421 32.889 36.939 1.00   19.65 ? 250  LEU B CB  1 
ATOM   4377 C CG  . LEU B 1 251 ? 59.944 31.785 35.985 1.00   22.91 ? 250  LEU B CG  1 
ATOM   4378 C CD1 . LEU B 1 251 ? 60.711 31.609 34.696 1.00   22.94 ? 250  LEU B CD1 1 
ATOM   4379 C CD2 . LEU B 1 251 ? 59.777 30.439 36.721 1.00   23.32 ? 250  LEU B CD2 1 
ATOM   4380 N N   . THR B 1 252 ? 61.429 35.496 38.331 1.00   18.88 ? 251  THR B N   1 
ATOM   4381 C CA  . THR B 1 252 ? 61.081 36.567 39.203 1.00   19.22 ? 251  THR B CA  1 
ATOM   4382 C C   . THR B 1 252 ? 62.343 37.263 39.674 1.00   18.63 ? 251  THR B C   1 
ATOM   4383 O O   . THR B 1 252 ? 63.109 36.688 40.413 1.00   19.57 ? 251  THR B O   1 
ATOM   4384 C CB  . THR B 1 252 ? 60.366 35.994 40.427 1.00   19.47 ? 251  THR B CB  1 
ATOM   4385 O OG1 . THR B 1 252 ? 59.305 35.128 40.007 1.00   22.54 ? 251  THR B OG1 1 
ATOM   4386 C CG2 . THR B 1 252 ? 59.711 37.075 41.180 1.00   20.59 ? 251  THR B CG2 1 
ATOM   4387 N N   . PRO B 1 253 ? 62.535 38.507 39.275 1.00   18.53 ? 252  PRO B N   1 
ATOM   4388 C CA  . PRO B 1 253 ? 63.715 39.264 39.689 1.00   17.79 ? 252  PRO B CA  1 
ATOM   4389 C C   . PRO B 1 253 ? 63.551 39.710 41.117 1.00   17.93 ? 252  PRO B C   1 
ATOM   4390 O O   . PRO B 1 253 ? 62.405 39.930 41.554 1.00   18.40 ? 252  PRO B O   1 
ATOM   4391 C CB  . PRO B 1 253 ? 63.686 40.484 38.763 1.00   18.01 ? 252  PRO B CB  1 
ATOM   4392 C CG  . PRO B 1 253 ? 62.258 40.632 38.345 1.00   18.71 ? 252  PRO B CG  1 
ATOM   4393 C CD  . PRO B 1 253 ? 61.627 39.299 38.434 1.00   18.49 ? 252  PRO B CD  1 
ATOM   4394 N N   . LYS B 1 254 ? 64.666 39.836 41.824 1.00   17.60 ? 253  LYS B N   1 
ATOM   4395 C CA  . LYS B 1 254 ? 64.677 40.276 43.207 1.00   17.69 ? 253  LYS B CA  1 
ATOM   4396 C C   . LYS B 1 254 ? 64.548 41.792 43.316 1.00   17.45 ? 253  LYS B C   1 
ATOM   4397 O O   . LYS B 1 254 ? 64.008 42.294 44.277 1.00   17.36 ? 253  LYS B O   1 
ATOM   4398 C CB  . LYS B 1 254 ? 65.977 39.822 43.898 1.00   16.84 ? 253  LYS B CB  1 
ATOM   4399 C CG  . LYS B 1 254 ? 66.246 38.312 43.815 1.00   18.80 ? 253  LYS B CG  1 
ATOM   4400 C CD  . LYS B 1 254 ? 65.063 37.509 44.301 1.00   19.92 ? 253  LYS B CD  1 
ATOM   4401 C CE  . LYS B 1 254 ? 65.271 36.018 44.143 1.00   23.00 ? 253  LYS B CE  1 
ATOM   4402 N NZ  . LYS B 1 254 ? 64.192 35.227 44.795 1.00   24.95 ? 253  LYS B NZ  1 
ATOM   4403 N N   . ILE B 1 255 ? 65.084 42.514 42.337 1.00   18.13 ? 254  ILE B N   1 
ATOM   4404 C CA  . ILE B 1 255 ? 65.039 43.963 42.326 1.00   18.80 ? 254  ILE B CA  1 
ATOM   4405 C C   . ILE B 1 255 ? 64.646 44.433 40.939 1.00   19.29 ? 254  ILE B C   1 
ATOM   4406 O O   . ILE B 1 255 ? 65.097 43.871 39.936 1.00   18.55 ? 254  ILE B O   1 
ATOM   4407 C CB  . ILE B 1 255 ? 66.420 44.549 42.655 1.00   18.90 ? 254  ILE B CB  1 
ATOM   4408 C CG1 . ILE B 1 255 ? 66.919 44.119 44.041 1.00   19.55 ? 254  ILE B CG1 1 
ATOM   4409 C CG2 . ILE B 1 255 ? 66.391 46.065 42.583 1.00   19.59 ? 254  ILE B CG2 1 
ATOM   4410 C CD1 . ILE B 1 255 ? 68.406 44.419 44.255 1.00   21.33 ? 254  ILE B CD1 1 
ATOM   4411 N N   . SER B 1 256 ? 63.793 45.451 40.887 1.00   19.25 ? 255  SER B N   1 
ATOM   4412 C CA  . SER B 1 256 ? 63.411 46.081 39.625 1.00   20.06 ? 255  SER B CA  1 
ATOM   4413 C C   . SER B 1 256 ? 63.555 47.606 39.680 1.00   20.98 ? 255  SER B C   1 
ATOM   4414 O O   . SER B 1 256 ? 63.263 48.249 40.706 1.00   20.98 ? 255  SER B O   1 
ATOM   4415 C CB  . SER B 1 256 ? 61.974 45.723 39.229 1.00   19.21 ? 255  SER B CB  1 
ATOM   4416 O OG  . SER B 1 256 ? 61.831 44.338 39.008 1.00   19.58 ? 255  SER B OG  1 
ATOM   4417 N N   . PHE B 1 257 ? 64.014 48.166 38.565 1.00   21.47 ? 256  PHE B N   1 
ATOM   4418 C CA  . PHE B 1 257 ? 64.165 49.604 38.401 1.00   22.17 ? 256  PHE B CA  1 
ATOM   4419 C C   . PHE B 1 257 ? 63.342 50.045 37.185 1.00   22.93 ? 256  PHE B C   1 
ATOM   4420 O O   . PHE B 1 257 ? 63.808 49.929 36.052 1.00   22.48 ? 256  PHE B O   1 
ATOM   4421 C CB  . PHE B 1 257 ? 65.615 49.978 38.150 1.00   21.98 ? 256  PHE B CB  1 
ATOM   4422 C CG  . PHE B 1 257 ? 66.546 49.701 39.288 1.00   23.52 ? 256  PHE B CG  1 
ATOM   4423 C CD1 . PHE B 1 257 ? 66.705 50.612 40.308 1.00   23.80 ? 256  PHE B CD1 1 
ATOM   4424 C CD2 . PHE B 1 257 ? 67.321 48.554 39.299 1.00   23.66 ? 256  PHE B CD2 1 
ATOM   4425 C CE1 . PHE B 1 257 ? 67.607 50.367 41.346 1.00   25.14 ? 256  PHE B CE1 1 
ATOM   4426 C CE2 . PHE B 1 257 ? 68.212 48.310 40.331 1.00   26.01 ? 256  PHE B CE2 1 
ATOM   4427 C CZ  . PHE B 1 257 ? 68.355 49.217 41.355 1.00   24.42 ? 256  PHE B CZ  1 
ATOM   4428 N N   . PRO B 1 258 ? 62.130 50.541 37.414 1.00   23.99 ? 257  PRO B N   1 
ATOM   4429 C CA  . PRO B 1 258 ? 61.271 51.042 36.324 1.00   24.26 ? 257  PRO B CA  1 
ATOM   4430 C C   . PRO B 1 258 ? 61.978 52.132 35.529 1.00   23.74 ? 257  PRO B C   1 
ATOM   4431 O O   . PRO B 1 258 ? 62.757 52.903 36.111 1.00   24.09 ? 257  PRO B O   1 
ATOM   4432 C CB  . PRO B 1 258 ? 60.046 51.590 37.066 1.00   24.54 ? 257  PRO B CB  1 
ATOM   4433 C CG  . PRO B 1 258 ? 60.012 50.794 38.336 1.00   25.29 ? 257  PRO B CG  1 
ATOM   4434 C CD  . PRO B 1 258 ? 61.460 50.638 38.719 1.00   24.60 ? 257  PRO B CD  1 
ATOM   4435 N N   . TRP B 1 259 ? 61.752 52.171 34.213 1.00   23.52 ? 258  TRP B N   1 
ATOM   4436 C CA  . TRP B 1 259 ? 62.483 53.076 33.362 1.00   23.31 ? 258  TRP B CA  1 
ATOM   4437 C C   . TRP B 1 259 ? 62.308 54.520 33.805 1.00   24.41 ? 258  TRP B C   1 
ATOM   4438 O O   . TRP B 1 259 ? 63.254 55.287 33.747 1.00   23.52 ? 258  TRP B O   1 
ATOM   4439 C CB  . TRP B 1 259 ? 62.091 52.925 31.892 1.00   23.46 ? 258  TRP B CB  1 
ATOM   4440 C CG  . TRP B 1 259 ? 62.676 51.699 31.278 1.00   20.18 ? 258  TRP B CG  1 
ATOM   4441 C CD1 . TRP B 1 259 ? 62.001 50.658 30.728 1.00   17.76 ? 258  TRP B CD1 1 
ATOM   4442 C CD2 . TRP B 1 259 ? 64.066 51.376 31.185 1.00   20.43 ? 258  TRP B CD2 1 
ATOM   4443 N NE1 . TRP B 1 259 ? 62.882 49.719 30.254 1.00   18.88 ? 258  TRP B NE1 1 
ATOM   4444 C CE2 . TRP B 1 259 ? 64.160 50.121 30.540 1.00   19.72 ? 258  TRP B CE2 1 
ATOM   4445 C CE3 . TRP B 1 259 ? 65.248 52.025 31.571 1.00   19.74 ? 258  TRP B CE3 1 
ATOM   4446 C CZ2 . TRP B 1 259 ? 65.370 49.504 30.291 1.00   21.05 ? 258  TRP B CZ2 1 
ATOM   4447 C CZ3 . TRP B 1 259 ? 66.464 51.408 31.313 1.00   21.56 ? 258  TRP B CZ3 1 
ATOM   4448 C CH2 . TRP B 1 259 ? 66.511 50.156 30.686 1.00   22.87 ? 258  TRP B CH2 1 
ATOM   4449 N N   . ASN B 1 260 ? 61.115 54.880 34.256 1.00   25.96 ? 259  ASN B N   1 
ATOM   4450 C CA  . ASN B 1 260 ? 60.872 56.278 34.643 1.00   27.91 ? 259  ASN B CA  1 
ATOM   4451 C C   . ASN B 1 260 ? 61.360 56.636 36.045 1.00   29.16 ? 259  ASN B C   1 
ATOM   4452 O O   . ASN B 1 260 ? 61.101 57.734 36.538 1.00   29.65 ? 259  ASN B O   1 
ATOM   4453 C CB  . ASN B 1 260 ? 59.406 56.662 34.480 1.00   28.50 ? 259  ASN B CB  1 
ATOM   4454 C CG  . ASN B 1 260 ? 58.483 55.872 35.360 1.00   29.73 ? 259  ASN B CG  1 
ATOM   4455 O OD1 . ASN B 1 260 ? 58.845 54.831 35.908 1.00   30.74 ? 259  ASN B OD1 1 
ATOM   4456 N ND2 . ASN B 1 260 ? 57.247 56.350 35.478 1.00   34.54 ? 259  ASN B ND2 1 
ATOM   4457 N N   . GLU B 1 261 ? 62.076 55.714 36.680 1.00   30.08 ? 260  GLU B N   1 
ATOM   4458 C CA  . GLU B 1 261 ? 62.635 55.957 38.004 1.00   30.80 ? 260  GLU B CA  1 
ATOM   4459 C C   . GLU B 1 261 ? 64.157 55.838 37.976 1.00   31.16 ? 260  GLU B C   1 
ATOM   4460 O O   . GLU B 1 261 ? 64.803 55.782 39.024 1.00   30.32 ? 260  GLU B O   1 
ATOM   4461 C CB  . GLU B 1 261 ? 62.022 55.000 39.016 1.00   31.52 ? 260  GLU B CB  1 
ATOM   4462 C CG  . GLU B 1 261 ? 60.553 55.291 39.261 1.00   33.30 ? 260  GLU B CG  1 
ATOM   4463 C CD  . GLU B 1 261 ? 59.854 54.217 40.058 1.00   36.71 ? 260  GLU B CD  1 
ATOM   4464 O OE1 . GLU B 1 261 ? 60.531 53.498 40.828 1.00   38.55 ? 260  GLU B OE1 1 
ATOM   4465 O OE2 . GLU B 1 261 ? 58.613 54.100 39.920 1.00   40.54 ? 260  GLU B OE2 1 
ATOM   4466 N N   . ILE B 1 262 ? 64.712 55.810 36.766 1.00   31.57 ? 261  ILE B N   1 
ATOM   4467 C CA  . ILE B 1 262 ? 66.149 55.750 36.539 1.00   33.25 ? 261  ILE B CA  1 
ATOM   4468 C C   . ILE B 1 262 ? 66.592 57.050 35.893 1.00   35.23 ? 261  ILE B C   1 
ATOM   4469 O O   . ILE B 1 262 ? 66.102 57.396 34.814 1.00   34.50 ? 261  ILE B O   1 
ATOM   4470 C CB  . ILE B 1 262 ? 66.492 54.610 35.551 1.00   33.28 ? 261  ILE B CB  1 
ATOM   4471 C CG1 . ILE B 1 262 ? 66.204 53.247 36.164 1.00   32.27 ? 261  ILE B CG1 1 
ATOM   4472 C CG2 . ILE B 1 262 ? 67.944 54.714 35.107 1.00   34.65 ? 261  ILE B CG2 1 
ATOM   4473 C CD1 . ILE B 1 262 ? 66.363 52.082 35.172 1.00   30.72 ? 261  ILE B CD1 1 
ATOM   4474 N N   . ARG B 1 263 ? 67.525 57.751 36.534 1.00   37.58 ? 262  ARG B N   1 
ATOM   4475 C CA  . ARG B 1 263 ? 68.011 59.035 36.037 1.00   40.03 ? 262  ARG B CA  1 
ATOM   4476 C C   . ARG B 1 263 ? 69.016 58.875 34.923 1.00   40.83 ? 262  ARG B C   1 
ATOM   4477 O O   . ARG B 1 263 ? 68.963 59.582 33.914 1.00   41.54 ? 262  ARG B O   1 
ATOM   4478 C CB  . ARG B 1 263 ? 68.683 59.832 37.162 1.00   40.68 ? 262  ARG B CB  1 
ATOM   4479 C CG  . ARG B 1 263 ? 69.151 61.222 36.730 1.00   43.23 ? 262  ARG B CG  1 
ATOM   4480 C CD  . ARG B 1 263 ? 69.931 62.002 37.792 1.00   46.75 ? 262  ARG B CD  1 
ATOM   4481 N NE  . ARG B 1 263 ? 71.317 61.544 37.923 1.00   49.88 ? 262  ARG B NE  1 
ATOM   4482 C CZ  . ARG B 1 263 ? 72.313 62.275 38.429 1.00   52.45 ? 262  ARG B CZ  1 
ATOM   4483 N NH1 . ARG B 1 263 ? 72.094 63.511 38.868 1.00   53.53 ? 262  ARG B NH1 1 
ATOM   4484 N NH2 . ARG B 1 263 ? 73.538 61.769 38.497 1.00   53.31 ? 262  ARG B NH2 1 
ATOM   4485 N N   . ASN B 1 264 ? 69.948 57.959 35.124 1.00   41.54 ? 263  ASN B N   1 
ATOM   4486 C CA  . ASN B 1 264 ? 71.026 57.762 34.191 1.00   42.25 ? 263  ASN B CA  1 
ATOM   4487 C C   . ASN B 1 264 ? 71.510 56.319 34.252 1.00   42.00 ? 263  ASN B C   1 
ATOM   4488 O O   . ASN B 1 264 ? 71.423 55.658 35.291 1.00   41.40 ? 263  ASN B O   1 
ATOM   4489 C CB  . ASN B 1 264 ? 72.173 58.713 34.557 1.00   42.85 ? 263  ASN B CB  1 
ATOM   4490 C CG  . ASN B 1 264 ? 72.842 59.336 33.344 1.00   44.59 ? 263  ASN B CG  1 
ATOM   4491 O OD1 . ASN B 1 264 ? 72.996 58.697 32.298 1.00   47.96 ? 263  ASN B OD1 1 
ATOM   4492 N ND2 . ASN B 1 264 ? 73.257 60.596 33.484 1.00   47.43 ? 263  ASN B ND2 1 
ATOM   4493 N N   . ILE B 1 265 ? 72.001 55.835 33.122 1.00   41.82 ? 264  ILE B N   1 
ATOM   4494 C CA  . ILE B 1 265 ? 72.624 54.517 33.047 1.00   41.65 ? 264  ILE B CA  1 
ATOM   4495 C C   . ILE B 1 265 ? 73.916 54.722 32.265 1.00   41.04 ? 264  ILE B C   1 
ATOM   4496 O O   . ILE B 1 265 ? 73.888 55.001 31.061 1.00   40.52 ? 264  ILE B O   1 
ATOM   4497 C CB  . ILE B 1 265 ? 71.693 53.491 32.377 1.00   41.89 ? 264  ILE B CB  1 
ATOM   4498 C CG1 . ILE B 1 265 ? 72.432 52.192 32.087 1.00   42.63 ? 264  ILE B CG1 1 
ATOM   4499 C CG2 . ILE B 1 265 ? 71.133 54.040 31.092 1.00   42.84 ? 264  ILE B CG2 1 
ATOM   4500 C CD1 . ILE B 1 265 ? 72.790 51.409 33.326 1.00   42.73 ? 264  ILE B CD1 1 
ATOM   4501 N N   . SER B 1 266 ? 75.042 54.632 32.965 1.00   40.14 ? 265  SER B N   1 
ATOM   4502 C CA  . SER B 1 266 ? 76.343 54.871 32.358 1.00   39.71 ? 265  SER B CA  1 
ATOM   4503 C C   . SER B 1 266 ? 77.260 53.666 32.463 1.00   39.02 ? 265  SER B C   1 
ATOM   4504 O O   . SER B 1 266 ? 77.058 52.762 33.286 1.00   37.32 ? 265  SER B O   1 
ATOM   4505 C CB  . SER B 1 266 ? 77.015 56.077 33.003 1.00   39.80 ? 265  SER B CB  1 
ATOM   4506 O OG  . SER B 1 266 ? 77.086 55.911 34.406 1.00   41.09 ? 265  SER B OG  1 
ATOM   4507 N N   . TYR B 1 267 ? 78.296 53.702 31.634 1.00   38.27 ? 266  TYR B N   1 
ATOM   4508 C CA  . TYR B 1 267 ? 79.218 52.602 31.489 1.00   38.11 ? 266  TYR B CA  1 
ATOM   4509 C C   . TYR B 1 267 ? 80.653 53.120 31.316 1.00   38.01 ? 266  TYR B C   1 
ATOM   4510 O O   . TYR B 1 267 ? 80.873 54.060 30.569 1.00   37.42 ? 266  TYR B O   1 
ATOM   4511 C CB  . TYR B 1 267 ? 78.805 51.807 30.259 1.00   38.08 ? 266  TYR B CB  1 
ATOM   4512 C CG  . TYR B 1 267 ? 79.796 50.766 29.877 1.00   38.37 ? 266  TYR B CG  1 
ATOM   4513 C CD1 . TYR B 1 267 ? 79.894 49.597 30.604 1.00   39.19 ? 266  TYR B CD1 1 
ATOM   4514 C CD2 . TYR B 1 267 ? 80.654 50.956 28.804 1.00   39.16 ? 266  TYR B CD2 1 
ATOM   4515 C CE1 . TYR B 1 267 ? 80.814 48.632 30.272 1.00   40.72 ? 266  TYR B CE1 1 
ATOM   4516 C CE2 . TYR B 1 267 ? 81.583 50.005 28.459 1.00   39.89 ? 266  TYR B CE2 1 
ATOM   4517 C CZ  . TYR B 1 267 ? 81.663 48.836 29.197 1.00   41.42 ? 266  TYR B CZ  1 
ATOM   4518 O OH  . TYR B 1 267 ? 82.589 47.864 28.874 1.00   42.58 ? 266  TYR B OH  1 
ATOM   4519 N N   . SER B 1 268 ? 81.612 52.501 32.000 1.00   38.33 ? 267  SER B N   1 
ATOM   4520 C CA  . SER B 1 268 ? 83.027 52.868 31.873 1.00   39.04 ? 267  SER B CA  1 
ATOM   4521 C C   . SER B 1 268 ? 83.884 51.665 32.226 1.00   38.97 ? 267  SER B C   1 
ATOM   4522 O O   . SER B 1 268 ? 83.926 51.248 33.374 1.00   39.02 ? 267  SER B O   1 
ATOM   4523 C CB  . SER B 1 268 ? 83.379 54.048 32.787 1.00   39.27 ? 267  SER B CB  1 
ATOM   4524 O OG  . SER B 1 268 ? 83.472 53.630 34.134 1.00   40.79 ? 267  SER B OG  1 
ATOM   4525 N N   . ASP B 1 269 ? 84.542 51.093 31.225 1.00   39.31 ? 268  ASP B N   1 
ATOM   4526 C CA  . ASP B 1 269 ? 85.342 49.903 31.421 1.00   40.10 ? 268  ASP B CA  1 
ATOM   4527 C C   . ASP B 1 269 ? 84.322 48.805 31.738 1.00   39.70 ? 268  ASP B C   1 
ATOM   4528 O O   . ASP B 1 269 ? 83.256 48.800 31.147 1.00   40.91 ? 268  ASP B O   1 
ATOM   4529 C CB  . ASP B 1 269 ? 86.427 50.123 32.490 1.00   40.34 ? 268  ASP B CB  1 
ATOM   4530 C CG  . ASP B 1 269 ? 87.529 51.064 32.002 1.00   42.59 ? 268  ASP B CG  1 
ATOM   4531 O OD1 . ASP B 1 269 ? 87.803 51.070 30.779 1.00   44.31 ? 268  ASP B OD1 1 
ATOM   4532 O OD2 . ASP B 1 269 ? 88.172 51.834 32.749 1.00   45.47 ? 268  ASP B OD2 1 
ATOM   4533 N N   . LYS B 1 270 ? 84.582 47.886 32.645 1.00   39.50 ? 269  LYS B N   1 
ATOM   4534 C CA  . LYS B 1 270 ? 83.595 46.818 32.847 1.00   38.51 ? 269  LYS B CA  1 
ATOM   4535 C C   . LYS B 1 270 ? 82.466 47.168 33.808 1.00   37.33 ? 269  LYS B C   1 
ATOM   4536 O O   . LYS B 1 270 ? 81.757 46.271 34.246 1.00   37.21 ? 269  LYS B O   1 
ATOM   4537 C CB  . LYS B 1 270 ? 84.279 45.562 33.372 1.00   38.85 ? 269  LYS B CB  1 
ATOM   4538 C CG  . LYS B 1 270 ? 84.723 45.656 34.837 1.00   40.62 ? 269  LYS B CG  1 
ATOM   4539 C CD  . LYS B 1 270 ? 85.885 44.712 35.128 1.00   42.17 ? 269  LYS B CD  1 
ATOM   4540 C CE  . LYS B 1 270 ? 86.377 44.843 36.551 1.00   44.31 ? 269  LYS B CE  1 
ATOM   4541 N NZ  . LYS B 1 270 ? 86.981 43.558 37.050 1.00   45.86 ? 269  LYS B NZ  1 
ATOM   4542 N N   . GLU B 1 271 ? 82.274 48.446 34.120 1.00   35.46 ? 270  GLU B N   1 
ATOM   4543 C CA  . GLU B 1 271 ? 81.321 48.812 35.166 1.00   34.13 ? 270  GLU B CA  1 
ATOM   4544 C C   . GLU B 1 271 ? 80.154 49.682 34.713 1.00   32.78 ? 270  GLU B C   1 
ATOM   4545 O O   . GLU B 1 271 ? 80.343 50.721 34.083 1.00   32.33 ? 270  GLU B O   1 
ATOM   4546 C CB  . GLU B 1 271 ? 82.057 49.506 36.322 1.00   34.06 ? 270  GLU B CB  1 
ATOM   4547 C CG  . GLU B 1 271 ? 81.170 49.840 37.518 1.00   34.81 ? 270  GLU B CG  1 
ATOM   4548 C CD  . GLU B 1 271 ? 81.920 50.499 38.661 1.00   36.88 ? 270  GLU B CD  1 
ATOM   4549 O OE1 . GLU B 1 271 ? 82.325 51.663 38.520 1.00   39.14 ? 270  GLU B OE1 1 
ATOM   4550 O OE2 . GLU B 1 271 ? 82.084 49.864 39.717 1.00   39.73 ? 270  GLU B OE2 1 
ATOM   4551 N N   . PHE B 1 272 ? 78.949 49.237 35.072 1.00   31.05 ? 271  PHE B N   1 
ATOM   4552 C CA  . PHE B 1 272 ? 77.713 49.952 34.791 1.00   29.63 ? 271  PHE B CA  1 
ATOM   4553 C C   . PHE B 1 272 ? 77.234 50.607 36.078 1.00   29.76 ? 271  PHE B C   1 
ATOM   4554 O O   . PHE B 1 272 ? 77.468 50.081 37.168 1.00   29.14 ? 271  PHE B O   1 
ATOM   4555 C CB  . PHE B 1 272 ? 76.637 48.974 34.333 1.00   29.56 ? 271  PHE B CB  1 
ATOM   4556 C CG  . PHE B 1 272 ? 76.721 48.598 32.886 1.00   27.16 ? 271  PHE B CG  1 
ATOM   4557 C CD1 . PHE B 1 272 ? 76.045 49.331 31.936 1.00   26.31 ? 271  PHE B CD1 1 
ATOM   4558 C CD2 . PHE B 1 272 ? 77.442 47.489 32.484 1.00   27.20 ? 271  PHE B CD2 1 
ATOM   4559 C CE1 . PHE B 1 272 ? 76.103 48.978 30.606 1.00   24.89 ? 271  PHE B CE1 1 
ATOM   4560 C CE2 . PHE B 1 272 ? 77.490 47.131 31.140 1.00   26.77 ? 271  PHE B CE2 1 
ATOM   4561 C CZ  . PHE B 1 272 ? 76.817 47.894 30.207 1.00   24.92 ? 271  PHE B CZ  1 
ATOM   4562 N N   . THR B 1 273 ? 76.567 51.748 35.962 1.00   29.37 ? 272  THR B N   1 
ATOM   4563 C CA  . THR B 1 273 ? 76.001 52.430 37.121 1.00   29.24 ? 272  THR B CA  1 
ATOM   4564 C C   . THR B 1 273 ? 74.564 52.831 36.822 1.00   29.22 ? 272  THR B C   1 
ATOM   4565 O O   . THR B 1 273 ? 74.317 53.570 35.877 1.00   29.64 ? 272  THR B O   1 
ATOM   4566 C CB  . THR B 1 273 ? 76.819 53.689 37.461 1.00   29.54 ? 272  THR B CB  1 
ATOM   4567 O OG1 . THR B 1 273 ? 78.148 53.318 37.852 1.00   29.55 ? 272  THR B OG1 1 
ATOM   4568 C CG2 . THR B 1 273 ? 76.258 54.398 38.695 1.00   29.55 ? 272  THR B CG2 1 
ATOM   4569 N N   . ILE B 1 274 ? 73.629 52.325 37.625 1.00   28.75 ? 273  ILE B N   1 
ATOM   4570 C CA  . ILE B 1 274 ? 72.220 52.691 37.532 1.00   28.62 ? 273  ILE B CA  1 
ATOM   4571 C C   . ILE B 1 274 ? 71.971 53.767 38.575 1.00   28.77 ? 273  ILE B C   1 
ATOM   4572 O O   . ILE B 1 274 ? 72.135 53.517 39.765 1.00   28.37 ? 273  ILE B O   1 
ATOM   4573 C CB  . ILE B 1 274 ? 71.307 51.491 37.860 1.00   28.27 ? 273  ILE B CB  1 
ATOM   4574 C CG1 . ILE B 1 274 ? 71.514 50.347 36.873 1.00   28.31 ? 273  ILE B CG1 1 
ATOM   4575 C CG2 . ILE B 1 274 ? 69.849 51.919 37.864 1.00   28.39 ? 273  ILE B CG2 1 
ATOM   4576 C CD1 . ILE B 1 274 ? 70.784 49.070 37.308 1.00   27.50 ? 273  ILE B CD1 1 
ATOM   4577 N N   . LYS B 1 275 ? 71.547 54.944 38.126 1.00   29.56 ? 274  LYS B N   1 
ATOM   4578 C CA  . LYS B 1 275 ? 71.309 56.076 39.009 1.00   30.13 ? 274  LYS B CA  1 
ATOM   4579 C C   . LYS B 1 275 ? 69.814 56.338 39.198 1.00   29.45 ? 274  LYS B C   1 
ATOM   4580 O O   . LYS B 1 275 ? 69.130 56.805 38.287 1.00   29.07 ? 274  LYS B O   1 
ATOM   4581 C CB  . LYS B 1 275 ? 72.013 57.316 38.447 1.00   31.03 ? 274  LYS B CB  1 
ATOM   4582 C CG  . LYS B 1 275 ? 73.486 57.082 38.131 1.00   33.72 ? 274  LYS B CG  1 
ATOM   4583 C CD  . LYS B 1 275 ? 74.158 58.350 37.577 1.00   37.02 ? 274  LYS B CD  1 
ATOM   4584 C CE  . LYS B 1 275 ? 75.648 58.140 37.311 1.00   38.34 ? 274  LYS B CE  1 
ATOM   4585 N NZ  . LYS B 1 275 ? 76.251 59.349 36.694 1.00   41.07 ? 274  LYS B NZ  1 
ATOM   4586 N N   . PRO B 1 276 ? 69.288 55.983 40.364 1.00   29.05 ? 275  PRO B N   1 
ATOM   4587 C CA  . PRO B 1 276 ? 67.872 56.216 40.660 1.00   29.46 ? 275  PRO B CA  1 
ATOM   4588 C C   . PRO B 1 276 ? 67.493 57.683 40.670 1.00   30.21 ? 275  PRO B C   1 
ATOM   4589 O O   . PRO B 1 276 ? 68.320 58.532 41.031 1.00   29.45 ? 275  PRO B O   1 
ATOM   4590 C CB  . PRO B 1 276 ? 67.708 55.614 42.055 1.00   29.30 ? 275  PRO B CB  1 
ATOM   4591 C CG  . PRO B 1 276 ? 68.803 54.566 42.129 1.00   29.31 ? 275  PRO B CG  1 
ATOM   4592 C CD  . PRO B 1 276 ? 69.955 55.236 41.444 1.00   29.29 ? 275  PRO B CD  1 
ATOM   4593 N N   . LEU B 1 277 ? 66.267 57.966 40.246 1.00   31.16 ? 276  LEU B N   1 
ATOM   4594 C CA  . LEU B 1 277 ? 65.730 59.320 40.282 1.00   32.61 ? 276  LEU B CA  1 
ATOM   4595 C C   . LEU B 1 277 ? 65.574 59.753 41.735 1.00   32.61 ? 276  LEU B C   1 
ATOM   4596 O O   . LEU B 1 277 ? 65.871 60.894 42.086 1.00   32.20 ? 276  LEU B O   1 
ATOM   4597 C CB  . LEU B 1 277 ? 64.373 59.390 39.573 1.00   33.08 ? 276  LEU B CB  1 
ATOM   4598 C CG  . LEU B 1 277 ? 64.420 59.347 38.040 1.00   36.09 ? 276  LEU B CG  1 
ATOM   4599 C CD1 . LEU B 1 277 ? 63.074 59.729 37.430 1.00   37.78 ? 276  LEU B CD1 1 
ATOM   4600 C CD2 . LEU B 1 277 ? 65.490 60.279 37.516 1.00   38.56 ? 276  LEU B CD2 1 
ATOM   4601 N N   . ASP B 1 278 ? 65.108 58.821 42.564 1.00   32.47 ? 277  ASP B N   1 
ATOM   4602 C CA  . ASP B 1 278 ? 64.922 59.046 43.992 1.00   32.57 ? 277  ASP B CA  1 
ATOM   4603 C C   . ASP B 1 278 ? 66.286 58.986 44.667 1.00   32.78 ? 277  ASP B C   1 
ATOM   4604 O O   . ASP B 1 278 ? 66.894 57.919 44.783 1.00   32.55 ? 277  ASP B O   1 
ATOM   4605 C CB  . ASP B 1 278 ? 63.967 57.993 44.561 1.00   32.61 ? 277  ASP B CB  1 
ATOM   4606 C CG  . ASP B 1 278 ? 63.622 58.232 46.017 1.00   32.24 ? 277  ASP B CG  1 
ATOM   4607 O OD1 . ASP B 1 278 ? 64.353 59.002 46.690 1.00   31.65 ? 277  ASP B OD1 1 
ATOM   4608 O OD2 . ASP B 1 278 ? 62.640 57.678 46.562 1.00   31.46 ? 277  ASP B OD2 1 
ATOM   4609 N N   . LYS B 1 279 ? 66.754 60.144 45.124 1.00   33.09 ? 278  LYS B N   1 
ATOM   4610 C CA  . LYS B 1 279 ? 68.076 60.273 45.722 1.00   33.55 ? 278  LYS B CA  1 
ATOM   4611 C C   . LYS B 1 279 ? 68.212 59.490 47.022 1.00   32.93 ? 278  LYS B C   1 
ATOM   4612 O O   . LYS B 1 279 ? 69.317 59.301 47.516 1.00   32.88 ? 278  LYS B O   1 
ATOM   4613 C CB  . LYS B 1 279 ? 68.391 61.750 45.989 1.00   34.67 ? 278  LYS B CB  1 
ATOM   4614 C CG  . LYS B 1 279 ? 67.415 62.437 46.945 1.00   37.04 ? 278  LYS B CG  1 
ATOM   4615 C CD  . LYS B 1 279 ? 67.341 63.942 46.691 1.00   39.97 ? 278  LYS B CD  1 
ATOM   4616 C CE  . LYS B 1 279 ? 66.060 64.549 47.232 1.00   41.79 ? 278  LYS B CE  1 
ATOM   4617 N NZ  . LYS B 1 279 ? 65.855 65.944 46.747 1.00   43.53 ? 278  LYS B NZ  1 
ATOM   4618 N N   . LYS B 1 280 ? 67.099 59.054 47.589 1.00   32.29 ? 279  LYS B N   1 
ATOM   4619 C CA  . LYS B 1 280 ? 67.166 58.285 48.830 1.00   32.03 ? 279  LYS B CA  1 
ATOM   4620 C C   . LYS B 1 280 ? 67.729 56.894 48.559 1.00   31.06 ? 279  LYS B C   1 
ATOM   4621 O O   . LYS B 1 280 ? 68.208 56.229 49.478 1.00   30.39 ? 279  LYS B O   1 
ATOM   4622 C CB  . LYS B 1 280 ? 65.794 58.165 49.493 1.00   32.71 ? 279  LYS B CB  1 
ATOM   4623 C CG  . LYS B 1 280 ? 65.262 59.447 50.134 1.00   34.42 ? 279  LYS B CG  1 
ATOM   4624 C CD  . LYS B 1 280 ? 63.808 59.263 50.598 1.00   36.58 ? 279  LYS B CD  1 
ATOM   4625 C CE  . LYS B 1 280 ? 63.329 60.386 51.512 1.00   39.00 ? 279  LYS B CE  1 
ATOM   4626 N NZ  . LYS B 1 280 ? 61.865 60.279 51.802 1.00   40.30 ? 279  LYS B NZ  1 
ATOM   4627 N N   . ILE B 1 281 ? 67.648 56.454 47.301 1.00   30.25 ? 280  ILE B N   1 
ATOM   4628 C CA  . ILE B 1 281 ? 68.177 55.151 46.883 1.00   29.70 ? 280  ILE B CA  1 
ATOM   4629 C C   . ILE B 1 281 ? 69.584 55.327 46.300 1.00   29.61 ? 280  ILE B C   1 
ATOM   4630 O O   . ILE B 1 281 ? 69.797 56.162 45.423 1.00   29.46 ? 280  ILE B O   1 
ATOM   4631 C CB  . ILE B 1 281 ? 67.242 54.514 45.838 1.00   29.17 ? 280  ILE B CB  1 
ATOM   4632 C CG1 . ILE B 1 281 ? 65.820 54.423 46.395 1.00   29.81 ? 280  ILE B CG1 1 
ATOM   4633 C CG2 . ILE B 1 281 ? 67.772 53.142 45.415 1.00   29.93 ? 280  ILE B CG2 1 
ATOM   4634 C CD1 . ILE B 1 281 ? 64.798 53.789 45.453 1.00   29.56 ? 280  ILE B CD1 1 
ATOM   4635 N N   . ASP B 1 282 ? 70.544 54.542 46.791 1.00   29.47 ? 281  ASP B N   1 
ATOM   4636 C CA  . ASP B 1 282 ? 71.920 54.625 46.312 1.00   29.73 ? 281  ASP B CA  1 
ATOM   4637 C C   . ASP B 1 282 ? 72.045 54.105 44.889 1.00   29.11 ? 281  ASP B C   1 
ATOM   4638 O O   . ASP B 1 282 ? 71.207 53.319 44.431 1.00   28.31 ? 281  ASP B O   1 
ATOM   4639 C CB  . ASP B 1 282 ? 72.855 53.811 47.210 1.00   30.41 ? 281  ASP B CB  1 
ATOM   4640 C CG  . ASP B 1 282 ? 73.117 54.483 48.547 1.00   32.12 ? 281  ASP B CG  1 
ATOM   4641 O OD1 . ASP B 1 282 ? 72.790 55.683 48.692 1.00   34.82 ? 281  ASP B OD1 1 
ATOM   4642 O OD2 . ASP B 1 282 ? 73.641 53.886 49.510 1.00   36.09 ? 281  ASP B OD2 1 
ATOM   4643 N N   . VAL B 1 283 ? 73.099 54.537 44.201 1.00   28.45 ? 282  VAL B N   1 
ATOM   4644 C CA  . VAL B 1 283 ? 73.351 54.067 42.852 1.00   28.05 ? 282  VAL B CA  1 
ATOM   4645 C C   . VAL B 1 283 ? 73.627 52.574 42.887 1.00   27.44 ? 282  VAL B C   1 
ATOM   4646 O O   . VAL B 1 283 ? 74.198 52.063 43.851 1.00   27.36 ? 282  VAL B O   1 
ATOM   4647 C CB  . VAL B 1 283 ? 74.512 54.823 42.179 1.00   28.40 ? 282  VAL B CB  1 
ATOM   4648 C CG1 . VAL B 1 283 ? 74.194 56.306 42.114 1.00   28.46 ? 282  VAL B CG1 1 
ATOM   4649 C CG2 . VAL B 1 283 ? 75.823 54.577 42.900 1.00   29.62 ? 282  VAL B CG2 1 
ATOM   4650 N N   . PHE B 1 284 ? 73.190 51.867 41.854 1.00   26.36 ? 283  PHE B N   1 
ATOM   4651 C CA  . PHE B 1 284 ? 73.427 50.433 41.766 1.00   26.18 ? 283  PHE B CA  1 
ATOM   4652 C C   . PHE B 1 284 ? 74.530 50.142 40.744 1.00   26.09 ? 283  PHE B C   1 
ATOM   4653 O O   . PHE B 1 284 ? 74.380 50.443 39.565 1.00   25.78 ? 283  PHE B O   1 
ATOM   4654 C CB  . PHE B 1 284 ? 72.124 49.684 41.409 1.00   26.00 ? 283  PHE B CB  1 
ATOM   4655 C CG  . PHE B 1 284 ? 72.258 48.182 41.459 1.00   25.97 ? 283  PHE B CG  1 
ATOM   4656 C CD1 . PHE B 1 284 ? 72.802 47.486 40.392 1.00   27.01 ? 283  PHE B CD1 1 
ATOM   4657 C CD2 . PHE B 1 284 ? 71.867 47.471 42.586 1.00   27.83 ? 283  PHE B CD2 1 
ATOM   4658 C CE1 . PHE B 1 284 ? 72.944 46.125 40.440 1.00   25.57 ? 283  PHE B CE1 1 
ATOM   4659 C CE2 . PHE B 1 284 ? 72.015 46.092 42.634 1.00   26.86 ? 283  PHE B CE2 1 
ATOM   4660 C CZ  . PHE B 1 284 ? 72.549 45.424 41.555 1.00   27.48 ? 283  PHE B CZ  1 
ATOM   4661 N N   . LYS B 1 285 ? 75.636 49.550 41.188 1.00   26.03 ? 284  LYS B N   1 
ATOM   4662 C CA  . LYS B 1 285 ? 76.751 49.257 40.293 1.00   26.56 ? 284  LYS B CA  1 
ATOM   4663 C C   . LYS B 1 285 ? 76.964 47.761 40.070 1.00   25.76 ? 284  LYS B C   1 
ATOM   4664 O O   . LYS B 1 285 ? 76.799 46.955 40.982 1.00   25.31 ? 284  LYS B O   1 
ATOM   4665 C CB  . LYS B 1 285 ? 78.063 49.827 40.849 1.00   27.12 ? 284  LYS B CB  1 
ATOM   4666 C CG  . LYS B 1 285 ? 78.133 51.337 40.901 1.00   30.14 ? 284  LYS B CG  1 
ATOM   4667 C CD  . LYS B 1 285 ? 79.377 51.768 41.660 1.00   32.49 ? 284  LYS B CD  1 
ATOM   4668 C CE  . LYS B 1 285 ? 79.611 53.252 41.604 1.00   34.77 ? 284  LYS B CE  1 
ATOM   4669 N NZ  . LYS B 1 285 ? 80.931 53.584 42.256 1.00   34.55 ? 284  LYS B NZ  1 
ATOM   4670 N N   . PHE B 1 286 ? 77.367 47.404 38.857 1.00   25.35 ? 285  PHE B N   1 
ATOM   4671 C CA  . PHE B 1 286 ? 77.662 46.016 38.545 1.00   25.30 ? 285  PHE B CA  1 
ATOM   4672 C C   . PHE B 1 286 ? 78.692 45.936 37.424 1.00   25.79 ? 285  PHE B C   1 
ATOM   4673 O O   . PHE B 1 286 ? 78.879 46.893 36.691 1.00   25.81 ? 285  PHE B O   1 
ATOM   4674 C CB  . PHE B 1 286 ? 76.386 45.252 38.181 1.00   24.78 ? 285  PHE B CB  1 
ATOM   4675 C CG  . PHE B 1 286 ? 75.685 45.758 36.947 1.00   24.38 ? 285  PHE B CG  1 
ATOM   4676 C CD1 . PHE B 1 286 ? 76.037 45.292 35.693 1.00   23.93 ? 285  PHE B CD1 1 
ATOM   4677 C CD2 . PHE B 1 286 ? 74.646 46.660 37.046 1.00   23.30 ? 285  PHE B CD2 1 
ATOM   4678 C CE1 . PHE B 1 286 ? 75.379 45.736 34.570 1.00   25.31 ? 285  PHE B CE1 1 
ATOM   4679 C CE2 . PHE B 1 286 ? 73.999 47.102 35.916 1.00   23.06 ? 285  PHE B CE2 1 
ATOM   4680 C CZ  . PHE B 1 286 ? 74.374 46.642 34.684 1.00   22.65 ? 285  PHE B CZ  1 
ATOM   4681 N N   . ASN B 1 287 ? 79.347 44.789 37.294 1.00   26.90 ? 286  ASN B N   1 
ATOM   4682 C CA  . ASN B 1 287 ? 80.357 44.599 36.267 1.00   27.97 ? 286  ASN B CA  1 
ATOM   4683 C C   . ASN B 1 287 ? 79.924 43.590 35.197 1.00   28.50 ? 286  ASN B C   1 
ATOM   4684 O O   . ASN B 1 287 ? 79.225 42.607 35.490 1.00   27.83 ? 286  ASN B O   1 
ATOM   4685 C CB  . ASN B 1 287 ? 81.676 44.111 36.874 1.00   28.34 ? 286  ASN B CB  1 
ATOM   4686 C CG  . ASN B 1 287 ? 82.297 45.095 37.861 1.00   30.94 ? 286  ASN B CG  1 
ATOM   4687 O OD1 . ASN B 1 287 ? 83.064 44.689 38.737 1.00   38.59 ? 286  ASN B OD1 1 
ATOM   4688 N ND2 . ASN B 1 287 ? 81.992 46.365 37.725 1.00   33.96 ? 286  ASN B ND2 1 
ATOM   4689 N N   . SER B 1 288 ? 80.381 43.836 33.968 1.00   29.78 ? 287  SER B N   1 
ATOM   4690 C CA  . SER B 1 288 ? 80.139 42.959 32.826 1.00   31.04 ? 287  SER B CA  1 
ATOM   4691 C C   . SER B 1 288 ? 81.408 42.888 31.948 1.00   32.44 ? 287  SER B C   1 
ATOM   4692 O O   . SER B 1 288 ? 81.850 43.896 31.411 1.00   32.14 ? 287  SER B O   1 
ATOM   4693 C CB  . SER B 1 288 ? 78.963 43.481 32.014 1.00   30.51 ? 287  SER B CB  1 
ATOM   4694 O OG  . SER B 1 288 ? 78.831 42.739 30.826 1.00   31.21 ? 287  SER B OG  1 
ATOM   4695 N N   . SER B 1 289 ? 81.945 41.676 31.786 1.00   34.59 ? 288  SER B N   1 
ATOM   4696 C CA  . SER B 1 289 ? 83.249 41.438 31.138 1.00   35.91 ? 288  SER B CA  1 
ATOM   4697 C C   . SER B 1 289 ? 83.396 41.719 29.634 1.00   36.08 ? 288  SER B C   1 
ATOM   4698 O O   . SER B 1 289 ? 84.447 42.201 29.183 1.00   36.35 ? 288  SER B O   1 
ATOM   4699 C CB  . SER B 1 289 ? 83.659 39.984 31.391 1.00   36.29 ? 288  SER B CB  1 
ATOM   4700 O OG  . SER B 1 289 ? 84.932 39.708 30.826 1.00   39.88 ? 288  SER B OG  1 
ATOM   4701 N N   . LYS B 1 290 ? 82.375 41.405 28.849 1.00   35.72 ? 289  LYS B N   1 
ATOM   4702 C CA  . LYS B 1 290 ? 82.500 41.515 27.405 1.00   35.42 ? 289  LYS B CA  1 
ATOM   4703 C C   . LYS B 1 290 ? 82.073 42.869 26.830 1.00   34.94 ? 289  LYS B C   1 
ATOM   4704 O O   . LYS B 1 290 ? 80.931 43.318 26.980 1.00   34.30 ? 289  LYS B O   1 
ATOM   4705 C CB  . LYS B 1 290 ? 81.742 40.383 26.731 1.00   35.88 ? 289  LYS B CB  1 
ATOM   4706 C CG  . LYS B 1 290 ? 82.140 39.017 27.236 1.00   36.80 ? 289  LYS B CG  1 
ATOM   4707 C CD  . LYS B 1 290 ? 81.337 37.935 26.564 1.00   38.53 ? 289  LYS B CD  1 
ATOM   4708 C CE  . LYS B 1 290 ? 81.940 36.569 26.817 1.00   40.35 ? 289  LYS B CE  1 
ATOM   4709 N NZ  . LYS B 1 290 ? 82.191 36.327 28.266 1.00   41.84 ? 289  LYS B NZ  1 
ATOM   4710 N N   . LEU B 1 291 ? 83.013 43.504 26.143 1.00   33.90 ? 290  LEU B N   1 
ATOM   4711 C CA  . LEU B 1 291 ? 82.782 44.795 25.516 1.00   33.47 ? 290  LEU B CA  1 
ATOM   4712 C C   . LEU B 1 291 ? 81.591 44.753 24.552 1.00   32.11 ? 290  LEU B C   1 
ATOM   4713 O O   . LEU B 1 291 ? 80.734 45.651 24.547 1.00   32.21 ? 290  LEU B O   1 
ATOM   4714 C CB  . LEU B 1 291 ? 84.053 45.196 24.761 1.00   34.00 ? 290  LEU B CB  1 
ATOM   4715 C CG  . LEU B 1 291 ? 84.074 46.509 23.988 1.00   36.01 ? 290  LEU B CG  1 
ATOM   4716 C CD1 . LEU B 1 291 ? 83.649 47.700 24.839 1.00   37.73 ? 290  LEU B CD1 1 
ATOM   4717 C CD2 . LEU B 1 291 ? 85.476 46.715 23.436 1.00   37.25 ? 290  LEU B CD2 1 
ATOM   4718 N N   . ARG B 1 292 ? 81.536 43.699 23.744 1.00   30.64 ? 291  ARG B N   1 
ATOM   4719 C CA  . ARG B 1 292 ? 80.479 43.557 22.747 1.00   29.64 ? 291  ARG B CA  1 
ATOM   4720 C C   . ARG B 1 292 ? 79.120 43.384 23.388 1.00   28.26 ? 291  ARG B C   1 
ATOM   4721 O O   . ARG B 1 292 ? 78.102 43.800 22.834 1.00   28.22 ? 291  ARG B O   1 
ATOM   4722 C CB  . ARG B 1 292 ? 80.752 42.377 21.840 1.00   30.14 ? 291  ARG B CB  1 
ATOM   4723 C CG  . ARG B 1 292 ? 80.976 41.071 22.554 1.00   30.38 ? 291  ARG B CG  1 
ATOM   4724 C CD  . ARG B 1 292 ? 81.605 40.073 21.643 1.00   32.72 ? 291  ARG B CD  1 
ATOM   4725 N NE  . ARG B 1 292 ? 81.639 38.716 22.148 1.00   34.59 ? 291  ARG B NE  1 
ATOM   4726 C CZ  . ARG B 1 292 ? 82.621 38.194 22.878 1.00   37.10 ? 291  ARG B CZ  1 
ATOM   4727 N NH1 . ARG B 1 292 ? 83.661 38.937 23.240 1.00   37.06 ? 291  ARG B NH1 1 
ATOM   4728 N NH2 . ARG B 1 292 ? 82.560 36.915 23.258 1.00   37.86 ? 291  ARG B NH2 1 
ATOM   4729 N N   . VAL B 1 293 ? 79.112 42.799 24.573 1.00   26.90 ? 292  VAL B N   1 
ATOM   4730 C CA  . VAL B 1 293 ? 77.873 42.598 25.305 1.00   25.53 ? 292  VAL B CA  1 
ATOM   4731 C C   . VAL B 1 293 ? 77.487 43.944 25.899 1.00   25.00 ? 292  VAL B C   1 
ATOM   4732 O O   . VAL B 1 293 ? 76.330 44.354 25.862 1.00   22.67 ? 292  VAL B O   1 
ATOM   4733 C CB  . VAL B 1 293 ? 78.051 41.544 26.380 1.00   25.51 ? 292  VAL B CB  1 
ATOM   4734 C CG1 . VAL B 1 293 ? 76.812 41.464 27.302 1.00   25.40 ? 292  VAL B CG1 1 
ATOM   4735 C CG2 . VAL B 1 293 ? 78.302 40.192 25.736 1.00   25.60 ? 292  VAL B CG2 1 
ATOM   4736 N N   . ASN B 1 294 ? 78.462 44.659 26.449 1.00   24.04 ? 293  ASN B N   1 
ATOM   4737 C CA  . ASN B 1 294 ? 78.158 45.939 27.052 1.00   24.99 ? 293  ASN B CA  1 
ATOM   4738 C C   . ASN B 1 294 ? 77.586 46.919 26.035 1.00   24.98 ? 293  ASN B C   1 
ATOM   4739 O O   . ASN B 1 294 ? 76.677 47.695 26.339 1.00   25.14 ? 293  ASN B O   1 
ATOM   4740 C CB  . ASN B 1 294 ? 79.394 46.485 27.759 1.00   25.67 ? 293  ASN B CB  1 
ATOM   4741 C CG  . ASN B 1 294 ? 79.858 45.579 28.879 1.00   27.34 ? 293  ASN B CG  1 
ATOM   4742 O OD1 . ASN B 1 294 ? 79.153 44.640 29.282 1.00   28.00 ? 293  ASN B OD1 1 
ATOM   4743 N ND2 . ASN B 1 294 ? 81.065 45.842 29.391 1.00   29.08 ? 293  ASN B ND2 1 
ATOM   4744 N N   . LYS B 1 295 ? 78.089 46.867 24.805 1.00   24.73 ? 294  LYS B N   1 
ATOM   4745 C CA  . LYS B 1 295 ? 77.560 47.730 23.761 1.00   25.12 ? 294  LYS B CA  1 
ATOM   4746 C C   . LYS B 1 295 ? 76.089 47.376 23.514 1.00   24.27 ? 294  LYS B C   1 
ATOM   4747 O O   . LYS B 1 295 ? 75.250 48.247 23.375 1.00   23.58 ? 294  LYS B O   1 
ATOM   4748 C CB  . LYS B 1 295 ? 78.397 47.609 22.485 1.00   25.78 ? 294  LYS B CB  1 
ATOM   4749 C CG  . LYS B 1 295 ? 79.622 48.545 22.484 1.00   29.86 ? 294  LYS B CG  1 
ATOM   4750 C CD  . LYS B 1 295 ? 80.515 48.300 21.278 1.00   32.67 ? 294  LYS B CD  1 
ATOM   4751 C CE  . LYS B 1 295 ? 81.906 48.899 21.453 1.00   34.45 ? 294  LYS B CE  1 
ATOM   4752 N NZ  . LYS B 1 295 ? 82.818 48.568 20.312 1.00   36.25 ? 294  LYS B NZ  1 
ATOM   4753 N N   . LEU B 1 296 ? 75.773 46.099 23.496 1.00   23.72 ? 295  LEU B N   1 
ATOM   4754 C CA  . LEU B 1 296 ? 74.395 45.652 23.295 1.00   23.84 ? 295  LEU B CA  1 
ATOM   4755 C C   . LEU B 1 296 ? 73.490 46.070 24.458 1.00   22.84 ? 295  LEU B C   1 
ATOM   4756 O O   . LEU B 1 296 ? 72.360 46.510 24.250 1.00   22.72 ? 295  LEU B O   1 
ATOM   4757 C CB  . LEU B 1 296 ? 74.367 44.139 23.163 1.00   24.02 ? 295  LEU B CB  1 
ATOM   4758 C CG  . LEU B 1 296 ? 73.286 43.443 22.323 1.00   27.19 ? 295  LEU B CG  1 
ATOM   4759 C CD1 . LEU B 1 296 ? 72.884 42.143 23.004 1.00   26.77 ? 295  LEU B CD1 1 
ATOM   4760 C CD2 . LEU B 1 296 ? 72.054 44.299 22.083 1.00   26.34 ? 295  LEU B CD2 1 
ATOM   4761 N N   . ILE B 1 297 ? 73.989 45.931 25.684 1.00   21.84 ? 296  ILE B N   1 
ATOM   4762 C CA  . ILE B 1 297 ? 73.225 46.339 26.852 1.00   21.04 ? 296  ILE B CA  1 
ATOM   4763 C C   . ILE B 1 297 ? 72.822 47.797 26.742 1.00   21.18 ? 296  ILE B C   1 
ATOM   4764 O O   . ILE B 1 297 ? 71.672 48.146 26.976 1.00   19.51 ? 296  ILE B O   1 
ATOM   4765 C CB  . ILE B 1 297 ? 74.010 46.079 28.173 1.00   20.29 ? 296  ILE B CB  1 
ATOM   4766 C CG1 . ILE B 1 297 ? 74.092 44.578 28.424 1.00   20.02 ? 296  ILE B CG1 1 
ATOM   4767 C CG2 . ILE B 1 297 ? 73.337 46.827 29.324 1.00   21.42 ? 296  ILE B CG2 1 
ATOM   4768 C CD1 . ILE B 1 297 ? 75.019 44.132 29.516 1.00   20.92 ? 296  ILE B CD1 1 
ATOM   4769 N N   . LEU B 1 298 ? 73.767 48.651 26.355 1.00   22.14 ? 297  LEU B N   1 
ATOM   4770 C CA  . LEU B 1 298 ? 73.483 50.066 26.186 1.00   23.65 ? 297  LEU B CA  1 
ATOM   4771 C C   . LEU B 1 298 ? 72.442 50.319 25.108 1.00   23.31 ? 297  LEU B C   1 
ATOM   4772 O O   . LEU B 1 298 ? 71.543 51.133 25.311 1.00   25.26 ? 297  LEU B O   1 
ATOM   4773 C CB  . LEU B 1 298 ? 74.766 50.819 25.827 1.00   24.86 ? 297  LEU B CB  1 
ATOM   4774 C CG  . LEU B 1 298 ? 75.651 51.044 27.037 1.00   28.16 ? 297  LEU B CG  1 
ATOM   4775 C CD1 . LEU B 1 298 ? 77.090 51.369 26.611 1.00   30.87 ? 297  LEU B CD1 1 
ATOM   4776 C CD2 . LEU B 1 298 ? 75.049 52.152 27.872 1.00   31.26 ? 297  LEU B CD2 1 
ATOM   4777 N N   . GLN B 1 299 ? 72.570 49.640 23.970 1.00   24.04 ? 298  GLN B N   1 
ATOM   4778 C CA  . GLN B 1 299 ? 71.580 49.773 22.898 1.00   23.51 ? 298  GLN B CA  1 
ATOM   4779 C C   . GLN B 1 299 ? 70.187 49.478 23.464 1.00   22.25 ? 298  GLN B C   1 
ATOM   4780 O O   . GLN B 1 299 ? 69.251 50.246 23.292 1.00   21.67 ? 298  GLN B O   1 
ATOM   4781 C CB  . GLN B 1 299 ? 71.855 48.827 21.716 1.00   24.35 ? 298  GLN B CB  1 
ATOM   4782 C CG  . GLN B 1 299 ? 73.023 49.166 20.770 1.00   26.48 ? 298  GLN B CG  1 
ATOM   4783 C CD  . GLN B 1 299 ? 72.937 48.400 19.443 1.00   29.29 ? 298  GLN B CD  1 
ATOM   4784 O OE1 . GLN B 1 299 ? 72.970 47.171 19.419 1.00   31.68 ? 298  GLN B OE1 1 
ATOM   4785 N NE2 . GLN B 1 299 ? 72.849 49.134 18.336 1.00   31.15 ? 298  GLN B NE2 1 
ATOM   4786 N N   . LEU B 1 300 ? 70.061 48.353 24.148 1.00   20.01 ? 299  LEU B N   1 
ATOM   4787 C CA  . LEU B 1 300 ? 68.781 47.936 24.694 1.00   19.81 ? 299  LEU B CA  1 
ATOM   4788 C C   . LEU B 1 300 ? 68.258 48.828 25.819 1.00   19.41 ? 299  LEU B C   1 
ATOM   4789 O O   . LEU B 1 300 ? 67.063 49.022 25.925 1.00   18.70 ? 299  LEU B O   1 
ATOM   4790 C CB  . LEU B 1 300 ? 68.891 46.491 25.139 1.00   19.62 ? 299  LEU B CB  1 
ATOM   4791 C CG  . LEU B 1 300 ? 69.142 45.503 24.002 1.00   19.26 ? 299  LEU B CG  1 
ATOM   4792 C CD1 . LEU B 1 300 ? 69.470 44.126 24.576 1.00   20.57 ? 299  LEU B CD1 1 
ATOM   4793 C CD2 . LEU B 1 300 ? 67.979 45.378 23.020 1.00   19.34 ? 299  LEU B CD2 1 
ATOM   4794 N N   . CYS B 1 301 ? 69.121 49.384 26.669 1.00   20.31 ? 300  CYS B N   1 
ATOM   4795 C CA  . CYS B 1 301 ? 68.654 50.295 27.707 1.00   20.99 ? 300  CYS B CA  1 
ATOM   4796 C C   . CYS B 1 301 ? 68.101 51.602 27.126 1.00   21.61 ? 300  CYS B C   1 
ATOM   4797 O O   . CYS B 1 301 ? 67.029 52.064 27.514 1.00   20.59 ? 300  CYS B O   1 
ATOM   4798 C CB  . CYS B 1 301 ? 69.764 50.649 28.701 1.00   22.01 ? 300  CYS B CB  1 
ATOM   4799 S SG  . CYS B 1 301 ? 70.212 49.260 29.746 1.00   22.67 ? 300  CYS B SG  1 
ATOM   4800 N N   . ILE B 1 302 ? 68.853 52.212 26.225 1.00   22.12 ? 301  ILE B N   1 
ATOM   4801 C CA  . ILE B 1 302 ? 68.426 53.458 25.611 1.00   22.96 ? 301  ILE B CA  1 
ATOM   4802 C C   . ILE B 1 302 ? 67.086 53.277 24.886 1.00   21.07 ? 301  ILE B C   1 
ATOM   4803 O O   . ILE B 1 302 ? 66.174 54.056 25.100 1.00   20.29 ? 301  ILE B O   1 
ATOM   4804 C CB  . ILE B 1 302 ? 69.511 54.007 24.665 1.00   23.89 ? 301  ILE B CB  1 
ATOM   4805 C CG1 . ILE B 1 302 ? 70.690 54.529 25.484 1.00   26.38 ? 301  ILE B CG1 1 
ATOM   4806 C CG2 . ILE B 1 302 ? 68.972 55.142 23.815 1.00   25.54 ? 301  ILE B CG2 1 
ATOM   4807 C CD1 . ILE B 1 302 ? 71.896 54.890 24.661 1.00   27.99 ? 301  ILE B CD1 1 
ATOM   4808 N N   . GLY B 1 303 ? 66.963 52.227 24.077 1.00   20.33 ? 302  GLY B N   1 
ATOM   4809 C CA  . GLY B 1 303 ? 65.757 52.007 23.300 1.00   19.53 ? 302  GLY B CA  1 
ATOM   4810 C C   . GLY B 1 303 ? 64.554 51.694 24.162 1.00   19.21 ? 302  GLY B C   1 
ATOM   4811 O O   . GLY B 1 303 ? 63.449 52.190 23.948 1.00   18.18 ? 302  GLY B O   1 
ATOM   4812 N N   . ASN B 1 304 ? 64.748 50.810 25.133 1.00   19.02 ? 303  ASN B N   1 
ATOM   4813 C CA  . ASN B 1 304 ? 63.642 50.470 26.013 1.00   18.50 ? 303  ASN B CA  1 
ATOM   4814 C C   . ASN B 1 304 ? 63.194 51.668 26.850 1.00   18.70 ? 303  ASN B C   1 
ATOM   4815 O O   . ASN B 1 304 ? 62.013 51.887 27.033 1.00   18.07 ? 303  ASN B O   1 
ATOM   4816 C CB  . ASN B 1 304 ? 64.007 49.295 26.911 1.00   17.91 ? 303  ASN B CB  1 
ATOM   4817 C CG  . ASN B 1 304 ? 63.750 47.956 26.230 1.00   16.06 ? 303  ASN B CG  1 
ATOM   4818 O OD1 . ASN B 1 304 ? 62.589 47.617 25.943 1.00   15.10 ? 303  ASN B OD1 1 
ATOM   4819 N ND2 . ASN B 1 304 ? 64.824 47.219 25.920 1.00   15.84 ? 303  ASN B ND2 1 
ATOM   4820 N N   . HIS B 1 305 ? 64.138 52.438 27.358 1.00   20.08 ? 304  HIS B N   1 
ATOM   4821 C CA  . HIS B 1 305 ? 63.769 53.601 28.150 1.00   21.32 ? 304  HIS B CA  1 
ATOM   4822 C C   . HIS B 1 305 ? 62.896 54.539 27.290 1.00   21.55 ? 304  HIS B C   1 
ATOM   4823 O O   . HIS B 1 305 ? 61.847 55.042 27.723 1.00   20.87 ? 304  HIS B O   1 
ATOM   4824 C CB  . HIS B 1 305 ? 65.017 54.305 28.667 1.00   22.33 ? 304  HIS B CB  1 
ATOM   4825 C CG  . HIS B 1 305 ? 64.721 55.578 29.399 1.00   25.99 ? 304  HIS B CG  1 
ATOM   4826 N ND1 . HIS B 1 305 ? 64.614 56.798 28.758 1.00   31.46 ? 304  HIS B ND1 1 
ATOM   4827 C CD2 . HIS B 1 305 ? 64.517 55.823 30.715 1.00   28.27 ? 304  HIS B CD2 1 
ATOM   4828 C CE1 . HIS B 1 305 ? 64.345 57.736 29.651 1.00   31.50 ? 304  HIS B CE1 1 
ATOM   4829 N NE2 . HIS B 1 305 ? 64.270 57.169 30.844 1.00   30.07 ? 304  HIS B NE2 1 
ATOM   4830 N N   . ASP B 1 306 ? 63.349 54.766 26.068 1.00   21.83 ? 305  ASP B N   1 
ATOM   4831 C CA  . ASP B 1 306 ? 62.648 55.605 25.099 1.00   22.67 ? 305  ASP B CA  1 
ATOM   4832 C C   . ASP B 1 306 ? 61.196 55.178 24.864 1.00   21.94 ? 305  ASP B C   1 
ATOM   4833 O O   . ASP B 1 306 ? 60.289 55.973 25.013 1.00   20.98 ? 305  ASP B O   1 
ATOM   4834 C CB  . ASP B 1 306 ? 63.424 55.561 23.785 1.00   22.80 ? 305  ASP B CB  1 
ATOM   4835 C CG  . ASP B 1 306 ? 62.695 56.233 22.653 1.00   26.86 ? 305  ASP B CG  1 
ATOM   4836 O OD1 . ASP B 1 306 ? 62.085 57.293 22.902 1.00   32.00 ? 305  ASP B OD1 1 
ATOM   4837 O OD2 . ASP B 1 306 ? 62.697 55.799 21.479 1.00   28.09 ? 305  ASP B OD2 1 
ATOM   4838 N N   . LEU B 1 307 ? 60.979 53.911 24.502 1.00   21.86 ? 306  LEU B N   1 
ATOM   4839 C CA  . LEU B 1 307 ? 59.638 53.409 24.214 1.00   21.51 ? 306  LEU B CA  1 
ATOM   4840 C C   . LEU B 1 307 ? 58.757 53.412 25.452 1.00   21.30 ? 306  LEU B C   1 
ATOM   4841 O O   . LEU B 1 307 ? 57.551 53.638 25.371 1.00   21.08 ? 306  LEU B O   1 
ATOM   4842 C CB  . LEU B 1 307 ? 59.711 51.989 23.608 1.00   22.22 ? 306  LEU B CB  1 
ATOM   4843 C CG  . LEU B 1 307 ? 60.413 51.921 22.246 1.00   22.55 ? 306  LEU B CG  1 
ATOM   4844 C CD1 . LEU B 1 307 ? 60.254 50.539 21.624 1.00   23.08 ? 306  LEU B CD1 1 
ATOM   4845 C CD2 . LEU B 1 307 ? 59.879 52.957 21.300 1.00   24.08 ? 306  LEU B CD2 1 
ATOM   4846 N N   . PHE B 1 308 ? 59.352 53.183 26.618 1.00   21.23 ? 307  PHE B N   1 
ATOM   4847 C CA  . PHE B 1 308 ? 58.585 53.201 27.859 1.00   21.99 ? 307  PHE B CA  1 
ATOM   4848 C C   . PHE B 1 308 ? 57.896 54.562 28.013 1.00   22.72 ? 307  PHE B C   1 
ATOM   4849 O O   . PHE B 1 308 ? 56.719 54.653 28.352 1.00   22.15 ? 307  PHE B O   1 
ATOM   4850 C CB  . PHE B 1 308 ? 59.519 52.942 29.044 1.00   21.82 ? 307  PHE B CB  1 
ATOM   4851 C CG  . PHE B 1 308 ? 58.845 52.979 30.384 1.00   22.32 ? 307  PHE B CG  1 
ATOM   4852 C CD1 . PHE B 1 308 ? 58.667 54.183 31.050 1.00   22.46 ? 307  PHE B CD1 1 
ATOM   4853 C CD2 . PHE B 1 308 ? 58.468 51.811 31.023 1.00   19.91 ? 307  PHE B CD2 1 
ATOM   4854 C CE1 . PHE B 1 308 ? 58.075 54.217 32.296 1.00   24.77 ? 307  PHE B CE1 1 
ATOM   4855 C CE2 . PHE B 1 308 ? 57.880 51.852 32.281 1.00   23.40 ? 307  PHE B CE2 1 
ATOM   4856 C CZ  . PHE B 1 308 ? 57.683 53.058 32.909 1.00   22.87 ? 307  PHE B CZ  1 
ATOM   4857 N N   . MET B 1 309 ? 58.635 55.613 27.715 1.00   24.91 ? 308  MET B N   1 
ATOM   4858 C CA  . MET B 1 309 ? 58.085 56.956 27.844 1.00   26.72 ? 308  MET B CA  1 
ATOM   4859 C C   . MET B 1 309 ? 57.073 57.208 26.718 1.00   27.75 ? 308  MET B C   1 
ATOM   4860 O O   . MET B 1 309 ? 55.981 57.744 26.946 1.00   27.42 ? 308  MET B O   1 
ATOM   4861 C CB  . MET B 1 309 ? 59.200 57.995 27.807 1.00   27.57 ? 308  MET B CB  1 
ATOM   4862 C CG  . MET B 1 309 ? 60.371 57.741 28.756 1.00   29.91 ? 308  MET B CG  1 
ATOM   4863 S SD  . MET B 1 309 ? 60.000 57.701 30.541 1.00   37.20 ? 308  MET B SD  1 
ATOM   4864 C CE  . MET B 1 309 ? 58.808 58.907 30.670 1.00   37.73 ? 308  MET B CE  1 
ATOM   4865 N N   . ARG B 1 310 ? 57.424 56.779 25.511 1.00   28.63 ? 309  ARG B N   1 
ATOM   4866 C CA  . ARG B 1 310 ? 56.594 57.035 24.340 1.00   29.68 ? 309  ARG B CA  1 
ATOM   4867 C C   . ARG B 1 310 ? 55.225 56.395 24.518 1.00   31.29 ? 309  ARG B C   1 
ATOM   4868 O O   . ARG B 1 310 ? 54.185 56.976 24.230 1.00   30.47 ? 309  ARG B O   1 
ATOM   4869 C CB  . ARG B 1 310 ? 57.313 56.544 23.072 1.00   29.97 ? 309  ARG B CB  1 
ATOM   4870 C CG  . ARG B 1 310 ? 58.655 57.266 22.868 1.00   28.55 ? 309  ARG B CG  1 
ATOM   4871 C CD  . ARG B 1 310 ? 59.573 56.784 21.754 1.00   30.91 ? 309  ARG B CD  1 
ATOM   4872 N NE  . ARG B 1 310 ? 58.919 56.686 20.460 1.00   30.23 ? 309  ARG B NE  1 
ATOM   4873 C CZ  . ARG B 1 310 ? 59.541 56.535 19.294 1.00   29.78 ? 309  ARG B CZ  1 
ATOM   4874 N NH1 . ARG B 1 310 ? 60.867 56.444 19.229 1.00   31.58 ? 309  ARG B NH1 1 
ATOM   4875 N NH2 . ARG B 1 310 ? 58.825 56.472 18.175 1.00   28.22 ? 309  ARG B NH2 1 
ATOM   4876 N N   . ARG B 1 311 ? 55.217 55.193 25.053 1.00   33.06 ? 310  ARG B N   1 
ATOM   4877 C CA  . ARG B 1 311 ? 53.976 54.484 25.211 1.00   34.98 ? 310  ARG B CA  1 
ATOM   4878 C C   . ARG B 1 311 ? 53.139 55.089 26.376 1.00   37.01 ? 310  ARG B C   1 
ATOM   4879 O O   . ARG B 1 311 ? 51.930 54.883 26.432 1.00   38.34 ? 310  ARG B O   1 
ATOM   4880 C CB  . ARG B 1 311 ? 54.332 52.980 25.298 1.00   34.63 ? 310  ARG B CB  1 
ATOM   4881 C CG  . ARG B 1 311 ? 53.655 52.136 26.283 1.00   34.38 ? 310  ARG B CG  1 
ATOM   4882 C CD  . ARG B 1 311 ? 54.432 50.831 26.523 1.00   30.11 ? 310  ARG B CD  1 
ATOM   4883 N NE  . ARG B 1 311 ? 55.154 50.407 25.322 1.00   26.60 ? 310  ARG B NE  1 
ATOM   4884 C CZ  . ARG B 1 311 ? 56.446 50.094 25.264 1.00   24.14 ? 310  ARG B CZ  1 
ATOM   4885 N NH1 . ARG B 1 311 ? 57.221 50.127 26.339 1.00   23.18 ? 310  ARG B NH1 1 
ATOM   4886 N NH2 . ARG B 1 311 ? 56.975 49.742 24.098 1.00   23.32 ? 310  ARG B NH2 1 
ATOM   4887 N N   . ARG B 1 312 ? 53.755 55.914 27.230 1.00   39.70 ? 311  ARG B N   1 
ATOM   4888 C CA  . ARG B 1 312 ? 53.079 56.491 28.417 1.00   42.10 ? 311  ARG B CA  1 
ATOM   4889 C C   . ARG B 1 312 ? 52.436 57.876 28.197 1.00   43.90 ? 311  ARG B C   1 
ATOM   4890 O O   . ARG B 1 312 ? 51.403 58.193 28.789 1.00   44.43 ? 311  ARG B O   1 
ATOM   4891 C CB  . ARG B 1 312 ? 54.033 56.516 29.601 1.00   42.43 ? 311  ARG B CB  1 
ATOM   4892 C CG  . ARG B 1 312 ? 53.432 55.851 30.814 1.00   43.68 ? 311  ARG B CG  1 
ATOM   4893 C CD  . ARG B 1 312 ? 54.449 55.235 31.720 1.00   44.11 ? 311  ARG B CD  1 
ATOM   4894 N NE  . ARG B 1 312 ? 55.176 54.235 30.976 1.00   45.07 ? 311  ARG B NE  1 
ATOM   4895 C CZ  . ARG B 1 312 ? 54.893 52.943 30.970 1.00   44.13 ? 311  ARG B CZ  1 
ATOM   4896 N NH1 . ARG B 1 312 ? 53.911 52.463 31.711 1.00   45.81 ? 311  ARG B NH1 1 
ATOM   4897 N NH2 . ARG B 1 312 ? 55.609 52.128 30.223 1.00   41.48 ? 311  ARG B NH2 1 
ATOM   4898 N N   . LYS B 1 313 ? 53.153 58.740 27.497 1.00   45.81 ? 312  LYS B N   1 
ATOM   4899 C CA  . LYS B 1 313 ? 52.559 59.827 26.701 1.00   47.43 ? 312  LYS B CA  1 
ATOM   4900 C C   . LYS B 1 313 ? 53.744 60.724 26.416 1.00   48.50 ? 312  LYS B C   1 
ATOM   4901 O O   . LYS B 1 313 ? 54.881 60.297 26.580 1.00   48.87 ? 312  LYS B O   1 
ATOM   4902 C CB  . LYS B 1 313 ? 51.355 60.534 27.379 1.00   47.52 ? 312  LYS B CB  1 
ATOM   4903 C CG  . LYS B 1 313 ? 51.027 61.968 26.912 1.00   48.76 ? 312  LYS B CG  1 
ATOM   4904 C CD  . LYS B 1 313 ? 49.829 62.084 25.952 1.00   49.21 ? 312  LYS B CD  1 
ATOM   4905 C CE  . LYS B 1 313 ? 50.146 63.040 24.860 1.00   48.75 ? 312  LYS B CE  1 
ATOM   4906 N NZ  . LYS B 1 313 ? 51.223 63.939 25.326 1.00   49.62 ? 312  LYS B NZ  1 
ATOM   4907 N N   . ALA B 1 314 ? 53.500 61.898 25.861 1.00   49.73 ? 313  ALA B N   1 
ATOM   4908 C CA  . ALA B 1 314 ? 54.480 62.954 25.924 1.00   50.43 ? 313  ALA B CA  1 
ATOM   4909 C C   . ALA B 1 314 ? 55.037 63.867 24.864 1.00   50.93 ? 313  ALA B C   1 
ATOM   4910 O O   . ALA B 1 314 ? 55.587 64.863 25.321 1.00   51.41 ? 313  ALA B O   1 
ATOM   4911 C CB  . ALA B 1 314 ? 55.021 63.176 27.289 1.00   50.61 ? 313  ALA B CB  1 
ATOM   4912 O OXT . ALA B 1 314 ? 54.911 63.639 23.662 1.00   51.57 ? 313  ALA B OXT 1 
HETATM 4913 S S   . SO4 C 2 .   ? 27.850 42.613 22.518 1.00   52.49 ? 1314 SO4 A S   1 
HETATM 4914 O O1  . SO4 C 2 .   ? 27.861 44.013 22.969 1.00   50.34 ? 1314 SO4 A O1  1 
HETATM 4915 O O2  . SO4 C 2 .   ? 26.516 42.038 22.687 1.00   51.09 ? 1314 SO4 A O2  1 
HETATM 4916 O O3  . SO4 C 2 .   ? 28.221 42.584 21.100 1.00   50.92 ? 1314 SO4 A O3  1 
HETATM 4917 O O4  . SO4 C 2 .   ? 28.800 41.832 23.310 1.00   52.31 ? 1314 SO4 A O4  1 
HETATM 4918 S S   . SO4 D 2 .   ? 48.550 33.316 36.534 1.00   32.60 ? 1315 SO4 A S   1 
HETATM 4919 O O1  . SO4 D 2 .   ? 47.591 33.825 35.561 1.00   32.66 ? 1315 SO4 A O1  1 
HETATM 4920 O O2  . SO4 D 2 .   ? 47.961 33.353 37.864 1.00   34.16 ? 1315 SO4 A O2  1 
HETATM 4921 O O3  . SO4 D 2 .   ? 48.871 31.934 36.216 1.00   28.51 ? 1315 SO4 A O3  1 
HETATM 4922 O O4  . SO4 D 2 .   ? 49.748 34.183 36.466 1.00   32.45 ? 1315 SO4 A O4  1 
HETATM 4923 S S   . SO4 E 2 .   ? 30.158 23.302 22.908 1.00   49.69 ? 1316 SO4 A S   1 
HETATM 4924 O O1  . SO4 E 2 .   ? 30.298 23.935 24.216 1.00   44.30 ? 1316 SO4 A O1  1 
HETATM 4925 O O2  . SO4 E 2 .   ? 31.422 22.672 22.534 1.00   48.07 ? 1316 SO4 A O2  1 
HETATM 4926 O O3  . SO4 E 2 .   ? 29.128 22.266 22.977 1.00   48.29 ? 1316 SO4 A O3  1 
HETATM 4927 O O4  . SO4 E 2 .   ? 29.794 24.313 21.919 1.00   49.03 ? 1316 SO4 A O4  1 
HETATM 4928 S S   . SO4 F 2 .   ? 4.868  59.788 55.946 1.00   50.87 ? 1317 SO4 A S   1 
HETATM 4929 O O1  . SO4 F 2 .   ? 5.337  59.862 57.329 1.00   48.85 ? 1317 SO4 A O1  1 
HETATM 4930 O O2  . SO4 F 2 .   ? 3.914  58.691 55.826 1.00   49.95 ? 1317 SO4 A O2  1 
HETATM 4931 O O3  . SO4 F 2 .   ? 4.228  61.048 55.590 1.00   50.86 ? 1317 SO4 A O3  1 
HETATM 4932 O O4  . SO4 F 2 .   ? 6.004  59.574 55.048 1.00   50.85 ? 1317 SO4 A O4  1 
HETATM 4933 S S   . SO4 G 2 .   ? 38.425 32.538 21.225 1.00   51.94 ? 1314 SO4 B S   1 
HETATM 4934 O O1  . SO4 G 2 .   ? 37.116 33.015 20.767 1.00   51.58 ? 1314 SO4 B O1  1 
HETATM 4935 O O2  . SO4 G 2 .   ? 38.759 33.226 22.470 1.00   52.35 ? 1314 SO4 B O2  1 
HETATM 4936 O O3  . SO4 G 2 .   ? 38.387 31.088 21.482 1.00   49.99 ? 1314 SO4 B O3  1 
HETATM 4937 O O4  . SO4 G 2 .   ? 39.428 32.815 20.220 1.00   50.45 ? 1314 SO4 B O4  1 
HETATM 4938 S S   . SO4 H 2 .   ? 82.051 58.965 2.078  1.00   47.22 ? 1315 SO4 B S   1 
HETATM 4939 O O1  . SO4 H 2 .   ? 82.691 60.252 2.336  1.00   46.32 ? 1315 SO4 B O1  1 
HETATM 4940 O O2  . SO4 H 2 .   ? 80.782 58.896 2.804  1.00   46.59 ? 1315 SO4 B O2  1 
HETATM 4941 O O3  . SO4 H 2 .   ? 81.843 58.816 0.640  1.00   45.17 ? 1315 SO4 B O3  1 
HETATM 4942 O O4  . SO4 H 2 .   ? 82.944 57.900 2.529  1.00   46.43 ? 1315 SO4 B O4  1 
HETATM 4943 O O   . HOH I 3 .   ? 10.124 52.753 69.196 1.00   44.13 ? 2001 HOH A O   1 
HETATM 4944 O O   . HOH I 3 .   ? 10.503 54.326 64.855 1.00   37.50 ? 2002 HOH A O   1 
HETATM 4945 O O   . HOH I 3 .   ? 11.451 52.609 65.806 1.00   32.91 ? 2003 HOH A O   1 
HETATM 4946 O O   . HOH I 3 .   ? 7.100  50.245 68.319 1.00   45.64 ? 2004 HOH A O   1 
HETATM 4947 O O   . HOH I 3 .   ? 13.496 45.156 62.952 1.00   32.61 ? 2005 HOH A O   1 
HETATM 4948 O O   . HOH I 3 .   ? 15.105 48.226 65.877 1.00   37.36 ? 2006 HOH A O   1 
HETATM 4949 O O   . HOH I 3 .   ? 10.774 47.708 66.346 1.00   31.91 ? 2007 HOH A O   1 
HETATM 4950 O O   . HOH I 3 .   ? 15.974 40.602 64.251 1.00   42.41 ? 2008 HOH A O   1 
HETATM 4951 O O   . HOH I 3 .   ? 22.870 38.421 46.106 1.00   25.07 ? 2009 HOH A O   1 
HETATM 4952 O O   . HOH I 3 .   ? 27.963 39.884 52.623 1.00   28.87 ? 2010 HOH A O   1 
HETATM 4953 O O   . HOH I 3 .   ? 24.511 34.160 48.479 1.00   38.65 ? 2011 HOH A O   1 
HETATM 4954 O O   . HOH I 3 .   ? 26.253 32.466 47.945 1.00   41.95 ? 2012 HOH A O   1 
HETATM 4955 O O   . HOH I 3 .   ? 21.853 36.138 45.196 1.00   34.86 ? 2013 HOH A O   1 
HETATM 4956 O O   . HOH I 3 .   ? 30.772 40.525 52.262 1.00   28.22 ? 2014 HOH A O   1 
HETATM 4957 O O   . HOH I 3 .   ? 34.330 36.306 52.674 1.00   50.78 ? 2015 HOH A O   1 
HETATM 4958 O O   . HOH I 3 .   ? 31.811 33.500 49.225 1.00   46.99 ? 2016 HOH A O   1 
HETATM 4959 O O   . HOH I 3 .   ? 31.357 34.531 51.138 1.00   58.73 ? 2017 HOH A O   1 
HETATM 4960 O O   . HOH I 3 .   ? 34.209 39.166 51.753 1.00   50.51 ? 2018 HOH A O   1 
HETATM 4961 O O   . HOH I 3 .   ? 28.296 39.339 55.485 1.00   28.10 ? 2019 HOH A O   1 
HETATM 4962 O O   . HOH I 3 .   ? 22.614 33.766 46.472 1.00   39.19 ? 2020 HOH A O   1 
HETATM 4963 O O   . HOH I 3 .   ? 31.975 42.016 54.004 1.00   44.49 ? 2021 HOH A O   1 
HETATM 4964 O O   . HOH I 3 .   ? 23.415 32.162 44.520 1.00   32.15 ? 2022 HOH A O   1 
HETATM 4965 O O   . HOH I 3 .   ? 33.193 40.569 56.066 1.00   39.23 ? 2023 HOH A O   1 
HETATM 4966 O O   . HOH I 3 .   ? 12.756 62.851 58.065 1.00   48.82 ? 2024 HOH A O   1 
HETATM 4967 O O   . HOH I 3 .   ? 17.473 33.477 53.081 1.00   50.67 ? 2025 HOH A O   1 
HETATM 4968 O O   . HOH I 3 .   ? 19.476 32.701 50.019 1.00   48.66 ? 2026 HOH A O   1 
HETATM 4969 O O   . HOH I 3 .   ? 26.891 37.877 57.181 1.00   30.89 ? 2027 HOH A O   1 
HETATM 4970 O O   . HOH I 3 .   ? 23.264 32.582 50.884 1.00   31.17 ? 2028 HOH A O   1 
HETATM 4971 O O   . HOH I 3 .   ? 26.500 42.559 58.923 1.00   25.20 ? 2029 HOH A O   1 
HETATM 4972 O O   . HOH I 3 .   ? 28.713 57.090 53.618 1.00   52.37 ? 2030 HOH A O   1 
HETATM 4973 O O   . HOH I 3 .   ? 12.723 59.903 59.545 1.00   46.00 ? 2031 HOH A O   1 
HETATM 4974 O O   . HOH I 3 .   ? 3.661  50.947 56.264 1.00   46.95 ? 2032 HOH A O   1 
HETATM 4975 O O   . HOH I 3 .   ? 20.217 37.895 62.070 1.00   51.69 ? 2033 HOH A O   1 
HETATM 4976 O O   . HOH I 3 .   ? 22.836 40.350 60.525 1.00   20.70 ? 2034 HOH A O   1 
HETATM 4977 O O   . HOH I 3 .   ? 14.996 35.981 60.103 1.00   38.39 ? 2035 HOH A O   1 
HETATM 4978 O O   . HOH I 3 .   ? 23.746 43.093 58.678 1.00   32.48 ? 2036 HOH A O   1 
HETATM 4979 O O   . HOH I 3 .   ? 11.670 59.657 53.569 1.00   48.75 ? 2037 HOH A O   1 
HETATM 4980 O O   . HOH I 3 .   ? 21.557 57.934 43.837 1.00   46.50 ? 2038 HOH A O   1 
HETATM 4981 O O   . HOH I 3 .   ? 16.169 42.299 63.181 1.00   49.29 ? 2039 HOH A O   1 
HETATM 4982 O O   . HOH I 3 .   ? 17.922 50.796 62.071 1.00   20.42 ? 2040 HOH A O   1 
HETATM 4983 O O   . HOH I 3 .   ? 26.529 56.515 52.870 1.00   44.82 ? 2041 HOH A O   1 
HETATM 4984 O O   . HOH I 3 .   ? 11.455 56.424 59.683 1.00   36.72 ? 2042 HOH A O   1 
HETATM 4985 O O   . HOH I 3 .   ? 17.808 56.292 61.010 1.00   39.26 ? 2043 HOH A O   1 
HETATM 4986 O O   . HOH I 3 .   ? 14.871 58.148 60.373 1.00   45.08 ? 2044 HOH A O   1 
HETATM 4987 O O   . HOH I 3 .   ? 31.343 53.373 53.061 1.00   39.66 ? 2045 HOH A O   1 
HETATM 4988 O O   . HOH I 3 .   ? 35.040 50.992 54.949 1.00   45.74 ? 2046 HOH A O   1 
HETATM 4989 O O   . HOH I 3 .   ? 28.535 41.711 56.789 1.00   38.65 ? 2047 HOH A O   1 
HETATM 4990 O O   . HOH I 3 .   ? 36.329 43.387 51.559 1.00   49.81 ? 2048 HOH A O   1 
HETATM 4991 O O   . HOH I 3 .   ? 9.411  51.363 54.212 1.00   27.15 ? 2049 HOH A O   1 
HETATM 4992 O O   . HOH I 3 .   ? 5.932  52.631 56.159 1.00   53.80 ? 2050 HOH A O   1 
HETATM 4993 O O   . HOH I 3 .   ? 35.081 55.418 44.281 1.00   56.39 ? 2051 HOH A O   1 
HETATM 4994 O O   . HOH I 3 .   ? 45.364 46.460 39.048 1.00   57.63 ? 2052 HOH A O   1 
HETATM 4995 O O   . HOH I 3 .   ? 9.850  58.074 53.826 1.00   41.18 ? 2053 HOH A O   1 
HETATM 4996 O O   . HOH I 3 .   ? 38.749 54.255 40.354 1.00   50.64 ? 2054 HOH A O   1 
HETATM 4997 O O   . HOH I 3 .   ? 21.083 53.163 43.230 1.00   40.27 ? 2055 HOH A O   1 
HETATM 4998 O O   . HOH I 3 .   ? 24.257 55.753 39.239 1.00   37.97 ? 2056 HOH A O   1 
HETATM 4999 O O   . HOH I 3 .   ? 17.298 57.866 58.843 1.00   45.88 ? 2057 HOH A O   1 
HETATM 5000 O O   . HOH I 3 .   ? 20.457 52.515 39.337 1.00   34.41 ? 2058 HOH A O   1 
HETATM 5001 O O   . HOH I 3 .   ? 9.221  56.531 35.813 1.00   48.05 ? 2059 HOH A O   1 
HETATM 5002 O O   . HOH I 3 .   ? 14.108 61.230 51.808 1.00   58.73 ? 2060 HOH A O   1 
HETATM 5003 O O   . HOH I 3 .   ? 18.159 40.167 35.623 1.00   27.50 ? 2061 HOH A O   1 
HETATM 5004 O O   . HOH I 3 .   ? 21.056 35.703 39.840 1.00   35.43 ? 2062 HOH A O   1 
HETATM 5005 O O   . HOH I 3 .   ? 21.694 25.267 24.922 1.00   59.83 ? 2063 HOH A O   1 
HETATM 5006 O O   . HOH I 3 .   ? 20.799 28.038 25.901 1.00   60.45 ? 2064 HOH A O   1 
HETATM 5007 O O   . HOH I 3 .   ? 11.057 35.353 45.271 1.00   48.42 ? 2065 HOH A O   1 
HETATM 5008 O O   . HOH I 3 .   ? 8.305  36.275 47.805 1.00   52.74 ? 2066 HOH A O   1 
HETATM 5009 O O   . HOH I 3 .   ? 22.992 56.620 47.210 1.00   46.74 ? 2067 HOH A O   1 
HETATM 5010 O O   . HOH I 3 .   ? 20.657 56.644 46.052 1.00   61.26 ? 2068 HOH A O   1 
HETATM 5011 O O   . HOH I 3 .   ? 12.605 39.097 32.635 1.00   50.68 ? 2069 HOH A O   1 
HETATM 5012 O O   . HOH I 3 .   ? 19.570 56.772 55.842 1.00   33.99 ? 2070 HOH A O   1 
HETATM 5013 O O   . HOH I 3 .   ? 21.054 54.569 55.877 1.00   21.43 ? 2071 HOH A O   1 
HETATM 5014 O O   . HOH I 3 .   ? 16.119 38.402 34.806 1.00   42.45 ? 2072 HOH A O   1 
HETATM 5015 O O   . HOH I 3 .   ? 14.760 53.548 39.071 1.00   58.98 ? 2073 HOH A O   1 
HETATM 5016 O O   . HOH I 3 .   ? 19.192 53.627 41.089 1.00   45.53 ? 2074 HOH A O   1 
HETATM 5017 O O   . HOH I 3 .   ? 31.183 16.191 39.419 1.00   45.00 ? 2075 HOH A O   1 
HETATM 5018 O O   . HOH I 3 .   ? 21.509 57.781 52.894 1.00   53.54 ? 2076 HOH A O   1 
HETATM 5019 O O   . HOH I 3 .   ? 25.238 53.189 48.864 1.00   49.63 ? 2077 HOH A O   1 
HETATM 5020 O O   . HOH I 3 .   ? 26.669 53.959 51.393 1.00   30.60 ? 2078 HOH A O   1 
HETATM 5021 O O   . HOH I 3 .   ? 7.318  59.416 50.357 1.00   44.58 ? 2079 HOH A O   1 
HETATM 5022 O O   . HOH I 3 .   ? 29.274 14.952 38.485 1.00   46.48 ? 2080 HOH A O   1 
HETATM 5023 O O   . HOH I 3 .   ? 27.928 52.538 58.916 1.00   37.89 ? 2081 HOH A O   1 
HETATM 5024 O O   . HOH I 3 .   ? 31.878 51.861 55.709 1.00   35.25 ? 2082 HOH A O   1 
HETATM 5025 O O   . HOH I 3 .   ? 14.120 33.865 55.875 1.00   49.74 ? 2083 HOH A O   1 
HETATM 5026 O O   . HOH I 3 .   ? 30.563 43.382 55.841 1.00   34.36 ? 2084 HOH A O   1 
HETATM 5027 O O   . HOH I 3 .   ? 13.831 35.677 48.455 1.00   52.72 ? 2085 HOH A O   1 
HETATM 5028 O O   . HOH I 3 .   ? 33.612 44.164 53.124 1.00   30.30 ? 2086 HOH A O   1 
HETATM 5029 O O   . HOH I 3 .   ? 6.455  47.064 7.516  1.00   54.59 ? 2087 HOH A O   1 
HETATM 5030 O O   . HOH I 3 .   ? 35.622 47.249 51.719 1.00   36.26 ? 2088 HOH A O   1 
HETATM 5031 O O   . HOH I 3 .   ? 29.331 53.144 51.229 1.00   27.37 ? 2089 HOH A O   1 
HETATM 5032 O O   . HOH I 3 .   ? 29.075 44.015 29.780 1.00   31.92 ? 2090 HOH A O   1 
HETATM 5033 O O   . HOH I 3 .   ? 39.901 45.998 26.697 1.00   46.20 ? 2091 HOH A O   1 
HETATM 5034 O O   . HOH I 3 .   ? 33.756 45.931 23.302 1.00   57.61 ? 2092 HOH A O   1 
HETATM 5035 O O   . HOH I 3 .   ? 30.606 56.377 46.464 1.00   44.60 ? 2093 HOH A O   1 
HETATM 5036 O O   . HOH I 3 .   ? 36.211 54.066 46.097 1.00   43.64 ? 2094 HOH A O   1 
HETATM 5037 O O   . HOH I 3 .   ? 49.398 41.681 35.774 1.00   49.05 ? 2095 HOH A O   1 
HETATM 5038 O O   . HOH I 3 .   ? 42.825 48.695 40.380 1.00   45.78 ? 2096 HOH A O   1 
HETATM 5039 O O   . HOH I 3 .   ? 21.885 29.828 26.763 1.00   39.29 ? 2097 HOH A O   1 
HETATM 5040 O O   . HOH I 3 .   ? 17.378 30.544 28.388 1.00   45.38 ? 2098 HOH A O   1 
HETATM 5041 O O   . HOH I 3 .   ? 37.799 52.645 44.440 1.00   41.38 ? 2099 HOH A O   1 
HETATM 5042 O O   . HOH I 3 .   ? 36.155 53.252 40.900 1.00   32.99 ? 2100 HOH A O   1 
HETATM 5043 O O   . HOH I 3 .   ? 24.751 54.290 43.651 1.00   33.42 ? 2101 HOH A O   1 
HETATM 5044 O O   . HOH I 3 .   ? 23.246 52.241 42.595 1.00   31.55 ? 2102 HOH A O   1 
HETATM 5045 O O   . HOH I 3 .   ? 23.947 53.467 38.315 1.00   28.98 ? 2103 HOH A O   1 
HETATM 5046 O O   . HOH I 3 .   ? 20.866 50.156 41.160 1.00   44.80 ? 2104 HOH A O   1 
HETATM 5047 O O   . HOH I 3 .   ? 11.587 55.093 36.732 1.00   48.08 ? 2105 HOH A O   1 
HETATM 5048 O O   . HOH I 3 .   ? 30.170 30.873 46.680 1.00   38.15 ? 2106 HOH A O   1 
HETATM 5049 O O   . HOH I 3 .   ? 35.081 31.560 47.222 1.00   51.46 ? 2107 HOH A O   1 
HETATM 5050 O O   . HOH I 3 .   ? 14.802 57.073 35.102 1.00   49.77 ? 2108 HOH A O   1 
HETATM 5051 O O   . HOH I 3 .   ? 22.087 38.193 34.255 1.00   30.41 ? 2109 HOH A O   1 
HETATM 5052 O O   . HOH I 3 .   ? 22.011 36.305 34.311 1.00   37.51 ? 2110 HOH A O   1 
HETATM 5053 O O   . HOH I 3 .   ? 19.803 40.024 37.636 1.00   28.68 ? 2111 HOH A O   1 
HETATM 5054 O O   . HOH I 3 .   ? 16.207 38.205 43.675 1.00   45.48 ? 2112 HOH A O   1 
HETATM 5055 O O   . HOH I 3 .   ? 18.373 36.844 40.096 1.00   35.12 ? 2113 HOH A O   1 
HETATM 5056 O O   . HOH I 3 .   ? 23.056 18.821 29.774 1.00   49.05 ? 2114 HOH A O   1 
HETATM 5057 O O   . HOH I 3 .   ? 24.089 26.497 26.166 1.00   53.66 ? 2115 HOH A O   1 
HETATM 5058 O O   . HOH I 3 .   ? 22.569 22.906 26.604 1.00   49.54 ? 2116 HOH A O   1 
HETATM 5059 O O   . HOH I 3 .   ? 20.062 35.602 31.905 1.00   34.81 ? 2117 HOH A O   1 
HETATM 5060 O O   . HOH I 3 .   ? 7.137  47.836 43.084 1.00   37.06 ? 2118 HOH A O   1 
HETATM 5061 O O   . HOH I 3 .   ? 24.960 27.786 22.696 1.00   51.99 ? 2119 HOH A O   1 
HETATM 5062 O O   . HOH I 3 .   ? 10.919 38.497 46.115 1.00   41.64 ? 2120 HOH A O   1 
HETATM 5063 O O   . HOH I 3 .   ? 4.930  37.122 43.513 1.00   49.35 ? 2121 HOH A O   1 
HETATM 5064 O O   . HOH I 3 .   ? -2.265 40.960 38.392 1.00   47.29 ? 2122 HOH A O   1 
HETATM 5065 O O   . HOH I 3 .   ? 13.366 36.290 36.072 1.00   47.01 ? 2123 HOH A O   1 
HETATM 5066 O O   . HOH I 3 .   ? 44.622 33.224 29.507 1.00   40.56 ? 2124 HOH A O   1 
HETATM 5067 O O   . HOH I 3 .   ? 45.981 30.912 30.445 1.00   32.56 ? 2125 HOH A O   1 
HETATM 5068 O O   . HOH I 3 .   ? 10.400 37.541 32.981 1.00   31.33 ? 2126 HOH A O   1 
HETATM 5069 O O   . HOH I 3 .   ? 10.466 44.710 37.002 1.00   28.74 ? 2127 HOH A O   1 
HETATM 5070 O O   . HOH I 3 .   ? 13.462 38.542 35.100 1.00   25.97 ? 2128 HOH A O   1 
HETATM 5071 O O   . HOH I 3 .   ? 31.654 21.731 50.811 1.00   63.78 ? 2129 HOH A O   1 
HETATM 5072 O O   . HOH I 3 .   ? 56.008 30.016 47.905 1.00   50.38 ? 2130 HOH A O   1 
HETATM 5073 O O   . HOH I 3 .   ? 18.115 43.190 36.029 1.00   17.68 ? 2131 HOH A O   1 
HETATM 5074 O O   . HOH I 3 .   ? 46.937 15.289 39.400 1.00   46.53 ? 2132 HOH A O   1 
HETATM 5075 O O   . HOH I 3 .   ? 51.200 26.654 49.961 1.00   51.67 ? 2133 HOH A O   1 
HETATM 5076 O O   . HOH I 3 .   ? 17.947 48.876 43.682 1.00   20.58 ? 2134 HOH A O   1 
HETATM 5077 O O   . HOH I 3 .   ? 16.406 51.253 41.220 1.00   31.28 ? 2135 HOH A O   1 
HETATM 5078 O O   . HOH I 3 .   ? 9.846  48.657 38.871 1.00   37.21 ? 2136 HOH A O   1 
HETATM 5079 O O   . HOH I 3 .   ? 15.897 54.713 41.301 1.00   38.42 ? 2137 HOH A O   1 
HETATM 5080 O O   . HOH I 3 .   ? 13.936 56.431 42.812 1.00   33.46 ? 2138 HOH A O   1 
HETATM 5081 O O   . HOH I 3 .   ? 33.604 17.271 40.069 1.00   47.66 ? 2139 HOH A O   1 
HETATM 5082 O O   . HOH I 3 .   ? 33.806 18.857 38.318 1.00   39.45 ? 2140 HOH A O   1 
HETATM 5083 O O   . HOH I 3 .   ? 30.205 18.777 40.051 1.00   45.29 ? 2141 HOH A O   1 
HETATM 5084 O O   . HOH I 3 .   ? 8.231  49.830 42.099 1.00   48.26 ? 2142 HOH A O   1 
HETATM 5085 O O   . HOH I 3 .   ? 4.364  54.802 56.210 1.00   41.20 ? 2143 HOH A O   1 
HETATM 5086 O O   . HOH I 3 .   ? 7.116  56.026 48.709 1.00   36.14 ? 2144 HOH A O   1 
HETATM 5087 O O   . HOH I 3 .   ? 29.940 12.786 36.236 1.00   35.55 ? 2145 HOH A O   1 
HETATM 5088 O O   . HOH I 3 .   ? 6.118  57.589 50.328 1.00   46.64 ? 2146 HOH A O   1 
HETATM 5089 O O   . HOH I 3 .   ? 37.038 17.438 27.799 1.00   51.07 ? 2147 HOH A O   1 
HETATM 5090 O O   . HOH I 3 .   ? 32.569 15.719 37.425 1.00   42.43 ? 2148 HOH A O   1 
HETATM 5091 O O   . HOH I 3 .   ? 42.144 4.777  41.485 1.00   49.15 ? 2149 HOH A O   1 
HETATM 5092 O O   . HOH I 3 .   ? 44.599 15.106 39.773 1.00   57.37 ? 2150 HOH A O   1 
HETATM 5093 O O   . HOH I 3 .   ? 41.207 14.126 29.825 1.00   42.24 ? 2151 HOH A O   1 
HETATM 5094 O O   . HOH I 3 .   ? 49.773 18.756 36.499 1.00   35.47 ? 2152 HOH A O   1 
HETATM 5095 O O   . HOH I 3 .   ? 53.253 23.008 36.441 1.00   45.57 ? 2153 HOH A O   1 
HETATM 5096 O O   . HOH I 3 .   ? 2.645  38.057 49.834 1.00   50.79 ? 2154 HOH A O   1 
HETATM 5097 O O   . HOH I 3 .   ? 59.948 26.436 43.637 1.00   44.95 ? 2155 HOH A O   1 
HETATM 5098 O O   . HOH I 3 .   ? 48.718 42.577 38.168 1.00   46.40 ? 2156 HOH A O   1 
HETATM 5099 O O   . HOH I 3 .   ? 48.696 38.964 34.420 1.00   55.30 ? 2157 HOH A O   1 
HETATM 5100 O O   . HOH I 3 .   ? 51.308 41.937 37.580 1.00   49.83 ? 2158 HOH A O   1 
HETATM 5101 O O   . HOH I 3 .   ? 9.185  39.812 63.630 1.00   48.55 ? 2159 HOH A O   1 
HETATM 5102 O O   . HOH I 3 .   ? 12.262 37.545 60.815 1.00   45.84 ? 2160 HOH A O   1 
HETATM 5103 O O   . HOH I 3 .   ? 10.893 36.091 53.929 1.00   47.63 ? 2161 HOH A O   1 
HETATM 5104 O O   . HOH I 3 .   ? 42.890 37.127 30.513 1.00   33.05 ? 2162 HOH A O   1 
HETATM 5105 O O   . HOH I 3 .   ? 10.400 39.326 51.070 1.00   31.51 ? 2163 HOH A O   1 
HETATM 5106 O O   . HOH I 3 .   ? 14.327 34.999 53.593 1.00   45.75 ? 2164 HOH A O   1 
HETATM 5107 O O   . HOH I 3 .   ? 46.505 42.259 30.908 1.00   51.11 ? 2165 HOH A O   1 
HETATM 5108 O O   . HOH I 3 .   ? 40.178 42.969 27.015 1.00   48.79 ? 2166 HOH A O   1 
HETATM 5109 O O   . HOH I 3 .   ? 36.478 34.383 25.359 1.00   54.61 ? 2167 HOH A O   1 
HETATM 5110 O O   . HOH I 3 .   ? 36.591 41.290 22.170 1.00   50.70 ? 2168 HOH A O   1 
HETATM 5111 O O   . HOH I 3 .   ? 36.886 45.510 24.016 1.00   54.71 ? 2169 HOH A O   1 
HETATM 5112 O O   . HOH I 3 .   ? 19.839 33.044 47.553 1.00   36.68 ? 2170 HOH A O   1 
HETATM 5113 O O   . HOH I 3 .   ? 14.850 38.851 47.134 1.00   39.25 ? 2171 HOH A O   1 
HETATM 5114 O O   . HOH I 3 .   ? 26.304 40.345 46.076 1.00   15.00 ? 2172 HOH A O   1 
HETATM 5115 O O   . HOH I 3 .   ? 15.533 35.870 32.296 1.00   57.80 ? 2173 HOH A O   1 
HETATM 5116 O O   . HOH I 3 .   ? 22.209 41.697 37.113 1.00   22.14 ? 2174 HOH A O   1 
HETATM 5117 O O   . HOH I 3 .   ? 22.849 45.769 32.959 1.00   14.10 ? 2175 HOH A O   1 
HETATM 5118 O O   . HOH I 3 .   ? -0.993 35.989 16.222 1.00   53.62 ? 2176 HOH A O   1 
HETATM 5119 O O   . HOH I 3 .   ? 16.762 41.234 13.213 1.00   33.74 ? 2177 HOH A O   1 
HETATM 5120 O O   . HOH I 3 .   ? 0.958  41.595 16.975 1.00   49.97 ? 2178 HOH A O   1 
HETATM 5121 O O   . HOH I 3 .   ? 14.978 44.682 11.535 1.00   31.86 ? 2179 HOH A O   1 
HETATM 5122 O O   . HOH I 3 .   ? 8.646  45.862 9.528  1.00   48.99 ? 2180 HOH A O   1 
HETATM 5123 O O   . HOH I 3 .   ? 12.884 46.451 10.678 1.00   33.54 ? 2181 HOH A O   1 
HETATM 5124 O O   . HOH I 3 .   ? -0.202 46.228 13.465 1.00   59.16 ? 2182 HOH A O   1 
HETATM 5125 O O   . HOH I 3 .   ? 27.284 49.544 32.813 1.00   13.89 ? 2183 HOH A O   1 
HETATM 5126 O O   . HOH I 3 .   ? 31.442 44.583 29.669 1.00   29.10 ? 2184 HOH A O   1 
HETATM 5127 O O   . HOH I 3 .   ? 37.271 46.499 27.820 1.00   61.23 ? 2185 HOH A O   1 
HETATM 5128 O O   . HOH I 3 .   ? 34.529 49.626 26.079 1.00   32.88 ? 2186 HOH A O   1 
HETATM 5129 O O   . HOH I 3 .   ? 33.718 46.463 26.643 1.00   46.48 ? 2187 HOH A O   1 
HETATM 5130 O O   . HOH I 3 .   ? 42.493 46.163 30.509 1.00   45.73 ? 2188 HOH A O   1 
HETATM 5131 O O   . HOH I 3 .   ? 39.468 44.221 32.248 1.00   21.44 ? 2189 HOH A O   1 
HETATM 5132 O O   . HOH I 3 .   ? 47.438 44.573 35.171 1.00   47.70 ? 2190 HOH A O   1 
HETATM 5133 O O   . HOH I 3 .   ? 46.125 41.405 35.649 1.00   47.29 ? 2191 HOH A O   1 
HETATM 5134 O O   . HOH I 3 .   ? 41.183 46.080 39.310 1.00   39.52 ? 2192 HOH A O   1 
HETATM 5135 O O   . HOH I 3 .   ? 42.097 43.691 31.668 1.00   40.04 ? 2193 HOH A O   1 
HETATM 5136 O O   . HOH I 3 .   ? 43.369 47.785 31.802 1.00   56.28 ? 2194 HOH A O   1 
HETATM 5137 O O   . HOH I 3 .   ? 12.801 34.191 29.181 1.00   47.61 ? 2195 HOH A O   1 
HETATM 5138 O O   . HOH I 3 .   ? 11.736 32.607 27.656 1.00   59.05 ? 2196 HOH A O   1 
HETATM 5139 O O   . HOH I 3 .   ? 20.009 31.379 28.242 1.00   35.61 ? 2197 HOH A O   1 
HETATM 5140 O O   . HOH I 3 .   ? 24.058 29.073 20.387 1.00   30.48 ? 2198 HOH A O   1 
HETATM 5141 O O   . HOH I 3 .   ? 22.990 30.098 24.306 1.00   48.79 ? 2199 HOH A O   1 
HETATM 5142 O O   . HOH I 3 .   ? 30.816 38.927 22.341 1.00   46.20 ? 2200 HOH A O   1 
HETATM 5143 O O   . HOH I 3 .   ? 35.923 51.354 30.964 1.00   25.79 ? 2201 HOH A O   1 
HETATM 5144 O O   . HOH I 3 .   ? 34.460 52.128 38.832 1.00   25.12 ? 2202 HOH A O   1 
HETATM 5145 O O   . HOH I 3 .   ? 33.090 52.525 36.531 1.00   28.09 ? 2203 HOH A O   1 
HETATM 5146 O O   . HOH I 3 .   ? 25.316 30.534 13.474 1.00   49.23 ? 2204 HOH A O   1 
HETATM 5147 O O   . HOH I 3 .   ? 42.080 47.900 46.020 1.00   47.30 ? 2205 HOH A O   1 
HETATM 5148 O O   . HOH I 3 .   ? 38.557 49.965 49.832 1.00   52.67 ? 2206 HOH A O   1 
HETATM 5149 O O   . HOH I 3 .   ? 24.959 57.102 15.455 1.00   49.22 ? 2207 HOH A O   1 
HETATM 5150 O O   . HOH I 3 .   ? 18.228 56.510 27.772 1.00   49.37 ? 2208 HOH A O   1 
HETATM 5151 O O   . HOH I 3 .   ? 38.673 39.271 47.849 1.00   42.59 ? 2209 HOH A O   1 
HETATM 5152 O O   . HOH I 3 .   ? 44.322 42.818 48.819 1.00   61.24 ? 2210 HOH A O   1 
HETATM 5153 O O   . HOH I 3 .   ? 40.108 43.309 51.237 1.00   60.93 ? 2211 HOH A O   1 
HETATM 5154 O O   . HOH I 3 .   ? 39.644 47.546 48.585 1.00   30.70 ? 2212 HOH A O   1 
HETATM 5155 O O   . HOH I 3 .   ? 7.467  54.791 30.400 1.00   51.39 ? 2213 HOH A O   1 
HETATM 5156 O O   . HOH I 3 .   ? 37.479 46.647 49.362 1.00   33.49 ? 2214 HOH A O   1 
HETATM 5157 O O   . HOH I 3 .   ? 43.045 42.361 42.051 1.00   38.18 ? 2215 HOH A O   1 
HETATM 5158 O O   . HOH I 3 .   ? 39.680 40.786 43.141 1.00   32.51 ? 2216 HOH A O   1 
HETATM 5159 O O   . HOH I 3 .   ? 13.807 49.133 10.544 1.00   35.04 ? 2217 HOH A O   1 
HETATM 5160 O O   . HOH I 3 .   ? 17.858 48.707 12.111 1.00   25.90 ? 2218 HOH A O   1 
HETATM 5161 O O   . HOH I 3 .   ? 9.449  54.525 10.360 1.00   48.57 ? 2219 HOH A O   1 
HETATM 5162 O O   . HOH I 3 .   ? 9.912  57.815 12.321 1.00   41.07 ? 2220 HOH A O   1 
HETATM 5163 O O   . HOH I 3 .   ? 8.972  49.772 11.930 1.00   39.42 ? 2221 HOH A O   1 
HETATM 5164 O O   . HOH I 3 .   ? 29.768 32.104 43.071 1.00   31.31 ? 2222 HOH A O   1 
HETATM 5165 O O   . HOH I 3 .   ? 24.597 34.922 39.940 1.00   21.13 ? 2223 HOH A O   1 
HETATM 5166 O O   . HOH I 3 .   ? 27.401 40.509 43.490 1.00   14.20 ? 2224 HOH A O   1 
HETATM 5167 O O   . HOH I 3 .   ? 12.523 53.625 34.667 1.00   41.93 ? 2225 HOH A O   1 
HETATM 5168 O O   . HOH I 3 .   ? 9.585  53.890 37.606 1.00   45.58 ? 2226 HOH A O   1 
HETATM 5169 O O   . HOH I 3 .   ? 29.453 30.050 42.312 1.00   29.77 ? 2227 HOH A O   1 
HETATM 5170 O O   . HOH I 3 .   ? 32.256 29.886 45.766 1.00   31.79 ? 2228 HOH A O   1 
HETATM 5171 O O   . HOH I 3 .   ? 25.770 26.767 40.806 1.00   55.82 ? 2229 HOH A O   1 
HETATM 5172 O O   . HOH I 3 .   ? 14.833 54.198 35.643 1.00   37.65 ? 2230 HOH A O   1 
HETATM 5173 O O   . HOH I 3 .   ? 26.370 38.514 33.216 1.00   28.16 ? 2231 HOH A O   1 
HETATM 5174 O O   . HOH I 3 .   ? 22.985 37.282 38.827 1.00   27.60 ? 2232 HOH A O   1 
HETATM 5175 O O   . HOH I 3 .   ? 22.256 39.086 37.438 1.00   31.43 ? 2233 HOH A O   1 
HETATM 5176 O O   . HOH I 3 .   ? 23.860 36.647 33.018 1.00   54.96 ? 2234 HOH A O   1 
HETATM 5177 O O   . HOH I 3 .   ? 21.287 55.944 36.173 1.00   41.62 ? 2235 HOH A O   1 
HETATM 5178 O O   . HOH I 3 .   ? 27.987 27.928 31.536 1.00   16.44 ? 2236 HOH A O   1 
HETATM 5179 O O   . HOH I 3 .   ? 25.127 23.754 35.943 1.00   27.27 ? 2237 HOH A O   1 
HETATM 5180 O O   . HOH I 3 .   ? 23.096 33.098 38.266 1.00   26.62 ? 2238 HOH A O   1 
HETATM 5181 O O   . HOH I 3 .   ? 20.803 27.580 30.059 1.00   40.95 ? 2239 HOH A O   1 
HETATM 5182 O O   . HOH I 3 .   ? 22.612 21.182 32.302 1.00   36.08 ? 2240 HOH A O   1 
HETATM 5183 O O   . HOH I 3 .   ? 22.698 25.261 29.049 1.00   39.69 ? 2241 HOH A O   1 
HETATM 5184 O O   . HOH I 3 .   ? 24.851 27.515 28.407 1.00   34.89 ? 2242 HOH A O   1 
HETATM 5185 O O   . HOH I 3 .   ? 21.841 34.915 30.295 1.00   25.39 ? 2243 HOH A O   1 
HETATM 5186 O O   . HOH I 3 .   ? 27.384 27.321 21.453 1.00   39.10 ? 2244 HOH A O   1 
HETATM 5187 O O   . HOH I 3 .   ? 28.831 27.332 20.283 1.00   38.58 ? 2245 HOH A O   1 
HETATM 5188 O O   . HOH I 3 .   ? 32.578 27.128 21.705 1.00   24.74 ? 2246 HOH A O   1 
HETATM 5189 O O   . HOH I 3 .   ? 29.001 33.194 26.223 1.00   14.80 ? 2247 HOH A O   1 
HETATM 5190 O O   . HOH I 3 .   ? 41.516 24.163 29.609 1.00   15.52 ? 2248 HOH A O   1 
HETATM 5191 O O   . HOH I 3 .   ? 44.510 34.129 32.192 1.00   35.97 ? 2249 HOH A O   1 
HETATM 5192 O O   . HOH I 3 .   ? 47.112 30.738 33.338 1.00   36.29 ? 2250 HOH A O   1 
HETATM 5193 O O   . HOH I 3 .   ? 36.418 30.321 44.415 1.00   20.78 ? 2251 HOH A O   1 
HETATM 5194 O O   . HOH I 3 .   ? 48.668 27.271 42.638 1.00   17.87 ? 2252 HOH A O   1 
HETATM 5195 O O   . HOH I 3 .   ? 39.802 34.817 48.249 1.00   45.73 ? 2253 HOH A O   1 
HETATM 5196 O O   . HOH I 3 .   ? 33.736 24.201 50.958 1.00   50.44 ? 2254 HOH A O   1 
HETATM 5197 O O   . HOH I 3 .   ? 37.360 21.952 50.413 1.00   45.43 ? 2255 HOH A O   1 
HETATM 5198 O O   . HOH I 3 .   ? 44.196 25.112 50.932 1.00   33.44 ? 2256 HOH A O   1 
HETATM 5199 O O   . HOH I 3 .   ? 54.152 30.859 45.479 1.00   34.93 ? 2257 HOH A O   1 
HETATM 5200 O O   . HOH I 3 .   ? 49.636 16.828 40.229 1.00   47.95 ? 2258 HOH A O   1 
HETATM 5201 O O   . HOH I 3 .   ? 52.411 24.997 47.419 1.00   40.19 ? 2259 HOH A O   1 
HETATM 5202 O O   . HOH I 3 .   ? 46.561 16.640 43.693 1.00   35.12 ? 2260 HOH A O   1 
HETATM 5203 O O   . HOH I 3 .   ? 37.390 12.882 48.424 1.00   56.85 ? 2261 HOH A O   1 
HETATM 5204 O O   . HOH I 3 .   ? 39.562 19.618 49.905 1.00   45.97 ? 2262 HOH A O   1 
HETATM 5205 O O   . HOH I 3 .   ? 34.533 13.627 48.620 1.00   52.13 ? 2263 HOH A O   1 
HETATM 5206 O O   . HOH I 3 .   ? 35.905 18.615 47.817 1.00   39.81 ? 2264 HOH A O   1 
HETATM 5207 O O   . HOH I 3 .   ? 34.432 19.217 41.342 1.00   65.31 ? 2265 HOH A O   1 
HETATM 5208 O O   . HOH I 3 .   ? 34.925 26.936 44.145 1.00   39.54 ? 2266 HOH A O   1 
HETATM 5209 O O   . HOH I 3 .   ? 31.039 18.611 43.186 1.00   63.70 ? 2267 HOH A O   1 
HETATM 5210 O O   . HOH I 3 .   ? 30.807 26.536 43.648 1.00   38.24 ? 2268 HOH A O   1 
HETATM 5211 O O   . HOH I 3 .   ? 27.226 22.370 38.116 1.00   50.73 ? 2269 HOH A O   1 
HETATM 5212 O O   . HOH I 3 .   ? 25.101 25.043 43.530 1.00   44.65 ? 2270 HOH A O   1 
HETATM 5213 O O   . HOH I 3 .   ? 28.517 27.923 43.700 1.00   38.06 ? 2271 HOH A O   1 
HETATM 5214 O O   . HOH I 3 .   ? 33.419 27.274 41.846 1.00   23.61 ? 2272 HOH A O   1 
HETATM 5215 O O   . HOH I 3 .   ? 34.544 27.220 39.152 1.00   14.82 ? 2273 HOH A O   1 
HETATM 5216 O O   . HOH I 3 .   ? 33.821 26.516 35.371 1.00   12.22 ? 2274 HOH A O   1 
HETATM 5217 O O   . HOH I 3 .   ? 32.087 20.638 39.204 1.00   28.10 ? 2275 HOH A O   1 
HETATM 5218 O O   . HOH I 3 .   ? 25.182 22.189 24.949 1.00   38.38 ? 2276 HOH A O   1 
HETATM 5219 O O   . HOH I 3 .   ? 25.755 18.792 27.790 1.00   35.30 ? 2277 HOH A O   1 
HETATM 5220 O O   . HOH I 3 .   ? 27.584 26.590 29.277 1.00   23.50 ? 2278 HOH A O   1 
HETATM 5221 O O   . HOH I 3 .   ? 32.378 14.213 31.866 1.00   26.32 ? 2279 HOH A O   1 
HETATM 5222 O O   . HOH I 3 .   ? 26.806 14.257 35.638 1.00   38.90 ? 2280 HOH A O   1 
HETATM 5223 O O   . HOH I 3 .   ? 28.772 15.456 23.636 1.00   26.22 ? 2281 HOH A O   1 
HETATM 5224 O O   . HOH I 3 .   ? 36.967 20.071 25.786 1.00   33.94 ? 2282 HOH A O   1 
HETATM 5225 O O   . HOH I 3 .   ? 35.859 8.488  26.582 1.00   39.86 ? 2283 HOH A O   1 
HETATM 5226 O O   . HOH I 3 .   ? 36.145 7.674  28.971 1.00   40.89 ? 2284 HOH A O   1 
HETATM 5227 O O   . HOH I 3 .   ? 34.642 11.729 26.826 1.00   42.06 ? 2285 HOH A O   1 
HETATM 5228 O O   . HOH I 3 .   ? 32.092 13.666 35.992 1.00   32.56 ? 2286 HOH A O   1 
HETATM 5229 O O   . HOH I 3 .   ? 38.160 7.710  34.090 1.00   62.74 ? 2287 HOH A O   1 
HETATM 5230 O O   . HOH I 3 .   ? 38.229 8.124  37.114 1.00   46.81 ? 2288 HOH A O   1 
HETATM 5231 O O   . HOH I 3 .   ? 41.933 7.161  40.110 1.00   54.82 ? 2289 HOH A O   1 
HETATM 5232 O O   . HOH I 3 .   ? 42.302 13.489 39.992 1.00   45.30 ? 2290 HOH A O   1 
HETATM 5233 O O   . HOH I 3 .   ? 31.530 45.040 20.444 1.00   38.81 ? 2291 HOH A O   1 
HETATM 5234 O O   . HOH I 3 .   ? 42.034 14.204 32.879 1.00   27.04 ? 2292 HOH A O   1 
HETATM 5235 O O   . HOH I 3 .   ? 37.264 15.496 42.254 1.00   36.36 ? 2293 HOH A O   1 
HETATM 5236 O O   . HOH I 3 .   ? 44.317 16.714 42.012 1.00   34.34 ? 2294 HOH A O   1 
HETATM 5237 O O   . HOH I 3 .   ? 46.755 10.479 35.194 1.00   60.60 ? 2295 HOH A O   1 
HETATM 5238 O O   . HOH I 3 .   ? 46.880 17.420 36.930 1.00   33.68 ? 2296 HOH A O   1 
HETATM 5239 O O   . HOH I 3 .   ? 40.522 16.312 28.471 1.00   35.09 ? 2297 HOH A O   1 
HETATM 5240 O O   . HOH I 3 .   ? 50.618 22.385 34.782 1.00   27.26 ? 2298 HOH A O   1 
HETATM 5241 O O   . HOH I 3 .   ? 53.205 27.622 38.951 1.00   39.15 ? 2299 HOH A O   1 
HETATM 5242 O O   . HOH I 3 .   ? 49.766 29.388 32.635 1.00   19.05 ? 2300 HOH A O   1 
HETATM 5243 O O   . HOH I 3 .   ? 52.934 29.610 35.417 1.00   30.92 ? 2301 HOH A O   1 
HETATM 5244 O O   . HOH I 3 .   ? 55.808 24.811 39.465 1.00   51.99 ? 2302 HOH A O   1 
HETATM 5245 O O   . HOH I 3 .   ? 56.354 26.149 42.048 1.00   70.76 ? 2303 HOH A O   1 
HETATM 5246 O O   . HOH I 3 .   ? 55.816 30.927 42.664 1.00   57.81 ? 2304 HOH A O   1 
HETATM 5247 O O   . HOH I 3 .   ? 47.635 40.453 38.634 1.00   41.30 ? 2305 HOH A O   1 
HETATM 5248 O O   . HOH I 3 .   ? 50.733 39.787 37.040 1.00   39.53 ? 2306 HOH A O   1 
HETATM 5249 O O   . HOH I 3 .   ? 46.627 35.688 49.083 1.00   48.11 ? 2307 HOH A O   1 
HETATM 5250 O O   . HOH I 3 .   ? 39.510 36.305 53.349 1.00   52.29 ? 2308 HOH A O   1 
HETATM 5251 O O   . HOH I 3 .   ? 40.488 36.724 50.031 1.00   54.01 ? 2309 HOH A O   1 
HETATM 5252 O O   . HOH I 3 .   ? 41.486 43.537 45.502 1.00   35.60 ? 2310 HOH A O   1 
HETATM 5253 O O   . HOH I 3 .   ? 47.068 41.151 45.848 1.00   36.91 ? 2311 HOH A O   1 
HETATM 5254 O O   . HOH I 3 .   ? 49.464 37.838 42.893 1.00   32.75 ? 2312 HOH A O   1 
HETATM 5255 O O   . HOH I 3 .   ? 38.389 39.524 45.301 1.00   38.16 ? 2313 HOH A O   1 
HETATM 5256 O O   . HOH I 3 .   ? 36.891 32.705 46.269 1.00   39.50 ? 2314 HOH A O   1 
HETATM 5257 O O   . HOH I 3 .   ? 42.803 36.105 33.053 1.00   24.09 ? 2315 HOH A O   1 
HETATM 5258 O O   . HOH I 3 .   ? 44.996 39.707 38.391 1.00   41.58 ? 2316 HOH A O   1 
HETATM 5259 O O   . HOH I 3 .   ? 33.497 28.781 37.000 1.00   17.92 ? 2317 HOH A O   1 
HETATM 5260 O O   . HOH I 3 .   ? 45.723 40.265 31.019 1.00   41.09 ? 2318 HOH A O   1 
HETATM 5261 O O   . HOH I 3 .   ? 39.035 40.590 29.301 1.00   25.42 ? 2319 HOH A O   1 
HETATM 5262 O O   . HOH I 3 .   ? 37.150 34.571 27.305 1.00   32.02 ? 2320 HOH A O   1 
HETATM 5263 O O   . HOH I 3 .   ? 32.009 39.981 26.058 1.00   33.41 ? 2321 HOH A O   1 
HETATM 5264 O O   . HOH I 3 .   ? 32.998 42.711 28.384 1.00   44.71 ? 2322 HOH A O   1 
HETATM 5265 O O   . HOH I 3 .   ? 41.013 39.564 26.175 1.00   38.04 ? 2323 HOH A O   1 
HETATM 5266 O O   . HOH I 3 .   ? 37.403 42.819 24.851 1.00   43.07 ? 2324 HOH A O   1 
HETATM 5267 O O   . HOH I 3 .   ? 37.991 43.359 27.169 1.00   43.32 ? 2325 HOH A O   1 
HETATM 5268 O O   . HOH I 3 .   ? 33.854 34.807 23.492 1.00   33.09 ? 2326 HOH A O   1 
HETATM 5269 O O   . HOH I 3 .   ? 30.770 32.978 24.221 1.00   19.72 ? 2327 HOH A O   1 
HETATM 5270 O O   . HOH I 3 .   ? 33.522 33.803 18.686 1.00   32.50 ? 2328 HOH A O   1 
HETATM 5271 O O   . HOH I 3 .   ? 31.460 30.638 21.119 1.00   46.50 ? 2329 HOH A O   1 
HETATM 5272 O O   . HOH I 3 .   ? 29.797 36.066 18.725 1.00   32.54 ? 2330 HOH A O   1 
HETATM 5273 O O   . HOH I 3 .   ? 32.831 31.623 23.920 1.00   29.78 ? 2331 HOH A O   1 
HETATM 5274 O O   . HOH I 3 .   ? 32.066 31.540 18.721 1.00   35.83 ? 2332 HOH A O   1 
HETATM 5275 O O   . HOH I 3 .   ? 29.892 31.237 18.436 1.00   34.30 ? 2333 HOH A O   1 
HETATM 5276 O O   . HOH I 3 .   ? 33.214 43.722 32.870 1.00   19.73 ? 2334 HOH A O   1 
HETATM 5277 O O   . HOH I 3 .   ? 28.180 42.424 27.366 1.00   26.18 ? 2335 HOH A O   1 
HETATM 5278 O O   . HOH I 3 .   ? 29.758 40.036 26.547 1.00   33.25 ? 2336 HOH A O   1 
HETATM 5279 O O   . HOH I 3 .   ? 26.706 44.726 30.476 1.00   15.19 ? 2337 HOH A O   1 
HETATM 5280 O O   . HOH I 3 .   ? 23.683 36.865 30.295 1.00   20.08 ? 2338 HOH A O   1 
HETATM 5281 O O   . HOH I 3 .   ? 23.658 39.754 32.982 1.00   35.04 ? 2339 HOH A O   1 
HETATM 5282 O O   . HOH I 3 .   ? 20.895 43.312 35.374 1.00   14.02 ? 2340 HOH A O   1 
HETATM 5283 O O   . HOH I 3 .   ? 19.473 40.297 33.185 1.00   28.75 ? 2341 HOH A O   1 
HETATM 5284 O O   . HOH I 3 .   ? 18.864 37.894 30.970 1.00   25.77 ? 2342 HOH A O   1 
HETATM 5285 O O   . HOH I 3 .   ? 13.596 38.043 30.468 1.00   40.22 ? 2343 HOH A O   1 
HETATM 5286 O O   . HOH I 3 .   ? 16.469 39.139 31.633 1.00   40.59 ? 2344 HOH A O   1 
HETATM 5287 O O   . HOH I 3 .   ? 10.048 41.024 27.034 1.00   34.49 ? 2345 HOH A O   1 
HETATM 5288 O O   . HOH I 3 .   ? 11.332 38.318 28.252 1.00   32.39 ? 2346 HOH A O   1 
HETATM 5289 O O   . HOH I 3 .   ? 6.915  38.402 23.618 1.00   52.55 ? 2347 HOH A O   1 
HETATM 5290 O O   . HOH I 3 .   ? 2.095  33.585 21.073 1.00   53.01 ? 2348 HOH A O   1 
HETATM 5291 O O   . HOH I 3 .   ? 0.325  35.129 19.143 1.00   60.16 ? 2349 HOH A O   1 
HETATM 5292 O O   . HOH I 3 .   ? 4.317  41.746 15.849 1.00   46.52 ? 2350 HOH A O   1 
HETATM 5293 O O   . HOH I 3 .   ? 14.318 42.444 12.968 1.00   31.50 ? 2351 HOH A O   1 
HETATM 5294 O O   . HOH I 3 .   ? 14.474 40.473 11.092 1.00   32.83 ? 2352 HOH A O   1 
HETATM 5295 O O   . HOH I 3 .   ? 10.579 44.211 11.520 1.00   31.35 ? 2353 HOH A O   1 
HETATM 5296 O O   . HOH I 3 .   ? 2.001  48.732 14.939 1.00   61.75 ? 2354 HOH A O   1 
HETATM 5297 O O   . HOH I 3 .   ? 13.641 38.357 10.913 1.00   35.94 ? 2355 HOH A O   1 
HETATM 5298 O O   . HOH I 3 .   ? 12.143 42.200 9.877  1.00   31.76 ? 2356 HOH A O   1 
HETATM 5299 O O   . HOH I 3 .   ? 4.222  36.184 16.344 1.00   45.01 ? 2357 HOH A O   1 
HETATM 5300 O O   . HOH I 3 .   ? 12.542 33.845 15.130 1.00   28.43 ? 2358 HOH A O   1 
HETATM 5301 O O   . HOH I 3 .   ? 8.920  33.706 14.993 1.00   33.16 ? 2359 HOH A O   1 
HETATM 5302 O O   . HOH I 3 .   ? 11.129 35.739 21.559 1.00   26.77 ? 2360 HOH A O   1 
HETATM 5303 O O   . HOH I 3 .   ? 29.168 50.469 22.191 1.00   27.69 ? 2361 HOH A O   1 
HETATM 5304 O O   . HOH I 3 .   ? 26.106 38.428 22.987 1.00   17.88 ? 2362 HOH A O   1 
HETATM 5305 O O   . HOH I 3 .   ? 17.889 39.081 15.057 1.00   31.59 ? 2363 HOH A O   1 
HETATM 5306 O O   . HOH I 3 .   ? 20.130 32.588 13.640 1.00   42.56 ? 2364 HOH A O   1 
HETATM 5307 O O   . HOH I 3 .   ? 14.978 34.948 13.288 1.00   44.96 ? 2365 HOH A O   1 
HETATM 5308 O O   . HOH I 3 .   ? 17.226 38.762 12.104 1.00   37.06 ? 2366 HOH A O   1 
HETATM 5309 O O   . HOH I 3 .   ? 16.412 33.732 11.681 1.00   41.32 ? 2367 HOH A O   1 
HETATM 5310 O O   . HOH I 3 .   ? 19.474 29.847 22.190 1.00   34.72 ? 2368 HOH A O   1 
HETATM 5311 O O   . HOH I 3 .   ? 16.621 31.620 15.868 1.00   34.65 ? 2369 HOH A O   1 
HETATM 5312 O O   . HOH I 3 .   ? 15.459 35.105 28.185 1.00   40.69 ? 2370 HOH A O   1 
HETATM 5313 O O   . HOH I 3 .   ? 17.219 35.004 29.929 1.00   36.23 ? 2371 HOH A O   1 
HETATM 5314 O O   . HOH I 3 .   ? 13.555 34.065 26.721 1.00   50.81 ? 2372 HOH A O   1 
HETATM 5315 O O   . HOH I 3 .   ? 22.263 30.407 21.938 1.00   24.04 ? 2373 HOH A O   1 
HETATM 5316 O O   . HOH I 3 .   ? 16.221 31.504 23.435 1.00   44.21 ? 2374 HOH A O   1 
HETATM 5317 O O   . HOH I 3 .   ? 19.886 33.920 28.382 1.00   26.32 ? 2375 HOH A O   1 
HETATM 5318 O O   . HOH I 3 .   ? 29.117 38.724 19.698 1.00   38.66 ? 2376 HOH A O   1 
HETATM 5319 O O   . HOH I 3 .   ? 21.424 36.079 17.021 1.00   17.17 ? 2377 HOH A O   1 
HETATM 5320 O O   . HOH I 3 .   ? 27.317 33.045 16.058 1.00   24.49 ? 2378 HOH A O   1 
HETATM 5321 O O   . HOH I 3 .   ? 22.012 35.190 10.129 1.00   26.55 ? 2379 HOH A O   1 
HETATM 5322 O O   . HOH I 3 .   ? 25.233 35.859 13.837 1.00   19.54 ? 2380 HOH A O   1 
HETATM 5323 O O   . HOH I 3 .   ? 22.454 32.449 13.857 1.00   26.17 ? 2381 HOH A O   1 
HETATM 5324 O O   . HOH I 3 .   ? 22.224 49.669 14.125 1.00   27.09 ? 2382 HOH A O   1 
HETATM 5325 O O   . HOH I 3 .   ? 24.695 46.202 13.860 1.00   22.15 ? 2383 HOH A O   1 
HETATM 5326 O O   . HOH I 3 .   ? 25.698 48.565 14.532 1.00   24.86 ? 2384 HOH A O   1 
HETATM 5327 O O   . HOH I 3 .   ? 23.357 58.731 23.148 1.00   29.88 ? 2385 HOH A O   1 
HETATM 5328 O O   . HOH I 3 .   ? 30.237 53.016 20.653 1.00   33.78 ? 2386 HOH A O   1 
HETATM 5329 O O   . HOH I 3 .   ? 27.796 51.966 14.726 1.00   39.66 ? 2387 HOH A O   1 
HETATM 5330 O O   . HOH I 3 .   ? 23.905 53.201 14.976 1.00   50.05 ? 2388 HOH A O   1 
HETATM 5331 O O   . HOH I 3 .   ? 22.652 56.271 14.949 1.00   31.22 ? 2389 HOH A O   1 
HETATM 5332 O O   . HOH I 3 .   ? 18.708 61.598 24.139 1.00   48.87 ? 2390 HOH A O   1 
HETATM 5333 O O   . HOH I 3 .   ? 16.703 66.274 15.922 1.00   51.56 ? 2391 HOH A O   1 
HETATM 5334 O O   . HOH I 3 .   ? 18.206 57.141 25.295 1.00   63.73 ? 2392 HOH A O   1 
HETATM 5335 O O   . HOH I 3 .   ? 14.988 63.977 15.936 1.00   40.20 ? 2393 HOH A O   1 
HETATM 5336 O O   . HOH I 3 .   ? 12.354 59.649 27.934 1.00   51.29 ? 2394 HOH A O   1 
HETATM 5337 O O   . HOH I 3 .   ? 16.951 61.251 24.842 1.00   58.32 ? 2395 HOH A O   1 
HETATM 5338 O O   . HOH I 3 .   ? 8.761  55.408 27.647 1.00   48.67 ? 2396 HOH A O   1 
HETATM 5339 O O   . HOH I 3 .   ? 7.050  55.738 26.046 1.00   54.33 ? 2397 HOH A O   1 
HETATM 5340 O O   . HOH I 3 .   ? 4.196  54.216 28.962 1.00   44.20 ? 2398 HOH A O   1 
HETATM 5341 O O   . HOH I 3 .   ? -4.279 52.196 24.926 1.00   48.51 ? 2399 HOH A O   1 
HETATM 5342 O O   . HOH I 3 .   ? -1.155 52.756 21.919 1.00   64.17 ? 2400 HOH A O   1 
HETATM 5343 O O   . HOH I 3 .   ? 1.650  41.899 19.587 1.00   52.62 ? 2401 HOH A O   1 
HETATM 5344 O O   . HOH I 3 .   ? 6.989  53.103 21.279 1.00   34.42 ? 2402 HOH A O   1 
HETATM 5345 O O   . HOH I 3 .   ? 4.086  50.694 14.847 1.00   44.91 ? 2403 HOH A O   1 
HETATM 5346 O O   . HOH I 3 .   ? 26.435 57.525 10.673 1.00   47.34 ? 2404 HOH A O   1 
HETATM 5347 O O   . HOH I 3 .   ? 24.154 59.382 7.870  1.00   45.84 ? 2405 HOH A O   1 
HETATM 5348 O O   . HOH I 3 .   ? 24.594 62.307 12.026 1.00   63.90 ? 2406 HOH A O   1 
HETATM 5349 O O   . HOH I 3 .   ? 24.618 60.695 9.564  1.00   46.13 ? 2407 HOH A O   1 
HETATM 5350 O O   . HOH I 3 .   ? 23.811 62.946 4.990  1.00   57.89 ? 2408 HOH A O   1 
HETATM 5351 O O   . HOH I 3 .   ? 24.857 58.764 2.727  1.00   55.25 ? 2409 HOH A O   1 
HETATM 5352 O O   . HOH I 3 .   ? 16.109 50.712 11.189 1.00   26.39 ? 2410 HOH A O   1 
HETATM 5353 O O   . HOH I 3 .   ? 11.387 57.053 8.555  1.00   45.94 ? 2411 HOH A O   1 
HETATM 5354 O O   . HOH I 3 .   ? 10.385 51.964 11.441 1.00   35.89 ? 2412 HOH A O   1 
HETATM 5355 O O   . HOH I 3 .   ? 11.971 56.169 11.165 1.00   32.41 ? 2413 HOH A O   1 
HETATM 5356 O O   . HOH I 3 .   ? 10.313 45.607 13.705 1.00   27.76 ? 2414 HOH A O   1 
HETATM 5357 O O   . HOH I 3 .   ? 11.027 48.327 13.164 1.00   26.86 ? 2415 HOH A O   1 
HETATM 5358 O O   . HOH I 3 .   ? 7.217  55.267 12.460 1.00   59.29 ? 2416 HOH A O   1 
HETATM 5359 O O   . HOH I 3 .   ? 6.968  40.972 27.622 1.00   47.23 ? 2417 HOH A O   1 
HETATM 5360 O O   . HOH I 3 .   ? 1.404  42.725 31.784 1.00   31.69 ? 2418 HOH A O   1 
HETATM 5361 O O   . HOH I 3 .   ? 2.204  42.214 34.725 1.00   46.92 ? 2419 HOH A O   1 
HETATM 5362 O O   . HOH I 3 .   ? 1.796  49.878 35.802 1.00   61.42 ? 2420 HOH A O   1 
HETATM 5363 O O   . HOH I 3 .   ? 5.766  51.672 38.779 1.00   49.50 ? 2421 HOH A O   1 
HETATM 5364 O O   . HOH I 3 .   ? 10.930 51.609 34.510 1.00   31.49 ? 2422 HOH A O   1 
HETATM 5365 O O   . HOH I 3 .   ? 13.918 49.991 39.761 1.00   59.26 ? 2423 HOH A O   1 
HETATM 5366 O O   . HOH I 3 .   ? 17.901 52.992 35.663 1.00   34.42 ? 2424 HOH A O   1 
HETATM 5367 O O   . HOH I 3 .   ? 23.107 54.287 36.154 1.00   37.81 ? 2425 HOH A O   1 
HETATM 5368 O O   . HOH I 3 .   ? 26.962 51.098 30.320 1.00   15.85 ? 2426 HOH A O   1 
HETATM 5369 O O   . HOH I 3 .   ? 25.495 46.403 32.240 1.00   13.48 ? 2427 HOH A O   1 
HETATM 5370 O O   . HOH I 3 .   ? 19.208 59.805 32.219 1.00   52.93 ? 2428 HOH A O   1 
HETATM 5371 O O   . HOH I 3 .   ? 23.381 60.523 29.908 1.00   47.33 ? 2429 HOH A O   1 
HETATM 5372 O O   . HOH I 3 .   ? 30.129 55.328 34.450 1.00   21.37 ? 2430 HOH A O   1 
HETATM 5373 O O   . HOH I 3 .   ? 31.645 61.525 34.031 1.00   34.22 ? 2431 HOH A O   1 
HETATM 5374 O O   . HOH I 3 .   ? 27.060 57.192 38.333 1.00   42.62 ? 2432 HOH A O   1 
HETATM 5375 O O   . HOH I 3 .   ? 31.210 56.731 38.670 1.00   42.43 ? 2433 HOH A O   1 
HETATM 5376 O O   . HOH I 3 .   ? 27.423 61.266 37.382 1.00   42.91 ? 2434 HOH A O   1 
HETATM 5377 O O   . HOH I 3 .   ? 30.545 52.697 35.614 1.00   24.94 ? 2435 HOH A O   1 
HETATM 5378 O O   . HOH I 3 .   ? 33.747 52.143 22.557 1.00   28.71 ? 2436 HOH A O   1 
HETATM 5379 O O   . HOH I 3 .   ? 27.456 66.210 28.657 1.00   24.57 ? 2437 HOH A O   1 
HETATM 5380 O O   . HOH I 3 .   ? 29.491 62.861 33.102 1.00   35.68 ? 2438 HOH A O   1 
HETATM 5381 O O   . HOH I 3 .   ? 28.672 45.493 21.435 1.00   32.54 ? 2439 HOH A O   1 
HETATM 5382 O O   . HOH I 3 .   ? 27.733 43.638 18.717 1.00   22.80 ? 2440 HOH A O   1 
HETATM 5383 O O   . HOH I 3 .   ? 51.291 31.237 34.850 1.00   47.01 ? 2441 HOH A O   1 
HETATM 5384 O O   . HOH I 3 .   ? 47.083 35.473 33.120 1.00   45.63 ? 2442 HOH A O   1 
HETATM 5385 O O   . HOH I 3 .   ? 34.161 22.770 22.058 1.00   40.64 ? 2443 HOH A O   1 
HETATM 5386 O O   . HOH I 3 .   ? 32.844 23.539 20.211 1.00   44.21 ? 2444 HOH A O   1 
HETATM 5387 O O   . HOH J 3 .   ? 76.756 53.822 -3.739 1.00   37.87 ? 2001 HOH B O   1 
HETATM 5388 O O   . HOH J 3 .   ? 71.870 48.513 -8.518 1.00   29.86 ? 2002 HOH B O   1 
HETATM 5389 O O   . HOH J 3 .   ? 68.872 34.199 -4.462 1.00   37.08 ? 2003 HOH B O   1 
HETATM 5390 O O   . HOH J 3 .   ? 64.510 37.422 10.832 1.00   23.00 ? 2004 HOH B O   1 
HETATM 5391 O O   . HOH J 3 .   ? 59.116 38.901 4.649  1.00   28.65 ? 2005 HOH B O   1 
HETATM 5392 O O   . HOH J 3 .   ? 62.924 32.970 7.585  1.00   37.62 ? 2006 HOH B O   1 
HETATM 5393 O O   . HOH J 3 .   ? 65.363 35.198 11.714 1.00   34.33 ? 2007 HOH B O   1 
HETATM 5394 O O   . HOH J 3 .   ? 56.512 39.496 4.924  1.00   34.96 ? 2008 HOH B O   1 
HETATM 5395 O O   . HOH J 3 .   ? 59.063 38.805 1.547  1.00   30.48 ? 2009 HOH B O   1 
HETATM 5396 O O   . HOH J 3 .   ? 55.173 41.089 3.362  1.00   59.01 ? 2010 HOH B O   1 
HETATM 5397 O O   . HOH J 3 .   ? 68.657 32.043 6.587  1.00   47.78 ? 2011 HOH B O   1 
HETATM 5398 O O   . HOH J 3 .   ? 60.453 37.517 -0.177 1.00   26.34 ? 2012 HOH B O   1 
HETATM 5399 O O   . HOH J 3 .   ? 70.357 33.246 3.828  1.00   55.75 ? 2013 HOH B O   1 
HETATM 5400 O O   . HOH J 3 .   ? 64.455 31.793 6.071  1.00   39.27 ? 2014 HOH B O   1 
HETATM 5401 O O   . HOH J 3 .   ? 60.560 42.154 -1.768 1.00   28.79 ? 2015 HOH B O   1 
HETATM 5402 O O   . HOH J 3 .   ? 58.355 57.933 8.323  1.00   40.77 ? 2016 HOH B O   1 
HETATM 5403 O O   . HOH J 3 .   ? 57.716 56.069 4.103  1.00   44.87 ? 2017 HOH B O   1 
HETATM 5404 O O   . HOH J 3 .   ? 68.949 59.397 -5.414 1.00   42.68 ? 2018 HOH B O   1 
HETATM 5405 O O   . HOH J 3 .   ? 71.419 37.753 -5.935 1.00   49.02 ? 2019 HOH B O   1 
HETATM 5406 O O   . HOH J 3 .   ? 63.351 42.800 -1.828 1.00   34.03 ? 2020 HOH B O   1 
HETATM 5407 O O   . HOH J 3 .   ? 64.351 40.301 -3.424 1.00   27.37 ? 2021 HOH B O   1 
HETATM 5408 O O   . HOH J 3 .   ? 75.566 61.105 4.576  1.00   53.41 ? 2022 HOH B O   1 
HETATM 5409 O O   . HOH J 3 .   ? 61.614 56.707 11.602 1.00   54.97 ? 2023 HOH B O   1 
HETATM 5410 O O   . HOH J 3 .   ? 64.245 57.743 13.669 1.00   52.72 ? 2024 HOH B O   1 
HETATM 5411 O O   . HOH J 3 .   ? 64.049 60.206 12.893 1.00   54.13 ? 2025 HOH B O   1 
HETATM 5412 O O   . HOH J 3 .   ? 77.374 33.569 27.366 1.00   56.44 ? 2026 HOH B O   1 
HETATM 5413 O O   . HOH J 3 .   ? 69.471 35.316 21.734 1.00   49.47 ? 2027 HOH B O   1 
HETATM 5414 O O   . HOH J 3 .   ? 73.344 45.382 -5.633 1.00   38.77 ? 2028 HOH B O   1 
HETATM 5415 O O   . HOH J 3 .   ? 69.037 50.820 -4.498 1.00   20.94 ? 2029 HOH B O   1 
HETATM 5416 O O   . HOH J 3 .   ? 57.434 55.300 8.241  1.00   49.73 ? 2030 HOH B O   1 
HETATM 5417 O O   . HOH J 3 .   ? 60.112 55.303 4.831  1.00   39.54 ? 2031 HOH B O   1 
HETATM 5418 O O   . HOH J 3 .   ? 75.482 56.108 -2.534 1.00   31.49 ? 2032 HOH B O   1 
HETATM 5419 O O   . HOH J 3 .   ? 68.460 57.323 -3.370 1.00   46.37 ? 2033 HOH B O   1 
HETATM 5420 O O   . HOH J 3 .   ? 74.482 54.571 -6.128 1.00   28.97 ? 2034 HOH B O   1 
HETATM 5421 O O   . HOH J 3 .   ? 72.055 57.922 -2.910 1.00   44.18 ? 2035 HOH B O   1 
HETATM 5422 O O   . HOH J 3 .   ? 56.004 52.223 -0.153 1.00   50.32 ? 2036 HOH B O   1 
HETATM 5423 O O   . HOH J 3 .   ? 58.988 41.008 0.397  1.00   38.15 ? 2037 HOH B O   1 
HETATM 5424 O O   . HOH J 3 .   ? 58.358 48.560 -2.313 1.00   40.74 ? 2038 HOH B O   1 
HETATM 5425 O O   . HOH J 3 .   ? 77.800 51.053 3.312  1.00   35.07 ? 2039 HOH B O   1 
HETATM 5426 O O   . HOH J 3 .   ? 55.592 52.526 4.581  1.00   39.03 ? 2040 HOH B O   1 
HETATM 5427 O O   . HOH J 3 .   ? 50.535 51.532 0.962  1.00   48.30 ? 2041 HOH B O   1 
HETATM 5428 O O   . HOH J 3 .   ? 49.100 42.685 32.207 1.00   42.35 ? 2042 HOH B O   1 
HETATM 5429 O O   . HOH J 3 .   ? 68.918 58.204 -0.482 1.00   52.46 ? 2043 HOH B O   1 
HETATM 5430 O O   . HOH J 3 .   ? 73.155 61.392 6.159  1.00   56.69 ? 2044 HOH B O   1 
HETATM 5431 O O   . HOH J 3 .   ? 65.896 34.554 17.295 1.00   45.34 ? 2045 HOH B O   1 
HETATM 5432 O O   . HOH J 3 .   ? 67.441 34.237 13.765 1.00   43.97 ? 2046 HOH B O   1 
HETATM 5433 O O   . HOH J 3 .   ? 69.051 39.273 21.783 1.00   26.40 ? 2047 HOH B O   1 
HETATM 5434 O O   . HOH J 3 .   ? 81.618 46.447 16.080 1.00   49.42 ? 2048 HOH B O   1 
HETATM 5435 O O   . HOH J 3 .   ? 67.011 34.714 21.290 1.00   42.01 ? 2049 HOH B O   1 
HETATM 5436 O O   . HOH J 3 .   ? 58.727 26.919 37.127 1.00   49.54 ? 2050 HOH B O   1 
HETATM 5437 O O   . HOH J 3 .   ? 53.514 19.355 34.793 1.00   37.03 ? 2051 HOH B O   1 
HETATM 5438 O O   . HOH J 3 .   ? 63.458 58.230 10.865 1.00   64.25 ? 2052 HOH B O   1 
HETATM 5439 O O   . HOH J 3 .   ? 72.713 34.671 25.770 1.00   47.10 ? 2053 HOH B O   1 
HETATM 5440 O O   . HOH J 3 .   ? 78.258 36.401 26.520 1.00   42.75 ? 2054 HOH B O   1 
HETATM 5441 O O   . HOH J 3 .   ? 42.246 35.323 28.608 1.00   38.36 ? 2055 HOH B O   1 
HETATM 5442 O O   . HOH J 3 .   ? 44.788 35.463 28.687 1.00   42.72 ? 2056 HOH B O   1 
HETATM 5443 O O   . HOH J 3 .   ? 65.882 54.228 1.844  1.00   27.73 ? 2057 HOH B O   1 
HETATM 5444 O O   . HOH J 3 .   ? 67.483 56.405 1.816  1.00   43.06 ? 2058 HOH B O   1 
HETATM 5445 O O   . HOH J 3 .   ? 79.599 44.539 19.323 1.00   40.76 ? 2059 HOH B O   1 
HETATM 5446 O O   . HOH J 3 .   ? 71.037 37.274 22.313 1.00   35.89 ? 2060 HOH B O   1 
HETATM 5447 O O   . HOH J 3 .   ? 79.462 46.855 18.148 1.00   59.99 ? 2061 HOH B O   1 
HETATM 5448 O O   . HOH J 3 .   ? 49.727 9.653  11.498 1.00   46.41 ? 2062 HOH B O   1 
HETATM 5449 O O   . HOH J 3 .   ? 65.341 57.106 5.173  1.00   48.62 ? 2063 HOH B O   1 
HETATM 5450 O O   . HOH J 3 .   ? 63.793 55.467 10.637 1.00   36.33 ? 2064 HOH B O   1 
HETATM 5451 O O   . HOH J 3 .   ? 59.999 53.540 6.792  1.00   42.33 ? 2065 HOH B O   1 
HETATM 5452 O O   . HOH J 3 .   ? 61.687 53.157 8.940  1.00   40.39 ? 2066 HOH B O   1 
HETATM 5453 O O   . HOH J 3 .   ? 80.293 57.834 7.499  1.00   56.87 ? 2067 HOH B O   1 
HETATM 5454 O O   . HOH J 3 .   ? 82.207 44.104 19.237 1.00   44.13 ? 2068 HOH B O   1 
HETATM 5455 O O   . HOH J 3 .   ? 33.932 17.471 18.096 1.00   61.44 ? 2069 HOH B O   1 
HETATM 5456 O O   . HOH J 3 .   ? 59.520 56.254 -0.571 1.00   49.80 ? 2070 HOH B O   1 
HETATM 5457 O O   . HOH J 3 .   ? 58.996 53.114 -0.912 1.00   40.49 ? 2071 HOH B O   1 
HETATM 5458 O O   . HOH J 3 .   ? 65.315 53.834 -1.029 1.00   27.17 ? 2072 HOH B O   1 
HETATM 5459 O O   . HOH J 3 .   ? 54.021 44.272 1.573  1.00   40.67 ? 2073 HOH B O   1 
HETATM 5460 O O   . HOH J 3 .   ? 56.771 42.496 1.441  1.00   54.44 ? 2074 HOH B O   1 
HETATM 5461 O O   . HOH J 3 .   ? 60.446 48.625 -2.928 1.00   44.00 ? 2075 HOH B O   1 
HETATM 5462 O O   . HOH J 3 .   ? 60.031 28.058 40.215 1.00   59.64 ? 2076 HOH B O   1 
HETATM 5463 O O   . HOH J 3 .   ? 53.494 43.169 3.969  1.00   39.06 ? 2077 HOH B O   1 
HETATM 5464 O O   . HOH J 3 .   ? 51.168 46.565 5.843  1.00   33.84 ? 2078 HOH B O   1 
HETATM 5465 O O   . HOH J 3 .   ? 57.609 52.121 6.384  1.00   28.31 ? 2079 HOH B O   1 
HETATM 5466 O O   . HOH J 3 .   ? 56.298 42.761 29.296 1.00   59.88 ? 2080 HOH B O   1 
HETATM 5467 O O   . HOH J 3 .   ? 47.366 43.249 29.038 1.00   52.99 ? 2081 HOH B O   1 
HETATM 5468 O O   . HOH J 3 .   ? 53.158 45.869 33.775 1.00   60.30 ? 2082 HOH B O   1 
HETATM 5469 O O   . HOH J 3 .   ? 53.073 48.500 33.950 1.00   51.90 ? 2083 HOH B O   1 
HETATM 5470 O O   . HOH J 3 .   ? 55.906 45.104 37.072 1.00   45.42 ? 2084 HOH B O   1 
HETATM 5471 O O   . HOH J 3 .   ? 52.020 49.958 2.549  1.00   42.59 ? 2085 HOH B O   1 
HETATM 5472 O O   . HOH J 3 .   ? 48.146 48.932 5.161  1.00   68.44 ? 2086 HOH B O   1 
HETATM 5473 O O   . HOH J 3 .   ? 50.794 54.849 8.493  1.00   27.70 ? 2087 HOH B O   1 
HETATM 5474 O O   . HOH J 3 .   ? 56.600 55.087 10.759 1.00   33.47 ? 2088 HOH B O   1 
HETATM 5475 O O   . HOH J 3 .   ? 58.533 47.415 39.288 1.00   39.52 ? 2089 HOH B O   1 
HETATM 5476 O O   . HOH J 3 .   ? 62.633 27.321 34.832 1.00   43.32 ? 2090 HOH B O   1 
HETATM 5477 O O   . HOH J 3 .   ? 50.561 51.818 16.067 1.00   51.63 ? 2091 HOH B O   1 
HETATM 5478 O O   . HOH J 3 .   ? 51.137 39.750 7.602  1.00   33.35 ? 2092 HOH B O   1 
HETATM 5479 O O   . HOH J 3 .   ? 44.659 46.332 8.691  1.00   49.46 ? 2093 HOH B O   1 
HETATM 5480 O O   . HOH J 3 .   ? 63.712 51.150 15.106 1.00   33.66 ? 2094 HOH B O   1 
HETATM 5481 O O   . HOH J 3 .   ? 62.081 53.576 14.159 1.00   34.15 ? 2095 HOH B O   1 
HETATM 5482 O O   . HOH J 3 .   ? 59.645 54.990 10.806 1.00   44.48 ? 2096 HOH B O   1 
HETATM 5483 O O   . HOH J 3 .   ? 62.969 52.343 18.524 1.00   34.49 ? 2097 HOH B O   1 
HETATM 5484 O O   . HOH J 3 .   ? 76.266 59.368 41.550 1.00   46.63 ? 2098 HOH B O   1 
HETATM 5485 O O   . HOH J 3 .   ? 57.379 30.224 10.912 1.00   50.73 ? 2099 HOH B O   1 
HETATM 5486 O O   . HOH J 3 .   ? 66.743 49.403 14.809 1.00   33.42 ? 2100 HOH B O   1 
HETATM 5487 O O   . HOH J 3 .   ? 64.215 31.967 19.079 1.00   19.45 ? 2101 HOH B O   1 
HETATM 5488 O O   . HOH J 3 .   ? 64.346 33.433 15.288 1.00   40.51 ? 2102 HOH B O   1 
HETATM 5489 O O   . HOH J 3 .   ? 54.224 26.450 10.820 1.00   50.52 ? 2103 HOH B O   1 
HETATM 5490 O O   . HOH J 3 .   ? 51.753 29.977 11.058 1.00   36.11 ? 2104 HOH B O   1 
HETATM 5491 O O   . HOH J 3 .   ? 59.255 27.497 10.392 1.00   52.56 ? 2105 HOH B O   1 
HETATM 5492 O O   . HOH J 3 .   ? 65.128 37.063 23.801 1.00   26.03 ? 2106 HOH B O   1 
HETATM 5493 O O   . HOH J 3 .   ? 65.168 35.010 22.917 1.00   42.04 ? 2107 HOH B O   1 
HETATM 5494 O O   . HOH J 3 .   ? 67.379 38.965 19.669 1.00   33.84 ? 2108 HOH B O   1 
HETATM 5495 O O   . HOH J 3 .   ? 68.765 35.740 16.749 1.00   34.11 ? 2109 HOH B O   1 
HETATM 5496 O O   . HOH J 3 .   ? 67.877 36.771 18.326 1.00   34.18 ? 2110 HOH B O   1 
HETATM 5497 O O   . HOH J 3 .   ? 65.368 29.004 31.011 1.00   50.44 ? 2111 HOH B O   1 
HETATM 5498 O O   . HOH J 3 .   ? 79.925 46.956 14.394 1.00   33.06 ? 2112 HOH B O   1 
HETATM 5499 O O   . HOH J 3 .   ? 55.577 27.304 38.288 1.00   43.47 ? 2113 HOH B O   1 
HETATM 5500 O O   . HOH J 3 .   ? 55.347 21.967 35.237 1.00   40.59 ? 2114 HOH B O   1 
HETATM 5501 O O   . HOH J 3 .   ? 57.525 21.872 36.485 1.00   50.34 ? 2115 HOH B O   1 
HETATM 5502 O O   . HOH J 3 .   ? 76.389 38.221 10.979 1.00   38.54 ? 2116 HOH B O   1 
HETATM 5503 O O   . HOH J 3 .   ? 84.624 41.504 20.534 1.00   54.15 ? 2117 HOH B O   1 
HETATM 5504 O O   . HOH J 3 .   ? 87.116 37.052 22.216 1.00   39.55 ? 2118 HOH B O   1 
HETATM 5505 O O   . HOH J 3 .   ? 89.489 40.467 18.798 1.00   40.54 ? 2119 HOH B O   1 
HETATM 5506 O O   . HOH J 3 .   ? 75.549 35.359 24.183 1.00   64.31 ? 2120 HOH B O   1 
HETATM 5507 O O   . HOH J 3 .   ? 40.863 31.542 26.847 1.00   56.45 ? 2121 HOH B O   1 
HETATM 5508 O O   . HOH J 3 .   ? 42.531 33.039 28.180 1.00   36.64 ? 2122 HOH B O   1 
HETATM 5509 O O   . HOH J 3 .   ? 76.901 37.163 24.566 1.00   42.68 ? 2123 HOH B O   1 
HETATM 5510 O O   . HOH J 3 .   ? 73.732 37.709 22.116 1.00   27.51 ? 2124 HOH B O   1 
HETATM 5511 O O   . HOH J 3 .   ? 76.543 43.860 20.137 1.00   29.94 ? 2125 HOH B O   1 
HETATM 5512 O O   . HOH J 3 .   ? 68.992 42.250 21.313 1.00   19.88 ? 2126 HOH B O   1 
HETATM 5513 O O   . HOH J 3 .   ? 68.915 47.989 13.677 1.00   22.29 ? 2127 HOH B O   1 
HETATM 5514 O O   . HOH J 3 .   ? 70.424 50.152 16.197 1.00   33.57 ? 2128 HOH B O   1 
HETATM 5515 O O   . HOH J 3 .   ? 77.115 47.764 18.371 1.00   31.60 ? 2129 HOH B O   1 
HETATM 5516 O O   . HOH J 3 .   ? 78.935 48.639 15.155 1.00   47.65 ? 2130 HOH B O   1 
HETATM 5517 O O   . HOH J 3 .   ? 47.638 10.319 10.341 1.00   41.09 ? 2131 HOH B O   1 
HETATM 5518 O O   . HOH J 3 .   ? 70.920 53.794 16.307 1.00   37.96 ? 2132 HOH B O   1 
HETATM 5519 O O   . HOH J 3 .   ? 70.296 57.468 14.991 1.00   59.05 ? 2133 HOH B O   1 
HETATM 5520 O O   . HOH J 3 .   ? 73.002 55.633 15.185 1.00   40.81 ? 2134 HOH B O   1 
HETATM 5521 O O   . HOH J 3 .   ? 52.414 9.886  13.560 1.00   42.07 ? 2135 HOH B O   1 
HETATM 5522 O O   . HOH J 3 .   ? 79.498 55.530 9.059  1.00   42.22 ? 2136 HOH B O   1 
HETATM 5523 O O   . HOH J 3 .   ? 82.687 56.755 7.234  1.00   51.81 ? 2137 HOH B O   1 
HETATM 5524 O O   . HOH J 3 .   ? 83.076 44.672 16.601 1.00   40.75 ? 2138 HOH B O   1 
HETATM 5525 O O   . HOH J 3 .   ? 38.797 16.536 27.325 1.00   28.82 ? 2139 HOH B O   1 
HETATM 5526 O O   . HOH J 3 .   ? 38.775 16.940 25.157 1.00   44.27 ? 2140 HOH B O   1 
HETATM 5527 O O   . HOH J 3 .   ? 39.953 15.191 19.173 1.00   41.26 ? 2141 HOH B O   1 
HETATM 5528 O O   . HOH J 3 .   ? 38.379 9.023  28.352 1.00   54.78 ? 2142 HOH B O   1 
HETATM 5529 O O   . HOH J 3 .   ? 44.782 15.405 32.407 1.00   61.25 ? 2143 HOH B O   1 
HETATM 5530 O O   . HOH J 3 .   ? 31.424 27.513 19.005 1.00   37.40 ? 2144 HOH B O   1 
HETATM 5531 O O   . HOH J 3 .   ? 35.420 31.091 25.480 1.00   33.10 ? 2145 HOH B O   1 
HETATM 5532 O O   . HOH J 3 .   ? 32.836 19.204 17.751 1.00   63.82 ? 2146 HOH B O   1 
HETATM 5533 O O   . HOH J 3 .   ? 30.129 29.452 17.979 1.00   40.75 ? 2147 HOH B O   1 
HETATM 5534 O O   . HOH J 3 .   ? 24.003 26.105 13.719 1.00   53.74 ? 2148 HOH B O   1 
HETATM 5535 O O   . HOH J 3 .   ? 79.749 36.176 4.417  1.00   60.83 ? 2149 HOH B O   1 
HETATM 5536 O O   . HOH J 3 .   ? 77.818 36.722 1.613  1.00   64.78 ? 2150 HOH B O   1 
HETATM 5537 O O   . HOH J 3 .   ? 79.279 38.438 -4.897 1.00   50.94 ? 2151 HOH B O   1 
HETATM 5538 O O   . HOH J 3 .   ? 76.156 35.495 2.763  1.00   55.71 ? 2152 HOH B O   1 
HETATM 5539 O O   . HOH J 3 .   ? 44.283 36.497 26.658 1.00   30.73 ? 2153 HOH B O   1 
HETATM 5540 O O   . HOH J 3 .   ? 76.699 38.894 5.933  1.00   28.30 ? 2154 HOH B O   1 
HETATM 5541 O O   . HOH J 3 .   ? 44.875 39.331 27.856 1.00   58.65 ? 2155 HOH B O   1 
HETATM 5542 O O   . HOH J 3 .   ? 48.664 30.882 30.102 1.00   30.34 ? 2156 HOH B O   1 
HETATM 5543 O O   . HOH J 3 .   ? 53.797 36.795 36.193 1.00   43.08 ? 2157 HOH B O   1 
HETATM 5544 O O   . HOH J 3 .   ? 67.405 32.037 9.566  1.00   41.11 ? 2158 HOH B O   1 
HETATM 5545 O O   . HOH J 3 .   ? 72.601 38.300 10.006 1.00   38.10 ? 2159 HOH B O   1 
HETATM 5546 O O   . HOH J 3 .   ? 56.613 28.856 39.793 1.00   45.68 ? 2160 HOH B O   1 
HETATM 5547 O O   . HOH J 3 .   ? 60.791 39.193 11.073 1.00   16.51 ? 2161 HOH B O   1 
HETATM 5548 O O   . HOH J 3 .   ? 64.785 40.629 20.210 1.00   21.33 ? 2162 HOH B O   1 
HETATM 5549 O O   . HOH J 3 .   ? 80.745 38.559 34.499 1.00   47.39 ? 2163 HOH B O   1 
HETATM 5550 O O   . HOH J 3 .   ? 64.313 44.619 24.203 1.00   14.70 ? 2164 HOH B O   1 
HETATM 5551 O O   . HOH J 3 .   ? 66.307 51.486 17.916 1.00   35.93 ? 2165 HOH B O   1 
HETATM 5552 O O   . HOH J 3 .   ? 71.910 45.057 45.721 1.00   34.55 ? 2166 HOH B O   1 
HETATM 5553 O O   . HOH J 3 .   ? 73.206 38.901 46.615 1.00   30.44 ? 2167 HOH B O   1 
HETATM 5554 O O   . HOH J 3 .   ? 74.064 47.109 46.517 1.00   37.06 ? 2168 HOH B O   1 
HETATM 5555 O O   . HOH J 3 .   ? 64.695 38.105 20.107 1.00   29.12 ? 2169 HOH B O   1 
HETATM 5556 O O   . HOH J 3 .   ? 59.543 48.384 24.364 1.00   18.13 ? 2170 HOH B O   1 
HETATM 5557 O O   . HOH J 3 .   ? 80.770 32.904 41.930 1.00   54.18 ? 2171 HOH B O   1 
HETATM 5558 O O   . HOH J 3 .   ? 57.240 43.398 26.909 1.00   25.33 ? 2172 HOH B O   1 
HETATM 5559 O O   . HOH J 3 .   ? 49.645 45.219 29.010 1.00   43.83 ? 2173 HOH B O   1 
HETATM 5560 O O   . HOH J 3 .   ? 52.883 47.699 31.144 1.00   39.50 ? 2174 HOH B O   1 
HETATM 5561 O O   . HOH J 3 .   ? 58.149 44.591 36.048 1.00   44.91 ? 2175 HOH B O   1 
HETATM 5562 O O   . HOH J 3 .   ? 59.047 42.244 36.043 1.00   38.48 ? 2176 HOH B O   1 
HETATM 5563 O O   . HOH J 3 .   ? 56.513 51.137 36.065 1.00   46.43 ? 2177 HOH B O   1 
HETATM 5564 O O   . HOH J 3 .   ? 59.079 46.999 36.968 1.00   36.11 ? 2178 HOH B O   1 
HETATM 5565 O O   . HOH J 3 .   ? 46.022 46.036 18.364 1.00   49.33 ? 2179 HOH B O   1 
HETATM 5566 O O   . HOH J 3 .   ? 71.090 32.675 45.311 1.00   45.66 ? 2180 HOH B O   1 
HETATM 5567 O O   . HOH J 3 .   ? 49.776 47.733 29.116 1.00   53.94 ? 2181 HOH B O   1 
HETATM 5568 O O   . HOH J 3 .   ? 47.227 52.977 26.217 1.00   51.04 ? 2182 HOH B O   1 
HETATM 5569 O O   . HOH J 3 .   ? 63.282 29.684 33.486 1.00   39.38 ? 2183 HOH B O   1 
HETATM 5570 O O   . HOH J 3 .   ? 74.271 33.983 28.260 1.00   57.12 ? 2184 HOH B O   1 
HETATM 5571 O O   . HOH J 3 .   ? 67.288 30.298 29.657 1.00   45.51 ? 2185 HOH B O   1 
HETATM 5572 O O   . HOH J 3 .   ? 75.044 31.913 29.901 1.00   49.99 ? 2186 HOH B O   1 
HETATM 5573 O O   . HOH J 3 .   ? 70.901 33.384 26.114 1.00   53.58 ? 2187 HOH B O   1 
HETATM 5574 O O   . HOH J 3 .   ? 57.616 38.308 38.401 1.00   44.14 ? 2188 HOH B O   1 
HETATM 5575 O O   . HOH J 3 .   ? 55.469 37.238 39.165 1.00   59.56 ? 2189 HOH B O   1 
HETATM 5576 O O   . HOH J 3 .   ? 52.976 50.637 18.079 1.00   21.62 ? 2190 HOH B O   1 
HETATM 5577 O O   . HOH J 3 .   ? 50.642 49.644 26.401 1.00   27.97 ? 2191 HOH B O   1 
HETATM 5578 O O   . HOH J 3 .   ? 48.598 48.246 7.447  1.00   44.87 ? 2192 HOH B O   1 
HETATM 5579 O O   . HOH J 3 .   ? 61.572 57.651 41.146 1.00   40.87 ? 2193 HOH B O   1 
HETATM 5580 O O   . HOH J 3 .   ? 43.788 42.642 9.494  1.00   53.84 ? 2194 HOH B O   1 
HETATM 5581 O O   . HOH J 3 .   ? 49.124 38.087 8.644  1.00   42.36 ? 2195 HOH B O   1 
HETATM 5582 O O   . HOH J 3 .   ? 47.196 46.620 8.784  1.00   32.62 ? 2196 HOH B O   1 
HETATM 5583 O O   . HOH J 3 .   ? 79.492 54.704 26.721 1.00   53.81 ? 2197 HOH B O   1 
HETATM 5584 O O   . HOH J 3 .   ? 49.954 45.032 7.442  1.00   29.67 ? 2198 HOH B O   1 
HETATM 5585 O O   . HOH J 3 .   ? 88.822 47.820 38.873 1.00   43.78 ? 2199 HOH B O   1 
HETATM 5586 O O   . HOH J 3 .   ? 44.318 41.107 14.925 1.00   41.98 ? 2200 HOH B O   1 
HETATM 5587 O O   . HOH J 3 .   ? 47.539 39.531 14.163 1.00   37.68 ? 2201 HOH B O   1 
HETATM 5588 O O   . HOH J 3 .   ? 50.325 36.340 7.219  1.00   34.49 ? 2202 HOH B O   1 
HETATM 5589 O O   . HOH J 3 .   ? 69.142 48.992 45.106 1.00   30.96 ? 2203 HOH B O   1 
HETATM 5590 O O   . HOH J 3 .   ? 77.800 48.900 47.847 1.00   56.32 ? 2204 HOH B O   1 
HETATM 5591 O O   . HOH J 3 .   ? 76.232 59.029 44.215 1.00   50.95 ? 2205 HOH B O   1 
HETATM 5592 O O   . HOH J 3 .   ? 77.819 50.303 45.235 1.00   32.77 ? 2206 HOH B O   1 
HETATM 5593 O O   . HOH J 3 .   ? 77.791 57.703 40.929 1.00   47.40 ? 2207 HOH B O   1 
HETATM 5594 O O   . HOH J 3 .   ? 57.807 30.941 14.068 1.00   24.52 ? 2208 HOH B O   1 
HETATM 5595 O O   . HOH J 3 .   ? 88.121 37.631 31.681 1.00   52.89 ? 2209 HOH B O   1 
HETATM 5596 O O   . HOH J 3 .   ? 62.675 33.778 17.377 1.00   18.28 ? 2210 HOH B O   1 
HETATM 5597 O O   . HOH J 3 .   ? 59.839 39.429 13.805 1.00   15.07 ? 2211 HOH B O   1 
HETATM 5598 O O   . HOH J 3 .   ? 85.901 38.827 26.601 1.00   50.69 ? 2212 HOH B O   1 
HETATM 5599 O O   . HOH J 3 .   ? 74.131 52.639 22.240 1.00   40.35 ? 2213 HOH B O   1 
HETATM 5600 O O   . HOH J 3 .   ? 52.421 26.347 13.591 1.00   29.76 ? 2214 HOH B O   1 
HETATM 5601 O O   . HOH J 3 .   ? 57.843 28.766 15.196 1.00   25.73 ? 2215 HOH B O   1 
HETATM 5602 O O   . HOH J 3 .   ? 55.019 28.620 11.894 1.00   31.96 ? 2216 HOH B O   1 
HETATM 5603 O O   . HOH J 3 .   ? 61.579 25.550 11.513 1.00   47.11 ? 2217 HOH B O   1 
HETATM 5604 O O   . HOH J 3 .   ? 61.147 25.482 16.183 1.00   49.27 ? 2218 HOH B O   1 
HETATM 5605 O O   . HOH J 3 .   ? 61.616 37.229 24.303 1.00   39.27 ? 2219 HOH B O   1 
HETATM 5606 O O   . HOH J 3 .   ? 64.239 36.098 18.545 1.00   31.76 ? 2220 HOH B O   1 
HETATM 5607 O O   . HOH J 3 .   ? 63.332 35.470 24.634 1.00   42.32 ? 2221 HOH B O   1 
HETATM 5608 O O   . HOH J 3 .   ? 59.144 27.135 26.060 1.00   17.58 ? 2222 HOH B O   1 
HETATM 5609 O O   . HOH J 3 .   ? 61.815 22.384 21.989 1.00   23.01 ? 2223 HOH B O   1 
HETATM 5610 O O   . HOH J 3 .   ? 66.548 24.606 21.337 1.00   54.38 ? 2224 HOH B O   1 
HETATM 5611 O O   . HOH J 3 .   ? 62.804 28.126 28.972 1.00   42.36 ? 2225 HOH B O   1 
HETATM 5612 O O   . HOH J 3 .   ? 64.723 21.464 28.383 1.00   38.83 ? 2226 HOH B O   1 
HETATM 5613 O O   . HOH J 3 .   ? 66.333 27.134 27.264 1.00   41.50 ? 2227 HOH B O   1 
HETATM 5614 O O   . HOH J 3 .   ? 58.577 61.862 26.903 1.00   34.75 ? 2228 HOH B O   1 
HETATM 5615 O O   . HOH J 3 .   ? 59.270 65.416 28.599 1.00   44.07 ? 2229 HOH B O   1 
HETATM 5616 O O   . HOH J 3 .   ? 65.506 33.973 27.445 1.00   20.80 ? 2230 HOH B O   1 
HETATM 5617 O O   . HOH J 3 .   ? 58.266 32.572 31.316 1.00   15.41 ? 2231 HOH B O   1 
HETATM 5618 O O   . HOH J 3 .   ? 56.956 23.423 34.259 1.00   40.14 ? 2232 HOH B O   1 
HETATM 5619 O O   . HOH J 3 .   ? 54.470 26.812 36.133 1.00   32.35 ? 2233 HOH B O   1 
HETATM 5620 O O   . HOH J 3 .   ? 45.572 23.871 28.408 1.00   15.83 ? 2234 HOH B O   1 
HETATM 5621 O O   . HOH J 3 .   ? 43.877 21.117 31.814 1.00   17.16 ? 2235 HOH B O   1 
HETATM 5622 O O   . HOH J 3 .   ? 53.210 25.685 22.366 1.00   13.62 ? 2236 HOH B O   1 
HETATM 5623 O O   . HOH J 3 .   ? 43.016 33.147 25.422 1.00   33.61 ? 2237 HOH B O   1 
HETATM 5624 O O   . HOH J 3 .   ? 40.176 30.660 24.046 1.00   42.60 ? 2238 HOH B O   1 
HETATM 5625 O O   . HOH J 3 .   ? 50.748 28.982 13.091 1.00   22.59 ? 2239 HOH B O   1 
HETATM 5626 O O   . HOH J 3 .   ? 38.402 26.490 15.227 1.00   17.32 ? 2240 HOH B O   1 
HETATM 5627 O O   . HOH J 3 .   ? 42.537 23.848 6.887  1.00   35.83 ? 2241 HOH B O   1 
HETATM 5628 O O   . HOH J 3 .   ? 32.992 30.334 11.962 1.00   41.67 ? 2242 HOH B O   1 
HETATM 5629 O O   . HOH J 3 .   ? 34.871 13.371 5.803  1.00   49.73 ? 2243 HOH B O   1 
HETATM 5630 O O   . HOH J 3 .   ? 39.797 15.955 14.650 1.00   39.97 ? 2244 HOH B O   1 
HETATM 5631 O O   . HOH J 3 .   ? 36.930 9.119  17.387 1.00   53.43 ? 2245 HOH B O   1 
HETATM 5632 O O   . HOH J 3 .   ? 44.587 12.176 10.439 1.00   51.94 ? 2246 HOH B O   1 
HETATM 5633 O O   . HOH J 3 .   ? 40.091 12.482 16.560 1.00   63.53 ? 2247 HOH B O   1 
HETATM 5634 O O   . HOH J 3 .   ? 41.574 11.261 18.897 1.00   50.53 ? 2248 HOH B O   1 
HETATM 5635 O O   . HOH J 3 .   ? 47.078 17.803 8.324  1.00   40.13 ? 2249 HOH B O   1 
HETATM 5636 O O   . HOH J 3 .   ? 50.244 17.179 10.419 1.00   36.21 ? 2250 HOH B O   1 
HETATM 5637 O O   . HOH J 3 .   ? 54.494 12.069 13.440 1.00   33.90 ? 2251 HOH B O   1 
HETATM 5638 O O   . HOH J 3 .   ? 62.155 23.548 13.928 1.00   46.69 ? 2252 HOH B O   1 
HETATM 5639 O O   . HOH J 3 .   ? 58.691 26.273 14.088 1.00   43.57 ? 2253 HOH B O   1 
HETATM 5640 O O   . HOH J 3 .   ? 53.645 25.964 15.810 1.00   18.67 ? 2254 HOH B O   1 
HETATM 5641 O O   . HOH J 3 .   ? 56.291 25.258 13.827 1.00   37.50 ? 2255 HOH B O   1 
HETATM 5642 O O   . HOH J 3 .   ? 52.555 26.279 18.592 1.00   13.83 ? 2256 HOH B O   1 
HETATM 5643 O O   . HOH J 3 .   ? 62.388 19.749 16.808 1.00   62.59 ? 2257 HOH B O   1 
HETATM 5644 O O   . HOH J 3 .   ? 59.311 23.140 34.784 1.00   47.52 ? 2258 HOH B O   1 
HETATM 5645 O O   . HOH J 3 .   ? 60.762 19.053 31.195 1.00   43.85 ? 2259 HOH B O   1 
HETATM 5646 O O   . HOH J 3 .   ? 58.808 25.462 27.948 1.00   28.38 ? 2260 HOH B O   1 
HETATM 5647 O O   . HOH J 3 .   ? 62.201 25.954 29.107 1.00   36.59 ? 2261 HOH B O   1 
HETATM 5648 O O   . HOH J 3 .   ? 60.998 14.133 31.695 1.00   39.41 ? 2262 HOH B O   1 
HETATM 5649 O O   . HOH J 3 .   ? 60.698 16.505 32.189 1.00   36.81 ? 2263 HOH B O   1 
HETATM 5650 O O   . HOH J 3 .   ? 54.458 12.862 26.488 1.00   28.62 ? 2264 HOH B O   1 
HETATM 5651 O O   . HOH J 3 .   ? 53.298 11.305 36.312 1.00   56.55 ? 2265 HOH B O   1 
HETATM 5652 O O   . HOH J 3 .   ? 51.785 12.405 32.820 1.00   55.69 ? 2266 HOH B O   1 
HETATM 5653 O O   . HOH J 3 .   ? 54.902 10.113 26.458 1.00   34.00 ? 2267 HOH B O   1 
HETATM 5654 O O   . HOH J 3 .   ? 50.280 5.914  19.954 1.00   45.96 ? 2268 HOH B O   1 
HETATM 5655 O O   . HOH J 3 .   ? 48.739 13.810 16.007 1.00   30.36 ? 2269 HOH B O   1 
HETATM 5656 O O   . HOH J 3 .   ? 39.040 10.507 25.592 1.00   52.57 ? 2270 HOH B O   1 
HETATM 5657 O O   . HOH J 3 .   ? 43.821 13.699 26.293 1.00   43.42 ? 2271 HOH B O   1 
HETATM 5658 O O   . HOH J 3 .   ? 39.592 17.049 21.306 1.00   30.17 ? 2272 HOH B O   1 
HETATM 5659 O O   . HOH J 3 .   ? 41.758 11.409 21.590 1.00   48.10 ? 2273 HOH B O   1 
HETATM 5660 O O   . HOH J 3 .   ? 41.307 16.451 26.013 1.00   46.13 ? 2274 HOH B O   1 
HETATM 5661 O O   . HOH J 3 .   ? 43.161 21.004 26.320 1.00   19.28 ? 2275 HOH B O   1 
HETATM 5662 O O   . HOH J 3 .   ? 45.813 16.074 30.369 1.00   31.08 ? 2276 HOH B O   1 
HETATM 5663 O O   . HOH J 3 .   ? 42.127 15.677 16.623 1.00   43.10 ? 2277 HOH B O   1 
HETATM 5664 O O   . HOH J 3 .   ? 34.046 27.321 18.617 1.00   31.86 ? 2278 HOH B O   1 
HETATM 5665 O O   . HOH J 3 .   ? 36.292 22.181 23.552 1.00   24.30 ? 2279 HOH B O   1 
HETATM 5666 O O   . HOH J 3 .   ? 37.466 29.244 24.979 1.00   17.43 ? 2280 HOH B O   1 
HETATM 5667 O O   . HOH J 3 .   ? 33.797 29.727 22.097 1.00   31.48 ? 2281 HOH B O   1 
HETATM 5668 O O   . HOH J 3 .   ? 31.211 29.791 15.641 1.00   63.90 ? 2282 HOH B O   1 
HETATM 5669 O O   . HOH J 3 .   ? 27.724 26.725 15.579 1.00   51.81 ? 2283 HOH B O   1 
HETATM 5670 O O   . HOH J 3 .   ? 30.488 21.156 17.070 1.00   67.31 ? 2284 HOH B O   1 
HETATM 5671 O O   . HOH J 3 .   ? 31.342 24.795 18.100 1.00   30.62 ? 2285 HOH B O   1 
HETATM 5672 O O   . HOH J 3 .   ? 27.675 26.344 13.173 1.00   50.03 ? 2286 HOH B O   1 
HETATM 5673 O O   . HOH J 3 .   ? 34.383 30.312 18.588 1.00   35.50 ? 2287 HOH B O   1 
HETATM 5674 O O   . HOH J 3 .   ? 33.515 23.403 17.271 1.00   56.28 ? 2288 HOH B O   1 
HETATM 5675 O O   . HOH J 3 .   ? 36.206 36.268 14.851 1.00   35.56 ? 2289 HOH B O   1 
HETATM 5676 O O   . HOH J 3 .   ? 33.610 34.566 12.036 1.00   29.47 ? 2290 HOH B O   1 
HETATM 5677 O O   . HOH J 3 .   ? 39.524 40.301 19.267 1.00   54.00 ? 2291 HOH B O   1 
HETATM 5678 O O   . HOH J 3 .   ? 49.206 35.732 8.924  1.00   61.37 ? 2292 HOH B O   1 
HETATM 5679 O O   . HOH J 3 .   ? 43.397 31.666 9.277  1.00   53.22 ? 2293 HOH B O   1 
HETATM 5680 O O   . HOH J 3 .   ? 41.346 34.510 8.144  1.00   37.84 ? 2294 HOH B O   1 
HETATM 5681 O O   . HOH J 3 .   ? 45.361 42.534 12.030 1.00   39.33 ? 2295 HOH B O   1 
HETATM 5682 O O   . HOH J 3 .   ? 50.215 31.895 10.928 1.00   46.11 ? 2296 HOH B O   1 
HETATM 5683 O O   . HOH J 3 .   ? 48.845 38.214 11.991 1.00   33.59 ? 2297 HOH B O   1 
HETATM 5684 O O   . HOH J 3 .   ? 44.500 35.289 24.326 1.00   20.83 ? 2298 HOH B O   1 
HETATM 5685 O O   . HOH J 3 .   ? 53.684 27.790 20.674 1.00   16.00 ? 2299 HOH B O   1 
HETATM 5686 O O   . HOH J 3 .   ? 47.907 39.746 28.092 1.00   23.13 ? 2300 HOH B O   1 
HETATM 5687 O O   . HOH J 3 .   ? 50.123 33.141 29.961 1.00   29.60 ? 2301 HOH B O   1 
HETATM 5688 O O   . HOH J 3 .   ? 55.471 39.181 31.003 1.00   33.34 ? 2302 HOH B O   1 
HETATM 5689 O O   . HOH J 3 .   ? 53.528 42.360 24.279 1.00   23.28 ? 2303 HOH B O   1 
HETATM 5690 O O   . HOH J 3 .   ? 54.387 42.080 28.805 1.00   42.00 ? 2304 HOH B O   1 
HETATM 5691 O O   . HOH J 3 .   ? 47.997 34.477 30.535 1.00   47.59 ? 2305 HOH B O   1 
HETATM 5692 O O   . HOH J 3 .   ? 53.247 34.639 34.099 1.00   34.95 ? 2306 HOH B O   1 
HETATM 5693 O O   . HOH J 3 .   ? 56.535 32.564 33.532 1.00   24.41 ? 2307 HOH B O   1 
HETATM 5694 O O   . HOH J 3 .   ? 60.971 37.824 34.520 1.00   22.98 ? 2308 HOH B O   1 
HETATM 5695 O O   . HOH J 3 .   ? 54.759 31.037 33.441 1.00   39.97 ? 2309 HOH B O   1 
HETATM 5696 O O   . HOH J 3 .   ? 58.617 40.014 33.089 1.00   31.13 ? 2310 HOH B O   1 
HETATM 5697 O O   . HOH J 3 .   ? 57.077 31.173 39.299 1.00   38.42 ? 2311 HOH B O   1 
HETATM 5698 O O   . HOH J 3 .   ? 58.535 42.222 27.826 1.00   27.68 ? 2312 HOH B O   1 
HETATM 5699 O O   . HOH J 3 .   ? 57.692 39.605 31.069 1.00   29.06 ? 2313 HOH B O   1 
HETATM 5700 O O   . HOH J 3 .   ? 60.463 43.726 26.766 1.00   16.71 ? 2314 HOH B O   1 
HETATM 5701 O O   . HOH J 3 .   ? 63.652 36.116 27.356 1.00   20.67 ? 2315 HOH B O   1 
HETATM 5702 O O   . HOH J 3 .   ? 63.913 38.771 24.391 1.00   32.23 ? 2316 HOH B O   1 
HETATM 5703 O O   . HOH J 3 .   ? 68.042 39.336 24.204 1.00   30.10 ? 2317 HOH B O   1 
HETATM 5704 O O   . HOH J 3 .   ? 66.196 42.319 21.936 1.00   16.27 ? 2318 HOH B O   1 
HETATM 5705 O O   . HOH J 3 .   ? 73.547 37.546 27.288 1.00   36.36 ? 2319 HOH B O   1 
HETATM 5706 O O   . HOH J 3 .   ? 70.735 38.507 25.907 1.00   32.29 ? 2320 HOH B O   1 
HETATM 5707 O O   . HOH J 3 .   ? 68.571 36.921 26.633 1.00   22.52 ? 2321 HOH B O   1 
HETATM 5708 O O   . HOH J 3 .   ? 79.763 39.033 32.453 1.00   44.57 ? 2322 HOH B O   1 
HETATM 5709 O O   . HOH J 3 .   ? 75.747 37.961 29.234 1.00   37.10 ? 2323 HOH B O   1 
HETATM 5710 O O   . HOH J 3 .   ? 77.057 40.483 30.618 1.00   44.19 ? 2324 HOH B O   1 
HETATM 5711 O O   . HOH J 3 .   ? 72.843 42.836 44.691 1.00   26.52 ? 2325 HOH B O   1 
HETATM 5712 O O   . HOH J 3 .   ? 76.500 44.562 45.871 1.00   28.71 ? 2326 HOH B O   1 
HETATM 5713 O O   . HOH J 3 .   ? 75.594 39.962 47.073 1.00   30.63 ? 2327 HOH B O   1 
HETATM 5714 O O   . HOH J 3 .   ? 82.348 36.040 40.900 1.00   45.30 ? 2328 HOH B O   1 
HETATM 5715 O O   . HOH J 3 .   ? 79.329 36.635 35.333 1.00   43.98 ? 2329 HOH B O   1 
HETATM 5716 O O   . HOH J 3 .   ? 79.479 32.698 37.619 1.00   55.79 ? 2330 HOH B O   1 
HETATM 5717 O O   . HOH J 3 .   ? 74.676 33.968 42.502 1.00   27.88 ? 2331 HOH B O   1 
HETATM 5718 O O   . HOH J 3 .   ? 78.158 34.040 43.127 1.00   32.75 ? 2332 HOH B O   1 
HETATM 5719 O O   . HOH J 3 .   ? 75.927 35.523 36.203 1.00   33.31 ? 2333 HOH B O   1 
HETATM 5720 O O   . HOH J 3 .   ? 58.642 41.662 30.364 1.00   34.53 ? 2334 HOH B O   1 
HETATM 5721 O O   . HOH J 3 .   ? 61.097 41.454 34.053 1.00   30.15 ? 2335 HOH B O   1 
HETATM 5722 O O   . HOH J 3 .   ? 59.150 43.242 33.717 1.00   34.63 ? 2336 HOH B O   1 
HETATM 5723 O O   . HOH J 3 .   ? 60.013 49.867 26.810 1.00   21.32 ? 2337 HOH B O   1 
HETATM 5724 O O   . HOH J 3 .   ? 57.993 49.410 35.280 1.00   28.01 ? 2338 HOH B O   1 
HETATM 5725 O O   . HOH J 3 .   ? 69.700 38.799 45.332 1.00   29.64 ? 2339 HOH B O   1 
HETATM 5726 O O   . HOH J 3 .   ? 69.216 39.185 42.536 1.00   39.02 ? 2340 HOH B O   1 
HETATM 5727 O O   . HOH J 3 .   ? 72.630 34.833 44.215 1.00   45.71 ? 2341 HOH B O   1 
HETATM 5728 O O   . HOH J 3 .   ? 68.150 29.691 35.741 1.00   47.37 ? 2342 HOH B O   1 
HETATM 5729 O O   . HOH J 3 .   ? 71.602 31.260 34.744 1.00   41.08 ? 2343 HOH B O   1 
HETATM 5730 O O   . HOH J 3 .   ? 67.056 27.141 38.595 1.00   43.78 ? 2344 HOH B O   1 
HETATM 5731 O O   . HOH J 3 .   ? 64.463 32.343 43.867 1.00   30.14 ? 2345 HOH B O   1 
HETATM 5732 O O   . HOH J 3 .   ? 70.252 34.562 27.823 1.00   42.04 ? 2346 HOH B O   1 
HETATM 5733 O O   . HOH J 3 .   ? 73.484 33.550 31.258 1.00   37.04 ? 2347 HOH B O   1 
HETATM 5734 O O   . HOH J 3 .   ? 67.353 33.223 29.178 1.00   27.42 ? 2348 HOH B O   1 
HETATM 5735 O O   . HOH J 3 .   ? 71.799 34.709 29.765 1.00   38.02 ? 2349 HOH B O   1 
HETATM 5736 O O   . HOH J 3 .   ? 65.000 30.037 35.970 1.00   28.52 ? 2350 HOH B O   1 
HETATM 5737 O O   . HOH J 3 .   ? 58.652 38.328 36.311 1.00   38.10 ? 2351 HOH B O   1 
HETATM 5738 O O   . HOH J 3 .   ? 65.784 35.916 40.537 1.00   17.55 ? 2352 HOH B O   1 
HETATM 5739 O O   . HOH J 3 .   ? 57.229 35.675 39.064 1.00   31.03 ? 2353 HOH B O   1 
HETATM 5740 O O   . HOH J 3 .   ? 59.749 33.063 41.855 1.00   30.90 ? 2354 HOH B O   1 
HETATM 5741 O O   . HOH J 3 .   ? 61.853 35.859 43.779 1.00   22.09 ? 2355 HOH B O   1 
HETATM 5742 O O   . HOH J 3 .   ? 62.332 46.212 43.307 1.00   25.63 ? 2356 HOH B O   1 
HETATM 5743 O O   . HOH J 3 .   ? 61.211 48.642 42.566 1.00   33.41 ? 2357 HOH B O   1 
HETATM 5744 O O   . HOH J 3 .   ? 59.241 43.170 38.552 1.00   28.07 ? 2358 HOH B O   1 
HETATM 5745 O O   . HOH J 3 .   ? 64.628 49.489 42.812 1.00   35.34 ? 2359 HOH B O   1 
HETATM 5746 O O   . HOH J 3 .   ? 54.539 54.420 35.867 1.00   47.01 ? 2360 HOH B O   1 
HETATM 5747 O O   . HOH J 3 .   ? 57.300 53.719 37.302 1.00   39.48 ? 2361 HOH B O   1 
HETATM 5748 O O   . HOH J 3 .   ? 64.054 56.270 41.700 1.00   29.50 ? 2362 HOH B O   1 
HETATM 5749 O O   . HOH J 3 .   ? 69.645 60.573 31.400 1.00   46.21 ? 2363 HOH B O   1 
HETATM 5750 O O   . HOH J 3 .   ? 68.296 56.988 32.615 1.00   58.09 ? 2364 HOH B O   1 
HETATM 5751 O O   . HOH J 3 .   ? 72.639 54.812 28.334 1.00   47.01 ? 2365 HOH B O   1 
HETATM 5752 O O   . HOH J 3 .   ? 74.710 56.249 35.097 1.00   62.70 ? 2366 HOH B O   1 
HETATM 5753 O O   . HOH J 3 .   ? 77.805 55.328 29.158 1.00   44.40 ? 2367 HOH B O   1 
HETATM 5754 O O   . HOH J 3 .   ? 84.809 52.387 36.130 1.00   47.05 ? 2368 HOH B O   1 
HETATM 5755 O O   . HOH J 3 .   ? 84.757 52.364 28.711 1.00   39.03 ? 2369 HOH B O   1 
HETATM 5756 O O   . HOH J 3 .   ? 86.786 53.305 34.920 1.00   64.57 ? 2370 HOH B O   1 
HETATM 5757 O O   . HOH J 3 .   ? 88.055 45.536 39.408 1.00   58.16 ? 2371 HOH B O   1 
HETATM 5758 O O   . HOH J 3 .   ? 89.071 43.604 35.448 1.00   40.84 ? 2372 HOH B O   1 
HETATM 5759 O O   . HOH J 3 .   ? 82.555 53.262 36.678 1.00   50.44 ? 2373 HOH B O   1 
HETATM 5760 O O   . HOH J 3 .   ? 79.914 53.063 35.560 1.00   30.52 ? 2374 HOH B O   1 
HETATM 5761 O O   . HOH J 3 .   ? 65.130 62.579 45.000 1.00   50.30 ? 2375 HOH B O   1 
HETATM 5762 O O   . HOH J 3 .   ? 74.782 50.913 48.043 1.00   32.12 ? 2376 HOH B O   1 
HETATM 5763 O O   . HOH J 3 .   ? 75.617 56.473 47.583 1.00   68.36 ? 2377 HOH B O   1 
HETATM 5764 O O   . HOH J 3 .   ? 73.976 51.258 50.424 1.00   41.56 ? 2378 HOH B O   1 
HETATM 5765 O O   . HOH J 3 .   ? 70.817 51.092 45.888 1.00   24.13 ? 2379 HOH B O   1 
HETATM 5766 O O   . HOH J 3 .   ? 73.321 49.306 45.936 1.00   35.00 ? 2380 HOH B O   1 
HETATM 5767 O O   . HOH J 3 .   ? 76.241 52.408 45.630 1.00   32.70 ? 2381 HOH B O   1 
HETATM 5768 O O   . HOH J 3 .   ? 74.731 56.746 45.517 1.00   36.42 ? 2382 HOH B O   1 
HETATM 5769 O O   . HOH J 3 .   ? 76.702 45.950 43.564 1.00   24.60 ? 2383 HOH B O   1 
HETATM 5770 O O   . HOH J 3 .   ? 79.657 56.374 41.734 1.00   50.08 ? 2384 HOH B O   1 
HETATM 5771 O O   . HOH J 3 .   ? 75.914 48.720 43.861 1.00   24.72 ? 2385 HOH B O   1 
HETATM 5772 O O   . HOH J 3 .   ? 84.671 47.692 38.336 1.00   41.47 ? 2386 HOH B O   1 
HETATM 5773 O O   . HOH J 3 .   ? 85.692 44.943 40.107 1.00   45.10 ? 2387 HOH B O   1 
HETATM 5774 O O   . HOH J 3 .   ? 82.355 42.941 40.790 1.00   45.83 ? 2388 HOH B O   1 
HETATM 5775 O O   . HOH J 3 .   ? 79.954 41.042 29.748 1.00   44.39 ? 2389 HOH B O   1 
HETATM 5776 O O   . HOH J 3 .   ? 85.803 44.359 30.399 1.00   53.39 ? 2390 HOH B O   1 
HETATM 5777 O O   . HOH J 3 .   ? 86.140 36.408 30.207 1.00   63.66 ? 2391 HOH B O   1 
HETATM 5778 O O   . HOH J 3 .   ? 88.183 39.646 30.813 1.00   47.18 ? 2392 HOH B O   1 
HETATM 5779 O O   . HOH J 3 .   ? 80.396 36.936 30.841 1.00   46.07 ? 2393 HOH B O   1 
HETATM 5780 O O   . HOH J 3 .   ? 85.735 42.519 25.749 1.00   33.17 ? 2394 HOH B O   1 
HETATM 5781 O O   . HOH J 3 .   ? 85.402 35.719 24.917 1.00   52.47 ? 2395 HOH B O   1 
HETATM 5782 O O   . HOH J 3 .   ? 80.363 35.100 22.985 1.00   54.42 ? 2396 HOH B O   1 
HETATM 5783 O O   . HOH J 3 .   ? 85.096 41.944 22.665 1.00   40.42 ? 2397 HOH B O   1 
HETATM 5784 O O   . HOH J 3 .   ? 80.804 50.109 17.731 1.00   59.45 ? 2398 HOH B O   1 
HETATM 5785 O O   . HOH J 3 .   ? 76.128 50.575 22.271 1.00   33.19 ? 2399 HOH B O   1 
HETATM 5786 O O   . HOH J 3 .   ? 85.407 47.712 18.898 1.00   37.63 ? 2400 HOH B O   1 
HETATM 5787 O O   . HOH J 3 .   ? 84.948 49.329 21.631 1.00   57.17 ? 2401 HOH B O   1 
HETATM 5788 O O   . HOH J 3 .   ? 75.884 46.179 20.185 1.00   38.41 ? 2402 HOH B O   1 
HETATM 5789 O O   . HOH J 3 .   ? 74.850 46.298 18.279 1.00   54.49 ? 2403 HOH B O   1 
HETATM 5790 O O   . HOH J 3 .   ? 69.227 51.432 20.788 1.00   39.27 ? 2404 HOH B O   1 
HETATM 5791 O O   . HOH J 3 .   ? 69.011 54.162 29.295 1.00   47.13 ? 2405 HOH B O   1 
HETATM 5792 O O   . HOH J 3 .   ? 66.333 56.734 25.802 1.00   32.28 ? 2406 HOH B O   1 
HETATM 5793 O O   . HOH J 3 .   ? 61.565 45.296 24.981 1.00   16.14 ? 2407 HOH B O   1 
HETATM 5794 O O   . HOH J 3 .   ? 63.821 58.324 33.163 1.00   43.99 ? 2408 HOH B O   1 
HETATM 5795 O O   . HOH J 3 .   ? 65.357 56.004 21.304 1.00   46.06 ? 2409 HOH B O   1 
HETATM 5796 O O   . HOH J 3 .   ? 63.683 53.301 21.109 1.00   39.36 ? 2410 HOH B O   1 
HETATM 5797 O O   . HOH J 3 .   ? 56.053 59.150 29.076 1.00   41.06 ? 2411 HOH B O   1 
HETATM 5798 O O   . HOH J 3 .   ? 62.826 54.425 17.053 1.00   39.19 ? 2412 HOH B O   1 
HETATM 5799 O O   . HOH J 3 .   ? 59.413 56.966 15.302 1.00   54.35 ? 2413 HOH B O   1 
HETATM 5800 O O   . HOH J 3 .   ? 53.748 51.999 35.071 1.00   51.28 ? 2414 HOH B O   1 
HETATM 5801 O O   . HOH J 3 .   ? 57.797 64.505 27.035 1.00   52.74 ? 2415 HOH B O   1 
HETATM 5802 O O   . HOH J 3 .   ? 40.027 35.167 24.218 1.00   43.61 ? 2416 HOH B O   1 
HETATM 5803 O O   . HOH J 3 .   ? 78.539 59.566 1.630  1.00   52.91 ? 2417 HOH B O   1 
# 
_database_PDB_caveat.id     1 
_database_PDB_caveat.text   'THERE ARE CHIRALITY ERRORS IN C-ALPHA CENTERS' 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -1  ?   ?   ?   A . n 
A 1 2   MET 2   1   ?   ?   ?   A . n 
A 1 3   ALA 3   2   ?   ?   ?   A . n 
A 1 4   GLY 4   3   ?   ?   ?   A . n 
A 1 5   ALA 5   4   ?   ?   ?   A . n 
A 1 6   ILE 6   5   ?   ?   ?   A . n 
A 1 7   ALA 7   6   ?   ?   ?   A . n 
A 1 8   SER 8   7   ?   ?   ?   A . n 
A 1 9   ARG 9   8   ?   ?   ?   A . n 
A 1 10  MET 10  9   ?   ?   ?   A . n 
A 1 11  SER 11  10  ?   ?   ?   A . n 
A 1 12  PHE 12  11  ?   ?   ?   A . n 
A 1 13  SER 13  12  ?   ?   ?   A . n 
A 1 14  SER 14  13  ?   ?   ?   A . n 
A 1 15  LEU 15  14  ?   ?   ?   A . n 
A 1 16  LYS 16  15  ?   ?   ?   A . n 
A 1 17  ARG 17  16  ?   ?   ?   A . n 
A 1 18  LYS 18  17  ?   ?   ?   A . n 
A 1 19  GLN 19  18  ?   ?   ?   A . n 
A 1 20  PRO 20  19  ?   ?   ?   A . n 
A 1 21  LYS 21  20  20  LYS LYS A . n 
A 1 22  THR 22  21  21  THR THR A . n 
A 1 23  PHE 23  22  22  PHE PHE A . n 
A 1 24  THR 24  23  23  THR THR A . n 
A 1 25  VAL 25  24  24  VAL VAL A . n 
A 1 26  ARG 26  25  25  ARG ARG A . n 
A 1 27  ILE 27  26  26  ILE ILE A . n 
A 1 28  VAL 28  27  27  VAL VAL A . n 
A 1 29  THR 29  28  28  THR THR A . n 
A 1 30  MET 30  29  29  MET MET A . n 
A 1 31  ASP 31  30  30  ASP ASP A . n 
A 1 32  ALA 32  31  31  ALA ALA A . n 
A 1 33  GLU 33  32  32  GLU GLU A . n 
A 1 34  MET 34  33  33  MET MET A . n 
A 1 35  GLU 35  34  34  GLU GLU A . n 
A 1 36  PHE 36  35  35  PHE PHE A . n 
A 1 37  ASN 37  36  36  ASN ASN A . n 
A 1 38  CYS 38  37  37  CYS CYS A . n 
A 1 39  GLU 39  38  38  GLU GLU A . n 
A 1 40  MET 40  39  39  MET MET A . n 
A 1 41  LYS 41  40  40  LYS LYS A . n 
A 1 42  TRP 42  41  41  TRP TRP A . n 
A 1 43  LYS 43  42  42  LYS LYS A . n 
A 1 44  GLY 44  43  43  GLY GLY A . n 
A 1 45  LYS 45  44  44  LYS LYS A . n 
A 1 46  ASP 46  45  45  ASP ASP A . n 
A 1 47  LEU 47  46  46  LEU LEU A . n 
A 1 48  PHE 48  47  47  PHE PHE A . n 
A 1 49  ASP 49  48  48  ASP ASP A . n 
A 1 50  LEU 50  49  49  LEU LEU A . n 
A 1 51  VAL 51  50  50  VAL VAL A . n 
A 1 52  CYS 52  51  51  CYS CYS A . n 
A 1 53  ARG 53  52  52  ARG ARG A . n 
A 1 54  THR 54  53  53  THR THR A . n 
A 1 55  LEU 55  54  54  LEU LEU A . n 
A 1 56  GLY 56  55  55  GLY GLY A . n 
A 1 57  LEU 57  56  56  LEU LEU A . n 
A 1 58  ARG 58  57  57  ARG ARG A . n 
A 1 59  GLU 59  58  58  GLU GLU A . n 
A 1 60  THR 60  59  59  THR THR A . n 
A 1 61  TRP 61  60  60  TRP TRP A . n 
A 1 62  PHE 62  61  61  PHE PHE A . n 
A 1 63  PHE 63  62  62  PHE PHE A . n 
A 1 64  GLY 64  63  63  GLY GLY A . n 
A 1 65  LEU 65  64  64  LEU LEU A . n 
A 1 66  GLN 66  65  65  GLN GLN A . n 
A 1 67  TYR 67  66  66  TYR TYR A . n 
A 1 68  THR 68  67  67  THR THR A . n 
A 1 69  ILE 69  68  68  ILE ILE A . n 
A 1 70  LYS 70  69  69  LYS LYS A . n 
A 1 71  ASP 71  70  70  ASP ASP A . n 
A 1 72  THR 72  71  71  THR THR A . n 
A 1 73  VAL 73  72  72  VAL VAL A . n 
A 1 74  ALA 74  73  73  ALA ALA A . n 
A 1 75  TRP 75  74  74  TRP TRP A . n 
A 1 76  LEU 76  75  75  LEU LEU A . n 
A 1 77  LYS 77  76  76  LYS LYS A . n 
A 1 78  MET 78  77  77  MET MET A . n 
A 1 79  ASP 79  78  78  ASP ASP A . n 
A 1 80  LYS 80  79  79  LYS LYS A . n 
A 1 81  LYS 81  80  80  LYS LYS A . n 
A 1 82  VAL 82  81  81  VAL VAL A . n 
A 1 83  LEU 83  82  82  LEU LEU A . n 
A 1 84  ASP 84  83  83  ASP ASP A . n 
A 1 85  HIS 85  84  84  HIS HIS A . n 
A 1 86  ASP 86  85  85  ASP ASP A . n 
A 1 87  VAL 87  86  86  VAL VAL A . n 
A 1 88  SER 88  87  87  SER SER A . n 
A 1 89  LYS 89  88  88  LYS LYS A . n 
A 1 90  GLU 90  89  89  GLU GLU A . n 
A 1 91  GLU 91  90  90  GLU GLU A . n 
A 1 92  PRO 92  91  91  PRO PRO A . n 
A 1 93  VAL 93  92  92  VAL VAL A . n 
A 1 94  THR 94  93  93  THR THR A . n 
A 1 95  PHE 95  94  94  PHE PHE A . n 
A 1 96  HIS 96  95  95  HIS HIS A . n 
A 1 97  PHE 97  96  96  PHE PHE A . n 
A 1 98  LEU 98  97  97  LEU LEU A . n 
A 1 99  ALA 99  98  98  ALA ALA A . n 
A 1 100 LYS 100 99  99  LYS LYS A . n 
A 1 101 PHE 101 100 100 PHE PHE A . n 
A 1 102 TYR 102 101 101 TYR TYR A . n 
A 1 103 PRO 103 102 102 PRO PRO A . n 
A 1 104 GLU 104 103 103 GLU GLU A . n 
A 1 105 ASN 105 104 104 ASN ASN A . n 
A 1 106 ALA 106 105 105 ALA ALA A . n 
A 1 107 GLU 107 106 106 GLU GLU A . n 
A 1 108 GLU 108 107 107 GLU GLU A . n 
A 1 109 GLU 109 108 108 GLU GLU A . n 
A 1 110 LEU 110 109 109 LEU LEU A . n 
A 1 111 VAL 111 110 110 VAL VAL A . n 
A 1 112 GLN 112 111 111 GLN GLN A . n 
A 1 113 GLU 113 112 112 GLU GLU A . n 
A 1 114 ILE 114 113 113 ILE ILE A . n 
A 1 115 THR 115 114 114 THR THR A . n 
A 1 116 GLN 116 115 115 GLN GLN A . n 
A 1 117 HIS 117 116 116 HIS HIS A . n 
A 1 118 LEU 118 117 117 LEU LEU A . n 
A 1 119 PHE 119 118 118 PHE PHE A . n 
A 1 120 PHE 120 119 119 PHE PHE A . n 
A 1 121 LEU 121 120 120 LEU LEU A . n 
A 1 122 GLN 122 121 121 GLN GLN A . n 
A 1 123 VAL 123 122 122 VAL VAL A . n 
A 1 124 LYS 124 123 123 LYS LYS A . n 
A 1 125 LYS 125 124 124 LYS LYS A . n 
A 1 126 GLN 126 125 125 GLN GLN A . n 
A 1 127 ILE 127 126 126 ILE ILE A . n 
A 1 128 LEU 128 127 127 LEU LEU A . n 
A 1 129 ASP 129 128 128 ASP ASP A . n 
A 1 130 GLU 130 129 129 GLU GLU A . n 
A 1 131 LYS 131 130 130 LYS LYS A . n 
A 1 132 ILE 132 131 131 ILE ILE A . n 
A 1 133 TYR 133 132 132 TYR TYR A . n 
A 1 134 CYS 134 133 133 CYS CYS A . n 
A 1 135 PRO 135 134 134 PRO PRO A . n 
A 1 136 PRO 136 135 135 PRO PRO A . n 
A 1 137 GLU 137 136 136 GLU GLU A . n 
A 1 138 ALA 138 137 137 ALA ALA A . n 
A 1 139 SER 139 138 138 SER SER A . n 
A 1 140 VAL 140 139 139 VAL VAL A . n 
A 1 141 LEU 141 140 140 LEU LEU A . n 
A 1 142 LEU 142 141 141 LEU LEU A . n 
A 1 143 ALA 143 142 142 ALA ALA A . n 
A 1 144 SER 144 143 143 SER SER A . n 
A 1 145 TYR 145 144 144 TYR TYR A . n 
A 1 146 ALA 146 145 145 ALA ALA A . n 
A 1 147 VAL 147 146 146 VAL VAL A . n 
A 1 148 GLN 148 147 147 GLN GLN A . n 
A 1 149 ALA 149 148 148 ALA ALA A . n 
A 1 150 LYS 150 149 149 LYS LYS A . n 
A 1 151 TYR 151 150 150 TYR TYR A . n 
A 1 152 GLY 152 151 151 GLY GLY A . n 
A 1 153 ASP 153 152 152 ASP ASP A . n 
A 1 154 TYR 154 153 153 TYR TYR A . n 
A 1 155 ASP 155 154 154 ASP ASP A . n 
A 1 156 PRO 156 155 155 PRO PRO A . n 
A 1 157 SER 157 156 156 SER SER A . n 
A 1 158 VAL 158 157 157 VAL VAL A . n 
A 1 159 HIS 159 158 158 HIS HIS A . n 
A 1 160 LYS 160 159 159 LYS LYS A . n 
A 1 161 ARG 161 160 160 ARG ARG A . n 
A 1 162 GLY 162 161 161 GLY GLY A . n 
A 1 163 PHE 163 162 162 PHE PHE A . n 
A 1 164 LEU 164 163 163 LEU LEU A . n 
A 1 165 ALA 165 164 164 ALA ALA A . n 
A 1 166 GLN 166 165 165 GLN GLN A . n 
A 1 167 GLU 167 166 166 GLU GLU A . n 
A 1 168 GLU 168 167 167 GLU GLU A . n 
A 1 169 LEU 169 168 168 LEU LEU A . n 
A 1 170 LEU 170 169 169 LEU LEU A . n 
A 1 171 PRO 171 170 170 PRO PRO A . n 
A 1 172 LYS 172 171 171 LYS LYS A . n 
A 1 173 ARG 173 172 172 ARG ARG A . n 
A 1 174 VAL 174 173 173 VAL VAL A . n 
A 1 175 ILE 175 174 174 ILE ILE A . n 
A 1 176 ASN 176 175 175 ASN ASN A . n 
A 1 177 LEU 177 176 176 LEU LEU A . n 
A 1 178 TYR 178 177 177 TYR TYR A . n 
A 1 179 GLN 179 178 178 GLN GLN A . n 
A 1 180 MET 180 179 179 MET MET A . n 
A 1 181 THR 181 180 180 THR THR A . n 
A 1 182 PRO 182 181 181 PRO PRO A . n 
A 1 183 GLU 183 182 182 GLU GLU A . n 
A 1 184 MET 184 183 183 MET MET A . n 
A 1 185 TRP 185 184 184 TRP TRP A . n 
A 1 186 GLU 186 185 185 GLU GLU A . n 
A 1 187 GLU 187 186 186 GLU GLU A . n 
A 1 188 ARG 188 187 187 ARG ARG A . n 
A 1 189 ILE 189 188 188 ILE ILE A . n 
A 1 190 THR 190 189 189 THR THR A . n 
A 1 191 ALA 191 190 190 ALA ALA A . n 
A 1 192 TRP 192 191 191 TRP TRP A . n 
A 1 193 TYR 193 192 192 TYR TYR A . n 
A 1 194 ALA 194 193 193 ALA ALA A . n 
A 1 195 GLU 195 194 194 GLU GLU A . n 
A 1 196 HIS 196 195 195 HIS HIS A . n 
A 1 197 ARG 197 196 196 ARG ARG A . n 
A 1 198 GLY 198 197 197 GLY GLY A . n 
A 1 199 ARG 199 198 198 ARG ARG A . n 
A 1 200 ALA 200 199 199 ALA ALA A . n 
A 1 201 ARG 201 200 200 ARG ARG A . n 
A 1 202 ASP 202 201 201 ASP ASP A . n 
A 1 203 GLU 203 202 202 GLU GLU A . n 
A 1 204 ALA 204 203 203 ALA ALA A . n 
A 1 205 GLU 205 204 204 GLU GLU A . n 
A 1 206 MET 206 205 205 MET MET A . n 
A 1 207 GLU 207 206 206 GLU GLU A . n 
A 1 208 TYR 208 207 207 TYR TYR A . n 
A 1 209 LEU 209 208 208 LEU LEU A . n 
A 1 210 LYS 210 209 209 LYS LYS A . n 
A 1 211 ILE 211 210 210 ILE ILE A . n 
A 1 212 ALA 212 211 211 ALA ALA A . n 
A 1 213 GLN 213 212 212 GLN GLN A . n 
A 1 214 ASP 214 213 213 ASP ASP A . n 
A 1 215 LEU 215 214 214 LEU LEU A . n 
A 1 216 GLU 216 215 215 GLU GLU A . n 
A 1 217 MET 217 216 216 MET MET A . n 
A 1 218 TYR 218 217 217 TYR TYR A . n 
A 1 219 GLY 219 218 218 GLY GLY A . n 
A 1 220 VAL 220 219 219 VAL VAL A . n 
A 1 221 ASN 221 220 220 ASN ASN A . n 
A 1 222 TYR 222 221 221 TYR TYR A . n 
A 1 223 PHE 223 222 222 PHE PHE A . n 
A 1 224 ALA 224 223 223 ALA ALA A . n 
A 1 225 ILE 225 224 224 ILE ILE A . n 
A 1 226 ARG 226 225 225 ARG ARG A . n 
A 1 227 ASN 227 226 226 ASN ASN A . n 
A 1 228 LYS 228 227 227 LYS LYS A . n 
A 1 229 LYS 229 228 228 LYS LYS A . n 
A 1 230 GLY 230 229 229 GLY GLY A . n 
A 1 231 THR 231 230 230 THR THR A . n 
A 1 232 GLU 232 231 231 GLU GLU A . n 
A 1 233 LEU 233 232 232 LEU LEU A . n 
A 1 234 LEU 234 233 233 LEU LEU A . n 
A 1 235 LEU 235 234 234 LEU LEU A . n 
A 1 236 GLY 236 235 235 GLY GLY A . n 
A 1 237 VAL 237 236 236 VAL VAL A . n 
A 1 238 ASP 238 237 237 ASP ASP A . n 
A 1 239 ALA 239 238 238 ALA ALA A . n 
A 1 240 LEU 240 239 239 LEU LEU A . n 
A 1 241 GLY 241 240 240 GLY GLY A . n 
A 1 242 LEU 242 241 241 LEU LEU A . n 
A 1 243 HIS 243 242 242 HIS HIS A . n 
A 1 244 ILE 244 243 243 ILE ILE A . n 
A 1 245 TYR 245 244 244 TYR TYR A . n 
A 1 246 ASP 246 245 245 ASP ASP A . n 
A 1 247 PRO 247 246 246 PRO PRO A . n 
A 1 248 GLU 248 247 247 GLU GLU A . n 
A 1 249 ASN 249 248 248 ASN ASN A . n 
A 1 250 ARG 250 249 249 ARG ARG A . n 
A 1 251 LEU 251 250 250 LEU LEU A . n 
A 1 252 THR 252 251 251 THR THR A . n 
A 1 253 PRO 253 252 252 PRO PRO A . n 
A 1 254 LYS 254 253 253 LYS LYS A . n 
A 1 255 ILE 255 254 254 ILE ILE A . n 
A 1 256 SER 256 255 255 SER SER A . n 
A 1 257 PHE 257 256 256 PHE PHE A . n 
A 1 258 PRO 258 257 257 PRO PRO A . n 
A 1 259 TRP 259 258 258 TRP TRP A . n 
A 1 260 ASN 260 259 259 ASN ASN A . n 
A 1 261 GLU 261 260 260 GLU GLU A . n 
A 1 262 ILE 262 261 261 ILE ILE A . n 
A 1 263 ARG 263 262 262 ARG ARG A . n 
A 1 264 ASN 264 263 263 ASN ASN A . n 
A 1 265 ILE 265 264 264 ILE ILE A . n 
A 1 266 SER 266 265 265 SER SER A . n 
A 1 267 TYR 267 266 266 TYR TYR A . n 
A 1 268 SER 268 267 267 SER SER A . n 
A 1 269 ASP 269 268 268 ASP ASP A . n 
A 1 270 LYS 270 269 269 LYS LYS A . n 
A 1 271 GLU 271 270 270 GLU GLU A . n 
A 1 272 PHE 272 271 271 PHE PHE A . n 
A 1 273 THR 273 272 272 THR THR A . n 
A 1 274 ILE 274 273 273 ILE ILE A . n 
A 1 275 LYS 275 274 274 LYS LYS A . n 
A 1 276 PRO 276 275 275 PRO PRO A . n 
A 1 277 LEU 277 276 276 LEU LEU A . n 
A 1 278 ASP 278 277 277 ASP ASP A . n 
A 1 279 LYS 279 278 278 LYS LYS A . n 
A 1 280 LYS 280 279 279 LYS LYS A . n 
A 1 281 ILE 281 280 280 ILE ILE A . n 
A 1 282 ASP 282 281 281 ASP ASP A . n 
A 1 283 VAL 283 282 282 VAL VAL A . n 
A 1 284 PHE 284 283 283 PHE PHE A . n 
A 1 285 LYS 285 284 284 LYS LYS A . n 
A 1 286 PHE 286 285 285 PHE PHE A . n 
A 1 287 ASN 287 286 286 ASN ASN A . n 
A 1 288 SER 288 287 287 SER SER A . n 
A 1 289 SER 289 288 288 SER SER A . n 
A 1 290 LYS 290 289 289 LYS LYS A . n 
A 1 291 LEU 291 290 290 LEU LEU A . n 
A 1 292 ARG 292 291 291 ARG ARG A . n 
A 1 293 VAL 293 292 292 VAL VAL A . n 
A 1 294 ASN 294 293 293 ASN ASN A . n 
A 1 295 LYS 295 294 294 LYS LYS A . n 
A 1 296 LEU 296 295 295 LEU LEU A . n 
A 1 297 ILE 297 296 296 ILE ILE A . n 
A 1 298 LEU 298 297 297 LEU LEU A . n 
A 1 299 GLN 299 298 298 GLN GLN A . n 
A 1 300 LEU 300 299 299 LEU LEU A . n 
A 1 301 CYS 301 300 300 CYS CYS A . n 
A 1 302 ILE 302 301 301 ILE ILE A . n 
A 1 303 GLY 303 302 302 GLY GLY A . n 
A 1 304 ASN 304 303 303 ASN ASN A . n 
A 1 305 HIS 305 304 304 HIS HIS A . n 
A 1 306 ASP 306 305 305 ASP ASP A . n 
A 1 307 LEU 307 306 306 LEU LEU A . n 
A 1 308 PHE 308 307 307 PHE PHE A . n 
A 1 309 MET 309 308 308 MET MET A . n 
A 1 310 ARG 310 309 309 ARG ARG A . n 
A 1 311 ARG 311 310 310 ARG ARG A . n 
A 1 312 ARG 312 311 311 ARG ARG A . n 
A 1 313 LYS 313 312 312 LYS LYS A . n 
A 1 314 ALA 314 313 313 ALA ALA A . n 
B 1 1   GLY 1   -1  ?   ?   ?   B . n 
B 1 2   MET 2   1   ?   ?   ?   B . n 
B 1 3   ALA 3   2   ?   ?   ?   B . n 
B 1 4   GLY 4   3   ?   ?   ?   B . n 
B 1 5   ALA 5   4   ?   ?   ?   B . n 
B 1 6   ILE 6   5   ?   ?   ?   B . n 
B 1 7   ALA 7   6   ?   ?   ?   B . n 
B 1 8   SER 8   7   ?   ?   ?   B . n 
B 1 9   ARG 9   8   ?   ?   ?   B . n 
B 1 10  MET 10  9   ?   ?   ?   B . n 
B 1 11  SER 11  10  ?   ?   ?   B . n 
B 1 12  PHE 12  11  ?   ?   ?   B . n 
B 1 13  SER 13  12  ?   ?   ?   B . n 
B 1 14  SER 14  13  ?   ?   ?   B . n 
B 1 15  LEU 15  14  ?   ?   ?   B . n 
B 1 16  LYS 16  15  ?   ?   ?   B . n 
B 1 17  ARG 17  16  ?   ?   ?   B . n 
B 1 18  LYS 18  17  ?   ?   ?   B . n 
B 1 19  GLN 19  18  ?   ?   ?   B . n 
B 1 20  PRO 20  19  ?   ?   ?   B . n 
B 1 21  LYS 21  20  20  LYS LYS B . n 
B 1 22  THR 22  21  21  THR THR B . n 
B 1 23  PHE 23  22  22  PHE PHE B . n 
B 1 24  THR 24  23  23  THR THR B . n 
B 1 25  VAL 25  24  24  VAL VAL B . n 
B 1 26  ARG 26  25  25  ARG ARG B . n 
B 1 27  ILE 27  26  26  ILE ILE B . n 
B 1 28  VAL 28  27  27  VAL VAL B . n 
B 1 29  THR 29  28  28  THR THR B . n 
B 1 30  MET 30  29  29  MET MET B . n 
B 1 31  ASP 31  30  30  ASP ASP B . n 
B 1 32  ALA 32  31  31  ALA ALA B . n 
B 1 33  GLU 33  32  32  GLU GLU B . n 
B 1 34  MET 34  33  33  MET MET B . n 
B 1 35  GLU 35  34  34  GLU GLU B . n 
B 1 36  PHE 36  35  35  PHE PHE B . n 
B 1 37  ASN 37  36  36  ASN ASN B . n 
B 1 38  CYS 38  37  37  CYS CYS B . n 
B 1 39  GLU 39  38  38  GLU GLU B . n 
B 1 40  MET 40  39  39  MET MET B . n 
B 1 41  LYS 41  40  40  LYS LYS B . n 
B 1 42  TRP 42  41  41  TRP TRP B . n 
B 1 43  LYS 43  42  42  LYS LYS B . n 
B 1 44  GLY 44  43  43  GLY GLY B . n 
B 1 45  LYS 45  44  44  LYS LYS B . n 
B 1 46  ASP 46  45  45  ASP ASP B . n 
B 1 47  LEU 47  46  46  LEU LEU B . n 
B 1 48  PHE 48  47  47  PHE PHE B . n 
B 1 49  ASP 49  48  48  ASP ASP B . n 
B 1 50  LEU 50  49  49  LEU LEU B . n 
B 1 51  VAL 51  50  50  VAL VAL B . n 
B 1 52  CYS 52  51  51  CYS CYS B . n 
B 1 53  ARG 53  52  52  ARG ARG B . n 
B 1 54  THR 54  53  53  THR THR B . n 
B 1 55  LEU 55  54  54  LEU LEU B . n 
B 1 56  GLY 56  55  55  GLY GLY B . n 
B 1 57  LEU 57  56  56  LEU LEU B . n 
B 1 58  ARG 58  57  57  ARG ARG B . n 
B 1 59  GLU 59  58  58  GLU GLU B . n 
B 1 60  THR 60  59  59  THR THR B . n 
B 1 61  TRP 61  60  60  TRP TRP B . n 
B 1 62  PHE 62  61  61  PHE PHE B . n 
B 1 63  PHE 63  62  62  PHE PHE B . n 
B 1 64  GLY 64  63  63  GLY GLY B . n 
B 1 65  LEU 65  64  64  LEU LEU B . n 
B 1 66  GLN 66  65  65  GLN GLN B . n 
B 1 67  TYR 67  66  66  TYR TYR B . n 
B 1 68  THR 68  67  67  THR THR B . n 
B 1 69  ILE 69  68  68  ILE ILE B . n 
B 1 70  LYS 70  69  69  LYS LYS B . n 
B 1 71  ASP 71  70  70  ASP ASP B . n 
B 1 72  THR 72  71  71  THR THR B . n 
B 1 73  VAL 73  72  72  VAL VAL B . n 
B 1 74  ALA 74  73  73  ALA ALA B . n 
B 1 75  TRP 75  74  74  TRP TRP B . n 
B 1 76  LEU 76  75  75  LEU LEU B . n 
B 1 77  LYS 77  76  76  LYS LYS B . n 
B 1 78  MET 78  77  77  MET MET B . n 
B 1 79  ASP 79  78  78  ASP ASP B . n 
B 1 80  LYS 80  79  79  LYS LYS B . n 
B 1 81  LYS 81  80  80  LYS LYS B . n 
B 1 82  VAL 82  81  81  VAL VAL B . n 
B 1 83  LEU 83  82  82  LEU LEU B . n 
B 1 84  ASP 84  83  83  ASP ASP B . n 
B 1 85  HIS 85  84  84  HIS HIS B . n 
B 1 86  ASP 86  85  85  ASP ASP B . n 
B 1 87  VAL 87  86  86  VAL VAL B . n 
B 1 88  SER 88  87  87  SER SER B . n 
B 1 89  LYS 89  88  88  LYS LYS B . n 
B 1 90  GLU 90  89  89  GLU GLU B . n 
B 1 91  GLU 91  90  90  GLU GLU B . n 
B 1 92  PRO 92  91  91  PRO PRO B . n 
B 1 93  VAL 93  92  92  VAL VAL B . n 
B 1 94  THR 94  93  93  THR THR B . n 
B 1 95  PHE 95  94  94  PHE PHE B . n 
B 1 96  HIS 96  95  95  HIS HIS B . n 
B 1 97  PHE 97  96  96  PHE PHE B . n 
B 1 98  LEU 98  97  97  LEU LEU B . n 
B 1 99  ALA 99  98  98  ALA ALA B . n 
B 1 100 LYS 100 99  99  LYS LYS B . n 
B 1 101 PHE 101 100 100 PHE PHE B . n 
B 1 102 TYR 102 101 101 TYR TYR B . n 
B 1 103 PRO 103 102 102 PRO PRO B . n 
B 1 104 GLU 104 103 103 GLU GLU B . n 
B 1 105 ASN 105 104 104 ASN ASN B . n 
B 1 106 ALA 106 105 105 ALA ALA B . n 
B 1 107 GLU 107 106 106 GLU GLU B . n 
B 1 108 GLU 108 107 107 GLU GLU B . n 
B 1 109 GLU 109 108 108 GLU GLU B . n 
B 1 110 LEU 110 109 109 LEU LEU B . n 
B 1 111 VAL 111 110 110 VAL VAL B . n 
B 1 112 GLN 112 111 111 GLN GLN B . n 
B 1 113 GLU 113 112 112 GLU GLU B . n 
B 1 114 ILE 114 113 113 ILE ILE B . n 
B 1 115 THR 115 114 114 THR THR B . n 
B 1 116 GLN 116 115 115 GLN GLN B . n 
B 1 117 HIS 117 116 116 HIS HIS B . n 
B 1 118 LEU 118 117 117 LEU LEU B . n 
B 1 119 PHE 119 118 118 PHE PHE B . n 
B 1 120 PHE 120 119 119 PHE PHE B . n 
B 1 121 LEU 121 120 120 LEU LEU B . n 
B 1 122 GLN 122 121 121 GLN GLN B . n 
B 1 123 VAL 123 122 122 VAL VAL B . n 
B 1 124 LYS 124 123 123 LYS LYS B . n 
B 1 125 LYS 125 124 124 LYS LYS B . n 
B 1 126 GLN 126 125 125 GLN GLN B . n 
B 1 127 ILE 127 126 126 ILE ILE B . n 
B 1 128 LEU 128 127 127 LEU LEU B . n 
B 1 129 ASP 129 128 128 ASP ASP B . n 
B 1 130 GLU 130 129 129 GLU GLU B . n 
B 1 131 LYS 131 130 130 LYS LYS B . n 
B 1 132 ILE 132 131 131 ILE ILE B . n 
B 1 133 TYR 133 132 132 TYR TYR B . n 
B 1 134 CYS 134 133 133 CYS CYS B . n 
B 1 135 PRO 135 134 134 PRO PRO B . n 
B 1 136 PRO 136 135 135 PRO PRO B . n 
B 1 137 GLU 137 136 136 GLU GLU B . n 
B 1 138 ALA 138 137 137 ALA ALA B . n 
B 1 139 SER 139 138 138 SER SER B . n 
B 1 140 VAL 140 139 139 VAL VAL B . n 
B 1 141 LEU 141 140 140 LEU LEU B . n 
B 1 142 LEU 142 141 141 LEU LEU B . n 
B 1 143 ALA 143 142 142 ALA ALA B . n 
B 1 144 SER 144 143 143 SER SER B . n 
B 1 145 TYR 145 144 144 TYR TYR B . n 
B 1 146 ALA 146 145 145 ALA ALA B . n 
B 1 147 VAL 147 146 146 VAL VAL B . n 
B 1 148 GLN 148 147 147 GLN GLN B . n 
B 1 149 ALA 149 148 148 ALA ALA B . n 
B 1 150 LYS 150 149 149 LYS LYS B . n 
B 1 151 TYR 151 150 150 TYR TYR B . n 
B 1 152 GLY 152 151 151 GLY GLY B . n 
B 1 153 ASP 153 152 152 ASP ASP B . n 
B 1 154 TYR 154 153 153 TYR TYR B . n 
B 1 155 ASP 155 154 154 ASP ASP B . n 
B 1 156 PRO 156 155 155 PRO PRO B . n 
B 1 157 SER 157 156 156 SER SER B . n 
B 1 158 VAL 158 157 157 VAL VAL B . n 
B 1 159 HIS 159 158 158 HIS HIS B . n 
B 1 160 LYS 160 159 159 LYS LYS B . n 
B 1 161 ARG 161 160 160 ARG ARG B . n 
B 1 162 GLY 162 161 161 GLY GLY B . n 
B 1 163 PHE 163 162 162 PHE PHE B . n 
B 1 164 LEU 164 163 163 LEU LEU B . n 
B 1 165 ALA 165 164 164 ALA ALA B . n 
B 1 166 GLN 166 165 165 GLN GLN B . n 
B 1 167 GLU 167 166 166 GLU GLU B . n 
B 1 168 GLU 168 167 167 GLU GLU B . n 
B 1 169 LEU 169 168 168 LEU LEU B . n 
B 1 170 LEU 170 169 169 LEU LEU B . n 
B 1 171 PRO 171 170 170 PRO PRO B . n 
B 1 172 LYS 172 171 171 LYS LYS B . n 
B 1 173 ARG 173 172 172 ARG ARG B . n 
B 1 174 VAL 174 173 173 VAL VAL B . n 
B 1 175 ILE 175 174 174 ILE ILE B . n 
B 1 176 ASN 176 175 175 ASN ASN B . n 
B 1 177 LEU 177 176 176 LEU LEU B . n 
B 1 178 TYR 178 177 177 TYR TYR B . n 
B 1 179 GLN 179 178 178 GLN GLN B . n 
B 1 180 MET 180 179 179 MET MET B . n 
B 1 181 THR 181 180 180 THR THR B . n 
B 1 182 PRO 182 181 181 PRO PRO B . n 
B 1 183 GLU 183 182 182 GLU GLU B . n 
B 1 184 MET 184 183 183 MET MET B . n 
B 1 185 TRP 185 184 184 TRP TRP B . n 
B 1 186 GLU 186 185 185 GLU GLU B . n 
B 1 187 GLU 187 186 186 GLU GLU B . n 
B 1 188 ARG 188 187 187 ARG ARG B . n 
B 1 189 ILE 189 188 188 ILE ILE B . n 
B 1 190 THR 190 189 189 THR THR B . n 
B 1 191 ALA 191 190 190 ALA ALA B . n 
B 1 192 TRP 192 191 191 TRP TRP B . n 
B 1 193 TYR 193 192 192 TYR TYR B . n 
B 1 194 ALA 194 193 193 ALA ALA B . n 
B 1 195 GLU 195 194 194 GLU GLU B . n 
B 1 196 HIS 196 195 195 HIS HIS B . n 
B 1 197 ARG 197 196 196 ARG ARG B . n 
B 1 198 GLY 198 197 197 GLY GLY B . n 
B 1 199 ARG 199 198 198 ARG ARG B . n 
B 1 200 ALA 200 199 199 ALA ALA B . n 
B 1 201 ARG 201 200 200 ARG ARG B . n 
B 1 202 ASP 202 201 201 ASP ASP B . n 
B 1 203 GLU 203 202 202 GLU GLU B . n 
B 1 204 ALA 204 203 203 ALA ALA B . n 
B 1 205 GLU 205 204 204 GLU GLU B . n 
B 1 206 MET 206 205 205 MET MET B . n 
B 1 207 GLU 207 206 206 GLU GLU B . n 
B 1 208 TYR 208 207 207 TYR TYR B . n 
B 1 209 LEU 209 208 208 LEU LEU B . n 
B 1 210 LYS 210 209 209 LYS LYS B . n 
B 1 211 ILE 211 210 210 ILE ILE B . n 
B 1 212 ALA 212 211 211 ALA ALA B . n 
B 1 213 GLN 213 212 212 GLN GLN B . n 
B 1 214 ASP 214 213 213 ASP ASP B . n 
B 1 215 LEU 215 214 214 LEU LEU B . n 
B 1 216 GLU 216 215 215 GLU GLU B . n 
B 1 217 MET 217 216 216 MET MET B . n 
B 1 218 TYR 218 217 217 TYR TYR B . n 
B 1 219 GLY 219 218 218 GLY GLY B . n 
B 1 220 VAL 220 219 219 VAL VAL B . n 
B 1 221 ASN 221 220 220 ASN ASN B . n 
B 1 222 TYR 222 221 221 TYR TYR B . n 
B 1 223 PHE 223 222 222 PHE PHE B . n 
B 1 224 ALA 224 223 223 ALA ALA B . n 
B 1 225 ILE 225 224 224 ILE ILE B . n 
B 1 226 ARG 226 225 225 ARG ARG B . n 
B 1 227 ASN 227 226 226 ASN ASN B . n 
B 1 228 LYS 228 227 227 LYS LYS B . n 
B 1 229 LYS 229 228 228 LYS LYS B . n 
B 1 230 GLY 230 229 229 GLY GLY B . n 
B 1 231 THR 231 230 230 THR THR B . n 
B 1 232 GLU 232 231 231 GLU GLU B . n 
B 1 233 LEU 233 232 232 LEU LEU B . n 
B 1 234 LEU 234 233 233 LEU LEU B . n 
B 1 235 LEU 235 234 234 LEU LEU B . n 
B 1 236 GLY 236 235 235 GLY GLY B . n 
B 1 237 VAL 237 236 236 VAL VAL B . n 
B 1 238 ASP 238 237 237 ASP ASP B . n 
B 1 239 ALA 239 238 238 ALA ALA B . n 
B 1 240 LEU 240 239 239 LEU LEU B . n 
B 1 241 GLY 241 240 240 GLY GLY B . n 
B 1 242 LEU 242 241 241 LEU LEU B . n 
B 1 243 HIS 243 242 242 HIS HIS B . n 
B 1 244 ILE 244 243 243 ILE ILE B . n 
B 1 245 TYR 245 244 244 TYR TYR B . n 
B 1 246 ASP 246 245 245 ASP ASP B . n 
B 1 247 PRO 247 246 246 PRO PRO B . n 
B 1 248 GLU 248 247 247 GLU GLU B . n 
B 1 249 ASN 249 248 248 ASN ASN B . n 
B 1 250 ARG 250 249 249 ARG ARG B . n 
B 1 251 LEU 251 250 250 LEU LEU B . n 
B 1 252 THR 252 251 251 THR THR B . n 
B 1 253 PRO 253 252 252 PRO PRO B . n 
B 1 254 LYS 254 253 253 LYS LYS B . n 
B 1 255 ILE 255 254 254 ILE ILE B . n 
B 1 256 SER 256 255 255 SER SER B . n 
B 1 257 PHE 257 256 256 PHE PHE B . n 
B 1 258 PRO 258 257 257 PRO PRO B . n 
B 1 259 TRP 259 258 258 TRP TRP B . n 
B 1 260 ASN 260 259 259 ASN ASN B . n 
B 1 261 GLU 261 260 260 GLU GLU B . n 
B 1 262 ILE 262 261 261 ILE ILE B . n 
B 1 263 ARG 263 262 262 ARG ARG B . n 
B 1 264 ASN 264 263 263 ASN ASN B . n 
B 1 265 ILE 265 264 264 ILE ILE B . n 
B 1 266 SER 266 265 265 SER SER B . n 
B 1 267 TYR 267 266 266 TYR TYR B . n 
B 1 268 SER 268 267 267 SER SER B . n 
B 1 269 ASP 269 268 268 ASP ASP B . n 
B 1 270 LYS 270 269 269 LYS LYS B . n 
B 1 271 GLU 271 270 270 GLU GLU B . n 
B 1 272 PHE 272 271 271 PHE PHE B . n 
B 1 273 THR 273 272 272 THR THR B . n 
B 1 274 ILE 274 273 273 ILE ILE B . n 
B 1 275 LYS 275 274 274 LYS LYS B . n 
B 1 276 PRO 276 275 275 PRO PRO B . n 
B 1 277 LEU 277 276 276 LEU LEU B . n 
B 1 278 ASP 278 277 277 ASP ASP B . n 
B 1 279 LYS 279 278 278 LYS LYS B . n 
B 1 280 LYS 280 279 279 LYS LYS B . n 
B 1 281 ILE 281 280 280 ILE ILE B . n 
B 1 282 ASP 282 281 281 ASP ASP B . n 
B 1 283 VAL 283 282 282 VAL VAL B . n 
B 1 284 PHE 284 283 283 PHE PHE B . n 
B 1 285 LYS 285 284 284 LYS LYS B . n 
B 1 286 PHE 286 285 285 PHE PHE B . n 
B 1 287 ASN 287 286 286 ASN ASN B . n 
B 1 288 SER 288 287 287 SER SER B . n 
B 1 289 SER 289 288 288 SER SER B . n 
B 1 290 LYS 290 289 289 LYS LYS B . n 
B 1 291 LEU 291 290 290 LEU LEU B . n 
B 1 292 ARG 292 291 291 ARG ARG B . n 
B 1 293 VAL 293 292 292 VAL VAL B . n 
B 1 294 ASN 294 293 293 ASN ASN B . n 
B 1 295 LYS 295 294 294 LYS LYS B . n 
B 1 296 LEU 296 295 295 LEU LEU B . n 
B 1 297 ILE 297 296 296 ILE ILE B . n 
B 1 298 LEU 298 297 297 LEU LEU B . n 
B 1 299 GLN 299 298 298 GLN GLN B . n 
B 1 300 LEU 300 299 299 LEU LEU B . n 
B 1 301 CYS 301 300 300 CYS CYS B . n 
B 1 302 ILE 302 301 301 ILE ILE B . n 
B 1 303 GLY 303 302 302 GLY GLY B . n 
B 1 304 ASN 304 303 303 ASN ASN B . n 
B 1 305 HIS 305 304 304 HIS HIS B . n 
B 1 306 ASP 306 305 305 ASP ASP B . n 
B 1 307 LEU 307 306 306 LEU LEU B . n 
B 1 308 PHE 308 307 307 PHE PHE B . n 
B 1 309 MET 309 308 308 MET MET B . n 
B 1 310 ARG 310 309 309 ARG ARG B . n 
B 1 311 ARG 311 310 310 ARG ARG B . n 
B 1 312 ARG 312 311 311 ARG ARG B . n 
B 1 313 LYS 313 312 312 LYS LYS B . n 
B 1 314 ALA 314 313 313 ALA ALA B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 SO4 1   1314 1314 SO4 SO4 A . 
D 2 SO4 1   1315 1315 SO4 SO4 A . 
E 2 SO4 1   1316 1316 SO4 SO4 A . 
F 2 SO4 1   1317 1317 SO4 SO4 A . 
G 2 SO4 1   1314 1314 SO4 SO4 B . 
H 2 SO4 1   1315 1315 SO4 SO4 B . 
I 3 HOH 1   2001 2001 HOH HOH A . 
I 3 HOH 2   2002 2002 HOH HOH A . 
I 3 HOH 3   2003 2003 HOH HOH A . 
I 3 HOH 4   2004 2004 HOH HOH A . 
I 3 HOH 5   2005 2005 HOH HOH A . 
I 3 HOH 6   2006 2006 HOH HOH A . 
I 3 HOH 7   2007 2007 HOH HOH A . 
I 3 HOH 8   2008 2008 HOH HOH A . 
I 3 HOH 9   2009 2009 HOH HOH A . 
I 3 HOH 10  2010 2010 HOH HOH A . 
I 3 HOH 11  2011 2011 HOH HOH A . 
I 3 HOH 12  2012 2012 HOH HOH A . 
I 3 HOH 13  2013 2013 HOH HOH A . 
I 3 HOH 14  2014 2014 HOH HOH A . 
I 3 HOH 15  2015 2015 HOH HOH A . 
I 3 HOH 16  2016 2016 HOH HOH A . 
I 3 HOH 17  2017 2017 HOH HOH A . 
I 3 HOH 18  2018 2018 HOH HOH A . 
I 3 HOH 19  2019 2019 HOH HOH A . 
I 3 HOH 20  2020 2020 HOH HOH A . 
I 3 HOH 21  2021 2021 HOH HOH A . 
I 3 HOH 22  2022 2022 HOH HOH A . 
I 3 HOH 23  2023 2023 HOH HOH A . 
I 3 HOH 24  2024 2024 HOH HOH A . 
I 3 HOH 25  2025 2025 HOH HOH A . 
I 3 HOH 26  2026 2026 HOH HOH A . 
I 3 HOH 27  2027 2027 HOH HOH A . 
I 3 HOH 28  2028 2028 HOH HOH A . 
I 3 HOH 29  2029 2029 HOH HOH A . 
I 3 HOH 30  2030 2030 HOH HOH A . 
I 3 HOH 31  2031 2031 HOH HOH A . 
I 3 HOH 32  2032 2032 HOH HOH A . 
I 3 HOH 33  2033 2033 HOH HOH A . 
I 3 HOH 34  2034 2034 HOH HOH A . 
I 3 HOH 35  2035 2035 HOH HOH A . 
I 3 HOH 36  2036 2036 HOH HOH A . 
I 3 HOH 37  2037 2037 HOH HOH A . 
I 3 HOH 38  2038 2038 HOH HOH A . 
I 3 HOH 39  2039 2039 HOH HOH A . 
I 3 HOH 40  2040 2040 HOH HOH A . 
I 3 HOH 41  2041 2041 HOH HOH A . 
I 3 HOH 42  2042 2042 HOH HOH A . 
I 3 HOH 43  2043 2043 HOH HOH A . 
I 3 HOH 44  2044 2044 HOH HOH A . 
I 3 HOH 45  2045 2045 HOH HOH A . 
I 3 HOH 46  2046 2046 HOH HOH A . 
I 3 HOH 47  2047 2047 HOH HOH A . 
I 3 HOH 48  2048 2048 HOH HOH A . 
I 3 HOH 49  2049 2049 HOH HOH A . 
I 3 HOH 50  2050 2050 HOH HOH A . 
I 3 HOH 51  2051 2051 HOH HOH A . 
I 3 HOH 52  2052 2052 HOH HOH A . 
I 3 HOH 53  2053 2053 HOH HOH A . 
I 3 HOH 54  2054 2054 HOH HOH A . 
I 3 HOH 55  2055 2055 HOH HOH A . 
I 3 HOH 56  2056 2056 HOH HOH A . 
I 3 HOH 57  2057 2057 HOH HOH A . 
I 3 HOH 58  2058 2058 HOH HOH A . 
I 3 HOH 59  2059 2059 HOH HOH A . 
I 3 HOH 60  2060 2060 HOH HOH A . 
I 3 HOH 61  2061 2061 HOH HOH A . 
I 3 HOH 62  2062 2062 HOH HOH A . 
I 3 HOH 63  2063 2063 HOH HOH A . 
I 3 HOH 64  2064 2064 HOH HOH A . 
I 3 HOH 65  2065 2065 HOH HOH A . 
I 3 HOH 66  2066 2066 HOH HOH A . 
I 3 HOH 67  2067 2067 HOH HOH A . 
I 3 HOH 68  2068 2068 HOH HOH A . 
I 3 HOH 69  2069 2069 HOH HOH A . 
I 3 HOH 70  2070 2070 HOH HOH A . 
I 3 HOH 71  2071 2071 HOH HOH A . 
I 3 HOH 72  2072 2072 HOH HOH A . 
I 3 HOH 73  2073 2073 HOH HOH A . 
I 3 HOH 74  2074 2074 HOH HOH A . 
I 3 HOH 75  2075 2075 HOH HOH A . 
I 3 HOH 76  2076 2076 HOH HOH A . 
I 3 HOH 77  2077 2077 HOH HOH A . 
I 3 HOH 78  2078 2078 HOH HOH A . 
I 3 HOH 79  2079 2079 HOH HOH A . 
I 3 HOH 80  2080 2080 HOH HOH A . 
I 3 HOH 81  2081 2081 HOH HOH A . 
I 3 HOH 82  2082 2082 HOH HOH A . 
I 3 HOH 83  2083 2083 HOH HOH A . 
I 3 HOH 84  2084 2084 HOH HOH A . 
I 3 HOH 85  2085 2085 HOH HOH A . 
I 3 HOH 86  2086 2086 HOH HOH A . 
I 3 HOH 87  2087 2087 HOH HOH A . 
I 3 HOH 88  2088 2088 HOH HOH A . 
I 3 HOH 89  2089 2089 HOH HOH A . 
I 3 HOH 90  2090 2090 HOH HOH A . 
I 3 HOH 91  2091 2091 HOH HOH A . 
I 3 HOH 92  2092 2092 HOH HOH A . 
I 3 HOH 93  2093 2093 HOH HOH A . 
I 3 HOH 94  2094 2094 HOH HOH A . 
I 3 HOH 95  2095 2095 HOH HOH A . 
I 3 HOH 96  2096 2096 HOH HOH A . 
I 3 HOH 97  2097 2097 HOH HOH A . 
I 3 HOH 98  2098 2098 HOH HOH A . 
I 3 HOH 99  2099 2099 HOH HOH A . 
I 3 HOH 100 2100 2100 HOH HOH A . 
I 3 HOH 101 2101 2101 HOH HOH A . 
I 3 HOH 102 2102 2102 HOH HOH A . 
I 3 HOH 103 2103 2103 HOH HOH A . 
I 3 HOH 104 2104 2104 HOH HOH A . 
I 3 HOH 105 2105 2105 HOH HOH A . 
I 3 HOH 106 2106 2106 HOH HOH A . 
I 3 HOH 107 2107 2107 HOH HOH A . 
I 3 HOH 108 2108 2108 HOH HOH A . 
I 3 HOH 109 2109 2109 HOH HOH A . 
I 3 HOH 110 2110 2110 HOH HOH A . 
I 3 HOH 111 2111 2111 HOH HOH A . 
I 3 HOH 112 2112 2112 HOH HOH A . 
I 3 HOH 113 2113 2113 HOH HOH A . 
I 3 HOH 114 2114 2114 HOH HOH A . 
I 3 HOH 115 2115 2115 HOH HOH A . 
I 3 HOH 116 2116 2116 HOH HOH A . 
I 3 HOH 117 2117 2117 HOH HOH A . 
I 3 HOH 118 2118 2118 HOH HOH A . 
I 3 HOH 119 2119 2119 HOH HOH A . 
I 3 HOH 120 2120 2120 HOH HOH A . 
I 3 HOH 121 2121 2121 HOH HOH A . 
I 3 HOH 122 2122 2122 HOH HOH A . 
I 3 HOH 123 2123 2123 HOH HOH A . 
I 3 HOH 124 2124 2124 HOH HOH A . 
I 3 HOH 125 2125 2125 HOH HOH A . 
I 3 HOH 126 2126 2126 HOH HOH A . 
I 3 HOH 127 2127 2127 HOH HOH A . 
I 3 HOH 128 2128 2128 HOH HOH A . 
I 3 HOH 129 2129 2129 HOH HOH A . 
I 3 HOH 130 2130 2130 HOH HOH A . 
I 3 HOH 131 2131 2131 HOH HOH A . 
I 3 HOH 132 2132 2132 HOH HOH A . 
I 3 HOH 133 2133 2133 HOH HOH A . 
I 3 HOH 134 2134 2134 HOH HOH A . 
I 3 HOH 135 2135 2135 HOH HOH A . 
I 3 HOH 136 2136 2136 HOH HOH A . 
I 3 HOH 137 2137 2137 HOH HOH A . 
I 3 HOH 138 2138 2138 HOH HOH A . 
I 3 HOH 139 2139 2139 HOH HOH A . 
I 3 HOH 140 2140 2140 HOH HOH A . 
I 3 HOH 141 2141 2141 HOH HOH A . 
I 3 HOH 142 2142 2142 HOH HOH A . 
I 3 HOH 143 2143 2143 HOH HOH A . 
I 3 HOH 144 2144 2144 HOH HOH A . 
I 3 HOH 145 2145 2145 HOH HOH A . 
I 3 HOH 146 2146 2146 HOH HOH A . 
I 3 HOH 147 2147 2147 HOH HOH A . 
I 3 HOH 148 2148 2148 HOH HOH A . 
I 3 HOH 149 2149 2149 HOH HOH A . 
I 3 HOH 150 2150 2150 HOH HOH A . 
I 3 HOH 151 2151 2151 HOH HOH A . 
I 3 HOH 152 2152 2152 HOH HOH A . 
I 3 HOH 153 2153 2153 HOH HOH A . 
I 3 HOH 154 2154 2154 HOH HOH A . 
I 3 HOH 155 2155 2155 HOH HOH A . 
I 3 HOH 156 2156 2156 HOH HOH A . 
I 3 HOH 157 2157 2157 HOH HOH A . 
I 3 HOH 158 2158 2158 HOH HOH A . 
I 3 HOH 159 2159 2159 HOH HOH A . 
I 3 HOH 160 2160 2160 HOH HOH A . 
I 3 HOH 161 2161 2161 HOH HOH A . 
I 3 HOH 162 2162 2162 HOH HOH A . 
I 3 HOH 163 2163 2163 HOH HOH A . 
I 3 HOH 164 2164 2164 HOH HOH A . 
I 3 HOH 165 2165 2165 HOH HOH A . 
I 3 HOH 166 2166 2166 HOH HOH A . 
I 3 HOH 167 2167 2167 HOH HOH A . 
I 3 HOH 168 2168 2168 HOH HOH A . 
I 3 HOH 169 2169 2169 HOH HOH A . 
I 3 HOH 170 2170 2170 HOH HOH A . 
I 3 HOH 171 2171 2171 HOH HOH A . 
I 3 HOH 172 2172 2172 HOH HOH A . 
I 3 HOH 173 2173 2173 HOH HOH A . 
I 3 HOH 174 2174 2174 HOH HOH A . 
I 3 HOH 175 2175 2175 HOH HOH A . 
I 3 HOH 176 2176 2176 HOH HOH A . 
I 3 HOH 177 2177 2177 HOH HOH A . 
I 3 HOH 178 2178 2178 HOH HOH A . 
I 3 HOH 179 2179 2179 HOH HOH A . 
I 3 HOH 180 2180 2180 HOH HOH A . 
I 3 HOH 181 2181 2181 HOH HOH A . 
I 3 HOH 182 2182 2182 HOH HOH A . 
I 3 HOH 183 2183 2183 HOH HOH A . 
I 3 HOH 184 2184 2184 HOH HOH A . 
I 3 HOH 185 2185 2185 HOH HOH A . 
I 3 HOH 186 2186 2186 HOH HOH A . 
I 3 HOH 187 2187 2187 HOH HOH A . 
I 3 HOH 188 2188 2188 HOH HOH A . 
I 3 HOH 189 2189 2189 HOH HOH A . 
I 3 HOH 190 2190 2190 HOH HOH A . 
I 3 HOH 191 2191 2191 HOH HOH A . 
I 3 HOH 192 2192 2192 HOH HOH A . 
I 3 HOH 193 2193 2193 HOH HOH A . 
I 3 HOH 194 2194 2194 HOH HOH A . 
I 3 HOH 195 2195 2195 HOH HOH A . 
I 3 HOH 196 2196 2196 HOH HOH A . 
I 3 HOH 197 2197 2197 HOH HOH A . 
I 3 HOH 198 2198 2198 HOH HOH A . 
I 3 HOH 199 2199 2199 HOH HOH A . 
I 3 HOH 200 2200 2200 HOH HOH A . 
I 3 HOH 201 2201 2201 HOH HOH A . 
I 3 HOH 202 2202 2202 HOH HOH A . 
I 3 HOH 203 2203 2203 HOH HOH A . 
I 3 HOH 204 2204 2204 HOH HOH A . 
I 3 HOH 205 2205 2205 HOH HOH A . 
I 3 HOH 206 2206 2206 HOH HOH A . 
I 3 HOH 207 2207 2207 HOH HOH A . 
I 3 HOH 208 2208 2208 HOH HOH A . 
I 3 HOH 209 2209 2209 HOH HOH A . 
I 3 HOH 210 2210 2210 HOH HOH A . 
I 3 HOH 211 2211 2211 HOH HOH A . 
I 3 HOH 212 2212 2212 HOH HOH A . 
I 3 HOH 213 2213 2213 HOH HOH A . 
I 3 HOH 214 2214 2214 HOH HOH A . 
I 3 HOH 215 2215 2215 HOH HOH A . 
I 3 HOH 216 2216 2216 HOH HOH A . 
I 3 HOH 217 2217 2217 HOH HOH A . 
I 3 HOH 218 2218 2218 HOH HOH A . 
I 3 HOH 219 2219 2219 HOH HOH A . 
I 3 HOH 220 2220 2220 HOH HOH A . 
I 3 HOH 221 2221 2221 HOH HOH A . 
I 3 HOH 222 2222 2222 HOH HOH A . 
I 3 HOH 223 2223 2223 HOH HOH A . 
I 3 HOH 224 2224 2224 HOH HOH A . 
I 3 HOH 225 2225 2225 HOH HOH A . 
I 3 HOH 226 2226 2226 HOH HOH A . 
I 3 HOH 227 2227 2227 HOH HOH A . 
I 3 HOH 228 2228 2228 HOH HOH A . 
I 3 HOH 229 2229 2229 HOH HOH A . 
I 3 HOH 230 2230 2230 HOH HOH A . 
I 3 HOH 231 2231 2231 HOH HOH A . 
I 3 HOH 232 2232 2232 HOH HOH A . 
I 3 HOH 233 2233 2233 HOH HOH A . 
I 3 HOH 234 2234 2234 HOH HOH A . 
I 3 HOH 235 2235 2235 HOH HOH A . 
I 3 HOH 236 2236 2236 HOH HOH A . 
I 3 HOH 237 2237 2237 HOH HOH A . 
I 3 HOH 238 2238 2238 HOH HOH A . 
I 3 HOH 239 2239 2239 HOH HOH A . 
I 3 HOH 240 2240 2240 HOH HOH A . 
I 3 HOH 241 2241 2241 HOH HOH A . 
I 3 HOH 242 2242 2242 HOH HOH A . 
I 3 HOH 243 2243 2243 HOH HOH A . 
I 3 HOH 244 2244 2244 HOH HOH A . 
I 3 HOH 245 2245 2245 HOH HOH A . 
I 3 HOH 246 2246 2246 HOH HOH A . 
I 3 HOH 247 2247 2247 HOH HOH A . 
I 3 HOH 248 2248 2248 HOH HOH A . 
I 3 HOH 249 2249 2249 HOH HOH A . 
I 3 HOH 250 2250 2250 HOH HOH A . 
I 3 HOH 251 2251 2251 HOH HOH A . 
I 3 HOH 252 2252 2252 HOH HOH A . 
I 3 HOH 253 2253 2253 HOH HOH A . 
I 3 HOH 254 2254 2254 HOH HOH A . 
I 3 HOH 255 2255 2255 HOH HOH A . 
I 3 HOH 256 2256 2256 HOH HOH A . 
I 3 HOH 257 2257 2257 HOH HOH A . 
I 3 HOH 258 2258 2258 HOH HOH A . 
I 3 HOH 259 2259 2259 HOH HOH A . 
I 3 HOH 260 2260 2260 HOH HOH A . 
I 3 HOH 261 2261 2261 HOH HOH A . 
I 3 HOH 262 2262 2262 HOH HOH A . 
I 3 HOH 263 2263 2263 HOH HOH A . 
I 3 HOH 264 2264 2264 HOH HOH A . 
I 3 HOH 265 2265 2265 HOH HOH A . 
I 3 HOH 266 2266 2266 HOH HOH A . 
I 3 HOH 267 2267 2267 HOH HOH A . 
I 3 HOH 268 2268 2268 HOH HOH A . 
I 3 HOH 269 2269 2269 HOH HOH A . 
I 3 HOH 270 2270 2270 HOH HOH A . 
I 3 HOH 271 2271 2271 HOH HOH A . 
I 3 HOH 272 2272 2272 HOH HOH A . 
I 3 HOH 273 2273 2273 HOH HOH A . 
I 3 HOH 274 2274 2274 HOH HOH A . 
I 3 HOH 275 2275 2275 HOH HOH A . 
I 3 HOH 276 2276 2276 HOH HOH A . 
I 3 HOH 277 2277 2277 HOH HOH A . 
I 3 HOH 278 2278 2278 HOH HOH A . 
I 3 HOH 279 2279 2279 HOH HOH A . 
I 3 HOH 280 2280 2280 HOH HOH A . 
I 3 HOH 281 2281 2281 HOH HOH A . 
I 3 HOH 282 2282 2282 HOH HOH A . 
I 3 HOH 283 2283 2283 HOH HOH A . 
I 3 HOH 284 2284 2284 HOH HOH A . 
I 3 HOH 285 2285 2285 HOH HOH A . 
I 3 HOH 286 2286 2286 HOH HOH A . 
I 3 HOH 287 2287 2287 HOH HOH A . 
I 3 HOH 288 2288 2288 HOH HOH A . 
I 3 HOH 289 2289 2289 HOH HOH A . 
I 3 HOH 290 2290 2290 HOH HOH A . 
I 3 HOH 291 2291 2291 HOH HOH A . 
I 3 HOH 292 2292 2292 HOH HOH A . 
I 3 HOH 293 2293 2293 HOH HOH A . 
I 3 HOH 294 2294 2294 HOH HOH A . 
I 3 HOH 295 2295 2295 HOH HOH A . 
I 3 HOH 296 2296 2296 HOH HOH A . 
I 3 HOH 297 2297 2297 HOH HOH A . 
I 3 HOH 298 2298 2298 HOH HOH A . 
I 3 HOH 299 2299 2299 HOH HOH A . 
I 3 HOH 300 2300 2300 HOH HOH A . 
I 3 HOH 301 2301 2301 HOH HOH A . 
I 3 HOH 302 2302 2302 HOH HOH A . 
I 3 HOH 303 2303 2303 HOH HOH A . 
I 3 HOH 304 2304 2304 HOH HOH A . 
I 3 HOH 305 2305 2305 HOH HOH A . 
I 3 HOH 306 2306 2306 HOH HOH A . 
I 3 HOH 307 2307 2307 HOH HOH A . 
I 3 HOH 308 2308 2308 HOH HOH A . 
I 3 HOH 309 2309 2309 HOH HOH A . 
I 3 HOH 310 2310 2310 HOH HOH A . 
I 3 HOH 311 2311 2311 HOH HOH A . 
I 3 HOH 312 2312 2312 HOH HOH A . 
I 3 HOH 313 2313 2313 HOH HOH A . 
I 3 HOH 314 2314 2314 HOH HOH A . 
I 3 HOH 315 2315 2315 HOH HOH A . 
I 3 HOH 316 2316 2316 HOH HOH A . 
I 3 HOH 317 2317 2317 HOH HOH A . 
I 3 HOH 318 2318 2318 HOH HOH A . 
I 3 HOH 319 2319 2319 HOH HOH A . 
I 3 HOH 320 2320 2320 HOH HOH A . 
I 3 HOH 321 2321 2321 HOH HOH A . 
I 3 HOH 322 2322 2322 HOH HOH A . 
I 3 HOH 323 2323 2323 HOH HOH A . 
I 3 HOH 324 2324 2324 HOH HOH A . 
I 3 HOH 325 2325 2325 HOH HOH A . 
I 3 HOH 326 2326 2326 HOH HOH A . 
I 3 HOH 327 2327 2327 HOH HOH A . 
I 3 HOH 328 2328 2328 HOH HOH A . 
I 3 HOH 329 2329 2329 HOH HOH A . 
I 3 HOH 330 2330 2330 HOH HOH A . 
I 3 HOH 331 2331 2331 HOH HOH A . 
I 3 HOH 332 2332 2332 HOH HOH A . 
I 3 HOH 333 2333 2333 HOH HOH A . 
I 3 HOH 334 2334 2334 HOH HOH A . 
I 3 HOH 335 2335 2335 HOH HOH A . 
I 3 HOH 336 2336 2336 HOH HOH A . 
I 3 HOH 337 2337 2337 HOH HOH A . 
I 3 HOH 338 2338 2338 HOH HOH A . 
I 3 HOH 339 2339 2339 HOH HOH A . 
I 3 HOH 340 2340 2340 HOH HOH A . 
I 3 HOH 341 2341 2341 HOH HOH A . 
I 3 HOH 342 2342 2342 HOH HOH A . 
I 3 HOH 343 2343 2343 HOH HOH A . 
I 3 HOH 344 2344 2344 HOH HOH A . 
I 3 HOH 345 2345 2345 HOH HOH A . 
I 3 HOH 346 2346 2346 HOH HOH A . 
I 3 HOH 347 2347 2347 HOH HOH A . 
I 3 HOH 348 2348 2348 HOH HOH A . 
I 3 HOH 349 2349 2349 HOH HOH A . 
I 3 HOH 350 2350 2350 HOH HOH A . 
I 3 HOH 351 2351 2351 HOH HOH A . 
I 3 HOH 352 2352 2352 HOH HOH A . 
I 3 HOH 353 2353 2353 HOH HOH A . 
I 3 HOH 354 2354 2354 HOH HOH A . 
I 3 HOH 355 2355 2355 HOH HOH A . 
I 3 HOH 356 2356 2356 HOH HOH A . 
I 3 HOH 357 2357 2357 HOH HOH A . 
I 3 HOH 358 2358 2358 HOH HOH A . 
I 3 HOH 359 2359 2359 HOH HOH A . 
I 3 HOH 360 2360 2360 HOH HOH A . 
I 3 HOH 361 2361 2361 HOH HOH A . 
I 3 HOH 362 2362 2362 HOH HOH A . 
I 3 HOH 363 2363 2363 HOH HOH A . 
I 3 HOH 364 2364 2364 HOH HOH A . 
I 3 HOH 365 2365 2365 HOH HOH A . 
I 3 HOH 366 2366 2366 HOH HOH A . 
I 3 HOH 367 2367 2367 HOH HOH A . 
I 3 HOH 368 2368 2368 HOH HOH A . 
I 3 HOH 369 2369 2369 HOH HOH A . 
I 3 HOH 370 2370 2370 HOH HOH A . 
I 3 HOH 371 2371 2371 HOH HOH A . 
I 3 HOH 372 2372 2372 HOH HOH A . 
I 3 HOH 373 2373 2373 HOH HOH A . 
I 3 HOH 374 2374 2374 HOH HOH A . 
I 3 HOH 375 2375 2375 HOH HOH A . 
I 3 HOH 376 2376 2376 HOH HOH A . 
I 3 HOH 377 2377 2377 HOH HOH A . 
I 3 HOH 378 2378 2378 HOH HOH A . 
I 3 HOH 379 2379 2379 HOH HOH A . 
I 3 HOH 380 2380 2380 HOH HOH A . 
I 3 HOH 381 2381 2381 HOH HOH A . 
I 3 HOH 382 2382 2382 HOH HOH A . 
I 3 HOH 383 2383 2383 HOH HOH A . 
I 3 HOH 384 2384 2384 HOH HOH A . 
I 3 HOH 385 2385 2385 HOH HOH A . 
I 3 HOH 386 2386 2386 HOH HOH A . 
I 3 HOH 387 2387 2387 HOH HOH A . 
I 3 HOH 388 2388 2388 HOH HOH A . 
I 3 HOH 389 2389 2389 HOH HOH A . 
I 3 HOH 390 2390 2390 HOH HOH A . 
I 3 HOH 391 2391 2391 HOH HOH A . 
I 3 HOH 392 2392 2392 HOH HOH A . 
I 3 HOH 393 2393 2393 HOH HOH A . 
I 3 HOH 394 2394 2394 HOH HOH A . 
I 3 HOH 395 2395 2395 HOH HOH A . 
I 3 HOH 396 2396 2396 HOH HOH A . 
I 3 HOH 397 2397 2397 HOH HOH A . 
I 3 HOH 398 2398 2398 HOH HOH A . 
I 3 HOH 399 2399 2399 HOH HOH A . 
I 3 HOH 400 2400 2400 HOH HOH A . 
I 3 HOH 401 2401 2401 HOH HOH A . 
I 3 HOH 402 2402 2402 HOH HOH A . 
I 3 HOH 403 2403 2403 HOH HOH A . 
I 3 HOH 404 2404 2404 HOH HOH A . 
I 3 HOH 405 2405 2405 HOH HOH A . 
I 3 HOH 406 2406 2406 HOH HOH A . 
I 3 HOH 407 2407 2407 HOH HOH A . 
I 3 HOH 408 2408 2408 HOH HOH A . 
I 3 HOH 409 2409 2409 HOH HOH A . 
I 3 HOH 410 2410 2410 HOH HOH A . 
I 3 HOH 411 2411 2411 HOH HOH A . 
I 3 HOH 412 2412 2412 HOH HOH A . 
I 3 HOH 413 2413 2413 HOH HOH A . 
I 3 HOH 414 2414 2414 HOH HOH A . 
I 3 HOH 415 2415 2415 HOH HOH A . 
I 3 HOH 416 2416 2416 HOH HOH A . 
I 3 HOH 417 2417 2417 HOH HOH A . 
I 3 HOH 418 2418 2418 HOH HOH A . 
I 3 HOH 419 2419 2419 HOH HOH A . 
I 3 HOH 420 2420 2420 HOH HOH A . 
I 3 HOH 421 2421 2421 HOH HOH A . 
I 3 HOH 422 2422 2422 HOH HOH A . 
I 3 HOH 423 2423 2423 HOH HOH A . 
I 3 HOH 424 2424 2424 HOH HOH A . 
I 3 HOH 425 2425 2425 HOH HOH A . 
I 3 HOH 426 2426 2426 HOH HOH A . 
I 3 HOH 427 2427 2427 HOH HOH A . 
I 3 HOH 428 2428 2428 HOH HOH A . 
I 3 HOH 429 2429 2429 HOH HOH A . 
I 3 HOH 430 2430 2430 HOH HOH A . 
I 3 HOH 431 2431 2431 HOH HOH A . 
I 3 HOH 432 2432 2432 HOH HOH A . 
I 3 HOH 433 2433 2433 HOH HOH A . 
I 3 HOH 434 2434 2434 HOH HOH A . 
I 3 HOH 435 2435 2435 HOH HOH A . 
I 3 HOH 436 2436 2436 HOH HOH A . 
I 3 HOH 437 2437 2437 HOH HOH A . 
I 3 HOH 438 2438 2438 HOH HOH A . 
I 3 HOH 439 2439 2439 HOH HOH A . 
I 3 HOH 440 2440 2440 HOH HOH A . 
I 3 HOH 441 2441 2441 HOH HOH A . 
I 3 HOH 442 2442 2442 HOH HOH A . 
I 3 HOH 443 2443 2443 HOH HOH A . 
I 3 HOH 444 2444 2444 HOH HOH A . 
J 3 HOH 1   2001 2001 HOH HOH B . 
J 3 HOH 2   2002 2002 HOH HOH B . 
J 3 HOH 3   2003 2003 HOH HOH B . 
J 3 HOH 4   2004 2004 HOH HOH B . 
J 3 HOH 5   2005 2005 HOH HOH B . 
J 3 HOH 6   2006 2006 HOH HOH B . 
J 3 HOH 7   2007 2007 HOH HOH B . 
J 3 HOH 8   2008 2008 HOH HOH B . 
J 3 HOH 9   2009 2009 HOH HOH B . 
J 3 HOH 10  2010 2010 HOH HOH B . 
J 3 HOH 11  2011 2011 HOH HOH B . 
J 3 HOH 12  2012 2012 HOH HOH B . 
J 3 HOH 13  2013 2013 HOH HOH B . 
J 3 HOH 14  2014 2014 HOH HOH B . 
J 3 HOH 15  2015 2015 HOH HOH B . 
J 3 HOH 16  2016 2016 HOH HOH B . 
J 3 HOH 17  2017 2017 HOH HOH B . 
J 3 HOH 18  2018 2018 HOH HOH B . 
J 3 HOH 19  2019 2019 HOH HOH B . 
J 3 HOH 20  2020 2020 HOH HOH B . 
J 3 HOH 21  2021 2021 HOH HOH B . 
J 3 HOH 22  2022 2022 HOH HOH B . 
J 3 HOH 23  2023 2023 HOH HOH B . 
J 3 HOH 24  2024 2024 HOH HOH B . 
J 3 HOH 25  2025 2025 HOH HOH B . 
J 3 HOH 26  2026 2026 HOH HOH B . 
J 3 HOH 27  2027 2027 HOH HOH B . 
J 3 HOH 28  2028 2028 HOH HOH B . 
J 3 HOH 29  2029 2029 HOH HOH B . 
J 3 HOH 30  2030 2030 HOH HOH B . 
J 3 HOH 31  2031 2031 HOH HOH B . 
J 3 HOH 32  2032 2032 HOH HOH B . 
J 3 HOH 33  2033 2033 HOH HOH B . 
J 3 HOH 34  2034 2034 HOH HOH B . 
J 3 HOH 35  2035 2035 HOH HOH B . 
J 3 HOH 36  2036 2036 HOH HOH B . 
J 3 HOH 37  2037 2037 HOH HOH B . 
J 3 HOH 38  2038 2038 HOH HOH B . 
J 3 HOH 39  2039 2039 HOH HOH B . 
J 3 HOH 40  2040 2040 HOH HOH B . 
J 3 HOH 41  2041 2041 HOH HOH B . 
J 3 HOH 42  2042 2042 HOH HOH B . 
J 3 HOH 43  2043 2043 HOH HOH B . 
J 3 HOH 44  2044 2044 HOH HOH B . 
J 3 HOH 45  2045 2045 HOH HOH B . 
J 3 HOH 46  2046 2046 HOH HOH B . 
J 3 HOH 47  2047 2047 HOH HOH B . 
J 3 HOH 48  2048 2048 HOH HOH B . 
J 3 HOH 49  2049 2049 HOH HOH B . 
J 3 HOH 50  2050 2050 HOH HOH B . 
J 3 HOH 51  2051 2051 HOH HOH B . 
J 3 HOH 52  2052 2052 HOH HOH B . 
J 3 HOH 53  2053 2053 HOH HOH B . 
J 3 HOH 54  2054 2054 HOH HOH B . 
J 3 HOH 55  2055 2055 HOH HOH B . 
J 3 HOH 56  2056 2056 HOH HOH B . 
J 3 HOH 57  2057 2057 HOH HOH B . 
J 3 HOH 58  2058 2058 HOH HOH B . 
J 3 HOH 59  2059 2059 HOH HOH B . 
J 3 HOH 60  2060 2060 HOH HOH B . 
J 3 HOH 61  2061 2061 HOH HOH B . 
J 3 HOH 62  2062 2062 HOH HOH B . 
J 3 HOH 63  2063 2063 HOH HOH B . 
J 3 HOH 64  2064 2064 HOH HOH B . 
J 3 HOH 65  2065 2065 HOH HOH B . 
J 3 HOH 66  2066 2066 HOH HOH B . 
J 3 HOH 67  2067 2067 HOH HOH B . 
J 3 HOH 68  2068 2068 HOH HOH B . 
J 3 HOH 69  2069 2069 HOH HOH B . 
J 3 HOH 70  2070 2070 HOH HOH B . 
J 3 HOH 71  2071 2071 HOH HOH B . 
J 3 HOH 72  2072 2072 HOH HOH B . 
J 3 HOH 73  2073 2073 HOH HOH B . 
J 3 HOH 74  2074 2074 HOH HOH B . 
J 3 HOH 75  2075 2075 HOH HOH B . 
J 3 HOH 76  2076 2076 HOH HOH B . 
J 3 HOH 77  2077 2077 HOH HOH B . 
J 3 HOH 78  2078 2078 HOH HOH B . 
J 3 HOH 79  2079 2079 HOH HOH B . 
J 3 HOH 80  2080 2080 HOH HOH B . 
J 3 HOH 81  2081 2081 HOH HOH B . 
J 3 HOH 82  2082 2082 HOH HOH B . 
J 3 HOH 83  2083 2083 HOH HOH B . 
J 3 HOH 84  2084 2084 HOH HOH B . 
J 3 HOH 85  2085 2085 HOH HOH B . 
J 3 HOH 86  2086 2086 HOH HOH B . 
J 3 HOH 87  2087 2087 HOH HOH B . 
J 3 HOH 88  2088 2088 HOH HOH B . 
J 3 HOH 89  2089 2089 HOH HOH B . 
J 3 HOH 90  2090 2090 HOH HOH B . 
J 3 HOH 91  2091 2091 HOH HOH B . 
J 3 HOH 92  2092 2092 HOH HOH B . 
J 3 HOH 93  2093 2093 HOH HOH B . 
J 3 HOH 94  2094 2094 HOH HOH B . 
J 3 HOH 95  2095 2095 HOH HOH B . 
J 3 HOH 96  2096 2096 HOH HOH B . 
J 3 HOH 97  2097 2097 HOH HOH B . 
J 3 HOH 98  2098 2098 HOH HOH B . 
J 3 HOH 99  2099 2099 HOH HOH B . 
J 3 HOH 100 2100 2100 HOH HOH B . 
J 3 HOH 101 2101 2101 HOH HOH B . 
J 3 HOH 102 2102 2102 HOH HOH B . 
J 3 HOH 103 2103 2103 HOH HOH B . 
J 3 HOH 104 2104 2104 HOH HOH B . 
J 3 HOH 105 2105 2105 HOH HOH B . 
J 3 HOH 106 2106 2106 HOH HOH B . 
J 3 HOH 107 2107 2107 HOH HOH B . 
J 3 HOH 108 2108 2108 HOH HOH B . 
J 3 HOH 109 2109 2109 HOH HOH B . 
J 3 HOH 110 2110 2110 HOH HOH B . 
J 3 HOH 111 2111 2111 HOH HOH B . 
J 3 HOH 112 2112 2112 HOH HOH B . 
J 3 HOH 113 2113 2113 HOH HOH B . 
J 3 HOH 114 2114 2114 HOH HOH B . 
J 3 HOH 115 2115 2115 HOH HOH B . 
J 3 HOH 116 2116 2116 HOH HOH B . 
J 3 HOH 117 2117 2117 HOH HOH B . 
J 3 HOH 118 2118 2118 HOH HOH B . 
J 3 HOH 119 2119 2119 HOH HOH B . 
J 3 HOH 120 2120 2120 HOH HOH B . 
J 3 HOH 121 2121 2121 HOH HOH B . 
J 3 HOH 122 2122 2122 HOH HOH B . 
J 3 HOH 123 2123 2123 HOH HOH B . 
J 3 HOH 124 2124 2124 HOH HOH B . 
J 3 HOH 125 2125 2125 HOH HOH B . 
J 3 HOH 126 2126 2126 HOH HOH B . 
J 3 HOH 127 2127 2127 HOH HOH B . 
J 3 HOH 128 2128 2128 HOH HOH B . 
J 3 HOH 129 2129 2129 HOH HOH B . 
J 3 HOH 130 2130 2130 HOH HOH B . 
J 3 HOH 131 2131 2131 HOH HOH B . 
J 3 HOH 132 2132 2132 HOH HOH B . 
J 3 HOH 133 2133 2133 HOH HOH B . 
J 3 HOH 134 2134 2134 HOH HOH B . 
J 3 HOH 135 2135 2135 HOH HOH B . 
J 3 HOH 136 2136 2136 HOH HOH B . 
J 3 HOH 137 2137 2137 HOH HOH B . 
J 3 HOH 138 2138 2138 HOH HOH B . 
J 3 HOH 139 2139 2139 HOH HOH B . 
J 3 HOH 140 2140 2140 HOH HOH B . 
J 3 HOH 141 2141 2141 HOH HOH B . 
J 3 HOH 142 2142 2142 HOH HOH B . 
J 3 HOH 143 2143 2143 HOH HOH B . 
J 3 HOH 144 2144 2144 HOH HOH B . 
J 3 HOH 145 2145 2145 HOH HOH B . 
J 3 HOH 146 2146 2146 HOH HOH B . 
J 3 HOH 147 2147 2147 HOH HOH B . 
J 3 HOH 148 2148 2148 HOH HOH B . 
J 3 HOH 149 2149 2149 HOH HOH B . 
J 3 HOH 150 2150 2150 HOH HOH B . 
J 3 HOH 151 2151 2151 HOH HOH B . 
J 3 HOH 152 2152 2152 HOH HOH B . 
J 3 HOH 153 2153 2153 HOH HOH B . 
J 3 HOH 154 2154 2154 HOH HOH B . 
J 3 HOH 155 2155 2155 HOH HOH B . 
J 3 HOH 156 2156 2156 HOH HOH B . 
J 3 HOH 157 2157 2157 HOH HOH B . 
J 3 HOH 158 2158 2158 HOH HOH B . 
J 3 HOH 159 2159 2159 HOH HOH B . 
J 3 HOH 160 2160 2160 HOH HOH B . 
J 3 HOH 161 2161 2161 HOH HOH B . 
J 3 HOH 162 2162 2162 HOH HOH B . 
J 3 HOH 163 2163 2163 HOH HOH B . 
J 3 HOH 164 2164 2164 HOH HOH B . 
J 3 HOH 165 2165 2165 HOH HOH B . 
J 3 HOH 166 2166 2166 HOH HOH B . 
J 3 HOH 167 2167 2167 HOH HOH B . 
J 3 HOH 168 2168 2168 HOH HOH B . 
J 3 HOH 169 2169 2169 HOH HOH B . 
J 3 HOH 170 2170 2170 HOH HOH B . 
J 3 HOH 171 2171 2171 HOH HOH B . 
J 3 HOH 172 2172 2172 HOH HOH B . 
J 3 HOH 173 2173 2173 HOH HOH B . 
J 3 HOH 174 2174 2174 HOH HOH B . 
J 3 HOH 175 2175 2175 HOH HOH B . 
J 3 HOH 176 2176 2176 HOH HOH B . 
J 3 HOH 177 2177 2177 HOH HOH B . 
J 3 HOH 178 2178 2178 HOH HOH B . 
J 3 HOH 179 2179 2179 HOH HOH B . 
J 3 HOH 180 2180 2180 HOH HOH B . 
J 3 HOH 181 2181 2181 HOH HOH B . 
J 3 HOH 182 2182 2182 HOH HOH B . 
J 3 HOH 183 2183 2183 HOH HOH B . 
J 3 HOH 184 2184 2184 HOH HOH B . 
J 3 HOH 185 2185 2185 HOH HOH B . 
J 3 HOH 186 2186 2186 HOH HOH B . 
J 3 HOH 187 2187 2187 HOH HOH B . 
J 3 HOH 188 2188 2188 HOH HOH B . 
J 3 HOH 189 2189 2189 HOH HOH B . 
J 3 HOH 190 2190 2190 HOH HOH B . 
J 3 HOH 191 2191 2191 HOH HOH B . 
J 3 HOH 192 2192 2192 HOH HOH B . 
J 3 HOH 193 2193 2193 HOH HOH B . 
J 3 HOH 194 2194 2194 HOH HOH B . 
J 3 HOH 195 2195 2195 HOH HOH B . 
J 3 HOH 196 2196 2196 HOH HOH B . 
J 3 HOH 197 2197 2197 HOH HOH B . 
J 3 HOH 198 2198 2198 HOH HOH B . 
J 3 HOH 199 2199 2199 HOH HOH B . 
J 3 HOH 200 2200 2200 HOH HOH B . 
J 3 HOH 201 2201 2201 HOH HOH B . 
J 3 HOH 202 2202 2202 HOH HOH B . 
J 3 HOH 203 2203 2203 HOH HOH B . 
J 3 HOH 204 2204 2204 HOH HOH B . 
J 3 HOH 205 2205 2205 HOH HOH B . 
J 3 HOH 206 2206 2206 HOH HOH B . 
J 3 HOH 207 2207 2207 HOH HOH B . 
J 3 HOH 208 2208 2208 HOH HOH B . 
J 3 HOH 209 2209 2209 HOH HOH B . 
J 3 HOH 210 2210 2210 HOH HOH B . 
J 3 HOH 211 2211 2211 HOH HOH B . 
J 3 HOH 212 2212 2212 HOH HOH B . 
J 3 HOH 213 2213 2213 HOH HOH B . 
J 3 HOH 214 2214 2214 HOH HOH B . 
J 3 HOH 215 2215 2215 HOH HOH B . 
J 3 HOH 216 2216 2216 HOH HOH B . 
J 3 HOH 217 2217 2217 HOH HOH B . 
J 3 HOH 218 2218 2218 HOH HOH B . 
J 3 HOH 219 2219 2219 HOH HOH B . 
J 3 HOH 220 2220 2220 HOH HOH B . 
J 3 HOH 221 2221 2221 HOH HOH B . 
J 3 HOH 222 2222 2222 HOH HOH B . 
J 3 HOH 223 2223 2223 HOH HOH B . 
J 3 HOH 224 2224 2224 HOH HOH B . 
J 3 HOH 225 2225 2225 HOH HOH B . 
J 3 HOH 226 2226 2226 HOH HOH B . 
J 3 HOH 227 2227 2227 HOH HOH B . 
J 3 HOH 228 2228 2228 HOH HOH B . 
J 3 HOH 229 2229 2229 HOH HOH B . 
J 3 HOH 230 2230 2230 HOH HOH B . 
J 3 HOH 231 2231 2231 HOH HOH B . 
J 3 HOH 232 2232 2232 HOH HOH B . 
J 3 HOH 233 2233 2233 HOH HOH B . 
J 3 HOH 234 2234 2234 HOH HOH B . 
J 3 HOH 235 2235 2235 HOH HOH B . 
J 3 HOH 236 2236 2236 HOH HOH B . 
J 3 HOH 237 2237 2237 HOH HOH B . 
J 3 HOH 238 2238 2238 HOH HOH B . 
J 3 HOH 239 2239 2239 HOH HOH B . 
J 3 HOH 240 2240 2240 HOH HOH B . 
J 3 HOH 241 2241 2241 HOH HOH B . 
J 3 HOH 242 2242 2242 HOH HOH B . 
J 3 HOH 243 2243 2243 HOH HOH B . 
J 3 HOH 244 2244 2244 HOH HOH B . 
J 3 HOH 245 2245 2245 HOH HOH B . 
J 3 HOH 246 2246 2246 HOH HOH B . 
J 3 HOH 247 2247 2247 HOH HOH B . 
J 3 HOH 248 2248 2248 HOH HOH B . 
J 3 HOH 249 2249 2249 HOH HOH B . 
J 3 HOH 250 2250 2250 HOH HOH B . 
J 3 HOH 251 2251 2251 HOH HOH B . 
J 3 HOH 252 2252 2252 HOH HOH B . 
J 3 HOH 253 2253 2253 HOH HOH B . 
J 3 HOH 254 2254 2254 HOH HOH B . 
J 3 HOH 255 2255 2255 HOH HOH B . 
J 3 HOH 256 2256 2256 HOH HOH B . 
J 3 HOH 257 2257 2257 HOH HOH B . 
J 3 HOH 258 2258 2258 HOH HOH B . 
J 3 HOH 259 2259 2259 HOH HOH B . 
J 3 HOH 260 2260 2260 HOH HOH B . 
J 3 HOH 261 2261 2261 HOH HOH B . 
J 3 HOH 262 2262 2262 HOH HOH B . 
J 3 HOH 263 2263 2263 HOH HOH B . 
J 3 HOH 264 2264 2264 HOH HOH B . 
J 3 HOH 265 2265 2265 HOH HOH B . 
J 3 HOH 266 2266 2266 HOH HOH B . 
J 3 HOH 267 2267 2267 HOH HOH B . 
J 3 HOH 268 2268 2268 HOH HOH B . 
J 3 HOH 269 2269 2269 HOH HOH B . 
J 3 HOH 270 2270 2270 HOH HOH B . 
J 3 HOH 271 2271 2271 HOH HOH B . 
J 3 HOH 272 2272 2272 HOH HOH B . 
J 3 HOH 273 2273 2273 HOH HOH B . 
J 3 HOH 274 2274 2274 HOH HOH B . 
J 3 HOH 275 2275 2275 HOH HOH B . 
J 3 HOH 276 2276 2276 HOH HOH B . 
J 3 HOH 277 2277 2277 HOH HOH B . 
J 3 HOH 278 2278 2278 HOH HOH B . 
J 3 HOH 279 2279 2279 HOH HOH B . 
J 3 HOH 280 2280 2280 HOH HOH B . 
J 3 HOH 281 2281 2281 HOH HOH B . 
J 3 HOH 282 2282 2282 HOH HOH B . 
J 3 HOH 283 2283 2283 HOH HOH B . 
J 3 HOH 284 2284 2284 HOH HOH B . 
J 3 HOH 285 2285 2285 HOH HOH B . 
J 3 HOH 286 2286 2286 HOH HOH B . 
J 3 HOH 287 2287 2287 HOH HOH B . 
J 3 HOH 288 2288 2288 HOH HOH B . 
J 3 HOH 289 2289 2289 HOH HOH B . 
J 3 HOH 290 2290 2290 HOH HOH B . 
J 3 HOH 291 2291 2291 HOH HOH B . 
J 3 HOH 292 2292 2292 HOH HOH B . 
J 3 HOH 293 2293 2293 HOH HOH B . 
J 3 HOH 294 2294 2294 HOH HOH B . 
J 3 HOH 295 2295 2295 HOH HOH B . 
J 3 HOH 296 2296 2296 HOH HOH B . 
J 3 HOH 297 2297 2297 HOH HOH B . 
J 3 HOH 298 2298 2298 HOH HOH B . 
J 3 HOH 299 2299 2299 HOH HOH B . 
J 3 HOH 300 2300 2300 HOH HOH B . 
J 3 HOH 301 2301 2301 HOH HOH B . 
J 3 HOH 302 2302 2302 HOH HOH B . 
J 3 HOH 303 2303 2303 HOH HOH B . 
J 3 HOH 304 2304 2304 HOH HOH B . 
J 3 HOH 305 2305 2305 HOH HOH B . 
J 3 HOH 306 2306 2306 HOH HOH B . 
J 3 HOH 307 2307 2307 HOH HOH B . 
J 3 HOH 308 2308 2308 HOH HOH B . 
J 3 HOH 309 2309 2309 HOH HOH B . 
J 3 HOH 310 2310 2310 HOH HOH B . 
J 3 HOH 311 2311 2311 HOH HOH B . 
J 3 HOH 312 2312 2312 HOH HOH B . 
J 3 HOH 313 2313 2313 HOH HOH B . 
J 3 HOH 314 2314 2314 HOH HOH B . 
J 3 HOH 315 2315 2315 HOH HOH B . 
J 3 HOH 316 2316 2316 HOH HOH B . 
J 3 HOH 317 2317 2317 HOH HOH B . 
J 3 HOH 318 2318 2318 HOH HOH B . 
J 3 HOH 319 2319 2319 HOH HOH B . 
J 3 HOH 320 2320 2320 HOH HOH B . 
J 3 HOH 321 2321 2321 HOH HOH B . 
J 3 HOH 322 2322 2322 HOH HOH B . 
J 3 HOH 323 2323 2323 HOH HOH B . 
J 3 HOH 324 2324 2324 HOH HOH B . 
J 3 HOH 325 2325 2325 HOH HOH B . 
J 3 HOH 326 2326 2326 HOH HOH B . 
J 3 HOH 327 2327 2327 HOH HOH B . 
J 3 HOH 328 2328 2328 HOH HOH B . 
J 3 HOH 329 2329 2329 HOH HOH B . 
J 3 HOH 330 2330 2330 HOH HOH B . 
J 3 HOH 331 2331 2331 HOH HOH B . 
J 3 HOH 332 2332 2332 HOH HOH B . 
J 3 HOH 333 2333 2333 HOH HOH B . 
J 3 HOH 334 2334 2334 HOH HOH B . 
J 3 HOH 335 2335 2335 HOH HOH B . 
J 3 HOH 336 2336 2336 HOH HOH B . 
J 3 HOH 337 2337 2337 HOH HOH B . 
J 3 HOH 338 2338 2338 HOH HOH B . 
J 3 HOH 339 2339 2339 HOH HOH B . 
J 3 HOH 340 2340 2340 HOH HOH B . 
J 3 HOH 341 2341 2341 HOH HOH B . 
J 3 HOH 342 2342 2342 HOH HOH B . 
J 3 HOH 343 2343 2343 HOH HOH B . 
J 3 HOH 344 2344 2344 HOH HOH B . 
J 3 HOH 345 2345 2345 HOH HOH B . 
J 3 HOH 346 2346 2346 HOH HOH B . 
J 3 HOH 347 2347 2347 HOH HOH B . 
J 3 HOH 348 2348 2348 HOH HOH B . 
J 3 HOH 349 2349 2349 HOH HOH B . 
J 3 HOH 350 2350 2350 HOH HOH B . 
J 3 HOH 351 2351 2351 HOH HOH B . 
J 3 HOH 352 2352 2352 HOH HOH B . 
J 3 HOH 353 2353 2353 HOH HOH B . 
J 3 HOH 354 2354 2354 HOH HOH B . 
J 3 HOH 355 2355 2355 HOH HOH B . 
J 3 HOH 356 2356 2356 HOH HOH B . 
J 3 HOH 357 2357 2357 HOH HOH B . 
J 3 HOH 358 2358 2358 HOH HOH B . 
J 3 HOH 359 2359 2359 HOH HOH B . 
J 3 HOH 360 2360 2360 HOH HOH B . 
J 3 HOH 361 2361 2361 HOH HOH B . 
J 3 HOH 362 2362 2362 HOH HOH B . 
J 3 HOH 363 2363 2363 HOH HOH B . 
J 3 HOH 364 2364 2364 HOH HOH B . 
J 3 HOH 365 2365 2365 HOH HOH B . 
J 3 HOH 366 2366 2366 HOH HOH B . 
J 3 HOH 367 2367 2367 HOH HOH B . 
J 3 HOH 368 2368 2368 HOH HOH B . 
J 3 HOH 369 2369 2369 HOH HOH B . 
J 3 HOH 370 2370 2370 HOH HOH B . 
J 3 HOH 371 2371 2371 HOH HOH B . 
J 3 HOH 372 2372 2372 HOH HOH B . 
J 3 HOH 373 2373 2373 HOH HOH B . 
J 3 HOH 374 2374 2374 HOH HOH B . 
J 3 HOH 375 2375 2375 HOH HOH B . 
J 3 HOH 376 2376 2376 HOH HOH B . 
J 3 HOH 377 2377 2377 HOH HOH B . 
J 3 HOH 378 2378 2378 HOH HOH B . 
J 3 HOH 379 2379 2379 HOH HOH B . 
J 3 HOH 380 2380 2380 HOH HOH B . 
J 3 HOH 381 2381 2381 HOH HOH B . 
J 3 HOH 382 2382 2382 HOH HOH B . 
J 3 HOH 383 2383 2383 HOH HOH B . 
J 3 HOH 384 2384 2384 HOH HOH B . 
J 3 HOH 385 2385 2385 HOH HOH B . 
J 3 HOH 386 2386 2386 HOH HOH B . 
J 3 HOH 387 2387 2387 HOH HOH B . 
J 3 HOH 388 2388 2388 HOH HOH B . 
J 3 HOH 389 2389 2389 HOH HOH B . 
J 3 HOH 390 2390 2390 HOH HOH B . 
J 3 HOH 391 2391 2391 HOH HOH B . 
J 3 HOH 392 2392 2392 HOH HOH B . 
J 3 HOH 393 2393 2393 HOH HOH B . 
J 3 HOH 394 2394 2394 HOH HOH B . 
J 3 HOH 395 2395 2395 HOH HOH B . 
J 3 HOH 396 2396 2396 HOH HOH B . 
J 3 HOH 397 2397 2397 HOH HOH B . 
J 3 HOH 398 2398 2398 HOH HOH B . 
J 3 HOH 399 2399 2399 HOH HOH B . 
J 3 HOH 400 2400 2400 HOH HOH B . 
J 3 HOH 401 2401 2401 HOH HOH B . 
J 3 HOH 402 2402 2402 HOH HOH B . 
J 3 HOH 403 2403 2403 HOH HOH B . 
J 3 HOH 404 2404 2404 HOH HOH B . 
J 3 HOH 405 2405 2405 HOH HOH B . 
J 3 HOH 406 2406 2406 HOH HOH B . 
J 3 HOH 407 2407 2407 HOH HOH B . 
J 3 HOH 408 2408 2408 HOH HOH B . 
J 3 HOH 409 2409 2409 HOH HOH B . 
J 3 HOH 410 2410 2410 HOH HOH B . 
J 3 HOH 411 2411 2411 HOH HOH B . 
J 3 HOH 412 2412 2412 HOH HOH B . 
J 3 HOH 413 2413 2413 HOH HOH B . 
J 3 HOH 414 2414 2414 HOH HOH B . 
J 3 HOH 415 2415 2415 HOH HOH B . 
J 3 HOH 416 2416 2416 HOH HOH B . 
J 3 HOH 417 2417 2417 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PQS 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2002-01-16 
2 'Structure model' 1 1 2011-05-08 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2019-05-15 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' Advisory                    
4 4 'Structure model' 'Data collection'           
5 4 'Structure model' 'Experimental preparation'  
6 4 'Structure model' Other                       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' exptl_crystal_grow           
2 4 'Structure model' pdbx_database_proc           
3 4 'Structure model' pdbx_database_status         
4 4 'Structure model' pdbx_unobs_or_zero_occ_atoms 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_exptl_crystal_grow.method'                  
2 4 'Structure model' '_pdbx_database_status.recvd_author_approval' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC   refinement       5.0.36 ? 1 
HKL-2000 'data reduction' .      ? 2 
HKL-2000 'data scaling'   .      ? 3 
AMoRE    phasing          .      ? 4 
# 
_pdbx_entry_details.entry_id             1H4R 
_pdbx_entry_details.compound_details     'ACTS AS A MEMBRANE STABILIZING PROTEIN.' 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     'N-TERMINAL GLYCINE IS FROM RTEV CLEAVAGE.' 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1 CE  A LYS 20   ? ? O A HOH 2004 ? ? 0.27 
2  1 CD  A LYS 20   ? ? O A HOH 2004 ? ? 1.32 
3  1 NZ  A LYS 20   ? ? O A HOH 2004 ? ? 1.68 
4  1 O   A HOH 2333 ? ? O B HOH 2147 ? ? 1.86 
5  1 O   A HOH 2244 ? ? O A HOH 2245 ? ? 1.86 
6  1 O   A HOH 2109 ? ? O A HOH 2110 ? ? 1.89 
7  1 O   A HOH 2390 ? ? O A HOH 2395 ? ? 1.92 
8  1 O   B HOH 2172 ? ? O B HOH 2312 ? ? 1.98 
9  1 O   A HOH 2008 ? ? O A HOH 2039 ? ? 2.02 
10 1 O   A HOH 2147 ? ? O B HOH 2139 ? ? 2.03 
11 1 OE1 B GLU 215  ? ? O B HOH 2307 ? ? 2.06 
12 1 O   A HOH 2167 ? ? O A HOH 2320 ? ? 2.07 
13 1 O   B HOH 2069 ? ? O B HOH 2146 ? ? 2.08 
14 1 O   B HOH 2109 ? ? O B HOH 2110 ? ? 2.08 
15 1 O   A HOH 2297 ? ? O B HOH 2139 ? ? 2.08 
16 1 O   B HOH 2080 ? ? O B HOH 2304 ? ? 2.09 
17 1 O   B HOH 2112 ? ? O B HOH 2130 ? ? 2.10 
18 1 N   A LYS 20   ? ? O A HOH 2002 ? ? 2.12 
19 1 OE2 A GLU 38   ? ? O A HOH 2043 ? ? 2.12 
20 1 O   B HOH 2202 ? ? O B HOH 2292 ? ? 2.13 
21 1 O   A HOH 2165 ? ? O A HOH 2318 ? ? 2.14 
22 1 NZ  B LYS 79   ? ? O B ASP 83   ? ? 2.15 
23 1 O   A TYR 266  ? ? O A HOH 2397 ? ? 2.16 
24 1 OE1 A GLN 115  ? ? O A HOH 2216 ? ? 2.17 
25 1 O   B HOH 2402 ? ? O B HOH 2403 ? ? 2.17 
26 1 O   B HOH 2187 ? ? O B HOH 2346 ? ? 2.17 
27 1 O   B HOH 2106 ? ? O B HOH 2316 ? ? 2.18 
28 1 O   B HOH 2038 ? ? O B HOH 2075 ? ? 2.18 
29 1 O   A HOH 2002 ? ? O A HOH 2003 ? ? 2.18 
30 1 O   A HOH 2079 ? ? O A HOH 2146 ? ? 2.19 
31 1 O   A HOH 2405 ? ? O A HOH 2407 ? ? 2.19 
32 1 O   B HOH 2209 ? ? O B HOH 2392 ? ? 2.19 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 O  A HOH 2419 ? ? 1_555 O   B HOH 2372 ? ? 1_455 1.57 
2 1 O  A HOH 2401 ? ? 1_555 O   B HOH 2119 ? ? 1_455 1.83 
3 1 O  B HOH 2075 ? ? 1_555 O   B HOH 2339 ? ? 2_664 1.95 
4 1 NZ A LYS 20   ? ? 1_555 NH2 B ARG 198  ? ? 2_565 2.02 
5 1 NZ A LYS 20   ? ? 1_555 NH1 B ARG 198  ? ? 2_565 2.10 
6 1 CD B LYS 20   ? ? 1_555 O   A HOH 2158 ? ? 2_664 2.10 
7 1 O  A HOH 2033 ? ? 1_555 O   A HOH 2382 ? ? 2_565 2.11 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CB A ASP 70  ? ? CG A ASP 70  ? ? OD2 A ASP 70  ? ? 124.57 118.30 6.27  0.90 N 
2 1 CB B ASP 268 ? ? CG B ASP 268 ? ? OD2 B ASP 268 ? ? 123.97 118.30 5.67  0.90 N 
3 1 N  B ALA 313 ? ? CA B ALA 313 ? ? C   B ALA 313 ? ? 131.65 111.00 20.65 2.70 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LYS A 69  ? ? 59.48   -127.36 
2 1 ASP A 268 ? ? 78.19   -128.27 
3 1 LYS B 69  ? ? 63.97   -128.02 
4 1 GLN B 178 ? ? -105.52 68.25   
5 1 ASP B 268 ? ? 68.00   -141.20 
6 1 LYS B 312 ? ? 165.45  -171.09 
# 
_pdbx_validate_chiral.id              1 
_pdbx_validate_chiral.PDB_model_num   1 
_pdbx_validate_chiral.auth_atom_id    CA 
_pdbx_validate_chiral.label_alt_id    ? 
_pdbx_validate_chiral.auth_asym_id    B 
_pdbx_validate_chiral.auth_comp_id    ALA 
_pdbx_validate_chiral.auth_seq_id     313 
_pdbx_validate_chiral.PDB_ins_code    ? 
_pdbx_validate_chiral.details         PLANAR 
_pdbx_validate_chiral.omega           . 
# 
loop_
_pdbx_distant_solvent_atoms.id 
_pdbx_distant_solvent_atoms.PDB_model_num 
_pdbx_distant_solvent_atoms.auth_atom_id 
_pdbx_distant_solvent_atoms.label_alt_id 
_pdbx_distant_solvent_atoms.auth_asym_id 
_pdbx_distant_solvent_atoms.auth_comp_id 
_pdbx_distant_solvent_atoms.auth_seq_id 
_pdbx_distant_solvent_atoms.PDB_ins_code 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance 
1  1 O ? A HOH 2023 ? 6.33 .    
2  1 O ? A HOH 2024 ? 7.61 .    
3  1 O ? A HOH 2059 ? 7.84 .    
4  1 O ? A HOH 2063 ? 6.24 .    
5  1 O ? A HOH 2080 ? 5.99 .    
6  1 O ? A HOH 2087 ? 5.97 .    
7  1 O ? A HOH 2092 ? .    6.21 
8  1 O ? A HOH 2105 ? 5.86 .    
9  1 O ? A HOH 2108 ? 6.39 .    
10 1 O ? A HOH 2155 ? 5.94 .    
11 1 O ? A HOH 2169 ? 5.93 .    
12 1 O ? A HOH 2182 ? 5.82 .    
13 1 O ? B HOH 2016 ? 6.20 .    
14 1 O ? B HOH 2027 ? 6.45 .    
15 1 O ? B HOH 2084 ? 6.28 .    
16 1 O ? B HOH 2090 ? 6.05 .    
17 1 O ? B HOH 2148 ? 6.37 .    
18 1 O ? B HOH 2204 ? 6.24 .    
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY -1 ? A GLY 1  
2  1 Y 1 A MET 1  ? A MET 2  
3  1 Y 1 A ALA 2  ? A ALA 3  
4  1 Y 1 A GLY 3  ? A GLY 4  
5  1 Y 1 A ALA 4  ? A ALA 5  
6  1 Y 1 A ILE 5  ? A ILE 6  
7  1 Y 1 A ALA 6  ? A ALA 7  
8  1 Y 1 A SER 7  ? A SER 8  
9  1 Y 1 A ARG 8  ? A ARG 9  
10 1 Y 1 A MET 9  ? A MET 10 
11 1 Y 1 A SER 10 ? A SER 11 
12 1 Y 1 A PHE 11 ? A PHE 12 
13 1 Y 1 A SER 12 ? A SER 13 
14 1 Y 1 A SER 13 ? A SER 14 
15 1 Y 1 A LEU 14 ? A LEU 15 
16 1 Y 1 A LYS 15 ? A LYS 16 
17 1 Y 1 A ARG 16 ? A ARG 17 
18 1 Y 1 A LYS 17 ? A LYS 18 
19 1 Y 1 A GLN 18 ? A GLN 19 
20 1 Y 1 A PRO 19 ? A PRO 20 
21 1 Y 1 B GLY -1 ? B GLY 1  
22 1 Y 1 B MET 1  ? B MET 2  
23 1 Y 1 B ALA 2  ? B ALA 3  
24 1 Y 1 B GLY 3  ? B GLY 4  
25 1 Y 1 B ALA 4  ? B ALA 5  
26 1 Y 1 B ILE 5  ? B ILE 6  
27 1 Y 1 B ALA 6  ? B ALA 7  
28 1 Y 1 B SER 7  ? B SER 8  
29 1 Y 1 B ARG 8  ? B ARG 9  
30 1 Y 1 B MET 9  ? B MET 10 
31 1 Y 1 B SER 10 ? B SER 11 
32 1 Y 1 B PHE 11 ? B PHE 12 
33 1 Y 1 B SER 12 ? B SER 13 
34 1 Y 1 B SER 13 ? B SER 14 
35 1 Y 1 B LEU 14 ? B LEU 15 
36 1 Y 1 B LYS 15 ? B LYS 16 
37 1 Y 1 B ARG 16 ? B ARG 17 
38 1 Y 1 B LYS 17 ? B LYS 18 
39 1 Y 1 B GLN 18 ? B GLN 19 
40 1 Y 1 B PRO 19 ? B PRO 20 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'SULFATE ION' SO4 
3 water         HOH 
#