data_1HDL
# 
_entry.id   1HDL 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.321 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1HDL         
PDBE  EBI-5546     
WWPDB D_1290005546 
BMRB  4910         
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB  1H0Z unspecified 'LEKTI DOMAIN SIX (HF7665)' 
BMRB 4910 unspecified .                           
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1HDL 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2000-11-16 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Lauber, T.' 1 
'Roesch, P.' 2 
'Marx, U.C.' 3 
# 
_citation.id                        primary 
_citation.title                     
;Homologous Proteins with Different Folds: The Three-Dimensional Structures of Domains 1 and 6 of the Multiple Kazal-Type Inhibitor Lekti
;
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            328 
_citation.page_first                205 
_citation.page_last                 ? 
_citation.year                      2003 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12684009 
_citation.pdbx_database_id_DOI      '10.1016/S0022-2836(03)00245-6' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Lauber, T.'    1 ? 
primary 'Schulz, A.'    2 ? 
primary 'Schweimer, K.' 3 ? 
primary 'Adermann, K.'  4 ? 
primary 'Marx, U.C.'    5 ? 
# 
_cell.entry_id           1HDL 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1HDL 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'SERINE PROTEINASE INHIBITOR LEKTI' 
_entity.formula_weight             6491.618 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'LEKTI DOMAIN ONE' 
_entity.details                    'DISULFIDE BRIDGES BETWEEN CYS 8 AND CYS 44, AND BETWEEN CYS 21 AND CYS 41' 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        HF6478 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       KNEDQEMCHEFQAFMKNGKLFCPQDKKFFQSLDGIMFINKCATCKMILEKEAKSQ 
_entity_poly.pdbx_seq_one_letter_code_can   KNEDQEMCHEFQAFMKNGKLFCPQDKKFFQSLDGIMFINKCATCKMILEKEAKSQ 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  LYS n 
1 2  ASN n 
1 3  GLU n 
1 4  ASP n 
1 5  GLN n 
1 6  GLU n 
1 7  MET n 
1 8  CYS n 
1 9  HIS n 
1 10 GLU n 
1 11 PHE n 
1 12 GLN n 
1 13 ALA n 
1 14 PHE n 
1 15 MET n 
1 16 LYS n 
1 17 ASN n 
1 18 GLY n 
1 19 LYS n 
1 20 LEU n 
1 21 PHE n 
1 22 CYS n 
1 23 PRO n 
1 24 GLN n 
1 25 ASP n 
1 26 LYS n 
1 27 LYS n 
1 28 PHE n 
1 29 PHE n 
1 30 GLN n 
1 31 SER n 
1 32 LEU n 
1 33 ASP n 
1 34 GLY n 
1 35 ILE n 
1 36 MET n 
1 37 PHE n 
1 38 ILE n 
1 39 ASN n 
1 40 LYS n 
1 41 CYS n 
1 42 ALA n 
1 43 THR n 
1 44 CYS n 
1 45 LYS n 
1 46 MET n 
1 47 ILE n 
1 48 LEU n 
1 49 GLU n 
1 50 LYS n 
1 51 GLU n 
1 52 ALA n 
1 53 LYS n 
1 54 SER n 
1 55 GLN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    'I.E. VAGINAL EPITHELIUM' 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'ORIGAMI (DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    CYTOPLASM 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET32A 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ISK5_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          Q9NQ38 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1HDL 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 55 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q9NQ38 
_struct_ref_seq.db_align_beg                  23 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  77 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       55 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1HDL ASN A 2 ? UNP Q9NQ38 ASP 24 variant 2 1 
1 1HDL GLU A 3 ? UNP Q9NQ38 SER 25 variant 3 2 
1 1HDL ASP A 4 ? UNP Q9NQ38 LEU 26 variant 4 3 
1 1HDL GLN A 5 ? UNP Q9NQ38 SER 27 variant 5 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1  1 2D-TOCSY            1 
2  1 2D-NOESY            1 
3  1 2D-COSY             1 
4  1 1H                  1 
5  1 15N-HSQC            1 
6  1 HNHA                1 
7  1 3D-1H               1 
8  1 15N-TOCSY-HSQC      1 
9  1 3D-1H               1 
10 1 15N-NOESY-HSQC      1 
11 1 3D-1H               1 
12 1 15N/1H              1 
13 1 15N-HMQC-NOESY-HSQC 1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id          1 
_pdbx_nmr_exptl_sample_conditions.temperature            298 
_pdbx_nmr_exptl_sample_conditions.pressure_units         atm 
_pdbx_nmr_exptl_sample_conditions.pressure               1 
_pdbx_nmr_exptl_sample_conditions.pH                     4.5 
_pdbx_nmr_exptl_sample_conditions.ionic_strength         ? 
_pdbx_nmr_exptl_sample_conditions.ionic_strength_units   ? 
_pdbx_nmr_exptl_sample_conditions.pH_units               pH 
_pdbx_nmr_exptl_sample_conditions.temperature_units      K 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.model             DRX 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.field_strength    600 
# 
_pdbx_nmr_refine.entry_id           1HDL 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   1HDL 
_pdbx_nmr_details.text       'THE STRUCTURE WAS DETERMINED USING STANDARD NMR TECHNIQUES ON 15N-LABELED AND UNLABELED HF6478' 
# 
_pdbx_nmr_ensemble.entry_id                             1HDL 
_pdbx_nmr_ensemble.conformers_calculated_total_number   60 
_pdbx_nmr_ensemble.conformers_submitted_total_number    21 
_pdbx_nmr_ensemble.conformer_selection_criteria         'LOWEST ENERGY' 
# 
_pdbx_nmr_representative.entry_id             1HDL 
_pdbx_nmr_representative.conformer_id         3 
_pdbx_nmr_representative.selection_criteria   ? 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
refinement           X-PLOR  3.851 BRUNGER 1 
'structure solution' NDEE    ?     ?       2 
'structure solution' NMRView 4.1.0 ?       3 
'structure solution' X-PLOR  3.851 ?       4 
# 
_exptl.entry_id          1HDL 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  1HDL 
_struct.title                     'LEKTI domain one' 
_struct.pdbx_descriptor           'SERINE PROTEINASE INHIBITOR LEKTI' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1HDL 
_struct_keywords.pdbx_keywords   'PUTATIVE SERINE PROTEINASE INHIBITOR' 
_struct_keywords.text            'PUTATIVE SERINE PROTEINASE INHIBITOR' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLN A 12 ? PHE A 14 ? GLN A 12 PHE A 14 1 ? 3  
HELX_P HELX_P2 2 LYS A 26 ? GLN A 30 ? LYS A 26 GLN A 30 1 ? 5  
HELX_P HELX_P3 3 LEU A 32 ? ALA A 52 ? LEU A 32 ALA A 52 1 ? 21 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 8  SG ? ? ? 1_555 A CYS 44 SG ? ? A CYS 8  A CYS 44 1_555 ? ? ? ? ? ? ? 2.020 ? 
disulf2 disulf ? ? A CYS 22 SG ? ? ? 1_555 A CYS 41 SG ? ? A CYS 22 A CYS 41 1_555 ? ? ? ? ? ? ? 2.020 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_sheet.id               S1 
_struct_sheet.type             ? 
_struct_sheet.number_strands   2 
_struct_sheet.details          ? 
# 
_struct_sheet_order.sheet_id     S1 
_struct_sheet_order.range_id_1   1 
_struct_sheet_order.range_id_2   2 
_struct_sheet_order.offset       ? 
_struct_sheet_order.sense        anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
S1 1 MET A 15 ? LYS A 16 ? MET A 15 LYS A 16 
S1 2 LYS A 19 ? LEU A 20 ? LYS A 19 LEU A 20 
# 
_pdbx_struct_sheet_hbond.sheet_id                S1 
_pdbx_struct_sheet_hbond.range_id_1              1 
_pdbx_struct_sheet_hbond.range_id_2              2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id   N 
_pdbx_struct_sheet_hbond.range_1_label_comp_id   LYS 
_pdbx_struct_sheet_hbond.range_1_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_1_label_seq_id    16 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id    N 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id    LYS 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id     16 
_pdbx_struct_sheet_hbond.range_2_label_atom_id   O 
_pdbx_struct_sheet_hbond.range_2_label_comp_id   LYS 
_pdbx_struct_sheet_hbond.range_2_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_2_label_seq_id    19 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id    O 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id    LYS 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id     19 
# 
_database_PDB_matrix.entry_id          1HDL 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1HDL 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . LYS A 1 1  ? -25.063 18.020 25.342 1.00 0.00 ? 1  LYS A N    1  
ATOM 2     C CA   . LYS A 1 1  ? -24.891 16.664 25.939 1.00 0.00 ? 1  LYS A CA   1  
ATOM 3     C C    . LYS A 1 1  ? -24.299 15.702 24.905 1.00 0.00 ? 1  LYS A C    1  
ATOM 4     O O    . LYS A 1 1  ? -23.293 15.063 25.142 1.00 0.00 ? 1  LYS A O    1  
ATOM 5     C CB   . LYS A 1 1  ? -26.301 16.224 26.335 1.00 0.00 ? 1  LYS A CB   1  
ATOM 6     C CG   . LYS A 1 1  ? -26.821 17.126 27.455 1.00 0.00 ? 1  LYS A CG   1  
ATOM 7     C CD   . LYS A 1 1  ? -28.191 16.627 27.917 1.00 0.00 ? 1  LYS A CD   1  
ATOM 8     C CE   . LYS A 1 1  ? -28.728 17.550 29.013 1.00 0.00 ? 1  LYS A CE   1  
ATOM 9     N NZ   . LYS A 1 1  ? -28.926 18.866 28.342 1.00 0.00 ? 1  LYS A NZ   1  
ATOM 10    H H1   . LYS A 1 1  ? -24.157 18.343 24.948 1.00 0.00 ? 1  LYS A H1   1  
ATOM 11    H H2   . LYS A 1 1  ? -25.773 17.978 24.584 1.00 0.00 ? 1  LYS A H2   1  
ATOM 12    H H3   . LYS A 1 1  ? -25.378 18.685 26.078 1.00 0.00 ? 1  LYS A H3   1  
ATOM 13    H HA   . LYS A 1 1  ? -24.261 16.714 26.813 1.00 0.00 ? 1  LYS A HA   1  
ATOM 14    H HB2  . LYS A 1 1  ? -26.955 16.298 25.479 1.00 0.00 ? 1  LYS A HB2  1  
ATOM 15    H HB3  . LYS A 1 1  ? -26.274 15.201 26.680 1.00 0.00 ? 1  LYS A HB3  1  
ATOM 16    H HG2  . LYS A 1 1  ? -26.131 17.104 28.285 1.00 0.00 ? 1  LYS A HG2  1  
ATOM 17    H HG3  . LYS A 1 1  ? -26.911 18.138 27.089 1.00 0.00 ? 1  LYS A HG3  1  
ATOM 18    H HD2  . LYS A 1 1  ? -28.875 16.626 27.081 1.00 0.00 ? 1  LYS A HD2  1  
ATOM 19    H HD3  . LYS A 1 1  ? -28.096 15.624 28.306 1.00 0.00 ? 1  LYS A HD3  1  
ATOM 20    H HE2  . LYS A 1 1  ? -29.667 17.176 29.393 1.00 0.00 ? 1  LYS A HE2  1  
ATOM 21    H HE3  . LYS A 1 1  ? -28.008 17.641 29.814 1.00 0.00 ? 1  LYS A HE3  1  
ATOM 22    H HZ1  . LYS A 1 1  ? -29.138 18.712 27.335 1.00 0.00 ? 1  LYS A HZ1  1  
ATOM 23    H HZ2  . LYS A 1 1  ? -29.718 19.368 28.790 1.00 0.00 ? 1  LYS A HZ2  1  
ATOM 24    H HZ3  . LYS A 1 1  ? -28.061 19.436 28.432 1.00 0.00 ? 1  LYS A HZ3  1  
ATOM 25    N N    . ASN A 1 2  ? -24.915 15.595 23.760 1.00 0.00 ? 2  ASN A N    1  
ATOM 26    C CA   . ASN A 1 2  ? -24.386 14.675 22.712 1.00 0.00 ? 2  ASN A CA   1  
ATOM 27    C C    . ASN A 1 2  ? -23.197 15.319 21.994 1.00 0.00 ? 2  ASN A C    1  
ATOM 28    O O    . ASN A 1 2  ? -23.112 16.525 21.873 1.00 0.00 ? 2  ASN A O    1  
ATOM 29    C CB   . ASN A 1 2  ? -25.549 14.469 21.742 1.00 0.00 ? 2  ASN A CB   1  
ATOM 30    C CG   . ASN A 1 2  ? -26.739 13.865 22.492 1.00 0.00 ? 2  ASN A CG   1  
ATOM 31    O OD1  . ASN A 1 2  ? -27.789 14.470 22.576 1.00 0.00 ? 2  ASN A OD1  1  
ATOM 32    N ND2  . ASN A 1 2  ? -26.617 12.689 23.044 1.00 0.00 ? 2  ASN A ND2  1  
ATOM 33    H H    . ASN A 1 2  ? -25.724 16.120 23.588 1.00 0.00 ? 2  ASN A H    1  
ATOM 34    H HA   . ASN A 1 2  ? -24.098 13.732 23.149 1.00 0.00 ? 2  ASN A HA   1  
ATOM 35    H HB2  . ASN A 1 2  ? -25.837 15.419 21.317 1.00 0.00 ? 2  ASN A HB2  1  
ATOM 36    H HB3  . ASN A 1 2  ? -25.244 13.799 20.952 1.00 0.00 ? 2  ASN A HB3  1  
ATOM 37    H HD21 . ASN A 1 2  ? -25.770 12.201 22.976 1.00 0.00 ? 2  ASN A HD21 1  
ATOM 38    H HD22 . ASN A 1 2  ? -27.373 12.294 23.527 1.00 0.00 ? 2  ASN A HD22 1  
ATOM 39    N N    . GLU A 1 3  ? -22.279 14.524 21.517 1.00 0.00 ? 3  GLU A N    1  
ATOM 40    C CA   . GLU A 1 3  ? -21.098 15.092 20.806 1.00 0.00 ? 3  GLU A CA   1  
ATOM 41    C C    . GLU A 1 3  ? -21.517 15.632 19.436 1.00 0.00 ? 3  GLU A C    1  
ATOM 42    O O    . GLU A 1 3  ? -20.730 16.223 18.723 1.00 0.00 ? 3  GLU A O    1  
ATOM 43    C CB   . GLU A 1 3  ? -20.127 13.921 20.649 1.00 0.00 ? 3  GLU A CB   1  
ATOM 44    C CG   . GLU A 1 3  ? -19.672 13.449 22.031 1.00 0.00 ? 3  GLU A CG   1  
ATOM 45    C CD   . GLU A 1 3  ? -18.627 12.342 21.873 1.00 0.00 ? 3  GLU A CD   1  
ATOM 46    O OE1  . GLU A 1 3  ? -18.324 11.997 20.743 1.00 0.00 ? 3  GLU A OE1  1  
ATOM 47    O OE2  . GLU A 1 3  ? -18.148 11.858 22.885 1.00 0.00 ? 3  GLU A OE2  1  
ATOM 48    H H    . GLU A 1 3  ? -22.366 13.554 21.624 1.00 0.00 ? 3  GLU A H    1  
ATOM 49    H HA   . GLU A 1 3  ? -20.642 15.872 21.396 1.00 0.00 ? 3  GLU A HA   1  
ATOM 50    H HB2  . GLU A 1 3  ? -20.622 13.110 20.136 1.00 0.00 ? 3  GLU A HB2  1  
ATOM 51    H HB3  . GLU A 1 3  ? -19.269 14.239 20.076 1.00 0.00 ? 3  GLU A HB3  1  
ATOM 52    H HG2  . GLU A 1 3  ? -19.238 14.278 22.570 1.00 0.00 ? 3  GLU A HG2  1  
ATOM 53    H HG3  . GLU A 1 3  ? -20.521 13.068 22.579 1.00 0.00 ? 3  GLU A HG3  1  
ATOM 54    N N    . ASP A 1 4  ? -22.752 15.434 19.063 1.00 0.00 ? 4  ASP A N    1  
ATOM 55    C CA   . ASP A 1 4  ? -23.222 15.937 17.740 1.00 0.00 ? 4  ASP A CA   1  
ATOM 56    C C    . ASP A 1 4  ? -23.488 17.443 17.812 1.00 0.00 ? 4  ASP A C    1  
ATOM 57    O O    . ASP A 1 4  ? -23.908 18.057 16.851 1.00 0.00 ? 4  ASP A O    1  
ATOM 58    C CB   . ASP A 1 4  ? -24.519 15.176 17.465 1.00 0.00 ? 4  ASP A CB   1  
ATOM 59    C CG   . ASP A 1 4  ? -24.194 13.840 16.794 1.00 0.00 ? 4  ASP A CG   1  
ATOM 60    O OD1  . ASP A 1 4  ? -23.036 13.625 16.475 1.00 0.00 ? 4  ASP A OD1  1  
ATOM 61    O OD2  . ASP A 1 4  ? -25.109 13.054 16.609 1.00 0.00 ? 4  ASP A OD2  1  
ATOM 62    H H    . ASP A 1 4  ? -23.371 14.956 19.653 1.00 0.00 ? 4  ASP A H    1  
ATOM 63    H HA   . ASP A 1 4  ? -22.495 15.718 16.973 1.00 0.00 ? 4  ASP A HA   1  
ATOM 64    H HB2  . ASP A 1 4  ? -25.034 14.995 18.397 1.00 0.00 ? 4  ASP A HB2  1  
ATOM 65    H HB3  . ASP A 1 4  ? -25.149 15.762 16.813 1.00 0.00 ? 4  ASP A HB3  1  
ATOM 66    N N    . GLN A 1 5  ? -23.245 18.043 18.945 1.00 0.00 ? 5  GLN A N    1  
ATOM 67    C CA   . GLN A 1 5  ? -23.482 19.509 19.081 1.00 0.00 ? 5  GLN A CA   1  
ATOM 68    C C    . GLN A 1 5  ? -22.189 20.208 19.502 1.00 0.00 ? 5  GLN A C    1  
ATOM 69    O O    . GLN A 1 5  ? -21.948 21.350 19.165 1.00 0.00 ? 5  GLN A O    1  
ATOM 70    C CB   . GLN A 1 5  ? -24.545 19.639 20.173 1.00 0.00 ? 5  GLN A CB   1  
ATOM 71    C CG   . GLN A 1 5  ? -25.742 18.749 19.832 1.00 0.00 ? 5  GLN A CG   1  
ATOM 72    C CD   . GLN A 1 5  ? -26.708 19.517 18.927 1.00 0.00 ? 5  GLN A CD   1  
ATOM 73    O OE1  . GLN A 1 5  ? -27.019 19.075 17.839 1.00 0.00 ? 5  GLN A OE1  1  
ATOM 74    N NE2  . GLN A 1 5  ? -27.198 20.655 19.334 1.00 0.00 ? 5  GLN A NE2  1  
ATOM 75    H H    . GLN A 1 5  ? -22.905 17.530 19.708 1.00 0.00 ? 5  GLN A H    1  
ATOM 76    H HA   . GLN A 1 5  ? -23.850 19.919 18.155 1.00 0.00 ? 5  GLN A HA   1  
ATOM 77    H HB2  . GLN A 1 5  ? -24.126 19.332 21.120 1.00 0.00 ? 5  GLN A HB2  1  
ATOM 78    H HB3  . GLN A 1 5  ? -24.868 20.667 20.239 1.00 0.00 ? 5  GLN A HB3  1  
ATOM 79    H HG2  . GLN A 1 5  ? -25.398 17.862 19.321 1.00 0.00 ? 5  GLN A HG2  1  
ATOM 80    H HG3  . GLN A 1 5  ? -26.250 18.465 20.742 1.00 0.00 ? 5  GLN A HG3  1  
ATOM 81    H HE21 . GLN A 1 5  ? -26.947 21.011 20.212 1.00 0.00 ? 5  GLN A HE21 1  
ATOM 82    H HE22 . GLN A 1 5  ? -27.818 21.154 18.762 1.00 0.00 ? 5  GLN A HE22 1  
ATOM 83    N N    . GLU A 1 6  ? -21.353 19.524 20.232 1.00 0.00 ? 6  GLU A N    1  
ATOM 84    C CA   . GLU A 1 6  ? -20.070 20.137 20.677 1.00 0.00 ? 6  GLU A CA   1  
ATOM 85    C C    . GLU A 1 6  ? -18.928 19.132 20.506 1.00 0.00 ? 6  GLU A C    1  
ATOM 86    O O    . GLU A 1 6  ? -18.199 18.842 21.433 1.00 0.00 ? 6  GLU A O    1  
ATOM 87    C CB   . GLU A 1 6  ? -20.279 20.469 22.154 1.00 0.00 ? 6  GLU A CB   1  
ATOM 88    C CG   . GLU A 1 6  ? -21.330 21.573 22.288 1.00 0.00 ? 6  GLU A CG   1  
ATOM 89    C CD   . GLU A 1 6  ? -21.258 22.175 23.692 1.00 0.00 ? 6  GLU A CD   1  
ATOM 90    O OE1  . GLU A 1 6  ? -20.589 21.595 24.531 1.00 0.00 ? 6  GLU A OE1  1  
ATOM 91    O OE2  . GLU A 1 6  ? -21.874 23.207 23.905 1.00 0.00 ? 6  GLU A OE2  1  
ATOM 92    H H    . GLU A 1 6  ? -21.570 18.603 20.487 1.00 0.00 ? 6  GLU A H    1  
ATOM 93    H HA   . GLU A 1 6  ? -19.868 21.038 20.120 1.00 0.00 ? 6  GLU A HA   1  
ATOM 94    H HB2  . GLU A 1 6  ? -20.616 19.587 22.677 1.00 0.00 ? 6  GLU A HB2  1  
ATOM 95    H HB3  . GLU A 1 6  ? -19.346 20.806 22.583 1.00 0.00 ? 6  GLU A HB3  1  
ATOM 96    H HG2  . GLU A 1 6  ? -21.138 22.343 21.555 1.00 0.00 ? 6  GLU A HG2  1  
ATOM 97    H HG3  . GLU A 1 6  ? -22.312 21.156 22.124 1.00 0.00 ? 6  GLU A HG3  1  
ATOM 98    N N    . MET A 1 7  ? -18.773 18.595 19.326 1.00 0.00 ? 7  MET A N    1  
ATOM 99    C CA   . MET A 1 7  ? -17.685 17.603 19.090 1.00 0.00 ? 7  MET A CA   1  
ATOM 100   C C    . MET A 1 7  ? -16.396 18.048 19.786 1.00 0.00 ? 7  MET A C    1  
ATOM 101   O O    . MET A 1 7  ? -15.677 17.248 20.351 1.00 0.00 ? 7  MET A O    1  
ATOM 102   C CB   . MET A 1 7  ? -17.493 17.579 17.573 1.00 0.00 ? 7  MET A CB   1  
ATOM 103   C CG   . MET A 1 7  ? -18.612 16.757 16.931 1.00 0.00 ? 7  MET A CG   1  
ATOM 104   S SD   . MET A 1 7  ? -18.513 15.045 17.512 1.00 0.00 ? 7  MET A SD   1  
ATOM 105   C CE   . MET A 1 7  ? -17.374 14.441 16.242 1.00 0.00 ? 7  MET A CE   1  
ATOM 106   H H    . MET A 1 7  ? -19.377 18.842 18.594 1.00 0.00 ? 7  MET A H    1  
ATOM 107   H HA   . MET A 1 7  ? -17.984 16.627 19.438 1.00 0.00 ? 7  MET A HA   1  
ATOM 108   H HB2  . MET A 1 7  ? -17.523 18.588 17.191 1.00 0.00 ? 7  MET A HB2  1  
ATOM 109   H HB3  . MET A 1 7  ? -16.538 17.133 17.338 1.00 0.00 ? 7  MET A HB3  1  
ATOM 110   H HG2  . MET A 1 7  ? -19.569 17.175 17.205 1.00 0.00 ? 7  MET A HG2  1  
ATOM 111   H HG3  . MET A 1 7  ? -18.504 16.779 15.857 1.00 0.00 ? 7  MET A HG3  1  
ATOM 112   H HE1  . MET A 1 7  ? -17.070 15.260 15.610 1.00 0.00 ? 7  MET A HE1  1  
ATOM 113   H HE2  . MET A 1 7  ? -16.502 14.012 16.716 1.00 0.00 ? 7  MET A HE2  1  
ATOM 114   H HE3  . MET A 1 7  ? -17.870 13.690 15.642 1.00 0.00 ? 7  MET A HE3  1  
ATOM 115   N N    . CYS A 1 8  ? -16.099 19.317 19.750 1.00 0.00 ? 8  CYS A N    1  
ATOM 116   C CA   . CYS A 1 8  ? -14.856 19.810 20.411 1.00 0.00 ? 8  CYS A CA   1  
ATOM 117   C C    . CYS A 1 8  ? -15.153 20.228 21.853 1.00 0.00 ? 8  CYS A C    1  
ATOM 118   O O    . CYS A 1 8  ? -15.715 21.277 22.103 1.00 0.00 ? 8  CYS A O    1  
ATOM 119   C CB   . CYS A 1 8  ? -14.417 21.015 19.579 1.00 0.00 ? 8  CYS A CB   1  
ATOM 120   S SG   . CYS A 1 8  ? -13.768 20.444 17.988 1.00 0.00 ? 8  CYS A SG   1  
ATOM 121   H H    . CYS A 1 8  ? -16.692 19.947 19.290 1.00 0.00 ? 8  CYS A H    1  
ATOM 122   H HA   . CYS A 1 8  ? -14.092 19.049 20.389 1.00 0.00 ? 8  CYS A HA   1  
ATOM 123   H HB2  . CYS A 1 8  ? -15.264 21.663 19.410 1.00 0.00 ? 8  CYS A HB2  1  
ATOM 124   H HB3  . CYS A 1 8  ? -13.648 21.557 20.108 1.00 0.00 ? 8  CYS A HB3  1  
ATOM 125   N N    . HIS A 1 9  ? -14.781 19.416 22.805 1.00 0.00 ? 9  HIS A N    1  
ATOM 126   C CA   . HIS A 1 9  ? -15.043 19.765 24.231 1.00 0.00 ? 9  HIS A CA   1  
ATOM 127   C C    . HIS A 1 9  ? -13.766 20.294 24.890 1.00 0.00 ? 9  HIS A C    1  
ATOM 128   O O    . HIS A 1 9  ? -13.770 21.320 25.539 1.00 0.00 ? 9  HIS A O    1  
ATOM 129   C CB   . HIS A 1 9  ? -15.479 18.455 24.886 1.00 0.00 ? 9  HIS A CB   1  
ATOM 130   C CG   . HIS A 1 9  ? -16.745 17.967 24.239 1.00 0.00 ? 9  HIS A CG   1  
ATOM 131   N ND1  . HIS A 1 9  ? -17.966 18.592 24.440 1.00 0.00 ? 9  HIS A ND1  1  
ATOM 132   C CD2  . HIS A 1 9  ? -16.997 16.915 23.394 1.00 0.00 ? 9  HIS A CD2  1  
ATOM 133   C CE1  . HIS A 1 9  ? -18.889 17.916 23.732 1.00 0.00 ? 9  HIS A CE1  1  
ATOM 134   N NE2  . HIS A 1 9  ? -18.352 16.884 23.075 1.00 0.00 ? 9  HIS A NE2  1  
ATOM 135   H H    . HIS A 1 9  ? -14.331 18.575 22.581 1.00 0.00 ? 9  HIS A H    1  
ATOM 136   H HA   . HIS A 1 9  ? -15.834 20.494 24.302 1.00 0.00 ? 9  HIS A HA   1  
ATOM 137   H HB2  . HIS A 1 9  ? -14.703 17.714 24.761 1.00 0.00 ? 9  HIS A HB2  1  
ATOM 138   H HB3  . HIS A 1 9  ? -15.653 18.620 25.939 1.00 0.00 ? 9  HIS A HB3  1  
ATOM 139   H HD1  . HIS A 1 9  ? -18.127 19.383 24.996 1.00 0.00 ? 9  HIS A HD1  1  
ATOM 140   H HD2  . HIS A 1 9  ? -16.257 16.216 23.033 1.00 0.00 ? 9  HIS A HD2  1  
ATOM 141   H HE1  . HIS A 1 9  ? -19.936 18.176 23.699 1.00 0.00 ? 9  HIS A HE1  1  
ATOM 142   N N    . GLU A 1 10 ? -12.673 19.599 24.729 1.00 0.00 ? 10 GLU A N    1  
ATOM 143   C CA   . GLU A 1 10 ? -11.398 20.060 25.347 1.00 0.00 ? 10 GLU A CA   1  
ATOM 144   C C    . GLU A 1 10 ? -10.667 21.017 24.402 1.00 0.00 ? 10 GLU A C    1  
ATOM 145   O O    . GLU A 1 10 ? -10.061 21.981 24.827 1.00 0.00 ? 10 GLU A O    1  
ATOM 146   C CB   . GLU A 1 10 ? -10.579 18.787 25.563 1.00 0.00 ? 10 GLU A CB   1  
ATOM 147   C CG   . GLU A 1 10 ? -11.007 18.124 26.874 1.00 0.00 ? 10 GLU A CG   1  
ATOM 148   C CD   . GLU A 1 10 ? -10.046 16.979 27.203 1.00 0.00 ? 10 GLU A CD   1  
ATOM 149   O OE1  . GLU A 1 10 ? -9.361  16.529 26.300 1.00 0.00 ? 10 GLU A OE1  1  
ATOM 150   O OE2  . GLU A 1 10 ? -10.013 16.572 28.353 1.00 0.00 ? 10 GLU A OE2  1  
ATOM 151   H H    . GLU A 1 10 ? -12.691 18.772 24.202 1.00 0.00 ? 10 GLU A H    1  
ATOM 152   H HA   . GLU A 1 10 ? -11.590 20.539 26.294 1.00 0.00 ? 10 GLU A HA   1  
ATOM 153   H HB2  . GLU A 1 10 ? -10.750 18.106 24.743 1.00 0.00 ? 10 GLU A HB2  1  
ATOM 154   H HB3  . GLU A 1 10 ? -9.530  19.037 25.611 1.00 0.00 ? 10 GLU A HB3  1  
ATOM 155   H HG2  . GLU A 1 10 ? -10.984 18.853 27.670 1.00 0.00 ? 10 GLU A HG2  1  
ATOM 156   H HG3  . GLU A 1 10 ? -12.009 17.734 26.770 1.00 0.00 ? 10 GLU A HG3  1  
ATOM 157   N N    . PHE A 1 11 ? -10.719 20.761 23.124 1.00 0.00 ? 11 PHE A N    1  
ATOM 158   C CA   . PHE A 1 11 ? -10.027 21.660 22.157 1.00 0.00 ? 11 PHE A CA   1  
ATOM 159   C C    . PHE A 1 11 ? -10.736 23.012 22.094 1.00 0.00 ? 11 PHE A C    1  
ATOM 160   O O    . PHE A 1 11 ? -10.141 24.018 21.769 1.00 0.00 ? 11 PHE A O    1  
ATOM 161   C CB   . PHE A 1 11 ? -10.127 20.955 20.810 1.00 0.00 ? 11 PHE A CB   1  
ATOM 162   C CG   . PHE A 1 11 ? -9.136  19.817 20.756 1.00 0.00 ? 11 PHE A CG   1  
ATOM 163   C CD1  . PHE A 1 11 ? -7.827  20.054 20.320 1.00 0.00 ? 11 PHE A CD1  1  
ATOM 164   C CD2  . PHE A 1 11 ? -9.525  18.526 21.135 1.00 0.00 ? 11 PHE A CD2  1  
ATOM 165   C CE1  . PHE A 1 11 ? -6.907  19.001 20.263 1.00 0.00 ? 11 PHE A CE1  1  
ATOM 166   C CE2  . PHE A 1 11 ? -8.604  17.474 21.079 1.00 0.00 ? 11 PHE A CE2  1  
ATOM 167   C CZ   . PHE A 1 11 ? -7.297  17.712 20.642 1.00 0.00 ? 11 PHE A CZ   1  
ATOM 168   H H    . PHE A 1 11 ? -11.214 19.979 22.800 1.00 0.00 ? 11 PHE A H    1  
ATOM 169   H HA   . PHE A 1 11 ? -8.992  21.787 22.431 1.00 0.00 ? 11 PHE A HA   1  
ATOM 170   H HB2  . PHE A 1 11 ? -11.126 20.574 20.684 1.00 0.00 ? 11 PHE A HB2  1  
ATOM 171   H HB3  . PHE A 1 11 ? -9.910  21.658 20.020 1.00 0.00 ? 11 PHE A HB3  1  
ATOM 172   H HD1  . PHE A 1 11 ? -7.526  21.049 20.029 1.00 0.00 ? 11 PHE A HD1  1  
ATOM 173   H HD2  . PHE A 1 11 ? -10.533 18.342 21.474 1.00 0.00 ? 11 PHE A HD2  1  
ATOM 174   H HE1  . PHE A 1 11 ? -5.896  19.183 19.927 1.00 0.00 ? 11 PHE A HE1  1  
ATOM 175   H HE2  . PHE A 1 11 ? -8.904  16.478 21.371 1.00 0.00 ? 11 PHE A HE2  1  
ATOM 176   H HZ   . PHE A 1 11 ? -6.586  16.900 20.600 1.00 0.00 ? 11 PHE A HZ   1  
ATOM 177   N N    . GLN A 1 12 ? -12.003 23.048 22.402 1.00 0.00 ? 12 GLN A N    1  
ATOM 178   C CA   . GLN A 1 12 ? -12.732 24.345 22.359 1.00 0.00 ? 12 GLN A CA   1  
ATOM 179   C C    . GLN A 1 12 ? -11.897 25.414 23.059 1.00 0.00 ? 12 GLN A C    1  
ATOM 180   O O    . GLN A 1 12 ? -11.728 26.509 22.563 1.00 0.00 ? 12 GLN A O    1  
ATOM 181   C CB   . GLN A 1 12 ? -14.038 24.098 23.113 1.00 0.00 ? 12 GLN A CB   1  
ATOM 182   C CG   . GLN A 1 12 ? -14.852 25.393 23.158 1.00 0.00 ? 12 GLN A CG   1  
ATOM 183   C CD   . GLN A 1 12 ? -15.912 25.291 24.256 1.00 0.00 ? 12 GLN A CD   1  
ATOM 184   O OE1  . GLN A 1 12 ? -15.607 24.948 25.381 1.00 0.00 ? 12 GLN A OE1  1  
ATOM 185   N NE2  . GLN A 1 12 ? -17.154 25.576 23.975 1.00 0.00 ? 12 GLN A NE2  1  
ATOM 186   H H    . GLN A 1 12 ? -12.471 22.227 22.662 1.00 0.00 ? 12 GLN A H    1  
ATOM 187   H HA   . GLN A 1 12 ? -12.939 24.632 21.339 1.00 0.00 ? 12 GLN A HA   1  
ATOM 188   H HB2  . GLN A 1 12 ? -14.607 23.332 22.608 1.00 0.00 ? 12 GLN A HB2  1  
ATOM 189   H HB3  . GLN A 1 12 ? -13.817 23.777 24.120 1.00 0.00 ? 12 GLN A HB3  1  
ATOM 190   H HG2  . GLN A 1 12 ? -14.195 26.224 23.367 1.00 0.00 ? 12 GLN A HG2  1  
ATOM 191   H HG3  . GLN A 1 12 ? -15.335 25.547 22.204 1.00 0.00 ? 12 GLN A HG3  1  
ATOM 192   H HE21 . GLN A 1 12 ? -17.401 25.853 23.068 1.00 0.00 ? 12 GLN A HE21 1  
ATOM 193   H HE22 . GLN A 1 12 ? -17.841 25.513 24.672 1.00 0.00 ? 12 GLN A HE22 1  
ATOM 194   N N    . ALA A 1 13 ? -11.362 25.100 24.205 1.00 0.00 ? 13 ALA A N    1  
ATOM 195   C CA   . ALA A 1 13 ? -10.526 26.095 24.930 1.00 0.00 ? 13 ALA A CA   1  
ATOM 196   C C    . ALA A 1 13 ? -9.345  26.515 24.053 1.00 0.00 ? 13 ALA A C    1  
ATOM 197   O O    . ALA A 1 13 ? -8.728  27.538 24.273 1.00 0.00 ? 13 ALA A O    1  
ATOM 198   C CB   . ALA A 1 13 ? -10.035 25.367 26.182 1.00 0.00 ? 13 ALA A CB   1  
ATOM 199   H H    . ALA A 1 13 ? -11.502 24.207 24.584 1.00 0.00 ? 13 ALA A H    1  
ATOM 200   H HA   . ALA A 1 13 ? -11.116 26.954 25.208 1.00 0.00 ? 13 ALA A HA   1  
ATOM 201   H HB1  . ALA A 1 13 ? -8.963  25.470 26.261 1.00 0.00 ? 13 ALA A HB1  1  
ATOM 202   H HB2  . ALA A 1 13 ? -10.504 25.796 27.055 1.00 0.00 ? 13 ALA A HB2  1  
ATOM 203   H HB3  . ALA A 1 13 ? -10.292 24.320 26.113 1.00 0.00 ? 13 ALA A HB3  1  
ATOM 204   N N    . PHE A 1 14 ? -9.025  25.731 23.057 1.00 0.00 ? 14 PHE A N    1  
ATOM 205   C CA   . PHE A 1 14 ? -7.886  26.088 22.168 1.00 0.00 ? 14 PHE A CA   1  
ATOM 206   C C    . PHE A 1 14 ? -8.360  26.994 21.028 1.00 0.00 ? 14 PHE A C    1  
ATOM 207   O O    . PHE A 1 14 ? -7.650  27.219 20.068 1.00 0.00 ? 14 PHE A O    1  
ATOM 208   C CB   . PHE A 1 14 ? -7.387  24.754 21.613 1.00 0.00 ? 14 PHE A CB   1  
ATOM 209   C CG   . PHE A 1 14 ? -6.959  23.844 22.744 1.00 0.00 ? 14 PHE A CG   1  
ATOM 210   C CD1  . PHE A 1 14 ? -6.759  24.357 24.033 1.00 0.00 ? 14 PHE A CD1  1  
ATOM 211   C CD2  . PHE A 1 14 ? -6.760  22.480 22.497 1.00 0.00 ? 14 PHE A CD2  1  
ATOM 212   C CE1  . PHE A 1 14 ? -6.362  23.506 25.071 1.00 0.00 ? 14 PHE A CE1  1  
ATOM 213   C CE2  . PHE A 1 14 ? -6.363  21.630 23.535 1.00 0.00 ? 14 PHE A CE2  1  
ATOM 214   C CZ   . PHE A 1 14 ? -6.163  22.143 24.822 1.00 0.00 ? 14 PHE A CZ   1  
ATOM 215   H H    . PHE A 1 14 ? -9.534  24.905 22.892 1.00 0.00 ? 14 PHE A H    1  
ATOM 216   H HA   . PHE A 1 14 ? -7.103  26.567 22.733 1.00 0.00 ? 14 PHE A HA   1  
ATOM 217   H HB2  . PHE A 1 14 ? -8.181  24.281 21.054 1.00 0.00 ? 14 PHE A HB2  1  
ATOM 218   H HB3  . PHE A 1 14 ? -6.548  24.931 20.961 1.00 0.00 ? 14 PHE A HB3  1  
ATOM 219   H HD1  . PHE A 1 14 ? -6.912  25.409 24.225 1.00 0.00 ? 14 PHE A HD1  1  
ATOM 220   H HD2  . PHE A 1 14 ? -6.914  22.084 21.504 1.00 0.00 ? 14 PHE A HD2  1  
ATOM 221   H HE1  . PHE A 1 14 ? -6.208  23.902 26.064 1.00 0.00 ? 14 PHE A HE1  1  
ATOM 222   H HE2  . PHE A 1 14 ? -6.211  20.579 23.342 1.00 0.00 ? 14 PHE A HE2  1  
ATOM 223   H HZ   . PHE A 1 14 ? -5.857  21.487 25.623 1.00 0.00 ? 14 PHE A HZ   1  
ATOM 224   N N    . MET A 1 15 ? -9.557  27.509 21.116 1.00 0.00 ? 15 MET A N    1  
ATOM 225   C CA   . MET A 1 15 ? -10.067 28.389 20.031 1.00 0.00 ? 15 MET A CA   1  
ATOM 226   C C    . MET A 1 15 ? -9.906  29.864 20.412 1.00 0.00 ? 15 MET A C    1  
ATOM 227   O O    . MET A 1 15 ? -10.478 30.335 21.375 1.00 0.00 ? 15 MET A O    1  
ATOM 228   C CB   . MET A 1 15 ? -11.545 28.022 19.897 1.00 0.00 ? 15 MET A CB   1  
ATOM 229   C CG   . MET A 1 15 ? -12.329 28.589 21.083 1.00 0.00 ? 15 MET A CG   1  
ATOM 230   S SD   . MET A 1 15 ? -13.866 27.656 21.291 1.00 0.00 ? 15 MET A SD   1  
ATOM 231   C CE   . MET A 1 15 ? -14.785 28.931 22.188 1.00 0.00 ? 15 MET A CE   1  
ATOM 232   H H    . MET A 1 15 ? -10.123 27.314 21.889 1.00 0.00 ? 15 MET A H    1  
ATOM 233   H HA   . MET A 1 15 ? -9.553  28.181 19.106 1.00 0.00 ? 15 MET A HA   1  
ATOM 234   H HB2  . MET A 1 15 ? -11.932 28.434 18.983 1.00 0.00 ? 15 MET A HB2  1  
ATOM 235   H HB3  . MET A 1 15 ? -11.648 26.948 19.879 1.00 0.00 ? 15 MET A HB3  1  
ATOM 236   H HG2  . MET A 1 15 ? -11.735 28.510 21.980 1.00 0.00 ? 15 MET A HG2  1  
ATOM 237   H HG3  . MET A 1 15 ? -12.562 29.625 20.896 1.00 0.00 ? 15 MET A HG3  1  
ATOM 238   H HE1  . MET A 1 15 ? -14.101 29.701 22.519 1.00 0.00 ? 15 MET A HE1  1  
ATOM 239   H HE2  . MET A 1 15 ? -15.531 29.362 21.535 1.00 0.00 ? 15 MET A HE2  1  
ATOM 240   H HE3  . MET A 1 15 ? -15.270 28.492 23.045 1.00 0.00 ? 15 MET A HE3  1  
ATOM 241   N N    . LYS A 1 16 ? -9.134  30.599 19.658 1.00 0.00 ? 16 LYS A N    1  
ATOM 242   C CA   . LYS A 1 16 ? -8.941  32.043 19.968 1.00 0.00 ? 16 LYS A CA   1  
ATOM 243   C C    . LYS A 1 16 ? -9.852  32.892 19.078 1.00 0.00 ? 16 LYS A C    1  
ATOM 244   O O    . LYS A 1 16 ? -9.454  33.353 18.027 1.00 0.00 ? 16 LYS A O    1  
ATOM 245   C CB   . LYS A 1 16 ? -7.471  32.326 19.658 1.00 0.00 ? 16 LYS A CB   1  
ATOM 246   C CG   . LYS A 1 16 ? -7.198  33.825 19.804 1.00 0.00 ? 16 LYS A CG   1  
ATOM 247   C CD   . LYS A 1 16 ? -7.570  34.276 21.218 1.00 0.00 ? 16 LYS A CD   1  
ATOM 248   C CE   . LYS A 1 16 ? -7.144  35.733 21.417 1.00 0.00 ? 16 LYS A CE   1  
ATOM 249   N NZ   . LYS A 1 16 ? -5.699  35.662 21.774 1.00 0.00 ? 16 LYS A NZ   1  
ATOM 250   H H    . LYS A 1 16 ? -8.685  30.201 18.884 1.00 0.00 ? 16 LYS A H    1  
ATOM 251   H HA   . LYS A 1 16 ? -9.143  32.236 21.010 1.00 0.00 ? 16 LYS A HA   1  
ATOM 252   H HB2  . LYS A 1 16 ? -6.845  31.779 20.347 1.00 0.00 ? 16 LYS A HB2  1  
ATOM 253   H HB3  . LYS A 1 16 ? -7.250  32.017 18.648 1.00 0.00 ? 16 LYS A HB3  1  
ATOM 254   H HG2  . LYS A 1 16 ? -6.150  34.019 19.628 1.00 0.00 ? 16 LYS A HG2  1  
ATOM 255   H HG3  . LYS A 1 16 ? -7.790  34.371 19.084 1.00 0.00 ? 16 LYS A HG3  1  
ATOM 256   H HD2  . LYS A 1 16 ? -8.638  34.192 21.353 1.00 0.00 ? 16 LYS A HD2  1  
ATOM 257   H HD3  . LYS A 1 16 ? -7.065  33.652 21.940 1.00 0.00 ? 16 LYS A HD3  1  
ATOM 258   H HE2  . LYS A 1 16 ? -7.278  36.292 20.502 1.00 0.00 ? 16 LYS A HE2  1  
ATOM 259   H HE3  . LYS A 1 16 ? -7.709  36.183 22.220 1.00 0.00 ? 16 LYS A HE3  1  
ATOM 260   H HZ1  . LYS A 1 16 ? -5.241  34.909 21.223 1.00 0.00 ? 16 LYS A HZ1  1  
ATOM 261   H HZ2  . LYS A 1 16 ? -5.244  36.572 21.559 1.00 0.00 ? 16 LYS A HZ2  1  
ATOM 262   H HZ3  . LYS A 1 16 ? -5.603  35.457 22.790 1.00 0.00 ? 16 LYS A HZ3  1  
ATOM 263   N N    . ASN A 1 17 ? -11.072 33.096 19.493 1.00 0.00 ? 17 ASN A N    1  
ATOM 264   C CA   . ASN A 1 17 ? -12.017 33.911 18.678 1.00 0.00 ? 17 ASN A CA   1  
ATOM 265   C C    . ASN A 1 17 ? -12.209 33.288 17.293 1.00 0.00 ? 17 ASN A C    1  
ATOM 266   O O    . ASN A 1 17 ? -12.073 33.946 16.281 1.00 0.00 ? 17 ASN A O    1  
ATOM 267   C CB   . ASN A 1 17 ? -11.363 35.288 18.566 1.00 0.00 ? 17 ASN A CB   1  
ATOM 268   C CG   . ASN A 1 17 ? -11.107 35.847 19.967 1.00 0.00 ? 17 ASN A CG   1  
ATOM 269   O OD1  . ASN A 1 17 ? -11.991 35.859 20.800 1.00 0.00 ? 17 ASN A OD1  1  
ATOM 270   N ND2  . ASN A 1 17 ? -9.924  36.312 20.262 1.00 0.00 ? 17 ASN A ND2  1  
ATOM 271   H H    . ASN A 1 17 ? -11.368 32.712 20.343 1.00 0.00 ? 17 ASN A H    1  
ATOM 272   H HA   . ASN A 1 17 ? -12.966 33.996 19.183 1.00 0.00 ? 17 ASN A HA   1  
ATOM 273   H HB2  . ASN A 1 17 ? -10.426 35.200 18.038 1.00 0.00 ? 17 ASN A HB2  1  
ATOM 274   H HB3  . ASN A 1 17 ? -12.019 35.956 18.027 1.00 0.00 ? 17 ASN A HB3  1  
ATOM 275   H HD21 . ASN A 1 17 ? -9.212  36.301 19.590 1.00 0.00 ? 17 ASN A HD21 1  
ATOM 276   H HD22 . ASN A 1 17 ? -9.749  36.671 21.156 1.00 0.00 ? 17 ASN A HD22 1  
ATOM 277   N N    . GLY A 1 18 ? -12.537 32.026 17.242 1.00 0.00 ? 18 GLY A N    1  
ATOM 278   C CA   . GLY A 1 18 ? -12.752 31.363 15.923 1.00 0.00 ? 18 GLY A CA   1  
ATOM 279   C C    . GLY A 1 18 ? -11.446 30.733 15.430 1.00 0.00 ? 18 GLY A C    1  
ATOM 280   O O    . GLY A 1 18 ? -11.429 30.009 14.455 1.00 0.00 ? 18 GLY A O    1  
ATOM 281   H H    . GLY A 1 18 ? -12.650 31.516 18.072 1.00 0.00 ? 18 GLY A H    1  
ATOM 282   H HA2  . GLY A 1 18 ? -13.503 30.594 16.028 1.00 0.00 ? 18 GLY A HA2  1  
ATOM 283   H HA3  . GLY A 1 18 ? -13.088 32.096 15.205 1.00 0.00 ? 18 GLY A HA3  1  
ATOM 284   N N    . LYS A 1 19 ? -10.353 31.000 16.090 1.00 0.00 ? 19 LYS A N    1  
ATOM 285   C CA   . LYS A 1 19 ? -9.057  30.410 15.644 1.00 0.00 ? 19 LYS A CA   1  
ATOM 286   C C    . LYS A 1 19 ? -8.708  29.185 16.493 1.00 0.00 ? 19 LYS A C    1  
ATOM 287   O O    . LYS A 1 19 ? -8.412  29.294 17.665 1.00 0.00 ? 19 LYS A O    1  
ATOM 288   C CB   . LYS A 1 19 ? -8.022  31.515 15.852 1.00 0.00 ? 19 LYS A CB   1  
ATOM 289   C CG   . LYS A 1 19 ? -6.707  31.111 15.181 1.00 0.00 ? 19 LYS A CG   1  
ATOM 290   C CD   . LYS A 1 19 ? -5.844  30.331 16.176 1.00 0.00 ? 19 LYS A CD   1  
ATOM 291   C CE   . LYS A 1 19 ? -4.960  31.307 16.956 1.00 0.00 ? 19 LYS A CE   1  
ATOM 292   N NZ   . LYS A 1 19 ? -3.693  30.563 17.203 1.00 0.00 ? 19 LYS A NZ   1  
ATOM 293   H H    . LYS A 1 19 ? -10.382 31.587 16.874 1.00 0.00 ? 19 LYS A H    1  
ATOM 294   H HA   . LYS A 1 19 ? -9.105  30.143 14.601 1.00 0.00 ? 19 LYS A HA   1  
ATOM 295   H HB2  . LYS A 1 19 ? -8.383  32.434 15.413 1.00 0.00 ? 19 LYS A HB2  1  
ATOM 296   H HB3  . LYS A 1 19 ? -7.857  31.661 16.909 1.00 0.00 ? 19 LYS A HB3  1  
ATOM 297   H HG2  . LYS A 1 19 ? -6.916  30.491 14.322 1.00 0.00 ? 19 LYS A HG2  1  
ATOM 298   H HG3  . LYS A 1 19 ? -6.178  31.998 14.864 1.00 0.00 ? 19 LYS A HG3  1  
ATOM 299   H HD2  . LYS A 1 19 ? -6.481  29.794 16.863 1.00 0.00 ? 19 LYS A HD2  1  
ATOM 300   H HD3  . LYS A 1 19 ? -5.221  29.629 15.640 1.00 0.00 ? 19 LYS A HD3  1  
ATOM 301   H HE2  . LYS A 1 19 ? -4.767  32.192 16.368 1.00 0.00 ? 19 LYS A HE2  1  
ATOM 302   H HE3  . LYS A 1 19 ? -5.429  31.572 17.892 1.00 0.00 ? 19 LYS A HE3  1  
ATOM 303   H HZ1  . LYS A 1 19 ? -3.556  29.851 16.458 1.00 0.00 ? 19 LYS A HZ1  1  
ATOM 304   H HZ2  . LYS A 1 19 ? -2.893  31.227 17.195 1.00 0.00 ? 19 LYS A HZ2  1  
ATOM 305   H HZ3  . LYS A 1 19 ? -3.744  30.091 18.129 1.00 0.00 ? 19 LYS A HZ3  1  
ATOM 306   N N    . LEU A 1 20 ? -8.738  28.019 15.910 1.00 0.00 ? 20 LEU A N    1  
ATOM 307   C CA   . LEU A 1 20 ? -8.404  26.792 16.688 1.00 0.00 ? 20 LEU A CA   1  
ATOM 308   C C    . LEU A 1 20 ? -6.931  26.425 16.487 1.00 0.00 ? 20 LEU A C    1  
ATOM 309   O O    . LEU A 1 20 ? -6.549  25.891 15.465 1.00 0.00 ? 20 LEU A O    1  
ATOM 310   C CB   . LEU A 1 20 ? -9.312  25.702 16.117 1.00 0.00 ? 20 LEU A CB   1  
ATOM 311   C CG   . LEU A 1 20 ? -9.531  24.616 17.172 1.00 0.00 ? 20 LEU A CG   1  
ATOM 312   C CD1  . LEU A 1 20 ? -10.198 23.401 16.523 1.00 0.00 ? 20 LEU A CD1  1  
ATOM 313   C CD2  . LEU A 1 20 ? -8.183  24.202 17.766 1.00 0.00 ? 20 LEU A CD2  1  
ATOM 314   H H    . LEU A 1 20 ? -8.977  27.950 14.962 1.00 0.00 ? 20 LEU A H    1  
ATOM 315   H HA   . LEU A 1 20 ? -8.618  26.939 17.735 1.00 0.00 ? 20 LEU A HA   1  
ATOM 316   H HB2  . LEU A 1 20 ? -10.263 26.134 15.841 1.00 0.00 ? 20 LEU A HB2  1  
ATOM 317   H HB3  . LEU A 1 20 ? -8.847  25.267 15.244 1.00 0.00 ? 20 LEU A HB3  1  
ATOM 318   H HG   . LEU A 1 20 ? -10.167 24.999 17.957 1.00 0.00 ? 20 LEU A HG   1  
ATOM 319   H HD11 . LEU A 1 20 ? -10.626 23.689 15.575 1.00 0.00 ? 20 LEU A HD11 1  
ATOM 320   H HD12 . LEU A 1 20 ? -9.461  22.628 16.365 1.00 0.00 ? 20 LEU A HD12 1  
ATOM 321   H HD13 . LEU A 1 20 ? -10.977 23.028 17.172 1.00 0.00 ? 20 LEU A HD13 1  
ATOM 322   H HD21 . LEU A 1 20 ? -7.462  24.079 16.972 1.00 0.00 ? 20 LEU A HD21 1  
ATOM 323   H HD22 . LEU A 1 20 ? -7.840  24.966 18.449 1.00 0.00 ? 20 LEU A HD22 1  
ATOM 324   H HD23 . LEU A 1 20 ? -8.296  23.268 18.298 1.00 0.00 ? 20 LEU A HD23 1  
ATOM 325   N N    . PHE A 1 21 ? -6.101  26.703 17.456 1.00 0.00 ? 21 PHE A N    1  
ATOM 326   C CA   . PHE A 1 21 ? -4.654  26.358 17.312 1.00 0.00 ? 21 PHE A CA   1  
ATOM 327   C C    . PHE A 1 21 ? -4.393  24.954 17.862 1.00 0.00 ? 21 PHE A C    1  
ATOM 328   O O    . PHE A 1 21 ? -3.694  24.772 18.838 1.00 0.00 ? 21 PHE A O    1  
ATOM 329   C CB   . PHE A 1 21 ? -3.871  27.415 18.109 1.00 0.00 ? 21 PHE A CB   1  
ATOM 330   C CG   . PHE A 1 21 ? -4.560  27.724 19.419 1.00 0.00 ? 21 PHE A CG   1  
ATOM 331   C CD1  . PHE A 1 21 ? -4.336  26.916 20.541 1.00 0.00 ? 21 PHE A CD1  1  
ATOM 332   C CD2  . PHE A 1 21 ? -5.420  28.826 19.512 1.00 0.00 ? 21 PHE A CD2  1  
ATOM 333   C CE1  . PHE A 1 21 ? -4.972  27.210 21.753 1.00 0.00 ? 21 PHE A CE1  1  
ATOM 334   C CE2  . PHE A 1 21 ? -6.054  29.119 20.724 1.00 0.00 ? 21 PHE A CE2  1  
ATOM 335   C CZ   . PHE A 1 21 ? -5.831  28.311 21.844 1.00 0.00 ? 21 PHE A CZ   1  
ATOM 336   H H    . PHE A 1 21 ? -6.432  27.128 18.273 1.00 0.00 ? 21 PHE A H    1  
ATOM 337   H HA   . PHE A 1 21 ? -4.368  26.404 16.272 1.00 0.00 ? 21 PHE A HA   1  
ATOM 338   H HB2  . PHE A 1 21 ? -2.877  27.044 18.309 1.00 0.00 ? 21 PHE A HB2  1  
ATOM 339   H HB3  . PHE A 1 21 ? -3.801  28.320 17.523 1.00 0.00 ? 21 PHE A HB3  1  
ATOM 340   H HD1  . PHE A 1 21 ? -3.673  26.067 20.472 1.00 0.00 ? 21 PHE A HD1  1  
ATOM 341   H HD2  . PHE A 1 21 ? -5.593  29.449 18.647 1.00 0.00 ? 21 PHE A HD2  1  
ATOM 342   H HE1  . PHE A 1 21 ? -4.800  26.586 22.618 1.00 0.00 ? 21 PHE A HE1  1  
ATOM 343   H HE2  . PHE A 1 21 ? -6.717  29.969 20.795 1.00 0.00 ? 21 PHE A HE2  1  
ATOM 344   H HZ   . PHE A 1 21 ? -6.321  28.538 22.780 1.00 0.00 ? 21 PHE A HZ   1  
ATOM 345   N N    . CYS A 1 22 ? -4.955  23.959 17.232 1.00 0.00 ? 22 CYS A N    1  
ATOM 346   C CA   . CYS A 1 22 ? -4.752  22.557 17.702 1.00 0.00 ? 22 CYS A CA   1  
ATOM 347   C C    . CYS A 1 22 ? -3.259  22.238 17.895 1.00 0.00 ? 22 CYS A C    1  
ATOM 348   O O    . CYS A 1 22 ? -2.886  21.674 18.904 1.00 0.00 ? 22 CYS A O    1  
ATOM 349   C CB   . CYS A 1 22 ? -5.352  21.675 16.606 1.00 0.00 ? 22 CYS A CB   1  
ATOM 350   S SG   . CYS A 1 22 ? -6.203  20.268 17.363 1.00 0.00 ? 22 CYS A SG   1  
ATOM 351   H H    . CYS A 1 22 ? -5.513  24.134 16.446 1.00 0.00 ? 22 CYS A H    1  
ATOM 352   H HA   . CYS A 1 22 ? -5.286  22.397 18.625 1.00 0.00 ? 22 CYS A HA   1  
ATOM 353   H HB2  . CYS A 1 22 ? -6.056  22.251 16.023 1.00 0.00 ? 22 CYS A HB2  1  
ATOM 354   H HB3  . CYS A 1 22 ? -4.565  21.311 15.963 1.00 0.00 ? 22 CYS A HB3  1  
ATOM 355   N N    . PRO A 1 23 ? -2.445  22.592 16.926 1.00 0.00 ? 23 PRO A N    1  
ATOM 356   C CA   . PRO A 1 23 ? -0.992  22.310 17.024 1.00 0.00 ? 23 PRO A CA   1  
ATOM 357   C C    . PRO A 1 23 ? -0.369  23.077 18.194 1.00 0.00 ? 23 PRO A C    1  
ATOM 358   O O    . PRO A 1 23 ? 0.178   24.150 18.028 1.00 0.00 ? 23 PRO A O    1  
ATOM 359   C CB   . PRO A 1 23 ? -0.458  22.813 15.680 1.00 0.00 ? 23 PRO A CB   1  
ATOM 360   C CG   . PRO A 1 23 ? -1.636  23.363 14.854 1.00 0.00 ? 23 PRO A CG   1  
ATOM 361   C CD   . PRO A 1 23 ? -2.914  23.283 15.699 1.00 0.00 ? 23 PRO A CD   1  
ATOM 362   H HA   . PRO A 1 23 ? -0.813  21.252 17.120 1.00 0.00 ? 23 PRO A HA   1  
ATOM 363   H HB2  . PRO A 1 23 ? 0.266   23.597 15.848 1.00 0.00 ? 23 PRO A HB2  1  
ATOM 364   H HB3  . PRO A 1 23 ? 0.009   21.997 15.148 1.00 0.00 ? 23 PRO A HB3  1  
ATOM 365   H HG2  . PRO A 1 23 ? -1.442  24.391 14.586 1.00 0.00 ? 23 PRO A HG2  1  
ATOM 366   H HG3  . PRO A 1 23 ? -1.757  22.772 13.958 1.00 0.00 ? 23 PRO A HG3  1  
ATOM 367   H HD2  . PRO A 1 23 ? -3.273  24.273 15.930 1.00 0.00 ? 23 PRO A HD2  1  
ATOM 368   H HD3  . PRO A 1 23 ? -3.671  22.705 15.194 1.00 0.00 ? 23 PRO A HD3  1  
ATOM 369   N N    . GLN A 1 24 ? -0.446  22.530 19.377 1.00 0.00 ? 24 GLN A N    1  
ATOM 370   C CA   . GLN A 1 24 ? 0.142   23.219 20.562 1.00 0.00 ? 24 GLN A CA   1  
ATOM 371   C C    . GLN A 1 24 ? 1.188   22.320 21.227 1.00 0.00 ? 24 GLN A C    1  
ATOM 372   O O    . GLN A 1 24 ? 2.371   22.435 20.974 1.00 0.00 ? 24 GLN A O    1  
ATOM 373   C CB   . GLN A 1 24 ? -1.037  23.459 21.506 1.00 0.00 ? 24 GLN A CB   1  
ATOM 374   C CG   . GLN A 1 24 ? -0.516  23.907 22.874 1.00 0.00 ? 24 GLN A CG   1  
ATOM 375   C CD   . GLN A 1 24 ? -1.689  24.043 23.846 1.00 0.00 ? 24 GLN A CD   1  
ATOM 376   O OE1  . GLN A 1 24 ? -2.113  25.139 24.156 1.00 0.00 ? 24 GLN A OE1  1  
ATOM 377   N NE2  . GLN A 1 24 ? -2.235  22.968 24.344 1.00 0.00 ? 24 GLN A NE2  1  
ATOM 378   H H    . GLN A 1 24 ? -0.891  21.664 19.486 1.00 0.00 ? 24 GLN A H    1  
ATOM 379   H HA   . GLN A 1 24 ? 0.581   24.159 20.274 1.00 0.00 ? 24 GLN A HA   1  
ATOM 380   H HB2  . GLN A 1 24 ? -1.675  24.227 21.095 1.00 0.00 ? 24 GLN A HB2  1  
ATOM 381   H HB3  . GLN A 1 24 ? -1.600  22.545 21.618 1.00 0.00 ? 24 GLN A HB3  1  
ATOM 382   H HG2  . GLN A 1 24 ? 0.181   23.174 23.253 1.00 0.00 ? 24 GLN A HG2  1  
ATOM 383   H HG3  . GLN A 1 24 ? -0.017  24.859 22.776 1.00 0.00 ? 24 GLN A HG3  1  
ATOM 384   H HE21 . GLN A 1 24 ? -1.893  22.084 24.094 1.00 0.00 ? 24 GLN A HE21 1  
ATOM 385   H HE22 . GLN A 1 24 ? -2.987  23.044 24.968 1.00 0.00 ? 24 GLN A HE22 1  
ATOM 386   N N    . ASP A 1 25 ? 0.760   21.426 22.074 1.00 0.00 ? 25 ASP A N    1  
ATOM 387   C CA   . ASP A 1 25 ? 1.726   20.519 22.756 1.00 0.00 ? 25 ASP A CA   1  
ATOM 388   C C    . ASP A 1 25 ? 1.308   19.060 22.552 1.00 0.00 ? 25 ASP A C    1  
ATOM 389   O O    . ASP A 1 25 ? 0.862   18.399 23.467 1.00 0.00 ? 25 ASP A O    1  
ATOM 390   C CB   . ASP A 1 25 ? 1.646   20.900 24.234 1.00 0.00 ? 25 ASP A CB   1  
ATOM 391   C CG   . ASP A 1 25 ? 2.986   20.602 24.910 1.00 0.00 ? 25 ASP A CG   1  
ATOM 392   O OD1  . ASP A 1 25 ? 3.758   19.847 24.343 1.00 0.00 ? 25 ASP A OD1  1  
ATOM 393   O OD2  . ASP A 1 25 ? 3.217   21.135 25.983 1.00 0.00 ? 25 ASP A OD2  1  
ATOM 394   H H    . ASP A 1 25 ? -0.199  21.351 22.263 1.00 0.00 ? 25 ASP A H    1  
ATOM 395   H HA   . ASP A 1 25 ? 2.725   20.682 22.385 1.00 0.00 ? 25 ASP A HA   1  
ATOM 396   H HB2  . ASP A 1 25 ? 1.424   21.954 24.322 1.00 0.00 ? 25 ASP A HB2  1  
ATOM 397   H HB3  . ASP A 1 25 ? 0.867   20.326 24.712 1.00 0.00 ? 25 ASP A HB3  1  
ATOM 398   N N    . LYS A 1 26 ? 1.447   18.554 21.358 1.00 0.00 ? 26 LYS A N    1  
ATOM 399   C CA   . LYS A 1 26 ? 1.053   17.140 21.094 1.00 0.00 ? 26 LYS A CA   1  
ATOM 400   C C    . LYS A 1 26 ? 1.942   16.172 21.882 1.00 0.00 ? 26 LYS A C    1  
ATOM 401   O O    . LYS A 1 26 ? 1.703   14.981 21.905 1.00 0.00 ? 26 LYS A O    1  
ATOM 402   C CB   . LYS A 1 26 ? 1.250   16.948 19.590 1.00 0.00 ? 26 LYS A CB   1  
ATOM 403   C CG   . LYS A 1 26 ? -0.051  17.287 18.859 1.00 0.00 ? 26 LYS A CG   1  
ATOM 404   C CD   . LYS A 1 26 ? 0.142   17.082 17.356 1.00 0.00 ? 26 LYS A CD   1  
ATOM 405   C CE   . LYS A 1 26 ? -0.983  17.787 16.595 1.00 0.00 ? 26 LYS A CE   1  
ATOM 406   N NZ   . LYS A 1 26 ? -0.734  17.463 15.162 1.00 0.00 ? 26 LYS A NZ   1  
ATOM 407   H H    . LYS A 1 26 ? 1.806   19.105 20.632 1.00 0.00 ? 26 LYS A H    1  
ATOM 408   H HA   . LYS A 1 26 ? 0.016   16.987 21.348 1.00 0.00 ? 26 LYS A HA   1  
ATOM 409   H HB2  . LYS A 1 26 ? 2.038   17.601 19.245 1.00 0.00 ? 26 LYS A HB2  1  
ATOM 410   H HB3  . LYS A 1 26 ? 1.519   15.922 19.390 1.00 0.00 ? 26 LYS A HB3  1  
ATOM 411   H HG2  . LYS A 1 26 ? -0.841  16.642 19.212 1.00 0.00 ? 26 LYS A HG2  1  
ATOM 412   H HG3  . LYS A 1 26 ? -0.315  18.317 19.051 1.00 0.00 ? 26 LYS A HG3  1  
ATOM 413   H HD2  . LYS A 1 26 ? 1.094   17.495 17.055 1.00 0.00 ? 26 LYS A HD2  1  
ATOM 414   H HD3  . LYS A 1 26 ? 0.122   16.025 17.131 1.00 0.00 ? 26 LYS A HD3  1  
ATOM 415   H HE2  . LYS A 1 26 ? -1.944  17.404 16.906 1.00 0.00 ? 26 LYS A HE2  1  
ATOM 416   H HE3  . LYS A 1 26 ? -0.932  18.854 16.754 1.00 0.00 ? 26 LYS A HE3  1  
ATOM 417   H HZ1  . LYS A 1 26 ? -0.525  16.450 15.066 1.00 0.00 ? 26 LYS A HZ1  1  
ATOM 418   H HZ2  . LYS A 1 26 ? -1.579  17.694 14.603 1.00 0.00 ? 26 LYS A HZ2  1  
ATOM 419   H HZ3  . LYS A 1 26 ? 0.074   18.020 14.817 1.00 0.00 ? 26 LYS A HZ3  1  
ATOM 420   N N    . LYS A 1 27 ? 2.964   16.669 22.529 1.00 0.00 ? 27 LYS A N    1  
ATOM 421   C CA   . LYS A 1 27 ? 3.859   15.772 23.316 1.00 0.00 ? 27 LYS A CA   1  
ATOM 422   C C    . LYS A 1 27 ? 3.028   14.740 24.082 1.00 0.00 ? 27 LYS A C    1  
ATOM 423   O O    . LYS A 1 27 ? 3.484   13.652 24.372 1.00 0.00 ? 27 LYS A O    1  
ATOM 424   C CB   . LYS A 1 27 ? 4.594   16.699 24.283 1.00 0.00 ? 27 LYS A CB   1  
ATOM 425   C CG   . LYS A 1 27 ? 5.747   17.389 23.552 1.00 0.00 ? 27 LYS A CG   1  
ATOM 426   C CD   . LYS A 1 27 ? 6.404   18.410 24.483 1.00 0.00 ? 27 LYS A CD   1  
ATOM 427   C CE   . LYS A 1 27 ? 7.356   19.298 23.677 1.00 0.00 ? 27 LYS A CE   1  
ATOM 428   N NZ   . LYS A 1 27 ? 7.881   20.287 24.661 1.00 0.00 ? 27 LYS A NZ   1  
ATOM 429   H H    . LYS A 1 27 ? 3.142   17.631 22.501 1.00 0.00 ? 27 LYS A H    1  
ATOM 430   H HA   . LYS A 1 27 ? 4.566   15.279 22.668 1.00 0.00 ? 27 LYS A HA   1  
ATOM 431   H HB2  . LYS A 1 27 ? 3.908   17.444 24.659 1.00 0.00 ? 27 LYS A HB2  1  
ATOM 432   H HB3  . LYS A 1 27 ? 4.984   16.122 25.107 1.00 0.00 ? 27 LYS A HB3  1  
ATOM 433   H HG2  . LYS A 1 27 ? 6.477   16.652 23.254 1.00 0.00 ? 27 LYS A HG2  1  
ATOM 434   H HG3  . LYS A 1 27 ? 5.366   17.894 22.676 1.00 0.00 ? 27 LYS A HG3  1  
ATOM 435   H HD2  . LYS A 1 27 ? 5.642   19.023 24.941 1.00 0.00 ? 27 LYS A HD2  1  
ATOM 436   H HD3  . LYS A 1 27 ? 6.959   17.892 25.251 1.00 0.00 ? 27 LYS A HD3  1  
ATOM 437   H HE2  . LYS A 1 27 ? 8.163   18.708 23.269 1.00 0.00 ? 27 LYS A HE2  1  
ATOM 438   H HE3  . LYS A 1 27 ? 6.820   19.802 22.887 1.00 0.00 ? 27 LYS A HE3  1  
ATOM 439   H HZ1  . LYS A 1 27 ? 8.017   19.823 25.581 1.00 0.00 ? 27 LYS A HZ1  1  
ATOM 440   H HZ2  . LYS A 1 27 ? 8.791   20.660 24.325 1.00 0.00 ? 27 LYS A HZ2  1  
ATOM 441   H HZ3  . LYS A 1 27 ? 7.201   21.068 24.763 1.00 0.00 ? 27 LYS A HZ3  1  
ATOM 442   N N    . PHE A 1 28 ? 1.808   15.071 24.406 1.00 0.00 ? 28 PHE A N    1  
ATOM 443   C CA   . PHE A 1 28 ? 0.947   14.107 25.145 1.00 0.00 ? 28 PHE A CA   1  
ATOM 444   C C    . PHE A 1 28 ? 0.900   12.772 24.397 1.00 0.00 ? 28 PHE A C    1  
ATOM 445   O O    . PHE A 1 28 ? 0.569   11.745 24.956 1.00 0.00 ? 28 PHE A O    1  
ATOM 446   C CB   . PHE A 1 28 ? -0.436  14.758 25.175 1.00 0.00 ? 28 PHE A CB   1  
ATOM 447   C CG   . PHE A 1 28 ? -0.318  16.171 25.696 1.00 0.00 ? 28 PHE A CG   1  
ATOM 448   C CD1  . PHE A 1 28 ? 0.335   16.417 26.910 1.00 0.00 ? 28 PHE A CD1  1  
ATOM 449   C CD2  . PHE A 1 28 ? -0.863  17.234 24.968 1.00 0.00 ? 28 PHE A CD2  1  
ATOM 450   C CE1  . PHE A 1 28 ? 0.443   17.726 27.394 1.00 0.00 ? 28 PHE A CE1  1  
ATOM 451   C CE2  . PHE A 1 28 ? -0.756  18.543 25.451 1.00 0.00 ? 28 PHE A CE2  1  
ATOM 452   C CZ   . PHE A 1 28 ? -0.102  18.790 26.664 1.00 0.00 ? 28 PHE A CZ   1  
ATOM 453   H H    . PHE A 1 28 ? 1.456   15.952 24.159 1.00 0.00 ? 28 PHE A H    1  
ATOM 454   H HA   . PHE A 1 28 ? 1.312   13.966 26.150 1.00 0.00 ? 28 PHE A HA   1  
ATOM 455   H HB2  . PHE A 1 28 ? -0.846  14.776 24.176 1.00 0.00 ? 28 PHE A HB2  1  
ATOM 456   H HB3  . PHE A 1 28 ? -1.088  14.189 25.820 1.00 0.00 ? 28 PHE A HB3  1  
ATOM 457   H HD1  . PHE A 1 28 ? 0.756   15.596 27.473 1.00 0.00 ? 28 PHE A HD1  1  
ATOM 458   H HD2  . PHE A 1 28 ? -1.365  17.046 24.031 1.00 0.00 ? 28 PHE A HD2  1  
ATOM 459   H HE1  . PHE A 1 28 ? 0.948   17.916 28.329 1.00 0.00 ? 28 PHE A HE1  1  
ATOM 460   H HE2  . PHE A 1 28 ? -1.176  19.363 24.888 1.00 0.00 ? 28 PHE A HE2  1  
ATOM 461   H HZ   . PHE A 1 28 ? -0.019  19.800 27.036 1.00 0.00 ? 28 PHE A HZ   1  
ATOM 462   N N    . PHE A 1 29 ? 1.234   12.781 23.134 1.00 0.00 ? 29 PHE A N    1  
ATOM 463   C CA   . PHE A 1 29 ? 1.215   11.515 22.345 1.00 0.00 ? 29 PHE A CA   1  
ATOM 464   C C    . PHE A 1 29 ? 1.911   10.399 23.126 1.00 0.00 ? 29 PHE A C    1  
ATOM 465   O O    . PHE A 1 29 ? 1.660   9.229  22.916 1.00 0.00 ? 29 PHE A O    1  
ATOM 466   C CB   . PHE A 1 29 ? 1.992   11.837 21.068 1.00 0.00 ? 29 PHE A CB   1  
ATOM 467   C CG   . PHE A 1 29 ? 1.901   10.671 20.114 1.00 0.00 ? 29 PHE A CG   1  
ATOM 468   C CD1  . PHE A 1 29 ? 2.643   9.509  20.357 1.00 0.00 ? 29 PHE A CD1  1  
ATOM 469   C CD2  . PHE A 1 29 ? 1.077   10.752 18.986 1.00 0.00 ? 29 PHE A CD2  1  
ATOM 470   C CE1  . PHE A 1 29 ? 2.559   8.427  19.472 1.00 0.00 ? 29 PHE A CE1  1  
ATOM 471   C CE2  . PHE A 1 29 ? 0.993   9.671  18.100 1.00 0.00 ? 29 PHE A CE2  1  
ATOM 472   C CZ   . PHE A 1 29 ? 1.735   8.508  18.343 1.00 0.00 ? 29 PHE A CZ   1  
ATOM 473   H H    . PHE A 1 29 ? 1.500   13.620 22.705 1.00 0.00 ? 29 PHE A H    1  
ATOM 474   H HA   . PHE A 1 29 ? 0.203   11.235 22.102 1.00 0.00 ? 29 PHE A HA   1  
ATOM 475   H HB2  . PHE A 1 29 ? 1.573   12.716 20.603 1.00 0.00 ? 29 PHE A HB2  1  
ATOM 476   H HB3  . PHE A 1 29 ? 3.028   12.020 21.314 1.00 0.00 ? 29 PHE A HB3  1  
ATOM 477   H HD1  . PHE A 1 29 ? 3.279   9.446  21.228 1.00 0.00 ? 29 PHE A HD1  1  
ATOM 478   H HD2  . PHE A 1 29 ? 0.504   11.649 18.798 1.00 0.00 ? 29 PHE A HD2  1  
ATOM 479   H HE1  . PHE A 1 29 ? 3.131   7.531  19.660 1.00 0.00 ? 29 PHE A HE1  1  
ATOM 480   H HE2  . PHE A 1 29 ? 0.357   9.733  17.230 1.00 0.00 ? 29 PHE A HE2  1  
ATOM 481   H HZ   . PHE A 1 29 ? 1.671   7.674  17.660 1.00 0.00 ? 29 PHE A HZ   1  
ATOM 482   N N    . GLN A 1 30 ? 2.787   10.755 24.024 1.00 0.00 ? 30 GLN A N    1  
ATOM 483   C CA   . GLN A 1 30 ? 3.507   9.722  24.820 1.00 0.00 ? 30 GLN A CA   1  
ATOM 484   C C    . GLN A 1 30 ? 2.543   9.017  25.779 1.00 0.00 ? 30 GLN A C    1  
ATOM 485   O O    . GLN A 1 30 ? 2.906   8.076  26.457 1.00 0.00 ? 30 GLN A O    1  
ATOM 486   C CB   . GLN A 1 30 ? 4.566   10.502 25.597 1.00 0.00 ? 30 GLN A CB   1  
ATOM 487   C CG   . GLN A 1 30 ? 5.639   11.001 24.629 1.00 0.00 ? 30 GLN A CG   1  
ATOM 488   C CD   . GLN A 1 30 ? 7.005   10.464 25.058 1.00 0.00 ? 30 GLN A CD   1  
ATOM 489   O OE1  . GLN A 1 30 ? 7.397   10.610 26.199 1.00 0.00 ? 30 GLN A OE1  1  
ATOM 490   N NE2  . GLN A 1 30 ? 7.752   9.844  24.186 1.00 0.00 ? 30 GLN A NE2  1  
ATOM 491   H H    . GLN A 1 30 ? 2.975   11.705 24.173 1.00 0.00 ? 30 GLN A H    1  
ATOM 492   H HA   . GLN A 1 30 ? 3.982   9.007  24.168 1.00 0.00 ? 30 GLN A HA   1  
ATOM 493   H HB2  . GLN A 1 30 ? 4.105   11.348 26.086 1.00 0.00 ? 30 GLN A HB2  1  
ATOM 494   H HB3  . GLN A 1 30 ? 5.018   9.859  26.338 1.00 0.00 ? 30 GLN A HB3  1  
ATOM 495   H HG2  . GLN A 1 30 ? 5.413   10.652 23.632 1.00 0.00 ? 30 GLN A HG2  1  
ATOM 496   H HG3  . GLN A 1 30 ? 5.657   12.080 24.637 1.00 0.00 ? 30 GLN A HG3  1  
ATOM 497   H HE21 . GLN A 1 30 ? 7.436   9.727  23.266 1.00 0.00 ? 30 GLN A HE21 1  
ATOM 498   H HE22 . GLN A 1 30 ? 8.628   9.497  24.451 1.00 0.00 ? 30 GLN A HE22 1  
ATOM 499   N N    . SER A 1 31 ? 1.317   9.461  25.842 1.00 0.00 ? 31 SER A N    1  
ATOM 500   C CA   . SER A 1 31 ? 0.335   8.810  26.759 1.00 0.00 ? 31 SER A CA   1  
ATOM 501   C C    . SER A 1 31 ? -0.957  8.483  26.005 1.00 0.00 ? 31 SER A C    1  
ATOM 502   O O    . SER A 1 31 ? -1.196  8.976  24.921 1.00 0.00 ? 31 SER A O    1  
ATOM 503   C CB   . SER A 1 31 ? 0.070   9.844  27.853 1.00 0.00 ? 31 SER A CB   1  
ATOM 504   O OG   . SER A 1 31 ? 1.269   10.089 28.574 1.00 0.00 ? 31 SER A OG   1  
ATOM 505   H H    . SER A 1 31 ? 1.041   10.221 25.288 1.00 0.00 ? 31 SER A H    1  
ATOM 506   H HA   . SER A 1 31 ? 0.758   7.917  27.190 1.00 0.00 ? 31 SER A HA   1  
ATOM 507   H HB2  . SER A 1 31 ? -0.275  10.764 27.404 1.00 0.00 ? 31 SER A HB2  1  
ATOM 508   H HB3  . SER A 1 31 ? -0.684  9.468  28.528 1.00 0.00 ? 31 SER A HB3  1  
ATOM 509   H HG   . SER A 1 31 ? 1.422   9.343  29.157 1.00 0.00 ? 31 SER A HG   1  
ATOM 510   N N    . LEU A 1 32 ? -1.793  7.655  26.572 1.00 0.00 ? 32 LEU A N    1  
ATOM 511   C CA   . LEU A 1 32 ? -3.069  7.300  25.885 1.00 0.00 ? 32 LEU A CA   1  
ATOM 512   C C    . LEU A 1 32 ? -3.958  8.536  25.754 1.00 0.00 ? 32 LEU A C    1  
ATOM 513   O O    . LEU A 1 32 ? -4.441  8.856  24.687 1.00 0.00 ? 32 LEU A O    1  
ATOM 514   C CB   . LEU A 1 32 ? -3.732  6.259  26.784 1.00 0.00 ? 32 LEU A CB   1  
ATOM 515   C CG   . LEU A 1 32 ? -4.674  5.390  25.948 1.00 0.00 ? 32 LEU A CG   1  
ATOM 516   C CD1  . LEU A 1 32 ? -5.033  4.125  26.730 1.00 0.00 ? 32 LEU A CD1  1  
ATOM 517   C CD2  . LEU A 1 32 ? -5.950  6.176  25.637 1.00 0.00 ? 32 LEU A CD2  1  
ATOM 518   H H    . LEU A 1 32 ? -1.584  7.269  27.447 1.00 0.00 ? 32 LEU A H    1  
ATOM 519   H HA   . LEU A 1 32 ? -2.870  6.878  24.917 1.00 0.00 ? 32 LEU A HA   1  
ATOM 520   H HB2  . LEU A 1 32 ? -2.974  5.637  27.236 1.00 0.00 ? 32 LEU A HB2  1  
ATOM 521   H HB3  . LEU A 1 32 ? -4.296  6.760  27.557 1.00 0.00 ? 32 LEU A HB3  1  
ATOM 522   H HG   . LEU A 1 32 ? -4.186  5.117  25.025 1.00 0.00 ? 32 LEU A HG   1  
ATOM 523   H HD11 . LEU A 1 32 ? -5.029  4.343  27.788 1.00 0.00 ? 32 LEU A HD11 1  
ATOM 524   H HD12 . LEU A 1 32 ? -6.015  3.786  26.436 1.00 0.00 ? 32 LEU A HD12 1  
ATOM 525   H HD13 . LEU A 1 32 ? -4.307  3.354  26.519 1.00 0.00 ? 32 LEU A HD13 1  
ATOM 526   H HD21 . LEU A 1 32 ? -6.092  6.941  26.386 1.00 0.00 ? 32 LEU A HD21 1  
ATOM 527   H HD22 . LEU A 1 32 ? -5.860  6.637  24.664 1.00 0.00 ? 32 LEU A HD22 1  
ATOM 528   H HD23 . LEU A 1 32 ? -6.796  5.506  25.641 1.00 0.00 ? 32 LEU A HD23 1  
ATOM 529   N N    . ASP A 1 33 ? -4.170  9.236  26.831 1.00 0.00 ? 33 ASP A N    1  
ATOM 530   C CA   . ASP A 1 33 ? -5.020  10.456 26.766 1.00 0.00 ? 33 ASP A CA   1  
ATOM 531   C C    . ASP A 1 33 ? -4.463  11.397 25.702 1.00 0.00 ? 33 ASP A C    1  
ATOM 532   O O    . ASP A 1 33 ? -5.195  12.007 24.948 1.00 0.00 ? 33 ASP A O    1  
ATOM 533   C CB   . ASP A 1 33 ? -4.926  11.089 28.154 1.00 0.00 ? 33 ASP A CB   1  
ATOM 534   C CG   . ASP A 1 33 ? -5.533  10.139 29.189 1.00 0.00 ? 33 ASP A CG   1  
ATOM 535   O OD1  . ASP A 1 33 ? -6.196  9.199  28.783 1.00 0.00 ? 33 ASP A OD1  1  
ATOM 536   O OD2  . ASP A 1 33 ? -5.324  10.368 30.369 1.00 0.00 ? 33 ASP A OD2  1  
ATOM 537   H H    . ASP A 1 33 ? -3.763  8.964  27.678 1.00 0.00 ? 33 ASP A H    1  
ATOM 538   H HA   . ASP A 1 33 ? -6.042  10.194 26.542 1.00 0.00 ? 33 ASP A HA   1  
ATOM 539   H HB2  . ASP A 1 33 ? -3.889  11.271 28.397 1.00 0.00 ? 33 ASP A HB2  1  
ATOM 540   H HB3  . ASP A 1 33 ? -5.467  12.023 28.162 1.00 0.00 ? 33 ASP A HB3  1  
ATOM 541   N N    . GLY A 1 34 ? -3.166  11.501 25.625 1.00 0.00 ? 34 GLY A N    1  
ATOM 542   C CA   . GLY A 1 34 ? -2.554  12.382 24.596 1.00 0.00 ? 34 GLY A CA   1  
ATOM 543   C C    . GLY A 1 34 ? -2.798  11.757 23.226 1.00 0.00 ? 34 GLY A C    1  
ATOM 544   O O    . GLY A 1 34 ? -3.253  12.403 22.304 1.00 0.00 ? 34 GLY A O    1  
ATOM 545   H H    . GLY A 1 34 ? -2.596  10.986 26.235 1.00 0.00 ? 34 GLY A H    1  
ATOM 546   H HA2  . GLY A 1 34 ? -3.011  13.357 24.635 1.00 0.00 ? 34 GLY A HA2  1  
ATOM 547   H HA3  . GLY A 1 34 ? -1.494  12.468 24.774 1.00 0.00 ? 34 GLY A HA3  1  
ATOM 548   N N    . ILE A 1 35 ? -2.516  10.494 23.092 1.00 0.00 ? 35 ILE A N    1  
ATOM 549   C CA   . ILE A 1 35 ? -2.750  9.819  21.787 1.00 0.00 ? 35 ILE A CA   1  
ATOM 550   C C    . ILE A 1 35 ? -4.208  10.022 21.375 1.00 0.00 ? 35 ILE A C    1  
ATOM 551   O O    . ILE A 1 35 ? -4.521  10.175 20.212 1.00 0.00 ? 35 ILE A O    1  
ATOM 552   C CB   . ILE A 1 35 ? -2.445  8.338  22.043 1.00 0.00 ? 35 ILE A CB   1  
ATOM 553   C CG1  . ILE A 1 35 ? -0.943  8.101  21.888 1.00 0.00 ? 35 ILE A CG1  1  
ATOM 554   C CG2  . ILE A 1 35 ? -3.198  7.464  21.036 1.00 0.00 ? 35 ILE A CG2  1  
ATOM 555   C CD1  . ILE A 1 35 ? -0.540  8.351  20.434 1.00 0.00 ? 35 ILE A CD1  1  
ATOM 556   H H    . ILE A 1 35 ? -2.164  9.988  23.853 1.00 0.00 ? 35 ILE A H    1  
ATOM 557   H HA   . ILE A 1 35 ? -2.087  10.212 21.036 1.00 0.00 ? 35 ILE A HA   1  
ATOM 558   H HB   . ILE A 1 35 ? -2.749  8.076  23.046 1.00 0.00 ? 35 ILE A HB   1  
ATOM 559   H HG12 . ILE A 1 35 ? -0.402  8.777  22.534 1.00 0.00 ? 35 ILE A HG12 1  
ATOM 560   H HG13 . ILE A 1 35 ? -0.709  7.081  22.157 1.00 0.00 ? 35 ILE A HG13 1  
ATOM 561   H HG21 . ILE A 1 35 ? -4.258  7.658  21.113 1.00 0.00 ? 35 ILE A HG21 1  
ATOM 562   H HG22 . ILE A 1 35 ? -2.862  7.695  20.036 1.00 0.00 ? 35 ILE A HG22 1  
ATOM 563   H HG23 . ILE A 1 35 ? -3.006  6.423  21.248 1.00 0.00 ? 35 ILE A HG23 1  
ATOM 564   H HD11 . ILE A 1 35 ? -1.318  8.911  19.936 1.00 0.00 ? 35 ILE A HD11 1  
ATOM 565   H HD12 . ILE A 1 35 ? 0.381   8.913  20.407 1.00 0.00 ? 35 ILE A HD12 1  
ATOM 566   H HD13 . ILE A 1 35 ? -0.399  7.406  19.931 1.00 0.00 ? 35 ILE A HD13 1  
ATOM 567   N N    . MET A 1 36 ? -5.099  10.034 22.326 1.00 0.00 ? 36 MET A N    1  
ATOM 568   C CA   . MET A 1 36 ? -6.537  10.237 21.991 1.00 0.00 ? 36 MET A CA   1  
ATOM 569   C C    . MET A 1 36 ? -6.787  11.700 21.625 1.00 0.00 ? 36 MET A C    1  
ATOM 570   O O    . MET A 1 36 ? -7.127  12.017 20.503 1.00 0.00 ? 36 MET A O    1  
ATOM 571   C CB   . MET A 1 36 ? -7.304  9.875  23.258 1.00 0.00 ? 36 MET A CB   1  
ATOM 572   C CG   . MET A 1 36 ? -7.692  8.395  23.217 1.00 0.00 ? 36 MET A CG   1  
ATOM 573   S SD   . MET A 1 36 ? -8.755  8.088  21.784 1.00 0.00 ? 36 MET A SD   1  
ATOM 574   C CE   . MET A 1 36 ? -10.336 8.417  22.600 1.00 0.00 ? 36 MET A CE   1  
ATOM 575   H H    . MET A 1 36 ? -4.822  9.914  23.261 1.00 0.00 ? 36 MET A H    1  
ATOM 576   H HA   . MET A 1 36 ? -6.832  9.588  21.182 1.00 0.00 ? 36 MET A HA   1  
ATOM 577   H HB2  . MET A 1 36 ? -6.684  10.062 24.122 1.00 0.00 ? 36 MET A HB2  1  
ATOM 578   H HB3  . MET A 1 36 ? -8.195  10.481 23.315 1.00 0.00 ? 36 MET A HB3  1  
ATOM 579   H HG2  . MET A 1 36 ? -6.800  7.791  23.140 1.00 0.00 ? 36 MET A HG2  1  
ATOM 580   H HG3  . MET A 1 36 ? -8.224  8.137  24.121 1.00 0.00 ? 36 MET A HG3  1  
ATOM 581   H HE1  . MET A 1 36 ? -10.215 8.320  23.670 1.00 0.00 ? 36 MET A HE1  1  
ATOM 582   H HE2  . MET A 1 36 ? -10.664 9.418  22.357 1.00 0.00 ? 36 MET A HE2  1  
ATOM 583   H HE3  . MET A 1 36 ? -11.073 7.708  22.258 1.00 0.00 ? 36 MET A HE3  1  
ATOM 584   N N    . PHE A 1 37 ? -6.620  12.598 22.559 1.00 0.00 ? 37 PHE A N    1  
ATOM 585   C CA   . PHE A 1 37 ? -6.849  14.033 22.241 1.00 0.00 ? 37 PHE A CA   1  
ATOM 586   C C    . PHE A 1 37 ? -6.156  14.363 20.911 1.00 0.00 ? 37 PHE A C    1  
ATOM 587   O O    . PHE A 1 37 ? -6.758  14.909 20.007 1.00 0.00 ? 37 PHE A O    1  
ATOM 588   C CB   . PHE A 1 37 ? -6.261  14.810 23.440 1.00 0.00 ? 37 PHE A CB   1  
ATOM 589   C CG   . PHE A 1 37 ? -5.178  15.769 22.998 1.00 0.00 ? 37 PHE A CG   1  
ATOM 590   C CD1  . PHE A 1 37 ? -3.859  15.323 22.870 1.00 0.00 ? 37 PHE A CD1  1  
ATOM 591   C CD2  . PHE A 1 37 ? -5.498  17.099 22.709 1.00 0.00 ? 37 PHE A CD2  1  
ATOM 592   C CE1  . PHE A 1 37 ? -2.860  16.206 22.452 1.00 0.00 ? 37 PHE A CE1  1  
ATOM 593   C CE2  . PHE A 1 37 ? -4.498  17.982 22.287 1.00 0.00 ? 37 PHE A CE2  1  
ATOM 594   C CZ   . PHE A 1 37 ? -3.179  17.534 22.159 1.00 0.00 ? 37 PHE A CZ   1  
ATOM 595   H H    . PHE A 1 37 ? -6.342  12.329 23.460 1.00 0.00 ? 37 PHE A H    1  
ATOM 596   H HA   . PHE A 1 37 ? -7.908  14.228 22.162 1.00 0.00 ? 37 PHE A HA   1  
ATOM 597   H HB2  . PHE A 1 37 ? -7.053  15.369 23.919 1.00 0.00 ? 37 PHE A HB2  1  
ATOM 598   H HB3  . PHE A 1 37 ? -5.846  14.107 24.148 1.00 0.00 ? 37 PHE A HB3  1  
ATOM 599   H HD1  . PHE A 1 37 ? -3.613  14.298 23.098 1.00 0.00 ? 37 PHE A HD1  1  
ATOM 600   H HD2  . PHE A 1 37 ? -6.516  17.443 22.811 1.00 0.00 ? 37 PHE A HD2  1  
ATOM 601   H HE1  . PHE A 1 37 ? -1.841  15.860 22.353 1.00 0.00 ? 37 PHE A HE1  1  
ATOM 602   H HE2  . PHE A 1 37 ? -4.744  19.010 22.063 1.00 0.00 ? 37 PHE A HE2  1  
ATOM 603   H HZ   . PHE A 1 37 ? -2.408  18.210 21.832 1.00 0.00 ? 37 PHE A HZ   1  
ATOM 604   N N    . ILE A 1 38 ? -4.904  14.015 20.775 1.00 0.00 ? 38 ILE A N    1  
ATOM 605   C CA   . ILE A 1 38 ? -4.195  14.291 19.496 1.00 0.00 ? 38 ILE A CA   1  
ATOM 606   C C    . ILE A 1 38 ? -5.021  13.752 18.329 1.00 0.00 ? 38 ILE A C    1  
ATOM 607   O O    . ILE A 1 38 ? -5.126  14.372 17.289 1.00 0.00 ? 38 ILE A O    1  
ATOM 608   C CB   . ILE A 1 38 ? -2.863  13.547 19.602 1.00 0.00 ? 38 ILE A CB   1  
ATOM 609   C CG1  . ILE A 1 38 ? -1.946  14.281 20.583 1.00 0.00 ? 38 ILE A CG1  1  
ATOM 610   C CG2  . ILE A 1 38 ? -2.201  13.493 18.224 1.00 0.00 ? 38 ILE A CG2  1  
ATOM 611   C CD1  . ILE A 1 38 ? -0.519  13.746 20.451 1.00 0.00 ? 38 ILE A CD1  1  
ATOM 612   H H    . ILE A 1 38 ? -4.437  13.560 21.506 1.00 0.00 ? 38 ILE A H    1  
ATOM 613   H HA   . ILE A 1 38 ? -4.022  15.347 19.380 1.00 0.00 ? 38 ILE A HA   1  
ATOM 614   H HB   . ILE A 1 38 ? -3.040  12.542 19.957 1.00 0.00 ? 38 ILE A HB   1  
ATOM 615   H HG12 . ILE A 1 38 ? -1.956  15.338 20.363 1.00 0.00 ? 38 ILE A HG12 1  
ATOM 616   H HG13 . ILE A 1 38 ? -2.296  14.121 21.591 1.00 0.00 ? 38 ILE A HG13 1  
ATOM 617   H HG21 . ILE A 1 38 ? -2.899  13.090 17.505 1.00 0.00 ? 38 ILE A HG21 1  
ATOM 618   H HG22 . ILE A 1 38 ? -1.911  14.489 17.925 1.00 0.00 ? 38 ILE A HG22 1  
ATOM 619   H HG23 . ILE A 1 38 ? -1.326  12.861 18.269 1.00 0.00 ? 38 ILE A HG23 1  
ATOM 620   H HD11 . ILE A 1 38 ? -0.520  12.871 19.817 1.00 0.00 ? 38 ILE A HD11 1  
ATOM 621   H HD12 . ILE A 1 38 ? 0.112   14.506 20.015 1.00 0.00 ? 38 ILE A HD12 1  
ATOM 622   H HD13 . ILE A 1 38 ? -0.142  13.481 21.428 1.00 0.00 ? 38 ILE A HD13 1  
ATOM 623   N N    . ASN A 1 39 ? -5.621  12.606 18.499 1.00 0.00 ? 39 ASN A N    1  
ATOM 624   C CA   . ASN A 1 39 ? -6.455  12.036 17.403 1.00 0.00 ? 39 ASN A CA   1  
ATOM 625   C C    . ASN A 1 39 ? -7.686  12.917 17.197 1.00 0.00 ? 39 ASN A C    1  
ATOM 626   O O    . ASN A 1 39 ? -8.146  13.118 16.090 1.00 0.00 ? 39 ASN A O    1  
ATOM 627   C CB   . ASN A 1 39 ? -6.862  10.643 17.884 1.00 0.00 ? 39 ASN A CB   1  
ATOM 628   C CG   . ASN A 1 39 ? -5.635  9.730  17.910 1.00 0.00 ? 39 ASN A CG   1  
ATOM 629   O OD1  . ASN A 1 39 ? -4.659  9.985  17.232 1.00 0.00 ? 39 ASN A OD1  1  
ATOM 630   N ND2  . ASN A 1 39 ? -5.643  8.670  18.670 1.00 0.00 ? 39 ASN A ND2  1  
ATOM 631   H H    . ASN A 1 39 ? -5.532  12.127 19.351 1.00 0.00 ? 39 ASN A H    1  
ATOM 632   H HA   . ASN A 1 39 ? -5.884  11.964 16.492 1.00 0.00 ? 39 ASN A HA   1  
ATOM 633   H HB2  . ASN A 1 39 ? -7.279  10.712 18.877 1.00 0.00 ? 39 ASN A HB2  1  
ATOM 634   H HB3  . ASN A 1 39 ? -7.601  10.233 17.212 1.00 0.00 ? 39 ASN A HB3  1  
ATOM 635   H HD21 . ASN A 1 39 ? -6.430  8.466  19.216 1.00 0.00 ? 39 ASN A HD21 1  
ATOM 636   H HD22 . ASN A 1 39 ? -4.863  8.078  18.694 1.00 0.00 ? 39 ASN A HD22 1  
ATOM 637   N N    . LYS A 1 40 ? -8.212  13.455 18.262 1.00 0.00 ? 40 LYS A N    1  
ATOM 638   C CA   . LYS A 1 40 ? -9.404  14.340 18.145 1.00 0.00 ? 40 LYS A CA   1  
ATOM 639   C C    . LYS A 1 40 ? -8.952  15.759 17.796 1.00 0.00 ? 40 LYS A C    1  
ATOM 640   O O    . LYS A 1 40 ? -9.736  16.592 17.390 1.00 0.00 ? 40 LYS A O    1  
ATOM 641   C CB   . LYS A 1 40 ? -10.062 14.307 19.525 1.00 0.00 ? 40 LYS A CB   1  
ATOM 642   C CG   . LYS A 1 40 ? -11.535 14.701 19.398 1.00 0.00 ? 40 LYS A CG   1  
ATOM 643   C CD   . LYS A 1 40 ? -12.127 14.916 20.793 1.00 0.00 ? 40 LYS A CD   1  
ATOM 644   C CE   . LYS A 1 40 ? -13.074 16.118 20.766 1.00 0.00 ? 40 LYS A CE   1  
ATOM 645   N NZ   . LYS A 1 40 ? -13.874 16.001 22.018 1.00 0.00 ? 40 LYS A NZ   1  
ATOM 646   H H    . LYS A 1 40 ? -7.814  13.284 19.139 1.00 0.00 ? 40 LYS A H    1  
ATOM 647   H HA   . LYS A 1 40 ? -10.085 13.963 17.398 1.00 0.00 ? 40 LYS A HA   1  
ATOM 648   H HB2  . LYS A 1 40 ? -9.991  13.310 19.933 1.00 0.00 ? 40 LYS A HB2  1  
ATOM 649   H HB3  . LYS A 1 40 ? -9.559  15.001 20.181 1.00 0.00 ? 40 LYS A HB3  1  
ATOM 650   H HG2  . LYS A 1 40 ? -11.616 15.616 18.829 1.00 0.00 ? 40 LYS A HG2  1  
ATOM 651   H HG3  . LYS A 1 40 ? -12.077 13.915 18.895 1.00 0.00 ? 40 LYS A HG3  1  
ATOM 652   H HD2  . LYS A 1 40 ? -12.674 14.034 21.092 1.00 0.00 ? 40 LYS A HD2  1  
ATOM 653   H HD3  . LYS A 1 40 ? -11.330 15.101 21.498 1.00 0.00 ? 40 LYS A HD3  1  
ATOM 654   H HE2  . LYS A 1 40 ? -12.511 17.039 20.765 1.00 0.00 ? 40 LYS A HE2  1  
ATOM 655   H HE3  . LYS A 1 40 ? -13.719 16.069 19.901 1.00 0.00 ? 40 LYS A HE3  1  
ATOM 656   H HZ1  . LYS A 1 40 ? -14.117 15.004 22.183 1.00 0.00 ? 40 LYS A HZ1  1  
ATOM 657   H HZ2  . LYS A 1 40 ? -13.318 16.357 22.820 1.00 0.00 ? 40 LYS A HZ2  1  
ATOM 658   H HZ3  . LYS A 1 40 ? -14.747 16.560 21.924 1.00 0.00 ? 40 LYS A HZ3  1  
ATOM 659   N N    . CYS A 1 41 ? -7.684  16.034 17.948 1.00 0.00 ? 41 CYS A N    1  
ATOM 660   C CA   . CYS A 1 41 ? -7.165  17.392 17.621 1.00 0.00 ? 41 CYS A CA   1  
ATOM 661   C C    . CYS A 1 41 ? -7.310  17.650 16.123 1.00 0.00 ? 41 CYS A C    1  
ATOM 662   O O    . CYS A 1 41 ? -8.135  18.430 15.689 1.00 0.00 ? 41 CYS A O    1  
ATOM 663   C CB   . CYS A 1 41 ? -5.687  17.350 18.010 1.00 0.00 ? 41 CYS A CB   1  
ATOM 664   S SG   . CYS A 1 41 ? -4.830  18.787 17.317 1.00 0.00 ? 41 CYS A SG   1  
ATOM 665   H H    . CYS A 1 41 ? -7.071  15.342 18.273 1.00 0.00 ? 41 CYS A H    1  
ATOM 666   H HA   . CYS A 1 41 ? -7.681  18.147 18.192 1.00 0.00 ? 41 CYS A HA   1  
ATOM 667   H HB2  . CYS A 1 41 ? -5.597  17.362 19.083 1.00 0.00 ? 41 CYS A HB2  1  
ATOM 668   H HB3  . CYS A 1 41 ? -5.241  16.446 17.623 1.00 0.00 ? 41 CYS A HB3  1  
ATOM 669   N N    . ALA A 1 42 ? -6.511  16.993 15.331 1.00 0.00 ? 42 ALA A N    1  
ATOM 670   C CA   . ALA A 1 42 ? -6.596  17.188 13.856 1.00 0.00 ? 42 ALA A CA   1  
ATOM 671   C C    . ALA A 1 42 ? -8.053  17.089 13.403 1.00 0.00 ? 42 ALA A C    1  
ATOM 672   O O    . ALA A 1 42 ? -8.460  17.716 12.445 1.00 0.00 ? 42 ALA A O    1  
ATOM 673   C CB   . ALA A 1 42 ? -5.767  16.053 13.256 1.00 0.00 ? 42 ALA A CB   1  
ATOM 674   H H    . ALA A 1 42 ? -5.856  16.367 15.708 1.00 0.00 ? 42 ALA A H    1  
ATOM 675   H HA   . ALA A 1 42 ? -6.178  18.141 13.577 1.00 0.00 ? 42 ALA A HA   1  
ATOM 676   H HB1  . ALA A 1 42 ? -4.940  15.825 13.912 1.00 0.00 ? 42 ALA A HB1  1  
ATOM 677   H HB2  . ALA A 1 42 ? -5.388  16.356 12.291 1.00 0.00 ? 42 ALA A HB2  1  
ATOM 678   H HB3  . ALA A 1 42 ? -6.387  15.177 13.140 1.00 0.00 ? 42 ALA A HB3  1  
ATOM 679   N N    . THR A 1 43 ? -8.844  16.312 14.090 1.00 0.00 ? 43 THR A N    1  
ATOM 680   C CA   . THR A 1 43 ? -10.276 16.179 13.703 1.00 0.00 ? 43 THR A CA   1  
ATOM 681   C C    . THR A 1 43 ? -11.065 17.379 14.230 1.00 0.00 ? 43 THR A C    1  
ATOM 682   O O    . THR A 1 43 ? -11.746 18.060 13.492 1.00 0.00 ? 43 THR A O    1  
ATOM 683   C CB   . THR A 1 43 ? -10.749 14.887 14.371 1.00 0.00 ? 43 THR A CB   1  
ATOM 684   O OG1  . THR A 1 43 ? -10.004 13.791 13.857 1.00 0.00 ? 43 THR A OG1  1  
ATOM 685   C CG2  . THR A 1 43 ? -12.236 14.677 14.083 1.00 0.00 ? 43 THR A CG2  1  
ATOM 686   H H    . THR A 1 43 ? -8.497  15.819 14.864 1.00 0.00 ? 43 THR A H    1  
ATOM 687   H HA   . THR A 1 43 ? -10.374 16.101 12.632 1.00 0.00 ? 43 THR A HA   1  
ATOM 688   H HB   . THR A 1 43 ? -10.599 14.956 15.437 1.00 0.00 ? 43 THR A HB   1  
ATOM 689   H HG1  . THR A 1 43 ? -10.395 12.982 14.195 1.00 0.00 ? 43 THR A HG1  1  
ATOM 690   H HG21 . THR A 1 43 ? -12.774 15.591 14.285 1.00 0.00 ? 43 THR A HG21 1  
ATOM 691   H HG22 . THR A 1 43 ? -12.367 14.404 13.046 1.00 0.00 ? 43 THR A HG22 1  
ATOM 692   H HG23 . THR A 1 43 ? -12.617 13.888 14.714 1.00 0.00 ? 43 THR A HG23 1  
ATOM 693   N N    . CYS A 1 44 ? -10.970 17.647 15.503 1.00 0.00 ? 44 CYS A N    1  
ATOM 694   C CA   . CYS A 1 44 ? -11.708 18.807 16.078 1.00 0.00 ? 44 CYS A CA   1  
ATOM 695   C C    . CYS A 1 44 ? -11.399 20.071 15.273 1.00 0.00 ? 44 CYS A C    1  
ATOM 696   O O    . CYS A 1 44 ? -12.185 20.996 15.222 1.00 0.00 ? 44 CYS A O    1  
ATOM 697   C CB   . CYS A 1 44 ? -11.187 18.940 17.509 1.00 0.00 ? 44 CYS A CB   1  
ATOM 698   S SG   . CYS A 1 44 ? -11.762 20.502 18.220 1.00 0.00 ? 44 CYS A SG   1  
ATOM 699   H H    . CYS A 1 44 ? -10.410 17.089 16.078 1.00 0.00 ? 44 CYS A H    1  
ATOM 700   H HA   . CYS A 1 44 ? -12.768 18.614 16.087 1.00 0.00 ? 44 CYS A HA   1  
ATOM 701   H HB2  . CYS A 1 44 ? -11.554 18.116 18.104 1.00 0.00 ? 44 CYS A HB2  1  
ATOM 702   H HB3  . CYS A 1 44 ? -10.107 18.924 17.502 1.00 0.00 ? 44 CYS A HB3  1  
ATOM 703   N N    . LYS A 1 45 ? -10.258 20.114 14.640 1.00 0.00 ? 45 LYS A N    1  
ATOM 704   C CA   . LYS A 1 45 ? -9.898  21.314 13.834 1.00 0.00 ? 45 LYS A CA   1  
ATOM 705   C C    . LYS A 1 45 ? -10.817 21.423 12.616 1.00 0.00 ? 45 LYS A C    1  
ATOM 706   O O    . LYS A 1 45 ? -11.367 22.469 12.334 1.00 0.00 ? 45 LYS A O    1  
ATOM 707   C CB   . LYS A 1 45 ? -8.453  21.078 13.396 1.00 0.00 ? 45 LYS A CB   1  
ATOM 708   C CG   . LYS A 1 45 ? -8.028  22.186 12.430 1.00 0.00 ? 45 LYS A CG   1  
ATOM 709   C CD   . LYS A 1 45 ? -7.037  21.622 11.411 1.00 0.00 ? 45 LYS A CD   1  
ATOM 710   C CE   . LYS A 1 45 ? -6.257  22.771 10.769 1.00 0.00 ? 45 LYS A CE   1  
ATOM 711   N NZ   . LYS A 1 45 ? -5.389  22.119 9.748  1.00 0.00 ? 45 LYS A NZ   1  
ATOM 712   H H    . LYS A 1 45 ? -9.640  19.355 14.692 1.00 0.00 ? 45 LYS A H    1  
ATOM 713   H HA   . LYS A 1 45 ? -9.960  22.206 14.437 1.00 0.00 ? 45 LYS A HA   1  
ATOM 714   H HB2  . LYS A 1 45 ? -7.807  21.087 14.262 1.00 0.00 ? 45 LYS A HB2  1  
ATOM 715   H HB3  . LYS A 1 45 ? -8.378  20.121 12.901 1.00 0.00 ? 45 LYS A HB3  1  
ATOM 716   H HG2  . LYS A 1 45 ? -8.897  22.567 11.915 1.00 0.00 ? 45 LYS A HG2  1  
ATOM 717   H HG3  . LYS A 1 45 ? -7.558  22.985 12.984 1.00 0.00 ? 45 LYS A HG3  1  
ATOM 718   H HD2  . LYS A 1 45 ? -6.350  20.953 11.908 1.00 0.00 ? 45 LYS A HD2  1  
ATOM 719   H HD3  . LYS A 1 45 ? -7.576  21.081 10.647 1.00 0.00 ? 45 LYS A HD3  1  
ATOM 720   H HE2  . LYS A 1 45 ? -6.934  23.468 10.297 1.00 0.00 ? 45 LYS A HE2  1  
ATOM 721   H HE3  . LYS A 1 45 ? -5.653  23.274 11.509 1.00 0.00 ? 45 LYS A HE3  1  
ATOM 722   H HZ1  . LYS A 1 45 ? -5.936  21.399 9.235  1.00 0.00 ? 45 LYS A HZ1  1  
ATOM 723   H HZ2  . LYS A 1 45 ? -5.045  22.837 9.077  1.00 0.00 ? 45 LYS A HZ2  1  
ATOM 724   H HZ3  . LYS A 1 45 ? -4.579  21.667 10.217 1.00 0.00 ? 45 LYS A HZ3  1  
ATOM 725   N N    . MET A 1 46 ? -10.992 20.350 11.894 1.00 0.00 ? 46 MET A N    1  
ATOM 726   C CA   . MET A 1 46 ? -11.880 20.398 10.698 1.00 0.00 ? 46 MET A CA   1  
ATOM 727   C C    . MET A 1 46 ? -13.317 20.701 11.128 1.00 0.00 ? 46 MET A C    1  
ATOM 728   O O    . MET A 1 46 ? -14.119 21.188 10.356 1.00 0.00 ? 46 MET A O    1  
ATOM 729   C CB   . MET A 1 46 ? -11.782 19.009 10.066 1.00 0.00 ? 46 MET A CB   1  
ATOM 730   C CG   . MET A 1 46 ? -12.374 17.960 11.010 1.00 0.00 ? 46 MET A CG   1  
ATOM 731   S SD   . MET A 1 46 ? -13.481 16.870 10.082 1.00 0.00 ? 46 MET A SD   1  
ATOM 732   C CE   . MET A 1 46 ? -14.841 18.046 9.880  1.00 0.00 ? 46 MET A CE   1  
ATOM 733   H H    . MET A 1 46 ? -10.542 19.515 12.139 1.00 0.00 ? 46 MET A H    1  
ATOM 734   H HA   . MET A 1 46 ? -11.532 21.145 10.002 1.00 0.00 ? 46 MET A HA   1  
ATOM 735   H HB2  . MET A 1 46 ? -12.328 19.000 9.136  1.00 0.00 ? 46 MET A HB2  1  
ATOM 736   H HB3  . MET A 1 46 ? -10.746 18.775 9.877  1.00 0.00 ? 46 MET A HB3  1  
ATOM 737   H HG2  . MET A 1 46 ? -11.575 17.376 11.445 1.00 0.00 ? 46 MET A HG2  1  
ATOM 738   H HG3  . MET A 1 46 ? -12.927 18.450 11.795 1.00 0.00 ? 46 MET A HG3  1  
ATOM 739   H HE1  . MET A 1 46 ? -15.005 18.569 10.813 1.00 0.00 ? 46 MET A HE1  1  
ATOM 740   H HE2  . MET A 1 46 ? -14.592 18.759 9.111  1.00 0.00 ? 46 MET A HE2  1  
ATOM 741   H HE3  . MET A 1 46 ? -15.738 17.513 9.598  1.00 0.00 ? 46 MET A HE3  1  
ATOM 742   N N    . ILE A 1 47 ? -13.643 20.422 12.359 1.00 0.00 ? 47 ILE A N    1  
ATOM 743   C CA   . ILE A 1 47 ? -15.025 20.699 12.845 1.00 0.00 ? 47 ILE A CA   1  
ATOM 744   C C    . ILE A 1 47 ? -15.322 22.195 12.719 1.00 0.00 ? 47 ILE A C    1  
ATOM 745   O O    . ILE A 1 47 ? -16.416 22.596 12.375 1.00 0.00 ? 47 ILE A O    1  
ATOM 746   C CB   . ILE A 1 47 ? -15.029 20.275 14.316 1.00 0.00 ? 47 ILE A CB   1  
ATOM 747   C CG1  . ILE A 1 47 ? -14.641 18.799 14.433 1.00 0.00 ? 47 ILE A CG1  1  
ATOM 748   C CG2  . ILE A 1 47 ? -16.428 20.481 14.900 1.00 0.00 ? 47 ILE A CG2  1  
ATOM 749   C CD1  . ILE A 1 47 ? -15.731 17.928 13.807 1.00 0.00 ? 47 ILE A CD1  1  
ATOM 750   H H    . ILE A 1 47 ? -12.977 20.034 12.962 1.00 0.00 ? 47 ILE A H    1  
ATOM 751   H HA   . ILE A 1 47 ? -15.746 20.122 12.290 1.00 0.00 ? 47 ILE A HA   1  
ATOM 752   H HB   . ILE A 1 47 ? -14.319 20.877 14.865 1.00 0.00 ? 47 ILE A HB   1  
ATOM 753   H HG12 . ILE A 1 47 ? -13.709 18.629 13.919 1.00 0.00 ? 47 ILE A HG12 1  
ATOM 754   H HG13 . ILE A 1 47 ? -14.530 18.539 15.475 1.00 0.00 ? 47 ILE A HG13 1  
ATOM 755   H HG21 . ILE A 1 47 ? -17.160 20.433 14.107 1.00 0.00 ? 47 ILE A HG21 1  
ATOM 756   H HG22 . ILE A 1 47 ? -16.632 19.707 15.625 1.00 0.00 ? 47 ILE A HG22 1  
ATOM 757   H HG23 . ILE A 1 47 ? -16.479 21.447 15.380 1.00 0.00 ? 47 ILE A HG23 1  
ATOM 758   H HD11 . ILE A 1 47 ? -16.093 18.396 12.904 1.00 0.00 ? 47 ILE A HD11 1  
ATOM 759   H HD12 . ILE A 1 47 ? -15.322 16.956 13.570 1.00 0.00 ? 47 ILE A HD12 1  
ATOM 760   H HD13 . ILE A 1 47 ? -16.547 17.814 14.506 1.00 0.00 ? 47 ILE A HD13 1  
ATOM 761   N N    . LEU A 1 48 ? -14.349 23.022 12.989 1.00 0.00 ? 48 LEU A N    1  
ATOM 762   C CA   . LEU A 1 48 ? -14.565 24.492 12.879 1.00 0.00 ? 48 LEU A CA   1  
ATOM 763   C C    . LEU A 1 48 ? -14.603 24.903 11.406 1.00 0.00 ? 48 LEU A C    1  
ATOM 764   O O    . LEU A 1 48 ? -15.394 25.731 11.001 1.00 0.00 ? 48 LEU A O    1  
ATOM 765   C CB   . LEU A 1 48 ? -13.361 25.123 13.578 1.00 0.00 ? 48 LEU A CB   1  
ATOM 766   C CG   . LEU A 1 48 ? -13.497 24.951 15.093 1.00 0.00 ? 48 LEU A CG   1  
ATOM 767   C CD1  . LEU A 1 48 ? -14.873 25.448 15.541 1.00 0.00 ? 48 LEU A CD1  1  
ATOM 768   C CD2  . LEU A 1 48 ? -13.345 23.473 15.456 1.00 0.00 ? 48 LEU A CD2  1  
ATOM 769   H H    . LEU A 1 48 ? -13.473 22.675 13.259 1.00 0.00 ? 48 LEU A H    1  
ATOM 770   H HA   . LEU A 1 48 ? -15.477 24.780 13.378 1.00 0.00 ? 48 LEU A HA   1  
ATOM 771   H HB2  . LEU A 1 48 ? -12.455 24.640 13.242 1.00 0.00 ? 48 LEU A HB2  1  
ATOM 772   H HB3  . LEU A 1 48 ? -13.317 26.176 13.339 1.00 0.00 ? 48 LEU A HB3  1  
ATOM 773   H HG   . LEU A 1 48 ? -12.728 25.524 15.589 1.00 0.00 ? 48 LEU A HG   1  
ATOM 774   H HD11 . LEU A 1 48 ? -15.164 26.295 14.937 1.00 0.00 ? 48 LEU A HD11 1  
ATOM 775   H HD12 . LEU A 1 48 ? -15.597 24.656 15.424 1.00 0.00 ? 48 LEU A HD12 1  
ATOM 776   H HD13 . LEU A 1 48 ? -14.827 25.745 16.578 1.00 0.00 ? 48 LEU A HD13 1  
ATOM 777   H HD21 . LEU A 1 48 ? -12.562 23.034 14.856 1.00 0.00 ? 48 LEU A HD21 1  
ATOM 778   H HD22 . LEU A 1 48 ? -13.089 23.384 16.501 1.00 0.00 ? 48 LEU A HD22 1  
ATOM 779   H HD23 . LEU A 1 48 ? -14.275 22.958 15.267 1.00 0.00 ? 48 LEU A HD23 1  
ATOM 780   N N    . GLU A 1 49 ? -13.752 24.326 10.601 1.00 0.00 ? 49 GLU A N    1  
ATOM 781   C CA   . GLU A 1 49 ? -13.737 24.681 9.153  1.00 0.00 ? 49 GLU A CA   1  
ATOM 782   C C    . GLU A 1 49 ? -15.122 24.452 8.540  1.00 0.00 ? 49 GLU A C    1  
ATOM 783   O O    . GLU A 1 49 ? -15.488 25.070 7.560  1.00 0.00 ? 49 GLU A O    1  
ATOM 784   C CB   . GLU A 1 49 ? -12.710 23.738 8.525  1.00 0.00 ? 49 GLU A CB   1  
ATOM 785   C CG   . GLU A 1 49 ? -11.342 23.975 9.167  1.00 0.00 ? 49 GLU A CG   1  
ATOM 786   C CD   . GLU A 1 49 ? -10.305 23.062 8.510  1.00 0.00 ? 49 GLU A CD   1  
ATOM 787   O OE1  . GLU A 1 49 ? -10.686 22.294 7.642  1.00 0.00 ? 49 GLU A OE1  1  
ATOM 788   O OE2  . GLU A 1 49 ? -9.147  23.146 8.886  1.00 0.00 ? 49 GLU A OE2  1  
ATOM 789   H H    . GLU A 1 49 ? -13.122 23.659 10.950 1.00 0.00 ? 49 GLU A H    1  
ATOM 790   H HA   . GLU A 1 49 ? -13.429 25.705 9.018  1.00 0.00 ? 49 GLU A HA   1  
ATOM 791   H HB2  . GLU A 1 49 ? -13.013 22.715 8.689  1.00 0.00 ? 49 GLU A HB2  1  
ATOM 792   H HB3  . GLU A 1 49 ? -12.648 23.930 7.464  1.00 0.00 ? 49 GLU A HB3  1  
ATOM 793   H HG2  . GLU A 1 49 ? -11.052 25.007 9.028  1.00 0.00 ? 49 GLU A HG2  1  
ATOM 794   H HG3  . GLU A 1 49 ? -11.397 23.756 10.223 1.00 0.00 ? 49 GLU A HG3  1  
ATOM 795   N N    . LYS A 1 50 ? -15.894 23.568 9.111  1.00 0.00 ? 50 LYS A N    1  
ATOM 796   C CA   . LYS A 1 50 ? -17.254 23.300 8.563  1.00 0.00 ? 50 LYS A CA   1  
ATOM 797   C C    . LYS A 1 50 ? -18.151 24.527 8.747  1.00 0.00 ? 50 LYS A C    1  
ATOM 798   O O    . LYS A 1 50 ? -18.996 24.819 7.926  1.00 0.00 ? 50 LYS A O    1  
ATOM 799   C CB   . LYS A 1 50 ? -17.785 22.121 9.379  1.00 0.00 ? 50 LYS A CB   1  
ATOM 800   C CG   . LYS A 1 50 ? -17.036 20.848 8.983  1.00 0.00 ? 50 LYS A CG   1  
ATOM 801   C CD   . LYS A 1 50 ? -17.524 20.374 7.612  1.00 0.00 ? 50 LYS A CD   1  
ATOM 802   C CE   . LYS A 1 50 ? -16.861 19.038 7.269  1.00 0.00 ? 50 LYS A CE   1  
ATOM 803   N NZ   . LYS A 1 50 ? -15.459 19.390 6.908  1.00 0.00 ? 50 LYS A NZ   1  
ATOM 804   H H    . LYS A 1 50 ? -15.579 23.081 9.901  1.00 0.00 ? 50 LYS A H    1  
ATOM 805   H HA   . LYS A 1 50 ? -17.194 23.029 7.520  1.00 0.00 ? 50 LYS A HA   1  
ATOM 806   H HB2  . LYS A 1 50 ? -17.635 22.315 10.430 1.00 0.00 ? 50 LYS A HB2  1  
ATOM 807   H HB3  . LYS A 1 50 ? -18.840 21.994 9.183  1.00 0.00 ? 50 LYS A HB3  1  
ATOM 808   H HG2  . LYS A 1 50 ? -15.977 21.052 8.937  1.00 0.00 ? 50 LYS A HG2  1  
ATOM 809   H HG3  . LYS A 1 50 ? -17.222 20.078 9.717  1.00 0.00 ? 50 LYS A HG3  1  
ATOM 810   H HD2  . LYS A 1 50 ? -18.596 20.249 7.635  1.00 0.00 ? 50 LYS A HD2  1  
ATOM 811   H HD3  . LYS A 1 50 ? -17.263 21.108 6.864  1.00 0.00 ? 50 LYS A HD3  1  
ATOM 812   H HE2  . LYS A 1 50 ? -16.875 18.381 8.125  1.00 0.00 ? 50 LYS A HE2  1  
ATOM 813   H HE3  . LYS A 1 50 ? -17.360 18.576 6.430  1.00 0.00 ? 50 LYS A HE3  1  
ATOM 814   H HZ1  . LYS A 1 50 ? -15.032 19.947 7.674  1.00 0.00 ? 50 LYS A HZ1  1  
ATOM 815   H HZ2  . LYS A 1 50 ? -14.908 18.520 6.767  1.00 0.00 ? 50 LYS A HZ2  1  
ATOM 816   H HZ3  . LYS A 1 50 ? -15.457 19.949 6.029  1.00 0.00 ? 50 LYS A HZ3  1  
ATOM 817   N N    . GLU A 1 51 ? -17.972 25.246 9.821  1.00 0.00 ? 51 GLU A N    1  
ATOM 818   C CA   . GLU A 1 51 ? -18.815 26.453 10.058 1.00 0.00 ? 51 GLU A CA   1  
ATOM 819   C C    . GLU A 1 51 ? -18.525 27.516 8.994  1.00 0.00 ? 51 GLU A C    1  
ATOM 820   O O    . GLU A 1 51 ? -19.346 28.366 8.713  1.00 0.00 ? 51 GLU A O    1  
ATOM 821   C CB   . GLU A 1 51 ? -18.407 26.955 11.443 1.00 0.00 ? 51 GLU A CB   1  
ATOM 822   C CG   . GLU A 1 51 ? -18.668 25.860 12.479 1.00 0.00 ? 51 GLU A CG   1  
ATOM 823   C CD   . GLU A 1 51 ? -18.198 26.337 13.854 1.00 0.00 ? 51 GLU A CD   1  
ATOM 824   O OE1  . GLU A 1 51 ? -17.017 26.609 13.993 1.00 0.00 ? 51 GLU A OE1  1  
ATOM 825   O OE2  . GLU A 1 51 ? -19.027 26.424 14.745 1.00 0.00 ? 51 GLU A OE2  1  
ATOM 826   H H    . GLU A 1 51 ? -17.285 24.993 10.472 1.00 0.00 ? 51 GLU A H    1  
ATOM 827   H HA   . GLU A 1 51 ? -19.861 26.190 10.054 1.00 0.00 ? 51 GLU A HA   1  
ATOM 828   H HB2  . GLU A 1 51 ? -17.356 27.204 11.440 1.00 0.00 ? 51 GLU A HB2  1  
ATOM 829   H HB3  . GLU A 1 51 ? -18.984 27.833 11.693 1.00 0.00 ? 51 GLU A HB3  1  
ATOM 830   H HG2  . GLU A 1 51 ? -19.725 25.644 12.515 1.00 0.00 ? 51 GLU A HG2  1  
ATOM 831   H HG3  . GLU A 1 51 ? -18.127 24.967 12.203 1.00 0.00 ? 51 GLU A HG3  1  
ATOM 832   N N    . ALA A 1 52 ? -17.364 27.473 8.401  1.00 0.00 ? 52 ALA A N    1  
ATOM 833   C CA   . ALA A 1 52 ? -17.023 28.481 7.357  1.00 0.00 ? 52 ALA A CA   1  
ATOM 834   C C    . ALA A 1 52 ? -17.829 28.215 6.083  1.00 0.00 ? 52 ALA A C    1  
ATOM 835   O O    . ALA A 1 52 ? -18.035 29.095 5.271  1.00 0.00 ? 52 ALA A O    1  
ATOM 836   C CB   . ALA A 1 52 ? -15.529 28.290 7.096  1.00 0.00 ? 52 ALA A CB   1  
ATOM 837   H H    . ALA A 1 52 ? -16.716 26.779 8.643  1.00 0.00 ? 52 ALA A H    1  
ATOM 838   H HA   . ALA A 1 52 ? -17.209 29.479 7.720  1.00 0.00 ? 52 ALA A HA   1  
ATOM 839   H HB1  . ALA A 1 52 ? -15.074 27.802 7.945  1.00 0.00 ? 52 ALA A HB1  1  
ATOM 840   H HB2  . ALA A 1 52 ? -15.064 29.253 6.943  1.00 0.00 ? 52 ALA A HB2  1  
ATOM 841   H HB3  . ALA A 1 52 ? -15.392 27.681 6.214  1.00 0.00 ? 52 ALA A HB3  1  
ATOM 842   N N    . LYS A 1 53 ? -18.288 27.006 5.901  1.00 0.00 ? 53 LYS A N    1  
ATOM 843   C CA   . LYS A 1 53 ? -19.081 26.685 4.680  1.00 0.00 ? 53 LYS A CA   1  
ATOM 844   C C    . LYS A 1 53 ? -20.532 27.140 4.856  1.00 0.00 ? 53 LYS A C    1  
ATOM 845   O O    . LYS A 1 53 ? -21.237 27.383 3.897  1.00 0.00 ? 53 LYS A O    1  
ATOM 846   C CB   . LYS A 1 53 ? -19.008 25.164 4.549  1.00 0.00 ? 53 LYS A CB   1  
ATOM 847   C CG   . LYS A 1 53 ? -17.620 24.761 4.046  1.00 0.00 ? 53 LYS A CG   1  
ATOM 848   C CD   . LYS A 1 53 ? -17.562 23.242 3.869  1.00 0.00 ? 53 LYS A CD   1  
ATOM 849   C CE   . LYS A 1 53 ? -16.171 22.839 3.376  1.00 0.00 ? 53 LYS A CE   1  
ATOM 850   N NZ   . LYS A 1 53 ? -16.179 21.349 3.388  1.00 0.00 ? 53 LYS A NZ   1  
ATOM 851   H H    . LYS A 1 53 ? -18.111 26.310 6.568  1.00 0.00 ? 53 LYS A H    1  
ATOM 852   H HA   . LYS A 1 53 ? -18.642 27.151 3.812  1.00 0.00 ? 53 LYS A HA   1  
ATOM 853   H HB2  . LYS A 1 53 ? -19.187 24.710 5.513  1.00 0.00 ? 53 LYS A HB2  1  
ATOM 854   H HB3  . LYS A 1 53 ? -19.756 24.826 3.848  1.00 0.00 ? 53 LYS A HB3  1  
ATOM 855   H HG2  . LYS A 1 53 ? -17.427 25.242 3.098  1.00 0.00 ? 53 LYS A HG2  1  
ATOM 856   H HG3  . LYS A 1 53 ? -16.874 25.068 4.764  1.00 0.00 ? 53 LYS A HG3  1  
ATOM 857   H HD2  . LYS A 1 53 ? -17.763 22.762 4.815  1.00 0.00 ? 53 LYS A HD2  1  
ATOM 858   H HD3  . LYS A 1 53 ? -18.303 22.936 3.145  1.00 0.00 ? 53 LYS A HD3  1  
ATOM 859   H HE2  . LYS A 1 53 ? -16.006 23.206 2.374  1.00 0.00 ? 53 LYS A HE2  1  
ATOM 860   H HE3  . LYS A 1 53 ? -15.412 23.216 4.045  1.00 0.00 ? 53 LYS A HE3  1  
ATOM 861   H HZ1  . LYS A 1 53 ? -17.112 21.004 3.086  1.00 0.00 ? 53 LYS A HZ1  1  
ATOM 862   H HZ2  . LYS A 1 53 ? -15.453 20.993 2.734  1.00 0.00 ? 53 LYS A HZ2  1  
ATOM 863   H HZ3  . LYS A 1 53 ? -15.978 21.009 4.350  1.00 0.00 ? 53 LYS A HZ3  1  
ATOM 864   N N    . SER A 1 54 ? -20.984 27.257 6.075  1.00 0.00 ? 54 SER A N    1  
ATOM 865   C CA   . SER A 1 54 ? -22.389 27.696 6.310  1.00 0.00 ? 54 SER A CA   1  
ATOM 866   C C    . SER A 1 54 ? -22.520 29.202 6.068  1.00 0.00 ? 54 SER A C    1  
ATOM 867   O O    . SER A 1 54 ? -23.597 29.712 5.835  1.00 0.00 ? 54 SER A O    1  
ATOM 868   C CB   . SER A 1 54 ? -22.669 27.362 7.776  1.00 0.00 ? 54 SER A CB   1  
ATOM 869   O OG   . SER A 1 54 ? -22.650 25.953 7.952  1.00 0.00 ? 54 SER A OG   1  
ATOM 870   H H    . SER A 1 54 ? -20.399 27.056 6.835  1.00 0.00 ? 54 SER A H    1  
ATOM 871   H HA   . SER A 1 54 ? -23.066 27.151 5.672  1.00 0.00 ? 54 SER A HA   1  
ATOM 872   H HB2  . SER A 1 54 ? -21.910 27.813 8.399  1.00 0.00 ? 54 SER A HB2  1  
ATOM 873   H HB3  . SER A 1 54 ? -23.639 27.747 8.054  1.00 0.00 ? 54 SER A HB3  1  
ATOM 874   H HG   . SER A 1 54 ? -21.793 25.711 8.312  1.00 0.00 ? 54 SER A HG   1  
ATOM 875   N N    . GLN A 1 55 ? -21.430 29.918 6.121  1.00 0.00 ? 55 GLN A N    1  
ATOM 876   C CA   . GLN A 1 55 ? -21.492 31.390 5.894  1.00 0.00 ? 55 GLN A CA   1  
ATOM 877   C C    . GLN A 1 55 ? -20.080 31.979 5.853  1.00 0.00 ? 55 GLN A C    1  
ATOM 878   O O    . GLN A 1 55 ? -19.293 31.642 6.722  1.00 0.00 ? 55 GLN A O    1  
ATOM 879   C CB   . GLN A 1 55 ? -22.269 31.942 7.089  1.00 0.00 ? 55 GLN A CB   1  
ATOM 880   C CG   . GLN A 1 55 ? -21.439 31.765 8.362  1.00 0.00 ? 55 GLN A CG   1  
ATOM 881   C CD   . GLN A 1 55 ? -22.260 32.213 9.573  1.00 0.00 ? 55 GLN A CD   1  
ATOM 882   O OE1  . GLN A 1 55 ? -23.461 32.038 9.606  1.00 0.00 ? 55 GLN A OE1  1  
ATOM 883   N NE2  . GLN A 1 55 ? -21.656 32.788 10.577 1.00 0.00 ? 55 GLN A NE2  1  
ATOM 884   O OXT  . GLN A 1 55 ? -19.809 32.758 4.954  1.00 0.00 ? 55 GLN A OXT  1  
ATOM 885   H H    . GLN A 1 55 ? -20.570 29.487 6.311  1.00 0.00 ? 55 GLN A H    1  
ATOM 886   H HA   . GLN A 1 55 ? -22.019 31.608 4.979  1.00 0.00 ? 55 GLN A HA   1  
ATOM 887   H HB2  . GLN A 1 55 ? -22.471 32.992 6.934  1.00 0.00 ? 55 GLN A HB2  1  
ATOM 888   H HB3  . GLN A 1 55 ? -23.202 31.408 7.190  1.00 0.00 ? 55 GLN A HB3  1  
ATOM 889   H HG2  . GLN A 1 55 ? -21.170 30.725 8.474  1.00 0.00 ? 55 GLN A HG2  1  
ATOM 890   H HG3  . GLN A 1 55 ? -20.543 32.363 8.293  1.00 0.00 ? 55 GLN A HG3  1  
ATOM 891   H HE21 . GLN A 1 55 ? -20.687 32.930 10.550 1.00 0.00 ? 55 GLN A HE21 1  
ATOM 892   H HE22 . GLN A 1 55 ? -22.173 33.079 11.358 1.00 0.00 ? 55 GLN A HE22 1  
ATOM 893   N N    . LYS A 1 1  ? -22.077 15.033 8.620  1.00 0.00 ? 1  LYS A N    2  
ATOM 894   C CA   . LYS A 1 1  ? -21.009 16.013 8.973  1.00 0.00 ? 1  LYS A CA   2  
ATOM 895   C C    . LYS A 1 1  ? -21.591 17.148 9.819  1.00 0.00 ? 1  LYS A C    2  
ATOM 896   O O    . LYS A 1 1  ? -21.310 18.309 9.594  1.00 0.00 ? 1  LYS A O    2  
ATOM 897   C CB   . LYS A 1 1  ? -20.503 16.546 7.632  1.00 0.00 ? 1  LYS A CB   2  
ATOM 898   C CG   . LYS A 1 1  ? -21.608 17.362 6.957  1.00 0.00 ? 1  LYS A CG   2  
ATOM 899   C CD   . LYS A 1 1  ? -21.158 17.767 5.553  1.00 0.00 ? 1  LYS A CD   2  
ATOM 900   C CE   . LYS A 1 1  ? -21.158 16.536 4.642  1.00 0.00 ? 1  LYS A CE   2  
ATOM 901   N NZ   . LYS A 1 1  ? -20.776 17.056 3.300  1.00 0.00 ? 1  LYS A NZ   2  
ATOM 902   H H1   . LYS A 1 1  ? -22.996 15.521 8.582  1.00 0.00 ? 1  LYS A H1   2  
ATOM 903   H H2   . LYS A 1 1  ? -21.870 14.612 7.693  1.00 0.00 ? 1  LYS A H2   2  
ATOM 904   H H3   . LYS A 1 1  ? -22.113 14.284 9.339  1.00 0.00 ? 1  LYS A H3   2  
ATOM 905   H HA   . LYS A 1 1  ? -20.206 15.521 9.500  1.00 0.00 ? 1  LYS A HA   2  
ATOM 906   H HB2  . LYS A 1 1  ? -19.641 17.175 7.797  1.00 0.00 ? 1  LYS A HB2  2  
ATOM 907   H HB3  . LYS A 1 1  ? -20.229 15.718 6.995  1.00 0.00 ? 1  LYS A HB3  2  
ATOM 908   H HG2  . LYS A 1 1  ? -22.506 16.765 6.891  1.00 0.00 ? 1  LYS A HG2  2  
ATOM 909   H HG3  . LYS A 1 1  ? -21.808 18.248 7.541  1.00 0.00 ? 1  LYS A HG3  2  
ATOM 910   H HD2  . LYS A 1 1  ? -21.837 18.507 5.157  1.00 0.00 ? 1  LYS A HD2  2  
ATOM 911   H HD3  . LYS A 1 1  ? -20.161 18.180 5.600  1.00 0.00 ? 1  LYS A HD3  2  
ATOM 912   H HE2  . LYS A 1 1  ? -20.433 15.814 4.987  1.00 0.00 ? 1  LYS A HE2  2  
ATOM 913   H HE3  . LYS A 1 1  ? -22.143 16.094 4.608  1.00 0.00 ? 1  LYS A HE3  2  
ATOM 914   H HZ1  . LYS A 1 1  ? -20.065 17.809 3.409  1.00 0.00 ? 1  LYS A HZ1  2  
ATOM 915   H HZ2  . LYS A 1 1  ? -20.379 16.283 2.729  1.00 0.00 ? 1  LYS A HZ2  2  
ATOM 916   H HZ3  . LYS A 1 1  ? -21.617 17.440 2.823  1.00 0.00 ? 1  LYS A HZ3  2  
ATOM 917   N N    . ASN A 1 2  ? -22.400 16.822 10.790 1.00 0.00 ? 2  ASN A N    2  
ATOM 918   C CA   . ASN A 1 2  ? -22.999 17.884 11.649 1.00 0.00 ? 2  ASN A CA   2  
ATOM 919   C C    . ASN A 1 2  ? -22.150 18.088 12.907 1.00 0.00 ? 2  ASN A C    2  
ATOM 920   O O    . ASN A 1 2  ? -21.921 17.169 13.669 1.00 0.00 ? 2  ASN A O    2  
ATOM 921   C CB   . ASN A 1 2  ? -24.386 17.356 12.018 1.00 0.00 ? 2  ASN A CB   2  
ATOM 922   C CG   . ASN A 1 2  ? -25.188 18.464 12.703 1.00 0.00 ? 2  ASN A CG   2  
ATOM 923   O OD1  . ASN A 1 2  ? -24.902 19.632 12.531 1.00 0.00 ? 2  ASN A OD1  2  
ATOM 924   N ND2  . ASN A 1 2  ? -26.187 18.144 13.479 1.00 0.00 ? 2  ASN A ND2  2  
ATOM 925   H H    . ASN A 1 2  ? -22.613 15.880 10.954 1.00 0.00 ? 2  ASN A H    2  
ATOM 926   H HA   . ASN A 1 2  ? -23.090 18.807 11.100 1.00 0.00 ? 2  ASN A HA   2  
ATOM 927   H HB2  . ASN A 1 2  ? -24.900 17.040 11.123 1.00 0.00 ? 2  ASN A HB2  2  
ATOM 928   H HB3  . ASN A 1 2  ? -24.284 16.517 12.691 1.00 0.00 ? 2  ASN A HB3  2  
ATOM 929   H HD21 . ASN A 1 2  ? -26.417 17.202 13.618 1.00 0.00 ? 2  ASN A HD21 2  
ATOM 930   H HD22 . ASN A 1 2  ? -26.706 18.847 13.923 1.00 0.00 ? 2  ASN A HD22 2  
ATOM 931   N N    . GLU A 1 3  ? -21.682 19.285 13.130 1.00 0.00 ? 3  GLU A N    2  
ATOM 932   C CA   . GLU A 1 3  ? -20.850 19.546 14.339 1.00 0.00 ? 3  GLU A CA   2  
ATOM 933   C C    . GLU A 1 3  ? -21.604 19.121 15.601 1.00 0.00 ? 3  GLU A C    2  
ATOM 934   O O    . GLU A 1 3  ? -21.017 18.894 16.640 1.00 0.00 ? 3  GLU A O    2  
ATOM 935   C CB   . GLU A 1 3  ? -20.612 21.056 14.338 1.00 0.00 ? 3  GLU A CB   2  
ATOM 936   C CG   . GLU A 1 3  ? -19.837 21.449 13.078 1.00 0.00 ? 3  GLU A CG   2  
ATOM 937   C CD   . GLU A 1 3  ? -19.865 22.971 12.916 1.00 0.00 ? 3  GLU A CD   2  
ATOM 938   O OE1  . GLU A 1 3  ? -20.515 23.621 13.718 1.00 0.00 ? 3  GLU A OE1  2  
ATOM 939   O OE2  . GLU A 1 3  ? -19.235 23.460 11.992 1.00 0.00 ? 3  GLU A OE2  2  
ATOM 940   H H    . GLU A 1 3  ? -21.878 20.013 12.504 1.00 0.00 ? 3  GLU A H    2  
ATOM 941   H HA   . GLU A 1 3  ? -19.908 19.025 14.267 1.00 0.00 ? 3  GLU A HA   2  
ATOM 942   H HB2  . GLU A 1 3  ? -21.562 21.569 14.351 1.00 0.00 ? 3  GLU A HB2  2  
ATOM 943   H HB3  . GLU A 1 3  ? -20.041 21.332 15.212 1.00 0.00 ? 3  GLU A HB3  2  
ATOM 944   H HG2  . GLU A 1 3  ? -18.815 21.116 13.166 1.00 0.00 ? 3  GLU A HG2  2  
ATOM 945   H HG3  . GLU A 1 3  ? -20.295 20.988 12.216 1.00 0.00 ? 3  GLU A HG3  2  
ATOM 946   N N    . ASP A 1 4  ? -22.901 19.008 15.518 1.00 0.00 ? 4  ASP A N    2  
ATOM 947   C CA   . ASP A 1 4  ? -23.694 18.595 16.712 1.00 0.00 ? 4  ASP A CA   2  
ATOM 948   C C    . ASP A 1 4  ? -23.627 17.076 16.889 1.00 0.00 ? 4  ASP A C    2  
ATOM 949   O O    . ASP A 1 4  ? -24.277 16.510 17.747 1.00 0.00 ? 4  ASP A O    2  
ATOM 950   C CB   . ASP A 1 4  ? -25.124 19.034 16.408 1.00 0.00 ? 4  ASP A CB   2  
ATOM 951   C CG   . ASP A 1 4  ? -25.297 20.507 16.789 1.00 0.00 ? 4  ASP A CG   2  
ATOM 952   O OD1  . ASP A 1 4  ? -24.347 21.084 17.292 1.00 0.00 ? 4  ASP A OD1  2  
ATOM 953   O OD2  . ASP A 1 4  ? -26.377 21.031 16.573 1.00 0.00 ? 4  ASP A OD2  2  
ATOM 954   H H    . ASP A 1 4  ? -23.356 19.194 14.670 1.00 0.00 ? 4  ASP A H    2  
ATOM 955   H HA   . ASP A 1 4  ? -23.333 19.094 17.597 1.00 0.00 ? 4  ASP A HA   2  
ATOM 956   H HB2  . ASP A 1 4  ? -25.321 18.909 15.354 1.00 0.00 ? 4  ASP A HB2  2  
ATOM 957   H HB3  . ASP A 1 4  ? -25.814 18.430 16.977 1.00 0.00 ? 4  ASP A HB3  2  
ATOM 958   N N    . GLN A 1 5  ? -22.842 16.413 16.087 1.00 0.00 ? 5  GLN A N    2  
ATOM 959   C CA   . GLN A 1 5  ? -22.726 14.932 16.209 1.00 0.00 ? 5  GLN A CA   2  
ATOM 960   C C    . GLN A 1 5  ? -21.295 14.566 16.599 1.00 0.00 ? 5  GLN A C    2  
ATOM 961   O O    . GLN A 1 5  ? -21.050 13.582 17.269 1.00 0.00 ? 5  GLN A O    2  
ATOM 962   C CB   . GLN A 1 5  ? -23.061 14.390 14.818 1.00 0.00 ? 5  GLN A CB   2  
ATOM 963   C CG   . GLN A 1 5  ? -24.575 14.446 14.603 1.00 0.00 ? 5  GLN A CG   2  
ATOM 964   C CD   . GLN A 1 5  ? -24.906 13.967 13.188 1.00 0.00 ? 5  GLN A CD   2  
ATOM 965   O OE1  . GLN A 1 5  ? -25.593 14.643 12.450 1.00 0.00 ? 5  GLN A OE1  2  
ATOM 966   N NE2  . GLN A 1 5  ? -24.442 12.818 12.777 1.00 0.00 ? 5  GLN A NE2  2  
ATOM 967   H H    . GLN A 1 5  ? -22.322 16.890 15.406 1.00 0.00 ? 5  GLN A H    2  
ATOM 968   H HA   . GLN A 1 5  ? -23.427 14.554 16.935 1.00 0.00 ? 5  GLN A HA   2  
ATOM 969   H HB2  . GLN A 1 5  ? -22.569 14.992 14.069 1.00 0.00 ? 5  GLN A HB2  2  
ATOM 970   H HB3  . GLN A 1 5  ? -22.723 13.368 14.739 1.00 0.00 ? 5  GLN A HB3  2  
ATOM 971   H HG2  . GLN A 1 5  ? -25.065 13.809 15.323 1.00 0.00 ? 5  GLN A HG2  2  
ATOM 972   H HG3  . GLN A 1 5  ? -24.919 15.462 14.728 1.00 0.00 ? 5  GLN A HG3  2  
ATOM 973   H HE21 . GLN A 1 5  ? -23.887 12.272 13.372 1.00 0.00 ? 5  GLN A HE21 2  
ATOM 974   H HE22 . GLN A 1 5  ? -24.648 12.502 11.872 1.00 0.00 ? 5  GLN A HE22 2  
ATOM 975   N N    . GLU A 1 6  ? -20.352 15.365 16.190 1.00 0.00 ? 6  GLU A N    2  
ATOM 976   C CA   . GLU A 1 6  ? -18.930 15.092 16.537 1.00 0.00 ? 6  GLU A CA   2  
ATOM 977   C C    . GLU A 1 6  ? -18.331 16.322 17.218 1.00 0.00 ? 6  GLU A C    2  
ATOM 978   O O    . GLU A 1 6  ? -17.136 16.540 17.195 1.00 0.00 ? 6  GLU A O    2  
ATOM 979   C CB   . GLU A 1 6  ? -18.237 14.823 15.200 1.00 0.00 ? 6  GLU A CB   2  
ATOM 980   C CG   . GLU A 1 6  ? -18.827 13.563 14.564 1.00 0.00 ? 6  GLU A CG   2  
ATOM 981   C CD   . GLU A 1 6  ? -18.301 13.420 13.135 1.00 0.00 ? 6  GLU A CD   2  
ATOM 982   O OE1  . GLU A 1 6  ? -17.757 14.387 12.625 1.00 0.00 ? 6  GLU A OE1  2  
ATOM 983   O OE2  . GLU A 1 6  ? -18.448 12.347 12.575 1.00 0.00 ? 6  GLU A OE2  2  
ATOM 984   H H    . GLU A 1 6  ? -20.583 16.156 15.658 1.00 0.00 ? 6  GLU A H    2  
ATOM 985   H HA   . GLU A 1 6  ? -18.854 14.227 17.177 1.00 0.00 ? 6  GLU A HA   2  
ATOM 986   H HB2  . GLU A 1 6  ? -18.388 15.664 14.542 1.00 0.00 ? 6  GLU A HB2  2  
ATOM 987   H HB3  . GLU A 1 6  ? -17.179 14.680 15.366 1.00 0.00 ? 6  GLU A HB3  2  
ATOM 988   H HG2  . GLU A 1 6  ? -18.539 12.698 15.143 1.00 0.00 ? 6  GLU A HG2  2  
ATOM 989   H HG3  . GLU A 1 6  ? -19.904 13.640 14.544 1.00 0.00 ? 6  GLU A HG3  2  
ATOM 990   N N    . MET A 1 7  ? -19.161 17.130 17.819 1.00 0.00 ? 7  MET A N    2  
ATOM 991   C CA   . MET A 1 7  ? -18.657 18.356 18.500 1.00 0.00 ? 7  MET A CA   2  
ATOM 992   C C    . MET A 1 7  ? -17.368 18.050 19.267 1.00 0.00 ? 7  MET A C    2  
ATOM 993   O O    . MET A 1 7  ? -17.025 16.907 19.495 1.00 0.00 ? 7  MET A O    2  
ATOM 994   C CB   . MET A 1 7  ? -19.771 18.758 19.467 1.00 0.00 ? 7  MET A CB   2  
ATOM 995   C CG   . MET A 1 7  ? -20.086 17.585 20.397 1.00 0.00 ? 7  MET A CG   2  
ATOM 996   S SD   . MET A 1 7  ? -21.718 17.824 21.141 1.00 0.00 ? 7  MET A SD   2  
ATOM 997   C CE   . MET A 1 7  ? -21.770 16.275 22.075 1.00 0.00 ? 7  MET A CE   2  
ATOM 998   H H    . MET A 1 7  ? -20.121 16.933 17.818 1.00 0.00 ? 7  MET A H    2  
ATOM 999   H HA   . MET A 1 7  ? -18.493 19.143 17.782 1.00 0.00 ? 7  MET A HA   2  
ATOM 1000  H HB2  . MET A 1 7  ? -19.451 19.607 20.053 1.00 0.00 ? 7  MET A HB2  2  
ATOM 1001  H HB3  . MET A 1 7  ? -20.656 19.020 18.906 1.00 0.00 ? 7  MET A HB3  2  
ATOM 1002  H HG2  . MET A 1 7  ? -20.079 16.665 19.832 1.00 0.00 ? 7  MET A HG2  2  
ATOM 1003  H HG3  . MET A 1 7  ? -19.340 17.534 21.176 1.00 0.00 ? 7  MET A HG3  2  
ATOM 1004  H HE1  . MET A 1 7  ? -20.829 16.133 22.586 1.00 0.00 ? 7  MET A HE1  2  
ATOM 1005  H HE2  . MET A 1 7  ? -22.575 16.317 22.796 1.00 0.00 ? 7  MET A HE2  2  
ATOM 1006  H HE3  . MET A 1 7  ? -21.940 15.452 21.401 1.00 0.00 ? 7  MET A HE3  2  
ATOM 1007  N N    . CYS A 1 8  ? -16.653 19.064 19.668 1.00 0.00 ? 8  CYS A N    2  
ATOM 1008  C CA   . CYS A 1 8  ? -15.387 18.832 20.421 1.00 0.00 ? 8  CYS A CA   2  
ATOM 1009  C C    . CYS A 1 8  ? -15.187 19.932 21.468 1.00 0.00 ? 8  CYS A C    2  
ATOM 1010  O O    . CYS A 1 8  ? -14.682 20.997 21.174 1.00 0.00 ? 8  CYS A O    2  
ATOM 1011  C CB   . CYS A 1 8  ? -14.284 18.891 19.364 1.00 0.00 ? 8  CYS A CB   2  
ATOM 1012  S SG   . CYS A 1 8  ? -12.775 18.143 20.025 1.00 0.00 ? 8  CYS A SG   2  
ATOM 1013  H H    . CYS A 1 8  ? -16.947 19.978 19.475 1.00 0.00 ? 8  CYS A H    2  
ATOM 1014  H HA   . CYS A 1 8  ? -15.398 17.861 20.889 1.00 0.00 ? 8  CYS A HA   2  
ATOM 1015  H HB2  . CYS A 1 8  ? -14.599 18.350 18.484 1.00 0.00 ? 8  CYS A HB2  2  
ATOM 1016  H HB3  . CYS A 1 8  ? -14.090 19.921 19.104 1.00 0.00 ? 8  CYS A HB3  2  
ATOM 1017  N N    . HIS A 1 9  ? -15.579 19.681 22.687 1.00 0.00 ? 9  HIS A N    2  
ATOM 1018  C CA   . HIS A 1 9  ? -15.411 20.714 23.750 1.00 0.00 ? 9  HIS A CA   2  
ATOM 1019  C C    . HIS A 1 9  ? -14.020 20.601 24.379 1.00 0.00 ? 9  HIS A C    2  
ATOM 1020  O O    . HIS A 1 9  ? -13.554 21.503 25.047 1.00 0.00 ? 9  HIS A O    2  
ATOM 1021  C CB   . HIS A 1 9  ? -16.493 20.400 24.784 1.00 0.00 ? 9  HIS A CB   2  
ATOM 1022  C CG   . HIS A 1 9  ? -17.850 20.579 24.160 1.00 0.00 ? 9  HIS A CG   2  
ATOM 1023  N ND1  . HIS A 1 9  ? -18.401 19.637 23.306 1.00 0.00 ? 9  HIS A ND1  2  
ATOM 1024  C CD2  . HIS A 1 9  ? -18.781 21.584 24.260 1.00 0.00 ? 9  HIS A CD2  2  
ATOM 1025  C CE1  . HIS A 1 9  ? -19.610 20.091 22.927 1.00 0.00 ? 9  HIS A CE1  2  
ATOM 1026  N NE2  . HIS A 1 9  ? -19.891 21.274 23.480 1.00 0.00 ? 9  HIS A NE2  2  
ATOM 1027  H H    . HIS A 1 9  ? -15.984 18.816 22.904 1.00 0.00 ? 9  HIS A H    2  
ATOM 1028  H HA   . HIS A 1 9  ? -15.563 21.701 23.344 1.00 0.00 ? 9  HIS A HA   2  
ATOM 1029  H HB2  . HIS A 1 9  ? -16.384 19.381 25.122 1.00 0.00 ? 9  HIS A HB2  2  
ATOM 1030  H HB3  . HIS A 1 9  ? -16.392 21.071 25.625 1.00 0.00 ? 9  HIS A HB3  2  
ATOM 1031  H HD1  . HIS A 1 9  ? -17.986 18.794 23.028 1.00 0.00 ? 9  HIS A HD1  2  
ATOM 1032  H HD2  . HIS A 1 9  ? -18.668 22.479 24.853 1.00 0.00 ? 9  HIS A HD2  2  
ATOM 1033  H HE1  . HIS A 1 9  ? -20.273 19.562 22.258 1.00 0.00 ? 9  HIS A HE1  2  
ATOM 1034  N N    . GLU A 1 10 ? -13.352 19.498 24.173 1.00 0.00 ? 10 GLU A N    2  
ATOM 1035  C CA   . GLU A 1 10 ? -11.992 19.328 24.760 1.00 0.00 ? 10 GLU A CA   2  
ATOM 1036  C C    . GLU A 1 10 ? -11.012 20.317 24.123 1.00 0.00 ? 10 GLU A C    2  
ATOM 1037  O O    . GLU A 1 10 ? -10.093 20.791 24.761 1.00 0.00 ? 10 GLU A O    2  
ATOM 1038  C CB   . GLU A 1 10 ? -11.594 17.890 24.426 1.00 0.00 ? 10 GLU A CB   2  
ATOM 1039  C CG   . GLU A 1 10 ? -12.420 16.922 25.275 1.00 0.00 ? 10 GLU A CG   2  
ATOM 1040  C CD   . GLU A 1 10 ? -12.058 15.482 24.905 1.00 0.00 ? 10 GLU A CD   2  
ATOM 1041  O OE1  . GLU A 1 10 ? -12.480 15.039 23.849 1.00 0.00 ? 10 GLU A OE1  2  
ATOM 1042  O OE2  . GLU A 1 10 ? -11.364 14.848 25.683 1.00 0.00 ? 10 GLU A OE2  2  
ATOM 1043  H H    . GLU A 1 10 ? -13.746 18.782 23.631 1.00 0.00 ? 10 GLU A H    2  
ATOM 1044  H HA   . GLU A 1 10 ? -12.024 19.462 25.829 1.00 0.00 ? 10 GLU A HA   2  
ATOM 1045  H HB2  . GLU A 1 10 ? -11.779 17.699 23.380 1.00 0.00 ? 10 GLU A HB2  2  
ATOM 1046  H HB3  . GLU A 1 10 ? -10.544 17.749 24.638 1.00 0.00 ? 10 GLU A HB3  2  
ATOM 1047  H HG2  . GLU A 1 10 ? -12.209 17.089 26.321 1.00 0.00 ? 10 GLU A HG2  2  
ATOM 1048  H HG3  . GLU A 1 10 ? -13.471 17.087 25.090 1.00 0.00 ? 10 GLU A HG3  2  
ATOM 1049  N N    . PHE A 1 11 ? -11.201 20.632 22.872 1.00 0.00 ? 11 PHE A N    2  
ATOM 1050  C CA   . PHE A 1 11 ? -10.277 21.590 22.198 1.00 0.00 ? 11 PHE A CA   2  
ATOM 1051  C C    . PHE A 1 11 ? -10.867 23.001 22.217 1.00 0.00 ? 11 PHE A C    2  
ATOM 1052  O O    . PHE A 1 11 ? -10.174 23.974 21.998 1.00 0.00 ? 11 PHE A O    2  
ATOM 1053  C CB   . PHE A 1 11 ? -10.164 21.091 20.760 1.00 0.00 ? 11 PHE A CB   2  
ATOM 1054  C CG   . PHE A 1 11 ? -9.182  19.945 20.688 1.00 0.00 ? 11 PHE A CG   2  
ATOM 1055  C CD1  . PHE A 1 11 ? -9.586  18.649 21.034 1.00 0.00 ? 11 PHE A CD1  2  
ATOM 1056  C CD2  . PHE A 1 11 ? -7.868  20.178 20.267 1.00 0.00 ? 11 PHE A CD2  2  
ATOM 1057  C CE1  . PHE A 1 11 ? -8.676  17.589 20.958 1.00 0.00 ? 11 PHE A CE1  2  
ATOM 1058  C CE2  . PHE A 1 11 ? -6.958  19.118 20.192 1.00 0.00 ? 11 PHE A CE2  2  
ATOM 1059  C CZ   . PHE A 1 11 ? -7.362  17.824 20.537 1.00 0.00 ? 11 PHE A CZ   2  
ATOM 1060  H H    . PHE A 1 11 ? -11.947 20.240 22.373 1.00 0.00 ? 11 PHE A H    2  
ATOM 1061  H HA   . PHE A 1 11 ? -9.308  21.577 22.669 1.00 0.00 ? 11 PHE A HA   2  
ATOM 1062  H HB2  . PHE A 1 11 ? -11.132 20.759 20.422 1.00 0.00 ? 11 PHE A HB2  2  
ATOM 1063  H HB3  . PHE A 1 11 ? -9.822  21.896 20.127 1.00 0.00 ? 11 PHE A HB3  2  
ATOM 1064  H HD1  . PHE A 1 11 ? -10.598 18.467 21.361 1.00 0.00 ? 11 PHE A HD1  2  
ATOM 1065  H HD2  . PHE A 1 11 ? -7.555  21.176 20.003 1.00 0.00 ? 11 PHE A HD2  2  
ATOM 1066  H HE1  . PHE A 1 11 ? -8.987  16.590 21.225 1.00 0.00 ? 11 PHE A HE1  2  
ATOM 1067  H HE2  . PHE A 1 11 ? -5.944  19.299 19.868 1.00 0.00 ? 11 PHE A HE2  2  
ATOM 1068  H HZ   . PHE A 1 11 ? -6.660  17.007 20.479 1.00 0.00 ? 11 PHE A HZ   2  
ATOM 1069  N N    . GLN A 1 12 ? -12.140 23.126 22.473 1.00 0.00 ? 12 GLN A N    2  
ATOM 1070  C CA   . GLN A 1 12 ? -12.756 24.483 22.499 1.00 0.00 ? 12 GLN A CA   2  
ATOM 1071  C C    . GLN A 1 12 ? -11.880 25.433 23.314 1.00 0.00 ? 12 GLN A C    2  
ATOM 1072  O O    . GLN A 1 12 ? -11.883 26.629 23.106 1.00 0.00 ? 12 GLN A O    2  
ATOM 1073  C CB   . GLN A 1 12 ? -14.116 24.301 23.170 1.00 0.00 ? 12 GLN A CB   2  
ATOM 1074  C CG   . GLN A 1 12 ? -14.825 25.655 23.246 1.00 0.00 ? 12 GLN A CG   2  
ATOM 1075  C CD   . GLN A 1 12 ? -16.058 25.537 24.144 1.00 0.00 ? 12 GLN A CD   2  
ATOM 1076  O OE1  . GLN A 1 12 ? -17.115 26.035 23.813 1.00 0.00 ? 12 GLN A OE1  2  
ATOM 1077  N NE2  . GLN A 1 12 ? -15.967 24.893 25.276 1.00 0.00 ? 12 GLN A NE2  2  
ATOM 1078  H H    . GLN A 1 12 ? -12.690 22.332 22.644 1.00 0.00 ? 12 GLN A H    2  
ATOM 1079  H HA   . GLN A 1 12 ? -12.887 24.857 21.496 1.00 0.00 ? 12 GLN A HA   2  
ATOM 1080  H HB2  . GLN A 1 12 ? -14.714 23.612 22.593 1.00 0.00 ? 12 GLN A HB2  2  
ATOM 1081  H HB3  . GLN A 1 12 ? -13.976 23.910 24.168 1.00 0.00 ? 12 GLN A HB3  2  
ATOM 1082  H HG2  . GLN A 1 12 ? -14.149 26.393 23.655 1.00 0.00 ? 12 GLN A HG2  2  
ATOM 1083  H HG3  . GLN A 1 12 ? -15.129 25.958 22.255 1.00 0.00 ? 12 GLN A HG3  2  
ATOM 1084  H HE21 . GLN A 1 12 ? -15.115 24.490 25.543 1.00 0.00 ? 12 GLN A HE21 2  
ATOM 1085  H HE22 . GLN A 1 12 ? -16.752 24.811 25.857 1.00 0.00 ? 12 GLN A HE22 2  
ATOM 1086  N N    . ALA A 1 13 ? -11.123 24.909 24.237 1.00 0.00 ? 13 ALA A N    2  
ATOM 1087  C CA   . ALA A 1 13 ? -10.241 25.782 25.060 1.00 0.00 ? 13 ALA A CA   2  
ATOM 1088  C C    . ALA A 1 13 ? -9.048  26.250 24.222 1.00 0.00 ? 13 ALA A C    2  
ATOM 1089  O O    . ALA A 1 13 ? -8.427  27.252 24.514 1.00 0.00 ? 13 ALA A O    2  
ATOM 1090  C CB   . ALA A 1 13 ? -9.773  24.898 26.215 1.00 0.00 ? 13 ALA A CB   2  
ATOM 1091  H H    . ALA A 1 13 ? -11.131 23.940 24.387 1.00 0.00 ? 13 ALA A H    2  
ATOM 1092  H HA   . ALA A 1 13 ? -10.793 26.627 25.439 1.00 0.00 ? 13 ALA A HA   2  
ATOM 1093  H HB1  . ALA A 1 13 ? -8.769  25.177 26.498 1.00 0.00 ? 13 ALA A HB1  2  
ATOM 1094  H HB2  . ALA A 1 13 ? -10.434 25.029 27.059 1.00 0.00 ? 13 ALA A HB2  2  
ATOM 1095  H HB3  . ALA A 1 13 ? -9.785  23.863 25.906 1.00 0.00 ? 13 ALA A HB3  2  
ATOM 1096  N N    . PHE A 1 14 ? -8.724  25.530 23.182 1.00 0.00 ? 14 PHE A N    2  
ATOM 1097  C CA   . PHE A 1 14 ? -7.575  25.931 22.326 1.00 0.00 ? 14 PHE A CA   2  
ATOM 1098  C C    . PHE A 1 14 ? -8.049  26.851 21.199 1.00 0.00 ? 14 PHE A C    2  
ATOM 1099  O O    . PHE A 1 14 ? -7.369  27.034 20.209 1.00 0.00 ? 14 PHE A O    2  
ATOM 1100  C CB   . PHE A 1 14 ? -7.041  24.622 21.751 1.00 0.00 ? 14 PHE A CB   2  
ATOM 1101  C CG   . PHE A 1 14 ? -6.789  23.639 22.870 1.00 0.00 ? 14 PHE A CG   2  
ATOM 1102  C CD1  . PHE A 1 14 ? -6.265  24.082 24.089 1.00 0.00 ? 14 PHE A CD1  2  
ATOM 1103  C CD2  . PHE A 1 14 ? -7.077  22.284 22.682 1.00 0.00 ? 14 PHE A CD2  2  
ATOM 1104  C CE1  . PHE A 1 14 ? -6.030  23.167 25.123 1.00 0.00 ? 14 PHE A CE1  2  
ATOM 1105  C CE2  . PHE A 1 14 ? -6.843  21.368 23.713 1.00 0.00 ? 14 PHE A CE2  2  
ATOM 1106  C CZ   . PHE A 1 14 ? -6.319  21.810 24.935 1.00 0.00 ? 14 PHE A CZ   2  
ATOM 1107  H H    . PHE A 1 14 ? -9.237  24.724 22.962 1.00 0.00 ? 14 PHE A H    2  
ATOM 1108  H HA   . PHE A 1 14 ? -6.813  26.414 22.917 1.00 0.00 ? 14 PHE A HA   2  
ATOM 1109  H HB2  . PHE A 1 14 ? -7.767  24.207 21.066 1.00 0.00 ? 14 PHE A HB2  2  
ATOM 1110  H HB3  . PHE A 1 14 ? -6.121  24.811 21.227 1.00 0.00 ? 14 PHE A HB3  2  
ATOM 1111  H HD1  . PHE A 1 14 ? -6.043  25.129 24.234 1.00 0.00 ? 14 PHE A HD1  2  
ATOM 1112  H HD2  . PHE A 1 14 ? -7.482  21.943 21.741 1.00 0.00 ? 14 PHE A HD2  2  
ATOM 1113  H HE1  . PHE A 1 14 ? -5.626  23.507 26.065 1.00 0.00 ? 14 PHE A HE1  2  
ATOM 1114  H HE2  . PHE A 1 14 ? -7.065  20.321 23.567 1.00 0.00 ? 14 PHE A HE2  2  
ATOM 1115  H HZ   . PHE A 1 14 ? -6.137  21.103 25.732 1.00 0.00 ? 14 PHE A HZ   2  
ATOM 1116  N N    . MET A 1 15 ? -9.213  27.426 21.333 1.00 0.00 ? 15 MET A N    2  
ATOM 1117  C CA   . MET A 1 15 ? -9.721  28.323 20.262 1.00 0.00 ? 15 MET A CA   2  
ATOM 1118  C C    . MET A 1 15 ? -9.471  29.792 20.626 1.00 0.00 ? 15 MET A C    2  
ATOM 1119  O O    . MET A 1 15 ? -9.975  30.295 21.611 1.00 0.00 ? 15 MET A O    2  
ATOM 1120  C CB   . MET A 1 15 ? -11.220 28.026 20.184 1.00 0.00 ? 15 MET A CB   2  
ATOM 1121  C CG   . MET A 1 15 ? -11.949 28.698 21.349 1.00 0.00 ? 15 MET A CG   2  
ATOM 1122  S SD   . MET A 1 15 ? -13.640 28.059 21.450 1.00 0.00 ? 15 MET A SD   2  
ATOM 1123  C CE   . MET A 1 15 ? -14.220 28.698 19.859 1.00 0.00 ? 15 MET A CE   2  
ATOM 1124  H H    . MET A 1 15 ? -9.755  27.263 22.131 1.00 0.00 ? 15 MET A H    2  
ATOM 1125  H HA   . MET A 1 15 ? -9.251  28.084 19.322 1.00 0.00 ? 15 MET A HA   2  
ATOM 1126  H HB2  . MET A 1 15 ? -11.608 28.404 19.255 1.00 0.00 ? 15 MET A HB2  2  
ATOM 1127  H HB3  . MET A 1 15 ? -11.377 26.960 20.230 1.00 0.00 ? 15 MET A HB3  2  
ATOM 1128  H HG2  . MET A 1 15 ? -11.430 28.486 22.271 1.00 0.00 ? 15 MET A HG2  2  
ATOM 1129  H HG3  . MET A 1 15 ? -11.976 29.765 21.188 1.00 0.00 ? 15 MET A HG3  2  
ATOM 1130  H HE1  . MET A 1 15 ? -14.050 29.761 19.814 1.00 0.00 ? 15 MET A HE1  2  
ATOM 1131  H HE2  . MET A 1 15 ? -13.678 28.214 19.059 1.00 0.00 ? 15 MET A HE2  2  
ATOM 1132  H HE3  . MET A 1 15 ? -15.279 28.500 19.758 1.00 0.00 ? 15 MET A HE3  2  
ATOM 1133  N N    . LYS A 1 16 ? -8.698  30.484 19.834 1.00 0.00 ? 16 LYS A N    2  
ATOM 1134  C CA   . LYS A 1 16 ? -8.419  31.918 20.127 1.00 0.00 ? 16 LYS A CA   2  
ATOM 1135  C C    . LYS A 1 16 ? -9.359  32.809 19.311 1.00 0.00 ? 16 LYS A C    2  
ATOM 1136  O O    . LYS A 1 16 ? -9.021  33.266 18.237 1.00 0.00 ? 16 LYS A O    2  
ATOM 1137  C CB   . LYS A 1 16 ? -6.967  32.137 19.700 1.00 0.00 ? 16 LYS A CB   2  
ATOM 1138  C CG   . LYS A 1 16 ? -6.506  33.525 20.149 1.00 0.00 ? 16 LYS A CG   2  
ATOM 1139  C CD   . LYS A 1 16 ? -5.859  34.253 18.969 1.00 0.00 ? 16 LYS A CD   2  
ATOM 1140  C CE   . LYS A 1 16 ? -5.138  35.504 19.474 1.00 0.00 ? 16 LYS A CE   2  
ATOM 1141  N NZ   . LYS A 1 16 ? -4.237  35.903 18.356 1.00 0.00 ? 16 LYS A NZ   2  
ATOM 1142  H H    . LYS A 1 16 ? -8.303  30.061 19.045 1.00 0.00 ? 16 LYS A H    2  
ATOM 1143  H HA   . LYS A 1 16 ? -8.529  32.117 21.181 1.00 0.00 ? 16 LYS A HA   2  
ATOM 1144  H HB2  . LYS A 1 16 ? -6.340  31.385 20.155 1.00 0.00 ? 16 LYS A HB2  2  
ATOM 1145  H HB3  . LYS A 1 16 ? -6.894  32.064 18.625 1.00 0.00 ? 16 LYS A HB3  2  
ATOM 1146  H HG2  . LYS A 1 16 ? -7.357  34.091 20.500 1.00 0.00 ? 16 LYS A HG2  2  
ATOM 1147  H HG3  . LYS A 1 16 ? -5.787  33.424 20.948 1.00 0.00 ? 16 LYS A HG3  2  
ATOM 1148  H HD2  . LYS A 1 16 ? -5.148  33.598 18.488 1.00 0.00 ? 16 LYS A HD2  2  
ATOM 1149  H HD3  . LYS A 1 16 ? -6.622  34.539 18.261 1.00 0.00 ? 16 LYS A HD3  2  
ATOM 1150  H HE2  . LYS A 1 16 ? -5.849  36.290 19.681 1.00 0.00 ? 16 LYS A HE2  2  
ATOM 1151  H HE3  . LYS A 1 16 ? -4.562  35.275 20.358 1.00 0.00 ? 16 LYS A HE3  2  
ATOM 1152  H HZ1  . LYS A 1 16 ? -3.773  35.058 17.967 1.00 0.00 ? 16 LYS A HZ1  2  
ATOM 1153  H HZ2  . LYS A 1 16 ? -4.794  36.364 17.609 1.00 0.00 ? 16 LYS A HZ2  2  
ATOM 1154  H HZ3  . LYS A 1 16 ? -3.516  36.564 18.711 1.00 0.00 ? 16 LYS A HZ3  2  
ATOM 1155  N N    . ASN A 1 17 ? -10.536 33.057 19.815 1.00 0.00 ? 17 ASN A N    2  
ATOM 1156  C CA   . ASN A 1 17 ? -11.505 33.918 19.077 1.00 0.00 ? 17 ASN A CA   2  
ATOM 1157  C C    . ASN A 1 17 ? -11.817 33.323 17.700 1.00 0.00 ? 17 ASN A C    2  
ATOM 1158  O O    . ASN A 1 17 ? -11.696 33.982 16.686 1.00 0.00 ? 17 ASN A O    2  
ATOM 1159  C CB   . ASN A 1 17 ? -10.806 35.269 18.933 1.00 0.00 ? 17 ASN A CB   2  
ATOM 1160  C CG   . ASN A 1 17 ? -10.425 35.795 20.318 1.00 0.00 ? 17 ASN A CG   2  
ATOM 1161  O OD1  . ASN A 1 17 ? -11.261 35.900 21.193 1.00 0.00 ? 17 ASN A OD1  2  
ATOM 1162  N ND2  . ASN A 1 17 ? -9.187  36.133 20.555 1.00 0.00 ? 17 ASN A ND2  2  
ATOM 1163  H H    . ASN A 1 17 ? -10.786 32.676 20.682 1.00 0.00 ? 17 ASN A H    2  
ATOM 1164  H HA   . ASN A 1 17 ? -12.413 34.033 19.647 1.00 0.00 ? 17 ASN A HA   2  
ATOM 1165  H HB2  . ASN A 1 17 ? -9.915  35.152 18.337 1.00 0.00 ? 17 ASN A HB2  2  
ATOM 1166  H HB3  . ASN A 1 17 ? -11.472 35.971 18.452 1.00 0.00 ? 17 ASN A HB3  2  
ATOM 1167  H HD21 . ASN A 1 17 ? -8.512  36.048 19.850 1.00 0.00 ? 17 ASN A HD21 2  
ATOM 1168  H HD22 . ASN A 1 17 ? -8.932  36.470 21.439 1.00 0.00 ? 17 ASN A HD22 2  
ATOM 1169  N N    . GLY A 1 18 ? -12.231 32.085 17.656 1.00 0.00 ? 18 GLY A N    2  
ATOM 1170  C CA   . GLY A 1 18 ? -12.562 31.455 16.345 1.00 0.00 ? 18 GLY A CA   2  
ATOM 1171  C C    . GLY A 1 18 ? -11.323 30.773 15.761 1.00 0.00 ? 18 GLY A C    2  
ATOM 1172  O O    . GLY A 1 18 ? -11.418 29.960 14.864 1.00 0.00 ? 18 GLY A O    2  
ATOM 1173  H H    . GLY A 1 18 ? -12.329 31.572 18.485 1.00 0.00 ? 18 GLY A H    2  
ATOM 1174  H HA2  . GLY A 1 18 ? -13.342 30.721 16.487 1.00 0.00 ? 18 GLY A HA2  2  
ATOM 1175  H HA3  . GLY A 1 18 ? -12.908 32.216 15.659 1.00 0.00 ? 18 GLY A HA3  2  
ATOM 1176  N N    . LYS A 1 19 ? -10.161 31.094 16.259 1.00 0.00 ? 19 LYS A N    2  
ATOM 1177  C CA   . LYS A 1 19 ? -8.923  30.457 15.722 1.00 0.00 ? 19 LYS A CA   2  
ATOM 1178  C C    . LYS A 1 19 ? -8.572  29.214 16.544 1.00 0.00 ? 19 LYS A C    2  
ATOM 1179  O O    . LYS A 1 19 ? -8.514  29.257 17.753 1.00 0.00 ? 19 LYS A O    2  
ATOM 1180  C CB   . LYS A 1 19 ? -7.833  31.519 15.867 1.00 0.00 ? 19 LYS A CB   2  
ATOM 1181  C CG   . LYS A 1 19 ? -6.707  31.231 14.872 1.00 0.00 ? 19 LYS A CG   2  
ATOM 1182  C CD   . LYS A 1 19 ? -5.893  30.030 15.356 1.00 0.00 ? 19 LYS A CD   2  
ATOM 1183  C CE   . LYS A 1 19 ? -4.648  29.870 14.481 1.00 0.00 ? 19 LYS A CE   2  
ATOM 1184  N NZ   . LYS A 1 19 ? -4.043  31.230 14.425 1.00 0.00 ? 19 LYS A NZ   2  
ATOM 1185  H H    . LYS A 1 19 ? -10.101 31.752 16.984 1.00 0.00 ? 19 LYS A H    2  
ATOM 1186  H HA   . LYS A 1 19 ? -9.051  30.199 14.684 1.00 0.00 ? 19 LYS A HA   2  
ATOM 1187  H HB2  . LYS A 1 19 ? -8.252  32.494 15.664 1.00 0.00 ? 19 LYS A HB2  2  
ATOM 1188  H HB3  . LYS A 1 19 ? -7.440  31.498 16.872 1.00 0.00 ? 19 LYS A HB3  2  
ATOM 1189  H HG2  . LYS A 1 19 ? -7.131  31.012 13.903 1.00 0.00 ? 19 LYS A HG2  2  
ATOM 1190  H HG3  . LYS A 1 19 ? -6.063  32.095 14.796 1.00 0.00 ? 19 LYS A HG3  2  
ATOM 1191  H HD2  . LYS A 1 19 ? -5.594  30.187 16.381 1.00 0.00 ? 19 LYS A HD2  2  
ATOM 1192  H HD3  . LYS A 1 19 ? -6.495  29.135 15.290 1.00 0.00 ? 19 LYS A HD3  2  
ATOM 1193  H HE2  . LYS A 1 19 ? -3.960  29.170 14.931 1.00 0.00 ? 19 LYS A HE2  2  
ATOM 1194  H HE3  . LYS A 1 19 ? -4.925  29.541 13.489 1.00 0.00 ? 19 LYS A HE3  2  
ATOM 1195  H HZ1  . LYS A 1 19 ? -4.199  31.716 15.331 1.00 0.00 ? 19 LYS A HZ1  2  
ATOM 1196  H HZ2  . LYS A 1 19 ? -3.021  31.149 14.249 1.00 0.00 ? 19 LYS A HZ2  2  
ATOM 1197  H HZ3  . LYS A 1 19 ? -4.486  31.775 13.658 1.00 0.00 ? 19 LYS A HZ3  2  
ATOM 1198  N N    . LEU A 1 20 ? -8.338  28.107 15.897 1.00 0.00 ? 20 LEU A N    2  
ATOM 1199  C CA   . LEU A 1 20 ? -7.995  26.868 16.651 1.00 0.00 ? 20 LEU A CA   2  
ATOM 1200  C C    . LEU A 1 20 ? -6.520  26.510 16.446 1.00 0.00 ? 20 LEU A C    2  
ATOM 1201  O O    . LEU A 1 20 ? -6.114  26.099 15.377 1.00 0.00 ? 20 LEU A O    2  
ATOM 1202  C CB   . LEU A 1 20 ? -8.897  25.783 16.063 1.00 0.00 ? 20 LEU A CB   2  
ATOM 1203  C CG   . LEU A 1 20 ? -9.112  24.682 17.103 1.00 0.00 ? 20 LEU A CG   2  
ATOM 1204  C CD1  . LEU A 1 20 ? -9.885  23.524 16.468 1.00 0.00 ? 20 LEU A CD1  2  
ATOM 1205  C CD2  . LEU A 1 20 ? -7.756  24.178 17.602 1.00 0.00 ? 20 LEU A CD2  2  
ATOM 1206  H H    . LEU A 1 20 ? -8.390  28.088 14.918 1.00 0.00 ? 20 LEU A H    2  
ATOM 1207  H HA   . LEU A 1 20 ? -8.209  26.995 17.699 1.00 0.00 ? 20 LEU A HA   2  
ATOM 1208  H HB2  . LEU A 1 20 ? -9.849  26.214 15.792 1.00 0.00 ? 20 LEU A HB2  2  
ATOM 1209  H HB3  . LEU A 1 20 ? -8.428  25.362 15.186 1.00 0.00 ? 20 LEU A HB3  2  
ATOM 1210  H HG   . LEU A 1 20 ? -9.677  25.078 17.934 1.00 0.00 ? 20 LEU A HG   2  
ATOM 1211  H HD11 . LEU A 1 20 ? -10.287 23.839 15.517 1.00 0.00 ? 20 LEU A HD11 2  
ATOM 1212  H HD12 . LEU A 1 20 ? -9.219  22.687 16.318 1.00 0.00 ? 20 LEU A HD12 2  
ATOM 1213  H HD13 . LEU A 1 20 ? -10.693 23.230 17.121 1.00 0.00 ? 20 LEU A HD13 2  
ATOM 1214  H HD21 . LEU A 1 20 ? -7.129  23.938 16.757 1.00 0.00 ? 20 LEU A HD21 2  
ATOM 1215  H HD22 . LEU A 1 20 ? -7.284  24.947 18.196 1.00 0.00 ? 20 LEU A HD22 2  
ATOM 1216  H HD23 . LEU A 1 20 ? -7.901  23.295 18.206 1.00 0.00 ? 20 LEU A HD23 2  
ATOM 1217  N N    . PHE A 1 21 ? -5.718  26.650 17.466 1.00 0.00 ? 21 PHE A N    2  
ATOM 1218  C CA   . PHE A 1 21 ? -4.272  26.303 17.325 1.00 0.00 ? 21 PHE A CA   2  
ATOM 1219  C C    . PHE A 1 21 ? -4.024  24.885 17.847 1.00 0.00 ? 21 PHE A C    2  
ATOM 1220  O O    . PHE A 1 21 ? -3.309  24.678 18.805 1.00 0.00 ? 21 PHE A O    2  
ATOM 1221  C CB   . PHE A 1 21 ? -3.496  27.338 18.153 1.00 0.00 ? 21 PHE A CB   2  
ATOM 1222  C CG   . PHE A 1 21 ? -4.180  27.581 19.480 1.00 0.00 ? 21 PHE A CG   2  
ATOM 1223  C CD1  . PHE A 1 21 ? -3.911  26.748 20.573 1.00 0.00 ? 21 PHE A CD1  2  
ATOM 1224  C CD2  . PHE A 1 21 ? -5.078  28.647 19.617 1.00 0.00 ? 21 PHE A CD2  2  
ATOM 1225  C CE1  . PHE A 1 21 ? -4.541  26.980 21.802 1.00 0.00 ? 21 PHE A CE1  2  
ATOM 1226  C CE2  . PHE A 1 21 ? -5.708  28.877 20.846 1.00 0.00 ? 21 PHE A CE2  2  
ATOM 1227  C CZ   . PHE A 1 21 ? -5.439  28.044 21.938 1.00 0.00 ? 21 PHE A CZ   2  
ATOM 1228  H H    . PHE A 1 21 ? -6.068  26.973 18.322 1.00 0.00 ? 21 PHE A H    2  
ATOM 1229  H HA   . PHE A 1 21 ? -3.977  26.371 16.289 1.00 0.00 ? 21 PHE A HA   2  
ATOM 1230  H HB2  . PHE A 1 21 ? -2.495  26.973 18.330 1.00 0.00 ? 21 PHE A HB2  2  
ATOM 1231  H HB3  . PHE A 1 21 ? -3.445  28.267 17.604 1.00 0.00 ? 21 PHE A HB3  2  
ATOM 1232  H HD1  . PHE A 1 21 ? -3.218  25.927 20.470 1.00 0.00 ? 21 PHE A HD1  2  
ATOM 1233  H HD2  . PHE A 1 21 ? -5.285  29.290 18.775 1.00 0.00 ? 21 PHE A HD2  2  
ATOM 1234  H HE1  . PHE A 1 21 ? -4.334  26.337 22.645 1.00 0.00 ? 21 PHE A HE1  2  
ATOM 1235  H HE2  . PHE A 1 21 ? -6.402  29.699 20.952 1.00 0.00 ? 21 PHE A HE2  2  
ATOM 1236  H HZ   . PHE A 1 21 ? -5.925  28.223 22.886 1.00 0.00 ? 21 PHE A HZ   2  
ATOM 1237  N N    . CYS A 1 22 ? -4.616  23.908 17.214 1.00 0.00 ? 22 CYS A N    2  
ATOM 1238  C CA   . CYS A 1 22 ? -4.427  22.497 17.660 1.00 0.00 ? 22 CYS A CA   2  
ATOM 1239  C C    . CYS A 1 22 ? -2.936  22.145 17.805 1.00 0.00 ? 22 CYS A C    2  
ATOM 1240  O O    . CYS A 1 22 ? -2.550  21.542 18.785 1.00 0.00 ? 22 CYS A O    2  
ATOM 1241  C CB   . CYS A 1 22 ? -5.077  21.642 16.570 1.00 0.00 ? 22 CYS A CB   2  
ATOM 1242  S SG   . CYS A 1 22 ? -5.864  20.200 17.327 1.00 0.00 ? 22 CYS A SG   2  
ATOM 1243  H H    . CYS A 1 22 ? -5.188  24.104 16.443 1.00 0.00 ? 22 CYS A H    2  
ATOM 1244  H HA   . CYS A 1 22 ? -4.937  22.335 18.596 1.00 0.00 ? 22 CYS A HA   2  
ATOM 1245  H HB2  . CYS A 1 22 ? -5.820  22.226 16.048 1.00 0.00 ? 22 CYS A HB2  2  
ATOM 1246  H HB3  . CYS A 1 22 ? -4.324  21.309 15.873 1.00 0.00 ? 22 CYS A HB3  2  
ATOM 1247  N N    . PRO A 1 23 ? -2.139  22.513 16.827 1.00 0.00 ? 23 PRO A N    2  
ATOM 1248  C CA   . PRO A 1 23 ? -0.690  22.200 16.882 1.00 0.00 ? 23 PRO A CA   2  
ATOM 1249  C C    . PRO A 1 23 ? -0.005  22.944 18.036 1.00 0.00 ? 23 PRO A C    2  
ATOM 1250  O O    . PRO A 1 23 ? 0.651   23.945 17.835 1.00 0.00 ? 23 PRO A O    2  
ATOM 1251  C CB   . PRO A 1 23 ? -0.183  22.705 15.529 1.00 0.00 ? 23 PRO A CB   2  
ATOM 1252  C CG   . PRO A 1 23 ? -1.372  23.293 14.744 1.00 0.00 ? 23 PRO A CG   2  
ATOM 1253  C CD   . PRO A 1 23 ? -2.622  23.245 15.631 1.00 0.00 ? 23 PRO A CD   2  
ATOM 1254  H HA   . PRO A 1 23 ? -0.530  21.137 16.962 1.00 0.00 ? 23 PRO A HA   2  
ATOM 1255  H HB2  . PRO A 1 23 ? 0.563   23.470 15.683 1.00 0.00 ? 23 PRO A HB2  2  
ATOM 1256  H HB3  . PRO A 1 23 ? 0.247   21.885 14.973 1.00 0.00 ? 23 PRO A HB3  2  
ATOM 1257  H HG2  . PRO A 1 23 ? -1.158  24.317 14.476 1.00 0.00 ? 23 PRO A HG2  2  
ATOM 1258  H HG3  . PRO A 1 23 ? -1.539  22.712 13.849 1.00 0.00 ? 23 PRO A HG3  2  
ATOM 1259  H HD2  . PRO A 1 23 ? -2.938  24.243 15.891 1.00 0.00 ? 23 PRO A HD2  2  
ATOM 1260  H HD3  . PRO A 1 23 ? -3.417  22.706 15.141 1.00 0.00 ? 23 PRO A HD3  2  
ATOM 1261  N N    . GLN A 1 24 ? -0.140  22.455 19.241 1.00 0.00 ? 24 GLN A N    2  
ATOM 1262  C CA   . GLN A 1 24 ? 0.517   23.127 20.395 1.00 0.00 ? 24 GLN A CA   2  
ATOM 1263  C C    . GLN A 1 24 ? 1.454   22.134 21.100 1.00 0.00 ? 24 GLN A C    2  
ATOM 1264  O O    . GLN A 1 24 ? 2.447   21.711 20.540 1.00 0.00 ? 24 GLN A O    2  
ATOM 1265  C CB   . GLN A 1 24 ? -0.630  23.565 21.311 1.00 0.00 ? 24 GLN A CB   2  
ATOM 1266  C CG   . GLN A 1 24 ? -1.589  22.394 21.544 1.00 0.00 ? 24 GLN A CG   2  
ATOM 1267  C CD   . GLN A 1 24 ? -2.407  22.650 22.812 1.00 0.00 ? 24 GLN A CD   2  
ATOM 1268  O OE1  . GLN A 1 24 ? -3.491  23.196 22.749 1.00 0.00 ? 24 GLN A OE1  2  
ATOM 1269  N NE2  . GLN A 1 24 ? -1.930  22.278 23.968 1.00 0.00 ? 24 GLN A NE2  2  
ATOM 1270  H H    . GLN A 1 24 ? -0.664  21.639 19.386 1.00 0.00 ? 24 GLN A H    2  
ATOM 1271  H HA   . GLN A 1 24 ? 1.072   23.990 20.059 1.00 0.00 ? 24 GLN A HA   2  
ATOM 1272  H HB2  . GLN A 1 24 ? -0.228  23.893 22.259 1.00 0.00 ? 24 GLN A HB2  2  
ATOM 1273  H HB3  . GLN A 1 24 ? -1.166  24.381 20.849 1.00 0.00 ? 24 GLN A HB3  2  
ATOM 1274  H HG2  . GLN A 1 24 ? -2.255  22.300 20.702 1.00 0.00 ? 24 GLN A HG2  2  
ATOM 1275  H HG3  . GLN A 1 24 ? -1.023  21.482 21.660 1.00 0.00 ? 24 GLN A HG3  2  
ATOM 1276  H HE21 . GLN A 1 24 ? -1.057  21.838 24.019 1.00 0.00 ? 24 GLN A HE21 2  
ATOM 1277  H HE22 . GLN A 1 24 ? -2.447  22.438 24.785 1.00 0.00 ? 24 GLN A HE22 2  
ATOM 1278  N N    . ASP A 1 25 ? 1.151   21.747 22.309 1.00 0.00 ? 25 ASP A N    2  
ATOM 1279  C CA   . ASP A 1 25 ? 2.028   20.774 23.020 1.00 0.00 ? 25 ASP A CA   2  
ATOM 1280  C C    . ASP A 1 25 ? 1.513   19.351 22.791 1.00 0.00 ? 25 ASP A C    2  
ATOM 1281  O O    . ASP A 1 25 ? 1.012   18.710 23.692 1.00 0.00 ? 25 ASP A O    2  
ATOM 1282  C CB   . ASP A 1 25 ? 1.922   21.153 24.496 1.00 0.00 ? 25 ASP A CB   2  
ATOM 1283  C CG   . ASP A 1 25 ? 2.668   20.120 25.342 1.00 0.00 ? 25 ASP A CG   2  
ATOM 1284  O OD1  . ASP A 1 25 ? 3.882   20.216 25.424 1.00 0.00 ? 25 ASP A OD1  2  
ATOM 1285  O OD2  . ASP A 1 25 ? 2.014   19.250 25.893 1.00 0.00 ? 25 ASP A OD2  2  
ATOM 1286  H H    . ASP A 1 25 ? 0.349   22.086 22.748 1.00 0.00 ? 25 ASP A H    2  
ATOM 1287  H HA   . ASP A 1 25 ? 3.049   20.868 22.685 1.00 0.00 ? 25 ASP A HA   2  
ATOM 1288  H HB2  . ASP A 1 25 ? 2.358   22.129 24.650 1.00 0.00 ? 25 ASP A HB2  2  
ATOM 1289  H HB3  . ASP A 1 25 ? 0.881   21.174 24.786 1.00 0.00 ? 25 ASP A HB3  2  
ATOM 1290  N N    . LYS A 1 26 ? 1.628   18.855 21.589 1.00 0.00 ? 26 LYS A N    2  
ATOM 1291  C CA   . LYS A 1 26 ? 1.137   17.476 21.298 1.00 0.00 ? 26 LYS A CA   2  
ATOM 1292  C C    . LYS A 1 26 ? 1.993   16.429 22.019 1.00 0.00 ? 26 LYS A C    2  
ATOM 1293  O O    . LYS A 1 26 ? 1.714   15.248 21.965 1.00 0.00 ? 26 LYS A O    2  
ATOM 1294  C CB   . LYS A 1 26 ? 1.266   17.325 19.782 1.00 0.00 ? 26 LYS A CB   2  
ATOM 1295  C CG   . LYS A 1 26 ? 0.095   18.036 19.100 1.00 0.00 ? 26 LYS A CG   2  
ATOM 1296  C CD   . LYS A 1 26 ? 0.370   18.147 17.599 1.00 0.00 ? 26 LYS A CD   2  
ATOM 1297  C CE   . LYS A 1 26 ? -0.718  17.399 16.824 1.00 0.00 ? 26 LYS A CE   2  
ATOM 1298  N NZ   . LYS A 1 26 ? -0.379  17.614 15.389 1.00 0.00 ? 26 LYS A NZ   2  
ATOM 1299  H H    . LYS A 1 26 ? 2.031   19.391 20.875 1.00 0.00 ? 26 LYS A H    2  
ATOM 1300  H HA   . LYS A 1 26 ? 0.103   17.378 21.587 1.00 0.00 ? 26 LYS A HA   2  
ATOM 1301  H HB2  . LYS A 1 26 ? 2.196   17.765 19.454 1.00 0.00 ? 26 LYS A HB2  2  
ATOM 1302  H HB3  . LYS A 1 26 ? 1.252   16.277 19.522 1.00 0.00 ? 26 LYS A HB3  2  
ATOM 1303  H HG2  . LYS A 1 26 ? -0.812  17.470 19.258 1.00 0.00 ? 26 LYS A HG2  2  
ATOM 1304  H HG3  . LYS A 1 26 ? -0.019  19.025 19.519 1.00 0.00 ? 26 LYS A HG3  2  
ATOM 1305  H HD2  . LYS A 1 26 ? 0.368   19.187 17.309 1.00 0.00 ? 26 LYS A HD2  2  
ATOM 1306  H HD3  . LYS A 1 26 ? 1.333   17.713 17.376 1.00 0.00 ? 26 LYS A HD3  2  
ATOM 1307  H HE2  . LYS A 1 26 ? -0.693  16.347 17.063 1.00 0.00 ? 26 LYS A HE2  2  
ATOM 1308  H HE3  . LYS A 1 26 ? -1.690  17.814 17.048 1.00 0.00 ? 26 LYS A HE3  2  
ATOM 1309  H HZ1  . LYS A 1 26 ? 0.647   17.513 15.256 1.00 0.00 ? 26 LYS A HZ1  2  
ATOM 1310  H HZ2  . LYS A 1 26 ? -0.873  16.909 14.807 1.00 0.00 ? 26 LYS A HZ2  2  
ATOM 1311  H HZ3  . LYS A 1 26 ? -0.675  18.570 15.103 1.00 0.00 ? 26 LYS A HZ3  2  
ATOM 1312  N N    . LYS A 1 27 ? 3.029   16.848 22.693 1.00 0.00 ? 27 LYS A N    2  
ATOM 1313  C CA   . LYS A 1 27 ? 3.893   15.871 23.415 1.00 0.00 ? 27 LYS A CA   2  
ATOM 1314  C C    . LYS A 1 27 ? 3.029   14.828 24.132 1.00 0.00 ? 27 LYS A C    2  
ATOM 1315  O O    . LYS A 1 27 ? 3.453   13.714 24.369 1.00 0.00 ? 27 LYS A O    2  
ATOM 1316  C CB   . LYS A 1 27 ? 4.672   16.711 24.425 1.00 0.00 ? 27 LYS A CB   2  
ATOM 1317  C CG   . LYS A 1 27 ? 5.764   17.499 23.699 1.00 0.00 ? 27 LYS A CG   2  
ATOM 1318  C CD   . LYS A 1 27 ? 6.491   18.402 24.697 1.00 0.00 ? 27 LYS A CD   2  
ATOM 1319  C CE   . LYS A 1 27 ? 7.511   19.268 23.955 1.00 0.00 ? 27 LYS A CE   2  
ATOM 1320  N NZ   . LYS A 1 27 ? 6.695   20.122 23.045 1.00 0.00 ? 27 LYS A NZ   2  
ATOM 1321  H H    . LYS A 1 27 ? 3.241   17.803 22.727 1.00 0.00 ? 27 LYS A H    2  
ATOM 1322  H HA   . LYS A 1 27 ? 4.574   15.392 22.729 1.00 0.00 ? 27 LYS A HA   2  
ATOM 1323  H HB2  . LYS A 1 27 ? 4.000   17.397 24.918 1.00 0.00 ? 27 LYS A HB2  2  
ATOM 1324  H HB3  . LYS A 1 27 ? 5.123   16.062 25.159 1.00 0.00 ? 27 LYS A HB3  2  
ATOM 1325  H HG2  . LYS A 1 27 ? 6.470   16.811 23.255 1.00 0.00 ? 27 LYS A HG2  2  
ATOM 1326  H HG3  . LYS A 1 27 ? 5.317   18.104 22.925 1.00 0.00 ? 27 LYS A HG3  2  
ATOM 1327  H HD2  . LYS A 1 27 ? 5.774   19.038 25.196 1.00 0.00 ? 27 LYS A HD2  2  
ATOM 1328  H HD3  . LYS A 1 27 ? 7.001   17.793 25.429 1.00 0.00 ? 27 LYS A HD3  2  
ATOM 1329  H HE2  . LYS A 1 27 ? 8.062   19.881 24.652 1.00 0.00 ? 27 LYS A HE2  2  
ATOM 1330  H HE3  . LYS A 1 27 ? 8.184   18.647 23.383 1.00 0.00 ? 27 LYS A HE3  2  
ATOM 1331  H HZ1  . LYS A 1 27 ? 5.857   20.469 23.553 1.00 0.00 ? 27 LYS A HZ1  2  
ATOM 1332  H HZ2  . LYS A 1 27 ? 7.267   20.930 22.724 1.00 0.00 ? 27 LYS A HZ2  2  
ATOM 1333  H HZ3  . LYS A 1 27 ? 6.392   19.563 22.223 1.00 0.00 ? 27 LYS A HZ3  2  
ATOM 1334  N N    . PHE A 1 28 ? 1.819   15.180 24.476 1.00 0.00 ? 28 PHE A N    2  
ATOM 1335  C CA   . PHE A 1 28 ? 0.928   14.209 25.174 1.00 0.00 ? 28 PHE A CA   2  
ATOM 1336  C C    . PHE A 1 28 ? 0.971   12.848 24.472 1.00 0.00 ? 28 PHE A C    2  
ATOM 1337  O O    . PHE A 1 28 ? 0.688   11.824 25.062 1.00 0.00 ? 28 PHE A O    2  
ATOM 1338  C CB   . PHE A 1 28 ? -0.472  14.815 25.075 1.00 0.00 ? 28 PHE A CB   2  
ATOM 1339  C CG   . PHE A 1 28 ? -0.457  16.227 25.613 1.00 0.00 ? 28 PHE A CG   2  
ATOM 1340  C CD1  . PHE A 1 28 ? 0.057   16.485 26.890 1.00 0.00 ? 28 PHE A CD1  2  
ATOM 1341  C CD2  . PHE A 1 28 ? -0.962  17.277 24.837 1.00 0.00 ? 28 PHE A CD2  2  
ATOM 1342  C CE1  . PHE A 1 28 ? 0.067   17.794 27.389 1.00 0.00 ? 28 PHE A CE1  2  
ATOM 1343  C CE2  . PHE A 1 28 ? -0.954  18.585 25.336 1.00 0.00 ? 28 PHE A CE2  2  
ATOM 1344  C CZ   . PHE A 1 28 ? -0.439  18.844 26.612 1.00 0.00 ? 28 PHE A CZ   2  
ATOM 1345  H H    . PHE A 1 28 ? 1.495   16.081 24.275 1.00 0.00 ? 28 PHE A H    2  
ATOM 1346  H HA   . PHE A 1 28 ? 1.215   14.110 26.210 1.00 0.00 ? 28 PHE A HA   2  
ATOM 1347  H HB2  . PHE A 1 28 ? -0.784  14.829 24.041 1.00 0.00 ? 28 PHE A HB2  2  
ATOM 1348  H HB3  . PHE A 1 28 ? -1.163  14.220 25.651 1.00 0.00 ? 28 PHE A HB3  2  
ATOM 1349  H HD1  . PHE A 1 28 ? 0.446   15.676 27.489 1.00 0.00 ? 28 PHE A HD1  2  
ATOM 1350  H HD2  . PHE A 1 28 ? -1.358  17.079 23.852 1.00 0.00 ? 28 PHE A HD2  2  
ATOM 1351  H HE1  . PHE A 1 28 ? 0.463   17.992 28.373 1.00 0.00 ? 28 PHE A HE1  2  
ATOM 1352  H HE2  . PHE A 1 28 ? -1.343  19.396 24.735 1.00 0.00 ? 28 PHE A HE2  2  
ATOM 1353  H HZ   . PHE A 1 28 ? -0.431  19.852 26.998 1.00 0.00 ? 28 PHE A HZ   2  
ATOM 1354  N N    . PHE A 1 29 ? 1.317   12.830 23.213 1.00 0.00 ? 29 PHE A N    2  
ATOM 1355  C CA   . PHE A 1 29 ? 1.374   11.538 22.468 1.00 0.00 ? 29 PHE A CA   2  
ATOM 1356  C C    . PHE A 1 29 ? 2.022   10.444 23.325 1.00 0.00 ? 29 PHE A C    2  
ATOM 1357  O O    . PHE A 1 29 ? 1.783   9.269  23.130 1.00 0.00 ? 29 PHE A O    2  
ATOM 1358  C CB   . PHE A 1 29 ? 2.234   11.831 21.238 1.00 0.00 ? 29 PHE A CB   2  
ATOM 1359  C CG   . PHE A 1 29 ? 2.284   10.608 20.354 1.00 0.00 ? 29 PHE A CG   2  
ATOM 1360  C CD1  . PHE A 1 29 ? 3.064   9.506  20.726 1.00 0.00 ? 29 PHE A CD1  2  
ATOM 1361  C CD2  . PHE A 1 29 ? 1.551   10.576 19.161 1.00 0.00 ? 29 PHE A CD2  2  
ATOM 1362  C CE1  . PHE A 1 29 ? 3.110   8.373  19.906 1.00 0.00 ? 29 PHE A CE1  2  
ATOM 1363  C CE2  . PHE A 1 29 ? 1.598   9.442  18.341 1.00 0.00 ? 29 PHE A CE2  2  
ATOM 1364  C CZ   . PHE A 1 29 ? 2.378   8.341  18.713 1.00 0.00 ? 29 PHE A CZ   2  
ATOM 1365  H H    . PHE A 1 29 ? 1.538   13.668 22.755 1.00 0.00 ? 29 PHE A H    2  
ATOM 1366  H HA   . PHE A 1 29 ? 0.386   11.238 22.161 1.00 0.00 ? 29 PHE A HA   2  
ATOM 1367  H HB2  . PHE A 1 29 ? 1.805   12.656 20.687 1.00 0.00 ? 29 PHE A HB2  2  
ATOM 1368  H HB3  . PHE A 1 29 ? 3.235   12.090 21.551 1.00 0.00 ? 29 PHE A HB3  2  
ATOM 1369  H HD1  . PHE A 1 29 ? 3.629   9.532  21.646 1.00 0.00 ? 29 PHE A HD1  2  
ATOM 1370  H HD2  . PHE A 1 29 ? 0.949   11.426 18.874 1.00 0.00 ? 29 PHE A HD2  2  
ATOM 1371  H HE1  . PHE A 1 29 ? 3.711   7.523  20.194 1.00 0.00 ? 29 PHE A HE1  2  
ATOM 1372  H HE2  . PHE A 1 29 ? 1.033   9.417  17.421 1.00 0.00 ? 29 PHE A HE2  2  
ATOM 1373  H HZ   . PHE A 1 29 ? 2.413   7.466  18.080 1.00 0.00 ? 29 PHE A HZ   2  
ATOM 1374  N N    . GLN A 1 30 ? 2.842   10.819 24.268 1.00 0.00 ? 30 GLN A N    2  
ATOM 1375  C CA   . GLN A 1 30 ? 3.506   9.798  25.129 1.00 0.00 ? 30 GLN A CA   2  
ATOM 1376  C C    . GLN A 1 30 ? 2.500   9.171  26.102 1.00 0.00 ? 30 GLN A C    2  
ATOM 1377  O O    . GLN A 1 30 ? 2.843   8.314  26.892 1.00 0.00 ? 30 GLN A O    2  
ATOM 1378  C CB   . GLN A 1 30 ? 4.583   10.568 25.895 1.00 0.00 ? 30 GLN A CB   2  
ATOM 1379  C CG   . GLN A 1 30 ? 3.922   11.446 26.960 1.00 0.00 ? 30 GLN A CG   2  
ATOM 1380  C CD   . GLN A 1 30 ? 5.000   12.068 27.849 1.00 0.00 ? 30 GLN A CD   2  
ATOM 1381  O OE1  . GLN A 1 30 ? 5.731   11.367 28.520 1.00 0.00 ? 30 GLN A OE1  2  
ATOM 1382  N NE2  . GLN A 1 30 ? 5.130   13.366 27.882 1.00 0.00 ? 30 GLN A NE2  2  
ATOM 1383  H H    . GLN A 1 30 ? 3.027   11.771 24.407 1.00 0.00 ? 30 GLN A H    2  
ATOM 1384  H HA   . GLN A 1 30 ? 3.966   9.036  24.521 1.00 0.00 ? 30 GLN A HA   2  
ATOM 1385  H HB2  . GLN A 1 30 ? 5.255   9.870  26.371 1.00 0.00 ? 30 GLN A HB2  2  
ATOM 1386  H HB3  . GLN A 1 30 ? 5.137   11.191 25.208 1.00 0.00 ? 30 GLN A HB3  2  
ATOM 1387  H HG2  . GLN A 1 30 ? 3.355   12.231 26.480 1.00 0.00 ? 30 GLN A HG2  2  
ATOM 1388  H HG3  . GLN A 1 30 ? 3.260   10.843 27.564 1.00 0.00 ? 30 GLN A HG3  2  
ATOM 1389  H HE21 . GLN A 1 30 ? 4.541   13.931 27.341 1.00 0.00 ? 30 GLN A HE21 2  
ATOM 1390  H HE22 . GLN A 1 30 ? 5.817   13.775 28.449 1.00 0.00 ? 30 GLN A HE22 2  
ATOM 1391  N N    . SER A 1 31 ? 1.263   9.586  26.052 1.00 0.00 ? 31 SER A N    2  
ATOM 1392  C CA   . SER A 1 31 ? 0.248   9.004  26.980 1.00 0.00 ? 31 SER A CA   2  
ATOM 1393  C C    . SER A 1 31 ? -1.058  8.723  26.231 1.00 0.00 ? 31 SER A C    2  
ATOM 1394  O O    . SER A 1 31 ? -1.322  9.291  25.189 1.00 0.00 ? 31 SER A O    2  
ATOM 1395  C CB   . SER A 1 31 ? 0.032   10.073 28.051 1.00 0.00 ? 31 SER A CB   2  
ATOM 1396  O OG   . SER A 1 31 ? -1.098  9.731  28.840 1.00 0.00 ? 31 SER A OG   2  
ATOM 1397  H H    . SER A 1 31 ? 1.000   10.278 25.410 1.00 0.00 ? 31 SER A H    2  
ATOM 1398  H HA   . SER A 1 31 ? 0.625   8.101  27.432 1.00 0.00 ? 31 SER A HA   2  
ATOM 1399  H HB2  . SER A 1 31 ? 0.907   10.134 28.681 1.00 0.00 ? 31 SER A HB2  2  
ATOM 1400  H HB3  . SER A 1 31 ? -0.136  11.029 27.577 1.00 0.00 ? 31 SER A HB3  2  
ATOM 1401  H HG   . SER A 1 31 ? -1.852  9.635  28.254 1.00 0.00 ? 31 SER A HG   2  
ATOM 1402  N N    . LEU A 1 32 ? -1.878  7.853  26.754 1.00 0.00 ? 32 LEU A N    2  
ATOM 1403  C CA   . LEU A 1 32 ? -3.166  7.541  26.070 1.00 0.00 ? 32 LEU A CA   2  
ATOM 1404  C C    . LEU A 1 32 ? -3.979  8.817  25.871 1.00 0.00 ? 32 LEU A C    2  
ATOM 1405  O O    . LEU A 1 32 ? -4.414  9.127  24.779 1.00 0.00 ? 32 LEU A O    2  
ATOM 1406  C CB   . LEU A 1 32 ? -3.897  6.584  27.008 1.00 0.00 ? 32 LEU A CB   2  
ATOM 1407  C CG   . LEU A 1 32 ? -4.724  5.596  26.184 1.00 0.00 ? 32 LEU A CG   2  
ATOM 1408  C CD1  . LEU A 1 32 ? -5.130  4.412  27.064 1.00 0.00 ? 32 LEU A CD1  2  
ATOM 1409  C CD2  . LEU A 1 32 ? -5.979  6.296  25.658 1.00 0.00 ? 32 LEU A CD2  2  
ATOM 1410  H H    . LEU A 1 32 ? -1.650  7.406  27.596 1.00 0.00 ? 32 LEU A H    2  
ATOM 1411  H HA   . LEU A 1 32 ? -2.984  7.061  25.125 1.00 0.00 ? 32 LEU A HA   2  
ATOM 1412  H HB2  . LEU A 1 32 ? -3.178  6.044  27.605 1.00 0.00 ? 32 LEU A HB2  2  
ATOM 1413  H HB3  . LEU A 1 32 ? -4.553  7.149  27.656 1.00 0.00 ? 32 LEU A HB3  2  
ATOM 1414  H HG   . LEU A 1 32 ? -4.134  5.240  25.352 1.00 0.00 ? 32 LEU A HG   2  
ATOM 1415  H HD11 . LEU A 1 32 ? -5.547  4.778  27.991 1.00 0.00 ? 32 LEU A HD11 2  
ATOM 1416  H HD12 . LEU A 1 32 ? -5.869  3.816  26.549 1.00 0.00 ? 32 LEU A HD12 2  
ATOM 1417  H HD13 . LEU A 1 32 ? -4.262  3.805  27.275 1.00 0.00 ? 32 LEU A HD13 2  
ATOM 1418  H HD21 . LEU A 1 32 ? -5.692  7.155  25.070 1.00 0.00 ? 32 LEU A HD21 2  
ATOM 1419  H HD22 . LEU A 1 32 ? -6.542  5.611  25.043 1.00 0.00 ? 32 LEU A HD22 2  
ATOM 1420  H HD23 . LEU A 1 32 ? -6.587  6.617  26.490 1.00 0.00 ? 32 LEU A HD23 2  
ATOM 1421  N N    . ASP A 1 33 ? -4.181  9.566  26.917 1.00 0.00 ? 33 ASP A N    2  
ATOM 1422  C CA   . ASP A 1 33 ? -4.958  10.828 26.785 1.00 0.00 ? 33 ASP A CA   2  
ATOM 1423  C C    . ASP A 1 33 ? -4.344  11.679 25.678 1.00 0.00 ? 33 ASP A C    2  
ATOM 1424  O O    . ASP A 1 33 ? -5.034  12.346 24.933 1.00 0.00 ? 33 ASP A O    2  
ATOM 1425  C CB   . ASP A 1 33 ? -4.832  11.524 28.140 1.00 0.00 ? 33 ASP A CB   2  
ATOM 1426  C CG   . ASP A 1 33 ? -5.924  12.587 28.273 1.00 0.00 ? 33 ASP A CG   2  
ATOM 1427  O OD1  . ASP A 1 33 ? -6.467  12.980 27.253 1.00 0.00 ? 33 ASP A OD1  2  
ATOM 1428  O OD2  . ASP A 1 33 ? -6.199  12.991 29.391 1.00 0.00 ? 33 ASP A OD2  2  
ATOM 1429  H H    . ASP A 1 33 ? -3.814  9.302  27.783 1.00 0.00 ? 33 ASP A H    2  
ATOM 1430  H HA   . ASP A 1 33 ? -5.993  10.615 26.568 1.00 0.00 ? 33 ASP A HA   2  
ATOM 1431  H HB2  . ASP A 1 33 ? -4.941  10.795 28.930 1.00 0.00 ? 33 ASP A HB2  2  
ATOM 1432  H HB3  . ASP A 1 33 ? -3.862  11.993 28.215 1.00 0.00 ? 33 ASP A HB3  2  
ATOM 1433  N N    . GLY A 1 34 ? -3.048  11.641 25.554 1.00 0.00 ? 34 GLY A N    2  
ATOM 1434  C CA   . GLY A 1 34 ? -2.384  12.429 24.483 1.00 0.00 ? 34 GLY A CA   2  
ATOM 1435  C C    . GLY A 1 34 ? -2.706  11.780 23.142 1.00 0.00 ? 34 GLY A C    2  
ATOM 1436  O O    . GLY A 1 34 ? -3.177  12.420 22.223 1.00 0.00 ? 34 GLY A O    2  
ATOM 1437  H H    . GLY A 1 34 ? -2.514  11.083 26.159 1.00 0.00 ? 34 GLY A H    2  
ATOM 1438  H HA2  . GLY A 1 34 ? -2.753  13.440 24.494 1.00 0.00 ? 34 GLY A HA2  2  
ATOM 1439  H HA3  . GLY A 1 34 ? -1.317  12.429 24.641 1.00 0.00 ? 34 GLY A HA3  2  
ATOM 1440  N N    . ILE A 1 35 ? -2.473  10.506 23.026 1.00 0.00 ? 35 ILE A N    2  
ATOM 1441  C CA   . ILE A 1 35 ? -2.786  9.814  21.748 1.00 0.00 ? 35 ILE A CA   2  
ATOM 1442  C C    . ILE A 1 35 ? -4.242  10.090 21.377 1.00 0.00 ? 35 ILE A C    2  
ATOM 1443  O O    . ILE A 1 35 ? -4.597  10.163 20.218 1.00 0.00 ? 35 ILE A O    2  
ATOM 1444  C CB   . ILE A 1 35 ? -2.558  8.326  22.031 1.00 0.00 ? 35 ILE A CB   2  
ATOM 1445  C CG1  . ILE A 1 35 ? -1.068  8.008  21.883 1.00 0.00 ? 35 ILE A CG1  2  
ATOM 1446  C CG2  . ILE A 1 35 ? -3.356  7.477  21.037 1.00 0.00 ? 35 ILE A CG2  2  
ATOM 1447  C CD1  . ILE A 1 35 ? -0.599  8.418  20.486 1.00 0.00 ? 35 ILE A CD1  2  
ATOM 1448  H H    . ILE A 1 35 ? -2.107  10.005 23.784 1.00 0.00 ? 35 ILE A H    2  
ATOM 1449  H HA   . ILE A 1 35 ? -2.127  10.151 20.966 1.00 0.00 ? 35 ILE A HA   2  
ATOM 1450  H HB   . ILE A 1 35 ? -2.876  8.097  23.037 1.00 0.00 ? 35 ILE A HB   2  
ATOM 1451  H HG12 . ILE A 1 35 ? -0.508  8.555  22.626 1.00 0.00 ? 35 ILE A HG12 2  
ATOM 1452  H HG13 . ILE A 1 35 ? -0.911  6.949  22.020 1.00 0.00 ? 35 ILE A HG13 2  
ATOM 1453  H HG21 . ILE A 1 35 ? -3.291  7.918  20.053 1.00 0.00 ? 35 ILE A HG21 2  
ATOM 1454  H HG22 . ILE A 1 35 ? -2.951  6.477  21.012 1.00 0.00 ? 35 ILE A HG22 2  
ATOM 1455  H HG23 . ILE A 1 35 ? -4.390  7.440  21.346 1.00 0.00 ? 35 ILE A HG23 2  
ATOM 1456  H HD11 . ILE A 1 35 ? -1.441  8.774  19.912 1.00 0.00 ? 35 ILE A HD11 2  
ATOM 1457  H HD12 . ILE A 1 35 ? 0.139   9.203  20.569 1.00 0.00 ? 35 ILE A HD12 2  
ATOM 1458  H HD13 . ILE A 1 35 ? -0.159  7.565  19.989 1.00 0.00 ? 35 ILE A HD13 2  
ATOM 1459  N N    . MET A 1 36 ? -5.088  10.255 22.359 1.00 0.00 ? 36 MET A N    2  
ATOM 1460  C CA   . MET A 1 36 ? -6.519  10.539 22.063 1.00 0.00 ? 36 MET A CA   2  
ATOM 1461  C C    . MET A 1 36 ? -6.678  11.982 21.583 1.00 0.00 ? 36 MET A C    2  
ATOM 1462  O O    . MET A 1 36 ? -7.017  12.234 20.445 1.00 0.00 ? 36 MET A O    2  
ATOM 1463  C CB   . MET A 1 36 ? -7.253  10.338 23.386 1.00 0.00 ? 36 MET A CB   2  
ATOM 1464  C CG   . MET A 1 36 ? -7.611  8.860  23.553 1.00 0.00 ? 36 MET A CG   2  
ATOM 1465  S SD   . MET A 1 36 ? -8.970  8.438  22.435 1.00 0.00 ? 36 MET A SD   2  
ATOM 1466  C CE   . MET A 1 36 ? -8.657  6.657  22.360 1.00 0.00 ? 36 MET A CE   2  
ATOM 1467  H H    . MET A 1 36 ? -4.778  10.198 23.290 1.00 0.00 ? 36 MET A H    2  
ATOM 1468  H HA   . MET A 1 36 ? -6.896  9.850  21.323 1.00 0.00 ? 36 MET A HA   2  
ATOM 1469  H HB2  . MET A 1 36 ? -6.618  10.650 24.201 1.00 0.00 ? 36 MET A HB2  2  
ATOM 1470  H HB3  . MET A 1 36 ? -8.154  10.931 23.383 1.00 0.00 ? 36 MET A HB3  2  
ATOM 1471  H HG2  . MET A 1 36 ? -6.750  8.252  23.318 1.00 0.00 ? 36 MET A HG2  2  
ATOM 1472  H HG3  . MET A 1 36 ? -7.914  8.677  24.573 1.00 0.00 ? 36 MET A HG3  2  
ATOM 1473  H HE1  . MET A 1 36 ? -7.639  6.458  22.665 1.00 0.00 ? 36 MET A HE1  2  
ATOM 1474  H HE2  . MET A 1 36 ? -9.343  6.144  23.018 1.00 0.00 ? 36 MET A HE2  2  
ATOM 1475  H HE3  . MET A 1 36 ? -8.802  6.308  21.350 1.00 0.00 ? 36 MET A HE3  2  
ATOM 1476  N N    . PHE A 1 37 ? -6.431  12.938 22.440 1.00 0.00 ? 37 PHE A N    2  
ATOM 1477  C CA   . PHE A 1 37 ? -6.568  14.358 22.015 1.00 0.00 ? 37 PHE A CA   2  
ATOM 1478  C C    . PHE A 1 37 ? -5.892  14.538 20.648 1.00 0.00 ? 37 PHE A C    2  
ATOM 1479  O O    . PHE A 1 37 ? -6.474  15.072 19.725 1.00 0.00 ? 37 PHE A O    2  
ATOM 1480  C CB   . PHE A 1 37 ? -5.896  15.179 23.139 1.00 0.00 ? 37 PHE A CB   2  
ATOM 1481  C CG   . PHE A 1 37 ? -4.750  16.013 22.605 1.00 0.00 ? 37 PHE A CG   2  
ATOM 1482  C CD1  . PHE A 1 37 ? -3.480  15.446 22.465 1.00 0.00 ? 37 PHE A CD1  2  
ATOM 1483  C CD2  . PHE A 1 37 ? -4.964  17.346 22.242 1.00 0.00 ? 37 PHE A CD2  2  
ATOM 1484  C CE1  . PHE A 1 37 ? -2.425  16.209 21.963 1.00 0.00 ? 37 PHE A CE1  2  
ATOM 1485  C CE2  . PHE A 1 37 ? -3.909  18.111 21.737 1.00 0.00 ? 37 PHE A CE2  2  
ATOM 1486  C CZ   . PHE A 1 37 ? -2.638  17.541 21.596 1.00 0.00 ? 37 PHE A CZ   2  
ATOM 1487  H H    . PHE A 1 37 ? -6.154  12.721 23.356 1.00 0.00 ? 37 PHE A H    2  
ATOM 1488  H HA   . PHE A 1 37 ? -7.612  14.621 21.946 1.00 0.00 ? 37 PHE A HA   2  
ATOM 1489  H HB2  . PHE A 1 37 ? -6.631  15.835 23.583 1.00 0.00 ? 37 PHE A HB2  2  
ATOM 1490  H HB3  . PHE A 1 37 ? -5.520  14.505 23.895 1.00 0.00 ? 37 PHE A HB3  2  
ATOM 1491  H HD1  . PHE A 1 37 ? -3.315  14.419 22.749 1.00 0.00 ? 37 PHE A HD1  2  
ATOM 1492  H HD2  . PHE A 1 37 ? -5.943  17.785 22.356 1.00 0.00 ? 37 PHE A HD2  2  
ATOM 1493  H HE1  . PHE A 1 37 ? -1.443  15.770 21.854 1.00 0.00 ? 37 PHE A HE1  2  
ATOM 1494  H HE2  . PHE A 1 37 ? -4.072  19.141 21.456 1.00 0.00 ? 37 PHE A HE2  2  
ATOM 1495  H HZ   . PHE A 1 37 ? -1.825  18.126 21.205 1.00 0.00 ? 37 PHE A HZ   2  
ATOM 1496  N N    . ILE A 1 38 ? -4.677  14.079 20.504 1.00 0.00 ? 38 ILE A N    2  
ATOM 1497  C CA   . ILE A 1 38 ? -3.988  14.211 19.190 1.00 0.00 ? 38 ILE A CA   2  
ATOM 1498  C C    . ILE A 1 38 ? -4.886  13.656 18.083 1.00 0.00 ? 38 ILE A C    2  
ATOM 1499  O O    . ILE A 1 38 ? -4.946  14.187 16.992 1.00 0.00 ? 38 ILE A O    2  
ATOM 1500  C CB   . ILE A 1 38 ? -2.711  13.376 19.315 1.00 0.00 ? 38 ILE A CB   2  
ATOM 1501  C CG1  . ILE A 1 38 ? -1.743  14.062 20.281 1.00 0.00 ? 38 ILE A CG1  2  
ATOM 1502  C CG2  . ILE A 1 38 ? -2.050  13.243 17.941 1.00 0.00 ? 38 ILE A CG2  2  
ATOM 1503  C CD1  . ILE A 1 38 ? -0.364  13.407 20.178 1.00 0.00 ? 38 ILE A CD1  2  
ATOM 1504  H H    . ILE A 1 38 ? -4.225  13.637 21.251 1.00 0.00 ? 38 ILE A H    2  
ATOM 1505  H HA   . ILE A 1 38 ? -3.740  15.240 18.995 1.00 0.00 ? 38 ILE A HA   2  
ATOM 1506  H HB   . ILE A 1 38 ? -2.959  12.394 19.692 1.00 0.00 ? 38 ILE A HB   2  
ATOM 1507  H HG12 . ILE A 1 38 ? -1.664  15.109 20.028 1.00 0.00 ? 38 ILE A HG12 2  
ATOM 1508  H HG13 . ILE A 1 38 ? -2.112  13.964 21.291 1.00 0.00 ? 38 ILE A HG13 2  
ATOM 1509  H HG21 . ILE A 1 38 ? -2.808  13.091 17.187 1.00 0.00 ? 38 ILE A HG21 2  
ATOM 1510  H HG22 . ILE A 1 38 ? -1.498  14.145 17.719 1.00 0.00 ? 38 ILE A HG22 2  
ATOM 1511  H HG23 . ILE A 1 38 ? -1.374  12.400 17.947 1.00 0.00 ? 38 ILE A HG23 2  
ATOM 1512  H HD11 . ILE A 1 38 ? -0.457  12.447 19.690 1.00 0.00 ? 38 ILE A HD11 2  
ATOM 1513  H HD12 . ILE A 1 38 ? 0.294   14.040 19.604 1.00 0.00 ? 38 ILE A HD12 2  
ATOM 1514  H HD13 . ILE A 1 38 ? 0.043   13.268 21.169 1.00 0.00 ? 38 ILE A HD13 2  
ATOM 1515  N N    . ASN A 1 39 ? -5.592  12.594 18.361 1.00 0.00 ? 39 ASN A N    2  
ATOM 1516  C CA   . ASN A 1 39 ? -6.495  12.010 17.328 1.00 0.00 ? 39 ASN A CA   2  
ATOM 1517  C C    . ASN A 1 39 ? -7.683  12.944 17.095 1.00 0.00 ? 39 ASN A C    2  
ATOM 1518  O O    . ASN A 1 39 ? -8.143  13.120 15.985 1.00 0.00 ? 39 ASN A O    2  
ATOM 1519  C CB   . ASN A 1 39 ? -6.964  10.676 17.908 1.00 0.00 ? 39 ASN A CB   2  
ATOM 1520  C CG   . ASN A 1 39 ? -5.802  9.681  17.903 1.00 0.00 ? 39 ASN A CG   2  
ATOM 1521  O OD1  . ASN A 1 39 ? -4.867  9.824  17.140 1.00 0.00 ? 39 ASN A OD1  2  
ATOM 1522  N ND2  . ASN A 1 39 ? -5.821  8.670  18.728 1.00 0.00 ? 39 ASN A ND2  2  
ATOM 1523  H H    . ASN A 1 39 ? -5.534  12.186 19.252 1.00 0.00 ? 39 ASN A H    2  
ATOM 1524  H HA   . ASN A 1 39 ? -5.959  11.847 16.409 1.00 0.00 ? 39 ASN A HA   2  
ATOM 1525  H HB2  . ASN A 1 39 ? -7.307  10.824 18.921 1.00 0.00 ? 39 ASN A HB2  2  
ATOM 1526  H HB3  . ASN A 1 39 ? -7.773  10.287 17.308 1.00 0.00 ? 39 ASN A HB3  2  
ATOM 1527  H HD21 . ASN A 1 39 ? -6.576  8.555  19.343 1.00 0.00 ? 39 ASN A HD21 2  
ATOM 1528  H HD22 . ASN A 1 39 ? -5.081  8.027  18.732 1.00 0.00 ? 39 ASN A HD22 2  
ATOM 1529  N N    . LYS A 1 40 ? -8.172  13.551 18.139 1.00 0.00 ? 40 LYS A N    2  
ATOM 1530  C CA   . LYS A 1 40 ? -9.321  14.489 17.989 1.00 0.00 ? 40 LYS A CA   2  
ATOM 1531  C C    . LYS A 1 40 ? -8.802  15.865 17.574 1.00 0.00 ? 40 LYS A C    2  
ATOM 1532  O O    . LYS A 1 40 ? -9.535  16.699 17.084 1.00 0.00 ? 40 LYS A O    2  
ATOM 1533  C CB   . LYS A 1 40 ? -9.966  14.553 19.374 1.00 0.00 ? 40 LYS A CB   2  
ATOM 1534  C CG   . LYS A 1 40 ? -10.709 13.246 19.655 1.00 0.00 ? 40 LYS A CG   2  
ATOM 1535  C CD   . LYS A 1 40 ? -11.270 13.277 21.078 1.00 0.00 ? 40 LYS A CD   2  
ATOM 1536  C CE   . LYS A 1 40 ? -11.222 11.871 21.677 1.00 0.00 ? 40 LYS A CE   2  
ATOM 1537  N NZ   . LYS A 1 40 ? -12.052 11.953 22.912 1.00 0.00 ? 40 LYS A NZ   2  
ATOM 1538  H H    . LYS A 1 40 ? -7.776  13.400 19.021 1.00 0.00 ? 40 LYS A H    2  
ATOM 1539  H HA   . LYS A 1 40 ? -10.027 14.113 17.265 1.00 0.00 ? 40 LYS A HA   2  
ATOM 1540  H HB2  . LYS A 1 40 ? -9.201  14.700 20.120 1.00 0.00 ? 40 LYS A HB2  2  
ATOM 1541  H HB3  . LYS A 1 40 ? -10.664 15.377 19.407 1.00 0.00 ? 40 LYS A HB3  2  
ATOM 1542  H HG2  . LYS A 1 40 ? -11.519 13.133 18.949 1.00 0.00 ? 40 LYS A HG2  2  
ATOM 1543  H HG3  . LYS A 1 40 ? -10.026 12.416 19.555 1.00 0.00 ? 40 LYS A HG3  2  
ATOM 1544  H HD2  . LYS A 1 40 ? -10.677 13.948 21.684 1.00 0.00 ? 40 LYS A HD2  2  
ATOM 1545  H HD3  . LYS A 1 40 ? -12.293 13.624 21.054 1.00 0.00 ? 40 LYS A HD3  2  
ATOM 1546  H HE2  . LYS A 1 40 ? -11.643 11.153 20.988 1.00 0.00 ? 40 LYS A HE2  2  
ATOM 1547  H HE3  . LYS A 1 40 ? -10.205 11.602 21.926 1.00 0.00 ? 40 LYS A HE3  2  
ATOM 1548  H HZ1  . LYS A 1 40 ? -12.869 12.571 22.740 1.00 0.00 ? 40 LYS A HZ1  2  
ATOM 1549  H HZ2  . LYS A 1 40 ? -12.388 11.002 23.168 1.00 0.00 ? 40 LYS A HZ2  2  
ATOM 1550  H HZ3  . LYS A 1 40 ? -11.479 12.340 23.690 1.00 0.00 ? 40 LYS A HZ3  2  
ATOM 1551  N N    . CYS A 1 41 ? -7.535  16.102 17.769 1.00 0.00 ? 41 CYS A N    2  
ATOM 1552  C CA   . CYS A 1 41 ? -6.948  17.416 17.389 1.00 0.00 ? 41 CYS A CA   2  
ATOM 1553  C C    . CYS A 1 41 ? -7.336  17.771 15.953 1.00 0.00 ? 41 CYS A C    2  
ATOM 1554  O O    . CYS A 1 41 ? -8.085  18.696 15.709 1.00 0.00 ? 41 CYS A O    2  
ATOM 1555  C CB   . CYS A 1 41 ? -5.438  17.206 17.496 1.00 0.00 ? 41 CYS A CB   2  
ATOM 1556  S SG   . CYS A 1 41 ? -4.571  18.696 16.949 1.00 0.00 ? 41 CYS A SG   2  
ATOM 1557  H H    . CYS A 1 41 ? -6.966  15.409 18.165 1.00 0.00 ? 41 CYS A H    2  
ATOM 1558  H HA   . CYS A 1 41 ? -7.266  18.188 18.072 1.00 0.00 ? 41 CYS A HA   2  
ATOM 1559  H HB2  . CYS A 1 41 ? -5.178  16.993 18.521 1.00 0.00 ? 41 CYS A HB2  2  
ATOM 1560  H HB3  . CYS A 1 41 ? -5.148  16.373 16.874 1.00 0.00 ? 41 CYS A HB3  2  
ATOM 1561  N N    . ALA A 1 42 ? -6.827  17.040 15.003 1.00 0.00 ? 42 ALA A N    2  
ATOM 1562  C CA   . ALA A 1 42 ? -7.157  17.326 13.577 1.00 0.00 ? 42 ALA A CA   2  
ATOM 1563  C C    . ALA A 1 42 ? -8.649  17.092 13.317 1.00 0.00 ? 42 ALA A C    2  
ATOM 1564  O O    . ALA A 1 42 ? -9.261  17.759 12.507 1.00 0.00 ? 42 ALA A O    2  
ATOM 1565  C CB   . ALA A 1 42 ? -6.311  16.343 12.769 1.00 0.00 ? 42 ALA A CB   2  
ATOM 1566  H H    . ALA A 1 42 ? -6.223  16.301 15.230 1.00 0.00 ? 42 ALA A H    2  
ATOM 1567  H HA   . ALA A 1 42 ? -6.886  18.339 13.324 1.00 0.00 ? 42 ALA A HA   2  
ATOM 1568  H HB1  . ALA A 1 42 ? -5.442  16.059 13.344 1.00 0.00 ? 42 ALA A HB1  2  
ATOM 1569  H HB2  . ALA A 1 42 ? -5.996  16.810 11.848 1.00 0.00 ? 42 ALA A HB2  2  
ATOM 1570  H HB3  . ALA A 1 42 ? -6.897  15.463 12.545 1.00 0.00 ? 42 ALA A HB3  2  
ATOM 1571  N N    . THR A 1 43 ? -9.238  16.148 14.000 1.00 0.00 ? 43 THR A N    2  
ATOM 1572  C CA   . THR A 1 43 ? -10.688 15.870 13.793 1.00 0.00 ? 43 THR A CA   2  
ATOM 1573  C C    . THR A 1 43 ? -11.527 17.028 14.335 1.00 0.00 ? 43 THR A C    2  
ATOM 1574  O O    . THR A 1 43 ? -12.531 17.401 13.763 1.00 0.00 ? 43 THR A O    2  
ATOM 1575  C CB   . THR A 1 43 ? -10.964 14.590 14.585 1.00 0.00 ? 43 THR A CB   2  
ATOM 1576  O OG1  . THR A 1 43 ? -10.169 13.534 14.066 1.00 0.00 ? 43 THR A OG1  2  
ATOM 1577  C CG2  . THR A 1 43 ? -12.444 14.225 14.465 1.00 0.00 ? 43 THR A CG2  2  
ATOM 1578  H H    . THR A 1 43 ? -8.727  15.624 14.649 1.00 0.00 ? 43 THR A H    2  
ATOM 1579  H HA   . THR A 1 43 ? -10.896 15.709 12.747 1.00 0.00 ? 43 THR A HA   2  
ATOM 1580  H HB   . THR A 1 43 ? -10.720 14.750 15.624 1.00 0.00 ? 43 THR A HB   2  
ATOM 1581  H HG1  . THR A 1 43 ? -10.655 13.122 13.349 1.00 0.00 ? 43 THR A HG1  2  
ATOM 1582  H HG21 . THR A 1 43 ? -12.852 14.665 13.567 1.00 0.00 ? 43 THR A HG21 2  
ATOM 1583  H HG22 . THR A 1 43 ? -12.547 13.151 14.419 1.00 0.00 ? 43 THR A HG22 2  
ATOM 1584  H HG23 . THR A 1 43 ? -12.979 14.601 15.324 1.00 0.00 ? 43 THR A HG23 2  
ATOM 1585  N N    . CYS A 1 44 ? -11.121 17.602 15.434 1.00 0.00 ? 44 CYS A N    2  
ATOM 1586  C CA   . CYS A 1 44 ? -11.892 18.739 16.011 1.00 0.00 ? 44 CYS A CA   2  
ATOM 1587  C C    . CYS A 1 44 ? -11.613 20.011 15.210 1.00 0.00 ? 44 CYS A C    2  
ATOM 1588  O O    . CYS A 1 44 ? -12.447 20.888 15.105 1.00 0.00 ? 44 CYS A O    2  
ATOM 1589  C CB   . CYS A 1 44 ? -11.379 18.881 17.444 1.00 0.00 ? 44 CYS A CB   2  
ATOM 1590  S SG   . CYS A 1 44 ? -11.834 17.409 18.395 1.00 0.00 ? 44 CYS A SG   2  
ATOM 1591  H H    . CYS A 1 44 ? -10.307 17.287 15.877 1.00 0.00 ? 44 CYS A H    2  
ATOM 1592  H HA   . CYS A 1 44 ? -12.947 18.517 16.015 1.00 0.00 ? 44 CYS A HA   2  
ATOM 1593  H HB2  . CYS A 1 44 ? -10.304 18.984 17.433 1.00 0.00 ? 44 CYS A HB2  2  
ATOM 1594  H HB3  . CYS A 1 44 ? -11.821 19.755 17.900 1.00 0.00 ? 44 CYS A HB3  2  
ATOM 1595  N N    . LYS A 1 45 ? -10.443 20.115 14.640 1.00 0.00 ? 45 LYS A N    2  
ATOM 1596  C CA   . LYS A 1 45 ? -10.108 21.327 13.840 1.00 0.00 ? 45 LYS A CA   2  
ATOM 1597  C C    . LYS A 1 45 ? -11.047 21.434 12.637 1.00 0.00 ? 45 LYS A C    2  
ATOM 1598  O O    . LYS A 1 45 ? -11.556 22.493 12.327 1.00 0.00 ? 45 LYS A O    2  
ATOM 1599  C CB   . LYS A 1 45 ? -8.666  21.111 13.378 1.00 0.00 ? 45 LYS A CB   2  
ATOM 1600  C CG   . LYS A 1 45 ? -8.277  22.200 12.376 1.00 0.00 ? 45 LYS A CG   2  
ATOM 1601  C CD   . LYS A 1 45 ? -7.341  21.610 11.319 1.00 0.00 ? 45 LYS A CD   2  
ATOM 1602  C CE   . LYS A 1 45 ? -6.859  22.723 10.386 1.00 0.00 ? 45 LYS A CE   2  
ATOM 1603  N NZ   . LYS A 1 45 ? -5.895  22.057 9.465  1.00 0.00 ? 45 LYS A NZ   2  
ATOM 1604  H H    . LYS A 1 45 ? -9.786  19.395 14.735 1.00 0.00 ? 45 LYS A H    2  
ATOM 1605  H HA   . LYS A 1 45 ? -10.172 22.214 14.450 1.00 0.00 ? 45 LYS A HA   2  
ATOM 1606  H HB2  . LYS A 1 45 ? -8.005  21.155 14.231 1.00 0.00 ? 45 LYS A HB2  2  
ATOM 1607  H HB3  . LYS A 1 45 ? -8.581  20.142 12.907 1.00 0.00 ? 45 LYS A HB3  2  
ATOM 1608  H HG2  . LYS A 1 45 ? -9.165  22.585 11.895 1.00 0.00 ? 45 LYS A HG2  2  
ATOM 1609  H HG3  . LYS A 1 45 ? -7.774  23.003 12.894 1.00 0.00 ? 45 LYS A HG3  2  
ATOM 1610  H HD2  . LYS A 1 45 ? -6.491  21.155 11.805 1.00 0.00 ? 45 LYS A HD2  2  
ATOM 1611  H HD3  . LYS A 1 45 ? -7.871  20.864 10.746 1.00 0.00 ? 45 LYS A HD3  2  
ATOM 1612  H HE2  . LYS A 1 45 ? -7.689  23.131 9.828  1.00 0.00 ? 45 LYS A HE2  2  
ATOM 1613  H HE3  . LYS A 1 45 ? -6.366  23.500 10.950 1.00 0.00 ? 45 LYS A HE3  2  
ATOM 1614  H HZ1  . LYS A 1 45 ? -6.166  21.062 9.338  1.00 0.00 ? 45 LYS A HZ1  2  
ATOM 1615  H HZ2  . LYS A 1 45 ? -5.904  22.539 8.545  1.00 0.00 ? 45 LYS A HZ2  2  
ATOM 1616  H HZ3  . LYS A 1 45 ? -4.938  22.107 9.873  1.00 0.00 ? 45 LYS A HZ3  2  
ATOM 1617  N N    . MET A 1 46 ? -11.282 20.345 11.958 1.00 0.00 ? 46 MET A N    2  
ATOM 1618  C CA   . MET A 1 46 ? -12.189 20.390 10.776 1.00 0.00 ? 46 MET A CA   2  
ATOM 1619  C C    . MET A 1 46 ? -13.605 20.767 11.220 1.00 0.00 ? 46 MET A C    2  
ATOM 1620  O O    . MET A 1 46 ? -14.383 21.302 10.456 1.00 0.00 ? 46 MET A O    2  
ATOM 1621  C CB   . MET A 1 46 ? -12.165 18.975 10.196 1.00 0.00 ? 46 MET A CB   2  
ATOM 1622  C CG   . MET A 1 46 ? -12.618 17.974 11.261 1.00 0.00 ? 46 MET A CG   2  
ATOM 1623  S SD   . MET A 1 46 ? -13.773 16.792 10.522 1.00 0.00 ? 46 MET A SD   2  
ATOM 1624  C CE   . MET A 1 46 ? -12.699 16.229 9.180  1.00 0.00 ? 46 MET A CE   2  
ATOM 1625  H H    . MET A 1 46 ? -10.862 19.500 12.224 1.00 0.00 ? 46 MET A H    2  
ATOM 1626  H HA   . MET A 1 46 ? -11.822 21.094 10.048 1.00 0.00 ? 46 MET A HA   2  
ATOM 1627  H HB2  . MET A 1 46 ? -12.831 18.924 9.348  1.00 0.00 ? 46 MET A HB2  2  
ATOM 1628  H HB3  . MET A 1 46 ? -11.162 18.734 9.880  1.00 0.00 ? 46 MET A HB3  2  
ATOM 1629  H HG2  . MET A 1 46 ? -11.759 17.444 11.646 1.00 0.00 ? 46 MET A HG2  2  
ATOM 1630  H HG3  . MET A 1 46 ? -13.108 18.500 12.065 1.00 0.00 ? 46 MET A HG3  2  
ATOM 1631  H HE1  . MET A 1 46 ? -11.941 16.977 8.989  1.00 0.00 ? 46 MET A HE1  2  
ATOM 1632  H HE2  . MET A 1 46 ? -12.229 15.297 9.463  1.00 0.00 ? 46 MET A HE2  2  
ATOM 1633  H HE3  . MET A 1 46 ? -13.284 16.077 8.288  1.00 0.00 ? 46 MET A HE3  2  
ATOM 1634  N N    . ILE A 1 47 ? -13.939 20.498 12.451 1.00 0.00 ? 47 ILE A N    2  
ATOM 1635  C CA   . ILE A 1 47 ? -15.301 20.846 12.946 1.00 0.00 ? 47 ILE A CA   2  
ATOM 1636  C C    . ILE A 1 47 ? -15.551 22.345 12.763 1.00 0.00 ? 47 ILE A C    2  
ATOM 1637  O O    . ILE A 1 47 ? -16.613 22.763 12.347 1.00 0.00 ? 47 ILE A O    2  
ATOM 1638  C CB   . ILE A 1 47 ? -15.294 20.484 14.432 1.00 0.00 ? 47 ILE A CB   2  
ATOM 1639  C CG1  . ILE A 1 47 ? -14.886 19.018 14.603 1.00 0.00 ? 47 ILE A CG1  2  
ATOM 1640  C CG2  . ILE A 1 47 ? -16.692 20.693 15.015 1.00 0.00 ? 47 ILE A CG2  2  
ATOM 1641  C CD1  . ILE A 1 47 ? -15.669 18.148 13.617 1.00 0.00 ? 47 ILE A CD1  2  
ATOM 1642  H H    . ILE A 1 47 ? -13.293 20.070 13.051 1.00 0.00 ? 47 ILE A H    2  
ATOM 1643  H HA   . ILE A 1 47 ? -16.051 20.271 12.428 1.00 0.00 ? 47 ILE A HA   2  
ATOM 1644  H HB   . ILE A 1 47 ? -14.589 21.114 14.953 1.00 0.00 ? 47 ILE A HB   2  
ATOM 1645  H HG12 . ILE A 1 47 ? -13.829 18.914 14.414 1.00 0.00 ? 47 ILE A HG12 2  
ATOM 1646  H HG13 . ILE A 1 47 ? -15.103 18.699 15.612 1.00 0.00 ? 47 ILE A HG13 2  
ATOM 1647  H HG21 . ILE A 1 47 ? -17.291 21.263 14.320 1.00 0.00 ? 47 ILE A HG21 2  
ATOM 1648  H HG22 . ILE A 1 47 ? -17.158 19.735 15.190 1.00 0.00 ? 47 ILE A HG22 2  
ATOM 1649  H HG23 . ILE A 1 47 ? -16.616 21.231 15.950 1.00 0.00 ? 47 ILE A HG23 2  
ATOM 1650  H HD11 . ILE A 1 47 ? -15.484 18.492 12.609 1.00 0.00 ? 47 ILE A HD11 2  
ATOM 1651  H HD12 . ILE A 1 47 ? -15.350 17.121 13.711 1.00 0.00 ? 47 ILE A HD12 2  
ATOM 1652  H HD13 . ILE A 1 47 ? -16.724 18.218 13.833 1.00 0.00 ? 47 ILE A HD13 2  
ATOM 1653  N N    . LEU A 1 48 ? -14.574 23.156 13.064 1.00 0.00 ? 48 LEU A N    2  
ATOM 1654  C CA   . LEU A 1 48 ? -14.748 24.626 12.902 1.00 0.00 ? 48 LEU A CA   2  
ATOM 1655  C C    . LEU A 1 48 ? -14.805 24.984 11.416 1.00 0.00 ? 48 LEU A C    2  
ATOM 1656  O O    . LEU A 1 48 ? -15.573 25.827 10.999 1.00 0.00 ? 48 LEU A O    2  
ATOM 1657  C CB   . LEU A 1 48 ? -13.511 25.245 13.555 1.00 0.00 ? 48 LEU A CB   2  
ATOM 1658  C CG   . LEU A 1 48 ? -13.659 25.199 15.076 1.00 0.00 ? 48 LEU A CG   2  
ATOM 1659  C CD1  . LEU A 1 48 ? -14.929 25.946 15.489 1.00 0.00 ? 48 LEU A CD1  2  
ATOM 1660  C CD2  . LEU A 1 48 ? -13.750 23.743 15.536 1.00 0.00 ? 48 LEU A CD2  2  
ATOM 1661  H H    . LEU A 1 48 ? -13.722 22.797 13.393 1.00 0.00 ? 48 LEU A H    2  
ATOM 1662  H HA   . LEU A 1 48 ? -15.639 24.960 13.408 1.00 0.00 ? 48 LEU A HA   2  
ATOM 1663  H HB2  . LEU A 1 48 ? -12.633 24.690 13.261 1.00 0.00 ? 48 LEU A HB2  2  
ATOM 1664  H HB3  . LEU A 1 48 ? -13.412 26.272 13.234 1.00 0.00 ? 48 LEU A HB3  2  
ATOM 1665  H HG   . LEU A 1 48 ? -12.801 25.668 15.534 1.00 0.00 ? 48 LEU A HG   2  
ATOM 1666  H HD11 . LEU A 1 48 ? -15.200 26.650 14.715 1.00 0.00 ? 48 LEU A HD11 2  
ATOM 1667  H HD12 . LEU A 1 48 ? -15.733 25.238 15.629 1.00 0.00 ? 48 LEU A HD12 2  
ATOM 1668  H HD13 . LEU A 1 48 ? -14.751 26.476 16.412 1.00 0.00 ? 48 LEU A HD13 2  
ATOM 1669  H HD21 . LEU A 1 48 ? -12.964 23.168 15.067 1.00 0.00 ? 48 LEU A HD21 2  
ATOM 1670  H HD22 . LEU A 1 48 ? -13.639 23.697 16.609 1.00 0.00 ? 48 LEU A HD22 2  
ATOM 1671  H HD23 . LEU A 1 48 ? -14.710 23.336 15.255 1.00 0.00 ? 48 LEU A HD23 2  
ATOM 1672  N N    . GLU A 1 49 ? -13.996 24.347 10.613 1.00 0.00 ? 49 GLU A N    2  
ATOM 1673  C CA   . GLU A 1 49 ? -14.006 24.650 9.153  1.00 0.00 ? 49 GLU A CA   2  
ATOM 1674  C C    . GLU A 1 49 ? -15.369 24.301 8.553  1.00 0.00 ? 49 GLU A C    2  
ATOM 1675  O O    . GLU A 1 49 ? -15.802 24.892 7.584  1.00 0.00 ? 49 GLU A O    2  
ATOM 1676  C CB   . GLU A 1 49 ? -12.912 23.762 8.557  1.00 0.00 ? 49 GLU A CB   2  
ATOM 1677  C CG   . GLU A 1 49 ? -11.556 24.165 9.138  1.00 0.00 ? 49 GLU A CG   2  
ATOM 1678  C CD   . GLU A 1 49 ? -11.148 25.529 8.580  1.00 0.00 ? 49 GLU A CD   2  
ATOM 1679  O OE1  . GLU A 1 49 ? -11.213 25.698 7.373  1.00 0.00 ? 49 GLU A OE1  2  
ATOM 1680  O OE2  . GLU A 1 49 ? -10.777 26.383 9.368  1.00 0.00 ? 49 GLU A OE2  2  
ATOM 1681  H H    . GLU A 1 49 ? -13.384 23.668 10.971 1.00 0.00 ? 49 GLU A H    2  
ATOM 1682  H HA   . GLU A 1 49 ? -13.772 25.687 8.982  1.00 0.00 ? 49 GLU A HA   2  
ATOM 1683  H HB2  . GLU A 1 49 ? -13.116 22.730 8.800  1.00 0.00 ? 49 GLU A HB2  2  
ATOM 1684  H HB3  . GLU A 1 49 ? -12.896 23.883 7.484  1.00 0.00 ? 49 GLU A HB3  2  
ATOM 1685  H HG2  . GLU A 1 49 ? -11.628 24.223 10.214 1.00 0.00 ? 49 GLU A HG2  2  
ATOM 1686  H HG3  . GLU A 1 49 ? -10.815 23.428 8.866  1.00 0.00 ? 49 GLU A HG3  2  
ATOM 1687  N N    . LYS A 1 50 ? -16.049 23.344 9.122  1.00 0.00 ? 50 LYS A N    2  
ATOM 1688  C CA   . LYS A 1 50 ? -17.385 22.957 8.585  1.00 0.00 ? 50 LYS A CA   2  
ATOM 1689  C C    . LYS A 1 50 ? -18.335 24.156 8.620  1.00 0.00 ? 50 LYS A C    2  
ATOM 1690  O O    . LYS A 1 50 ? -18.983 24.476 7.643  1.00 0.00 ? 50 LYS A O    2  
ATOM 1691  C CB   . LYS A 1 50 ? -17.881 21.852 9.519  1.00 0.00 ? 50 LYS A CB   2  
ATOM 1692  C CG   . LYS A 1 50 ? -17.167 20.541 9.183  1.00 0.00 ? 50 LYS A CG   2  
ATOM 1693  C CD   . LYS A 1 50 ? -17.902 19.376 9.849  1.00 0.00 ? 50 LYS A CD   2  
ATOM 1694  C CE   . LYS A 1 50 ? -17.046 18.110 9.752  1.00 0.00 ? 50 LYS A CE   2  
ATOM 1695  N NZ   . LYS A 1 50 ? -17.767 17.100 10.577 1.00 0.00 ? 50 LYS A NZ   2  
ATOM 1696  H H    . LYS A 1 50 ? -15.680 22.881 9.903  1.00 0.00 ? 50 LYS A H    2  
ATOM 1697  H HA   . LYS A 1 50 ? -17.291 22.577 7.581  1.00 0.00 ? 50 LYS A HA   2  
ATOM 1698  H HB2  . LYS A 1 50 ? -17.670 22.124 10.542 1.00 0.00 ? 50 LYS A HB2  2  
ATOM 1699  H HB3  . LYS A 1 50 ? -18.945 21.725 9.391  1.00 0.00 ? 50 LYS A HB3  2  
ATOM 1700  H HG2  . LYS A 1 50 ? -17.159 20.398 8.114  1.00 0.00 ? 50 LYS A HG2  2  
ATOM 1701  H HG3  . LYS A 1 50 ? -16.151 20.580 9.548  1.00 0.00 ? 50 LYS A HG3  2  
ATOM 1702  H HD2  . LYS A 1 50 ? -18.082 19.610 10.887 1.00 0.00 ? 50 LYS A HD2  2  
ATOM 1703  H HD3  . LYS A 1 50 ? -18.844 19.211 9.348  1.00 0.00 ? 50 LYS A HD3  2  
ATOM 1704  H HE2  . LYS A 1 50 ? -16.978 17.780 8.727  1.00 0.00 ? 50 LYS A HE2  2  
ATOM 1705  H HE3  . LYS A 1 50 ? -16.061 18.292 10.156 1.00 0.00 ? 50 LYS A HE3  2  
ATOM 1706  H HZ1  . LYS A 1 50 ? -18.791 17.197 10.425 1.00 0.00 ? 50 LYS A HZ1  2  
ATOM 1707  H HZ2  . LYS A 1 50 ? -17.464 16.145 10.298 1.00 0.00 ? 50 LYS A HZ2  2  
ATOM 1708  H HZ3  . LYS A 1 50 ? -17.549 17.251 11.581 1.00 0.00 ? 50 LYS A HZ3  2  
ATOM 1709  N N    . GLU A 1 51 ? -18.424 24.821 9.739  1.00 0.00 ? 51 GLU A N    2  
ATOM 1710  C CA   . GLU A 1 51 ? -19.333 26.000 9.837  1.00 0.00 ? 51 GLU A CA   2  
ATOM 1711  C C    . GLU A 1 51 ? -18.794 27.155 8.989  1.00 0.00 ? 51 GLU A C    2  
ATOM 1712  O O    . GLU A 1 51 ? -19.515 28.066 8.633  1.00 0.00 ? 51 GLU A O    2  
ATOM 1713  C CB   . GLU A 1 51 ? -19.334 26.376 11.318 1.00 0.00 ? 51 GLU A CB   2  
ATOM 1714  C CG   . GLU A 1 51 ? -17.909 26.720 11.758 1.00 0.00 ? 51 GLU A CG   2  
ATOM 1715  C CD   . GLU A 1 51 ? -17.952 27.838 12.800 1.00 0.00 ? 51 GLU A CD   2  
ATOM 1716  O OE1  . GLU A 1 51 ? -18.972 28.502 12.886 1.00 0.00 ? 51 GLU A OE1  2  
ATOM 1717  O OE2  . GLU A 1 51 ? -16.965 28.011 13.495 1.00 0.00 ? 51 GLU A OE2  2  
ATOM 1718  H H    . GLU A 1 51 ? -17.893 24.547 10.516 1.00 0.00 ? 51 GLU A H    2  
ATOM 1719  H HA   . GLU A 1 51 ? -20.330 25.734 9.523  1.00 0.00 ? 51 GLU A HA   2  
ATOM 1720  H HB2  . GLU A 1 51 ? -19.974 27.233 11.471 1.00 0.00 ? 51 GLU A HB2  2  
ATOM 1721  H HB3  . GLU A 1 51 ? -19.700 25.545 11.901 1.00 0.00 ? 51 GLU A HB3  2  
ATOM 1722  H HG2  . GLU A 1 51 ? -17.445 25.844 12.187 1.00 0.00 ? 51 GLU A HG2  2  
ATOM 1723  H HG3  . GLU A 1 51 ? -17.337 27.048 10.901 1.00 0.00 ? 51 GLU A HG3  2  
ATOM 1724  N N    . ALA A 1 52 ? -17.531 27.124 8.662  1.00 0.00 ? 52 ALA A N    2  
ATOM 1725  C CA   . ALA A 1 52 ? -16.948 28.220 7.837  1.00 0.00 ? 52 ALA A CA   2  
ATOM 1726  C C    . ALA A 1 52 ? -17.537 28.191 6.425  1.00 0.00 ? 52 ALA A C    2  
ATOM 1727  O O    . ALA A 1 52 ? -17.460 29.155 5.690  1.00 0.00 ? 52 ALA A O    2  
ATOM 1728  C CB   . ALA A 1 52 ? -15.447 27.929 7.797  1.00 0.00 ? 52 ALA A CB   2  
ATOM 1729  H H    . ALA A 1 52 ? -16.966 26.380 8.959  1.00 0.00 ? 52 ALA A H    2  
ATOM 1730  H HA   . ALA A 1 52 ? -17.125 29.177 8.301  1.00 0.00 ? 52 ALA A HA   2  
ATOM 1731  H HB1  . ALA A 1 52 ? -15.264 26.930 8.161  1.00 0.00 ? 52 ALA A HB1  2  
ATOM 1732  H HB2  . ALA A 1 52 ? -15.091 28.014 6.782  1.00 0.00 ? 52 ALA A HB2  2  
ATOM 1733  H HB3  . ALA A 1 52 ? -14.926 28.641 8.422  1.00 0.00 ? 52 ALA A HB3  2  
ATOM 1734  N N    . LYS A 1 53 ? -18.127 27.092 6.041  1.00 0.00 ? 53 LYS A N    2  
ATOM 1735  C CA   . LYS A 1 53 ? -18.721 27.002 4.676  1.00 0.00 ? 53 LYS A CA   2  
ATOM 1736  C C    . LYS A 1 53 ? -20.113 27.643 4.662  1.00 0.00 ? 53 LYS A C    2  
ATOM 1737  O O    . LYS A 1 53 ? -20.498 28.293 3.711  1.00 0.00 ? 53 LYS A O    2  
ATOM 1738  C CB   . LYS A 1 53 ? -18.818 25.504 4.385  1.00 0.00 ? 53 LYS A CB   2  
ATOM 1739  C CG   . LYS A 1 53 ? -17.420 24.948 4.107  1.00 0.00 ? 53 LYS A CG   2  
ATOM 1740  C CD   . LYS A 1 53 ? -17.508 23.438 3.880  1.00 0.00 ? 53 LYS A CD   2  
ATOM 1741  C CE   . LYS A 1 53 ? -16.104 22.833 3.917  1.00 0.00 ? 53 LYS A CE   2  
ATOM 1742  N NZ   . LYS A 1 53 ? -16.304 21.384 3.636  1.00 0.00 ? 53 LYS A NZ   2  
ATOM 1743  H H    . LYS A 1 53 ? -18.179 26.326 6.649  1.00 0.00 ? 53 LYS A H    2  
ATOM 1744  H HA   . LYS A 1 53 ? -18.079 27.478 3.952  1.00 0.00 ? 53 LYS A HA   2  
ATOM 1745  H HB2  . LYS A 1 53 ? -19.244 24.998 5.238  1.00 0.00 ? 53 LYS A HB2  2  
ATOM 1746  H HB3  . LYS A 1 53 ? -19.447 25.345 3.520  1.00 0.00 ? 53 LYS A HB3  2  
ATOM 1747  H HG2  . LYS A 1 53 ? -17.012 25.422 3.226  1.00 0.00 ? 53 LYS A HG2  2  
ATOM 1748  H HG3  . LYS A 1 53 ? -16.778 25.149 4.953  1.00 0.00 ? 53 LYS A HG3  2  
ATOM 1749  H HD2  . LYS A 1 53 ? -18.112 22.992 4.657  1.00 0.00 ? 53 LYS A HD2  2  
ATOM 1750  H HD3  . LYS A 1 53 ? -17.958 23.244 2.919  1.00 0.00 ? 53 LYS A HD3  2  
ATOM 1751  H HE2  . LYS A 1 53 ? -15.481 23.282 3.156  1.00 0.00 ? 53 LYS A HE2  2  
ATOM 1752  H HE3  . LYS A 1 53 ? -15.661 22.969 4.893  1.00 0.00 ? 53 LYS A HE3  2  
ATOM 1753  H HZ1  . LYS A 1 53 ? -17.003 21.273 2.872  1.00 0.00 ? 53 LYS A HZ1  2  
ATOM 1754  H HZ2  . LYS A 1 53 ? -15.402 20.958 3.344  1.00 0.00 ? 53 LYS A HZ2  2  
ATOM 1755  H HZ3  . LYS A 1 53 ? -16.649 20.909 4.493  1.00 0.00 ? 53 LYS A HZ3  2  
ATOM 1756  N N    . SER A 1 54 ? -20.868 27.464 5.711  1.00 0.00 ? 54 SER A N    2  
ATOM 1757  C CA   . SER A 1 54 ? -22.233 28.063 5.758  1.00 0.00 ? 54 SER A CA   2  
ATOM 1758  C C    . SER A 1 54 ? -22.139 29.591 5.787  1.00 0.00 ? 54 SER A C    2  
ATOM 1759  O O    . SER A 1 54 ? -23.100 30.287 5.521  1.00 0.00 ? 54 SER A O    2  
ATOM 1760  C CB   . SER A 1 54 ? -22.852 27.538 7.053  1.00 0.00 ? 54 SER A CB   2  
ATOM 1761  O OG   . SER A 1 54 ? -22.110 28.022 8.162  1.00 0.00 ? 54 SER A OG   2  
ATOM 1762  H H    . SER A 1 54 ? -20.539 26.937 6.469  1.00 0.00 ? 54 SER A H    2  
ATOM 1763  H HA   . SER A 1 54 ? -22.817 27.737 4.912  1.00 0.00 ? 54 SER A HA   2  
ATOM 1764  H HB2  . SER A 1 54 ? -23.875 27.878 7.127  1.00 0.00 ? 54 SER A HB2  2  
ATOM 1765  H HB3  . SER A 1 54 ? -22.832 26.458 7.050  1.00 0.00 ? 54 SER A HB3  2  
ATOM 1766  H HG   . SER A 1 54 ? -22.000 28.969 8.055  1.00 0.00 ? 54 SER A HG   2  
ATOM 1767  N N    . GLN A 1 55 ? -20.990 30.118 6.109  1.00 0.00 ? 55 GLN A N    2  
ATOM 1768  C CA   . GLN A 1 55 ? -20.836 31.601 6.156  1.00 0.00 ? 55 GLN A CA   2  
ATOM 1769  C C    . GLN A 1 55 ? -19.824 32.061 5.102  1.00 0.00 ? 55 GLN A C    2  
ATOM 1770  O O    . GLN A 1 55 ? -20.191 32.110 3.940  1.00 0.00 ? 55 GLN A O    2  
ATOM 1771  C CB   . GLN A 1 55 ? -20.317 31.901 7.562  1.00 0.00 ? 55 GLN A CB   2  
ATOM 1772  C CG   . GLN A 1 55 ? -20.376 33.409 7.816  1.00 0.00 ? 55 GLN A CG   2  
ATOM 1773  C CD   . GLN A 1 55 ? -19.764 33.719 9.184  1.00 0.00 ? 55 GLN A CD   2  
ATOM 1774  O OE1  . GLN A 1 55 ? -20.360 33.441 10.206 1.00 0.00 ? 55 GLN A OE1  2  
ATOM 1775  N NE2  . GLN A 1 55 ? -18.591 34.288 9.247  1.00 0.00 ? 55 GLN A NE2  2  
ATOM 1776  O OXT  . GLN A 1 55 ? -18.701 32.355 5.477  1.00 0.00 ? 55 GLN A OXT  2  
ATOM 1777  H H    . GLN A 1 55 ? -20.227 29.539 6.320  1.00 0.00 ? 55 GLN A H    2  
ATOM 1778  H HA   . GLN A 1 55 ? -21.787 32.084 6.003  1.00 0.00 ? 55 GLN A HA   2  
ATOM 1779  H HB2  . GLN A 1 55 ? -20.931 31.390 8.289  1.00 0.00 ? 55 GLN A HB2  2  
ATOM 1780  H HB3  . GLN A 1 55 ? -19.296 31.561 7.651  1.00 0.00 ? 55 GLN A HB3  2  
ATOM 1781  H HG2  . GLN A 1 55 ? -19.821 33.925 7.048  1.00 0.00 ? 55 GLN A HG2  2  
ATOM 1782  H HG3  . GLN A 1 55 ? -21.405 33.737 7.800  1.00 0.00 ? 55 GLN A HG3  2  
ATOM 1783  H HE21 . GLN A 1 55 ? -18.111 34.511 8.422  1.00 0.00 ? 55 GLN A HE21 2  
ATOM 1784  H HE22 . GLN A 1 55 ? -18.191 34.491 10.118 1.00 0.00 ? 55 GLN A HE22 2  
ATOM 1785  N N    . LYS A 1 1  ? -27.475 16.245 14.179 1.00 0.00 ? 1  LYS A N    3  
ATOM 1786  C CA   . LYS A 1 1  ? -27.987 15.106 14.994 1.00 0.00 ? 1  LYS A CA   3  
ATOM 1787  C C    . LYS A 1 1  ? -27.583 15.279 16.460 1.00 0.00 ? 1  LYS A C    3  
ATOM 1788  O O    . LYS A 1 1  ? -28.272 14.842 17.360 1.00 0.00 ? 1  LYS A O    3  
ATOM 1789  C CB   . LYS A 1 1  ? -27.323 13.864 14.398 1.00 0.00 ? 1  LYS A CB   3  
ATOM 1790  C CG   . LYS A 1 1  ? -27.894 13.599 13.003 1.00 0.00 ? 1  LYS A CG   3  
ATOM 1791  C CD   . LYS A 1 1  ? -27.268 12.326 12.429 1.00 0.00 ? 1  LYS A CD   3  
ATOM 1792  C CE   . LYS A 1 1  ? -27.717 12.146 10.978 1.00 0.00 ? 1  LYS A CE   3  
ATOM 1793  N NZ   . LYS A 1 1  ? -26.914 10.998 10.470 1.00 0.00 ? 1  LYS A NZ   3  
ATOM 1794  H H1   . LYS A 1 1  ? -27.748 17.143 14.630 1.00 0.00 ? 1  LYS A H1   3  
ATOM 1795  H H2   . LYS A 1 1  ? -26.439 16.189 14.116 1.00 0.00 ? 1  LYS A H2   3  
ATOM 1796  H H3   . LYS A 1 1  ? -27.881 16.199 13.224 1.00 0.00 ? 1  LYS A H3   3  
ATOM 1797  H HA   . LYS A 1 1  ? -29.059 15.029 14.904 1.00 0.00 ? 1  LYS A HA   3  
ATOM 1798  H HB2  . LYS A 1 1  ? -26.257 14.024 14.326 1.00 0.00 ? 1  LYS A HB2  3  
ATOM 1799  H HB3  . LYS A 1 1  ? -27.516 13.012 15.033 1.00 0.00 ? 1  LYS A HB3  3  
ATOM 1800  H HG2  . LYS A 1 1  ? -28.965 13.475 13.071 1.00 0.00 ? 1  LYS A HG2  3  
ATOM 1801  H HG3  . LYS A 1 1  ? -27.669 14.434 12.357 1.00 0.00 ? 1  LYS A HG3  3  
ATOM 1802  H HD2  . LYS A 1 1  ? -26.192 12.405 12.467 1.00 0.00 ? 1  LYS A HD2  3  
ATOM 1803  H HD3  . LYS A 1 1  ? -27.587 11.474 13.013 1.00 0.00 ? 1  LYS A HD3  3  
ATOM 1804  H HE2  . LYS A 1 1  ? -28.772 11.914 10.937 1.00 0.00 ? 1  LYS A HE2  3  
ATOM 1805  H HE3  . LYS A 1 1  ? -27.504 13.037 10.405 1.00 0.00 ? 1  LYS A HE3  3  
ATOM 1806  H HZ1  . LYS A 1 1  ? -26.658 10.376 11.263 1.00 0.00 ? 1  LYS A HZ1  3  
ATOM 1807  H HZ2  . LYS A 1 1  ? -27.474 10.461 9.779  1.00 0.00 ? 1  LYS A HZ2  3  
ATOM 1808  H HZ3  . LYS A 1 1  ? -26.049 11.355 10.014 1.00 0.00 ? 1  LYS A HZ3  3  
ATOM 1809  N N    . ASN A 1 2  ? -26.470 15.916 16.708 1.00 0.00 ? 2  ASN A N    3  
ATOM 1810  C CA   . ASN A 1 2  ? -26.023 16.118 18.116 1.00 0.00 ? 2  ASN A CA   3  
ATOM 1811  C C    . ASN A 1 2  ? -26.564 17.445 18.655 1.00 0.00 ? 2  ASN A C    3  
ATOM 1812  O O    . ASN A 1 2  ? -26.323 18.497 18.096 1.00 0.00 ? 2  ASN A O    3  
ATOM 1813  C CB   . ASN A 1 2  ? -24.496 16.148 18.048 1.00 0.00 ? 2  ASN A CB   3  
ATOM 1814  C CG   . ASN A 1 2  ? -23.977 14.774 17.623 1.00 0.00 ? 2  ASN A CG   3  
ATOM 1815  O OD1  . ASN A 1 2  ? -24.091 13.814 18.359 1.00 0.00 ? 2  ASN A OD1  3  
ATOM 1816  N ND2  . ASN A 1 2  ? -23.406 14.637 16.457 1.00 0.00 ? 2  ASN A ND2  3  
ATOM 1817  H H    . ASN A 1 2  ? -25.928 16.261 15.967 1.00 0.00 ? 2  ASN A H    3  
ATOM 1818  H HA   . ASN A 1 2  ? -26.349 15.298 18.737 1.00 0.00 ? 2  ASN A HA   3  
ATOM 1819  H HB2  . ASN A 1 2  ? -24.183 16.890 17.328 1.00 0.00 ? 2  ASN A HB2  3  
ATOM 1820  H HB3  . ASN A 1 2  ? -24.097 16.399 19.019 1.00 0.00 ? 2  ASN A HB3  3  
ATOM 1821  H HD21 . ASN A 1 2  ? -23.314 15.411 15.863 1.00 0.00 ? 2  ASN A HD21 3  
ATOM 1822  H HD22 . ASN A 1 2  ? -23.069 13.760 16.176 1.00 0.00 ? 2  ASN A HD22 3  
ATOM 1823  N N    . GLU A 1 3  ? -27.293 17.406 19.737 1.00 0.00 ? 3  GLU A N    3  
ATOM 1824  C CA   . GLU A 1 3  ? -27.847 18.668 20.307 1.00 0.00 ? 3  GLU A CA   3  
ATOM 1825  C C    . GLU A 1 3  ? -26.717 19.540 20.862 1.00 0.00 ? 3  GLU A C    3  
ATOM 1826  O O    . GLU A 1 3  ? -26.925 20.676 21.238 1.00 0.00 ? 3  GLU A O    3  
ATOM 1827  C CB   . GLU A 1 3  ? -28.779 18.219 21.433 1.00 0.00 ? 3  GLU A CB   3  
ATOM 1828  C CG   . GLU A 1 3  ? -29.585 19.419 21.934 1.00 0.00 ? 3  GLU A CG   3  
ATOM 1829  C CD   . GLU A 1 3  ? -30.459 18.991 23.114 1.00 0.00 ? 3  GLU A CD   3  
ATOM 1830  O OE1  . GLU A 1 3  ? -31.132 17.981 22.991 1.00 0.00 ? 3  GLU A OE1  3  
ATOM 1831  O OE2  . GLU A 1 3  ? -30.440 19.680 24.120 1.00 0.00 ? 3  GLU A OE2  3  
ATOM 1832  H H    . GLU A 1 3  ? -27.476 16.548 20.173 1.00 0.00 ? 3  GLU A H    3  
ATOM 1833  H HA   . GLU A 1 3  ? -28.406 19.205 19.558 1.00 0.00 ? 3  GLU A HA   3  
ATOM 1834  H HB2  . GLU A 1 3  ? -29.453 17.461 21.062 1.00 0.00 ? 3  GLU A HB2  3  
ATOM 1835  H HB3  . GLU A 1 3  ? -28.194 17.814 22.245 1.00 0.00 ? 3  GLU A HB3  3  
ATOM 1836  H HG2  . GLU A 1 3  ? -28.909 20.199 22.251 1.00 0.00 ? 3  GLU A HG2  3  
ATOM 1837  H HG3  . GLU A 1 3  ? -30.213 19.789 21.136 1.00 0.00 ? 3  GLU A HG3  3  
ATOM 1838  N N    . ASP A 1 4  ? -25.522 19.017 20.916 1.00 0.00 ? 4  ASP A N    3  
ATOM 1839  C CA   . ASP A 1 4  ? -24.383 19.818 21.447 1.00 0.00 ? 4  ASP A CA   3  
ATOM 1840  C C    . ASP A 1 4  ? -23.721 20.612 20.319 1.00 0.00 ? 4  ASP A C    3  
ATOM 1841  O O    . ASP A 1 4  ? -23.177 21.676 20.532 1.00 0.00 ? 4  ASP A O    3  
ATOM 1842  C CB   . ASP A 1 4  ? -23.409 18.790 22.022 1.00 0.00 ? 4  ASP A CB   3  
ATOM 1843  C CG   . ASP A 1 4  ? -22.619 19.422 23.170 1.00 0.00 ? 4  ASP A CG   3  
ATOM 1844  O OD1  . ASP A 1 4  ? -22.666 20.634 23.298 1.00 0.00 ? 4  ASP A OD1  3  
ATOM 1845  O OD2  . ASP A 1 4  ? -21.981 18.683 23.902 1.00 0.00 ? 4  ASP A OD2  3  
ATOM 1846  H H    . ASP A 1 4  ? -25.374 18.099 20.608 1.00 0.00 ? 4  ASP A H    3  
ATOM 1847  H HA   . ASP A 1 4  ? -24.719 20.482 22.226 1.00 0.00 ? 4  ASP A HA   3  
ATOM 1848  H HB2  . ASP A 1 4  ? -23.961 17.938 22.391 1.00 0.00 ? 4  ASP A HB2  3  
ATOM 1849  H HB3  . ASP A 1 4  ? -22.726 18.469 21.249 1.00 0.00 ? 4  ASP A HB3  3  
ATOM 1850  N N    . GLN A 1 5  ? -23.760 20.100 19.119 1.00 0.00 ? 5  GLN A N    3  
ATOM 1851  C CA   . GLN A 1 5  ? -23.130 20.823 17.974 1.00 0.00 ? 5  GLN A CA   3  
ATOM 1852  C C    . GLN A 1 5  ? -21.609 20.796 18.119 1.00 0.00 ? 5  GLN A C    3  
ATOM 1853  O O    . GLN A 1 5  ? -20.917 20.110 17.394 1.00 0.00 ? 5  GLN A O    3  
ATOM 1854  C CB   . GLN A 1 5  ? -23.655 22.258 18.064 1.00 0.00 ? 5  GLN A CB   3  
ATOM 1855  C CG   . GLN A 1 5  ? -24.016 22.758 16.664 1.00 0.00 ? 5  GLN A CG   3  
ATOM 1856  C CD   . GLN A 1 5  ? -24.616 24.162 16.765 1.00 0.00 ? 5  GLN A CD   3  
ATOM 1857  O OE1  . GLN A 1 5  ? -25.821 24.321 16.767 1.00 0.00 ? 5  GLN A OE1  3  
ATOM 1858  N NE2  . GLN A 1 5  ? -23.822 25.194 16.849 1.00 0.00 ? 5  GLN A NE2  3  
ATOM 1859  H H    . GLN A 1 5  ? -24.202 19.238 18.970 1.00 0.00 ? 5  GLN A H    3  
ATOM 1860  H HA   . GLN A 1 5  ? -23.426 20.379 17.040 1.00 0.00 ? 5  GLN A HA   3  
ATOM 1861  H HB2  . GLN A 1 5  ? -24.533 22.281 18.691 1.00 0.00 ? 5  GLN A HB2  3  
ATOM 1862  H HB3  . GLN A 1 5  ? -22.893 22.894 18.488 1.00 0.00 ? 5  GLN A HB3  3  
ATOM 1863  H HG2  . GLN A 1 5  ? -23.126 22.791 16.052 1.00 0.00 ? 5  GLN A HG2  3  
ATOM 1864  H HG3  . GLN A 1 5  ? -24.736 22.090 16.216 1.00 0.00 ? 5  GLN A HG3  3  
ATOM 1865  H HE21 . GLN A 1 5  ? -22.851 25.065 16.849 1.00 0.00 ? 5  GLN A HE21 3  
ATOM 1866  H HE22 . GLN A 1 5  ? -24.198 26.097 16.914 1.00 0.00 ? 5  GLN A HE22 3  
ATOM 1867  N N    . GLU A 1 6  ? -21.087 21.533 19.056 1.00 0.00 ? 6  GLU A N    3  
ATOM 1868  C CA   . GLU A 1 6  ? -19.611 21.546 19.258 1.00 0.00 ? 6  GLU A CA   3  
ATOM 1869  C C    . GLU A 1 6  ? -19.152 20.193 19.806 1.00 0.00 ? 6  GLU A C    3  
ATOM 1870  O O    . GLU A 1 6  ? -18.591 20.104 20.880 1.00 0.00 ? 6  GLU A O    3  
ATOM 1871  C CB   . GLU A 1 6  ? -19.363 22.655 20.281 1.00 0.00 ? 6  GLU A CB   3  
ATOM 1872  C CG   . GLU A 1 6  ? -19.959 23.967 19.767 1.00 0.00 ? 6  GLU A CG   3  
ATOM 1873  C CD   . GLU A 1 6  ? -19.180 24.432 18.535 1.00 0.00 ? 6  GLU A CD   3  
ATOM 1874  O OE1  . GLU A 1 6  ? -18.010 24.102 18.438 1.00 0.00 ? 6  GLU A OE1  3  
ATOM 1875  O OE2  . GLU A 1 6  ? -19.768 25.112 17.709 1.00 0.00 ? 6  GLU A OE2  3  
ATOM 1876  H H    . GLU A 1 6  ? -21.667 22.072 19.631 1.00 0.00 ? 6  GLU A H    3  
ATOM 1877  H HA   . GLU A 1 6  ? -19.104 21.773 18.334 1.00 0.00 ? 6  GLU A HA   3  
ATOM 1878  H HB2  . GLU A 1 6  ? -19.828 22.391 21.219 1.00 0.00 ? 6  GLU A HB2  3  
ATOM 1879  H HB3  . GLU A 1 6  ? -18.299 22.776 20.428 1.00 0.00 ? 6  GLU A HB3  3  
ATOM 1880  H HG2  . GLU A 1 6  ? -20.994 23.812 19.501 1.00 0.00 ? 6  GLU A HG2  3  
ATOM 1881  H HG3  . GLU A 1 6  ? -19.894 24.719 20.539 1.00 0.00 ? 6  GLU A HG3  3  
ATOM 1882  N N    . MET A 1 7  ? -19.394 19.138 19.076 1.00 0.00 ? 7  MET A N    3  
ATOM 1883  C CA   . MET A 1 7  ? -18.979 17.787 19.553 1.00 0.00 ? 7  MET A CA   3  
ATOM 1884  C C    . MET A 1 7  ? -17.585 17.847 20.180 1.00 0.00 ? 7  MET A C    3  
ATOM 1885  O O    . MET A 1 7  ? -17.250 17.069 21.051 1.00 0.00 ? 7  MET A O    3  
ATOM 1886  C CB   . MET A 1 7  ? -18.960 16.914 18.297 1.00 0.00 ? 7  MET A CB   3  
ATOM 1887  C CG   . MET A 1 7  ? -20.394 16.630 17.850 1.00 0.00 ? 7  MET A CG   3  
ATOM 1888  S SD   . MET A 1 7  ? -20.368 15.642 16.334 1.00 0.00 ? 7  MET A SD   3  
ATOM 1889  C CE   . MET A 1 7  ? -19.926 14.062 17.098 1.00 0.00 ? 7  MET A CE   3  
ATOM 1890  H H    . MET A 1 7  ? -19.852 19.233 18.215 1.00 0.00 ? 7  MET A H    3  
ATOM 1891  H HA   . MET A 1 7  ? -19.697 17.400 20.258 1.00 0.00 ? 7  MET A HA   3  
ATOM 1892  H HB2  . MET A 1 7  ? -18.431 17.430 17.509 1.00 0.00 ? 7  MET A HB2  3  
ATOM 1893  H HB3  . MET A 1 7  ? -18.459 15.982 18.515 1.00 0.00 ? 7  MET A HB3  3  
ATOM 1894  H HG2  . MET A 1 7  ? -20.912 16.086 18.626 1.00 0.00 ? 7  MET A HG2  3  
ATOM 1895  H HG3  . MET A 1 7  ? -20.904 17.563 17.664 1.00 0.00 ? 7  MET A HG3  3  
ATOM 1896  H HE1  . MET A 1 7  ? -19.481 14.240 18.064 1.00 0.00 ? 7  MET A HE1  3  
ATOM 1897  H HE2  . MET A 1 7  ? -20.816 13.460 17.219 1.00 0.00 ? 7  MET A HE2  3  
ATOM 1898  H HE3  . MET A 1 7  ? -19.217 13.544 16.467 1.00 0.00 ? 7  MET A HE3  3  
ATOM 1899  N N    . CYS A 1 8  ? -16.767 18.764 19.741 1.00 0.00 ? 8  CYS A N    3  
ATOM 1900  C CA   . CYS A 1 8  ? -15.393 18.873 20.308 1.00 0.00 ? 8  CYS A CA   3  
ATOM 1901  C C    . CYS A 1 8  ? -15.349 19.949 21.396 1.00 0.00 ? 8  CYS A C    3  
ATOM 1902  O O    . CYS A 1 8  ? -15.626 21.107 21.149 1.00 0.00 ? 8  CYS A O    3  
ATOM 1903  C CB   . CYS A 1 8  ? -14.513 19.269 19.122 1.00 0.00 ? 8  CYS A CB   3  
ATOM 1904  S SG   . CYS A 1 8  ? -12.854 19.680 19.711 1.00 0.00 ? 8  CYS A SG   3  
ATOM 1905  H H    . CYS A 1 8  ? -17.056 19.380 19.035 1.00 0.00 ? 8  CYS A H    3  
ATOM 1906  H HA   . CYS A 1 8  ? -15.072 17.923 20.703 1.00 0.00 ? 8  CYS A HA   3  
ATOM 1907  H HB2  . CYS A 1 8  ? -14.455 18.445 18.427 1.00 0.00 ? 8  CYS A HB2  3  
ATOM 1908  H HB3  . CYS A 1 8  ? -14.942 20.128 18.627 1.00 0.00 ? 8  CYS A HB3  3  
ATOM 1909  N N    . HIS A 1 9  ? -15.002 19.577 22.598 1.00 0.00 ? 9  HIS A N    3  
ATOM 1910  C CA   . HIS A 1 9  ? -14.939 20.581 23.700 1.00 0.00 ? 9  HIS A CA   3  
ATOM 1911  C C    . HIS A 1 9  ? -13.534 20.615 24.307 1.00 0.00 ? 9  HIS A C    3  
ATOM 1912  O O    . HIS A 1 9  ? -13.135 21.586 24.920 1.00 0.00 ? 9  HIS A O    3  
ATOM 1913  C CB   . HIS A 1 9  ? -15.958 20.099 24.733 1.00 0.00 ? 9  HIS A CB   3  
ATOM 1914  C CG   . HIS A 1 9  ? -17.325 20.056 24.108 1.00 0.00 ? 9  HIS A CG   3  
ATOM 1915  N ND1  . HIS A 1 9  ? -17.977 18.863 23.837 1.00 0.00 ? 9  HIS A ND1  3  
ATOM 1916  C CD2  . HIS A 1 9  ? -18.176 21.050 23.694 1.00 0.00 ? 9  HIS A CD2  3  
ATOM 1917  C CE1  . HIS A 1 9  ? -19.165 19.167 23.284 1.00 0.00 ? 9  HIS A CE1  3  
ATOM 1918  N NE2  . HIS A 1 9  ? -19.338 20.487 23.173 1.00 0.00 ? 9  HIS A NE2  3  
ATOM 1919  H H    . HIS A 1 9  ? -14.781 18.639 22.777 1.00 0.00 ? 9  HIS A H    3  
ATOM 1920  H HA   . HIS A 1 9  ? -15.216 21.557 23.337 1.00 0.00 ? 9  HIS A HA   3  
ATOM 1921  H HB2  . HIS A 1 9  ? -15.686 19.110 25.074 1.00 0.00 ? 9  HIS A HB2  3  
ATOM 1922  H HB3  . HIS A 1 9  ? -15.968 20.778 25.573 1.00 0.00 ? 9  HIS A HB3  3  
ATOM 1923  H HD1  . HIS A 1 9  ? -17.635 17.961 24.015 1.00 0.00 ? 9  HIS A HD1  3  
ATOM 1924  H HD2  . HIS A 1 9  ? -17.975 22.109 23.762 1.00 0.00 ? 9  HIS A HD2  3  
ATOM 1925  H HE1  . HIS A 1 9  ? -19.892 18.433 22.967 1.00 0.00 ? 9  HIS A HE1  3  
ATOM 1926  N N    . GLU A 1 10 ? -12.780 19.561 24.145 1.00 0.00 ? 10 GLU A N    3  
ATOM 1927  C CA   . GLU A 1 10 ? -11.402 19.537 24.714 1.00 0.00 ? 10 GLU A CA   3  
ATOM 1928  C C    . GLU A 1 10 ? -10.524 20.578 24.015 1.00 0.00 ? 10 GLU A C    3  
ATOM 1929  O O    . GLU A 1 10 ? -9.777  21.299 24.646 1.00 0.00 ? 10 GLU A O    3  
ATOM 1930  C CB   . GLU A 1 10 ? -10.883 18.126 24.439 1.00 0.00 ? 10 GLU A CB   3  
ATOM 1931  C CG   . GLU A 1 10 ? -9.440  18.008 24.938 1.00 0.00 ? 10 GLU A CG   3  
ATOM 1932  C CD   . GLU A 1 10 ? -8.967  16.560 24.792 1.00 0.00 ? 10 GLU A CD   3  
ATOM 1933  O OE1  . GLU A 1 10 ? -9.814  15.689 24.694 1.00 0.00 ? 10 GLU A OE1  3  
ATOM 1934  O OE2  . GLU A 1 10 ? -7.766  16.350 24.782 1.00 0.00 ? 10 GLU A OE2  3  
ATOM 1935  H H    . GLU A 1 10 ? -13.120 18.788 23.649 1.00 0.00 ? 10 GLU A H    3  
ATOM 1936  H HA   . GLU A 1 10 ? -11.429 19.720 25.777 1.00 0.00 ? 10 GLU A HA   3  
ATOM 1937  H HB2  . GLU A 1 10 ? -11.501 17.408 24.958 1.00 0.00 ? 10 GLU A HB2  3  
ATOM 1938  H HB3  . GLU A 1 10 ? -10.914 17.931 23.378 1.00 0.00 ? 10 GLU A HB3  3  
ATOM 1939  H HG2  . GLU A 1 10 ? -8.803  18.656 24.352 1.00 0.00 ? 10 GLU A HG2  3  
ATOM 1940  H HG3  . GLU A 1 10 ? -9.393  18.300 25.976 1.00 0.00 ? 10 GLU A HG3  3  
ATOM 1941  N N    . PHE A 1 11 ? -10.609 20.664 22.715 1.00 0.00 ? 11 PHE A N    3  
ATOM 1942  C CA   . PHE A 1 11 ? -9.780  21.661 21.980 1.00 0.00 ? 11 PHE A CA   3  
ATOM 1943  C C    . PHE A 1 11 ? -10.459 23.031 22.004 1.00 0.00 ? 11 PHE A C    3  
ATOM 1944  O O    . PHE A 1 11 ? -9.834  24.045 21.776 1.00 0.00 ? 11 PHE A O    3  
ATOM 1945  C CB   . PHE A 1 11 ? -9.703  21.144 20.548 1.00 0.00 ? 11 PHE A CB   3  
ATOM 1946  C CG   . PHE A 1 11 ? -8.721  19.999 20.466 1.00 0.00 ? 11 PHE A CG   3  
ATOM 1947  C CD1  . PHE A 1 11 ? -9.150  18.688 20.704 1.00 0.00 ? 11 PHE A CD1  3  
ATOM 1948  C CD2  . PHE A 1 11 ? -7.382  20.249 20.140 1.00 0.00 ? 11 PHE A CD2  3  
ATOM 1949  C CE1  . PHE A 1 11 ? -8.241  17.629 20.618 1.00 0.00 ? 11 PHE A CE1  3  
ATOM 1950  C CE2  . PHE A 1 11 ? -6.473  19.189 20.055 1.00 0.00 ? 11 PHE A CE2  3  
ATOM 1951  C CZ   . PHE A 1 11 ? -6.904  17.880 20.292 1.00 0.00 ? 11 PHE A CZ   3  
ATOM 1952  H H    . PHE A 1 11 ? -11.219 20.075 22.223 1.00 0.00 ? 11 PHE A H    3  
ATOM 1953  H HA   . PHE A 1 11 ? -8.792  21.721 22.407 1.00 0.00 ? 11 PHE A HA   3  
ATOM 1954  H HB2  . PHE A 1 11 ? -10.677 20.808 20.241 1.00 0.00 ? 11 PHE A HB2  3  
ATOM 1955  H HB3  . PHE A 1 11 ? -9.378  21.942 19.898 1.00 0.00 ? 11 PHE A HB3  3  
ATOM 1956  H HD1  . PHE A 1 11 ? -10.181 18.494 20.957 1.00 0.00 ? 11 PHE A HD1  3  
ATOM 1957  H HD2  . PHE A 1 11 ? -7.051  21.260 19.959 1.00 0.00 ? 11 PHE A HD2  3  
ATOM 1958  H HE1  . PHE A 1 11 ? -8.571  16.617 20.802 1.00 0.00 ? 11 PHE A HE1  3  
ATOM 1959  H HE2  . PHE A 1 11 ? -5.441  19.382 19.804 1.00 0.00 ? 11 PHE A HE2  3  
ATOM 1960  H HZ   . PHE A 1 11 ? -6.202  17.064 20.227 1.00 0.00 ? 11 PHE A HZ   3  
ATOM 1961  N N    . GLN A 1 12 ? -11.736 23.071 22.274 1.00 0.00 ? 12 GLN A N    3  
ATOM 1962  C CA   . GLN A 1 12 ? -12.439 24.384 22.306 1.00 0.00 ? 12 GLN A CA   3  
ATOM 1963  C C    . GLN A 1 12 ? -11.611 25.385 23.110 1.00 0.00 ? 12 GLN A C    3  
ATOM 1964  O O    . GLN A 1 12 ? -11.502 26.540 22.758 1.00 0.00 ? 12 GLN A O    3  
ATOM 1965  C CB   . GLN A 1 12 ? -13.775 24.115 22.998 1.00 0.00 ? 12 GLN A CB   3  
ATOM 1966  C CG   . GLN A 1 12 ? -14.574 25.418 23.074 1.00 0.00 ? 12 GLN A CG   3  
ATOM 1967  C CD   . GLN A 1 12 ? -15.859 25.185 23.870 1.00 0.00 ? 12 GLN A CD   3  
ATOM 1968  O OE1  . GLN A 1 12 ? -16.014 24.164 24.510 1.00 0.00 ? 12 GLN A OE1  3  
ATOM 1969  N NE2  . GLN A 1 12 ? -16.795 26.095 23.857 1.00 0.00 ? 12 GLN A NE2  3  
ATOM 1970  H H    . GLN A 1 12 ? -12.229 22.242 22.453 1.00 0.00 ? 12 GLN A H    3  
ATOM 1971  H HA   . GLN A 1 12 ? -12.606 24.748 21.305 1.00 0.00 ? 12 GLN A HA   3  
ATOM 1972  H HB2  . GLN A 1 12 ? -14.332 23.383 22.433 1.00 0.00 ? 12 GLN A HB2  3  
ATOM 1973  H HB3  . GLN A 1 12 ? -13.597 23.741 23.995 1.00 0.00 ? 12 GLN A HB3  3  
ATOM 1974  H HG2  . GLN A 1 12 ? -13.979 26.177 23.563 1.00 0.00 ? 12 GLN A HG2  3  
ATOM 1975  H HG3  . GLN A 1 12 ? -14.822 25.747 22.075 1.00 0.00 ? 12 GLN A HG3  3  
ATOM 1976  H HE21 . GLN A 1 12 ? -16.670 26.919 23.341 1.00 0.00 ? 12 GLN A HE21 3  
ATOM 1977  H HE22 . GLN A 1 12 ? -17.622 25.955 24.363 1.00 0.00 ? 12 GLN A HE22 3  
ATOM 1978  N N    . ALA A 1 13 ? -11.020 24.944 24.185 1.00 0.00 ? 13 ALA A N    3  
ATOM 1979  C CA   . ALA A 1 13 ? -10.191 25.866 25.009 1.00 0.00 ? 13 ALA A CA   3  
ATOM 1980  C C    . ALA A 1 13 ? -9.008  26.376 24.183 1.00 0.00 ? 13 ALA A C    3  
ATOM 1981  O O    . ALA A 1 13 ? -8.411  27.388 24.495 1.00 0.00 ? 13 ALA A O    3  
ATOM 1982  C CB   . ALA A 1 13 ? -9.704  25.019 26.183 1.00 0.00 ? 13 ALA A CB   3  
ATOM 1983  H H    . ALA A 1 13 ? -11.117 24.005 24.449 1.00 0.00 ? 13 ALA A H    3  
ATOM 1984  H HA   . ALA A 1 13 ? -10.786 26.691 25.370 1.00 0.00 ? 13 ALA A HA   3  
ATOM 1985  H HB1  . ALA A 1 13 ? -9.004  25.591 26.775 1.00 0.00 ? 13 ALA A HB1  3  
ATOM 1986  H HB2  . ALA A 1 13 ? -9.215  24.131 25.808 1.00 0.00 ? 13 ALA A HB2  3  
ATOM 1987  H HB3  . ALA A 1 13 ? -10.546 24.734 26.796 1.00 0.00 ? 13 ALA A HB3  3  
ATOM 1988  N N    . PHE A 1 14 ? -8.663  25.680 23.132 1.00 0.00 ? 14 PHE A N    3  
ATOM 1989  C CA   . PHE A 1 14 ? -7.520  26.123 22.290 1.00 0.00 ? 14 PHE A CA   3  
ATOM 1990  C C    . PHE A 1 14 ? -8.013  27.007 21.140 1.00 0.00 ? 14 PHE A C    3  
ATOM 1991  O O    . PHE A 1 14 ? -7.320  27.207 20.162 1.00 0.00 ? 14 PHE A O    3  
ATOM 1992  C CB   . PHE A 1 14 ? -6.917  24.832 21.740 1.00 0.00 ? 14 PHE A CB   3  
ATOM 1993  C CG   . PHE A 1 14 ? -6.671  23.856 22.866 1.00 0.00 ? 14 PHE A CG   3  
ATOM 1994  C CD1  . PHE A 1 14 ? -6.520  24.316 24.179 1.00 0.00 ? 14 PHE A CD1  3  
ATOM 1995  C CD2  . PHE A 1 14 ? -6.591  22.486 22.591 1.00 0.00 ? 14 PHE A CD2  3  
ATOM 1996  C CE1  . PHE A 1 14 ? -6.290  23.405 25.218 1.00 0.00 ? 14 PHE A CE1  3  
ATOM 1997  C CE2  . PHE A 1 14 ? -6.362  21.575 23.628 1.00 0.00 ? 14 PHE A CE2  3  
ATOM 1998  C CZ   . PHE A 1 14 ? -6.211  22.034 24.942 1.00 0.00 ? 14 PHE A CZ   3  
ATOM 1999  H H    . PHE A 1 14 ? -9.155  24.864 22.897 1.00 0.00 ? 14 PHE A H    3  
ATOM 2000  H HA   . PHE A 1 14 ? -6.791  26.646 22.887 1.00 0.00 ? 14 PHE A HA   3  
ATOM 2001  H HB2  . PHE A 1 14 ? -7.599  24.394 21.026 1.00 0.00 ? 14 PHE A HB2  3  
ATOM 2002  H HB3  . PHE A 1 14 ? -5.984  25.056 21.250 1.00 0.00 ? 14 PHE A HB3  3  
ATOM 2003  H HD1  . PHE A 1 14 ? -6.581  25.373 24.392 1.00 0.00 ? 14 PHE A HD1  3  
ATOM 2004  H HD2  . PHE A 1 14 ? -6.708  22.131 21.577 1.00 0.00 ? 14 PHE A HD2  3  
ATOM 2005  H HE1  . PHE A 1 14 ? -6.175  23.759 26.232 1.00 0.00 ? 14 PHE A HE1  3  
ATOM 2006  H HE2  . PHE A 1 14 ? -6.302  20.518 23.414 1.00 0.00 ? 14 PHE A HE2  3  
ATOM 2007  H HZ   . PHE A 1 14 ? -6.034  21.331 25.742 1.00 0.00 ? 14 PHE A HZ   3  
ATOM 2008  N N    . MET A 1 15 ? -9.205  27.530 21.238 1.00 0.00 ? 15 MET A N    3  
ATOM 2009  C CA   . MET A 1 15 ? -9.727  28.384 20.139 1.00 0.00 ? 15 MET A CA   3  
ATOM 2010  C C    . MET A 1 15 ? -9.557  29.871 20.477 1.00 0.00 ? 15 MET A C    3  
ATOM 2011  O O    . MET A 1 15 ? -10.140 30.381 21.412 1.00 0.00 ? 15 MET A O    3  
ATOM 2012  C CB   . MET A 1 15 ? -11.207 28.011 20.029 1.00 0.00 ? 15 MET A CB   3  
ATOM 2013  C CG   . MET A 1 15 ? -11.998 28.654 21.172 1.00 0.00 ? 15 MET A CG   3  
ATOM 2014  S SD   . MET A 1 15 ? -13.627 27.874 21.292 1.00 0.00 ? 15 MET A SD   3  
ATOM 2015  C CE   . MET A 1 15 ? -14.299 28.508 19.734 1.00 0.00 ? 15 MET A CE   3  
ATOM 2016  H H    . MET A 1 15 ? -9.759  27.354 22.024 1.00 0.00 ? 15 MET A H    3  
ATOM 2017  H HA   . MET A 1 15 ? -9.222  28.151 19.213 1.00 0.00 ? 15 MET A HA   3  
ATOM 2018  H HB2  . MET A 1 15 ? -11.592 28.360 19.088 1.00 0.00 ? 15 MET A HB2  3  
ATOM 2019  H HB3  . MET A 1 15 ? -11.311 26.938 20.083 1.00 0.00 ? 15 MET A HB3  3  
ATOM 2020  H HG2  . MET A 1 15 ? -11.466 28.520 22.101 1.00 0.00 ? 15 MET A HG2  3  
ATOM 2021  H HG3  . MET A 1 15 ? -12.118 29.710 20.976 1.00 0.00 ? 15 MET A HG3  3  
ATOM 2022  H HE1  . MET A 1 15 ? -13.635 29.264 19.339 1.00 0.00 ? 15 MET A HE1  3  
ATOM 2023  H HE2  . MET A 1 15 ? -14.387 27.702 19.025 1.00 0.00 ? 15 MET A HE2  3  
ATOM 2024  H HE3  . MET A 1 15 ? -15.276 28.936 19.913 1.00 0.00 ? 15 MET A HE3  3  
ATOM 2025  N N    . LYS A 1 16 ? -8.761  30.570 19.714 1.00 0.00 ? 16 LYS A N    3  
ATOM 2026  C CA   . LYS A 1 16 ? -8.554  32.023 19.976 1.00 0.00 ? 16 LYS A CA   3  
ATOM 2027  C C    . LYS A 1 16 ? -9.488  32.847 19.089 1.00 0.00 ? 16 LYS A C    3  
ATOM 2028  O O    . LYS A 1 16 ? -9.131  33.247 17.998 1.00 0.00 ? 16 LYS A O    3  
ATOM 2029  C CB   . LYS A 1 16 ? -7.093  32.292 19.611 1.00 0.00 ? 16 LYS A CB   3  
ATOM 2030  C CG   . LYS A 1 16 ? -6.662  33.640 20.194 1.00 0.00 ? 16 LYS A CG   3  
ATOM 2031  C CD   . LYS A 1 16 ? -6.167  34.551 19.070 1.00 0.00 ? 16 LYS A CD   3  
ATOM 2032  C CE   . LYS A 1 16 ? -5.496  35.787 19.671 1.00 0.00 ? 16 LYS A CE   3  
ATOM 2033  N NZ   . LYS A 1 16 ? -4.266  35.991 18.855 1.00 0.00 ? 16 LYS A NZ   3  
ATOM 2034  H H    . LYS A 1 16 ? -8.303  30.141 18.964 1.00 0.00 ? 16 LYS A H    3  
ATOM 2035  H HA   . LYS A 1 16 ? -8.724  32.247 21.018 1.00 0.00 ? 16 LYS A HA   3  
ATOM 2036  H HB2  . LYS A 1 16 ? -6.470  31.510 20.015 1.00 0.00 ? 16 LYS A HB2  3  
ATOM 2037  H HB3  . LYS A 1 16 ? -6.990  32.316 18.536 1.00 0.00 ? 16 LYS A HB3  3  
ATOM 2038  H HG2  . LYS A 1 16 ? -7.503  34.104 20.689 1.00 0.00 ? 16 LYS A HG2  3  
ATOM 2039  H HG3  . LYS A 1 16 ? -5.867  33.485 20.909 1.00 0.00 ? 16 LYS A HG3  3  
ATOM 2040  H HD2  . LYS A 1 16 ? -5.453  34.014 18.460 1.00 0.00 ? 16 LYS A HD2  3  
ATOM 2041  H HD3  . LYS A 1 16 ? -7.004  34.857 18.459 1.00 0.00 ? 16 LYS A HD3  3  
ATOM 2042  H HE2  . LYS A 1 16 ? -6.148  36.644 19.592 1.00 0.00 ? 16 LYS A HE2  3  
ATOM 2043  H HE3  . LYS A 1 16 ? -5.236  35.607 20.705 1.00 0.00 ? 16 LYS A HE3  3  
ATOM 2044  H HZ1  . LYS A 1 16 ? -3.797  35.077 18.700 1.00 0.00 ? 16 LYS A HZ1  3  
ATOM 2045  H HZ2  . LYS A 1 16 ? -4.525  36.409 17.938 1.00 0.00 ? 16 LYS A HZ2  3  
ATOM 2046  H HZ3  . LYS A 1 16 ? -3.618  36.630 19.357 1.00 0.00 ? 16 LYS A HZ3  3  
ATOM 2047  N N    . ASN A 1 17 ? -10.684 33.098 19.544 1.00 0.00 ? 17 ASN A N    3  
ATOM 2048  C CA   . ASN A 1 17 ? -11.645 33.891 18.726 1.00 0.00 ? 17 ASN A CA   3  
ATOM 2049  C C    . ASN A 1 17 ? -11.883 33.208 17.376 1.00 0.00 ? 17 ASN A C    3  
ATOM 2050  O O    . ASN A 1 17 ? -11.769 33.817 16.331 1.00 0.00 ? 17 ASN A O    3  
ATOM 2051  C CB   . ASN A 1 17 ? -10.976 35.251 18.531 1.00 0.00 ? 17 ASN A CB   3  
ATOM 2052  C CG   . ASN A 1 17 ? -10.654 35.861 19.897 1.00 0.00 ? 17 ASN A CG   3  
ATOM 2053  O OD1  . ASN A 1 17 ? -11.500 35.913 20.768 1.00 0.00 ? 17 ASN A OD1  3  
ATOM 2054  N ND2  . ASN A 1 17 ? -9.458  36.329 20.122 1.00 0.00 ? 17 ASN A ND2  3  
ATOM 2055  H H    . ASN A 1 17 ? -10.953 32.763 20.423 1.00 0.00 ? 17 ASN A H    3  
ATOM 2056  H HA   . ASN A 1 17 ? -12.577 34.010 19.253 1.00 0.00 ? 17 ASN A HA   3  
ATOM 2057  H HB2  . ASN A 1 17 ? -10.063 35.126 17.971 1.00 0.00 ? 17 ASN A HB2  3  
ATOM 2058  H HB3  . ASN A 1 17 ? -11.643 35.907 17.993 1.00 0.00 ? 17 ASN A HB3  3  
ATOM 2059  H HD21 . ASN A 1 17 ? -8.775  36.288 19.419 1.00 0.00 ? 17 ASN A HD21 3  
ATOM 2060  H HD22 . ASN A 1 17 ? -9.241  36.721 20.992 1.00 0.00 ? 17 ASN A HD22 3  
ATOM 2061  N N    . GLY A 1 18 ? -12.219 31.948 17.393 1.00 0.00 ? 18 GLY A N    3  
ATOM 2062  C CA   . GLY A 1 18 ? -12.473 31.224 16.114 1.00 0.00 ? 18 GLY A CA   3  
ATOM 2063  C C    . GLY A 1 18 ? -11.165 30.638 15.575 1.00 0.00 ? 18 GLY A C    3  
ATOM 2064  O O    . GLY A 1 18 ? -11.165 29.839 14.659 1.00 0.00 ? 18 GLY A O    3  
ATOM 2065  H H    . GLY A 1 18 ? -12.311 31.479 18.249 1.00 0.00 ? 18 GLY A H    3  
ATOM 2066  H HA2  . GLY A 1 18 ? -13.178 30.424 16.290 1.00 0.00 ? 18 GLY A HA2  3  
ATOM 2067  H HA3  . GLY A 1 18 ? -12.884 31.911 15.390 1.00 0.00 ? 18 GLY A HA3  3  
ATOM 2068  N N    . LYS A 1 19 ? -10.049 31.026 16.129 1.00 0.00 ? 19 LYS A N    3  
ATOM 2069  C CA   . LYS A 1 19 ? -8.748  30.486 15.636 1.00 0.00 ? 19 LYS A CA   3  
ATOM 2070  C C    . LYS A 1 19 ? -8.307  29.298 16.494 1.00 0.00 ? 19 LYS A C    3  
ATOM 2071  O O    . LYS A 1 19 ? -7.958  29.447 17.647 1.00 0.00 ? 19 LYS A O    3  
ATOM 2072  C CB   . LYS A 1 19 ? -7.758  31.643 15.773 1.00 0.00 ? 19 LYS A CB   3  
ATOM 2073  C CG   . LYS A 1 19 ? -6.560  31.404 14.849 1.00 0.00 ? 19 LYS A CG   3  
ATOM 2074  C CD   . LYS A 1 19 ? -5.968  30.019 15.126 1.00 0.00 ? 19 LYS A CD   3  
ATOM 2075  C CE   . LYS A 1 19 ? -4.588  29.916 14.475 1.00 0.00 ? 19 LYS A CE   3  
ATOM 2076  N NZ   . LYS A 1 19 ? -4.822  29.176 13.202 1.00 0.00 ? 19 LYS A NZ   3  
ATOM 2077  H H    . LYS A 1 19 ? -10.064 31.673 16.865 1.00 0.00 ? 19 LYS A H    3  
ATOM 2078  H HA   . LYS A 1 19 ? -8.830  30.193 14.602 1.00 0.00 ? 19 LYS A HA   3  
ATOM 2079  H HB2  . LYS A 1 19 ? -8.244  32.567 15.498 1.00 0.00 ? 19 LYS A HB2  3  
ATOM 2080  H HB3  . LYS A 1 19 ? -7.417  31.706 16.796 1.00 0.00 ? 19 LYS A HB3  3  
ATOM 2081  H HG2  . LYS A 1 19 ? -6.884  31.456 13.820 1.00 0.00 ? 19 LYS A HG2  3  
ATOM 2082  H HG3  . LYS A 1 19 ? -5.810  32.159 15.031 1.00 0.00 ? 19 LYS A HG3  3  
ATOM 2083  H HD2  . LYS A 1 19 ? -5.875  29.874 16.192 1.00 0.00 ? 19 LYS A HD2  3  
ATOM 2084  H HD3  . LYS A 1 19 ? -6.618  29.260 14.716 1.00 0.00 ? 19 LYS A HD3  3  
ATOM 2085  H HE2  . LYS A 1 19 ? -4.194  30.901 14.269 1.00 0.00 ? 19 LYS A HE2  3  
ATOM 2086  H HE3  . LYS A 1 19 ? -3.912  29.365 15.111 1.00 0.00 ? 19 LYS A HE3  3  
ATOM 2087  H HZ1  . LYS A 1 19 ? -5.590  28.489 13.337 1.00 0.00 ? 19 LYS A HZ1  3  
ATOM 2088  H HZ2  . LYS A 1 19 ? -5.085  29.850 12.454 1.00 0.00 ? 19 LYS A HZ2  3  
ATOM 2089  H HZ3  . LYS A 1 19 ? -3.955  28.674 12.928 1.00 0.00 ? 19 LYS A HZ3  3  
ATOM 2090  N N    . LEU A 1 20 ? -8.316  28.117 15.940 1.00 0.00 ? 20 LEU A N    3  
ATOM 2091  C CA   . LEU A 1 20 ? -7.896  26.922 16.727 1.00 0.00 ? 20 LEU A CA   3  
ATOM 2092  C C    . LEU A 1 20 ? -6.406  26.642 16.510 1.00 0.00 ? 20 LEU A C    3  
ATOM 2093  O O    . LEU A 1 20 ? -5.982  26.304 15.423 1.00 0.00 ? 20 LEU A O    3  
ATOM 2094  C CB   . LEU A 1 20 ? -8.740  25.771 16.179 1.00 0.00 ? 20 LEU A CB   3  
ATOM 2095  C CG   . LEU A 1 20 ? -8.886  24.688 17.249 1.00 0.00 ? 20 LEU A CG   3  
ATOM 2096  C CD1  . LEU A 1 20 ? -9.651  23.497 16.667 1.00 0.00 ? 20 LEU A CD1  3  
ATOM 2097  C CD2  . LEU A 1 20 ? -7.501  24.228 17.707 1.00 0.00 ? 20 LEU A CD2  3  
ATOM 2098  H H    . LEU A 1 20 ? -8.599  28.015 15.008 1.00 0.00 ? 20 LEU A H    3  
ATOM 2099  H HA   . LEU A 1 20 ? -8.105  27.066 17.776 1.00 0.00 ? 20 LEU A HA   3  
ATOM 2100  H HB2  . LEU A 1 20 ? -9.716  26.140 15.904 1.00 0.00 ? 20 LEU A HB2  3  
ATOM 2101  H HB3  . LEU A 1 20 ? -8.255  25.352 15.309 1.00 0.00 ? 20 LEU A HB3  3  
ATOM 2102  H HG   . LEU A 1 20 ? -9.429  25.087 18.093 1.00 0.00 ? 20 LEU A HG   3  
ATOM 2103  H HD11 . LEU A 1 20 ? -10.395 23.853 15.971 1.00 0.00 ? 20 LEU A HD11 3  
ATOM 2104  H HD12 . LEU A 1 20 ? -8.961  22.842 16.155 1.00 0.00 ? 20 LEU A HD12 3  
ATOM 2105  H HD13 . LEU A 1 20 ? -10.135 22.955 17.466 1.00 0.00 ? 20 LEU A HD13 3  
ATOM 2106  H HD21 . LEU A 1 20 ? -6.848  24.143 16.851 1.00 0.00 ? 20 LEU A HD21 3  
ATOM 2107  H HD22 . LEU A 1 20 ? -7.092  24.950 18.399 1.00 0.00 ? 20 LEU A HD22 3  
ATOM 2108  H HD23 . LEU A 1 20 ? -7.582  23.268 18.194 1.00 0.00 ? 20 LEU A HD23 3  
ATOM 2109  N N    . PHE A 1 21 ? -5.608  26.769 17.537 1.00 0.00 ? 21 PHE A N    3  
ATOM 2110  C CA   . PHE A 1 21 ? -4.148  26.496 17.372 1.00 0.00 ? 21 PHE A CA   3  
ATOM 2111  C C    . PHE A 1 21 ? -3.818  25.086 17.871 1.00 0.00 ? 21 PHE A C    3  
ATOM 2112  O O    . PHE A 1 21 ? -3.161  24.905 18.877 1.00 0.00 ? 21 PHE A O    3  
ATOM 2113  C CB   . PHE A 1 21 ? -3.409  27.558 18.196 1.00 0.00 ? 21 PHE A CB   3  
ATOM 2114  C CG   . PHE A 1 21 ? -4.116  27.802 19.509 1.00 0.00 ? 21 PHE A CG   3  
ATOM 2115  C CD1  . PHE A 1 21 ? -3.836  26.996 20.619 1.00 0.00 ? 21 PHE A CD1  3  
ATOM 2116  C CD2  . PHE A 1 21 ? -5.047  28.843 19.616 1.00 0.00 ? 21 PHE A CD2  3  
ATOM 2117  C CE1  . PHE A 1 21 ? -4.487  27.231 21.836 1.00 0.00 ? 21 PHE A CE1  3  
ATOM 2118  C CE2  . PHE A 1 21 ? -5.697  29.078 20.833 1.00 0.00 ? 21 PHE A CE2  3  
ATOM 2119  C CZ   . PHE A 1 21 ? -5.417  28.272 21.942 1.00 0.00 ? 21 PHE A CZ   3  
ATOM 2120  H H    . PHE A 1 21 ? -5.971  27.034 18.408 1.00 0.00 ? 21 PHE A H    3  
ATOM 2121  H HA   . PHE A 1 21 ? -3.873  26.589 16.333 1.00 0.00 ? 21 PHE A HA   3  
ATOM 2122  H HB2  . PHE A 1 21 ? -2.402  27.219 18.394 1.00 0.00 ? 21 PHE A HB2  3  
ATOM 2123  H HB3  . PHE A 1 21 ? -3.371  28.481 17.637 1.00 0.00 ? 21 PHE A HB3  3  
ATOM 2124  H HD1  . PHE A 1 21 ? -3.118  26.194 20.536 1.00 0.00 ? 21 PHE A HD1  3  
ATOM 2125  H HD2  . PHE A 1 21 ? -5.263  29.465 18.760 1.00 0.00 ? 21 PHE A HD2  3  
ATOM 2126  H HE1  . PHE A 1 21 ? -4.272  26.609 22.692 1.00 0.00 ? 21 PHE A HE1  3  
ATOM 2127  H HE2  . PHE A 1 21 ? -6.416  29.879 20.916 1.00 0.00 ? 21 PHE A HE2  3  
ATOM 2128  H HZ   . PHE A 1 21 ? -5.919  28.453 22.882 1.00 0.00 ? 21 PHE A HZ   3  
ATOM 2129  N N    . CYS A 1 22 ? -4.273  24.088 17.165 1.00 0.00 ? 22 CYS A N    3  
ATOM 2130  C CA   . CYS A 1 22 ? -3.999  22.681 17.575 1.00 0.00 ? 22 CYS A CA   3  
ATOM 2131  C C    . CYS A 1 22 ? -2.510  22.467 17.889 1.00 0.00 ? 22 CYS A C    3  
ATOM 2132  O O    . CYS A 1 22 ? -2.180  21.902 18.914 1.00 0.00 ? 22 CYS A O    3  
ATOM 2133  C CB   . CYS A 1 22 ? -4.417  21.829 16.376 1.00 0.00 ? 22 CYS A CB   3  
ATOM 2134  S SG   . CYS A 1 22 ? -5.392  20.417 16.948 1.00 0.00 ? 22 CYS A SG   3  
ATOM 2135  H H    . CYS A 1 22 ? -4.800  24.265 16.358 1.00 0.00 ? 22 CYS A H    3  
ATOM 2136  H HA   . CYS A 1 22 ? -4.600  22.419 18.431 1.00 0.00 ? 22 CYS A HA   3  
ATOM 2137  H HB2  . CYS A 1 22 ? -5.010  22.428 15.699 1.00 0.00 ? 22 CYS A HB2  3  
ATOM 2138  H HB3  . CYS A 1 22 ? -3.537  21.472 15.863 1.00 0.00 ? 22 CYS A HB3  3  
ATOM 2139  N N    . PRO A 1 23 ? -1.649  22.907 17.000 1.00 0.00 ? 23 PRO A N    3  
ATOM 2140  C CA   . PRO A 1 23 ? -0.192  22.729 17.209 1.00 0.00 ? 23 PRO A CA   3  
ATOM 2141  C C    . PRO A 1 23 ? 0.270   23.466 18.468 1.00 0.00 ? 23 PRO A C    3  
ATOM 2142  O O    . PRO A 1 23 ? 0.766   24.575 18.407 1.00 0.00 ? 23 PRO A O    3  
ATOM 2143  C CB   . PRO A 1 23 ? 0.411   23.346 15.945 1.00 0.00 ? 23 PRO A CB   3  
ATOM 2144  C CG   . PRO A 1 23 ? -0.734  23.851 15.046 1.00 0.00 ? 23 PRO A CG   3  
ATOM 2145  C CD   . PRO A 1 23 ? -2.071  23.599 15.756 1.00 0.00 ? 23 PRO A CD   3  
ATOM 2146  H HA   . PRO A 1 23 ? 0.062   21.683 17.265 1.00 0.00 ? 23 PRO A HA   3  
ATOM 2147  H HB2  . PRO A 1 23 ? 1.052   24.172 16.215 1.00 0.00 ? 23 PRO A HB2  3  
ATOM 2148  H HB3  . PRO A 1 23 ? 0.985   22.601 15.415 1.00 0.00 ? 23 PRO A HB3  3  
ATOM 2149  H HG2  . PRO A 1 23 ? -0.614  24.910 14.868 1.00 0.00 ? 23 PRO A HG2  3  
ATOM 2150  H HG3  . PRO A 1 23 ? -0.718  23.321 14.106 1.00 0.00 ? 23 PRO A HG3  3  
ATOM 2151  H HD2  . PRO A 1 23 ? -2.556  24.534 15.982 1.00 0.00 ? 23 PRO A HD2  3  
ATOM 2152  H HD3  . PRO A 1 23 ? -2.709  22.966 15.158 1.00 0.00 ? 23 PRO A HD3  3  
ATOM 2153  N N    . GLN A 1 24 ? 0.114   22.852 19.608 1.00 0.00 ? 24 GLN A N    3  
ATOM 2154  C CA   . GLN A 1 24 ? 0.545   23.502 20.878 1.00 0.00 ? 24 GLN A CA   3  
ATOM 2155  C C    . GLN A 1 24 ? 1.479   22.568 21.649 1.00 0.00 ? 24 GLN A C    3  
ATOM 2156  O O    . GLN A 1 24 ? 2.682   22.739 21.655 1.00 0.00 ? 24 GLN A O    3  
ATOM 2157  C CB   . GLN A 1 24 ? -0.748  23.740 21.659 1.00 0.00 ? 24 GLN A CB   3  
ATOM 2158  C CG   . GLN A 1 24 ? -0.417  24.042 23.122 1.00 0.00 ? 24 GLN A CG   3  
ATOM 2159  C CD   . GLN A 1 24 ? -1.705  24.036 23.946 1.00 0.00 ? 24 GLN A CD   3  
ATOM 2160  O OE1  . GLN A 1 24 ? -2.249  25.077 24.255 1.00 0.00 ? 24 GLN A OE1  3  
ATOM 2161  N NE2  . GLN A 1 24 ? -2.221  22.896 24.317 1.00 0.00 ? 24 GLN A NE2  3  
ATOM 2162  H H    . GLN A 1 24 ? -0.285  21.957 19.628 1.00 0.00 ? 24 GLN A H    3  
ATOM 2163  H HA   . GLN A 1 24 ? 1.033   24.441 20.677 1.00 0.00 ? 24 GLN A HA   3  
ATOM 2164  H HB2  . GLN A 1 24 ? -1.278  24.578 21.230 1.00 0.00 ? 24 GLN A HB2  3  
ATOM 2165  H HB3  . GLN A 1 24 ? -1.368  22.858 21.605 1.00 0.00 ? 24 GLN A HB3  3  
ATOM 2166  H HG2  . GLN A 1 24 ? 0.257   23.290 23.502 1.00 0.00 ? 24 GLN A HG2  3  
ATOM 2167  H HG3  . GLN A 1 24 ? 0.051   25.014 23.192 1.00 0.00 ? 24 GLN A HG3  3  
ATOM 2168  H HE21 . GLN A 1 24 ? -1.781  22.056 24.067 1.00 0.00 ? 24 GLN A HE21 3  
ATOM 2169  H HE22 . GLN A 1 24 ? -3.045  22.879 24.845 1.00 0.00 ? 24 GLN A HE22 3  
ATOM 2170  N N    . ASP A 1 25 ? 0.931   21.576 22.295 1.00 0.00 ? 25 ASP A N    3  
ATOM 2171  C CA   . ASP A 1 25 ? 1.781   20.622 23.063 1.00 0.00 ? 25 ASP A CA   3  
ATOM 2172  C C    . ASP A 1 25 ? 1.317   19.185 22.810 1.00 0.00 ? 25 ASP A C    3  
ATOM 2173  O O    . ASP A 1 25 ? 0.659   18.582 23.632 1.00 0.00 ? 25 ASP A O    3  
ATOM 2174  C CB   . ASP A 1 25 ? 1.580   20.999 24.530 1.00 0.00 ? 25 ASP A CB   3  
ATOM 2175  C CG   . ASP A 1 25 ? 2.740   20.450 25.362 1.00 0.00 ? 25 ASP A CG   3  
ATOM 2176  O OD1  . ASP A 1 25 ? 3.609   19.816 24.784 1.00 0.00 ? 25 ASP A OD1  3  
ATOM 2177  O OD2  . ASP A 1 25 ? 2.742   20.671 26.561 1.00 0.00 ? 25 ASP A OD2  3  
ATOM 2178  H H    . ASP A 1 25 ? -0.041  21.457 22.270 1.00 0.00 ? 25 ASP A H    3  
ATOM 2179  H HA   . ASP A 1 25 ? 2.818   20.738 22.791 1.00 0.00 ? 25 ASP A HA   3  
ATOM 2180  H HB2  . ASP A 1 25 ? 1.546   22.075 24.624 1.00 0.00 ? 25 ASP A HB2  3  
ATOM 2181  H HB3  . ASP A 1 25 ? 0.650   20.578 24.886 1.00 0.00 ? 25 ASP A HB3  3  
ATOM 2182  N N    . LYS A 1 26 ? 1.653   18.633 21.676 1.00 0.00 ? 26 LYS A N    3  
ATOM 2183  C CA   . LYS A 1 26 ? 1.226   17.237 21.369 1.00 0.00 ? 26 LYS A CA   3  
ATOM 2184  C C    . LYS A 1 26 ? 1.952   16.233 22.274 1.00 0.00 ? 26 LYS A C    3  
ATOM 2185  O O    . LYS A 1 26 ? 1.706   15.045 22.214 1.00 0.00 ? 26 LYS A O    3  
ATOM 2186  C CB   . LYS A 1 26 ? 1.611   17.020 19.905 1.00 0.00 ? 26 LYS A CB   3  
ATOM 2187  C CG   . LYS A 1 26 ? 0.493   17.542 18.999 1.00 0.00 ? 26 LYS A CG   3  
ATOM 2188  C CD   . LYS A 1 26 ? 0.983   17.572 17.550 1.00 0.00 ? 26 LYS A CD   3  
ATOM 2189  C CE   . LYS A 1 26 ? 0.589   16.269 16.852 1.00 0.00 ? 26 LYS A CE   3  
ATOM 2190  N NZ   . LYS A 1 26 ? 0.995   16.461 15.430 1.00 0.00 ? 26 LYS A NZ   3  
ATOM 2191  H H    . LYS A 1 26 ? 2.182   19.137 21.024 1.00 0.00 ? 26 LYS A H    3  
ATOM 2192  H HA   . LYS A 1 26 ? 0.158   17.139 21.484 1.00 0.00 ? 26 LYS A HA   3  
ATOM 2193  H HB2  . LYS A 1 26 ? 2.526   17.552 19.691 1.00 0.00 ? 26 LYS A HB2  3  
ATOM 2194  H HB3  . LYS A 1 26 ? 1.759   15.965 19.725 1.00 0.00 ? 26 LYS A HB3  3  
ATOM 2195  H HG2  . LYS A 1 26 ? -0.366  16.891 19.077 1.00 0.00 ? 26 LYS A HG2  3  
ATOM 2196  H HG3  . LYS A 1 26 ? 0.216   18.539 19.308 1.00 0.00 ? 26 LYS A HG3  3  
ATOM 2197  H HD2  . LYS A 1 26 ? 0.531   18.407 17.035 1.00 0.00 ? 26 LYS A HD2  3  
ATOM 2198  H HD3  . LYS A 1 26 ? 2.057   17.678 17.535 1.00 0.00 ? 26 LYS A HD3  3  
ATOM 2199  H HE2  . LYS A 1 26 ? 1.121   15.435 17.285 1.00 0.00 ? 26 LYS A HE2  3  
ATOM 2200  H HE3  . LYS A 1 26 ? -0.478  16.113 16.920 1.00 0.00 ? 26 LYS A HE3  3  
ATOM 2201  H HZ1  . LYS A 1 26 ? 1.988   16.767 15.391 1.00 0.00 ? 26 LYS A HZ1  3  
ATOM 2202  H HZ2  . LYS A 1 26 ? 0.891   15.564 14.915 1.00 0.00 ? 26 LYS A HZ2  3  
ATOM 2203  H HZ3  . LYS A 1 26 ? 0.390   17.185 14.993 1.00 0.00 ? 26 LYS A HZ3  3  
ATOM 2204  N N    . LYS A 1 27 ? 2.843   16.698 23.111 1.00 0.00 ? 27 LYS A N    3  
ATOM 2205  C CA   . LYS A 1 27 ? 3.577   15.766 24.017 1.00 0.00 ? 27 LYS A CA   3  
ATOM 2206  C C    . LYS A 1 27 ? 2.617   14.715 24.585 1.00 0.00 ? 27 LYS A C    3  
ATOM 2207  O O    . LYS A 1 27 ? 3.007   13.610 24.904 1.00 0.00 ? 27 LYS A O    3  
ATOM 2208  C CB   . LYS A 1 27 ? 4.118   16.655 25.136 1.00 0.00 ? 27 LYS A CB   3  
ATOM 2209  C CG   . LYS A 1 27 ? 5.409   17.335 24.672 1.00 0.00 ? 27 LYS A CG   3  
ATOM 2210  C CD   . LYS A 1 27 ? 6.023   18.112 25.837 1.00 0.00 ? 27 LYS A CD   3  
ATOM 2211  C CE   . LYS A 1 27 ? 7.260   18.871 25.352 1.00 0.00 ? 27 LYS A CE   3  
ATOM 2212  N NZ   . LYS A 1 27 ? 7.428   19.989 26.325 1.00 0.00 ? 27 LYS A NZ   3  
ATOM 2213  H H    . LYS A 1 27 ? 3.029   17.658 23.147 1.00 0.00 ? 27 LYS A H    3  
ATOM 2214  H HA   . LYS A 1 27 ? 4.391   15.293 23.493 1.00 0.00 ? 27 LYS A HA   3  
ATOM 2215  H HB2  . LYS A 1 27 ? 3.386   17.408 25.384 1.00 0.00 ? 27 LYS A HB2  3  
ATOM 2216  H HB3  . LYS A 1 27 ? 4.324   16.052 26.006 1.00 0.00 ? 27 LYS A HB3  3  
ATOM 2217  H HG2  . LYS A 1 27 ? 6.108   16.586 24.329 1.00 0.00 ? 27 LYS A HG2  3  
ATOM 2218  H HG3  . LYS A 1 27 ? 5.187   18.016 23.863 1.00 0.00 ? 27 LYS A HG3  3  
ATOM 2219  H HD2  . LYS A 1 27 ? 5.298   18.814 26.224 1.00 0.00 ? 27 LYS A HD2  3  
ATOM 2220  H HD3  . LYS A 1 27 ? 6.308   17.423 26.619 1.00 0.00 ? 27 LYS A HD3  3  
ATOM 2221  H HE2  . LYS A 1 27 ? 8.126   18.226 25.367 1.00 0.00 ? 27 LYS A HE2  3  
ATOM 2222  H HE3  . LYS A 1 27 ? 7.096   19.259 24.358 1.00 0.00 ? 27 LYS A HE3  3  
ATOM 2223  H HZ1  . LYS A 1 27 ? 6.504   20.232 26.735 1.00 0.00 ? 27 LYS A HZ1  3  
ATOM 2224  H HZ2  . LYS A 1 27 ? 8.078   19.696 27.080 1.00 0.00 ? 27 LYS A HZ2  3  
ATOM 2225  H HZ3  . LYS A 1 27 ? 7.821   20.817 25.835 1.00 0.00 ? 27 LYS A HZ3  3  
ATOM 2226  N N    . PHE A 1 28 ? 1.362   15.055 24.706 1.00 0.00 ? 28 PHE A N    3  
ATOM 2227  C CA   . PHE A 1 28 ? 0.368   14.083 25.246 1.00 0.00 ? 28 PHE A CA   3  
ATOM 2228  C C    . PHE A 1 28 ? 0.504   12.731 24.537 1.00 0.00 ? 28 PHE A C    3  
ATOM 2229  O O    . PHE A 1 28 ? 0.094   11.708 25.047 1.00 0.00 ? 28 PHE A O    3  
ATOM 2230  C CB   . PHE A 1 28 ? -0.991  14.718 24.950 1.00 0.00 ? 28 PHE A CB   3  
ATOM 2231  C CG   . PHE A 1 28 ? -1.017  16.131 25.482 1.00 0.00 ? 28 PHE A CG   3  
ATOM 2232  C CD1  . PHE A 1 28 ? -0.682  16.381 26.819 1.00 0.00 ? 28 PHE A CD1  3  
ATOM 2233  C CD2  . PHE A 1 28 ? -1.380  17.191 24.642 1.00 0.00 ? 28 PHE A CD2  3  
ATOM 2234  C CE1  . PHE A 1 28 ? -0.710  17.690 27.314 1.00 0.00 ? 28 PHE A CE1  3  
ATOM 2235  C CE2  . PHE A 1 28 ? -1.407  18.500 25.139 1.00 0.00 ? 28 PHE A CE2  3  
ATOM 2236  C CZ   . PHE A 1 28 ? -1.073  18.750 26.474 1.00 0.00 ? 28 PHE A CZ   3  
ATOM 2237  H H    . PHE A 1 28 ? 1.072   15.952 24.438 1.00 0.00 ? 28 PHE A H    3  
ATOM 2238  H HA   . PHE A 1 28 ? 0.492   13.963 26.311 1.00 0.00 ? 28 PHE A HA   3  
ATOM 2239  H HB2  . PHE A 1 28 ? -1.158  14.731 23.884 1.00 0.00 ? 28 PHE A HB2  3  
ATOM 2240  H HB3  . PHE A 1 28 ? -1.766  14.145 25.428 1.00 0.00 ? 28 PHE A HB3  3  
ATOM 2241  H HD1  . PHE A 1 28 ? -0.402  15.564 27.468 1.00 0.00 ? 28 PHE A HD1  3  
ATOM 2242  H HD2  . PHE A 1 28 ? -1.637  16.999 23.611 1.00 0.00 ? 28 PHE A HD2  3  
ATOM 2243  H HE1  . PHE A 1 28 ? -0.452  17.883 28.345 1.00 0.00 ? 28 PHE A HE1  3  
ATOM 2244  H HE2  . PHE A 1 28 ? -1.688  19.317 24.490 1.00 0.00 ? 28 PHE A HE2  3  
ATOM 2245  H HZ   . PHE A 1 28 ? -1.095  19.760 26.857 1.00 0.00 ? 28 PHE A HZ   3  
ATOM 2246  N N    . PHE A 1 29 ? 1.077   12.720 23.363 1.00 0.00 ? 29 PHE A N    3  
ATOM 2247  C CA   . PHE A 1 29 ? 1.243   11.436 22.619 1.00 0.00 ? 29 PHE A CA   3  
ATOM 2248  C C    . PHE A 1 29 ? 1.940   10.393 23.498 1.00 0.00 ? 29 PHE A C    3  
ATOM 2249  O O    . PHE A 1 29 ? 1.894   9.209  23.226 1.00 0.00 ? 29 PHE A O    3  
ATOM 2250  C CB   . PHE A 1 29 ? 2.119   11.795 21.418 1.00 0.00 ? 29 PHE A CB   3  
ATOM 2251  C CG   . PHE A 1 29 ? 2.359   10.564 20.576 1.00 0.00 ? 29 PHE A CG   3  
ATOM 2252  C CD1  . PHE A 1 29 ? 3.203   9.549  21.042 1.00 0.00 ? 29 PHE A CD1  3  
ATOM 2253  C CD2  . PHE A 1 29 ? 1.739   10.439 19.327 1.00 0.00 ? 29 PHE A CD2  3  
ATOM 2254  C CE1  . PHE A 1 29 ? 3.426   8.409  20.260 1.00 0.00 ? 29 PHE A CE1  3  
ATOM 2255  C CE2  . PHE A 1 29 ? 1.962   9.300  18.544 1.00 0.00 ? 29 PHE A CE2  3  
ATOM 2256  C CZ   . PHE A 1 29 ? 2.805   8.284  19.011 1.00 0.00 ? 29 PHE A CZ   3  
ATOM 2257  H H    . PHE A 1 29 ? 1.400   13.557 22.971 1.00 0.00 ? 29 PHE A H    3  
ATOM 2258  H HA   . PHE A 1 29 ? 0.287   11.069 22.281 1.00 0.00 ? 29 PHE A HA   3  
ATOM 2259  H HB2  . PHE A 1 29 ? 1.624   12.546 20.822 1.00 0.00 ? 29 PHE A HB2  3  
ATOM 2260  H HB3  . PHE A 1 29 ? 3.066   12.181 21.767 1.00 0.00 ? 29 PHE A HB3  3  
ATOM 2261  H HD1  . PHE A 1 29 ? 3.683   9.645  22.005 1.00 0.00 ? 29 PHE A HD1  3  
ATOM 2262  H HD2  . PHE A 1 29 ? 1.088   11.222 18.966 1.00 0.00 ? 29 PHE A HD2  3  
ATOM 2263  H HE1  . PHE A 1 29 ? 4.077   7.626  20.620 1.00 0.00 ? 29 PHE A HE1  3  
ATOM 2264  H HE2  . PHE A 1 29 ? 1.483   9.204  17.582 1.00 0.00 ? 29 PHE A HE2  3  
ATOM 2265  H HZ   . PHE A 1 29 ? 2.977   7.405  18.408 1.00 0.00 ? 29 PHE A HZ   3  
ATOM 2266  N N    . GLN A 1 30 ? 2.592   10.820 24.543 1.00 0.00 ? 30 GLN A N    3  
ATOM 2267  C CA   . GLN A 1 30 ? 3.301   9.852  25.430 1.00 0.00 ? 30 GLN A CA   3  
ATOM 2268  C C    . GLN A 1 30 ? 2.301   8.977  26.193 1.00 0.00 ? 30 GLN A C    3  
ATOM 2269  O O    . GLN A 1 30 ? 2.681   8.074  26.912 1.00 0.00 ? 30 GLN A O    3  
ATOM 2270  C CB   . GLN A 1 30 ? 4.099   10.722 26.401 1.00 0.00 ? 30 GLN A CB   3  
ATOM 2271  C CG   . GLN A 1 30 ? 5.225   11.428 25.645 1.00 0.00 ? 30 GLN A CG   3  
ATOM 2272  C CD   . GLN A 1 30 ? 6.387   11.705 26.601 1.00 0.00 ? 30 GLN A CD   3  
ATOM 2273  O OE1  . GLN A 1 30 ? 6.935   10.795 27.189 1.00 0.00 ? 30 GLN A OE1  3  
ATOM 2274  N NE2  . GLN A 1 30 ? 6.785   12.934 26.782 1.00 0.00 ? 30 GLN A NE2  3  
ATOM 2275  H H    . GLN A 1 30 ? 2.623   11.778 24.742 1.00 0.00 ? 30 GLN A H    3  
ATOM 2276  H HA   . GLN A 1 30 ? 3.974   9.238  24.853 1.00 0.00 ? 30 GLN A HA   3  
ATOM 2277  H HB2  . GLN A 1 30 ? 3.446   11.459 26.844 1.00 0.00 ? 30 GLN A HB2  3  
ATOM 2278  H HB3  . GLN A 1 30 ? 4.521   10.101 27.178 1.00 0.00 ? 30 GLN A HB3  3  
ATOM 2279  H HG2  . GLN A 1 30 ? 5.567   10.798 24.836 1.00 0.00 ? 30 GLN A HG2  3  
ATOM 2280  H HG3  . GLN A 1 30 ? 4.860   12.362 25.243 1.00 0.00 ? 30 GLN A HG3  3  
ATOM 2281  H HE21 . GLN A 1 30 ? 6.343   13.668 26.308 1.00 0.00 ? 30 GLN A HE21 3  
ATOM 2282  H HE22 . GLN A 1 30 ? 7.528   13.123 27.393 1.00 0.00 ? 30 GLN A HE22 3  
ATOM 2283  N N    . SER A 1 31 ? 1.030   9.233  26.050 1.00 0.00 ? 31 SER A N    3  
ATOM 2284  C CA   . SER A 1 31 ? 0.023   8.406  26.781 1.00 0.00 ? 31 SER A CA   3  
ATOM 2285  C C    . SER A 1 31 ? -1.234  8.211  25.928 1.00 0.00 ? 31 SER A C    3  
ATOM 2286  O O    . SER A 1 31 ? -1.489  8.951  25.000 1.00 0.00 ? 31 SER A O    3  
ATOM 2287  C CB   . SER A 1 31 ? -0.306  9.206  28.042 1.00 0.00 ? 31 SER A CB   3  
ATOM 2288  O OG   . SER A 1 31 ? 0.889   9.463  28.763 1.00 0.00 ? 31 SER A OG   3  
ATOM 2289  H H    . SER A 1 31 ? 0.737   9.967  25.469 1.00 0.00 ? 31 SER A H    3  
ATOM 2290  H HA   . SER A 1 31 ? 0.446   7.452  27.051 1.00 0.00 ? 31 SER A HA   3  
ATOM 2291  H HB2  . SER A 1 31 ? -0.767  10.142 27.763 1.00 0.00 ? 31 SER A HB2  3  
ATOM 2292  H HB3  . SER A 1 31 ? -0.986  8.639  28.659 1.00 0.00 ? 31 SER A HB3  3  
ATOM 2293  H HG   . SER A 1 31 ? 1.107   10.392 28.656 1.00 0.00 ? 31 SER A HG   3  
ATOM 2294  N N    . LEU A 1 32 ? -2.027  7.220  26.244 1.00 0.00 ? 32 LEU A N    3  
ATOM 2295  C CA   . LEU A 1 32 ? -3.271  6.983  25.456 1.00 0.00 ? 32 LEU A CA   3  
ATOM 2296  C C    . LEU A 1 32 ? -4.183  8.203  25.548 1.00 0.00 ? 32 LEU A C    3  
ATOM 2297  O O    . LEU A 1 32 ? -4.509  8.825  24.557 1.00 0.00 ? 32 LEU A O    3  
ATOM 2298  C CB   . LEU A 1 32 ? -3.937  5.773  26.108 1.00 0.00 ? 32 LEU A CB   3  
ATOM 2299  C CG   . LEU A 1 32 ? -4.687  4.969  25.046 1.00 0.00 ? 32 LEU A CG   3  
ATOM 2300  C CD1  . LEU A 1 32 ? -5.027  3.584  25.597 1.00 0.00 ? 32 LEU A CD1  3  
ATOM 2301  C CD2  . LEU A 1 32 ? -5.979  5.700  24.672 1.00 0.00 ? 32 LEU A CD2  3  
ATOM 2302  H H    . LEU A 1 32 ? -1.807  6.638  27.000 1.00 0.00 ? 32 LEU A H    3  
ATOM 2303  H HA   . LEU A 1 32 ? -3.034  6.767  24.431 1.00 0.00 ? 32 LEU A HA   3  
ATOM 2304  H HB2  . LEU A 1 32 ? -3.183  5.151  26.567 1.00 0.00 ? 32 LEU A HB2  3  
ATOM 2305  H HB3  . LEU A 1 32 ? -4.633  6.111  26.861 1.00 0.00 ? 32 LEU A HB3  3  
ATOM 2306  H HG   . LEU A 1 32 ? -4.067  4.865  24.167 1.00 0.00 ? 32 LEU A HG   3  
ATOM 2307  H HD11 . LEU A 1 32 ? -5.383  3.678  26.613 1.00 0.00 ? 32 LEU A HD11 3  
ATOM 2308  H HD12 . LEU A 1 32 ? -5.795  3.132  24.987 1.00 0.00 ? 32 LEU A HD12 3  
ATOM 2309  H HD13 . LEU A 1 32 ? -4.143  2.963  25.581 1.00 0.00 ? 32 LEU A HD13 3  
ATOM 2310  H HD21 . LEU A 1 32 ? -6.547  5.908  25.567 1.00 0.00 ? 32 LEU A HD21 3  
ATOM 2311  H HD22 . LEU A 1 32 ? -5.738  6.628  24.175 1.00 0.00 ? 32 LEU A HD22 3  
ATOM 2312  H HD23 . LEU A 1 32 ? -6.565  5.079  24.010 1.00 0.00 ? 32 LEU A HD23 3  
ATOM 2313  N N    . ASP A 1 33 ? -4.588  8.556  26.735 1.00 0.00 ? 33 ASP A N    3  
ATOM 2314  C CA   . ASP A 1 33 ? -5.467  9.746  26.888 1.00 0.00 ? 33 ASP A CA   3  
ATOM 2315  C C    . ASP A 1 33 ? -4.831  10.917 26.153 1.00 0.00 ? 33 ASP A C    3  
ATOM 2316  O O    . ASP A 1 33 ? -5.500  11.714 25.526 1.00 0.00 ? 33 ASP A O    3  
ATOM 2317  C CB   . ASP A 1 33 ? -5.526  10.014 28.392 1.00 0.00 ? 33 ASP A CB   3  
ATOM 2318  C CG   . ASP A 1 33 ? -6.629  11.033 28.687 1.00 0.00 ? 33 ASP A CG   3  
ATOM 2319  O OD1  . ASP A 1 33 ? -7.308  11.428 27.753 1.00 0.00 ? 33 ASP A OD1  3  
ATOM 2320  O OD2  . ASP A 1 33 ? -6.775  11.402 29.841 1.00 0.00 ? 33 ASP A OD2  3  
ATOM 2321  H H    . ASP A 1 33 ? -4.303  8.048  27.519 1.00 0.00 ? 33 ASP A H    3  
ATOM 2322  H HA   . ASP A 1 33 ? -6.453  9.543  26.501 1.00 0.00 ? 33 ASP A HA   3  
ATOM 2323  H HB2  . ASP A 1 33 ? -5.739  9.093  28.915 1.00 0.00 ? 33 ASP A HB2  3  
ATOM 2324  H HB3  . ASP A 1 33 ? -4.576  10.406 28.726 1.00 0.00 ? 33 ASP A HB3  3  
ATOM 2325  N N    . GLY A 1 34 ? -3.532  11.010 26.207 1.00 0.00 ? 34 GLY A N    3  
ATOM 2326  C CA   . GLY A 1 34 ? -2.840  12.109 25.491 1.00 0.00 ? 34 GLY A CA   3  
ATOM 2327  C C    . GLY A 1 34 ? -2.893  11.810 23.996 1.00 0.00 ? 34 GLY A C    3  
ATOM 2328  O O    . GLY A 1 34 ? -3.098  12.686 23.183 1.00 0.00 ? 34 GLY A O    3  
ATOM 2329  H H    . GLY A 1 34 ? -3.012  10.344 26.705 1.00 0.00 ? 34 GLY A H    3  
ATOM 2330  H HA2  . GLY A 1 34 ? -3.338  13.043 25.693 1.00 0.00 ? 34 GLY A HA2  3  
ATOM 2331  H HA3  . GLY A 1 34 ? -1.812  12.165 25.816 1.00 0.00 ? 34 GLY A HA3  3  
ATOM 2332  N N    . ILE A 1 35 ? -2.724  10.571 23.633 1.00 0.00 ? 35 ILE A N    3  
ATOM 2333  C CA   . ILE A 1 35 ? -2.779  10.202 22.192 1.00 0.00 ? 35 ILE A CA   3  
ATOM 2334  C C    . ILE A 1 35 ? -4.148  10.576 21.618 1.00 0.00 ? 35 ILE A C    3  
ATOM 2335  O O    . ILE A 1 35 ? -4.265  10.991 20.482 1.00 0.00 ? 35 ILE A O    3  
ATOM 2336  C CB   . ILE A 1 35 ? -2.556  8.683  22.166 1.00 0.00 ? 35 ILE A CB   3  
ATOM 2337  C CG1  . ILE A 1 35 ? -1.056  8.395  22.098 1.00 0.00 ? 35 ILE A CG1  3  
ATOM 2338  C CG2  . ILE A 1 35 ? -3.242  8.063  20.942 1.00 0.00 ? 35 ILE A CG2  3  
ATOM 2339  C CD1  . ILE A 1 35 ? -0.535  8.750  20.705 1.00 0.00 ? 35 ILE A CD1  3  
ATOM 2340  H H    . ILE A 1 35 ? -2.571  9.880  24.310 1.00 0.00 ? 35 ILE A H    3  
ATOM 2341  H HA   . ILE A 1 35 ? -1.995  10.700 21.647 1.00 0.00 ? 35 ILE A HA   3  
ATOM 2342  H HB   . ILE A 1 35 ? -2.966  8.246  23.065 1.00 0.00 ? 35 ILE A HB   3  
ATOM 2343  H HG12 . ILE A 1 35 ? -0.541  8.989  22.839 1.00 0.00 ? 35 ILE A HG12 3  
ATOM 2344  H HG13 . ILE A 1 35 ? -0.881  7.347  22.292 1.00 0.00 ? 35 ILE A HG13 3  
ATOM 2345  H HG21 . ILE A 1 35 ? -3.128  8.723  20.094 1.00 0.00 ? 35 ILE A HG21 3  
ATOM 2346  H HG22 . ILE A 1 35 ? -2.789  7.109  20.719 1.00 0.00 ? 35 ILE A HG22 3  
ATOM 2347  H HG23 . ILE A 1 35 ? -4.292  7.923  21.150 1.00 0.00 ? 35 ILE A HG23 3  
ATOM 2348  H HD11 . ILE A 1 35 ? -1.162  9.517  20.271 1.00 0.00 ? 35 ILE A HD11 3  
ATOM 2349  H HD12 . ILE A 1 35 ? 0.479   9.115  20.782 1.00 0.00 ? 35 ILE A HD12 3  
ATOM 2350  H HD13 . ILE A 1 35 ? -0.555  7.872  20.078 1.00 0.00 ? 35 ILE A HD13 3  
ATOM 2351  N N    . MET A 1 36 ? -5.184  10.429 22.396 1.00 0.00 ? 36 MET A N    3  
ATOM 2352  C CA   . MET A 1 36 ? -6.544  10.774 21.893 1.00 0.00 ? 36 MET A CA   3  
ATOM 2353  C C    . MET A 1 36 ? -6.565  12.208 21.355 1.00 0.00 ? 36 MET A C    3  
ATOM 2354  O O    . MET A 1 36 ? -6.929  12.446 20.220 1.00 0.00 ? 36 MET A O    3  
ATOM 2355  C CB   . MET A 1 36 ? -7.461  10.651 23.108 1.00 0.00 ? 36 MET A CB   3  
ATOM 2356  C CG   . MET A 1 36 ? -7.718  9.173  23.407 1.00 0.00 ? 36 MET A CG   3  
ATOM 2357  S SD   . MET A 1 36 ? -8.506  8.393  21.976 1.00 0.00 ? 36 MET A SD   3  
ATOM 2358  C CE   . MET A 1 36 ? -7.045  7.514  21.368 1.00 0.00 ? 36 MET A CE   3  
ATOM 2359  H H    . MET A 1 36 ? -5.068  10.090 23.311 1.00 0.00 ? 36 MET A H    3  
ATOM 2360  H HA   . MET A 1 36 ? -6.851  10.080 21.128 1.00 0.00 ? 36 MET A HA   3  
ATOM 2361  H HB2  . MET A 1 36 ? -6.992  11.116 23.962 1.00 0.00 ? 36 MET A HB2  3  
ATOM 2362  H HB3  . MET A 1 36 ? -8.397  11.145 22.898 1.00 0.00 ? 36 MET A HB3  3  
ATOM 2363  H HG2  . MET A 1 36 ? -6.780  8.679  23.614 1.00 0.00 ? 36 MET A HG2  3  
ATOM 2364  H HG3  . MET A 1 36 ? -8.367  9.087  24.266 1.00 0.00 ? 36 MET A HG3  3  
ATOM 2365  H HE1  . MET A 1 36 ? -6.656  6.879  22.153 1.00 0.00 ? 36 MET A HE1  3  
ATOM 2366  H HE2  . MET A 1 36 ? -7.318  6.911  20.512 1.00 0.00 ? 36 MET A HE2  3  
ATOM 2367  H HE3  . MET A 1 36 ? -6.290  8.225  21.077 1.00 0.00 ? 36 MET A HE3  3  
ATOM 2368  N N    . PHE A 1 37 ? -6.183  13.165 22.157 1.00 0.00 ? 37 PHE A N    3  
ATOM 2369  C CA   . PHE A 1 37 ? -6.190  14.578 21.684 1.00 0.00 ? 37 PHE A CA   3  
ATOM 2370  C C    . PHE A 1 37 ? -5.604  14.653 20.263 1.00 0.00 ? 37 PHE A C    3  
ATOM 2371  O O    . PHE A 1 37 ? -6.218  15.185 19.361 1.00 0.00 ? 37 PHE A O    3  
ATOM 2372  C CB   . PHE A 1 37 ? -5.354  15.351 22.731 1.00 0.00 ? 37 PHE A CB   3  
ATOM 2373  C CG   . PHE A 1 37 ? -4.212  16.109 22.088 1.00 0.00 ? 37 PHE A CG   3  
ATOM 2374  C CD1  . PHE A 1 37 ? -2.998  15.463 21.834 1.00 0.00 ? 37 PHE A CD1  3  
ATOM 2375  C CD2  . PHE A 1 37 ? -4.370  17.456 21.744 1.00 0.00 ? 37 PHE A CD2  3  
ATOM 2376  C CE1  . PHE A 1 37 ? -1.946  16.158 21.236 1.00 0.00 ? 37 PHE A CE1  3  
ATOM 2377  C CE2  . PHE A 1 37 ? -3.317  18.152 21.143 1.00 0.00 ? 37 PHE A CE2  3  
ATOM 2378  C CZ   . PHE A 1 37 ? -2.104  17.500 20.889 1.00 0.00 ? 37 PHE A CZ   3  
ATOM 2379  H H    . PHE A 1 37 ? -5.896  12.954 23.071 1.00 0.00 ? 37 PHE A H    3  
ATOM 2380  H HA   . PHE A 1 37 ? -7.201  14.955 21.679 1.00 0.00 ? 37 PHE A HA   3  
ATOM 2381  H HB2  . PHE A 1 37 ? -5.998  16.055 23.240 1.00 0.00 ? 37 PHE A HB2  3  
ATOM 2382  H HB3  . PHE A 1 37 ? -4.954  14.652 23.450 1.00 0.00 ? 37 PHE A HB3  3  
ATOM 2383  H HD1  . PHE A 1 37 ? -2.873  14.427 22.100 1.00 0.00 ? 37 PHE A HD1  3  
ATOM 2384  H HD2  . PHE A 1 37 ? -5.303  17.957 21.944 1.00 0.00 ? 37 PHE A HD2  3  
ATOM 2385  H HE1  . PHE A 1 37 ? -1.010  15.657 21.040 1.00 0.00 ? 37 PHE A HE1  3  
ATOM 2386  H HE2  . PHE A 1 37 ? -3.438  19.191 20.876 1.00 0.00 ? 37 PHE A HE2  3  
ATOM 2387  H HZ   . PHE A 1 37 ? -1.294  18.032 20.424 1.00 0.00 ? 37 PHE A HZ   3  
ATOM 2388  N N    . ILE A 1 38 ? -4.434  14.115 20.049 1.00 0.00 ? 38 ILE A N    3  
ATOM 2389  C CA   . ILE A 1 38 ? -3.842  14.160 18.682 1.00 0.00 ? 38 ILE A CA   3  
ATOM 2390  C C    . ILE A 1 38 ? -4.854  13.642 17.661 1.00 0.00 ? 38 ILE A C    3  
ATOM 2391  O O    . ILE A 1 38 ? -4.946  14.135 16.555 1.00 0.00 ? 38 ILE A O    3  
ATOM 2392  C CB   . ILE A 1 38 ? -2.620  13.244 18.739 1.00 0.00 ? 38 ILE A CB   3  
ATOM 2393  C CG1  . ILE A 1 38 ? -1.526  13.907 19.581 1.00 0.00 ? 38 ILE A CG1  3  
ATOM 2394  C CG2  . ILE A 1 38 ? -2.101  13.005 17.320 1.00 0.00 ? 38 ILE A CG2  3  
ATOM 2395  C CD1  . ILE A 1 38 ? -0.197  13.175 19.376 1.00 0.00 ? 38 ILE A CD1  3  
ATOM 2396  H H    . ILE A 1 38 ? -3.950  13.678 20.778 1.00 0.00 ? 38 ILE A H    3  
ATOM 2397  H HA   . ILE A 1 38 ? -3.541  15.164 18.436 1.00 0.00 ? 38 ILE A HA   3  
ATOM 2398  H HB   . ILE A 1 38 ? -2.896  12.300 19.185 1.00 0.00 ? 38 ILE A HB   3  
ATOM 2399  H HG12 . ILE A 1 38 ? -1.418  14.939 19.281 1.00 0.00 ? 38 ILE A HG12 3  
ATOM 2400  H HG13 . ILE A 1 38 ? -1.801  13.863 20.625 1.00 0.00 ? 38 ILE A HG13 3  
ATOM 2401  H HG21 . ILE A 1 38 ? -2.928  12.762 16.669 1.00 0.00 ? 38 ILE A HG21 3  
ATOM 2402  H HG22 . ILE A 1 38 ? -1.611  13.899 16.960 1.00 0.00 ? 38 ILE A HG22 3  
ATOM 2403  H HG23 . ILE A 1 38 ? -1.396  12.187 17.327 1.00 0.00 ? 38 ILE A HG23 3  
ATOM 2404  H HD11 . ILE A 1 38 ? -0.001  13.071 18.319 1.00 0.00 ? 38 ILE A HD11 3  
ATOM 2405  H HD12 . ILE A 1 38 ? 0.598   13.743 19.835 1.00 0.00 ? 38 ILE A HD12 3  
ATOM 2406  H HD13 . ILE A 1 38 ? -0.251  12.197 19.830 1.00 0.00 ? 38 ILE A HD13 3  
ATOM 2407  N N    . ASN A 1 39 ? -5.618  12.651 18.026 1.00 0.00 ? 39 ASN A N    3  
ATOM 2408  C CA   . ASN A 1 39 ? -6.630  12.101 17.080 1.00 0.00 ? 39 ASN A CA   3  
ATOM 2409  C C    . ASN A 1 39 ? -7.759  13.115 16.879 1.00 0.00 ? 39 ASN A C    3  
ATOM 2410  O O    . ASN A 1 39 ? -8.353  13.200 15.822 1.00 0.00 ? 39 ASN A O    3  
ATOM 2411  C CB   . ASN A 1 39 ? -7.157  10.834 17.753 1.00 0.00 ? 39 ASN A CB   3  
ATOM 2412  C CG   . ASN A 1 39 ? -5.977  9.975  18.213 1.00 0.00 ? 39 ASN A CG   3  
ATOM 2413  O OD1  . ASN A 1 39 ? -6.112  9.168  19.110 1.00 0.00 ? 39 ASN A OD1  3  
ATOM 2414  N ND2  . ASN A 1 39 ? -4.817  10.116 17.631 1.00 0.00 ? 39 ASN A ND2  3  
ATOM 2415  H H    . ASN A 1 39 ? -5.529  12.269 18.926 1.00 0.00 ? 39 ASN A H    3  
ATOM 2416  H HA   . ASN A 1 39 ? -6.171  11.856 16.136 1.00 0.00 ? 39 ASN A HA   3  
ATOM 2417  H HB2  . ASN A 1 39 ? -7.760  11.105 18.607 1.00 0.00 ? 39 ASN A HB2  3  
ATOM 2418  H HB3  . ASN A 1 39 ? -7.757  10.276 17.050 1.00 0.00 ? 39 ASN A HB3  3  
ATOM 2419  H HD21 . ASN A 1 39 ? -4.708  10.768 16.908 1.00 0.00 ? 39 ASN A HD21 3  
ATOM 2420  H HD22 . ASN A 1 39 ? -4.056  9.571  17.919 1.00 0.00 ? 39 ASN A HD22 3  
ATOM 2421  N N    . LYS A 1 40 ? -8.054  13.888 17.886 1.00 0.00 ? 40 LYS A N    3  
ATOM 2422  C CA   . LYS A 1 40 ? -9.138  14.903 17.757 1.00 0.00 ? 40 LYS A CA   3  
ATOM 2423  C C    . LYS A 1 40 ? -8.538  16.260 17.383 1.00 0.00 ? 40 LYS A C    3  
ATOM 2424  O O    . LYS A 1 40 ? -9.231  17.163 16.963 1.00 0.00 ? 40 LYS A O    3  
ATOM 2425  C CB   . LYS A 1 40 ? -9.789  14.966 19.139 1.00 0.00 ? 40 LYS A CB   3  
ATOM 2426  C CG   . LYS A 1 40 ? -10.651 13.721 19.357 1.00 0.00 ? 40 LYS A CG   3  
ATOM 2427  C CD   . LYS A 1 40 ? -11.056 13.637 20.829 1.00 0.00 ? 40 LYS A CD   3  
ATOM 2428  C CE   . LYS A 1 40 ? -11.344 12.180 21.196 1.00 0.00 ? 40 LYS A CE   3  
ATOM 2429  N NZ   . LYS A 1 40 ? -12.053 12.249 22.505 1.00 0.00 ? 40 LYS A NZ   3  
ATOM 2430  H H    . LYS A 1 40 ? -7.558  13.804 18.727 1.00 0.00 ? 40 LYS A H    3  
ATOM 2431  H HA   . LYS A 1 40 ? -9.863  14.592 17.022 1.00 0.00 ? 40 LYS A HA   3  
ATOM 2432  H HB2  . LYS A 1 40 ? -9.020  15.008 19.896 1.00 0.00 ? 40 LYS A HB2  3  
ATOM 2433  H HB3  . LYS A 1 40 ? -10.407 15.849 19.206 1.00 0.00 ? 40 LYS A HB3  3  
ATOM 2434  H HG2  . LYS A 1 40 ? -11.536 13.785 18.741 1.00 0.00 ? 40 LYS A HG2  3  
ATOM 2435  H HG3  . LYS A 1 40 ? -10.087 12.841 19.087 1.00 0.00 ? 40 LYS A HG3  3  
ATOM 2436  H HD2  . LYS A 1 40 ? -10.253 14.011 21.446 1.00 0.00 ? 40 LYS A HD2  3  
ATOM 2437  H HD3  . LYS A 1 40 ? -11.942 14.231 20.993 1.00 0.00 ? 40 LYS A HD3  3  
ATOM 2438  H HE2  . LYS A 1 40 ? -11.976 11.722 20.450 1.00 0.00 ? 40 LYS A HE2  3  
ATOM 2439  H HE3  . LYS A 1 40 ? -10.421 11.629 21.299 1.00 0.00 ? 40 LYS A HE3  3  
ATOM 2440  H HZ1  . LYS A 1 40 ? -11.635 13.006 23.085 1.00 0.00 ? 40 LYS A HZ1  3  
ATOM 2441  H HZ2  . LYS A 1 40 ? -13.060 12.452 22.343 1.00 0.00 ? 40 LYS A HZ2  3  
ATOM 2442  H HZ3  . LYS A 1 40 ? -11.961 11.340 22.999 1.00 0.00 ? 40 LYS A HZ3  3  
ATOM 2443  N N    . CYS A 1 41 ? -7.251  16.405 17.534 1.00 0.00 ? 41 CYS A N    3  
ATOM 2444  C CA   . CYS A 1 41 ? -6.599  17.699 17.187 1.00 0.00 ? 41 CYS A CA   3  
ATOM 2445  C C    . CYS A 1 41 ? -6.940  18.092 15.751 1.00 0.00 ? 41 CYS A C    3  
ATOM 2446  O O    . CYS A 1 41 ? -7.699  19.009 15.509 1.00 0.00 ? 41 CYS A O    3  
ATOM 2447  C CB   . CYS A 1 41 ? -5.101  17.428 17.322 1.00 0.00 ? 41 CYS A CB   3  
ATOM 2448  S SG   . CYS A 1 41 ? -4.168  18.835 16.672 1.00 0.00 ? 41 CYS A SG   3  
ATOM 2449  H H    . CYS A 1 41 ? -6.712  15.661 17.875 1.00 0.00 ? 41 CYS A H    3  
ATOM 2450  H HA   . CYS A 1 41 ? -6.899  18.472 17.875 1.00 0.00 ? 41 CYS A HA   3  
ATOM 2451  H HB2  . CYS A 1 41 ? -4.854  17.282 18.362 1.00 0.00 ? 41 CYS A HB2  3  
ATOM 2452  H HB3  . CYS A 1 41 ? -4.845  16.538 16.765 1.00 0.00 ? 41 CYS A HB3  3  
ATOM 2453  N N    . ALA A 1 42 ? -6.384  17.401 14.797 1.00 0.00 ? 42 ALA A N    3  
ATOM 2454  C CA   . ALA A 1 42 ? -6.673  17.730 13.372 1.00 0.00 ? 42 ALA A CA   3  
ATOM 2455  C C    . ALA A 1 42 ? -8.164  17.542 13.079 1.00 0.00 ? 42 ALA A C    3  
ATOM 2456  O O    . ALA A 1 42 ? -8.749  18.259 12.293 1.00 0.00 ? 42 ALA A O    3  
ATOM 2457  C CB   . ALA A 1 42 ? -5.836  16.743 12.557 1.00 0.00 ? 42 ALA A CB   3  
ATOM 2458  H H    . ALA A 1 42 ? -5.775  16.665 15.018 1.00 0.00 ? 42 ALA A H    3  
ATOM 2459  H HA   . ALA A 1 42 ? -6.371  18.741 13.149 1.00 0.00 ? 42 ALA A HA   3  
ATOM 2460  H HB1  . ALA A 1 42 ? -6.032  15.738 12.898 1.00 0.00 ? 42 ALA A HB1  3  
ATOM 2461  H HB2  . ALA A 1 42 ? -6.096  16.826 11.512 1.00 0.00 ? 42 ALA A HB2  3  
ATOM 2462  H HB3  . ALA A 1 42 ? -4.788  16.969 12.686 1.00 0.00 ? 42 ALA A HB3  3  
ATOM 2463  N N    . THR A 1 43 ? -8.784  16.582 13.710 1.00 0.00 ? 43 THR A N    3  
ATOM 2464  C CA   . THR A 1 43 ? -10.236 16.350 13.472 1.00 0.00 ? 43 THR A CA   3  
ATOM 2465  C C    . THR A 1 43 ? -11.048 17.525 14.018 1.00 0.00 ? 43 THR A C    3  
ATOM 2466  O O    . THR A 1 43 ? -11.776 18.177 13.298 1.00 0.00 ? 43 THR A O    3  
ATOM 2467  C CB   . THR A 1 43 ? -10.564 15.068 14.239 1.00 0.00 ? 43 THR A CB   3  
ATOM 2468  O OG1  . THR A 1 43 ? -9.670  14.038 13.838 1.00 0.00 ? 43 THR A OG1  3  
ATOM 2469  C CG2  . THR A 1 43 ? -12.002 14.644 13.939 1.00 0.00 ? 43 THR A CG2  3  
ATOM 2470  H H    . THR A 1 43 ? -8.294  16.017 14.342 1.00 0.00 ? 43 THR A H    3  
ATOM 2471  H HA   . THR A 1 43 ? -10.430 16.211 12.420 1.00 0.00 ? 43 THR A HA   3  
ATOM 2472  H HB   . THR A 1 43 ? -10.459 15.244 15.298 1.00 0.00 ? 43 THR A HB   3  
ATOM 2473  H HG1  . THR A 1 43 ? -9.808  13.874 12.902 1.00 0.00 ? 43 THR A HG1  3  
ATOM 2474  H HG21 . THR A 1 43 ? -12.581 15.511 13.660 1.00 0.00 ? 43 THR A HG21 3  
ATOM 2475  H HG22 . THR A 1 43 ? -12.006 13.932 13.127 1.00 0.00 ? 43 THR A HG22 3  
ATOM 2476  H HG23 . THR A 1 43 ? -12.435 14.190 14.818 1.00 0.00 ? 43 THR A HG23 3  
ATOM 2477  N N    . CYS A 1 44 ? -10.925 17.805 15.286 1.00 0.00 ? 44 CYS A N    3  
ATOM 2478  C CA   . CYS A 1 44 ? -11.687 18.941 15.875 1.00 0.00 ? 44 CYS A CA   3  
ATOM 2479  C C    . CYS A 1 44 ? -11.445 20.211 15.057 1.00 0.00 ? 44 CYS A C    3  
ATOM 2480  O O    . CYS A 1 44 ? -12.277 21.095 15.001 1.00 0.00 ? 44 CYS A O    3  
ATOM 2481  C CB   . CYS A 1 44 ? -11.136 19.099 17.291 1.00 0.00 ? 44 CYS A CB   3  
ATOM 2482  S SG   . CYS A 1 44 ? -11.948 20.499 18.101 1.00 0.00 ? 44 CYS A SG   3  
ATOM 2483  H H    . CYS A 1 44 ? -10.330 17.270 15.849 1.00 0.00 ? 44 CYS A H    3  
ATOM 2484  H HA   . CYS A 1 44 ? -12.740 18.712 15.912 1.00 0.00 ? 44 CYS A HA   3  
ATOM 2485  H HB2  . CYS A 1 44 ? -11.326 18.197 17.854 1.00 0.00 ? 44 CYS A HB2  3  
ATOM 2486  H HB3  . CYS A 1 44 ? -10.072 19.278 17.245 1.00 0.00 ? 44 CYS A HB3  3  
ATOM 2487  N N    . LYS A 1 45 ? -10.311 20.309 14.417 1.00 0.00 ? 45 LYS A N    3  
ATOM 2488  C CA   . LYS A 1 45 ? -10.020 21.521 13.601 1.00 0.00 ? 45 LYS A CA   3  
ATOM 2489  C C    . LYS A 1 45 ? -11.002 21.610 12.430 1.00 0.00 ? 45 LYS A C    3  
ATOM 2490  O O    . LYS A 1 45 ? -11.600 22.640 12.188 1.00 0.00 ? 45 LYS A O    3  
ATOM 2491  C CB   . LYS A 1 45 ? -8.593  21.326 13.090 1.00 0.00 ? 45 LYS A CB   3  
ATOM 2492  C CG   . LYS A 1 45 ? -8.236  22.464 12.132 1.00 0.00 ? 45 LYS A CG   3  
ATOM 2493  C CD   . LYS A 1 45 ? -7.247  21.957 11.082 1.00 0.00 ? 45 LYS A CD   3  
ATOM 2494  C CE   . LYS A 1 45 ? -6.725  23.139 10.262 1.00 0.00 ? 45 LYS A CE   3  
ATOM 2495  N NZ   . LYS A 1 45 ? -5.692  22.552 9.362  1.00 0.00 ? 45 LYS A NZ   3  
ATOM 2496  H H    . LYS A 1 45 ? -9.652  19.585 14.473 1.00 0.00 ? 45 LYS A H    3  
ATOM 2497  H HA   . LYS A 1 45 ? -10.076 22.409 14.210 1.00 0.00 ? 45 LYS A HA   3  
ATOM 2498  H HB2  . LYS A 1 45 ? -7.908  21.329 13.925 1.00 0.00 ? 45 LYS A HB2  3  
ATOM 2499  H HB3  . LYS A 1 45 ? -8.522  20.383 12.569 1.00 0.00 ? 45 LYS A HB3  3  
ATOM 2500  H HG2  . LYS A 1 45 ? -9.132  22.817 11.643 1.00 0.00 ? 45 LYS A HG2  3  
ATOM 2501  H HG3  . LYS A 1 45 ? -7.788  23.275 12.688 1.00 0.00 ? 45 LYS A HG3  3  
ATOM 2502  H HD2  . LYS A 1 45 ? -6.420  21.466 11.574 1.00 0.00 ? 45 LYS A HD2  3  
ATOM 2503  H HD3  . LYS A 1 45 ? -7.746  21.257 10.428 1.00 0.00 ? 45 LYS A HD3  3  
ATOM 2504  H HE2  . LYS A 1 45 ? -7.524  23.577 9.683  1.00 0.00 ? 45 LYS A HE2  3  
ATOM 2505  H HE3  . LYS A 1 45 ? -6.281  23.879 10.911 1.00 0.00 ? 45 LYS A HE3  3  
ATOM 2506  H HZ1  . LYS A 1 45 ? -6.046  21.661 8.962  1.00 0.00 ? 45 LYS A HZ1  3  
ATOM 2507  H HZ2  . LYS A 1 45 ? -5.486  23.221 8.591  1.00 0.00 ? 45 LYS A HZ2  3  
ATOM 2508  H HZ3  . LYS A 1 45 ? -4.824  22.367 9.902  1.00 0.00 ? 45 LYS A HZ3  3  
ATOM 2509  N N    . MET A 1 46 ? -11.175 20.539 11.703 1.00 0.00 ? 46 MET A N    3  
ATOM 2510  C CA   . MET A 1 46 ? -12.121 20.572 10.551 1.00 0.00 ? 46 MET A CA   3  
ATOM 2511  C C    . MET A 1 46 ? -13.546 20.812 11.052 1.00 0.00 ? 46 MET A C    3  
ATOM 2512  O O    . MET A 1 46 ? -14.398 21.293 10.330 1.00 0.00 ? 46 MET A O    3  
ATOM 2513  C CB   . MET A 1 46 ? -12.002 19.196 9.890  1.00 0.00 ? 46 MET A CB   3  
ATOM 2514  C CG   . MET A 1 46 ? -12.514 18.111 10.839 1.00 0.00 ? 46 MET A CG   3  
ATOM 2515  S SD   . MET A 1 46 ? -13.648 17.017 9.946  1.00 0.00 ? 46 MET A SD   3  
ATOM 2516  C CE   . MET A 1 46 ? -12.428 16.292 8.825  1.00 0.00 ? 46 MET A CE   3  
ATOM 2517  H H    . MET A 1 46 ? -10.685 19.717 11.914 1.00 0.00 ? 46 MET A H    3  
ATOM 2518  H HA   . MET A 1 46 ? -11.834 21.341 9.853  1.00 0.00 ? 46 MET A HA   3  
ATOM 2519  H HB2  . MET A 1 46 ? -12.587 19.184 8.984  1.00 0.00 ? 46 MET A HB2  3  
ATOM 2520  H HB3  . MET A 1 46 ? -10.968 19.004 9.651  1.00 0.00 ? 46 MET A HB3  3  
ATOM 2521  H HG2  . MET A 1 46 ? -11.679 17.536 11.212 1.00 0.00 ? 46 MET A HG2  3  
ATOM 2522  H HG3  . MET A 1 46 ? -13.033 18.567 11.665 1.00 0.00 ? 46 MET A HG3  3  
ATOM 2523  H HE1  . MET A 1 46 ? -11.552 15.999 9.387  1.00 0.00 ? 46 MET A HE1  3  
ATOM 2524  H HE2  . MET A 1 46 ? -12.855 15.427 8.338  1.00 0.00 ? 46 MET A HE2  3  
ATOM 2525  H HE3  . MET A 1 46 ? -12.146 17.019 8.079  1.00 0.00 ? 46 MET A HE3  3  
ATOM 2526  N N    . ILE A 1 47 ? -13.810 20.489 12.288 1.00 0.00 ? 47 ILE A N    3  
ATOM 2527  C CA   . ILE A 1 47 ? -15.178 20.707 12.839 1.00 0.00 ? 47 ILE A CA   3  
ATOM 2528  C C    . ILE A 1 47 ? -15.557 22.182 12.704 1.00 0.00 ? 47 ILE A C    3  
ATOM 2529  O O    . ILE A 1 47 ? -16.677 22.521 12.380 1.00 0.00 ? 47 ILE A O    3  
ATOM 2530  C CB   . ILE A 1 47 ? -15.087 20.312 14.315 1.00 0.00 ? 47 ILE A CB   3  
ATOM 2531  C CG1  . ILE A 1 47 ? -14.656 18.848 14.431 1.00 0.00 ? 47 ILE A CG1  3  
ATOM 2532  C CG2  . ILE A 1 47 ? -16.455 20.493 14.976 1.00 0.00 ? 47 ILE A CG2  3  
ATOM 2533  C CD1  . ILE A 1 47 ? -15.712 17.953 13.781 1.00 0.00 ? 47 ILE A CD1  3  
ATOM 2534  H H    . ILE A 1 47 ? -13.108 20.107 12.852 1.00 0.00 ? 47 ILE A H    3  
ATOM 2535  H HA   . ILE A 1 47 ? -15.896 20.083 12.331 1.00 0.00 ? 47 ILE A HA   3  
ATOM 2536  H HB   . ILE A 1 47 ? -14.361 20.940 14.811 1.00 0.00 ? 47 ILE A HB   3  
ATOM 2537  H HG12 . ILE A 1 47 ? -13.709 18.710 13.931 1.00 0.00 ? 47 ILE A HG12 3  
ATOM 2538  H HG13 . ILE A 1 47 ? -14.554 18.585 15.473 1.00 0.00 ? 47 ILE A HG13 3  
ATOM 2539  H HG21 . ILE A 1 47 ? -16.765 21.522 14.883 1.00 0.00 ? 47 ILE A HG21 3  
ATOM 2540  H HG22 . ILE A 1 47 ? -17.177 19.853 14.489 1.00 0.00 ? 47 ILE A HG22 3  
ATOM 2541  H HG23 . ILE A 1 47 ? -16.387 20.230 16.021 1.00 0.00 ? 47 ILE A HG23 3  
ATOM 2542  H HD11 . ILE A 1 47 ? -16.458 18.566 13.299 1.00 0.00 ? 47 ILE A HD11 3  
ATOM 2543  H HD12 . ILE A 1 47 ? -15.240 17.315 13.047 1.00 0.00 ? 47 ILE A HD12 3  
ATOM 2544  H HD13 . ILE A 1 47 ? -16.182 17.343 14.539 1.00 0.00 ? 47 ILE A HD13 3  
ATOM 2545  N N    . LEU A 1 48 ? -14.625 23.062 12.946 1.00 0.00 ? 48 LEU A N    3  
ATOM 2546  C CA   . LEU A 1 48 ? -14.920 24.517 12.829 1.00 0.00 ? 48 LEU A CA   3  
ATOM 2547  C C    . LEU A 1 48 ? -15.040 24.901 11.354 1.00 0.00 ? 48 LEU A C    3  
ATOM 2548  O O    . LEU A 1 48 ? -15.892 25.679 10.971 1.00 0.00 ? 48 LEU A O    3  
ATOM 2549  C CB   . LEU A 1 48 ? -13.724 25.219 13.472 1.00 0.00 ? 48 LEU A CB   3  
ATOM 2550  C CG   . LEU A 1 48 ? -13.807 25.083 14.994 1.00 0.00 ? 48 LEU A CG   3  
ATOM 2551  C CD1  . LEU A 1 48 ? -15.147 25.636 15.483 1.00 0.00 ? 48 LEU A CD1  3  
ATOM 2552  C CD2  . LEU A 1 48 ? -13.692 23.607 15.384 1.00 0.00 ? 48 LEU A CD2  3  
ATOM 2553  H H    . LEU A 1 48 ? -13.726 22.764 13.202 1.00 0.00 ? 48 LEU A H    3  
ATOM 2554  H HA   . LEU A 1 48 ? -15.825 24.763 13.361 1.00 0.00 ? 48 LEU A HA   3  
ATOM 2555  H HB2  . LEU A 1 48 ? -12.809 24.766 13.120 1.00 0.00 ? 48 LEU A HB2  3  
ATOM 2556  H HB3  . LEU A 1 48 ? -13.734 26.265 13.204 1.00 0.00 ? 48 LEU A HB3  3  
ATOM 2557  H HG   . LEU A 1 48 ? -13.001 25.639 15.449 1.00 0.00 ? 48 LEU A HG   3  
ATOM 2558  H HD11 . LEU A 1 48 ? -15.512 26.369 14.779 1.00 0.00 ? 48 LEU A HD11 3  
ATOM 2559  H HD12 . LEU A 1 48 ? -15.861 24.830 15.564 1.00 0.00 ? 48 LEU A HD12 3  
ATOM 2560  H HD13 . LEU A 1 48 ? -15.015 26.100 16.449 1.00 0.00 ? 48 LEU A HD13 3  
ATOM 2561  H HD21 . LEU A 1 48 ? -12.881 23.152 14.835 1.00 0.00 ? 48 LEU A HD21 3  
ATOM 2562  H HD22 . LEU A 1 48 ? -13.497 23.529 16.444 1.00 0.00 ? 48 LEU A HD22 3  
ATOM 2563  H HD23 . LEU A 1 48 ? -14.616 23.100 15.149 1.00 0.00 ? 48 LEU A HD23 3  
ATOM 2564  N N    . GLU A 1 49 ? -14.196 24.355 10.521 1.00 0.00 ? 49 GLU A N    3  
ATOM 2565  C CA   . GLU A 1 49 ? -14.266 24.685 9.068  1.00 0.00 ? 49 GLU A CA   3  
ATOM 2566  C C    . GLU A 1 49 ? -15.592 24.190 8.485  1.00 0.00 ? 49 GLU A C    3  
ATOM 2567  O O    . GLU A 1 49 ? -16.060 24.679 7.475  1.00 0.00 ? 49 GLU A O    3  
ATOM 2568  C CB   . GLU A 1 49 ? -13.090 23.939 8.435  1.00 0.00 ? 49 GLU A CB   3  
ATOM 2569  C CG   . GLU A 1 49 ? -11.776 24.505 8.978  1.00 0.00 ? 49 GLU A CG   3  
ATOM 2570  C CD   . GLU A 1 49 ? -10.602 23.891 8.215  1.00 0.00 ? 49 GLU A CD   3  
ATOM 2571  O OE1  . GLU A 1 49 ? -10.846 23.028 7.387  1.00 0.00 ? 49 GLU A OE1  3  
ATOM 2572  O OE2  . GLU A 1 49 ? -9.479  24.292 8.470  1.00 0.00 ? 49 GLU A OE2  3  
ATOM 2573  H H    . GLU A 1 49 ? -13.520 23.726 10.849 1.00 0.00 ? 49 GLU A H    3  
ATOM 2574  H HA   . GLU A 1 49 ? -14.157 25.747 8.916  1.00 0.00 ? 49 GLU A HA   3  
ATOM 2575  H HB2  . GLU A 1 49 ? -13.158 22.889 8.678  1.00 0.00 ? 49 GLU A HB2  3  
ATOM 2576  H HB3  . GLU A 1 49 ? -13.120 24.064 7.363  1.00 0.00 ? 49 GLU A HB3  3  
ATOM 2577  H HG2  . GLU A 1 49 ? -11.766 25.577 8.851  1.00 0.00 ? 49 GLU A HG2  3  
ATOM 2578  H HG3  . GLU A 1 49 ? -11.688 24.266 10.028 1.00 0.00 ? 49 GLU A HG3  3  
ATOM 2579  N N    . LYS A 1 50 ? -16.201 23.225 9.117  1.00 0.00 ? 50 LYS A N    3  
ATOM 2580  C CA   . LYS A 1 50 ? -17.498 22.697 8.604  1.00 0.00 ? 50 LYS A CA   3  
ATOM 2581  C C    . LYS A 1 50 ? -18.628 23.680 8.920  1.00 0.00 ? 50 LYS A C    3  
ATOM 2582  O O    . LYS A 1 50 ? -19.500 23.923 8.108  1.00 0.00 ? 50 LYS A O    3  
ATOM 2583  C CB   . LYS A 1 50 ? -17.711 21.380 9.348  1.00 0.00 ? 50 LYS A CB   3  
ATOM 2584  C CG   . LYS A 1 50 ? -16.739 20.327 8.812  1.00 0.00 ? 50 LYS A CG   3  
ATOM 2585  C CD   . LYS A 1 50 ? -17.222 19.837 7.445  1.00 0.00 ? 50 LYS A CD   3  
ATOM 2586  C CE   . LYS A 1 50 ? -16.379 18.640 7.005  1.00 0.00 ? 50 LYS A CE   3  
ATOM 2587  N NZ   . LYS A 1 50 ? -16.761 18.408 5.583  1.00 0.00 ? 50 LYS A NZ   3  
ATOM 2588  H H    . LYS A 1 50 ? -15.807 22.847 9.930  1.00 0.00 ? 50 LYS A H    3  
ATOM 2589  H HA   . LYS A 1 50 ? -17.439 22.516 7.542  1.00 0.00 ? 50 LYS A HA   3  
ATOM 2590  H HB2  . LYS A 1 50 ? -17.532 21.530 10.404 1.00 0.00 ? 50 LYS A HB2  3  
ATOM 2591  H HB3  . LYS A 1 50 ? -18.726 21.042 9.200  1.00 0.00 ? 50 LYS A HB3  3  
ATOM 2592  H HG2  . LYS A 1 50 ? -15.756 20.762 8.711  1.00 0.00 ? 50 LYS A HG2  3  
ATOM 2593  H HG3  . LYS A 1 50 ? -16.696 19.494 9.497  1.00 0.00 ? 50 LYS A HG3  3  
ATOM 2594  H HD2  . LYS A 1 50 ? -18.259 19.541 7.514  1.00 0.00 ? 50 LYS A HD2  3  
ATOM 2595  H HD3  . LYS A 1 50 ? -17.123 20.634 6.722  1.00 0.00 ? 50 LYS A HD3  3  
ATOM 2596  H HE2  . LYS A 1 50 ? -15.327 18.874 7.077  1.00 0.00 ? 50 LYS A HE2  3  
ATOM 2597  H HE3  . LYS A 1 50 ? -16.615 17.773 7.604  1.00 0.00 ? 50 LYS A HE3  3  
ATOM 2598  H HZ1  . LYS A 1 50 ? -17.797 18.422 5.496  1.00 0.00 ? 50 LYS A HZ1  3  
ATOM 2599  H HZ2  . LYS A 1 50 ? -16.355 19.156 4.987  1.00 0.00 ? 50 LYS A HZ2  3  
ATOM 2600  H HZ3  . LYS A 1 50 ? -16.399 17.482 5.274  1.00 0.00 ? 50 LYS A HZ3  3  
ATOM 2601  N N    . GLU A 1 51 ? -18.619 24.247 10.095 1.00 0.00 ? 51 GLU A N    3  
ATOM 2602  C CA   . GLU A 1 51 ? -19.693 25.214 10.465 1.00 0.00 ? 51 GLU A CA   3  
ATOM 2603  C C    . GLU A 1 51 ? -19.704 26.390 9.484  1.00 0.00 ? 51 GLU A C    3  
ATOM 2604  O O    . GLU A 1 51 ? -20.718 27.026 9.275  1.00 0.00 ? 51 GLU A O    3  
ATOM 2605  C CB   . GLU A 1 51 ? -19.329 25.691 11.871 1.00 0.00 ? 51 GLU A CB   3  
ATOM 2606  C CG   . GLU A 1 51 ? -19.297 24.494 12.825 1.00 0.00 ? 51 GLU A CG   3  
ATOM 2607  C CD   . GLU A 1 51 ? -18.785 24.947 14.194 1.00 0.00 ? 51 GLU A CD   3  
ATOM 2608  O OE1  . GLU A 1 51 ? -18.572 26.136 14.361 1.00 0.00 ? 51 GLU A OE1  3  
ATOM 2609  O OE2  . GLU A 1 51 ? -18.616 24.096 15.052 1.00 0.00 ? 51 GLU A OE2  3  
ATOM 2610  H H    . GLU A 1 51 ? -17.907 24.038 10.735 1.00 0.00 ? 51 GLU A H    3  
ATOM 2611  H HA   . GLU A 1 51 ? -20.653 24.724 10.478 1.00 0.00 ? 51 GLU A HA   3  
ATOM 2612  H HB2  . GLU A 1 51 ? -18.357 26.162 11.852 1.00 0.00 ? 51 GLU A HB2  3  
ATOM 2613  H HB3  . GLU A 1 51 ? -20.067 26.403 12.212 1.00 0.00 ? 51 GLU A HB3  3  
ATOM 2614  H HG2  . GLU A 1 51 ? -20.293 24.090 12.928 1.00 0.00 ? 51 GLU A HG2  3  
ATOM 2615  H HG3  . GLU A 1 51 ? -18.639 23.735 12.427 1.00 0.00 ? 51 GLU A HG3  3  
ATOM 2616  N N    . ALA A 1 52 ? -18.585 26.681 8.881  1.00 0.00 ? 52 ALA A N    3  
ATOM 2617  C CA   . ALA A 1 52 ? -18.532 27.814 7.913  1.00 0.00 ? 52 ALA A CA   3  
ATOM 2618  C C    . ALA A 1 52 ? -19.105 27.381 6.561  1.00 0.00 ? 52 ALA A C    3  
ATOM 2619  O O    . ALA A 1 52 ? -18.735 26.359 6.019  1.00 0.00 ? 52 ALA A O    3  
ATOM 2620  C CB   . ALA A 1 52 ? -17.047 28.155 7.782  1.00 0.00 ? 52 ALA A CB   3  
ATOM 2621  H H    . ALA A 1 52 ? -17.779 26.155 9.063  1.00 0.00 ? 52 ALA A H    3  
ATOM 2622  H HA   . ALA A 1 52 ? -19.072 28.665 8.297  1.00 0.00 ? 52 ALA A HA   3  
ATOM 2623  H HB1  . ALA A 1 52 ? -16.488 27.625 8.539  1.00 0.00 ? 52 ALA A HB1  3  
ATOM 2624  H HB2  . ALA A 1 52 ? -16.696 27.862 6.804  1.00 0.00 ? 52 ALA A HB2  3  
ATOM 2625  H HB3  . ALA A 1 52 ? -16.909 29.218 7.911  1.00 0.00 ? 52 ALA A HB3  3  
ATOM 2626  N N    . LYS A 1 53 ? -20.006 28.149 6.013  1.00 0.00 ? 53 LYS A N    3  
ATOM 2627  C CA   . LYS A 1 53 ? -20.601 27.779 4.697  1.00 0.00 ? 53 LYS A CA   3  
ATOM 2628  C C    . LYS A 1 53 ? -21.236 26.387 4.776  1.00 0.00 ? 53 LYS A C    3  
ATOM 2629  O O    . LYS A 1 53 ? -21.122 25.590 3.866  1.00 0.00 ? 53 LYS A O    3  
ATOM 2630  C CB   . LYS A 1 53 ? -19.426 27.778 3.718  1.00 0.00 ? 53 LYS A CB   3  
ATOM 2631  C CG   . LYS A 1 53 ? -18.767 29.158 3.712  1.00 0.00 ? 53 LYS A CG   3  
ATOM 2632  C CD   . LYS A 1 53 ? -17.664 29.193 2.653  1.00 0.00 ? 53 LYS A CD   3  
ATOM 2633  C CE   . LYS A 1 53 ? -17.009 30.576 2.644  1.00 0.00 ? 53 LYS A CE   3  
ATOM 2634  N NZ   . LYS A 1 53 ? -15.855 30.446 1.711  1.00 0.00 ? 53 LYS A NZ   3  
ATOM 2635  H H    . LYS A 1 53 ? -20.292 28.970 6.466  1.00 0.00 ? 53 LYS A H    3  
ATOM 2636  H HA   . LYS A 1 53 ? -21.331 28.511 4.393  1.00 0.00 ? 53 LYS A HA   3  
ATOM 2637  H HB2  . LYS A 1 53 ? -18.704 27.035 4.024  1.00 0.00 ? 53 LYS A HB2  3  
ATOM 2638  H HB3  . LYS A 1 53 ? -19.783 27.545 2.726  1.00 0.00 ? 53 LYS A HB3  3  
ATOM 2639  H HG2  . LYS A 1 53 ? -19.509 29.910 3.485  1.00 0.00 ? 53 LYS A HG2  3  
ATOM 2640  H HG3  . LYS A 1 53 ? -18.340 29.358 4.684  1.00 0.00 ? 53 LYS A HG3  3  
ATOM 2641  H HD2  . LYS A 1 53 ? -16.921 28.445 2.883  1.00 0.00 ? 53 LYS A HD2  3  
ATOM 2642  H HD3  . LYS A 1 53 ? -18.091 28.991 1.682  1.00 0.00 ? 53 LYS A HD3  3  
ATOM 2643  H HE2  . LYS A 1 53 ? -17.704 31.319 2.283  1.00 0.00 ? 53 LYS A HE2  3  
ATOM 2644  H HE3  . LYS A 1 53 ? -16.663 30.834 3.635  1.00 0.00 ? 53 LYS A HE3  3  
ATOM 2645  H HZ1  . LYS A 1 53 ? -15.413 29.513 1.832  1.00 0.00 ? 53 LYS A HZ1  3  
ATOM 2646  H HZ2  . LYS A 1 53 ? -16.190 30.548 0.731  1.00 0.00 ? 53 LYS A HZ2  3  
ATOM 2647  H HZ3  . LYS A 1 53 ? -15.156 31.188 1.916  1.00 0.00 ? 53 LYS A HZ3  3  
ATOM 2648  N N    . SER A 1 54 ? -21.905 26.092 5.856  1.00 0.00 ? 54 SER A N    3  
ATOM 2649  C CA   . SER A 1 54 ? -22.548 24.753 5.992  1.00 0.00 ? 54 SER A CA   3  
ATOM 2650  C C    . SER A 1 54 ? -23.637 24.579 4.930  1.00 0.00 ? 54 SER A C    3  
ATOM 2651  O O    . SER A 1 54 ? -24.074 23.481 4.649  1.00 0.00 ? 54 SER A O    3  
ATOM 2652  C CB   . SER A 1 54 ? -23.159 24.746 7.393  1.00 0.00 ? 54 SER A CB   3  
ATOM 2653  O OG   . SER A 1 54 ? -23.614 23.438 7.705  1.00 0.00 ? 54 SER A OG   3  
ATOM 2654  H H    . SER A 1 54 ? -21.985 26.749 6.579  1.00 0.00 ? 54 SER A H    3  
ATOM 2655  H HA   . SER A 1 54 ? -21.810 23.970 5.908  1.00 0.00 ? 54 SER A HA   3  
ATOM 2656  H HB2  . SER A 1 54 ? -22.412 25.049 8.112  1.00 0.00 ? 54 SER A HB2  3  
ATOM 2657  H HB3  . SER A 1 54 ? -23.991 25.433 7.427  1.00 0.00 ? 54 SER A HB3  3  
ATOM 2658  H HG   . SER A 1 54 ? -24.453 23.301 7.259  1.00 0.00 ? 54 SER A HG   3  
ATOM 2659  N N    . GLN A 1 55 ? -24.076 25.656 4.338  1.00 0.00 ? 55 GLN A N    3  
ATOM 2660  C CA   . GLN A 1 55 ? -25.137 25.553 3.294  1.00 0.00 ? 55 GLN A CA   3  
ATOM 2661  C C    . GLN A 1 55 ? -24.503 25.440 1.905  1.00 0.00 ? 55 GLN A C    3  
ATOM 2662  O O    . GLN A 1 55 ? -23.499 24.757 1.789  1.00 0.00 ? 55 GLN A O    3  
ATOM 2663  C CB   . GLN A 1 55 ? -25.938 26.849 3.414  1.00 0.00 ? 55 GLN A CB   3  
ATOM 2664  C CG   . GLN A 1 55 ? -26.803 26.800 4.675  1.00 0.00 ? 55 GLN A CG   3  
ATOM 2665  C CD   . GLN A 1 55 ? -27.564 28.119 4.823  1.00 0.00 ? 55 GLN A CD   3  
ATOM 2666  O OE1  . GLN A 1 55 ? -27.837 28.788 3.847  1.00 0.00 ? 55 GLN A OE1  3  
ATOM 2667  N NE2  . GLN A 1 55 ? -27.919 28.522 6.012  1.00 0.00 ? 55 GLN A NE2  3  
ATOM 2668  O OXT  . GLN A 1 55 ? -25.032 26.039 0.984  1.00 0.00 ? 55 GLN A OXT  3  
ATOM 2669  H H    . GLN A 1 55 ? -23.710 26.532 4.578  1.00 0.00 ? 55 GLN A H    3  
ATOM 2670  H HA   . GLN A 1 55 ? -25.776 24.705 3.488  1.00 0.00 ? 55 GLN A HA   3  
ATOM 2671  H HB2  . GLN A 1 55 ? -25.259 27.687 3.476  1.00 0.00 ? 55 GLN A HB2  3  
ATOM 2672  H HB3  . GLN A 1 55 ? -26.571 26.962 2.547  1.00 0.00 ? 55 GLN A HB3  3  
ATOM 2673  H HG2  . GLN A 1 55 ? -27.508 25.985 4.596  1.00 0.00 ? 55 GLN A HG2  3  
ATOM 2674  H HG3  . GLN A 1 55 ? -26.173 26.648 5.538  1.00 0.00 ? 55 GLN A HG3  3  
ATOM 2675  H HE21 . GLN A 1 55 ? -27.698 27.983 6.799  1.00 0.00 ? 55 GLN A HE21 3  
ATOM 2676  H HE22 . GLN A 1 55 ? -28.407 29.366 6.117  1.00 0.00 ? 55 GLN A HE22 3  
ATOM 2677  N N    . LYS A 1 1  ? -21.771 9.868  20.594 1.00 0.00 ? 1  LYS A N    4  
ATOM 2678  C CA   . LYS A 1 1  ? -21.537 8.918  19.468 1.00 0.00 ? 1  LYS A CA   4  
ATOM 2679  C C    . LYS A 1 1  ? -20.650 9.568  18.403 1.00 0.00 ? 1  LYS A C    4  
ATOM 2680  O O    . LYS A 1 1  ? -19.473 9.284  18.302 1.00 0.00 ? 1  LYS A O    4  
ATOM 2681  C CB   . LYS A 1 1  ? -22.925 8.626  18.901 1.00 0.00 ? 1  LYS A CB   4  
ATOM 2682  C CG   . LYS A 1 1  ? -23.741 7.837  19.927 1.00 0.00 ? 1  LYS A CG   4  
ATOM 2683  C CD   . LYS A 1 1  ? -25.076 7.424  19.305 1.00 0.00 ? 1  LYS A CD   4  
ATOM 2684  C CE   . LYS A 1 1  ? -25.878 6.601  20.315 1.00 0.00 ? 1  LYS A CE   4  
ATOM 2685  N NZ   . LYS A 1 1  ? -27.182 6.340  19.644 1.00 0.00 ? 1  LYS A NZ   4  
ATOM 2686  H H1   . LYS A 1 1  ? -20.922 10.450 20.740 1.00 0.00 ? 1  LYS A H1   4  
ATOM 2687  H H2   . LYS A 1 1  ? -22.579 10.482 20.366 1.00 0.00 ? 1  LYS A H2   4  
ATOM 2688  H H3   . LYS A 1 1  ? -21.975 9.333  21.461 1.00 0.00 ? 1  LYS A H3   4  
ATOM 2689  H HA   . LYS A 1 1  ? -21.086 8.008  19.830 1.00 0.00 ? 1  LYS A HA   4  
ATOM 2690  H HB2  . LYS A 1 1  ? -23.427 9.556  18.681 1.00 0.00 ? 1  LYS A HB2  4  
ATOM 2691  H HB3  . LYS A 1 1  ? -22.828 8.046  17.995 1.00 0.00 ? 1  LYS A HB3  4  
ATOM 2692  H HG2  . LYS A 1 1  ? -23.193 6.954  20.220 1.00 0.00 ? 1  LYS A HG2  4  
ATOM 2693  H HG3  . LYS A 1 1  ? -23.922 8.453  20.794 1.00 0.00 ? 1  LYS A HG3  4  
ATOM 2694  H HD2  . LYS A 1 1  ? -25.636 8.309  19.036 1.00 0.00 ? 1  LYS A HD2  4  
ATOM 2695  H HD3  . LYS A 1 1  ? -24.894 6.831  18.421 1.00 0.00 ? 1  LYS A HD3  4  
ATOM 2696  H HE2  . LYS A 1 1  ? -25.371 5.671  20.527 1.00 0.00 ? 1  LYS A HE2  4  
ATOM 2697  H HE3  . LYS A 1 1  ? -26.028 7.166  21.223 1.00 0.00 ? 1  LYS A HE3  4  
ATOM 2698  H HZ1  . LYS A 1 1  ? -27.402 7.126  18.997 1.00 0.00 ? 1  LYS A HZ1  4  
ATOM 2699  H HZ2  . LYS A 1 1  ? -27.124 5.454  19.105 1.00 0.00 ? 1  LYS A HZ2  4  
ATOM 2700  H HZ3  . LYS A 1 1  ? -27.931 6.260  20.360 1.00 0.00 ? 1  LYS A HZ3  4  
ATOM 2701  N N    . ASN A 1 2  ? -21.208 10.437 17.605 1.00 0.00 ? 2  ASN A N    4  
ATOM 2702  C CA   . ASN A 1 2  ? -20.399 11.104 16.545 1.00 0.00 ? 2  ASN A CA   4  
ATOM 2703  C C    . ASN A 1 2  ? -19.844 12.435 17.059 1.00 0.00 ? 2  ASN A C    4  
ATOM 2704  O O    . ASN A 1 2  ? -20.555 13.235 17.632 1.00 0.00 ? 2  ASN A O    4  
ATOM 2705  C CB   . ASN A 1 2  ? -21.377 11.343 15.394 1.00 0.00 ? 2  ASN A CB   4  
ATOM 2706  C CG   . ASN A 1 2  ? -22.007 10.013 14.976 1.00 0.00 ? 2  ASN A CG   4  
ATOM 2707  O OD1  . ASN A 1 2  ? -23.201 9.933  14.767 1.00 0.00 ? 2  ASN A OD1  4  
ATOM 2708  N ND2  . ASN A 1 2  ? -21.249 8.959  14.843 1.00 0.00 ? 2  ASN A ND2  4  
ATOM 2709  H H    . ASN A 1 2  ? -22.160 10.651 17.702 1.00 0.00 ? 2  ASN A H    4  
ATOM 2710  H HA   . ASN A 1 2  ? -19.598 10.459 16.220 1.00 0.00 ? 2  ASN A HA   4  
ATOM 2711  H HB2  . ASN A 1 2  ? -22.150 12.023 15.715 1.00 0.00 ? 2  ASN A HB2  4  
ATOM 2712  H HB3  . ASN A 1 2  ? -20.847 11.769 14.556 1.00 0.00 ? 2  ASN A HB3  4  
ATOM 2713  H HD21 . ASN A 1 2  ? -20.286 9.023  15.013 1.00 0.00 ? 2  ASN A HD21 4  
ATOM 2714  H HD22 . ASN A 1 2  ? -21.644 8.103  14.576 1.00 0.00 ? 2  ASN A HD22 4  
ATOM 2715  N N    . GLU A 1 3  ? -18.578 12.676 16.856 1.00 0.00 ? 3  GLU A N    4  
ATOM 2716  C CA   . GLU A 1 3  ? -17.978 13.956 17.332 1.00 0.00 ? 3  GLU A CA   4  
ATOM 2717  C C    . GLU A 1 3  ? -18.673 15.145 16.663 1.00 0.00 ? 3  GLU A C    4  
ATOM 2718  O O    . GLU A 1 3  ? -18.707 16.237 17.194 1.00 0.00 ? 3  GLU A O    4  
ATOM 2719  C CB   . GLU A 1 3  ? -16.511 13.885 16.911 1.00 0.00 ? 3  GLU A CB   4  
ATOM 2720  C CG   . GLU A 1 3  ? -15.838 12.697 17.601 1.00 0.00 ? 3  GLU A CG   4  
ATOM 2721  C CD   . GLU A 1 3  ? -14.401 12.559 17.095 1.00 0.00 ? 3  GLU A CD   4  
ATOM 2722  O OE1  . GLU A 1 3  ? -13.720 13.569 17.019 1.00 0.00 ? 3  GLU A OE1  4  
ATOM 2723  O OE2  . GLU A 1 3  ? -14.005 11.446 16.790 1.00 0.00 ? 3  GLU A OE2  4  
ATOM 2724  H H    . GLU A 1 3  ? -18.021 12.018 16.390 1.00 0.00 ? 3  GLU A H    4  
ATOM 2725  H HA   . GLU A 1 3  ? -18.051 14.031 18.405 1.00 0.00 ? 3  GLU A HA   4  
ATOM 2726  H HB2  . GLU A 1 3  ? -16.449 13.762 15.839 1.00 0.00 ? 3  GLU A HB2  4  
ATOM 2727  H HB3  . GLU A 1 3  ? -16.010 14.798 17.196 1.00 0.00 ? 3  GLU A HB3  4  
ATOM 2728  H HG2  . GLU A 1 3  ? -15.829 12.858 18.669 1.00 0.00 ? 3  GLU A HG2  4  
ATOM 2729  H HG3  . GLU A 1 3  ? -16.387 11.794 17.378 1.00 0.00 ? 3  GLU A HG3  4  
ATOM 2730  N N    . ASP A 1 4  ? -19.228 14.941 15.500 1.00 0.00 ? 4  ASP A N    4  
ATOM 2731  C CA   . ASP A 1 4  ? -19.921 16.059 14.795 1.00 0.00 ? 4  ASP A CA   4  
ATOM 2732  C C    . ASP A 1 4  ? -21.153 16.499 15.588 1.00 0.00 ? 4  ASP A C    4  
ATOM 2733  O O    . ASP A 1 4  ? -21.683 17.574 15.386 1.00 0.00 ? 4  ASP A O    4  
ATOM 2734  C CB   . ASP A 1 4  ? -20.337 15.476 13.446 1.00 0.00 ? 4  ASP A CB   4  
ATOM 2735  C CG   . ASP A 1 4  ? -19.106 15.339 12.547 1.00 0.00 ? 4  ASP A CG   4  
ATOM 2736  O OD1  . ASP A 1 4  ? -18.120 16.002 12.822 1.00 0.00 ? 4  ASP A OD1  4  
ATOM 2737  O OD2  . ASP A 1 4  ? -19.171 14.576 11.598 1.00 0.00 ? 4  ASP A OD2  4  
ATOM 2738  H H    . ASP A 1 4  ? -19.189 14.053 15.088 1.00 0.00 ? 4  ASP A H    4  
ATOM 2739  H HA   . ASP A 1 4  ? -19.248 16.888 14.648 1.00 0.00 ? 4  ASP A HA   4  
ATOM 2740  H HB2  . ASP A 1 4  ? -20.781 14.503 13.597 1.00 0.00 ? 4  ASP A HB2  4  
ATOM 2741  H HB3  . ASP A 1 4  ? -21.056 16.131 12.977 1.00 0.00 ? 4  ASP A HB3  4  
ATOM 2742  N N    . GLN A 1 5  ? -21.611 15.678 16.491 1.00 0.00 ? 5  GLN A N    4  
ATOM 2743  C CA   . GLN A 1 5  ? -22.807 16.049 17.301 1.00 0.00 ? 5  GLN A CA   4  
ATOM 2744  C C    . GLN A 1 5  ? -22.370 16.875 18.509 1.00 0.00 ? 5  GLN A C    4  
ATOM 2745  O O    . GLN A 1 5  ? -22.937 17.905 18.814 1.00 0.00 ? 5  GLN A O    4  
ATOM 2746  C CB   . GLN A 1 5  ? -23.416 14.719 17.748 1.00 0.00 ? 5  GLN A CB   4  
ATOM 2747  C CG   . GLN A 1 5  ? -24.140 14.068 16.567 1.00 0.00 ? 5  GLN A CG   4  
ATOM 2748  C CD   . GLN A 1 5  ? -25.131 15.065 15.964 1.00 0.00 ? 5  GLN A CD   4  
ATOM 2749  O OE1  . GLN A 1 5  ? -25.541 16.003 16.619 1.00 0.00 ? 5  GLN A OE1  4  
ATOM 2750  N NE2  . GLN A 1 5  ? -25.538 14.900 14.735 1.00 0.00 ? 5  GLN A NE2  4  
ATOM 2751  H H    . GLN A 1 5  ? -21.166 14.820 16.641 1.00 0.00 ? 5  GLN A H    4  
ATOM 2752  H HA   . GLN A 1 5  ? -23.513 16.598 16.704 1.00 0.00 ? 5  GLN A HA   4  
ATOM 2753  H HB2  . GLN A 1 5  ? -22.631 14.063 18.095 1.00 0.00 ? 5  GLN A HB2  4  
ATOM 2754  H HB3  . GLN A 1 5  ? -24.118 14.895 18.549 1.00 0.00 ? 5  GLN A HB3  4  
ATOM 2755  H HG2  . GLN A 1 5  ? -23.418 13.780 15.817 1.00 0.00 ? 5  GLN A HG2  4  
ATOM 2756  H HG3  . GLN A 1 5  ? -24.672 13.193 16.910 1.00 0.00 ? 5  GLN A HG3  4  
ATOM 2757  H HE21 . GLN A 1 5  ? -25.209 14.143 14.207 1.00 0.00 ? 5  GLN A HE21 4  
ATOM 2758  H HE22 . GLN A 1 5  ? -26.174 15.533 14.341 1.00 0.00 ? 5  GLN A HE22 4  
ATOM 2759  N N    . GLU A 1 6  ? -21.350 16.433 19.186 1.00 0.00 ? 6  GLU A N    4  
ATOM 2760  C CA   . GLU A 1 6  ? -20.850 17.190 20.367 1.00 0.00 ? 6  GLU A CA   4  
ATOM 2761  C C    . GLU A 1 6  ? -19.791 18.198 19.914 1.00 0.00 ? 6  GLU A C    4  
ATOM 2762  O O    . GLU A 1 6  ? -19.370 19.056 20.664 1.00 0.00 ? 6  GLU A O    4  
ATOM 2763  C CB   . GLU A 1 6  ? -20.234 16.135 21.286 1.00 0.00 ? 6  GLU A CB   4  
ATOM 2764  C CG   . GLU A 1 6  ? -21.347 15.285 21.902 1.00 0.00 ? 6  GLU A CG   4  
ATOM 2765  C CD   . GLU A 1 6  ? -21.812 14.238 20.887 1.00 0.00 ? 6  GLU A CD   4  
ATOM 2766  O OE1  . GLU A 1 6  ? -20.963 13.555 20.339 1.00 0.00 ? 6  GLU A OE1  4  
ATOM 2767  O OE2  . GLU A 1 6  ? -23.010 14.137 20.676 1.00 0.00 ? 6  GLU A OE2  4  
ATOM 2768  H H    . GLU A 1 6  ? -20.905 15.606 18.908 1.00 0.00 ? 6  GLU A H    4  
ATOM 2769  H HA   . GLU A 1 6  ? -21.662 17.692 20.868 1.00 0.00 ? 6  GLU A HA   4  
ATOM 2770  H HB2  . GLU A 1 6  ? -19.573 15.501 20.713 1.00 0.00 ? 6  GLU A HB2  4  
ATOM 2771  H HB3  . GLU A 1 6  ? -19.676 16.622 22.071 1.00 0.00 ? 6  GLU A HB3  4  
ATOM 2772  H HG2  . GLU A 1 6  ? -20.975 14.788 22.786 1.00 0.00 ? 6  GLU A HG2  4  
ATOM 2773  H HG3  . GLU A 1 6  ? -22.179 15.920 22.169 1.00 0.00 ? 6  GLU A HG3  4  
ATOM 2774  N N    . MET A 1 7  ? -19.363 18.097 18.684 1.00 0.00 ? 7  MET A N    4  
ATOM 2775  C CA   . MET A 1 7  ? -18.337 19.043 18.164 1.00 0.00 ? 7  MET A CA   4  
ATOM 2776  C C    . MET A 1 7  ? -17.062 18.964 19.010 1.00 0.00 ? 7  MET A C    4  
ATOM 2777  O O    . MET A 1 7  ? -16.668 17.907 19.459 1.00 0.00 ? 7  MET A O    4  
ATOM 2778  C CB   . MET A 1 7  ? -18.977 20.426 18.280 1.00 0.00 ? 7  MET A CB   4  
ATOM 2779  C CG   . MET A 1 7  ? -20.319 20.431 17.544 1.00 0.00 ? 7  MET A CG   4  
ATOM 2780  S SD   . MET A 1 7  ? -20.854 22.139 17.279 1.00 0.00 ? 7  MET A SD   4  
ATOM 2781  C CE   . MET A 1 7  ? -21.643 22.384 18.890 1.00 0.00 ? 7  MET A CE   4  
ATOM 2782  H H    . MET A 1 7  ? -19.720 17.398 18.097 1.00 0.00 ? 7  MET A H    4  
ATOM 2783  H HA   . MET A 1 7  ? -18.119 18.823 17.130 1.00 0.00 ? 7  MET A HA   4  
ATOM 2784  H HB2  . MET A 1 7  ? -19.136 20.662 19.322 1.00 0.00 ? 7  MET A HB2  4  
ATOM 2785  H HB3  . MET A 1 7  ? -18.323 21.163 17.840 1.00 0.00 ? 7  MET A HB3  4  
ATOM 2786  H HG2  . MET A 1 7  ? -20.208 19.936 16.592 1.00 0.00 ? 7  MET A HG2  4  
ATOM 2787  H HG3  . MET A 1 7  ? -21.057 19.910 18.137 1.00 0.00 ? 7  MET A HG3  4  
ATOM 2788  H HE1  . MET A 1 7  ? -21.438 21.537 19.525 1.00 0.00 ? 7  MET A HE1  4  
ATOM 2789  H HE2  . MET A 1 7  ? -21.251 23.280 19.349 1.00 0.00 ? 7  MET A HE2  4  
ATOM 2790  H HE3  . MET A 1 7  ? -22.712 22.479 18.755 1.00 0.00 ? 7  MET A HE3  4  
ATOM 2791  N N    . CYS A 1 8  ? -16.416 20.076 19.227 1.00 0.00 ? 8  CYS A N    4  
ATOM 2792  C CA   . CYS A 1 8  ? -15.166 20.066 20.040 1.00 0.00 ? 8  CYS A CA   4  
ATOM 2793  C C    . CYS A 1 8  ? -15.453 20.549 21.464 1.00 0.00 ? 8  CYS A C    4  
ATOM 2794  O O    . CYS A 1 8  ? -15.827 21.684 21.681 1.00 0.00 ? 8  CYS A O    4  
ATOM 2795  C CB   . CYS A 1 8  ? -14.224 21.036 19.327 1.00 0.00 ? 8  CYS A CB   4  
ATOM 2796  S SG   . CYS A 1 8  ? -13.611 20.273 17.805 1.00 0.00 ? 8  CYS A SG   4  
ATOM 2797  H H    . CYS A 1 8  ? -16.750 20.919 18.854 1.00 0.00 ? 8  CYS A H    4  
ATOM 2798  H HA   . CYS A 1 8  ? -14.735 19.078 20.056 1.00 0.00 ? 8  CYS A HA   4  
ATOM 2799  H HB2  . CYS A 1 8  ? -14.756 21.944 19.086 1.00 0.00 ? 8  CYS A HB2  4  
ATOM 2800  H HB3  . CYS A 1 8  ? -13.390 21.269 19.974 1.00 0.00 ? 8  CYS A HB3  4  
ATOM 2801  N N    . HIS A 1 9  ? -15.272 19.698 22.437 1.00 0.00 ? 9  HIS A N    4  
ATOM 2802  C CA   . HIS A 1 9  ? -15.530 20.113 23.846 1.00 0.00 ? 9  HIS A CA   4  
ATOM 2803  C C    . HIS A 1 9  ? -14.204 20.277 24.593 1.00 0.00 ? 9  HIS A C    4  
ATOM 2804  O O    . HIS A 1 9  ? -14.111 21.007 25.560 1.00 0.00 ? 9  HIS A O    4  
ATOM 2805  C CB   . HIS A 1 9  ? -16.354 18.978 24.454 1.00 0.00 ? 9  HIS A CB   4  
ATOM 2806  C CG   . HIS A 1 9  ? -15.535 17.717 24.476 1.00 0.00 ? 9  HIS A CG   4  
ATOM 2807  N ND1  . HIS A 1 9  ? -14.498 17.524 25.375 1.00 0.00 ? 9  HIS A ND1  4  
ATOM 2808  C CD2  . HIS A 1 9  ? -15.591 16.575 23.716 1.00 0.00 ? 9  HIS A CD2  4  
ATOM 2809  C CE1  . HIS A 1 9  ? -13.976 16.307 25.135 1.00 0.00 ? 9  HIS A CE1  4  
ATOM 2810  N NE2  . HIS A 1 9  ? -14.606 15.686 24.134 1.00 0.00 ? 9  HIS A NE2  4  
ATOM 2811  H H    . HIS A 1 9  ? -14.966 18.788 22.242 1.00 0.00 ? 9  HIS A H    4  
ATOM 2812  H HA   . HIS A 1 9  ? -16.093 21.033 23.871 1.00 0.00 ? 9  HIS A HA   4  
ATOM 2813  H HB2  . HIS A 1 9  ? -16.638 19.240 25.463 1.00 0.00 ? 9  HIS A HB2  4  
ATOM 2814  H HB3  . HIS A 1 9  ? -17.242 18.820 23.861 1.00 0.00 ? 9  HIS A HB3  4  
ATOM 2815  H HD1  . HIS A 1 9  ? -14.199 18.157 26.060 1.00 0.00 ? 9  HIS A HD1  4  
ATOM 2816  H HD2  . HIS A 1 9  ? -16.294 16.395 22.915 1.00 0.00 ? 9  HIS A HD2  4  
ATOM 2817  H HE1  . HIS A 1 9  ? -13.149 15.883 25.685 1.00 0.00 ? 9  HIS A HE1  4  
ATOM 2818  N N    . GLU A 1 10 ? -13.177 19.607 24.149 1.00 0.00 ? 10 GLU A N    4  
ATOM 2819  C CA   . GLU A 1 10 ? -11.856 19.727 24.831 1.00 0.00 ? 10 GLU A CA   4  
ATOM 2820  C C    . GLU A 1 10 ? -10.986 20.761 24.113 1.00 0.00 ? 10 GLU A C    4  
ATOM 2821  O O    . GLU A 1 10 ? -10.329 21.573 24.734 1.00 0.00 ? 10 GLU A O    4  
ATOM 2822  C CB   . GLU A 1 10 ? -11.230 18.336 24.733 1.00 0.00 ? 10 GLU A CB   4  
ATOM 2823  C CG   . GLU A 1 10 ? -10.009 18.262 25.652 1.00 0.00 ? 10 GLU A CG   4  
ATOM 2824  C CD   . GLU A 1 10 ? -9.275  16.939 25.423 1.00 0.00 ? 10 GLU A CD   4  
ATOM 2825  O OE1  . GLU A 1 10 ? -9.896  15.903 25.594 1.00 0.00 ? 10 GLU A OE1  4  
ATOM 2826  O OE2  . GLU A 1 10 ? -8.106  16.985 25.080 1.00 0.00 ? 10 GLU A OE2  4  
ATOM 2827  H H    . GLU A 1 10 ? -13.272 19.026 23.366 1.00 0.00 ? 10 GLU A H    4  
ATOM 2828  H HA   . GLU A 1 10 ? -11.990 20.000 25.866 1.00 0.00 ? 10 GLU A HA   4  
ATOM 2829  H HB2  . GLU A 1 10 ? -11.953 17.594 25.035 1.00 0.00 ? 10 GLU A HB2  4  
ATOM 2830  H HB3  . GLU A 1 10 ? -10.926 18.149 23.714 1.00 0.00 ? 10 GLU A HB3  4  
ATOM 2831  H HG2  . GLU A 1 10 ? -9.343  19.085 25.434 1.00 0.00 ? 10 GLU A HG2  4  
ATOM 2832  H HG3  . GLU A 1 10 ? -10.329 18.322 26.682 1.00 0.00 ? 10 GLU A HG3  4  
ATOM 2833  N N    . PHE A 1 11 ? -10.978 20.740 22.807 1.00 0.00 ? 11 PHE A N    4  
ATOM 2834  C CA   . PHE A 1 11 ? -10.152 21.724 22.052 1.00 0.00 ? 11 PHE A CA   4  
ATOM 2835  C C    . PHE A 1 11 ? -10.857 23.082 22.010 1.00 0.00 ? 11 PHE A C    4  
ATOM 2836  O O    . PHE A 1 11 ? -10.248 24.097 21.743 1.00 0.00 ? 11 PHE A O    4  
ATOM 2837  C CB   . PHE A 1 11 ? -10.040 21.153 20.641 1.00 0.00 ? 11 PHE A CB   4  
ATOM 2838  C CG   . PHE A 1 11 ? -9.079  19.986 20.629 1.00 0.00 ? 11 PHE A CG   4  
ATOM 2839  C CD1  . PHE A 1 11 ? -9.472  18.745 21.146 1.00 0.00 ? 11 PHE A CD1  4  
ATOM 2840  C CD2  . PHE A 1 11 ? -7.796  20.146 20.092 1.00 0.00 ? 11 PHE A CD2  4  
ATOM 2841  C CE1  . PHE A 1 11 ? -8.582  17.665 21.123 1.00 0.00 ? 11 PHE A CE1  4  
ATOM 2842  C CE2  . PHE A 1 11 ? -6.906  19.064 20.069 1.00 0.00 ? 11 PHE A CE2  4  
ATOM 2843  C CZ   . PHE A 1 11 ? -7.301  17.824 20.584 1.00 0.00 ? 11 PHE A CZ   4  
ATOM 2844  H H    . PHE A 1 11 ? -11.517 20.079 22.324 1.00 0.00 ? 11 PHE A H    4  
ATOM 2845  H HA   . PHE A 1 11 ? -9.173  21.817 22.494 1.00 0.00 ? 11 PHE A HA   4  
ATOM 2846  H HB2  . PHE A 1 11 ? -11.012 20.824 20.316 1.00 0.00 ? 11 PHE A HB2  4  
ATOM 2847  H HB3  . PHE A 1 11 ? -9.679  21.921 19.973 1.00 0.00 ? 11 PHE A HB3  4  
ATOM 2848  H HD1  . PHE A 1 11 ? -10.460 18.620 21.562 1.00 0.00 ? 11 PHE A HD1  4  
ATOM 2849  H HD2  . PHE A 1 11 ? -7.491  21.102 19.694 1.00 0.00 ? 11 PHE A HD2  4  
ATOM 2850  H HE1  . PHE A 1 11 ? -8.885  16.707 21.521 1.00 0.00 ? 11 PHE A HE1  4  
ATOM 2851  H HE2  . PHE A 1 11 ? -5.916  19.186 19.654 1.00 0.00 ? 11 PHE A HE2  4  
ATOM 2852  H HZ   . PHE A 1 11 ? -6.615  16.990 20.568 1.00 0.00 ? 11 PHE A HZ   4  
ATOM 2853  N N    . GLN A 1 12 ? -12.136 23.111 22.266 1.00 0.00 ? 12 GLN A N    4  
ATOM 2854  C CA   . GLN A 1 12 ? -12.866 24.409 22.233 1.00 0.00 ? 12 GLN A CA   4  
ATOM 2855  C C    . GLN A 1 12 ? -12.082 25.461 23.019 1.00 0.00 ? 12 GLN A C    4  
ATOM 2856  O O    . GLN A 1 12 ? -11.986 26.605 22.622 1.00 0.00 ? 12 GLN A O    4  
ATOM 2857  C CB   . GLN A 1 12 ? -14.213 24.136 22.898 1.00 0.00 ? 12 GLN A CB   4  
ATOM 2858  C CG   . GLN A 1 12 ? -15.197 25.243 22.514 1.00 0.00 ? 12 GLN A CG   4  
ATOM 2859  C CD   . GLN A 1 12 ? -16.259 25.389 23.607 1.00 0.00 ? 12 GLN A CD   4  
ATOM 2860  O OE1  . GLN A 1 12 ? -16.102 24.871 24.694 1.00 0.00 ? 12 GLN A OE1  4  
ATOM 2861  N NE2  . GLN A 1 12 ? -17.340 26.078 23.362 1.00 0.00 ? 12 GLN A NE2  4  
ATOM 2862  H H    . GLN A 1 12 ? -12.616 22.282 22.475 1.00 0.00 ? 12 GLN A H    4  
ATOM 2863  H HA   . GLN A 1 12 ? -13.014 24.732 21.216 1.00 0.00 ? 12 GLN A HA   4  
ATOM 2864  H HB2  . GLN A 1 12 ? -14.595 23.183 22.563 1.00 0.00 ? 12 GLN A HB2  4  
ATOM 2865  H HB3  . GLN A 1 12 ? -14.091 24.120 23.971 1.00 0.00 ? 12 GLN A HB3  4  
ATOM 2866  H HG2  . GLN A 1 12 ? -14.664 26.176 22.403 1.00 0.00 ? 12 GLN A HG2  4  
ATOM 2867  H HG3  . GLN A 1 12 ? -15.676 24.991 21.579 1.00 0.00 ? 12 GLN A HG3  4  
ATOM 2868  H HE21 . GLN A 1 12 ? -17.466 26.496 22.484 1.00 0.00 ? 12 GLN A HE21 4  
ATOM 2869  H HE22 . GLN A 1 12 ? -18.025 26.177 24.055 1.00 0.00 ? 12 GLN A HE22 4  
ATOM 2870  N N    . ALA A 1 13 ? -11.513 25.079 24.128 1.00 0.00 ? 13 ALA A N    4  
ATOM 2871  C CA   . ALA A 1 13 ? -10.726 26.053 24.932 1.00 0.00 ? 13 ALA A CA   4  
ATOM 2872  C C    . ALA A 1 13 ? -9.511  26.521 24.128 1.00 0.00 ? 13 ALA A C    4  
ATOM 2873  O O    . ALA A 1 13 ? -8.896  27.521 24.437 1.00 0.00 ? 13 ALA A O    4  
ATOM 2874  C CB   . ALA A 1 13 ? -10.285 25.279 26.174 1.00 0.00 ? 13 ALA A CB   4  
ATOM 2875  H H    . ALA A 1 13 ? -11.597 24.149 24.427 1.00 0.00 ? 13 ALA A H    4  
ATOM 2876  H HA   . ALA A 1 13 ? -11.340 26.893 25.215 1.00 0.00 ? 13 ALA A HA   4  
ATOM 2877  H HB1  . ALA A 1 13 ? -9.230  25.059 26.106 1.00 0.00 ? 13 ALA A HB1  4  
ATOM 2878  H HB2  . ALA A 1 13 ? -10.472 25.876 27.055 1.00 0.00 ? 13 ALA A HB2  4  
ATOM 2879  H HB3  . ALA A 1 13 ? -10.842 24.356 26.239 1.00 0.00 ? 13 ALA A HB3  4  
ATOM 2880  N N    . PHE A 1 14 ? -9.164  25.801 23.095 1.00 0.00 ? 14 PHE A N    4  
ATOM 2881  C CA   . PHE A 1 14 ? -7.992  26.199 22.269 1.00 0.00 ? 14 PHE A CA   4  
ATOM 2882  C C    . PHE A 1 14 ? -8.419  27.200 21.190 1.00 0.00 ? 14 PHE A C    4  
ATOM 2883  O O    . PHE A 1 14 ? -7.694  27.460 20.251 1.00 0.00 ? 14 PHE A O    4  
ATOM 2884  C CB   . PHE A 1 14 ? -7.505  24.897 21.631 1.00 0.00 ? 14 PHE A CB   4  
ATOM 2885  C CG   . PHE A 1 14 ? -7.098  23.913 22.707 1.00 0.00 ? 14 PHE A CG   4  
ATOM 2886  C CD1  . PHE A 1 14 ? -6.876  24.348 24.022 1.00 0.00 ? 14 PHE A CD1  4  
ATOM 2887  C CD2  . PHE A 1 14 ? -6.943  22.559 22.385 1.00 0.00 ? 14 PHE A CD2  4  
ATOM 2888  C CE1  . PHE A 1 14 ? -6.500  23.430 25.009 1.00 0.00 ? 14 PHE A CE1  4  
ATOM 2889  C CE2  . PHE A 1 14 ? -6.566  21.642 23.374 1.00 0.00 ? 14 PHE A CE2  4  
ATOM 2890  C CZ   . PHE A 1 14 ? -6.345  22.077 24.686 1.00 0.00 ? 14 PHE A CZ   4  
ATOM 2891  H H    . PHE A 1 14 ? -9.673  24.995 22.862 1.00 0.00 ? 14 PHE A H    4  
ATOM 2892  H HA   . PHE A 1 14 ? -7.218  26.618 22.889 1.00 0.00 ? 14 PHE A HA   4  
ATOM 2893  H HB2  . PHE A 1 14 ? -8.301  24.470 21.038 1.00 0.00 ? 14 PHE A HB2  4  
ATOM 2894  H HB3  . PHE A 1 14 ? -6.658  25.105 20.997 1.00 0.00 ? 14 PHE A HB3  4  
ATOM 2895  H HD1  . PHE A 1 14 ? -6.995  25.391 24.272 1.00 0.00 ? 14 PHE A HD1  4  
ATOM 2896  H HD2  . PHE A 1 14 ? -7.114  22.222 21.373 1.00 0.00 ? 14 PHE A HD2  4  
ATOM 2897  H HE1  . PHE A 1 14 ? -6.329  23.767 26.022 1.00 0.00 ? 14 PHE A HE1  4  
ATOM 2898  H HE2  . PHE A 1 14 ? -6.448  20.597 23.124 1.00 0.00 ? 14 PHE A HE2  4  
ATOM 2899  H HZ   . PHE A 1 14 ? -6.055  21.369 25.448 1.00 0.00 ? 14 PHE A HZ   4  
ATOM 2900  N N    . MET A 1 15 ? -9.591  27.758 21.314 1.00 0.00 ? 15 MET A N    4  
ATOM 2901  C CA   . MET A 1 15 ? -10.061 28.735 20.296 1.00 0.00 ? 15 MET A CA   4  
ATOM 2902  C C    . MET A 1 15 ? -9.620  30.150 20.670 1.00 0.00 ? 15 MET A C    4  
ATOM 2903  O O    . MET A 1 15 ? -10.193 30.784 21.533 1.00 0.00 ? 15 MET A O    4  
ATOM 2904  C CB   . MET A 1 15 ? -11.581 28.624 20.324 1.00 0.00 ? 15 MET A CB   4  
ATOM 2905  C CG   . MET A 1 15 ? -11.982 27.209 19.919 1.00 0.00 ? 15 MET A CG   4  
ATOM 2906  S SD   . MET A 1 15 ? -13.780 27.032 20.033 1.00 0.00 ? 15 MET A SD   4  
ATOM 2907  C CE   . MET A 1 15 ? -14.180 27.770 18.430 1.00 0.00 ? 15 MET A CE   4  
ATOM 2908  H H    . MET A 1 15 ? -10.166 27.532 22.073 1.00 0.00 ? 15 MET A H    4  
ATOM 2909  H HA   . MET A 1 15 ? -9.690  28.470 19.318 1.00 0.00 ? 15 MET A HA   4  
ATOM 2910  H HB2  . MET A 1 15 ? -11.940 28.830 21.322 1.00 0.00 ? 15 MET A HB2  4  
ATOM 2911  H HB3  . MET A 1 15 ? -12.007 29.333 19.634 1.00 0.00 ? 15 MET A HB3  4  
ATOM 2912  H HG2  . MET A 1 15 ? -11.664 27.024 18.905 1.00 0.00 ? 15 MET A HG2  4  
ATOM 2913  H HG3  . MET A 1 15 ? -11.505 26.501 20.578 1.00 0.00 ? 15 MET A HG3  4  
ATOM 2914  H HE1  . MET A 1 15 ? -13.596 27.289 17.658 1.00 0.00 ? 15 MET A HE1  4  
ATOM 2915  H HE2  . MET A 1 15 ? -15.229 27.634 18.222 1.00 0.00 ? 15 MET A HE2  4  
ATOM 2916  H HE3  . MET A 1 15 ? -13.953 28.827 18.455 1.00 0.00 ? 15 MET A HE3  4  
ATOM 2917  N N    . LYS A 1 16 ? -8.608  30.647 20.021 1.00 0.00 ? 16 LYS A N    4  
ATOM 2918  C CA   . LYS A 1 16 ? -8.127  32.025 20.331 1.00 0.00 ? 16 LYS A CA   4  
ATOM 2919  C C    . LYS A 1 16 ? -8.693  33.020 19.315 1.00 0.00 ? 16 LYS A C    4  
ATOM 2920  O O    . LYS A 1 16 ? -8.243  33.095 18.189 1.00 0.00 ? 16 LYS A O    4  
ATOM 2921  C CB   . LYS A 1 16 ? -6.604  31.949 20.216 1.00 0.00 ? 16 LYS A CB   4  
ATOM 2922  C CG   . LYS A 1 16 ? -6.010  33.347 20.404 1.00 0.00 ? 16 LYS A CG   4  
ATOM 2923  C CD   . LYS A 1 16 ? -4.489  33.281 20.252 1.00 0.00 ? 16 LYS A CD   4  
ATOM 2924  C CE   . LYS A 1 16 ? -3.913  32.323 21.296 1.00 0.00 ? 16 LYS A CE   4  
ATOM 2925  N NZ   . LYS A 1 16 ? -2.441  32.348 21.065 1.00 0.00 ? 16 LYS A NZ   4  
ATOM 2926  H H    . LYS A 1 16 ? -8.167  30.115 19.328 1.00 0.00 ? 16 LYS A H    4  
ATOM 2927  H HA   . LYS A 1 16 ? -8.408  32.306 21.333 1.00 0.00 ? 16 LYS A HA   4  
ATOM 2928  H HB2  . LYS A 1 16 ? -6.218  31.289 20.978 1.00 0.00 ? 16 LYS A HB2  4  
ATOM 2929  H HB3  . LYS A 1 16 ? -6.335  31.572 19.241 1.00 0.00 ? 16 LYS A HB3  4  
ATOM 2930  H HG2  . LYS A 1 16 ? -6.419  34.015 19.659 1.00 0.00 ? 16 LYS A HG2  4  
ATOM 2931  H HG3  . LYS A 1 16 ? -6.258  33.713 21.390 1.00 0.00 ? 16 LYS A HG3  4  
ATOM 2932  H HD2  . LYS A 1 16 ? -4.242  32.925 19.262 1.00 0.00 ? 16 LYS A HD2  4  
ATOM 2933  H HD3  . LYS A 1 16 ? -4.070  34.265 20.395 1.00 0.00 ? 16 LYS A HD3  4  
ATOM 2934  H HE2  . LYS A 1 16 ? -4.144  32.670 22.292 1.00 0.00 ? 16 LYS A HE2  4  
ATOM 2935  H HE3  . LYS A 1 16 ? -4.300  31.326 21.145 1.00 0.00 ? 16 LYS A HE3  4  
ATOM 2936  H HZ1  . LYS A 1 16 ? -2.243  32.137 20.066 1.00 0.00 ? 16 LYS A HZ1  4  
ATOM 2937  H HZ2  . LYS A 1 16 ? -2.068  33.289 21.302 1.00 0.00 ? 16 LYS A HZ2  4  
ATOM 2938  H HZ3  . LYS A 1 16 ? -1.983  31.636 21.667 1.00 0.00 ? 16 LYS A HZ3  4  
ATOM 2939  N N    . ASN A 1 17 ? -9.679  33.783 19.702 1.00 0.00 ? 17 ASN A N    4  
ATOM 2940  C CA   . ASN A 1 17 ? -10.273 34.770 18.756 1.00 0.00 ? 17 ASN A CA   4  
ATOM 2941  C C    . ASN A 1 17 ? -10.788 34.053 17.504 1.00 0.00 ? 17 ASN A C    4  
ATOM 2942  O O    . ASN A 1 17 ? -10.405 34.367 16.396 1.00 0.00 ? 17 ASN A O    4  
ATOM 2943  C CB   . ASN A 1 17 ? -9.124  35.714 18.397 1.00 0.00 ? 17 ASN A CB   4  
ATOM 2944  C CG   . ASN A 1 17 ? -9.684  36.961 17.711 1.00 0.00 ? 17 ASN A CG   4  
ATOM 2945  O OD1  . ASN A 1 17 ? -10.420 36.861 16.748 1.00 0.00 ? 17 ASN A OD1  4  
ATOM 2946  N ND2  . ASN A 1 17 ? -9.365  38.140 18.167 1.00 0.00 ? 17 ASN A ND2  4  
ATOM 2947  H H    . ASN A 1 17 ? -10.029 33.705 20.614 1.00 0.00 ? 17 ASN A H    4  
ATOM 2948  H HA   . ASN A 1 17 ? -11.068 35.320 19.232 1.00 0.00 ? 17 ASN A HA   4  
ATOM 2949  H HB2  . ASN A 1 17 ? -8.603  36.003 19.297 1.00 0.00 ? 17 ASN A HB2  4  
ATOM 2950  H HB3  . ASN A 1 17 ? -8.441  35.212 17.730 1.00 0.00 ? 17 ASN A HB3  4  
ATOM 2951  H HD21 . ASN A 1 17 ? -8.771  38.221 18.944 1.00 0.00 ? 17 ASN A HD21 4  
ATOM 2952  H HD22 . ASN A 1 17 ? -9.718  38.945 17.735 1.00 0.00 ? 17 ASN A HD22 4  
ATOM 2953  N N    . GLY A 1 18 ? -11.652 33.090 17.676 1.00 0.00 ? 18 GLY A N    4  
ATOM 2954  C CA   . GLY A 1 18 ? -12.187 32.352 16.498 1.00 0.00 ? 18 GLY A CA   4  
ATOM 2955  C C    . GLY A 1 18 ? -11.048 31.589 15.820 1.00 0.00 ? 18 GLY A C    4  
ATOM 2956  O O    . GLY A 1 18 ? -11.104 31.283 14.646 1.00 0.00 ? 18 GLY A O    4  
ATOM 2957  H H    . GLY A 1 18 ? -11.946 32.850 18.579 1.00 0.00 ? 18 GLY A H    4  
ATOM 2958  H HA2  . GLY A 1 18 ? -12.945 31.655 16.823 1.00 0.00 ? 18 GLY A HA2  4  
ATOM 2959  H HA3  . GLY A 1 18 ? -12.618 33.053 15.798 1.00 0.00 ? 18 GLY A HA3  4  
ATOM 2960  N N    . LYS A 1 19 ? -10.012 31.281 16.553 1.00 0.00 ? 19 LYS A N    4  
ATOM 2961  C CA   . LYS A 1 19 ? -8.867  30.539 15.952 1.00 0.00 ? 19 LYS A CA   4  
ATOM 2962  C C    . LYS A 1 19 ? -8.511  29.326 16.814 1.00 0.00 ? 19 LYS A C    4  
ATOM 2963  O O    . LYS A 1 19 ? -7.980  29.458 17.900 1.00 0.00 ? 19 LYS A O    4  
ATOM 2964  C CB   . LYS A 1 19 ? -7.713  31.541 15.937 1.00 0.00 ? 19 LYS A CB   4  
ATOM 2965  C CG   . LYS A 1 19 ? -6.596  31.019 15.030 1.00 0.00 ? 19 LYS A CG   4  
ATOM 2966  C CD   . LYS A 1 19 ? -5.665  30.113 15.837 1.00 0.00 ? 19 LYS A CD   4  
ATOM 2967  C CE   . LYS A 1 19 ? -4.577  29.551 14.919 1.00 0.00 ? 19 LYS A CE   4  
ATOM 2968  N NZ   . LYS A 1 19 ? -3.678  30.707 14.642 1.00 0.00 ? 19 LYS A NZ   4  
ATOM 2969  H H    . LYS A 1 19 ? -9.986  31.538 17.498 1.00 0.00 ? 19 LYS A H    4  
ATOM 2970  H HA   . LYS A 1 19 ? -9.103  30.232 14.945 1.00 0.00 ? 19 LYS A HA   4  
ATOM 2971  H HB2  . LYS A 1 19 ? -8.065  32.491 15.564 1.00 0.00 ? 19 LYS A HB2  4  
ATOM 2972  H HB3  . LYS A 1 19 ? -7.334  31.666 16.940 1.00 0.00 ? 19 LYS A HB3  4  
ATOM 2973  H HG2  . LYS A 1 19 ? -7.028  30.457 14.215 1.00 0.00 ? 19 LYS A HG2  4  
ATOM 2974  H HG3  . LYS A 1 19 ? -6.035  31.853 14.635 1.00 0.00 ? 19 LYS A HG3  4  
ATOM 2975  H HD2  . LYS A 1 19 ? -5.206  30.684 16.631 1.00 0.00 ? 19 LYS A HD2  4  
ATOM 2976  H HD3  . LYS A 1 19 ? -6.233  29.298 16.261 1.00 0.00 ? 19 LYS A HD3  4  
ATOM 2977  H HE2  . LYS A 1 19 ? -4.034  28.763 15.418 1.00 0.00 ? 19 LYS A HE2  4  
ATOM 2978  H HE3  . LYS A 1 19 ? -5.013  29.185 14.001 1.00 0.00 ? 19 LYS A HE3  4  
ATOM 2979  H HZ1  . LYS A 1 19 ? -3.531  31.250 15.516 1.00 0.00 ? 19 LYS A HZ1  4  
ATOM 2980  H HZ2  . LYS A 1 19 ? -2.761  30.358 14.296 1.00 0.00 ? 19 LYS A HZ2  4  
ATOM 2981  H HZ3  . LYS A 1 19 ? -4.111  31.318 13.920 1.00 0.00 ? 19 LYS A HZ3  4  
ATOM 2982  N N    . LEU A 1 20 ? -8.797  28.146 16.340 1.00 0.00 ? 20 LEU A N    4  
ATOM 2983  C CA   . LEU A 1 20 ? -8.472  26.926 17.132 1.00 0.00 ? 20 LEU A CA   4  
ATOM 2984  C C    . LEU A 1 20 ? -7.012  26.527 16.907 1.00 0.00 ? 20 LEU A C    4  
ATOM 2985  O O    . LEU A 1 20 ? -6.657  26.003 15.870 1.00 0.00 ? 20 LEU A O    4  
ATOM 2986  C CB   . LEU A 1 20 ? -9.410  25.844 16.592 1.00 0.00 ? 20 LEU A CB   4  
ATOM 2987  C CG   . LEU A 1 20 ? -9.548  24.721 17.624 1.00 0.00 ? 20 LEU A CG   4  
ATOM 2988  C CD1  . LEU A 1 20 ? -10.332 23.559 17.009 1.00 0.00 ? 20 LEU A CD1  4  
ATOM 2989  C CD2  . LEU A 1 20 ? -8.159  24.234 18.042 1.00 0.00 ? 20 LEU A CD2  4  
ATOM 2990  H H    . LEU A 1 20 ? -9.223  28.061 15.461 1.00 0.00 ? 20 LEU A H    4  
ATOM 2991  H HA   . LEU A 1 20 ? -8.663  27.092 18.180 1.00 0.00 ? 20 LEU A HA   4  
ATOM 2992  H HB2  . LEU A 1 20 ? -10.380 26.274 16.396 1.00 0.00 ? 20 LEU A HB2  4  
ATOM 2993  H HB3  . LEU A 1 20 ? -9.003  25.441 15.676 1.00 0.00 ? 20 LEU A HB3  4  
ATOM 2994  H HG   . LEU A 1 20 ? -10.074 25.092 18.490 1.00 0.00 ? 20 LEU A HG   4  
ATOM 2995  H HD11 . LEU A 1 20 ? -10.812 23.889 16.101 1.00 0.00 ? 20 LEU A HD11 4  
ATOM 2996  H HD12 . LEU A 1 20 ? -9.655  22.748 16.785 1.00 0.00 ? 20 LEU A HD12 4  
ATOM 2997  H HD13 . LEU A 1 20 ? -11.081 23.220 17.710 1.00 0.00 ? 20 LEU A HD13 4  
ATOM 2998  H HD21 . LEU A 1 20 ? -7.544  24.104 17.163 1.00 0.00 ? 20 LEU A HD21 4  
ATOM 2999  H HD22 . LEU A 1 20 ? -7.704  24.961 18.696 1.00 0.00 ? 20 LEU A HD22 4  
ATOM 3000  H HD23 . LEU A 1 20 ? -8.249  23.290 18.560 1.00 0.00 ? 20 LEU A HD23 4  
ATOM 3001  N N    . PHE A 1 21 ? -6.160  26.761 17.869 1.00 0.00 ? 21 PHE A N    4  
ATOM 3002  C CA   . PHE A 1 21 ? -4.730  26.377 17.689 1.00 0.00 ? 21 PHE A CA   4  
ATOM 3003  C C    . PHE A 1 21 ? -4.498  24.960 18.220 1.00 0.00 ? 21 PHE A C    4  
ATOM 3004  O O    . PHE A 1 21 ? -3.881  24.756 19.244 1.00 0.00 ? 21 PHE A O    4  
ATOM 3005  C CB   . PHE A 1 21 ? -3.897  27.413 18.465 1.00 0.00 ? 21 PHE A CB   4  
ATOM 3006  C CG   . PHE A 1 21 ? -4.427  27.606 19.870 1.00 0.00 ? 21 PHE A CG   4  
ATOM 3007  C CD1  . PHE A 1 21 ? -3.956  26.801 20.915 1.00 0.00 ? 21 PHE A CD1  4  
ATOM 3008  C CD2  . PHE A 1 21 ? -5.373  28.606 20.130 1.00 0.00 ? 21 PHE A CD2  4  
ATOM 3009  C CE1  . PHE A 1 21 ? -4.434  26.994 22.217 1.00 0.00 ? 21 PHE A CE1  4  
ATOM 3010  C CE2  . PHE A 1 21 ? -5.851  28.798 21.432 1.00 0.00 ? 21 PHE A CE2  4  
ATOM 3011  C CZ   . PHE A 1 21 ? -5.381  27.992 22.475 1.00 0.00 ? 21 PHE A CZ   4  
ATOM 3012  H H    . PHE A 1 21 ? -6.463  27.177 18.702 1.00 0.00 ? 21 PHE A H    4  
ATOM 3013  H HA   . PHE A 1 21 ? -4.472  26.419 16.642 1.00 0.00 ? 21 PHE A HA   4  
ATOM 3014  H HB2  . PHE A 1 21 ? -2.872  27.074 18.517 1.00 0.00 ? 21 PHE A HB2  4  
ATOM 3015  H HB3  . PHE A 1 21 ? -3.931  28.358 17.941 1.00 0.00 ? 21 PHE A HB3  4  
ATOM 3016  H HD1  . PHE A 1 21 ? -3.225  26.032 20.720 1.00 0.00 ? 21 PHE A HD1  4  
ATOM 3017  H HD2  . PHE A 1 21 ? -5.736  29.229 19.325 1.00 0.00 ? 21 PHE A HD2  4  
ATOM 3018  H HE1  . PHE A 1 21 ? -4.071  26.373 23.023 1.00 0.00 ? 21 PHE A HE1  4  
ATOM 3019  H HE2  . PHE A 1 21 ? -6.582  29.567 21.630 1.00 0.00 ? 21 PHE A HE2  4  
ATOM 3020  H HZ   . PHE A 1 21 ? -5.749  28.140 23.480 1.00 0.00 ? 21 PHE A HZ   4  
ATOM 3021  N N    . CYS A 1 22 ? -4.994  23.979 17.519 1.00 0.00 ? 22 CYS A N    4  
ATOM 3022  C CA   . CYS A 1 22 ? -4.815  22.567 17.961 1.00 0.00 ? 22 CYS A CA   4  
ATOM 3023  C C    . CYS A 1 22 ? -3.346  22.265 18.297 1.00 0.00 ? 22 CYS A C    4  
ATOM 3024  O O    . CYS A 1 22 ? -3.067  21.681 19.325 1.00 0.00 ? 22 CYS A O    4  
ATOM 3025  C CB   . CYS A 1 22 ? -5.279  21.714 16.778 1.00 0.00 ? 22 CYS A CB   4  
ATOM 3026  S SG   . CYS A 1 22 ? -6.178  20.269 17.391 1.00 0.00 ? 22 CYS A SG   4  
ATOM 3027  H H    . CYS A 1 22 ? -5.489  24.171 16.694 1.00 0.00 ? 22 CYS A H    4  
ATOM 3028  H HA   . CYS A 1 22 ? -5.439  22.365 18.817 1.00 0.00 ? 22 CYS A HA   4  
ATOM 3029  H HB2  . CYS A 1 22 ? -5.926  22.300 16.143 1.00 0.00 ? 22 CYS A HB2  4  
ATOM 3030  H HB3  . CYS A 1 22 ? -4.421  21.385 16.213 1.00 0.00 ? 22 CYS A HB3  4  
ATOM 3031  N N    . PRO A 1 23 ? -2.442  22.656 17.425 1.00 0.00 ? 23 PRO A N    4  
ATOM 3032  C CA   . PRO A 1 23 ? -1.003  22.390 17.666 1.00 0.00 ? 23 PRO A CA   4  
ATOM 3033  C C    . PRO A 1 23 ? -0.522  23.103 18.933 1.00 0.00 ? 23 PRO A C    4  
ATOM 3034  O O    . PRO A 1 23 ? 0.185   24.088 18.875 1.00 0.00 ? 23 PRO A O    4  
ATOM 3035  C CB   . PRO A 1 23 ? -0.337  22.964 16.413 1.00 0.00 ? 23 PRO A CB   4  
ATOM 3036  C CG   . PRO A 1 23 ? -1.429  23.534 15.488 1.00 0.00 ? 23 PRO A CG   4  
ATOM 3037  C CD   . PRO A 1 23 ? -2.792  23.374 16.173 1.00 0.00 ? 23 PRO A CD   4  
ATOM 3038  H HA   . PRO A 1 23 ? -0.817  21.330 17.729 1.00 0.00 ? 23 PRO A HA   4  
ATOM 3039  H HB2  . PRO A 1 23 ? 0.347   23.751 16.694 1.00 0.00 ? 23 PRO A HB2  4  
ATOM 3040  H HB3  . PRO A 1 23 ? 0.202   22.182 15.899 1.00 0.00 ? 23 PRO A HB3  4  
ATOM 3041  H HG2  . PRO A 1 23 ? -1.237  24.581 15.304 1.00 0.00 ? 23 PRO A HG2  4  
ATOM 3042  H HG3  . PRO A 1 23 ? -1.428  22.996 14.552 1.00 0.00 ? 23 PRO A HG3  4  
ATOM 3043  H HD2  . PRO A 1 23 ? -3.217  24.342 16.387 1.00 0.00 ? 23 PRO A HD2  4  
ATOM 3044  H HD3  . PRO A 1 23 ? -3.459  22.787 15.562 1.00 0.00 ? 23 PRO A HD3  4  
ATOM 3045  N N    . GLN A 1 24 ? -0.899  22.602 20.079 1.00 0.00 ? 24 GLN A N    4  
ATOM 3046  C CA   . GLN A 1 24 ? -0.462  23.238 21.355 1.00 0.00 ? 24 GLN A CA   4  
ATOM 3047  C C    . GLN A 1 24 ? 0.697   22.441 21.959 1.00 0.00 ? 24 GLN A C    4  
ATOM 3048  O O    . GLN A 1 24 ? 1.742   22.977 22.271 1.00 0.00 ? 24 GLN A O    4  
ATOM 3049  C CB   . GLN A 1 24 ? -1.693  23.183 22.264 1.00 0.00 ? 24 GLN A CB   4  
ATOM 3050  C CG   . GLN A 1 24 ? -1.266  23.332 23.727 1.00 0.00 ? 24 GLN A CG   4  
ATOM 3051  C CD   . GLN A 1 24 ? -2.509  23.447 24.612 1.00 0.00 ? 24 GLN A CD   4  
ATOM 3052  O OE1  . GLN A 1 24 ? -2.741  24.470 25.224 1.00 0.00 ? 24 GLN A OE1  4  
ATOM 3053  N NE2  . GLN A 1 24 ? -3.325  22.432 24.705 1.00 0.00 ? 24 GLN A NE2  4  
ATOM 3054  H H    . GLN A 1 24 ? -1.465  21.803 20.101 1.00 0.00 ? 24 GLN A H    4  
ATOM 3055  H HA   . GLN A 1 24 ? -0.169  24.259 21.188 1.00 0.00 ? 24 GLN A HA   4  
ATOM 3056  H HB2  . GLN A 1 24 ? -2.367  23.986 22.003 1.00 0.00 ? 24 GLN A HB2  4  
ATOM 3057  H HB3  . GLN A 1 24 ? -2.195  22.236 22.131 1.00 0.00 ? 24 GLN A HB3  4  
ATOM 3058  H HG2  . GLN A 1 24 ? -0.692  22.467 24.024 1.00 0.00 ? 24 GLN A HG2  4  
ATOM 3059  H HG3  . GLN A 1 24 ? -0.662  24.220 23.838 1.00 0.00 ? 24 GLN A HG3  4  
ATOM 3060  H HE21 . GLN A 1 24 ? -3.138  21.607 24.211 1.00 0.00 ? 24 GLN A HE21 4  
ATOM 3061  H HE22 . GLN A 1 24 ? -4.121  22.495 25.271 1.00 0.00 ? 24 GLN A HE22 4  
ATOM 3062  N N    . ASP A 1 25 ? 0.515   21.163 22.119 1.00 0.00 ? 25 ASP A N    4  
ATOM 3063  C CA   . ASP A 1 25 ? 1.597   20.315 22.696 1.00 0.00 ? 25 ASP A CA   4  
ATOM 3064  C C    . ASP A 1 25 ? 1.292   18.836 22.439 1.00 0.00 ? 25 ASP A C    4  
ATOM 3065  O O    . ASP A 1 25 ? 1.069   18.069 23.354 1.00 0.00 ? 25 ASP A O    4  
ATOM 3066  C CB   . ASP A 1 25 ? 1.584   20.619 24.195 1.00 0.00 ? 25 ASP A CB   4  
ATOM 3067  C CG   . ASP A 1 25 ? 2.699   19.829 24.884 1.00 0.00 ? 25 ASP A CG   4  
ATOM 3068  O OD1  . ASP A 1 25 ? 3.541   19.295 24.181 1.00 0.00 ? 25 ASP A OD1  4  
ATOM 3069  O OD2  . ASP A 1 25 ? 2.691   19.771 26.103 1.00 0.00 ? 25 ASP A OD2  4  
ATOM 3070  H H    . ASP A 1 25 ? -0.337  20.758 21.856 1.00 0.00 ? 25 ASP A H    4  
ATOM 3071  H HA   . ASP A 1 25 ? 2.552   20.582 22.273 1.00 0.00 ? 25 ASP A HA   4  
ATOM 3072  H HB2  . ASP A 1 25 ? 1.744   21.676 24.349 1.00 0.00 ? 25 ASP A HB2  4  
ATOM 3073  H HB3  . ASP A 1 25 ? 0.630   20.334 24.613 1.00 0.00 ? 25 ASP A HB3  4  
ATOM 3074  N N    . LYS A 1 26 ? 1.277   18.435 21.198 1.00 0.00 ? 26 LYS A N    4  
ATOM 3075  C CA   . LYS A 1 26 ? 0.984   17.010 20.869 1.00 0.00 ? 26 LYS A CA   4  
ATOM 3076  C C    . LYS A 1 26 ? 1.939   16.070 21.612 1.00 0.00 ? 26 LYS A C    4  
ATOM 3077  O O    . LYS A 1 26 ? 1.705   14.882 21.700 1.00 0.00 ? 26 LYS A O    4  
ATOM 3078  C CB   . LYS A 1 26 ? 1.193   16.905 19.358 1.00 0.00 ? 26 LYS A CB   4  
ATOM 3079  C CG   . LYS A 1 26 ? 0.041   17.604 18.632 1.00 0.00 ? 26 LYS A CG   4  
ATOM 3080  C CD   . LYS A 1 26 ? 0.269   17.526 17.122 1.00 0.00 ? 26 LYS A CD   4  
ATOM 3081  C CE   . LYS A 1 26 ? -0.737  18.431 16.406 1.00 0.00 ? 26 LYS A CE   4  
ATOM 3082  N NZ   . LYS A 1 26 ? -0.452  18.245 14.956 1.00 0.00 ? 26 LYS A NZ   4  
ATOM 3083  H H    . LYS A 1 26 ? 1.458   19.073 20.478 1.00 0.00 ? 26 LYS A H    4  
ATOM 3084  H HA   . LYS A 1 26 ? -0.040  16.773 21.111 1.00 0.00 ? 26 LYS A HA   4  
ATOM 3085  H HB2  . LYS A 1 26 ? 2.127   17.378 19.091 1.00 0.00 ? 26 LYS A HB2  4  
ATOM 3086  H HB3  . LYS A 1 26 ? 1.221   15.864 19.070 1.00 0.00 ? 26 LYS A HB3  4  
ATOM 3087  H HG2  . LYS A 1 26 ? -0.891  17.119 18.882 1.00 0.00 ? 26 LYS A HG2  4  
ATOM 3088  H HG3  . LYS A 1 26 ? -0.001  18.640 18.937 1.00 0.00 ? 26 LYS A HG3  4  
ATOM 3089  H HD2  . LYS A 1 26 ? 1.272   17.851 16.890 1.00 0.00 ? 26 LYS A HD2  4  
ATOM 3090  H HD3  . LYS A 1 26 ? 0.135   16.507 16.789 1.00 0.00 ? 26 LYS A HD3  4  
ATOM 3091  H HE2  . LYS A 1 26 ? -1.748  18.124 16.633 1.00 0.00 ? 26 LYS A HE2  4  
ATOM 3092  H HE3  . LYS A 1 26 ? -0.584  19.462 16.691 1.00 0.00 ? 26 LYS A HE3  4  
ATOM 3093  H HZ1  . LYS A 1 26 ? 0.551   18.006 14.828 1.00 0.00 ? 26 LYS A HZ1  4  
ATOM 3094  H HZ2  . LYS A 1 26 ? -1.043  17.475 14.583 1.00 0.00 ? 26 LYS A HZ2  4  
ATOM 3095  H HZ3  . LYS A 1 26 ? -0.664  19.125 14.444 1.00 0.00 ? 26 LYS A HZ3  4  
ATOM 3096  N N    . LYS A 1 27 ? 3.012   16.591 22.148 1.00 0.00 ? 27 LYS A N    4  
ATOM 3097  C CA   . LYS A 1 27 ? 3.976   15.725 22.885 1.00 0.00 ? 27 LYS A CA   4  
ATOM 3098  C C    . LYS A 1 27 ? 3.226   14.709 23.752 1.00 0.00 ? 27 LYS A C    4  
ATOM 3099  O O    . LYS A 1 27 ? 3.724   13.640 24.044 1.00 0.00 ? 27 LYS A O    4  
ATOM 3100  C CB   . LYS A 1 27 ? 4.776   16.690 23.759 1.00 0.00 ? 27 LYS A CB   4  
ATOM 3101  C CG   . LYS A 1 27 ? 5.593   17.627 22.867 1.00 0.00 ? 27 LYS A CG   4  
ATOM 3102  C CD   . LYS A 1 27 ? 6.546   18.454 23.732 1.00 0.00 ? 27 LYS A CD   4  
ATOM 3103  C CE   . LYS A 1 27 ? 7.446   19.303 22.831 1.00 0.00 ? 27 LYS A CE   4  
ATOM 3104  N NZ   . LYS A 1 27 ? 8.386   19.986 23.764 1.00 0.00 ? 27 LYS A NZ   4  
ATOM 3105  H H    . LYS A 1 27 ? 3.186   17.551 22.066 1.00 0.00 ? 27 LYS A H    4  
ATOM 3106  H HA   . LYS A 1 27 ? 4.634   15.220 22.196 1.00 0.00 ? 27 LYS A HA   4  
ATOM 3107  H HB2  . LYS A 1 27 ? 4.100   17.271 24.367 1.00 0.00 ? 27 LYS A HB2  4  
ATOM 3108  H HB3  . LYS A 1 27 ? 5.442   16.129 24.396 1.00 0.00 ? 27 LYS A HB3  4  
ATOM 3109  H HG2  . LYS A 1 27 ? 6.163   17.044 22.159 1.00 0.00 ? 27 LYS A HG2  4  
ATOM 3110  H HG3  . LYS A 1 27 ? 4.926   18.288 22.333 1.00 0.00 ? 27 LYS A HG3  4  
ATOM 3111  H HD2  . LYS A 1 27 ? 5.974   19.100 24.382 1.00 0.00 ? 27 LYS A HD2  4  
ATOM 3112  H HD3  . LYS A 1 27 ? 7.156   17.793 24.330 1.00 0.00 ? 27 LYS A HD3  4  
ATOM 3113  H HE2  . LYS A 1 27 ? 7.991   18.673 22.144 1.00 0.00 ? 27 LYS A HE2  4  
ATOM 3114  H HE3  . LYS A 1 27 ? 6.858   20.029 22.292 1.00 0.00 ? 27 LYS A HE3  4  
ATOM 3115  H HZ1  . LYS A 1 27 ? 7.856   20.377 24.568 1.00 0.00 ? 27 LYS A HZ1  4  
ATOM 3116  H HZ2  . LYS A 1 27 ? 9.090   19.301 24.111 1.00 0.00 ? 27 LYS A HZ2  4  
ATOM 3117  H HZ3  . LYS A 1 27 ? 8.870   20.759 23.265 1.00 0.00 ? 27 LYS A HZ3  4  
ATOM 3118  N N    . PHE A 1 28 ? 2.029   15.032 24.163 1.00 0.00 ? 28 PHE A N    4  
ATOM 3119  C CA   . PHE A 1 28 ? 1.247   14.082 25.005 1.00 0.00 ? 28 PHE A CA   4  
ATOM 3120  C C    . PHE A 1 28 ? 1.159   12.715 24.318 1.00 0.00 ? 28 PHE A C    4  
ATOM 3121  O O    . PHE A 1 28 ? 0.871   11.713 24.942 1.00 0.00 ? 28 PHE A O    4  
ATOM 3122  C CB   . PHE A 1 28 ? -0.139  14.716 25.128 1.00 0.00 ? 28 PHE A CB   4  
ATOM 3123  C CG   . PHE A 1 28 ? 0.003   16.152 25.576 1.00 0.00 ? 28 PHE A CG   4  
ATOM 3124  C CD1  . PHE A 1 28 ? 0.867   16.474 26.629 1.00 0.00 ? 28 PHE A CD1  4  
ATOM 3125  C CD2  . PHE A 1 28 ? -0.730  17.161 24.939 1.00 0.00 ? 28 PHE A CD2  4  
ATOM 3126  C CE1  . PHE A 1 28 ? 0.998   17.804 27.045 1.00 0.00 ? 28 PHE A CE1  4  
ATOM 3127  C CE2  . PHE A 1 28 ? -0.598  18.490 25.354 1.00 0.00 ? 28 PHE A CE2  4  
ATOM 3128  C CZ   . PHE A 1 28 ? 0.266   18.812 26.407 1.00 0.00 ? 28 PHE A CZ   4  
ATOM 3129  H H    . PHE A 1 28 ? 1.643   15.898 23.916 1.00 0.00 ? 28 PHE A H    4  
ATOM 3130  H HA   . PHE A 1 28 ? 1.696   13.986 25.981 1.00 0.00 ? 28 PHE A HA   4  
ATOM 3131  H HB2  . PHE A 1 28 ? -0.635  14.686 24.170 1.00 0.00 ? 28 PHE A HB2  4  
ATOM 3132  H HB3  . PHE A 1 28 ? -0.722  14.168 25.853 1.00 0.00 ? 28 PHE A HB3  4  
ATOM 3133  H HD1  . PHE A 1 28 ? 1.432   15.696 27.121 1.00 0.00 ? 28 PHE A HD1  4  
ATOM 3134  H HD2  . PHE A 1 28 ? -1.396  16.913 24.126 1.00 0.00 ? 28 PHE A HD2  4  
ATOM 3135  H HE1  . PHE A 1 28 ? 1.666   18.053 27.857 1.00 0.00 ? 28 PHE A HE1  4  
ATOM 3136  H HE2  . PHE A 1 28 ? -1.164  19.269 24.863 1.00 0.00 ? 28 PHE A HE2  4  
ATOM 3137  H HZ   . PHE A 1 28 ? 0.367   19.840 26.728 1.00 0.00 ? 28 PHE A HZ   4  
ATOM 3138  N N    . PHE A 1 29 ? 1.407   12.668 23.036 1.00 0.00 ? 29 PHE A N    4  
ATOM 3139  C CA   . PHE A 1 29 ? 1.343   11.369 22.304 1.00 0.00 ? 29 PHE A CA   4  
ATOM 3140  C C    . PHE A 1 29 ? 1.987   10.254 23.135 1.00 0.00 ? 29 PHE A C    4  
ATOM 3141  O O    . PHE A 1 29 ? 1.662   9.092  22.990 1.00 0.00 ? 29 PHE A O    4  
ATOM 3142  C CB   . PHE A 1 29 ? 2.140   11.606 21.019 1.00 0.00 ? 29 PHE A CB   4  
ATOM 3143  C CG   . PHE A 1 29 ? 2.018   10.405 20.113 1.00 0.00 ? 29 PHE A CG   4  
ATOM 3144  C CD1  . PHE A 1 29 ? 2.693   9.219  20.427 1.00 0.00 ? 29 PHE A CD1  4  
ATOM 3145  C CD2  . PHE A 1 29 ? 1.233   10.477 18.955 1.00 0.00 ? 29 PHE A CD2  4  
ATOM 3146  C CE1  . PHE A 1 29 ? 2.582   8.106  19.585 1.00 0.00 ? 29 PHE A CE1  4  
ATOM 3147  C CE2  . PHE A 1 29 ? 1.124   9.364  18.112 1.00 0.00 ? 29 PHE A CE2  4  
ATOM 3148  C CZ   . PHE A 1 29 ? 1.798   8.179  18.428 1.00 0.00 ? 29 PHE A CZ   4  
ATOM 3149  H H    . PHE A 1 29 ? 1.639   13.489 22.554 1.00 0.00 ? 29 PHE A H    4  
ATOM 3150  H HA   . PHE A 1 29 ? 0.323   11.120 22.063 1.00 0.00 ? 29 PHE A HA   4  
ATOM 3151  H HB2  . PHE A 1 29 ? 1.754   12.478 20.513 1.00 0.00 ? 29 PHE A HB2  4  
ATOM 3152  H HB3  . PHE A 1 29 ? 3.179   11.766 21.267 1.00 0.00 ? 29 PHE A HB3  4  
ATOM 3153  H HD1  . PHE A 1 29 ? 3.298   9.162  21.320 1.00 0.00 ? 29 PHE A HD1  4  
ATOM 3154  H HD2  . PHE A 1 29 ? 0.713   11.392 18.713 1.00 0.00 ? 29 PHE A HD2  4  
ATOM 3155  H HE1  . PHE A 1 29 ? 3.103   7.192  19.828 1.00 0.00 ? 29 PHE A HE1  4  
ATOM 3156  H HE2  . PHE A 1 29 ? 0.519   9.421  17.220 1.00 0.00 ? 29 PHE A HE2  4  
ATOM 3157  H HZ   . PHE A 1 29 ? 1.714   7.321  17.777 1.00 0.00 ? 29 PHE A HZ   4  
ATOM 3158  N N    . GLN A 1 30 ? 2.903   10.599 23.998 1.00 0.00 ? 30 GLN A N    4  
ATOM 3159  C CA   . GLN A 1 30 ? 3.573   9.560  24.833 1.00 0.00 ? 30 GLN A CA   4  
ATOM 3160  C C    . GLN A 1 30 ? 2.580   8.931  25.816 1.00 0.00 ? 30 GLN A C    4  
ATOM 3161  O O    . GLN A 1 30 ? 2.901   7.992  26.518 1.00 0.00 ? 30 GLN A O    4  
ATOM 3162  C CB   . GLN A 1 30 ? 4.666   10.314 25.591 1.00 0.00 ? 30 GLN A CB   4  
ATOM 3163  C CG   . GLN A 1 30 ? 4.021   11.261 26.604 1.00 0.00 ? 30 GLN A CG   4  
ATOM 3164  C CD   . GLN A 1 30 ? 5.101   12.129 27.251 1.00 0.00 ? 30 GLN A CD   4  
ATOM 3165  O OE1  . GLN A 1 30 ? 6.050   11.620 27.814 1.00 0.00 ? 30 GLN A OE1  4  
ATOM 3166  N NE2  . GLN A 1 30 ? 4.996   13.428 27.195 1.00 0.00 ? 30 GLN A NE2  4  
ATOM 3167  H H    . GLN A 1 30 ? 3.153   11.540 24.095 1.00 0.00 ? 30 GLN A H    4  
ATOM 3168  H HA   . GLN A 1 30 ? 4.015   8.802  24.208 1.00 0.00 ? 30 GLN A HA   4  
ATOM 3169  H HB2  . GLN A 1 30 ? 5.298   9.607  26.109 1.00 0.00 ? 30 GLN A HB2  4  
ATOM 3170  H HB3  . GLN A 1 30 ? 5.261   10.885 24.891 1.00 0.00 ? 30 GLN A HB3  4  
ATOM 3171  H HG2  . GLN A 1 30 ? 3.306   11.895 26.099 1.00 0.00 ? 30 GLN A HG2  4  
ATOM 3172  H HG3  . GLN A 1 30 ? 3.518   10.685 27.366 1.00 0.00 ? 30 GLN A HG3  4  
ATOM 3173  H HE21 . GLN A 1 30 ? 4.230   13.838 26.741 1.00 0.00 ? 30 GLN A HE21 4  
ATOM 3174  H HE22 . GLN A 1 30 ? 5.682   13.994 27.605 1.00 0.00 ? 30 GLN A HE22 4  
ATOM 3175  N N    . SER A 1 31 ? 1.378   9.439  25.878 1.00 0.00 ? 31 SER A N    4  
ATOM 3176  C CA   . SER A 1 31 ? 0.376   8.862  26.821 1.00 0.00 ? 31 SER A CA   4  
ATOM 3177  C C    . SER A 1 31 ? -0.957  8.631  26.107 1.00 0.00 ? 31 SER A C    4  
ATOM 3178  O O    . SER A 1 31 ? -1.281  9.299  25.145 1.00 0.00 ? 31 SER A O    4  
ATOM 3179  C CB   . SER A 1 31 ? 0.219   9.912  27.922 1.00 0.00 ? 31 SER A CB   4  
ATOM 3180  O OG   . SER A 1 31 ? 1.472   10.119 28.560 1.00 0.00 ? 31 SER A OG   4  
ATOM 3181  H H    . SER A 1 31 ? 1.134   10.197 25.307 1.00 0.00 ? 31 SER A H    4  
ATOM 3182  H HA   . SER A 1 31 ? 0.743   7.939  27.242 1.00 0.00 ? 31 SER A HA   4  
ATOM 3183  H HB2  . SER A 1 31 ? -0.121  10.840 27.488 1.00 0.00 ? 31 SER A HB2  4  
ATOM 3184  H HB3  . SER A 1 31 ? -0.501  9.567  28.649 1.00 0.00 ? 31 SER A HB3  4  
ATOM 3185  H HG   . SER A 1 31 ? 1.323   10.126 29.508 1.00 0.00 ? 31 SER A HG   4  
ATOM 3186  N N    . LEU A 1 32 ? -1.737  7.691  26.570 1.00 0.00 ? 32 LEU A N    4  
ATOM 3187  C CA   . LEU A 1 32 ? -3.049  7.425  25.914 1.00 0.00 ? 32 LEU A CA   4  
ATOM 3188  C C    . LEU A 1 32 ? -3.856  8.718  25.815 1.00 0.00 ? 32 LEU A C    4  
ATOM 3189  O O    . LEU A 1 32 ? -4.418  9.035  24.786 1.00 0.00 ? 32 LEU A O    4  
ATOM 3190  C CB   . LEU A 1 32 ? -3.757  6.422  26.824 1.00 0.00 ? 32 LEU A CB   4  
ATOM 3191  C CG   . LEU A 1 32 ? -4.814  5.663  26.018 1.00 0.00 ? 32 LEU A CG   4  
ATOM 3192  C CD1  . LEU A 1 32 ? -5.114  4.327  26.701 1.00 0.00 ? 32 LEU A CD1  4  
ATOM 3193  C CD2  . LEU A 1 32 ? -6.094  6.497  25.944 1.00 0.00 ? 32 LEU A CD2  4  
ATOM 3194  H H    . LEU A 1 32 ? -1.461  7.163  27.348 1.00 0.00 ? 32 LEU A H    4  
ATOM 3195  H HA   . LEU A 1 32 ? -2.903  6.998  24.938 1.00 0.00 ? 32 LEU A HA   4  
ATOM 3196  H HB2  . LEU A 1 32 ? -3.035  5.723  27.220 1.00 0.00 ? 32 LEU A HB2  4  
ATOM 3197  H HB3  . LEU A 1 32 ? -4.235  6.949  27.636 1.00 0.00 ? 32 LEU A HB3  4  
ATOM 3198  H HG   . LEU A 1 32 ? -4.444  5.482  25.021 1.00 0.00 ? 32 LEU A HG   4  
ATOM 3199  H HD11 . LEU A 1 32 ? -4.690  4.327  27.694 1.00 0.00 ? 32 LEU A HD11 4  
ATOM 3200  H HD12 . LEU A 1 32 ? -6.184  4.189  26.767 1.00 0.00 ? 32 LEU A HD12 4  
ATOM 3201  H HD13 . LEU A 1 32 ? -4.683  3.522  26.125 1.00 0.00 ? 32 LEU A HD13 4  
ATOM 3202  H HD21 . LEU A 1 32 ? -6.277  6.964  26.901 1.00 0.00 ? 32 LEU A HD21 4  
ATOM 3203  H HD22 . LEU A 1 32 ? -5.983  7.260  25.187 1.00 0.00 ? 32 LEU A HD22 4  
ATOM 3204  H HD23 . LEU A 1 32 ? -6.927  5.857  25.691 1.00 0.00 ? 32 LEU A HD23 4  
ATOM 3205  N N    . ASP A 1 33 ? -3.908  9.472  26.875 1.00 0.00 ? 33 ASP A N    4  
ATOM 3206  C CA   . ASP A 1 33 ? -4.670  10.750 26.839 1.00 0.00 ? 33 ASP A CA   4  
ATOM 3207  C C    . ASP A 1 33 ? -4.120  11.629 25.719 1.00 0.00 ? 33 ASP A C    4  
ATOM 3208  O O    . ASP A 1 33 ? -4.857  12.272 25.000 1.00 0.00 ? 33 ASP A O    4  
ATOM 3209  C CB   . ASP A 1 33 ? -4.435  11.399 28.204 1.00 0.00 ? 33 ASP A CB   4  
ATOM 3210  C CG   . ASP A 1 33 ? -5.154  10.588 29.284 1.00 0.00 ? 33 ASP A CG   4  
ATOM 3211  O OD1  . ASP A 1 33 ? -6.164  9.982  28.969 1.00 0.00 ? 33 ASP A OD1  4  
ATOM 3212  O OD2  . ASP A 1 33 ? -4.681  10.586 30.409 1.00 0.00 ? 33 ASP A OD2  4  
ATOM 3213  H H    . ASP A 1 33 ? -3.440  9.200  27.691 1.00 0.00 ? 33 ASP A H    4  
ATOM 3214  H HA   . ASP A 1 33 ? -5.721  10.561 26.690 1.00 0.00 ? 33 ASP A HA   4  
ATOM 3215  H HB2  . ASP A 1 33 ? -3.376  11.420 28.415 1.00 0.00 ? 33 ASP A HB2  4  
ATOM 3216  H HB3  . ASP A 1 33 ? -4.821  12.407 28.195 1.00 0.00 ? 33 ASP A HB3  4  
ATOM 3217  N N    . GLY A 1 34 ? -2.828  11.640 25.554 1.00 0.00 ? 34 GLY A N    4  
ATOM 3218  C CA   . GLY A 1 34 ? -2.229  12.457 24.466 1.00 0.00 ? 34 GLY A CA   4  
ATOM 3219  C C    . GLY A 1 34 ? -2.585  11.807 23.131 1.00 0.00 ? 34 GLY A C    4  
ATOM 3220  O O    . GLY A 1 34 ? -3.045  12.454 22.213 1.00 0.00 ? 34 GLY A O    4  
ATOM 3221  H H    . GLY A 1 34 ? -2.254  11.100 26.136 1.00 0.00 ? 34 GLY A H    4  
ATOM 3222  H HA2  . GLY A 1 34 ? -2.629  13.456 24.500 1.00 0.00 ? 34 GLY A HA2  4  
ATOM 3223  H HA3  . GLY A 1 34 ? -1.158  12.488 24.581 1.00 0.00 ? 34 GLY A HA3  4  
ATOM 3224  N N    . ILE A 1 35 ? -2.393  10.525 23.026 1.00 0.00 ? 35 ILE A N    4  
ATOM 3225  C CA   . ILE A 1 35 ? -2.739  9.828  21.759 1.00 0.00 ? 35 ILE A CA   4  
ATOM 3226  C C    . ILE A 1 35 ? -4.206  10.090 21.423 1.00 0.00 ? 35 ILE A C    4  
ATOM 3227  O O    . ILE A 1 35 ? -4.581  10.198 20.273 1.00 0.00 ? 35 ILE A O    4  
ATOM 3228  C CB   . ILE A 1 35 ? -2.495  8.342  22.039 1.00 0.00 ? 35 ILE A CB   4  
ATOM 3229  C CG1  . ILE A 1 35 ? -1.000  8.044  21.918 1.00 0.00 ? 35 ILE A CG1  4  
ATOM 3230  C CG2  . ILE A 1 35 ? -3.264  7.491  21.026 1.00 0.00 ? 35 ILE A CG2  4  
ATOM 3231  C CD1  . ILE A 1 35 ? -0.496  8.522  20.555 1.00 0.00 ? 35 ILE A CD1  4  
ATOM 3232  H H    . ILE A 1 35 ? -2.035  10.021 23.785 1.00 0.00 ? 35 ILE A H    4  
ATOM 3233  H HA   . ILE A 1 35 ? -2.103  10.166 20.958 1.00 0.00 ? 35 ILE A HA   4  
ATOM 3234  H HB   . ILE A 1 35 ? -2.830  8.104  23.037 1.00 0.00 ? 35 ILE A HB   4  
ATOM 3235  H HG12 . ILE A 1 35 ? -0.464  8.560  22.701 1.00 0.00 ? 35 ILE A HG12 4  
ATOM 3236  H HG13 . ILE A 1 35 ? -0.836  6.980  22.009 1.00 0.00 ? 35 ILE A HG13 4  
ATOM 3237  H HG21 . ILE A 1 35 ? -2.955  7.754  20.025 1.00 0.00 ? 35 ILE A HG21 4  
ATOM 3238  H HG22 . ILE A 1 35 ? -3.058  6.446  21.203 1.00 0.00 ? 35 ILE A HG22 4  
ATOM 3239  H HG23 . ILE A 1 35 ? -4.323  7.672  21.134 1.00 0.00 ? 35 ILE A HG23 4  
ATOM 3240  H HD11 . ILE A 1 35 ? -1.320  8.546  19.855 1.00 0.00 ? 35 ILE A HD11 4  
ATOM 3241  H HD12 . ILE A 1 35 ? -0.079  9.514  20.653 1.00 0.00 ? 35 ILE A HD12 4  
ATOM 3242  H HD13 . ILE A 1 35 ? 0.264   7.846  20.193 1.00 0.00 ? 35 ILE A HD13 4  
ATOM 3243  N N    . MET A 1 36 ? -5.037  10.203 22.422 1.00 0.00 ? 36 MET A N    4  
ATOM 3244  C CA   . MET A 1 36 ? -6.480  10.468 22.160 1.00 0.00 ? 36 MET A CA   4  
ATOM 3245  C C    . MET A 1 36 ? -6.670  11.910 21.690 1.00 0.00 ? 36 MET A C    4  
ATOM 3246  O O    . MET A 1 36 ? -7.082  12.160 20.575 1.00 0.00 ? 36 MET A O    4  
ATOM 3247  C CB   . MET A 1 36 ? -7.178  10.253 23.499 1.00 0.00 ? 36 MET A CB   4  
ATOM 3248  C CG   . MET A 1 36 ? -7.736  8.829  23.565 1.00 0.00 ? 36 MET A CG   4  
ATOM 3249  S SD   . MET A 1 36 ? -8.932  8.710  24.919 1.00 0.00 ? 36 MET A SD   4  
ATOM 3250  C CE   . MET A 1 36 ? -10.422 8.602  23.897 1.00 0.00 ? 36 MET A CE   4  
ATOM 3251  H H    . MET A 1 36 ? -4.710  10.118 23.345 1.00 0.00 ? 36 MET A H    4  
ATOM 3252  H HA   . MET A 1 36 ? -6.864  9.776  21.428 1.00 0.00 ? 36 MET A HA   4  
ATOM 3253  H HB2  . MET A 1 36 ? -6.472  10.402 24.303 1.00 0.00 ? 36 MET A HB2  4  
ATOM 3254  H HB3  . MET A 1 36 ? -7.986  10.963 23.594 1.00 0.00 ? 36 MET A HB3  4  
ATOM 3255  H HG2  . MET A 1 36 ? -8.224  8.591  22.631 1.00 0.00 ? 36 MET A HG2  4  
ATOM 3256  H HG3  . MET A 1 36 ? -6.928  8.134  23.736 1.00 0.00 ? 36 MET A HG3  4  
ATOM 3257  H HE1  . MET A 1 36 ? -10.162 8.203  22.926 1.00 0.00 ? 36 MET A HE1  4  
ATOM 3258  H HE2  . MET A 1 36 ? -11.139 7.952  24.378 1.00 0.00 ? 36 MET A HE2  4  
ATOM 3259  H HE3  . MET A 1 36 ? -10.851 9.583  23.779 1.00 0.00 ? 36 MET A HE3  4  
ATOM 3260  N N    . PHE A 1 37 ? -6.372  12.867 22.529 1.00 0.00 ? 37 PHE A N    4  
ATOM 3261  C CA   . PHE A 1 37 ? -6.540  14.287 22.114 1.00 0.00 ? 37 PHE A CA   4  
ATOM 3262  C C    . PHE A 1 37 ? -5.856  14.497 20.754 1.00 0.00 ? 37 PHE A C    4  
ATOM 3263  O O    . PHE A 1 37 ? -6.442  15.028 19.832 1.00 0.00 ? 37 PHE A O    4  
ATOM 3264  C CB   . PHE A 1 37 ? -5.902  15.115 23.252 1.00 0.00 ? 37 PHE A CB   4  
ATOM 3265  C CG   . PHE A 1 37 ? -4.763  15.974 22.743 1.00 0.00 ? 37 PHE A CG   4  
ATOM 3266  C CD1  . PHE A 1 37 ? -3.479  15.434 22.628 1.00 0.00 ? 37 PHE A CD1  4  
ATOM 3267  C CD2  . PHE A 1 37 ? -4.997  17.305 22.385 1.00 0.00 ? 37 PHE A CD2  4  
ATOM 3268  C CE1  . PHE A 1 37 ? -2.429  16.223 22.151 1.00 0.00 ? 37 PHE A CE1  4  
ATOM 3269  C CE2  . PHE A 1 37 ? -3.946  18.096 21.909 1.00 0.00 ? 37 PHE A CE2  4  
ATOM 3270  C CZ   . PHE A 1 37 ? -2.663  17.553 21.791 1.00 0.00 ? 37 PHE A CZ   4  
ATOM 3271  H H    . PHE A 1 37 ? -6.038  12.651 23.426 1.00 0.00 ? 37 PHE A H    4  
ATOM 3272  H HA   . PHE A 1 37 ? -7.590  14.524 22.036 1.00 0.00 ? 37 PHE A HA   4  
ATOM 3273  H HB2  . PHE A 1 37 ? -6.657  15.756 23.685 1.00 0.00 ? 37 PHE A HB2  4  
ATOM 3274  H HB3  . PHE A 1 37 ? -5.527  14.444 24.011 1.00 0.00 ? 37 PHE A HB3  4  
ATOM 3275  H HD1  . PHE A 1 37 ? -3.299  14.406 22.906 1.00 0.00 ? 37 PHE A HD1  4  
ATOM 3276  H HD2  . PHE A 1 37 ? -5.987  17.724 22.482 1.00 0.00 ? 37 PHE A HD2  4  
ATOM 3277  H HE1  . PHE A 1 37 ? -1.437  15.807 22.062 1.00 0.00 ? 37 PHE A HE1  4  
ATOM 3278  H HE2  . PHE A 1 37 ? -4.126  19.124 21.631 1.00 0.00 ? 37 PHE A HE2  4  
ATOM 3279  H HZ   . PHE A 1 37 ? -1.853  18.156 21.421 1.00 0.00 ? 37 PHE A HZ   4  
ATOM 3280  N N    . ILE A 1 38 ? -4.630  14.064 20.614 1.00 0.00 ? 38 ILE A N    4  
ATOM 3281  C CA   . ILE A 1 38 ? -3.936  14.223 19.303 1.00 0.00 ? 38 ILE A CA   4  
ATOM 3282  C C    . ILE A 1 38 ? -4.799  13.620 18.192 1.00 0.00 ? 38 ILE A C    4  
ATOM 3283  O O    . ILE A 1 38 ? -4.839  14.116 17.084 1.00 0.00 ? 38 ILE A O    4  
ATOM 3284  C CB   . ILE A 1 38 ? -2.624  13.446 19.436 1.00 0.00 ? 38 ILE A CB   4  
ATOM 3285  C CG1  . ILE A 1 38 ? -1.675  14.193 20.377 1.00 0.00 ? 38 ILE A CG1  4  
ATOM 3286  C CG2  . ILE A 1 38 ? -1.974  13.308 18.056 1.00 0.00 ? 38 ILE A CG2  4  
ATOM 3287  C CD1  . ILE A 1 38 ? -0.259  13.630 20.238 1.00 0.00 ? 38 ILE A CD1  4  
ATOM 3288  H H    . ILE A 1 38 ? -4.173  13.624 21.360 1.00 0.00 ? 38 ILE A H    4  
ATOM 3289  H HA   . ILE A 1 38 ? -3.736  15.262 19.105 1.00 0.00 ? 38 ILE A HA   4  
ATOM 3290  H HB   . ILE A 1 38 ? -2.827  12.464 19.837 1.00 0.00 ? 38 ILE A HB   4  
ATOM 3291  H HG12 . ILE A 1 38 ? -1.672  15.243 20.125 1.00 0.00 ? 38 ILE A HG12 4  
ATOM 3292  H HG13 . ILE A 1 38 ? -2.009  14.070 21.395 1.00 0.00 ? 38 ILE A HG13 4  
ATOM 3293  H HG21 . ILE A 1 38 ? -2.648  13.682 17.300 1.00 0.00 ? 38 ILE A HG21 4  
ATOM 3294  H HG22 . ILE A 1 38 ? -1.057  13.877 18.031 1.00 0.00 ? 38 ILE A HG22 4  
ATOM 3295  H HG23 . ILE A 1 38 ? -1.758  12.268 17.862 1.00 0.00 ? 38 ILE A HG23 4  
ATOM 3296  H HD11 . ILE A 1 38 ? -0.299  12.675 19.736 1.00 0.00 ? 38 ILE A HD11 4  
ATOM 3297  H HD12 . ILE A 1 38 ? 0.346   14.314 19.662 1.00 0.00 ? 38 ILE A HD12 4  
ATOM 3298  H HD13 . ILE A 1 38 ? 0.176   13.503 21.219 1.00 0.00 ? 38 ILE A HD13 4  
ATOM 3299  N N    . ASN A 1 39 ? -5.490  12.552 18.486 1.00 0.00 ? 39 ASN A N    4  
ATOM 3300  C CA   . ASN A 1 39 ? -6.353  11.914 17.448 1.00 0.00 ? 39 ASN A CA   4  
ATOM 3301  C C    . ASN A 1 39 ? -7.586  12.781 17.191 1.00 0.00 ? 39 ASN A C    4  
ATOM 3302  O O    . ASN A 1 39 ? -8.031  12.933 16.071 1.00 0.00 ? 39 ASN A O    4  
ATOM 3303  C CB   . ASN A 1 39 ? -6.763  10.566 18.041 1.00 0.00 ? 39 ASN A CB   4  
ATOM 3304  C CG   . ASN A 1 39 ? -5.585  9.594  17.970 1.00 0.00 ? 39 ASN A CG   4  
ATOM 3305  O OD1  . ASN A 1 39 ? -4.679  9.773  17.180 1.00 0.00 ? 39 ASN A OD1  4  
ATOM 3306  N ND2  . ASN A 1 39 ? -5.558  8.565  18.771 1.00 0.00 ? 39 ASN A ND2  4  
ATOM 3307  H H    . ASN A 1 39 ? -5.444  12.171 19.390 1.00 0.00 ? 39 ASN A H    4  
ATOM 3308  H HA   . ASN A 1 39 ? -5.800  11.766 16.538 1.00 0.00 ? 39 ASN A HA   4  
ATOM 3309  H HB2  . ASN A 1 39 ? -7.057  10.700 19.071 1.00 0.00 ? 39 ASN A HB2  4  
ATOM 3310  H HB3  . ASN A 1 39 ? -7.594  10.165 17.480 1.00 0.00 ? 39 ASN A HB3  4  
ATOM 3311  H HD21 . ASN A 1 39 ? -6.288  8.423  19.410 1.00 0.00 ? 39 ASN A HD21 4  
ATOM 3312  H HD22 . ASN A 1 39 ? -4.808  7.935  18.737 1.00 0.00 ? 39 ASN A HD22 4  
ATOM 3313  N N    . LYS A 1 40 ? -8.134  13.353 18.224 1.00 0.00 ? 40 LYS A N    4  
ATOM 3314  C CA   . LYS A 1 40 ? -9.337  14.217 18.048 1.00 0.00 ? 40 LYS A CA   4  
ATOM 3315  C C    . LYS A 1 40 ? -8.907  15.622 17.627 1.00 0.00 ? 40 LYS A C    4  
ATOM 3316  O O    . LYS A 1 40 ? -9.667  16.369 17.047 1.00 0.00 ? 40 LYS A O    4  
ATOM 3317  C CB   . LYS A 1 40 ? -10.009 14.248 19.421 1.00 0.00 ? 40 LYS A CB   4  
ATOM 3318  C CG   . LYS A 1 40 ? -11.493 14.577 19.253 1.00 0.00 ? 40 LYS A CG   4  
ATOM 3319  C CD   . LYS A 1 40 ? -12.083 14.978 20.607 1.00 0.00 ? 40 LYS A CD   4  
ATOM 3320  C CE   . LYS A 1 40 ? -13.380 15.758 20.388 1.00 0.00 ? 40 LYS A CE   4  
ATOM 3321  N NZ   . LYS A 1 40 ? -14.157 15.564 21.643 1.00 0.00 ? 40 LYS A NZ   4  
ATOM 3322  H H    . LYS A 1 40 ? -7.753  13.218 19.114 1.00 0.00 ? 40 LYS A H    4  
ATOM 3323  H HA   . LYS A 1 40 ? -10.007 13.791 17.318 1.00 0.00 ? 40 LYS A HA   4  
ATOM 3324  H HB2  . LYS A 1 40 ? -9.905  13.282 19.894 1.00 0.00 ? 40 LYS A HB2  4  
ATOM 3325  H HB3  . LYS A 1 40 ? -9.540  15.002 20.036 1.00 0.00 ? 40 LYS A HB3  4  
ATOM 3326  H HG2  . LYS A 1 40 ? -11.604 15.394 18.556 1.00 0.00 ? 40 LYS A HG2  4  
ATOM 3327  H HG3  . LYS A 1 40 ? -12.015 13.709 18.877 1.00 0.00 ? 40 LYS A HG3  4  
ATOM 3328  H HD2  . LYS A 1 40 ? -12.289 14.091 21.187 1.00 0.00 ? 40 LYS A HD2  4  
ATOM 3329  H HD3  . LYS A 1 40 ? -11.375 15.599 21.138 1.00 0.00 ? 40 LYS A HD3  4  
ATOM 3330  H HE2  . LYS A 1 40 ? -13.168 16.806 20.234 1.00 0.00 ? 40 LYS A HE2  4  
ATOM 3331  H HE3  . LYS A 1 40 ? -13.922 15.355 19.544 1.00 0.00 ? 40 LYS A HE3  4  
ATOM 3332  H HZ1  . LYS A 1 40 ? -14.174 14.554 21.889 1.00 0.00 ? 40 LYS A HZ1  4  
ATOM 3333  H HZ2  . LYS A 1 40 ? -13.707 16.097 22.415 1.00 0.00 ? 40 LYS A HZ2  4  
ATOM 3334  H HZ3  . LYS A 1 40 ? -15.130 15.906 21.506 1.00 0.00 ? 40 LYS A HZ3  4  
ATOM 3335  N N    . CYS A 1 41 ? -7.687  15.982 17.912 1.00 0.00 ? 41 CYS A N    4  
ATOM 3336  C CA   . CYS A 1 41 ? -7.195  17.335 17.526 1.00 0.00 ? 41 CYS A CA   4  
ATOM 3337  C C    . CYS A 1 41 ? -7.397  17.555 16.028 1.00 0.00 ? 41 CYS A C    4  
ATOM 3338  O O    . CYS A 1 41 ? -8.254  18.306 15.607 1.00 0.00 ? 41 CYS A O    4  
ATOM 3339  C CB   . CYS A 1 41 ? -5.706  17.316 17.865 1.00 0.00 ? 41 CYS A CB   4  
ATOM 3340  S SG   . CYS A 1 41 ? -4.889  18.741 17.108 1.00 0.00 ? 41 CYS A SG   4  
ATOM 3341  H H    . CYS A 1 41 ? -7.090  15.360 18.377 1.00 0.00 ? 41 CYS A H    4  
ATOM 3342  H HA   . CYS A 1 41 ? -7.697  18.100 18.095 1.00 0.00 ? 41 CYS A HA   4  
ATOM 3343  H HB2  . CYS A 1 41 ? -5.581  17.355 18.935 1.00 0.00 ? 41 CYS A HB2  4  
ATOM 3344  H HB3  . CYS A 1 41 ? -5.264  16.406 17.487 1.00 0.00 ? 41 CYS A HB3  4  
ATOM 3345  N N    . ALA A 1 42 ? -6.612  16.900 15.221 1.00 0.00 ? 42 ALA A N    4  
ATOM 3346  C CA   . ALA A 1 42 ? -6.756  17.064 13.746 1.00 0.00 ? 42 ALA A CA   4  
ATOM 3347  C C    . ALA A 1 42 ? -8.218  16.856 13.338 1.00 0.00 ? 42 ALA A C    4  
ATOM 3348  O O    . ALA A 1 42 ? -8.700  17.446 12.392 1.00 0.00 ? 42 ALA A O    4  
ATOM 3349  C CB   . ALA A 1 42 ? -5.866  15.980 13.135 1.00 0.00 ? 42 ALA A CB   4  
ATOM 3350  H H    . ALA A 1 42 ? -5.931  16.297 15.587 1.00 0.00 ? 42 ALA A H    4  
ATOM 3351  H HA   . ALA A 1 42 ? -6.413  18.040 13.440 1.00 0.00 ? 42 ALA A HA   4  
ATOM 3352  H HB1  . ALA A 1 42 ? -5.916  15.090 13.744 1.00 0.00 ? 42 ALA A HB1  4  
ATOM 3353  H HB2  . ALA A 1 42 ? -6.207  15.754 12.137 1.00 0.00 ? 42 ALA A HB2  4  
ATOM 3354  H HB3  . ALA A 1 42 ? -4.846  16.333 13.096 1.00 0.00 ? 42 ALA A HB3  4  
ATOM 3355  N N    . THR A 1 43 ? -8.924  16.025 14.055 1.00 0.00 ? 43 THR A N    4  
ATOM 3356  C CA   . THR A 1 43 ? -10.355 15.777 13.722 1.00 0.00 ? 43 THR A CA   4  
ATOM 3357  C C    . THR A 1 43 ? -11.220 16.913 14.272 1.00 0.00 ? 43 THR A C    4  
ATOM 3358  O O    . THR A 1 43 ? -12.313 17.158 13.801 1.00 0.00 ? 43 THR A O    4  
ATOM 3359  C CB   . THR A 1 43 ? -10.699 14.455 14.410 1.00 0.00 ? 43 THR A CB   4  
ATOM 3360  O OG1  . THR A 1 43 ? -9.860  13.427 13.903 1.00 0.00 ? 43 THR A OG1  4  
ATOM 3361  C CG2  . THR A 1 43 ? -12.163 14.103 14.139 1.00 0.00 ? 43 THR A CG2  4  
ATOM 3362  H H    . THR A 1 43 ? -8.514  15.569 14.814 1.00 0.00 ? 43 THR A H    4  
ATOM 3363  H HA   . THR A 1 43 ? -10.485 15.684 12.656 1.00 0.00 ? 43 THR A HA   4  
ATOM 3364  H HB   . THR A 1 43 ? -10.548 14.553 15.474 1.00 0.00 ? 43 THR A HB   4  
ATOM 3365  H HG1  . THR A 1 43 ? -9.601  13.670 13.011 1.00 0.00 ? 43 THR A HG1  4  
ATOM 3366  H HG21 . THR A 1 43 ? -12.318 14.009 13.074 1.00 0.00 ? 43 THR A HG21 4  
ATOM 3367  H HG22 . THR A 1 43 ? -12.403 13.167 14.622 1.00 0.00 ? 43 THR A HG22 4  
ATOM 3368  H HG23 . THR A 1 43 ? -12.799 14.884 14.528 1.00 0.00 ? 43 THR A HG23 4  
ATOM 3369  N N    . CYS A 1 44 ? -10.736 17.612 15.261 1.00 0.00 ? 44 CYS A N    4  
ATOM 3370  C CA   . CYS A 1 44 ? -11.525 18.738 15.831 1.00 0.00 ? 44 CYS A CA   4  
ATOM 3371  C C    . CYS A 1 44 ? -11.344 19.982 14.960 1.00 0.00 ? 44 CYS A C    4  
ATOM 3372  O O    . CYS A 1 44 ? -12.282 20.696 14.673 1.00 0.00 ? 44 CYS A O    4  
ATOM 3373  C CB   . CYS A 1 44 ? -10.944 18.972 17.225 1.00 0.00 ? 44 CYS A CB   4  
ATOM 3374  S SG   . CYS A 1 44 ? -11.608 20.514 17.900 1.00 0.00 ? 44 CYS A SG   4  
ATOM 3375  H H    . CYS A 1 44 ? -9.850  17.401 15.622 1.00 0.00 ? 44 CYS A H    4  
ATOM 3376  H HA   . CYS A 1 44 ? -12.569 18.473 15.904 1.00 0.00 ? 44 CYS A HA   4  
ATOM 3377  H HB2  . CYS A 1 44 ? -11.213 18.149 17.870 1.00 0.00 ? 44 CYS A HB2  4  
ATOM 3378  H HB3  . CYS A 1 44 ? -9.868  19.041 17.158 1.00 0.00 ? 44 CYS A HB3  4  
ATOM 3379  N N    . LYS A 1 45 ? -10.138 20.238 14.531 1.00 0.00 ? 45 LYS A N    4  
ATOM 3380  C CA   . LYS A 1 45 ? -9.891  21.428 13.671 1.00 0.00 ? 45 LYS A CA   4  
ATOM 3381  C C    . LYS A 1 45 ? -10.820 21.386 12.456 1.00 0.00 ? 45 LYS A C    4  
ATOM 3382  O O    . LYS A 1 45 ? -11.357 22.392 12.038 1.00 0.00 ? 45 LYS A O    4  
ATOM 3383  C CB   . LYS A 1 45 ? -8.429  21.303 13.238 1.00 0.00 ? 45 LYS A CB   4  
ATOM 3384  C CG   . LYS A 1 45 ? -8.122  22.326 12.141 1.00 0.00 ? 45 LYS A CG   4  
ATOM 3385  C CD   . LYS A 1 45 ? -7.170  21.702 11.119 1.00 0.00 ? 45 LYS A CD   4  
ATOM 3386  C CE   . LYS A 1 45 ? -5.793  21.507 11.756 1.00 0.00 ? 45 LYS A CE   4  
ATOM 3387  N NZ   . LYS A 1 45 ? -4.935  20.980 10.657 1.00 0.00 ? 45 LYS A NZ   4  
ATOM 3388  H H    . LYS A 1 45 ? -9.395  19.645 14.771 1.00 0.00 ? 45 LYS A H    4  
ATOM 3389  H HA   . LYS A 1 45 ? -10.036 22.338 14.230 1.00 0.00 ? 45 LYS A HA   4  
ATOM 3390  H HB2  . LYS A 1 45 ? -7.787  21.483 14.087 1.00 0.00 ? 45 LYS A HB2  4  
ATOM 3391  H HB3  . LYS A 1 45 ? -8.251  20.307 12.859 1.00 0.00 ? 45 LYS A HB3  4  
ATOM 3392  H HG2  . LYS A 1 45 ? -9.037  22.617 11.649 1.00 0.00 ? 45 LYS A HG2  4  
ATOM 3393  H HG3  . LYS A 1 45 ? -7.657  23.196 12.580 1.00 0.00 ? 45 LYS A HG3  4  
ATOM 3394  H HD2  . LYS A 1 45 ? -7.560  20.745 10.802 1.00 0.00 ? 45 LYS A HD2  4  
ATOM 3395  H HD3  . LYS A 1 45 ? -7.082  22.356 10.264 1.00 0.00 ? 45 LYS A HD3  4  
ATOM 3396  H HE2  . LYS A 1 45 ? -5.407  22.451 12.114 1.00 0.00 ? 45 LYS A HE2  4  
ATOM 3397  H HE3  . LYS A 1 45 ? -5.850  20.792 12.564 1.00 0.00 ? 45 LYS A HE3  4  
ATOM 3398  H HZ1  . LYS A 1 45 ? -5.171  21.466 9.769  1.00 0.00 ? 45 LYS A HZ1  4  
ATOM 3399  H HZ2  . LYS A 1 45 ? -3.935  21.148 10.886 1.00 0.00 ? 45 LYS A HZ2  4  
ATOM 3400  H HZ3  . LYS A 1 45 ? -5.101  19.958 10.549 1.00 0.00 ? 45 LYS A HZ3  4  
ATOM 3401  N N    . MET A 1 46 ? -11.017 20.228 11.887 1.00 0.00 ? 46 MET A N    4  
ATOM 3402  C CA   . MET A 1 46 ? -11.914 20.129 10.704 1.00 0.00 ? 46 MET A CA   4  
ATOM 3403  C C    . MET A 1 46 ? -13.347 20.478 11.108 1.00 0.00 ? 46 MET A C    4  
ATOM 3404  O O    . MET A 1 46 ? -14.153 20.882 10.295 1.00 0.00 ? 46 MET A O    4  
ATOM 3405  C CB   . MET A 1 46 ? -11.819 18.672 10.253 1.00 0.00 ? 46 MET A CB   4  
ATOM 3406  C CG   . MET A 1 46 ? -12.455 17.766 11.308 1.00 0.00 ? 46 MET A CG   4  
ATOM 3407  S SD   . MET A 1 46 ? -13.892 16.926 10.596 1.00 0.00 ? 46 MET A SD   4  
ATOM 3408  C CE   . MET A 1 46 ? -13.979 15.568 11.790 1.00 0.00 ? 46 MET A CE   4  
ATOM 3409  H H    . MET A 1 46 ? -10.576 19.425 12.241 1.00 0.00 ? 46 MET A H    4  
ATOM 3410  H HA   . MET A 1 46 ? -11.572 20.783 9.916  1.00 0.00 ? 46 MET A HA   4  
ATOM 3411  H HB2  . MET A 1 46 ? -12.338 18.551 9.315  1.00 0.00 ? 46 MET A HB2  4  
ATOM 3412  H HB3  . MET A 1 46 ? -10.781 18.403 10.128 1.00 0.00 ? 46 MET A HB3  4  
ATOM 3413  H HG2  . MET A 1 46 ? -11.733 17.033 11.635 1.00 0.00 ? 46 MET A HG2  4  
ATOM 3414  H HG3  . MET A 1 46 ? -12.768 18.360 12.152 1.00 0.00 ? 46 MET A HG3  4  
ATOM 3415  H HE1  . MET A 1 46 ? -13.649 15.914 12.756 1.00 0.00 ? 46 MET A HE1  4  
ATOM 3416  H HE2  . MET A 1 46 ? -15.000 15.219 11.863 1.00 0.00 ? 46 MET A HE2  4  
ATOM 3417  H HE3  . MET A 1 46 ? -13.341 14.760 11.461 1.00 0.00 ? 46 MET A HE3  4  
ATOM 3418  N N    . ILE A 1 47 ? -13.666 20.330 12.364 1.00 0.00 ? 47 ILE A N    4  
ATOM 3419  C CA   . ILE A 1 47 ? -15.043 20.657 12.832 1.00 0.00 ? 47 ILE A CA   4  
ATOM 3420  C C    . ILE A 1 47 ? -15.331 22.138 12.581 1.00 0.00 ? 47 ILE A C    4  
ATOM 3421  O O    . ILE A 1 47 ? -16.428 22.517 12.225 1.00 0.00 ? 47 ILE A O    4  
ATOM 3422  C CB   . ILE A 1 47 ? -15.039 20.355 14.331 1.00 0.00 ? 47 ILE A CB   4  
ATOM 3423  C CG1  . ILE A 1 47 ? -14.577 18.914 14.562 1.00 0.00 ? 47 ILE A CG1  4  
ATOM 3424  C CG2  . ILE A 1 47 ? -16.452 20.532 14.890 1.00 0.00 ? 47 ILE A CG2  4  
ATOM 3425  C CD1  . ILE A 1 47 ? -15.366 17.972 13.651 1.00 0.00 ? 47 ILE A CD1  4  
ATOM 3426  H H    . ILE A 1 47 ? -12.995 20.006 13.001 1.00 0.00 ? 47 ILE A H    4  
ATOM 3427  H HA   . ILE A 1 47 ? -15.770 20.039 12.329 1.00 0.00 ? 47 ILE A HA   4  
ATOM 3428  H HB   . ILE A 1 47 ? -14.365 21.034 14.833 1.00 0.00 ? 47 ILE A HB   4  
ATOM 3429  H HG12 . ILE A 1 47 ? -13.524 18.833 14.339 1.00 0.00 ? 47 ILE A HG12 4  
ATOM 3430  H HG13 . ILE A 1 47 ? -14.747 18.643 15.594 1.00 0.00 ? 47 ILE A HG13 4  
ATOM 3431  H HG21 . ILE A 1 47 ? -17.155 19.999 14.266 1.00 0.00 ? 47 ILE A HG21 4  
ATOM 3432  H HG22 . ILE A 1 47 ? -16.493 20.138 15.895 1.00 0.00 ? 47 ILE A HG22 4  
ATOM 3433  H HG23 . ILE A 1 47 ? -16.705 21.581 14.903 1.00 0.00 ? 47 ILE A HG23 4  
ATOM 3434  H HD11 . ILE A 1 47 ? -15.227 18.269 12.621 1.00 0.00 ? 47 ILE A HD11 4  
ATOM 3435  H HD12 . ILE A 1 47 ? -15.011 16.961 13.785 1.00 0.00 ? 47 ILE A HD12 4  
ATOM 3436  H HD13 . ILE A 1 47 ? -16.414 18.022 13.902 1.00 0.00 ? 47 ILE A HD13 4  
ATOM 3437  N N    . LEU A 1 48 ? -14.346 22.976 12.758 1.00 0.00 ? 48 LEU A N    4  
ATOM 3438  C CA   . LEU A 1 48 ? -14.554 24.432 12.522 1.00 0.00 ? 48 LEU A CA   4  
ATOM 3439  C C    . LEU A 1 48 ? -14.684 24.697 11.022 1.00 0.00 ? 48 LEU A C    4  
ATOM 3440  O O    . LEU A 1 48 ? -15.479 25.508 10.590 1.00 0.00 ? 48 LEU A O    4  
ATOM 3441  C CB   . LEU A 1 48 ? -13.300 25.108 13.076 1.00 0.00 ? 48 LEU A CB   4  
ATOM 3442  C CG   . LEU A 1 48 ? -13.357 25.124 14.605 1.00 0.00 ? 48 LEU A CG   4  
ATOM 3443  C CD1  . LEU A 1 48 ? -14.646 25.812 15.060 1.00 0.00 ? 48 LEU A CD1  4  
ATOM 3444  C CD2  . LEU A 1 48 ? -13.330 23.689 15.133 1.00 0.00 ? 48 LEU A CD2  4  
ATOM 3445  H H    . LEU A 1 48 ? -13.467 22.646 13.039 1.00 0.00 ? 48 LEU A H    4  
ATOM 3446  H HA   . LEU A 1 48 ? -15.428 24.781 13.048 1.00 0.00 ? 48 LEU A HA   4  
ATOM 3447  H HB2  . LEU A 1 48 ? -12.425 24.562 12.755 1.00 0.00 ? 48 LEU A HB2  4  
ATOM 3448  H HB3  . LEU A 1 48 ? -13.246 26.122 12.708 1.00 0.00 ? 48 LEU A HB3  4  
ATOM 3449  H HG   . LEU A 1 48 ? -12.506 25.665 14.989 1.00 0.00 ? 48 LEU A HG   4  
ATOM 3450  H HD11 . LEU A 1 48 ? -15.033 26.420 14.255 1.00 0.00 ? 48 LEU A HD11 4  
ATOM 3451  H HD12 . LEU A 1 48 ? -15.377 25.065 15.330 1.00 0.00 ? 48 LEU A HD12 4  
ATOM 3452  H HD13 . LEU A 1 48 ? -14.438 26.437 15.915 1.00 0.00 ? 48 LEU A HD13 4  
ATOM 3453  H HD21 . LEU A 1 48 ? -12.570 23.127 14.611 1.00 0.00 ? 48 LEU A HD21 4  
ATOM 3454  H HD22 . LEU A 1 48 ? -13.108 23.700 16.190 1.00 0.00 ? 48 LEU A HD22 4  
ATOM 3455  H HD23 . LEU A 1 48 ? -14.293 23.228 14.972 1.00 0.00 ? 48 LEU A HD23 4  
ATOM 3456  N N    . GLU A 1 49 ? -13.909 24.014 10.225 1.00 0.00 ? 49 GLU A N    4  
ATOM 3457  C CA   . GLU A 1 49 ? -13.990 24.224 8.751  1.00 0.00 ? 49 GLU A CA   4  
ATOM 3458  C C    . GLU A 1 49 ? -15.392 23.873 8.247  1.00 0.00 ? 49 GLU A C    4  
ATOM 3459  O O    . GLU A 1 49 ? -15.835 24.359 7.226  1.00 0.00 ? 49 GLU A O    4  
ATOM 3460  C CB   . GLU A 1 49 ? -12.952 23.271 8.158  1.00 0.00 ? 49 GLU A CB   4  
ATOM 3461  C CG   . GLU A 1 49 ? -11.563 23.641 8.682  1.00 0.00 ? 49 GLU A CG   4  
ATOM 3462  C CD   . GLU A 1 49 ? -10.517 22.722 8.048  1.00 0.00 ? 49 GLU A CD   4  
ATOM 3463  O OE1  . GLU A 1 49 ? -10.910 21.739 7.444  1.00 0.00 ? 49 GLU A OE1  4  
ATOM 3464  O OE2  . GLU A 1 49 ? -9.341  23.019 8.177  1.00 0.00 ? 49 GLU A OE2  4  
ATOM 3465  H H    . GLU A 1 49 ? -13.275 23.363 10.595 1.00 0.00 ? 49 GLU A H    4  
ATOM 3466  H HA   . GLU A 1 49 ? -13.742 25.243 8.499  1.00 0.00 ? 49 GLU A HA   4  
ATOM 3467  H HB2  . GLU A 1 49 ? -13.187 22.257 8.447  1.00 0.00 ? 49 GLU A HB2  4  
ATOM 3468  H HB3  . GLU A 1 49 ? -12.964 23.350 7.081  1.00 0.00 ? 49 GLU A HB3  4  
ATOM 3469  H HG2  . GLU A 1 49 ? -11.344 24.667 8.427  1.00 0.00 ? 49 GLU A HG2  4  
ATOM 3470  H HG3  . GLU A 1 49 ? -11.541 23.525 9.755  1.00 0.00 ? 49 GLU A HG3  4  
ATOM 3471  N N    . LYS A 1 50 ? -16.093 23.032 8.958  1.00 0.00 ? 50 LYS A N    4  
ATOM 3472  C CA   . LYS A 1 50 ? -17.467 22.651 8.522  1.00 0.00 ? 50 LYS A CA   4  
ATOM 3473  C C    . LYS A 1 50 ? -18.451 23.786 8.824  1.00 0.00 ? 50 LYS A C    4  
ATOM 3474  O O    . LYS A 1 50 ? -19.247 24.167 7.990  1.00 0.00 ? 50 LYS A O    4  
ATOM 3475  C CB   . LYS A 1 50 ? -17.814 21.408 9.343  1.00 0.00 ? 50 LYS A CB   4  
ATOM 3476  C CG   . LYS A 1 50 ? -17.002 20.217 8.831  1.00 0.00 ? 50 LYS A CG   4  
ATOM 3477  C CD   . LYS A 1 50 ? -17.728 19.577 7.647  1.00 0.00 ? 50 LYS A CD   4  
ATOM 3478  C CE   . LYS A 1 50 ? -16.906 18.399 7.121  1.00 0.00 ? 50 LYS A CE   4  
ATOM 3479  N NZ   . LYS A 1 50 ? -16.883 17.419 8.243  1.00 0.00 ? 50 LYS A NZ   4  
ATOM 3480  H H    . LYS A 1 50 ? -15.717 22.652 9.779  1.00 0.00 ? 50 LYS A H    4  
ATOM 3481  H HA   . LYS A 1 50 ? -17.477 22.413 7.470  1.00 0.00 ? 50 LYS A HA   4  
ATOM 3482  H HB2  . LYS A 1 50 ? -17.577 21.586 10.382 1.00 0.00 ? 50 LYS A HB2  4  
ATOM 3483  H HB3  . LYS A 1 50 ? -18.867 21.194 9.246  1.00 0.00 ? 50 LYS A HB3  4  
ATOM 3484  H HG2  . LYS A 1 50 ? -16.026 20.556 8.515  1.00 0.00 ? 50 LYS A HG2  4  
ATOM 3485  H HG3  . LYS A 1 50 ? -16.892 19.490 9.622  1.00 0.00 ? 50 LYS A HG3  4  
ATOM 3486  H HD2  . LYS A 1 50 ? -18.698 19.226 7.965  1.00 0.00 ? 50 LYS A HD2  4  
ATOM 3487  H HD3  . LYS A 1 50 ? -17.851 20.309 6.861  1.00 0.00 ? 50 LYS A HD3  4  
ATOM 3488  H HE2  . LYS A 1 50 ? -17.381 17.966 6.254  1.00 0.00 ? 50 LYS A HE2  4  
ATOM 3489  H HE3  . LYS A 1 50 ? -15.902 18.718 6.881  1.00 0.00 ? 50 LYS A HE3  4  
ATOM 3490  H HZ1  . LYS A 1 50 ? -17.750 17.520 8.810  1.00 0.00 ? 50 LYS A HZ1  4  
ATOM 3491  H HZ2  . LYS A 1 50 ? -16.833 16.453 7.861  1.00 0.00 ? 50 LYS A HZ2  4  
ATOM 3492  H HZ3  . LYS A 1 50 ? -16.053 17.598 8.844  1.00 0.00 ? 50 LYS A HZ3  4  
ATOM 3493  N N    . GLU A 1 51 ? -18.399 24.329 10.009 1.00 0.00 ? 51 GLU A N    4  
ATOM 3494  C CA   . GLU A 1 51 ? -19.330 25.440 10.361 1.00 0.00 ? 51 GLU A CA   4  
ATOM 3495  C C    . GLU A 1 51 ? -19.235 26.557 9.318  1.00 0.00 ? 51 GLU A C    4  
ATOM 3496  O O    . GLU A 1 51 ? -20.171 27.299 9.101  1.00 0.00 ? 51 GLU A O    4  
ATOM 3497  C CB   . GLU A 1 51 ? -18.856 25.938 11.726 1.00 0.00 ? 51 GLU A CB   4  
ATOM 3498  C CG   . GLU A 1 51 ? -19.078 24.845 12.774 1.00 0.00 ? 51 GLU A CG   4  
ATOM 3499  C CD   . GLU A 1 51 ? -18.597 25.342 14.138 1.00 0.00 ? 51 GLU A CD   4  
ATOM 3500  O OE1  . GLU A 1 51 ? -17.492 25.856 14.205 1.00 0.00 ? 51 GLU A OE1  4  
ATOM 3501  O OE2  . GLU A 1 51 ? -19.341 25.200 15.095 1.00 0.00 ? 51 GLU A OE2  4  
ATOM 3502  H H    . GLU A 1 51 ? -17.748 24.008 10.668 1.00 0.00 ? 51 GLU A H    4  
ATOM 3503  H HA   . GLU A 1 51 ? -20.343 25.075 10.432 1.00 0.00 ? 51 GLU A HA   4  
ATOM 3504  H HB2  . GLU A 1 51 ? -17.805 26.180 11.675 1.00 0.00 ? 51 GLU A HB2  4  
ATOM 3505  H HB3  . GLU A 1 51 ? -19.416 26.819 12.002 1.00 0.00 ? 51 GLU A HB3  4  
ATOM 3506  H HG2  . GLU A 1 51 ? -20.129 24.606 12.828 1.00 0.00 ? 51 GLU A HG2  4  
ATOM 3507  H HG3  . GLU A 1 51 ? -18.521 23.962 12.496 1.00 0.00 ? 51 GLU A HG3  4  
ATOM 3508  N N    . ALA A 1 52 ? -18.109 26.679 8.670  1.00 0.00 ? 52 ALA A N    4  
ATOM 3509  C CA   . ALA A 1 52 ? -17.951 27.747 7.641  1.00 0.00 ? 52 ALA A CA   4  
ATOM 3510  C C    . ALA A 1 52 ? -18.603 27.313 6.326  1.00 0.00 ? 52 ALA A C    4  
ATOM 3511  O O    . ALA A 1 52 ? -18.548 26.160 5.946  1.00 0.00 ? 52 ALA A O    4  
ATOM 3512  C CB   . ALA A 1 52 ? -16.441 27.906 7.464  1.00 0.00 ? 52 ALA A CB   4  
ATOM 3513  H H    . ALA A 1 52 ? -17.366 26.068 8.861  1.00 0.00 ? 52 ALA A H    4  
ATOM 3514  H HA   . ALA A 1 52 ? -18.381 28.673 7.988  1.00 0.00 ? 52 ALA A HA   4  
ATOM 3515  H HB1  . ALA A 1 52 ? -16.014 28.319 8.365  1.00 0.00 ? 52 ALA A HB1  4  
ATOM 3516  H HB2  . ALA A 1 52 ? -16.244 28.570 6.635  1.00 0.00 ? 52 ALA A HB2  4  
ATOM 3517  H HB3  . ALA A 1 52 ? -15.998 26.941 7.265  1.00 0.00 ? 52 ALA A HB3  4  
ATOM 3518  N N    . LYS A 1 53 ? -19.222 28.226 5.629  1.00 0.00 ? 53 LYS A N    4  
ATOM 3519  C CA   . LYS A 1 53 ? -19.878 27.863 4.339  1.00 0.00 ? 53 LYS A CA   4  
ATOM 3520  C C    . LYS A 1 53 ? -18.853 27.265 3.374  1.00 0.00 ? 53 LYS A C    4  
ATOM 3521  O O    . LYS A 1 53 ? -19.201 26.620 2.404  1.00 0.00 ? 53 LYS A O    4  
ATOM 3522  C CB   . LYS A 1 53 ? -20.427 29.181 3.790  1.00 0.00 ? 53 LYS A CB   4  
ATOM 3523  C CG   . LYS A 1 53 ? -21.514 29.712 4.727  1.00 0.00 ? 53 LYS A CG   4  
ATOM 3524  C CD   . LYS A 1 53 ? -21.944 31.108 4.273  1.00 0.00 ? 53 LYS A CD   4  
ATOM 3525  C CE   . LYS A 1 53 ? -23.040 31.633 5.203  1.00 0.00 ? 53 LYS A CE   4  
ATOM 3526  N NZ   . LYS A 1 53 ? -23.507 32.897 4.566  1.00 0.00 ? 53 LYS A NZ   4  
ATOM 3527  H H    . LYS A 1 53 ? -19.256 29.151 5.954  1.00 0.00 ? 53 LYS A H    4  
ATOM 3528  H HA   . LYS A 1 53 ? -20.686 27.171 4.510  1.00 0.00 ? 53 LYS A HA   4  
ATOM 3529  H HB2  . LYS A 1 53 ? -19.627 29.904 3.721  1.00 0.00 ? 53 LYS A HB2  4  
ATOM 3530  H HB3  . LYS A 1 53 ? -20.848 29.016 2.810  1.00 0.00 ? 53 LYS A HB3  4  
ATOM 3531  H HG2  . LYS A 1 53 ? -22.365 29.048 4.704  1.00 0.00 ? 53 LYS A HG2  4  
ATOM 3532  H HG3  . LYS A 1 53 ? -21.127 29.765 5.735  1.00 0.00 ? 53 LYS A HG3  4  
ATOM 3533  H HD2  . LYS A 1 53 ? -21.094 31.775 4.306  1.00 0.00 ? 53 LYS A HD2  4  
ATOM 3534  H HD3  . LYS A 1 53 ? -22.322 31.057 3.263  1.00 0.00 ? 53 LYS A HD3  4  
ATOM 3535  H HE2  . LYS A 1 53 ? -23.851 30.923 5.267  1.00 0.00 ? 53 LYS A HE2  4  
ATOM 3536  H HE3  . LYS A 1 53 ? -22.636 31.834 6.183  1.00 0.00 ? 53 LYS A HE3  4  
ATOM 3537  H HZ1  . LYS A 1 53 ? -23.378 32.836 3.537  1.00 0.00 ? 53 LYS A HZ1  4  
ATOM 3538  H HZ2  . LYS A 1 53 ? -24.515 33.042 4.783  1.00 0.00 ? 53 LYS A HZ2  4  
ATOM 3539  H HZ3  . LYS A 1 53 ? -22.954 33.696 4.935  1.00 0.00 ? 53 LYS A HZ3  4  
ATOM 3540  N N    . SER A 1 54 ? -17.590 27.471 3.631  1.00 0.00 ? 54 SER A N    4  
ATOM 3541  C CA   . SER A 1 54 ? -16.543 26.914 2.726  1.00 0.00 ? 54 SER A CA   4  
ATOM 3542  C C    . SER A 1 54 ? -16.602 25.384 2.727  1.00 0.00 ? 54 SER A C    4  
ATOM 3543  O O    . SER A 1 54 ? -16.178 24.737 1.792  1.00 0.00 ? 54 SER A O    4  
ATOM 3544  C CB   . SER A 1 54 ? -15.215 27.399 3.310  1.00 0.00 ? 54 SER A CB   4  
ATOM 3545  O OG   . SER A 1 54 ? -15.181 28.818 3.293  1.00 0.00 ? 54 SER A OG   4  
ATOM 3546  H H    . SER A 1 54 ? -17.330 27.994 4.418  1.00 0.00 ? 54 SER A H    4  
ATOM 3547  H HA   . SER A 1 54 ? -16.667 27.296 1.726  1.00 0.00 ? 54 SER A HA   4  
ATOM 3548  H HB2  . SER A 1 54 ? -15.119 27.048 4.326  1.00 0.00 ? 54 SER A HB2  4  
ATOM 3549  H HB3  . SER A 1 54 ? -14.400 27.012 2.717  1.00 0.00 ? 54 SER A HB3  4  
ATOM 3550  H HG   . SER A 1 54 ? -14.269 29.092 3.178  1.00 0.00 ? 54 SER A HG   4  
ATOM 3551  N N    . GLN A 1 55 ? -17.126 24.801 3.771  1.00 0.00 ? 55 GLN A N    4  
ATOM 3552  C CA   . GLN A 1 55 ? -17.211 23.313 3.829  1.00 0.00 ? 55 GLN A CA   4  
ATOM 3553  C C    . GLN A 1 55 ? -15.867 22.691 3.438  1.00 0.00 ? 55 GLN A C    4  
ATOM 3554  O O    . GLN A 1 55 ? -15.646 22.503 2.254  1.00 0.00 ? 55 GLN A O    4  
ATOM 3555  C CB   . GLN A 1 55 ? -18.291 22.938 2.814  1.00 0.00 ? 55 GLN A CB   4  
ATOM 3556  C CG   . GLN A 1 55 ? -18.544 21.430 2.870  1.00 0.00 ? 55 GLN A CG   4  
ATOM 3557  C CD   . GLN A 1 55 ? -19.287 21.085 4.162  1.00 0.00 ? 55 GLN A CD   4  
ATOM 3558  O OE1  . GLN A 1 55 ? -18.807 21.356 5.244  1.00 0.00 ? 55 GLN A OE1  4  
ATOM 3559  N NE2  . GLN A 1 55 ? -20.449 20.493 4.095  1.00 0.00 ? 55 GLN A NE2  4  
ATOM 3560  O OXT  . GLN A 1 55 ? -15.083 22.413 4.332  1.00 0.00 ? 55 GLN A OXT  4  
ATOM 3561  H H    . GLN A 1 55 ? -17.464 25.340 4.516  1.00 0.00 ? 55 GLN A H    4  
ATOM 3562  H HA   . GLN A 1 55 ? -17.504 22.990 4.814  1.00 0.00 ? 55 GLN A HA   4  
ATOM 3563  H HB2  . GLN A 1 55 ? -19.204 23.466 3.048  1.00 0.00 ? 55 GLN A HB2  4  
ATOM 3564  H HB3  . GLN A 1 55 ? -17.963 23.212 1.822  1.00 0.00 ? 55 GLN A HB3  4  
ATOM 3565  H HG2  . GLN A 1 55 ? -19.143 21.134 2.020  1.00 0.00 ? 55 GLN A HG2  4  
ATOM 3566  H HG3  . GLN A 1 55 ? -17.601 20.905 2.846  1.00 0.00 ? 55 GLN A HG3  4  
ATOM 3567  H HE21 . GLN A 1 55 ? -20.838 20.274 3.223  1.00 0.00 ? 55 GLN A HE21 4  
ATOM 3568  H HE22 . GLN A 1 55 ? -20.933 20.269 4.918  1.00 0.00 ? 55 GLN A HE22 4  
ATOM 3569  N N    . LYS A 1 1  ? -31.433 18.796 18.990 1.00 0.00 ? 1  LYS A N    5  
ATOM 3570  C CA   . LYS A 1 1  ? -29.950 18.957 18.963 1.00 0.00 ? 1  LYS A CA   5  
ATOM 3571  C C    . LYS A 1 1  ? -29.270 17.658 19.403 1.00 0.00 ? 1  LYS A C    5  
ATOM 3572  O O    . LYS A 1 1  ? -29.703 17.002 20.329 1.00 0.00 ? 1  LYS A O    5  
ATOM 3573  C CB   . LYS A 1 1  ? -29.656 20.081 19.955 1.00 0.00 ? 1  LYS A CB   5  
ATOM 3574  C CG   . LYS A 1 1  ? -30.300 21.378 19.460 1.00 0.00 ? 1  LYS A CG   5  
ATOM 3575  C CD   . LYS A 1 1  ? -30.061 22.491 20.482 1.00 0.00 ? 1  LYS A CD   5  
ATOM 3576  C CE   . LYS A 1 1  ? -30.793 23.758 20.037 1.00 0.00 ? 1  LYS A CE   5  
ATOM 3577  N NZ   . LYS A 1 1  ? -30.527 24.751 21.116 1.00 0.00 ? 1  LYS A NZ   5  
ATOM 3578  H H1   . LYS A 1 1  ? -31.681 17.814 18.759 1.00 0.00 ? 1  LYS A H1   5  
ATOM 3579  H H2   . LYS A 1 1  ? -31.789 19.029 19.941 1.00 0.00 ? 1  LYS A H2   5  
ATOM 3580  H H3   . LYS A 1 1  ? -31.864 19.434 18.291 1.00 0.00 ? 1  LYS A H3   5  
ATOM 3581  H HA   . LYS A 1 1  ? -29.620 19.240 17.976 1.00 0.00 ? 1  LYS A HA   5  
ATOM 3582  H HB2  . LYS A 1 1  ? -30.062 19.825 20.922 1.00 0.00 ? 1  LYS A HB2  5  
ATOM 3583  H HB3  . LYS A 1 1  ? -28.587 20.219 20.037 1.00 0.00 ? 1  LYS A HB3  5  
ATOM 3584  H HG2  . LYS A 1 1  ? -29.863 21.659 18.514 1.00 0.00 ? 1  LYS A HG2  5  
ATOM 3585  H HG3  . LYS A 1 1  ? -31.362 21.227 19.334 1.00 0.00 ? 1  LYS A HG3  5  
ATOM 3586  H HD2  . LYS A 1 1  ? -30.435 22.180 21.446 1.00 0.00 ? 1  LYS A HD2  5  
ATOM 3587  H HD3  . LYS A 1 1  ? -29.003 22.692 20.555 1.00 0.00 ? 1  LYS A HD3  5  
ATOM 3588  H HE2  . LYS A 1 1  ? -30.395 24.111 19.096 1.00 0.00 ? 1  LYS A HE2  5  
ATOM 3589  H HE3  . LYS A 1 1  ? -31.852 23.571 19.951 1.00 0.00 ? 1  LYS A HE3  5  
ATOM 3590  H HZ1  . LYS A 1 1  ? -30.753 24.327 22.039 1.00 0.00 ? 1  LYS A HZ1  5  
ATOM 3591  H HZ2  . LYS A 1 1  ? -29.525 25.027 21.095 1.00 0.00 ? 1  LYS A HZ2  5  
ATOM 3592  H HZ3  . LYS A 1 1  ? -31.118 25.594 20.967 1.00 0.00 ? 1  LYS A HZ3  5  
ATOM 3593  N N    . ASN A 1 2  ? -28.207 17.281 18.745 1.00 0.00 ? 2  ASN A N    5  
ATOM 3594  C CA   . ASN A 1 2  ? -27.501 16.024 19.126 1.00 0.00 ? 2  ASN A CA   5  
ATOM 3595  C C    . ASN A 1 2  ? -26.502 16.297 20.255 1.00 0.00 ? 2  ASN A C    5  
ATOM 3596  O O    . ASN A 1 2  ? -25.700 17.207 20.181 1.00 0.00 ? 2  ASN A O    5  
ATOM 3597  C CB   . ASN A 1 2  ? -26.767 15.583 17.859 1.00 0.00 ? 2  ASN A CB   5  
ATOM 3598  C CG   . ASN A 1 2  ? -27.784 15.113 16.818 1.00 0.00 ? 2  ASN A CG   5  
ATOM 3599  O OD1  . ASN A 1 2  ? -27.721 15.504 15.670 1.00 0.00 ? 2  ASN A OD1  5  
ATOM 3600  N ND2  . ASN A 1 2  ? -28.727 14.283 17.174 1.00 0.00 ? 2  ASN A ND2  5  
ATOM 3601  H H    . ASN A 1 2  ? -27.875 17.824 18.001 1.00 0.00 ? 2  ASN A H    5  
ATOM 3602  H HA   . ASN A 1 2  ? -28.209 15.268 19.423 1.00 0.00 ? 2  ASN A HA   5  
ATOM 3603  H HB2  . ASN A 1 2  ? -26.205 16.415 17.461 1.00 0.00 ? 2  ASN A HB2  5  
ATOM 3604  H HB3  . ASN A 1 2  ? -26.093 14.774 18.097 1.00 0.00 ? 2  ASN A HB3  5  
ATOM 3605  H HD21 . ASN A 1 2  ? -28.779 13.968 18.101 1.00 0.00 ? 2  ASN A HD21 5  
ATOM 3606  H HD22 . ASN A 1 2  ? -29.384 13.976 16.514 1.00 0.00 ? 2  ASN A HD22 5  
ATOM 3607  N N    . GLU A 1 3  ? -26.546 15.516 21.299 1.00 0.00 ? 3  GLU A N    5  
ATOM 3608  C CA   . GLU A 1 3  ? -25.598 15.730 22.431 1.00 0.00 ? 3  GLU A CA   5  
ATOM 3609  C C    . GLU A 1 3  ? -24.222 15.157 22.080 1.00 0.00 ? 3  GLU A C    5  
ATOM 3610  O O    . GLU A 1 3  ? -23.244 15.404 22.757 1.00 0.00 ? 3  GLU A O    5  
ATOM 3611  C CB   . GLU A 1 3  ? -26.211 14.973 23.609 1.00 0.00 ? 3  GLU A CB   5  
ATOM 3612  C CG   . GLU A 1 3  ? -27.433 15.737 24.125 1.00 0.00 ? 3  GLU A CG   5  
ATOM 3613  C CD   . GLU A 1 3  ? -26.986 17.077 24.711 1.00 0.00 ? 3  GLU A CD   5  
ATOM 3614  O OE1  . GLU A 1 3  ? -25.840 17.172 25.117 1.00 0.00 ? 3  GLU A OE1  5  
ATOM 3615  O OE2  . GLU A 1 3  ? -27.799 17.987 24.743 1.00 0.00 ? 3  GLU A OE2  5  
ATOM 3616  H H    . GLU A 1 3  ? -27.201 14.788 21.340 1.00 0.00 ? 3  GLU A H    5  
ATOM 3617  H HA   . GLU A 1 3  ? -25.522 16.780 22.666 1.00 0.00 ? 3  GLU A HA   5  
ATOM 3618  H HB2  . GLU A 1 3  ? -26.512 13.987 23.287 1.00 0.00 ? 3  GLU A HB2  5  
ATOM 3619  H HB3  . GLU A 1 3  ? -25.480 14.886 24.400 1.00 0.00 ? 3  GLU A HB3  5  
ATOM 3620  H HG2  . GLU A 1 3  ? -28.119 15.910 23.309 1.00 0.00 ? 3  GLU A HG2  5  
ATOM 3621  H HG3  . GLU A 1 3  ? -27.924 15.154 24.891 1.00 0.00 ? 3  GLU A HG3  5  
ATOM 3622  N N    . ASP A 1 4  ? -24.141 14.392 21.026 1.00 0.00 ? 4  ASP A N    5  
ATOM 3623  C CA   . ASP A 1 4  ? -22.830 13.802 20.629 1.00 0.00 ? 4  ASP A CA   5  
ATOM 3624  C C    . ASP A 1 4  ? -22.802 13.552 19.119 1.00 0.00 ? 4  ASP A C    5  
ATOM 3625  O O    . ASP A 1 4  ? -23.088 12.467 18.654 1.00 0.00 ? 4  ASP A O    5  
ATOM 3626  C CB   . ASP A 1 4  ? -22.742 12.480 21.393 1.00 0.00 ? 4  ASP A CB   5  
ATOM 3627  C CG   . ASP A 1 4  ? -21.286 12.204 21.771 1.00 0.00 ? 4  ASP A CG   5  
ATOM 3628  O OD1  . ASP A 1 4  ? -20.413 12.778 21.142 1.00 0.00 ? 4  ASP A OD1  5  
ATOM 3629  O OD2  . ASP A 1 4  ? -21.069 11.425 22.683 1.00 0.00 ? 4  ASP A OD2  5  
ATOM 3630  H H    . ASP A 1 4  ? -24.943 14.205 20.494 1.00 0.00 ? 4  ASP A H    5  
ATOM 3631  H HA   . ASP A 1 4  ? -22.020 14.451 20.921 1.00 0.00 ? 4  ASP A HA   5  
ATOM 3632  H HB2  . ASP A 1 4  ? -23.342 12.543 22.290 1.00 0.00 ? 4  ASP A HB2  5  
ATOM 3633  H HB3  . ASP A 1 4  ? -23.111 11.680 20.770 1.00 0.00 ? 4  ASP A HB3  5  
ATOM 3634  N N    . GLN A 1 5  ? -22.461 14.549 18.349 1.00 0.00 ? 5  GLN A N    5  
ATOM 3635  C CA   . GLN A 1 5  ? -22.418 14.368 16.869 1.00 0.00 ? 5  GLN A CA   5  
ATOM 3636  C C    . GLN A 1 5  ? -21.120 14.946 16.300 1.00 0.00 ? 5  GLN A C    5  
ATOM 3637  O O    . GLN A 1 5  ? -21.116 15.982 15.665 1.00 0.00 ? 5  GLN A O    5  
ATOM 3638  C CB   . GLN A 1 5  ? -23.626 15.142 16.342 1.00 0.00 ? 5  GLN A CB   5  
ATOM 3639  C CG   . GLN A 1 5  ? -23.811 14.845 14.852 1.00 0.00 ? 5  GLN A CG   5  
ATOM 3640  C CD   . GLN A 1 5  ? -24.946 15.709 14.299 1.00 0.00 ? 5  GLN A CD   5  
ATOM 3641  O OE1  . GLN A 1 5  ? -25.322 16.698 14.899 1.00 0.00 ? 5  GLN A OE1  5  
ATOM 3642  N NE2  . GLN A 1 5  ? -25.514 15.377 13.171 1.00 0.00 ? 5  GLN A NE2  5  
ATOM 3643  H H    . GLN A 1 5  ? -22.235 15.418 18.743 1.00 0.00 ? 5  GLN A H    5  
ATOM 3644  H HA   . GLN A 1 5  ? -22.510 13.324 16.615 1.00 0.00 ? 5  GLN A HA   5  
ATOM 3645  H HB2  . GLN A 1 5  ? -24.511 14.839 16.882 1.00 0.00 ? 5  GLN A HB2  5  
ATOM 3646  H HB3  . GLN A 1 5  ? -23.464 16.200 16.481 1.00 0.00 ? 5  GLN A HB3  5  
ATOM 3647  H HG2  . GLN A 1 5  ? -22.897 15.071 14.324 1.00 0.00 ? 5  GLN A HG2  5  
ATOM 3648  H HG3  . GLN A 1 5  ? -24.056 13.802 14.721 1.00 0.00 ? 5  GLN A HG3  5  
ATOM 3649  H HE21 . GLN A 1 5  ? -25.212 14.581 12.687 1.00 0.00 ? 5  GLN A HE21 5  
ATOM 3650  H HE22 . GLN A 1 5  ? -26.241 15.925 12.809 1.00 0.00 ? 5  GLN A HE22 5  
ATOM 3651  N N    . GLU A 1 6  ? -20.017 14.284 16.521 1.00 0.00 ? 6  GLU A N    5  
ATOM 3652  C CA   . GLU A 1 6  ? -18.720 14.795 15.991 1.00 0.00 ? 6  GLU A CA   5  
ATOM 3653  C C    . GLU A 1 6  ? -18.409 16.172 16.583 1.00 0.00 ? 6  GLU A C    5  
ATOM 3654  O O    . GLU A 1 6  ? -17.667 16.948 16.016 1.00 0.00 ? 6  GLU A O    5  
ATOM 3655  C CB   . GLU A 1 6  ? -18.925 14.895 14.479 1.00 0.00 ? 6  GLU A CB   5  
ATOM 3656  C CG   . GLU A 1 6  ? -19.595 13.618 13.969 1.00 0.00 ? 6  GLU A CG   5  
ATOM 3657  C CD   . GLU A 1 6  ? -19.713 13.677 12.444 1.00 0.00 ? 6  GLU A CD   5  
ATOM 3658  O OE1  . GLU A 1 6  ? -19.694 14.774 11.910 1.00 0.00 ? 6  GLU A OE1  5  
ATOM 3659  O OE2  . GLU A 1 6  ? -19.820 12.624 11.837 1.00 0.00 ? 6  GLU A OE2  5  
ATOM 3660  H H    . GLU A 1 6  ? -20.042 13.449 17.034 1.00 0.00 ? 6  GLU A H    5  
ATOM 3661  H HA   . GLU A 1 6  ? -17.924 14.101 16.209 1.00 0.00 ? 6  GLU A HA   5  
ATOM 3662  H HB2  . GLU A 1 6  ? -19.552 15.745 14.255 1.00 0.00 ? 6  GLU A HB2  5  
ATOM 3663  H HB3  . GLU A 1 6  ? -17.967 15.018 13.993 1.00 0.00 ? 6  GLU A HB3  5  
ATOM 3664  H HG2  . GLU A 1 6  ? -19.000 12.762 14.251 1.00 0.00 ? 6  GLU A HG2  5  
ATOM 3665  H HG3  . GLU A 1 6  ? -20.580 13.530 14.402 1.00 0.00 ? 6  GLU A HG3  5  
ATOM 3666  N N    . MET A 1 7  ? -18.972 16.480 17.720 1.00 0.00 ? 7  MET A N    5  
ATOM 3667  C CA   . MET A 1 7  ? -18.706 17.807 18.347 1.00 0.00 ? 7  MET A CA   5  
ATOM 3668  C C    . MET A 1 7  ? -17.440 17.740 19.203 1.00 0.00 ? 7  MET A C    5  
ATOM 3669  O O    . MET A 1 7  ? -17.172 16.751 19.857 1.00 0.00 ? 7  MET A O    5  
ATOM 3670  C CB   . MET A 1 7  ? -19.931 18.087 19.217 1.00 0.00 ? 7  MET A CB   5  
ATOM 3671  C CG   . MET A 1 7  ? -21.139 18.368 18.322 1.00 0.00 ? 7  MET A CG   5  
ATOM 3672  S SD   . MET A 1 7  ? -22.622 18.537 19.346 1.00 0.00 ? 7  MET A SD   5  
ATOM 3673  C CE   . MET A 1 7  ? -22.182 20.111 20.123 1.00 0.00 ? 7  MET A CE   5  
ATOM 3674  H H    . MET A 1 7  ? -19.568 15.840 18.162 1.00 0.00 ? 7  MET A H    5  
ATOM 3675  H HA   . MET A 1 7  ? -18.610 18.569 17.589 1.00 0.00 ? 7  MET A HA   5  
ATOM 3676  H HB2  . MET A 1 7  ? -20.135 17.226 19.838 1.00 0.00 ? 7  MET A HB2  5  
ATOM 3677  H HB3  . MET A 1 7  ? -19.739 18.945 19.844 1.00 0.00 ? 7  MET A HB3  5  
ATOM 3678  H HG2  . MET A 1 7  ? -20.974 19.283 17.772 1.00 0.00 ? 7  MET A HG2  5  
ATOM 3679  H HG3  . MET A 1 7  ? -21.272 17.550 17.630 1.00 0.00 ? 7  MET A HG3  5  
ATOM 3680  H HE1  . MET A 1 7  ? -21.126 20.297 19.984 1.00 0.00 ? 7  MET A HE1  5  
ATOM 3681  H HE2  . MET A 1 7  ? -22.757 20.908 19.669 1.00 0.00 ? 7  MET A HE2  5  
ATOM 3682  H HE3  . MET A 1 7  ? -22.404 20.068 21.176 1.00 0.00 ? 7  MET A HE3  5  
ATOM 3683  N N    . CYS A 1 8  ? -16.656 18.784 19.204 1.00 0.00 ? 8  CYS A N    5  
ATOM 3684  C CA   . CYS A 1 8  ? -15.406 18.777 20.018 1.00 0.00 ? 8  CYS A CA   5  
ATOM 3685  C C    . CYS A 1 8  ? -15.429 19.921 21.035 1.00 0.00 ? 8  CYS A C    5  
ATOM 3686  O O    . CYS A 1 8  ? -15.720 21.053 20.704 1.00 0.00 ? 8  CYS A O    5  
ATOM 3687  C CB   . CYS A 1 8  ? -14.278 18.982 19.007 1.00 0.00 ? 8  CYS A CB   5  
ATOM 3688  S SG   . CYS A 1 8  ? -12.687 18.969 19.867 1.00 0.00 ? 8  CYS A SG   5  
ATOM 3689  H H    . CYS A 1 8  ? -16.889 19.571 18.669 1.00 0.00 ? 8  CYS A H    5  
ATOM 3690  H HA   . CYS A 1 8  ? -15.286 17.829 20.517 1.00 0.00 ? 8  CYS A HA   5  
ATOM 3691  H HB2  . CYS A 1 8  ? -14.300 18.186 18.277 1.00 0.00 ? 8  CYS A HB2  5  
ATOM 3692  H HB3  . CYS A 1 8  ? -14.410 19.931 18.508 1.00 0.00 ? 8  CYS A HB3  5  
ATOM 3693  N N    . HIS A 1 9  ? -15.124 19.634 22.271 1.00 0.00 ? 9  HIS A N    5  
ATOM 3694  C CA   . HIS A 1 9  ? -15.128 20.706 23.308 1.00 0.00 ? 9  HIS A CA   5  
ATOM 3695  C C    . HIS A 1 9  ? -13.785 20.741 24.042 1.00 0.00 ? 9  HIS A C    5  
ATOM 3696  O O    . HIS A 1 9  ? -13.512 21.641 24.811 1.00 0.00 ? 9  HIS A O    5  
ATOM 3697  C CB   . HIS A 1 9  ? -16.253 20.323 24.269 1.00 0.00 ? 9  HIS A CB   5  
ATOM 3698  C CG   . HIS A 1 9  ? -17.560 20.289 23.526 1.00 0.00 ? 9  HIS A CG   5  
ATOM 3699  N ND1  . HIS A 1 9  ? -18.052 21.391 22.845 1.00 0.00 ? 9  HIS A ND1  5  
ATOM 3700  C CD2  . HIS A 1 9  ? -18.488 19.293 23.349 1.00 0.00 ? 9  HIS A CD2  5  
ATOM 3701  C CE1  . HIS A 1 9  ? -19.226 21.036 22.294 1.00 0.00 ? 9  HIS A CE1  5  
ATOM 3702  N NE2  . HIS A 1 9  ? -19.540 19.767 22.570 1.00 0.00 ? 9  HIS A NE2  5  
ATOM 3703  H H    . HIS A 1 9  ? -14.892 18.714 22.518 1.00 0.00 ? 9  HIS A H    5  
ATOM 3704  H HA   . HIS A 1 9  ? -15.338 21.664 22.859 1.00 0.00 ? 9  HIS A HA   5  
ATOM 3705  H HB2  . HIS A 1 9  ? -16.052 19.347 24.689 1.00 0.00 ? 9  HIS A HB2  5  
ATOM 3706  H HB3  . HIS A 1 9  ? -16.310 21.051 25.065 1.00 0.00 ? 9  HIS A HB3  5  
ATOM 3707  H HD1  . HIS A 1 9  ? -17.622 22.269 22.777 1.00 0.00 ? 9  HIS A HD1  5  
ATOM 3708  H HD2  . HIS A 1 9  ? -18.413 18.294 23.750 1.00 0.00 ? 9  HIS A HD2  5  
ATOM 3709  H HE1  . HIS A 1 9  ? -19.842 21.697 21.702 1.00 0.00 ? 9  HIS A HE1  5  
ATOM 3710  N N    . GLU A 1 10 ? -12.944 19.768 23.814 1.00 0.00 ? 10 GLU A N    5  
ATOM 3711  C CA   . GLU A 1 10 ? -11.622 19.753 24.504 1.00 0.00 ? 10 GLU A CA   5  
ATOM 3712  C C    . GLU A 1 10 ? -10.647 20.703 23.802 1.00 0.00 ? 10 GLU A C    5  
ATOM 3713  O O    . GLU A 1 10 ? -9.873  21.391 24.437 1.00 0.00 ? 10 GLU A O    5  
ATOM 3714  C CB   . GLU A 1 10 ? -11.139 18.305 24.410 1.00 0.00 ? 10 GLU A CB   5  
ATOM 3715  C CG   . GLU A 1 10 ? -10.745 17.988 22.968 1.00 0.00 ? 10 GLU A CG   5  
ATOM 3716  C CD   . GLU A 1 10 ? -10.639 16.472 22.790 1.00 0.00 ? 10 GLU A CD   5  
ATOM 3717  O OE1  . GLU A 1 10 ? -10.622 15.777 23.792 1.00 0.00 ? 10 GLU A OE1  5  
ATOM 3718  O OE2  . GLU A 1 10 ? -10.579 16.032 21.654 1.00 0.00 ? 10 GLU A OE2  5  
ATOM 3719  H H    . GLU A 1 10 ? -13.181 19.051 23.191 1.00 0.00 ? 10 GLU A H    5  
ATOM 3720  H HA   . GLU A 1 10 ? -11.739 20.035 25.539 1.00 0.00 ? 10 GLU A HA   5  
ATOM 3721  H HB2  . GLU A 1 10 ? -10.282 18.170 25.055 1.00 0.00 ? 10 GLU A HB2  5  
ATOM 3722  H HB3  . GLU A 1 10 ? -11.930 17.641 24.722 1.00 0.00 ? 10 GLU A HB3  5  
ATOM 3723  H HG2  . GLU A 1 10 ? -11.494 18.378 22.296 1.00 0.00 ? 10 GLU A HG2  5  
ATOM 3724  H HG3  . GLU A 1 10 ? -9.790  18.444 22.749 1.00 0.00 ? 10 GLU A HG3  5  
ATOM 3725  N N    . PHE A 1 11 ? -10.683 20.758 22.497 1.00 0.00 ? 11 PHE A N    5  
ATOM 3726  C CA   . PHE A 1 11 ? -9.761  21.678 21.768 1.00 0.00 ? 11 PHE A CA   5  
ATOM 3727  C C    . PHE A 1 11 ? -10.345 23.090 21.754 1.00 0.00 ? 11 PHE A C    5  
ATOM 3728  O O    . PHE A 1 11 ? -9.645  24.058 21.538 1.00 0.00 ? 11 PHE A O    5  
ATOM 3729  C CB   . PHE A 1 11 ? -9.680  21.134 20.344 1.00 0.00 ? 11 PHE A CB   5  
ATOM 3730  C CG   . PHE A 1 11 ? -8.710  19.976 20.287 1.00 0.00 ? 11 PHE A CG   5  
ATOM 3731  C CD1  . PHE A 1 11 ? -9.158  18.671 20.523 1.00 0.00 ? 11 PHE A CD1  5  
ATOM 3732  C CD2  . PHE A 1 11 ? -7.359  20.208 19.996 1.00 0.00 ? 11 PHE A CD2  5  
ATOM 3733  C CE1  . PHE A 1 11 ? -8.258  17.601 20.467 1.00 0.00 ? 11 PHE A CE1  5  
ATOM 3734  C CE2  . PHE A 1 11 ? -6.460  19.138 19.940 1.00 0.00 ? 11 PHE A CE2  5  
ATOM 3735  C CZ   . PHE A 1 11 ? -6.910  17.835 20.175 1.00 0.00 ? 11 PHE A CZ   5  
ATOM 3736  H H    . PHE A 1 11 ? -11.319 20.205 21.999 1.00 0.00 ? 11 PHE A H    5  
ATOM 3737  H HA   . PHE A 1 11 ? -8.784  21.675 22.223 1.00 0.00 ? 11 PHE A HA   5  
ATOM 3738  H HB2  . PHE A 1 11 ? -10.657 20.803 20.037 1.00 0.00 ? 11 PHE A HB2  5  
ATOM 3739  H HB3  . PHE A 1 11 ? -9.343  21.915 19.680 1.00 0.00 ? 11 PHE A HB3  5  
ATOM 3740  H HD1  . PHE A 1 11 ? -10.197 18.489 20.749 1.00 0.00 ? 11 PHE A HD1  5  
ATOM 3741  H HD2  . PHE A 1 11 ? -7.013  21.213 19.813 1.00 0.00 ? 11 PHE A HD2  5  
ATOM 3742  H HE1  . PHE A 1 11 ? -8.605  16.594 20.648 1.00 0.00 ? 11 PHE A HE1  5  
ATOM 3743  H HE2  . PHE A 1 11 ? -5.417  19.317 19.716 1.00 0.00 ? 11 PHE A HE2  5  
ATOM 3744  H HZ   . PHE A 1 11 ? -6.216  17.010 20.134 1.00 0.00 ? 11 PHE A HZ   5  
ATOM 3745  N N    . GLN A 1 12 ? -11.624 23.216 21.981 1.00 0.00 ? 12 GLN A N    5  
ATOM 3746  C CA   . GLN A 1 12 ? -12.240 24.571 21.982 1.00 0.00 ? 12 GLN A CA   5  
ATOM 3747  C C    . GLN A 1 12 ? -11.374 25.519 22.806 1.00 0.00 ? 12 GLN A C    5  
ATOM 3748  O O    . GLN A 1 12 ? -11.106 26.636 22.412 1.00 0.00 ? 12 GLN A O    5  
ATOM 3749  C CB   . GLN A 1 12 ? -13.611 24.391 22.632 1.00 0.00 ? 12 GLN A CB   5  
ATOM 3750  C CG   . GLN A 1 12 ? -14.370 25.719 22.591 1.00 0.00 ? 12 GLN A CG   5  
ATOM 3751  C CD   . GLN A 1 12 ? -15.698 25.571 23.335 1.00 0.00 ? 12 GLN A CD   5  
ATOM 3752  O OE1  . GLN A 1 12 ? -15.720 25.238 24.503 1.00 0.00 ? 12 GLN A OE1  5  
ATOM 3753  N NE2  . GLN A 1 12 ? -16.815 25.806 22.702 1.00 0.00 ? 12 GLN A NE2  5  
ATOM 3754  H H    . GLN A 1 12 ? -12.175 22.425 22.153 1.00 0.00 ? 12 GLN A H    5  
ATOM 3755  H HA   . GLN A 1 12 ? -12.352 24.939 20.973 1.00 0.00 ? 12 GLN A HA   5  
ATOM 3756  H HB2  . GLN A 1 12 ? -14.171 23.640 22.093 1.00 0.00 ? 12 GLN A HB2  5  
ATOM 3757  H HB3  . GLN A 1 12 ? -13.486 24.080 23.658 1.00 0.00 ? 12 GLN A HB3  5  
ATOM 3758  H HG2  . GLN A 1 12 ? -13.775 26.489 23.063 1.00 0.00 ? 12 GLN A HG2  5  
ATOM 3759  H HG3  . GLN A 1 12 ? -14.560 25.993 21.564 1.00 0.00 ? 12 GLN A HG3  5  
ATOM 3760  H HE21 . GLN A 1 12 ? -16.798 26.075 21.760 1.00 0.00 ? 12 GLN A HE21 5  
ATOM 3761  H HE22 . GLN A 1 12 ? -17.672 25.714 23.169 1.00 0.00 ? 12 GLN A HE22 5  
ATOM 3762  N N    . ALA A 1 13 ? -10.922 25.075 23.946 1.00 0.00 ? 13 ALA A N    5  
ATOM 3763  C CA   . ALA A 1 13 ? -10.060 25.945 24.792 1.00 0.00 ? 13 ALA A CA   5  
ATOM 3764  C C    . ALA A 1 13 ? -8.824  26.367 23.998 1.00 0.00 ? 13 ALA A C    5  
ATOM 3765  O O    . ALA A 1 13 ? -8.178  27.346 24.311 1.00 0.00 ? 13 ALA A O    5  
ATOM 3766  C CB   . ALA A 1 13 ? -9.662  25.074 25.984 1.00 0.00 ? 13 ALA A CB   5  
ATOM 3767  H H    . ALA A 1 13 ? -11.143 24.167 24.241 1.00 0.00 ? 13 ALA A H    5  
ATOM 3768  H HA   . ALA A 1 13 ? -10.609 26.810 25.130 1.00 0.00 ? 13 ALA A HA   5  
ATOM 3769  H HB1  . ALA A 1 13 ? -8.879  25.565 26.542 1.00 0.00 ? 13 ALA A HB1  5  
ATOM 3770  H HB2  . ALA A 1 13 ? -9.305  24.118 25.629 1.00 0.00 ? 13 ALA A HB2  5  
ATOM 3771  H HB3  . ALA A 1 13 ? -10.519 24.923 26.623 1.00 0.00 ? 13 ALA A HB3  5  
ATOM 3772  N N    . PHE A 1 14 ? -8.492  25.636 22.967 1.00 0.00 ? 14 PHE A N    5  
ATOM 3773  C CA   . PHE A 1 14 ? -7.302  25.998 22.155 1.00 0.00 ? 14 PHE A CA   5  
ATOM 3774  C C    . PHE A 1 14 ? -7.707  26.933 21.013 1.00 0.00 ? 14 PHE A C    5  
ATOM 3775  O O    . PHE A 1 14 ? -6.991  27.093 20.045 1.00 0.00 ? 14 PHE A O    5  
ATOM 3776  C CB   . PHE A 1 14 ? -6.786  24.672 21.602 1.00 0.00 ? 14 PHE A CB   5  
ATOM 3777  C CG   . PHE A 1 14 ? -6.582  23.688 22.732 1.00 0.00 ? 14 PHE A CG   5  
ATOM 3778  C CD1  . PHE A 1 14 ? -6.430  24.142 24.048 1.00 0.00 ? 14 PHE A CD1  5  
ATOM 3779  C CD2  . PHE A 1 14 ? -6.545  22.317 22.458 1.00 0.00 ? 14 PHE A CD2  5  
ATOM 3780  C CE1  . PHE A 1 14 ? -6.241  23.223 25.088 1.00 0.00 ? 14 PHE A CE1  5  
ATOM 3781  C CE2  . PHE A 1 14 ? -6.356  21.399 23.496 1.00 0.00 ? 14 PHE A CE2  5  
ATOM 3782  C CZ   . PHE A 1 14 ? -6.204  21.852 24.811 1.00 0.00 ? 14 PHE A CZ   5  
ATOM 3783  H H    . PHE A 1 14 ? -9.027  24.847 22.726 1.00 0.00 ? 14 PHE A H    5  
ATOM 3784  H HA   . PHE A 1 14 ? -6.549  26.457 22.775 1.00 0.00 ? 14 PHE A HA   5  
ATOM 3785  H HB2  . PHE A 1 14 ? -7.505  24.271 20.904 1.00 0.00 ? 14 PHE A HB2  5  
ATOM 3786  H HB3  . PHE A 1 14 ? -5.849  24.835 21.097 1.00 0.00 ? 14 PHE A HB3  5  
ATOM 3787  H HD1  . PHE A 1 14 ? -6.458  25.201 24.261 1.00 0.00 ? 14 PHE A HD1  5  
ATOM 3788  H HD2  . PHE A 1 14 ? -6.661  21.969 21.445 1.00 0.00 ? 14 PHE A HD2  5  
ATOM 3789  H HE1  . PHE A 1 14 ? -6.123  23.573 26.102 1.00 0.00 ? 14 PHE A HE1  5  
ATOM 3790  H HE2  . PHE A 1 14 ? -6.329  20.341 23.280 1.00 0.00 ? 14 PHE A HE2  5  
ATOM 3791  H HZ   . PHE A 1 14 ? -6.060  21.142 25.613 1.00 0.00 ? 14 PHE A HZ   5  
ATOM 3792  N N    . MET A 1 15 ? -8.856  27.547 21.114 1.00 0.00 ? 15 MET A N    5  
ATOM 3793  C CA   . MET A 1 15 ? -9.308  28.463 20.033 1.00 0.00 ? 15 MET A CA   5  
ATOM 3794  C C    . MET A 1 15 ? -9.047  29.922 20.422 1.00 0.00 ? 15 MET A C    5  
ATOM 3795  O O    . MET A 1 15 ? -9.575  30.423 21.395 1.00 0.00 ? 15 MET A O    5  
ATOM 3796  C CB   . MET A 1 15 ? -10.806 28.192 19.902 1.00 0.00 ? 15 MET A CB   5  
ATOM 3797  C CG   . MET A 1 15 ? -11.557 28.837 21.069 1.00 0.00 ? 15 MET A CG   5  
ATOM 3798  S SD   . MET A 1 15 ? -13.200 28.092 21.214 1.00 0.00 ? 15 MET A SD   5  
ATOM 3799  C CE   . MET A 1 15 ? -14.017 29.496 22.013 1.00 0.00 ? 15 MET A CE   5  
ATOM 3800  H H    . MET A 1 15 ? -9.425  27.401 21.896 1.00 0.00 ? 15 MET A H    5  
ATOM 3801  H HA   . MET A 1 15 ? -8.810  28.226 19.107 1.00 0.00 ? 15 MET A HA   5  
ATOM 3802  H HB2  . MET A 1 15 ? -11.162 28.605 18.976 1.00 0.00 ? 15 MET A HB2  5  
ATOM 3803  H HB3  . MET A 1 15 ? -10.980 27.125 19.909 1.00 0.00 ? 15 MET A HB3  5  
ATOM 3804  H HG2  . MET A 1 15 ? -11.008 28.678 21.984 1.00 0.00 ? 15 MET A HG2  5  
ATOM 3805  H HG3  . MET A 1 15 ? -11.658 29.897 20.890 1.00 0.00 ? 15 MET A HG3  5  
ATOM 3806  H HE1  . MET A 1 15 ? -13.905 30.375 21.394 1.00 0.00 ? 15 MET A HE1  5  
ATOM 3807  H HE2  . MET A 1 15 ? -15.066 29.279 22.140 1.00 0.00 ? 15 MET A HE2  5  
ATOM 3808  H HE3  . MET A 1 15 ? -13.567 29.669 22.982 1.00 0.00 ? 15 MET A HE3  5  
ATOM 3809  N N    . LYS A 1 16 ? -8.235  30.609 19.665 1.00 0.00 ? 16 LYS A N    5  
ATOM 3810  C CA   . LYS A 1 16 ? -7.943  32.035 19.985 1.00 0.00 ? 16 LYS A CA   5  
ATOM 3811  C C    . LYS A 1 16 ? -8.844  32.952 19.154 1.00 0.00 ? 16 LYS A C    5  
ATOM 3812  O O    . LYS A 1 16 ? -8.441  33.475 18.133 1.00 0.00 ? 16 LYS A O    5  
ATOM 3813  C CB   . LYS A 1 16 ? -6.476  32.238 19.605 1.00 0.00 ? 16 LYS A CB   5  
ATOM 3814  C CG   . LYS A 1 16 ? -6.049  33.664 19.959 1.00 0.00 ? 16 LYS A CG   5  
ATOM 3815  C CD   . LYS A 1 16 ? -6.020  33.825 21.480 1.00 0.00 ? 16 LYS A CD   5  
ATOM 3816  C CE   . LYS A 1 16 ? -4.814  33.074 22.049 1.00 0.00 ? 16 LYS A CE   5  
ATOM 3817  N NZ   . LYS A 1 16 ? -4.729  33.511 23.471 1.00 0.00 ? 16 LYS A NZ   5  
ATOM 3818  H H    . LYS A 1 16 ? -7.820  30.189 18.884 1.00 0.00 ? 16 LYS A H    5  
ATOM 3819  H HA   . LYS A 1 16 ? -8.082  32.223 21.039 1.00 0.00 ? 16 LYS A HA   5  
ATOM 3820  H HB2  . LYS A 1 16 ? -5.862  31.535 20.146 1.00 0.00 ? 16 LYS A HB2  5  
ATOM 3821  H HB3  . LYS A 1 16 ? -6.354  32.079 18.543 1.00 0.00 ? 16 LYS A HB3  5  
ATOM 3822  H HG2  . LYS A 1 16 ? -5.065  33.856 19.557 1.00 0.00 ? 16 LYS A HG2  5  
ATOM 3823  H HG3  . LYS A 1 16 ? -6.753  34.366 19.536 1.00 0.00 ? 16 LYS A HG3  5  
ATOM 3824  H HD2  . LYS A 1 16 ? -5.943  34.872 21.730 1.00 0.00 ? 16 LYS A HD2  5  
ATOM 3825  H HD3  . LYS A 1 16 ? -6.928  33.419 21.903 1.00 0.00 ? 16 LYS A HD3  5  
ATOM 3826  H HE2  . LYS A 1 16 ? -4.974  32.008 21.992 1.00 0.00 ? 16 LYS A HE2  5  
ATOM 3827  H HE3  . LYS A 1 16 ? -3.916  33.349 21.516 1.00 0.00 ? 16 LYS A HE3  5  
ATOM 3828  H HZ1  . LYS A 1 16 ? -5.101  34.479 23.559 1.00 0.00 ? 16 LYS A HZ1  5  
ATOM 3829  H HZ2  . LYS A 1 16 ? -5.289  32.869 24.066 1.00 0.00 ? 16 LYS A HZ2  5  
ATOM 3830  H HZ3  . LYS A 1 16 ? -3.738  33.492 23.781 1.00 0.00 ? 16 LYS A HZ3  5  
ATOM 3831  N N    . ASN A 1 17 ? -10.062 33.148 19.580 1.00 0.00 ? 17 ASN A N    5  
ATOM 3832  C CA   . ASN A 1 17 ? -10.990 34.026 18.811 1.00 0.00 ? 17 ASN A CA   5  
ATOM 3833  C C    . ASN A 1 17 ? -11.323 33.384 17.463 1.00 0.00 ? 17 ASN A C    5  
ATOM 3834  O O    . ASN A 1 17 ? -11.179 33.992 16.422 1.00 0.00 ? 17 ASN A O    5  
ATOM 3835  C CB   . ASN A 1 17 ? -10.226 35.336 18.611 1.00 0.00 ? 17 ASN A CB   5  
ATOM 3836  C CG   . ASN A 1 17 ? -11.217 36.465 18.318 1.00 0.00 ? 17 ASN A CG   5  
ATOM 3837  O OD1  . ASN A 1 17 ? -12.021 36.364 17.413 1.00 0.00 ? 17 ASN A OD1  5  
ATOM 3838  N ND2  . ASN A 1 17 ? -11.192 37.543 19.053 1.00 0.00 ? 17 ASN A ND2  5  
ATOM 3839  H H    . ASN A 1 17 ? -10.367 32.714 20.404 1.00 0.00 ? 17 ASN A H    5  
ATOM 3840  H HA   . ASN A 1 17 ? -11.891 34.205 19.375 1.00 0.00 ? 17 ASN A HA   5  
ATOM 3841  H HB2  . ASN A 1 17 ? -9.671  35.570 19.507 1.00 0.00 ? 17 ASN A HB2  5  
ATOM 3842  H HB3  . ASN A 1 17 ? -9.544  35.232 17.780 1.00 0.00 ? 17 ASN A HB3  5  
ATOM 3843  H HD21 . ASN A 1 17 ? -10.544 37.624 19.782 1.00 0.00 ? 17 ASN A HD21 5  
ATOM 3844  H HD22 . ASN A 1 17 ? -11.822 38.272 18.874 1.00 0.00 ? 17 ASN A HD22 5  
ATOM 3845  N N    . GLY A 1 18 ? -11.769 32.159 17.476 1.00 0.00 ? 18 GLY A N    5  
ATOM 3846  C CA   . GLY A 1 18 ? -12.115 31.475 16.199 1.00 0.00 ? 18 GLY A CA   5  
ATOM 3847  C C    . GLY A 1 18 ? -10.862 30.817 15.612 1.00 0.00 ? 18 GLY A C    5  
ATOM 3848  O O    . GLY A 1 18 ? -10.945 29.965 14.749 1.00 0.00 ? 18 GLY A O    5  
ATOM 3849  H H    . GLY A 1 18 ? -11.879 31.688 18.329 1.00 0.00 ? 18 GLY A H    5  
ATOM 3850  H HA2  . GLY A 1 18 ? -12.863 30.718 16.386 1.00 0.00 ? 18 GLY A HA2  5  
ATOM 3851  H HA3  . GLY A 1 18 ? -12.503 32.198 15.497 1.00 0.00 ? 18 GLY A HA3  5  
ATOM 3852  N N    . LYS A 1 19 ? -9.704  31.203 16.070 1.00 0.00 ? 19 LYS A N    5  
ATOM 3853  C CA   . LYS A 1 19 ? -8.451  30.597 15.534 1.00 0.00 ? 19 LYS A CA   5  
ATOM 3854  C C    . LYS A 1 19 ? -8.020  29.410 16.399 1.00 0.00 ? 19 LYS A C    5  
ATOM 3855  O O    . LYS A 1 19 ? -7.495  29.576 17.481 1.00 0.00 ? 19 LYS A O    5  
ATOM 3856  C CB   . LYS A 1 19 ? -7.409  31.713 15.599 1.00 0.00 ? 19 LYS A CB   5  
ATOM 3857  C CG   . LYS A 1 19 ? -6.325  31.459 14.551 1.00 0.00 ? 19 LYS A CG   5  
ATOM 3858  C CD   . LYS A 1 19 ? -5.521  30.213 14.934 1.00 0.00 ? 19 LYS A CD   5  
ATOM 3859  C CE   . LYS A 1 19 ? -4.359  30.037 13.956 1.00 0.00 ? 19 LYS A CE   5  
ATOM 3860  N NZ   . LYS A 1 19 ? -3.644  28.817 14.429 1.00 0.00 ? 19 LYS A NZ   5  
ATOM 3861  H H    . LYS A 1 19 ? -9.655  31.892 16.766 1.00 0.00 ? 19 LYS A H    5  
ATOM 3862  H HA   . LYS A 1 19 ? -8.592  30.285 14.511 1.00 0.00 ? 19 LYS A HA   5  
ATOM 3863  H HB2  . LYS A 1 19 ? -7.886  32.662 15.401 1.00 0.00 ? 19 LYS A HB2  5  
ATOM 3864  H HB3  . LYS A 1 19 ? -6.963  31.733 16.582 1.00 0.00 ? 19 LYS A HB3  5  
ATOM 3865  H HG2  . LYS A 1 19 ? -6.785  31.306 13.586 1.00 0.00 ? 19 LYS A HG2  5  
ATOM 3866  H HG3  . LYS A 1 19 ? -5.663  32.311 14.502 1.00 0.00 ? 19 LYS A HG3  5  
ATOM 3867  H HD2  . LYS A 1 19 ? -5.135  30.327 15.936 1.00 0.00 ? 19 LYS A HD2  5  
ATOM 3868  H HD3  . LYS A 1 19 ? -6.162  29.343 14.893 1.00 0.00 ? 19 LYS A HD3  5  
ATOM 3869  H HE2  . LYS A 1 19 ? -4.730  29.889 12.953 1.00 0.00 ? 19 LYS A HE2  5  
ATOM 3870  H HE3  . LYS A 1 19 ? -3.703  30.894 13.993 1.00 0.00 ? 19 LYS A HE3  5  
ATOM 3871  H HZ1  . LYS A 1 19 ? -4.337  28.127 14.785 1.00 0.00 ? 19 LYS A HZ1  5  
ATOM 3872  H HZ2  . LYS A 1 19 ? -3.111  28.400 13.639 1.00 0.00 ? 19 LYS A HZ2  5  
ATOM 3873  H HZ3  . LYS A 1 19 ? -2.986  29.074 15.191 1.00 0.00 ? 19 LYS A HZ3  5  
ATOM 3874  N N    . LEU A 1 20 ? -8.237  28.214 15.928 1.00 0.00 ? 20 LEU A N    5  
ATOM 3875  C CA   . LEU A 1 20 ? -7.840  27.016 16.722 1.00 0.00 ? 20 LEU A CA   5  
ATOM 3876  C C    . LEU A 1 20 ? -6.349  26.721 16.530 1.00 0.00 ? 20 LEU A C    5  
ATOM 3877  O O    . LEU A 1 20 ? -5.913  26.361 15.456 1.00 0.00 ? 20 LEU A O    5  
ATOM 3878  C CB   . LEU A 1 20 ? -8.688  25.874 16.157 1.00 0.00 ? 20 LEU A CB   5  
ATOM 3879  C CG   . LEU A 1 20 ? -8.851  24.783 17.217 1.00 0.00 ? 20 LEU A CG   5  
ATOM 3880  C CD1  . LEU A 1 20 ? -9.690  23.639 16.643 1.00 0.00 ? 20 LEU A CD1  5  
ATOM 3881  C CD2  . LEU A 1 20 ? -7.474  24.253 17.621 1.00 0.00 ? 20 LEU A CD2  5  
ATOM 3882  H H    . LEU A 1 20 ? -8.660  28.102 15.051 1.00 0.00 ? 20 LEU A H    5  
ATOM 3883  H HA   . LEU A 1 20 ? -8.066  27.161 17.765 1.00 0.00 ? 20 LEU A HA   5  
ATOM 3884  H HB2  . LEU A 1 20 ? -9.659  26.253 15.878 1.00 0.00 ? 20 LEU A HB2  5  
ATOM 3885  H HB3  . LEU A 1 20 ? -8.199  25.461 15.287 1.00 0.00 ? 20 LEU A HB3  5  
ATOM 3886  H HG   . LEU A 1 20 ? -9.347  25.194 18.084 1.00 0.00 ? 20 LEU A HG   5  
ATOM 3887  H HD11 . LEU A 1 20 ? -10.557 24.044 16.143 1.00 0.00 ? 20 LEU A HD11 5  
ATOM 3888  H HD12 . LEU A 1 20 ? -9.098  23.075 15.938 1.00 0.00 ? 20 LEU A HD12 5  
ATOM 3889  H HD13 . LEU A 1 20 ? -10.009 22.989 17.445 1.00 0.00 ? 20 LEU A HD13 5  
ATOM 3890  H HD21 . LEU A 1 20 ? -6.949  23.907 16.743 1.00 0.00 ? 20 LEU A HD21 5  
ATOM 3891  H HD22 . LEU A 1 20 ? -6.907  25.043 18.091 1.00 0.00 ? 20 LEU A HD22 5  
ATOM 3892  H HD23 . LEU A 1 20 ? -7.593  23.433 18.315 1.00 0.00 ? 20 LEU A HD23 5  
ATOM 3893  N N    . PHE A 1 21 ? -5.566  26.863 17.565 1.00 0.00 ? 21 PHE A N    5  
ATOM 3894  C CA   . PHE A 1 21 ? -4.105  26.577 17.428 1.00 0.00 ? 21 PHE A CA   5  
ATOM 3895  C C    . PHE A 1 21 ? -3.800  25.163 17.928 1.00 0.00 ? 21 PHE A C    5  
ATOM 3896  O O    . PHE A 1 21 ? -3.181  24.971 18.957 1.00 0.00 ? 21 PHE A O    5  
ATOM 3897  C CB   . PHE A 1 21 ? -3.375  27.629 18.277 1.00 0.00 ? 21 PHE A CB   5  
ATOM 3898  C CG   . PHE A 1 21 ? -4.105  27.871 19.578 1.00 0.00 ? 21 PHE A CG   5  
ATOM 3899  C CD1  . PHE A 1 21 ? -3.847  27.062 20.690 1.00 0.00 ? 21 PHE A CD1  5  
ATOM 3900  C CD2  . PHE A 1 21 ? -5.034  28.915 19.672 1.00 0.00 ? 21 PHE A CD2  5  
ATOM 3901  C CE1  . PHE A 1 21 ? -4.518  27.295 21.897 1.00 0.00 ? 21 PHE A CE1  5  
ATOM 3902  C CE2  . PHE A 1 21 ? -5.706  29.148 20.879 1.00 0.00 ? 21 PHE A CE2  5  
ATOM 3903  C CZ   . PHE A 1 21 ? -5.447  28.339 21.990 1.00 0.00 ? 21 PHE A CZ   5  
ATOM 3904  H H    . PHE A 1 21 ? -5.937  27.146 18.425 1.00 0.00 ? 21 PHE A H    5  
ATOM 3905  H HA   . PHE A 1 21 ? -3.807  26.674 16.396 1.00 0.00 ? 21 PHE A HA   5  
ATOM 3906  H HB2  . PHE A 1 21 ? -2.375  27.280 18.491 1.00 0.00 ? 21 PHE A HB2  5  
ATOM 3907  H HB3  . PHE A 1 21 ? -3.318  28.555 17.724 1.00 0.00 ? 21 PHE A HB3  5  
ATOM 3908  H HD1  . PHE A 1 21 ? -3.131  26.256 20.618 1.00 0.00 ? 21 PHE A HD1  5  
ATOM 3909  H HD2  . PHE A 1 21 ? -5.234  29.539 18.814 1.00 0.00 ? 21 PHE A HD2  5  
ATOM 3910  H HE1  . PHE A 1 21 ? -4.319  26.671 22.755 1.00 0.00 ? 21 PHE A HE1  5  
ATOM 3911  H HE2  . PHE A 1 21 ? -6.424  29.952 20.951 1.00 0.00 ? 21 PHE A HE2  5  
ATOM 3912  H HZ   . PHE A 1 21 ? -5.965  28.519 22.921 1.00 0.00 ? 21 PHE A HZ   5  
ATOM 3913  N N    . CYS A 1 22 ? -4.233  24.170 17.198 1.00 0.00 ? 22 CYS A N    5  
ATOM 3914  C CA   . CYS A 1 22 ? -3.978  22.759 17.611 1.00 0.00 ? 22 CYS A CA   5  
ATOM 3915  C C    . CYS A 1 22 ? -2.501  22.544 17.979 1.00 0.00 ? 22 CYS A C    5  
ATOM 3916  O O    . CYS A 1 22 ? -2.209  21.977 19.012 1.00 0.00 ? 22 CYS A O    5  
ATOM 3917  C CB   . CYS A 1 22 ? -4.353  21.913 16.393 1.00 0.00 ? 22 CYS A CB   5  
ATOM 3918  S SG   . CYS A 1 22 ? -5.373  20.514 16.921 1.00 0.00 ? 22 CYS A SG   5  
ATOM 3919  H H    . CYS A 1 22 ? -4.727  24.355 16.372 1.00 0.00 ? 22 CYS A H    5  
ATOM 3920  H HA   . CYS A 1 22 ? -4.610  22.496 18.443 1.00 0.00 ? 22 CYS A HA   5  
ATOM 3921  H HB2  . CYS A 1 22 ? -4.905  22.518 15.690 1.00 0.00 ? 22 CYS A HB2  5  
ATOM 3922  H HB3  . CYS A 1 22 ? -3.454  21.543 15.922 1.00 0.00 ? 22 CYS A HB3  5  
ATOM 3923  N N    . PRO A 1 23 ? -1.609  22.987 17.122 1.00 0.00 ? 23 PRO A N    5  
ATOM 3924  C CA   . PRO A 1 23 ? -0.161  22.810 17.383 1.00 0.00 ? 23 PRO A CA   5  
ATOM 3925  C C    . PRO A 1 23 ? 0.257   23.554 18.654 1.00 0.00 ? 23 PRO A C    5  
ATOM 3926  O O    . PRO A 1 23 ? 0.763   24.658 18.603 1.00 0.00 ? 23 PRO A O    5  
ATOM 3927  C CB   . PRO A 1 23 ? 0.486   23.421 16.137 1.00 0.00 ? 23 PRO A CB   5  
ATOM 3928  C CG   . PRO A 1 23 ? -0.628  23.923 15.197 1.00 0.00 ? 23 PRO A CG   5  
ATOM 3929  C CD   . PRO A 1 23 ? -1.987  23.680 15.865 1.00 0.00 ? 23 PRO A CD   5  
ATOM 3930  H HA   . PRO A 1 23 ? 0.090   21.764 17.453 1.00 0.00 ? 23 PRO A HA   5  
ATOM 3931  H HB2  . PRO A 1 23 ? 1.117   24.248 16.426 1.00 0.00 ? 23 PRO A HB2  5  
ATOM 3932  H HB3  . PRO A 1 23 ? 1.077   22.673 15.631 1.00 0.00 ? 23 PRO A HB3  5  
ATOM 3933  H HG2  . PRO A 1 23 ? -0.497  24.980 15.014 1.00 0.00 ? 23 PRO A HG2  5  
ATOM 3934  H HG3  . PRO A 1 23 ? -0.582  23.385 14.263 1.00 0.00 ? 23 PRO A HG3  5  
ATOM 3935  H HD2  . PRO A 1 23 ? -2.474  24.620 16.075 1.00 0.00 ? 23 PRO A HD2  5  
ATOM 3936  H HD3  . PRO A 1 23 ? -2.611  23.052 15.249 1.00 0.00 ? 23 PRO A HD3  5  
ATOM 3937  N N    . GLN A 1 24 ? 0.053   22.950 19.791 1.00 0.00 ? 24 GLN A N    5  
ATOM 3938  C CA   . GLN A 1 24 ? 0.440   23.608 21.072 1.00 0.00 ? 24 GLN A CA   5  
ATOM 3939  C C    . GLN A 1 24 ? 1.355   22.682 21.872 1.00 0.00 ? 24 GLN A C    5  
ATOM 3940  O O    . GLN A 1 24 ? 2.555   22.866 21.926 1.00 0.00 ? 24 GLN A O    5  
ATOM 3941  C CB   . GLN A 1 24 ? -0.879  23.834 21.814 1.00 0.00 ? 24 GLN A CB   5  
ATOM 3942  C CG   . GLN A 1 24 ? -0.599  24.139 23.288 1.00 0.00 ? 24 GLN A CG   5  
ATOM 3943  C CD   . GLN A 1 24 ? -1.902  24.050 24.083 1.00 0.00 ? 24 GLN A CD   5  
ATOM 3944  O OE1  . GLN A 1 24 ? -2.542  25.050 24.340 1.00 0.00 ? 24 GLN A OE1  5  
ATOM 3945  N NE2  . GLN A 1 24 ? -2.327  22.882 24.484 1.00 0.00 ? 24 GLN A NE2  5  
ATOM 3946  H H    . GLN A 1 24 ? -0.353  22.059 19.804 1.00 0.00 ? 24 GLN A H    5  
ATOM 3947  H HA   . GLN A 1 24 ? 0.924   24.550 20.885 1.00 0.00 ? 24 GLN A HA   5  
ATOM 3948  H HB2  . GLN A 1 24 ? -1.405  24.665 21.368 1.00 0.00 ? 24 GLN A HB2  5  
ATOM 3949  H HB3  . GLN A 1 24 ? -1.488  22.945 21.742 1.00 0.00 ? 24 GLN A HB3  5  
ATOM 3950  H HG2  . GLN A 1 24 ? 0.108   23.424 23.679 1.00 0.00 ? 24 GLN A HG2  5  
ATOM 3951  H HG3  . GLN A 1 24 ? -0.189  25.135 23.378 1.00 0.00 ? 24 GLN A HG3  5  
ATOM 3952  H HE21 . GLN A 1 24 ? -1.811  22.075 24.273 1.00 0.00 ? 24 GLN A HE21 5  
ATOM 3953  H HE22 . GLN A 1 24 ? -3.161  22.813 24.993 1.00 0.00 ? 24 GLN A HE22 5  
ATOM 3954  N N    . ASP A 1 25 ? 0.793   21.683 22.491 1.00 0.00 ? 25 ASP A N    5  
ATOM 3955  C CA   . ASP A 1 25 ? 1.619   20.734 23.289 1.00 0.00 ? 25 ASP A CA   5  
ATOM 3956  C C    . ASP A 1 25 ? 1.180   19.294 23.004 1.00 0.00 ? 25 ASP A C    5  
ATOM 3957  O O    . ASP A 1 25 ? 0.473   18.685 23.782 1.00 0.00 ? 25 ASP A O    5  
ATOM 3958  C CB   . ASP A 1 25 ? 1.347   21.102 24.747 1.00 0.00 ? 25 ASP A CB   5  
ATOM 3959  C CG   . ASP A 1 25 ? 2.499   20.606 25.623 1.00 0.00 ? 25 ASP A CG   5  
ATOM 3960  O OD1  . ASP A 1 25 ? 3.314   19.848 25.121 1.00 0.00 ? 25 ASP A OD1  5  
ATOM 3961  O OD2  . ASP A 1 25 ? 2.549   20.993 26.778 1.00 0.00 ? 25 ASP A OD2  5  
ATOM 3962  H H    . ASP A 1 25 ? -0.176  21.556 22.430 1.00 0.00 ? 25 ASP A H    5  
ATOM 3963  H HA   . ASP A 1 25 ? 2.665   20.863 23.064 1.00 0.00 ? 25 ASP A HA   5  
ATOM 3964  H HB2  . ASP A 1 25 ? 1.262   22.176 24.838 1.00 0.00 ? 25 ASP A HB2  5  
ATOM 3965  H HB3  . ASP A 1 25 ? 0.426   20.640 25.069 1.00 0.00 ? 25 ASP A HB3  5  
ATOM 3966  N N    . LYS A 1 26 ? 1.593   18.747 21.893 1.00 0.00 ? 26 LYS A N    5  
ATOM 3967  C CA   . LYS A 1 26 ? 1.198   17.349 21.554 1.00 0.00 ? 26 LYS A CA   5  
ATOM 3968  C C    . LYS A 1 26 ? 1.873   16.349 22.500 1.00 0.00 ? 26 LYS A C    5  
ATOM 3969  O O    . LYS A 1 26 ? 1.641   15.158 22.421 1.00 0.00 ? 26 LYS A O    5  
ATOM 3970  C CB   . LYS A 1 26 ? 1.682   17.140 20.120 1.00 0.00 ? 26 LYS A CB   5  
ATOM 3971  C CG   . LYS A 1 26 ? 0.586   17.566 19.140 1.00 0.00 ? 26 LYS A CG   5  
ATOM 3972  C CD   . LYS A 1 26 ? 1.179   17.688 17.735 1.00 0.00 ? 26 LYS A CD   5  
ATOM 3973  C CE   . LYS A 1 26 ? 0.386   18.722 16.934 1.00 0.00 ? 26 LYS A CE   5  
ATOM 3974  N NZ   . LYS A 1 26 ? 0.985   18.690 15.570 1.00 0.00 ? 26 LYS A NZ   5  
ATOM 3975  H H    . LYS A 1 26 ? 2.160   19.259 21.277 1.00 0.00 ? 26 LYS A H    5  
ATOM 3976  H HA   . LYS A 1 26 ? 0.126   17.242 21.596 1.00 0.00 ? 26 LYS A HA   5  
ATOM 3977  H HB2  . LYS A 1 26 ? 2.568   17.734 19.949 1.00 0.00 ? 26 LYS A HB2  5  
ATOM 3978  H HB3  . LYS A 1 26 ? 1.916   16.096 19.967 1.00 0.00 ? 26 LYS A HB3  5  
ATOM 3979  H HG2  . LYS A 1 26 ? -0.201  16.826 19.135 1.00 0.00 ? 26 LYS A HG2  5  
ATOM 3980  H HG3  . LYS A 1 26 ? 0.181   18.520 19.445 1.00 0.00 ? 26 LYS A HG3  5  
ATOM 3981  H HD2  . LYS A 1 26 ? 2.210   18.001 17.806 1.00 0.00 ? 26 LYS A HD2  5  
ATOM 3982  H HD3  . LYS A 1 26 ? 1.127   16.731 17.238 1.00 0.00 ? 26 LYS A HD3  5  
ATOM 3983  H HE2  . LYS A 1 26 ? -0.658  18.446 16.893 1.00 0.00 ? 26 LYS A HE2  5  
ATOM 3984  H HE3  . LYS A 1 26 ? 0.499   19.703 17.371 1.00 0.00 ? 26 LYS A HE3  5  
ATOM 3985  H HZ1  . LYS A 1 26 ? 2.008   18.871 15.637 1.00 0.00 ? 26 LYS A HZ1  5  
ATOM 3986  H HZ2  . LYS A 1 26 ? 0.825   17.755 15.142 1.00 0.00 ? 26 LYS A HZ2  5  
ATOM 3987  H HZ3  . LYS A 1 26 ? 0.542   19.419 14.978 1.00 0.00 ? 26 LYS A HZ3  5  
ATOM 3988  N N    . LYS A 1 27 ? 2.702   16.819 23.395 1.00 0.00 ? 27 LYS A N    5  
ATOM 3989  C CA   . LYS A 1 27 ? 3.386   15.892 24.344 1.00 0.00 ? 27 LYS A CA   5  
ATOM 3990  C C    . LYS A 1 27 ? 2.408   14.821 24.840 1.00 0.00 ? 27 LYS A C    5  
ATOM 3991  O O    . LYS A 1 27 ? 2.797   13.726 25.195 1.00 0.00 ? 27 LYS A O    5  
ATOM 3992  C CB   . LYS A 1 27 ? 3.837   16.782 25.502 1.00 0.00 ? 27 LYS A CB   5  
ATOM 3993  C CG   . LYS A 1 27 ? 5.154   17.468 25.137 1.00 0.00 ? 27 LYS A CG   5  
ATOM 3994  C CD   . LYS A 1 27 ? 5.574   18.402 26.275 1.00 0.00 ? 27 LYS A CD   5  
ATOM 3995  C CE   . LYS A 1 27 ? 6.573   19.433 25.748 1.00 0.00 ? 27 LYS A CE   5  
ATOM 3996  N NZ   . LYS A 1 27 ? 6.850   20.324 26.911 1.00 0.00 ? 27 LYS A NZ   5  
ATOM 3997  H H    . LYS A 1 27 ? 2.878   17.779 23.444 1.00 0.00 ? 27 LYS A H    5  
ATOM 3998  H HA   . LYS A 1 27 ? 4.243   15.434 23.876 1.00 0.00 ? 27 LYS A HA   5  
ATOM 3999  H HB2  . LYS A 1 27 ? 3.082   17.531 25.694 1.00 0.00 ? 27 LYS A HB2  5  
ATOM 4000  H HB3  . LYS A 1 27 ? 3.978   16.179 26.385 1.00 0.00 ? 27 LYS A HB3  5  
ATOM 4001  H HG2  . LYS A 1 27 ? 5.919   16.722 24.982 1.00 0.00 ? 27 LYS A HG2  5  
ATOM 4002  H HG3  . LYS A 1 27 ? 5.023   18.042 24.232 1.00 0.00 ? 27 LYS A HG3  5  
ATOM 4003  H HD2  . LYS A 1 27 ? 4.703   18.909 26.663 1.00 0.00 ? 27 LYS A HD2  5  
ATOM 4004  H HD3  . LYS A 1 27 ? 6.033   17.824 27.063 1.00 0.00 ? 27 LYS A HD3  5  
ATOM 4005  H HE2  . LYS A 1 27 ? 7.481   18.946 25.424 1.00 0.00 ? 27 LYS A HE2  5  
ATOM 4006  H HE3  . LYS A 1 27 ? 6.138   19.999 24.937 1.00 0.00 ? 27 LYS A HE3  5  
ATOM 4007  H HZ1  . LYS A 1 27 ? 5.958   20.539 27.403 1.00 0.00 ? 27 LYS A HZ1  5  
ATOM 4008  H HZ2  . LYS A 1 27 ? 7.501   19.848 27.566 1.00 0.00 ? 27 LYS A HZ2  5  
ATOM 4009  H HZ3  . LYS A 1 27 ? 7.282   21.208 26.577 1.00 0.00 ? 27 LYS A HZ3  5  
ATOM 4010  N N    . PHE A 1 28 ? 1.141   15.131 24.864 1.00 0.00 ? 28 PHE A N    5  
ATOM 4011  C CA   . PHE A 1 28 ? 0.132   14.138 25.331 1.00 0.00 ? 28 PHE A CA   5  
ATOM 4012  C C    . PHE A 1 28 ? 0.354   12.783 24.647 1.00 0.00 ? 28 PHE A C    5  
ATOM 4013  O O    . PHE A 1 28 ? -0.073  11.755 25.134 1.00 0.00 ? 28 PHE A O    5  
ATOM 4014  C CB   . PHE A 1 28 ? -1.214  14.738 24.926 1.00 0.00 ? 28 PHE A CB   5  
ATOM 4015  C CG   . PHE A 1 28 ? -1.320  16.144 25.471 1.00 0.00 ? 28 PHE A CG   5  
ATOM 4016  C CD1  . PHE A 1 28 ? -1.120  16.381 26.835 1.00 0.00 ? 28 PHE A CD1  5  
ATOM 4017  C CD2  . PHE A 1 28 ? -1.618  17.208 24.611 1.00 0.00 ? 28 PHE A CD2  5  
ATOM 4018  C CE1  . PHE A 1 28 ? -1.217  17.682 27.341 1.00 0.00 ? 28 PHE A CE1  5  
ATOM 4019  C CE2  . PHE A 1 28 ? -1.716  18.510 25.118 1.00 0.00 ? 28 PHE A CE2  5  
ATOM 4020  C CZ   . PHE A 1 28 ? -1.515  18.747 26.482 1.00 0.00 ? 28 PHE A CZ   5  
ATOM 4021  H H    . PHE A 1 28 ? 0.850   16.020 24.571 1.00 0.00 ? 28 PHE A H    5  
ATOM 4022  H HA   . PHE A 1 28 ? 0.177   14.029 26.403 1.00 0.00 ? 28 PHE A HA   5  
ATOM 4023  H HB2  . PHE A 1 28 ? -1.289  14.761 23.849 1.00 0.00 ? 28 PHE A HB2  5  
ATOM 4024  H HB3  . PHE A 1 28 ? -2.013  14.138 25.329 1.00 0.00 ? 28 PHE A HB3  5  
ATOM 4025  H HD1  . PHE A 1 28 ? -0.889  15.560 27.498 1.00 0.00 ? 28 PHE A HD1  5  
ATOM 4026  H HD2  . PHE A 1 28 ? -1.773  17.026 23.557 1.00 0.00 ? 28 PHE A HD2  5  
ATOM 4027  H HE1  . PHE A 1 28 ? -1.061  17.866 28.394 1.00 0.00 ? 28 PHE A HE1  5  
ATOM 4028  H HE2  . PHE A 1 28 ? -1.947  19.331 24.455 1.00 0.00 ? 28 PHE A HE2  5  
ATOM 4029  H HZ   . PHE A 1 28 ? -1.590  19.751 26.873 1.00 0.00 ? 28 PHE A HZ   5  
ATOM 4030  N N    . PHE A 1 29 ? 1.021   12.774 23.525 1.00 0.00 ? 29 PHE A N    5  
ATOM 4031  C CA   . PHE A 1 29 ? 1.275   11.486 22.810 1.00 0.00 ? 29 PHE A CA   5  
ATOM 4032  C C    . PHE A 1 29 ? 1.984   10.491 23.737 1.00 0.00 ? 29 PHE A C    5  
ATOM 4033  O O    . PHE A 1 29 ? 2.028   9.306  23.475 1.00 0.00 ? 29 PHE A O    5  
ATOM 4034  C CB   . PHE A 1 29 ? 2.183   11.868 21.636 1.00 0.00 ? 29 PHE A CB   5  
ATOM 4035  C CG   . PHE A 1 29 ? 2.515   10.639 20.822 1.00 0.00 ? 29 PHE A CG   5  
ATOM 4036  C CD1  . PHE A 1 29 ? 3.382   9.668  21.338 1.00 0.00 ? 29 PHE A CD1  5  
ATOM 4037  C CD2  . PHE A 1 29 ? 1.957   10.471 19.549 1.00 0.00 ? 29 PHE A CD2  5  
ATOM 4038  C CE1  . PHE A 1 29 ? 3.688   8.529  20.584 1.00 0.00 ? 29 PHE A CE1  5  
ATOM 4039  C CE2  . PHE A 1 29 ? 2.263   9.332  18.794 1.00 0.00 ? 29 PHE A CE2  5  
ATOM 4040  C CZ   . PHE A 1 29 ? 3.128   8.361  19.311 1.00 0.00 ? 29 PHE A CZ   5  
ATOM 4041  H H    . PHE A 1 29 ? 1.358   13.614 23.149 1.00 0.00 ? 29 PHE A H    5  
ATOM 4042  H HA   . PHE A 1 29 ? 0.351   11.070 22.443 1.00 0.00 ? 29 PHE A HA   5  
ATOM 4043  H HB2  . PHE A 1 29 ? 1.675   12.587 21.010 1.00 0.00 ? 29 PHE A HB2  5  
ATOM 4044  H HB3  . PHE A 1 29 ? 3.094   12.305 22.016 1.00 0.00 ? 29 PHE A HB3  5  
ATOM 4045  H HD1  . PHE A 1 29 ? 3.813   9.798  22.320 1.00 0.00 ? 29 PHE A HD1  5  
ATOM 4046  H HD2  . PHE A 1 29 ? 1.288   11.219 19.150 1.00 0.00 ? 29 PHE A HD2  5  
ATOM 4047  H HE1  . PHE A 1 29 ? 4.356   7.781  20.984 1.00 0.00 ? 29 PHE A HE1  5  
ATOM 4048  H HE2  . PHE A 1 29 ? 1.832   9.202  17.812 1.00 0.00 ? 29 PHE A HE2  5  
ATOM 4049  H HZ   . PHE A 1 29 ? 3.365   7.483  18.730 1.00 0.00 ? 29 PHE A HZ   5  
ATOM 4050  N N    . GLN A 1 30 ? 2.543   10.966 24.816 1.00 0.00 ? 30 GLN A N    5  
ATOM 4051  C CA   . GLN A 1 30 ? 3.256   10.051 25.755 1.00 0.00 ? 30 GLN A CA   5  
ATOM 4052  C C    . GLN A 1 30 ? 2.298   9.009  26.338 1.00 0.00 ? 30 GLN A C    5  
ATOM 4053  O O    . GLN A 1 30 ? 2.714   8.058  26.969 1.00 0.00 ? 30 GLN A O    5  
ATOM 4054  C CB   . GLN A 1 30 ? 3.790   10.962 26.861 1.00 0.00 ? 30 GLN A CB   5  
ATOM 4055  C CG   . GLN A 1 30 ? 4.965   11.782 26.324 1.00 0.00 ? 30 GLN A CG   5  
ATOM 4056  C CD   . GLN A 1 30 ? 5.890   12.165 27.481 1.00 0.00 ? 30 GLN A CD   5  
ATOM 4057  O OE1  . GLN A 1 30 ? 6.430   11.308 28.152 1.00 0.00 ? 30 GLN A OE1  5  
ATOM 4058  N NE2  . GLN A 1 30 ? 6.098   13.427 27.741 1.00 0.00 ? 30 GLN A NE2  5  
ATOM 4059  H H    . GLN A 1 30 ? 2.497   11.924 25.009 1.00 0.00 ? 30 GLN A H    5  
ATOM 4060  H HA   . GLN A 1 30 ? 4.079   9.566  25.255 1.00 0.00 ? 30 GLN A HA   5  
ATOM 4061  H HB2  . GLN A 1 30 ? 3.006   11.628 27.189 1.00 0.00 ? 30 GLN A HB2  5  
ATOM 4062  H HB3  . GLN A 1 30 ? 4.122   10.360 27.695 1.00 0.00 ? 30 GLN A HB3  5  
ATOM 4063  H HG2  . GLN A 1 30 ? 5.513   11.194 25.603 1.00 0.00 ? 30 GLN A HG2  5  
ATOM 4064  H HG3  . GLN A 1 30 ? 4.592   12.677 25.850 1.00 0.00 ? 30 GLN A HG3  5  
ATOM 4065  H HE21 . GLN A 1 30 ? 5.663   14.117 27.199 1.00 0.00 ? 30 GLN A HE21 5  
ATOM 4066  H HE22 . GLN A 1 30 ? 6.688   13.683 28.480 1.00 0.00 ? 30 GLN A HE22 5  
ATOM 4067  N N    . SER A 1 31 ? 1.019   9.177  26.140 1.00 0.00 ? 31 SER A N    5  
ATOM 4068  C CA   . SER A 1 31 ? 0.052   8.185  26.697 1.00 0.00 ? 31 SER A CA   5  
ATOM 4069  C C    . SER A 1 31 ? -1.168  8.044  25.782 1.00 0.00 ? 31 SER A C    5  
ATOM 4070  O O    . SER A 1 31 ? -1.398  8.855  24.907 1.00 0.00 ? 31 SER A O    5  
ATOM 4071  C CB   . SER A 1 31 ? -0.361  8.755  28.054 1.00 0.00 ? 31 SER A CB   5  
ATOM 4072  O OG   . SER A 1 31 ? -0.646  10.139 27.919 1.00 0.00 ? 31 SER A OG   5  
ATOM 4073  H H    . SER A 1 31 ? 0.696   9.952  25.631 1.00 0.00 ? 31 SER A H    5  
ATOM 4074  H HA   . SER A 1 31 ? 0.532   7.229  26.833 1.00 0.00 ? 31 SER A HA   5  
ATOM 4075  H HB2  . SER A 1 31 ? -1.241  8.240  28.408 1.00 0.00 ? 31 SER A HB2  5  
ATOM 4076  H HB3  . SER A 1 31 ? 0.445   8.620  28.761 1.00 0.00 ? 31 SER A HB3  5  
ATOM 4077  H HG   . SER A 1 31 ? -1.589  10.262 28.048 1.00 0.00 ? 31 SER A HG   5  
ATOM 4078  N N    . LEU A 1 32 ? -1.952  7.019  25.984 1.00 0.00 ? 32 LEU A N    5  
ATOM 4079  C CA   . LEU A 1 32 ? -3.161  6.822  25.132 1.00 0.00 ? 32 LEU A CA   5  
ATOM 4080  C C    . LEU A 1 32 ? -4.126  7.990  25.310 1.00 0.00 ? 32 LEU A C    5  
ATOM 4081  O O    . LEU A 1 32 ? -4.516  8.640  24.360 1.00 0.00 ? 32 LEU A O    5  
ATOM 4082  C CB   . LEU A 1 32 ? -3.796  5.527  25.635 1.00 0.00 ? 32 LEU A CB   5  
ATOM 4083  C CG   . LEU A 1 32 ? -4.595  4.878  24.503 1.00 0.00 ? 32 LEU A CG   5  
ATOM 4084  C CD1  . LEU A 1 32 ? -4.821  3.398  24.823 1.00 0.00 ? 32 LEU A CD1  5  
ATOM 4085  C CD2  . LEU A 1 32 ? -5.948  5.581  24.367 1.00 0.00 ? 32 LEU A CD2  5  
ATOM 4086  H H    . LEU A 1 32 ? -1.748  6.380  26.698 1.00 0.00 ? 32 LEU A H    5  
ATOM 4087  H HA   . LEU A 1 32 ? -2.881  6.719  24.099 1.00 0.00 ? 32 LEU A HA   5  
ATOM 4088  H HB2  . LEU A 1 32 ? -3.022  4.850  25.964 1.00 0.00 ? 32 LEU A HB2  5  
ATOM 4089  H HB3  . LEU A 1 32 ? -4.456  5.749  26.460 1.00 0.00 ? 32 LEU A HB3  5  
ATOM 4090  H HG   . LEU A 1 32 ? -4.048  4.967  23.578 1.00 0.00 ? 32 LEU A HG   5  
ATOM 4091  H HD11 . LEU A 1 32 ? -4.891  3.268  25.891 1.00 0.00 ? 32 LEU A HD11 5  
ATOM 4092  H HD12 . LEU A 1 32 ? -5.737  3.065  24.358 1.00 0.00 ? 32 LEU A HD12 5  
ATOM 4093  H HD13 . LEU A 1 32 ? -3.992  2.818  24.443 1.00 0.00 ? 32 LEU A HD13 5  
ATOM 4094  H HD21 . LEU A 1 32 ? -6.326  5.827  25.348 1.00 0.00 ? 32 LEU A HD21 5  
ATOM 4095  H HD22 . LEU A 1 32 ? -5.826  6.486  23.791 1.00 0.00 ? 32 LEU A HD22 5  
ATOM 4096  H HD23 . LEU A 1 32 ? -6.645  4.926  23.867 1.00 0.00 ? 32 LEU A HD23 5  
ATOM 4097  N N    . ASP A 1 33 ? -4.510  8.268  26.523 1.00 0.00 ? 33 ASP A N    5  
ATOM 4098  C CA   . ASP A 1 33 ? -5.446  9.400  26.762 1.00 0.00 ? 33 ASP A CA   5  
ATOM 4099  C C    . ASP A 1 33 ? -4.861  10.666 26.146 1.00 0.00 ? 33 ASP A C    5  
ATOM 4100  O O    . ASP A 1 33 ? -5.560  11.466 25.558 1.00 0.00 ? 33 ASP A O    5  
ATOM 4101  C CB   . ASP A 1 33 ? -5.544  9.530  28.282 1.00 0.00 ? 33 ASP A CB   5  
ATOM 4102  C CG   . ASP A 1 33 ? -6.532  10.642 28.637 1.00 0.00 ? 33 ASP A CG   5  
ATOM 4103  O OD1  . ASP A 1 33 ? -6.956  11.342 27.732 1.00 0.00 ? 33 ASP A OD1  5  
ATOM 4104  O OD2  . ASP A 1 33 ? -6.849  10.774 29.808 1.00 0.00 ? 33 ASP A OD2  5  
ATOM 4105  H H    . ASP A 1 33 ? -4.179  7.737  27.273 1.00 0.00 ? 33 ASP A H    5  
ATOM 4106  H HA   . ASP A 1 33 ? -6.415  9.187  26.340 1.00 0.00 ? 33 ASP A HA   5  
ATOM 4107  H HB2  . ASP A 1 33 ? -5.887  8.595  28.702 1.00 0.00 ? 33 ASP A HB2  5  
ATOM 4108  H HB3  . ASP A 1 33 ? -4.571  9.770  28.686 1.00 0.00 ? 33 ASP A HB3  5  
ATOM 4109  N N    . GLY A 1 34 ? -3.575  10.839 26.259 1.00 0.00 ? 34 GLY A N    5  
ATOM 4110  C CA   . GLY A 1 34 ? -2.937  12.038 25.660 1.00 0.00 ? 34 GLY A CA   5  
ATOM 4111  C C    . GLY A 1 34 ? -2.893  11.848 24.146 1.00 0.00 ? 34 GLY A C    5  
ATOM 4112  O O    . GLY A 1 34 ? -3.051  12.779 23.386 1.00 0.00 ? 34 GLY A O    5  
ATOM 4113  H H    . GLY A 1 34 ? -3.029  10.170 26.724 1.00 0.00 ? 34 GLY A H    5  
ATOM 4114  H HA2  . GLY A 1 34 ? -3.517  12.915 25.899 1.00 0.00 ? 34 GLY A HA2  5  
ATOM 4115  H HA3  . GLY A 1 34 ? -1.934  12.147 26.042 1.00 0.00 ? 34 GLY A HA3  5  
ATOM 4116  N N    . ILE A 1 35 ? -2.691  10.635 23.708 1.00 0.00 ? 35 ILE A N    5  
ATOM 4117  C CA   . ILE A 1 35 ? -2.649  10.365 22.244 1.00 0.00 ? 35 ILE A CA   5  
ATOM 4118  C C    . ILE A 1 35 ? -4.017  10.671 21.626 1.00 0.00 ? 35 ILE A C    5  
ATOM 4119  O O    . ILE A 1 35 ? -4.114  11.159 20.518 1.00 0.00 ? 35 ILE A O    5  
ATOM 4120  C CB   . ILE A 1 35 ? -2.301  8.871  22.135 1.00 0.00 ? 35 ILE A CB   5  
ATOM 4121  C CG1  . ILE A 1 35 ? -0.785  8.719  21.993 1.00 0.00 ? 35 ILE A CG1  5  
ATOM 4122  C CG2  . ILE A 1 35 ? -2.987  8.241  20.916 1.00 0.00 ? 35 ILE A CG2  5  
ATOM 4123  C CD1  . ILE A 1 35 ? -0.333  9.304  20.653 1.00 0.00 ? 35 ILE A CD1  5  
ATOM 4124  H H    . ILE A 1 35 ? -2.576  9.901  24.345 1.00 0.00 ? 35 ILE A H    5  
ATOM 4125  H HA   . ILE A 1 35 ? -1.884  10.959 21.775 1.00 0.00 ? 35 ILE A HA   5  
ATOM 4126  H HB   . ILE A 1 35 ? -2.627  8.363  23.030 1.00 0.00 ? 35 ILE A HB   5  
ATOM 4127  H HG12 . ILE A 1 35 ? -0.294  9.244  22.798 1.00 0.00 ? 35 ILE A HG12 5  
ATOM 4128  H HG13 . ILE A 1 35 ? -0.523  7.671  22.035 1.00 0.00 ? 35 ILE A HG13 5  
ATOM 4129  H HG21 . ILE A 1 35 ? -4.053  8.401  20.981 1.00 0.00 ? 35 ILE A HG21 5  
ATOM 4130  H HG22 . ILE A 1 35 ? -2.608  8.697  20.014 1.00 0.00 ? 35 ILE A HG22 5  
ATOM 4131  H HG23 . ILE A 1 35 ? -2.784  7.181  20.897 1.00 0.00 ? 35 ILE A HG23 5  
ATOM 4132  H HD11 . ILE A 1 35 ? -1.125  9.200  19.926 1.00 0.00 ? 35 ILE A HD11 5  
ATOM 4133  H HD12 . ILE A 1 35 ? -0.096  10.349 20.777 1.00 0.00 ? 35 ILE A HD12 5  
ATOM 4134  H HD13 . ILE A 1 35 ? 0.543   8.775  20.308 1.00 0.00 ? 35 ILE A HD13 5  
ATOM 4135  N N    . MET A 1 36 ? -5.073  10.385 22.334 1.00 0.00 ? 36 MET A N    5  
ATOM 4136  C CA   . MET A 1 36 ? -6.430  10.656 21.783 1.00 0.00 ? 36 MET A CA   5  
ATOM 4137  C C    . MET A 1 36 ? -6.515  12.088 21.248 1.00 0.00 ? 36 MET A C    5  
ATOM 4138  O O    . MET A 1 36 ? -6.910  12.316 20.122 1.00 0.00 ? 36 MET A O    5  
ATOM 4139  C CB   . MET A 1 36 ? -7.386  10.477 22.960 1.00 0.00 ? 36 MET A CB   5  
ATOM 4140  C CG   . MET A 1 36 ? -7.884  9.031  22.995 1.00 0.00 ? 36 MET A CG   5  
ATOM 4141  S SD   . MET A 1 36 ? -8.930  8.789  24.453 1.00 0.00 ? 36 MET A SD   5  
ATOM 4142  C CE   . MET A 1 36 ? -10.526 8.902  23.607 1.00 0.00 ? 36 MET A CE   5  
ATOM 4143  H H    . MET A 1 36 ? -4.973  9.987  23.228 1.00 0.00 ? 36 MET A H    5  
ATOM 4144  H HA   . MET A 1 36 ? -6.669  9.949  21.005 1.00 0.00 ? 36 MET A HA   5  
ATOM 4145  H HB2  . MET A 1 36 ? -6.870  10.704 23.881 1.00 0.00 ? 36 MET A HB2  5  
ATOM 4146  H HB3  . MET A 1 36 ? -8.225  11.145 22.841 1.00 0.00 ? 36 MET A HB3  5  
ATOM 4147  H HG2  . MET A 1 36 ? -8.456  8.824  22.104 1.00 0.00 ? 36 MET A HG2  5  
ATOM 4148  H HG3  . MET A 1 36 ? -7.039  8.360  23.044 1.00 0.00 ? 36 MET A HG3  5  
ATOM 4149  H HE1  . MET A 1 36 ? -10.363 9.142  22.565 1.00 0.00 ? 36 MET A HE1  5  
ATOM 4150  H HE2  . MET A 1 36 ? -11.043 7.956  23.688 1.00 0.00 ? 36 MET A HE2  5  
ATOM 4151  H HE3  . MET A 1 36 ? -11.122 9.676  24.062 1.00 0.00 ? 36 MET A HE3  5  
ATOM 4152  N N    . PHE A 1 37 ? -6.153  13.056 22.047 1.00 0.00 ? 37 PHE A N    5  
ATOM 4153  C CA   . PHE A 1 37 ? -6.224  14.469 21.574 1.00 0.00 ? 37 PHE A CA   5  
ATOM 4154  C C    . PHE A 1 37 ? -5.627  14.574 20.160 1.00 0.00 ? 37 PHE A C    5  
ATOM 4155  O O    . PHE A 1 37 ? -6.234  15.127 19.263 1.00 0.00 ? 37 PHE A O    5  
ATOM 4156  C CB   . PHE A 1 37 ? -5.440  15.279 22.632 1.00 0.00 ? 37 PHE A CB   5  
ATOM 4157  C CG   . PHE A 1 37 ? -4.282  16.033 22.015 1.00 0.00 ? 37 PHE A CG   5  
ATOM 4158  C CD1  . PHE A 1 37 ? -3.070  15.379 21.770 1.00 0.00 ? 37 PHE A CD1  5  
ATOM 4159  C CD2  . PHE A 1 37 ? -4.425  17.384 21.685 1.00 0.00 ? 37 PHE A CD2  5  
ATOM 4160  C CE1  . PHE A 1 37 ? -2.004  16.072 21.196 1.00 0.00 ? 37 PHE A CE1  5  
ATOM 4161  C CE2  . PHE A 1 37 ? -3.358  18.079 21.107 1.00 0.00 ? 37 PHE A CE2  5  
ATOM 4162  C CZ   . PHE A 1 37 ? -2.148  17.421 20.863 1.00 0.00 ? 37 PHE A CZ   5  
ATOM 4163  H H    . PHE A 1 37 ? -5.840  12.856 22.955 1.00 0.00 ? 37 PHE A H    5  
ATOM 4164  H HA   . PHE A 1 37 ? -7.253  14.795 21.560 1.00 0.00 ? 37 PHE A HA   5  
ATOM 4165  H HB2  . PHE A 1 37 ? -6.111  15.987 23.097 1.00 0.00 ? 37 PHE A HB2  5  
ATOM 4166  H HB3  . PHE A 1 37 ? -5.061  14.604 23.385 1.00 0.00 ? 37 PHE A HB3  5  
ATOM 4167  H HD1  . PHE A 1 37 ? -2.958  14.338 22.026 1.00 0.00 ? 37 PHE A HD1  5  
ATOM 4168  H HD2  . PHE A 1 37 ? -5.357  17.891 21.878 1.00 0.00 ? 37 PHE A HD2  5  
ATOM 4169  H HE1  . PHE A 1 37 ? -1.069  15.566 21.006 1.00 0.00 ? 37 PHE A HE1  5  
ATOM 4170  H HE2  . PHE A 1 37 ? -3.466  19.122 20.852 1.00 0.00 ? 37 PHE A HE2  5  
ATOM 4171  H HZ   . PHE A 1 37 ? -1.327  17.951 20.417 1.00 0.00 ? 37 PHE A HZ   5  
ATOM 4172  N N    . ILE A 1 38 ? -4.457  14.037 19.947 1.00 0.00 ? 38 ILE A N    5  
ATOM 4173  C CA   . ILE A 1 38 ? -3.847  14.105 18.588 1.00 0.00 ? 38 ILE A CA   5  
ATOM 4174  C C    . ILE A 1 38 ? -4.859  13.636 17.541 1.00 0.00 ? 38 ILE A C    5  
ATOM 4175  O O    . ILE A 1 38 ? -4.947  14.179 16.459 1.00 0.00 ? 38 ILE A O    5  
ATOM 4176  C CB   . ILE A 1 38 ? -2.649  13.157 18.640 1.00 0.00 ? 38 ILE A CB   5  
ATOM 4177  C CG1  . ILE A 1 38 ? -1.580  13.740 19.566 1.00 0.00 ? 38 ILE A CG1  5  
ATOM 4178  C CG2  . ILE A 1 38 ? -2.072  12.988 17.234 1.00 0.00 ? 38 ILE A CG2  5  
ATOM 4179  C CD1  . ILE A 1 38 ? -0.295  12.918 19.442 1.00 0.00 ? 38 ILE A CD1  5  
ATOM 4180  H H    . ILE A 1 38 ? -3.983  13.585 20.672 1.00 0.00 ? 38 ILE A H    5  
ATOM 4181  H HA   . ILE A 1 38 ? -3.519  15.106 18.371 1.00 0.00 ? 38 ILE A HA   5  
ATOM 4182  H HB   . ILE A 1 38 ? -2.968  12.196 19.017 1.00 0.00 ? 38 ILE A HB   5  
ATOM 4183  H HG12 . ILE A 1 38 ? -1.380  14.764 19.286 1.00 0.00 ? 38 ILE A HG12 5  
ATOM 4184  H HG13 . ILE A 1 38 ? -1.931  13.707 20.587 1.00 0.00 ? 38 ILE A HG13 5  
ATOM 4185  H HG21 . ILE A 1 38 ? -2.859  12.695 16.555 1.00 0.00 ? 38 ILE A HG21 5  
ATOM 4186  H HG22 . ILE A 1 38 ? -1.644  13.925 16.906 1.00 0.00 ? 38 ILE A HG22 5  
ATOM 4187  H HG23 . ILE A 1 38 ? -1.306  12.228 17.247 1.00 0.00 ? 38 ILE A HG23 5  
ATOM 4188  H HD11 . ILE A 1 38 ? -0.417  12.172 18.672 1.00 0.00 ? 38 ILE A HD11 5  
ATOM 4189  H HD12 . ILE A 1 38 ? 0.526   13.570 19.186 1.00 0.00 ? 38 ILE A HD12 5  
ATOM 4190  H HD13 . ILE A 1 38 ? -0.087  12.432 20.384 1.00 0.00 ? 38 ILE A HD13 5  
ATOM 4191  N N    . ASN A 1 39 ? -5.628  12.633 17.862 1.00 0.00 ? 39 ASN A N    5  
ATOM 4192  C CA   . ASN A 1 39 ? -6.641  12.131 16.892 1.00 0.00 ? 39 ASN A CA   5  
ATOM 4193  C C    . ASN A 1 39 ? -7.797  13.129 16.792 1.00 0.00 ? 39 ASN A C    5  
ATOM 4194  O O    . ASN A 1 39 ? -8.474  13.213 15.786 1.00 0.00 ? 39 ASN A O    5  
ATOM 4195  C CB   . ASN A 1 39 ? -7.127  10.802 17.472 1.00 0.00 ? 39 ASN A CB   5  
ATOM 4196  C CG   . ASN A 1 39 ? -5.991  9.778  17.419 1.00 0.00 ? 39 ASN A CG   5  
ATOM 4197  O OD1  . ASN A 1 39 ? -5.281  9.691  16.437 1.00 0.00 ? 39 ASN A OD1  5  
ATOM 4198  N ND2  . ASN A 1 39 ? -5.788  8.993  18.442 1.00 0.00 ? 39 ASN A ND2  5  
ATOM 4199  H H    . ASN A 1 39 ? -5.543  12.215 18.744 1.00 0.00 ? 39 ASN A H    5  
ATOM 4200  H HA   . ASN A 1 39 ? -6.194  11.971 15.924 1.00 0.00 ? 39 ASN A HA   5  
ATOM 4201  H HB2  . ASN A 1 39 ? -7.433  10.947 18.498 1.00 0.00 ? 39 ASN A HB2  5  
ATOM 4202  H HB3  . ASN A 1 39 ? -7.964  10.441 16.894 1.00 0.00 ? 39 ASN A HB3  5  
ATOM 4203  H HD21 . ASN A 1 39 ? -6.360  9.064  19.234 1.00 0.00 ? 39 ASN A HD21 5  
ATOM 4204  H HD22 . ASN A 1 39 ? -5.064  8.334  18.417 1.00 0.00 ? 39 ASN A HD22 5  
ATOM 4205  N N    . LYS A 1 40 ? -8.018  13.890 17.827 1.00 0.00 ? 40 LYS A N    5  
ATOM 4206  C CA   . LYS A 1 40 ? -9.121  14.890 17.797 1.00 0.00 ? 40 LYS A CA   5  
ATOM 4207  C C    . LYS A 1 40 ? -8.563  16.265 17.421 1.00 0.00 ? 40 LYS A C    5  
ATOM 4208  O O    . LYS A 1 40 ? -9.297  17.182 17.117 1.00 0.00 ? 40 LYS A O    5  
ATOM 4209  C CB   . LYS A 1 40 ? -9.683  14.906 19.217 1.00 0.00 ? 40 LYS A CB   5  
ATOM 4210  C CG   . LYS A 1 40 ? -10.650 13.734 19.396 1.00 0.00 ? 40 LYS A CG   5  
ATOM 4211  C CD   . LYS A 1 40 ? -11.052 13.625 20.868 1.00 0.00 ? 40 LYS A CD   5  
ATOM 4212  C CE   . LYS A 1 40 ? -11.399 12.170 21.194 1.00 0.00 ? 40 LYS A CE   5  
ATOM 4213  N NZ   . LYS A 1 40 ? -12.023 12.221 22.546 1.00 0.00 ? 40 LYS A NZ   5  
ATOM 4214  H H    . LYS A 1 40 ? -7.455  13.807 18.625 1.00 0.00 ? 40 LYS A H    5  
ATOM 4215  H HA   . LYS A 1 40 ? -9.886  14.588 17.098 1.00 0.00 ? 40 LYS A HA   5  
ATOM 4216  H HB2  . LYS A 1 40 ? -8.873  14.817 19.926 1.00 0.00 ? 40 LYS A HB2  5  
ATOM 4217  H HB3  . LYS A 1 40 ? -10.208 15.835 19.386 1.00 0.00 ? 40 LYS A HB3  5  
ATOM 4218  H HG2  . LYS A 1 40 ? -11.532 13.900 18.794 1.00 0.00 ? 40 LYS A HG2  5  
ATOM 4219  H HG3  . LYS A 1 40 ? -10.168 12.820 19.085 1.00 0.00 ? 40 LYS A HG3  5  
ATOM 4220  H HD2  . LYS A 1 40 ? -10.230 13.947 21.491 1.00 0.00 ? 40 LYS A HD2  5  
ATOM 4221  H HD3  . LYS A 1 40 ? -11.912 14.251 21.054 1.00 0.00 ? 40 LYS A HD3  5  
ATOM 4222  H HE2  . LYS A 1 40 ? -12.100 11.781 20.471 1.00 0.00 ? 40 LYS A HE2  5  
ATOM 4223  H HE3  . LYS A 1 40 ? -10.504 11.566 21.215 1.00 0.00 ? 40 LYS A HE3  5  
ATOM 4224  H HZ1  . LYS A 1 40 ? -12.661 13.041 22.603 1.00 0.00 ? 40 LYS A HZ1  5  
ATOM 4225  H HZ2  . LYS A 1 40 ? -12.564 11.349 22.712 1.00 0.00 ? 40 LYS A HZ2  5  
ATOM 4226  H HZ3  . LYS A 1 40 ? -11.280 12.308 23.268 1.00 0.00 ? 40 LYS A HZ3  5  
ATOM 4227  N N    . CYS A 1 41 ? -7.267  16.411 17.435 1.00 0.00 ? 41 CYS A N    5  
ATOM 4228  C CA   . CYS A 1 41 ? -6.662  17.724 17.075 1.00 0.00 ? 41 CYS A CA   5  
ATOM 4229  C C    . CYS A 1 41 ? -7.042  18.096 15.642 1.00 0.00 ? 41 CYS A C    5  
ATOM 4230  O O    . CYS A 1 41 ? -7.860  18.963 15.408 1.00 0.00 ? 41 CYS A O    5  
ATOM 4231  C CB   . CYS A 1 41 ? -5.153  17.505 17.186 1.00 0.00 ? 41 CYS A CB   5  
ATOM 4232  S SG   . CYS A 1 41 ? -4.278  18.892 16.417 1.00 0.00 ? 41 CYS A SG   5  
ATOM 4233  H H    . CYS A 1 41 ? -6.691  15.657 17.680 1.00 0.00 ? 41 CYS A H    5  
ATOM 4234  H HA   . CYS A 1 41 ? -6.978  18.490 17.762 1.00 0.00 ? 41 CYS A HA   5  
ATOM 4235  H HB2  . CYS A 1 41 ? -4.876  17.436 18.225 1.00 0.00 ? 41 CYS A HB2  5  
ATOM 4236  H HB3  . CYS A 1 41 ? -4.884  16.590 16.681 1.00 0.00 ? 41 CYS A HB3  5  
ATOM 4237  N N    . ALA A 1 42 ? -6.454  17.439 14.683 1.00 0.00 ? 42 ALA A N    5  
ATOM 4238  C CA   . ALA A 1 42 ? -6.780  17.748 13.261 1.00 0.00 ? 42 ALA A CA   5  
ATOM 4239  C C    . ALA A 1 42 ? -8.286  17.615 13.028 1.00 0.00 ? 42 ALA A C    5  
ATOM 4240  O O    . ALA A 1 42 ? -8.866  18.318 12.223 1.00 0.00 ? 42 ALA A O    5  
ATOM 4241  C CB   . ALA A 1 42 ? -6.013  16.709 12.441 1.00 0.00 ? 42 ALA A CB   5  
ATOM 4242  H H    . ALA A 1 42 ? -5.798  16.742 14.899 1.00 0.00 ? 42 ALA A H    5  
ATOM 4243  H HA   . ALA A 1 42 ? -6.446  18.740 13.005 1.00 0.00 ? 42 ALA A HA   5  
ATOM 4244  H HB1  . ALA A 1 42 ? -5.139  16.392 12.990 1.00 0.00 ? 42 ALA A HB1  5  
ATOM 4245  H HB2  . ALA A 1 42 ? -5.710  17.145 11.501 1.00 0.00 ? 42 ALA A HB2  5  
ATOM 4246  H HB3  . ALA A 1 42 ? -6.650  15.857 12.255 1.00 0.00 ? 42 ALA A HB3  5  
ATOM 4247  N N    . THR A 1 43 ? -8.926  16.723 13.732 1.00 0.00 ? 43 THR A N    5  
ATOM 4248  C CA   . THR A 1 43 ? -10.395 16.546 13.562 1.00 0.00 ? 43 THR A CA   5  
ATOM 4249  C C    . THR A 1 43 ? -11.133 17.728 14.190 1.00 0.00 ? 43 THR A C    5  
ATOM 4250  O O    . THR A 1 43 ? -11.896 18.414 13.541 1.00 0.00 ? 43 THR A O    5  
ATOM 4251  C CB   . THR A 1 43 ? -10.727 15.248 14.301 1.00 0.00 ? 43 THR A CB   5  
ATOM 4252  O OG1  . THR A 1 43 ? -9.823  14.231 13.894 1.00 0.00 ? 43 THR A OG1  5  
ATOM 4253  C CG2  . THR A 1 43 ? -12.159 14.823 13.974 1.00 0.00 ? 43 THR A CG2  5  
ATOM 4254  H H    . THR A 1 43 ? -8.440  16.172 14.379 1.00 0.00 ? 43 THR A H    5  
ATOM 4255  H HA   . THR A 1 43 ? -10.646 16.453 12.517 1.00 0.00 ? 43 THR A HA   5  
ATOM 4256  H HB   . THR A 1 43 ? -10.638 15.406 15.365 1.00 0.00 ? 43 THR A HB   5  
ATOM 4257  H HG1  . THR A 1 43 ? -9.504  13.784 14.683 1.00 0.00 ? 43 THR A HG1  5  
ATOM 4258  H HG21 . THR A 1 43 ? -12.675 15.638 13.490 1.00 0.00 ? 43 THR A HG21 5  
ATOM 4259  H HG22 . THR A 1 43 ? -12.138 13.967 13.314 1.00 0.00 ? 43 THR A HG22 5  
ATOM 4260  H HG23 . THR A 1 43 ? -12.673 14.561 14.886 1.00 0.00 ? 43 THR A HG23 5  
ATOM 4261  N N    . CYS A 1 44 ? -10.908 17.978 15.450 1.00 0.00 ? 44 CYS A N    5  
ATOM 4262  C CA   . CYS A 1 44 ? -11.592 19.124 16.111 1.00 0.00 ? 44 CYS A CA   5  
ATOM 4263  C C    . CYS A 1 44 ? -11.429 20.382 15.257 1.00 0.00 ? 44 CYS A C    5  
ATOM 4264  O O    . CYS A 1 44 ? -12.215 21.304 15.332 1.00 0.00 ? 44 CYS A O    5  
ATOM 4265  C CB   . CYS A 1 44 ? -10.886 19.289 17.458 1.00 0.00 ? 44 CYS A CB   5  
ATOM 4266  S SG   . CYS A 1 44 ? -11.448 18.002 18.599 1.00 0.00 ? 44 CYS A SG   5  
ATOM 4267  H H    . CYS A 1 44 ? -10.285 17.419 15.956 1.00 0.00 ? 44 CYS A H    5  
ATOM 4268  H HA   . CYS A 1 44 ? -12.637 18.903 16.265 1.00 0.00 ? 44 CYS A HA   5  
ATOM 4269  H HB2  . CYS A 1 44 ? -9.819  19.205 17.317 1.00 0.00 ? 44 CYS A HB2  5  
ATOM 4270  H HB3  . CYS A 1 44 ? -11.118 20.261 17.869 1.00 0.00 ? 44 CYS A HB3  5  
ATOM 4271  N N    . LYS A 1 45 ? -10.410 20.420 14.442 1.00 0.00 ? 45 LYS A N    5  
ATOM 4272  C CA   . LYS A 1 45 ? -10.189 21.612 13.575 1.00 0.00 ? 45 LYS A CA   5  
ATOM 4273  C C    . LYS A 1 45 ? -11.272 21.685 12.496 1.00 0.00 ? 45 LYS A C    5  
ATOM 4274  O O    . LYS A 1 45 ? -11.915 22.700 12.316 1.00 0.00 ? 45 LYS A O    5  
ATOM 4275  C CB   . LYS A 1 45 ? -8.817  21.394 12.940 1.00 0.00 ? 45 LYS A CB   5  
ATOM 4276  C CG   . LYS A 1 45 ? -8.534  22.517 11.941 1.00 0.00 ? 45 LYS A CG   5  
ATOM 4277  C CD   . LYS A 1 45 ? -7.629  21.994 10.824 1.00 0.00 ? 45 LYS A CD   5  
ATOM 4278  C CE   . LYS A 1 45 ? -7.030  23.175 10.060 1.00 0.00 ? 45 LYS A CE   5  
ATOM 4279  N NZ   . LYS A 1 45 ? -6.100  22.559 9.071  1.00 0.00 ? 45 LYS A NZ   5  
ATOM 4280  H H    . LYS A 1 45 ? -9.790  19.662 14.398 1.00 0.00 ? 45 LYS A H    5  
ATOM 4281  H HA   . LYS A 1 45 ? -10.184 22.513 14.166 1.00 0.00 ? 45 LYS A HA   5  
ATOM 4282  H HB2  . LYS A 1 45 ? -8.060  21.396 13.709 1.00 0.00 ? 45 LYS A HB2  5  
ATOM 4283  H HB3  . LYS A 1 45 ? -8.805  20.443 12.426 1.00 0.00 ? 45 LYS A HB3  5  
ATOM 4284  H HG2  . LYS A 1 45 ? -9.465  22.864 11.517 1.00 0.00 ? 45 LYS A HG2  5  
ATOM 4285  H HG3  . LYS A 1 45 ? -8.044  23.334 12.448 1.00 0.00 ? 45 LYS A HG3  5  
ATOM 4286  H HD2  . LYS A 1 45 ? -6.834  21.401 11.252 1.00 0.00 ? 45 LYS A HD2  5  
ATOM 4287  H HD3  . LYS A 1 45 ? -8.209  21.383 10.147 1.00 0.00 ? 45 LYS A HD3  5  
ATOM 4288  H HE2  . LYS A 1 45 ? -7.807  23.726 9.550  1.00 0.00 ? 45 LYS A HE2  5  
ATOM 4289  H HE3  . LYS A 1 45 ? -6.488  23.823 10.733 1.00 0.00 ? 45 LYS A HE3  5  
ATOM 4290  H HZ1  . LYS A 1 45 ? -6.472  21.635 8.772  1.00 0.00 ? 45 LYS A HZ1  5  
ATOM 4291  H HZ2  . LYS A 1 45 ? -6.012  23.183 8.243  1.00 0.00 ? 45 LYS A HZ2  5  
ATOM 4292  H HZ3  . LYS A 1 45 ? -5.166  22.428 9.509  1.00 0.00 ? 45 LYS A HZ3  5  
ATOM 4293  N N    . MET A 1 46 ? -11.484 20.615 11.776 1.00 0.00 ? 46 MET A N    5  
ATOM 4294  C CA   . MET A 1 46 ? -12.532 20.637 10.714 1.00 0.00 ? 46 MET A CA   5  
ATOM 4295  C C    . MET A 1 46 ? -13.891 20.959 11.337 1.00 0.00 ? 46 MET A C    5  
ATOM 4296  O O    . MET A 1 46 ? -14.772 21.490 10.691 1.00 0.00 ? 46 MET A O    5  
ATOM 4297  C CB   . MET A 1 46 ? -12.528 19.233 10.106 1.00 0.00 ? 46 MET A CB   5  
ATOM 4298  C CG   . MET A 1 46 ? -12.852 18.194 11.182 1.00 0.00 ? 46 MET A CG   5  
ATOM 4299  S SD   . MET A 1 46 ? -13.962 16.940 10.496 1.00 0.00 ? 46 MET A SD   5  
ATOM 4300  C CE   . MET A 1 46 ? -13.108 16.722 8.915  1.00 0.00 ? 46 MET A CE   5  
ATOM 4301  H H    . MET A 1 46 ? -10.960 19.802 11.934 1.00 0.00 ? 46 MET A H    5  
ATOM 4302  H HA   . MET A 1 46 ? -12.283 21.366 9.958  1.00 0.00 ? 46 MET A HA   5  
ATOM 4303  H HB2  . MET A 1 46 ? -13.272 19.180 9.324  1.00 0.00 ? 46 MET A HB2  5  
ATOM 4304  H HB3  . MET A 1 46 ? -11.555 19.025 9.689  1.00 0.00 ? 46 MET A HB3  5  
ATOM 4305  H HG2  . MET A 1 46 ? -11.938 17.724 11.513 1.00 0.00 ? 46 MET A HG2  5  
ATOM 4306  H HG3  . MET A 1 46 ? -13.330 18.679 12.019 1.00 0.00 ? 46 MET A HG3  5  
ATOM 4307  H HE1  . MET A 1 46 ? -12.046 16.649 9.085  1.00 0.00 ? 46 MET A HE1  5  
ATOM 4308  H HE2  . MET A 1 46 ? -13.458 15.815 8.441  1.00 0.00 ? 46 MET A HE2  5  
ATOM 4309  H HE3  . MET A 1 46 ? -13.311 17.570 8.277  1.00 0.00 ? 46 MET A HE3  5  
ATOM 4310  N N    . ILE A 1 47 ? -14.062 20.650 12.593 1.00 0.00 ? 47 ILE A N    5  
ATOM 4311  C CA   . ILE A 1 47 ? -15.358 20.949 13.261 1.00 0.00 ? 47 ILE A CA   5  
ATOM 4312  C C    . ILE A 1 47 ? -15.649 22.447 13.161 1.00 0.00 ? 47 ILE A C    5  
ATOM 4313  O O    . ILE A 1 47 ? -16.773 22.861 12.952 1.00 0.00 ? 47 ILE A O    5  
ATOM 4314  C CB   . ILE A 1 47 ? -15.163 20.532 14.719 1.00 0.00 ? 47 ILE A CB   5  
ATOM 4315  C CG1  . ILE A 1 47 ? -14.734 19.066 14.780 1.00 0.00 ? 47 ILE A CG1  5  
ATOM 4316  C CG2  . ILE A 1 47 ? -16.478 20.710 15.480 1.00 0.00 ? 47 ILE A CG2  5  
ATOM 4317  C CD1  . ILE A 1 47 ? -15.653 18.225 13.890 1.00 0.00 ? 47 ILE A CD1  5  
ATOM 4318  H H    . ILE A 1 47 ? -13.335 20.228 13.096 1.00 0.00 ? 47 ILE A H    5  
ATOM 4319  H HA   . ILE A 1 47 ? -16.156 20.377 12.814 1.00 0.00 ? 47 ILE A HA   5  
ATOM 4320  H HB   . ILE A 1 47 ? -14.400 21.150 15.171 1.00 0.00 ? 47 ILE A HB   5  
ATOM 4321  H HG12 . ILE A 1 47 ? -13.715 18.974 14.433 1.00 0.00 ? 47 ILE A HG12 5  
ATOM 4322  H HG13 . ILE A 1 47 ? -14.799 18.713 15.799 1.00 0.00 ? 47 ILE A HG13 5  
ATOM 4323  H HG21 . ILE A 1 47 ? -17.285 20.275 14.911 1.00 0.00 ? 47 ILE A HG21 5  
ATOM 4324  H HG22 . ILE A 1 47 ? -16.408 20.220 16.440 1.00 0.00 ? 47 ILE A HG22 5  
ATOM 4325  H HG23 . ILE A 1 47 ? -16.669 21.763 15.628 1.00 0.00 ? 47 ILE A HG23 5  
ATOM 4326  H HD11 . ILE A 1 47 ? -16.563 18.775 13.693 1.00 0.00 ? 47 ILE A HD11 5  
ATOM 4327  H HD12 . ILE A 1 47 ? -15.152 18.011 12.957 1.00 0.00 ? 47 ILE A HD12 5  
ATOM 4328  H HD13 . ILE A 1 47 ? -15.892 17.300 14.392 1.00 0.00 ? 47 ILE A HD13 5  
ATOM 4329  N N    . LEU A 1 48 ? -14.640 23.263 13.300 1.00 0.00 ? 48 LEU A N    5  
ATOM 4330  C CA   . LEU A 1 48 ? -14.852 24.734 13.201 1.00 0.00 ? 48 LEU A CA   5  
ATOM 4331  C C    . LEU A 1 48 ? -15.185 25.106 11.756 1.00 0.00 ? 48 LEU A C    5  
ATOM 4332  O O    . LEU A 1 48 ? -16.059 25.908 11.494 1.00 0.00 ? 48 LEU A O    5  
ATOM 4333  C CB   . LEU A 1 48 ? -13.525 25.361 13.627 1.00 0.00 ? 48 LEU A CB   5  
ATOM 4334  C CG   . LEU A 1 48 ? -13.377 25.267 15.147 1.00 0.00 ? 48 LEU A CG   5  
ATOM 4335  C CD1  . LEU A 1 48 ? -14.634 25.821 15.819 1.00 0.00 ? 48 LEU A CD1  5  
ATOM 4336  C CD2  . LEU A 1 48 ? -13.185 23.804 15.551 1.00 0.00 ? 48 LEU A CD2  5  
ATOM 4337  H H    . LEU A 1 48 ? -13.741 22.908 13.460 1.00 0.00 ? 48 LEU A H    5  
ATOM 4338  H HA   . LEU A 1 48 ? -15.643 25.048 13.864 1.00 0.00 ? 48 LEU A HA   5  
ATOM 4339  H HB2  . LEU A 1 48 ? -12.710 24.834 13.153 1.00 0.00 ? 48 LEU A HB2  5  
ATOM 4340  H HB3  . LEU A 1 48 ? -13.504 26.399 13.328 1.00 0.00 ? 48 LEU A HB3  5  
ATOM 4341  H HG   . LEU A 1 48 ? -12.518 25.842 15.461 1.00 0.00 ? 48 LEU A HG   5  
ATOM 4342  H HD11 . LEU A 1 48 ? -15.203 26.395 15.101 1.00 0.00 ? 48 LEU A HD11 5  
ATOM 4343  H HD12 . LEU A 1 48 ? -15.238 25.003 16.185 1.00 0.00 ? 48 LEU A HD12 5  
ATOM 4344  H HD13 . LEU A 1 48 ? -14.351 26.457 16.645 1.00 0.00 ? 48 LEU A HD13 5  
ATOM 4345  H HD21 . LEU A 1 48 ? -12.441 23.350 14.915 1.00 0.00 ? 48 LEU A HD21 5  
ATOM 4346  H HD22 . LEU A 1 48 ? -12.859 23.754 16.579 1.00 0.00 ? 48 LEU A HD22 5  
ATOM 4347  H HD23 . LEU A 1 48 ? -14.121 23.276 15.444 1.00 0.00 ? 48 LEU A HD23 5  
ATOM 4348  N N    . GLU A 1 49 ? -14.499 24.518 10.814 1.00 0.00 ? 49 GLU A N    5  
ATOM 4349  C CA   . GLU A 1 49 ? -14.782 24.828 9.385  1.00 0.00 ? 49 GLU A CA   5  
ATOM 4350  C C    . GLU A 1 49 ? -16.026 24.061 8.932  1.00 0.00 ? 49 GLU A C    5  
ATOM 4351  O O    . GLU A 1 49 ? -16.629 24.370 7.923  1.00 0.00 ? 49 GLU A O    5  
ATOM 4352  C CB   . GLU A 1 49 ? -13.547 24.351 8.619  1.00 0.00 ? 49 GLU A CB   5  
ATOM 4353  C CG   . GLU A 1 49 ? -12.306 25.061 9.161  1.00 0.00 ? 49 GLU A CG   5  
ATOM 4354  C CD   . GLU A 1 49 ? -12.080 26.360 8.383  1.00 0.00 ? 49 GLU A CD   5  
ATOM 4355  O OE1  . GLU A 1 49 ? -12.945 26.716 7.600  1.00 0.00 ? 49 GLU A OE1  5  
ATOM 4356  O OE2  . GLU A 1 49 ? -11.046 26.975 8.585  1.00 0.00 ? 49 GLU A OE2  5  
ATOM 4357  H H    . GLU A 1 49 ? -13.802 23.866 11.046 1.00 0.00 ? 49 GLU A H    5  
ATOM 4358  H HA   . GLU A 1 49 ? -14.919 25.888 9.245  1.00 0.00 ? 49 GLU A HA   5  
ATOM 4359  H HB2  . GLU A 1 49 ? -13.436 23.284 8.745  1.00 0.00 ? 49 GLU A HB2  5  
ATOM 4360  H HB3  . GLU A 1 49 ? -13.664 24.579 7.570  1.00 0.00 ? 49 GLU A HB3  5  
ATOM 4361  H HG2  . GLU A 1 49 ? -12.448 25.288 10.207 1.00 0.00 ? 49 GLU A HG2  5  
ATOM 4362  H HG3  . GLU A 1 49 ? -11.445 24.419 9.046  1.00 0.00 ? 49 GLU A HG3  5  
ATOM 4363  N N    . LYS A 1 50 ? -16.414 23.063 9.678  1.00 0.00 ? 50 LYS A N    5  
ATOM 4364  C CA   . LYS A 1 50 ? -17.619 22.270 9.305  1.00 0.00 ? 50 LYS A CA   5  
ATOM 4365  C C    . LYS A 1 50 ? -18.876 23.137 9.423  1.00 0.00 ? 50 LYS A C    5  
ATOM 4366  O O    . LYS A 1 50 ? -19.783 23.046 8.620  1.00 0.00 ? 50 LYS A O    5  
ATOM 4367  C CB   . LYS A 1 50 ? -17.661 21.123 10.316 1.00 0.00 ? 50 LYS A CB   5  
ATOM 4368  C CG   . LYS A 1 50 ? -18.829 20.192 9.986  1.00 0.00 ? 50 LYS A CG   5  
ATOM 4369  C CD   . LYS A 1 50 ? -20.127 20.790 10.535 1.00 0.00 ? 50 LYS A CD   5  
ATOM 4370  C CE   . LYS A 1 50 ? -21.140 19.669 10.780 1.00 0.00 ? 50 LYS A CE   5  
ATOM 4371  N NZ   . LYS A 1 50 ? -22.261 20.323 11.514 1.00 0.00 ? 50 LYS A NZ   5  
ATOM 4372  H H    . LYS A 1 50 ? -15.912 22.836 10.489 1.00 0.00 ? 50 LYS A H    5  
ATOM 4373  H HA   . LYS A 1 50 ? -17.522 21.880 8.305  1.00 0.00 ? 50 LYS A HA   5  
ATOM 4374  H HB2  . LYS A 1 50 ? -16.735 20.568 10.267 1.00 0.00 ? 50 LYS A HB2  5  
ATOM 4375  H HB3  . LYS A 1 50 ? -17.788 21.523 11.310 1.00 0.00 ? 50 LYS A HB3  5  
ATOM 4376  H HG2  . LYS A 1 50 ? -18.909 20.078 8.915  1.00 0.00 ? 50 LYS A HG2  5  
ATOM 4377  H HG3  . LYS A 1 50 ? -18.658 19.227 10.440 1.00 0.00 ? 50 LYS A HG3  5  
ATOM 4378  H HD2  . LYS A 1 50 ? -19.924 21.301 11.464 1.00 0.00 ? 50 LYS A HD2  5  
ATOM 4379  H HD3  . LYS A 1 50 ? -20.531 21.490 9.819  1.00 0.00 ? 50 LYS A HD3  5  
ATOM 4380  H HE2  . LYS A 1 50 ? -21.490 19.266 9.841  1.00 0.00 ? 50 LYS A HE2  5  
ATOM 4381  H HE3  . LYS A 1 50 ? -20.700 18.889 11.384 1.00 0.00 ? 50 LYS A HE3  5  
ATOM 4382  H HZ1  . LYS A 1 50 ? -22.344 21.314 11.211 1.00 0.00 ? 50 LYS A HZ1  5  
ATOM 4383  H HZ2  . LYS A 1 50 ? -23.149 19.821 11.307 1.00 0.00 ? 50 LYS A HZ2  5  
ATOM 4384  H HZ3  . LYS A 1 50 ? -22.073 20.290 12.535 1.00 0.00 ? 50 LYS A HZ3  5  
ATOM 4385  N N    . GLU A 1 51 ? -18.936 23.977 10.421 1.00 0.00 ? 51 GLU A N    5  
ATOM 4386  C CA   . GLU A 1 51 ? -20.133 24.849 10.589 1.00 0.00 ? 51 GLU A CA   5  
ATOM 4387  C C    . GLU A 1 51 ? -20.215 25.859 9.441  1.00 0.00 ? 51 GLU A C    5  
ATOM 4388  O O    . GLU A 1 51 ? -21.283 26.289 9.053  1.00 0.00 ? 51 GLU A O    5  
ATOM 4389  C CB   . GLU A 1 51 ? -19.917 25.568 11.921 1.00 0.00 ? 51 GLU A CB   5  
ATOM 4390  C CG   . GLU A 1 51 ? -21.114 26.474 12.212 1.00 0.00 ? 51 GLU A CG   5  
ATOM 4391  C CD   . GLU A 1 51 ? -20.940 27.125 13.586 1.00 0.00 ? 51 GLU A CD   5  
ATOM 4392  O OE1  . GLU A 1 51 ? -21.230 26.467 14.572 1.00 0.00 ? 51 GLU A OE1  5  
ATOM 4393  O OE2  . GLU A 1 51 ? -20.520 28.269 13.630 1.00 0.00 ? 51 GLU A OE2  5  
ATOM 4394  H H    . GLU A 1 51 ? -18.193 24.036 11.059 1.00 0.00 ? 51 GLU A H    5  
ATOM 4395  H HA   . GLU A 1 51 ? -21.030 24.254 10.632 1.00 0.00 ? 51 GLU A HA   5  
ATOM 4396  H HB2  . GLU A 1 51 ? -19.817 24.838 12.712 1.00 0.00 ? 51 GLU A HB2  5  
ATOM 4397  H HB3  . GLU A 1 51 ? -19.019 26.165 11.867 1.00 0.00 ? 51 GLU A HB3  5  
ATOM 4398  H HG2  . GLU A 1 51 ? -21.177 27.243 11.456 1.00 0.00 ? 51 GLU A HG2  5  
ATOM 4399  H HG3  . GLU A 1 51 ? -22.021 25.888 12.204 1.00 0.00 ? 51 GLU A HG3  5  
ATOM 4400  N N    . ALA A 1 52 ? -19.093 26.239 8.896  1.00 0.00 ? 52 ALA A N    5  
ATOM 4401  C CA   . ALA A 1 52 ? -19.102 27.219 7.772  1.00 0.00 ? 52 ALA A CA   5  
ATOM 4402  C C    . ALA A 1 52 ? -19.445 26.515 6.457  1.00 0.00 ? 52 ALA A C    5  
ATOM 4403  O O    . ALA A 1 52 ? -19.967 27.114 5.539  1.00 0.00 ? 52 ALA A O    5  
ATOM 4404  C CB   . ALA A 1 52 ? -17.681 27.781 7.726  1.00 0.00 ? 52 ALA A CB   5  
ATOM 4405  H H    . ALA A 1 52 ? -18.243 25.879 9.225  1.00 0.00 ? 52 ALA A H    5  
ATOM 4406  H HA   . ALA A 1 52 ? -19.805 28.012 7.970  1.00 0.00 ? 52 ALA A HA   5  
ATOM 4407  H HB1  . ALA A 1 52 ? -17.559 28.519 8.506  1.00 0.00 ? 52 ALA A HB1  5  
ATOM 4408  H HB2  . ALA A 1 52 ? -16.972 26.980 7.875  1.00 0.00 ? 52 ALA A HB2  5  
ATOM 4409  H HB3  . ALA A 1 52 ? -17.507 28.242 6.764  1.00 0.00 ? 52 ALA A HB3  5  
ATOM 4410  N N    . LYS A 1 53 ? -19.153 25.247 6.360  1.00 0.00 ? 53 LYS A N    5  
ATOM 4411  C CA   . LYS A 1 53 ? -19.461 24.506 5.103  1.00 0.00 ? 53 LYS A CA   5  
ATOM 4412  C C    . LYS A 1 53 ? -20.971 24.281 4.977  1.00 0.00 ? 53 LYS A C    5  
ATOM 4413  O O    . LYS A 1 53 ? -21.504 24.178 3.891  1.00 0.00 ? 53 LYS A O    5  
ATOM 4414  C CB   . LYS A 1 53 ? -18.730 23.170 5.240  1.00 0.00 ? 53 LYS A CB   5  
ATOM 4415  C CG   . LYS A 1 53 ? -19.038 22.293 4.024  1.00 0.00 ? 53 LYS A CG   5  
ATOM 4416  C CD   . LYS A 1 53 ? -18.252 20.984 4.128  1.00 0.00 ? 53 LYS A CD   5  
ATOM 4417  C CE   . LYS A 1 53 ? -18.666 20.048 2.990  1.00 0.00 ? 53 LYS A CE   5  
ATOM 4418  N NZ   . LYS A 1 53 ? -17.742 18.885 3.097  1.00 0.00 ? 53 LYS A NZ   5  
ATOM 4419  H H    . LYS A 1 53 ? -18.731 24.782 7.112  1.00 0.00 ? 53 LYS A H    5  
ATOM 4420  H HA   . LYS A 1 53 ? -19.088 25.043 4.246  1.00 0.00 ? 53 LYS A HA   5  
ATOM 4421  H HB2  . LYS A 1 53 ? -17.666 23.346 5.298  1.00 0.00 ? 53 LYS A HB2  5  
ATOM 4422  H HB3  . LYS A 1 53 ? -19.061 22.669 6.138  1.00 0.00 ? 53 LYS A HB3  5  
ATOM 4423  H HG2  . LYS A 1 53 ? -20.096 22.077 3.995  1.00 0.00 ? 53 LYS A HG2  5  
ATOM 4424  H HG3  . LYS A 1 53 ? -18.751 22.814 3.123  1.00 0.00 ? 53 LYS A HG3  5  
ATOM 4425  H HD2  . LYS A 1 53 ? -17.194 21.191 4.056  1.00 0.00 ? 53 LYS A HD2  5  
ATOM 4426  H HD3  . LYS A 1 53 ? -18.463 20.511 5.076  1.00 0.00 ? 53 LYS A HD3  5  
ATOM 4427  H HE2  . LYS A 1 53 ? -19.689 19.729 3.121  1.00 0.00 ? 53 LYS A HE2  5  
ATOM 4428  H HE3  . LYS A 1 53 ? -18.543 20.541 2.036  1.00 0.00 ? 53 LYS A HE3  5  
ATOM 4429  H HZ1  . LYS A 1 53 ? -16.766 19.224 3.209  1.00 0.00 ? 53 LYS A HZ1  5  
ATOM 4430  H HZ2  . LYS A 1 53 ? -18.006 18.307 3.922  1.00 0.00 ? 53 LYS A HZ2  5  
ATOM 4431  H HZ3  . LYS A 1 53 ? -17.808 18.308 2.234  1.00 0.00 ? 53 LYS A HZ3  5  
ATOM 4432  N N    . SER A 1 54 ? -21.662 24.204 6.081  1.00 0.00 ? 54 SER A N    5  
ATOM 4433  C CA   . SER A 1 54 ? -23.136 23.986 6.024  1.00 0.00 ? 54 SER A CA   5  
ATOM 4434  C C    . SER A 1 54 ? -23.842 25.262 5.555  1.00 0.00 ? 54 SER A C    5  
ATOM 4435  O O    . SER A 1 54 ? -24.994 25.239 5.169  1.00 0.00 ? 54 SER A O    5  
ATOM 4436  C CB   . SER A 1 54 ? -23.543 23.644 7.457  1.00 0.00 ? 54 SER A CB   5  
ATOM 4437  O OG   . SER A 1 54 ? -23.297 24.763 8.297  1.00 0.00 ? 54 SER A OG   5  
ATOM 4438  H H    . SER A 1 54 ? -21.213 24.289 6.948  1.00 0.00 ? 54 SER A H    5  
ATOM 4439  H HA   . SER A 1 54 ? -23.371 23.162 5.368  1.00 0.00 ? 54 SER A HA   5  
ATOM 4440  H HB2  . SER A 1 54 ? -24.593 23.397 7.485  1.00 0.00 ? 54 SER A HB2  5  
ATOM 4441  H HB3  . SER A 1 54 ? -22.964 22.800 7.803  1.00 0.00 ? 54 SER A HB3  5  
ATOM 4442  H HG   . SER A 1 54 ? -22.483 25.178 8.008  1.00 0.00 ? 54 SER A HG   5  
ATOM 4443  N N    . GLN A 1 55 ? -23.160 26.373 5.585  1.00 0.00 ? 55 GLN A N    5  
ATOM 4444  C CA   . GLN A 1 55 ? -23.793 27.649 5.140  1.00 0.00 ? 55 GLN A CA   5  
ATOM 4445  C C    . GLN A 1 55 ? -23.475 27.912 3.666  1.00 0.00 ? 55 GLN A C    5  
ATOM 4446  O O    . GLN A 1 55 ? -22.871 27.050 3.048  1.00 0.00 ? 55 GLN A O    5  
ATOM 4447  C CB   . GLN A 1 55 ? -23.170 28.729 6.025  1.00 0.00 ? 55 GLN A CB   5  
ATOM 4448  C CG   . GLN A 1 55 ? -23.509 28.446 7.490  1.00 0.00 ? 55 GLN A CG   5  
ATOM 4449  C CD   . GLN A 1 55 ? -25.026 28.351 7.654  1.00 0.00 ? 55 GLN A CD   5  
ATOM 4450  O OE1  . GLN A 1 55 ? -25.632 27.375 7.255  1.00 0.00 ? 55 GLN A OE1  5  
ATOM 4451  N NE2  . GLN A 1 55 ? -25.673 29.329 8.228  1.00 0.00 ? 55 GLN A NE2  5  
ATOM 4452  O OXT  . GLN A 1 55 ? -23.841 28.969 3.181  1.00 0.00 ? 55 GLN A OXT  5  
ATOM 4453  H H    . GLN A 1 55 ? -22.232 26.370 5.900  1.00 0.00 ? 55 GLN A H    5  
ATOM 4454  H HA   . GLN A 1 55 ? -24.859 27.615 5.297  1.00 0.00 ? 55 GLN A HA   5  
ATOM 4455  H HB2  . GLN A 1 55 ? -22.097 28.725 5.896  1.00 0.00 ? 55 GLN A HB2  5  
ATOM 4456  H HB3  . GLN A 1 55 ? -23.562 29.695 5.744  1.00 0.00 ? 55 GLN A HB3  5  
ATOM 4457  H HG2  . GLN A 1 55 ? -23.054 27.514 7.791  1.00 0.00 ? 55 GLN A HG2  5  
ATOM 4458  H HG3  . GLN A 1 55 ? -23.130 29.248 8.108  1.00 0.00 ? 55 GLN A HG3  5  
ATOM 4459  H HE21 . GLN A 1 55 ? -25.185 30.116 8.550  1.00 0.00 ? 55 GLN A HE21 5  
ATOM 4460  H HE22 . GLN A 1 55 ? -26.644 29.276 8.337  1.00 0.00 ? 55 GLN A HE22 5  
ATOM 4461  N N    . LYS A 1 1  ? -31.743 18.939 18.493 1.00 0.00 ? 1  LYS A N    6  
ATOM 4462  C CA   . LYS A 1 1  ? -30.762 18.143 17.701 1.00 0.00 ? 1  LYS A CA   6  
ATOM 4463  C C    . LYS A 1 1  ? -29.332 18.539 18.075 1.00 0.00 ? 1  LYS A C    6  
ATOM 4464  O O    . LYS A 1 1  ? -29.097 19.168 19.088 1.00 0.00 ? 1  LYS A O    6  
ATOM 4465  C CB   . LYS A 1 1  ? -31.051 18.495 16.242 1.00 0.00 ? 1  LYS A CB   6  
ATOM 4466  C CG   . LYS A 1 1  ? -30.556 19.913 15.951 1.00 0.00 ? 1  LYS A CG   6  
ATOM 4467  C CD   . LYS A 1 1  ? -30.915 20.294 14.513 1.00 0.00 ? 1  LYS A CD   6  
ATOM 4468  C CE   . LYS A 1 1  ? -30.053 19.486 13.541 1.00 0.00 ? 1  LYS A CE   6  
ATOM 4469  N NZ   . LYS A 1 1  ? -30.540 19.874 12.187 1.00 0.00 ? 1  LYS A NZ   6  
ATOM 4470  H H1   . LYS A 1 1  ? -31.388 19.911 18.607 1.00 0.00 ? 1  LYS A H1   6  
ATOM 4471  H H2   . LYS A 1 1  ? -32.656 18.960 17.995 1.00 0.00 ? 1  LYS A H2   6  
ATOM 4472  H H3   . LYS A 1 1  ? -31.869 18.503 19.428 1.00 0.00 ? 1  LYS A H3   6  
ATOM 4473  H HA   . LYS A 1 1  ? -30.916 17.088 17.862 1.00 0.00 ? 1  LYS A HA   6  
ATOM 4474  H HB2  . LYS A 1 1  ? -30.542 17.797 15.595 1.00 0.00 ? 1  LYS A HB2  6  
ATOM 4475  H HB3  . LYS A 1 1  ? -32.115 18.441 16.062 1.00 0.00 ? 1  LYS A HB3  6  
ATOM 4476  H HG2  . LYS A 1 1  ? -31.026 20.606 16.635 1.00 0.00 ? 1  LYS A HG2  6  
ATOM 4477  H HG3  . LYS A 1 1  ? -29.485 19.953 16.077 1.00 0.00 ? 1  LYS A HG3  6  
ATOM 4478  H HD2  . LYS A 1 1  ? -31.959 20.079 14.334 1.00 0.00 ? 1  LYS A HD2  6  
ATOM 4479  H HD3  . LYS A 1 1  ? -30.734 21.348 14.364 1.00 0.00 ? 1  LYS A HD3  6  
ATOM 4480  H HE2  . LYS A 1 1  ? -29.012 19.748 13.655 1.00 0.00 ? 1  LYS A HE2  6  
ATOM 4481  H HE3  . LYS A 1 1  ? -30.197 18.428 13.703 1.00 0.00 ? 1  LYS A HE3  6  
ATOM 4482  H HZ1  . LYS A 1 1  ? -31.537 20.160 12.245 1.00 0.00 ? 1  LYS A HZ1  6  
ATOM 4483  H HZ2  . LYS A 1 1  ? -29.971 20.668 11.829 1.00 0.00 ? 1  LYS A HZ2  6  
ATOM 4484  H HZ3  . LYS A 1 1  ? -30.452 19.065 11.541 1.00 0.00 ? 1  LYS A HZ3  6  
ATOM 4485  N N    . ASN A 1 2  ? -28.374 18.175 17.267 1.00 0.00 ? 2  ASN A N    6  
ATOM 4486  C CA   . ASN A 1 2  ? -26.961 18.532 17.578 1.00 0.00 ? 2  ASN A CA   6  
ATOM 4487  C C    . ASN A 1 2  ? -26.575 19.831 16.868 1.00 0.00 ? 2  ASN A C    6  
ATOM 4488  O O    . ASN A 1 2  ? -26.995 20.093 15.757 1.00 0.00 ? 2  ASN A O    6  
ATOM 4489  C CB   . ASN A 1 2  ? -26.132 17.362 17.044 1.00 0.00 ? 2  ASN A CB   6  
ATOM 4490  C CG   . ASN A 1 2  ? -26.458 16.100 17.845 1.00 0.00 ? 2  ASN A CG   6  
ATOM 4491  O OD1  . ASN A 1 2  ? -26.585 15.028 17.285 1.00 0.00 ? 2  ASN A OD1  6  
ATOM 4492  N ND2  . ASN A 1 2  ? -26.600 16.180 19.139 1.00 0.00 ? 2  ASN A ND2  6  
ATOM 4493  H H    . ASN A 1 2  ? -28.586 17.668 16.455 1.00 0.00 ? 2  ASN A H    6  
ATOM 4494  H HA   . ASN A 1 2  ? -26.821 18.627 18.643 1.00 0.00 ? 2  ASN A HA   6  
ATOM 4495  H HB2  . ASN A 1 2  ? -26.368 17.200 16.003 1.00 0.00 ? 2  ASN A HB2  6  
ATOM 4496  H HB3  . ASN A 1 2  ? -25.081 17.591 17.144 1.00 0.00 ? 2  ASN A HB3  6  
ATOM 4497  H HD21 . ASN A 1 2  ? -26.499 17.044 19.591 1.00 0.00 ? 2  ASN A HD21 6  
ATOM 4498  H HD22 . ASN A 1 2  ? -26.809 15.377 19.660 1.00 0.00 ? 2  ASN A HD22 6  
ATOM 4499  N N    . GLU A 1 3  ? -25.779 20.650 17.500 1.00 0.00 ? 3  GLU A N    6  
ATOM 4500  C CA   . GLU A 1 3  ? -25.367 21.933 16.861 1.00 0.00 ? 3  GLU A CA   6  
ATOM 4501  C C    . GLU A 1 3  ? -24.296 21.677 15.797 1.00 0.00 ? 3  GLU A C    6  
ATOM 4502  O O    . GLU A 1 3  ? -24.044 22.506 14.946 1.00 0.00 ? 3  GLU A O    6  
ATOM 4503  C CB   . GLU A 1 3  ? -24.799 22.779 18.000 1.00 0.00 ? 3  GLU A CB   6  
ATOM 4504  C CG   . GLU A 1 3  ? -25.946 23.312 18.860 1.00 0.00 ? 3  GLU A CG   6  
ATOM 4505  C CD   . GLU A 1 3  ? -25.380 24.187 19.980 1.00 0.00 ? 3  GLU A CD   6  
ATOM 4506  O OE1  . GLU A 1 3  ? -24.180 24.407 19.983 1.00 0.00 ? 3  GLU A OE1  6  
ATOM 4507  O OE2  . GLU A 1 3  ? -26.155 24.622 20.815 1.00 0.00 ? 3  GLU A OE2  6  
ATOM 4508  H H    . GLU A 1 3  ? -25.451 20.422 18.395 1.00 0.00 ? 3  GLU A H    6  
ATOM 4509  H HA   . GLU A 1 3  ? -26.221 22.428 16.425 1.00 0.00 ? 3  GLU A HA   6  
ATOM 4510  H HB2  . GLU A 1 3  ? -24.146 22.170 18.609 1.00 0.00 ? 3  GLU A HB2  6  
ATOM 4511  H HB3  . GLU A 1 3  ? -24.241 23.607 17.590 1.00 0.00 ? 3  GLU A HB3  6  
ATOM 4512  H HG2  . GLU A 1 3  ? -26.613 23.900 18.246 1.00 0.00 ? 3  GLU A HG2  6  
ATOM 4513  H HG3  . GLU A 1 3  ? -26.489 22.483 19.291 1.00 0.00 ? 3  GLU A HG3  6  
ATOM 4514  N N    . ASP A 1 4  ? -23.663 20.537 15.839 1.00 0.00 ? 4  ASP A N    6  
ATOM 4515  C CA   . ASP A 1 4  ? -22.610 20.233 14.828 1.00 0.00 ? 4  ASP A CA   6  
ATOM 4516  C C    . ASP A 1 4  ? -21.675 21.433 14.667 1.00 0.00 ? 4  ASP A C    6  
ATOM 4517  O O    . ASP A 1 4  ? -21.045 21.611 13.643 1.00 0.00 ? 4  ASP A O    6  
ATOM 4518  C CB   . ASP A 1 4  ? -23.371 19.973 13.531 1.00 0.00 ? 4  ASP A CB   6  
ATOM 4519  C CG   . ASP A 1 4  ? -23.980 18.570 13.569 1.00 0.00 ? 4  ASP A CG   6  
ATOM 4520  O OD1  . ASP A 1 4  ? -23.574 17.792 14.417 1.00 0.00 ? 4  ASP A OD1  6  
ATOM 4521  O OD2  . ASP A 1 4  ? -24.843 18.298 12.750 1.00 0.00 ? 4  ASP A OD2  6  
ATOM 4522  H H    . ASP A 1 4  ? -23.880 19.880 16.534 1.00 0.00 ? 4  ASP A H    6  
ATOM 4523  H HA   . ASP A 1 4  ? -22.053 19.355 15.113 1.00 0.00 ? 4  ASP A HA   6  
ATOM 4524  H HB2  . ASP A 1 4  ? -24.157 20.705 13.424 1.00 0.00 ? 4  ASP A HB2  6  
ATOM 4525  H HB3  . ASP A 1 4  ? -22.692 20.049 12.696 1.00 0.00 ? 4  ASP A HB3  6  
ATOM 4526  N N    . GLN A 1 5  ? -21.578 22.257 15.672 1.00 0.00 ? 5  GLN A N    6  
ATOM 4527  C CA   . GLN A 1 5  ? -20.681 23.447 15.581 1.00 0.00 ? 5  GLN A CA   6  
ATOM 4528  C C    . GLN A 1 5  ? -19.665 23.417 16.724 1.00 0.00 ? 5  GLN A C    6  
ATOM 4529  O O    . GLN A 1 5  ? -18.686 24.137 16.723 1.00 0.00 ? 5  GLN A O    6  
ATOM 4530  C CB   . GLN A 1 5  ? -21.608 24.655 15.717 1.00 0.00 ? 5  GLN A CB   6  
ATOM 4531  C CG   . GLN A 1 5  ? -22.152 25.037 14.339 1.00 0.00 ? 5  GLN A CG   6  
ATOM 4532  C CD   . GLN A 1 5  ? -23.164 26.174 14.488 1.00 0.00 ? 5  GLN A CD   6  
ATOM 4533  O OE1  . GLN A 1 5  ? -22.803 27.333 14.449 1.00 0.00 ? 5  GLN A OE1  6  
ATOM 4534  N NE2  . GLN A 1 5  ? -24.427 25.889 14.658 1.00 0.00 ? 5  GLN A NE2  6  
ATOM 4535  H H    . GLN A 1 5  ? -22.093 22.090 16.490 1.00 0.00 ? 5  GLN A H    6  
ATOM 4536  H HA   . GLN A 1 5  ? -20.179 23.470 14.628 1.00 0.00 ? 5  GLN A HA   6  
ATOM 4537  H HB2  . GLN A 1 5  ? -22.430 24.407 16.373 1.00 0.00 ? 5  GLN A HB2  6  
ATOM 4538  H HB3  . GLN A 1 5  ? -21.057 25.487 16.129 1.00 0.00 ? 5  GLN A HB3  6  
ATOM 4539  H HG2  . GLN A 1 5  ? -21.338 25.359 13.706 1.00 0.00 ? 5  GLN A HG2  6  
ATOM 4540  H HG3  . GLN A 1 5  ? -22.636 24.179 13.894 1.00 0.00 ? 5  GLN A HG3  6  
ATOM 4541  H HE21 . GLN A 1 5  ? -24.718 24.954 14.689 1.00 0.00 ? 5  GLN A HE21 6  
ATOM 4542  H HE22 . GLN A 1 5  ? -25.083 26.611 14.754 1.00 0.00 ? 5  GLN A HE22 6  
ATOM 4543  N N    . GLU A 1 6  ? -19.894 22.580 17.695 1.00 0.00 ? 6  GLU A N    6  
ATOM 4544  C CA   . GLU A 1 6  ? -18.952 22.480 18.844 1.00 0.00 ? 6  GLU A CA   6  
ATOM 4545  C C    . GLU A 1 6  ? -18.874 21.025 19.300 1.00 0.00 ? 6  GLU A C    6  
ATOM 4546  O O    . GLU A 1 6  ? -18.580 20.732 20.442 1.00 0.00 ? 6  GLU A O    6  
ATOM 4547  C CB   . GLU A 1 6  ? -19.562 23.357 19.938 1.00 0.00 ? 6  GLU A CB   6  
ATOM 4548  C CG   . GLU A 1 6  ? -20.958 22.838 20.288 1.00 0.00 ? 6  GLU A CG   6  
ATOM 4549  C CD   . GLU A 1 6  ? -21.459 23.536 21.554 1.00 0.00 ? 6  GLU A CD   6  
ATOM 4550  O OE1  . GLU A 1 6  ? -20.725 24.352 22.087 1.00 0.00 ? 6  GLU A OE1  6  
ATOM 4551  O OE2  . GLU A 1 6  ? -22.568 23.242 21.970 1.00 0.00 ? 6  GLU A OE2  6  
ATOM 4552  H H    . GLU A 1 6  ? -20.688 22.008 17.667 1.00 0.00 ? 6  GLU A H    6  
ATOM 4553  H HA   . GLU A 1 6  ? -17.976 22.847 18.569 1.00 0.00 ? 6  GLU A HA   6  
ATOM 4554  H HB2  . GLU A 1 6  ? -18.935 23.324 20.816 1.00 0.00 ? 6  GLU A HB2  6  
ATOM 4555  H HB3  . GLU A 1 6  ? -19.633 24.375 19.584 1.00 0.00 ? 6  GLU A HB3  6  
ATOM 4556  H HG2  . GLU A 1 6  ? -21.634 23.047 19.472 1.00 0.00 ? 6  GLU A HG2  6  
ATOM 4557  H HG3  . GLU A 1 6  ? -20.914 21.773 20.457 1.00 0.00 ? 6  GLU A HG3  6  
ATOM 4558  N N    . MET A 1 7  ? -19.147 20.111 18.408 1.00 0.00 ? 7  MET A N    6  
ATOM 4559  C CA   . MET A 1 7  ? -19.105 18.668 18.771 1.00 0.00 ? 7  MET A CA   6  
ATOM 4560  C C    . MET A 1 7  ? -17.901 18.380 19.672 1.00 0.00 ? 7  MET A C    6  
ATOM 4561  O O    . MET A 1 7  ? -18.011 17.695 20.670 1.00 0.00 ? 7  MET A O    6  
ATOM 4562  C CB   . MET A 1 7  ? -18.965 17.931 17.439 1.00 0.00 ? 7  MET A CB   6  
ATOM 4563  C CG   . MET A 1 7  ? -20.242 18.114 16.618 1.00 0.00 ? 7  MET A CG   6  
ATOM 4564  S SD   . MET A 1 7  ? -19.980 17.475 14.945 1.00 0.00 ? 7  MET A SD   6  
ATOM 4565  C CE   . MET A 1 7  ? -19.443 15.813 15.419 1.00 0.00 ? 7  MET A CE   6  
ATOM 4566  H H    . MET A 1 7  ? -19.389 20.377 17.496 1.00 0.00 ? 7  MET A H    6  
ATOM 4567  H HA   . MET A 1 7  ? -20.023 18.379 19.256 1.00 0.00 ? 7  MET A HA   6  
ATOM 4568  H HB2  . MET A 1 7  ? -18.125 18.333 16.892 1.00 0.00 ? 7  MET A HB2  6  
ATOM 4569  H HB3  . MET A 1 7  ? -18.804 16.879 17.625 1.00 0.00 ? 7  MET A HB3  6  
ATOM 4570  H HG2  . MET A 1 7  ? -21.053 17.575 17.086 1.00 0.00 ? 7  MET A HG2  6  
ATOM 4571  H HG3  . MET A 1 7  ? -20.490 19.164 16.567 1.00 0.00 ? 7  MET A HG3  6  
ATOM 4572  H HE1  . MET A 1 7  ? -19.776 15.598 16.421 1.00 0.00 ? 7  MET A HE1  6  
ATOM 4573  H HE2  . MET A 1 7  ? -19.870 15.090 14.738 1.00 0.00 ? 7  MET A HE2  6  
ATOM 4574  H HE3  . MET A 1 7  ? -18.364 15.760 15.380 1.00 0.00 ? 7  MET A HE3  6  
ATOM 4575  N N    . CYS A 1 8  ? -16.753 18.896 19.327 1.00 0.00 ? 8  CYS A N    6  
ATOM 4576  C CA   . CYS A 1 8  ? -15.544 18.650 20.164 1.00 0.00 ? 8  CYS A CA   6  
ATOM 4577  C C    . CYS A 1 8  ? -15.437 19.706 21.267 1.00 0.00 ? 8  CYS A C    6  
ATOM 4578  O O    . CYS A 1 8  ? -15.427 20.893 21.005 1.00 0.00 ? 8  CYS A O    6  
ATOM 4579  C CB   . CYS A 1 8  ? -14.364 18.761 19.198 1.00 0.00 ? 8  CYS A CB   6  
ATOM 4580  S SG   . CYS A 1 8  ? -12.831 18.355 20.069 1.00 0.00 ? 8  CYS A SG   6  
ATOM 4581  H H    . CYS A 1 8  ? -16.686 19.445 18.518 1.00 0.00 ? 8  CYS A H    6  
ATOM 4582  H HA   . CYS A 1 8  ? -15.577 17.660 20.591 1.00 0.00 ? 8  CYS A HA   6  
ATOM 4583  H HB2  . CYS A 1 8  ? -14.505 18.073 18.377 1.00 0.00 ? 8  CYS A HB2  6  
ATOM 4584  H HB3  . CYS A 1 8  ? -14.306 19.770 18.816 1.00 0.00 ? 8  CYS A HB3  6  
ATOM 4585  N N    . HIS A 1 9  ? -15.356 19.283 22.498 1.00 0.00 ? 9  HIS A N    6  
ATOM 4586  C CA   . HIS A 1 9  ? -15.249 20.262 23.618 1.00 0.00 ? 9  HIS A CA   6  
ATOM 4587  C C    . HIS A 1 9  ? -13.847 20.211 24.231 1.00 0.00 ? 9  HIS A C    6  
ATOM 4588  O O    . HIS A 1 9  ? -13.448 21.088 24.969 1.00 0.00 ? 9  HIS A O    6  
ATOM 4589  C CB   . HIS A 1 9  ? -16.296 19.813 24.638 1.00 0.00 ? 9  HIS A CB   6  
ATOM 4590  C CG   . HIS A 1 9  ? -15.974 18.419 25.103 1.00 0.00 ? 9  HIS A CG   6  
ATOM 4591  N ND1  . HIS A 1 9  ? -15.025 18.168 26.083 1.00 0.00 ? 9  HIS A ND1  6  
ATOM 4592  C CD2  . HIS A 1 9  ? -16.464 17.191 24.733 1.00 0.00 ? 9  HIS A CD2  6  
ATOM 4593  C CE1  . HIS A 1 9  ? -14.976 16.836 26.267 1.00 0.00 ? 9  HIS A CE1  6  
ATOM 4594  N NE2  . HIS A 1 9  ? -15.833 16.193 25.469 1.00 0.00 ? 9  HIS A NE2  6  
ATOM 4595  H H    . HIS A 1 9  ? -15.365 18.322 22.688 1.00 0.00 ? 9  HIS A H    6  
ATOM 4596  H HA   . HIS A 1 9  ? -15.474 21.258 23.272 1.00 0.00 ? 9  HIS A HA   6  
ATOM 4597  H HB2  . HIS A 1 9  ? -16.288 20.485 25.482 1.00 0.00 ? 9  HIS A HB2  6  
ATOM 4598  H HB3  . HIS A 1 9  ? -17.272 19.821 24.178 1.00 0.00 ? 9  HIS A HB3  6  
ATOM 4599  H HD1  . HIS A 1 9  ? -14.488 18.838 26.555 1.00 0.00 ? 9  HIS A HD1  6  
ATOM 4600  H HD2  . HIS A 1 9  ? -17.225 17.026 23.985 1.00 0.00 ? 9  HIS A HD2  6  
ATOM 4601  H HE1  . HIS A 1 9  ? -14.323 16.345 26.974 1.00 0.00 ? 9  HIS A HE1  6  
ATOM 4602  N N    . GLU A 1 10 ? -13.098 19.185 23.931 1.00 0.00 ? 10 GLU A N    6  
ATOM 4603  C CA   . GLU A 1 10 ? -11.723 19.074 24.498 1.00 0.00 ? 10 GLU A CA   6  
ATOM 4604  C C    . GLU A 1 10 ? -10.829 20.187 23.945 1.00 0.00 ? 10 GLU A C    6  
ATOM 4605  O O    . GLU A 1 10 ? -10.065 20.797 24.667 1.00 0.00 ? 10 GLU A O    6  
ATOM 4606  C CB   . GLU A 1 10 ? -11.217 17.706 24.041 1.00 0.00 ? 10 GLU A CB   6  
ATOM 4607  C CG   . GLU A 1 10 ? -9.751  17.545 24.447 1.00 0.00 ? 10 GLU A CG   6  
ATOM 4608  C CD   . GLU A 1 10 ? -9.634  17.600 25.971 1.00 0.00 ? 10 GLU A CD   6  
ATOM 4609  O OE1  . GLU A 1 10 ? -10.630 17.354 26.631 1.00 0.00 ? 10 GLU A OE1  6  
ATOM 4610  O OE2  . GLU A 1 10 ? -8.551  17.889 26.453 1.00 0.00 ? 10 GLU A OE2  6  
ATOM 4611  H H    . GLU A 1 10 ? -13.439 18.486 23.335 1.00 0.00 ? 10 GLU A H    6  
ATOM 4612  H HA   . GLU A 1 10 ? -11.755 19.114 25.575 1.00 0.00 ? 10 GLU A HA   6  
ATOM 4613  H HB2  . GLU A 1 10 ? -11.806 16.930 24.506 1.00 0.00 ? 10 GLU A HB2  6  
ATOM 4614  H HB3  . GLU A 1 10 ? -11.304 17.630 22.968 1.00 0.00 ? 10 GLU A HB3  6  
ATOM 4615  H HG2  . GLU A 1 10 ? -9.381  16.595 24.092 1.00 0.00 ? 10 GLU A HG2  6  
ATOM 4616  H HG3  . GLU A 1 10 ? -9.168  18.344 24.012 1.00 0.00 ? 10 GLU A HG3  6  
ATOM 4617  N N    . PHE A 1 11 ? -10.915 20.454 22.672 1.00 0.00 ? 11 PHE A N    6  
ATOM 4618  C CA   . PHE A 1 11 ? -10.067 21.525 22.075 1.00 0.00 ? 11 PHE A CA   6  
ATOM 4619  C C    . PHE A 1 11 ? -10.807 22.864 22.094 1.00 0.00 ? 11 PHE A C    6  
ATOM 4620  O O    . PHE A 1 11 ? -10.219 23.910 21.908 1.00 0.00 ? 11 PHE A O    6  
ATOM 4621  C CB   . PHE A 1 11 ? -9.818  21.072 20.638 1.00 0.00 ? 11 PHE A CB   6  
ATOM 4622  C CG   . PHE A 1 11 ? -8.796  19.960 20.629 1.00 0.00 ? 11 PHE A CG   6  
ATOM 4623  C CD1  . PHE A 1 11 ? -9.167  18.665 21.011 1.00 0.00 ? 11 PHE A CD1  6  
ATOM 4624  C CD2  . PHE A 1 11 ? -7.478  20.225 20.242 1.00 0.00 ? 11 PHE A CD2  6  
ATOM 4625  C CE1  . PHE A 1 11 ? -8.218  17.636 21.003 1.00 0.00 ? 11 PHE A CE1  6  
ATOM 4626  C CE2  . PHE A 1 11 ? -6.530  19.197 20.235 1.00 0.00 ? 11 PHE A CE2  6  
ATOM 4627  C CZ   . PHE A 1 11 ? -6.900  17.902 20.615 1.00 0.00 ? 11 PHE A CZ   6  
ATOM 4628  H H    . PHE A 1 11 ? -11.535 19.949 22.106 1.00 0.00 ? 11 PHE A H    6  
ATOM 4629  H HA   . PHE A 1 11 ? -9.131  21.602 22.604 1.00 0.00 ? 11 PHE A HA   6  
ATOM 4630  H HB2  . PHE A 1 11 ? -10.742 20.717 20.208 1.00 0.00 ? 11 PHE A HB2  6  
ATOM 4631  H HB3  . PHE A 1 11 ? -9.448  21.904 20.059 1.00 0.00 ? 11 PHE A HB3  6  
ATOM 4632  H HD1  . PHE A 1 11 ? -10.182 18.459 21.312 1.00 0.00 ? 11 PHE A HD1  6  
ATOM 4633  H HD2  . PHE A 1 11 ? -7.191  21.224 19.948 1.00 0.00 ? 11 PHE A HD2  6  
ATOM 4634  H HE1  . PHE A 1 11 ? -8.503  16.636 21.296 1.00 0.00 ? 11 PHE A HE1  6  
ATOM 4635  H HE2  . PHE A 1 11 ? -5.513  19.401 19.937 1.00 0.00 ? 11 PHE A HE2  6  
ATOM 4636  H HZ   . PHE A 1 11 ? -6.168  17.110 20.611 1.00 0.00 ? 11 PHE A HZ   6  
ATOM 4637  N N    . GLN A 1 12 ? -12.093 22.842 22.315 1.00 0.00 ? 12 GLN A N    6  
ATOM 4638  C CA   . GLN A 1 12 ? -12.861 24.119 22.344 1.00 0.00 ? 12 GLN A CA   6  
ATOM 4639  C C    . GLN A 1 12 ? -12.121 25.156 23.193 1.00 0.00 ? 12 GLN A C    6  
ATOM 4640  O O    . GLN A 1 12 ? -12.271 26.347 23.005 1.00 0.00 ? 12 GLN A O    6  
ATOM 4641  C CB   . GLN A 1 12 ? -14.204 23.762 22.980 1.00 0.00 ? 12 GLN A CB   6  
ATOM 4642  C CG   . GLN A 1 12 ? -15.144 24.966 22.896 1.00 0.00 ? 12 GLN A CG   6  
ATOM 4643  C CD   . GLN A 1 12 ? -16.565 24.531 23.266 1.00 0.00 ? 12 GLN A CD   6  
ATOM 4644  O OE1  . GLN A 1 12 ? -17.096 23.601 22.693 1.00 0.00 ? 12 GLN A OE1  6  
ATOM 4645  N NE2  . GLN A 1 12 ? -17.205 25.169 24.208 1.00 0.00 ? 12 GLN A NE2  6  
ATOM 4646  H H    . GLN A 1 12 ? -12.552 21.989 22.462 1.00 0.00 ? 12 GLN A H    6  
ATOM 4647  H HA   . GLN A 1 12 ? -13.014 24.490 21.342 1.00 0.00 ? 12 GLN A HA   6  
ATOM 4648  H HB2  . GLN A 1 12 ? -14.640 22.927 22.453 1.00 0.00 ? 12 GLN A HB2  6  
ATOM 4649  H HB3  . GLN A 1 12 ? -14.051 23.495 24.015 1.00 0.00 ? 12 GLN A HB3  6  
ATOM 4650  H HG2  . GLN A 1 12 ? -14.812 25.730 23.582 1.00 0.00 ? 12 GLN A HG2  6  
ATOM 4651  H HG3  . GLN A 1 12 ? -15.138 25.359 21.890 1.00 0.00 ? 12 GLN A HG3  6  
ATOM 4652  H HE21 . GLN A 1 12 ? -16.776 25.920 24.671 1.00 0.00 ? 12 GLN A HE21 6  
ATOM 4653  H HE22 . GLN A 1 12 ? -18.114 24.897 24.453 1.00 0.00 ? 12 GLN A HE22 6  
ATOM 4654  N N    . ALA A 1 13 ? -11.321 24.713 24.123 1.00 0.00 ? 13 ALA A N    6  
ATOM 4655  C CA   . ALA A 1 13 ? -10.569 25.672 24.984 1.00 0.00 ? 13 ALA A CA   6  
ATOM 4656  C C    . ALA A 1 13 ? -9.336  26.196 24.242 1.00 0.00 ? 13 ALA A C    6  
ATOM 4657  O O    . ALA A 1 13 ? -8.791  27.229 24.579 1.00 0.00 ? 13 ALA A O    6  
ATOM 4658  C CB   . ALA A 1 13 ? -10.152 24.860 26.210 1.00 0.00 ? 13 ALA A CB   6  
ATOM 4659  H H    . ALA A 1 13 ? -11.213 23.747 24.257 1.00 0.00 ? 13 ALA A H    6  
ATOM 4660  H HA   . ALA A 1 13 ? -11.206 26.489 25.283 1.00 0.00 ? 13 ALA A HA   6  
ATOM 4661  H HB1  . ALA A 1 13 ? -10.045 25.521 27.057 1.00 0.00 ? 13 ALA A HB1  6  
ATOM 4662  H HB2  . ALA A 1 13 ? -9.208  24.372 26.014 1.00 0.00 ? 13 ALA A HB2  6  
ATOM 4663  H HB3  . ALA A 1 13 ? -10.905 24.116 26.423 1.00 0.00 ? 13 ALA A HB3  6  
ATOM 4664  N N    . PHE A 1 14 ? -8.890  25.493 23.236 1.00 0.00 ? 14 PHE A N    6  
ATOM 4665  C CA   . PHE A 1 14 ? -7.694  25.953 22.479 1.00 0.00 ? 14 PHE A CA   6  
ATOM 4666  C C    . PHE A 1 14 ? -8.117  26.893 21.350 1.00 0.00 ? 14 PHE A C    6  
ATOM 4667  O O    . PHE A 1 14 ? -7.383  27.119 20.411 1.00 0.00 ? 14 PHE A O    6  
ATOM 4668  C CB   . PHE A 1 14 ? -7.071  24.679 21.913 1.00 0.00 ? 14 PHE A CB   6  
ATOM 4669  C CG   . PHE A 1 14 ? -6.915  23.656 23.014 1.00 0.00 ? 14 PHE A CG   6  
ATOM 4670  C CD1  . PHE A 1 14 ? -6.826  24.067 24.350 1.00 0.00 ? 14 PHE A CD1  6  
ATOM 4671  C CD2  . PHE A 1 14 ? -6.860  22.295 22.697 1.00 0.00 ? 14 PHE A CD2  6  
ATOM 4672  C CE1  . PHE A 1 14 ? -6.684  23.117 25.368 1.00 0.00 ? 14 PHE A CE1  6  
ATOM 4673  C CE2  . PHE A 1 14 ? -6.716  21.344 23.713 1.00 0.00 ? 14 PHE A CE2  6  
ATOM 4674  C CZ   . PHE A 1 14 ? -6.629  21.755 25.048 1.00 0.00 ? 14 PHE A CZ   6  
ATOM 4675  H H    . PHE A 1 14 ? -9.340  24.664 22.978 1.00 0.00 ? 14 PHE A H    6  
ATOM 4676  H HA   . PHE A 1 14 ? -6.997  26.444 23.138 1.00 0.00 ? 14 PHE A HA   6  
ATOM 4677  H HB2  . PHE A 1 14 ? -7.708  24.279 21.139 1.00 0.00 ? 14 PHE A HB2  6  
ATOM 4678  H HB3  . PHE A 1 14 ? -6.104  24.908 21.499 1.00 0.00 ? 14 PHE A HB3  6  
ATOM 4679  H HD1  . PHE A 1 14 ? -6.869  25.119 24.595 1.00 0.00 ? 14 PHE A HD1  6  
ATOM 4680  H HD2  . PHE A 1 14 ? -6.927  21.980 21.667 1.00 0.00 ? 14 PHE A HD2  6  
ATOM 4681  H HE1  . PHE A 1 14 ? -6.615  23.433 26.397 1.00 0.00 ? 14 PHE A HE1  6  
ATOM 4682  H HE2  . PHE A 1 14 ? -6.674  20.293 23.467 1.00 0.00 ? 14 PHE A HE2  6  
ATOM 4683  H HZ   . PHE A 1 14 ? -6.519  21.020 25.833 1.00 0.00 ? 14 PHE A HZ   6  
ATOM 4684  N N    . MET A 1 15 ? -9.297  27.437 21.435 1.00 0.00 ? 15 MET A N    6  
ATOM 4685  C CA   . MET A 1 15 ? -9.767  28.363 20.367 1.00 0.00 ? 15 MET A CA   6  
ATOM 4686  C C    . MET A 1 15 ? -9.207  29.767 20.596 1.00 0.00 ? 15 MET A C    6  
ATOM 4687  O O    . MET A 1 15 ? -9.067  30.218 21.715 1.00 0.00 ? 15 MET A O    6  
ATOM 4688  C CB   . MET A 1 15 ? -11.289 28.370 20.490 1.00 0.00 ? 15 MET A CB   6  
ATOM 4689  C CG   . MET A 1 15 ? -11.851 27.107 19.842 1.00 0.00 ? 15 MET A CG   6  
ATOM 4690  S SD   . MET A 1 15 ? -13.577 27.383 19.371 1.00 0.00 ? 15 MET A SD   6  
ATOM 4691  C CE   . MET A 1 15 ? -14.217 27.704 21.032 1.00 0.00 ? 15 MET A CE   6  
ATOM 4692  H H    . MET A 1 15 ? -9.876  27.235 22.199 1.00 0.00 ? 15 MET A H    6  
ATOM 4693  H HA   . MET A 1 15 ? -9.478  27.995 19.395 1.00 0.00 ? 15 MET A HA   6  
ATOM 4694  H HB2  . MET A 1 15 ? -11.566 28.393 21.534 1.00 0.00 ? 15 MET A HB2  6  
ATOM 4695  H HB3  . MET A 1 15 ? -11.688 29.240 19.991 1.00 0.00 ? 15 MET A HB3  6  
ATOM 4696  H HG2  . MET A 1 15 ? -11.271 26.866 18.965 1.00 0.00 ? 15 MET A HG2  6  
ATOM 4697  H HG3  . MET A 1 15 ? -11.796 26.291 20.544 1.00 0.00 ? 15 MET A HG3  6  
ATOM 4698  H HE1  . MET A 1 15 ? -13.831 26.960 21.715 1.00 0.00 ? 15 MET A HE1  6  
ATOM 4699  H HE2  . MET A 1 15 ? -13.905 28.683 21.357 1.00 0.00 ? 15 MET A HE2  6  
ATOM 4700  H HE3  . MET A 1 15 ? -15.297 27.660 21.016 1.00 0.00 ? 15 MET A HE3  6  
ATOM 4701  N N    . LYS A 1 16 ? -8.892  30.461 19.541 1.00 0.00 ? 16 LYS A N    6  
ATOM 4702  C CA   . LYS A 1 16 ? -8.346  31.840 19.685 1.00 0.00 ? 16 LYS A CA   6  
ATOM 4703  C C    . LYS A 1 16 ? -9.159  32.810 18.824 1.00 0.00 ? 16 LYS A C    6  
ATOM 4704  O O    . LYS A 1 16 ? -8.867  33.017 17.662 1.00 0.00 ? 16 LYS A O    6  
ATOM 4705  C CB   . LYS A 1 16 ? -6.905  31.754 19.185 1.00 0.00 ? 16 LYS A CB   6  
ATOM 4706  C CG   . LYS A 1 16 ? -6.087  32.899 19.788 1.00 0.00 ? 16 LYS A CG   6  
ATOM 4707  C CD   . LYS A 1 16 ? -5.321  33.621 18.677 1.00 0.00 ? 16 LYS A CD   6  
ATOM 4708  C CE   . LYS A 1 16 ? -4.631  34.858 19.254 1.00 0.00 ? 16 LYS A CE   6  
ATOM 4709  N NZ   . LYS A 1 16 ? -3.424  35.053 18.401 1.00 0.00 ? 16 LYS A NZ   6  
ATOM 4710  H H    . LYS A 1 16 ? -9.022  30.074 18.649 1.00 0.00 ? 16 LYS A H    6  
ATOM 4711  H HA   . LYS A 1 16 ? -8.363  32.148 20.719 1.00 0.00 ? 16 LYS A HA   6  
ATOM 4712  H HB2  . LYS A 1 16 ? -6.476  30.809 19.483 1.00 0.00 ? 16 LYS A HB2  6  
ATOM 4713  H HB3  . LYS A 1 16 ? -6.892  31.832 18.107 1.00 0.00 ? 16 LYS A HB3  6  
ATOM 4714  H HG2  . LYS A 1 16 ? -6.750  33.595 20.280 1.00 0.00 ? 16 LYS A HG2  6  
ATOM 4715  H HG3  . LYS A 1 16 ? -5.386  32.500 20.506 1.00 0.00 ? 16 LYS A HG3  6  
ATOM 4716  H HD2  . LYS A 1 16 ? -4.580  32.955 18.260 1.00 0.00 ? 16 LYS A HD2  6  
ATOM 4717  H HD3  . LYS A 1 16 ? -6.011  33.921 17.902 1.00 0.00 ? 16 LYS A HD3  6  
ATOM 4718  H HE2  . LYS A 1 16 ? -5.281  35.718 19.187 1.00 0.00 ? 16 LYS A HE2  6  
ATOM 4719  H HE3  . LYS A 1 16 ? -4.341  34.683 20.280 1.00 0.00 ? 16 LYS A HE3  6  
ATOM 4720  H HZ1  . LYS A 1 16 ? -3.601  34.658 17.455 1.00 0.00 ? 16 LYS A HZ1  6  
ATOM 4721  H HZ2  . LYS A 1 16 ? -3.217  36.069 18.321 1.00 0.00 ? 16 LYS A HZ2  6  
ATOM 4722  H HZ3  . LYS A 1 16 ? -2.612  34.570 18.834 1.00 0.00 ? 16 LYS A HZ3  6  
ATOM 4723  N N    . ASN A 1 17 ? -10.181 33.396 19.381 1.00 0.00 ? 17 ASN A N    6  
ATOM 4724  C CA   . ASN A 1 17 ? -11.017 34.342 18.589 1.00 0.00 ? 17 ASN A CA   6  
ATOM 4725  C C    . ASN A 1 17 ? -11.541 33.642 17.335 1.00 0.00 ? 17 ASN A C    6  
ATOM 4726  O O    . ASN A 1 17 ? -11.428 34.144 16.235 1.00 0.00 ? 17 ASN A O    6  
ATOM 4727  C CB   . ASN A 1 17 ? -10.080 35.490 18.214 1.00 0.00 ? 17 ASN A CB   6  
ATOM 4728  C CG   . ASN A 1 17 ? -9.614  36.206 19.483 1.00 0.00 ? 17 ASN A CG   6  
ATOM 4729  O OD1  . ASN A 1 17 ? -10.421 36.650 20.276 1.00 0.00 ? 17 ASN A OD1  6  
ATOM 4730  N ND2  . ASN A 1 17 ? -8.336  36.338 19.709 1.00 0.00 ? 17 ASN A ND2  6  
ATOM 4731  H H    . ASN A 1 17 ? -10.404 33.210 20.316 1.00 0.00 ? 17 ASN A H    6  
ATOM 4732  H HA   . ASN A 1 17 ? -11.837 34.709 19.184 1.00 0.00 ? 17 ASN A HA   6  
ATOM 4733  H HB2  . ASN A 1 17 ? -9.223  35.097 17.688 1.00 0.00 ? 17 ASN A HB2  6  
ATOM 4734  H HB3  . ASN A 1 17 ? -10.603 36.189 17.578 1.00 0.00 ? 17 ASN A HB3  6  
ATOM 4735  H HD21 . ASN A 1 17 ? -7.685  35.980 19.070 1.00 0.00 ? 17 ASN A HD21 6  
ATOM 4736  H HD22 . ASN A 1 17 ? -8.027  36.795 20.519 1.00 0.00 ? 17 ASN A HD22 6  
ATOM 4737  N N    . GLY A 1 18 ? -12.111 32.481 17.497 1.00 0.00 ? 18 GLY A N    6  
ATOM 4738  C CA   . GLY A 1 18 ? -12.639 31.738 16.319 1.00 0.00 ? 18 GLY A CA   6  
ATOM 4739  C C    . GLY A 1 18 ? -11.488 31.014 15.617 1.00 0.00 ? 18 GLY A C    6  
ATOM 4740  O O    . GLY A 1 18 ? -11.640 30.496 14.529 1.00 0.00 ? 18 GLY A O    6  
ATOM 4741  H H    . GLY A 1 18 ? -12.187 32.096 18.395 1.00 0.00 ? 18 GLY A H    6  
ATOM 4742  H HA2  . GLY A 1 18 ? -13.373 31.017 16.648 1.00 0.00 ? 18 GLY A HA2  6  
ATOM 4743  H HA3  . GLY A 1 18 ? -13.100 32.434 15.633 1.00 0.00 ? 18 GLY A HA3  6  
ATOM 4744  N N    . LYS A 1 19 ? -10.337 30.973 16.232 1.00 0.00 ? 19 LYS A N    6  
ATOM 4745  C CA   . LYS A 1 19 ? -9.177  30.283 15.599 1.00 0.00 ? 19 LYS A CA   6  
ATOM 4746  C C    . LYS A 1 19 ? -8.658  29.169 16.511 1.00 0.00 ? 19 LYS A C    6  
ATOM 4747  O O    . LYS A 1 19 ? -8.035  29.421 17.523 1.00 0.00 ? 19 LYS A O    6  
ATOM 4748  C CB   . LYS A 1 19 ? -8.117  31.369 15.427 1.00 0.00 ? 19 LYS A CB   6  
ATOM 4749  C CG   . LYS A 1 19 ? -7.088  30.916 14.388 1.00 0.00 ? 19 LYS A CG   6  
ATOM 4750  C CD   . LYS A 1 19 ? -6.160  29.867 15.008 1.00 0.00 ? 19 LYS A CD   6  
ATOM 4751  C CE   . LYS A 1 19 ? -5.028  29.547 14.029 1.00 0.00 ? 19 LYS A CE   6  
ATOM 4752  N NZ   . LYS A 1 19 ? -3.950  28.957 14.871 1.00 0.00 ? 19 LYS A NZ   6  
ATOM 4753  H H    . LYS A 1 19 ? -10.234 31.397 17.110 1.00 0.00 ? 19 LYS A H    6  
ATOM 4754  H HA   . LYS A 1 19 ? -9.455  29.884 14.635 1.00 0.00 ? 19 LYS A HA   6  
ATOM 4755  H HB2  . LYS A 1 19 ? -8.587  32.282 15.094 1.00 0.00 ? 19 LYS A HB2  6  
ATOM 4756  H HB3  . LYS A 1 19 ? -7.624  31.541 16.372 1.00 0.00 ? 19 LYS A HB3  6  
ATOM 4757  H HG2  . LYS A 1 19 ? -7.599  30.487 13.540 1.00 0.00 ? 19 LYS A HG2  6  
ATOM 4758  H HG3  . LYS A 1 19 ? -6.505  31.766 14.066 1.00 0.00 ? 19 LYS A HG3  6  
ATOM 4759  H HD2  . LYS A 1 19 ? -5.743  30.253 15.926 1.00 0.00 ? 19 LYS A HD2  6  
ATOM 4760  H HD3  . LYS A 1 19 ? -6.720  28.968 15.217 1.00 0.00 ? 19 LYS A HD3  6  
ATOM 4761  H HE2  . LYS A 1 19 ? -5.362  28.832 13.290 1.00 0.00 ? 19 LYS A HE2  6  
ATOM 4762  H HE3  . LYS A 1 19 ? -4.681  30.449 13.549 1.00 0.00 ? 19 LYS A HE3  6  
ATOM 4763  H HZ1  . LYS A 1 19 ? -4.352  28.224 15.487 1.00 0.00 ? 19 LYS A HZ1  6  
ATOM 4764  H HZ2  . LYS A 1 19 ? -3.222  28.537 14.256 1.00 0.00 ? 19 LYS A HZ2  6  
ATOM 4765  H HZ3  . LYS A 1 19 ? -3.521  29.702 15.456 1.00 0.00 ? 19 LYS A HZ3  6  
ATOM 4766  N N    . LEU A 1 20 ? -8.910  27.939 16.158 1.00 0.00 ? 20 LEU A N    6  
ATOM 4767  C CA   . LEU A 1 20 ? -8.432  26.806 17.001 1.00 0.00 ? 20 LEU A CA   6  
ATOM 4768  C C    . LEU A 1 20 ? -7.001  26.425 16.606 1.00 0.00 ? 20 LEU A C    6  
ATOM 4769  O O    . LEU A 1 20 ? -6.749  25.998 15.496 1.00 0.00 ? 20 LEU A O    6  
ATOM 4770  C CB   . LEU A 1 20 ? -9.408  25.663 16.697 1.00 0.00 ? 20 LEU A CB   6  
ATOM 4771  C CG   . LEU A 1 20 ? -8.778  24.316 17.063 1.00 0.00 ? 20 LEU A CG   6  
ATOM 4772  C CD1  . LEU A 1 20 ? -8.661  24.200 18.583 1.00 0.00 ? 20 LEU A CD1  6  
ATOM 4773  C CD2  . LEU A 1 20 ? -9.659  23.183 16.535 1.00 0.00 ? 20 LEU A CD2  6  
ATOM 4774  H H    . LEU A 1 20 ? -9.413  27.759 15.337 1.00 0.00 ? 20 LEU A H    6  
ATOM 4775  H HA   . LEU A 1 20 ? -8.479  27.064 18.046 1.00 0.00 ? 20 LEU A HA   6  
ATOM 4776  H HB2  . LEU A 1 20 ? -10.311 25.803 17.273 1.00 0.00 ? 20 LEU A HB2  6  
ATOM 4777  H HB3  . LEU A 1 20 ? -9.651  25.670 15.645 1.00 0.00 ? 20 LEU A HB3  6  
ATOM 4778  H HG   . LEU A 1 20 ? -7.797  24.242 16.619 1.00 0.00 ? 20 LEU A HG   6  
ATOM 4779  H HD11 . LEU A 1 20 ? -9.497  24.701 19.047 1.00 0.00 ? 20 LEU A HD11 6  
ATOM 4780  H HD12 . LEU A 1 20 ? -8.664  23.157 18.865 1.00 0.00 ? 20 LEU A HD12 6  
ATOM 4781  H HD13 . LEU A 1 20 ? -7.739  24.659 18.909 1.00 0.00 ? 20 LEU A HD13 6  
ATOM 4782  H HD21 . LEU A 1 20 ? -10.491 23.600 15.986 1.00 0.00 ? 20 LEU A HD21 6  
ATOM 4783  H HD22 . LEU A 1 20 ? -9.079  22.550 15.880 1.00 0.00 ? 20 LEU A HD22 6  
ATOM 4784  H HD23 . LEU A 1 20 ? -10.032 22.600 17.363 1.00 0.00 ? 20 LEU A HD23 6  
ATOM 4785  N N    . PHE A 1 21 ? -6.062  26.565 17.504 1.00 0.00 ? 21 PHE A N    6  
ATOM 4786  C CA   . PHE A 1 21 ? -4.656  26.195 17.161 1.00 0.00 ? 21 PHE A CA   6  
ATOM 4787  C C    . PHE A 1 21 ? -4.360  24.767 17.627 1.00 0.00 ? 21 PHE A C    6  
ATOM 4788  O O    . PHE A 1 21 ? -3.842  24.542 18.702 1.00 0.00 ? 21 PHE A O    6  
ATOM 4789  C CB   . PHE A 1 21 ? -3.747  27.209 17.873 1.00 0.00 ? 21 PHE A CB   6  
ATOM 4790  C CG   . PHE A 1 21 ? -4.241  27.494 19.274 1.00 0.00 ? 21 PHE A CG   6  
ATOM 4791  C CD1  . PHE A 1 21 ? -3.834  26.685 20.343 1.00 0.00 ? 21 PHE A CD1  6  
ATOM 4792  C CD2  . PHE A 1 21 ? -5.097  28.579 19.505 1.00 0.00 ? 21 PHE A CD2  6  
ATOM 4793  C CE1  . PHE A 1 21 ? -4.284  26.960 21.641 1.00 0.00 ? 21 PHE A CE1  6  
ATOM 4794  C CE2  . PHE A 1 21 ? -5.547  28.853 20.802 1.00 0.00 ? 21 PHE A CE2  6  
ATOM 4795  C CZ   . PHE A 1 21 ? -5.141  28.044 21.870 1.00 0.00 ? 21 PHE A CZ   6  
ATOM 4796  H H    . PHE A 1 21 ? -6.285  26.902 18.396 1.00 0.00 ? 21 PHE A H    6  
ATOM 4797  H HA   . PHE A 1 21 ? -4.510  26.268 16.094 1.00 0.00 ? 21 PHE A HA   6  
ATOM 4798  H HB2  . PHE A 1 21 ? -2.745  26.811 17.926 1.00 0.00 ? 21 PHE A HB2  6  
ATOM 4799  H HB3  . PHE A 1 21 ? -3.733  28.130 17.309 1.00 0.00 ? 21 PHE A HB3  6  
ATOM 4800  H HD1  . PHE A 1 21 ? -3.173  25.851 20.168 1.00 0.00 ? 21 PHE A HD1  6  
ATOM 4801  H HD2  . PHE A 1 21 ? -5.411  29.203 18.682 1.00 0.00 ? 21 PHE A HD2  6  
ATOM 4802  H HE1  . PHE A 1 21 ? -3.970  26.337 22.464 1.00 0.00 ? 21 PHE A HE1  6  
ATOM 4803  H HE2  . PHE A 1 21 ? -6.208  29.689 20.978 1.00 0.00 ? 21 PHE A HE2  6  
ATOM 4804  H HZ   . PHE A 1 21 ? -5.487  28.256 22.870 1.00 0.00 ? 21 PHE A HZ   6  
ATOM 4805  N N    . CYS A 1 22 ? -4.693  23.799 16.817 1.00 0.00 ? 22 CYS A N    6  
ATOM 4806  C CA   . CYS A 1 22 ? -4.441  22.378 17.193 1.00 0.00 ? 22 CYS A CA   6  
ATOM 4807  C C    . CYS A 1 22 ? -2.973  22.160 17.615 1.00 0.00 ? 22 CYS A C    6  
ATOM 4808  O O    . CYS A 1 22 ? -2.724  21.522 18.618 1.00 0.00 ? 22 CYS A O    6  
ATOM 4809  C CB   . CYS A 1 22 ? -4.805  21.569 15.935 1.00 0.00 ? 22 CYS A CB   6  
ATOM 4810  S SG   . CYS A 1 22 ? -3.943  19.973 15.925 1.00 0.00 ? 22 CYS A SG   6  
ATOM 4811  H H    . CYS A 1 22 ? -5.112  24.008 15.956 1.00 0.00 ? 22 CYS A H    6  
ATOM 4812  H HA   . CYS A 1 22 ? -5.097  22.095 18.002 1.00 0.00 ? 22 CYS A HA   6  
ATOM 4813  H HB2  . CYS A 1 22 ? -5.872  21.394 15.926 1.00 0.00 ? 22 CYS A HB2  6  
ATOM 4814  H HB3  . CYS A 1 22 ? -4.532  22.129 15.056 1.00 0.00 ? 22 CYS A HB3  6  
ATOM 4815  N N    . PRO A 1 23 ? -2.039  22.679 16.847 1.00 0.00 ? 23 PRO A N    6  
ATOM 4816  C CA   . PRO A 1 23 ? -0.607  22.499 17.186 1.00 0.00 ? 23 PRO A CA   6  
ATOM 4817  C C    . PRO A 1 23 ? -0.281  23.142 18.538 1.00 0.00 ? 23 PRO A C    6  
ATOM 4818  O O    . PRO A 1 23 ? 0.201   24.255 18.608 1.00 0.00 ? 23 PRO A O    6  
ATOM 4819  C CB   . PRO A 1 23 ? 0.107   23.220 16.042 1.00 0.00 ? 23 PRO A CB   6  
ATOM 4820  C CG   . PRO A 1 23 ? -0.951  23.786 15.077 1.00 0.00 ? 23 PRO A CG   6  
ATOM 4821  C CD   . PRO A 1 23 ? -2.347  23.460 15.624 1.00 0.00 ? 23 PRO A CD   6  
ATOM 4822  H HA   . PRO A 1 23 ? -0.343  21.454 17.187 1.00 0.00 ? 23 PRO A HA   6  
ATOM 4823  H HB2  . PRO A 1 23 ? 0.706   24.025 16.438 1.00 0.00 ? 23 PRO A HB2  6  
ATOM 4824  H HB3  . PRO A 1 23 ? 0.742   22.522 15.514 1.00 0.00 ? 23 PRO A HB3  6  
ATOM 4825  H HG2  . PRO A 1 23 ? -0.833  24.858 15.000 1.00 0.00 ? 23 PRO A HG2  6  
ATOM 4826  H HG3  . PRO A 1 23 ? -0.829  23.338 14.102 1.00 0.00 ? 23 PRO A HG3  6  
ATOM 4827  H HD2  . PRO A 1 23 ? -2.874  24.368 15.867 1.00 0.00 ? 23 PRO A HD2  6  
ATOM 4828  H HD3  . PRO A 1 23 ? -2.901  22.866 14.915 1.00 0.00 ? 23 PRO A HD3  6  
ATOM 4829  N N    . GLN A 1 24 ? -0.536  22.444 19.611 1.00 0.00 ? 24 GLN A N    6  
ATOM 4830  C CA   . GLN A 1 24 ? -0.236  23.006 20.959 1.00 0.00 ? 24 GLN A CA   6  
ATOM 4831  C C    . GLN A 1 24 ? 0.902   22.219 21.614 1.00 0.00 ? 24 GLN A C    6  
ATOM 4832  O O    . GLN A 1 24 ? 2.042   22.637 21.616 1.00 0.00 ? 24 GLN A O    6  
ATOM 4833  C CB   . GLN A 1 24 ? -1.532  22.842 21.755 1.00 0.00 ? 24 GLN A CB   6  
ATOM 4834  C CG   . GLN A 1 24 ? -1.250  23.060 23.243 1.00 0.00 ? 24 GLN A CG   6  
ATOM 4835  C CD   . GLN A 1 24 ? -2.539  22.854 24.042 1.00 0.00 ? 24 GLN A CD   6  
ATOM 4836  O OE1  . GLN A 1 24 ? -3.096  23.795 24.570 1.00 0.00 ? 24 GLN A OE1  6  
ATOM 4837  N NE2  . GLN A 1 24 ? -3.039  21.654 24.152 1.00 0.00 ? 24 GLN A NE2  6  
ATOM 4838  H H    . GLN A 1 24 ? -0.921  21.548 19.529 1.00 0.00 ? 24 GLN A H    6  
ATOM 4839  H HA   . GLN A 1 24 ? 0.021   24.049 20.886 1.00 0.00 ? 24 GLN A HA   6  
ATOM 4840  H HB2  . GLN A 1 24 ? -2.257  23.567 21.415 1.00 0.00 ? 24 GLN A HB2  6  
ATOM 4841  H HB3  . GLN A 1 24 ? -1.922  21.846 21.605 1.00 0.00 ? 24 GLN A HB3  6  
ATOM 4842  H HG2  . GLN A 1 24 ? -0.504  22.354 23.576 1.00 0.00 ? 24 GLN A HG2  6  
ATOM 4843  H HG3  . GLN A 1 24 ? -0.888  24.065 23.397 1.00 0.00 ? 24 GLN A HG3  6  
ATOM 4844  H HE21 . GLN A 1 24 ? -2.590  20.894 23.726 1.00 0.00 ? 24 GLN A HE21 6  
ATOM 4845  H HE22 . GLN A 1 24 ? -3.865  21.512 24.662 1.00 0.00 ? 24 GLN A HE22 6  
ATOM 4846  N N    . ASP A 1 25 ? 0.598   21.077 22.167 1.00 0.00 ? 25 ASP A N    6  
ATOM 4847  C CA   . ASP A 1 25 ? 1.657   20.256 22.819 1.00 0.00 ? 25 ASP A CA   6  
ATOM 4848  C C    . ASP A 1 25 ? 1.372   18.767 22.602 1.00 0.00 ? 25 ASP A C    6  
ATOM 4849  O O    . ASP A 1 25 ? 1.087   18.037 23.530 1.00 0.00 ? 25 ASP A O    6  
ATOM 4850  C CB   . ASP A 1 25 ? 1.576   20.610 24.305 1.00 0.00 ? 25 ASP A CB   6  
ATOM 4851  C CG   . ASP A 1 25 ? 2.677   19.871 25.068 1.00 0.00 ? 25 ASP A CG   6  
ATOM 4852  O OD1  . ASP A 1 25 ? 3.594   19.389 24.424 1.00 0.00 ? 25 ASP A OD1  6  
ATOM 4853  O OD2  . ASP A 1 25 ? 2.585   19.803 26.283 1.00 0.00 ? 25 ASP A OD2  6  
ATOM 4854  H H    . ASP A 1 25 ? -0.328  20.760 22.150 1.00 0.00 ? 25 ASP A H    6  
ATOM 4855  H HA   . ASP A 1 25 ? 2.629   20.515 22.430 1.00 0.00 ? 25 ASP A HA   6  
ATOM 4856  H HB2  . ASP A 1 25 ? 1.706   21.676 24.428 1.00 0.00 ? 25 ASP A HB2  6  
ATOM 4857  H HB3  . ASP A 1 25 ? 0.611   20.318 24.692 1.00 0.00 ? 25 ASP A HB3  6  
ATOM 4858  N N    . LYS A 1 26 ? 1.443   18.313 21.380 1.00 0.00 ? 26 LYS A N    6  
ATOM 4859  C CA   . LYS A 1 26 ? 1.171   16.874 21.094 1.00 0.00 ? 26 LYS A CA   6  
ATOM 4860  C C    . LYS A 1 26 ? 2.094   15.969 21.917 1.00 0.00 ? 26 LYS A C    6  
ATOM 4861  O O    . LYS A 1 26 ? 1.870   14.780 22.026 1.00 0.00 ? 26 LYS A O    6  
ATOM 4862  C CB   . LYS A 1 26 ? 1.448   16.708 19.601 1.00 0.00 ? 26 LYS A CB   6  
ATOM 4863  C CG   . LYS A 1 26 ? 0.215   17.138 18.804 1.00 0.00 ? 26 LYS A CG   6  
ATOM 4864  C CD   . LYS A 1 26 ? 0.594   17.305 17.330 1.00 0.00 ? 26 LYS A CD   6  
ATOM 4865  C CE   . LYS A 1 26 ? 0.417   15.971 16.604 1.00 0.00 ? 26 LYS A CE   6  
ATOM 4866  N NZ   . LYS A 1 26 ? 0.806   16.250 15.193 1.00 0.00 ? 26 LYS A NZ   6  
ATOM 4867  H H    . LYS A 1 26 ? 1.672   18.921 20.647 1.00 0.00 ? 26 LYS A H    6  
ATOM 4868  H HA   . LYS A 1 26 ? 0.139   16.643 21.300 1.00 0.00 ? 26 LYS A HA   6  
ATOM 4869  H HB2  . LYS A 1 26 ? 2.291   17.323 19.321 1.00 0.00 ? 26 LYS A HB2  6  
ATOM 4870  H HB3  . LYS A 1 26 ? 1.671   15.674 19.390 1.00 0.00 ? 26 LYS A HB3  6  
ATOM 4871  H HG2  . LYS A 1 26 ? -0.553  16.385 18.894 1.00 0.00 ? 26 LYS A HG2  6  
ATOM 4872  H HG3  . LYS A 1 26 ? -0.155  18.077 19.189 1.00 0.00 ? 26 LYS A HG3  6  
ATOM 4873  H HD2  . LYS A 1 26 ? -0.044  18.049 16.877 1.00 0.00 ? 26 LYS A HD2  6  
ATOM 4874  H HD3  . LYS A 1 26 ? 1.624   17.621 17.257 1.00 0.00 ? 26 LYS A HD3  6  
ATOM 4875  H HE2  . LYS A 1 26 ? 1.066   15.221 17.033 1.00 0.00 ? 26 LYS A HE2  6  
ATOM 4876  H HE3  . LYS A 1 26 ? -0.613  15.650 16.653 1.00 0.00 ? 26 LYS A HE3  6  
ATOM 4877  H HZ1  . LYS A 1 26 ? 1.577   16.948 15.177 1.00 0.00 ? 26 LYS A HZ1  6  
ATOM 4878  H HZ2  . LYS A 1 26 ? 1.130   15.370 14.742 1.00 0.00 ? 26 LYS A HZ2  6  
ATOM 4879  H HZ3  . LYS A 1 26 ? -0.014  16.624 14.676 1.00 0.00 ? 26 LYS A HZ3  6  
ATOM 4880  N N    . LYS A 1 27 ? 3.129   16.517 22.496 1.00 0.00 ? 27 LYS A N    6  
ATOM 4881  C CA   . LYS A 1 27 ? 4.058   15.682 23.310 1.00 0.00 ? 27 LYS A CA   6  
ATOM 4882  C C    . LYS A 1 27 ? 3.270   14.690 24.171 1.00 0.00 ? 27 LYS A C    6  
ATOM 4883  O O    . LYS A 1 27 ? 3.762   13.637 24.527 1.00 0.00 ? 27 LYS A O    6  
ATOM 4884  C CB   . LYS A 1 27 ? 4.807   16.682 24.191 1.00 0.00 ? 27 LYS A CB   6  
ATOM 4885  C CG   . LYS A 1 27 ? 5.807   17.465 23.337 1.00 0.00 ? 27 LYS A CG   6  
ATOM 4886  C CD   . LYS A 1 27 ? 6.528   18.494 24.212 1.00 0.00 ? 27 LYS A CD   6  
ATOM 4887  C CE   . LYS A 1 27 ? 7.443   19.354 23.339 1.00 0.00 ? 27 LYS A CE   6  
ATOM 4888  N NZ   . LYS A 1 27 ? 8.110   20.288 24.291 1.00 0.00 ? 27 LYS A NZ   6  
ATOM 4889  H H    . LYS A 1 27 ? 3.295   17.476 22.397 1.00 0.00 ? 27 LYS A H    6  
ATOM 4890  H HA   . LYS A 1 27 ? 4.754   15.159 22.673 1.00 0.00 ? 27 LYS A HA   6  
ATOM 4891  H HB2  . LYS A 1 27 ? 4.102   17.365 24.637 1.00 0.00 ? 27 LYS A HB2  6  
ATOM 4892  H HB3  . LYS A 1 27 ? 5.335   16.152 24.967 1.00 0.00 ? 27 LYS A HB3  6  
ATOM 4893  H HG2  . LYS A 1 27 ? 6.529   16.784 22.913 1.00 0.00 ? 27 LYS A HG2  6  
ATOM 4894  H HG3  . LYS A 1 27 ? 5.281   17.974 22.542 1.00 0.00 ? 27 LYS A HG3  6  
ATOM 4895  H HD2  . LYS A 1 27 ? 5.801   19.123 24.702 1.00 0.00 ? 27 LYS A HD2  6  
ATOM 4896  H HD3  . LYS A 1 27 ? 7.120   17.980 24.956 1.00 0.00 ? 27 LYS A HD3  6  
ATOM 4897  H HE2  . LYS A 1 27 ? 8.178   18.739 22.841 1.00 0.00 ? 27 LYS A HE2  6  
ATOM 4898  H HE3  . LYS A 1 27 ? 6.862   19.907 22.616 1.00 0.00 ? 27 LYS A HE3  6  
ATOM 4899  H HZ1  . LYS A 1 27 ? 8.570   19.742 25.047 1.00 0.00 ? 27 LYS A HZ1  6  
ATOM 4900  H HZ2  . LYS A 1 27 ? 8.822   20.850 23.785 1.00 0.00 ? 27 LYS A HZ2  6  
ATOM 4901  H HZ3  . LYS A 1 27 ? 7.400   20.925 24.706 1.00 0.00 ? 27 LYS A HZ3  6  
ATOM 4902  N N    . PHE A 1 28 ? 2.050   15.014 24.505 1.00 0.00 ? 28 PHE A N    6  
ATOM 4903  C CA   . PHE A 1 28 ? 1.234   14.086 25.338 1.00 0.00 ? 28 PHE A CA   6  
ATOM 4904  C C    . PHE A 1 28 ? 1.155   12.707 24.676 1.00 0.00 ? 28 PHE A C    6  
ATOM 4905  O O    . PHE A 1 28 ? 0.806   11.727 25.304 1.00 0.00 ? 28 PHE A O    6  
ATOM 4906  C CB   . PHE A 1 28 ? -0.152  14.728 25.405 1.00 0.00 ? 28 PHE A CB   6  
ATOM 4907  C CG   . PHE A 1 28 ? -0.027  16.163 25.861 1.00 0.00 ? 28 PHE A CG   6  
ATOM 4908  C CD1  . PHE A 1 28 ? 0.749   16.477 26.984 1.00 0.00 ? 28 PHE A CD1  6  
ATOM 4909  C CD2  . PHE A 1 28 ? -0.689  17.180 25.163 1.00 0.00 ? 28 PHE A CD2  6  
ATOM 4910  C CE1  . PHE A 1 28 ? 0.862   17.808 27.407 1.00 0.00 ? 28 PHE A CE1  6  
ATOM 4911  C CE2  . PHE A 1 28 ? -0.575  18.509 25.585 1.00 0.00 ? 28 PHE A CE2  6  
ATOM 4912  C CZ   . PHE A 1 28 ? 0.200   18.823 26.707 1.00 0.00 ? 28 PHE A CZ   6  
ATOM 4913  H H    . PHE A 1 28 ? 1.670   15.867 24.208 1.00 0.00 ? 28 PHE A H    6  
ATOM 4914  H HA   . PHE A 1 28 ? 1.649   14.005 26.330 1.00 0.00 ? 28 PHE A HA   6  
ATOM 4915  H HB2  . PHE A 1 28 ? -0.609  14.701 24.425 1.00 0.00 ? 28 PHE A HB2  6  
ATOM 4916  H HB3  . PHE A 1 28 ? -0.768  14.182 26.103 1.00 0.00 ? 28 PHE A HB3  6  
ATOM 4917  H HD1  . PHE A 1 28 ? 1.261   15.693 27.523 1.00 0.00 ? 28 PHE A HD1  6  
ATOM 4918  H HD2  . PHE A 1 28 ? -1.286  16.939 24.296 1.00 0.00 ? 28 PHE A HD2  6  
ATOM 4919  H HE1  . PHE A 1 28 ? 1.461   18.050 28.272 1.00 0.00 ? 28 PHE A HE1  6  
ATOM 4920  H HE2  . PHE A 1 28 ? -1.087  19.293 25.045 1.00 0.00 ? 28 PHE A HE2  6  
ATOM 4921  H HZ   . PHE A 1 28 ? 0.287   19.849 27.034 1.00 0.00 ? 28 PHE A HZ   6  
ATOM 4922  N N    . PHE A 1 29 ? 1.476   12.621 23.412 1.00 0.00 ? 29 PHE A N    6  
ATOM 4923  C CA   . PHE A 1 29 ? 1.417   11.304 22.710 1.00 0.00 ? 29 PHE A CA   6  
ATOM 4924  C C    . PHE A 1 29 ? 1.979   10.197 23.606 1.00 0.00 ? 29 PHE A C    6  
ATOM 4925  O O    . PHE A 1 29 ? 1.625   9.041  23.478 1.00 0.00 ? 29 PHE A O    6  
ATOM 4926  C CB   . PHE A 1 29 ? 2.291   11.476 21.467 1.00 0.00 ? 29 PHE A CB   6  
ATOM 4927  C CG   . PHE A 1 29 ? 2.142   10.267 20.575 1.00 0.00 ? 29 PHE A CG   6  
ATOM 4928  C CD1  . PHE A 1 29 ? 2.609   9.017  21.002 1.00 0.00 ? 29 PHE A CD1  6  
ATOM 4929  C CD2  . PHE A 1 29 ? 1.534   10.395 19.320 1.00 0.00 ? 29 PHE A CD2  6  
ATOM 4930  C CE1  . PHE A 1 29 ? 2.469   7.897  20.174 1.00 0.00 ? 29 PHE A CE1  6  
ATOM 4931  C CE2  . PHE A 1 29 ? 1.393   9.274  18.493 1.00 0.00 ? 29 PHE A CE2  6  
ATOM 4932  C CZ   . PHE A 1 29 ? 1.861   8.025  18.920 1.00 0.00 ? 29 PHE A CZ   6  
ATOM 4933  H H    . PHE A 1 29 ? 1.753   13.423 22.923 1.00 0.00 ? 29 PHE A H    6  
ATOM 4934  H HA   . PHE A 1 29 ? 0.404   11.076 22.419 1.00 0.00 ? 29 PHE A HA   6  
ATOM 4935  H HB2  . PHE A 1 29 ? 1.983   12.360 20.930 1.00 0.00 ? 29 PHE A HB2  6  
ATOM 4936  H HB3  . PHE A 1 29 ? 3.324   11.579 21.766 1.00 0.00 ? 29 PHE A HB3  6  
ATOM 4937  H HD1  . PHE A 1 29 ? 3.078   8.919  21.970 1.00 0.00 ? 29 PHE A HD1  6  
ATOM 4938  H HD2  . PHE A 1 29 ? 1.173   11.358 18.991 1.00 0.00 ? 29 PHE A HD2  6  
ATOM 4939  H HE1  . PHE A 1 29 ? 2.829   6.934  20.504 1.00 0.00 ? 29 PHE A HE1  6  
ATOM 4940  H HE2  . PHE A 1 29 ? 0.925   9.372  17.525 1.00 0.00 ? 29 PHE A HE2  6  
ATOM 4941  H HZ   . PHE A 1 29 ? 1.753   7.161  18.282 1.00 0.00 ? 29 PHE A HZ   6  
ATOM 4942  N N    . GLN A 1 30 ? 2.855   10.542 24.507 1.00 0.00 ? 30 GLN A N    6  
ATOM 4943  C CA   . GLN A 1 30 ? 3.446   9.513  25.410 1.00 0.00 ? 30 GLN A CA   6  
ATOM 4944  C C    . GLN A 1 30 ? 2.379   8.939  26.350 1.00 0.00 ? 30 GLN A C    6  
ATOM 4945  O O    . GLN A 1 30 ? 2.632   8.015  27.097 1.00 0.00 ? 30 GLN A O    6  
ATOM 4946  C CB   . GLN A 1 30 ? 4.518   10.263 26.202 1.00 0.00 ? 30 GLN A CB   6  
ATOM 4947  C CG   . GLN A 1 30 ? 3.851   11.154 27.252 1.00 0.00 ? 30 GLN A CG   6  
ATOM 4948  C CD   . GLN A 1 30 ? 4.920   11.966 27.985 1.00 0.00 ? 30 GLN A CD   6  
ATOM 4949  O OE1  . GLN A 1 30 ? 5.860   11.412 28.520 1.00 0.00 ? 30 GLN A OE1  6  
ATOM 4950  N NE2  . GLN A 1 30 ? 4.815   13.266 28.032 1.00 0.00 ? 30 GLN A NE2  6  
ATOM 4951  H H    . GLN A 1 30 ? 3.128   11.478 24.591 1.00 0.00 ? 30 GLN A H    6  
ATOM 4952  H HA   . GLN A 1 30 ? 3.902   8.726  24.832 1.00 0.00 ? 30 GLN A HA   6  
ATOM 4953  H HB2  . GLN A 1 30 ? 5.167   9.553  26.693 1.00 0.00 ? 30 GLN A HB2  6  
ATOM 4954  H HB3  . GLN A 1 30 ? 5.099   10.877 25.529 1.00 0.00 ? 30 GLN A HB3  6  
ATOM 4955  H HG2  . GLN A 1 30 ? 3.159   11.827 26.768 1.00 0.00 ? 30 GLN A HG2  6  
ATOM 4956  H HG3  . GLN A 1 30 ? 3.318   10.539 27.961 1.00 0.00 ? 30 GLN A HG3  6  
ATOM 4957  H HE21 . GLN A 1 30 ? 4.057   13.712 27.599 1.00 0.00 ? 30 GLN A HE21 6  
ATOM 4958  H HE22 . GLN A 1 30 ? 5.495   13.795 28.499 1.00 0.00 ? 30 GLN A HE22 6  
ATOM 4959  N N    . SER A 1 31 ? 1.187   9.474  26.319 1.00 0.00 ? 31 SER A N    6  
ATOM 4960  C CA   . SER A 1 31 ? 0.114   8.949  27.212 1.00 0.00 ? 31 SER A CA   6  
ATOM 4961  C C    . SER A 1 31 ? -1.174  8.729  26.412 1.00 0.00 ? 31 SER A C    6  
ATOM 4962  O O    . SER A 1 31 ? -1.405  9.365  25.404 1.00 0.00 ? 31 SER A O    6  
ATOM 4963  C CB   . SER A 1 31 ? -0.090  10.035 28.269 1.00 0.00 ? 31 SER A CB   6  
ATOM 4964  O OG   . SER A 1 31 ? -0.502  11.239 27.638 1.00 0.00 ? 31 SER A OG   6  
ATOM 4965  H H    . SER A 1 31 ? 0.997   10.217 25.709 1.00 0.00 ? 31 SER A H    6  
ATOM 4966  H HA   . SER A 1 31 ? 0.430   8.032  27.681 1.00 0.00 ? 31 SER A HA   6  
ATOM 4967  H HB2  . SER A 1 31 ? -0.848  9.718  28.969 1.00 0.00 ? 31 SER A HB2  6  
ATOM 4968  H HB3  . SER A 1 31 ? 0.838   10.204 28.795 1.00 0.00 ? 31 SER A HB3  6  
ATOM 4969  H HG   . SER A 1 31 ? 0.278   11.668 27.279 1.00 0.00 ? 31 SER A HG   6  
ATOM 4970  N N    . LEU A 1 32 ? -2.014  7.832  26.852 1.00 0.00 ? 32 LEU A N    6  
ATOM 4971  C CA   . LEU A 1 32 ? -3.282  7.575  26.111 1.00 0.00 ? 32 LEU A CA   6  
ATOM 4972  C C    . LEU A 1 32 ? -4.027  8.888  25.874 1.00 0.00 ? 32 LEU A C    6  
ATOM 4973  O O    . LEU A 1 32 ? -4.420  9.199  24.767 1.00 0.00 ? 32 LEU A O    6  
ATOM 4974  C CB   . LEU A 1 32 ? -4.098  6.655  27.016 1.00 0.00 ? 32 LEU A CB   6  
ATOM 4975  C CG   . LEU A 1 32 ? -5.109  5.879  26.171 1.00 0.00 ? 32 LEU A CG   6  
ATOM 4976  C CD1  . LEU A 1 32 ? -5.519  4.602  26.908 1.00 0.00 ? 32 LEU A CD1  6  
ATOM 4977  C CD2  . LEU A 1 32 ? -6.346  6.748  25.931 1.00 0.00 ? 32 LEU A CD2  6  
ATOM 4978  H H    . LEU A 1 32 ? -1.810  7.327  27.667 1.00 0.00 ? 32 LEU A H    6  
ATOM 4979  H HA   . LEU A 1 32 ? -3.079  7.085  25.176 1.00 0.00 ? 32 LEU A HA   6  
ATOM 4980  H HB2  . LEU A 1 32 ? -3.438  5.963  27.517 1.00 0.00 ? 32 LEU A HB2  6  
ATOM 4981  H HB3  . LEU A 1 32 ? -4.623  7.248  27.751 1.00 0.00 ? 32 LEU A HB3  6  
ATOM 4982  H HG   . LEU A 1 32 ? -4.662  5.619  25.223 1.00 0.00 ? 32 LEU A HG   6  
ATOM 4983  H HD11 . LEU A 1 32 ? -5.479  4.772  27.973 1.00 0.00 ? 32 LEU A HD11 6  
ATOM 4984  H HD12 . LEU A 1 32 ? -6.524  4.328  26.624 1.00 0.00 ? 32 LEU A HD12 6  
ATOM 4985  H HD13 . LEU A 1 32 ? -4.841  3.803  26.646 1.00 0.00 ? 32 LEU A HD13 6  
ATOM 4986  H HD21 . LEU A 1 32 ? -6.550  7.335  26.814 1.00 0.00 ? 32 LEU A HD21 6  
ATOM 4987  H HD22 . LEU A 1 32 ? -6.165  7.406  25.093 1.00 0.00 ? 32 LEU A HD22 6  
ATOM 4988  H HD23 . LEU A 1 32 ? -7.193  6.116  25.715 1.00 0.00 ? 32 LEU A HD23 6  
ATOM 4989  N N    . ASP A 1 33 ? -4.214  9.664  26.902 1.00 0.00 ? 33 ASP A N    6  
ATOM 4990  C CA   . ASP A 1 33 ? -4.924  10.960 26.729 1.00 0.00 ? 33 ASP A CA   6  
ATOM 4991  C C    . ASP A 1 33 ? -4.239  11.761 25.629 1.00 0.00 ? 33 ASP A C    6  
ATOM 4992  O O    . ASP A 1 33 ? -4.876  12.428 24.839 1.00 0.00 ? 33 ASP A O    6  
ATOM 4993  C CB   . ASP A 1 33 ? -4.800  11.672 28.076 1.00 0.00 ? 33 ASP A CB   6  
ATOM 4994  C CG   . ASP A 1 33 ? -5.610  10.917 29.131 1.00 0.00 ? 33 ASP A CG   6  
ATOM 4995  O OD1  . ASP A 1 33 ? -6.379  10.050 28.749 1.00 0.00 ? 33 ASP A OD1  6  
ATOM 4996  O OD2  . ASP A 1 33 ? -5.448  11.218 30.302 1.00 0.00 ? 33 ASP A OD2  6  
ATOM 4997  H H    . ASP A 1 33 ? -3.880  9.398  27.781 1.00 0.00 ? 33 ASP A H    6  
ATOM 4998  H HA   . ASP A 1 33 ? -5.962  10.795 26.486 1.00 0.00 ? 33 ASP A HA   6  
ATOM 4999  H HB2  . ASP A 1 33 ? -3.762  11.701 28.373 1.00 0.00 ? 33 ASP A HB2  6  
ATOM 5000  H HB3  . ASP A 1 33 ? -5.177  12.680 27.986 1.00 0.00 ? 33 ASP A HB3  6  
ATOM 5001  N N    . GLY A 1 34 ? -2.940  11.684 25.563 1.00 0.00 ? 34 GLY A N    6  
ATOM 5002  C CA   . GLY A 1 34 ? -2.209  12.422 24.503 1.00 0.00 ? 34 GLY A CA   6  
ATOM 5003  C C    . GLY A 1 34 ? -2.493  11.744 23.166 1.00 0.00 ? 34 GLY A C    6  
ATOM 5004  O O    . GLY A 1 34 ? -2.871  12.376 22.199 1.00 0.00 ? 34 GLY A O    6  
ATOM 5005  H H    . GLY A 1 34 ? -2.450  11.126 26.205 1.00 0.00 ? 34 GLY A H    6  
ATOM 5006  H HA2  . GLY A 1 34 ? -2.547  13.443 24.472 1.00 0.00 ? 34 GLY A HA2  6  
ATOM 5007  H HA3  . GLY A 1 34 ? -1.151  12.395 24.706 1.00 0.00 ? 34 GLY A HA3  6  
ATOM 5008  N N    . ILE A 1 35 ? -2.332  10.454 23.110 1.00 0.00 ? 35 ILE A N    6  
ATOM 5009  C CA   . ILE A 1 35 ? -2.609  9.728  21.842 1.00 0.00 ? 35 ILE A CA   6  
ATOM 5010  C C    . ILE A 1 35 ? -4.035  10.037 21.386 1.00 0.00 ? 35 ILE A C    6  
ATOM 5011  O O    . ILE A 1 35 ? -4.321  10.103 20.207 1.00 0.00 ? 35 ILE A O    6  
ATOM 5012  C CB   . ILE A 1 35 ? -2.440  8.242  22.189 1.00 0.00 ? 35 ILE A CB   6  
ATOM 5013  C CG1  . ILE A 1 35 ? -0.977  7.846  21.991 1.00 0.00 ? 35 ILE A CG1  6  
ATOM 5014  C CG2  . ILE A 1 35 ? -3.320  7.378  21.278 1.00 0.00 ? 35 ILE A CG2  6  
ATOM 5015  C CD1  . ILE A 1 35 ? -0.558  8.174  20.556 1.00 0.00 ? 35 ILE A CD1  6  
ATOM 5016  H H    . ILE A 1 35 ? -2.038  9.964  23.906 1.00 0.00 ? 35 ILE A H    6  
ATOM 5017  H HA   . ILE A 1 35 ? -1.900  10.014 21.084 1.00 0.00 ? 35 ILE A HA   6  
ATOM 5018  H HB   . ILE A 1 35 ? -2.721  8.079  23.220 1.00 0.00 ? 35 ILE A HB   6  
ATOM 5019  H HG12 . ILE A 1 35 ? -0.358  8.397  22.683 1.00 0.00 ? 35 ILE A HG12 6  
ATOM 5020  H HG13 . ILE A 1 35 ? -0.863  6.787  22.167 1.00 0.00 ? 35 ILE A HG13 6  
ATOM 5021  H HG21 . ILE A 1 35 ? -3.368  7.825  20.296 1.00 0.00 ? 35 ILE A HG21 6  
ATOM 5022  H HG22 . ILE A 1 35 ? -2.897  6.387  21.203 1.00 0.00 ? 35 ILE A HG22 6  
ATOM 5023  H HG23 . ILE A 1 35 ? -4.315  7.315  21.694 1.00 0.00 ? 35 ILE A HG23 6  
ATOM 5024  H HD11 . ILE A 1 35 ? -1.409  8.563  20.013 1.00 0.00 ? 35 ILE A HD11 6  
ATOM 5025  H HD12 . ILE A 1 35 ? 0.228   8.913  20.571 1.00 0.00 ? 35 ILE A HD12 6  
ATOM 5026  H HD13 . ILE A 1 35 ? -0.201  7.277  20.072 1.00 0.00 ? 35 ILE A HD13 6  
ATOM 5027  N N    . MET A 1 36 ? -4.931  10.235 22.313 1.00 0.00 ? 36 MET A N    6  
ATOM 5028  C CA   . MET A 1 36 ? -6.335  10.547 21.927 1.00 0.00 ? 36 MET A CA   6  
ATOM 5029  C C    . MET A 1 36 ? -6.451  12.013 21.509 1.00 0.00 ? 36 MET A C    6  
ATOM 5030  O O    . MET A 1 36 ? -6.751  12.322 20.373 1.00 0.00 ? 36 MET A O    6  
ATOM 5031  C CB   . MET A 1 36 ? -7.166  10.289 23.180 1.00 0.00 ? 36 MET A CB   6  
ATOM 5032  C CG   . MET A 1 36 ? -7.643  8.835  23.188 1.00 0.00 ? 36 MET A CG   6  
ATOM 5033  S SD   . MET A 1 36 ? -8.671  8.528  21.730 1.00 0.00 ? 36 MET A SD   6  
ATOM 5034  C CE   . MET A 1 36 ? -10.255 9.008  22.463 1.00 0.00 ? 36 MET A CE   6  
ATOM 5035  H H    . MET A 1 36 ? -4.678  10.181 23.262 1.00 0.00 ? 36 MET A H    6  
ATOM 5036  H HA   . MET A 1 36 ? -6.659  9.900  21.129 1.00 0.00 ? 36 MET A HA   6  
ATOM 5037  H HB2  . MET A 1 36 ? -6.565  10.477 24.057 1.00 0.00 ? 36 MET A HB2  6  
ATOM 5038  H HB3  . MET A 1 36 ? -8.020  10.950 23.179 1.00 0.00 ? 36 MET A HB3  6  
ATOM 5039  H HG2  . MET A 1 36 ? -6.788  8.175  23.170 1.00 0.00 ? 36 MET A HG2  6  
ATOM 5040  H HG3  . MET A 1 36 ? -8.222  8.651  24.081 1.00 0.00 ? 36 MET A HG3  6  
ATOM 5041  H HE1  . MET A 1 36 ? -10.316 8.618  23.470 1.00 0.00 ? 36 MET A HE1  6  
ATOM 5042  H HE2  . MET A 1 36 ? -10.328 10.084 22.492 1.00 0.00 ? 36 MET A HE2  6  
ATOM 5043  H HE3  . MET A 1 36 ? -11.063 8.610  21.866 1.00 0.00 ? 36 MET A HE3  6  
ATOM 5044  N N    . PHE A 1 37 ? -6.217  12.923 22.416 1.00 0.00 ? 37 PHE A N    6  
ATOM 5045  C CA   . PHE A 1 37 ? -6.317  14.363 22.053 1.00 0.00 ? 37 PHE A CA   6  
ATOM 5046  C C    . PHE A 1 37 ? -5.588  14.599 20.723 1.00 0.00 ? 37 PHE A C    6  
ATOM 5047  O O    . PHE A 1 37 ? -6.127  15.188 19.807 1.00 0.00 ? 37 PHE A O    6  
ATOM 5048  C CB   . PHE A 1 37 ? -5.675  15.118 23.239 1.00 0.00 ? 37 PHE A CB   6  
ATOM 5049  C CG   . PHE A 1 37 ? -4.489  15.946 22.792 1.00 0.00 ? 37 PHE A CG   6  
ATOM 5050  C CD1  . PHE A 1 37 ? -3.225  15.357 22.692 1.00 0.00 ? 37 PHE A CD1  6  
ATOM 5051  C CD2  . PHE A 1 37 ? -4.657  17.298 22.476 1.00 0.00 ? 37 PHE A CD2  6  
ATOM 5052  C CE1  . PHE A 1 37 ? -2.130  16.115 22.274 1.00 0.00 ? 37 PHE A CE1  6  
ATOM 5053  C CE2  . PHE A 1 37 ? -3.559  18.059 22.058 1.00 0.00 ? 37 PHE A CE2  6  
ATOM 5054  C CZ   . PHE A 1 37 ? -2.296  17.466 21.956 1.00 0.00 ? 37 PHE A CZ   6  
ATOM 5055  H H    . PHE A 1 37 ? -5.974  12.659 23.329 1.00 0.00 ? 37 PHE A H    6  
ATOM 5056  H HA   . PHE A 1 37 ? -7.355  14.647 21.960 1.00 0.00 ? 37 PHE A HA   6  
ATOM 5057  H HB2  . PHE A 1 37 ? -6.413  15.770 23.683 1.00 0.00 ? 37 PHE A HB2  6  
ATOM 5058  H HB3  . PHE A 1 37 ? -5.346  14.400 23.977 1.00 0.00 ? 37 PHE A HB3  6  
ATOM 5059  H HD1  . PHE A 1 37 ? -3.097  14.315 22.936 1.00 0.00 ? 37 PHE A HD1  6  
ATOM 5060  H HD2  . PHE A 1 37 ? -5.631  17.754 22.557 1.00 0.00 ? 37 PHE A HD2  6  
ATOM 5061  H HE1  . PHE A 1 37 ? -1.154  15.658 22.198 1.00 0.00 ? 37 PHE A HE1  6  
ATOM 5062  H HE2  . PHE A 1 37 ? -3.687  19.103 21.812 1.00 0.00 ? 37 PHE A HE2  6  
ATOM 5063  H HZ   . PHE A 1 37 ? -1.450  18.047 21.631 1.00 0.00 ? 37 PHE A HZ   6  
ATOM 5064  N N    . ILE A 1 38 ? -4.376  14.127 20.601 1.00 0.00 ? 38 ILE A N    6  
ATOM 5065  C CA   . ILE A 1 38 ? -3.638  14.314 19.321 1.00 0.00 ? 38 ILE A CA   6  
ATOM 5066  C C    . ILE A 1 38 ? -4.509  13.846 18.156 1.00 0.00 ? 38 ILE A C    6  
ATOM 5067  O O    . ILE A 1 38 ? -4.532  14.449 17.101 1.00 0.00 ? 38 ILE A O    6  
ATOM 5068  C CB   . ILE A 1 38 ? -2.389  13.440 19.443 1.00 0.00 ? 38 ILE A CB   6  
ATOM 5069  C CG1  . ILE A 1 38 ? -1.402  14.088 20.416 1.00 0.00 ? 38 ILE A CG1  6  
ATOM 5070  C CG2  . ILE A 1 38 ? -1.734  13.299 18.067 1.00 0.00 ? 38 ILE A CG2  6  
ATOM 5071  C CD1  . ILE A 1 38 ? -0.035  13.410 20.291 1.00 0.00 ? 38 ILE A CD1  6  
ATOM 5072  H H    . ILE A 1 38 ? -3.960  13.642 21.341 1.00 0.00 ? 38 ILE A H    6  
ATOM 5073  H HA   . ILE A 1 38 ? -3.359  15.346 19.194 1.00 0.00 ? 38 ILE A HA   6  
ATOM 5074  H HB   . ILE A 1 38 ? -2.669  12.462 19.809 1.00 0.00 ? 38 ILE A HB   6  
ATOM 5075  H HG12 . ILE A 1 38 ? -1.305  15.139 20.183 1.00 0.00 ? 38 ILE A HG12 6  
ATOM 5076  H HG13 . ILE A 1 38 ? -1.766  13.975 21.425 1.00 0.00 ? 38 ILE A HG13 6  
ATOM 5077  H HG21 . ILE A 1 38 ? -2.472  12.974 17.348 1.00 0.00 ? 38 ILE A HG21 6  
ATOM 5078  H HG22 . ILE A 1 38 ? -1.330  14.254 17.762 1.00 0.00 ? 38 ILE A HG22 6  
ATOM 5079  H HG23 . ILE A 1 38 ? -0.938  12.572 18.120 1.00 0.00 ? 38 ILE A HG23 6  
ATOM 5080  H HD11 . ILE A 1 38 ? -0.153  12.447 19.815 1.00 0.00 ? 38 ILE A HD11 6  
ATOM 5081  H HD12 . ILE A 1 38 ? 0.620   14.028 19.695 1.00 0.00 ? 38 ILE A HD12 6  
ATOM 5082  H HD13 . ILE A 1 38 ? 0.391   13.276 21.274 1.00 0.00 ? 38 ILE A HD13 6  
ATOM 5083  N N    . ASN A 1 39 ? -5.233  12.777 18.343 1.00 0.00 ? 39 ASN A N    6  
ATOM 5084  C CA   . ASN A 1 39 ? -6.112  12.275 17.248 1.00 0.00 ? 39 ASN A CA   6  
ATOM 5085  C C    . ASN A 1 39 ? -7.286  13.233 17.044 1.00 0.00 ? 39 ASN A C    6  
ATOM 5086  O O    . ASN A 1 39 ? -7.750  13.437 15.940 1.00 0.00 ? 39 ASN A O    6  
ATOM 5087  C CB   . ASN A 1 39 ? -6.606  10.909 17.725 1.00 0.00 ? 39 ASN A CB   6  
ATOM 5088  C CG   . ASN A 1 39 ? -5.514  9.862  17.499 1.00 0.00 ? 39 ASN A CG   6  
ATOM 5089  O OD1  . ASN A 1 39 ? -4.789  9.925  16.526 1.00 0.00 ? 39 ASN A OD1  6  
ATOM 5090  N ND2  . ASN A 1 39 ? -5.364  8.896  18.364 1.00 0.00 ? 39 ASN A ND2  6  
ATOM 5091  H H    . ASN A 1 39 ? -5.204  12.310 19.206 1.00 0.00 ? 39 ASN A H    6  
ATOM 5092  H HA   . ASN A 1 39 ? -5.551  12.168 16.335 1.00 0.00 ? 39 ASN A HA   6  
ATOM 5093  H HB2  . ASN A 1 39 ? -6.844  10.959 18.777 1.00 0.00 ? 39 ASN A HB2  6  
ATOM 5094  H HB3  . ASN A 1 39 ? -7.491  10.632 17.170 1.00 0.00 ? 39 ASN A HB3  6  
ATOM 5095  H HD21 . ASN A 1 39 ? -5.948  8.847  19.149 1.00 0.00 ? 39 ASN A HD21 6  
ATOM 5096  H HD22 . ASN A 1 39 ? -4.667  8.222  18.228 1.00 0.00 ? 39 ASN A HD22 6  
ATOM 5097  N N    . LYS A 1 40 ? -7.762  13.825 18.102 1.00 0.00 ? 40 LYS A N    6  
ATOM 5098  C CA   . LYS A 1 40 ? -8.904  14.776 17.975 1.00 0.00 ? 40 LYS A CA   6  
ATOM 5099  C C    . LYS A 1 40 ? -8.396  16.156 17.545 1.00 0.00 ? 40 LYS A C    6  
ATOM 5100  O O    . LYS A 1 40 ? -9.141  16.970 17.037 1.00 0.00 ? 40 LYS A O    6  
ATOM 5101  C CB   . LYS A 1 40 ? -9.524  14.841 19.370 1.00 0.00 ? 40 LYS A CB   6  
ATOM 5102  C CG   . LYS A 1 40 ? -10.219 13.514 19.681 1.00 0.00 ? 40 LYS A CG   6  
ATOM 5103  C CD   . LYS A 1 40 ? -10.746 13.537 21.117 1.00 0.00 ? 40 LYS A CD   6  
ATOM 5104  C CE   . LYS A 1 40 ? -12.234 13.898 21.109 1.00 0.00 ? 40 LYS A CE   6  
ATOM 5105  N NZ   . LYS A 1 40 ? -12.673 13.732 22.523 1.00 0.00 ? 40 LYS A NZ   6  
ATOM 5106  H H    . LYS A 1 40 ? -7.369  13.646 18.982 1.00 0.00 ? 40 LYS A H    6  
ATOM 5107  H HA   . LYS A 1 40 ? -9.627  14.403 17.267 1.00 0.00 ? 40 LYS A HA   6  
ATOM 5108  H HB2  . LYS A 1 40 ? -8.750  15.023 20.101 1.00 0.00 ? 40 LYS A HB2  6  
ATOM 5109  H HB3  . LYS A 1 40 ? -10.247 15.643 19.405 1.00 0.00 ? 40 LYS A HB3  6  
ATOM 5110  H HG2  . LYS A 1 40 ? -11.043 13.370 18.997 1.00 0.00 ? 40 LYS A HG2  6  
ATOM 5111  H HG3  . LYS A 1 40 ? -9.514  12.704 19.569 1.00 0.00 ? 40 LYS A HG3  6  
ATOM 5112  H HD2  . LYS A 1 40 ? -10.614 12.563 21.565 1.00 0.00 ? 40 LYS A HD2  6  
ATOM 5113  H HD3  . LYS A 1 40 ? -10.200 14.274 21.689 1.00 0.00 ? 40 LYS A HD3  6  
ATOM 5114  H HE2  . LYS A 1 40 ? -12.370 14.920 20.789 1.00 0.00 ? 40 LYS A HE2  6  
ATOM 5115  H HE3  . LYS A 1 40 ? -12.779 13.226 20.464 1.00 0.00 ? 40 LYS A HE3  6  
ATOM 5116  H HZ1  . LYS A 1 40 ? -11.959 14.140 23.159 1.00 0.00 ? 40 LYS A HZ1  6  
ATOM 5117  H HZ2  . LYS A 1 40 ? -13.579 14.223 22.664 1.00 0.00 ? 40 LYS A HZ2  6  
ATOM 5118  H HZ3  . LYS A 1 40 ? -12.789 12.720 22.734 1.00 0.00 ? 40 LYS A HZ3  6  
ATOM 5119  N N    . CYS A 1 41 ? -7.133  16.424 17.742 1.00 0.00 ? 41 CYS A N    6  
ATOM 5120  C CA   . CYS A 1 41 ? -6.582  17.751 17.341 1.00 0.00 ? 41 CYS A CA   6  
ATOM 5121  C C    . CYS A 1 41 ? -7.013  18.087 15.912 1.00 0.00 ? 41 CYS A C    6  
ATOM 5122  O O    . CYS A 1 41 ? -7.745  19.028 15.678 1.00 0.00 ? 41 CYS A O    6  
ATOM 5123  C CB   . CYS A 1 41 ? -5.063  17.592 17.418 1.00 0.00 ? 41 CYS A CB   6  
ATOM 5124  S SG   . CYS A 1 41 ? -4.304  19.201 17.755 1.00 0.00 ? 41 CYS A SG   6  
ATOM 5125  H H    . CYS A 1 41 ? -6.548  15.753 18.152 1.00 0.00 ? 41 CYS A H    6  
ATOM 5126  H HA   . CYS A 1 41 ? -6.909  18.517 18.025 1.00 0.00 ? 41 CYS A HA   6  
ATOM 5127  H HB2  . CYS A 1 41 ? -4.813  16.903 18.212 1.00 0.00 ? 41 CYS A HB2  6  
ATOM 5128  H HB3  . CYS A 1 41 ? -4.693  17.209 16.479 1.00 0.00 ? 41 CYS A HB3  6  
ATOM 5129  N N    . ALA A 1 42 ? -6.567  17.322 14.954 1.00 0.00 ? 42 ALA A N    6  
ATOM 5130  C CA   . ALA A 1 42 ? -6.956  17.596 13.541 1.00 0.00 ? 42 ALA A CA   6  
ATOM 5131  C C    . ALA A 1 42 ? -8.455  17.358 13.353 1.00 0.00 ? 42 ALA A C    6  
ATOM 5132  O O    . ALA A 1 42 ? -9.105  18.013 12.562 1.00 0.00 ? 42 ALA A O    6  
ATOM 5133  C CB   . ALA A 1 42 ? -6.144  16.604 12.708 1.00 0.00 ? 42 ALA A CB   6  
ATOM 5134  H H    . ALA A 1 42 ? -5.980  16.566 15.162 1.00 0.00 ? 42 ALA A H    6  
ATOM 5135  H HA   . ALA A 1 42 ? -6.696  18.607 13.267 1.00 0.00 ? 42 ALA A HA   6  
ATOM 5136  H HB1  . ALA A 1 42 ? -6.010  15.690 13.267 1.00 0.00 ? 42 ALA A HB1  6  
ATOM 5137  H HB2  . ALA A 1 42 ? -5.179  17.031 12.478 1.00 0.00 ? 42 ALA A HB2  6  
ATOM 5138  H HB3  . ALA A 1 42 ? -6.671  16.390 11.790 1.00 0.00 ? 42 ALA A HB3  6  
ATOM 5139  N N    . THR A 1 43 ? -9.010  16.425 14.077 1.00 0.00 ? 43 THR A N    6  
ATOM 5140  C CA   . THR A 1 43 ? -10.469 16.144 13.943 1.00 0.00 ? 43 THR A CA   6  
ATOM 5141  C C    . THR A 1 43 ? -11.284 17.345 14.427 1.00 0.00 ? 43 THR A C    6  
ATOM 5142  O O    . THR A 1 43 ? -12.069 17.912 13.694 1.00 0.00 ? 43 THR A O    6  
ATOM 5143  C CB   . THR A 1 43 ? -10.723 14.928 14.834 1.00 0.00 ? 43 THR A CB   6  
ATOM 5144  O OG1  . THR A 1 43 ? -9.813  13.892 14.489 1.00 0.00 ? 43 THR A OG1  6  
ATOM 5145  C CG2  . THR A 1 43 ? -12.158 14.437 14.635 1.00 0.00 ? 43 THR A CG2  6  
ATOM 5146  H H    . THR A 1 43 ? -8.468  15.907 14.710 1.00 0.00 ? 43 THR A H    6  
ATOM 5147  H HA   . THR A 1 43 ? -10.715 15.908 12.920 1.00 0.00 ? 43 THR A HA   6  
ATOM 5148  H HB   . THR A 1 43 ? -10.581 15.203 15.867 1.00 0.00 ? 43 THR A HB   6  
ATOM 5149  H HG1  . THR A 1 43 ? -9.987  13.141 15.062 1.00 0.00 ? 43 THR A HG1  6  
ATOM 5150  H HG21 . THR A 1 43 ? -12.596 14.941 13.787 1.00 0.00 ? 43 THR A HG21 6  
ATOM 5151  H HG22 . THR A 1 43 ? -12.153 13.372 14.456 1.00 0.00 ? 43 THR A HG22 6  
ATOM 5152  H HG23 . THR A 1 43 ? -12.737 14.651 15.521 1.00 0.00 ? 43 THR A HG23 6  
ATOM 5153  N N    . CYS A 1 44 ? -11.104 17.740 15.657 1.00 0.00 ? 44 CYS A N    6  
ATOM 5154  C CA   . CYS A 1 44 ? -11.871 18.907 16.182 1.00 0.00 ? 44 CYS A CA   6  
ATOM 5155  C C    . CYS A 1 44 ? -11.648 20.130 15.288 1.00 0.00 ? 44 CYS A C    6  
ATOM 5156  O O    . CYS A 1 44 ? -12.532 20.939 15.095 1.00 0.00 ? 44 CYS A O    6  
ATOM 5157  C CB   . CYS A 1 44 ? -11.305 19.155 17.582 1.00 0.00 ? 44 CYS A CB   6  
ATOM 5158  S SG   . CYS A 1 44 ? -11.593 17.696 18.615 1.00 0.00 ? 44 CYS A SG   6  
ATOM 5159  H H    . CYS A 1 44 ? -10.466 17.272 16.235 1.00 0.00 ? 44 CYS A H    6  
ATOM 5160  H HA   . CYS A 1 44 ? -12.921 18.671 16.245 1.00 0.00 ? 44 CYS A HA   6  
ATOM 5161  H HB2  . CYS A 1 44 ? -10.245 19.343 17.514 1.00 0.00 ? 44 CYS A HB2  6  
ATOM 5162  H HB3  . CYS A 1 44 ? -11.796 20.010 18.022 1.00 0.00 ? 44 CYS A HB3  6  
ATOM 5163  N N    . LYS A 1 45 ? -10.471 20.270 14.744 1.00 0.00 ? 45 LYS A N    6  
ATOM 5164  C CA   . LYS A 1 45 ? -10.190 21.441 13.863 1.00 0.00 ? 45 LYS A CA   6  
ATOM 5165  C C    . LYS A 1 45 ? -11.161 21.469 12.678 1.00 0.00 ? 45 LYS A C    6  
ATOM 5166  O O    . LYS A 1 45 ? -11.785 22.474 12.402 1.00 0.00 ? 45 LYS A O    6  
ATOM 5167  C CB   . LYS A 1 45 ? -8.756  21.229 13.374 1.00 0.00 ? 45 LYS A CB   6  
ATOM 5168  C CG   . LYS A 1 45 ? -8.399  22.313 12.355 1.00 0.00 ? 45 LYS A CG   6  
ATOM 5169  C CD   . LYS A 1 45 ? -7.450  21.733 11.304 1.00 0.00 ? 45 LYS A CD   6  
ATOM 5170  C CE   . LYS A 1 45 ? -6.977  22.850 10.371 1.00 0.00 ? 45 LYS A CE   6  
ATOM 5171  N NZ   . LYS A 1 45 ? -5.793  22.281 9.666  1.00 0.00 ? 45 LYS A NZ   6  
ATOM 5172  H H    . LYS A 1 45 ? -9.771  19.608 14.914 1.00 0.00 ? 45 LYS A H    6  
ATOM 5173  H HA   . LYS A 1 45 ? -10.254 22.359 14.424 1.00 0.00 ? 45 LYS A HA   6  
ATOM 5174  H HB2  . LYS A 1 45 ? -8.078  21.284 14.212 1.00 0.00 ? 45 LYS A HB2  6  
ATOM 5175  H HB3  . LYS A 1 45 ? -8.675  20.257 12.908 1.00 0.00 ? 45 LYS A HB3  6  
ATOM 5176  H HG2  . LYS A 1 45 ? -9.300  22.665 11.873 1.00 0.00 ? 45 LYS A HG2  6  
ATOM 5177  H HG3  . LYS A 1 45 ? -7.917  23.138 12.860 1.00 0.00 ? 45 LYS A HG3  6  
ATOM 5178  H HD2  . LYS A 1 45 ? -6.597  21.289 11.796 1.00 0.00 ? 45 LYS A HD2  6  
ATOM 5179  H HD3  . LYS A 1 45 ? -7.968  20.979 10.730 1.00 0.00 ? 45 LYS A HD3  6  
ATOM 5180  H HE2  . LYS A 1 45 ? -7.752  23.102 9.662  1.00 0.00 ? 45 LYS A HE2  6  
ATOM 5181  H HE3  . LYS A 1 45 ? -6.692  23.720 10.942 1.00 0.00 ? 45 LYS A HE3  6  
ATOM 5182  H HZ1  . LYS A 1 45 ? -5.083  21.985 10.364 1.00 0.00 ? 45 LYS A HZ1  6  
ATOM 5183  H HZ2  . LYS A 1 45 ? -6.087  21.459 9.102  1.00 0.00 ? 45 LYS A HZ2  6  
ATOM 5184  H HZ3  . LYS A 1 45 ? -5.384  23.005 9.038  1.00 0.00 ? 45 LYS A HZ3  6  
ATOM 5185  N N    . MET A 1 46 ? -11.291 20.379 11.973 1.00 0.00 ? 46 MET A N    6  
ATOM 5186  C CA   . MET A 1 46 ? -12.219 20.355 10.804 1.00 0.00 ? 46 MET A CA   6  
ATOM 5187  C C    . MET A 1 46 ? -13.646 20.682 11.250 1.00 0.00 ? 46 MET A C    6  
ATOM 5188  O O    . MET A 1 46 ? -14.462 21.133 10.471 1.00 0.00 ? 46 MET A O    6  
ATOM 5189  C CB   . MET A 1 46 ? -12.132 18.931 10.249 1.00 0.00 ? 46 MET A CB   6  
ATOM 5190  C CG   . MET A 1 46 ? -12.775 17.944 11.225 1.00 0.00 ? 46 MET A CG   6  
ATOM 5191  S SD   . MET A 1 46 ? -14.044 16.984 10.362 1.00 0.00 ? 46 MET A SD   6  
ATOM 5192  C CE   . MET A 1 46 ? -15.110 18.374 9.906  1.00 0.00 ? 46 MET A CE   6  
ATOM 5193  H H    . MET A 1 46 ? -10.777 19.579 12.206 1.00 0.00 ? 46 MET A H    6  
ATOM 5194  H HA   . MET A 1 46 ? -11.892 21.059 10.055 1.00 0.00 ? 46 MET A HA   6  
ATOM 5195  H HB2  . MET A 1 46 ? -12.647 18.885 9.302  1.00 0.00 ? 46 MET A HB2  6  
ATOM 5196  H HB3  . MET A 1 46 ? -11.095 18.667 10.106 1.00 0.00 ? 46 MET A HB3  6  
ATOM 5197  H HG2  . MET A 1 46 ? -12.018 17.275 11.610 1.00 0.00 ? 46 MET A HG2  6  
ATOM 5198  H HG3  . MET A 1 46 ? -13.226 18.482 12.042 1.00 0.00 ? 46 MET A HG3  6  
ATOM 5199  H HE1  . MET A 1 46 ? -15.312 18.973 10.782 1.00 0.00 ? 46 MET A HE1  6  
ATOM 5200  H HE2  . MET A 1 46 ? -14.616 18.980 9.164  1.00 0.00 ? 46 MET A HE2  6  
ATOM 5201  H HE3  . MET A 1 46 ? -16.038 17.995 9.499  1.00 0.00 ? 46 MET A HE3  6  
ATOM 5202  N N    . ILE A 1 47 ? -13.952 20.461 12.497 1.00 0.00 ? 47 ILE A N    6  
ATOM 5203  C CA   . ILE A 1 47 ? -15.326 20.764 12.990 1.00 0.00 ? 47 ILE A CA   6  
ATOM 5204  C C    . ILE A 1 47 ? -15.630 22.251 12.798 1.00 0.00 ? 47 ILE A C    6  
ATOM 5205  O O    . ILE A 1 47 ? -16.741 22.634 12.489 1.00 0.00 ? 47 ILE A O    6  
ATOM 5206  C CB   . ILE A 1 47 ? -15.306 20.407 14.477 1.00 0.00 ? 47 ILE A CB   6  
ATOM 5207  C CG1  . ILE A 1 47 ? -14.848 18.956 14.648 1.00 0.00 ? 47 ILE A CG1  6  
ATOM 5208  C CG2  . ILE A 1 47 ? -16.712 20.569 15.059 1.00 0.00 ? 47 ILE A CG2  6  
ATOM 5209  C CD1  . ILE A 1 47 ? -15.633 18.057 13.690 1.00 0.00 ? 47 ILE A CD1  6  
ATOM 5210  H H    . ILE A 1 47 ? -13.278 20.099 13.108 1.00 0.00 ? 47 ILE A H    6  
ATOM 5211  H HA   . ILE A 1 47 ? -16.054 20.159 12.474 1.00 0.00 ? 47 ILE A HA   6  
ATOM 5212  H HB   . ILE A 1 47 ? -14.624 21.063 14.996 1.00 0.00 ? 47 ILE A HB   6  
ATOM 5213  H HG12 . ILE A 1 47 ? -13.793 18.883 14.428 1.00 0.00 ? 47 ILE A HG12 6  
ATOM 5214  H HG13 . ILE A 1 47 ? -15.026 18.641 15.666 1.00 0.00 ? 47 ILE A HG13 6  
ATOM 5215  H HG21 . ILE A 1 47 ? -17.120 21.521 14.753 1.00 0.00 ? 47 ILE A HG21 6  
ATOM 5216  H HG22 . ILE A 1 47 ? -17.346 19.773 14.698 1.00 0.00 ? 47 ILE A HG22 6  
ATOM 5217  H HG23 . ILE A 1 47 ? -16.662 20.529 16.137 1.00 0.00 ? 47 ILE A HG23 6  
ATOM 5218  H HD11 . ILE A 1 47 ? -16.691 18.228 13.821 1.00 0.00 ? 47 ILE A HD11 6  
ATOM 5219  H HD12 . ILE A 1 47 ? -15.355 18.286 12.672 1.00 0.00 ? 47 ILE A HD12 6  
ATOM 5220  H HD13 . ILE A 1 47 ? -15.407 17.022 13.901 1.00 0.00 ? 47 ILE A HD13 6  
ATOM 5221  N N    . LEU A 1 48 ? -14.647 23.091 12.974 1.00 0.00 ? 48 LEU A N    6  
ATOM 5222  C CA   . LEU A 1 48 ? -14.873 24.553 12.795 1.00 0.00 ? 48 LEU A CA   6  
ATOM 5223  C C    . LEU A 1 48 ? -14.914 24.897 11.304 1.00 0.00 ? 48 LEU A C    6  
ATOM 5224  O O    . LEU A 1 48 ? -15.707 25.705 10.864 1.00 0.00 ? 48 LEU A O    6  
ATOM 5225  C CB   . LEU A 1 48 ? -13.677 25.226 13.467 1.00 0.00 ? 48 LEU A CB   6  
ATOM 5226  C CG   . LEU A 1 48 ? -13.819 25.124 14.986 1.00 0.00 ? 48 LEU A CG   6  
ATOM 5227  C CD1  . LEU A 1 48 ? -15.176 25.690 15.410 1.00 0.00 ? 48 LEU A CD1  6  
ATOM 5228  C CD2  . LEU A 1 48 ? -13.721 23.659 15.412 1.00 0.00 ? 48 LEU A CD2  6  
ATOM 5229  H H    . LEU A 1 48 ? -13.757 22.760 13.218 1.00 0.00 ? 48 LEU A H    6  
ATOM 5230  H HA   . LEU A 1 48 ? -15.788 24.856 13.279 1.00 0.00 ? 48 LEU A HA   6  
ATOM 5231  H HB2  . LEU A 1 48 ? -12.766 24.734 13.156 1.00 0.00 ? 48 LEU A HB2  6  
ATOM 5232  H HB3  . LEU A 1 48 ? -13.639 26.266 13.178 1.00 0.00 ? 48 LEU A HB3  6  
ATOM 5233  H HG   . LEU A 1 48 ? -13.030 25.691 15.458 1.00 0.00 ? 48 LEU A HG   6  
ATOM 5234  H HD11 . LEU A 1 48 ? -15.584 26.286 14.607 1.00 0.00 ? 48 LEU A HD11 6  
ATOM 5235  H HD12 . LEU A 1 48 ? -15.850 24.876 15.634 1.00 0.00 ? 48 LEU A HD12 6  
ATOM 5236  H HD13 . LEU A 1 48 ? -15.051 26.306 16.288 1.00 0.00 ? 48 LEU A HD13 6  
ATOM 5237  H HD21 . LEU A 1 48 ? -12.928 23.175 14.860 1.00 0.00 ? 48 LEU A HD21 6  
ATOM 5238  H HD22 . LEU A 1 48 ? -13.506 23.604 16.469 1.00 0.00 ? 48 LEU A HD22 6  
ATOM 5239  H HD23 . LEU A 1 48 ? -14.657 23.161 15.208 1.00 0.00 ? 48 LEU A HD23 6  
ATOM 5240  N N    . GLU A 1 49 ? -14.063 24.286 10.526 1.00 0.00 ? 49 GLU A N    6  
ATOM 5241  C CA   . GLU A 1 49 ? -14.052 24.576 9.062  1.00 0.00 ? 49 GLU A CA   6  
ATOM 5242  C C    . GLU A 1 49 ? -15.423 24.274 8.455  1.00 0.00 ? 49 GLU A C    6  
ATOM 5243  O O    . GLU A 1 49 ? -15.801 24.829 7.443  1.00 0.00 ? 49 GLU A O    6  
ATOM 5244  C CB   . GLU A 1 49 ? -12.991 23.641 8.482  1.00 0.00 ? 49 GLU A CB   6  
ATOM 5245  C CG   . GLU A 1 49 ? -11.627 23.977 9.088  1.00 0.00 ? 49 GLU A CG   6  
ATOM 5246  C CD   . GLU A 1 49 ? -10.533 23.227 8.326  1.00 0.00 ? 49 GLU A CD   6  
ATOM 5247  O OE1  . GLU A 1 49 ? -10.860 22.266 7.651  1.00 0.00 ? 49 GLU A OE1  6  
ATOM 5248  O OE2  . GLU A 1 49 ? -9.385  23.628 8.430  1.00 0.00 ? 49 GLU A OE2  6  
ATOM 5249  H H    . GLU A 1 49 ? -13.431 23.637 10.902 1.00 0.00 ? 49 GLU A H    6  
ATOM 5250  H HA   . GLU A 1 49 ? -13.777 25.603 8.883  1.00 0.00 ? 49 GLU A HA   6  
ATOM 5251  H HB2  . GLU A 1 49 ? -13.246 22.618 8.716  1.00 0.00 ? 49 GLU A HB2  6  
ATOM 5252  H HB3  . GLU A 1 49 ? -12.949 23.765 7.410  1.00 0.00 ? 49 GLU A HB3  6  
ATOM 5253  H HG2  . GLU A 1 49 ? -11.453 25.041 9.015  1.00 0.00 ? 49 GLU A HG2  6  
ATOM 5254  H HG3  . GLU A 1 49 ? -11.611 23.680 10.126 1.00 0.00 ? 49 GLU A HG3  6  
ATOM 5255  N N    . LYS A 1 50 ? -16.172 23.396 9.066  1.00 0.00 ? 50 LYS A N    6  
ATOM 5256  C CA   . LYS A 1 50 ? -17.519 23.059 8.523  1.00 0.00 ? 50 LYS A CA   6  
ATOM 5257  C C    . LYS A 1 50 ? -18.492 24.216 8.771  1.00 0.00 ? 50 LYS A C    6  
ATOM 5258  O O    . LYS A 1 50 ? -19.333 24.519 7.947  1.00 0.00 ? 50 LYS A O    6  
ATOM 5259  C CB   . LYS A 1 50 ? -17.957 21.814 9.296  1.00 0.00 ? 50 LYS A CB   6  
ATOM 5260  C CG   . LYS A 1 50 ? -17.086 20.626 8.883  1.00 0.00 ? 50 LYS A CG   6  
ATOM 5261  C CD   . LYS A 1 50 ? -17.494 20.153 7.487  1.00 0.00 ? 50 LYS A CD   6  
ATOM 5262  C CE   . LYS A 1 50 ? -16.888 18.775 7.218  1.00 0.00 ? 50 LYS A CE   6  
ATOM 5263  N NZ   . LYS A 1 50 ? -17.177 18.507 5.780  1.00 0.00 ? 50 LYS A NZ   6  
ATOM 5264  H H    . LYS A 1 50 ? -15.849 22.960 9.881  1.00 0.00 ? 50 LYS A H    6  
ATOM 5265  H HA   . LYS A 1 50 ? -17.457 22.837 7.470  1.00 0.00 ? 50 LYS A HA   6  
ATOM 5266  H HB2  . LYS A 1 50 ? -17.848 21.991 10.355 1.00 0.00 ? 50 LYS A HB2  6  
ATOM 5267  H HB3  . LYS A 1 50 ? -18.991 21.596 9.072  1.00 0.00 ? 50 LYS A HB3  6  
ATOM 5268  H HG2  . LYS A 1 50 ? -16.048 20.927 8.873  1.00 0.00 ? 50 LYS A HG2  6  
ATOM 5269  H HG3  . LYS A 1 50 ? -17.219 19.820 9.589  1.00 0.00 ? 50 LYS A HG3  6  
ATOM 5270  H HD2  . LYS A 1 50 ? -18.571 20.091 7.429  1.00 0.00 ? 50 LYS A HD2  6  
ATOM 5271  H HD3  . LYS A 1 50 ? -17.135 20.856 6.750  1.00 0.00 ? 50 LYS A HD3  6  
ATOM 5272  H HE2  . LYS A 1 50 ? -15.821 18.795 7.389  1.00 0.00 ? 50 LYS A HE2  6  
ATOM 5273  H HE3  . LYS A 1 50 ? -17.357 18.029 7.842  1.00 0.00 ? 50 LYS A HE3  6  
ATOM 5274  H HZ1  . LYS A 1 50 ? -18.192 18.639 5.600  1.00 0.00 ? 50 LYS A HZ1  6  
ATOM 5275  H HZ2  . LYS A 1 50 ? -16.634 19.165 5.188  1.00 0.00 ? 50 LYS A HZ2  6  
ATOM 5276  H HZ3  . LYS A 1 50 ? -16.908 17.528 5.550  1.00 0.00 ? 50 LYS A HZ3  6  
ATOM 5277  N N    . GLU A 1 51 ? -18.383 24.864 9.898  1.00 0.00 ? 51 GLU A N    6  
ATOM 5278  C CA   . GLU A 1 51 ? -19.302 26.001 10.196 1.00 0.00 ? 51 GLU A CA   6  
ATOM 5279  C C    . GLU A 1 51 ? -19.053 27.150 9.215  1.00 0.00 ? 51 GLU A C    6  
ATOM 5280  O O    . GLU A 1 51 ? -19.946 27.908 8.891  1.00 0.00 ? 51 GLU A O    6  
ATOM 5281  C CB   . GLU A 1 51 ? -18.955 26.429 11.622 1.00 0.00 ? 51 GLU A CB   6  
ATOM 5282  C CG   . GLU A 1 51 ? -19.914 27.534 12.070 1.00 0.00 ? 51 GLU A CG   6  
ATOM 5283  C CD   . GLU A 1 51 ? -19.486 28.055 13.443 1.00 0.00 ? 51 GLU A CD   6  
ATOM 5284  O OE1  . GLU A 1 51 ? -18.912 27.283 14.194 1.00 0.00 ? 51 GLU A OE1  6  
ATOM 5285  O OE2  . GLU A 1 51 ? -19.741 29.215 13.722 1.00 0.00 ? 51 GLU A OE2  6  
ATOM 5286  H H    . GLU A 1 51 ? -17.698 24.606 10.548 1.00 0.00 ? 51 GLU A H    6  
ATOM 5287  H HA   . GLU A 1 51 ? -20.328 25.679 10.146 1.00 0.00 ? 51 GLU A HA   6  
ATOM 5288  H HB2  . GLU A 1 51 ? -19.048 25.581 12.284 1.00 0.00 ? 51 GLU A HB2  6  
ATOM 5289  H HB3  . GLU A 1 51 ? -17.941 26.799 11.650 1.00 0.00 ? 51 GLU A HB3  6  
ATOM 5290  H HG2  . GLU A 1 51 ? -19.889 28.344 11.355 1.00 0.00 ? 51 GLU A HG2  6  
ATOM 5291  H HG3  . GLU A 1 51 ? -20.916 27.138 12.131 1.00 0.00 ? 51 GLU A HG3  6  
ATOM 5292  N N    . ALA A 1 52 ? -17.846 27.282 8.740  1.00 0.00 ? 52 ALA A N    6  
ATOM 5293  C CA   . ALA A 1 52 ? -17.539 28.379 7.779  1.00 0.00 ? 52 ALA A CA   6  
ATOM 5294  C C    . ALA A 1 52 ? -18.000 27.991 6.372  1.00 0.00 ? 52 ALA A C    6  
ATOM 5295  O O    . ALA A 1 52 ? -18.231 28.835 5.529  1.00 0.00 ? 52 ALA A O    6  
ATOM 5296  C CB   . ALA A 1 52 ? -16.018 28.532 7.823  1.00 0.00 ? 52 ALA A CB   6  
ATOM 5297  H H    . ALA A 1 52 ? -17.142 26.659 9.013  1.00 0.00 ? 52 ALA A H    6  
ATOM 5298  H HA   . ALA A 1 52 ? -18.011 29.297 8.091  1.00 0.00 ? 52 ALA A HA   6  
ATOM 5299  H HB1  . ALA A 1 52 ? -15.643 28.125 8.751  1.00 0.00 ? 52 ALA A HB1  6  
ATOM 5300  H HB2  . ALA A 1 52 ? -15.579 27.999 6.992  1.00 0.00 ? 52 ALA A HB2  6  
ATOM 5301  H HB3  . ALA A 1 52 ? -15.759 29.578 7.757  1.00 0.00 ? 52 ALA A HB3  6  
ATOM 5302  N N    . LYS A 1 53 ? -18.137 26.719 6.113  1.00 0.00 ? 53 LYS A N    6  
ATOM 5303  C CA   . LYS A 1 53 ? -18.583 26.275 4.762  1.00 0.00 ? 53 LYS A CA   6  
ATOM 5304  C C    . LYS A 1 53 ? -17.873 27.087 3.675  1.00 0.00 ? 53 LYS A C    6  
ATOM 5305  O O    . LYS A 1 53 ? -18.488 27.575 2.749  1.00 0.00 ? 53 LYS A O    6  
ATOM 5306  C CB   . LYS A 1 53 ? -20.087 26.544 4.734  1.00 0.00 ? 53 LYS A CB   6  
ATOM 5307  C CG   . LYS A 1 53 ? -20.760 25.793 5.885  1.00 0.00 ? 53 LYS A CG   6  
ATOM 5308  C CD   . LYS A 1 53 ? -22.260 26.094 5.883  1.00 0.00 ? 53 LYS A CD   6  
ATOM 5309  C CE   . LYS A 1 53 ? -22.493 27.524 6.373  1.00 0.00 ? 53 LYS A CE   6  
ATOM 5310  N NZ   . LYS A 1 53 ? -23.974 27.649 6.495  1.00 0.00 ? 53 LYS A NZ   6  
ATOM 5311  H H    . LYS A 1 53 ? -17.946 26.055 6.808  1.00 0.00 ? 53 LYS A H    6  
ATOM 5312  H HA   . LYS A 1 53 ? -18.395 25.222 4.630  1.00 0.00 ? 53 LYS A HA   6  
ATOM 5313  H HB2  . LYS A 1 53 ? -20.266 27.604 4.843  1.00 0.00 ? 53 LYS A HB2  6  
ATOM 5314  H HB3  . LYS A 1 53 ? -20.497 26.204 3.795  1.00 0.00 ? 53 LYS A HB3  6  
ATOM 5315  H HG2  . LYS A 1 53 ? -20.606 24.731 5.761  1.00 0.00 ? 53 LYS A HG2  6  
ATOM 5316  H HG3  . LYS A 1 53 ? -20.330 26.111 6.823  1.00 0.00 ? 53 LYS A HG3  6  
ATOM 5317  H HD2  . LYS A 1 53 ? -22.647 25.989 4.881  1.00 0.00 ? 53 LYS A HD2  6  
ATOM 5318  H HD3  . LYS A 1 53 ? -22.767 25.402 6.539  1.00 0.00 ? 53 LYS A HD3  6  
ATOM 5319  H HE2  . LYS A 1 53 ? -22.023 27.675 7.334  1.00 0.00 ? 53 LYS A HE2  6  
ATOM 5320  H HE3  . LYS A 1 53 ? -22.114 28.235 5.653  1.00 0.00 ? 53 LYS A HE3  6  
ATOM 5321  H HZ1  . LYS A 1 53 ? -24.357 26.799 6.951  1.00 0.00 ? 53 LYS A HZ1  6  
ATOM 5322  H HZ2  . LYS A 1 53 ? -24.203 28.487 7.069  1.00 0.00 ? 53 LYS A HZ2  6  
ATOM 5323  H HZ3  . LYS A 1 53 ? -24.391 27.751 5.549  1.00 0.00 ? 53 LYS A HZ3  6  
ATOM 5324  N N    . SER A 1 54 ? -16.581 27.235 3.783  1.00 0.00 ? 54 SER A N    6  
ATOM 5325  C CA   . SER A 1 54 ? -15.832 28.014 2.756  1.00 0.00 ? 54 SER A CA   6  
ATOM 5326  C C    . SER A 1 54 ? -15.744 27.219 1.451  1.00 0.00 ? 54 SER A C    6  
ATOM 5327  O O    . SER A 1 54 ? -15.498 27.767 0.394  1.00 0.00 ? 54 SER A O    6  
ATOM 5328  C CB   . SER A 1 54 ? -14.440 28.220 3.353  1.00 0.00 ? 54 SER A CB   6  
ATOM 5329  O OG   . SER A 1 54 ? -13.824 26.958 3.565  1.00 0.00 ? 54 SER A OG   6  
ATOM 5330  H H    . SER A 1 54 ? -16.103 26.833 4.538  1.00 0.00 ? 54 SER A H    6  
ATOM 5331  H HA   . SER A 1 54 ? -16.306 28.968 2.587  1.00 0.00 ? 54 SER A HA   6  
ATOM 5332  H HB2  . SER A 1 54 ? -13.839 28.805 2.672  1.00 0.00 ? 54 SER A HB2  6  
ATOM 5333  H HB3  . SER A 1 54 ? -14.525 28.741 4.295  1.00 0.00 ? 54 SER A HB3  6  
ATOM 5334  H HG   . SER A 1 54 ? -12.878 27.100 3.641  1.00 0.00 ? 54 SER A HG   6  
ATOM 5335  N N    . GLN A 1 55 ? -15.946 25.931 1.515  1.00 0.00 ? 55 GLN A N    6  
ATOM 5336  C CA   . GLN A 1 55 ? -15.874 25.103 0.278  1.00 0.00 ? 55 GLN A CA   6  
ATOM 5337  C C    . GLN A 1 55 ? -17.170 25.240 -0.526 1.00 0.00 ? 55 GLN A C    6  
ATOM 5338  O O    . GLN A 1 55 ? -17.828 26.258 -0.382 1.00 0.00 ? 55 GLN A O    6  
ATOM 5339  C CB   . GLN A 1 55 ? -15.701 23.667 0.773  1.00 0.00 ? 55 GLN A CB   6  
ATOM 5340  C CG   . GLN A 1 55 ? -14.353 23.530 1.482  1.00 0.00 ? 55 GLN A CG   6  
ATOM 5341  C CD   . GLN A 1 55 ? -13.233 23.476 0.442  1.00 0.00 ? 55 GLN A CD   6  
ATOM 5342  O OE1  . GLN A 1 55 ? -13.426 23.856 -0.696 1.00 0.00 ? 55 GLN A OE1  6  
ATOM 5343  N NE2  . GLN A 1 55 ? -12.062 23.016 0.786  1.00 0.00 ? 55 GLN A NE2  6  
ATOM 5344  O OXT  . GLN A 1 55 ? -17.484 24.326 -1.271 1.00 0.00 ? 55 GLN A OXT  6  
ATOM 5345  H H    . GLN A 1 55 ? -16.145 25.509 2.377  1.00 0.00 ? 55 GLN A H    6  
ATOM 5346  H HA   . GLN A 1 55 ? -15.026 25.391 -0.322 1.00 0.00 ? 55 GLN A HA   6  
ATOM 5347  H HB2  . GLN A 1 55 ? -16.497 23.425 1.462  1.00 0.00 ? 55 GLN A HB2  6  
ATOM 5348  H HB3  . GLN A 1 55 ? -15.736 22.990 -0.068 1.00 0.00 ? 55 GLN A HB3  6  
ATOM 5349  H HG2  . GLN A 1 55 ? -14.201 24.379 2.131  1.00 0.00 ? 55 GLN A HG2  6  
ATOM 5350  H HG3  . GLN A 1 55 ? -14.345 22.623 2.068  1.00 0.00 ? 55 GLN A HG3  6  
ATOM 5351  H HE21 . GLN A 1 55 ? -11.905 22.710 1.704  1.00 0.00 ? 55 GLN A HE21 6  
ATOM 5352  H HE22 . GLN A 1 55 ? -11.338 22.977 0.126  1.00 0.00 ? 55 GLN A HE22 6  
ATOM 5353  N N    . LYS A 1 1  ? -26.004 11.414 22.778 1.00 0.00 ? 1  LYS A N    7  
ATOM 5354  C CA   . LYS A 1 1  ? -25.394 12.553 22.033 1.00 0.00 ? 1  LYS A CA   7  
ATOM 5355  C C    . LYS A 1 1  ? -24.540 12.031 20.875 1.00 0.00 ? 1  LYS A C    7  
ATOM 5356  O O    . LYS A 1 1  ? -23.772 11.101 21.026 1.00 0.00 ? 1  LYS A O    7  
ATOM 5357  C CB   . LYS A 1 1  ? -24.521 13.275 23.059 1.00 0.00 ? 1  LYS A CB   7  
ATOM 5358  C CG   . LYS A 1 1  ? -25.414 13.945 24.106 1.00 0.00 ? 1  LYS A CG   7  
ATOM 5359  C CD   . LYS A 1 1  ? -24.544 14.722 25.097 1.00 0.00 ? 1  LYS A CD   7  
ATOM 5360  C CE   . LYS A 1 1  ? -25.440 15.519 26.047 1.00 0.00 ? 1  LYS A CE   7  
ATOM 5361  N NZ   . LYS A 1 1  ? -24.496 16.291 26.902 1.00 0.00 ? 1  LYS A NZ   7  
ATOM 5362  H H1   . LYS A 1 1  ? -26.190 10.630 22.121 1.00 0.00 ? 1  LYS A H1   7  
ATOM 5363  H H2   . LYS A 1 1  ? -25.350 11.093 23.519 1.00 0.00 ? 1  LYS A H2   7  
ATOM 5364  H H3   . LYS A 1 1  ? -26.898 11.723 23.212 1.00 0.00 ? 1  LYS A H3   7  
ATOM 5365  H HA   . LYS A 1 1  ? -26.159 13.218 21.667 1.00 0.00 ? 1  LYS A HA   7  
ATOM 5366  H HB2  . LYS A 1 1  ? -23.871 12.563 23.544 1.00 0.00 ? 1  LYS A HB2  7  
ATOM 5367  H HB3  . LYS A 1 1  ? -23.925 14.026 22.562 1.00 0.00 ? 1  LYS A HB3  7  
ATOM 5368  H HG2  . LYS A 1 1  ? -26.096 14.625 23.616 1.00 0.00 ? 1  LYS A HG2  7  
ATOM 5369  H HG3  . LYS A 1 1  ? -25.976 13.190 24.636 1.00 0.00 ? 1  LYS A HG3  7  
ATOM 5370  H HD2  . LYS A 1 1  ? -23.941 14.029 25.666 1.00 0.00 ? 1  LYS A HD2  7  
ATOM 5371  H HD3  . LYS A 1 1  ? -23.900 15.399 24.556 1.00 0.00 ? 1  LYS A HD3  7  
ATOM 5372  H HE2  . LYS A 1 1  ? -26.078 16.189 25.489 1.00 0.00 ? 1  LYS A HE2  7  
ATOM 5373  H HE3  . LYS A 1 1  ? -26.034 14.850 26.652 1.00 0.00 ? 1  LYS A HE3  7  
ATOM 5374  H HZ1  . LYS A 1 1  ? -23.840 15.638 27.374 1.00 0.00 ? 1  LYS A HZ1  7  
ATOM 5375  H HZ2  . LYS A 1 1  ? -23.957 16.956 26.312 1.00 0.00 ? 1  LYS A HZ2  7  
ATOM 5376  H HZ3  . LYS A 1 1  ? -25.034 16.822 27.619 1.00 0.00 ? 1  LYS A HZ3  7  
ATOM 5377  N N    . ASN A 1 2  ? -24.668 12.622 19.718 1.00 0.00 ? 2  ASN A N    7  
ATOM 5378  C CA   . ASN A 1 2  ? -23.863 12.159 18.551 1.00 0.00 ? 2  ASN A CA   7  
ATOM 5379  C C    . ASN A 1 2  ? -22.463 12.777 18.595 1.00 0.00 ? 2  ASN A C    7  
ATOM 5380  O O    . ASN A 1 2  ? -22.233 13.771 19.253 1.00 0.00 ? 2  ASN A O    7  
ATOM 5381  C CB   . ASN A 1 2  ? -24.628 12.652 17.322 1.00 0.00 ? 2  ASN A CB   7  
ATOM 5382  C CG   . ASN A 1 2  ? -26.028 12.035 17.312 1.00 0.00 ? 2  ASN A CG   7  
ATOM 5383  O OD1  . ASN A 1 2  ? -27.009 12.729 17.133 1.00 0.00 ? 2  ASN A OD1  7  
ATOM 5384  N ND2  . ASN A 1 2  ? -26.163 10.749 17.497 1.00 0.00 ? 2  ASN A ND2  7  
ATOM 5385  H H    . ASN A 1 2  ? -25.292 13.370 19.617 1.00 0.00 ? 2  ASN A H    7  
ATOM 5386  H HA   . ASN A 1 2  ? -23.800 11.082 18.539 1.00 0.00 ? 2  ASN A HA   7  
ATOM 5387  H HB2  . ASN A 1 2  ? -24.709 13.727 17.356 1.00 0.00 ? 2  ASN A HB2  7  
ATOM 5388  H HB3  . ASN A 1 2  ? -24.098 12.359 16.428 1.00 0.00 ? 2  ASN A HB3  7  
ATOM 5389  H HD21 . ASN A 1 2  ? -25.371 10.190 17.641 1.00 0.00 ? 2  ASN A HD21 7  
ATOM 5390  H HD22 . ASN A 1 2  ? -27.055 10.345 17.492 1.00 0.00 ? 2  ASN A HD22 7  
ATOM 5391  N N    . GLU A 1 3  ? -21.525 12.193 17.900 1.00 0.00 ? 3  GLU A N    7  
ATOM 5392  C CA   . GLU A 1 3  ? -20.141 12.749 17.903 1.00 0.00 ? 3  GLU A CA   7  
ATOM 5393  C C    . GLU A 1 3  ? -20.116 14.108 17.200 1.00 0.00 ? 3  GLU A C    7  
ATOM 5394  O O    . GLU A 1 3  ? -19.264 14.935 17.456 1.00 0.00 ? 3  GLU A O    7  
ATOM 5395  C CB   . GLU A 1 3  ? -19.302 11.729 17.132 1.00 0.00 ? 3  GLU A CB   7  
ATOM 5396  C CG   . GLU A 1 3  ? -19.075 10.492 18.003 1.00 0.00 ? 3  GLU A CG   7  
ATOM 5397  C CD   . GLU A 1 3  ? -18.268 9.457  17.216 1.00 0.00 ? 3  GLU A CD   7  
ATOM 5398  O OE1  . GLU A 1 3  ? -17.813 9.786  16.134 1.00 0.00 ? 3  GLU A OE1  7  
ATOM 5399  O OE2  . GLU A 1 3  ? -18.119 8.351  17.710 1.00 0.00 ? 3  GLU A OE2  7  
ATOM 5400  H H    . GLU A 1 3  ? -21.730 11.391 17.376 1.00 0.00 ? 3  GLU A H    7  
ATOM 5401  H HA   . GLU A 1 3  ? -19.773 12.840 18.913 1.00 0.00 ? 3  GLU A HA   7  
ATOM 5402  H HB2  . GLU A 1 3  ? -19.822 11.444 16.230 1.00 0.00 ? 3  GLU A HB2  7  
ATOM 5403  H HB3  . GLU A 1 3  ? -18.349 12.168 16.875 1.00 0.00 ? 3  GLU A HB3  7  
ATOM 5404  H HG2  . GLU A 1 3  ? -18.531 10.772 18.892 1.00 0.00 ? 3  GLU A HG2  7  
ATOM 5405  H HG3  . GLU A 1 3  ? -20.029 10.069 18.282 1.00 0.00 ? 3  GLU A HG3  7  
ATOM 5406  N N    . ASP A 1 4  ? -21.046 14.345 16.315 1.00 0.00 ? 4  ASP A N    7  
ATOM 5407  C CA   . ASP A 1 4  ? -21.076 15.652 15.597 1.00 0.00 ? 4  ASP A CA   7  
ATOM 5408  C C    . ASP A 1 4  ? -21.564 16.758 16.536 1.00 0.00 ? 4  ASP A C    7  
ATOM 5409  O O    . ASP A 1 4  ? -21.366 17.930 16.287 1.00 0.00 ? 4  ASP A O    7  
ATOM 5410  C CB   . ASP A 1 4  ? -22.062 15.450 14.448 1.00 0.00 ? 4  ASP A CB   7  
ATOM 5411  C CG   . ASP A 1 4  ? -21.404 14.610 13.351 1.00 0.00 ? 4  ASP A CG   7  
ATOM 5412  O OD1  . ASP A 1 4  ? -20.186 14.626 13.272 1.00 0.00 ? 4  ASP A OD1  7  
ATOM 5413  O OD2  . ASP A 1 4  ? -22.128 13.966 12.610 1.00 0.00 ? 4  ASP A OD2  7  
ATOM 5414  H H    . ASP A 1 4  ? -21.725 13.666 16.124 1.00 0.00 ? 4  ASP A H    7  
ATOM 5415  H HA   . ASP A 1 4  ? -20.099 15.891 15.207 1.00 0.00 ? 4  ASP A HA   7  
ATOM 5416  H HB2  . ASP A 1 4  ? -22.941 14.938 14.814 1.00 0.00 ? 4  ASP A HB2  7  
ATOM 5417  H HB3  . ASP A 1 4  ? -22.347 16.410 14.044 1.00 0.00 ? 4  ASP A HB3  7  
ATOM 5418  N N    . GLN A 1 5  ? -22.202 16.393 17.614 1.00 0.00 ? 5  GLN A N    7  
ATOM 5419  C CA   . GLN A 1 5  ? -22.704 17.422 18.569 1.00 0.00 ? 5  GLN A CA   7  
ATOM 5420  C C    . GLN A 1 5  ? -21.549 17.969 19.411 1.00 0.00 ? 5  GLN A C    7  
ATOM 5421  O O    . GLN A 1 5  ? -21.229 17.444 20.459 1.00 0.00 ? 5  GLN A O    7  
ATOM 5422  C CB   . GLN A 1 5  ? -23.711 16.685 19.454 1.00 0.00 ? 5  GLN A CB   7  
ATOM 5423  C CG   . GLN A 1 5  ? -24.393 17.683 20.391 1.00 0.00 ? 5  GLN A CG   7  
ATOM 5424  C CD   . GLN A 1 5  ? -25.716 17.095 20.886 1.00 0.00 ? 5  GLN A CD   7  
ATOM 5425  O OE1  . GLN A 1 5  ? -26.248 16.180 20.289 1.00 0.00 ? 5  GLN A OE1  7  
ATOM 5426  N NE2  . GLN A 1 5  ? -26.274 17.587 21.959 1.00 0.00 ? 5  GLN A NE2  7  
ATOM 5427  H H    . GLN A 1 5  ? -22.351 15.442 17.797 1.00 0.00 ? 5  GLN A H    7  
ATOM 5428  H HA   . GLN A 1 5  ? -23.196 18.223 18.038 1.00 0.00 ? 5  GLN A HA   7  
ATOM 5429  H HB2  . GLN A 1 5  ? -24.455 16.208 18.832 1.00 0.00 ? 5  GLN A HB2  7  
ATOM 5430  H HB3  . GLN A 1 5  ? -23.196 15.937 20.037 1.00 0.00 ? 5  GLN A HB3  7  
ATOM 5431  H HG2  . GLN A 1 5  ? -23.750 17.882 21.236 1.00 0.00 ? 5  GLN A HG2  7  
ATOM 5432  H HG3  . GLN A 1 5  ? -24.584 18.603 19.859 1.00 0.00 ? 5  GLN A HG3  7  
ATOM 5433  H HE21 . GLN A 1 5  ? -25.845 18.326 22.439 1.00 0.00 ? 5  GLN A HE21 7  
ATOM 5434  H HE22 . GLN A 1 5  ? -27.121 17.217 22.283 1.00 0.00 ? 5  GLN A HE22 7  
ATOM 5435  N N    . GLU A 1 6  ? -20.919 19.019 18.961 1.00 0.00 ? 6  GLU A N    7  
ATOM 5436  C CA   . GLU A 1 6  ? -19.785 19.599 19.737 1.00 0.00 ? 6  GLU A CA   7  
ATOM 5437  C C    . GLU A 1 6  ? -18.649 18.579 19.853 1.00 0.00 ? 6  GLU A C    7  
ATOM 5438  O O    . GLU A 1 6  ? -18.020 18.449 20.885 1.00 0.00 ? 6  GLU A O    7  
ATOM 5439  C CB   . GLU A 1 6  ? -20.366 19.914 21.116 1.00 0.00 ? 6  GLU A CB   7  
ATOM 5440  C CG   . GLU A 1 6  ? -21.723 20.603 20.953 1.00 0.00 ? 6  GLU A CG   7  
ATOM 5441  C CD   . GLU A 1 6  ? -22.379 20.767 22.325 1.00 0.00 ? 6  GLU A CD   7  
ATOM 5442  O OE1  . GLU A 1 6  ? -21.979 20.065 23.239 1.00 0.00 ? 6  GLU A OE1  7  
ATOM 5443  O OE2  . GLU A 1 6  ? -23.270 21.592 22.439 1.00 0.00 ? 6  GLU A OE2  7  
ATOM 5444  H H    . GLU A 1 6  ? -21.192 19.428 18.113 1.00 0.00 ? 6  GLU A H    7  
ATOM 5445  H HA   . GLU A 1 6  ? -19.432 20.504 19.270 1.00 0.00 ? 6  GLU A HA   7  
ATOM 5446  H HB2  . GLU A 1 6  ? -20.493 18.997 21.672 1.00 0.00 ? 6  GLU A HB2  7  
ATOM 5447  H HB3  . GLU A 1 6  ? -19.693 20.568 21.649 1.00 0.00 ? 6  GLU A HB3  7  
ATOM 5448  H HG2  . GLU A 1 6  ? -21.582 21.574 20.503 1.00 0.00 ? 6  GLU A HG2  7  
ATOM 5449  H HG3  . GLU A 1 6  ? -22.359 20.001 20.320 1.00 0.00 ? 6  GLU A HG3  7  
ATOM 5450  N N    . MET A 1 7  ? -18.379 17.854 18.801 1.00 0.00 ? 7  MET A N    7  
ATOM 5451  C CA   . MET A 1 7  ? -17.283 16.843 18.851 1.00 0.00 ? 7  MET A CA   7  
ATOM 5452  C C    . MET A 1 7  ? -16.062 17.423 19.569 1.00 0.00 ? 7  MET A C    7  
ATOM 5453  O O    . MET A 1 7  ? -15.320 16.717 20.221 1.00 0.00 ? 7  MET A O    7  
ATOM 5454  C CB   . MET A 1 7  ? -16.955 16.544 17.388 1.00 0.00 ? 7  MET A CB   7  
ATOM 5455  C CG   . MET A 1 7  ? -16.189 15.222 17.297 1.00 0.00 ? 7  MET A CG   7  
ATOM 5456  S SD   . MET A 1 7  ? -15.358 15.115 15.693 1.00 0.00 ? 7  MET A SD   7  
ATOM 5457  C CE   . MET A 1 7  ? -16.811 14.660 14.714 1.00 0.00 ? 7  MET A CE   7  
ATOM 5458  H H    . MET A 1 7  ? -18.897 17.974 17.978 1.00 0.00 ? 7  MET A H    7  
ATOM 5459  H HA   . MET A 1 7  ? -17.621 15.945 19.344 1.00 0.00 ? 7  MET A HA   7  
ATOM 5460  H HB2  . MET A 1 7  ? -17.870 16.469 16.821 1.00 0.00 ? 7  MET A HB2  7  
ATOM 5461  H HB3  . MET A 1 7  ? -16.346 17.340 16.986 1.00 0.00 ? 7  MET A HB3  7  
ATOM 5462  H HG2  . MET A 1 7  ? -15.453 15.177 18.087 1.00 0.00 ? 7  MET A HG2  7  
ATOM 5463  H HG3  . MET A 1 7  ? -16.880 14.398 17.401 1.00 0.00 ? 7  MET A HG3  7  
ATOM 5464  H HE1  . MET A 1 7  ? -17.631 15.320 14.960 1.00 0.00 ? 7  MET A HE1  7  
ATOM 5465  H HE2  . MET A 1 7  ? -16.583 14.748 13.665 1.00 0.00 ? 7  MET A HE2  7  
ATOM 5466  H HE3  . MET A 1 7  ? -17.088 13.638 14.936 1.00 0.00 ? 7  MET A HE3  7  
ATOM 5467  N N    . CYS A 1 8  ? -15.849 18.705 19.455 1.00 0.00 ? 8  CYS A N    7  
ATOM 5468  C CA   . CYS A 1 8  ? -14.677 19.330 20.133 1.00 0.00 ? 8  CYS A CA   7  
ATOM 5469  C C    . CYS A 1 8  ? -15.033 19.693 21.577 1.00 0.00 ? 8  CYS A C    7  
ATOM 5470  O O    . CYS A 1 8  ? -16.034 20.329 21.838 1.00 0.00 ? 8  CYS A O    7  
ATOM 5471  C CB   . CYS A 1 8  ? -14.375 20.590 19.321 1.00 0.00 ? 8  CYS A CB   7  
ATOM 5472  S SG   . CYS A 1 8  ? -13.728 20.121 17.697 1.00 0.00 ? 8  CYS A SG   7  
ATOM 5473  H H    . CYS A 1 8  ? -16.460 19.259 18.924 1.00 0.00 ? 8  CYS A H    7  
ATOM 5474  H HA   . CYS A 1 8  ? -13.828 18.664 20.109 1.00 0.00 ? 8  CYS A HA   7  
ATOM 5475  H HB2  . CYS A 1 8  ? -15.281 21.164 19.196 1.00 0.00 ? 8  CYS A HB2  7  
ATOM 5476  H HB3  . CYS A 1 8  ? -13.641 21.187 19.843 1.00 0.00 ? 8  CYS A HB3  7  
ATOM 5477  N N    . HIS A 1 9  ? -14.222 19.291 22.517 1.00 0.00 ? 9  HIS A N    7  
ATOM 5478  C CA   . HIS A 1 9  ? -14.518 19.612 23.944 1.00 0.00 ? 9  HIS A CA   7  
ATOM 5479  C C    . HIS A 1 9  ? -13.249 20.084 24.656 1.00 0.00 ? 9  HIS A C    7  
ATOM 5480  O O    . HIS A 1 9  ? -13.279 20.994 25.461 1.00 0.00 ? 9  HIS A O    7  
ATOM 5481  C CB   . HIS A 1 9  ? -15.015 18.298 24.549 1.00 0.00 ? 9  HIS A CB   7  
ATOM 5482  C CG   . HIS A 1 9  ? -15.193 18.468 26.033 1.00 0.00 ? 9  HIS A CG   7  
ATOM 5483  N ND1  . HIS A 1 9  ? -16.128 19.340 26.570 1.00 0.00 ? 9  HIS A ND1  7  
ATOM 5484  C CD2  . HIS A 1 9  ? -14.564 17.886 27.105 1.00 0.00 ? 9  HIS A CD2  7  
ATOM 5485  C CE1  . HIS A 1 9  ? -16.035 19.259 27.910 1.00 0.00 ? 9  HIS A CE1  7  
ATOM 5486  N NE2  . HIS A 1 9  ? -15.096 18.386 28.290 1.00 0.00 ? 9  HIS A NE2  7  
ATOM 5487  H H    . HIS A 1 9  ? -13.420 18.777 22.287 1.00 0.00 ? 9  HIS A H    7  
ATOM 5488  H HA   . HIS A 1 9  ? -15.289 20.362 24.008 1.00 0.00 ? 9  HIS A HA   7  
ATOM 5489  H HB2  . HIS A 1 9  ? -15.959 18.030 24.101 1.00 0.00 ? 9  HIS A HB2  7  
ATOM 5490  H HB3  . HIS A 1 9  ? -14.292 17.520 24.361 1.00 0.00 ? 9  HIS A HB3  7  
ATOM 5491  H HD1  . HIS A 1 9  ? -16.744 19.910 26.067 1.00 0.00 ? 9  HIS A HD1  7  
ATOM 5492  H HD2  . HIS A 1 9  ? -13.776 17.151 27.040 1.00 0.00 ? 9  HIS A HD2  7  
ATOM 5493  H HE1  . HIS A 1 9  ? -16.644 19.829 28.596 1.00 0.00 ? 9  HIS A HE1  7  
ATOM 5494  N N    . GLU A 1 10 ? -12.132 19.474 24.367 1.00 0.00 ? 10 GLU A N    7  
ATOM 5495  C CA   . GLU A 1 10 ? -10.862 19.888 25.030 1.00 0.00 ? 10 GLU A CA   7  
ATOM 5496  C C    . GLU A 1 10 ? -10.128 20.923 24.173 1.00 0.00 ? 10 GLU A C    7  
ATOM 5497  O O    . GLU A 1 10 ? -9.438  21.784 24.681 1.00 0.00 ? 10 GLU A O    7  
ATOM 5498  C CB   . GLU A 1 10 ? -10.038 18.605 25.146 1.00 0.00 ? 10 GLU A CB   7  
ATOM 5499  C CG   . GLU A 1 10 ? -9.546  18.187 23.759 1.00 0.00 ? 10 GLU A CG   7  
ATOM 5500  C CD   . GLU A 1 10 ? -8.621  16.976 23.889 1.00 0.00 ? 10 GLU A CD   7  
ATOM 5501  O OE1  . GLU A 1 10 ? -7.510  17.153 24.362 1.00 0.00 ? 10 GLU A OE1  7  
ATOM 5502  O OE2  . GLU A 1 10 ? -9.039  15.893 23.515 1.00 0.00 ? 10 GLU A OE2  7  
ATOM 5503  H H    . GLU A 1 10 ? -12.128 18.742 23.715 1.00 0.00 ? 10 GLU A H    7  
ATOM 5504  H HA   . GLU A 1 10 ? -11.063 20.286 26.012 1.00 0.00 ? 10 GLU A HA   7  
ATOM 5505  H HB2  . GLU A 1 10 ? -9.189  18.779 25.791 1.00 0.00 ? 10 GLU A HB2  7  
ATOM 5506  H HB3  . GLU A 1 10 ? -10.652 17.820 25.562 1.00 0.00 ? 10 GLU A HB3  7  
ATOM 5507  H HG2  . GLU A 1 10 ? -10.392 17.930 23.139 1.00 0.00 ? 10 GLU A HG2  7  
ATOM 5508  H HG3  . GLU A 1 10 ? -9.005  19.006 23.307 1.00 0.00 ? 10 GLU A HG3  7  
ATOM 5509  N N    . PHE A 1 11 ? -10.269 20.846 22.879 1.00 0.00 ? 11 PHE A N    7  
ATOM 5510  C CA   . PHE A 1 11 ? -9.577  21.828 21.997 1.00 0.00 ? 11 PHE A CA   7  
ATOM 5511  C C    . PHE A 1 11 ? -10.294 23.177 22.036 1.00 0.00 ? 11 PHE A C    7  
ATOM 5512  O O    . PHE A 1 11 ? -9.717  24.204 21.742 1.00 0.00 ? 11 PHE A O    7  
ATOM 5513  C CB   . PHE A 1 11 ? -9.658  21.237 20.594 1.00 0.00 ? 11 PHE A CB   7  
ATOM 5514  C CG   . PHE A 1 11 ? -8.751  20.034 20.492 1.00 0.00 ? 11 PHE A CG   7  
ATOM 5515  C CD1  . PHE A 1 11 ? -7.407  20.201 20.139 1.00 0.00 ? 11 PHE A CD1  7  
ATOM 5516  C CD2  . PHE A 1 11 ? -9.256  18.753 20.742 1.00 0.00 ? 11 PHE A CD2  7  
ATOM 5517  C CE1  . PHE A 1 11 ? -6.567  19.086 20.037 1.00 0.00 ? 11 PHE A CE1  7  
ATOM 5518  C CE2  . PHE A 1 11 ? -8.417  17.639 20.638 1.00 0.00 ? 11 PHE A CE2  7  
ATOM 5519  C CZ   . PHE A 1 11 ? -7.073  17.806 20.286 1.00 0.00 ? 11 PHE A CZ   7  
ATOM 5520  H H    . PHE A 1 11 ? -10.829 20.145 22.485 1.00 0.00 ? 11 PHE A H    7  
ATOM 5521  H HA   . PHE A 1 11 ? -8.546  21.939 22.291 1.00 0.00 ? 11 PHE A HA   7  
ATOM 5522  H HB2  . PHE A 1 11 ? -10.675 20.942 20.393 1.00 0.00 ? 11 PHE A HB2  7  
ATOM 5523  H HB3  . PHE A 1 11 ? -9.351  21.979 19.874 1.00 0.00 ? 11 PHE A HB3  7  
ATOM 5524  H HD1  . PHE A 1 11 ? -7.016  21.189 19.950 1.00 0.00 ? 11 PHE A HD1  7  
ATOM 5525  H HD2  . PHE A 1 11 ? -10.292 18.624 21.015 1.00 0.00 ? 11 PHE A HD2  7  
ATOM 5526  H HE1  . PHE A 1 11 ? -5.530  19.214 19.765 1.00 0.00 ? 11 PHE A HE1  7  
ATOM 5527  H HE2  . PHE A 1 11 ? -8.805  16.652 20.832 1.00 0.00 ? 11 PHE A HE2  7  
ATOM 5528  H HZ   . PHE A 1 11 ? -6.424  16.946 20.207 1.00 0.00 ? 11 PHE A HZ   7  
ATOM 5529  N N    . GLN A 1 12 ? -11.550 23.186 22.391 1.00 0.00 ? 12 GLN A N    7  
ATOM 5530  C CA   . GLN A 1 12 ? -12.289 24.479 22.440 1.00 0.00 ? 12 GLN A CA   7  
ATOM 5531  C C    . GLN A 1 12 ? -11.434 25.533 23.141 1.00 0.00 ? 12 GLN A C    7  
ATOM 5532  O O    . GLN A 1 12 ? -11.283 26.639 22.666 1.00 0.00 ? 12 GLN A O    7  
ATOM 5533  C CB   . GLN A 1 12 ? -13.557 24.194 23.244 1.00 0.00 ? 12 GLN A CB   7  
ATOM 5534  C CG   . GLN A 1 12 ? -14.457 25.432 23.214 1.00 0.00 ? 12 GLN A CG   7  
ATOM 5535  C CD   . GLN A 1 12 ? -15.786 25.115 23.904 1.00 0.00 ? 12 GLN A CD   7  
ATOM 5536  O OE1  . GLN A 1 12 ? -16.096 23.967 24.152 1.00 0.00 ? 12 GLN A OE1  7  
ATOM 5537  N NE2  . GLN A 1 12 ? -16.590 26.093 24.224 1.00 0.00 ? 12 GLN A NE2  7  
ATOM 5538  H H    . GLN A 1 12 ? -12.004 22.349 22.621 1.00 0.00 ? 12 GLN A H    7  
ATOM 5539  H HA   . GLN A 1 12 ? -12.547 24.803 21.444 1.00 0.00 ? 12 GLN A HA   7  
ATOM 5540  H HB2  . GLN A 1 12 ? -14.081 23.356 22.808 1.00 0.00 ? 12 GLN A HB2  7  
ATOM 5541  H HB3  . GLN A 1 12 ? -13.293 23.964 24.265 1.00 0.00 ? 12 GLN A HB3  7  
ATOM 5542  H HG2  . GLN A 1 12 ? -13.967 26.245 23.729 1.00 0.00 ? 12 GLN A HG2  7  
ATOM 5543  H HG3  . GLN A 1 12 ? -14.643 25.717 22.189 1.00 0.00 ? 12 GLN A HG3  7  
ATOM 5544  H HE21 . GLN A 1 12 ? -16.340 27.018 24.023 1.00 0.00 ? 12 GLN A HE21 7  
ATOM 5545  H HE22 . GLN A 1 12 ? -17.443 25.900 24.666 1.00 0.00 ? 12 GLN A HE22 7  
ATOM 5546  N N    . ALA A 1 13 ? -10.866 25.195 24.265 1.00 0.00 ? 13 ALA A N    7  
ATOM 5547  C CA   . ALA A 1 13 ? -10.015 26.179 24.990 1.00 0.00 ? 13 ALA A CA   7  
ATOM 5548  C C    . ALA A 1 13 ? -8.878  26.651 24.079 1.00 0.00 ? 13 ALA A C    7  
ATOM 5549  O O    . ALA A 1 13 ? -8.269  27.675 24.313 1.00 0.00 ? 13 ALA A O    7  
ATOM 5550  C CB   . ALA A 1 13 ? -9.461  25.414 26.192 1.00 0.00 ? 13 ALA A CB   7  
ATOM 5551  H H    . ALA A 1 13 ? -10.995 24.295 24.629 1.00 0.00 ? 13 ALA A H    7  
ATOM 5552  H HA   . ALA A 1 13 ? -10.606 27.016 25.323 1.00 0.00 ? 13 ALA A HA   7  
ATOM 5553  H HB1  . ALA A 1 13 ? -8.382  25.398 26.143 1.00 0.00 ? 13 ALA A HB1  7  
ATOM 5554  H HB2  . ALA A 1 13 ? -9.773  25.903 27.104 1.00 0.00 ? 13 ALA A HB2  7  
ATOM 5555  H HB3  . ALA A 1 13 ? -9.838  24.402 26.179 1.00 0.00 ? 13 ALA A HB3  7  
ATOM 5556  N N    . PHE A 1 14 ? -8.587  25.910 23.043 1.00 0.00 ? 14 PHE A N    7  
ATOM 5557  C CA   . PHE A 1 14 ? -7.491  26.315 22.122 1.00 0.00 ? 14 PHE A CA   7  
ATOM 5558  C C    . PHE A 1 14 ? -8.044  27.157 20.967 1.00 0.00 ? 14 PHE A C    7  
ATOM 5559  O O    . PHE A 1 14 ? -7.377  27.377 19.977 1.00 0.00 ? 14 PHE A O    7  
ATOM 5560  C CB   . PHE A 1 14 ? -6.921  25.002 21.589 1.00 0.00 ? 14 PHE A CB   7  
ATOM 5561  C CG   . PHE A 1 14 ? -6.589  24.071 22.734 1.00 0.00 ? 14 PHE A CG   7  
ATOM 5562  C CD1  . PHE A 1 14 ? -6.508  24.559 24.046 1.00 0.00 ? 14 PHE A CD1  7  
ATOM 5563  C CD2  . PHE A 1 14 ? -6.359  22.714 22.479 1.00 0.00 ? 14 PHE A CD2  7  
ATOM 5564  C CE1  . PHE A 1 14 ? -6.200  23.689 25.099 1.00 0.00 ? 14 PHE A CE1  7  
ATOM 5565  C CE2  . PHE A 1 14 ? -6.050  21.845 23.531 1.00 0.00 ? 14 PHE A CE2  7  
ATOM 5566  C CZ   . PHE A 1 14 ? -5.970  22.332 24.841 1.00 0.00 ? 14 PHE A CZ   7  
ATOM 5567  H H    . PHE A 1 14 ? -9.088  25.084 22.870 1.00 0.00 ? 14 PHE A H    7  
ATOM 5568  H HA   . PHE A 1 14 ? -6.728  26.859 22.657 1.00 0.00 ? 14 PHE A HA   7  
ATOM 5569  H HB2  . PHE A 1 14 ? -7.650  24.530 20.946 1.00 0.00 ? 14 PHE A HB2  7  
ATOM 5570  H HB3  . PHE A 1 14 ? -6.027  25.205 21.024 1.00 0.00 ? 14 PHE A HB3  7  
ATOM 5571  H HD1  . PHE A 1 14 ? -6.685  25.605 24.244 1.00 0.00 ? 14 PHE A HD1  7  
ATOM 5572  H HD2  . PHE A 1 14 ? -6.419  22.337 21.469 1.00 0.00 ? 14 PHE A HD2  7  
ATOM 5573  H HE1  . PHE A 1 14 ? -6.138  24.065 26.109 1.00 0.00 ? 14 PHE A HE1  7  
ATOM 5574  H HE2  . PHE A 1 14 ? -5.874  20.798 23.331 1.00 0.00 ? 14 PHE A HE2  7  
ATOM 5575  H HZ   . PHE A 1 14 ? -5.733  21.661 25.654 1.00 0.00 ? 14 PHE A HZ   7  
ATOM 5576  N N    . MET A 1 15 ? -9.260  27.622 21.077 1.00 0.00 ? 15 MET A N    7  
ATOM 5577  C CA   . MET A 1 15 ? -9.840  28.436 19.976 1.00 0.00 ? 15 MET A CA   7  
ATOM 5578  C C    . MET A 1 15 ? -9.707  29.933 20.280 1.00 0.00 ? 15 MET A C    7  
ATOM 5579  O O    . MET A 1 15 ? -10.256 30.438 21.239 1.00 0.00 ? 15 MET A O    7  
ATOM 5580  C CB   . MET A 1 15 ? -11.310 28.016 19.917 1.00 0.00 ? 15 MET A CB   7  
ATOM 5581  C CG   . MET A 1 15 ? -12.093 28.676 21.055 1.00 0.00 ? 15 MET A CG   7  
ATOM 5582  S SD   . MET A 1 15 ? -13.701 27.863 21.230 1.00 0.00 ? 15 MET A SD   7  
ATOM 5583  C CE   . MET A 1 15 ? -14.380 28.352 19.626 1.00 0.00 ? 15 MET A CE   7  
ATOM 5584  H H    . MET A 1 15 ? -9.792  27.432 21.875 1.00 0.00 ? 15 MET A H    7  
ATOM 5585  H HA   . MET A 1 15 ? -9.355  28.199 19.042 1.00 0.00 ? 15 MET A HA   7  
ATOM 5586  H HB2  . MET A 1 15 ? -11.728 28.322 18.974 1.00 0.00 ? 15 MET A HB2  7  
ATOM 5587  H HB3  . MET A 1 15 ? -11.381 26.944 20.008 1.00 0.00 ? 15 MET A HB3  7  
ATOM 5588  H HG2  . MET A 1 15 ? -11.540 28.581 21.977 1.00 0.00 ? 15 MET A HG2  7  
ATOM 5589  H HG3  . MET A 1 15 ? -12.241 29.721 20.832 1.00 0.00 ? 15 MET A HG3  7  
ATOM 5590  H HE1  . MET A 1 15 ? -13.722 28.022 18.839 1.00 0.00 ? 15 MET A HE1  7  
ATOM 5591  H HE2  . MET A 1 15 ? -15.352 27.897 19.494 1.00 0.00 ? 15 MET A HE2  7  
ATOM 5592  H HE3  . MET A 1 15 ? -14.472 29.428 19.589 1.00 0.00 ? 15 MET A HE3  7  
ATOM 5593  N N    . LYS A 1 16 ? -8.981  30.646 19.462 1.00 0.00 ? 16 LYS A N    7  
ATOM 5594  C CA   . LYS A 1 16 ? -8.814  32.108 19.690 1.00 0.00 ? 16 LYS A CA   7  
ATOM 5595  C C    . LYS A 1 16 ? -9.802  32.886 18.817 1.00 0.00 ? 16 LYS A C    7  
ATOM 5596  O O    . LYS A 1 16 ? -9.494  33.273 17.708 1.00 0.00 ? 16 LYS A O    7  
ATOM 5597  C CB   . LYS A 1 16 ? -7.374  32.415 19.275 1.00 0.00 ? 16 LYS A CB   7  
ATOM 5598  C CG   . LYS A 1 16 ? -7.056  33.879 19.585 1.00 0.00 ? 16 LYS A CG   7  
ATOM 5599  C CD   . LYS A 1 16 ? -6.448  34.542 18.348 1.00 0.00 ? 16 LYS A CD   7  
ATOM 5600  C CE   . LYS A 1 16 ? -5.604  35.744 18.777 1.00 0.00 ? 16 LYS A CE   7  
ATOM 5601  N NZ   . LYS A 1 16 ? -4.779  36.079 17.582 1.00 0.00 ? 16 LYS A NZ   7  
ATOM 5602  H H    . LYS A 1 16 ? -8.550  30.219 18.695 1.00 0.00 ? 16 LYS A H    7  
ATOM 5603  H HA   . LYS A 1 16 ? -8.957  32.348 20.731 1.00 0.00 ? 16 LYS A HA   7  
ATOM 5604  H HB2  . LYS A 1 16 ? -6.697  31.777 19.821 1.00 0.00 ? 16 LYS A HB2  7  
ATOM 5605  H HB3  . LYS A 1 16 ? -7.260  32.239 18.215 1.00 0.00 ? 16 LYS A HB3  7  
ATOM 5606  H HG2  . LYS A 1 16 ? -7.965  34.394 19.859 1.00 0.00 ? 16 LYS A HG2  7  
ATOM 5607  H HG3  . LYS A 1 16 ? -6.353  33.929 20.403 1.00 0.00 ? 16 LYS A HG3  7  
ATOM 5608  H HD2  . LYS A 1 16 ? -5.822  33.831 17.829 1.00 0.00 ? 16 LYS A HD2  7  
ATOM 5609  H HD3  . LYS A 1 16 ? -7.238  34.873 17.691 1.00 0.00 ? 16 LYS A HD3  7  
ATOM 5610  H HE2  . LYS A 1 16 ? -6.240  36.576 19.039 1.00 0.00 ? 16 LYS A HE2  7  
ATOM 5611  H HE3  . LYS A 1 16 ? -4.968  35.479 19.610 1.00 0.00 ? 16 LYS A HE3  7  
ATOM 5612  H HZ1  . LYS A 1 16 ? -5.372  36.039 16.729 1.00 0.00 ? 16 LYS A HZ1  7  
ATOM 5613  H HZ2  . LYS A 1 16 ? -4.390  37.037 17.686 1.00 0.00 ? 16 LYS A HZ2  7  
ATOM 5614  H HZ3  . LYS A 1 16 ? -4.000  35.394 17.496 1.00 0.00 ? 16 LYS A HZ3  7  
ATOM 5615  N N    . ASN A 1 17 ? -10.987 33.109 19.312 1.00 0.00 ? 17 ASN A N    7  
ATOM 5616  C CA   . ASN A 1 17 ? -12.005 33.859 18.521 1.00 0.00 ? 17 ASN A CA   7  
ATOM 5617  C C    . ASN A 1 17 ? -12.309 33.136 17.205 1.00 0.00 ? 17 ASN A C    7  
ATOM 5618  O O    . ASN A 1 17 ? -12.276 33.722 16.142 1.00 0.00 ? 17 ASN A O    7  
ATOM 5619  C CB   . ASN A 1 17 ? -11.378 35.228 18.255 1.00 0.00 ? 17 ASN A CB   7  
ATOM 5620  C CG   . ASN A 1 17 ? -11.027 35.898 19.585 1.00 0.00 ? 17 ASN A CG   7  
ATOM 5621  O OD1  . ASN A 1 17 ? -11.866 36.027 20.454 1.00 0.00 ? 17 ASN A OD1  7  
ATOM 5622  N ND2  . ASN A 1 17 ? -9.813  36.332 19.781 1.00 0.00 ? 17 ASN A ND2  7  
ATOM 5623  H H    . ASN A 1 17 ? -11.211 32.784 20.208 1.00 0.00 ? 17 ASN A H    7  
ATOM 5624  H HA   . ASN A 1 17 ? -12.909 33.977 19.096 1.00 0.00 ? 17 ASN A HA   7  
ATOM 5625  H HB2  . ASN A 1 17 ? -10.481 35.106 17.668 1.00 0.00 ? 17 ASN A HB2  7  
ATOM 5626  H HB3  . ASN A 1 17 ? -12.080 35.847 17.714 1.00 0.00 ? 17 ASN A HB3  7  
ATOM 5627  H HD21 . ASN A 1 17 ? -9.136  36.228 19.080 1.00 0.00 ? 17 ASN A HD21 7  
ATOM 5628  H HD22 . ASN A 1 17 ? -9.577  36.762 20.629 1.00 0.00 ? 17 ASN A HD22 7  
ATOM 5629  N N    . GLY A 1 18 ? -12.619 31.871 17.271 1.00 0.00 ? 18 GLY A N    7  
ATOM 5630  C CA   . GLY A 1 18 ? -12.944 31.114 16.028 1.00 0.00 ? 18 GLY A CA   7  
ATOM 5631  C C    . GLY A 1 18 ? -11.681 30.466 15.450 1.00 0.00 ? 18 GLY A C    7  
ATOM 5632  O O    . GLY A 1 18 ? -11.755 29.586 14.616 1.00 0.00 ? 18 GLY A O    7  
ATOM 5633  H H    . GLY A 1 18 ? -12.651 31.421 18.142 1.00 0.00 ? 18 GLY A H    7  
ATOM 5634  H HA2  . GLY A 1 18 ? -13.667 30.345 16.256 1.00 0.00 ? 18 GLY A HA2  7  
ATOM 5635  H HA3  . GLY A 1 18 ? -13.363 31.791 15.298 1.00 0.00 ? 18 GLY A HA3  7  
ATOM 5636  N N    . LYS A 1 19 ? -10.524 30.890 15.877 1.00 0.00 ? 19 LYS A N    7  
ATOM 5637  C CA   . LYS A 1 19 ? -9.270  30.286 15.335 1.00 0.00 ? 19 LYS A CA   7  
ATOM 5638  C C    . LYS A 1 19 ? -8.735  29.216 16.288 1.00 0.00 ? 19 LYS A C    7  
ATOM 5639  O O    . LYS A 1 19 ? -8.315  29.506 17.388 1.00 0.00 ? 19 LYS A O    7  
ATOM 5640  C CB   . LYS A 1 19 ? -8.281  31.448 15.230 1.00 0.00 ? 19 LYS A CB   7  
ATOM 5641  C CG   . LYS A 1 19 ? -7.134  31.060 14.291 1.00 0.00 ? 19 LYS A CG   7  
ATOM 5642  C CD   . LYS A 1 19 ? -6.431  29.809 14.826 1.00 0.00 ? 19 LYS A CD   7  
ATOM 5643  C CE   . LYS A 1 19 ? -5.101  29.618 14.094 1.00 0.00 ? 19 LYS A CE   7  
ATOM 5644  N NZ   . LYS A 1 19 ? -5.409  28.671 12.985 1.00 0.00 ? 19 LYS A NZ   7  
ATOM 5645  H H    . LYS A 1 19 ? -10.477 31.603 16.548 1.00 0.00 ? 19 LYS A H    7  
ATOM 5646  H HA   . LYS A 1 19 ? -9.448  29.866 14.358 1.00 0.00 ? 19 LYS A HA   7  
ATOM 5647  H HB2  . LYS A 1 19 ? -8.789  32.317 14.837 1.00 0.00 ? 19 LYS A HB2  7  
ATOM 5648  H HB3  . LYS A 1 19 ? -7.885  31.673 16.209 1.00 0.00 ? 19 LYS A HB3  7  
ATOM 5649  H HG2  . LYS A 1 19 ? -7.527  30.859 13.306 1.00 0.00 ? 19 LYS A HG2  7  
ATOM 5650  H HG3  . LYS A 1 19 ? -6.426  31.873 14.236 1.00 0.00 ? 19 LYS A HG3  7  
ATOM 5651  H HD2  . LYS A 1 19 ? -6.246  29.923 15.884 1.00 0.00 ? 19 LYS A HD2  7  
ATOM 5652  H HD3  . LYS A 1 19 ? -7.059  28.944 14.662 1.00 0.00 ? 19 LYS A HD3  7  
ATOM 5653  H HE2  . LYS A 1 19 ? -4.752  30.561 13.698 1.00 0.00 ? 19 LYS A HE2  7  
ATOM 5654  H HE3  . LYS A 1 19 ? -4.365  29.193 14.759 1.00 0.00 ? 19 LYS A HE3  7  
ATOM 5655  H HZ1  . LYS A 1 19 ? -5.870  27.823 13.374 1.00 0.00 ? 19 LYS A HZ1  7  
ATOM 5656  H HZ2  . LYS A 1 19 ? -6.045  29.131 12.302 1.00 0.00 ? 19 LYS A HZ2  7  
ATOM 5657  H HZ3  . LYS A 1 19 ? -4.528  28.400 12.506 1.00 0.00 ? 19 LYS A HZ3  7  
ATOM 5658  N N    . LEU A 1 20 ? -8.739  27.981 15.873 1.00 0.00 ? 20 LEU A N    7  
ATOM 5659  C CA   . LEU A 1 20 ? -8.223  26.898 16.758 1.00 0.00 ? 20 LEU A CA   7  
ATOM 5660  C C    . LEU A 1 20 ? -6.760  26.591 16.419 1.00 0.00 ? 20 LEU A C    7  
ATOM 5661  O O    . LEU A 1 20 ? -6.427  26.280 15.294 1.00 0.00 ? 20 LEU A O    7  
ATOM 5662  C CB   . LEU A 1 20 ? -9.107  25.687 16.459 1.00 0.00 ? 20 LEU A CB   7  
ATOM 5663  C CG   . LEU A 1 20 ? -9.010  24.686 17.613 1.00 0.00 ? 20 LEU A CG   7  
ATOM 5664  C CD1  . LEU A 1 20 ? -9.828  23.438 17.276 1.00 0.00 ? 20 LEU A CD1  7  
ATOM 5665  C CD2  . LEU A 1 20 ? -7.546  24.293 17.827 1.00 0.00 ? 20 LEU A CD2  7  
ATOM 5666  H H    . LEU A 1 20 ? -9.075  27.765 14.979 1.00 0.00 ? 20 LEU A H    7  
ATOM 5667  H HA   . LEU A 1 20 ? -8.319  27.179 17.794 1.00 0.00 ? 20 LEU A HA   7  
ATOM 5668  H HB2  . LEU A 1 20 ? -10.132 26.008 16.347 1.00 0.00 ? 20 LEU A HB2  7  
ATOM 5669  H HB3  . LEU A 1 20 ? -8.776  25.216 15.545 1.00 0.00 ? 20 LEU A HB3  7  
ATOM 5670  H HG   . LEU A 1 20 ? -9.396  25.137 18.514 1.00 0.00 ? 20 LEU A HG   7  
ATOM 5671  H HD11 . LEU A 1 20 ? -10.042 23.422 16.218 1.00 0.00 ? 20 LEU A HD11 7  
ATOM 5672  H HD12 . LEU A 1 20 ? -9.264  22.555 17.543 1.00 0.00 ? 20 LEU A HD12 7  
ATOM 5673  H HD13 . LEU A 1 20 ? -10.755 23.454 17.830 1.00 0.00 ? 20 LEU A HD13 7  
ATOM 5674  H HD21 . LEU A 1 20 ? -7.067  24.158 16.869 1.00 0.00 ? 20 LEU A HD21 7  
ATOM 5675  H HD22 . LEU A 1 20 ? -7.042  25.074 18.377 1.00 0.00 ? 20 LEU A HD22 7  
ATOM 5676  H HD23 . LEU A 1 20 ? -7.500  23.370 18.386 1.00 0.00 ? 20 LEU A HD23 7  
ATOM 5677  N N    . PHE A 1 21 ? -5.885  26.667 17.386 1.00 0.00 ? 21 PHE A N    7  
ATOM 5678  C CA   . PHE A 1 21 ? -4.448  26.365 17.108 1.00 0.00 ? 21 PHE A CA   7  
ATOM 5679  C C    . PHE A 1 21 ? -4.094  24.974 17.640 1.00 0.00 ? 21 PHE A C    7  
ATOM 5680  O O    . PHE A 1 21 ? -3.422  24.827 18.641 1.00 0.00 ? 21 PHE A O    7  
ATOM 5681  C CB   . PHE A 1 21 ? -3.627  27.450 17.824 1.00 0.00 ? 21 PHE A CB   7  
ATOM 5682  C CG   . PHE A 1 21 ? -4.255  27.809 19.151 1.00 0.00 ? 21 PHE A CG   7  
ATOM 5683  C CD1  . PHE A 1 21 ? -3.974  27.045 20.291 1.00 0.00 ? 21 PHE A CD1  7  
ATOM 5684  C CD2  . PHE A 1 21 ? -5.114  28.910 19.241 1.00 0.00 ? 21 PHE A CD2  7  
ATOM 5685  C CE1  . PHE A 1 21 ? -4.555  27.383 21.520 1.00 0.00 ? 21 PHE A CE1  7  
ATOM 5686  C CE2  . PHE A 1 21 ? -5.693  29.249 20.470 1.00 0.00 ? 21 PHE A CE2  7  
ATOM 5687  C CZ   . PHE A 1 21 ? -5.413  28.486 21.609 1.00 0.00 ? 21 PHE A CZ   7  
ATOM 5688  H H    . PHE A 1 21 ? -6.176  26.911 18.289 1.00 0.00 ? 21 PHE A H    7  
ATOM 5689  H HA   . PHE A 1 21 ? -4.261  26.411 16.047 1.00 0.00 ? 21 PHE A HA   7  
ATOM 5690  H HB2  . PHE A 1 21 ? -2.625  27.085 17.992 1.00 0.00 ? 21 PHE A HB2  7  
ATOM 5691  H HB3  . PHE A 1 21 ? -3.584  28.331 17.201 1.00 0.00 ? 21 PHE A HB3  7  
ATOM 5692  H HD1  . PHE A 1 21 ? -3.312  26.196 20.222 1.00 0.00 ? 21 PHE A HD1  7  
ATOM 5693  H HD2  . PHE A 1 21 ? -5.330  29.499 18.362 1.00 0.00 ? 21 PHE A HD2  7  
ATOM 5694  H HE1  . PHE A 1 21 ? -4.339  26.794 22.398 1.00 0.00 ? 21 PHE A HE1  7  
ATOM 5695  H HE2  . PHE A 1 21 ? -6.355  30.098 20.539 1.00 0.00 ? 21 PHE A HE2  7  
ATOM 5696  H HZ   . PHE A 1 21 ? -5.859  28.747 22.557 1.00 0.00 ? 21 PHE A HZ   7  
ATOM 5697  N N    . CYS A 1 22 ? -4.551  23.952 16.969 1.00 0.00 ? 22 CYS A N    7  
ATOM 5698  C CA   . CYS A 1 22 ? -4.259  22.558 17.417 1.00 0.00 ? 22 CYS A CA   7  
ATOM 5699  C C    . CYS A 1 22 ? -2.770  22.375 17.751 1.00 0.00 ? 22 CYS A C    7  
ATOM 5700  O O    . CYS A 1 22 ? -2.442  21.856 18.800 1.00 0.00 ? 22 CYS A O    7  
ATOM 5701  C CB   . CYS A 1 22 ? -4.653  21.672 16.235 1.00 0.00 ? 22 CYS A CB   7  
ATOM 5702  S SG   . CYS A 1 22 ? -5.689  20.307 16.824 1.00 0.00 ? 22 CYS A SG   7  
ATOM 5703  H H    . CYS A 1 22 ? -5.093  24.102 16.166 1.00 0.00 ? 22 CYS A H    7  
ATOM 5704  H HA   . CYS A 1 22 ? -4.865  22.309 18.274 1.00 0.00 ? 22 CYS A HA   7  
ATOM 5705  H HB2  . CYS A 1 22 ? -5.204  22.257 15.513 1.00 0.00 ? 22 CYS A HB2  7  
ATOM 5706  H HB3  . CYS A 1 22 ? -3.763  21.273 15.772 1.00 0.00 ? 22 CYS A HB3  7  
ATOM 5707  N N    . PRO A 1 23 ? -1.908  22.791 16.853 1.00 0.00 ? 23 PRO A N    7  
ATOM 5708  C CA   . PRO A 1 23 ? -0.450  22.641 17.079 1.00 0.00 ? 23 PRO A CA   7  
ATOM 5709  C C    . PRO A 1 23 ? -0.008  23.424 18.318 1.00 0.00 ? 23 PRO A C    7  
ATOM 5710  O O    . PRO A 1 23 ? 0.482   24.532 18.227 1.00 0.00 ? 23 PRO A O    7  
ATOM 5711  C CB   . PRO A 1 23 ? 0.154   23.224 15.800 1.00 0.00 ? 23 PRO A CB   7  
ATOM 5712  C CG   . PRO A 1 23 ? -0.990  23.681 14.876 1.00 0.00 ? 23 PRO A CG   7  
ATOM 5713  C CD   . PRO A 1 23 ? -2.330  23.429 15.581 1.00 0.00 ? 23 PRO A CD   7  
ATOM 5714  H HA   . PRO A 1 23 ? -0.184  21.600 17.172 1.00 0.00 ? 23 PRO A HA   7  
ATOM 5715  H HB2  . PRO A 1 23 ? 0.780   24.070 16.047 1.00 0.00 ? 23 PRO A HB2  7  
ATOM 5716  H HB3  . PRO A 1 23 ? 0.745   22.469 15.301 1.00 0.00 ? 23 PRO A HB3  7  
ATOM 5717  H HG2  . PRO A 1 23 ? -0.886  24.735 14.664 1.00 0.00 ? 23 PRO A HG2  7  
ATOM 5718  H HG3  . PRO A 1 23 ? -0.957  23.121 13.953 1.00 0.00 ? 23 PRO A HG3  7  
ATOM 5719  H HD2  . PRO A 1 23 ? -2.835  24.363 15.769 1.00 0.00 ? 23 PRO A HD2  7  
ATOM 5720  H HD3  . PRO A 1 23 ? -2.950  22.762 15.002 1.00 0.00 ? 23 PRO A HD3  7  
ATOM 5721  N N    . GLN A 1 24 ? -0.176  22.846 19.477 1.00 0.00 ? 24 GLN A N    7  
ATOM 5722  C CA   . GLN A 1 24 ? 0.235   23.540 20.730 1.00 0.00 ? 24 GLN A CA   7  
ATOM 5723  C C    . GLN A 1 24 ? 1.174   22.641 21.535 1.00 0.00 ? 24 GLN A C    7  
ATOM 5724  O O    . GLN A 1 24 ? 2.376   22.813 21.526 1.00 0.00 ? 24 GLN A O    7  
ATOM 5725  C CB   . GLN A 1 24 ? -1.071  23.778 21.493 1.00 0.00 ? 24 GLN A CB   7  
ATOM 5726  C CG   . GLN A 1 24 ? -0.761  24.135 22.949 1.00 0.00 ? 24 GLN A CG   7  
ATOM 5727  C CD   . GLN A 1 24 ? -2.051  24.082 23.769 1.00 0.00 ? 24 GLN A CD   7  
ATOM 5728  O OE1  . GLN A 1 24 ? -2.625  25.104 24.088 1.00 0.00 ? 24 GLN A OE1  7  
ATOM 5729  N NE2  . GLN A 1 24 ? -2.535  22.924 24.128 1.00 0.00 ? 24 GLN A NE2  7  
ATOM 5730  H H    . GLN A 1 24 ? -0.570  21.951 19.521 1.00 0.00 ? 24 GLN A H    7  
ATOM 5731  H HA   . GLN A 1 24 ? 0.709   24.480 20.505 1.00 0.00 ? 24 GLN A HA   7  
ATOM 5732  H HB2  . GLN A 1 24 ? -1.614  24.589 21.031 1.00 0.00 ? 24 GLN A HB2  7  
ATOM 5733  H HB3  . GLN A 1 24 ? -1.672  22.881 21.463 1.00 0.00 ? 24 GLN A HB3  7  
ATOM 5734  H HG2  . GLN A 1 24 ? -0.051  23.430 23.353 1.00 0.00 ? 24 GLN A HG2  7  
ATOM 5735  H HG3  . GLN A 1 24 ? -0.345  25.131 22.995 1.00 0.00 ? 24 GLN A HG3  7  
ATOM 5736  H HE21 . GLN A 1 24 ? -2.073  22.098 23.870 1.00 0.00 ? 24 GLN A HE21 7  
ATOM 5737  H HE22 . GLN A 1 24 ? -3.361  22.879 24.653 1.00 0.00 ? 24 GLN A HE22 7  
ATOM 5738  N N    . ASP A 1 25 ? 0.630   21.678 22.224 1.00 0.00 ? 25 ASP A N    7  
ATOM 5739  C CA   . ASP A 1 25 ? 1.484   20.758 23.027 1.00 0.00 ? 25 ASP A CA   7  
ATOM 5740  C C    . ASP A 1 25 ? 1.066   19.307 22.779 1.00 0.00 ? 25 ASP A C    7  
ATOM 5741  O O    . ASP A 1 25 ? 0.386   18.701 23.582 1.00 0.00 ? 25 ASP A O    7  
ATOM 5742  C CB   . ASP A 1 25 ? 1.233   21.151 24.483 1.00 0.00 ? 25 ASP A CB   7  
ATOM 5743  C CG   . ASP A 1 25 ? 2.447   20.768 25.331 1.00 0.00 ? 25 ASP A CG   7  
ATOM 5744  O OD1  . ASP A 1 25 ? 3.454   21.449 25.230 1.00 0.00 ? 25 ASP A OD1  7  
ATOM 5745  O OD2  . ASP A 1 25 ? 2.350   19.798 26.066 1.00 0.00 ? 25 ASP A OD2  7  
ATOM 5746  H H    . ASP A 1 25 ? -0.342  21.559 22.211 1.00 0.00 ? 25 ASP A H    7  
ATOM 5747  H HA   . ASP A 1 25 ? 2.525   20.900 22.782 1.00 0.00 ? 25 ASP A HA   7  
ATOM 5748  H HB2  . ASP A 1 25 ? 1.070   22.217 24.546 1.00 0.00 ? 25 ASP A HB2  7  
ATOM 5749  H HB3  . ASP A 1 25 ? 0.359   20.632 24.850 1.00 0.00 ? 25 ASP A HB3  7  
ATOM 5750  N N    . LYS A 1 26 ? 1.465   18.749 21.669 1.00 0.00 ? 26 LYS A N    7  
ATOM 5751  C CA   . LYS A 1 26 ? 1.087   17.337 21.363 1.00 0.00 ? 26 LYS A CA   7  
ATOM 5752  C C    . LYS A 1 26 ? 1.797   16.364 22.312 1.00 0.00 ? 26 LYS A C    7  
ATOM 5753  O O    . LYS A 1 26 ? 1.589   15.168 22.250 1.00 0.00 ? 26 LYS A O    7  
ATOM 5754  C CB   . LYS A 1 26 ? 1.545   17.111 19.922 1.00 0.00 ? 26 LYS A CB   7  
ATOM 5755  C CG   . LYS A 1 26 ? 0.430   17.534 18.962 1.00 0.00 ? 26 LYS A CG   7  
ATOM 5756  C CD   . LYS A 1 26 ? 0.982   17.594 17.536 1.00 0.00 ? 26 LYS A CD   7  
ATOM 5757  C CE   . LYS A 1 26 ? 0.158   18.586 16.713 1.00 0.00 ? 26 LYS A CE   7  
ATOM 5758  N NZ   . LYS A 1 26 ? 0.628   18.401 15.311 1.00 0.00 ? 26 LYS A NZ   7  
ATOM 5759  H H    . LYS A 1 26 ? 2.010   19.257 21.033 1.00 0.00 ? 26 LYS A H    7  
ATOM 5760  H HA   . LYS A 1 26 ? 0.019   17.213 21.430 1.00 0.00 ? 26 LYS A HA   7  
ATOM 5761  H HB2  . LYS A 1 26 ? 2.430   17.699 19.728 1.00 0.00 ? 26 LYS A HB2  7  
ATOM 5762  H HB3  . LYS A 1 26 ? 1.769   16.065 19.775 1.00 0.00 ? 26 LYS A HB3  7  
ATOM 5763  H HG2  . LYS A 1 26 ? -0.375  16.816 19.007 1.00 0.00 ? 26 LYS A HG2  7  
ATOM 5764  H HG3  . LYS A 1 26 ? 0.061   18.508 19.246 1.00 0.00 ? 26 LYS A HG3  7  
ATOM 5765  H HD2  . LYS A 1 26 ? 2.013   17.915 17.562 1.00 0.00 ? 26 LYS A HD2  7  
ATOM 5766  H HD3  . LYS A 1 26 ? 0.920   16.614 17.086 1.00 0.00 ? 26 LYS A HD3  7  
ATOM 5767  H HE2  . LYS A 1 26 ? -0.894  18.357 16.790 1.00 0.00 ? 26 LYS A HE2  7  
ATOM 5768  H HE3  . LYS A 1 26 ? 0.348   19.597 17.043 1.00 0.00 ? 26 LYS A HE3  7  
ATOM 5769  H HZ1  . LYS A 1 26 ? 1.635   18.147 15.312 1.00 0.00 ? 26 LYS A HZ1  7  
ATOM 5770  H HZ2  . LYS A 1 26 ? 0.081   17.642 14.859 1.00 0.00 ? 26 LYS A HZ2  7  
ATOM 5771  H HZ3  . LYS A 1 26 ? 0.495   19.288 14.781 1.00 0.00 ? 26 LYS A HZ3  7  
ATOM 5772  N N    . LYS A 1 27 ? 2.631   16.861 23.188 1.00 0.00 ? 27 LYS A N    7  
ATOM 5773  C CA   . LYS A 1 27 ? 3.344   15.958 24.135 1.00 0.00 ? 27 LYS A CA   7  
ATOM 5774  C C    . LYS A 1 27 ? 2.389   14.884 24.666 1.00 0.00 ? 27 LYS A C    7  
ATOM 5775  O O    . LYS A 1 27 ? 2.795   13.797 25.024 1.00 0.00 ? 27 LYS A O    7  
ATOM 5776  C CB   . LYS A 1 27 ? 3.808   16.871 25.269 1.00 0.00 ? 27 LYS A CB   7  
ATOM 5777  C CG   . LYS A 1 27 ? 4.869   17.841 24.744 1.00 0.00 ? 27 LYS A CG   7  
ATOM 5778  C CD   . LYS A 1 27 ? 6.143   17.064 24.401 1.00 0.00 ? 27 LYS A CD   7  
ATOM 5779  C CE   . LYS A 1 27 ? 7.204   18.030 23.870 1.00 0.00 ? 27 LYS A CE   7  
ATOM 5780  N NZ   . LYS A 1 27 ? 8.250   17.154 23.271 1.00 0.00 ? 27 LYS A NZ   7  
ATOM 5781  H H    . LYS A 1 27 ? 2.788   17.825 23.225 1.00 0.00 ? 27 LYS A H    7  
ATOM 5782  H HA   . LYS A 1 27 ? 4.196   15.503 23.657 1.00 0.00 ? 27 LYS A HA   7  
ATOM 5783  H HB2  . LYS A 1 27 ? 2.966   17.431 25.649 1.00 0.00 ? 27 LYS A HB2  7  
ATOM 5784  H HB3  . LYS A 1 27 ? 4.229   16.273 26.062 1.00 0.00 ? 27 LYS A HB3  7  
ATOM 5785  H HG2  . LYS A 1 27 ? 4.499   18.334 23.859 1.00 0.00 ? 27 LYS A HG2  7  
ATOM 5786  H HG3  . LYS A 1 27 ? 5.090   18.578 25.502 1.00 0.00 ? 27 LYS A HG3  7  
ATOM 5787  H HD2  . LYS A 1 27 ? 6.515   16.575 25.289 1.00 0.00 ? 27 LYS A HD2  7  
ATOM 5788  H HD3  . LYS A 1 27 ? 5.921   16.323 23.648 1.00 0.00 ? 27 LYS A HD3  7  
ATOM 5789  H HE2  . LYS A 1 27 ? 6.779   18.678 23.117 1.00 0.00 ? 27 LYS A HE2  7  
ATOM 5790  H HE3  . LYS A 1 27 ? 7.620   18.613 24.678 1.00 0.00 ? 27 LYS A HE3  7  
ATOM 5791  H HZ1  . LYS A 1 27 ? 7.796   16.415 22.696 1.00 0.00 ? 27 LYS A HZ1  7  
ATOM 5792  H HZ2  . LYS A 1 27 ? 8.876   17.722 22.669 1.00 0.00 ? 27 LYS A HZ2  7  
ATOM 5793  H HZ3  . LYS A 1 27 ? 8.806   16.710 24.031 1.00 0.00 ? 27 LYS A HZ3  7  
ATOM 5794  N N    . PHE A 1 28 ? 1.117   15.180 24.711 1.00 0.00 ? 28 PHE A N    7  
ATOM 5795  C CA   . PHE A 1 28 ? 0.132   14.178 25.210 1.00 0.00 ? 28 PHE A CA   7  
ATOM 5796  C C    . PHE A 1 28 ? 0.341   12.836 24.503 1.00 0.00 ? 28 PHE A C    7  
ATOM 5797  O O    . PHE A 1 28 ? -0.056  11.797 24.990 1.00 0.00 ? 28 PHE A O    7  
ATOM 5798  C CB   . PHE A 1 28 ? -1.234  14.767 24.856 1.00 0.00 ? 28 PHE A CB   7  
ATOM 5799  C CG   . PHE A 1 28 ? -1.326  16.180 25.383 1.00 0.00 ? 28 PHE A CG   7  
ATOM 5800  C CD1  . PHE A 1 28 ? -1.083  16.438 26.737 1.00 0.00 ? 28 PHE A CD1  7  
ATOM 5801  C CD2  . PHE A 1 28 ? -1.656  17.230 24.517 1.00 0.00 ? 28 PHE A CD2  7  
ATOM 5802  C CE1  . PHE A 1 28 ? -1.169  17.747 27.226 1.00 0.00 ? 28 PHE A CE1  7  
ATOM 5803  C CE2  . PHE A 1 28 ? -1.743  18.539 25.007 1.00 0.00 ? 28 PHE A CE2  7  
ATOM 5804  C CZ   . PHE A 1 28 ? -1.499  18.798 26.362 1.00 0.00 ? 28 PHE A CZ   7  
ATOM 5805  H H    . PHE A 1 28 ? 0.810   16.062 24.413 1.00 0.00 ? 28 PHE A H    7  
ATOM 5806  H HA   . PHE A 1 28 ? 0.217   14.061 26.279 1.00 0.00 ? 28 PHE A HA   7  
ATOM 5807  H HB2  . PHE A 1 28 ? -1.356  14.774 23.783 1.00 0.00 ? 28 PHE A HB2  7  
ATOM 5808  H HB3  . PHE A 1 28 ? -2.012  14.166 25.302 1.00 0.00 ? 28 PHE A HB3  7  
ATOM 5809  H HD1  . PHE A 1 28 ? -0.827  15.628 27.404 1.00 0.00 ? 28 PHE A HD1  7  
ATOM 5810  H HD2  . PHE A 1 28 ? -1.843  17.032 23.473 1.00 0.00 ? 28 PHE A HD2  7  
ATOM 5811  H HE1  . PHE A 1 28 ? -0.980  17.947 28.271 1.00 0.00 ? 28 PHE A HE1  7  
ATOM 5812  H HE2  . PHE A 1 28 ? -1.998  19.349 24.341 1.00 0.00 ? 28 PHE A HE2  7  
ATOM 5813  H HZ   . PHE A 1 28 ? -1.565  19.808 26.739 1.00 0.00 ? 28 PHE A HZ   7  
ATOM 5814  N N    . PHE A 1 29 ? 0.967   12.852 23.357 1.00 0.00 ? 29 PHE A N    7  
ATOM 5815  C CA   . PHE A 1 29 ? 1.210   11.583 22.612 1.00 0.00 ? 29 PHE A CA   7  
ATOM 5816  C C    . PHE A 1 29 ? 1.978   10.592 23.495 1.00 0.00 ? 29 PHE A C    7  
ATOM 5817  O O    . PHE A 1 29 ? 2.032   9.410  23.218 1.00 0.00 ? 29 PHE A O    7  
ATOM 5818  C CB   . PHE A 1 29 ? 2.055   12.002 21.406 1.00 0.00 ? 29 PHE A CB   7  
ATOM 5819  C CG   . PHE A 1 29 ? 2.463   10.785 20.609 1.00 0.00 ? 29 PHE A CG   7  
ATOM 5820  C CD1  . PHE A 1 29 ? 3.417   9.900  21.124 1.00 0.00 ? 29 PHE A CD1  7  
ATOM 5821  C CD2  . PHE A 1 29 ? 1.890   10.543 19.354 1.00 0.00 ? 29 PHE A CD2  7  
ATOM 5822  C CE1  . PHE A 1 29 ? 3.800   8.774  20.384 1.00 0.00 ? 29 PHE A CE1  7  
ATOM 5823  C CE2  . PHE A 1 29 ? 2.272   9.417  18.614 1.00 0.00 ? 29 PHE A CE2  7  
ATOM 5824  C CZ   . PHE A 1 29 ? 3.226   8.533  19.130 1.00 0.00 ? 29 PHE A CZ   7  
ATOM 5825  H H    . PHE A 1 29 ? 1.279   13.704 22.985 1.00 0.00 ? 29 PHE A H    7  
ATOM 5826  H HA   . PHE A 1 29 ? 0.279   11.154 22.282 1.00 0.00 ? 29 PHE A HA   7  
ATOM 5827  H HB2  . PHE A 1 29 ? 1.481   12.665 20.778 1.00 0.00 ? 29 PHE A HB2  7  
ATOM 5828  H HB3  . PHE A 1 29 ? 2.941   12.516 21.752 1.00 0.00 ? 29 PHE A HB3  7  
ATOM 5829  H HD1  . PHE A 1 29 ? 3.859   10.085 22.091 1.00 0.00 ? 29 PHE A HD1  7  
ATOM 5830  H HD2  . PHE A 1 29 ? 1.155   11.225 18.955 1.00 0.00 ? 29 PHE A HD2  7  
ATOM 5831  H HE1  . PHE A 1 29 ? 4.536   8.092  20.781 1.00 0.00 ? 29 PHE A HE1  7  
ATOM 5832  H HE2  . PHE A 1 29 ? 1.830   9.231  17.646 1.00 0.00 ? 29 PHE A HE2  7  
ATOM 5833  H HZ   . PHE A 1 29 ? 3.522   7.664  18.559 1.00 0.00 ? 29 PHE A HZ   7  
ATOM 5834  N N    . GLN A 1 30 ? 2.574   11.067 24.554 1.00 0.00 ? 30 GLN A N    7  
ATOM 5835  C CA   . GLN A 1 30 ? 3.346   10.160 25.453 1.00 0.00 ? 30 GLN A CA   7  
ATOM 5836  C C    . GLN A 1 30 ? 2.416   9.159  26.148 1.00 0.00 ? 30 GLN A C    7  
ATOM 5837  O O    . GLN A 1 30 ? 2.863   8.258  26.828 1.00 0.00 ? 30 GLN A O    7  
ATOM 5838  C CB   . GLN A 1 30 ? 3.996   11.085 26.482 1.00 0.00 ? 30 GLN A CB   7  
ATOM 5839  C CG   . GLN A 1 30 ? 4.961   12.039 25.774 1.00 0.00 ? 30 GLN A CG   7  
ATOM 5840  C CD   . GLN A 1 30 ? 6.392   11.748 26.226 1.00 0.00 ? 30 GLN A CD   7  
ATOM 5841  O OE1  . GLN A 1 30 ? 6.722   11.912 27.384 1.00 0.00 ? 30 GLN A OE1  7  
ATOM 5842  N NE2  . GLN A 1 30 ? 7.264   11.320 25.354 1.00 0.00 ? 30 GLN A NE2  7  
ATOM 5843  H H    . GLN A 1 30 ? 2.518   12.023 24.757 1.00 0.00 ? 30 GLN A H    7  
ATOM 5844  H HA   . GLN A 1 30 ? 4.109   9.639  24.896 1.00 0.00 ? 30 GLN A HA   7  
ATOM 5845  H HB2  . GLN A 1 30 ? 3.230   11.656 26.986 1.00 0.00 ? 30 GLN A HB2  7  
ATOM 5846  H HB3  . GLN A 1 30 ? 4.540   10.496 27.205 1.00 0.00 ? 30 GLN A HB3  7  
ATOM 5847  H HG2  . GLN A 1 30 ? 4.886   11.901 24.706 1.00 0.00 ? 30 GLN A HG2  7  
ATOM 5848  H HG3  . GLN A 1 30 ? 4.705   13.060 26.023 1.00 0.00 ? 30 GLN A HG3  7  
ATOM 5849  H HE21 . GLN A 1 30 ? 6.997   11.188 24.420 1.00 0.00 ? 30 GLN A HE21 7  
ATOM 5850  H HE22 . GLN A 1 30 ? 8.183   11.129 25.633 1.00 0.00 ? 30 GLN A HE22 7  
ATOM 5851  N N    . SER A 1 31 ? 1.129   9.308  25.990 1.00 0.00 ? 31 SER A N    7  
ATOM 5852  C CA   . SER A 1 31 ? 0.191   8.355  26.655 1.00 0.00 ? 31 SER A CA   7  
ATOM 5853  C C    . SER A 1 31 ? -1.065  8.149  25.803 1.00 0.00 ? 31 SER A C    7  
ATOM 5854  O O    . SER A 1 31 ? -1.334  8.897  24.884 1.00 0.00 ? 31 SER A O    7  
ATOM 5855  C CB   . SER A 1 31 ? -0.168  9.015  27.987 1.00 0.00 ? 31 SER A CB   7  
ATOM 5856  O OG   . SER A 1 31 ? -0.494  10.379 27.767 1.00 0.00 ? 31 SER A OG   7  
ATOM 5857  H H    . SER A 1 31 ? 0.780   10.042 25.441 1.00 0.00 ? 31 SER A H    7  
ATOM 5858  H HA   . SER A 1 31 ? 0.680   7.411  26.836 1.00 0.00 ? 31 SER A HA   7  
ATOM 5859  H HB2  . SER A 1 31 ? -1.017  8.508  28.424 1.00 0.00 ? 31 SER A HB2  7  
ATOM 5860  H HB3  . SER A 1 31 ? 0.674   8.950  28.659 1.00 0.00 ? 31 SER A HB3  7  
ATOM 5861  H HG   . SER A 1 31 ? -1.013  10.685 28.516 1.00 0.00 ? 31 SER A HG   7  
ATOM 5862  N N    . LEU A 1 32 ? -1.836  7.139  26.105 1.00 0.00 ? 32 LEU A N    7  
ATOM 5863  C CA   . LEU A 1 32 ? -3.076  6.881  25.316 1.00 0.00 ? 32 LEU A CA   7  
ATOM 5864  C C    . LEU A 1 32 ? -4.078  8.014  25.529 1.00 0.00 ? 32 LEU A C    7  
ATOM 5865  O O    . LEU A 1 32 ? -4.537  8.635  24.591 1.00 0.00 ? 32 LEU A O    7  
ATOM 5866  C CB   . LEU A 1 32 ? -3.632  5.568  25.865 1.00 0.00 ? 32 LEU A CB   7  
ATOM 5867  C CG   . LEU A 1 32 ? -4.446  4.865  24.776 1.00 0.00 ? 32 LEU A CG   7  
ATOM 5868  C CD1  . LEU A 1 32 ? -4.651  3.397  25.161 1.00 0.00 ? 32 LEU A CD1  7  
ATOM 5869  C CD2  . LEU A 1 32 ? -5.808  5.549  24.635 1.00 0.00 ? 32 LEU A CD2  7  
ATOM 5870  H H    . LEU A 1 32 ? -1.600  6.549  26.851 1.00 0.00 ? 32 LEU A H    7  
ATOM 5871  H HA   . LEU A 1 32 ? -2.843  6.776  24.272 1.00 0.00 ? 32 LEU A HA   7  
ATOM 5872  H HB2  . LEU A 1 32 ? -2.816  4.932  26.172 1.00 0.00 ? 32 LEU A HB2  7  
ATOM 5873  H HB3  . LEU A 1 32 ? -4.268  5.775  26.712 1.00 0.00 ? 32 LEU A HB3  7  
ATOM 5874  H HG   . LEU A 1 32 ? -3.916  4.920  23.837 1.00 0.00 ? 32 LEU A HG   7  
ATOM 5875  H HD11 . LEU A 1 32 ? -4.746  3.317  26.234 1.00 0.00 ? 32 LEU A HD11 7  
ATOM 5876  H HD12 . LEU A 1 32 ? -5.547  3.023  24.691 1.00 0.00 ? 32 LEU A HD12 7  
ATOM 5877  H HD13 . LEU A 1 32 ? -3.802  2.817  24.831 1.00 0.00 ? 32 LEU A HD13 7  
ATOM 5878  H HD21 . LEU A 1 32 ? -6.295  5.582  25.598 1.00 0.00 ? 32 LEU A HD21 7  
ATOM 5879  H HD22 . LEU A 1 32 ? -5.669  6.554  24.266 1.00 0.00 ? 32 LEU A HD22 7  
ATOM 5880  H HD23 . LEU A 1 32 ? -6.420  4.991  23.941 1.00 0.00 ? 32 LEU A HD23 7  
ATOM 5881  N N    . ASP A 1 33 ? -4.416  8.291  26.754 1.00 0.00 ? 33 ASP A N    7  
ATOM 5882  C CA   . ASP A 1 33 ? -5.382  9.389  27.026 1.00 0.00 ? 33 ASP A CA   7  
ATOM 5883  C C    . ASP A 1 33 ? -4.860  10.677 26.401 1.00 0.00 ? 33 ASP A C    7  
ATOM 5884  O O    . ASP A 1 33 ? -5.594  11.433 25.796 1.00 0.00 ? 33 ASP A O    7  
ATOM 5885  C CB   . ASP A 1 33 ? -5.440  9.509  28.550 1.00 0.00 ? 33 ASP A CB   7  
ATOM 5886  C CG   . ASP A 1 33 ? -6.564  10.471 28.941 1.00 0.00 ? 33 ASP A CG   7  
ATOM 5887  O OD1  . ASP A 1 33 ? -7.165  11.043 28.048 1.00 0.00 ? 33 ASP A OD1  7  
ATOM 5888  O OD2  . ASP A 1 33 ? -6.803  10.619 30.128 1.00 0.00 ? 33 ASP A OD2  7  
ATOM 5889  H H    . ASP A 1 33 ? -4.028  7.782  27.494 1.00 0.00 ? 33 ASP A H    7  
ATOM 5890  H HA   . ASP A 1 33 ? -6.356  9.143  26.632 1.00 0.00 ? 33 ASP A HA   7  
ATOM 5891  H HB2  . ASP A 1 33 ? -5.631  8.538  28.981 1.00 0.00 ? 33 ASP A HB2  7  
ATOM 5892  H HB3  . ASP A 1 33 ? -4.498  9.889  28.916 1.00 0.00 ? 33 ASP A HB3  7  
ATOM 5893  N N    . GLY A 1 34 ? -3.587  10.922 26.527 1.00 0.00 ? 34 GLY A N    7  
ATOM 5894  C CA   . GLY A 1 34 ? -3.006  12.146 25.921 1.00 0.00 ? 34 GLY A CA   7  
ATOM 5895  C C    . GLY A 1 34 ? -2.954  11.952 24.408 1.00 0.00 ? 34 GLY A C    7  
ATOM 5896  O O    . GLY A 1 34 ? -3.110  12.881 23.644 1.00 0.00 ? 34 GLY A O    7  
ATOM 5897  H H    . GLY A 1 34 ? -3.010  10.288 27.006 1.00 0.00 ? 34 GLY A H    7  
ATOM 5898  H HA2  . GLY A 1 34 ? -3.625  12.998 26.157 1.00 0.00 ? 34 GLY A HA2  7  
ATOM 5899  H HA3  . GLY A 1 34 ? -2.008  12.304 26.301 1.00 0.00 ? 34 GLY A HA3  7  
ATOM 5900  N N    . ILE A 1 35 ? -2.750  10.738 23.974 1.00 0.00 ? 35 ILE A N    7  
ATOM 5901  C CA   . ILE A 1 35 ? -2.700  10.463 22.511 1.00 0.00 ? 35 ILE A CA   7  
ATOM 5902  C C    . ILE A 1 35 ? -4.079  10.714 21.896 1.00 0.00 ? 35 ILE A C    7  
ATOM 5903  O O    . ILE A 1 35 ? -4.197  11.200 20.788 1.00 0.00 ? 35 ILE A O    7  
ATOM 5904  C CB   . ILE A 1 35 ? -2.297  8.984  22.406 1.00 0.00 ? 35 ILE A CB   7  
ATOM 5905  C CG1  . ILE A 1 35 ? -0.773  8.883  22.332 1.00 0.00 ? 35 ILE A CG1  7  
ATOM 5906  C CG2  . ILE A 1 35 ? -2.907  8.347  21.150 1.00 0.00 ? 35 ILE A CG2  7  
ATOM 5907  C CD1  . ILE A 1 35 ? -0.298  9.322  20.944 1.00 0.00 ? 35 ILE A CD1  7  
ATOM 5908  H H    . ILE A 1 35 ? -2.636  10.003 24.613 1.00 0.00 ? 35 ILE A H    7  
ATOM 5909  H HA   . ILE A 1 35 ? -1.959  11.082 22.037 1.00 0.00 ? 35 ILE A HA   7  
ATOM 5910  H HB   . ILE A 1 35 ? -2.648  8.456  23.280 1.00 0.00 ? 35 ILE A HB   7  
ATOM 5911  H HG12 . ILE A 1 35 ? -0.333  9.523  23.082 1.00 0.00 ? 35 ILE A HG12 7  
ATOM 5912  H HG13 . ILE A 1 35 ? -0.471  7.861  22.509 1.00 0.00 ? 35 ILE A HG13 7  
ATOM 5913  H HG21 . ILE A 1 35 ? -2.963  9.085  20.364 1.00 0.00 ? 35 ILE A HG21 7  
ATOM 5914  H HG22 . ILE A 1 35 ? -2.288  7.523  20.828 1.00 0.00 ? 35 ILE A HG22 7  
ATOM 5915  H HG23 . ILE A 1 35 ? -3.900  7.985  21.375 1.00 0.00 ? 35 ILE A HG23 7  
ATOM 5916  H HD11 . ILE A 1 35 ? -0.803  8.736  20.190 1.00 0.00 ? 35 ILE A HD11 7  
ATOM 5917  H HD12 . ILE A 1 35 ? -0.527  10.367 20.799 1.00 0.00 ? 35 ILE A HD12 7  
ATOM 5918  H HD13 . ILE A 1 35 ? 0.767   9.170  20.865 1.00 0.00 ? 35 ILE A HD13 7  
ATOM 5919  N N    . MET A 1 36 ? -5.121  10.384 22.605 1.00 0.00 ? 36 MET A N    7  
ATOM 5920  C CA   . MET A 1 36 ? -6.489  10.605 22.056 1.00 0.00 ? 36 MET A CA   7  
ATOM 5921  C C    . MET A 1 36 ? -6.609  12.022 21.492 1.00 0.00 ? 36 MET A C    7  
ATOM 5922  O O    . MET A 1 36 ? -7.035  12.219 20.371 1.00 0.00 ? 36 MET A O    7  
ATOM 5923  C CB   . MET A 1 36 ? -7.433  10.427 23.242 1.00 0.00 ? 36 MET A CB   7  
ATOM 5924  C CG   . MET A 1 36 ? -7.761  8.943  23.418 1.00 0.00 ? 36 MET A CG   7  
ATOM 5925  S SD   . MET A 1 36 ? -8.679  8.350  21.976 1.00 0.00 ? 36 MET A SD   7  
ATOM 5926  C CE   . MET A 1 36 ? -10.254 9.158  22.361 1.00 0.00 ? 36 MET A CE   7  
ATOM 5927  H H    . MET A 1 36 ? -5.006  9.992  23.497 1.00 0.00 ? 36 MET A H    7  
ATOM 5928  H HA   . MET A 1 36 ? -6.712  9.875  21.294 1.00 0.00 ? 36 MET A HA   7  
ATOM 5929  H HB2  . MET A 1 36 ? -6.962  10.802 24.137 1.00 0.00 ? 36 MET A HB2  7  
ATOM 5930  H HB3  . MET A 1 36 ? -8.343  10.978 23.054 1.00 0.00 ? 36 MET A HB3  7  
ATOM 5931  H HG2  . MET A 1 36 ? -6.843  8.382  23.516 1.00 0.00 ? 36 MET A HG2  7  
ATOM 5932  H HG3  . MET A 1 36 ? -8.360  8.810  24.307 1.00 0.00 ? 36 MET A HG3  7  
ATOM 5933  H HE1  . MET A 1 36 ? -10.072 10.017 22.992 1.00 0.00 ? 36 MET A HE1  7  
ATOM 5934  H HE2  . MET A 1 36 ? -10.727 9.479  21.447 1.00 0.00 ? 36 MET A HE2  7  
ATOM 5935  H HE3  . MET A 1 36 ? -10.901 8.458  22.872 1.00 0.00 ? 36 MET A HE3  7  
ATOM 5936  N N    . PHE A 1 37 ? -6.240  13.014 22.258 1.00 0.00 ? 37 PHE A N    7  
ATOM 5937  C CA   . PHE A 1 37 ? -6.343  14.411 21.752 1.00 0.00 ? 37 PHE A CA   7  
ATOM 5938  C C    . PHE A 1 37 ? -5.794  14.477 20.317 1.00 0.00 ? 37 PHE A C    7  
ATOM 5939  O O    . PHE A 1 37 ? -6.425  15.015 19.429 1.00 0.00 ? 37 PHE A O    7  
ATOM 5940  C CB   . PHE A 1 37 ? -5.530  15.260 22.758 1.00 0.00 ? 37 PHE A CB   7  
ATOM 5941  C CG   . PHE A 1 37 ? -4.387  15.981 22.079 1.00 0.00 ? 37 PHE A CG   7  
ATOM 5942  C CD1  . PHE A 1 37 ? -3.193  15.307 21.819 1.00 0.00 ? 37 PHE A CD1  7  
ATOM 5943  C CD2  . PHE A 1 37 ? -4.529  17.322 21.707 1.00 0.00 ? 37 PHE A CD2  7  
ATOM 5944  C CE1  . PHE A 1 37 ? -2.140  15.967 21.181 1.00 0.00 ? 37 PHE A CE1  7  
ATOM 5945  C CE2  . PHE A 1 37 ? -3.476  17.984 21.071 1.00 0.00 ? 37 PHE A CE2  7  
ATOM 5946  C CZ   . PHE A 1 37 ? -2.282  17.304 20.806 1.00 0.00 ? 37 PHE A CZ   7  
ATOM 5947  H H    . PHE A 1 37 ? -5.899  12.839 23.161 1.00 0.00 ? 37 PHE A H    7  
ATOM 5948  H HA   . PHE A 1 37 ? -7.375  14.727 21.763 1.00 0.00 ? 37 PHE A HA   7  
ATOM 5949  H HB2  . PHE A 1 37 ? -6.187  15.989 23.211 1.00 0.00 ? 37 PHE A HB2  7  
ATOM 5950  H HB3  . PHE A 1 37 ? -5.134  14.613 23.527 1.00 0.00 ? 37 PHE A HB3  7  
ATOM 5951  H HD1  . PHE A 1 37 ? -3.083  14.273 22.107 1.00 0.00 ? 37 PHE A HD1  7  
ATOM 5952  H HD2  . PHE A 1 37 ? -5.449  17.846 21.917 1.00 0.00 ? 37 PHE A HD2  7  
ATOM 5953  H HE1  . PHE A 1 37 ? -1.217  15.444 20.981 1.00 0.00 ? 37 PHE A HE1  7  
ATOM 5954  H HE2  . PHE A 1 37 ? -3.584  19.018 20.780 1.00 0.00 ? 37 PHE A HE2  7  
ATOM 5955  H HZ   . PHE A 1 37 ? -1.473  17.808 20.310 1.00 0.00 ? 37 PHE A HZ   7  
ATOM 5956  N N    . ILE A 1 38 ? -4.637  13.919 20.076 1.00 0.00 ? 38 ILE A N    7  
ATOM 5957  C CA   . ILE A 1 38 ? -4.075  13.943 18.695 1.00 0.00 ? 38 ILE A CA   7  
ATOM 5958  C C    . ILE A 1 38 ? -5.113  13.414 17.707 1.00 0.00 ? 38 ILE A C    7  
ATOM 5959  O O    . ILE A 1 38 ? -5.303  13.958 16.637 1.00 0.00 ? 38 ILE A O    7  
ATOM 5960  C CB   . ILE A 1 38 ? -2.863  13.012 18.737 1.00 0.00 ? 38 ILE A CB   7  
ATOM 5961  C CG1  . ILE A 1 38 ? -1.758  13.642 19.586 1.00 0.00 ? 38 ILE A CG1  7  
ATOM 5962  C CG2  . ILE A 1 38 ? -2.349  12.787 17.313 1.00 0.00 ? 38 ILE A CG2  7  
ATOM 5963  C CD1  . ILE A 1 38 ? -0.482  12.809 19.467 1.00 0.00 ? 38 ILE A CD1  7  
ATOM 5964  H H    . ILE A 1 38 ? -4.145  13.478 20.797 1.00 0.00 ? 38 ILE A H    7  
ATOM 5965  H HA   . ILE A 1 38 ? -3.770  14.939 18.428 1.00 0.00 ? 38 ILE A HA   7  
ATOM 5966  H HB   . ILE A 1 38 ? -3.151  12.065 19.169 1.00 0.00 ? 38 ILE A HB   7  
ATOM 5967  H HG12 . ILE A 1 38 ? -1.567  14.647 19.239 1.00 0.00 ? 38 ILE A HG12 7  
ATOM 5968  H HG13 . ILE A 1 38 ? -2.072  13.671 20.618 1.00 0.00 ? 38 ILE A HG13 7  
ATOM 5969  H HG21 . ILE A 1 38 ? -3.036  13.232 16.607 1.00 0.00 ? 38 ILE A HG21 7  
ATOM 5970  H HG22 . ILE A 1 38 ? -1.376  13.245 17.205 1.00 0.00 ? 38 ILE A HG22 7  
ATOM 5971  H HG23 . ILE A 1 38 ? -2.272  11.727 17.122 1.00 0.00 ? 38 ILE A HG23 7  
ATOM 5972  H HD11 . ILE A 1 38 ? -0.594  12.086 18.673 1.00 0.00 ? 38 ILE A HD11 7  
ATOM 5973  H HD12 . ILE A 1 38 ? 0.354   13.457 19.248 1.00 0.00 ? 38 ILE A HD12 7  
ATOM 5974  H HD13 . ILE A 1 38 ? -0.303  12.292 20.399 1.00 0.00 ? 38 ILE A HD13 7  
ATOM 5975  N N    . ASN A 1 39 ? -5.786  12.356 18.061 1.00 0.00 ? 39 ASN A N    7  
ATOM 5976  C CA   . ASN A 1 39 ? -6.815  11.788 17.144 1.00 0.00 ? 39 ASN A CA   7  
ATOM 5977  C C    . ASN A 1 39 ? -7.979  12.769 16.993 1.00 0.00 ? 39 ASN A C    7  
ATOM 5978  O O    . ASN A 1 39 ? -8.660  12.792 15.987 1.00 0.00 ? 39 ASN A O    7  
ATOM 5979  C CB   . ASN A 1 39 ? -7.283  10.498 17.817 1.00 0.00 ? 39 ASN A CB   7  
ATOM 5980  C CG   . ASN A 1 39 ? -6.140  9.482  17.825 1.00 0.00 ? 39 ASN A CG   7  
ATOM 5981  O OD1  . ASN A 1 39 ? -5.441  9.329  16.843 1.00 0.00 ? 39 ASN A OD1  7  
ATOM 5982  N ND2  . ASN A 1 39 ? -5.918  8.775  18.900 1.00 0.00 ? 39 ASN A ND2  7  
ATOM 5983  H H    . ASN A 1 39 ? -5.615  11.936 18.930 1.00 0.00 ? 39 ASN A H    7  
ATOM 5984  H HA   . ASN A 1 39 ? -6.381  11.567 16.181 1.00 0.00 ? 39 ASN A HA   7  
ATOM 5985  H HB2  . ASN A 1 39 ? -7.583  10.710 18.833 1.00 0.00 ? 39 ASN A HB2  7  
ATOM 5986  H HB3  . ASN A 1 39 ? -8.122  10.091 17.272 1.00 0.00 ? 39 ASN A HB3  7  
ATOM 5987  H HD21 . ASN A 1 39 ? -6.482  8.898  19.692 1.00 0.00 ? 39 ASN A HD21 7  
ATOM 5988  H HD22 . ASN A 1 39 ? -5.188  8.122  18.915 1.00 0.00 ? 39 ASN A HD22 7  
ATOM 5989  N N    . LYS A 1 40 ? -8.210  13.582 17.987 1.00 0.00 ? 40 LYS A N    7  
ATOM 5990  C CA   . LYS A 1 40 ? -9.328  14.563 17.902 1.00 0.00 ? 40 LYS A CA   7  
ATOM 5991  C C    . LYS A 1 40 ? -8.803  15.925 17.436 1.00 0.00 ? 40 LYS A C    7  
ATOM 5992  O O    . LYS A 1 40 ? -9.543  16.747 16.934 1.00 0.00 ? 40 LYS A O    7  
ATOM 5993  C CB   . LYS A 1 40 ? -9.879  14.657 19.324 1.00 0.00 ? 40 LYS A CB   7  
ATOM 5994  C CG   . LYS A 1 40 ? -11.079 15.607 19.344 1.00 0.00 ? 40 LYS A CG   7  
ATOM 5995  C CD   . LYS A 1 40 ? -11.563 15.787 20.783 1.00 0.00 ? 40 LYS A CD   7  
ATOM 5996  C CE   . LYS A 1 40 ? -12.187 14.480 21.277 1.00 0.00 ? 40 LYS A CE   7  
ATOM 5997  N NZ   . LYS A 1 40 ? -12.601 14.763 22.681 1.00 0.00 ? 40 LYS A NZ   7  
ATOM 5998  H H    . LYS A 1 40 ? -7.648  13.547 18.789 1.00 0.00 ? 40 LYS A H    7  
ATOM 5999  H HA   . LYS A 1 40 ? -10.095 14.205 17.233 1.00 0.00 ? 40 LYS A HA   7  
ATOM 6000  H HB2  . LYS A 1 40 ? -10.189 13.678 19.655 1.00 0.00 ? 40 LYS A HB2  7  
ATOM 6001  H HB3  . LYS A 1 40 ? -9.111  15.032 19.983 1.00 0.00 ? 40 LYS A HB3  7  
ATOM 6002  H HG2  . LYS A 1 40 ? -10.786 16.565 18.939 1.00 0.00 ? 40 LYS A HG2  7  
ATOM 6003  H HG3  . LYS A 1 40 ? -11.876 15.192 18.745 1.00 0.00 ? 40 LYS A HG3  7  
ATOM 6004  H HD2  . LYS A 1 40 ? -10.726 16.047 21.414 1.00 0.00 ? 40 LYS A HD2  7  
ATOM 6005  H HD3  . LYS A 1 40 ? -12.300 16.575 20.819 1.00 0.00 ? 40 LYS A HD3  7  
ATOM 6006  H HE2  . LYS A 1 40 ? -13.047 14.224 20.677 1.00 0.00 ? 40 LYS A HE2  7  
ATOM 6007  H HE3  . LYS A 1 40 ? -11.460 13.683 21.252 1.00 0.00 ? 40 LYS A HE3  7  
ATOM 6008  H HZ1  . LYS A 1 40 ? -13.243 15.580 22.696 1.00 0.00 ? 40 LYS A HZ1  7  
ATOM 6009  H HZ2  . LYS A 1 40 ? -13.088 13.930 23.072 1.00 0.00 ? 40 LYS A HZ2  7  
ATOM 6010  H HZ3  . LYS A 1 40 ? -11.761 14.975 23.254 1.00 0.00 ? 40 LYS A HZ3  7  
ATOM 6011  N N    . CYS A 1 41 ? -7.531  16.170 17.597 1.00 0.00 ? 41 CYS A N    7  
ATOM 6012  C CA   . CYS A 1 41 ? -6.960  17.478 17.161 1.00 0.00 ? 41 CYS A CA   7  
ATOM 6013  C C    . CYS A 1 41 ? -7.307  17.740 15.694 1.00 0.00 ? 41 CYS A C    7  
ATOM 6014  O O    . CYS A 1 41 ? -8.168  18.538 15.380 1.00 0.00 ? 41 CYS A O    7  
ATOM 6015  C CB   . CYS A 1 41 ? -5.447  17.325 17.335 1.00 0.00 ? 41 CYS A CB   7  
ATOM 6016  S SG   . CYS A 1 41 ? -4.586  18.654 16.453 1.00 0.00 ? 41 CYS A SG   7  
ATOM 6017  H H    . CYS A 1 41 ? -6.949  15.493 18.004 1.00 0.00 ? 41 CYS A H    7  
ATOM 6018  H HA   . CYS A 1 41 ? -7.326  18.277 17.786 1.00 0.00 ? 41 CYS A HA   7  
ATOM 6019  H HB2  . CYS A 1 41 ? -5.201  17.373 18.383 1.00 0.00 ? 41 CYS A HB2  7  
ATOM 6020  H HB3  . CYS A 1 41 ? -5.135  16.371 16.937 1.00 0.00 ? 41 CYS A HB3  7  
ATOM 6021  N N    . ALA A 1 42 ? -6.639  17.074 14.796 1.00 0.00 ? 42 ALA A N    7  
ATOM 6022  C CA   . ALA A 1 42 ? -6.921  17.281 13.346 1.00 0.00 ? 42 ALA A CA   7  
ATOM 6023  C C    . ALA A 1 42 ? -8.394  16.989 13.044 1.00 0.00 ? 42 ALA A C    7  
ATOM 6024  O O    . ALA A 1 42 ? -8.982  17.572 12.156 1.00 0.00 ? 42 ALA A O    7  
ATOM 6025  C CB   . ALA A 1 42 ? -6.017  16.283 12.623 1.00 0.00 ? 42 ALA A CB   7  
ATOM 6026  H H    . ALA A 1 42 ? -5.947  16.436 15.076 1.00 0.00 ? 42 ALA A H    7  
ATOM 6027  H HA   . ALA A 1 42 ? -6.667  18.287 13.054 1.00 0.00 ? 42 ALA A HA   7  
ATOM 6028  H HB1  . ALA A 1 42 ? -6.378  15.280 12.795 1.00 0.00 ? 42 ALA A HB1  7  
ATOM 6029  H HB2  . ALA A 1 42 ? -6.026  16.492 11.563 1.00 0.00 ? 42 ALA A HB2  7  
ATOM 6030  H HB3  . ALA A 1 42 ? -5.009  16.372 12.999 1.00 0.00 ? 42 ALA A HB3  7  
ATOM 6031  N N    . THR A 1 43 ? -8.995  16.094 13.779 1.00 0.00 ? 43 THR A N    7  
ATOM 6032  C CA   . THR A 1 43 ? -10.429 15.768 13.533 1.00 0.00 ? 43 THR A CA   7  
ATOM 6033  C C    . THR A 1 43 ? -11.327 16.841 14.153 1.00 0.00 ? 43 THR A C    7  
ATOM 6034  O O    . THR A 1 43 ? -12.489 16.962 13.819 1.00 0.00 ? 43 THR A O    7  
ATOM 6035  C CB   . THR A 1 43 ? -10.654 14.418 14.216 1.00 0.00 ? 43 THR A CB   7  
ATOM 6036  O OG1  . THR A 1 43 ? -9.793  13.447 13.636 1.00 0.00 ? 43 THR A OG1  7  
ATOM 6037  C CG2  . THR A 1 43 ? -12.110 13.988 14.031 1.00 0.00 ? 43 THR A CG2  7  
ATOM 6038  H H    . THR A 1 43 ? -8.503  15.635 14.492 1.00 0.00 ? 43 THR A H    7  
ATOM 6039  H HA   . THR A 1 43 ? -10.620 15.682 12.474 1.00 0.00 ? 43 THR A HA   7  
ATOM 6040  H HB   . THR A 1 43 ? -10.440 14.506 15.270 1.00 0.00 ? 43 THR A HB   7  
ATOM 6041  H HG1  . THR A 1 43 ? -9.748  13.616 12.692 1.00 0.00 ? 43 THR A HG1  7  
ATOM 6042  H HG21 . THR A 1 43 ? -12.729 14.863 13.898 1.00 0.00 ? 43 THR A HG21 7  
ATOM 6043  H HG22 . THR A 1 43 ? -12.191 13.353 13.161 1.00 0.00 ? 43 THR A HG22 7  
ATOM 6044  H HG23 . THR A 1 43 ? -12.438 13.445 14.905 1.00 0.00 ? 43 THR A HG23 7  
ATOM 6045  N N    . CYS A 1 44 ? -10.797 17.621 15.054 1.00 0.00 ? 44 CYS A N    7  
ATOM 6046  C CA   . CYS A 1 44 ? -11.617 18.687 15.695 1.00 0.00 ? 44 CYS A CA   7  
ATOM 6047  C C    . CYS A 1 44 ? -11.466 20.000 14.925 1.00 0.00 ? 44 CYS A C    7  
ATOM 6048  O O    . CYS A 1 44 ? -12.436 20.614 14.528 1.00 0.00 ? 44 CYS A O    7  
ATOM 6049  C CB   . CYS A 1 44 ? -11.057 18.825 17.111 1.00 0.00 ? 44 CYS A CB   7  
ATOM 6050  S SG   . CYS A 1 44 ? -11.725 20.320 17.884 1.00 0.00 ? 44 CYS A SG   7  
ATOM 6051  H H    . CYS A 1 44 ? -9.858  17.507 15.309 1.00 0.00 ? 44 CYS A H    7  
ATOM 6052  H HA   . CYS A 1 44 ? -12.655 18.392 15.737 1.00 0.00 ? 44 CYS A HA   7  
ATOM 6053  H HB2  . CYS A 1 44 ? -11.338 17.962 17.695 1.00 0.00 ? 44 CYS A HB2  7  
ATOM 6054  H HB3  . CYS A 1 44 ? -9.980  18.893 17.066 1.00 0.00 ? 44 CYS A HB3  7  
ATOM 6055  N N    . LYS A 1 45 ? -10.254 20.435 14.704 1.00 0.00 ? 45 LYS A N    7  
ATOM 6056  C CA   . LYS A 1 45 ? -10.049 21.706 13.952 1.00 0.00 ? 45 LYS A CA   7  
ATOM 6057  C C    . LYS A 1 45 ? -10.825 21.659 12.637 1.00 0.00 ? 45 LYS A C    7  
ATOM 6058  O O    . LYS A 1 45 ? -11.186 22.675 12.078 1.00 0.00 ? 45 LYS A O    7  
ATOM 6059  C CB   . LYS A 1 45 ? -8.545  21.776 13.687 1.00 0.00 ? 45 LYS A CB   7  
ATOM 6060  C CG   . LYS A 1 45 ? -8.113  20.569 12.852 1.00 0.00 ? 45 LYS A CG   7  
ATOM 6061  C CD   . LYS A 1 45 ? -7.317  21.047 11.639 1.00 0.00 ? 45 LYS A CD   7  
ATOM 6062  C CE   . LYS A 1 45 ? -5.856  21.267 12.041 1.00 0.00 ? 45 LYS A CE   7  
ATOM 6063  N NZ   . LYS A 1 45 ? -5.086  21.134 10.773 1.00 0.00 ? 45 LYS A NZ   7  
ATOM 6064  H H    . LYS A 1 45 ? -9.483  19.925 15.027 1.00 0.00 ? 45 LYS A H    7  
ATOM 6065  H HA   . LYS A 1 45 ? -10.361 22.551 14.544 1.00 0.00 ? 45 LYS A HA   7  
ATOM 6066  H HB2  . LYS A 1 45 ? -8.317  22.684 13.150 1.00 0.00 ? 45 LYS A HB2  7  
ATOM 6067  H HB3  . LYS A 1 45 ? -8.014  21.770 14.627 1.00 0.00 ? 45 LYS A HB3  7  
ATOM 6068  H HG2  . LYS A 1 45 ? -7.497  19.916 13.453 1.00 0.00 ? 45 LYS A HG2  7  
ATOM 6069  H HG3  . LYS A 1 45 ? -8.986  20.031 12.517 1.00 0.00 ? 45 LYS A HG3  7  
ATOM 6070  H HD2  . LYS A 1 45 ? -7.367  20.302 10.859 1.00 0.00 ? 45 LYS A HD2  7  
ATOM 6071  H HD3  . LYS A 1 45 ? -7.734  21.975 11.278 1.00 0.00 ? 45 LYS A HD3  7  
ATOM 6072  H HE2  . LYS A 1 45 ? -5.726  22.255 12.458 1.00 0.00 ? 45 LYS A HE2  7  
ATOM 6073  H HE3  . LYS A 1 45 ? -5.545  20.514 12.751 1.00 0.00 ? 45 LYS A HE3  7  
ATOM 6074  H HZ1  . LYS A 1 45 ? -5.594  21.619 10.006 1.00 0.00 ? 45 LYS A HZ1  7  
ATOM 6075  H HZ2  . LYS A 1 45 ? -4.146  21.562 10.893 1.00 0.00 ? 45 LYS A HZ2  7  
ATOM 6076  H HZ3  . LYS A 1 45 ? -4.982  20.128 10.534 1.00 0.00 ? 45 LYS A HZ3  7  
ATOM 6077  N N    . MET A 1 46 ? -11.089 20.481 12.143 1.00 0.00 ? 46 MET A N    7  
ATOM 6078  C CA   . MET A 1 46 ? -11.846 20.362 10.869 1.00 0.00 ? 46 MET A CA   7  
ATOM 6079  C C    . MET A 1 46 ? -13.337 20.580 11.134 1.00 0.00 ? 46 MET A C    7  
ATOM 6080  O O    . MET A 1 46 ? -14.083 20.982 10.263 1.00 0.00 ? 46 MET A O    7  
ATOM 6081  C CB   . MET A 1 46 ? -11.579 18.939 10.373 1.00 0.00 ? 46 MET A CB   7  
ATOM 6082  C CG   . MET A 1 46 ? -12.178 17.924 11.351 1.00 0.00 ? 46 MET A CG   7  
ATOM 6083  S SD   . MET A 1 46 ? -13.297 16.813 10.460 1.00 0.00 ? 46 MET A SD   7  
ATOM 6084  C CE   . MET A 1 46 ? -14.369 18.081 9.738  1.00 0.00 ? 46 MET A CE   7  
ATOM 6085  H H    . MET A 1 46 ? -10.790 19.676 12.613 1.00 0.00 ? 46 MET A H    7  
ATOM 6086  H HA   . MET A 1 46 ? -11.482 21.078 10.150 1.00 0.00 ? 46 MET A HA   7  
ATOM 6087  H HB2  . MET A 1 46 ? -12.029 18.809 9.401  1.00 0.00 ? 46 MET A HB2  7  
ATOM 6088  H HB3  . MET A 1 46 ? -10.515 18.780 10.300 1.00 0.00 ? 46 MET A HB3  7  
ATOM 6089  H HG2  . MET A 1 46 ? -11.383 17.347 11.799 1.00 0.00 ? 46 MET A HG2  7  
ATOM 6090  H HG3  . MET A 1 46 ? -12.723 18.442 12.122 1.00 0.00 ? 46 MET A HG3  7  
ATOM 6091  H HE1  . MET A 1 46 ? -14.673 18.777 10.502 1.00 0.00 ? 46 MET A HE1  7  
ATOM 6092  H HE2  . MET A 1 46 ? -13.828 18.612 8.966  1.00 0.00 ? 46 MET A HE2  7  
ATOM 6093  H HE3  . MET A 1 46 ? -15.245 17.612 9.312  1.00 0.00 ? 46 MET A HE3  7  
ATOM 6094  N N    . ILE A 1 47 ? -13.774 20.327 12.338 1.00 0.00 ? 47 ILE A N    7  
ATOM 6095  C CA   . ILE A 1 47 ? -15.213 20.528 12.666 1.00 0.00 ? 47 ILE A CA   7  
ATOM 6096  C C    . ILE A 1 47 ? -15.557 22.009 12.528 1.00 0.00 ? 47 ILE A C    7  
ATOM 6097  O O    . ILE A 1 47 ? -16.645 22.374 12.127 1.00 0.00 ? 47 ILE A O    7  
ATOM 6098  C CB   . ILE A 1 47 ? -15.362 20.074 14.120 1.00 0.00 ? 47 ILE A CB   7  
ATOM 6099  C CG1  . ILE A 1 47 ? -14.806 18.656 14.276 1.00 0.00 ? 47 ILE A CG1  7  
ATOM 6100  C CG2  . ILE A 1 47 ? -16.843 20.084 14.506 1.00 0.00 ? 47 ILE A CG2  7  
ATOM 6101  C CD1  . ILE A 1 47 ? -15.369 17.761 13.170 1.00 0.00 ? 47 ILE A CD1  7  
ATOM 6102  H H    . ILE A 1 47 ? -13.153 20.010 13.027 1.00 0.00 ? 47 ILE A H    7  
ATOM 6103  H HA   . ILE A 1 47 ? -15.837 19.930 12.022 1.00 0.00 ? 47 ILE A HA   7  
ATOM 6104  H HB   . ILE A 1 47 ? -14.817 20.746 14.765 1.00 0.00 ? 47 ILE A HB   7  
ATOM 6105  H HG12 . ILE A 1 47 ? -13.730 18.682 14.205 1.00 0.00 ? 47 ILE A HG12 7  
ATOM 6106  H HG13 . ILE A 1 47 ? -15.095 18.262 15.239 1.00 0.00 ? 47 ILE A HG13 7  
ATOM 6107  H HG21 . ILE A 1 47 ? -17.271 21.046 14.267 1.00 0.00 ? 47 ILE A HG21 7  
ATOM 6108  H HG22 . ILE A 1 47 ? -17.364 19.312 13.959 1.00 0.00 ? 47 ILE A HG22 7  
ATOM 6109  H HG23 . ILE A 1 47 ? -16.940 19.902 15.567 1.00 0.00 ? 47 ILE A HG23 7  
ATOM 6110  H HD11 . ILE A 1 47 ? -15.158 18.201 12.208 1.00 0.00 ? 47 ILE A HD11 7  
ATOM 6111  H HD12 . ILE A 1 47 ? -14.910 16.785 13.228 1.00 0.00 ? 47 ILE A HD12 7  
ATOM 6112  H HD13 . ILE A 1 47 ? -16.438 17.663 13.294 1.00 0.00 ? 47 ILE A HD13 7  
ATOM 6113  N N    . LEU A 1 48 ? -14.627 22.866 12.847 1.00 0.00 ? 48 LEU A N    7  
ATOM 6114  C CA   . LEU A 1 48 ? -14.883 24.327 12.726 1.00 0.00 ? 48 LEU A CA   7  
ATOM 6115  C C    . LEU A 1 48 ? -14.994 24.703 11.251 1.00 0.00 ? 48 LEU A C    7  
ATOM 6116  O O    . LEU A 1 48 ? -15.819 25.508 10.865 1.00 0.00 ? 48 LEU A O    7  
ATOM 6117  C CB   . LEU A 1 48 ? -13.666 24.993 13.363 1.00 0.00 ? 48 LEU A CB   7  
ATOM 6118  C CG   . LEU A 1 48 ? -13.603 24.615 14.842 1.00 0.00 ? 48 LEU A CG   7  
ATOM 6119  C CD1  . LEU A 1 48 ? -12.221 24.040 15.163 1.00 0.00 ? 48 LEU A CD1  7  
ATOM 6120  C CD2  . LEU A 1 48 ? -13.854 25.860 15.693 1.00 0.00 ? 48 LEU A CD2  7  
ATOM 6121  H H    . LEU A 1 48 ? -13.755 22.547 13.161 1.00 0.00 ? 48 LEU A H    7  
ATOM 6122  H HA   . LEU A 1 48 ? -15.779 24.602 13.259 1.00 0.00 ? 48 LEU A HA   7  
ATOM 6123  H HB2  . LEU A 1 48 ? -12.769 24.656 12.865 1.00 0.00 ? 48 LEU A HB2  7  
ATOM 6124  H HB3  . LEU A 1 48 ? -13.751 26.065 13.267 1.00 0.00 ? 48 LEU A HB3  7  
ATOM 6125  H HG   . LEU A 1 48 ? -14.359 23.875 15.057 1.00 0.00 ? 48 LEU A HG   7  
ATOM 6126  H HD11 . LEU A 1 48 ? -11.461 24.639 14.683 1.00 0.00 ? 48 LEU A HD11 7  
ATOM 6127  H HD12 . LEU A 1 48 ? -12.066 24.050 16.232 1.00 0.00 ? 48 LEU A HD12 7  
ATOM 6128  H HD13 . LEU A 1 48 ? -12.162 23.024 14.800 1.00 0.00 ? 48 LEU A HD13 7  
ATOM 6129  H HD21 . LEU A 1 48 ? -14.667 26.429 15.264 1.00 0.00 ? 48 LEU A HD21 7  
ATOM 6130  H HD22 . LEU A 1 48 ? -14.113 25.564 16.698 1.00 0.00 ? 48 LEU A HD22 7  
ATOM 6131  H HD23 . LEU A 1 48 ? -12.962 26.468 15.714 1.00 0.00 ? 48 LEU A HD23 7  
ATOM 6132  N N    . GLU A 1 49 ? -14.178 24.116 10.419 1.00 0.00 ? 49 GLU A N    7  
ATOM 6133  C CA   . GLU A 1 49 ? -14.249 24.432 8.966  1.00 0.00 ? 49 GLU A CA   7  
ATOM 6134  C C    . GLU A 1 49 ? -15.711 24.422 8.513  1.00 0.00 ? 49 GLU A C    7  
ATOM 6135  O O    . GLU A 1 49 ? -16.081 25.067 7.552  1.00 0.00 ? 49 GLU A O    7  
ATOM 6136  C CB   . GLU A 1 49 ? -13.463 23.317 8.275  1.00 0.00 ? 49 GLU A CB   7  
ATOM 6137  C CG   . GLU A 1 49 ? -11.986 23.421 8.656  1.00 0.00 ? 49 GLU A CG   7  
ATOM 6138  C CD   . GLU A 1 49 ? -11.308 24.483 7.787  1.00 0.00 ? 49 GLU A CD   7  
ATOM 6139  O OE1  . GLU A 1 49 ? -11.904 24.879 6.798  1.00 0.00 ? 49 GLU A OE1  7  
ATOM 6140  O OE2  . GLU A 1 49 ? -10.205 24.881 8.124  1.00 0.00 ? 49 GLU A OE2  7  
ATOM 6141  H H    . GLU A 1 49 ? -13.525 23.461 10.750 1.00 0.00 ? 49 GLU A H    7  
ATOM 6142  H HA   . GLU A 1 49 ? -13.794 25.389 8.763  1.00 0.00 ? 49 GLU A HA   7  
ATOM 6143  H HB2  . GLU A 1 49 ? -13.848 22.358 8.590  1.00 0.00 ? 49 GLU A HB2  7  
ATOM 6144  H HB3  . GLU A 1 49 ? -13.567 23.412 7.204  1.00 0.00 ? 49 GLU A HB3  7  
ATOM 6145  H HG2  . GLU A 1 49 ? -11.900 23.700 9.696  1.00 0.00 ? 49 GLU A HG2  7  
ATOM 6146  H HG3  . GLU A 1 49 ? -11.505 22.467 8.499  1.00 0.00 ? 49 GLU A HG3  7  
ATOM 6147  N N    . LYS A 1 50 ? -16.544 23.694 9.207  1.00 0.00 ? 50 LYS A N    7  
ATOM 6148  C CA   . LYS A 1 50 ? -17.984 23.638 8.828  1.00 0.00 ? 50 LYS A CA   7  
ATOM 6149  C C    . LYS A 1 50 ? -18.691 24.924 9.268  1.00 0.00 ? 50 LYS A C    7  
ATOM 6150  O O    . LYS A 1 50 ? -19.615 25.386 8.628  1.00 0.00 ? 50 LYS A O    7  
ATOM 6151  C CB   . LYS A 1 50 ? -18.549 22.431 9.583  1.00 0.00 ? 50 LYS A CB   7  
ATOM 6152  C CG   . LYS A 1 50 ? -17.663 21.206 9.337  1.00 0.00 ? 50 LYS A CG   7  
ATOM 6153  C CD   . LYS A 1 50 ? -18.099 20.513 8.045  1.00 0.00 ? 50 LYS A CD   7  
ATOM 6154  C CE   . LYS A 1 50 ? -17.788 19.017 8.140  1.00 0.00 ? 50 LYS A CE   7  
ATOM 6155  N NZ   . LYS A 1 50 ? -18.451 18.413 6.950  1.00 0.00 ? 50 LYS A NZ   7  
ATOM 6156  H H    . LYS A 1 50 ? -16.222 23.185 9.979  1.00 0.00 ? 50 LYS A H    7  
ATOM 6157  H HA   . LYS A 1 50 ? -18.091 23.492 7.765  1.00 0.00 ? 50 LYS A HA   7  
ATOM 6158  H HB2  . LYS A 1 50 ? -18.575 22.650 10.640 1.00 0.00 ? 50 LYS A HB2  7  
ATOM 6159  H HB3  . LYS A 1 50 ? -19.551 22.227 9.233  1.00 0.00 ? 50 LYS A HB3  7  
ATOM 6160  H HG2  . LYS A 1 50 ? -16.634 21.515 9.249  1.00 0.00 ? 50 LYS A HG2  7  
ATOM 6161  H HG3  . LYS A 1 50 ? -17.763 20.519 10.165 1.00 0.00 ? 50 LYS A HG3  7  
ATOM 6162  H HD2  . LYS A 1 50 ? -19.160 20.651 7.902  1.00 0.00 ? 50 LYS A HD2  7  
ATOM 6163  H HD3  . LYS A 1 50 ? -17.564 20.939 7.210  1.00 0.00 ? 50 LYS A HD3  7  
ATOM 6164  H HE2  . LYS A 1 50 ? -16.721 18.852 8.101  1.00 0.00 ? 50 LYS A HE2  7  
ATOM 6165  H HE3  . LYS A 1 50 ? -18.200 18.604 9.050  1.00 0.00 ? 50 LYS A HE3  7  
ATOM 6166  H HZ1  . LYS A 1 50 ? -18.347 19.050 6.135  1.00 0.00 ? 50 LYS A HZ1  7  
ATOM 6167  H HZ2  . LYS A 1 50 ? -18.006 17.497 6.735  1.00 0.00 ? 50 LYS A HZ2  7  
ATOM 6168  H HZ3  . LYS A 1 50 ? -19.460 18.271 7.150  1.00 0.00 ? 50 LYS A HZ3  7  
ATOM 6169  N N    . GLU A 1 51 ? -18.264 25.507 10.357 1.00 0.00 ? 51 GLU A N    7  
ATOM 6170  C CA   . GLU A 1 51 ? -18.914 26.763 10.832 1.00 0.00 ? 51 GLU A CA   7  
ATOM 6171  C C    . GLU A 1 51 ? -18.758 27.868 9.785  1.00 0.00 ? 51 GLU A C    7  
ATOM 6172  O O    . GLU A 1 51 ? -19.563 28.774 9.699  1.00 0.00 ? 51 GLU A O    7  
ATOM 6173  C CB   . GLU A 1 51 ? -18.172 27.131 12.117 1.00 0.00 ? 51 GLU A CB   7  
ATOM 6174  C CG   . GLU A 1 51 ? -18.748 28.431 12.682 1.00 0.00 ? 51 GLU A CG   7  
ATOM 6175  C CD   . GLU A 1 51 ? -17.889 28.901 13.858 1.00 0.00 ? 51 GLU A CD   7  
ATOM 6176  O OE1  . GLU A 1 51 ? -17.133 28.093 14.374 1.00 0.00 ? 51 GLU A OE1  7  
ATOM 6177  O OE2  . GLU A 1 51 ? -18.002 30.059 14.223 1.00 0.00 ? 51 GLU A OE2  7  
ATOM 6178  H H    . GLU A 1 51 ? -17.516 25.121 10.861 1.00 0.00 ? 51 GLU A H    7  
ATOM 6179  H HA   . GLU A 1 51 ? -19.957 26.590 11.045 1.00 0.00 ? 51 GLU A HA   7  
ATOM 6180  H HB2  . GLU A 1 51 ? -18.292 26.340 12.842 1.00 0.00 ? 51 GLU A HB2  7  
ATOM 6181  H HB3  . GLU A 1 51 ? -17.123 27.266 11.900 1.00 0.00 ? 51 GLU A HB3  7  
ATOM 6182  H HG2  . GLU A 1 51 ? -18.750 29.189 11.912 1.00 0.00 ? 51 GLU A HG2  7  
ATOM 6183  H HG3  . GLU A 1 51 ? -19.759 28.260 13.021 1.00 0.00 ? 51 GLU A HG3  7  
ATOM 6184  N N    . ALA A 1 52 ? -17.726 27.800 8.989  1.00 0.00 ? 52 ALA A N    7  
ATOM 6185  C CA   . ALA A 1 52 ? -17.518 28.847 7.947  1.00 0.00 ? 52 ALA A CA   7  
ATOM 6186  C C    . ALA A 1 52 ? -18.411 28.571 6.735  1.00 0.00 ? 52 ALA A C    7  
ATOM 6187  O O    . ALA A 1 52 ? -18.938 27.489 6.573  1.00 0.00 ? 52 ALA A O    7  
ATOM 6188  C CB   . ALA A 1 52 ? -16.042 28.735 7.563  1.00 0.00 ? 52 ALA A CB   7  
ATOM 6189  H H    . ALA A 1 52 ? -17.090 27.061 9.075  1.00 0.00 ? 52 ALA A H    7  
ATOM 6190  H HA   . ALA A 1 52 ? -17.721 29.826 8.351  1.00 0.00 ? 52 ALA A HA   7  
ATOM 6191  H HB1  . ALA A 1 52 ? -15.768 27.692 7.491  1.00 0.00 ? 52 ALA A HB1  7  
ATOM 6192  H HB2  . ALA A 1 52 ? -15.882 29.215 6.609  1.00 0.00 ? 52 ALA A HB2  7  
ATOM 6193  H HB3  . ALA A 1 52 ? -15.437 29.217 8.315  1.00 0.00 ? 52 ALA A HB3  7  
ATOM 6194  N N    . LYS A 1 53 ? -18.586 29.543 5.881  1.00 0.00 ? 53 LYS A N    7  
ATOM 6195  C CA   . LYS A 1 53 ? -19.445 29.335 4.680  1.00 0.00 ? 53 LYS A CA   7  
ATOM 6196  C C    . LYS A 1 53 ? -18.625 28.719 3.543  1.00 0.00 ? 53 LYS A C    7  
ATOM 6197  O O    . LYS A 1 53 ? -19.158 28.318 2.527  1.00 0.00 ? 53 LYS A O    7  
ATOM 6198  C CB   . LYS A 1 53 ? -19.931 30.732 4.295  1.00 0.00 ? 53 LYS A CB   7  
ATOM 6199  C CG   . LYS A 1 53 ? -20.752 31.321 5.443  1.00 0.00 ? 53 LYS A CG   7  
ATOM 6200  C CD   . LYS A 1 53 ? -21.308 32.685 5.027  1.00 0.00 ? 53 LYS A CD   7  
ATOM 6201  C CE   . LYS A 1 53 ? -22.027 33.327 6.216  1.00 0.00 ? 53 LYS A CE   7  
ATOM 6202  N NZ   . LYS A 1 53 ? -23.290 32.549 6.363  1.00 0.00 ? 53 LYS A NZ   7  
ATOM 6203  H H    . LYS A 1 53 ? -18.152 30.409 6.029  1.00 0.00 ? 53 LYS A H    7  
ATOM 6204  H HA   . LYS A 1 53 ? -20.287 28.707 4.922  1.00 0.00 ? 53 LYS A HA   7  
ATOM 6205  H HB2  . LYS A 1 53 ? -19.080 31.368 4.097  1.00 0.00 ? 53 LYS A HB2  7  
ATOM 6206  H HB3  . LYS A 1 53 ? -20.545 30.668 3.408  1.00 0.00 ? 53 LYS A HB3  7  
ATOM 6207  H HG2  . LYS A 1 53 ? -21.571 30.656 5.678  1.00 0.00 ? 53 LYS A HG2  7  
ATOM 6208  H HG3  . LYS A 1 53 ? -20.123 31.438 6.313  1.00 0.00 ? 53 LYS A HG3  7  
ATOM 6209  H HD2  . LYS A 1 53 ? -20.496 33.323 4.710  1.00 0.00 ? 53 LYS A HD2  7  
ATOM 6210  H HD3  . LYS A 1 53 ? -22.004 32.557 4.211  1.00 0.00 ? 53 LYS A HD3  7  
ATOM 6211  H HE2  . LYS A 1 53 ? -21.426 33.241 7.109  1.00 0.00 ? 53 LYS A HE2  7  
ATOM 6212  H HE3  . LYS A 1 53 ? -22.246 34.364 6.007  1.00 0.00 ? 53 LYS A HE3  7  
ATOM 6213  H HZ1  . LYS A 1 53 ? -23.763 32.481 5.439  1.00 0.00 ? 53 LYS A HZ1  7  
ATOM 6214  H HZ2  . LYS A 1 53 ? -23.072 31.596 6.713  1.00 0.00 ? 53 LYS A HZ2  7  
ATOM 6215  H HZ3  . LYS A 1 53 ? -23.916 33.030 7.039  1.00 0.00 ? 53 LYS A HZ3  7  
ATOM 6216  N N    . SER A 1 54 ? -17.333 28.638 3.706  1.00 0.00 ? 54 SER A N    7  
ATOM 6217  C CA   . SER A 1 54 ? -16.482 28.047 2.634  1.00 0.00 ? 54 SER A CA   7  
ATOM 6218  C C    . SER A 1 54 ? -16.723 26.537 2.540  1.00 0.00 ? 54 SER A C    7  
ATOM 6219  O O    . SER A 1 54 ? -16.399 25.907 1.553  1.00 0.00 ? 54 SER A O    7  
ATOM 6220  C CB   . SER A 1 54 ? -15.044 28.334 3.067  1.00 0.00 ? 54 SER A CB   7  
ATOM 6221  O OG   . SER A 1 54 ? -14.799 27.727 4.326  1.00 0.00 ? 54 SER A OG   7  
ATOM 6222  H H    . SER A 1 54 ? -16.922 28.966 4.533  1.00 0.00 ? 54 SER A H    7  
ATOM 6223  H HA   . SER A 1 54 ? -16.684 28.521 1.687  1.00 0.00 ? 54 SER A HA   7  
ATOM 6224  H HB2  . SER A 1 54 ? -14.360 27.934 2.334  1.00 0.00 ? 54 SER A HB2  7  
ATOM 6225  H HB3  . SER A 1 54 ? -14.900 29.402 3.148  1.00 0.00 ? 54 SER A HB3  7  
ATOM 6226  H HG   . SER A 1 54 ? -14.549 26.813 4.171  1.00 0.00 ? 54 SER A HG   7  
ATOM 6227  N N    . GLN A 1 55 ? -17.289 25.954 3.560  1.00 0.00 ? 55 GLN A N    7  
ATOM 6228  C CA   . GLN A 1 55 ? -17.550 24.486 3.530  1.00 0.00 ? 55 GLN A CA   7  
ATOM 6229  C C    . GLN A 1 55 ? -18.413 24.080 4.728  1.00 0.00 ? 55 GLN A C    7  
ATOM 6230  O O    . GLN A 1 55 ? -17.998 24.338 5.845  1.00 0.00 ? 55 GLN A O    7  
ATOM 6231  C CB   . GLN A 1 55 ? -16.171 23.835 3.618  1.00 0.00 ? 55 GLN A CB   7  
ATOM 6232  C CG   . GLN A 1 55 ? -16.307 22.324 3.425  1.00 0.00 ? 55 GLN A CG   7  
ATOM 6233  C CD   . GLN A 1 55 ? -14.919 21.706 3.237  1.00 0.00 ? 55 GLN A CD   7  
ATOM 6234  O OE1  . GLN A 1 55 ? -14.189 22.085 2.341  1.00 0.00 ? 55 GLN A OE1  7  
ATOM 6235  N NE2  . GLN A 1 55 ? -14.522 20.766 4.049  1.00 0.00 ? 55 GLN A NE2  7  
ATOM 6236  O OXT  . GLN A 1 55 ? -19.473 23.518 4.506  1.00 0.00 ? 55 GLN A OXT  7  
ATOM 6237  H H    . GLN A 1 55 ? -17.542 26.480 4.348  1.00 0.00 ? 55 GLN A H    7  
ATOM 6238  H HA   . GLN A 1 55 ? -18.032 24.208 2.605  1.00 0.00 ? 55 GLN A HA   7  
ATOM 6239  H HB2  . GLN A 1 55 ? -15.531 24.240 2.846  1.00 0.00 ? 55 GLN A HB2  7  
ATOM 6240  H HB3  . GLN A 1 55 ? -15.738 24.037 4.587  1.00 0.00 ? 55 GLN A HB3  7  
ATOM 6241  H HG2  . GLN A 1 55 ? -16.778 21.891 4.295  1.00 0.00 ? 55 GLN A HG2  7  
ATOM 6242  H HG3  . GLN A 1 55 ? -16.910 22.124 2.552  1.00 0.00 ? 55 GLN A HG3  7  
ATOM 6243  H HE21 . GLN A 1 55 ? -15.110 20.460 4.770  1.00 0.00 ? 55 GLN A HE21 7  
ATOM 6244  H HE22 . GLN A 1 55 ? -13.634 20.364 3.936  1.00 0.00 ? 55 GLN A HE22 7  
ATOM 6245  N N    . LYS A 1 1  ? -28.427 25.481 19.045 1.00 0.00 ? 1  LYS A N    8  
ATOM 6246  C CA   . LYS A 1 1  ? -27.571 25.357 20.260 1.00 0.00 ? 1  LYS A CA   8  
ATOM 6247  C C    . LYS A 1 1  ? -27.456 23.889 20.678 1.00 0.00 ? 1  LYS A C    8  
ATOM 6248  O O    . LYS A 1 1  ? -28.179 23.419 21.534 1.00 0.00 ? 1  LYS A O    8  
ATOM 6249  C CB   . LYS A 1 1  ? -28.293 26.167 21.337 1.00 0.00 ? 1  LYS A CB   8  
ATOM 6250  C CG   . LYS A 1 1  ? -27.380 26.328 22.554 1.00 0.00 ? 1  LYS A CG   8  
ATOM 6251  C CD   . LYS A 1 1  ? -28.066 27.220 23.591 1.00 0.00 ? 1  LYS A CD   8  
ATOM 6252  C CE   . LYS A 1 1  ? -27.106 27.483 24.753 1.00 0.00 ? 1  LYS A CE   8  
ATOM 6253  N NZ   . LYS A 1 1  ? -27.872 28.347 25.694 1.00 0.00 ? 1  LYS A NZ   8  
ATOM 6254  H H1   . LYS A 1 1  ? -28.108 24.802 18.325 1.00 0.00 ? 1  LYS A H1   8  
ATOM 6255  H H2   . LYS A 1 1  ? -29.416 25.281 19.298 1.00 0.00 ? 1  LYS A H2   8  
ATOM 6256  H H3   . LYS A 1 1  ? -28.353 26.445 18.665 1.00 0.00 ? 1  LYS A H3   8  
ATOM 6257  H HA   . LYS A 1 1  ? -26.593 25.775 20.078 1.00 0.00 ? 1  LYS A HA   8  
ATOM 6258  H HB2  . LYS A 1 1  ? -28.544 27.142 20.944 1.00 0.00 ? 1  LYS A HB2  8  
ATOM 6259  H HB3  . LYS A 1 1  ? -29.197 25.653 21.629 1.00 0.00 ? 1  LYS A HB3  8  
ATOM 6260  H HG2  . LYS A 1 1  ? -27.184 25.358 22.987 1.00 0.00 ? 1  LYS A HG2  8  
ATOM 6261  H HG3  . LYS A 1 1  ? -26.448 26.781 22.249 1.00 0.00 ? 1  LYS A HG3  8  
ATOM 6262  H HD2  . LYS A 1 1  ? -28.341 28.159 23.132 1.00 0.00 ? 1  LYS A HD2  8  
ATOM 6263  H HD3  . LYS A 1 1  ? -28.952 26.727 23.961 1.00 0.00 ? 1  LYS A HD3  8  
ATOM 6264  H HE2  . LYS A 1 1  ? -26.834 26.554 25.233 1.00 0.00 ? 1  LYS A HE2  8  
ATOM 6265  H HE3  . LYS A 1 1  ? -26.224 27.999 24.402 1.00 0.00 ? 1  LYS A HE3  8  
ATOM 6266  H HZ1  . LYS A 1 1  ? -28.580 28.895 25.166 1.00 0.00 ? 1  LYS A HZ1  8  
ATOM 6267  H HZ2  . LYS A 1 1  ? -28.353 27.753 26.398 1.00 0.00 ? 1  LYS A HZ2  8  
ATOM 6268  H HZ3  . LYS A 1 1  ? -27.219 28.998 26.177 1.00 0.00 ? 1  LYS A HZ3  8  
ATOM 6269  N N    . ASN A 1 2  ? -26.553 23.159 20.081 1.00 0.00 ? 2  ASN A N    8  
ATOM 6270  C CA   . ASN A 1 2  ? -26.395 21.721 20.445 1.00 0.00 ? 2  ASN A CA   8  
ATOM 6271  C C    . ASN A 1 2  ? -25.005 21.222 20.043 1.00 0.00 ? 2  ASN A C    8  
ATOM 6272  O O    . ASN A 1 2  ? -24.189 21.966 19.536 1.00 0.00 ? 2  ASN A O    8  
ATOM 6273  C CB   . ASN A 1 2  ? -27.478 20.990 19.650 1.00 0.00 ? 2  ASN A CB   8  
ATOM 6274  C CG   . ASN A 1 2  ? -27.311 21.294 18.160 1.00 0.00 ? 2  ASN A CG   8  
ATOM 6275  O OD1  . ASN A 1 2  ? -26.322 21.874 17.753 1.00 0.00 ? 2  ASN A OD1  8  
ATOM 6276  N ND2  . ASN A 1 2  ? -28.241 20.925 17.323 1.00 0.00 ? 2  ASN A ND2  8  
ATOM 6277  H H    . ASN A 1 2  ? -25.979 23.556 19.392 1.00 0.00 ? 2  ASN A H    8  
ATOM 6278  H HA   . ASN A 1 2  ? -26.556 21.580 21.501 1.00 0.00 ? 2  ASN A HA   8  
ATOM 6279  H HB2  . ASN A 1 2  ? -27.388 19.927 19.813 1.00 0.00 ? 2  ASN A HB2  8  
ATOM 6280  H HB3  . ASN A 1 2  ? -28.452 21.324 19.978 1.00 0.00 ? 2  ASN A HB3  8  
ATOM 6281  H HD21 . ASN A 1 2  ? -29.038 20.458 17.651 1.00 0.00 ? 2  ASN A HD21 8  
ATOM 6282  H HD22 . ASN A 1 2  ? -28.143 21.115 16.367 1.00 0.00 ? 2  ASN A HD22 8  
ATOM 6283  N N    . GLU A 1 3  ? -24.729 19.965 20.267 1.00 0.00 ? 3  GLU A N    8  
ATOM 6284  C CA   . GLU A 1 3  ? -23.391 19.417 19.900 1.00 0.00 ? 3  GLU A CA   8  
ATOM 6285  C C    . GLU A 1 3  ? -23.301 19.206 18.386 1.00 0.00 ? 3  GLU A C    8  
ATOM 6286  O O    . GLU A 1 3  ? -22.289 18.777 17.869 1.00 0.00 ? 3  GLU A O    8  
ATOM 6287  C CB   . GLU A 1 3  ? -23.296 18.081 20.636 1.00 0.00 ? 3  GLU A CB   8  
ATOM 6288  C CG   . GLU A 1 3  ? -23.269 18.332 22.145 1.00 0.00 ? 3  GLU A CG   8  
ATOM 6289  C CD   . GLU A 1 3  ? -24.690 18.232 22.704 1.00 0.00 ? 3  GLU A CD   8  
ATOM 6290  O OE1  . GLU A 1 3  ? -25.621 18.324 21.921 1.00 0.00 ? 3  GLU A OE1  8  
ATOM 6291  O OE2  . GLU A 1 3  ? -24.823 18.067 23.906 1.00 0.00 ? 3  GLU A OE2  8  
ATOM 6292  H H    . GLU A 1 3  ? -25.401 19.383 20.678 1.00 0.00 ? 3  GLU A H    8  
ATOM 6293  H HA   . GLU A 1 3  ? -22.608 20.078 20.236 1.00 0.00 ? 3  GLU A HA   8  
ATOM 6294  H HB2  . GLU A 1 3  ? -24.153 17.471 20.387 1.00 0.00 ? 3  GLU A HB2  8  
ATOM 6295  H HB3  . GLU A 1 3  ? -22.393 17.570 20.340 1.00 0.00 ? 3  GLU A HB3  8  
ATOM 6296  H HG2  . GLU A 1 3  ? -22.643 17.592 22.622 1.00 0.00 ? 3  GLU A HG2  8  
ATOM 6297  H HG3  . GLU A 1 3  ? -22.874 19.317 22.339 1.00 0.00 ? 3  GLU A HG3  8  
ATOM 6298  N N    . ASP A 1 4  ? -24.351 19.507 17.671 1.00 0.00 ? 4  ASP A N    8  
ATOM 6299  C CA   . ASP A 1 4  ? -24.322 19.325 16.191 1.00 0.00 ? 4  ASP A CA   8  
ATOM 6300  C C    . ASP A 1 4  ? -23.458 20.410 15.543 1.00 0.00 ? 4  ASP A C    8  
ATOM 6301  O O    . ASP A 1 4  ? -23.270 20.435 14.342 1.00 0.00 ? 4  ASP A O    8  
ATOM 6302  C CB   . ASP A 1 4  ? -25.777 19.462 15.746 1.00 0.00 ? 4  ASP A CB   8  
ATOM 6303  C CG   . ASP A 1 4  ? -26.504 18.134 15.963 1.00 0.00 ? 4  ASP A CG   8  
ATOM 6304  O OD1  . ASP A 1 4  ? -25.854 17.186 16.374 1.00 0.00 ? 4  ASP A OD1  8  
ATOM 6305  O OD2  . ASP A 1 4  ? -27.698 18.086 15.714 1.00 0.00 ? 4  ASP A OD2  8  
ATOM 6306  H H    . ASP A 1 4  ? -25.158 19.853 18.107 1.00 0.00 ? 4  ASP A H    8  
ATOM 6307  H HA   . ASP A 1 4  ? -23.949 18.345 15.938 1.00 0.00 ? 4  ASP A HA   8  
ATOM 6308  H HB2  . ASP A 1 4  ? -26.260 20.235 16.327 1.00 0.00 ? 4  ASP A HB2  8  
ATOM 6309  H HB3  . ASP A 1 4  ? -25.811 19.724 14.699 1.00 0.00 ? 4  ASP A HB3  8  
ATOM 6310  N N    . GLN A 1 5  ? -22.927 21.305 16.330 1.00 0.00 ? 5  GLN A N    8  
ATOM 6311  C CA   . GLN A 1 5  ? -22.073 22.388 15.763 1.00 0.00 ? 5  GLN A CA   8  
ATOM 6312  C C    . GLN A 1 5  ? -20.688 22.347 16.410 1.00 0.00 ? 5  GLN A C    8  
ATOM 6313  O O    . GLN A 1 5  ? -19.691 22.672 15.796 1.00 0.00 ? 5  GLN A O    8  
ATOM 6314  C CB   . GLN A 1 5  ? -22.797 23.688 16.116 1.00 0.00 ? 5  GLN A CB   8  
ATOM 6315  C CG   . GLN A 1 5  ? -24.260 23.589 15.680 1.00 0.00 ? 5  GLN A CG   8  
ATOM 6316  C CD   . GLN A 1 5  ? -25.062 24.724 16.320 1.00 0.00 ? 5  GLN A CD   8  
ATOM 6317  O OE1  . GLN A 1 5  ? -25.812 25.406 15.651 1.00 0.00 ? 5  GLN A OE1  8  
ATOM 6318  N NE2  . GLN A 1 5  ? -24.935 24.957 17.598 1.00 0.00 ? 5  GLN A NE2  8  
ATOM 6319  H H    . GLN A 1 5  ? -23.089 21.266 17.296 1.00 0.00 ? 5  GLN A H    8  
ATOM 6320  H HA   . GLN A 1 5  ? -21.993 22.285 14.694 1.00 0.00 ? 5  GLN A HA   8  
ATOM 6321  H HB2  . GLN A 1 5  ? -22.749 23.850 17.182 1.00 0.00 ? 5  GLN A HB2  8  
ATOM 6322  H HB3  . GLN A 1 5  ? -22.324 24.514 15.604 1.00 0.00 ? 5  GLN A HB3  8  
ATOM 6323  H HG2  . GLN A 1 5  ? -24.322 23.667 14.604 1.00 0.00 ? 5  GLN A HG2  8  
ATOM 6324  H HG3  . GLN A 1 5  ? -24.666 22.640 15.996 1.00 0.00 ? 5  GLN A HG3  8  
ATOM 6325  H HE21 . GLN A 1 5  ? -24.330 24.407 18.138 1.00 0.00 ? 5  GLN A HE21 8  
ATOM 6326  H HE22 . GLN A 1 5  ? -25.444 25.681 18.017 1.00 0.00 ? 5  GLN A HE22 8  
ATOM 6327  N N    . GLU A 1 6  ? -20.622 21.942 17.648 1.00 0.00 ? 6  GLU A N    8  
ATOM 6328  C CA   . GLU A 1 6  ? -19.305 21.868 18.344 1.00 0.00 ? 6  GLU A CA   8  
ATOM 6329  C C    . GLU A 1 6  ? -19.133 20.489 18.984 1.00 0.00 ? 6  GLU A C    8  
ATOM 6330  O O    . GLU A 1 6  ? -18.813 20.369 20.151 1.00 0.00 ? 6  GLU A O    8  
ATOM 6331  C CB   . GLU A 1 6  ? -19.361 22.955 19.418 1.00 0.00 ? 6  GLU A CB   8  
ATOM 6332  C CG   . GLU A 1 6  ? -19.242 24.330 18.759 1.00 0.00 ? 6  GLU A CG   8  
ATOM 6333  C CD   . GLU A 1 6  ? -19.074 25.399 19.841 1.00 0.00 ? 6  GLU A CD   8  
ATOM 6334  O OE1  . GLU A 1 6  ? -19.384 25.111 20.985 1.00 0.00 ? 6  GLU A OE1  8  
ATOM 6335  O OE2  . GLU A 1 6  ? -18.640 26.489 19.506 1.00 0.00 ? 6  GLU A OE2  8  
ATOM 6336  H H    . GLU A 1 6  ? -21.439 21.681 18.119 1.00 0.00 ? 6  GLU A H    8  
ATOM 6337  H HA   . GLU A 1 6  ? -18.500 22.070 17.655 1.00 0.00 ? 6  GLU A HA   8  
ATOM 6338  H HB2  . GLU A 1 6  ? -20.301 22.888 19.947 1.00 0.00 ? 6  GLU A HB2  8  
ATOM 6339  H HB3  . GLU A 1 6  ? -18.546 22.817 20.112 1.00 0.00 ? 6  GLU A HB3  8  
ATOM 6340  H HG2  . GLU A 1 6  ? -18.384 24.342 18.104 1.00 0.00 ? 6  GLU A HG2  8  
ATOM 6341  H HG3  . GLU A 1 6  ? -20.135 24.534 18.188 1.00 0.00 ? 6  GLU A HG3  8  
ATOM 6342  N N    . MET A 1 7  ? -19.351 19.446 18.229 1.00 0.00 ? 7  MET A N    8  
ATOM 6343  C CA   . MET A 1 7  ? -19.208 18.072 18.790 1.00 0.00 ? 7  MET A CA   8  
ATOM 6344  C C    . MET A 1 7  ? -17.968 17.988 19.684 1.00 0.00 ? 7  MET A C    8  
ATOM 6345  O O    . MET A 1 7  ? -17.962 17.308 20.691 1.00 0.00 ? 7  MET A O    8  
ATOM 6346  C CB   . MET A 1 7  ? -19.052 17.161 17.573 1.00 0.00 ? 7  MET A CB   8  
ATOM 6347  C CG   . MET A 1 7  ? -20.321 17.226 16.721 1.00 0.00 ? 7  MET A CG   8  
ATOM 6348  S SD   . MET A 1 7  ? -20.254 15.951 15.438 1.00 0.00 ? 7  MET A SD   8  
ATOM 6349  C CE   . MET A 1 7  ? -19.075 16.789 14.350 1.00 0.00 ? 7  MET A CE   8  
ATOM 6350  H H    . MET A 1 7  ? -19.613 19.567 17.293 1.00 0.00 ? 7  MET A H    8  
ATOM 6351  H HA   . MET A 1 7  ? -20.092 17.799 19.343 1.00 0.00 ? 7  MET A HA   8  
ATOM 6352  H HB2  . MET A 1 7  ? -18.207 17.489 16.984 1.00 0.00 ? 7  MET A HB2  8  
ATOM 6353  H HB3  . MET A 1 7  ? -18.890 16.145 17.901 1.00 0.00 ? 7  MET A HB3  8  
ATOM 6354  H HG2  . MET A 1 7  ? -21.185 17.060 17.348 1.00 0.00 ? 7  MET A HG2  8  
ATOM 6355  H HG3  . MET A 1 7  ? -20.395 18.200 16.259 1.00 0.00 ? 7  MET A HG3  8  
ATOM 6356  H HE1  . MET A 1 7  ? -18.163 16.987 14.889 1.00 0.00 ? 7  MET A HE1  8  
ATOM 6357  H HE2  . MET A 1 7  ? -18.859 16.156 13.500 1.00 0.00 ? 7  MET A HE2  8  
ATOM 6358  H HE3  . MET A 1 7  ? -19.501 17.723 14.011 1.00 0.00 ? 7  MET A HE3  8  
ATOM 6359  N N    . CYS A 1 8  ? -16.918 18.674 19.325 1.00 0.00 ? 8  CYS A N    8  
ATOM 6360  C CA   . CYS A 1 8  ? -15.680 18.631 20.156 1.00 0.00 ? 8  CYS A CA   8  
ATOM 6361  C C    . CYS A 1 8  ? -15.666 19.797 21.147 1.00 0.00 ? 8  CYS A C    8  
ATOM 6362  O O    . CYS A 1 8  ? -15.620 20.950 20.764 1.00 0.00 ? 8  CYS A O    8  
ATOM 6363  C CB   . CYS A 1 8  ? -14.529 18.762 19.159 1.00 0.00 ? 8  CYS A CB   8  
ATOM 6364  S SG   . CYS A 1 8  ? -12.959 18.462 20.008 1.00 0.00 ? 8  CYS A SG   8  
ATOM 6365  H H    . CYS A 1 8  ? -16.942 19.217 18.510 1.00 0.00 ? 8  CYS A H    8  
ATOM 6366  H HA   . CYS A 1 8  ? -15.609 17.691 20.679 1.00 0.00 ? 8  CYS A HA   8  
ATOM 6367  H HB2  . CYS A 1 8  ? -14.654 18.038 18.367 1.00 0.00 ? 8  CYS A HB2  8  
ATOM 6368  H HB3  . CYS A 1 8  ? -14.527 19.758 18.739 1.00 0.00 ? 8  CYS A HB3  8  
ATOM 6369  N N    . HIS A 1 9  ? -15.704 19.509 22.419 1.00 0.00 ? 9  HIS A N    8  
ATOM 6370  C CA   . HIS A 1 9  ? -15.693 20.602 23.432 1.00 0.00 ? 9  HIS A CA   8  
ATOM 6371  C C    . HIS A 1 9  ? -14.350 20.625 24.168 1.00 0.00 ? 9  HIS A C    8  
ATOM 6372  O O    . HIS A 1 9  ? -14.036 21.560 24.878 1.00 0.00 ? 9  HIS A O    8  
ATOM 6373  C CB   . HIS A 1 9  ? -16.828 20.261 24.397 1.00 0.00 ? 9  HIS A CB   8  
ATOM 6374  C CG   . HIS A 1 9  ? -18.140 20.314 23.663 1.00 0.00 ? 9  HIS A CG   8  
ATOM 6375  N ND1  . HIS A 1 9  ? -18.737 19.181 23.133 1.00 0.00 ? 9  HIS A ND1  8  
ATOM 6376  C CD2  . HIS A 1 9  ? -18.982 21.357 23.362 1.00 0.00 ? 9  HIS A CD2  8  
ATOM 6377  C CE1  . HIS A 1 9  ? -19.886 19.563 22.547 1.00 0.00 ? 9  HIS A CE1  8  
ATOM 6378  N NE2  . HIS A 1 9  ? -20.084 20.880 22.657 1.00 0.00 ? 9  HIS A NE2  8  
ATOM 6379  H H    . HIS A 1 9  ? -15.740 18.573 22.707 1.00 0.00 ? 9  HIS A H    8  
ATOM 6380  H HA   . HIS A 1 9  ? -15.881 21.554 22.962 1.00 0.00 ? 9  HIS A HA   8  
ATOM 6381  H HB2  . HIS A 1 9  ? -16.678 19.268 24.794 1.00 0.00 ? 9  HIS A HB2  8  
ATOM 6382  H HB3  . HIS A 1 9  ? -16.840 20.975 25.206 1.00 0.00 ? 9  HIS A HB3  8  
ATOM 6383  H HD1  . HIS A 1 9  ? -18.386 18.267 23.177 1.00 0.00 ? 9  HIS A HD1  8  
ATOM 6384  H HD2  . HIS A 1 9  ? -18.815 22.388 23.631 1.00 0.00 ? 9  HIS A HD2  8  
ATOM 6385  H HE1  . HIS A 1 9  ? -20.566 18.889 22.047 1.00 0.00 ? 9  HIS A HE1  8  
ATOM 6386  N N    . GLU A 1 10 ? -13.555 19.604 24.004 1.00 0.00 ? 10 GLU A N    8  
ATOM 6387  C CA   . GLU A 1 10 ? -12.233 19.569 24.694 1.00 0.00 ? 10 GLU A CA   8  
ATOM 6388  C C    . GLU A 1 10 ? -11.267 20.558 24.037 1.00 0.00 ? 10 GLU A C    8  
ATOM 6389  O O    . GLU A 1 10 ? -10.573 21.298 24.706 1.00 0.00 ? 10 GLU A O    8  
ATOM 6390  C CB   . GLU A 1 10 ? -11.732 18.135 24.521 1.00 0.00 ? 10 GLU A CB   8  
ATOM 6391  C CG   . GLU A 1 10 ? -10.476 17.929 25.372 1.00 0.00 ? 10 GLU A CG   8  
ATOM 6392  C CD   . GLU A 1 10 ? -9.674  16.750 24.819 1.00 0.00 ? 10 GLU A CD   8  
ATOM 6393  O OE1  . GLU A 1 10 ? -10.141 16.129 23.880 1.00 0.00 ? 10 GLU A OE1  8  
ATOM 6394  O OE2  . GLU A 1 10 ? -8.604  16.490 25.345 1.00 0.00 ? 10 GLU A OE2  8  
ATOM 6395  H H    . GLU A 1 10 ? -13.826 18.859 23.427 1.00 0.00 ? 10 GLU A H    8  
ATOM 6396  H HA   . GLU A 1 10 ? -12.349 19.794 25.742 1.00 0.00 ? 10 GLU A HA   8  
ATOM 6397  H HB2  . GLU A 1 10 ? -12.499 17.444 24.836 1.00 0.00 ? 10 GLU A HB2  8  
ATOM 6398  H HB3  . GLU A 1 10 ? -11.494 17.961 23.481 1.00 0.00 ? 10 GLU A HB3  8  
ATOM 6399  H HG2  . GLU A 1 10 ? -9.871  18.823 25.343 1.00 0.00 ? 10 GLU A HG2  8  
ATOM 6400  H HG3  . GLU A 1 10 ? -10.764 17.722 26.392 1.00 0.00 ? 10 GLU A HG3  8  
ATOM 6401  N N    . PHE A 1 11 ? -11.216 20.577 22.733 1.00 0.00 ? 11 PHE A N    8  
ATOM 6402  C CA   . PHE A 1 11 ? -10.292 21.518 22.040 1.00 0.00 ? 11 PHE A CA   8  
ATOM 6403  C C    . PHE A 1 11 ? -10.936 22.900 21.913 1.00 0.00 ? 11 PHE A C    8  
ATOM 6404  O O    . PHE A 1 11 ? -10.270 23.881 21.655 1.00 0.00 ? 11 PHE A O    8  
ATOM 6405  C CB   . PHE A 1 11 ? -10.068 20.915 20.656 1.00 0.00 ? 11 PHE A CB   8  
ATOM 6406  C CG   . PHE A 1 11 ? -9.074  19.781 20.748 1.00 0.00 ? 11 PHE A CG   8  
ATOM 6407  C CD1  . PHE A 1 11 ? -9.488  18.515 21.182 1.00 0.00 ? 11 PHE A CD1  8  
ATOM 6408  C CD2  . PHE A 1 11 ? -7.737  19.994 20.391 1.00 0.00 ? 11 PHE A CD2  8  
ATOM 6409  C CE1  . PHE A 1 11 ? -8.566  17.466 21.260 1.00 0.00 ? 11 PHE A CE1  8  
ATOM 6410  C CE2  . PHE A 1 11 ? -6.815  18.944 20.469 1.00 0.00 ? 11 PHE A CE2  8  
ATOM 6411  C CZ   . PHE A 1 11 ? -7.230  17.681 20.902 1.00 0.00 ? 11 PHE A CZ   8  
ATOM 6412  H H    . PHE A 1 11 ? -11.784 19.971 22.211 1.00 0.00 ? 11 PHE A H    8  
ATOM 6413  H HA   . PHE A 1 11 ? -9.355  21.586 22.567 1.00 0.00 ? 11 PHE A HA   8  
ATOM 6414  H HB2  . PHE A 1 11 ? -11.005 20.545 20.274 1.00 0.00 ? 11 PHE A HB2  8  
ATOM 6415  H HB3  . PHE A 1 11 ? -9.685  21.674 19.991 1.00 0.00 ? 11 PHE A HB3  8  
ATOM 6416  H HD1  . PHE A 1 11 ? -10.517 18.349 21.460 1.00 0.00 ? 11 PHE A HD1  8  
ATOM 6417  H HD2  . PHE A 1 11 ? -7.417  20.970 20.057 1.00 0.00 ? 11 PHE A HD2  8  
ATOM 6418  H HE1  . PHE A 1 11 ? -8.884  16.490 21.595 1.00 0.00 ? 11 PHE A HE1  8  
ATOM 6419  H HE2  . PHE A 1 11 ? -5.784  19.110 20.194 1.00 0.00 ? 11 PHE A HE2  8  
ATOM 6420  H HZ   . PHE A 1 11 ? -6.518  16.871 20.963 1.00 0.00 ? 11 PHE A HZ   8  
ATOM 6421  N N    . GLN A 1 12 ? -12.227 22.990 22.090 1.00 0.00 ? 12 GLN A N    8  
ATOM 6422  C CA   . GLN A 1 12 ? -12.889 24.320 21.978 1.00 0.00 ? 12 GLN A CA   8  
ATOM 6423  C C    . GLN A 1 12 ? -12.103 25.346 22.790 1.00 0.00 ? 12 GLN A C    8  
ATOM 6424  O O    . GLN A 1 12 ? -11.942 26.480 22.388 1.00 0.00 ? 12 GLN A O    8  
ATOM 6425  C CB   . GLN A 1 12 ? -14.288 24.131 22.561 1.00 0.00 ? 12 GLN A CB   8  
ATOM 6426  C CG   . GLN A 1 12 ? -15.066 25.442 22.438 1.00 0.00 ? 12 GLN A CG   8  
ATOM 6427  C CD   . GLN A 1 12 ? -16.375 25.337 23.223 1.00 0.00 ? 12 GLN A CD   8  
ATOM 6428  O OE1  . GLN A 1 12 ? -16.366 25.088 24.412 1.00 0.00 ? 12 GLN A OE1  8  
ATOM 6429  N NE2  . GLN A 1 12 ? -17.509 25.516 22.602 1.00 0.00 ? 12 GLN A NE2  8  
ATOM 6430  H H    . GLN A 1 12 ? -12.755 22.191 22.297 1.00 0.00 ? 12 GLN A H    8  
ATOM 6431  H HA   . GLN A 1 12 ? -12.955 24.626 20.945 1.00 0.00 ? 12 GLN A HA   8  
ATOM 6432  H HB2  . GLN A 1 12 ? -14.803 23.352 22.018 1.00 0.00 ? 12 GLN A HB2  8  
ATOM 6433  H HB3  . GLN A 1 12 ? -14.211 23.853 23.602 1.00 0.00 ? 12 GLN A HB3  8  
ATOM 6434  H HG2  . GLN A 1 12 ? -14.472 26.252 22.835 1.00 0.00 ? 12 GLN A HG2  8  
ATOM 6435  H HG3  . GLN A 1 12 ? -15.285 25.635 21.398 1.00 0.00 ? 12 GLN A HG3  8  
ATOM 6436  H HE21 . GLN A 1 12 ? -17.517 25.716 21.643 1.00 0.00 ? 12 GLN A HE21 8  
ATOM 6437  H HE22 . GLN A 1 12 ? -18.354 25.450 23.096 1.00 0.00 ? 12 GLN A HE22 8  
ATOM 6438  N N    . ALA A 1 13 ? -11.601 24.952 23.926 1.00 0.00 ? 13 ALA A N    8  
ATOM 6439  C CA   . ALA A 1 13 ? -10.814 25.901 24.758 1.00 0.00 ? 13 ALA A CA   8  
ATOM 6440  C C    . ALA A 1 13 ? -9.556  26.327 23.999 1.00 0.00 ? 13 ALA A C    8  
ATOM 6441  O O    . ALA A 1 13 ? -8.949  27.336 24.295 1.00 0.00 ? 13 ALA A O    8  
ATOM 6442  C CB   . ALA A 1 13 ? -10.442 25.116 26.016 1.00 0.00 ? 13 ALA A CB   8  
ATOM 6443  H H    . ALA A 1 13 ? -11.734 24.029 24.229 1.00 0.00 ? 13 ALA A H    8  
ATOM 6444  H HA   . ALA A 1 13 ? -11.409 26.762 25.019 1.00 0.00 ? 13 ALA A HA   8  
ATOM 6445  H HB1  . ALA A 1 13 ? -10.347 25.795 26.850 1.00 0.00 ? 13 ALA A HB1  8  
ATOM 6446  H HB2  . ALA A 1 13 ? -9.503  24.606 25.858 1.00 0.00 ? 13 ALA A HB2  8  
ATOM 6447  H HB3  . ALA A 1 13 ? -11.214 24.391 26.228 1.00 0.00 ? 13 ALA A HB3  8  
ATOM 6448  N N    . PHE A 1 14 ? -9.160  25.560 23.018 1.00 0.00 ? 14 PHE A N    8  
ATOM 6449  C CA   . PHE A 1 14 ? -7.943  25.917 22.241 1.00 0.00 ? 14 PHE A CA   8  
ATOM 6450  C C    . PHE A 1 14 ? -8.311  26.816 21.058 1.00 0.00 ? 14 PHE A C    8  
ATOM 6451  O O    . PHE A 1 14 ? -7.534  26.996 20.140 1.00 0.00 ? 14 PHE A O    8  
ATOM 6452  C CB   . PHE A 1 14 ? -7.391  24.580 21.747 1.00 0.00 ? 14 PHE A CB   8  
ATOM 6453  C CG   . PHE A 1 14 ? -7.191  23.642 22.917 1.00 0.00 ? 14 PHE A CG   8  
ATOM 6454  C CD1  . PHE A 1 14 ? -7.074  24.151 24.217 1.00 0.00 ? 14 PHE A CD1  8  
ATOM 6455  C CD2  . PHE A 1 14 ? -7.123  22.261 22.698 1.00 0.00 ? 14 PHE A CD2  8  
ATOM 6456  C CE1  . PHE A 1 14 ? -6.890  23.278 25.296 1.00 0.00 ? 14 PHE A CE1  8  
ATOM 6457  C CE2  . PHE A 1 14 ? -6.939  21.389 23.777 1.00 0.00 ? 14 PHE A CE2  8  
ATOM 6458  C CZ   . PHE A 1 14 ? -6.822  21.897 25.076 1.00 0.00 ? 14 PHE A CZ   8  
ATOM 6459  H H    . PHE A 1 14 ? -9.661  24.746 22.794 1.00 0.00 ? 14 PHE A H    8  
ATOM 6460  H HA   . PHE A 1 14 ? -7.220  26.401 22.876 1.00 0.00 ? 14 PHE A HA   8  
ATOM 6461  H HB2  . PHE A 1 14 ? -8.087  24.140 21.049 1.00 0.00 ? 14 PHE A HB2  8  
ATOM 6462  H HB3  . PHE A 1 14 ? -6.447  24.744 21.255 1.00 0.00 ? 14 PHE A HB3  8  
ATOM 6463  H HD1  . PHE A 1 14 ? -7.126  25.215 24.387 1.00 0.00 ? 14 PHE A HD1  8  
ATOM 6464  H HD2  . PHE A 1 14 ? -7.214  21.868 21.695 1.00 0.00 ? 14 PHE A HD2  8  
ATOM 6465  H HE1  . PHE A 1 14 ? -6.799  23.671 26.298 1.00 0.00 ? 14 PHE A HE1  8  
ATOM 6466  H HE2  . PHE A 1 14 ? -6.888  20.324 23.606 1.00 0.00 ? 14 PHE A HE2  8  
ATOM 6467  H HZ   . PHE A 1 14 ? -6.680  21.224 25.908 1.00 0.00 ? 14 PHE A HZ   8  
ATOM 6468  N N    . MET A 1 15 ? -9.489  27.379 21.064 1.00 0.00 ? 15 MET A N    8  
ATOM 6469  C CA   . MET A 1 15 ? -9.897  28.257 19.935 1.00 0.00 ? 15 MET A CA   8  
ATOM 6470  C C    . MET A 1 15 ? -9.703  29.734 20.303 1.00 0.00 ? 15 MET A C    8  
ATOM 6471  O O    . MET A 1 15 ? -10.385 30.272 21.153 1.00 0.00 ? 15 MET A O    8  
ATOM 6472  C CB   . MET A 1 15 ? -11.375 27.932 19.707 1.00 0.00 ? 15 MET A CB   8  
ATOM 6473  C CG   . MET A 1 15 ? -12.230 28.562 20.808 1.00 0.00 ? 15 MET A CG   8  
ATOM 6474  S SD   . MET A 1 15 ? -13.842 27.741 20.869 1.00 0.00 ? 15 MET A SD   8  
ATOM 6475  C CE   . MET A 1 15 ? -14.649 28.912 21.987 1.00 0.00 ? 15 MET A CE   8  
ATOM 6476  H H    . MET A 1 15 ? -10.108 27.221 21.805 1.00 0.00 ? 15 MET A H    8  
ATOM 6477  H HA   . MET A 1 15 ? -9.330  28.015 19.051 1.00 0.00 ? 15 MET A HA   8  
ATOM 6478  H HB2  . MET A 1 15 ? -11.680 28.320 18.753 1.00 0.00 ? 15 MET A HB2  8  
ATOM 6479  H HB3  . MET A 1 15 ? -11.512 26.860 19.717 1.00 0.00 ? 15 MET A HB3  8  
ATOM 6480  H HG2  . MET A 1 15 ? -11.734 28.451 21.760 1.00 0.00 ? 15 MET A HG2  8  
ATOM 6481  H HG3  . MET A 1 15 ? -12.371 29.610 20.597 1.00 0.00 ? 15 MET A HG3  8  
ATOM 6482  H HE1  . MET A 1 15 ? -13.991 29.751 22.165 1.00 0.00 ? 15 MET A HE1  8  
ATOM 6483  H HE2  . MET A 1 15 ? -15.570 29.260 21.540 1.00 0.00 ? 15 MET A HE2  8  
ATOM 6484  H HE3  . MET A 1 15 ? -14.868 28.425 22.924 1.00 0.00 ? 15 MET A HE3  8  
ATOM 6485  N N    . LYS A 1 16 ? -8.775  30.393 19.665 1.00 0.00 ? 16 LYS A N    8  
ATOM 6486  C CA   . LYS A 1 16 ? -8.536  31.832 19.970 1.00 0.00 ? 16 LYS A CA   8  
ATOM 6487  C C    . LYS A 1 16 ? -9.376  32.708 19.037 1.00 0.00 ? 16 LYS A C    8  
ATOM 6488  O O    . LYS A 1 16 ? -8.947  33.075 17.961 1.00 0.00 ? 16 LYS A O    8  
ATOM 6489  C CB   . LYS A 1 16 ? -7.045  32.051 19.712 1.00 0.00 ? 16 LYS A CB   8  
ATOM 6490  C CG   . LYS A 1 16 ? -6.612  33.383 20.331 1.00 0.00 ? 16 LYS A CG   8  
ATOM 6491  C CD   . LYS A 1 16 ? -5.785  34.173 19.314 1.00 0.00 ? 16 LYS A CD   8  
ATOM 6492  C CE   . LYS A 1 16 ? -5.071  35.325 20.023 1.00 0.00 ? 16 LYS A CE   8  
ATOM 6493  N NZ   . LYS A 1 16 ? -3.933  35.677 19.128 1.00 0.00 ? 16 LYS A NZ   8  
ATOM 6494  H H    . LYS A 1 16 ? -8.237  29.942 18.984 1.00 0.00 ? 16 LYS A H    8  
ATOM 6495  H HA   . LYS A 1 16 ? -8.770  32.045 21.001 1.00 0.00 ? 16 LYS A HA   8  
ATOM 6496  H HB2  . LYS A 1 16 ? -6.480  31.246 20.159 1.00 0.00 ? 16 LYS A HB2  8  
ATOM 6497  H HB3  . LYS A 1 16 ? -6.862  32.073 18.649 1.00 0.00 ? 16 LYS A HB3  8  
ATOM 6498  H HG2  . LYS A 1 16 ? -7.487  33.954 20.605 1.00 0.00 ? 16 LYS A HG2  8  
ATOM 6499  H HG3  . LYS A 1 16 ? -6.015  33.194 21.211 1.00 0.00 ? 16 LYS A HG3  8  
ATOM 6500  H HD2  . LYS A 1 16 ? -5.054  33.520 18.860 1.00 0.00 ? 16 LYS A HD2  8  
ATOM 6501  H HD3  . LYS A 1 16 ? -6.437  34.569 18.549 1.00 0.00 ? 16 LYS A HD3  8  
ATOM 6502  H HE2  . LYS A 1 16 ? -5.736  36.169 20.134 1.00 0.00 ? 16 LYS A HE2  8  
ATOM 6503  H HE3  . LYS A 1 16 ? -4.706  35.004 20.988 1.00 0.00 ? 16 LYS A HE3  8  
ATOM 6504  H HZ1  . LYS A 1 16 ? -4.178  35.443 18.146 1.00 0.00 ? 16 LYS A HZ1  8  
ATOM 6505  H HZ2  . LYS A 1 16 ? -3.735  36.695 19.200 1.00 0.00 ? 16 LYS A HZ2  8  
ATOM 6506  H HZ3  . LYS A 1 16 ? -3.088  35.138 19.414 1.00 0.00 ? 16 LYS A HZ3  8  
ATOM 6507  N N    . ASN A 1 17 ? -10.571 33.041 19.440 1.00 0.00 ? 17 ASN A N    8  
ATOM 6508  C CA   . ASN A 1 17 ? -11.444 33.888 18.577 1.00 0.00 ? 17 ASN A CA   8  
ATOM 6509  C C    . ASN A 1 17 ? -11.663 33.216 17.219 1.00 0.00 ? 17 ASN A C    8  
ATOM 6510  O O    . ASN A 1 17 ? -11.452 33.808 16.180 1.00 0.00 ? 17 ASN A O    8  
ATOM 6511  C CB   . ASN A 1 17 ? -10.684 35.204 18.408 1.00 0.00 ? 17 ASN A CB   8  
ATOM 6512  C CG   . ASN A 1 17 ? -10.438 35.830 19.782 1.00 0.00 ? 17 ASN A CG   8  
ATOM 6513  O OD1  . ASN A 1 17 ? -11.360 36.018 20.550 1.00 0.00 ? 17 ASN A OD1  8  
ATOM 6514  N ND2  . ASN A 1 17 ? -9.224  36.164 20.125 1.00 0.00 ? 17 ASN A ND2  8  
ATOM 6515  H H    . ASN A 1 17 ? -10.898 32.731 20.310 1.00 0.00 ? 17 ASN A H    8  
ATOM 6516  H HA   . ASN A 1 17 ? -12.389 34.068 19.063 1.00 0.00 ? 17 ASN A HA   8  
ATOM 6517  H HB2  . ASN A 1 17 ? -9.737  35.017 17.925 1.00 0.00 ? 17 ASN A HB2  8  
ATOM 6518  H HB3  . ASN A 1 17 ? -11.268 35.882 17.803 1.00 0.00 ? 17 ASN A HB3  8  
ATOM 6519  H HD21 . ASN A 1 17 ? -8.481  36.012 19.505 1.00 0.00 ? 17 ASN A HD21 8  
ATOM 6520  H HD22 . ASN A 1 17 ? -9.057  36.566 21.002 1.00 0.00 ? 17 ASN A HD22 8  
ATOM 6521  N N    . GLY A 1 18 ? -12.092 31.984 17.223 1.00 0.00 ? 18 GLY A N    8  
ATOM 6522  C CA   . GLY A 1 18 ? -12.335 31.274 15.935 1.00 0.00 ? 18 GLY A CA   8  
ATOM 6523  C C    . GLY A 1 18 ? -11.037 30.625 15.446 1.00 0.00 ? 18 GLY A C    8  
ATOM 6524  O O    . GLY A 1 18 ? -11.046 29.801 14.553 1.00 0.00 ? 18 GLY A O    8  
ATOM 6525  H H    . GLY A 1 18 ? -12.261 31.528 18.074 1.00 0.00 ? 18 GLY A H    8  
ATOM 6526  H HA2  . GLY A 1 18 ? -13.084 30.511 16.083 1.00 0.00 ? 18 GLY A HA2  8  
ATOM 6527  H HA3  . GLY A 1 18 ? -12.683 31.981 15.197 1.00 0.00 ? 18 GLY A HA3  8  
ATOM 6528  N N    . LYS A 1 19 ? -9.921  30.987 16.018 1.00 0.00 ? 19 LYS A N    8  
ATOM 6529  C CA   . LYS A 1 19 ? -8.629  30.386 15.573 1.00 0.00 ? 19 LYS A CA   8  
ATOM 6530  C C    . LYS A 1 19 ? -8.253  29.205 16.471 1.00 0.00 ? 19 LYS A C    8  
ATOM 6531  O O    . LYS A 1 19 ? -7.846  29.377 17.602 1.00 0.00 ? 19 LYS A O    8  
ATOM 6532  C CB   . LYS A 1 19 ? -7.599  31.505 15.704 1.00 0.00 ? 19 LYS A CB   8  
ATOM 6533  C CG   . LYS A 1 19 ? -6.391  31.188 14.820 1.00 0.00 ? 19 LYS A CG   8  
ATOM 6534  C CD   . LYS A 1 19 ? -5.620  30.002 15.410 1.00 0.00 ? 19 LYS A CD   8  
ATOM 6535  C CE   . LYS A 1 19 ? -4.307  29.820 14.646 1.00 0.00 ? 19 LYS A CE   8  
ATOM 6536  N NZ   . LYS A 1 19 ? -4.572  28.705 13.694 1.00 0.00 ? 19 LYS A NZ   8  
ATOM 6537  H H    . LYS A 1 19 ? -9.931  31.655 16.735 1.00 0.00 ? 19 LYS A H    8  
ATOM 6538  H HA   . LYS A 1 19 ? -8.697  30.068 14.544 1.00 0.00 ? 19 LYS A HA   8  
ATOM 6539  H HB2  . LYS A 1 19 ? -8.040  32.440 15.390 1.00 0.00 ? 19 LYS A HB2  8  
ATOM 6540  H HB3  . LYS A 1 19 ? -7.282  31.585 16.734 1.00 0.00 ? 19 LYS A HB3  8  
ATOM 6541  H HG2  . LYS A 1 19 ? -6.729  30.938 13.826 1.00 0.00 ? 19 LYS A HG2  8  
ATOM 6542  H HG3  . LYS A 1 19 ? -5.742  32.050 14.774 1.00 0.00 ? 19 LYS A HG3  8  
ATOM 6543  H HD2  . LYS A 1 19 ? -5.408  30.192 16.451 1.00 0.00 ? 19 LYS A HD2  8  
ATOM 6544  H HD3  . LYS A 1 19 ? -6.215  29.104 15.321 1.00 0.00 ? 19 LYS A HD3  8  
ATOM 6545  H HE2  . LYS A 1 19 ? -4.056  30.722 14.107 1.00 0.00 ? 19 LYS A HE2  8  
ATOM 6546  H HE3  . LYS A 1 19 ? -3.510  29.554 15.325 1.00 0.00 ? 19 LYS A HE3  8  
ATOM 6547  H HZ1  . LYS A 1 19 ? -5.237  28.032 14.124 1.00 0.00 ? 19 LYS A HZ1  8  
ATOM 6548  H HZ2  . LYS A 1 19 ? -4.984  29.086 12.820 1.00 0.00 ? 19 LYS A HZ2  8  
ATOM 6549  H HZ3  . LYS A 1 19 ? -3.679  28.218 13.473 1.00 0.00 ? 19 LYS A HZ3  8  
ATOM 6550  N N    . LEU A 1 20 ? -8.383  28.007 15.974 1.00 0.00 ? 20 LEU A N    8  
ATOM 6551  C CA   . LEU A 1 20 ? -8.030  26.815 16.799 1.00 0.00 ? 20 LEU A CA   8  
ATOM 6552  C C    . LEU A 1 20 ? -6.533  26.515 16.681 1.00 0.00 ? 20 LEU A C    8  
ATOM 6553  O O    . LEU A 1 20 ? -6.043  26.173 15.623 1.00 0.00 ? 20 LEU A O    8  
ATOM 6554  C CB   . LEU A 1 20 ? -8.852  25.671 16.203 1.00 0.00 ? 20 LEU A CB   8  
ATOM 6555  C CG   . LEU A 1 20 ? -9.077  24.593 17.266 1.00 0.00 ? 20 LEU A CG   8  
ATOM 6556  C CD1  . LEU A 1 20 ? -9.764  23.386 16.626 1.00 0.00 ? 20 LEU A CD1  8  
ATOM 6557  C CD2  . LEU A 1 20 ? -7.729  24.163 17.848 1.00 0.00 ? 20 LEU A CD2  8  
ATOM 6558  H H    . LEU A 1 20 ? -8.711  27.889 15.059 1.00 0.00 ? 20 LEU A H    8  
ATOM 6559  H HA   . LEU A 1 20 ? -8.306  26.972 17.829 1.00 0.00 ? 20 LEU A HA   8  
ATOM 6560  H HB2  . LEU A 1 20 ? -9.806  26.050 15.868 1.00 0.00 ? 20 LEU A HB2  8  
ATOM 6561  H HB3  . LEU A 1 20 ? -8.320  25.245 15.366 1.00 0.00 ? 20 LEU A HB3  8  
ATOM 6562  H HG   . LEU A 1 20 ? -9.701  24.988 18.053 1.00 0.00 ? 20 LEU A HG   8  
ATOM 6563  H HD11 . LEU A 1 20 ? -10.383 23.717 15.806 1.00 0.00 ? 20 LEU A HD11 8  
ATOM 6564  H HD12 . LEU A 1 20 ? -9.017  22.698 16.259 1.00 0.00 ? 20 LEU A HD12 8  
ATOM 6565  H HD13 . LEU A 1 20 ? -10.379 22.890 17.363 1.00 0.00 ? 20 LEU A HD13 8  
ATOM 6566  H HD21 . LEU A 1 20 ? -7.027  23.994 17.045 1.00 0.00 ? 20 LEU A HD21 8  
ATOM 6567  H HD22 . LEU A 1 20 ? -7.353  24.940 18.497 1.00 0.00 ? 20 LEU A HD22 8  
ATOM 6568  H HD23 . LEU A 1 20 ? -7.856  23.251 18.413 1.00 0.00 ? 20 LEU A HD23 8  
ATOM 6569  N N    . PHE A 1 21 ? -5.801  26.629 17.758 1.00 0.00 ? 21 PHE A N    8  
ATOM 6570  C CA   . PHE A 1 21 ? -4.340  26.336 17.689 1.00 0.00 ? 21 PHE A CA   8  
ATOM 6571  C C    . PHE A 1 21 ? -4.060  24.947 18.266 1.00 0.00 ? 21 PHE A C    8  
ATOM 6572  O O    . PHE A 1 21 ? -3.389  24.796 19.266 1.00 0.00 ? 21 PHE A O    8  
ATOM 6573  C CB   . PHE A 1 21 ? -3.648  27.431 18.514 1.00 0.00 ? 21 PHE A CB   8  
ATOM 6574  C CG   . PHE A 1 21 ? -4.319  27.596 19.860 1.00 0.00 ? 21 PHE A CG   8  
ATOM 6575  C CD1  . PHE A 1 21 ? -3.893  26.833 20.955 1.00 0.00 ? 21 PHE A CD1  8  
ATOM 6576  C CD2  . PHE A 1 21 ? -5.355  28.525 20.017 1.00 0.00 ? 21 PHE A CD2  8  
ATOM 6577  C CE1  . PHE A 1 21 ? -4.502  26.999 22.204 1.00 0.00 ? 21 PHE A CE1  8  
ATOM 6578  C CE2  . PHE A 1 21 ? -5.966  28.689 21.266 1.00 0.00 ? 21 PHE A CE2  8  
ATOM 6579  C CZ   . PHE A 1 21 ? -5.539  27.927 22.359 1.00 0.00 ? 21 PHE A CZ   8  
ATOM 6580  H H    . PHE A 1 21 ? -6.212  26.897 18.604 1.00 0.00 ? 21 PHE A H    8  
ATOM 6581  H HA   . PHE A 1 21 ? -4.004  26.384 16.666 1.00 0.00 ? 21 PHE A HA   8  
ATOM 6582  H HB2  . PHE A 1 21 ? -2.614  27.161 18.663 1.00 0.00 ? 21 PHE A HB2  8  
ATOM 6583  H HB3  . PHE A 1 21 ? -3.698  28.365 17.976 1.00 0.00 ? 21 PHE A HB3  8  
ATOM 6584  H HD1  . PHE A 1 21 ? -3.092  26.119 20.838 1.00 0.00 ? 21 PHE A HD1  8  
ATOM 6585  H HD2  . PHE A 1 21 ? -5.685  29.114 19.174 1.00 0.00 ? 21 PHE A HD2  8  
ATOM 6586  H HE1  . PHE A 1 21 ? -4.173  26.411 23.048 1.00 0.00 ? 21 PHE A HE1  8  
ATOM 6587  H HE2  . PHE A 1 21 ? -6.765  29.405 21.387 1.00 0.00 ? 21 PHE A HE2  8  
ATOM 6588  H HZ   . PHE A 1 21 ? -6.009  28.055 23.324 1.00 0.00 ? 21 PHE A HZ   8  
ATOM 6589  N N    . CYS A 1 22 ? -4.575  23.928 17.634 1.00 0.00 ? 22 CYS A N    8  
ATOM 6590  C CA   . CYS A 1 22 ? -4.349  22.540 18.130 1.00 0.00 ? 22 CYS A CA   8  
ATOM 6591  C C    . CYS A 1 22 ? -2.856  22.274 18.394 1.00 0.00 ? 22 CYS A C    8  
ATOM 6592  O O    . CYS A 1 22 ? -2.509  21.737 19.426 1.00 0.00 ? 22 CYS A O    8  
ATOM 6593  C CB   . CYS A 1 22 ? -4.869  21.624 17.019 1.00 0.00 ? 22 CYS A CB   8  
ATOM 6594  S SG   . CYS A 1 22 ? -5.696  20.192 17.754 1.00 0.00 ? 22 CYS A SG   8  
ATOM 6595  H H    . CYS A 1 22 ? -5.113  24.077 16.827 1.00 0.00 ? 22 CYS A H    8  
ATOM 6596  H HA   . CYS A 1 22 ? -4.918  22.372 19.031 1.00 0.00 ? 22 CYS A HA   8  
ATOM 6597  H HB2  . CYS A 1 22 ? -5.567  22.167 16.400 1.00 0.00 ? 22 CYS A HB2  8  
ATOM 6598  H HB3  . CYS A 1 22 ? -4.042  21.282 16.416 1.00 0.00 ? 22 CYS A HB3  8  
ATOM 6599  N N    . PRO A 1 23 ? -2.014  22.641 17.457 1.00 0.00 ? 23 PRO A N    8  
ATOM 6600  C CA   . PRO A 1 23 ? -0.557  22.411 17.620 1.00 0.00 ? 23 PRO A CA   8  
ATOM 6601  C C    . PRO A 1 23 ? 0.005   23.239 18.781 1.00 0.00 ? 23 PRO A C    8  
ATOM 6602  O O    . PRO A 1 23 ? 0.533   24.316 18.589 1.00 0.00 ? 23 PRO A O    8  
ATOM 6603  C CB   . PRO A 1 23 ? 0.012   22.886 16.281 1.00 0.00 ? 23 PRO A CB   8  
ATOM 6604  C CG   . PRO A 1 23 ? -1.150  23.372 15.393 1.00 0.00 ? 23 PRO A CG   8  
ATOM 6605  C CD   . PRO A 1 23 ? -2.452  23.296 16.199 1.00 0.00 ? 23 PRO A CD   8  
ATOM 6606  H HA   . PRO A 1 23 ? -0.348  21.363 17.759 1.00 0.00 ? 23 PRO A HA   8  
ATOM 6607  H HB2  . PRO A 1 23 ? 0.705   23.697 16.448 1.00 0.00 ? 23 PRO A HB2  8  
ATOM 6608  H HB3  . PRO A 1 23 ? 0.523   22.068 15.794 1.00 0.00 ? 23 PRO A HB3  8  
ATOM 6609  H HG2  . PRO A 1 23 ? -0.970  24.393 15.089 1.00 0.00 ? 23 PRO A HG2  8  
ATOM 6610  H HG3  . PRO A 1 23 ? -1.226  22.741 14.520 1.00 0.00 ? 23 PRO A HG3  8  
ATOM 6611  H HD2  . PRO A 1 23 ? -2.833  24.286 16.394 1.00 0.00 ? 23 PRO A HD2  8  
ATOM 6612  H HD3  . PRO A 1 23 ? -3.186  22.696 15.683 1.00 0.00 ? 23 PRO A HD3  8  
ATOM 6613  N N    . GLN A 1 24 ? -0.097  22.740 19.984 1.00 0.00 ? 24 GLN A N    8  
ATOM 6614  C CA   . GLN A 1 24 ? 0.441   23.497 21.153 1.00 0.00 ? 24 GLN A CA   8  
ATOM 6615  C C    . GLN A 1 24 ? 1.394   22.612 21.966 1.00 0.00 ? 24 GLN A C    8  
ATOM 6616  O O    . GLN A 1 24 ? 2.285   23.096 22.634 1.00 0.00 ? 24 GLN A O    8  
ATOM 6617  C CB   . GLN A 1 24 ? -0.786  23.884 21.984 1.00 0.00 ? 24 GLN A CB   8  
ATOM 6618  C CG   . GLN A 1 24 ? -1.349  22.649 22.689 1.00 0.00 ? 24 GLN A CG   8  
ATOM 6619  C CD   . GLN A 1 24 ? -2.863  22.588 22.479 1.00 0.00 ? 24 GLN A CD   8  
ATOM 6620  O OE1  . GLN A 1 24 ? -3.599  23.376 23.039 1.00 0.00 ? 24 GLN A OE1  8  
ATOM 6621  N NE2  . GLN A 1 24 ? -3.361  21.679 21.689 1.00 0.00 ? 24 GLN A NE2  8  
ATOM 6622  H H    . GLN A 1 24 ? -0.523  21.868 20.117 1.00 0.00 ? 24 GLN A H    8  
ATOM 6623  H HA   . GLN A 1 24 ? 0.951   24.385 20.819 1.00 0.00 ? 24 GLN A HA   8  
ATOM 6624  H HB2  . GLN A 1 24 ? -0.501  24.619 22.722 1.00 0.00 ? 24 GLN A HB2  8  
ATOM 6625  H HB3  . GLN A 1 24 ? -1.542  24.303 21.335 1.00 0.00 ? 24 GLN A HB3  8  
ATOM 6626  H HG2  . GLN A 1 24 ? -0.896  21.761 22.280 1.00 0.00 ? 24 GLN A HG2  8  
ATOM 6627  H HG3  . GLN A 1 24 ? -1.135  22.709 23.747 1.00 0.00 ? 24 GLN A HG3  8  
ATOM 6628  H HE21 . GLN A 1 24 ? -2.766  21.044 21.237 1.00 0.00 ? 24 GLN A HE21 8  
ATOM 6629  H HE22 . GLN A 1 24 ? -4.330  21.631 21.545 1.00 0.00 ? 24 GLN A HE22 8  
ATOM 6630  N N    . ASP A 1 25 ? 1.214   21.319 21.909 1.00 0.00 ? 25 ASP A N    8  
ATOM 6631  C CA   . ASP A 1 25 ? 2.104   20.398 22.672 1.00 0.00 ? 25 ASP A CA   8  
ATOM 6632  C C    . ASP A 1 25 ? 1.675   18.948 22.428 1.00 0.00 ? 25 ASP A C    8  
ATOM 6633  O O    . ASP A 1 25 ? 1.400   18.206 23.350 1.00 0.00 ? 25 ASP A O    8  
ATOM 6634  C CB   . ASP A 1 25 ? 1.911   20.777 24.141 1.00 0.00 ? 25 ASP A CB   8  
ATOM 6635  C CG   . ASP A 1 25 ? 2.814   19.905 25.016 1.00 0.00 ? 25 ASP A CG   8  
ATOM 6636  O OD1  . ASP A 1 25 ? 3.490   19.050 24.469 1.00 0.00 ? 25 ASP A OD1  8  
ATOM 6637  O OD2  . ASP A 1 25 ? 2.813   20.107 26.219 1.00 0.00 ? 25 ASP A OD2  8  
ATOM 6638  H H    . ASP A 1 25 ? 0.492   20.952 21.362 1.00 0.00 ? 25 ASP A H    8  
ATOM 6639  H HA   . ASP A 1 25 ? 3.134   20.542 22.383 1.00 0.00 ? 25 ASP A HA   8  
ATOM 6640  H HB2  . ASP A 1 25 ? 2.170   21.816 24.282 1.00 0.00 ? 25 ASP A HB2  8  
ATOM 6641  H HB3  . ASP A 1 25 ? 0.880   20.622 24.420 1.00 0.00 ? 25 ASP A HB3  8  
ATOM 6642  N N    . LYS A 1 26 ? 1.608   18.544 21.188 1.00 0.00 ? 26 LYS A N    8  
ATOM 6643  C CA   . LYS A 1 26 ? 1.187   17.147 20.872 1.00 0.00 ? 26 LYS A CA   8  
ATOM 6644  C C    . LYS A 1 26 ? 2.086   16.130 21.584 1.00 0.00 ? 26 LYS A C    8  
ATOM 6645  O O    . LYS A 1 26 ? 1.768   14.960 21.659 1.00 0.00 ? 26 LYS A O    8  
ATOM 6646  C CB   . LYS A 1 26 ? 1.333   17.024 19.355 1.00 0.00 ? 26 LYS A CB   8  
ATOM 6647  C CG   . LYS A 1 26 ? 0.020   17.435 18.685 1.00 0.00 ? 26 LYS A CG   8  
ATOM 6648  C CD   . LYS A 1 26 ? 0.202   17.439 17.165 1.00 0.00 ? 26 LYS A CD   8  
ATOM 6649  C CE   . LYS A 1 26 ? -0.833  18.369 16.528 1.00 0.00 ? 26 LYS A CE   8  
ATOM 6650  N NZ   . LYS A 1 26 ? -0.302  18.652 15.165 1.00 0.00 ? 26 LYS A NZ   8  
ATOM 6651  H H    . LYS A 1 26 ? 1.829   19.163 20.462 1.00 0.00 ? 26 LYS A H    8  
ATOM 6652  H HA   . LYS A 1 26 ? 0.158   16.996 21.152 1.00 0.00 ? 26 LYS A HA   8  
ATOM 6653  H HB2  . LYS A 1 26 ? 2.128   17.670 19.015 1.00 0.00 ? 26 LYS A HB2  8  
ATOM 6654  H HB3  . LYS A 1 26 ? 1.564   16.001 19.096 1.00 0.00 ? 26 LYS A HB3  8  
ATOM 6655  H HG2  . LYS A 1 26 ? -0.757  16.734 18.952 1.00 0.00 ? 26 LYS A HG2  8  
ATOM 6656  H HG3  . LYS A 1 26 ? -0.260  18.425 19.015 1.00 0.00 ? 26 LYS A HG3  8  
ATOM 6657  H HD2  . LYS A 1 26 ? 1.195   17.786 16.923 1.00 0.00 ? 26 LYS A HD2  8  
ATOM 6658  H HD3  . LYS A 1 26 ? 0.069   16.437 16.784 1.00 0.00 ? 26 LYS A HD3  8  
ATOM 6659  H HE2  . LYS A 1 26 ? -1.792  17.875 16.463 1.00 0.00 ? 26 LYS A HE2  8  
ATOM 6660  H HE3  . LYS A 1 26 ? -0.918  19.282 17.097 1.00 0.00 ? 26 LYS A HE3  8  
ATOM 6661  H HZ1  . LYS A 1 26 ? 0.110   17.786 14.766 1.00 0.00 ? 26 LYS A HZ1  8  
ATOM 6662  H HZ2  . LYS A 1 26 ? -1.078  18.982 14.554 1.00 0.00 ? 26 LYS A HZ2  8  
ATOM 6663  H HZ3  . LYS A 1 26 ? 0.430   19.388 15.224 1.00 0.00 ? 26 LYS A HZ3  8  
ATOM 6664  N N    . LYS A 1 27 ? 3.202   16.561 22.110 1.00 0.00 ? 27 LYS A N    8  
ATOM 6665  C CA   . LYS A 1 27 ? 4.108   15.613 22.818 1.00 0.00 ? 27 LYS A CA   8  
ATOM 6666  C C    . LYS A 1 27 ? 3.293   14.657 23.696 1.00 0.00 ? 27 LYS A C    8  
ATOM 6667  O O    . LYS A 1 27 ? 3.709   13.550 23.977 1.00 0.00 ? 27 LYS A O    8  
ATOM 6668  C CB   . LYS A 1 27 ? 5.004   16.500 23.681 1.00 0.00 ? 27 LYS A CB   8  
ATOM 6669  C CG   . LYS A 1 27 ? 5.873   17.380 22.781 1.00 0.00 ? 27 LYS A CG   8  
ATOM 6670  C CD   . LYS A 1 27 ? 6.796   18.238 23.648 1.00 0.00 ? 27 LYS A CD   8  
ATOM 6671  C CE   . LYS A 1 27 ? 7.710   19.073 22.748 1.00 0.00 ? 27 LYS A CE   8  
ATOM 6672  N NZ   . LYS A 1 27 ? 8.600   19.811 23.688 1.00 0.00 ? 27 LYS A NZ   8  
ATOM 6673  H H    . LYS A 1 27 ? 3.444   17.507 22.043 1.00 0.00 ? 27 LYS A H    8  
ATOM 6674  H HA   . LYS A 1 27 ? 4.706   15.061 22.110 1.00 0.00 ? 27 LYS A HA   8  
ATOM 6675  H HB2  . LYS A 1 27 ? 4.390   17.125 24.312 1.00 0.00 ? 27 LYS A HB2  8  
ATOM 6676  H HB3  . LYS A 1 27 ? 5.636   15.880 24.296 1.00 0.00 ? 27 LYS A HB3  8  
ATOM 6677  H HG2  . LYS A 1 27 ? 6.467   16.755 22.131 1.00 0.00 ? 27 LYS A HG2  8  
ATOM 6678  H HG3  . LYS A 1 27 ? 5.241   18.021 22.185 1.00 0.00 ? 27 LYS A HG3  8  
ATOM 6679  H HD2  . LYS A 1 27 ? 6.202   18.895 24.266 1.00 0.00 ? 27 LYS A HD2  8  
ATOM 6680  H HD3  . LYS A 1 27 ? 7.397   17.598 24.277 1.00 0.00 ? 27 LYS A HD3  8  
ATOM 6681  H HE2  . LYS A 1 27 ? 8.293   18.430 22.105 1.00 0.00 ? 27 LYS A HE2  8  
ATOM 6682  H HE3  . LYS A 1 27 ? 7.126   19.767 22.161 1.00 0.00 ? 27 LYS A HE3  8  
ATOM 6683  H HZ1  . LYS A 1 27 ? 8.054   20.110 24.521 1.00 0.00 ? 27 LYS A HZ1  8  
ATOM 6684  H HZ2  . LYS A 1 27 ? 9.377   19.190 23.989 1.00 0.00 ? 27 LYS A HZ2  8  
ATOM 6685  H HZ3  . LYS A 1 27 ? 8.989   20.650 23.210 1.00 0.00 ? 27 LYS A HZ3  8  
ATOM 6686  N N    . PHE A 1 28 ? 2.133   15.074 24.126 1.00 0.00 ? 28 PHE A N    8  
ATOM 6687  C CA   . PHE A 1 28 ? 1.288   14.190 24.981 1.00 0.00 ? 28 PHE A CA   8  
ATOM 6688  C C    . PHE A 1 28 ? 1.181   12.793 24.358 1.00 0.00 ? 28 PHE A C    8  
ATOM 6689  O O    . PHE A 1 28 ? 0.891   11.824 25.031 1.00 0.00 ? 28 PHE A O    8  
ATOM 6690  C CB   . PHE A 1 28 ? -0.085  14.866 25.016 1.00 0.00 ? 28 PHE A CB   8  
ATOM 6691  C CG   . PHE A 1 28 ? 0.071   16.324 25.383 1.00 0.00 ? 28 PHE A CG   8  
ATOM 6692  C CD1  . PHE A 1 28 ? 0.931   16.699 26.423 1.00 0.00 ? 28 PHE A CD1  8  
ATOM 6693  C CD2  . PHE A 1 28 ? -0.643  17.301 24.680 1.00 0.00 ? 28 PHE A CD2  8  
ATOM 6694  C CE1  . PHE A 1 28 ? 1.075   18.050 26.759 1.00 0.00 ? 28 PHE A CE1  8  
ATOM 6695  C CE2  . PHE A 1 28 ? -0.500  18.653 25.016 1.00 0.00 ? 28 PHE A CE2  8  
ATOM 6696  C CZ   . PHE A 1 28 ? 0.359   19.027 26.055 1.00 0.00 ? 28 PHE A CZ   8  
ATOM 6697  H H    . PHE A 1 28 ? 1.815   15.969 23.886 1.00 0.00 ? 28 PHE A H    8  
ATOM 6698  H HA   . PHE A 1 28 ? 1.694   14.129 25.978 1.00 0.00 ? 28 PHE A HA   8  
ATOM 6699  H HB2  . PHE A 1 28 ? -0.548  14.788 24.044 1.00 0.00 ? 28 PHE A HB2  8  
ATOM 6700  H HB3  . PHE A 1 28 ? -0.707  14.377 25.750 1.00 0.00 ? 28 PHE A HB3  8  
ATOM 6701  H HD1  . PHE A 1 28 ? 1.482   15.946 26.965 1.00 0.00 ? 28 PHE A HD1  8  
ATOM 6702  H HD2  . PHE A 1 28 ? -1.305  17.013 23.877 1.00 0.00 ? 28 PHE A HD2  8  
ATOM 6703  H HE1  . PHE A 1 28 ? 1.737   18.340 27.562 1.00 0.00 ? 28 PHE A HE1  8  
ATOM 6704  H HE2  . PHE A 1 28 ? -1.052  19.405 24.473 1.00 0.00 ? 28 PHE A HE2  8  
ATOM 6705  H HZ   . PHE A 1 28 ? 0.470   20.070 26.313 1.00 0.00 ? 28 PHE A HZ   8  
ATOM 6706  N N    . PHE A 1 29 ? 1.411   12.685 23.076 1.00 0.00 ? 29 PHE A N    8  
ATOM 6707  C CA   . PHE A 1 29 ? 1.321   11.355 22.402 1.00 0.00 ? 29 PHE A CA   8  
ATOM 6708  C C    . PHE A 1 29 ? 1.929   10.256 23.280 1.00 0.00 ? 29 PHE A C    8  
ATOM 6709  O O    . PHE A 1 29 ? 1.567   9.100  23.180 1.00 0.00 ? 29 PHE A O    8  
ATOM 6710  C CB   . PHE A 1 29 ? 2.129   11.513 21.114 1.00 0.00 ? 29 PHE A CB   8  
ATOM 6711  C CG   . PHE A 1 29 ? 2.058   10.236 20.313 1.00 0.00 ? 29 PHE A CG   8  
ATOM 6712  C CD1  . PHE A 1 29 ? 2.695   9.080  20.780 1.00 0.00 ? 29 PHE A CD1  8  
ATOM 6713  C CD2  . PHE A 1 29 ? 1.355   10.208 19.103 1.00 0.00 ? 29 PHE A CD2  8  
ATOM 6714  C CE1  . PHE A 1 29 ? 2.628   7.895  20.036 1.00 0.00 ? 29 PHE A CE1  8  
ATOM 6715  C CE2  . PHE A 1 29 ? 1.289   9.024  18.359 1.00 0.00 ? 29 PHE A CE2  8  
ATOM 6716  C CZ   . PHE A 1 29 ? 1.926   7.868  18.825 1.00 0.00 ? 29 PHE A CZ   8  
ATOM 6717  H H    . PHE A 1 29 ? 1.639   13.481 22.553 1.00 0.00 ? 29 PHE A H    8  
ATOM 6718  H HA   . PHE A 1 29 ? 0.297   11.123 22.165 1.00 0.00 ? 29 PHE A HA   8  
ATOM 6719  H HB2  . PHE A 1 29 ? 1.722   12.327 20.532 1.00 0.00 ? 29 PHE A HB2  8  
ATOM 6720  H HB3  . PHE A 1 29 ? 3.159   11.727 21.360 1.00 0.00 ? 29 PHE A HB3  8  
ATOM 6721  H HD1  . PHE A 1 29 ? 3.236   9.101  21.714 1.00 0.00 ? 29 PHE A HD1  8  
ATOM 6722  H HD2  . PHE A 1 29 ? 0.865   11.100 18.743 1.00 0.00 ? 29 PHE A HD2  8  
ATOM 6723  H HE1  . PHE A 1 29 ? 3.119   7.003  20.396 1.00 0.00 ? 29 PHE A HE1  8  
ATOM 6724  H HE2  . PHE A 1 29 ? 0.747   9.003  17.425 1.00 0.00 ? 29 PHE A HE2  8  
ATOM 6725  H HZ   . PHE A 1 29 ? 1.875   6.954  18.252 1.00 0.00 ? 29 PHE A HZ   8  
ATOM 6726  N N    . GLN A 1 30 ? 2.850   10.602 24.137 1.00 0.00 ? 30 GLN A N    8  
ATOM 6727  C CA   . GLN A 1 30 ? 3.479   9.572  25.014 1.00 0.00 ? 30 GLN A CA   8  
ATOM 6728  C C    . GLN A 1 30 ? 2.463   9.027  26.024 1.00 0.00 ? 30 GLN A C    8  
ATOM 6729  O O    . GLN A 1 30 ? 2.752   8.119  26.778 1.00 0.00 ? 30 GLN A O    8  
ATOM 6730  C CB   . GLN A 1 30 ? 4.609   10.306 25.736 1.00 0.00 ? 30 GLN A CB   8  
ATOM 6731  C CG   . GLN A 1 30 ? 4.016   11.254 26.779 1.00 0.00 ? 30 GLN A CG   8  
ATOM 6732  C CD   . GLN A 1 30 ? 5.130   12.111 27.382 1.00 0.00 ? 30 GLN A CD   8  
ATOM 6733  O OE1  . GLN A 1 30 ? 6.015   11.603 28.040 1.00 0.00 ? 30 GLN A OE1  8  
ATOM 6734  N NE2  . GLN A 1 30 ? 5.124   13.401 27.182 1.00 0.00 ? 30 GLN A NE2  8  
ATOM 6735  H H    . GLN A 1 30 ? 3.131   11.538 24.201 1.00 0.00 ? 30 GLN A H    8  
ATOM 6736  H HA   . GLN A 1 30 ? 3.885   8.769  24.418 1.00 0.00 ? 30 GLN A HA   8  
ATOM 6737  H HB2  . GLN A 1 30 ? 5.249   9.587  26.225 1.00 0.00 ? 30 GLN A HB2  8  
ATOM 6738  H HB3  . GLN A 1 30 ? 5.185   10.873 25.020 1.00 0.00 ? 30 GLN A HB3  8  
ATOM 6739  H HG2  . GLN A 1 30 ? 3.284   11.894 26.310 1.00 0.00 ? 30 GLN A HG2  8  
ATOM 6740  H HG3  . GLN A 1 30 ? 3.542   10.679 27.561 1.00 0.00 ? 30 GLN A HG3  8  
ATOM 6741  H HE21 . GLN A 1 30 ? 4.409   13.811 26.650 1.00 0.00 ? 30 GLN A HE21 8  
ATOM 6742  H HE22 . GLN A 1 30 ? 5.833   13.960 27.563 1.00 0.00 ? 30 GLN A HE22 8  
ATOM 6743  N N    . SER A 1 31 ? 1.276   9.570  26.049 1.00 0.00 ? 31 SER A N    8  
ATOM 6744  C CA   . SER A 1 31 ? 0.252   9.075  27.015 1.00 0.00 ? 31 SER A CA   8  
ATOM 6745  C C    . SER A 1 31 ? -1.089  8.860  26.306 1.00 0.00 ? 31 SER A C    8  
ATOM 6746  O O    . SER A 1 31 ? -1.423  9.553  25.366 1.00 0.00 ? 31 SER A O    8  
ATOM 6747  C CB   . SER A 1 31 ? 0.132   10.181 28.063 1.00 0.00 ? 31 SER A CB   8  
ATOM 6748  O OG   . SER A 1 31 ? -0.854  9.821  29.020 1.00 0.00 ? 31 SER A OG   8  
ATOM 6749  H H    . SER A 1 31 ? 1.057   10.302 25.435 1.00 0.00 ? 31 SER A H    8  
ATOM 6750  H HA   . SER A 1 31 ? 0.584   8.161  27.480 1.00 0.00 ? 31 SER A HA   8  
ATOM 6751  H HB2  . SER A 1 31 ? 1.083   10.312 28.558 1.00 0.00 ? 31 SER A HB2  8  
ATOM 6752  H HB3  . SER A 1 31 ? -0.153  11.105 27.582 1.00 0.00 ? 31 SER A HB3  8  
ATOM 6753  H HG   . SER A 1 31 ? -0.578  10.167 29.873 1.00 0.00 ? 31 SER A HG   8  
ATOM 6754  N N    . LEU A 1 32 ? -1.861  7.906  26.753 1.00 0.00 ? 32 LEU A N    8  
ATOM 6755  C CA   . LEU A 1 32 ? -3.179  7.650  26.104 1.00 0.00 ? 32 LEU A CA   8  
ATOM 6756  C C    . LEU A 1 32 ? -3.922  8.966  25.888 1.00 0.00 ? 32 LEU A C    8  
ATOM 6757  O O    . LEU A 1 32 ? -4.361  9.273  24.798 1.00 0.00 ? 32 LEU A O    8  
ATOM 6758  C CB   . LEU A 1 32 ? -3.944  6.762  27.084 1.00 0.00 ? 32 LEU A CB   8  
ATOM 6759  C CG   . LEU A 1 32 ? -5.267  6.323  26.454 1.00 0.00 ? 32 LEU A CG   8  
ATOM 6760  C CD1  . LEU A 1 32 ? -5.019  5.828  25.028 1.00 0.00 ? 32 LEU A CD1  8  
ATOM 6761  C CD2  . LEU A 1 32 ? -5.876  5.192  27.287 1.00 0.00 ? 32 LEU A CD2  8  
ATOM 6762  H H    . LEU A 1 32 ? -1.575  7.358  27.514 1.00 0.00 ? 32 LEU A H    8  
ATOM 6763  H HA   . LEU A 1 32 ? -3.046  7.136  25.169 1.00 0.00 ? 32 LEU A HA   8  
ATOM 6764  H HB2  . LEU A 1 32 ? -3.349  5.892  27.320 1.00 0.00 ? 32 LEU A HB2  8  
ATOM 6765  H HB3  . LEU A 1 32 ? -4.143  7.317  27.988 1.00 0.00 ? 32 LEU A HB3  8  
ATOM 6766  H HG   . LEU A 1 32 ? -5.950  7.159  26.431 1.00 0.00 ? 32 LEU A HG   8  
ATOM 6767  H HD11 . LEU A 1 32 ? -4.204  5.118  25.029 1.00 0.00 ? 32 LEU A HD11 8  
ATOM 6768  H HD12 . LEU A 1 32 ? -5.911  5.350  24.651 1.00 0.00 ? 32 LEU A HD12 8  
ATOM 6769  H HD13 . LEU A 1 32 ? -4.764  6.666  24.396 1.00 0.00 ? 32 LEU A HD13 8  
ATOM 6770  H HD21 . LEU A 1 32 ? -5.953  5.506  28.317 1.00 0.00 ? 32 LEU A HD21 8  
ATOM 6771  H HD22 . LEU A 1 32 ? -6.859  4.954  26.908 1.00 0.00 ? 32 LEU A HD22 8  
ATOM 6772  H HD23 . LEU A 1 32 ? -5.245  4.319  27.223 1.00 0.00 ? 32 LEU A HD23 8  
ATOM 6773  N N    . ASP A 1 33 ? -4.059  9.750  26.918 1.00 0.00 ? 33 ASP A N    8  
ATOM 6774  C CA   . ASP A 1 33 ? -4.765  11.051 26.767 1.00 0.00 ? 33 ASP A CA   8  
ATOM 6775  C C    . ASP A 1 33 ? -4.142  11.815 25.606 1.00 0.00 ? 33 ASP A C    8  
ATOM 6776  O O    . ASP A 1 33 ? -4.819  12.475 24.844 1.00 0.00 ? 33 ASP A O    8  
ATOM 6777  C CB   . ASP A 1 33 ? -4.540  11.789 28.088 1.00 0.00 ? 33 ASP A CB   8  
ATOM 6778  C CG   . ASP A 1 33 ? -5.601  12.880 28.249 1.00 0.00 ? 33 ASP A CG   8  
ATOM 6779  O OD1  . ASP A 1 33 ? -6.095  13.351 27.238 1.00 0.00 ? 33 ASP A OD1  8  
ATOM 6780  O OD2  . ASP A 1 33 ? -5.901  13.225 29.380 1.00 0.00 ? 33 ASP A OD2  8  
ATOM 6781  H H    . ASP A 1 33 ? -3.690  9.486  27.785 1.00 0.00 ? 33 ASP A H    8  
ATOM 6782  H HA   . ASP A 1 33 ? -5.817  10.894 26.598 1.00 0.00 ? 33 ASP A HA   8  
ATOM 6783  H HB2  . ASP A 1 33 ? -4.616  11.089 28.908 1.00 0.00 ? 33 ASP A HB2  8  
ATOM 6784  H HB3  . ASP A 1 33 ? -3.559  12.237 28.088 1.00 0.00 ? 33 ASP A HB3  8  
ATOM 6785  N N    . GLY A 1 34 ? -2.853  11.707 25.453 1.00 0.00 ? 34 GLY A N    8  
ATOM 6786  C CA   . GLY A 1 34 ? -2.182  12.402 24.326 1.00 0.00 ? 34 GLY A CA   8  
ATOM 6787  C C    . GLY A 1 34 ? -2.552  11.678 23.036 1.00 0.00 ? 34 GLY A C    8  
ATOM 6788  O O    . GLY A 1 34 ? -3.008  12.272 22.080 1.00 0.00 ? 34 GLY A O    8  
ATOM 6789  H H    . GLY A 1 34 ? -2.331  11.152 26.071 1.00 0.00 ? 34 GLY A H    8  
ATOM 6790  H HA2  . GLY A 1 34 ? -2.517  13.424 24.277 1.00 0.00 ? 34 GLY A HA2  8  
ATOM 6791  H HA3  . GLY A 1 34 ? -1.114  12.375 24.464 1.00 0.00 ? 34 GLY A HA3  8  
ATOM 6792  N N    . ILE A 1 35 ? -2.380  10.389 23.010 1.00 0.00 ? 35 ILE A N    8  
ATOM 6793  C CA   . ILE A 1 35 ? -2.745  9.624  21.789 1.00 0.00 ? 35 ILE A CA   8  
ATOM 6794  C C    . ILE A 1 35 ? -4.203  9.920  21.436 1.00 0.00 ? 35 ILE A C    8  
ATOM 6795  O O    . ILE A 1 35 ? -4.584  9.937  20.282 1.00 0.00 ? 35 ILE A O    8  
ATOM 6796  C CB   . ILE A 1 35 ? -2.544  8.150  22.168 1.00 0.00 ? 35 ILE A CB   8  
ATOM 6797  C CG1  . ILE A 1 35 ? -1.099  7.750  21.870 1.00 0.00 ? 35 ILE A CG1  8  
ATOM 6798  C CG2  . ILE A 1 35 ? -3.487  7.257  21.355 1.00 0.00 ? 35 ILE A CG2  8  
ATOM 6799  C CD1  . ILE A 1 35 ? -0.796  8.007  20.392 1.00 0.00 ? 35 ILE A CD1  8  
ATOM 6800  H H    . ILE A 1 35 ? -2.027  9.927  23.797 1.00 0.00 ? 35 ILE A H    8  
ATOM 6801  H HA   . ILE A 1 35 ? -2.097  9.891  20.971 1.00 0.00 ? 35 ILE A HA   8  
ATOM 6802  H HB   . ILE A 1 35 ? -2.744  8.020  23.221 1.00 0.00 ? 35 ILE A HB   8  
ATOM 6803  H HG12 . ILE A 1 35 ? -0.429  8.337  22.482 1.00 0.00 ? 35 ILE A HG12 8  
ATOM 6804  H HG13 . ILE A 1 35 ? -0.962  6.702  22.090 1.00 0.00 ? 35 ILE A HG13 8  
ATOM 6805  H HG21 . ILE A 1 35 ? -3.300  7.402  20.301 1.00 0.00 ? 35 ILE A HG21 8  
ATOM 6806  H HG22 . ILE A 1 35 ? -3.316  6.223  21.613 1.00 0.00 ? 35 ILE A HG22 8  
ATOM 6807  H HG23 . ILE A 1 35 ? -4.511  7.519  21.578 1.00 0.00 ? 35 ILE A HG23 8  
ATOM 6808  H HD11 . ILE A 1 35 ? -1.669  8.423  19.912 1.00 0.00 ? 35 ILE A HD11 8  
ATOM 6809  H HD12 . ILE A 1 35 ? 0.027   8.702  20.309 1.00 0.00 ? 35 ILE A HD12 8  
ATOM 6810  H HD13 . ILE A 1 35 ? -0.530  7.076  19.913 1.00 0.00 ? 35 ILE A HD13 8  
ATOM 6811  N N    . MET A 1 36 ? -5.020  10.161 22.424 1.00 0.00 ? 36 MET A N    8  
ATOM 6812  C CA   . MET A 1 36 ? -6.451  10.464 22.145 1.00 0.00 ? 36 MET A CA   8  
ATOM 6813  C C    . MET A 1 36 ? -6.607  11.919 21.695 1.00 0.00 ? 36 MET A C    8  
ATOM 6814  O O    . MET A 1 36 ? -6.977  12.192 20.570 1.00 0.00 ? 36 MET A O    8  
ATOM 6815  C CB   . MET A 1 36 ? -7.173  10.245 23.469 1.00 0.00 ? 36 MET A CB   8  
ATOM 6816  C CG   . MET A 1 36 ? -7.678  8.803  23.545 1.00 0.00 ? 36 MET A CG   8  
ATOM 6817  S SD   . MET A 1 36 ? -8.869  8.511  22.212 1.00 0.00 ? 36 MET A SD   8  
ATOM 6818  C CE   . MET A 1 36 ? -10.367 8.822  23.177 1.00 0.00 ? 36 MET A CE   8  
ATOM 6819  H H    . MET A 1 36 ? -4.689  10.146 23.350 1.00 0.00 ? 36 MET A H    8  
ATOM 6820  H HA   . MET A 1 36 ? -6.840  9.792  21.397 1.00 0.00 ? 36 MET A HA   8  
ATOM 6821  H HB2  . MET A 1 36 ? -6.494  10.433 24.288 1.00 0.00 ? 36 MET A HB2  8  
ATOM 6822  H HB3  . MET A 1 36 ? -8.010  10.925 23.531 1.00 0.00 ? 36 MET A HB3  8  
ATOM 6823  H HG2  . MET A 1 36 ? -6.846  8.124  23.438 1.00 0.00 ? 36 MET A HG2  8  
ATOM 6824  H HG3  . MET A 1 36 ? -8.158  8.638  24.498 1.00 0.00 ? 36 MET A HG3  8  
ATOM 6825  H HE1  . MET A 1 36 ? -10.312 8.281  24.110 1.00 0.00 ? 36 MET A HE1  8  
ATOM 6826  H HE2  . MET A 1 36 ? -10.454 9.883  23.373 1.00 0.00 ? 36 MET A HE2  8  
ATOM 6827  H HE3  . MET A 1 36 ? -11.231 8.490  22.621 1.00 0.00 ? 36 MET A HE3  8  
ATOM 6828  N N    . PHE A 1 37 ? -6.332  12.859 22.562 1.00 0.00 ? 37 PHE A N    8  
ATOM 6829  C CA   . PHE A 1 37 ? -6.475  14.288 22.163 1.00 0.00 ? 37 PHE A CA   8  
ATOM 6830  C C    . PHE A 1 37 ? -5.838  14.492 20.781 1.00 0.00 ? 37 PHE A C    8  
ATOM 6831  O O    . PHE A 1 37 ? -6.431  15.079 19.898 1.00 0.00 ? 37 PHE A O    8  
ATOM 6832  C CB   . PHE A 1 37 ? -5.777  15.093 23.283 1.00 0.00 ? 37 PHE A CB   8  
ATOM 6833  C CG   . PHE A 1 37 ? -4.608  15.893 22.747 1.00 0.00 ? 37 PHE A CG   8  
ATOM 6834  C CD1  . PHE A 1 37 ? -3.376  15.270 22.534 1.00 0.00 ? 37 PHE A CD1  8  
ATOM 6835  C CD2  . PHE A 1 37 ? -4.763  17.252 22.459 1.00 0.00 ? 37 PHE A CD2  8  
ATOM 6836  C CE1  . PHE A 1 37 ? -2.300  16.002 22.027 1.00 0.00 ? 37 PHE A CE1  8  
ATOM 6837  C CE2  . PHE A 1 37 ? -3.684  17.987 21.954 1.00 0.00 ? 37 PHE A CE2  8  
ATOM 6838  C CZ   . PHE A 1 37 ? -2.455  17.359 21.736 1.00 0.00 ? 37 PHE A CZ   8  
ATOM 6839  H H    . PHE A 1 37 ? -6.034  12.625 23.467 1.00 0.00 ? 37 PHE A H    8  
ATOM 6840  H HA   . PHE A 1 37 ? -7.522  14.551 22.125 1.00 0.00 ? 37 PHE A HA   8  
ATOM 6841  H HB2  . PHE A 1 37 ? -6.493  15.773 23.725 1.00 0.00 ? 37 PHE A HB2  8  
ATOM 6842  H HB3  . PHE A 1 37 ? -5.422  14.412 24.042 1.00 0.00 ? 37 PHE A HB3  8  
ATOM 6843  H HD1  . PHE A 1 37 ? -3.256  14.222 22.758 1.00 0.00 ? 37 PHE A HD1  8  
ATOM 6844  H HD2  . PHE A 1 37 ? -5.711  17.737 22.633 1.00 0.00 ? 37 PHE A HD2  8  
ATOM 6845  H HE1  . PHE A 1 37 ? -1.348  15.520 21.863 1.00 0.00 ? 37 PHE A HE1  8  
ATOM 6846  H HE2  . PHE A 1 37 ? -3.804  19.036 21.729 1.00 0.00 ? 37 PHE A HE2  8  
ATOM 6847  H HZ   . PHE A 1 37 ? -1.626  17.918 21.341 1.00 0.00 ? 37 PHE A HZ   8  
ATOM 6848  N N    . ILE A 1 38 ? -4.646  13.994 20.575 1.00 0.00 ? 38 ILE A N    8  
ATOM 6849  C CA   . ILE A 1 38 ? -4.006  14.150 19.239 1.00 0.00 ? 38 ILE A CA   8  
ATOM 6850  C C    . ILE A 1 38 ? -4.960  13.647 18.157 1.00 0.00 ? 38 ILE A C    8  
ATOM 6851  O O    . ILE A 1 38 ? -5.083  14.233 17.100 1.00 0.00 ? 38 ILE A O    8  
ATOM 6852  C CB   . ILE A 1 38 ? -2.746  13.285 19.285 1.00 0.00 ? 38 ILE A CB   8  
ATOM 6853  C CG1  . ILE A 1 38 ? -1.690  13.957 20.166 1.00 0.00 ? 38 ILE A CG1  8  
ATOM 6854  C CG2  . ILE A 1 38 ? -2.197  13.119 17.867 1.00 0.00 ? 38 ILE A CG2  8  
ATOM 6855  C CD1  . ILE A 1 38 ? -0.328  13.297 19.936 1.00 0.00 ? 38 ILE A CD1  8  
ATOM 6856  H H    . ILE A 1 38 ? -4.184  13.510 21.288 1.00 0.00 ? 38 ILE A H    8  
ATOM 6857  H HA   . ILE A 1 38 ? -3.743  15.179 19.064 1.00 0.00 ? 38 ILE A HA   8  
ATOM 6858  H HB   . ILE A 1 38 ? -2.990  12.314 19.693 1.00 0.00 ? 38 ILE A HB   8  
ATOM 6859  H HG12 . ILE A 1 38 ? -1.627  15.006 19.915 1.00 0.00 ? 38 ILE A HG12 8  
ATOM 6860  H HG13 . ILE A 1 38 ? -1.967  13.852 21.203 1.00 0.00 ? 38 ILE A HG13 8  
ATOM 6861  H HG21 . ILE A 1 38 ? -2.989  12.791 17.210 1.00 0.00 ? 38 ILE A HG21 8  
ATOM 6862  H HG22 . ILE A 1 38 ? -1.809  14.065 17.519 1.00 0.00 ? 38 ILE A HG22 8  
ATOM 6863  H HG23 . ILE A 1 38 ? -1.405  12.384 17.871 1.00 0.00 ? 38 ILE A HG23 8  
ATOM 6864  H HD11 . ILE A 1 38 ? -0.441  12.223 19.956 1.00 0.00 ? 38 ILE A HD11 8  
ATOM 6865  H HD12 . ILE A 1 38 ? 0.063   13.601 18.976 1.00 0.00 ? 38 ILE A HD12 8  
ATOM 6866  H HD13 . ILE A 1 38 ? 0.356   13.601 20.715 1.00 0.00 ? 38 ILE A HD13 8  
ATOM 6867  N N    . ASN A 1 39 ? -5.645  12.568 18.420 1.00 0.00 ? 39 ASN A N    8  
ATOM 6868  C CA   . ASN A 1 39 ? -6.602  12.029 17.412 1.00 0.00 ? 39 ASN A CA   8  
ATOM 6869  C C    . ASN A 1 39 ? -7.746  13.023 17.207 1.00 0.00 ? 39 ASN A C    8  
ATOM 6870  O O    . ASN A 1 39 ? -8.184  13.265 16.100 1.00 0.00 ? 39 ASN A O    8  
ATOM 6871  C CB   . ASN A 1 39 ? -7.123  10.723 18.011 1.00 0.00 ? 39 ASN A CB   8  
ATOM 6872  C CG   . ASN A 1 39 ? -5.978  9.714  18.107 1.00 0.00 ? 39 ASN A CG   8  
ATOM 6873  O OD1  . ASN A 1 39 ? -4.947  9.886  17.486 1.00 0.00 ? 39 ASN A OD1  8  
ATOM 6874  N ND2  . ASN A 1 39 ? -6.114  8.660  18.864 1.00 0.00 ? 39 ASN A ND2  8  
ATOM 6875  H H    . ASN A 1 39 ? -5.535  12.116 19.286 1.00 0.00 ? 39 ASN A H    8  
ATOM 6876  H HA   . ASN A 1 39 ? -6.100  11.835 16.481 1.00 0.00 ? 39 ASN A HA   8  
ATOM 6877  H HB2  . ASN A 1 39 ? -7.521  10.911 18.997 1.00 0.00 ? 39 ASN A HB2  8  
ATOM 6878  H HB3  . ASN A 1 39 ? -7.904  10.323 17.380 1.00 0.00 ? 39 ASN A HB3  8  
ATOM 6879  H HD21 . ASN A 1 39 ? -6.944  8.521  19.365 1.00 0.00 ? 39 ASN A HD21 8  
ATOM 6880  H HD22 . ASN A 1 39 ? -5.386  8.009  18.932 1.00 0.00 ? 39 ASN A HD22 8  
ATOM 6881  N N    . LYS A 1 40 ? -8.220  13.607 18.269 1.00 0.00 ? 40 LYS A N    8  
ATOM 6882  C CA   . LYS A 1 40 ? -9.326  14.599 18.146 1.00 0.00 ? 40 LYS A CA   8  
ATOM 6883  C C    . LYS A 1 40 ? -8.745  15.971 17.801 1.00 0.00 ? 40 LYS A C    8  
ATOM 6884  O O    . LYS A 1 40 ? -9.450  16.878 17.408 1.00 0.00 ? 40 LYS A O    8  
ATOM 6885  C CB   . LYS A 1 40 ? -9.991  14.628 19.523 1.00 0.00 ? 40 LYS A CB   8  
ATOM 6886  C CG   . LYS A 1 40 ? -10.657 13.277 19.795 1.00 0.00 ? 40 LYS A CG   8  
ATOM 6887  C CD   . LYS A 1 40 ? -11.278 13.288 21.193 1.00 0.00 ? 40 LYS A CD   8  
ATOM 6888  C CE   . LYS A 1 40 ? -11.527 11.849 21.651 1.00 0.00 ? 40 LYS A CE   8  
ATOM 6889  N NZ   . LYS A 1 40 ? -12.692 11.939 22.576 1.00 0.00 ? 40 LYS A NZ   8  
ATOM 6890  H H    . LYS A 1 40 ? -7.842  13.401 19.149 1.00 0.00 ? 40 LYS A H    8  
ATOM 6891  H HA   . LYS A 1 40 ? -10.035 14.286 17.397 1.00 0.00 ? 40 LYS A HA   8  
ATOM 6892  H HB2  . LYS A 1 40 ? -9.245  14.820 20.279 1.00 0.00 ? 40 LYS A HB2  8  
ATOM 6893  H HB3  . LYS A 1 40 ? -10.737 15.408 19.546 1.00 0.00 ? 40 LYS A HB3  8  
ATOM 6894  H HG2  . LYS A 1 40 ? -11.429 13.103 19.060 1.00 0.00 ? 40 LYS A HG2  8  
ATOM 6895  H HG3  . LYS A 1 40 ? -9.918  12.493 19.735 1.00 0.00 ? 40 LYS A HG3  8  
ATOM 6896  H HD2  . LYS A 1 40 ? -10.602 13.772 21.883 1.00 0.00 ? 40 LYS A HD2  8  
ATOM 6897  H HD3  . LYS A 1 40 ? -12.214 13.825 21.168 1.00 0.00 ? 40 LYS A HD3  8  
ATOM 6898  H HE2  . LYS A 1 40 ? -11.767 11.222 20.805 1.00 0.00 ? 40 LYS A HE2  8  
ATOM 6899  H HE3  . LYS A 1 40 ? -10.663 11.465 22.170 1.00 0.00 ? 40 LYS A HE3  8  
ATOM 6900  H HZ1  . LYS A 1 40 ? -12.536 12.712 23.255 1.00 0.00 ? 40 LYS A HZ1  8  
ATOM 6901  H HZ2  . LYS A 1 40 ? -13.556 12.128 22.030 1.00 0.00 ? 40 LYS A HZ2  8  
ATOM 6902  H HZ3  . LYS A 1 40 ? -12.795 11.040 23.091 1.00 0.00 ? 40 LYS A HZ3  8  
ATOM 6903  N N    . CYS A 1 41 ? -7.458  16.125 17.945 1.00 0.00 ? 41 CYS A N    8  
ATOM 6904  C CA   . CYS A 1 41 ? -6.815  17.429 17.626 1.00 0.00 ? 41 CYS A CA   8  
ATOM 6905  C C    . CYS A 1 41 ? -7.082  17.806 16.168 1.00 0.00 ? 41 CYS A C    8  
ATOM 6906  O O    . CYS A 1 41 ? -7.780  18.757 15.877 1.00 0.00 ? 41 CYS A O    8  
ATOM 6907  C CB   . CYS A 1 41 ? -5.324  17.185 17.852 1.00 0.00 ? 41 CYS A CB   8  
ATOM 6908  S SG   . CYS A 1 41 ? -4.387  18.684 17.463 1.00 0.00 ? 41 CYS A SG   8  
ATOM 6909  H H    . CYS A 1 41 ? -6.912  15.376 18.263 1.00 0.00 ? 41 CYS A H    8  
ATOM 6910  H HA   . CYS A 1 41 ? -7.170  18.201 18.289 1.00 0.00 ? 41 CYS A HA   8  
ATOM 6911  H HB2  . CYS A 1 41 ? -5.157  16.914 18.882 1.00 0.00 ? 41 CYS A HB2  8  
ATOM 6912  H HB3  . CYS A 1 41 ? -4.992  16.380 17.213 1.00 0.00 ? 41 CYS A HB3  8  
ATOM 6913  N N    . ALA A 1 42 ? -6.527  17.065 15.251 1.00 0.00 ? 42 ALA A N    8  
ATOM 6914  C CA   . ALA A 1 42 ? -6.744  17.374 13.808 1.00 0.00 ? 42 ALA A CA   8  
ATOM 6915  C C    . ALA A 1 42 ? -8.223  17.210 13.445 1.00 0.00 ? 42 ALA A C    8  
ATOM 6916  O O    . ALA A 1 42 ? -8.739  17.888 12.579 1.00 0.00 ? 42 ALA A O    8  
ATOM 6917  C CB   . ALA A 1 42 ? -5.891  16.354 13.053 1.00 0.00 ? 42 ALA A CB   8  
ATOM 6918  H H    . ALA A 1 42 ? -5.967  16.304 15.513 1.00 0.00 ? 42 ALA A H    8  
ATOM 6919  H HA   . ALA A 1 42 ? -6.408  18.374 13.582 1.00 0.00 ? 42 ALA A HA   8  
ATOM 6920  H HB1  . ALA A 1 42 ? -5.094  16.007 13.695 1.00 0.00 ? 42 ALA A HB1  8  
ATOM 6921  H HB2  . ALA A 1 42 ? -5.470  16.816 12.173 1.00 0.00 ? 42 ALA A HB2  8  
ATOM 6922  H HB3  . ALA A 1 42 ? -6.507  15.516 12.760 1.00 0.00 ? 42 ALA A HB3  8  
ATOM 6923  N N    . THR A 1 43 ? -8.909  16.315 14.103 1.00 0.00 ? 43 THR A N    8  
ATOM 6924  C CA   . THR A 1 43 ? -10.354 16.108 13.796 1.00 0.00 ? 43 THR A CA   8  
ATOM 6925  C C    . THR A 1 43 ? -11.181 17.266 14.360 1.00 0.00 ? 43 THR A C    8  
ATOM 6926  O O    . THR A 1 43 ? -12.034 17.814 13.694 1.00 0.00 ? 43 THR A O    8  
ATOM 6927  C CB   . THR A 1 43 ? -10.723 14.796 14.491 1.00 0.00 ? 43 THR A CB   8  
ATOM 6928  O OG1  . THR A 1 43 ? -9.940  13.741 13.949 1.00 0.00 ? 43 THR A OG1  8  
ATOM 6929  C CG2  . THR A 1 43 ? -12.207 14.498 14.269 1.00 0.00 ? 43 THR A CG2  8  
ATOM 6930  H H    . THR A 1 43 ? -8.476  15.780 14.796 1.00 0.00 ? 43 THR A H    8  
ATOM 6931  H HA   . THR A 1 43 ? -10.506 16.019 12.732 1.00 0.00 ? 43 THR A HA   8  
ATOM 6932  H HB   . THR A 1 43 ? -10.531 14.882 15.549 1.00 0.00 ? 43 THR A HB   8  
ATOM 6933  H HG1  . THR A 1 43 ? -9.623  13.203 14.678 1.00 0.00 ? 43 THR A HG1  8  
ATOM 6934  H HG21 . THR A 1 43 ? -12.759 15.425 14.242 1.00 0.00 ? 43 THR A HG21 8  
ATOM 6935  H HG22 . THR A 1 43 ? -12.333 13.976 13.332 1.00 0.00 ? 43 THR A HG22 8  
ATOM 6936  H HG23 . THR A 1 43 ? -12.574 13.882 15.076 1.00 0.00 ? 43 THR A HG23 8  
ATOM 6937  N N    . CYS A 1 44 ? -10.931 17.645 15.582 1.00 0.00 ? 44 CYS A N    8  
ATOM 6938  C CA   . CYS A 1 44 ? -11.701 18.772 16.180 1.00 0.00 ? 44 CYS A CA   8  
ATOM 6939  C C    . CYS A 1 44 ? -11.442 20.054 15.387 1.00 0.00 ? 44 CYS A C    8  
ATOM 6940  O O    . CYS A 1 44 ? -12.241 20.969 15.386 1.00 0.00 ? 44 CYS A O    8  
ATOM 6941  C CB   . CYS A 1 44 ? -11.171 18.905 17.608 1.00 0.00 ? 44 CYS A CB   8  
ATOM 6942  S SG   . CYS A 1 44 ? -11.813 17.548 18.619 1.00 0.00 ? 44 CYS A SG   8  
ATOM 6943  H H    . CYS A 1 44 ? -10.236 17.194 16.104 1.00 0.00 ? 44 CYS A H    8  
ATOM 6944  H HA   . CYS A 1 44 ? -12.755 18.543 16.196 1.00 0.00 ? 44 CYS A HA   8  
ATOM 6945  H HB2  . CYS A 1 44 ? -10.092 18.867 17.597 1.00 0.00 ? 44 CYS A HB2  8  
ATOM 6946  H HB3  . CYS A 1 44 ? -11.494 19.848 18.025 1.00 0.00 ? 44 CYS A HB3  8  
ATOM 6947  N N    . LYS A 1 45 ? -10.328 20.125 14.709 1.00 0.00 ? 45 LYS A N    8  
ATOM 6948  C CA   . LYS A 1 45 ? -10.014 21.342 13.910 1.00 0.00 ? 45 LYS A CA   8  
ATOM 6949  C C    . LYS A 1 45 ? -10.959 21.443 12.710 1.00 0.00 ? 45 LYS A C    8  
ATOM 6950  O O    . LYS A 1 45 ? -11.478 22.499 12.405 1.00 0.00 ? 45 LYS A O    8  
ATOM 6951  C CB   . LYS A 1 45 ? -8.570  21.147 13.442 1.00 0.00 ? 45 LYS A CB   8  
ATOM 6952  C CG   . LYS A 1 45 ? -8.201  22.242 12.438 1.00 0.00 ? 45 LYS A CG   8  
ATOM 6953  C CD   . LYS A 1 45 ? -7.273  21.660 11.368 1.00 0.00 ? 45 LYS A CD   8  
ATOM 6954  C CE   . LYS A 1 45 ? -6.688  22.797 10.526 1.00 0.00 ? 45 LYS A CE   8  
ATOM 6955  N NZ   . LYS A 1 45 ? -5.559  22.174 9.778  1.00 0.00 ? 45 LYS A NZ   8  
ATOM 6956  H H    . LYS A 1 45 ? -9.700  19.373 14.723 1.00 0.00 ? 45 LYS A H    8  
ATOM 6957  H HA   . LYS A 1 45 ? -10.087 22.226 14.525 1.00 0.00 ? 45 LYS A HA   8  
ATOM 6958  H HB2  . LYS A 1 45 ? -7.907  21.201 14.293 1.00 0.00 ? 45 LYS A HB2  8  
ATOM 6959  H HB3  . LYS A 1 45 ? -8.472  20.180 12.972 1.00 0.00 ? 45 LYS A HB3  8  
ATOM 6960  H HG2  . LYS A 1 45 ? -9.096  22.621 11.969 1.00 0.00 ? 45 LYS A HG2  8  
ATOM 6961  H HG3  . LYS A 1 45 ? -7.694  23.047 12.952 1.00 0.00 ? 45 LYS A HG3  8  
ATOM 6962  H HD2  . LYS A 1 45 ? -6.472  21.115 11.844 1.00 0.00 ? 45 LYS A HD2  8  
ATOM 6963  H HD3  . LYS A 1 45 ? -7.834  20.992 10.731 1.00 0.00 ? 45 LYS A HD3  8  
ATOM 6964  H HE2  . LYS A 1 45 ? -7.430  23.176 9.839  1.00 0.00 ? 45 LYS A HE2  8  
ATOM 6965  H HE3  . LYS A 1 45 ? -6.326  23.588 11.164 1.00 0.00 ? 45 LYS A HE3  8  
ATOM 6966  H HZ1  . LYS A 1 45 ? -5.059  21.506 10.399 1.00 0.00 ? 45 LYS A HZ1  8  
ATOM 6967  H HZ2  . LYS A 1 45 ? -5.928  21.670 8.949  1.00 0.00 ? 45 LYS A HZ2  8  
ATOM 6968  H HZ3  . LYS A 1 45 ? -4.900  22.916 9.467  1.00 0.00 ? 45 LYS A HZ3  8  
ATOM 6969  N N    . MET A 1 46 ? -11.185 20.356 12.026 1.00 0.00 ? 46 MET A N    8  
ATOM 6970  C CA   . MET A 1 46 ? -12.096 20.397 10.847 1.00 0.00 ? 46 MET A CA   8  
ATOM 6971  C C    . MET A 1 46 ? -13.511 20.775 11.289 1.00 0.00 ? 46 MET A C    8  
ATOM 6972  O O    . MET A 1 46 ? -14.305 21.270 10.514 1.00 0.00 ? 46 MET A O    8  
ATOM 6973  C CB   . MET A 1 46 ? -12.068 18.982 10.266 1.00 0.00 ? 46 MET A CB   8  
ATOM 6974  C CG   . MET A 1 46 ? -12.735 18.004 11.235 1.00 0.00 ? 46 MET A CG   8  
ATOM 6975  S SD   . MET A 1 46 ? -14.069 17.126 10.385 1.00 0.00 ? 46 MET A SD   8  
ATOM 6976  C CE   . MET A 1 46 ? -14.430 15.936 11.700 1.00 0.00 ? 46 MET A CE   8  
ATOM 6977  H H    . MET A 1 46 ? -10.757 19.513 12.287 1.00 0.00 ? 46 MET A H    8  
ATOM 6978  H HA   . MET A 1 46 ? -11.731 21.102 10.116 1.00 0.00 ? 46 MET A HA   8  
ATOM 6979  H HB2  . MET A 1 46 ? -12.598 18.971 9.326  1.00 0.00 ? 46 MET A HB2  8  
ATOM 6980  H HB3  . MET A 1 46 ? -11.044 18.683 10.105 1.00 0.00 ? 46 MET A HB3  8  
ATOM 6981  H HG2  . MET A 1 46 ? -12.003 17.292 11.588 1.00 0.00 ? 46 MET A HG2  8  
ATOM 6982  H HG3  . MET A 1 46 ? -13.140 18.547 12.074 1.00 0.00 ? 46 MET A HG3  8  
ATOM 6983  H HE1  . MET A 1 46 ? -13.931 16.244 12.609 1.00 0.00 ? 46 MET A HE1  8  
ATOM 6984  H HE2  . MET A 1 46 ? -15.494 15.899 11.872 1.00 0.00 ? 46 MET A HE2  8  
ATOM 6985  H HE3  . MET A 1 46 ? -14.081 14.956 11.405 1.00 0.00 ? 46 MET A HE3  8  
ATOM 6986  N N    . ILE A 1 47 ? -13.829 20.548 12.533 1.00 0.00 ? 47 ILE A N    8  
ATOM 6987  C CA   . ILE A 1 47 ? -15.189 20.897 13.030 1.00 0.00 ? 47 ILE A CA   8  
ATOM 6988  C C    . ILE A 1 47 ? -15.441 22.393 12.841 1.00 0.00 ? 47 ILE A C    8  
ATOM 6989  O O    . ILE A 1 47 ? -16.512 22.809 12.443 1.00 0.00 ? 47 ILE A O    8  
ATOM 6990  C CB   . ILE A 1 47 ? -15.178 20.537 14.518 1.00 0.00 ? 47 ILE A CB   8  
ATOM 6991  C CG1  . ILE A 1 47 ? -14.736 19.081 14.694 1.00 0.00 ? 47 ILE A CG1  8  
ATOM 6992  C CG2  . ILE A 1 47 ? -16.584 20.714 15.095 1.00 0.00 ? 47 ILE A CG2  8  
ATOM 6993  C CD1  . ILE A 1 47 ? -15.489 18.192 13.703 1.00 0.00 ? 47 ILE A CD1  8  
ATOM 6994  H H    . ILE A 1 47 ? -13.171 20.149 13.138 1.00 0.00 ? 47 ILE A H    8  
ATOM 6995  H HA   . ILE A 1 47 ? -15.941 20.318 12.515 1.00 0.00 ? 47 ILE A HA   8  
ATOM 6996  H HB   . ILE A 1 47 ? -14.491 21.187 15.039 1.00 0.00 ? 47 ILE A HB   8  
ATOM 6997  H HG12 . ILE A 1 47 ? -13.674 19.003 14.515 1.00 0.00 ? 47 ILE A HG12 8  
ATOM 6998  H HG13 . ILE A 1 47 ? -14.954 18.761 15.702 1.00 0.00 ? 47 ILE A HG13 8  
ATOM 6999  H HG21 . ILE A 1 47 ? -17.317 20.461 14.343 1.00 0.00 ? 47 ILE A HG21 8  
ATOM 7000  H HG22 . ILE A 1 47 ? -16.706 20.067 15.951 1.00 0.00 ? 47 ILE A HG22 8  
ATOM 7001  H HG23 . ILE A 1 47 ? -16.721 21.742 15.398 1.00 0.00 ? 47 ILE A HG23 8  
ATOM 7002  H HD11 . ILE A 1 47 ? -16.411 18.675 13.413 1.00 0.00 ? 47 ILE A HD11 8  
ATOM 7003  H HD12 . ILE A 1 47 ? -14.877 18.031 12.827 1.00 0.00 ? 47 ILE A HD12 8  
ATOM 7004  H HD13 . ILE A 1 47 ? -15.709 17.242 14.167 1.00 0.00 ? 47 ILE A HD13 8  
ATOM 7005  N N    . LEU A 1 48 ? -14.458 23.205 13.118 1.00 0.00 ? 48 LEU A N    8  
ATOM 7006  C CA   . LEU A 1 48 ? -14.634 24.675 12.950 1.00 0.00 ? 48 LEU A CA   8  
ATOM 7007  C C    . LEU A 1 48 ? -14.678 25.027 11.462 1.00 0.00 ? 48 LEU A C    8  
ATOM 7008  O O    . LEU A 1 48 ? -15.438 25.873 11.035 1.00 0.00 ? 48 LEU A O    8  
ATOM 7009  C CB   . LEU A 1 48 ? -13.403 25.299 13.611 1.00 0.00 ? 48 LEU A CB   8  
ATOM 7010  C CG   . LEU A 1 48 ? -13.556 25.246 15.131 1.00 0.00 ? 48 LEU A CG   8  
ATOM 7011  C CD1  . LEU A 1 48 ? -14.833 25.981 15.542 1.00 0.00 ? 48 LEU A CD1  8  
ATOM 7012  C CD2  . LEU A 1 48 ? -13.636 23.788 15.588 1.00 0.00 ? 48 LEU A CD2  8  
ATOM 7013  H H    . LEU A 1 48 ? -13.602 22.847 13.433 1.00 0.00 ? 48 LEU A H    8  
ATOM 7014  H HA   . LEU A 1 48 ? -15.531 25.009 13.447 1.00 0.00 ? 48 LEU A HA   8  
ATOM 7015  H HB2  . LEU A 1 48 ? -12.521 24.749 13.318 1.00 0.00 ? 48 LEU A HB2  8  
ATOM 7016  H HB3  . LEU A 1 48 ? -13.308 26.327 13.293 1.00 0.00 ? 48 LEU A HB3  8  
ATOM 7017  H HG   . LEU A 1 48 ? -12.704 25.721 15.593 1.00 0.00 ? 48 LEU A HG   8  
ATOM 7018  H HD11 . LEU A 1 48 ? -15.149 26.631 14.740 1.00 0.00 ? 48 LEU A HD11 8  
ATOM 7019  H HD12 . LEU A 1 48 ? -15.611 25.261 15.750 1.00 0.00 ? 48 LEU A HD12 8  
ATOM 7020  H HD13 . LEU A 1 48 ? -14.641 26.569 16.428 1.00 0.00 ? 48 LEU A HD13 8  
ATOM 7021  H HD21 . LEU A 1 48 ? -12.852 23.218 15.111 1.00 0.00 ? 48 LEU A HD21 8  
ATOM 7022  H HD22 . LEU A 1 48 ? -13.516 23.739 16.660 1.00 0.00 ? 48 LEU A HD22 8  
ATOM 7023  H HD23 . LEU A 1 48 ? -14.597 23.377 15.314 1.00 0.00 ? 48 LEU A HD23 8  
ATOM 7024  N N    . GLU A 1 49 ? -13.865 24.383 10.669 1.00 0.00 ? 49 GLU A N    8  
ATOM 7025  C CA   . GLU A 1 49 ? -13.860 24.679 9.208  1.00 0.00 ? 49 GLU A CA   8  
ATOM 7026  C C    . GLU A 1 49 ? -15.236 24.385 8.603  1.00 0.00 ? 49 GLU A C    8  
ATOM 7027  O O    . GLU A 1 49 ? -15.614 24.946 7.594  1.00 0.00 ? 49 GLU A O    8  
ATOM 7028  C CB   . GLU A 1 49 ? -12.805 23.743 8.617  1.00 0.00 ? 49 GLU A CB   8  
ATOM 7029  C CG   . GLU A 1 49 ? -11.435 24.083 9.208  1.00 0.00 ? 49 GLU A CG   8  
ATOM 7030  C CD   . GLU A 1 49 ? -10.881 25.336 8.527  1.00 0.00 ? 49 GLU A CD   8  
ATOM 7031  O OE1  . GLU A 1 49 ? -11.219 25.558 7.376  1.00 0.00 ? 49 GLU A OE1  8  
ATOM 7032  O OE2  . GLU A 1 49 ? -10.129 26.051 9.167  1.00 0.00 ? 49 GLU A OE2  8  
ATOM 7033  H H    . GLU A 1 49 ? -13.260 23.703 11.034 1.00 0.00 ? 49 GLU A H    8  
ATOM 7034  H HA   . GLU A 1 49 ? -13.582 25.706 9.031  1.00 0.00 ? 49 GLU A HA   8  
ATOM 7035  H HB2  . GLU A 1 49 ? -13.057 22.721 8.855  1.00 0.00 ? 49 GLU A HB2  8  
ATOM 7036  H HB3  . GLU A 1 49 ? -12.774 23.866 7.544  1.00 0.00 ? 49 GLU A HB3  8  
ATOM 7037  H HG2  . GLU A 1 49 ? -11.536 24.264 10.268 1.00 0.00 ? 49 GLU A HG2  8  
ATOM 7038  H HG3  . GLU A 1 49 ? -10.760 23.256 9.047  1.00 0.00 ? 49 GLU A HG3  8  
ATOM 7039  N N    . LYS A 1 50 ? -15.987 23.512 9.214  1.00 0.00 ? 50 LYS A N    8  
ATOM 7040  C CA   . LYS A 1 50 ? -17.338 23.183 8.677  1.00 0.00 ? 50 LYS A CA   8  
ATOM 7041  C C    . LYS A 1 50 ? -18.320 24.318 8.978  1.00 0.00 ? 50 LYS A C    8  
ATOM 7042  O O    . LYS A 1 50 ? -19.151 24.668 8.164  1.00 0.00 ? 50 LYS A O    8  
ATOM 7043  C CB   . LYS A 1 50 ? -17.756 21.906 9.406  1.00 0.00 ? 50 LYS A CB   8  
ATOM 7044  C CG   . LYS A 1 50 ? -16.883 20.740 8.935  1.00 0.00 ? 50 LYS A CG   8  
ATOM 7045  C CD   . LYS A 1 50 ? -17.273 20.355 7.507  1.00 0.00 ? 50 LYS A CD   8  
ATOM 7046  C CE   . LYS A 1 50 ? -16.728 18.962 7.187  1.00 0.00 ? 50 LYS A CE   8  
ATOM 7047  N NZ   . LYS A 1 50 ? -17.058 18.744 5.750  1.00 0.00 ? 50 LYS A NZ   8  
ATOM 7048  H H    . LYS A 1 50 ? -15.663 23.071 10.028 1.00 0.00 ? 50 LYS A H    8  
ATOM 7049  H HA   . LYS A 1 50 ? -17.288 23.000 7.614  1.00 0.00 ? 50 LYS A HA   8  
ATOM 7050  H HB2  . LYS A 1 50 ? -17.631 22.042 10.470 1.00 0.00 ? 50 LYS A HB2  8  
ATOM 7051  H HB3  . LYS A 1 50 ? -18.792 21.690 9.191  1.00 0.00 ? 50 LYS A HB3  8  
ATOM 7052  H HG2  . LYS A 1 50 ? -15.845 21.037 8.957  1.00 0.00 ? 50 LYS A HG2  8  
ATOM 7053  H HG3  . LYS A 1 50 ? -17.030 19.894 9.589  1.00 0.00 ? 50 LYS A HG3  8  
ATOM 7054  H HD2  . LYS A 1 50 ? -18.350 20.351 7.417  1.00 0.00 ? 50 LYS A HD2  8  
ATOM 7055  H HD3  . LYS A 1 50 ? -16.858 21.073 6.815  1.00 0.00 ? 50 LYS A HD3  8  
ATOM 7056  H HE2  . LYS A 1 50 ? -15.659 18.933 7.337  1.00 0.00 ? 50 LYS A HE2  8  
ATOM 7057  H HE3  . LYS A 1 50 ? -17.215 18.218 7.802  1.00 0.00 ? 50 LYS A HE3  8  
ATOM 7058  H HZ1  . LYS A 1 50 ? -18.072 18.918 5.597  1.00 0.00 ? 50 LYS A HZ1  8  
ATOM 7059  H HZ2  . LYS A 1 50 ? -16.501 19.398 5.164  1.00 0.00 ? 50 LYS A HZ2  8  
ATOM 7060  H HZ3  . LYS A 1 50 ? -16.828 17.765 5.486  1.00 0.00 ? 50 LYS A HZ3  8  
ATOM 7061  N N    . GLU A 1 51 ? -18.230 24.897 10.145 1.00 0.00 ? 51 GLU A N    8  
ATOM 7062  C CA   . GLU A 1 51 ? -19.158 26.009 10.499 1.00 0.00 ? 51 GLU A CA   8  
ATOM 7063  C C    . GLU A 1 51 ? -19.065 27.128 9.457  1.00 0.00 ? 51 GLU A C    8  
ATOM 7064  O O    . GLU A 1 51 ? -19.990 27.892 9.268  1.00 0.00 ? 51 GLU A O    8  
ATOM 7065  C CB   . GLU A 1 51 ? -18.680 26.506 11.863 1.00 0.00 ? 51 GLU A CB   8  
ATOM 7066  C CG   . GLU A 1 51 ? -18.963 25.439 12.922 1.00 0.00 ? 51 GLU A CG   8  
ATOM 7067  C CD   . GLU A 1 51 ? -18.420 25.906 14.274 1.00 0.00 ? 51 GLU A CD   8  
ATOM 7068  O OE1  . GLU A 1 51 ? -17.917 27.016 14.337 1.00 0.00 ? 51 GLU A OE1  8  
ATOM 7069  O OE2  . GLU A 1 51 ? -18.515 25.145 15.223 1.00 0.00 ? 51 GLU A OE2  8  
ATOM 7070  H H    . GLU A 1 51 ? -17.553 24.600 10.788 1.00 0.00 ? 51 GLU A H    8  
ATOM 7071  H HA   . GLU A 1 51 ? -20.171 25.647 10.573 1.00 0.00 ? 51 GLU A HA   8  
ATOM 7072  H HB2  . GLU A 1 51 ? -17.618 26.702 11.823 1.00 0.00 ? 51 GLU A HB2  8  
ATOM 7073  H HB3  . GLU A 1 51 ? -19.204 27.415 12.119 1.00 0.00 ? 51 GLU A HB3  8  
ATOM 7074  H HG2  . GLU A 1 51 ? -20.029 25.281 12.998 1.00 0.00 ? 51 GLU A HG2  8  
ATOM 7075  H HG3  . GLU A 1 51 ? -18.481 24.515 12.639 1.00 0.00 ? 51 GLU A HG3  8  
ATOM 7076  N N    . ALA A 1 52 ? -17.954 27.230 8.782  1.00 0.00 ? 52 ALA A N    8  
ATOM 7077  C CA   . ALA A 1 52 ? -17.802 28.298 7.753  1.00 0.00 ? 52 ALA A CA   8  
ATOM 7078  C C    . ALA A 1 52 ? -18.531 27.904 6.466  1.00 0.00 ? 52 ALA A C    8  
ATOM 7079  O O    . ALA A 1 52 ? -18.923 28.744 5.681  1.00 0.00 ? 52 ALA A O    8  
ATOM 7080  C CB   . ALA A 1 52 ? -16.297 28.400 7.507  1.00 0.00 ? 52 ALA A CB   8  
ATOM 7081  H H    . ALA A 1 52 ? -17.219 26.604 8.949  1.00 0.00 ? 52 ALA A H    8  
ATOM 7082  H HA   . ALA A 1 52 ? -18.178 29.237 8.128  1.00 0.00 ? 52 ALA A HA   8  
ATOM 7083  H HB1  . ALA A 1 52 ? -15.767 28.217 8.430  1.00 0.00 ? 52 ALA A HB1  8  
ATOM 7084  H HB2  . ALA A 1 52 ? -16.058 29.390 7.146  1.00 0.00 ? 52 ALA A HB2  8  
ATOM 7085  H HB3  . ALA A 1 52 ? -16.002 27.667 6.771  1.00 0.00 ? 52 ALA A HB3  8  
ATOM 7086  N N    . LYS A 1 53 ? -18.715 26.631 6.244  1.00 0.00 ? 53 LYS A N    8  
ATOM 7087  C CA   . LYS A 1 53 ? -19.418 26.185 5.007  1.00 0.00 ? 53 LYS A CA   8  
ATOM 7088  C C    . LYS A 1 53 ? -18.887 26.952 3.792  1.00 0.00 ? 53 LYS A C    8  
ATOM 7089  O O    . LYS A 1 53 ? -19.640 27.527 3.032  1.00 0.00 ? 53 LYS A O    8  
ATOM 7090  C CB   . LYS A 1 53 ? -20.892 26.515 5.248  1.00 0.00 ? 53 LYS A CB   8  
ATOM 7091  C CG   . LYS A 1 53 ? -21.377 25.793 6.506  1.00 0.00 ? 53 LYS A CG   8  
ATOM 7092  C CD   . LYS A 1 53 ? -22.798 26.250 6.840  1.00 0.00 ? 53 LYS A CD   8  
ATOM 7093  C CE   . LYS A 1 53 ? -23.232 25.635 8.172  1.00 0.00 ? 53 LYS A CE   8  
ATOM 7094  N NZ   . LYS A 1 53 ? -24.628 26.116 8.377  1.00 0.00 ? 53 LYS A NZ   8  
ATOM 7095  H H    . LYS A 1 53 ? -18.392 25.969 6.889  1.00 0.00 ? 53 LYS A H    8  
ATOM 7096  H HA   . LYS A 1 53 ? -19.296 25.123 4.866  1.00 0.00 ? 53 LYS A HA   8  
ATOM 7097  H HB2  . LYS A 1 53 ? -21.006 27.581 5.377  1.00 0.00 ? 53 LYS A HB2  8  
ATOM 7098  H HB3  . LYS A 1 53 ? -21.476 26.190 4.399  1.00 0.00 ? 53 LYS A HB3  8  
ATOM 7099  H HG2  . LYS A 1 53 ? -21.372 24.727 6.335  1.00 0.00 ? 53 LYS A HG2  8  
ATOM 7100  H HG3  . LYS A 1 53 ? -20.720 26.028 7.331  1.00 0.00 ? 53 LYS A HG3  8  
ATOM 7101  H HD2  . LYS A 1 53 ? -22.821 27.328 6.916  1.00 0.00 ? 53 LYS A HD2  8  
ATOM 7102  H HD3  . LYS A 1 53 ? -23.471 25.931 6.059  1.00 0.00 ? 53 LYS A HD3  8  
ATOM 7103  H HE2  . LYS A 1 53 ? -23.210 24.557 8.112  1.00 0.00 ? 53 LYS A HE2  8  
ATOM 7104  H HE3  . LYS A 1 53 ? -22.595 25.982 8.971  1.00 0.00 ? 53 LYS A HE3  8  
ATOM 7105  H HZ1  . LYS A 1 53 ? -25.145 26.075 7.476  1.00 0.00 ? 53 LYS A HZ1  8  
ATOM 7106  H HZ2  . LYS A 1 53 ? -25.104 25.511 9.076  1.00 0.00 ? 53 LYS A HZ2  8  
ATOM 7107  H HZ3  . LYS A 1 53 ? -24.609 27.097 8.722  1.00 0.00 ? 53 LYS A HZ3  8  
ATOM 7108  N N    . SER A 1 54 ? -17.595 26.964 3.605  1.00 0.00 ? 54 SER A N    8  
ATOM 7109  C CA   . SER A 1 54 ? -17.018 27.695 2.441  1.00 0.00 ? 54 SER A CA   8  
ATOM 7110  C C    . SER A 1 54 ? -16.657 26.709 1.325  1.00 0.00 ? 54 SER A C    8  
ATOM 7111  O O    . SER A 1 54 ? -15.607 26.098 1.339  1.00 0.00 ? 54 SER A O    8  
ATOM 7112  C CB   . SER A 1 54 ? -15.761 28.375 2.983  1.00 0.00 ? 54 SER A CB   8  
ATOM 7113  O OG   . SER A 1 54 ? -15.276 29.305 2.026  1.00 0.00 ? 54 SER A OG   8  
ATOM 7114  H H    . SER A 1 54 ? -17.006 26.494 4.231  1.00 0.00 ? 54 SER A H    8  
ATOM 7115  H HA   . SER A 1 54 ? -17.712 28.436 2.079  1.00 0.00 ? 54 SER A HA   8  
ATOM 7116  H HB2  . SER A 1 54 ? -16.000 28.894 3.900  1.00 0.00 ? 54 SER A HB2  8  
ATOM 7117  H HB3  . SER A 1 54 ? -15.003 27.630 3.178  1.00 0.00 ? 54 SER A HB3  8  
ATOM 7118  H HG   . SER A 1 54 ? -14.677 29.907 2.474  1.00 0.00 ? 54 SER A HG   8  
ATOM 7119  N N    . GLN A 1 55 ? -17.519 26.552 0.359  1.00 0.00 ? 55 GLN A N    8  
ATOM 7120  C CA   . GLN A 1 55 ? -17.224 25.608 -0.757 1.00 0.00 ? 55 GLN A CA   8  
ATOM 7121  C C    . GLN A 1 55 ? -16.896 24.219 -0.202 1.00 0.00 ? 55 GLN A C    8  
ATOM 7122  O O    . GLN A 1 55 ? -17.823 23.515 0.164  1.00 0.00 ? 55 GLN A O    8  
ATOM 7123  C CB   . GLN A 1 55 ? -16.008 26.202 -1.468 1.00 0.00 ? 55 GLN A CB   8  
ATOM 7124  C CG   . GLN A 1 55 ? -16.389 27.544 -2.096 1.00 0.00 ? 55 GLN A CG   8  
ATOM 7125  C CD   . GLN A 1 55 ? -15.192 28.106 -2.863 1.00 0.00 ? 55 GLN A CD   8  
ATOM 7126  O OE1  . GLN A 1 55 ? -14.291 27.377 -3.228 1.00 0.00 ? 55 GLN A OE1  8  
ATOM 7127  N NE2  . GLN A 1 55 ? -15.143 29.384 -3.128 1.00 0.00 ? 55 GLN A NE2  8  
ATOM 7128  O OXT  . GLN A 1 55 ? -15.724 23.884 -0.154 1.00 0.00 ? 55 GLN A OXT  8  
ATOM 7129  H H    . GLN A 1 55 ? -18.361 27.056 0.365  1.00 0.00 ? 55 GLN A H    8  
ATOM 7130  H HA   . GLN A 1 55 ? -18.060 25.555 -1.438 1.00 0.00 ? 55 GLN A HA   8  
ATOM 7131  H HB2  . GLN A 1 55 ? -15.212 26.351 -0.754 1.00 0.00 ? 55 GLN A HB2  8  
ATOM 7132  H HB3  . GLN A 1 55 ? -15.676 25.524 -2.241 1.00 0.00 ? 55 GLN A HB3  8  
ATOM 7133  H HG2  . GLN A 1 55 ? -17.218 27.401 -2.775 1.00 0.00 ? 55 GLN A HG2  8  
ATOM 7134  H HG3  . GLN A 1 55 ? -16.677 28.236 -1.319 1.00 0.00 ? 55 GLN A HG3  8  
ATOM 7135  H HE21 . GLN A 1 55 ? -15.869 29.973 -2.835 1.00 0.00 ? 55 GLN A HE21 8  
ATOM 7136  H HE22 . GLN A 1 55 ? -14.380 29.753 -3.619 1.00 0.00 ? 55 GLN A HE22 8  
ATOM 7137  N N    . LYS A 1 1  ? -28.899 17.529 14.097 1.00 0.00 ? 1  LYS A N    9  
ATOM 7138  C CA   . LYS A 1 1  ? -28.635 16.168 13.549 1.00 0.00 ? 1  LYS A CA   9  
ATOM 7139  C C    . LYS A 1 1  ? -27.675 15.404 14.465 1.00 0.00 ? 1  LYS A C    9  
ATOM 7140  O O    . LYS A 1 1  ? -28.020 14.386 15.031 1.00 0.00 ? 1  LYS A O    9  
ATOM 7141  C CB   . LYS A 1 1  ? -27.993 16.409 12.182 1.00 0.00 ? 1  LYS A CB   9  
ATOM 7142  C CG   . LYS A 1 1  ? -28.993 17.120 11.267 1.00 0.00 ? 1  LYS A CG   9  
ATOM 7143  C CD   . LYS A 1 1  ? -28.347 17.370 9.902  1.00 0.00 ? 1  LYS A CD   9  
ATOM 7144  C CE   . LYS A 1 1  ? -29.324 18.136 9.008  1.00 0.00 ? 1  LYS A CE   9  
ATOM 7145  N NZ   . LYS A 1 1  ? -28.517 18.547 7.826  1.00 0.00 ? 1  LYS A NZ   9  
ATOM 7146  H H1   . LYS A 1 1  ? -29.081 17.461 15.119 1.00 0.00 ? 1  LYS A H1   9  
ATOM 7147  H H2   . LYS A 1 1  ? -28.072 18.137 13.931 1.00 0.00 ? 1  LYS A H2   9  
ATOM 7148  H H3   . LYS A 1 1  ? -29.728 17.939 13.623 1.00 0.00 ? 1  LYS A H3   9  
ATOM 7149  H HA   . LYS A 1 1  ? -29.558 15.622 13.431 1.00 0.00 ? 1  LYS A HA   9  
ATOM 7150  H HB2  . LYS A 1 1  ? -27.114 17.024 12.301 1.00 0.00 ? 1  LYS A HB2  9  
ATOM 7151  H HB3  . LYS A 1 1  ? -27.713 15.463 11.743 1.00 0.00 ? 1  LYS A HB3  9  
ATOM 7152  H HG2  . LYS A 1 1  ? -29.870 16.502 11.143 1.00 0.00 ? 1  LYS A HG2  9  
ATOM 7153  H HG3  . LYS A 1 1  ? -29.277 18.063 11.709 1.00 0.00 ? 1  LYS A HG3  9  
ATOM 7154  H HD2  . LYS A 1 1  ? -27.446 17.950 10.031 1.00 0.00 ? 1  LYS A HD2  9  
ATOM 7155  H HD3  . LYS A 1 1  ? -28.104 16.423 9.441  1.00 0.00 ? 1  LYS A HD3  9  
ATOM 7156  H HE2  . LYS A 1 1  ? -30.138 17.495 8.704  1.00 0.00 ? 1  LYS A HE2  9  
ATOM 7157  H HE3  . LYS A 1 1  ? -29.702 19.006 9.526  1.00 0.00 ? 1  LYS A HE3  9  
ATOM 7158  H HZ1  . LYS A 1 1  ? -27.704 19.115 8.142  1.00 0.00 ? 1  LYS A HZ1  9  
ATOM 7159  H HZ2  . LYS A 1 1  ? -28.176 17.700 7.328  1.00 0.00 ? 1  LYS A HZ2  9  
ATOM 7160  H HZ3  . LYS A 1 1  ? -29.107 19.111 7.182  1.00 0.00 ? 1  LYS A HZ3  9  
ATOM 7161  N N    . ASN A 1 2  ? -26.473 15.889 14.617 1.00 0.00 ? 2  ASN A N    9  
ATOM 7162  C CA   . ASN A 1 2  ? -25.494 15.189 15.498 1.00 0.00 ? 2  ASN A CA   9  
ATOM 7163  C C    . ASN A 1 2  ? -25.919 15.311 16.964 1.00 0.00 ? 2  ASN A C    9  
ATOM 7164  O O    . ASN A 1 2  ? -26.262 16.377 17.435 1.00 0.00 ? 2  ASN A O    9  
ATOM 7165  C CB   . ASN A 1 2  ? -24.164 15.907 15.264 1.00 0.00 ? 2  ASN A CB   9  
ATOM 7166  C CG   . ASN A 1 2  ? -23.019 15.046 15.802 1.00 0.00 ? 2  ASN A CG   9  
ATOM 7167  O OD1  . ASN A 1 2  ? -23.131 13.838 15.870 1.00 0.00 ? 2  ASN A OD1  9  
ATOM 7168  N ND2  . ASN A 1 2  ? -21.915 15.622 16.191 1.00 0.00 ? 2  ASN A ND2  9  
ATOM 7169  H H    . ASN A 1 2  ? -26.214 16.711 14.152 1.00 0.00 ? 2  ASN A H    9  
ATOM 7170  H HA   . ASN A 1 2  ? -25.407 14.151 15.216 1.00 0.00 ? 2  ASN A HA   9  
ATOM 7171  H HB2  . ASN A 1 2  ? -24.025 16.071 14.205 1.00 0.00 ? 2  ASN A HB2  9  
ATOM 7172  H HB3  . ASN A 1 2  ? -24.174 16.856 15.778 1.00 0.00 ? 2  ASN A HB3  9  
ATOM 7173  H HD21 . ASN A 1 2  ? -21.825 16.596 16.139 1.00 0.00 ? 2  ASN A HD21 9  
ATOM 7174  H HD22 . ASN A 1 2  ? -21.176 15.079 16.539 1.00 0.00 ? 2  ASN A HD22 9  
ATOM 7175  N N    . GLU A 1 3  ? -25.899 14.226 17.689 1.00 0.00 ? 3  GLU A N    9  
ATOM 7176  C CA   . GLU A 1 3  ? -26.301 14.279 19.125 1.00 0.00 ? 3  GLU A CA   9  
ATOM 7177  C C    . GLU A 1 3  ? -25.233 15.004 19.948 1.00 0.00 ? 3  GLU A C    9  
ATOM 7178  O O    . GLU A 1 3  ? -25.508 15.545 21.001 1.00 0.00 ? 3  GLU A O    9  
ATOM 7179  C CB   . GLU A 1 3  ? -26.413 12.817 19.559 1.00 0.00 ? 3  GLU A CB   9  
ATOM 7180  C CG   . GLU A 1 3  ? -27.659 12.191 18.931 1.00 0.00 ? 3  GLU A CG   9  
ATOM 7181  C CD   . GLU A 1 3  ? -27.240 11.237 17.811 1.00 0.00 ? 3  GLU A CD   9  
ATOM 7182  O OE1  . GLU A 1 3  ? -26.131 10.733 17.872 1.00 0.00 ? 3  GLU A OE1  9  
ATOM 7183  O OE2  . GLU A 1 3  ? -28.037 11.023 16.912 1.00 0.00 ? 3  GLU A OE2  9  
ATOM 7184  H H    . GLU A 1 3  ? -25.619 13.376 17.290 1.00 0.00 ? 3  GLU A H    9  
ATOM 7185  H HA   . GLU A 1 3  ? -27.256 14.769 19.230 1.00 0.00 ? 3  GLU A HA   9  
ATOM 7186  H HB2  . GLU A 1 3  ? -25.535 12.278 19.233 1.00 0.00 ? 3  GLU A HB2  9  
ATOM 7187  H HB3  . GLU A 1 3  ? -26.488 12.767 20.635 1.00 0.00 ? 3  GLU A HB3  9  
ATOM 7188  H HG2  . GLU A 1 3  ? -28.206 11.645 19.684 1.00 0.00 ? 3  GLU A HG2  9  
ATOM 7189  H HG3  . GLU A 1 3  ? -28.287 12.970 18.523 1.00 0.00 ? 3  GLU A HG3  9  
ATOM 7190  N N    . ASP A 1 4  ? -24.015 15.016 19.479 1.00 0.00 ? 4  ASP A N    9  
ATOM 7191  C CA   . ASP A 1 4  ? -22.931 15.703 20.239 1.00 0.00 ? 4  ASP A CA   9  
ATOM 7192  C C    . ASP A 1 4  ? -22.923 17.199 19.918 1.00 0.00 ? 4  ASP A C    9  
ATOM 7193  O O    . ASP A 1 4  ? -22.593 18.019 20.751 1.00 0.00 ? 4  ASP A O    9  
ATOM 7194  C CB   . ASP A 1 4  ? -21.636 15.044 19.764 1.00 0.00 ? 4  ASP A CB   9  
ATOM 7195  C CG   . ASP A 1 4  ? -21.642 13.565 20.156 1.00 0.00 ? 4  ASP A CG   9  
ATOM 7196  O OD1  . ASP A 1 4  ? -22.277 13.238 21.146 1.00 0.00 ? 4  ASP A OD1  9  
ATOM 7197  O OD2  . ASP A 1 4  ? -21.014 12.786 19.460 1.00 0.00 ? 4  ASP A OD2  9  
ATOM 7198  H H    . ASP A 1 4  ? -23.813 14.572 18.629 1.00 0.00 ? 4  ASP A H    9  
ATOM 7199  H HA   . ASP A 1 4  ? -23.057 15.546 21.297 1.00 0.00 ? 4  ASP A HA   9  
ATOM 7200  H HB2  . ASP A 1 4  ? -21.560 15.131 18.690 1.00 0.00 ? 4  ASP A HB2  9  
ATOM 7201  H HB3  . ASP A 1 4  ? -20.792 15.536 20.225 1.00 0.00 ? 4  ASP A HB3  9  
ATOM 7202  N N    . GLN A 1 5  ? -23.274 17.557 18.714 1.00 0.00 ? 5  GLN A N    9  
ATOM 7203  C CA   . GLN A 1 5  ? -23.282 19.000 18.333 1.00 0.00 ? 5  GLN A CA   9  
ATOM 7204  C C    . GLN A 1 5  ? -21.890 19.592 18.542 1.00 0.00 ? 5  GLN A C    9  
ATOM 7205  O O    . GLN A 1 5  ? -21.086 19.646 17.632 1.00 0.00 ? 5  GLN A O    9  
ATOM 7206  C CB   . GLN A 1 5  ? -24.298 19.662 19.266 1.00 0.00 ? 5  GLN A CB   9  
ATOM 7207  C CG   . GLN A 1 5  ? -25.699 19.134 18.953 1.00 0.00 ? 5  GLN A CG   9  
ATOM 7208  C CD   . GLN A 1 5  ? -26.692 19.681 19.982 1.00 0.00 ? 5  GLN A CD   9  
ATOM 7209  O OE1  . GLN A 1 5  ? -26.298 20.293 20.956 1.00 0.00 ? 5  GLN A OE1  9  
ATOM 7210  N NE2  . GLN A 1 5  ? -27.970 19.484 19.807 1.00 0.00 ? 5  GLN A NE2  9  
ATOM 7211  H H    . GLN A 1 5  ? -23.526 16.877 18.060 1.00 0.00 ? 5  GLN A H    9  
ATOM 7212  H HA   . GLN A 1 5  ? -23.591 19.118 17.308 1.00 0.00 ? 5  GLN A HA   9  
ATOM 7213  H HB2  . GLN A 1 5  ? -24.050 19.436 20.292 1.00 0.00 ? 5  GLN A HB2  9  
ATOM 7214  H HB3  . GLN A 1 5  ? -24.277 20.732 19.119 1.00 0.00 ? 5  GLN A HB3  9  
ATOM 7215  H HG2  . GLN A 1 5  ? -25.993 19.454 17.965 1.00 0.00 ? 5  GLN A HG2  9  
ATOM 7216  H HG3  . GLN A 1 5  ? -25.695 18.054 18.995 1.00 0.00 ? 5  GLN A HG3  9  
ATOM 7217  H HE21 . GLN A 1 5  ? -28.287 18.991 19.022 1.00 0.00 ? 5  GLN A HE21 9  
ATOM 7218  H HE22 . GLN A 1 5  ? -28.613 19.831 20.460 1.00 0.00 ? 5  GLN A HE22 9  
ATOM 7219  N N    . GLU A 1 6  ? -21.590 20.020 19.737 1.00 0.00 ? 6  GLU A N    9  
ATOM 7220  C CA   . GLU A 1 6  ? -20.238 20.587 20.001 1.00 0.00 ? 6  GLU A CA   9  
ATOM 7221  C C    . GLU A 1 6  ? -19.199 19.468 19.911 1.00 0.00 ? 6  GLU A C    9  
ATOM 7222  O O    . GLU A 1 6  ? -18.515 19.163 20.867 1.00 0.00 ? 6  GLU A O    9  
ATOM 7223  C CB   . GLU A 1 6  ? -20.309 21.144 21.424 1.00 0.00 ? 6  GLU A CB   9  
ATOM 7224  C CG   . GLU A 1 6  ? -21.291 22.316 21.464 1.00 0.00 ? 6  GLU A CG   9  
ATOM 7225  C CD   . GLU A 1 6  ? -21.385 22.851 22.894 1.00 0.00 ? 6  GLU A CD   9  
ATOM 7226  O OE1  . GLU A 1 6  ? -20.729 22.293 23.758 1.00 0.00 ? 6  GLU A OE1  9  
ATOM 7227  O OE2  . GLU A 1 6  ? -22.112 23.808 23.101 1.00 0.00 ? 6  GLU A OE2  9  
ATOM 7228  H H    . GLU A 1 6  ? -22.247 19.956 20.460 1.00 0.00 ? 6  GLU A H    9  
ATOM 7229  H HA   . GLU A 1 6  ? -20.012 21.375 19.301 1.00 0.00 ? 6  GLU A HA   9  
ATOM 7230  H HB2  . GLU A 1 6  ? -20.645 20.370 22.097 1.00 0.00 ? 6  GLU A HB2  9  
ATOM 7231  H HB3  . GLU A 1 6  ? -19.329 21.484 21.726 1.00 0.00 ? 6  GLU A HB3  9  
ATOM 7232  H HG2  . GLU A 1 6  ? -20.943 23.101 20.809 1.00 0.00 ? 6  GLU A HG2  9  
ATOM 7233  H HG3  . GLU A 1 6  ? -22.265 21.982 21.139 1.00 0.00 ? 6  GLU A HG3  9  
ATOM 7234  N N    . MET A 1 7  ? -19.092 18.845 18.767 1.00 0.00 ? 7  MET A N    9  
ATOM 7235  C CA   . MET A 1 7  ? -18.114 17.732 18.602 1.00 0.00 ? 7  MET A CA   9  
ATOM 7236  C C    . MET A 1 7  ? -16.804 18.055 19.326 1.00 0.00 ? 7  MET A C    9  
ATOM 7237  O O    . MET A 1 7  ? -16.111 17.175 19.797 1.00 0.00 ? 7  MET A O    9  
ATOM 7238  C CB   . MET A 1 7  ? -17.881 17.634 17.095 1.00 0.00 ? 7  MET A CB   9  
ATOM 7239  C CG   . MET A 1 7  ? -19.125 17.047 16.424 1.00 0.00 ? 7  MET A CG   9  
ATOM 7240  S SD   . MET A 1 7  ? -18.797 16.793 14.662 1.00 0.00 ? 7  MET A SD   9  
ATOM 7241  C CE   . MET A 1 7  ? -18.653 14.990 14.716 1.00 0.00 ? 7  MET A CE   9  
ATOM 7242  H H    . MET A 1 7  ? -19.664 19.104 18.016 1.00 0.00 ? 7  MET A H    9  
ATOM 7243  H HA   . MET A 1 7  ? -18.536 16.809 18.969 1.00 0.00 ? 7  MET A HA   9  
ATOM 7244  H HB2  . MET A 1 7  ? -17.688 18.619 16.696 1.00 0.00 ? 7  MET A HB2  9  
ATOM 7245  H HB3  . MET A 1 7  ? -17.033 16.995 16.902 1.00 0.00 ? 7  MET A HB3  9  
ATOM 7246  H HG2  . MET A 1 7  ? -19.369 16.101 16.884 1.00 0.00 ? 7  MET A HG2  9  
ATOM 7247  H HG3  . MET A 1 7  ? -19.953 17.729 16.541 1.00 0.00 ? 7  MET A HG3  9  
ATOM 7248  H HE1  . MET A 1 7  ? -18.076 14.700 15.579 1.00 0.00 ? 7  MET A HE1  9  
ATOM 7249  H HE2  . MET A 1 7  ? -19.639 14.553 14.783 1.00 0.00 ? 7  MET A HE2  9  
ATOM 7250  H HE3  . MET A 1 7  ? -18.157 14.642 13.820 1.00 0.00 ? 7  MET A HE3  9  
ATOM 7251  N N    . CYS A 1 8  ? -16.460 19.311 19.417 1.00 0.00 ? 8  CYS A N    9  
ATOM 7252  C CA   . CYS A 1 8  ? -15.194 19.690 20.109 1.00 0.00 ? 8  CYS A CA   9  
ATOM 7253  C C    . CYS A 1 8  ? -15.489 20.179 21.529 1.00 0.00 ? 8  CYS A C    9  
ATOM 7254  O O    . CYS A 1 8  ? -16.353 21.007 21.744 1.00 0.00 ? 8  CYS A O    9  
ATOM 7255  C CB   . CYS A 1 8  ? -14.606 20.821 19.266 1.00 0.00 ? 8  CYS A CB   9  
ATOM 7256  S SG   . CYS A 1 8  ? -13.786 20.126 17.811 1.00 0.00 ? 8  CYS A SG   9  
ATOM 7257  H H    . CYS A 1 8  ? -17.032 20.005 19.030 1.00 0.00 ? 8  CYS A H    9  
ATOM 7258  H HA   . CYS A 1 8  ? -14.512 18.855 20.131 1.00 0.00 ? 8  CYS A HA   9  
ATOM 7259  H HB2  . CYS A 1 8  ? -15.398 21.485 18.950 1.00 0.00 ? 8  CYS A HB2  9  
ATOM 7260  H HB3  . CYS A 1 8  ? -13.888 21.373 19.854 1.00 0.00 ? 8  CYS A HB3  9  
ATOM 7261  N N    . HIS A 1 9  ? -14.778 19.674 22.500 1.00 0.00 ? 9  HIS A N    9  
ATOM 7262  C CA   . HIS A 1 9  ? -15.018 20.113 23.905 1.00 0.00 ? 9  HIS A CA   9  
ATOM 7263  C C    . HIS A 1 9  ? -13.690 20.453 24.587 1.00 0.00 ? 9  HIS A C    9  
ATOM 7264  O O    . HIS A 1 9  ? -13.565 21.458 25.259 1.00 0.00 ? 9  HIS A O    9  
ATOM 7265  C CB   . HIS A 1 9  ? -15.675 18.915 24.591 1.00 0.00 ? 9  HIS A CB   9  
ATOM 7266  C CG   . HIS A 1 9  ? -16.002 19.270 26.015 1.00 0.00 ? 9  HIS A CG   9  
ATOM 7267  N ND1  . HIS A 1 9  ? -16.603 18.373 26.883 1.00 0.00 ? 9  HIS A ND1  9  
ATOM 7268  C CD2  . HIS A 1 9  ? -15.818 20.424 26.736 1.00 0.00 ? 9  HIS A CD2  9  
ATOM 7269  C CE1  . HIS A 1 9  ? -16.758 18.996 28.066 1.00 0.00 ? 9  HIS A CE1  9  
ATOM 7270  N NE2  . HIS A 1 9  ? -16.296 20.249 28.031 1.00 0.00 ? 9  HIS A NE2  9  
ATOM 7271  H H    . HIS A 1 9  ? -14.086 19.009 22.306 1.00 0.00 ? 9  HIS A H    9  
ATOM 7272  H HA   . HIS A 1 9  ? -15.683 20.961 23.929 1.00 0.00 ? 9  HIS A HA   9  
ATOM 7273  H HB2  . HIS A 1 9  ? -16.583 18.653 24.067 1.00 0.00 ? 9  HIS A HB2  9  
ATOM 7274  H HB3  . HIS A 1 9  ? -14.996 18.075 24.577 1.00 0.00 ? 9  HIS A HB3  9  
ATOM 7275  H HD1  . HIS A 1 9  ? -16.866 17.453 26.675 1.00 0.00 ? 9  HIS A HD1  9  
ATOM 7276  H HD2  . HIS A 1 9  ? -15.370 21.330 26.356 1.00 0.00 ? 9  HIS A HD2  9  
ATOM 7277  H HE1  . HIS A 1 9  ? -17.202 18.538 28.938 1.00 0.00 ? 9  HIS A HE1  9  
ATOM 7278  N N    . GLU A 1 10 ? -12.698 19.623 24.419 1.00 0.00 ? 10 GLU A N    9  
ATOM 7279  C CA   . GLU A 1 10 ? -11.379 19.898 25.057 1.00 0.00 ? 10 GLU A CA   9  
ATOM 7280  C C    . GLU A 1 10 ? -10.591 20.917 24.231 1.00 0.00 ? 10 GLU A C    9  
ATOM 7281  O O    . GLU A 1 10 ? -10.029 21.856 24.760 1.00 0.00 ? 10 GLU A O    9  
ATOM 7282  C CB   . GLU A 1 10 ? -10.658 18.549 25.072 1.00 0.00 ? 10 GLU A CB   9  
ATOM 7283  C CG   . GLU A 1 10 ? -11.164 17.714 26.249 1.00 0.00 ? 10 GLU A CG   9  
ATOM 7284  C CD   . GLU A 1 10 ? -11.005 18.509 27.546 1.00 0.00 ? 10 GLU A CD   9  
ATOM 7285  O OE1  . GLU A 1 10 ? -9.873  18.756 27.931 1.00 0.00 ? 10 GLU A OE1  9  
ATOM 7286  O OE2  . GLU A 1 10 ? -12.016 18.859 28.132 1.00 0.00 ? 10 GLU A OE2  9  
ATOM 7287  H H    . GLU A 1 10 ? -12.820 18.818 23.874 1.00 0.00 ? 10 GLU A H    9  
ATOM 7288  H HA   . GLU A 1 10 ? -11.516 20.253 26.066 1.00 0.00 ? 10 GLU A HA   9  
ATOM 7289  H HB2  . GLU A 1 10 ? -10.856 18.026 24.147 1.00 0.00 ? 10 GLU A HB2  9  
ATOM 7290  H HB3  . GLU A 1 10 ? -9.595  18.710 25.175 1.00 0.00 ? 10 GLU A HB3  9  
ATOM 7291  H HG2  . GLU A 1 10 ? -12.206 17.474 26.099 1.00 0.00 ? 10 GLU A HG2  9  
ATOM 7292  H HG3  . GLU A 1 10 ? -10.590 16.801 26.314 1.00 0.00 ? 10 GLU A HG3  9  
ATOM 7293  N N    . PHE A 1 11 ? -10.543 20.742 22.939 1.00 0.00 ? 11 PHE A N    9  
ATOM 7294  C CA   . PHE A 1 11 ? -9.789  21.702 22.085 1.00 0.00 ? 11 PHE A CA   9  
ATOM 7295  C C    . PHE A 1 11 ? -10.457 23.076 22.114 1.00 0.00 ? 11 PHE A C    9  
ATOM 7296  O O    . PHE A 1 11 ? -9.841  24.078 21.819 1.00 0.00 ? 11 PHE A O    9  
ATOM 7297  C CB   . PHE A 1 11 ? -9.849  21.120 20.677 1.00 0.00 ? 11 PHE A CB   9  
ATOM 7298  C CG   . PHE A 1 11 ? -8.905  19.947 20.566 1.00 0.00 ? 11 PHE A CG   9  
ATOM 7299  C CD1  . PHE A 1 11 ? -7.576  20.154 20.176 1.00 0.00 ? 11 PHE A CD1  9  
ATOM 7300  C CD2  . PHE A 1 11 ? -9.358  18.652 20.846 1.00 0.00 ? 11 PHE A CD2  9  
ATOM 7301  C CE1  . PHE A 1 11 ? -6.701  19.068 20.065 1.00 0.00 ? 11 PHE A CE1  9  
ATOM 7302  C CE2  . PHE A 1 11 ? -8.483  17.566 20.734 1.00 0.00 ? 11 PHE A CE2  9  
ATOM 7303  C CZ   . PHE A 1 11 ? -7.155  17.774 20.343 1.00 0.00 ? 11 PHE A CZ   9  
ATOM 7304  H H    . PHE A 1 11 ? -11.003 19.977 22.531 1.00 0.00 ? 11 PHE A H    9  
ATOM 7305  H HA   . PHE A 1 11 ? -8.765  21.772 22.411 1.00 0.00 ? 11 PHE A HA   9  
ATOM 7306  H HB2  . PHE A 1 11 ? -10.855 20.797 20.470 1.00 0.00 ? 11 PHE A HB2  9  
ATOM 7307  H HB3  . PHE A 1 11 ? -9.563  21.880 19.964 1.00 0.00 ? 11 PHE A HB3  9  
ATOM 7308  H HD1  . PHE A 1 11 ? -7.225  21.153 19.965 1.00 0.00 ? 11 PHE A HD1  9  
ATOM 7309  H HD2  . PHE A 1 11 ? -10.381 18.490 21.148 1.00 0.00 ? 11 PHE A HD2  9  
ATOM 7310  H HE1  . PHE A 1 11 ? -5.676  19.228 19.764 1.00 0.00 ? 11 PHE A HE1  9  
ATOM 7311  H HE2  . PHE A 1 11 ? -8.832  16.567 20.949 1.00 0.00 ? 11 PHE A HE2  9  
ATOM 7312  H HZ   . PHE A 1 11 ? -6.481  16.936 20.257 1.00 0.00 ? 11 PHE A HZ   9  
ATOM 7313  N N    . GLN A 1 12 ? -11.713 23.136 22.466 1.00 0.00 ? 12 GLN A N    9  
ATOM 7314  C CA   . GLN A 1 12 ? -12.399 24.458 22.509 1.00 0.00 ? 12 GLN A CA   9  
ATOM 7315  C C    . GLN A 1 12 ? -11.506 25.467 23.228 1.00 0.00 ? 12 GLN A C    9  
ATOM 7316  O O    . GLN A 1 12 ? -11.287 26.564 22.758 1.00 0.00 ? 12 GLN A O    9  
ATOM 7317  C CB   . GLN A 1 12 ? -13.687 24.223 23.296 1.00 0.00 ? 12 GLN A CB   9  
ATOM 7318  C CG   . GLN A 1 12 ? -14.463 25.539 23.398 1.00 0.00 ? 12 GLN A CG   9  
ATOM 7319  C CD   . GLN A 1 12 ? -15.520 25.425 24.497 1.00 0.00 ? 12 GLN A CD   9  
ATOM 7320  O OE1  . GLN A 1 12 ? -15.644 24.399 25.135 1.00 0.00 ? 12 GLN A OE1  9  
ATOM 7321  N NE2  . GLN A 1 12 ? -16.295 26.445 24.748 1.00 0.00 ? 12 GLN A NE2  9  
ATOM 7322  H H    . GLN A 1 12 ? -12.201 22.319 22.699 1.00 0.00 ? 12 GLN A H    9  
ATOM 7323  H HA   . GLN A 1 12 ? -12.628 24.800 21.511 1.00 0.00 ? 12 GLN A HA   9  
ATOM 7324  H HB2  . GLN A 1 12 ? -14.291 23.487 22.787 1.00 0.00 ? 12 GLN A HB2  9  
ATOM 7325  H HB3  . GLN A 1 12 ? -13.445 23.870 24.287 1.00 0.00 ? 12 GLN A HB3  9  
ATOM 7326  H HG2  . GLN A 1 12 ? -13.780 26.341 23.635 1.00 0.00 ? 12 GLN A HG2  9  
ATOM 7327  H HG3  . GLN A 1 12 ? -14.945 25.746 22.454 1.00 0.00 ? 12 GLN A HG3  9  
ATOM 7328  H HE21 . GLN A 1 12 ? -16.195 27.275 24.234 1.00 0.00 ? 12 GLN A HE21 9  
ATOM 7329  H HE22 . GLN A 1 12 ? -16.975 26.383 25.450 1.00 0.00 ? 12 GLN A HE22 9  
ATOM 7330  N N    . ALA A 1 13 ? -10.978 25.098 24.363 1.00 0.00 ? 13 ALA A N    9  
ATOM 7331  C CA   . ALA A 1 13 ? -10.089 26.032 25.105 1.00 0.00 ? 13 ALA A CA   9  
ATOM 7332  C C    . ALA A 1 13 ? -8.915  26.441 24.215 1.00 0.00 ? 13 ALA A C    9  
ATOM 7333  O O    . ALA A 1 13 ? -8.247  27.425 24.463 1.00 0.00 ? 13 ALA A O    9  
ATOM 7334  C CB   . ALA A 1 13 ? -9.596  25.236 26.313 1.00 0.00 ? 13 ALA A CB   9  
ATOM 7335  H H    . ALA A 1 13 ? -11.161 24.205 24.722 1.00 0.00 ? 13 ALA A H    9  
ATOM 7336  H HA   . ALA A 1 13 ? -10.640 26.900 25.432 1.00 0.00 ? 13 ALA A HA   9  
ATOM 7337  H HB1  . ALA A 1 13 ? -8.671  25.662 26.673 1.00 0.00 ? 13 ALA A HB1  9  
ATOM 7338  H HB2  . ALA A 1 13 ? -10.337 25.273 27.098 1.00 0.00 ? 13 ALA A HB2  9  
ATOM 7339  H HB3  . ALA A 1 13 ? -9.430  24.208 26.024 1.00 0.00 ? 13 ALA A HB3  9  
ATOM 7340  N N    . PHE A 1 14 ? -8.658  25.690 23.175 1.00 0.00 ? 14 PHE A N    9  
ATOM 7341  C CA   . PHE A 1 14 ? -7.530  26.035 22.270 1.00 0.00 ? 14 PHE A CA   9  
ATOM 7342  C C    . PHE A 1 14 ? -8.009  26.964 21.150 1.00 0.00 ? 14 PHE A C    9  
ATOM 7343  O O    . PHE A 1 14 ? -7.348  27.128 20.144 1.00 0.00 ? 14 PHE A O    9  
ATOM 7344  C CB   . PHE A 1 14 ? -7.073  24.697 21.690 1.00 0.00 ? 14 PHE A CB   9  
ATOM 7345  C CG   . PHE A 1 14 ? -6.722  23.735 22.803 1.00 0.00 ? 14 PHE A CG   9  
ATOM 7346  C CD1  . PHE A 1 14 ? -6.600  24.190 24.125 1.00 0.00 ? 14 PHE A CD1  9  
ATOM 7347  C CD2  . PHE A 1 14 ? -6.516  22.384 22.509 1.00 0.00 ? 14 PHE A CD2  9  
ATOM 7348  C CE1  . PHE A 1 14 ? -6.275  23.289 25.147 1.00 0.00 ? 14 PHE A CE1  9  
ATOM 7349  C CE2  . PHE A 1 14 ? -6.191  21.484 23.530 1.00 0.00 ? 14 PHE A CE2  9  
ATOM 7350  C CZ   . PHE A 1 14 ? -6.070  21.937 24.850 1.00 0.00 ? 14 PHE A CZ   9  
ATOM 7351  H H    . PHE A 1 14 ? -9.207  24.898 22.990 1.00 0.00 ? 14 PHE A H    9  
ATOM 7352  H HA   . PHE A 1 14 ? -6.725  26.490 22.824 1.00 0.00 ? 14 PHE A HA   9  
ATOM 7353  H HB2  . PHE A 1 14 ? -7.869  24.276 21.092 1.00 0.00 ? 14 PHE A HB2  9  
ATOM 7354  H HB3  . PHE A 1 14 ? -6.208  24.855 21.068 1.00 0.00 ? 14 PHE A HB3  9  
ATOM 7355  H HD1  . PHE A 1 14 ? -6.758  25.233 24.354 1.00 0.00 ? 14 PHE A HD1  9  
ATOM 7356  H HD2  . PHE A 1 14 ? -6.609  22.034 21.492 1.00 0.00 ? 14 PHE A HD2  9  
ATOM 7357  H HE1  . PHE A 1 14 ? -6.181  23.639 26.165 1.00 0.00 ? 14 PHE A HE1  9  
ATOM 7358  H HE2  . PHE A 1 14 ? -6.034  20.441 23.299 1.00 0.00 ? 14 PHE A HE2  9  
ATOM 7359  H HZ   . PHE A 1 14 ? -5.819  21.242 25.637 1.00 0.00 ? 14 PHE A HZ   9  
ATOM 7360  N N    . MET A 1 15 ? -9.156  27.566 21.311 1.00 0.00 ? 15 MET A N    9  
ATOM 7361  C CA   . MET A 1 15 ? -9.674  28.473 20.253 1.00 0.00 ? 15 MET A CA   9  
ATOM 7362  C C    . MET A 1 15 ? -9.432  29.937 20.639 1.00 0.00 ? 15 MET A C    9  
ATOM 7363  O O    . MET A 1 15 ? -9.977  30.435 21.604 1.00 0.00 ? 15 MET A O    9  
ATOM 7364  C CB   . MET A 1 15 ? -11.168 28.167 20.181 1.00 0.00 ? 15 MET A CB   9  
ATOM 7365  C CG   . MET A 1 15 ? -11.876 28.729 21.417 1.00 0.00 ? 15 MET A CG   9  
ATOM 7366  S SD   . MET A 1 15 ? -13.444 27.859 21.660 1.00 0.00 ? 15 MET A SD   9  
ATOM 7367  C CE   . MET A 1 15 ? -14.314 29.193 22.520 1.00 0.00 ? 15 MET A CE   9  
ATOM 7368  H H    . MET A 1 15 ? -9.681  27.416 22.121 1.00 0.00 ? 15 MET A H    9  
ATOM 7369  H HA   . MET A 1 15 ? -9.207  28.252 19.306 1.00 0.00 ? 15 MET A HA   9  
ATOM 7370  H HB2  . MET A 1 15 ? -11.582 28.618 19.297 1.00 0.00 ? 15 MET A HB2  9  
ATOM 7371  H HB3  . MET A 1 15 ? -11.314 27.097 20.139 1.00 0.00 ? 15 MET A HB3  9  
ATOM 7372  H HG2  . MET A 1 15 ? -11.249 28.594 22.285 1.00 0.00 ? 15 MET A HG2  9  
ATOM 7373  H HG3  . MET A 1 15 ? -12.068 29.781 21.273 1.00 0.00 ? 15 MET A HG3  9  
ATOM 7374  H HE1  . MET A 1 15 ? -13.685 30.073 22.545 1.00 0.00 ? 15 MET A HE1  9  
ATOM 7375  H HE2  . MET A 1 15 ? -15.234 29.416 21.998 1.00 0.00 ? 15 MET A HE2  9  
ATOM 7376  H HE3  . MET A 1 15 ? -14.539 28.887 23.528 1.00 0.00 ? 15 MET A HE3  9  
ATOM 7377  N N    . LYS A 1 16 ? -8.615  30.629 19.891 1.00 0.00 ? 16 LYS A N    9  
ATOM 7378  C CA   . LYS A 1 16 ? -8.339  32.058 20.213 1.00 0.00 ? 16 LYS A CA   9  
ATOM 7379  C C    . LYS A 1 16 ? -9.282  32.969 19.421 1.00 0.00 ? 16 LYS A C    9  
ATOM 7380  O O    . LYS A 1 16 ? -8.918  33.520 18.402 1.00 0.00 ? 16 LYS A O    9  
ATOM 7381  C CB   . LYS A 1 16 ? -6.890  32.290 19.783 1.00 0.00 ? 16 LYS A CB   9  
ATOM 7382  C CG   . LYS A 1 16 ? -6.514  33.752 20.028 1.00 0.00 ? 16 LYS A CG   9  
ATOM 7383  C CD   . LYS A 1 16 ? -5.155  34.041 19.388 1.00 0.00 ? 16 LYS A CD   9  
ATOM 7384  C CE   . LYS A 1 16 ? -4.702  35.452 19.771 1.00 0.00 ? 16 LYS A CE   9  
ATOM 7385  N NZ   . LYS A 1 16 ? -3.374  35.616 19.114 1.00 0.00 ? 16 LYS A NZ   9  
ATOM 7386  H H    . LYS A 1 16 ? -8.185  30.210 19.119 1.00 0.00 ? 16 LYS A H    9  
ATOM 7387  H HA   . LYS A 1 16 ? -8.442  32.235 21.272 1.00 0.00 ? 16 LYS A HA   9  
ATOM 7388  H HB2  . LYS A 1 16 ? -6.237  31.651 20.357 1.00 0.00 ? 16 LYS A HB2  9  
ATOM 7389  H HB3  . LYS A 1 16 ? -6.785  32.061 18.733 1.00 0.00 ? 16 LYS A HB3  9  
ATOM 7390  H HG2  . LYS A 1 16 ? -7.263  34.395 19.590 1.00 0.00 ? 16 LYS A HG2  9  
ATOM 7391  H HG3  . LYS A 1 16 ? -6.458  33.936 21.090 1.00 0.00 ? 16 LYS A HG3  9  
ATOM 7392  H HD2  . LYS A 1 16 ? -4.431  33.322 19.740 1.00 0.00 ? 16 LYS A HD2  9  
ATOM 7393  H HD3  . LYS A 1 16 ? -5.240  33.970 18.314 1.00 0.00 ? 16 LYS A HD3  9  
ATOM 7394  H HE2  . LYS A 1 16 ? -5.401  36.185 19.397 1.00 0.00 ? 16 LYS A HE2  9  
ATOM 7395  H HE3  . LYS A 1 16 ? -4.603  35.536 20.843 1.00 0.00 ? 16 LYS A HE3  9  
ATOM 7396  H HZ1  . LYS A 1 16 ? -3.318  34.992 18.285 1.00 0.00 ? 16 LYS A HZ1  9  
ATOM 7397  H HZ2  . LYS A 1 16 ? -3.257  36.603 18.810 1.00 0.00 ? 16 LYS A HZ2  9  
ATOM 7398  H HZ3  . LYS A 1 16 ? -2.621  35.368 19.787 1.00 0.00 ? 16 LYS A HZ3  9  
ATOM 7399  N N    . ASN A 1 17 ? -10.492 33.131 19.884 1.00 0.00 ? 17 ASN A N    9  
ATOM 7400  C CA   . ASN A 1 17 ? -11.456 34.007 19.157 1.00 0.00 ? 17 ASN A CA   9  
ATOM 7401  C C    . ASN A 1 17 ? -11.777 33.420 17.779 1.00 0.00 ? 17 ASN A C    9  
ATOM 7402  O O    . ASN A 1 17 ? -11.587 34.057 16.764 1.00 0.00 ? 17 ASN A O    9  
ATOM 7403  C CB   . ASN A 1 17 ? -10.739 35.350 19.012 1.00 0.00 ? 17 ASN A CB   9  
ATOM 7404  C CG   . ASN A 1 17 ? -11.765 36.446 18.718 1.00 0.00 ? 17 ASN A CG   9  
ATOM 7405  O OD1  . ASN A 1 17 ? -12.534 36.341 17.784 1.00 0.00 ? 17 ASN A OD1  9  
ATOM 7406  N ND2  . ASN A 1 17 ? -11.808 37.502 19.484 1.00 0.00 ? 17 ASN A ND2  9  
ATOM 7407  H H    . ASN A 1 17 ? -10.766 32.678 20.708 1.00 0.00 ? 17 ASN A H    9  
ATOM 7408  H HA   . ASN A 1 17 ? -12.358 34.132 19.733 1.00 0.00 ? 17 ASN A HA   9  
ATOM 7409  H HB2  . ASN A 1 17 ? -10.219 35.581 19.930 1.00 0.00 ? 17 ASN A HB2  9  
ATOM 7410  H HB3  . ASN A 1 17 ? -10.030 35.294 18.200 1.00 0.00 ? 17 ASN A HB3  9  
ATOM 7411  H HD21 . ASN A 1 17 ? -11.187 37.588 20.237 1.00 0.00 ? 17 ASN A HD21 9  
ATOM 7412  H HD22 . ASN A 1 17 ? -12.462 38.209 19.304 1.00 0.00 ? 17 ASN A HD22 9  
ATOM 7413  N N    . GLY A 1 18 ? -12.265 32.209 17.738 1.00 0.00 ? 18 GLY A N    9  
ATOM 7414  C CA   . GLY A 1 18 ? -12.600 31.587 16.425 1.00 0.00 ? 18 GLY A CA   9  
ATOM 7415  C C    . GLY A 1 18 ? -11.347 30.949 15.822 1.00 0.00 ? 18 GLY A C    9  
ATOM 7416  O O    . GLY A 1 18 ? -11.418 30.214 14.856 1.00 0.00 ? 18 GLY A O    9  
ATOM 7417  H H    . GLY A 1 18 ? -12.414 31.712 18.568 1.00 0.00 ? 18 GLY A H    9  
ATOM 7418  H HA2  . GLY A 1 18 ? -13.356 30.830 16.569 1.00 0.00 ? 18 GLY A HA2  9  
ATOM 7419  H HA3  . GLY A 1 18 ? -12.975 32.346 15.754 1.00 0.00 ? 18 GLY A HA3  9  
ATOM 7420  N N    . LYS A 1 19 ? -10.201 31.220 16.383 1.00 0.00 ? 19 LYS A N    9  
ATOM 7421  C CA   . LYS A 1 19 ? -8.947  30.625 15.837 1.00 0.00 ? 19 LYS A CA   9  
ATOM 7422  C C    . LYS A 1 19 ? -8.572  29.365 16.622 1.00 0.00 ? 19 LYS A C    9  
ATOM 7423  O O    . LYS A 1 19 ? -8.235  29.425 17.786 1.00 0.00 ? 19 LYS A O    9  
ATOM 7424  C CB   . LYS A 1 19 ? -7.882  31.707 16.019 1.00 0.00 ? 19 LYS A CB   9  
ATOM 7425  C CG   . LYS A 1 19 ? -6.724  31.452 15.052 1.00 0.00 ? 19 LYS A CG   9  
ATOM 7426  C CD   . LYS A 1 19 ? -5.961  30.201 15.489 1.00 0.00 ? 19 LYS A CD   9  
ATOM 7427  C CE   . LYS A 1 19 ? -4.708  30.040 14.628 1.00 0.00 ? 19 LYS A CE   9  
ATOM 7428  N NZ   . LYS A 1 19 ? -5.183  29.368 13.385 1.00 0.00 ? 19 LYS A NZ   9  
ATOM 7429  H H    . LYS A 1 19 ? -10.163 31.814 17.162 1.00 0.00 ? 19 LYS A H    9  
ATOM 7430  H HA   . LYS A 1 19 ? -9.063  30.396 14.789 1.00 0.00 ? 19 LYS A HA   9  
ATOM 7431  H HB2  . LYS A 1 19 ? -8.314  32.676 15.815 1.00 0.00 ? 19 LYS A HB2  9  
ATOM 7432  H HB3  . LYS A 1 19 ? -7.514  31.684 17.035 1.00 0.00 ? 19 LYS A HB3  9  
ATOM 7433  H HG2  . LYS A 1 19 ? -7.113  31.308 14.055 1.00 0.00 ? 19 LYS A HG2  9  
ATOM 7434  H HG3  . LYS A 1 19 ? -6.057  32.301 15.057 1.00 0.00 ? 19 LYS A HG3  9  
ATOM 7435  H HD2  . LYS A 1 19 ? -5.676  30.297 16.526 1.00 0.00 ? 19 LYS A HD2  9  
ATOM 7436  H HD3  . LYS A 1 19 ? -6.594  29.334 15.368 1.00 0.00 ? 19 LYS A HD3  9  
ATOM 7437  H HE2  . LYS A 1 19 ? -4.285  31.006 14.395 1.00 0.00 ? 19 LYS A HE2  9  
ATOM 7438  H HE3  . LYS A 1 19 ? -3.980  29.422 15.134 1.00 0.00 ? 19 LYS A HE3  9  
ATOM 7439  H HZ1  . LYS A 1 19 ? -5.833  28.595 13.637 1.00 0.00 ? 19 LYS A HZ1  9  
ATOM 7440  H HZ2  . LYS A 1 19 ? -5.678  30.058 12.786 1.00 0.00 ? 19 LYS A HZ2  9  
ATOM 7441  H HZ3  . LYS A 1 19 ? -4.369  28.982 12.866 1.00 0.00 ? 19 LYS A HZ3  9  
ATOM 7442  N N    . LEU A 1 20 ? -8.628  28.223 15.993 1.00 0.00 ? 20 LEU A N    9  
ATOM 7443  C CA   . LEU A 1 20 ? -8.274  26.963 16.706 1.00 0.00 ? 20 LEU A CA   9  
ATOM 7444  C C    . LEU A 1 20 ? -6.792  26.638 16.502 1.00 0.00 ? 20 LEU A C    9  
ATOM 7445  O O    . LEU A 1 20 ? -6.388  26.175 15.454 1.00 0.00 ? 20 LEU A O    9  
ATOM 7446  C CB   . LEU A 1 20 ? -9.151  25.887 16.063 1.00 0.00 ? 20 LEU A CB   9  
ATOM 7447  C CG   . LEU A 1 20 ? -9.310  24.706 17.026 1.00 0.00 ? 20 LEU A CG   9  
ATOM 7448  C CD1  . LEU A 1 20 ? -9.890  23.508 16.271 1.00 0.00 ? 20 LEU A CD1  9  
ATOM 7449  C CD2  . LEU A 1 20 ? -7.947  24.328 17.608 1.00 0.00 ? 20 LEU A CD2  9  
ATOM 7450  H H    . LEU A 1 20 ? -8.902  28.195 15.052 1.00 0.00 ? 20 LEU A H    9  
ATOM 7451  H HA   . LEU A 1 20 ? -8.502  27.046 17.756 1.00 0.00 ? 20 LEU A HA   9  
ATOM 7452  H HB2  . LEU A 1 20 ? -10.122 26.301 15.839 1.00 0.00 ? 20 LEU A HB2  9  
ATOM 7453  H HB3  . LEU A 1 20 ? -8.687  25.545 15.149 1.00 0.00 ? 20 LEU A HB3  9  
ATOM 7454  H HG   . LEU A 1 20 ? -9.979  24.984 17.827 1.00 0.00 ? 20 LEU A HG   9  
ATOM 7455  H HD11 . LEU A 1 20 ? -10.588 23.856 15.524 1.00 0.00 ? 20 LEU A HD11 9  
ATOM 7456  H HD12 . LEU A 1 20 ? -9.090  22.964 15.791 1.00 0.00 ? 20 LEU A HD12 9  
ATOM 7457  H HD13 . LEU A 1 20 ? -10.401 22.858 16.965 1.00 0.00 ? 20 LEU A HD13 9  
ATOM 7458  H HD21 . LEU A 1 20 ? -7.229  24.225 16.807 1.00 0.00 ? 20 LEU A HD21 9  
ATOM 7459  H HD22 . LEU A 1 20 ? -7.619  25.101 18.288 1.00 0.00 ? 20 LEU A HD22 9  
ATOM 7460  H HD23 . LEU A 1 20 ? -8.029  23.391 18.140 1.00 0.00 ? 20 LEU A HD23 9  
ATOM 7461  N N    . PHE A 1 21 ? -5.977  26.866 17.497 1.00 0.00 ? 21 PHE A N    9  
ATOM 7462  C CA   . PHE A 1 21 ? -4.524  26.554 17.348 1.00 0.00 ? 21 PHE A CA   9  
ATOM 7463  C C    . PHE A 1 21 ? -4.232  25.154 17.895 1.00 0.00 ? 21 PHE A C    9  
ATOM 7464  O O    . PHE A 1 21 ? -3.513  24.986 18.858 1.00 0.00 ? 21 PHE A O    9  
ATOM 7465  C CB   . PHE A 1 21 ? -3.765  27.629 18.140 1.00 0.00 ? 21 PHE A CB   9  
ATOM 7466  C CG   . PHE A 1 21 ? -4.425  27.879 19.479 1.00 0.00 ? 21 PHE A CG   9  
ATOM 7467  C CD1  . PHE A 1 21 ? -4.101  27.082 20.584 1.00 0.00 ? 21 PHE A CD1  9  
ATOM 7468  C CD2  . PHE A 1 21 ? -5.355  28.918 19.617 1.00 0.00 ? 21 PHE A CD2  9  
ATOM 7469  C CE1  . PHE A 1 21 ? -4.706  27.321 21.823 1.00 0.00 ? 21 PHE A CE1  9  
ATOM 7470  C CE2  . PHE A 1 21 ? -5.959  29.157 20.856 1.00 0.00 ? 21 PHE A CE2  9  
ATOM 7471  C CZ   . PHE A 1 21 ? -5.636  28.359 21.959 1.00 0.00 ? 21 PHE A CZ   9  
ATOM 7472  H H    . PHE A 1 21 ? -6.321  27.231 18.338 1.00 0.00 ? 21 PHE A H    9  
ATOM 7473  H HA   . PHE A 1 21 ? -4.244  26.606 16.305 1.00 0.00 ? 21 PHE A HA   9  
ATOM 7474  H HB2  . PHE A 1 21 ? -2.749  27.301 18.302 1.00 0.00 ? 21 PHE A HB2  9  
ATOM 7475  H HB3  . PHE A 1 21 ? -3.756  28.548 17.574 1.00 0.00 ? 21 PHE A HB3  9  
ATOM 7476  H HD1  . PHE A 1 21 ? -3.383  26.282 20.481 1.00 0.00 ? 21 PHE A HD1  9  
ATOM 7477  H HD2  . PHE A 1 21 ? -5.606  29.534 18.765 1.00 0.00 ? 21 PHE A HD2  9  
ATOM 7478  H HE1  . PHE A 1 21 ? -4.456  26.705 22.674 1.00 0.00 ? 21 PHE A HE1  9  
ATOM 7479  H HE2  . PHE A 1 21 ? -6.677  29.957 20.963 1.00 0.00 ? 21 PHE A HE2  9  
ATOM 7480  H HZ   . PHE A 1 21 ? -6.101  28.544 22.915 1.00 0.00 ? 21 PHE A HZ   9  
ATOM 7481  N N    . CYS A 1 22 ? -4.790  24.147 17.278 1.00 0.00 ? 22 CYS A N    9  
ATOM 7482  C CA   . CYS A 1 22 ? -4.557  22.751 17.746 1.00 0.00 ? 22 CYS A CA   9  
ATOM 7483  C C    . CYS A 1 22 ? -3.058  22.459 17.927 1.00 0.00 ? 22 CYS A C    9  
ATOM 7484  O O    . CYS A 1 22 ? -2.667  21.909 18.937 1.00 0.00 ? 22 CYS A O    9  
ATOM 7485  C CB   . CYS A 1 22 ? -5.149  21.860 16.654 1.00 0.00 ? 22 CYS A CB   9  
ATOM 7486  S SG   . CYS A 1 22 ? -5.960  20.433 17.414 1.00 0.00 ? 22 CYS A SG   9  
ATOM 7487  H H    . CYS A 1 22 ? -5.365  24.311 16.502 1.00 0.00 ? 22 CYS A H    9  
ATOM 7488  H HA   . CYS A 1 22 ? -5.081  22.580 18.673 1.00 0.00 ? 22 CYS A HA   9  
ATOM 7489  H HB2  . CYS A 1 22 ? -5.871  22.423 16.081 1.00 0.00 ? 22 CYS A HB2  9  
ATOM 7490  H HB3  . CYS A 1 22 ? -4.361  21.516 16.002 1.00 0.00 ? 22 CYS A HB3  9  
ATOM 7491  N N    . PRO A 1 23 ? -2.256  22.820 16.950 1.00 0.00 ? 23 PRO A N    9  
ATOM 7492  C CA   . PRO A 1 23 ? -0.800  22.561 17.042 1.00 0.00 ? 23 PRO A CA   9  
ATOM 7493  C C    . PRO A 1 23 ? -0.193  23.301 18.237 1.00 0.00 ? 23 PRO A C    9  
ATOM 7494  O O    . PRO A 1 23 ? 0.363   24.374 18.102 1.00 0.00 ? 23 PRO A O    9  
ATOM 7495  C CB   . PRO A 1 23 ? -0.270  23.108 15.715 1.00 0.00 ? 23 PRO A CB   9  
ATOM 7496  C CG   . PRO A 1 23 ? -1.456  23.659 14.899 1.00 0.00 ? 23 PRO A CG   9  
ATOM 7497  C CD   . PRO A 1 23 ? -2.742  23.497 15.720 1.00 0.00 ? 23 PRO A CD   9  
ATOM 7498  H HA   . PRO A 1 23 ? -0.603  21.503 17.109 1.00 0.00 ? 23 PRO A HA   9  
ATOM 7499  H HB2  . PRO A 1 23 ? 0.438   23.901 15.906 1.00 0.00 ? 23 PRO A HB2  9  
ATOM 7500  H HB3  . PRO A 1 23 ? 0.212   22.315 15.163 1.00 0.00 ? 23 PRO A HB3  9  
ATOM 7501  H HG2  . PRO A 1 23 ? -1.292  24.705 14.685 1.00 0.00 ? 23 PRO A HG2  9  
ATOM 7502  H HG3  . PRO A 1 23 ? -1.544  23.110 13.973 1.00 0.00 ? 23 PRO A HG3  9  
ATOM 7503  H HD2  . PRO A 1 23 ? -3.159  24.462 15.950 1.00 0.00 ? 23 PRO A HD2  9  
ATOM 7504  H HD3  . PRO A 1 23 ? -3.455  22.882 15.195 1.00 0.00 ? 23 PRO A HD3  9  
ATOM 7505  N N    . GLN A 1 24 ? -0.294  22.729 19.406 1.00 0.00 ? 24 GLN A N    9  
ATOM 7506  C CA   . GLN A 1 24 ? 0.277   23.384 20.617 1.00 0.00 ? 24 GLN A CA   9  
ATOM 7507  C C    . GLN A 1 24 ? 1.319   22.467 21.261 1.00 0.00 ? 24 GLN A C    9  
ATOM 7508  O O    . GLN A 1 24 ? 2.500   22.567 20.993 1.00 0.00 ? 24 GLN A O    9  
ATOM 7509  C CB   . GLN A 1 24 ? -0.914  23.588 21.553 1.00 0.00 ? 24 GLN A CB   9  
ATOM 7510  C CG   . GLN A 1 24 ? -0.411  24.031 22.929 1.00 0.00 ? 24 GLN A CG   9  
ATOM 7511  C CD   . GLN A 1 24 ? -1.598  24.161 23.886 1.00 0.00 ? 24 GLN A CD   9  
ATOM 7512  O OE1  . GLN A 1 24 ? -2.052  25.252 24.166 1.00 0.00 ? 24 GLN A OE1  9  
ATOM 7513  N NE2  . GLN A 1 24 ? -2.124  23.083 24.399 1.00 0.00 ? 24 GLN A NE2  9  
ATOM 7514  H H    . GLN A 1 24 ? -0.744  21.862 19.486 1.00 0.00 ? 24 GLN A H    9  
ATOM 7515  H HA   . GLN A 1 24 ? 0.714   24.335 20.362 1.00 0.00 ? 24 GLN A HA   9  
ATOM 7516  H HB2  . GLN A 1 24 ? -1.566  24.347 21.147 1.00 0.00 ? 24 GLN A HB2  9  
ATOM 7517  H HB3  . GLN A 1 24 ? -1.458  22.660 21.651 1.00 0.00 ? 24 GLN A HB3  9  
ATOM 7518  H HG2  . GLN A 1 24 ? 0.282   23.298 23.314 1.00 0.00 ? 24 GLN A HG2  9  
ATOM 7519  H HG3  . GLN A 1 24 ? 0.086   24.986 22.841 1.00 0.00 ? 24 GLN A HG3  9  
ATOM 7520  H HE21 . GLN A 1 24 ? -1.757  22.202 24.169 1.00 0.00 ? 24 GLN A HE21 9  
ATOM 7521  H HE22 . GLN A 1 24 ? -2.884  23.152 25.012 1.00 0.00 ? 24 GLN A HE22 9  
ATOM 7522  N N    . ASP A 1 25 ? 0.889   21.573 22.107 1.00 0.00 ? 25 ASP A N    9  
ATOM 7523  C CA   . ASP A 1 25 ? 1.850   20.646 22.766 1.00 0.00 ? 25 ASP A CA   9  
ATOM 7524  C C    . ASP A 1 25 ? 1.392   19.198 22.577 1.00 0.00 ? 25 ASP A C    9  
ATOM 7525  O O    . ASP A 1 25 ? 0.864   18.582 23.479 1.00 0.00 ? 25 ASP A O    9  
ATOM 7526  C CB   . ASP A 1 25 ? 1.818   21.032 24.246 1.00 0.00 ? 25 ASP A CB   9  
ATOM 7527  C CG   . ASP A 1 25 ? 3.188   20.764 24.874 1.00 0.00 ? 25 ASP A CG   9  
ATOM 7528  O OD1  . ASP A 1 25 ? 3.971   20.058 24.260 1.00 0.00 ? 25 ASP A OD1  9  
ATOM 7529  O OD2  . ASP A 1 25 ? 3.431   21.271 25.957 1.00 0.00 ? 25 ASP A OD2  9  
ATOM 7530  H H    . ASP A 1 25 ? -0.068  21.509 22.308 1.00 0.00 ? 25 ASP A H    9  
ATOM 7531  H HA   . ASP A 1 25 ? 2.843   20.784 22.370 1.00 0.00 ? 25 ASP A HA   9  
ATOM 7532  H HB2  . ASP A 1 25 ? 1.579   22.082 24.338 1.00 0.00 ? 25 ASP A HB2  9  
ATOM 7533  H HB3  . ASP A 1 25 ? 1.068   20.446 24.755 1.00 0.00 ? 25 ASP A HB3  9  
ATOM 7534  N N    . LYS A 1 26 ? 1.587   18.650 21.407 1.00 0.00 ? 26 LYS A N    9  
ATOM 7535  C CA   . LYS A 1 26 ? 1.155   17.243 21.159 1.00 0.00 ? 26 LYS A CA   9  
ATOM 7536  C C    . LYS A 1 26 ? 1.960   16.263 22.023 1.00 0.00 ? 26 LYS A C    9  
ATOM 7537  O O    . LYS A 1 26 ? 1.692   15.078 22.038 1.00 0.00 ? 26 LYS A O    9  
ATOM 7538  C CB   . LYS A 1 26 ? 1.432   17.001 19.676 1.00 0.00 ? 26 LYS A CB   9  
ATOM 7539  C CG   . LYS A 1 26 ? 0.264   17.541 18.845 1.00 0.00 ? 26 LYS A CG   9  
ATOM 7540  C CD   . LYS A 1 26 ? 0.489   17.206 17.369 1.00 0.00 ? 26 LYS A CD   9  
ATOM 7541  C CE   . LYS A 1 26 ? -0.358  18.137 16.501 1.00 0.00 ? 26 LYS A CE   9  
ATOM 7542  N NZ   . LYS A 1 26 ? -0.434  17.460 15.175 1.00 0.00 ? 26 LYS A NZ   9  
ATOM 7543  H H    . LYS A 1 26 ? 2.012   19.166 20.691 1.00 0.00 ? 26 LYS A H    9  
ATOM 7544  H HA   . LYS A 1 26 ? 0.100   17.135 21.356 1.00 0.00 ? 26 LYS A HA   9  
ATOM 7545  H HB2  . LYS A 1 26 ? 2.342   17.509 19.391 1.00 0.00 ? 26 LYS A HB2  9  
ATOM 7546  H HB3  . LYS A 1 26 ? 1.540   15.941 19.497 1.00 0.00 ? 26 LYS A HB3  9  
ATOM 7547  H HG2  . LYS A 1 26 ? -0.656  17.087 19.181 1.00 0.00 ? 26 LYS A HG2  9  
ATOM 7548  H HG3  . LYS A 1 26 ? 0.203   18.613 18.966 1.00 0.00 ? 26 LYS A HG3  9  
ATOM 7549  H HD2  . LYS A 1 26 ? 1.533   17.338 17.125 1.00 0.00 ? 26 LYS A HD2  9  
ATOM 7550  H HD3  . LYS A 1 26 ? 0.204   16.182 17.184 1.00 0.00 ? 26 LYS A HD3  9  
ATOM 7551  H HE2  . LYS A 1 26 ? -1.346  18.248 16.923 1.00 0.00 ? 26 LYS A HE2  9  
ATOM 7552  H HE3  . LYS A 1 26 ? 0.120   19.100 16.404 1.00 0.00 ? 26 LYS A HE3  9  
ATOM 7553  H HZ1  . LYS A 1 26 ? 0.437   16.917 15.013 1.00 0.00 ? 26 LYS A HZ1  9  
ATOM 7554  H HZ2  . LYS A 1 26 ? -1.248  16.814 15.161 1.00 0.00 ? 26 LYS A HZ2  9  
ATOM 7555  H HZ3  . LYS A 1 26 ? -0.544  18.175 14.427 1.00 0.00 ? 26 LYS A HZ3  9  
ATOM 7556  N N    . LYS A 1 27 ? 2.939   16.743 22.743 1.00 0.00 ? 27 LYS A N    9  
ATOM 7557  C CA   . LYS A 1 27 ? 3.751   15.834 23.601 1.00 0.00 ? 27 LYS A CA   9  
ATOM 7558  C C    . LYS A 1 27 ? 2.847   14.823 24.313 1.00 0.00 ? 27 LYS A C    9  
ATOM 7559  O O    . LYS A 1 27 ? 3.266   13.735 24.656 1.00 0.00 ? 27 LYS A O    9  
ATOM 7560  C CB   . LYS A 1 27 ? 4.431   16.755 24.613 1.00 0.00 ? 27 LYS A CB   9  
ATOM 7561  C CG   . LYS A 1 27 ? 5.422   17.667 23.889 1.00 0.00 ? 27 LYS A CG   9  
ATOM 7562  C CD   . LYS A 1 27 ? 6.639   16.852 23.450 1.00 0.00 ? 27 LYS A CD   9  
ATOM 7563  C CE   . LYS A 1 27 ? 7.569   17.734 22.614 1.00 0.00 ? 27 LYS A CE   9  
ATOM 7564  N NZ   . LYS A 1 27 ? 8.438   16.777 21.871 1.00 0.00 ? 27 LYS A NZ   9  
ATOM 7565  H H    . LYS A 1 27 ? 3.143   17.699 22.720 1.00 0.00 ? 27 LYS A H    9  
ATOM 7566  H HA   . LYS A 1 27 ? 4.496   15.323 23.012 1.00 0.00 ? 27 LYS A HA   9  
ATOM 7567  H HB2  . LYS A 1 27 ? 3.684   17.357 25.111 1.00 0.00 ? 27 LYS A HB2  9  
ATOM 7568  H HB3  . LYS A 1 27 ? 4.957   16.161 25.343 1.00 0.00 ? 27 LYS A HB3  9  
ATOM 7569  H HG2  . LYS A 1 27 ? 4.946   18.098 23.019 1.00 0.00 ? 27 LYS A HG2  9  
ATOM 7570  H HG3  . LYS A 1 27 ? 5.738   18.456 24.553 1.00 0.00 ? 27 LYS A HG3  9  
ATOM 7571  H HD2  . LYS A 1 27 ? 7.168   16.497 24.322 1.00 0.00 ? 27 LYS A HD2  9  
ATOM 7572  H HD3  . LYS A 1 27 ? 6.314   16.009 22.857 1.00 0.00 ? 27 LYS A HD3  9  
ATOM 7573  H HE2  . LYS A 1 27 ? 6.996   18.336 21.924 1.00 0.00 ? 27 LYS A HE2  9  
ATOM 7574  H HE3  . LYS A 1 27 ? 8.168   18.364 23.256 1.00 0.00 ? 27 LYS A HE3  9  
ATOM 7575  H HZ1  . LYS A 1 27 ? 8.749   16.022 22.515 1.00 0.00 ? 27 LYS A HZ1  9  
ATOM 7576  H HZ2  . LYS A 1 27 ? 7.902   16.364 21.082 1.00 0.00 ? 27 LYS A HZ2  9  
ATOM 7577  H HZ3  . LYS A 1 27 ? 9.267   17.280 21.498 1.00 0.00 ? 27 LYS A HZ3  9  
ATOM 7578  N N    . PHE A 1 28 ? 1.608   15.169 24.534 1.00 0.00 ? 28 PHE A N    9  
ATOM 7579  C CA   . PHE A 1 28 ? 0.681   14.223 25.218 1.00 0.00 ? 28 PHE A CA   9  
ATOM 7580  C C    . PHE A 1 28 ? 0.707   12.861 24.514 1.00 0.00 ? 28 PHE A C    9  
ATOM 7581  O O    . PHE A 1 28 ? 0.324   11.854 25.075 1.00 0.00 ? 28 PHE A O    9  
ATOM 7582  C CB   . PHE A 1 28 ? -0.701  14.864 25.098 1.00 0.00 ? 28 PHE A CB   9  
ATOM 7583  C CG   . PHE A 1 28 ? -0.658  16.271 25.647 1.00 0.00 ? 28 PHE A CG   9  
ATOM 7584  C CD1  . PHE A 1 28 ? -0.321  16.493 26.988 1.00 0.00 ? 28 PHE A CD1  9  
ATOM 7585  C CD2  . PHE A 1 28 ? -0.955  17.356 24.813 1.00 0.00 ? 28 PHE A CD2  9  
ATOM 7586  C CE1  . PHE A 1 28 ? -0.283  17.798 27.494 1.00 0.00 ? 28 PHE A CE1  9  
ATOM 7587  C CE2  . PHE A 1 28 ? -0.916  18.660 25.319 1.00 0.00 ? 28 PHE A CE2  9  
ATOM 7588  C CZ   . PHE A 1 28 ? -0.581  18.882 26.658 1.00 0.00 ? 28 PHE A CZ   9  
ATOM 7589  H H    . PHE A 1 28 ? 1.285   16.050 24.249 1.00 0.00 ? 28 PHE A H    9  
ATOM 7590  H HA   . PHE A 1 28 ? 0.950   14.116 26.257 1.00 0.00 ? 28 PHE A HA   9  
ATOM 7591  H HB2  . PHE A 1 28 ? -0.995  14.892 24.059 1.00 0.00 ? 28 PHE A HB2  9  
ATOM 7592  H HB3  . PHE A 1 28 ? -1.417  14.283 25.659 1.00 0.00 ? 28 PHE A HB3  9  
ATOM 7593  H HD1  . PHE A 1 28 ? -0.091  15.657 27.632 1.00 0.00 ? 28 PHE A HD1  9  
ATOM 7594  H HD2  . PHE A 1 28 ? -1.212  17.186 23.779 1.00 0.00 ? 28 PHE A HD2  9  
ATOM 7595  H HE1  . PHE A 1 28 ? -0.025  17.969 28.528 1.00 0.00 ? 28 PHE A HE1  9  
ATOM 7596  H HE2  . PHE A 1 28 ? -1.147  19.496 24.674 1.00 0.00 ? 28 PHE A HE2  9  
ATOM 7597  H HZ   . PHE A 1 28 ? -0.551  19.889 27.046 1.00 0.00 ? 28 PHE A HZ   9  
ATOM 7598  N N    . PHE A 1 29 ? 1.157   12.826 23.288 1.00 0.00 ? 29 PHE A N    9  
ATOM 7599  C CA   . PHE A 1 29 ? 1.212   11.534 22.544 1.00 0.00 ? 29 PHE A CA   9  
ATOM 7600  C C    . PHE A 1 29 ? 1.888   10.453 23.395 1.00 0.00 ? 29 PHE A C    9  
ATOM 7601  O O    . PHE A 1 29 ? 1.721   9.273  23.163 1.00 0.00 ? 29 PHE A O    9  
ATOM 7602  C CB   . PHE A 1 29 ? 2.052   11.833 21.300 1.00 0.00 ? 29 PHE A CB   9  
ATOM 7603  C CG   . PHE A 1 29 ? 2.105   10.608 20.421 1.00 0.00 ? 29 PHE A CG   9  
ATOM 7604  C CD1  . PHE A 1 29 ? 2.807   9.473  20.842 1.00 0.00 ? 29 PHE A CD1  9  
ATOM 7605  C CD2  . PHE A 1 29 ? 1.450   10.606 19.182 1.00 0.00 ? 29 PHE A CD2  9  
ATOM 7606  C CE1  . PHE A 1 29 ? 2.855   8.336  20.026 1.00 0.00 ? 29 PHE A CE1  9  
ATOM 7607  C CE2  . PHE A 1 29 ? 1.498   9.469  18.367 1.00 0.00 ? 29 PHE A CE2  9  
ATOM 7608  C CZ   . PHE A 1 29 ? 2.200   8.335  18.789 1.00 0.00 ? 29 PHE A CZ   9  
ATOM 7609  H H    . PHE A 1 29 ? 1.461   13.651 22.855 1.00 0.00 ? 29 PHE A H    9  
ATOM 7610  H HA   . PHE A 1 29 ? 0.222   11.223 22.253 1.00 0.00 ? 29 PHE A HA   9  
ATOM 7611  H HB2  . PHE A 1 29 ? 1.608   12.650 20.752 1.00 0.00 ? 29 PHE A HB2  9  
ATOM 7612  H HB3  . PHE A 1 29 ? 3.053   12.105 21.599 1.00 0.00 ? 29 PHE A HB3  9  
ATOM 7613  H HD1  . PHE A 1 29 ? 3.312   9.474  21.796 1.00 0.00 ? 29 PHE A HD1  9  
ATOM 7614  H HD2  . PHE A 1 29 ? 0.908   11.482 18.857 1.00 0.00 ? 29 PHE A HD2  9  
ATOM 7615  H HE1  . PHE A 1 29 ? 3.397   7.460  20.352 1.00 0.00 ? 29 PHE A HE1  9  
ATOM 7616  H HE2  . PHE A 1 29 ? 0.992   9.468  17.413 1.00 0.00 ? 29 PHE A HE2  9  
ATOM 7617  H HZ   . PHE A 1 29 ? 2.237   7.457  18.160 1.00 0.00 ? 29 PHE A HZ   9  
ATOM 7618  N N    . GLN A 1 30 ? 2.653   10.847 24.377 1.00 0.00 ? 30 GLN A N    9  
ATOM 7619  C CA   . GLN A 1 30 ? 3.344   9.843  25.236 1.00 0.00 ? 30 GLN A CA   9  
ATOM 7620  C C    . GLN A 1 30 ? 2.335   9.096  26.116 1.00 0.00 ? 30 GLN A C    9  
ATOM 7621  O O    . GLN A 1 30 ? 2.692   8.205  26.861 1.00 0.00 ? 30 GLN A O    9  
ATOM 7622  C CB   . GLN A 1 30 ? 4.303   10.663 26.100 1.00 0.00 ? 30 GLN A CB   9  
ATOM 7623  C CG   . GLN A 1 30 ? 5.488   11.122 25.249 1.00 0.00 ? 30 GLN A CG   9  
ATOM 7624  C CD   . GLN A 1 30 ? 6.698   11.373 26.151 1.00 0.00 ? 30 GLN A CD   9  
ATOM 7625  O OE1  . GLN A 1 30 ? 7.277   10.446 26.682 1.00 0.00 ? 30 GLN A OE1  9  
ATOM 7626  N NE2  . GLN A 1 30 ? 7.105   12.596 26.348 1.00 0.00 ? 30 GLN A NE2  9  
ATOM 7627  H H    . GLN A 1 30 ? 2.778   11.803 24.545 1.00 0.00 ? 30 GLN A H    9  
ATOM 7628  H HA   . GLN A 1 30 ? 3.901   9.149  24.630 1.00 0.00 ? 30 GLN A HA   9  
ATOM 7629  H HB2  . GLN A 1 30 ? 3.786   11.527 26.492 1.00 0.00 ? 30 GLN A HB2  9  
ATOM 7630  H HB3  . GLN A 1 30 ? 4.660   10.056 26.919 1.00 0.00 ? 30 GLN A HB3  9  
ATOM 7631  H HG2  . GLN A 1 30 ? 5.729   10.357 24.527 1.00 0.00 ? 30 GLN A HG2  9  
ATOM 7632  H HG3  . GLN A 1 30 ? 5.230   12.036 24.734 1.00 0.00 ? 30 GLN A HG3  9  
ATOM 7633  H HE21 . GLN A 1 30 ? 6.637   13.343 25.920 1.00 0.00 ? 30 GLN A HE21 9  
ATOM 7634  H HE22 . GLN A 1 30 ? 7.878   12.768 26.924 1.00 0.00 ? 30 GLN A HE22 9  
ATOM 7635  N N    . SER A 1 31 ? 1.080   9.448  26.040 1.00 0.00 ? 31 SER A N    9  
ATOM 7636  C CA   . SER A 1 31 ? 0.063   8.749  26.879 1.00 0.00 ? 31 SER A CA   9  
ATOM 7637  C C    . SER A 1 31 ? -1.187  8.437  26.052 1.00 0.00 ? 31 SER A C    9  
ATOM 7638  O O    . SER A 1 31 ? -1.444  9.061  25.041 1.00 0.00 ? 31 SER A O    9  
ATOM 7639  C CB   . SER A 1 31 ? -0.270  9.734  27.999 1.00 0.00 ? 31 SER A CB   9  
ATOM 7640  O OG   . SER A 1 31 ? 0.899   9.996  28.761 1.00 0.00 ? 31 SER A OG   9  
ATOM 7641  H H    . SER A 1 31 ? 0.806   10.170 25.436 1.00 0.00 ? 31 SER A H    9  
ATOM 7642  H HA   . SER A 1 31 ? 0.475   7.843  27.296 1.00 0.00 ? 31 SER A HA   9  
ATOM 7643  H HB2  . SER A 1 31 ? -0.635  10.655 27.572 1.00 0.00 ? 31 SER A HB2  9  
ATOM 7644  H HB3  . SER A 1 31 ? -1.029  9.308  28.640 1.00 0.00 ? 31 SER A HB3  9  
ATOM 7645  H HG   . SER A 1 31 ? 1.298   10.801 28.424 1.00 0.00 ? 31 SER A HG   9  
ATOM 7646  N N    . LEU A 1 32 ? -1.967  7.479  26.473 1.00 0.00 ? 32 LEU A N    9  
ATOM 7647  C CA   . LEU A 1 32 ? -3.200  7.133  25.709 1.00 0.00 ? 32 LEU A CA   9  
ATOM 7648  C C    . LEU A 1 32 ? -4.119  8.350  25.621 1.00 0.00 ? 32 LEU A C    9  
ATOM 7649  O O    . LEU A 1 32 ? -4.606  8.698  24.564 1.00 0.00 ? 32 LEU A O    9  
ATOM 7650  C CB   . LEU A 1 32 ? -3.868  6.015  26.506 1.00 0.00 ? 32 LEU A CB   9  
ATOM 7651  C CG   . LEU A 1 32 ? -4.693  5.139  25.562 1.00 0.00 ? 32 LEU A CG   9  
ATOM 7652  C CD1  . LEU A 1 32 ? -4.960  3.785  26.223 1.00 0.00 ? 32 LEU A CD1  9  
ATOM 7653  C CD2  . LEU A 1 32 ? -6.024  5.830  25.259 1.00 0.00 ? 32 LEU A CD2  9  
ATOM 7654  H H    . LEU A 1 32 ? -1.743  6.988  27.291 1.00 0.00 ? 32 LEU A H    9  
ATOM 7655  H HA   . LEU A 1 32 ? -2.946  6.783  24.725 1.00 0.00 ? 32 LEU A HA   9  
ATOM 7656  H HB2  . LEU A 1 32 ? -3.111  5.414  26.988 1.00 0.00 ? 32 LEU A HB2  9  
ATOM 7657  H HB3  . LEU A 1 32 ? -4.515  6.446  27.255 1.00 0.00 ? 32 LEU A HB3  9  
ATOM 7658  H HG   . LEU A 1 32 ? -4.148  4.989  24.642 1.00 0.00 ? 32 LEU A HG   9  
ATOM 7659  H HD11 . LEU A 1 32 ? -5.470  3.938  27.162 1.00 0.00 ? 32 LEU A HD11 9  
ATOM 7660  H HD12 . LEU A 1 32 ? -5.576  3.183  25.572 1.00 0.00 ? 32 LEU A HD12 9  
ATOM 7661  H HD13 . LEU A 1 32 ? -4.023  3.279  26.399 1.00 0.00 ? 32 LEU A HD13 9  
ATOM 7662  H HD21 . LEU A 1 32 ? -6.394  6.306  26.155 1.00 0.00 ? 32 LEU A HD21 9  
ATOM 7663  H HD22 . LEU A 1 32 ? -5.875  6.575  24.490 1.00 0.00 ? 32 LEU A HD22 9  
ATOM 7664  H HD23 . LEU A 1 32 ? -6.740  5.098  24.917 1.00 0.00 ? 32 LEU A HD23 9  
ATOM 7665  N N    . ASP A 1 33 ? -4.352  9.003  26.723 1.00 0.00 ? 33 ASP A N    9  
ATOM 7666  C CA   . ASP A 1 33 ? -5.232  10.204 26.699 1.00 0.00 ? 33 ASP A CA   9  
ATOM 7667  C C    . ASP A 1 33 ? -4.675  11.213 25.702 1.00 0.00 ? 33 ASP A C    9  
ATOM 7668  O O    . ASP A 1 33 ? -5.403  11.840 24.959 1.00 0.00 ? 33 ASP A O    9  
ATOM 7669  C CB   . ASP A 1 33 ? -5.190  10.763 28.121 1.00 0.00 ? 33 ASP A CB   9  
ATOM 7670  C CG   . ASP A 1 33 ? -6.343  11.749 28.317 1.00 0.00 ? 33 ASP A CG   9  
ATOM 7671  O OD1  . ASP A 1 33 ? -6.896  12.189 27.321 1.00 0.00 ? 33 ASP A OD1  9  
ATOM 7672  O OD2  . ASP A 1 33 ? -6.655  12.048 29.458 1.00 0.00 ? 33 ASP A OD2  9  
ATOM 7673  H H    . ASP A 1 33 ? -3.942  8.710  27.560 1.00 0.00 ? 33 ASP A H    9  
ATOM 7674  H HA   . ASP A 1 33 ? -6.241  9.929  26.435 1.00 0.00 ? 33 ASP A HA   9  
ATOM 7675  H HB2  . ASP A 1 33 ? -5.284  9.954  28.830 1.00 0.00 ? 33 ASP A HB2  9  
ATOM 7676  H HB3  . ASP A 1 33 ? -4.251  11.273 28.279 1.00 0.00 ? 33 ASP A HB3  9  
ATOM 7677  N N    . GLY A 1 34 ? -3.380  11.360 25.668 1.00 0.00 ? 34 GLY A N    9  
ATOM 7678  C CA   . GLY A 1 34 ? -2.768  12.310 24.703 1.00 0.00 ? 34 GLY A CA   9  
ATOM 7679  C C    . GLY A 1 34 ? -2.945  11.744 23.298 1.00 0.00 ? 34 GLY A C    9  
ATOM 7680  O O    . GLY A 1 34 ? -3.349  12.430 22.382 1.00 0.00 ? 34 GLY A O    9  
ATOM 7681  H H    . GLY A 1 34 ? -2.810  10.831 26.266 1.00 0.00 ? 34 GLY A H    9  
ATOM 7682  H HA2  . GLY A 1 34 ? -3.261  13.266 24.773 1.00 0.00 ? 34 GLY A HA2  9  
ATOM 7683  H HA3  . GLY A 1 34 ? -1.718  12.426 24.921 1.00 0.00 ? 34 GLY A HA3  9  
ATOM 7684  N N    . ILE A 1 35 ? -2.660  10.484 23.127 1.00 0.00 ? 35 ILE A N    9  
ATOM 7685  C CA   . ILE A 1 35 ? -2.829  9.864  21.787 1.00 0.00 ? 35 ILE A CA   9  
ATOM 7686  C C    . ILE A 1 35 ? -4.266  10.077 21.315 1.00 0.00 ? 35 ILE A C    9  
ATOM 7687  O O    . ILE A 1 35 ? -4.523  10.302 20.150 1.00 0.00 ? 35 ILE A O    9  
ATOM 7688  C CB   . ILE A 1 35 ? -2.529  8.376  21.990 1.00 0.00 ? 35 ILE A CB   9  
ATOM 7689  C CG1  . ILE A 1 35 ? -1.016  8.158  21.948 1.00 0.00 ? 35 ILE A CG1  9  
ATOM 7690  C CG2  . ILE A 1 35 ? -3.188  7.553  20.879 1.00 0.00 ? 35 ILE A CG2  9  
ATOM 7691  C CD1  . ILE A 1 35 ? -0.462  8.715  20.635 1.00 0.00 ? 35 ILE A CD1  9  
ATOM 7692  H H    . ILE A 1 35 ? -2.350  9.945  23.884 1.00 0.00 ? 35 ILE A H    9  
ATOM 7693  H HA   . ILE A 1 35 ? -2.135  10.292 21.084 1.00 0.00 ? 35 ILE A HA   9  
ATOM 7694  H HB   . ILE A 1 35 ? -2.911  8.058  22.949 1.00 0.00 ? 35 ILE A HB   9  
ATOM 7695  H HG12 . ILE A 1 35 ? -0.554  8.668  22.780 1.00 0.00 ? 35 ILE A HG12 9  
ATOM 7696  H HG13 . ILE A 1 35 ? -0.803  7.100  22.009 1.00 0.00 ? 35 ILE A HG13 9  
ATOM 7697  H HG21 . ILE A 1 35 ? -3.019  8.035  19.926 1.00 0.00 ? 35 ILE A HG21 9  
ATOM 7698  H HG22 . ILE A 1 35 ? -2.759  6.562  20.862 1.00 0.00 ? 35 ILE A HG22 9  
ATOM 7699  H HG23 . ILE A 1 35 ? -4.249  7.484  21.064 1.00 0.00 ? 35 ILE A HG23 9  
ATOM 7700  H HD11 . ILE A 1 35 ? -1.269  8.830  19.925 1.00 0.00 ? 35 ILE A HD11 9  
ATOM 7701  H HD12 . ILE A 1 35 ? -0.004  9.675  20.817 1.00 0.00 ? 35 ILE A HD12 9  
ATOM 7702  H HD13 . ILE A 1 35 ? 0.273   8.034  20.236 1.00 0.00 ? 35 ILE A HD13 9  
ATOM 7703  N N    . MET A 1 36 ? -5.206  10.019 22.217 1.00 0.00 ? 36 MET A N    9  
ATOM 7704  C CA   . MET A 1 36 ? -6.625  10.231 21.820 1.00 0.00 ? 36 MET A CA   9  
ATOM 7705  C C    . MET A 1 36 ? -6.846  11.695 21.445 1.00 0.00 ? 36 MET A C    9  
ATOM 7706  O O    . MET A 1 36 ? -7.127  12.019 20.309 1.00 0.00 ? 36 MET A O    9  
ATOM 7707  C CB   . MET A 1 36 ? -7.451  9.879  23.052 1.00 0.00 ? 36 MET A CB   9  
ATOM 7708  C CG   . MET A 1 36 ? -8.060  8.486  22.881 1.00 0.00 ? 36 MET A CG   9  
ATOM 7709  S SD   . MET A 1 36 ? -9.120  8.113  24.298 1.00 0.00 ? 36 MET A SD   9  
ATOM 7710  C CE   . MET A 1 36 ? -9.272  6.334  24.006 1.00 0.00 ? 36 MET A CE   9  
ATOM 7711  H H    . MET A 1 36 ? -4.974  9.845  23.156 1.00 0.00 ? 36 MET A H    9  
ATOM 7712  H HA   . MET A 1 36 ? -6.889  9.584  20.998 1.00 0.00 ? 36 MET A HA   9  
ATOM 7713  H HB2  . MET A 1 36 ? -6.819  9.894  23.927 1.00 0.00 ? 36 MET A HB2  9  
ATOM 7714  H HB3  . MET A 1 36 ? -8.241  10.607 23.163 1.00 0.00 ? 36 MET A HB3  9  
ATOM 7715  H HG2  . MET A 1 36 ? -8.646  8.458  21.975 1.00 0.00 ? 36 MET A HG2  9  
ATOM 7716  H HG3  . MET A 1 36 ? -7.268  7.753  22.820 1.00 0.00 ? 36 MET A HG3  9  
ATOM 7717  H HE1  . MET A 1 36 ? -8.310  5.934  23.718 1.00 0.00 ? 36 MET A HE1  9  
ATOM 7718  H HE2  . MET A 1 36 ? -9.605  5.847  24.909 1.00 0.00 ? 36 MET A HE2  9  
ATOM 7719  H HE3  . MET A 1 36 ? -9.992  6.159  23.218 1.00 0.00 ? 36 MET A HE3  9  
ATOM 7720  N N    . PHE A 1 37 ? -6.716  12.587 22.390 1.00 0.00 ? 37 PHE A N    9  
ATOM 7721  C CA   . PHE A 1 37 ? -6.918  14.027 22.072 1.00 0.00 ? 37 PHE A CA   9  
ATOM 7722  C C    . PHE A 1 37 ? -6.147  14.364 20.789 1.00 0.00 ? 37 PHE A C    9  
ATOM 7723  O O    . PHE A 1 37 ? -6.695  14.901 19.848 1.00 0.00 ? 37 PHE A O    9  
ATOM 7724  C CB   . PHE A 1 37 ? -6.393  14.789 23.309 1.00 0.00 ? 37 PHE A CB   9  
ATOM 7725  C CG   . PHE A 1 37 ? -5.291  15.757 22.931 1.00 0.00 ? 37 PHE A CG   9  
ATOM 7726  C CD1  . PHE A 1 37 ? -3.959  15.332 22.928 1.00 0.00 ? 37 PHE A CD1  9  
ATOM 7727  C CD2  . PHE A 1 37 ? -5.608  17.072 22.576 1.00 0.00 ? 37 PHE A CD2  9  
ATOM 7728  C CE1  . PHE A 1 37 ? -2.943  16.221 22.569 1.00 0.00 ? 37 PHE A CE1  9  
ATOM 7729  C CE2  . PHE A 1 37 ? -4.590  17.963 22.215 1.00 0.00 ? 37 PHE A CE2  9  
ATOM 7730  C CZ   . PHE A 1 37 ? -3.257  17.536 22.212 1.00 0.00 ? 37 PHE A CZ   9  
ATOM 7731  H H    . PHE A 1 37 ? -6.484  12.311 23.303 1.00 0.00 ? 37 PHE A H    9  
ATOM 7732  H HA   . PHE A 1 37 ? -7.969  14.230 21.935 1.00 0.00 ? 37 PHE A HA   9  
ATOM 7733  H HB2  . PHE A 1 37 ? -7.209  15.342 23.754 1.00 0.00 ? 37 PHE A HB2  9  
ATOM 7734  H HB3  . PHE A 1 37 ? -6.010  14.080 24.028 1.00 0.00 ? 37 PHE A HB3  9  
ATOM 7735  H HD1  . PHE A 1 37 ? -3.715  14.317 23.203 1.00 0.00 ? 37 PHE A HD1  9  
ATOM 7736  H HD2  . PHE A 1 37 ? -6.636  17.400 22.582 1.00 0.00 ? 37 PHE A HD2  9  
ATOM 7737  H HE1  . PHE A 1 37 ? -1.913  15.891 22.565 1.00 0.00 ? 37 PHE A HE1  9  
ATOM 7738  H HE2  . PHE A 1 37 ? -4.832  18.978 21.942 1.00 0.00 ? 37 PHE A HE2  9  
ATOM 7739  H HZ   . PHE A 1 37 ? -2.472  18.218 21.932 1.00 0.00 ? 37 PHE A HZ   9  
ATOM 7740  N N    . ILE A 1 38 ? -4.883  14.035 20.738 1.00 0.00 ? 38 ILE A N    9  
ATOM 7741  C CA   . ILE A 1 38 ? -4.094  14.323 19.509 1.00 0.00 ? 38 ILE A CA   9  
ATOM 7742  C C    . ILE A 1 38 ? -4.865  13.830 18.286 1.00 0.00 ? 38 ILE A C    9  
ATOM 7743  O O    . ILE A 1 38 ? -4.889  14.470 17.253 1.00 0.00 ? 38 ILE A O    9  
ATOM 7744  C CB   . ILE A 1 38 ? -2.788  13.546 19.676 1.00 0.00 ? 38 ILE A CB   9  
ATOM 7745  C CG1  . ILE A 1 38 ? -1.910  14.243 20.718 1.00 0.00 ? 38 ILE A CG1  9  
ATOM 7746  C CG2  . ILE A 1 38 ? -2.050  13.500 18.337 1.00 0.00 ? 38 ILE A CG2  9  
ATOM 7747  C CD1  . ILE A 1 38 ? -0.520  13.603 20.729 1.00 0.00 ? 38 ILE A CD1  9  
ATOM 7748  H H    . ILE A 1 38 ? -4.459  13.588 21.499 1.00 0.00 ? 38 ILE A H    9  
ATOM 7749  H HA   . ILE A 1 38 ? -3.892  15.376 19.429 1.00 0.00 ? 38 ILE A HA   9  
ATOM 7750  H HB   . ILE A 1 38 ? -3.006  12.540 20.003 1.00 0.00 ? 38 ILE A HB   9  
ATOM 7751  H HG12 . ILE A 1 38 ? -1.822  15.290 20.471 1.00 0.00 ? 38 ILE A HG12 9  
ATOM 7752  H HG13 . ILE A 1 38 ? -2.360  14.141 21.693 1.00 0.00 ? 38 ILE A HG13 9  
ATOM 7753  H HG21 . ILE A 1 38 ? -2.689  13.055 17.589 1.00 0.00 ? 38 ILE A HG21 9  
ATOM 7754  H HG22 . ILE A 1 38 ? -1.789  14.504 18.035 1.00 0.00 ? 38 ILE A HG22 9  
ATOM 7755  H HG23 . ILE A 1 38 ? -1.151  12.911 18.441 1.00 0.00 ? 38 ILE A HG23 9  
ATOM 7756  H HD11 . ILE A 1 38 ? -0.443  12.894 19.918 1.00 0.00 ? 38 ILE A HD11 9  
ATOM 7757  H HD12 . ILE A 1 38 ? 0.230   14.370 20.610 1.00 0.00 ? 38 ILE A HD12 9  
ATOM 7758  H HD13 . ILE A 1 38 ? -0.367  13.092 21.668 1.00 0.00 ? 38 ILE A HD13 9  
ATOM 7759  N N    . ASN A 1 39 ? -5.511  12.702 18.401 1.00 0.00 ? 39 ASN A N    9  
ATOM 7760  C CA   . ASN A 1 39 ? -6.298  12.179 17.250 1.00 0.00 ? 39 ASN A CA   9  
ATOM 7761  C C    . ASN A 1 39 ? -7.519  13.071 17.032 1.00 0.00 ? 39 ASN A C    9  
ATOM 7762  O O    . ASN A 1 39 ? -7.949  13.300 15.919 1.00 0.00 ? 39 ASN A O    9  
ATOM 7763  C CB   . ASN A 1 39 ? -6.724  10.768 17.659 1.00 0.00 ? 39 ASN A CB   9  
ATOM 7764  C CG   . ASN A 1 39 ? -5.485  9.885  17.809 1.00 0.00 ? 39 ASN A CG   9  
ATOM 7765  O OD1  . ASN A 1 39 ? -4.440  10.187 17.269 1.00 0.00 ? 39 ASN A OD1  9  
ATOM 7766  N ND2  . ASN A 1 39 ? -5.558  8.799  18.528 1.00 0.00 ? 39 ASN A ND2  9  
ATOM 7767  H H    . ASN A 1 39 ? -5.489  12.209 19.250 1.00 0.00 ? 39 ASN A H    9  
ATOM 7768  H HA   . ASN A 1 39 ? -5.690  12.142 16.361 1.00 0.00 ? 39 ASN A HA   9  
ATOM 7769  H HB2  . ASN A 1 39 ? -7.253  10.811 18.599 1.00 0.00 ? 39 ASN A HB2  9  
ATOM 7770  H HB3  . ASN A 1 39 ? -7.372  10.355 16.900 1.00 0.00 ? 39 ASN A HB3  9  
ATOM 7771  H HD21 . ASN A 1 39 ? -6.402  8.556  18.965 1.00 0.00 ? 39 ASN A HD21 9  
ATOM 7772  H HD22 . ASN A 1 39 ? -4.770  8.225  18.631 1.00 0.00 ? 39 ASN A HD22 9  
ATOM 7773  N N    . LYS A 1 40 ? -8.069  13.586 18.096 1.00 0.00 ? 40 LYS A N    9  
ATOM 7774  C CA   . LYS A 1 40 ? -9.254  14.478 17.971 1.00 0.00 ? 40 LYS A CA   9  
ATOM 7775  C C    . LYS A 1 40 ? -8.793  15.890 17.604 1.00 0.00 ? 40 LYS A C    9  
ATOM 7776  O O    . LYS A 1 40 ? -9.572  16.720 17.182 1.00 0.00 ? 40 LYS A O    9  
ATOM 7777  C CB   . LYS A 1 40 ? -9.907  14.468 19.354 1.00 0.00 ? 40 LYS A CB   9  
ATOM 7778  C CG   . LYS A 1 40 ? -11.268 15.162 19.279 1.00 0.00 ? 40 LYS A CG   9  
ATOM 7779  C CD   . LYS A 1 40 ? -11.801 15.395 20.695 1.00 0.00 ? 40 LYS A CD   9  
ATOM 7780  C CE   . LYS A 1 40 ? -12.985 16.363 20.639 1.00 0.00 ? 40 LYS A CE   9  
ATOM 7781  N NZ   . LYS A 1 40 ? -13.533 16.378 22.024 1.00 0.00 ? 40 LYS A NZ   9  
ATOM 7782  H H    . LYS A 1 40 ? -7.694  13.392 18.980 1.00 0.00 ? 40 LYS A H    9  
ATOM 7783  H HA   . LYS A 1 40 ? -9.941  14.097 17.231 1.00 0.00 ? 40 LYS A HA   9  
ATOM 7784  H HB2  . LYS A 1 40 ? -10.038 13.448 19.681 1.00 0.00 ? 40 LYS A HB2  9  
ATOM 7785  H HB3  . LYS A 1 40 ? -9.273  14.991 20.054 1.00 0.00 ? 40 LYS A HB3  9  
ATOM 7786  H HG2  . LYS A 1 40 ? -11.161 16.112 18.775 1.00 0.00 ? 40 LYS A HG2  9  
ATOM 7787  H HG3  . LYS A 1 40 ? -11.960 14.540 18.731 1.00 0.00 ? 40 LYS A HG3  9  
ATOM 7788  H HD2  . LYS A 1 40 ? -12.126 14.454 21.116 1.00 0.00 ? 40 LYS A HD2  9  
ATOM 7789  H HD3  . LYS A 1 40 ? -11.020 15.815 21.310 1.00 0.00 ? 40 LYS A HD3  9  
ATOM 7790  H HE2  . LYS A 1 40 ? -12.649 17.351 20.357 1.00 0.00 ? 40 LYS A HE2  9  
ATOM 7791  H HE3  . LYS A 1 40 ? -13.730 16.006 19.943 1.00 0.00 ? 40 LYS A HE3  9  
ATOM 7792  H HZ1  . LYS A 1 40 ? -13.325 15.470 22.488 1.00 0.00 ? 40 LYS A HZ1  9  
ATOM 7793  H HZ2  . LYS A 1 40 ? -13.095 17.152 22.563 1.00 0.00 ? 40 LYS A HZ2  9  
ATOM 7794  H HZ3  . LYS A 1 40 ? -14.562 16.523 21.988 1.00 0.00 ? 40 LYS A HZ3  9  
ATOM 7795  N N    . CYS A 1 41 ? -7.526  16.162 17.759 1.00 0.00 ? 41 CYS A N    9  
ATOM 7796  C CA   . CYS A 1 41 ? -7.003  17.514 17.414 1.00 0.00 ? 41 CYS A CA   9  
ATOM 7797  C C    . CYS A 1 41 ? -7.189  17.774 15.921 1.00 0.00 ? 41 CYS A C    9  
ATOM 7798  O O    . CYS A 1 41 ? -7.994  18.586 15.512 1.00 0.00 ? 41 CYS A O    9  
ATOM 7799  C CB   . CYS A 1 41 ? -5.515  17.456 17.757 1.00 0.00 ? 41 CYS A CB   9  
ATOM 7800  S SG   . CYS A 1 41 ? -4.678  18.909 17.076 1.00 0.00 ? 41 CYS A SG   9  
ATOM 7801  H H    . CYS A 1 41 ? -6.916  15.474 18.097 1.00 0.00 ? 41 CYS A H    9  
ATOM 7802  H HA   . CYS A 1 41 ? -7.492  18.275 18.000 1.00 0.00 ? 41 CYS A HA   9  
ATOM 7803  H HB2  . CYS A 1 41 ? -5.393  17.439 18.827 1.00 0.00 ? 41 CYS A HB2  9  
ATOM 7804  H HB3  . CYS A 1 41 ? -5.083  16.562 17.333 1.00 0.00 ? 41 CYS A HB3  9  
ATOM 7805  N N    . ALA A 1 42 ? -6.446  17.080 15.106 1.00 0.00 ? 42 ALA A N    9  
ATOM 7806  C CA   . ALA A 1 42 ? -6.572  17.273 13.634 1.00 0.00 ? 42 ALA A CA   9  
ATOM 7807  C C    . ALA A 1 42 ? -8.039  17.165 13.215 1.00 0.00 ? 42 ALA A C    9  
ATOM 7808  O O    . ALA A 1 42 ? -8.473  17.789 12.267 1.00 0.00 ? 42 ALA A O    9  
ATOM 7809  C CB   . ALA A 1 42 ? -5.750  16.142 13.014 1.00 0.00 ? 42 ALA A CB   9  
ATOM 7810  H H    . ALA A 1 42 ? -5.807  16.430 15.466 1.00 0.00 ? 42 ALA A H    9  
ATOM 7811  H HA   . ALA A 1 42 ? -6.165  18.227 13.343 1.00 0.00 ? 42 ALA A HA   9  
ATOM 7812  H HB1  . ALA A 1 42 ? -6.130  15.191 13.359 1.00 0.00 ? 42 ALA A HB1  9  
ATOM 7813  H HB2  . ALA A 1 42 ? -5.825  16.190 11.938 1.00 0.00 ? 42 ALA A HB2  9  
ATOM 7814  H HB3  . ALA A 1 42 ? -4.716  16.245 13.307 1.00 0.00 ? 42 ALA A HB3  9  
ATOM 7815  N N    . THR A 1 43 ? -8.809  16.381 13.920 1.00 0.00 ? 43 THR A N    9  
ATOM 7816  C CA   . THR A 1 43 ? -10.249 16.240 13.568 1.00 0.00 ? 43 THR A CA   9  
ATOM 7817  C C    . THR A 1 43 ? -11.025 17.451 14.086 1.00 0.00 ? 43 THR A C    9  
ATOM 7818  O O    . THR A 1 43 ? -11.719 18.120 13.350 1.00 0.00 ? 43 THR A O    9  
ATOM 7819  C CB   . THR A 1 43 ? -10.709 14.962 14.271 1.00 0.00 ? 43 THR A CB   9  
ATOM 7820  O OG1  . THR A 1 43 ? -9.917  13.869 13.830 1.00 0.00 ? 43 THR A OG1  9  
ATOM 7821  C CG2  . THR A 1 43 ? -12.179 14.697 13.941 1.00 0.00 ? 43 THR A CG2  9  
ATOM 7822  H H    . THR A 1 43 ? -8.442  15.891 14.685 1.00 0.00 ? 43 THR A H    9  
ATOM 7823  H HA   . THR A 1 43 ? -10.370 16.140 12.501 1.00 0.00 ? 43 THR A HA   9  
ATOM 7824  H HB   . THR A 1 43 ? -10.600 15.079 15.339 1.00 0.00 ? 43 THR A HB   9  
ATOM 7825  H HG1  . THR A 1 43 ? -9.050  14.207 13.595 1.00 0.00 ? 43 THR A HG1  9  
ATOM 7826  H HG21 . THR A 1 43 ? -12.642 15.613 13.603 1.00 0.00 ? 43 THR A HG21 9  
ATOM 7827  H HG22 . THR A 1 43 ? -12.243 13.953 13.161 1.00 0.00 ? 43 THR A HG22 9  
ATOM 7828  H HG23 . THR A 1 43 ? -12.687 14.340 14.824 1.00 0.00 ? 43 THR A HG23 9  
ATOM 7829  N N    . CYS A 1 44 ? -10.904 17.742 15.349 1.00 0.00 ? 44 CYS A N    9  
ATOM 7830  C CA   . CYS A 1 44 ? -11.626 18.916 15.911 1.00 0.00 ? 44 CYS A CA   9  
ATOM 7831  C C    . CYS A 1 44 ? -11.444 20.118 14.986 1.00 0.00 ? 44 CYS A C    9  
ATOM 7832  O O    . CYS A 1 44 ? -12.324 20.940 14.839 1.00 0.00 ? 44 CYS A O    9  
ATOM 7833  C CB   . CYS A 1 44 ? -10.969 19.173 17.267 1.00 0.00 ? 44 CYS A CB   9  
ATOM 7834  S SG   . CYS A 1 44 ? -11.829 20.525 18.108 1.00 0.00 ? 44 CYS A SG   9  
ATOM 7835  H H    . CYS A 1 44 ? -10.333 17.196 15.926 1.00 0.00 ? 44 CYS A H    9  
ATOM 7836  H HA   . CYS A 1 44 ? -12.672 18.691 16.041 1.00 0.00 ? 44 CYS A HA   9  
ATOM 7837  H HB2  . CYS A 1 44 ? -11.026 18.279 17.870 1.00 0.00 ? 44 CYS A HB2  9  
ATOM 7838  H HB3  . CYS A 1 44 ? -9.933  19.442 17.120 1.00 0.00 ? 44 CYS A HB3  9  
ATOM 7839  N N    . LYS A 1 45 ? -10.304 20.223 14.357 1.00 0.00 ? 45 LYS A N    9  
ATOM 7840  C CA   . LYS A 1 45 ? -10.060 21.370 13.438 1.00 0.00 ? 45 LYS A CA   9  
ATOM 7841  C C    . LYS A 1 45 ? -11.081 21.360 12.296 1.00 0.00 ? 45 LYS A C    9  
ATOM 7842  O O    . LYS A 1 45 ? -11.678 22.370 11.979 1.00 0.00 ? 45 LYS A O    9  
ATOM 7843  C CB   . LYS A 1 45 ? -8.649  21.151 12.894 1.00 0.00 ? 45 LYS A CB   9  
ATOM 7844  C CG   . LYS A 1 45 ? -8.350  22.200 11.821 1.00 0.00 ? 45 LYS A CG   9  
ATOM 7845  C CD   . LYS A 1 45 ? -7.444  21.592 10.749 1.00 0.00 ? 45 LYS A CD   9  
ATOM 7846  C CE   . LYS A 1 45 ? -6.845  22.713 9.894  1.00 0.00 ? 45 LYS A CE   9  
ATOM 7847  N NZ   . LYS A 1 45 ? -5.840  22.035 9.027  1.00 0.00 ? 45 LYS A NZ   9  
ATOM 7848  H H    . LYS A 1 45 ? -9.608  19.545 14.489 1.00 0.00 ? 45 LYS A H    9  
ATOM 7849  H HA   . LYS A 1 45 ? -10.107 22.302 13.977 1.00 0.00 ? 45 LYS A HA   9  
ATOM 7850  H HB2  . LYS A 1 45 ? -7.934  21.245 13.699 1.00 0.00 ? 45 LYS A HB2  9  
ATOM 7851  H HB3  . LYS A 1 45 ? -8.577  20.164 12.463 1.00 0.00 ? 45 LYS A HB3  9  
ATOM 7852  H HG2  . LYS A 1 45 ? -9.276  22.525 11.367 1.00 0.00 ? 45 LYS A HG2  9  
ATOM 7853  H HG3  . LYS A 1 45 ? -7.855  23.047 12.273 1.00 0.00 ? 45 LYS A HG3  9  
ATOM 7854  H HD2  . LYS A 1 45 ? -6.648  21.036 11.223 1.00 0.00 ? 45 LYS A HD2  9  
ATOM 7855  H HD3  . LYS A 1 45 ? -8.022  20.931 10.121 1.00 0.00 ? 45 LYS A HD3  9  
ATOM 7856  H HE2  . LYS A 1 45 ? -7.611  23.175 9.291  1.00 0.00 ? 45 LYS A HE2  9  
ATOM 7857  H HE3  . LYS A 1 45 ? -6.364  23.448 10.522 1.00 0.00 ? 45 LYS A HE3  9  
ATOM 7858  H HZ1  . LYS A 1 45 ? -6.097  21.034 8.913  1.00 0.00 ? 45 LYS A HZ1  9  
ATOM 7859  H HZ2  . LYS A 1 45 ? -5.820  22.498 8.094  1.00 0.00 ? 45 LYS A HZ2  9  
ATOM 7860  H HZ3  . LYS A 1 45 ? -4.901  22.101 9.468  1.00 0.00 ? 45 LYS A HZ3  9  
ATOM 7861  N N    . MET A 1 46 ? -11.288 20.230 11.676 1.00 0.00 ? 46 MET A N    9  
ATOM 7862  C CA   . MET A 1 46 ? -12.273 20.171 10.560 1.00 0.00 ? 46 MET A CA   9  
ATOM 7863  C C    . MET A 1 46 ? -13.663 20.541 11.077 1.00 0.00 ? 46 MET A C    9  
ATOM 7864  O O    . MET A 1 46 ? -14.531 20.946 10.331 1.00 0.00 ? 46 MET A O    9  
ATOM 7865  C CB   . MET A 1 46 ? -12.239 18.725 10.065 1.00 0.00 ? 46 MET A CB   9  
ATOM 7866  C CG   . MET A 1 46 ? -12.881 17.801 11.101 1.00 0.00 ? 46 MET A CG   9  
ATOM 7867  S SD   . MET A 1 46 ? -14.255 16.902 10.339 1.00 0.00 ? 46 MET A SD   9  
ATOM 7868  C CE   . MET A 1 46 ? -13.269 15.902 9.198  1.00 0.00 ? 46 MET A CE   9  
ATOM 7869  H H    . MET A 1 46 ? -10.801 19.423 11.945 1.00 0.00 ? 46 MET A H    9  
ATOM 7870  H HA   . MET A 1 46 ? -11.976 20.838 9.766  1.00 0.00 ? 46 MET A HA   9  
ATOM 7871  H HB2  . MET A 1 46 ? -12.783 18.652 9.136  1.00 0.00 ? 46 MET A HB2  9  
ATOM 7872  H HB3  . MET A 1 46 ? -11.215 18.426 9.908  1.00 0.00 ? 46 MET A HB3  9  
ATOM 7873  H HG2  . MET A 1 46 ? -12.144 17.098 11.459 1.00 0.00 ? 46 MET A HG2  9  
ATOM 7874  H HG3  . MET A 1 46 ? -13.250 18.385 11.928 1.00 0.00 ? 46 MET A HG3  9  
ATOM 7875  H HE1  . MET A 1 46 ? -12.517 15.361 9.749  1.00 0.00 ? 46 MET A HE1  9  
ATOM 7876  H HE2  . MET A 1 46 ? -13.913 15.201 8.686  1.00 0.00 ? 46 MET A HE2  9  
ATOM 7877  H HE3  . MET A 1 46 ? -12.788 16.550 8.477  1.00 0.00 ? 46 MET A HE3  9  
ATOM 7878  N N    . ILE A 1 47 ? -13.872 20.412 12.356 1.00 0.00 ? 47 ILE A N    9  
ATOM 7879  C CA   . ILE A 1 47 ? -15.199 20.766 12.936 1.00 0.00 ? 47 ILE A CA   9  
ATOM 7880  C C    . ILE A 1 47 ? -15.397 22.281 12.870 1.00 0.00 ? 47 ILE A C    9  
ATOM 7881  O O    . ILE A 1 47 ? -16.498 22.768 12.700 1.00 0.00 ? 47 ILE A O    9  
ATOM 7882  C CB   . ILE A 1 47 ? -15.138 20.293 14.389 1.00 0.00 ? 47 ILE A CB   9  
ATOM 7883  C CG1  . ILE A 1 47 ? -14.706 18.825 14.432 1.00 0.00 ? 47 ILE A CG1  9  
ATOM 7884  C CG2  . ILE A 1 47 ? -16.520 20.436 15.029 1.00 0.00 ? 47 ILE A CG2  9  
ATOM 7885  C CD1  . ILE A 1 47 ? -15.575 18.008 13.473 1.00 0.00 ? 47 ILE A CD1  9  
ATOM 7886  H H    . ILE A 1 47 ? -13.153 20.089 12.937 1.00 0.00 ? 47 ILE A H    9  
ATOM 7887  H HA   . ILE A 1 47 ? -15.990 20.255 12.410 1.00 0.00 ? 47 ILE A HA   9  
ATOM 7888  H HB   . ILE A 1 47 ? -14.426 20.894 14.933 1.00 0.00 ? 47 ILE A HB   9  
ATOM 7889  H HG12 . ILE A 1 47 ? -13.670 18.746 14.136 1.00 0.00 ? 47 ILE A HG12 9  
ATOM 7890  H HG13 . ILE A 1 47 ? -14.824 18.445 15.436 1.00 0.00 ? 47 ILE A HG13 9  
ATOM 7891  H HG21 . ILE A 1 47 ? -17.072 21.216 14.525 1.00 0.00 ? 47 ILE A HG21 9  
ATOM 7892  H HG22 . ILE A 1 47 ? -17.056 19.503 14.942 1.00 0.00 ? 47 ILE A HG22 9  
ATOM 7893  H HG23 . ILE A 1 47 ? -16.409 20.691 16.072 1.00 0.00 ? 47 ILE A HG23 9  
ATOM 7894  H HD11 . ILE A 1 47 ? -15.481 18.407 12.473 1.00 0.00 ? 47 ILE A HD11 9  
ATOM 7895  H HD12 . ILE A 1 47 ? -15.249 16.978 13.482 1.00 0.00 ? 47 ILE A HD12 9  
ATOM 7896  H HD13 . ILE A 1 47 ? -16.607 18.062 13.786 1.00 0.00 ? 47 ILE A HD13 9  
ATOM 7897  N N    . LEU A 1 48 ? -14.334 23.029 12.997 1.00 0.00 ? 48 LEU A N    9  
ATOM 7898  C CA   . LEU A 1 48 ? -14.452 24.512 12.935 1.00 0.00 ? 48 LEU A CA   9  
ATOM 7899  C C    . LEU A 1 48 ? -14.679 24.958 11.489 1.00 0.00 ? 48 LEU A C    9  
ATOM 7900  O O    . LEU A 1 48 ? -15.484 25.824 11.215 1.00 0.00 ? 48 LEU A O    9  
ATOM 7901  C CB   . LEU A 1 48 ? -13.113 25.042 13.449 1.00 0.00 ? 48 LEU A CB   9  
ATOM 7902  C CG   . LEU A 1 48 ? -13.098 25.013 14.979 1.00 0.00 ? 48 LEU A CG   9  
ATOM 7903  C CD1  . LEU A 1 48 ? -14.326 25.750 15.518 1.00 0.00 ? 48 LEU A CD1  9  
ATOM 7904  C CD2  . LEU A 1 48 ? -13.119 23.562 15.460 1.00 0.00 ? 48 LEU A CD2  9  
ATOM 7905  H H    . LEU A 1 48 ? -13.457 22.613 13.128 1.00 0.00 ? 48 LEU A H    9  
ATOM 7906  H HA   . LEU A 1 48 ? -15.255 24.856 13.568 1.00 0.00 ? 48 LEU A HA   9  
ATOM 7907  H HB2  . LEU A 1 48 ? -12.313 24.424 13.070 1.00 0.00 ? 48 LEU A HB2  9  
ATOM 7908  H HB3  . LEU A 1 48 ? -12.974 26.058 13.108 1.00 0.00 ? 48 LEU A HB3  9  
ATOM 7909  H HG   . LEU A 1 48 ? -12.202 25.497 15.337 1.00 0.00 ? 48 LEU A HG   9  
ATOM 7910  H HD11 . LEU A 1 48 ? -14.679 26.452 14.777 1.00 0.00 ? 48 LEU A HD11 9  
ATOM 7911  H HD12 . LEU A 1 48 ? -15.106 25.036 15.738 1.00 0.00 ? 48 LEU A HD12 9  
ATOM 7912  H HD13 . LEU A 1 48 ? -14.059 26.281 16.420 1.00 0.00 ? 48 LEU A HD13 9  
ATOM 7913  H HD21 . LEU A 1 48 ? -12.302 23.022 15.005 1.00 0.00 ? 48 LEU A HD21 9  
ATOM 7914  H HD22 . LEU A 1 48 ? -13.013 23.537 16.535 1.00 0.00 ? 48 LEU A HD22 9  
ATOM 7915  H HD23 . LEU A 1 48 ? -14.056 23.102 15.180 1.00 0.00 ? 48 LEU A HD23 9  
ATOM 7916  N N    . GLU A 1 49 ? -13.973 24.369 10.561 1.00 0.00 ? 49 GLU A N    9  
ATOM 7917  C CA   . GLU A 1 49 ? -14.149 24.762 9.133  1.00 0.00 ? 49 GLU A CA   9  
ATOM 7918  C C    . GLU A 1 49 ? -15.490 24.245 8.606  1.00 0.00 ? 49 GLU A C    9  
ATOM 7919  O O    . GLU A 1 49 ? -16.076 24.813 7.706  1.00 0.00 ? 49 GLU A O    9  
ATOM 7920  C CB   . GLU A 1 49 ? -12.990 24.099 8.390  1.00 0.00 ? 49 GLU A CB   9  
ATOM 7921  C CG   . GLU A 1 49 ? -13.152 22.579 8.449  1.00 0.00 ? 49 GLU A CG   9  
ATOM 7922  C CD   . GLU A 1 49 ? -12.005 21.914 7.686  1.00 0.00 ? 49 GLU A CD   9  
ATOM 7923  O OE1  . GLU A 1 49 ? -11.192 22.636 7.131  1.00 0.00 ? 49 GLU A OE1  9  
ATOM 7924  O OE2  . GLU A 1 49 ? -11.958 20.695 7.668  1.00 0.00 ? 49 GLU A OE2  9  
ATOM 7925  H H    . GLU A 1 49 ? -13.325 23.669 10.804 1.00 0.00 ? 49 GLU A H    9  
ATOM 7926  H HA   . GLU A 1 49 ? -14.090 25.833 9.027  1.00 0.00 ? 49 GLU A HA   9  
ATOM 7927  H HB2  . GLU A 1 49 ? -12.991 24.422 7.360  1.00 0.00 ? 49 GLU A HB2  9  
ATOM 7928  H HB3  . GLU A 1 49 ? -12.057 24.379 8.856  1.00 0.00 ? 49 GLU A HB3  9  
ATOM 7929  H HG2  . GLU A 1 49 ? -13.136 22.257 9.478  1.00 0.00 ? 49 GLU A HG2  9  
ATOM 7930  H HG3  . GLU A 1 49 ? -14.094 22.300 7.999  1.00 0.00 ? 49 GLU A HG3  9  
ATOM 7931  N N    . LYS A 1 50 ? -15.978 23.170 9.160  1.00 0.00 ? 50 LYS A N    9  
ATOM 7932  C CA   . LYS A 1 50 ? -17.281 22.615 8.692  1.00 0.00 ? 50 LYS A CA   9  
ATOM 7933  C C    . LYS A 1 50 ? -18.380 23.674 8.812  1.00 0.00 ? 50 LYS A C    9  
ATOM 7934  O O    . LYS A 1 50 ? -19.219 23.813 7.945  1.00 0.00 ? 50 LYS A O    9  
ATOM 7935  C CB   . LYS A 1 50 ? -17.566 21.437 9.624  1.00 0.00 ? 50 LYS A CB   9  
ATOM 7936  C CG   . LYS A 1 50 ? -17.228 20.127 8.911  1.00 0.00 ? 50 LYS A CG   9  
ATOM 7937  C CD   . LYS A 1 50 ? -18.131 19.011 9.438  1.00 0.00 ? 50 LYS A CD   9  
ATOM 7938  C CE   . LYS A 1 50 ? -19.337 18.847 8.510  1.00 0.00 ? 50 LYS A CE   9  
ATOM 7939  N NZ   . LYS A 1 50 ? -19.998 17.591 8.962  1.00 0.00 ? 50 LYS A NZ   9  
ATOM 7940  H H    . LYS A 1 50 ? -15.488 22.728 9.884  1.00 0.00 ? 50 LYS A H    9  
ATOM 7941  H HA   . LYS A 1 50 ? -17.199 22.269 7.675  1.00 0.00 ? 50 LYS A HA   9  
ATOM 7942  H HB2  . LYS A 1 50 ? -16.962 21.528 10.515 1.00 0.00 ? 50 LYS A HB2  9  
ATOM 7943  H HB3  . LYS A 1 50 ? -18.611 21.439 9.897  1.00 0.00 ? 50 LYS A HB3  9  
ATOM 7944  H HG2  . LYS A 1 50 ? -17.383 20.245 7.848  1.00 0.00 ? 50 LYS A HG2  9  
ATOM 7945  H HG3  . LYS A 1 50 ? -16.195 19.872 9.097  1.00 0.00 ? 50 LYS A HG3  9  
ATOM 7946  H HD2  . LYS A 1 50 ? -17.575 18.085 9.472  1.00 0.00 ? 50 LYS A HD2  9  
ATOM 7947  H HD3  . LYS A 1 50 ? -18.472 19.262 10.430 1.00 0.00 ? 50 LYS A HD3  9  
ATOM 7948  H HE2  . LYS A 1 50 ? -20.009 19.686 8.617  1.00 0.00 ? 50 LYS A HE2  9  
ATOM 7949  H HE3  . LYS A 1 50 ? -19.011 18.754 7.484  1.00 0.00 ? 50 LYS A HE3  9  
ATOM 7950  H HZ1  . LYS A 1 50 ? -19.279 16.851 9.100  1.00 0.00 ? 50 LYS A HZ1  9  
ATOM 7951  H HZ2  . LYS A 1 50 ? -20.495 17.765 9.859  1.00 0.00 ? 50 LYS A HZ2  9  
ATOM 7952  H HZ3  . LYS A 1 50 ? -20.679 17.278 8.242  1.00 0.00 ? 50 LYS A HZ3  9  
ATOM 7953  N N    . GLU A 1 51 ? -18.381 24.422 9.882  1.00 0.00 ? 51 GLU A N    9  
ATOM 7954  C CA   . GLU A 1 51 ? -19.426 25.472 10.057 1.00 0.00 ? 51 GLU A CA   9  
ATOM 7955  C C    . GLU A 1 51 ? -19.323 26.513 8.940  1.00 0.00 ? 51 GLU A C    9  
ATOM 7956  O O    . GLU A 1 51 ? -20.282 27.185 8.614  1.00 0.00 ? 51 GLU A O    9  
ATOM 7957  C CB   . GLU A 1 51 ? -19.122 26.108 11.413 1.00 0.00 ? 51 GLU A CB   9  
ATOM 7958  C CG   . GLU A 1 51 ? -19.439 25.108 12.527 1.00 0.00 ? 51 GLU A CG   9  
ATOM 7959  C CD   . GLU A 1 51 ? -18.838 25.604 13.844 1.00 0.00 ? 51 GLU A CD   9  
ATOM 7960  O OE1  . GLU A 1 51 ? -18.011 26.501 13.794 1.00 0.00 ? 51 GLU A OE1  9  
ATOM 7961  O OE2  . GLU A 1 51 ? -19.213 25.079 14.878 1.00 0.00 ? 51 GLU A OE2  9  
ATOM 7962  H H    . GLU A 1 51 ? -17.695 24.294 10.569 1.00 0.00 ? 51 GLU A H    9  
ATOM 7963  H HA   . GLU A 1 51 ? -20.408 25.027 10.071 1.00 0.00 ? 51 GLU A HA   9  
ATOM 7964  H HB2  . GLU A 1 51 ? -18.078 26.379 11.458 1.00 0.00 ? 51 GLU A HB2  9  
ATOM 7965  H HB3  . GLU A 1 51 ? -19.730 26.992 11.540 1.00 0.00 ? 51 GLU A HB3  9  
ATOM 7966  H HG2  . GLU A 1 51 ? -20.509 25.014 12.633 1.00 0.00 ? 51 GLU A HG2  9  
ATOM 7967  H HG3  . GLU A 1 51 ? -19.016 24.146 12.278 1.00 0.00 ? 51 GLU A HG3  9  
ATOM 7968  N N    . ALA A 1 52 ? -18.167 26.653 8.350  1.00 0.00 ? 52 ALA A N    9  
ATOM 7969  C CA   . ALA A 1 52 ? -18.005 27.651 7.254  1.00 0.00 ? 52 ALA A CA   9  
ATOM 7970  C C    . ALA A 1 52 ? -18.611 27.115 5.955  1.00 0.00 ? 52 ALA A C    9  
ATOM 7971  O O    . ALA A 1 52 ? -18.778 25.924 5.782  1.00 0.00 ? 52 ALA A O    9  
ATOM 7972  C CB   . ALA A 1 52 ? -16.494 27.836 7.107  1.00 0.00 ? 52 ALA A CB   9  
ATOM 7973  H H    . ALA A 1 52 ? -17.406 26.101 8.628  1.00 0.00 ? 52 ALA A H    9  
ATOM 7974  H HA   . ALA A 1 52 ? -18.465 28.589 7.528  1.00 0.00 ? 52 ALA A HA   9  
ATOM 7975  H HB1  . ALA A 1 52 ? -15.986 27.279 7.882  1.00 0.00 ? 52 ALA A HB1  9  
ATOM 7976  H HB2  . ALA A 1 52 ? -16.180 27.472 6.140  1.00 0.00 ? 52 ALA A HB2  9  
ATOM 7977  H HB3  . ALA A 1 52 ? -16.248 28.884 7.196  1.00 0.00 ? 52 ALA A HB3  9  
ATOM 7978  N N    . LYS A 1 53 ? -18.941 27.984 5.041  1.00 0.00 ? 53 LYS A N    9  
ATOM 7979  C CA   . LYS A 1 53 ? -19.535 27.524 3.753  1.00 0.00 ? 53 LYS A CA   9  
ATOM 7980  C C    . LYS A 1 53 ? -18.600 26.527 3.065  1.00 0.00 ? 53 LYS A C    9  
ATOM 7981  O O    . LYS A 1 53 ? -19.023 25.710 2.271  1.00 0.00 ? 53 LYS A O    9  
ATOM 7982  C CB   . LYS A 1 53 ? -19.683 28.790 2.910  1.00 0.00 ? 53 LYS A CB   9  
ATOM 7983  C CG   . LYS A 1 53 ? -20.419 28.457 1.612  1.00 0.00 ? 53 LYS A CG   9  
ATOM 7984  C CD   . LYS A 1 53 ? -20.426 29.684 0.699  1.00 0.00 ? 53 LYS A CD   9  
ATOM 7985  C CE   . LYS A 1 53 ? -21.169 29.354 -0.596 1.00 0.00 ? 53 LYS A CE   9  
ATOM 7986  N NZ   . LYS A 1 53 ? -21.124 30.614 -1.393 1.00 0.00 ? 53 LYS A NZ   9  
ATOM 7987  H H    . LYS A 1 53 ? -18.797 28.941 5.199  1.00 0.00 ? 53 LYS A H    9  
ATOM 7988  H HA   . LYS A 1 53 ? -20.504 27.079 3.923  1.00 0.00 ? 53 LYS A HA   9  
ATOM 7989  H HB2  . LYS A 1 53 ? -20.246 29.527 3.464  1.00 0.00 ? 53 LYS A HB2  9  
ATOM 7990  H HB3  . LYS A 1 53 ? -18.705 29.185 2.679  1.00 0.00 ? 53 LYS A HB3  9  
ATOM 7991  H HG2  . LYS A 1 53 ? -19.917 27.640 1.113  1.00 0.00 ? 53 LYS A HG2  9  
ATOM 7992  H HG3  . LYS A 1 53 ? -21.436 28.171 1.836  1.00 0.00 ? 53 LYS A HG3  9  
ATOM 7993  H HD2  . LYS A 1 53 ? -20.920 30.503 1.201  1.00 0.00 ? 53 LYS A HD2  9  
ATOM 7994  H HD3  . LYS A 1 53 ? -19.409 29.966 0.468  1.00 0.00 ? 53 LYS A HD3  9  
ATOM 7995  H HE2  . LYS A 1 53 ? -20.669 28.557 -1.125 1.00 0.00 ? 53 LYS A HE2  9  
ATOM 7996  H HE3  . LYS A 1 53 ? -22.193 29.082 -0.384 1.00 0.00 ? 53 LYS A HE3  9  
ATOM 7997  H HZ1  . LYS A 1 53 ? -20.243 31.126 -1.181 1.00 0.00 ? 53 LYS A HZ1  9  
ATOM 7998  H HZ2  . LYS A 1 53 ? -21.156 30.385 -2.407 1.00 0.00 ? 53 LYS A HZ2  9  
ATOM 7999  H HZ3  . LYS A 1 53 ? -21.939 31.210 -1.149 1.00 0.00 ? 53 LYS A HZ3  9  
ATOM 8000  N N    . SER A 1 54 ? -17.330 26.588 3.363  1.00 0.00 ? 54 SER A N    9  
ATOM 8001  C CA   . SER A 1 54 ? -16.369 25.643 2.725  1.00 0.00 ? 54 SER A CA   9  
ATOM 8002  C C    . SER A 1 54 ? -16.641 25.546 1.221  1.00 0.00 ? 54 SER A C    9  
ATOM 8003  O O    . SER A 1 54 ? -16.643 24.475 0.649  1.00 0.00 ? 54 SER A O    9  
ATOM 8004  C CB   . SER A 1 54 ? -16.626 24.297 3.404  1.00 0.00 ? 54 SER A CB   9  
ATOM 8005  O OG   . SER A 1 54 ? -16.405 24.421 4.801  1.00 0.00 ? 54 SER A OG   9  
ATOM 8006  H H    . SER A 1 54 ? -17.009 27.254 4.006  1.00 0.00 ? 54 SER A H    9  
ATOM 8007  H HA   . SER A 1 54 ? -15.354 25.958 2.906  1.00 0.00 ? 54 SER A HA   9  
ATOM 8008  H HB2  . SER A 1 54 ? -17.648 23.994 3.227  1.00 0.00 ? 54 SER A HB2  9  
ATOM 8009  H HB3  . SER A 1 54 ? -15.956 23.554 2.998  1.00 0.00 ? 54 SER A HB3  9  
ATOM 8010  H HG   . SER A 1 54 ? -17.250 24.326 5.245  1.00 0.00 ? 54 SER A HG   9  
ATOM 8011  N N    . GLN A 1 55 ? -16.870 26.659 0.577  1.00 0.00 ? 55 GLN A N    9  
ATOM 8012  C CA   . GLN A 1 55 ? -17.141 26.628 -0.888 1.00 0.00 ? 55 GLN A CA   9  
ATOM 8013  C C    . GLN A 1 55 ? -15.942 26.042 -1.637 1.00 0.00 ? 55 GLN A C    9  
ATOM 8014  O O    . GLN A 1 55 ? -15.061 26.807 -1.997 1.00 0.00 ? 55 GLN A O    9  
ATOM 8015  C CB   . GLN A 1 55 ? -17.356 28.091 -1.281 1.00 0.00 ? 55 GLN A CB   9  
ATOM 8016  C CG   . GLN A 1 55 ? -17.641 28.180 -2.782 1.00 0.00 ? 55 GLN A CG   9  
ATOM 8017  C CD   . GLN A 1 55 ? -17.704 29.649 -3.202 1.00 0.00 ? 55 GLN A CD   9  
ATOM 8018  O OE1  . GLN A 1 55 ? -17.104 30.499 -2.575 1.00 0.00 ? 55 GLN A OE1  9  
ATOM 8019  N NE2  . GLN A 1 55 ? -18.411 29.986 -4.246 1.00 0.00 ? 55 GLN A NE2  9  
ATOM 8020  O OXT  . GLN A 1 55 ? -15.924 24.839 -1.838 1.00 0.00 ? 55 GLN A OXT  9  
ATOM 8021  H H    . GLN A 1 55 ? -16.863 27.513 1.058  1.00 0.00 ? 55 GLN A H    9  
ATOM 8022  H HA   . GLN A 1 55 ? -18.032 26.057 -1.095 1.00 0.00 ? 55 GLN A HA   9  
ATOM 8023  H HB2  . GLN A 1 55 ? -18.196 28.490 -0.732 1.00 0.00 ? 55 GLN A HB2  9  
ATOM 8024  H HB3  . GLN A 1 55 ? -16.469 28.660 -1.048 1.00 0.00 ? 55 GLN A HB3  9  
ATOM 8025  H HG2  . GLN A 1 55 ? -16.853 27.682 -3.327 1.00 0.00 ? 55 GLN A HG2  9  
ATOM 8026  H HG3  . GLN A 1 55 ? -18.584 27.702 -2.998 1.00 0.00 ? 55 GLN A HG3  9  
ATOM 8027  H HE21 . GLN A 1 55 ? -18.896 29.301 -4.752 1.00 0.00 ? 55 GLN A HE21 9  
ATOM 8028  H HE22 . GLN A 1 55 ? -18.458 30.925 -4.523 1.00 0.00 ? 55 GLN A HE22 9  
ATOM 8029  N N    . LYS A 1 1  ? -25.627 23.328 11.855 1.00 0.00 ? 1  LYS A N    10 
ATOM 8030  C CA   . LYS A 1 1  ? -25.765 23.164 13.331 1.00 0.00 ? 1  LYS A CA   10 
ATOM 8031  C C    . LYS A 1 1  ? -25.182 21.817 13.772 1.00 0.00 ? 1  LYS A C    10 
ATOM 8032  O O    . LYS A 1 1  ? -25.863 20.812 13.791 1.00 0.00 ? 1  LYS A O    10 
ATOM 8033  C CB   . LYS A 1 1  ? -27.270 23.208 13.596 1.00 0.00 ? 1  LYS A CB   10 
ATOM 8034  C CG   . LYS A 1 1  ? -27.524 23.197 15.104 1.00 0.00 ? 1  LYS A CG   10 
ATOM 8035  C CD   . LYS A 1 1  ? -27.310 24.603 15.667 1.00 0.00 ? 1  LYS A CD   10 
ATOM 8036  C CE   . LYS A 1 1  ? -27.450 24.568 17.190 1.00 0.00 ? 1  LYS A CE   10 
ATOM 8037  N NZ   . LYS A 1 1  ? -27.116 25.949 17.637 1.00 0.00 ? 1  LYS A NZ   10 
ATOM 8038  H H1   . LYS A 1 1  ? -24.797 22.795 11.524 1.00 0.00 ? 1  LYS A H1   10 
ATOM 8039  H H2   . LYS A 1 1  ? -26.481 22.966 11.384 1.00 0.00 ? 1  LYS A H2   10 
ATOM 8040  H H3   . LYS A 1 1  ? -25.508 24.334 11.627 1.00 0.00 ? 1  LYS A H3   10 
ATOM 8041  H HA   . LYS A 1 1  ? -25.276 23.974 13.848 1.00 0.00 ? 1  LYS A HA   10 
ATOM 8042  H HB2  . LYS A 1 1  ? -27.685 24.108 13.168 1.00 0.00 ? 1  LYS A HB2  10 
ATOM 8043  H HB3  . LYS A 1 1  ? -27.741 22.346 13.146 1.00 0.00 ? 1  LYS A HB3  10 
ATOM 8044  H HG2  . LYS A 1 1  ? -28.540 22.885 15.296 1.00 0.00 ? 1  LYS A HG2  10 
ATOM 8045  H HG3  . LYS A 1 1  ? -26.841 22.510 15.580 1.00 0.00 ? 1  LYS A HG3  10 
ATOM 8046  H HD2  . LYS A 1 1  ? -26.320 24.948 15.405 1.00 0.00 ? 1  LYS A HD2  10 
ATOM 8047  H HD3  . LYS A 1 1  ? -28.048 25.274 15.253 1.00 0.00 ? 1  LYS A HD3  10 
ATOM 8048  H HE2  . LYS A 1 1  ? -28.465 24.319 17.467 1.00 0.00 ? 1  LYS A HE2  10 
ATOM 8049  H HE3  . LYS A 1 1  ? -26.758 23.857 17.615 1.00 0.00 ? 1  LYS A HE3  10 
ATOM 8050  H HZ1  . LYS A 1 1  ? -27.780 26.623 17.204 1.00 0.00 ? 1  LYS A HZ1  10 
ATOM 8051  H HZ2  . LYS A 1 1  ? -27.188 26.006 18.672 1.00 0.00 ? 1  LYS A HZ2  10 
ATOM 8052  H HZ3  . LYS A 1 1  ? -26.145 26.182 17.346 1.00 0.00 ? 1  LYS A HZ3  10 
ATOM 8053  N N    . ASN A 1 2  ? -23.926 21.791 14.125 1.00 0.00 ? 2  ASN A N    10 
ATOM 8054  C CA   . ASN A 1 2  ? -23.299 20.512 14.565 1.00 0.00 ? 2  ASN A CA   10 
ATOM 8055  C C    . ASN A 1 2  ? -23.732 19.366 13.648 1.00 0.00 ? 2  ASN A C    10 
ATOM 8056  O O    . ASN A 1 2  ? -24.422 18.454 14.061 1.00 0.00 ? 2  ASN A O    10 
ATOM 8057  C CB   . ASN A 1 2  ? -23.816 20.286 15.986 1.00 0.00 ? 2  ASN A CB   10 
ATOM 8058  C CG   . ASN A 1 2  ? -23.292 21.396 16.901 1.00 0.00 ? 2  ASN A CG   10 
ATOM 8059  O OD1  . ASN A 1 2  ? -22.181 21.860 16.738 1.00 0.00 ? 2  ASN A OD1  10 
ATOM 8060  N ND2  . ASN A 1 2  ? -24.051 21.843 17.863 1.00 0.00 ? 2  ASN A ND2  10 
ATOM 8061  H H    . ASN A 1 2  ? -23.394 22.615 14.102 1.00 0.00 ? 2  ASN A H    10 
ATOM 8062  H HA   . ASN A 1 2  ? -22.225 20.602 14.574 1.00 0.00 ? 2  ASN A HA   10 
ATOM 8063  H HB2  . ASN A 1 2  ? -24.896 20.301 15.984 1.00 0.00 ? 2  ASN A HB2  10 
ATOM 8064  H HB3  . ASN A 1 2  ? -23.470 19.329 16.347 1.00 0.00 ? 2  ASN A HB3  10 
ATOM 8065  H HD21 . ASN A 1 2  ? -24.947 21.470 17.995 1.00 0.00 ? 2  ASN A HD21 10 
ATOM 8066  H HD22 . ASN A 1 2  ? -23.724 22.552 18.455 1.00 0.00 ? 2  ASN A HD22 10 
ATOM 8067  N N    . GLU A 1 3  ? -23.332 19.403 12.406 1.00 0.00 ? 3  GLU A N    10 
ATOM 8068  C CA   . GLU A 1 3  ? -23.722 18.314 11.466 1.00 0.00 ? 3  GLU A CA   10 
ATOM 8069  C C    . GLU A 1 3  ? -22.820 17.092 11.666 1.00 0.00 ? 3  GLU A C    10 
ATOM 8070  O O    . GLU A 1 3  ? -23.083 16.023 11.151 1.00 0.00 ? 3  GLU A O    10 
ATOM 8071  C CB   . GLU A 1 3  ? -23.521 18.905 10.071 1.00 0.00 ? 3  GLU A CB   10 
ATOM 8072  C CG   . GLU A 1 3  ? -24.414 20.137 9.907  1.00 0.00 ? 3  GLU A CG   10 
ATOM 8073  C CD   . GLU A 1 3  ? -24.090 20.829 8.582  1.00 0.00 ? 3  GLU A CD   10 
ATOM 8074  O OE1  . GLU A 1 3  ? -23.265 20.307 7.851  1.00 0.00 ? 3  GLU A OE1  10 
ATOM 8075  O OE2  . GLU A 1 3  ? -24.672 21.869 8.322  1.00 0.00 ? 3  GLU A OE2  10 
ATOM 8076  H H    . GLU A 1 3  ? -22.776 20.145 12.093 1.00 0.00 ? 3  GLU A H    10 
ATOM 8077  H HA   . GLU A 1 3  ? -24.756 18.045 11.606 1.00 0.00 ? 3  GLU A HA   10 
ATOM 8078  H HB2  . GLU A 1 3  ? -22.487 19.190 9.945  1.00 0.00 ? 3  GLU A HB2  10 
ATOM 8079  H HB3  . GLU A 1 3  ? -23.785 18.169 9.326  1.00 0.00 ? 3  GLU A HB3  10 
ATOM 8080  H HG2  . GLU A 1 3  ? -25.451 19.834 9.912  1.00 0.00 ? 3  GLU A HG2  10 
ATOM 8081  H HG3  . GLU A 1 3  ? -24.236 20.821 10.724 1.00 0.00 ? 3  GLU A HG3  10 
ATOM 8082  N N    . ASP A 1 4  ? -21.760 17.241 12.413 1.00 0.00 ? 4  ASP A N    10 
ATOM 8083  C CA   . ASP A 1 4  ? -20.845 16.086 12.646 1.00 0.00 ? 4  ASP A CA   10 
ATOM 8084  C C    . ASP A 1 4  ? -21.370 15.221 13.795 1.00 0.00 ? 4  ASP A C    10 
ATOM 8085  O O    . ASP A 1 4  ? -21.097 14.039 13.866 1.00 0.00 ? 4  ASP A O    10 
ATOM 8086  C CB   . ASP A 1 4  ? -19.500 16.713 13.013 1.00 0.00 ? 4  ASP A CB   10 
ATOM 8087  C CG   . ASP A 1 4  ? -18.793 17.183 11.741 1.00 0.00 ? 4  ASP A CG   10 
ATOM 8088  O OD1  . ASP A 1 4  ? -19.234 16.806 10.668 1.00 0.00 ? 4  ASP A OD1  10 
ATOM 8089  O OD2  . ASP A 1 4  ? -17.822 17.913 11.861 1.00 0.00 ? 4  ASP A OD2  10 
ATOM 8090  H H    . ASP A 1 4  ? -21.566 18.110 12.821 1.00 0.00 ? 4  ASP A H    10 
ATOM 8091  H HA   . ASP A 1 4  ? -20.745 15.498 11.747 1.00 0.00 ? 4  ASP A HA   10 
ATOM 8092  H HB2  . ASP A 1 4  ? -19.661 17.555 13.669 1.00 0.00 ? 4  ASP A HB2  10 
ATOM 8093  H HB3  . ASP A 1 4  ? -18.887 15.979 13.515 1.00 0.00 ? 4  ASP A HB3  10 
ATOM 8094  N N    . GLN A 1 5  ? -22.119 15.805 14.695 1.00 0.00 ? 5  GLN A N    10 
ATOM 8095  C CA   . GLN A 1 5  ? -22.674 15.030 15.852 1.00 0.00 ? 5  GLN A CA   10 
ATOM 8096  C C    . GLN A 1 5  ? -21.589 14.751 16.895 1.00 0.00 ? 5  GLN A C    10 
ATOM 8097  O O    . GLN A 1 5  ? -21.793 14.953 18.076 1.00 0.00 ? 5  GLN A O    10 
ATOM 8098  C CB   . GLN A 1 5  ? -23.207 13.723 15.262 1.00 0.00 ? 5  GLN A CB   10 
ATOM 8099  C CG   . GLN A 1 5  ? -24.561 13.394 15.894 1.00 0.00 ? 5  GLN A CG   10 
ATOM 8100  C CD   . GLN A 1 5  ? -25.172 12.180 15.192 1.00 0.00 ? 5  GLN A CD   10 
ATOM 8101  O OE1  . GLN A 1 5  ? -25.088 12.054 13.987 1.00 0.00 ? 5  GLN A OE1  10 
ATOM 8102  N NE2  . GLN A 1 5  ? -25.789 11.274 15.901 1.00 0.00 ? 5  GLN A NE2  10 
ATOM 8103  H H    . GLN A 1 5  ? -22.319 16.760 14.613 1.00 0.00 ? 5  GLN A H    10 
ATOM 8104  H HA   . GLN A 1 5  ? -23.482 15.578 16.304 1.00 0.00 ? 5  GLN A HA   10 
ATOM 8105  H HB2  . GLN A 1 5  ? -23.326 13.832 14.193 1.00 0.00 ? 5  GLN A HB2  10 
ATOM 8106  H HB3  . GLN A 1 5  ? -22.510 12.925 15.467 1.00 0.00 ? 5  GLN A HB3  10 
ATOM 8107  H HG2  . GLN A 1 5  ? -24.424 13.173 16.943 1.00 0.00 ? 5  GLN A HG2  10 
ATOM 8108  H HG3  . GLN A 1 5  ? -25.223 14.242 15.790 1.00 0.00 ? 5  GLN A HG3  10 
ATOM 8109  H HE21 . GLN A 1 5  ? -25.858 11.375 16.873 1.00 0.00 ? 5  GLN A HE21 10 
ATOM 8110  H HE22 . GLN A 1 5  ? -26.185 10.493 15.461 1.00 0.00 ? 5  GLN A HE22 10 
ATOM 8111  N N    . GLU A 1 6  ? -20.444 14.287 16.471 1.00 0.00 ? 6  GLU A N    10 
ATOM 8112  C CA   . GLU A 1 6  ? -19.345 13.993 17.439 1.00 0.00 ? 6  GLU A CA   10 
ATOM 8113  C C    . GLU A 1 6  ? -19.305 15.062 18.534 1.00 0.00 ? 6  GLU A C    10 
ATOM 8114  O O    . GLU A 1 6  ? -18.929 14.803 19.659 1.00 0.00 ? 6  GLU A O    10 
ATOM 8115  C CB   . GLU A 1 6  ? -18.061 14.033 16.608 1.00 0.00 ? 6  GLU A CB   10 
ATOM 8116  C CG   . GLU A 1 6  ? -18.123 12.958 15.521 1.00 0.00 ? 6  GLU A CG   10 
ATOM 8117  C CD   . GLU A 1 6  ? -16.734 12.781 14.902 1.00 0.00 ? 6  GLU A CD   10 
ATOM 8118  O OE1  . GLU A 1 6  ? -15.801 13.385 15.405 1.00 0.00 ? 6  GLU A OE1  10 
ATOM 8119  O OE2  . GLU A 1 6  ? -16.628 12.042 13.937 1.00 0.00 ? 6  GLU A OE2  10 
ATOM 8120  H H    . GLU A 1 6  ? -20.308 14.129 15.518 1.00 0.00 ? 6  GLU A H    10 
ATOM 8121  H HA   . GLU A 1 6  ? -19.474 13.015 17.872 1.00 0.00 ? 6  GLU A HA   10 
ATOM 8122  H HB2  . GLU A 1 6  ? -17.961 15.004 16.148 1.00 0.00 ? 6  GLU A HB2  10 
ATOM 8123  H HB3  . GLU A 1 6  ? -17.212 13.849 17.249 1.00 0.00 ? 6  GLU A HB3  10 
ATOM 8124  H HG2  . GLU A 1 6  ? -18.445 12.024 15.956 1.00 0.00 ? 6  GLU A HG2  10 
ATOM 8125  H HG3  . GLU A 1 6  ? -18.822 13.260 14.755 1.00 0.00 ? 6  GLU A HG3  10 
ATOM 8126  N N    . MET A 1 7  ? -19.700 16.262 18.209 1.00 0.00 ? 7  MET A N    10 
ATOM 8127  C CA   . MET A 1 7  ? -19.697 17.352 19.225 1.00 0.00 ? 7  MET A CA   10 
ATOM 8128  C C    . MET A 1 7  ? -18.332 17.441 19.910 1.00 0.00 ? 7  MET A C    10 
ATOM 8129  O O    . MET A 1 7  ? -18.238 17.662 21.101 1.00 0.00 ? 7  MET A O    10 
ATOM 8130  C CB   . MET A 1 7  ? -20.777 16.956 20.231 1.00 0.00 ? 7  MET A CB   10 
ATOM 8131  C CG   . MET A 1 7  ? -22.151 17.363 19.693 1.00 0.00 ? 7  MET A CG   10 
ATOM 8132  S SD   . MET A 1 7  ? -23.442 16.673 20.757 1.00 0.00 ? 7  MET A SD   10 
ATOM 8133  C CE   . MET A 1 7  ? -24.719 16.510 19.486 1.00 0.00 ? 7  MET A CE   10 
ATOM 8134  H H    . MET A 1 7  ? -20.003 16.445 17.295 1.00 0.00 ? 7  MET A H    10 
ATOM 8135  H HA   . MET A 1 7  ? -19.951 18.295 18.765 1.00 0.00 ? 7  MET A HA   10 
ATOM 8136  H HB2  . MET A 1 7  ? -20.752 15.887 20.382 1.00 0.00 ? 7  MET A HB2  10 
ATOM 8137  H HB3  . MET A 1 7  ? -20.596 17.456 21.171 1.00 0.00 ? 7  MET A HB3  10 
ATOM 8138  H HG2  . MET A 1 7  ? -22.229 18.440 19.683 1.00 0.00 ? 7  MET A HG2  10 
ATOM 8139  H HG3  . MET A 1 7  ? -22.271 16.983 18.689 1.00 0.00 ? 7  MET A HG3  10 
ATOM 8140  H HE1  . MET A 1 7  ? -24.252 16.462 18.511 1.00 0.00 ? 7  MET A HE1  10 
ATOM 8141  H HE2  . MET A 1 7  ? -25.290 15.610 19.663 1.00 0.00 ? 7  MET A HE2  10 
ATOM 8142  H HE3  . MET A 1 7  ? -25.378 17.363 19.523 1.00 0.00 ? 7  MET A HE3  10 
ATOM 8143  N N    . CYS A 1 8  ? -17.272 17.270 19.168 1.00 0.00 ? 8  CYS A N    10 
ATOM 8144  C CA   . CYS A 1 8  ? -15.915 17.345 19.781 1.00 0.00 ? 8  CYS A CA   10 
ATOM 8145  C C    . CYS A 1 8  ? -15.824 18.558 20.712 1.00 0.00 ? 8  CYS A C    10 
ATOM 8146  O O    . CYS A 1 8  ? -15.915 18.434 21.917 1.00 0.00 ? 8  CYS A O    10 
ATOM 8147  C CB   . CYS A 1 8  ? -14.956 17.500 18.602 1.00 0.00 ? 8  CYS A CB   10 
ATOM 8148  S SG   . CYS A 1 8  ? -13.272 17.739 19.223 1.00 0.00 ? 8  CYS A SG   10 
ATOM 8149  H H    . CYS A 1 8  ? -17.368 17.092 18.209 1.00 0.00 ? 8  CYS A H    10 
ATOM 8150  H HA   . CYS A 1 8  ? -15.694 16.438 20.321 1.00 0.00 ? 8  CYS A HA   10 
ATOM 8151  H HB2  . CYS A 1 8  ? -14.990 16.611 17.990 1.00 0.00 ? 8  CYS A HB2  10 
ATOM 8152  H HB3  . CYS A 1 8  ? -15.245 18.356 18.010 1.00 0.00 ? 8  CYS A HB3  10 
ATOM 8153  N N    . HIS A 1 9  ? -15.646 19.727 20.162 1.00 0.00 ? 9  HIS A N    10 
ATOM 8154  C CA   . HIS A 1 9  ? -15.550 20.947 21.015 1.00 0.00 ? 9  HIS A CA   10 
ATOM 8155  C C    . HIS A 1 9  ? -14.575 20.707 22.171 1.00 0.00 ? 9  HIS A C    10 
ATOM 8156  O O    . HIS A 1 9  ? -14.654 21.339 23.206 1.00 0.00 ? 9  HIS A O    10 
ATOM 8157  C CB   . HIS A 1 9  ? -16.966 21.172 21.545 1.00 0.00 ? 9  HIS A CB   10 
ATOM 8158  C CG   . HIS A 1 9  ? -17.840 21.683 20.433 1.00 0.00 ? 9  HIS A CG   10 
ATOM 8159  N ND1  . HIS A 1 9  ? -18.704 20.856 19.732 1.00 0.00 ? 9  HIS A ND1  10 
ATOM 8160  C CD2  . HIS A 1 9  ? -17.997 22.934 19.890 1.00 0.00 ? 9  HIS A CD2  10 
ATOM 8161  C CE1  . HIS A 1 9  ? -19.335 21.612 18.816 1.00 0.00 ? 9  HIS A CE1  10 
ATOM 8162  N NE2  . HIS A 1 9  ? -18.942 22.887 18.869 1.00 0.00 ? 9  HIS A NE2  10 
ATOM 8163  H H    . HIS A 1 9  ? -15.577 19.805 19.187 1.00 0.00 ? 9  HIS A H    10 
ATOM 8164  H HA   . HIS A 1 9  ? -15.237 21.795 20.427 1.00 0.00 ? 9  HIS A HA   10 
ATOM 8165  H HB2  . HIS A 1 9  ? -17.364 20.239 21.917 1.00 0.00 ? 9  HIS A HB2  10 
ATOM 8166  H HB3  . HIS A 1 9  ? -16.940 21.896 22.345 1.00 0.00 ? 9  HIS A HB3  10 
ATOM 8167  H HD1  . HIS A 1 9  ? -18.831 19.895 19.877 1.00 0.00 ? 9  HIS A HD1  10 
ATOM 8168  H HD2  . HIS A 1 9  ? -17.467 23.820 20.207 1.00 0.00 ? 9  HIS A HD2  10 
ATOM 8169  H HE1  . HIS A 1 9  ? -20.071 21.234 18.122 1.00 0.00 ? 9  HIS A HE1  10 
ATOM 8170  N N    . GLU A 1 10 ? -13.654 19.797 22.001 1.00 0.00 ? 10 GLU A N    10 
ATOM 8171  C CA   . GLU A 1 10 ? -12.673 19.515 23.088 1.00 0.00 ? 10 GLU A CA   10 
ATOM 8172  C C    . GLU A 1 10 ? -11.470 20.454 22.969 1.00 0.00 ? 10 GLU A C    10 
ATOM 8173  O O    . GLU A 1 10 ? -10.781 20.721 23.934 1.00 0.00 ? 10 GLU A O    10 
ATOM 8174  C CB   . GLU A 1 10 ? -12.244 18.065 22.866 1.00 0.00 ? 10 GLU A CB   10 
ATOM 8175  C CG   . GLU A 1 10 ? -11.077 17.730 23.797 1.00 0.00 ? 10 GLU A CG   10 
ATOM 8176  C CD   . GLU A 1 10 ? -10.638 16.283 23.564 1.00 0.00 ? 10 GLU A CD   10 
ATOM 8177  O OE1  . GLU A 1 10 ? -11.482 15.477 23.209 1.00 0.00 ? 10 GLU A OE1  10 
ATOM 8178  O OE2  . GLU A 1 10 ? -9.464  16.004 23.746 1.00 0.00 ? 10 GLU A OE2  10 
ATOM 8179  H H    . GLU A 1 10 ? -13.608 19.300 21.159 1.00 0.00 ? 10 GLU A H    10 
ATOM 8180  H HA   . GLU A 1 10 ? -13.139 19.619 24.054 1.00 0.00 ? 10 GLU A HA   10 
ATOM 8181  H HB2  . GLU A 1 10 ? -13.074 17.407 23.079 1.00 0.00 ? 10 GLU A HB2  10 
ATOM 8182  H HB3  . GLU A 1 10 ? -11.936 17.934 21.840 1.00 0.00 ? 10 GLU A HB3  10 
ATOM 8183  H HG2  . GLU A 1 10 ? -10.251 18.394 23.592 1.00 0.00 ? 10 GLU A HG2  10 
ATOM 8184  H HG3  . GLU A 1 10 ? -11.389 17.850 24.823 1.00 0.00 ? 10 GLU A HG3  10 
ATOM 8185  N N    . PHE A 1 11 ? -11.212 20.957 21.794 1.00 0.00 ? 11 PHE A N    10 
ATOM 8186  C CA   . PHE A 1 11 ? -10.055 21.878 21.615 1.00 0.00 ? 11 PHE A CA   10 
ATOM 8187  C C    . PHE A 1 11 ? -10.528 23.333 21.641 1.00 0.00 ? 11 PHE A C    10 
ATOM 8188  O O    . PHE A 1 11 ? -9.738  24.253 21.560 1.00 0.00 ? 11 PHE A O    10 
ATOM 8189  C CB   . PHE A 1 11 ? -9.478  21.528 20.244 1.00 0.00 ? 11 PHE A CB   10 
ATOM 8190  C CG   . PHE A 1 11 ? -8.604  20.299 20.357 1.00 0.00 ? 11 PHE A CG   10 
ATOM 8191  C CD1  . PHE A 1 11 ? -9.160  19.076 20.753 1.00 0.00 ? 11 PHE A CD1  10 
ATOM 8192  C CD2  . PHE A 1 11 ? -7.237  20.384 20.064 1.00 0.00 ? 11 PHE A CD2  10 
ATOM 8193  C CE1  . PHE A 1 11 ? -8.351  17.940 20.854 1.00 0.00 ? 11 PHE A CE1  10 
ATOM 8194  C CE2  . PHE A 1 11 ? -6.428  19.246 20.166 1.00 0.00 ? 11 PHE A CE2  10 
ATOM 8195  C CZ   . PHE A 1 11 ? -6.985  18.025 20.560 1.00 0.00 ? 11 PHE A CZ   10 
ATOM 8196  H H    . PHE A 1 11 ? -11.779 20.729 21.027 1.00 0.00 ? 11 PHE A H    10 
ATOM 8197  H HA   . PHE A 1 11 ? -9.314  21.706 22.381 1.00 0.00 ? 11 PHE A HA   10 
ATOM 8198  H HB2  . PHE A 1 11 ? -10.284 21.334 19.555 1.00 0.00 ? 11 PHE A HB2  10 
ATOM 8199  H HB3  . PHE A 1 11 ? -8.888  22.356 19.882 1.00 0.00 ? 11 PHE A HB3  10 
ATOM 8200  H HD1  . PHE A 1 11 ? -10.212 19.009 20.982 1.00 0.00 ? 11 PHE A HD1  10 
ATOM 8201  H HD2  . PHE A 1 11 ? -6.808  21.326 19.759 1.00 0.00 ? 11 PHE A HD2  10 
ATOM 8202  H HE1  . PHE A 1 11 ? -8.780  16.997 21.159 1.00 0.00 ? 11 PHE A HE1  10 
ATOM 8203  H HE2  . PHE A 1 11 ? -5.373  19.310 19.940 1.00 0.00 ? 11 PHE A HE2  10 
ATOM 8204  H HZ   . PHE A 1 11 ? -6.361  17.149 20.640 1.00 0.00 ? 11 PHE A HZ   10 
ATOM 8205  N N    . GLN A 1 12 ? -11.810 23.553 21.754 1.00 0.00 ? 12 GLN A N    10 
ATOM 8206  C CA   . GLN A 1 12 ? -12.323 24.953 21.785 1.00 0.00 ? 12 GLN A CA   10 
ATOM 8207  C C    . GLN A 1 12 ? -11.454 25.804 22.712 1.00 0.00 ? 12 GLN A C    10 
ATOM 8208  O O    . GLN A 1 12 ? -11.095 26.920 22.393 1.00 0.00 ? 12 GLN A O    10 
ATOM 8209  C CB   . GLN A 1 12 ? -13.747 24.848 22.330 1.00 0.00 ? 12 GLN A CB   10 
ATOM 8210  C CG   . GLN A 1 12 ? -14.464 26.186 22.138 1.00 0.00 ? 12 GLN A CG   10 
ATOM 8211  C CD   . GLN A 1 12 ? -15.931 26.046 22.552 1.00 0.00 ? 12 GLN A CD   10 
ATOM 8212  O OE1  . GLN A 1 12 ? -16.477 24.961 22.542 1.00 0.00 ? 12 GLN A OE1  10 
ATOM 8213  N NE2  . GLN A 1 12 ? -16.596 27.108 22.919 1.00 0.00 ? 12 GLN A NE2  10 
ATOM 8214  H H    . GLN A 1 12 ? -12.434 22.800 21.819 1.00 0.00 ? 12 GLN A H    10 
ATOM 8215  H HA   . GLN A 1 12 ? -12.337 25.373 20.791 1.00 0.00 ? 12 GLN A HA   10 
ATOM 8216  H HB2  . GLN A 1 12 ? -14.280 24.073 21.800 1.00 0.00 ? 12 GLN A HB2  10 
ATOM 8217  H HB3  . GLN A 1 12 ? -13.713 24.607 23.383 1.00 0.00 ? 12 GLN A HB3  10 
ATOM 8218  H HG2  . GLN A 1 12 ? -13.989 26.941 22.747 1.00 0.00 ? 12 GLN A HG2  10 
ATOM 8219  H HG3  . GLN A 1 12 ? -14.410 26.477 21.098 1.00 0.00 ? 12 GLN A HG3  10 
ATOM 8220  H HE21 . GLN A 1 12 ? -16.156 27.984 22.927 1.00 0.00 ? 12 GLN A HE21 10 
ATOM 8221  H HE22 . GLN A 1 12 ? -17.535 27.029 23.186 1.00 0.00 ? 12 GLN A HE22 10 
ATOM 8222  N N    . ALA A 1 13 ? -11.108 25.282 23.856 1.00 0.00 ? 13 ALA A N    10 
ATOM 8223  C CA   . ALA A 1 13 ? -10.256 26.058 24.799 1.00 0.00 ? 13 ALA A CA   10 
ATOM 8224  C C    . ALA A 1 13 ? -8.973  26.494 24.093 1.00 0.00 ? 13 ALA A C    10 
ATOM 8225  O O    . ALA A 1 13 ? -8.343  27.464 24.466 1.00 0.00 ? 13 ALA A O    10 
ATOM 8226  C CB   . ALA A 1 13 ? -9.940  25.087 25.938 1.00 0.00 ? 13 ALA A CB   10 
ATOM 8227  H H    . ALA A 1 13 ? -11.403 24.378 24.093 1.00 0.00 ? 13 ALA A H    10 
ATOM 8228  H HA   . ALA A 1 13 ? -10.791 26.913 25.179 1.00 0.00 ? 13 ALA A HA   10 
ATOM 8229  H HB1  . ALA A 1 13 ? -9.365  25.597 26.696 1.00 0.00 ? 13 ALA A HB1  10 
ATOM 8230  H HB2  . ALA A 1 13 ? -9.369  24.255 25.553 1.00 0.00 ? 13 ALA A HB2  10 
ATOM 8231  H HB3  . ALA A 1 13 ? -10.862 24.724 26.368 1.00 0.00 ? 13 ALA A HB3  10 
ATOM 8232  N N    . PHE A 1 14 ? -8.583  25.782 23.072 1.00 0.00 ? 14 PHE A N    10 
ATOM 8233  C CA   . PHE A 1 14 ? -7.344  26.148 22.336 1.00 0.00 ? 14 PHE A CA   10 
ATOM 8234  C C    . PHE A 1 14 ? -7.674  27.091 21.177 1.00 0.00 ? 14 PHE A C    10 
ATOM 8235  O O    . PHE A 1 14 ? -6.886  27.271 20.270 1.00 0.00 ? 14 PHE A O    10 
ATOM 8236  C CB   . PHE A 1 14 ? -6.803  24.821 21.806 1.00 0.00 ? 14 PHE A CB   10 
ATOM 8237  C CG   . PHE A 1 14 ? -6.810  23.795 22.914 1.00 0.00 ? 14 PHE A CG   10 
ATOM 8238  C CD1  . PHE A 1 14 ? -6.577  24.191 24.236 1.00 0.00 ? 14 PHE A CD1  10 
ATOM 8239  C CD2  . PHE A 1 14 ? -7.051  22.448 22.619 1.00 0.00 ? 14 PHE A CD2  10 
ATOM 8240  C CE1  . PHE A 1 14 ? -6.583  23.239 25.263 1.00 0.00 ? 14 PHE A CE1  10 
ATOM 8241  C CE2  . PHE A 1 14 ? -7.058  21.496 23.646 1.00 0.00 ? 14 PHE A CE2  10 
ATOM 8242  C CZ   . PHE A 1 14 ? -6.824  21.891 24.968 1.00 0.00 ? 14 PHE A CZ   10 
ATOM 8243  H H    . PHE A 1 14 ? -9.106  25.002 22.789 1.00 0.00 ? 14 PHE A H    10 
ATOM 8244  H HA   . PHE A 1 14 ? -6.627  26.599 23.001 1.00 0.00 ? 14 PHE A HA   10 
ATOM 8245  H HB2  . PHE A 1 14 ? -7.424  24.478 20.992 1.00 0.00 ? 14 PHE A HB2  10 
ATOM 8246  H HB3  . PHE A 1 14 ? -5.795  24.961 21.454 1.00 0.00 ? 14 PHE A HB3  10 
ATOM 8247  H HD1  . PHE A 1 14 ? -6.390  25.230 24.464 1.00 0.00 ? 14 PHE A HD1  10 
ATOM 8248  H HD2  . PHE A 1 14 ? -7.233  22.143 21.599 1.00 0.00 ? 14 PHE A HD2  10 
ATOM 8249  H HE1  . PHE A 1 14 ? -6.402  23.544 26.283 1.00 0.00 ? 14 PHE A HE1  10 
ATOM 8250  H HE2  . PHE A 1 14 ? -7.244  20.457 23.418 1.00 0.00 ? 14 PHE A HE2  10 
ATOM 8251  H HZ   . PHE A 1 14 ? -6.828  21.158 25.761 1.00 0.00 ? 14 PHE A HZ   10 
ATOM 8252  N N    . MET A 1 15 ? -8.832  27.694 21.193 1.00 0.00 ? 15 MET A N    10 
ATOM 8253  C CA   . MET A 1 15 ? -9.198  28.618 20.088 1.00 0.00 ? 15 MET A CA   10 
ATOM 8254  C C    . MET A 1 15 ? -8.856  30.064 20.466 1.00 0.00 ? 15 MET A C    10 
ATOM 8255  O O    . MET A 1 15 ? -9.196  30.532 21.535 1.00 0.00 ? 15 MET A O    10 
ATOM 8256  C CB   . MET A 1 15 ? -10.709 28.441 19.913 1.00 0.00 ? 15 MET A CB   10 
ATOM 8257  C CG   . MET A 1 15 ? -11.452 29.225 20.996 1.00 0.00 ? 15 MET A CG   10 
ATOM 8258  S SD   . MET A 1 15 ? -13.207 28.784 20.965 1.00 0.00 ? 15 MET A SD   10 
ATOM 8259  C CE   . MET A 1 15 ? -13.572 29.425 19.312 1.00 0.00 ? 15 MET A CE   10 
ATOM 8260  H H    . MET A 1 15 ? -9.460  27.538 21.926 1.00 0.00 ? 15 MET A H    10 
ATOM 8261  H HA   . MET A 1 15 ? -8.689  28.334 19.182 1.00 0.00 ? 15 MET A HA   10 
ATOM 8262  H HB2  . MET A 1 15 ? -10.999 28.806 18.945 1.00 0.00 ? 15 MET A HB2  10 
ATOM 8263  H HB3  . MET A 1 15 ? -10.960 27.395 19.992 1.00 0.00 ? 15 MET A HB3  10 
ATOM 8264  H HG2  . MET A 1 15 ? -11.037 28.986 21.964 1.00 0.00 ? 15 MET A HG2  10 
ATOM 8265  H HG3  . MET A 1 15 ? -11.343 30.284 20.809 1.00 0.00 ? 15 MET A HG3  10 
ATOM 8266  H HE1  . MET A 1 15 ? -13.002 30.329 19.144 1.00 0.00 ? 15 MET A HE1  10 
ATOM 8267  H HE2  . MET A 1 15 ? -13.306 28.683 18.572 1.00 0.00 ? 15 MET A HE2  10 
ATOM 8268  H HE3  . MET A 1 15 ? -14.624 29.647 19.235 1.00 0.00 ? 15 MET A HE3  10 
ATOM 8269  N N    . LYS A 1 16 ? -8.189  30.774 19.599 1.00 0.00 ? 16 LYS A N    10 
ATOM 8270  C CA   . LYS A 1 16 ? -7.829  32.188 19.910 1.00 0.00 ? 16 LYS A CA   10 
ATOM 8271  C C    . LYS A 1 16 ? -8.720  33.149 19.118 1.00 0.00 ? 16 LYS A C    10 
ATOM 8272  O O    . LYS A 1 16 ? -8.309  33.715 18.125 1.00 0.00 ? 16 LYS A O    10 
ATOM 8273  C CB   . LYS A 1 16 ? -6.369  32.329 19.478 1.00 0.00 ? 16 LYS A CB   10 
ATOM 8274  C CG   . LYS A 1 16 ? -5.925  33.786 19.646 1.00 0.00 ? 16 LYS A CG   10 
ATOM 8275  C CD   . LYS A 1 16 ? -4.491  33.943 19.137 1.00 0.00 ? 16 LYS A CD   10 
ATOM 8276  C CE   . LYS A 1 16 ? -3.986  35.352 19.458 1.00 0.00 ? 16 LYS A CE   10 
ATOM 8277  N NZ   . LYS A 1 16 ? -4.101  35.470 20.939 1.00 0.00 ? 16 LYS A NZ   10 
ATOM 8278  H H    . LYS A 1 16 ? -7.925  30.378 18.742 1.00 0.00 ? 16 LYS A H    10 
ATOM 8279  H HA   . LYS A 1 16 ? -7.919  32.375 20.968 1.00 0.00 ? 16 LYS A HA   10 
ATOM 8280  H HB2  . LYS A 1 16 ? -5.748  31.692 20.089 1.00 0.00 ? 16 LYS A HB2  10 
ATOM 8281  H HB3  . LYS A 1 16 ? -6.271  32.041 18.441 1.00 0.00 ? 16 LYS A HB3  10 
ATOM 8282  H HG2  . LYS A 1 16 ? -6.580  34.429 19.079 1.00 0.00 ? 16 LYS A HG2  10 
ATOM 8283  H HG3  . LYS A 1 16 ? -5.968  34.057 20.689 1.00 0.00 ? 16 LYS A HG3  10 
ATOM 8284  H HD2  . LYS A 1 16 ? -3.856  33.215 19.619 1.00 0.00 ? 16 LYS A HD2  10 
ATOM 8285  H HD3  . LYS A 1 16 ? -4.469  33.789 18.068 1.00 0.00 ? 16 LYS A HD3  10 
ATOM 8286  H HE2  . LYS A 1 16 ? -2.958  35.461 19.150 1.00 0.00 ? 16 LYS A HE2  10 
ATOM 8287  H HE3  . LYS A 1 16 ? -4.606  36.092 18.973 1.00 0.00 ? 16 LYS A HE3  10 
ATOM 8288  H HZ1  . LYS A 1 16 ? -3.867  34.556 21.378 1.00 0.00 ? 16 LYS A HZ1  10 
ATOM 8289  H HZ2  . LYS A 1 16 ? -3.442  36.197 21.280 1.00 0.00 ? 16 LYS A HZ2  10 
ATOM 8290  H HZ3  . LYS A 1 16 ? -5.073  35.738 21.192 1.00 0.00 ? 16 LYS A HZ3  10 
ATOM 8291  N N    . ASN A 1 17 ? -9.937  33.339 19.551 1.00 0.00 ? 17 ASN A N    10 
ATOM 8292  C CA   . ASN A 1 17 ? -10.857 34.267 18.828 1.00 0.00 ? 17 ASN A CA   10 
ATOM 8293  C C    . ASN A 1 17 ? -11.232 33.693 17.458 1.00 0.00 ? 17 ASN A C    10 
ATOM 8294  O O    . ASN A 1 17 ? -11.040 34.323 16.438 1.00 0.00 ? 17 ASN A O    10 
ATOM 8295  C CB   . ASN A 1 17 ? -10.068 35.567 18.666 1.00 0.00 ? 17 ASN A CB   10 
ATOM 8296  C CG   . ASN A 1 17 ? -11.038 36.726 18.433 1.00 0.00 ? 17 ASN A CG   10 
ATOM 8297  O OD1  . ASN A 1 17 ? -11.846 36.686 17.527 1.00 0.00 ? 17 ASN A OD1  10 
ATOM 8298  N ND2  . ASN A 1 17 ? -10.991 37.768 19.219 1.00 0.00 ? 17 ASN A ND2  10 
ATOM 8299  H H    . ASN A 1 17 ? -10.247 32.872 20.356 1.00 0.00 ? 17 ASN A H    10 
ATOM 8300  H HA   . ASN A 1 17 ? -11.744 34.447 19.415 1.00 0.00 ? 17 ASN A HA   10 
ATOM 8301  H HB2  . ASN A 1 17 ? -9.493  35.754 19.560 1.00 0.00 ? 17 ASN A HB2  10 
ATOM 8302  H HB3  . ASN A 1 17 ? -9.402  35.481 17.819 1.00 0.00 ? 17 ASN A HB3  10 
ATOM 8303  H HD21 . ASN A 1 17 ? -10.339 37.801 19.948 1.00 0.00 ? 17 ASN A HD21 10 
ATOM 8304  H HD22 . ASN A 1 17 ? -11.609 38.515 19.079 1.00 0.00 ? 17 ASN A HD22 10 
ATOM 8305  N N    . GLY A 1 18 ? -11.772 32.504 17.427 1.00 0.00 ? 18 GLY A N    10 
ATOM 8306  C CA   . GLY A 1 18 ? -12.162 31.899 16.122 1.00 0.00 ? 18 GLY A CA   10 
ATOM 8307  C C    . GLY A 1 18 ? -10.999 31.072 15.573 1.00 0.00 ? 18 GLY A C    10 
ATOM 8308  O O    . GLY A 1 18 ? -11.194 30.107 14.858 1.00 0.00 ? 18 GLY A O    10 
ATOM 8309  H H    . GLY A 1 18 ? -11.923 32.010 18.261 1.00 0.00 ? 18 GLY A H    10 
ATOM 8310  H HA2  . GLY A 1 18 ? -13.021 31.261 16.264 1.00 0.00 ? 18 GLY A HA2  10 
ATOM 8311  H HA3  . GLY A 1 18 ? -12.408 32.683 15.421 1.00 0.00 ? 18 GLY A HA3  10 
ATOM 8312  N N    . LYS A 1 19 ? -9.791  31.435 15.905 1.00 0.00 ? 19 LYS A N    10 
ATOM 8313  C CA   . LYS A 1 19 ? -8.619  30.663 15.404 1.00 0.00 ? 19 LYS A CA   10 
ATOM 8314  C C    . LYS A 1 19 ? -8.325  29.502 16.354 1.00 0.00 ? 19 LYS A C    10 
ATOM 8315  O O    . LYS A 1 19 ? -8.602  29.575 17.532 1.00 0.00 ? 19 LYS A O    10 
ATOM 8316  C CB   . LYS A 1 19 ? -7.457  31.656 15.396 1.00 0.00 ? 19 LYS A CB   10 
ATOM 8317  C CG   . LYS A 1 19 ? -6.333  31.118 14.508 1.00 0.00 ? 19 LYS A CG   10 
ATOM 8318  C CD   . LYS A 1 19 ? -5.337  30.330 15.362 1.00 0.00 ? 19 LYS A CD   10 
ATOM 8319  C CE   . LYS A 1 19 ? -4.157  29.888 14.493 1.00 0.00 ? 19 LYS A CE   10 
ATOM 8320  N NZ   . LYS A 1 19 ? -3.376  31.133 14.250 1.00 0.00 ? 19 LYS A NZ   10 
ATOM 8321  H H    . LYS A 1 19 ? -9.656  32.213 16.486 1.00 0.00 ? 19 LYS A H    10 
ATOM 8322  H HA   . LYS A 1 19 ? -8.802  30.298 14.406 1.00 0.00 ? 19 LYS A HA   10 
ATOM 8323  H HB2  . LYS A 1 19 ? -7.798  32.606 15.010 1.00 0.00 ? 19 LYS A HB2  10 
ATOM 8324  H HB3  . LYS A 1 19 ? -7.089  31.788 16.403 1.00 0.00 ? 19 LYS A HB3  10 
ATOM 8325  H HG2  . LYS A 1 19 ? -6.750  30.471 13.752 1.00 0.00 ? 19 LYS A HG2  10 
ATOM 8326  H HG3  . LYS A 1 19 ? -5.823  31.945 14.033 1.00 0.00 ? 19 LYS A HG3  10 
ATOM 8327  H HD2  . LYS A 1 19 ? -4.978  30.954 16.166 1.00 0.00 ? 19 LYS A HD2  10 
ATOM 8328  H HD3  . LYS A 1 19 ? -5.826  29.459 15.774 1.00 0.00 ? 19 LYS A HD3  10 
ATOM 8329  H HE2  . LYS A 1 19 ? -3.555  29.163 15.019 1.00 0.00 ? 19 LYS A HE2  10 
ATOM 8330  H HE3  . LYS A 1 19 ? -4.511  29.477 13.560 1.00 0.00 ? 19 LYS A HE3  10 
ATOM 8331  H HZ1  . LYS A 1 19 ? -3.387  31.723 15.105 1.00 0.00 ? 19 LYS A HZ1  10 
ATOM 8332  H HZ2  . LYS A 1 19 ? -2.394  30.885 14.010 1.00 0.00 ? 19 LYS A HZ2  10 
ATOM 8333  H HZ3  . LYS A 1 19 ? -3.802  31.662 13.462 1.00 0.00 ? 19 LYS A HZ3  10 
ATOM 8334  N N    . LEU A 1 20 ? -7.771  28.433 15.855 1.00 0.00 ? 20 LEU A N    10 
ATOM 8335  C CA   . LEU A 1 20 ? -7.470  27.274 16.743 1.00 0.00 ? 20 LEU A CA   10 
ATOM 8336  C C    . LEU A 1 20 ? -5.990  26.899 16.643 1.00 0.00 ? 20 LEU A C    10 
ATOM 8337  O O    . LEU A 1 20 ? -5.505  26.527 15.592 1.00 0.00 ? 20 LEU A O    10 
ATOM 8338  C CB   . LEU A 1 20 ? -8.349  26.137 16.216 1.00 0.00 ? 20 LEU A CB   10 
ATOM 8339  C CG   . LEU A 1 20 ? -7.864  24.804 16.793 1.00 0.00 ? 20 LEU A CG   10 
ATOM 8340  C CD1  . LEU A 1 20 ? -8.159  24.760 18.294 1.00 0.00 ? 20 LEU A CD1  10 
ATOM 8341  C CD2  . LEU A 1 20 ? -8.594  23.653 16.096 1.00 0.00 ? 20 LEU A CD2  10 
ATOM 8342  H H    . LEU A 1 20 ? -7.557  28.391 14.900 1.00 0.00 ? 20 LEU A H    10 
ATOM 8343  H HA   . LEU A 1 20 ? -7.734  27.501 17.763 1.00 0.00 ? 20 LEU A HA   10 
ATOM 8344  H HB2  . LEU A 1 20 ? -9.372  26.307 16.515 1.00 0.00 ? 20 LEU A HB2  10 
ATOM 8345  H HB3  . LEU A 1 20 ? -8.289  26.106 15.139 1.00 0.00 ? 20 LEU A HB3  10 
ATOM 8346  H HG   . LEU A 1 20 ? -6.801  24.706 16.632 1.00 0.00 ? 20 LEU A HG   10 
ATOM 8347  H HD11 . LEU A 1 20 ? -8.965  25.441 18.522 1.00 0.00 ? 20 LEU A HD11 10 
ATOM 8348  H HD12 . LEU A 1 20 ? -8.444  23.757 18.576 1.00 0.00 ? 20 LEU A HD12 10 
ATOM 8349  H HD13 . LEU A 1 20 ? -7.276  25.052 18.843 1.00 0.00 ? 20 LEU A HD13 10 
ATOM 8350  H HD21 . LEU A 1 20 ? -8.622  23.837 15.031 1.00 0.00 ? 20 LEU A HD21 10 
ATOM 8351  H HD22 . LEU A 1 20 ? -8.072  22.727 16.286 1.00 0.00 ? 20 LEU A HD22 10 
ATOM 8352  H HD23 . LEU A 1 20 ? -9.603  23.583 16.476 1.00 0.00 ? 20 LEU A HD23 10 
ATOM 8353  N N    . PHE A 1 21 ? -5.270  26.979 17.729 1.00 0.00 ? 21 PHE A N    10 
ATOM 8354  C CA   . PHE A 1 21 ? -3.823  26.611 17.684 1.00 0.00 ? 21 PHE A CA   10 
ATOM 8355  C C    . PHE A 1 21 ? -3.637  25.172 18.174 1.00 0.00 ? 21 PHE A C    10 
ATOM 8356  O O    . PHE A 1 21 ? -3.059  24.924 19.213 1.00 0.00 ? 21 PHE A O    10 
ATOM 8357  C CB   . PHE A 1 21 ? -3.091  27.603 18.600 1.00 0.00 ? 21 PHE A CB   10 
ATOM 8358  C CG   . PHE A 1 21 ? -3.893  27.873 19.852 1.00 0.00 ? 21 PHE A CG   10 
ATOM 8359  C CD1  . PHE A 1 21 ? -3.794  27.012 20.951 1.00 0.00 ? 21 PHE A CD1  10 
ATOM 8360  C CD2  . PHE A 1 21 ? -4.730  28.994 19.915 1.00 0.00 ? 21 PHE A CD2  10 
ATOM 8361  C CE1  . PHE A 1 21 ? -4.532  27.271 22.112 1.00 0.00 ? 21 PHE A CE1  10 
ATOM 8362  C CE2  . PHE A 1 21 ? -5.467  29.254 21.076 1.00 0.00 ? 21 PHE A CE2  10 
ATOM 8363  C CZ   . PHE A 1 21 ? -5.369  28.392 22.174 1.00 0.00 ? 21 PHE A CZ   10 
ATOM 8364  H H    . PHE A 1 21 ? -5.682  27.271 18.568 1.00 0.00 ? 21 PHE A H    10 
ATOM 8365  H HA   . PHE A 1 21 ? -3.452  26.706 16.675 1.00 0.00 ? 21 PHE A HA   10 
ATOM 8366  H HB2  . PHE A 1 21 ? -2.132  27.190 18.875 1.00 0.00 ? 21 PHE A HB2  10 
ATOM 8367  H HB3  . PHE A 1 21 ? -2.938  28.531 18.069 1.00 0.00 ? 21 PHE A HB3  10 
ATOM 8368  H HD1  . PHE A 1 21 ? -3.148  26.148 20.904 1.00 0.00 ? 21 PHE A HD1  10 
ATOM 8369  H HD2  . PHE A 1 21 ? -4.807  29.659 19.067 1.00 0.00 ? 21 PHE A HD2  10 
ATOM 8370  H HE1  . PHE A 1 21 ? -4.456  26.607 22.961 1.00 0.00 ? 21 PHE A HE1  10 
ATOM 8371  H HE2  . PHE A 1 21 ? -6.113  30.118 21.123 1.00 0.00 ? 21 PHE A HE2  10 
ATOM 8372  H HZ   . PHE A 1 21 ? -5.938  28.593 23.071 1.00 0.00 ? 21 PHE A HZ   10 
ATOM 8373  N N    . CYS A 1 22 ? -4.124  24.222 17.422 1.00 0.00 ? 22 CYS A N    10 
ATOM 8374  C CA   . CYS A 1 22 ? -3.984  22.792 17.824 1.00 0.00 ? 22 CYS A CA   10 
ATOM 8375  C C    . CYS A 1 22 ? -2.542  22.466 18.243 1.00 0.00 ? 22 CYS A C    10 
ATOM 8376  O O    . CYS A 1 22 ? -2.331  21.868 19.279 1.00 0.00 ? 22 CYS A O    10 
ATOM 8377  C CB   . CYS A 1 22 ? -4.376  21.987 16.585 1.00 0.00 ? 22 CYS A CB   10 
ATOM 8378  S SG   . CYS A 1 22 ? -5.478  20.634 17.066 1.00 0.00 ? 22 CYS A SG   10 
ATOM 8379  H H    . CYS A 1 22 ? -4.584  24.451 16.587 1.00 0.00 ? 22 CYS A H    10 
ATOM 8380  H HA   . CYS A 1 22 ? -4.664  22.566 18.631 1.00 0.00 ? 22 CYS A HA   10 
ATOM 8381  H HB2  . CYS A 1 22 ? -4.882  22.630 15.881 1.00 0.00 ? 22 CYS A HB2  10 
ATOM 8382  H HB3  . CYS A 1 22 ? -3.489  21.577 16.125 1.00 0.00 ? 22 CYS A HB3  10 
ATOM 8383  N N    . PRO A 1 23 ? -1.587  22.855 17.428 1.00 0.00 ? 23 PRO A N    10 
ATOM 8384  C CA   . PRO A 1 23 ? -0.167  22.570 17.745 1.00 0.00 ? 23 PRO A CA   10 
ATOM 8385  C C    . PRO A 1 23 ? 0.240   23.240 19.061 1.00 0.00 ? 23 PRO A C    10 
ATOM 8386  O O    . PRO A 1 23 ? 0.826   24.304 19.076 1.00 0.00 ? 23 PRO A O    10 
ATOM 8387  C CB   . PRO A 1 23 ? 0.577   23.174 16.553 1.00 0.00 ? 23 PRO A CB   10 
ATOM 8388  C CG   . PRO A 1 23 ? -0.455  23.779 15.580 1.00 0.00 ? 23 PRO A CG   10 
ATOM 8389  C CD   . PRO A 1 23 ? -1.861  23.588 16.166 1.00 0.00 ? 23 PRO A CD   10 
ATOM 8390  H HA   . PRO A 1 23 ? 0.008   21.507 17.789 1.00 0.00 ? 23 PRO A HA   10 
ATOM 8391  H HB2  . PRO A 1 23 ? 1.247   23.948 16.897 1.00 0.00 ? 23 PRO A HB2  10 
ATOM 8392  H HB3  . PRO A 1 23 ? 1.141   22.403 16.049 1.00 0.00 ? 23 PRO A HB3  10 
ATOM 8393  H HG2  . PRO A 1 23 ? -0.256  24.833 15.451 1.00 0.00 ? 23 PRO A HG2  10 
ATOM 8394  H HG3  . PRO A 1 23 ? -0.389  23.278 14.626 1.00 0.00 ? 23 PRO A HG3  10 
ATOM 8395  H HD2  . PRO A 1 23 ? -2.312  24.546 16.366 1.00 0.00 ? 23 PRO A HD2  10 
ATOM 8396  H HD3  . PRO A 1 23 ? -2.476  23.000 15.503 1.00 0.00 ? 23 PRO A HD3  10 
ATOM 8397  N N    . GLN A 1 24 ? -0.069  22.616 20.166 1.00 0.00 ? 24 GLN A N    10 
ATOM 8398  C CA   . GLN A 1 24 ? 0.296   23.200 21.489 1.00 0.00 ? 24 GLN A CA   10 
ATOM 8399  C C    . GLN A 1 24 ? 1.340   22.315 22.175 1.00 0.00 ? 24 GLN A C    10 
ATOM 8400  O O    . GLN A 1 24 ? 2.518   22.609 22.176 1.00 0.00 ? 24 GLN A O    10 
ATOM 8401  C CB   . GLN A 1 24 ? -1.012  23.213 22.285 1.00 0.00 ? 24 GLN A CB   10 
ATOM 8402  C CG   . GLN A 1 24 ? -0.709  23.338 23.781 1.00 0.00 ? 24 GLN A CG   10 
ATOM 8403  C CD   . GLN A 1 24 ? -2.002  23.653 24.537 1.00 0.00 ? 24 GLN A CD   10 
ATOM 8404  O OE1  . GLN A 1 24 ? -2.140  24.712 25.115 1.00 0.00 ? 24 GLN A OE1  10 
ATOM 8405  N NE2  . GLN A 1 24 ? -2.962  22.769 24.558 1.00 0.00 ? 24 GLN A NE2  10 
ATOM 8406  H H    . GLN A 1 24 ? -0.540  21.758 20.125 1.00 0.00 ? 24 GLN A H    10 
ATOM 8407  H HA   . GLN A 1 24 ? 0.668   24.203 21.372 1.00 0.00 ? 24 GLN A HA   10 
ATOM 8408  H HB2  . GLN A 1 24 ? -1.616  24.051 21.969 1.00 0.00 ? 24 GLN A HB2  10 
ATOM 8409  H HB3  . GLN A 1 24 ? -1.550  22.294 22.104 1.00 0.00 ? 24 GLN A HB3  10 
ATOM 8410  H HG2  . GLN A 1 24 ? -0.298  22.409 24.145 1.00 0.00 ? 24 GLN A HG2  10 
ATOM 8411  H HG3  . GLN A 1 24 ? 0.003   24.133 23.941 1.00 0.00 ? 24 GLN A HG3  10 
ATOM 8412  H HE21 . GLN A 1 24 ? -2.850  21.913 24.092 1.00 0.00 ? 24 GLN A HE21 10 
ATOM 8413  H HE22 . GLN A 1 24 ? -3.793  22.959 25.038 1.00 0.00 ? 24 GLN A HE22 10 
ATOM 8414  N N    . ASP A 1 25 ? 0.911   21.228 22.750 1.00 0.00 ? 25 ASP A N    10 
ATOM 8415  C CA   . ASP A 1 25 ? 1.866   20.310 23.432 1.00 0.00 ? 25 ASP A CA   10 
ATOM 8416  C C    . ASP A 1 25 ? 1.553   18.863 23.048 1.00 0.00 ? 25 ASP A C    10 
ATOM 8417  O O    . ASP A 1 25 ? 1.219   18.045 23.881 1.00 0.00 ? 25 ASP A O    10 
ATOM 8418  C CB   . ASP A 1 25 ? 1.637   20.534 24.928 1.00 0.00 ? 25 ASP A CB   10 
ATOM 8419  C CG   . ASP A 1 25 ? 2.481   21.719 25.402 1.00 0.00 ? 25 ASP A CG   10 
ATOM 8420  O OD1  . ASP A 1 25 ? 3.136   22.324 24.570 1.00 0.00 ? 25 ASP A OD1  10 
ATOM 8421  O OD2  . ASP A 1 25 ? 2.458   21.999 26.589 1.00 0.00 ? 25 ASP A OD2  10 
ATOM 8422  H H    . ASP A 1 25 ? -0.045  21.013 22.729 1.00 0.00 ? 25 ASP A H    10 
ATOM 8423  H HA   . ASP A 1 25 ? 2.882   20.560 23.171 1.00 0.00 ? 25 ASP A HA   10 
ATOM 8424  H HB2  . ASP A 1 25 ? 0.592   20.742 25.105 1.00 0.00 ? 25 ASP A HB2  10 
ATOM 8425  H HB3  . ASP A 1 25 ? 1.924   19.646 25.472 1.00 0.00 ? 25 ASP A HB3  10 
ATOM 8426  N N    . LYS A 1 26 ? 1.652   18.543 21.786 1.00 0.00 ? 26 LYS A N    10 
ATOM 8427  C CA   . LYS A 1 26 ? 1.353   17.153 21.336 1.00 0.00 ? 26 LYS A CA   10 
ATOM 8428  C C    . LYS A 1 26 ? 2.171   16.133 22.134 1.00 0.00 ? 26 LYS A C    10 
ATOM 8429  O O    . LYS A 1 26 ? 1.871   14.955 22.138 1.00 0.00 ? 26 LYS A O    10 
ATOM 8430  C CB   . LYS A 1 26 ? 1.745   17.124 19.859 1.00 0.00 ? 26 LYS A CB   10 
ATOM 8431  C CG   . LYS A 1 26 ? 0.583   17.652 19.016 1.00 0.00 ? 26 LYS A CG   10 
ATOM 8432  C CD   . LYS A 1 26 ? 0.913   17.484 17.531 1.00 0.00 ? 26 LYS A CD   10 
ATOM 8433  C CE   . LYS A 1 26 ? 0.035   18.427 16.705 1.00 0.00 ? 26 LYS A CE   10 
ATOM 8434  N NZ   . LYS A 1 26 ? 0.638   18.414 15.342 1.00 0.00 ? 26 LYS A NZ   10 
ATOM 8435  H H    . LYS A 1 26 ? 1.918   19.222 21.131 1.00 0.00 ? 26 LYS A H    10 
ATOM 8436  H HA   . LYS A 1 26 ? 0.298   16.947 21.437 1.00 0.00 ? 26 LYS A HA   10 
ATOM 8437  H HB2  . LYS A 1 26 ? 2.614   17.746 19.706 1.00 0.00 ? 26 LYS A HB2  10 
ATOM 8438  H HB3  . LYS A 1 26 ? 1.972   16.109 19.566 1.00 0.00 ? 26 LYS A HB3  10 
ATOM 8439  H HG2  . LYS A 1 26 ? -0.314  17.099 19.249 1.00 0.00 ? 26 LYS A HG2  10 
ATOM 8440  H HG3  . LYS A 1 26 ? 0.427   18.699 19.233 1.00 0.00 ? 26 LYS A HG3  10 
ATOM 8441  H HD2  . LYS A 1 26 ? 1.953   17.723 17.364 1.00 0.00 ? 26 LYS A HD2  10 
ATOM 8442  H HD3  . LYS A 1 26 ? 0.725   16.463 17.233 1.00 0.00 ? 26 LYS A HD3  10 
ATOM 8443  H HE2  . LYS A 1 26 ? -0.980  18.062 16.670 1.00 0.00 ? 26 LYS A HE2  10 
ATOM 8444  H HE3  . LYS A 1 26 ? 0.064   19.425 17.118 1.00 0.00 ? 26 LYS A HE3  10 
ATOM 8445  H HZ1  . LYS A 1 26 ? 1.093   17.493 15.174 1.00 0.00 ? 26 LYS A HZ1  10 
ATOM 8446  H HZ2  . LYS A 1 26 ? -0.105  18.568 14.633 1.00 0.00 ? 26 LYS A HZ2  10 
ATOM 8447  H HZ3  . LYS A 1 26 ? 1.347   19.170 15.269 1.00 0.00 ? 26 LYS A HZ3  10 
ATOM 8448  N N    . LYS A 1 27 ? 3.200   16.569 22.812 1.00 0.00 ? 27 LYS A N    10 
ATOM 8449  C CA   . LYS A 1 27 ? 4.028   15.619 23.610 1.00 0.00 ? 27 LYS A CA   10 
ATOM 8450  C C    . LYS A 1 27 ? 3.127   14.619 24.341 1.00 0.00 ? 27 LYS A C    10 
ATOM 8451  O O    . LYS A 1 27 ? 3.527   13.510 24.637 1.00 0.00 ? 27 LYS A O    10 
ATOM 8452  C CB   . LYS A 1 27 ? 4.779   16.498 24.610 1.00 0.00 ? 27 LYS A CB   10 
ATOM 8453  C CG   . LYS A 1 27 ? 6.000   17.116 23.927 1.00 0.00 ? 27 LYS A CG   10 
ATOM 8454  C CD   . LYS A 1 27 ? 6.793   17.935 24.947 1.00 0.00 ? 27 LYS A CD   10 
ATOM 8455  C CE   . LYS A 1 27 ? 7.926   18.675 24.235 1.00 0.00 ? 27 LYS A CE   10 
ATOM 8456  N NZ   . LYS A 1 27 ? 8.802   19.180 25.331 1.00 0.00 ? 27 LYS A NZ   10 
ATOM 8457  H H    . LYS A 1 27 ? 3.428   17.521 22.799 1.00 0.00 ? 27 LYS A H    10 
ATOM 8458  H HA   . LYS A 1 27 ? 4.727   15.101 22.975 1.00 0.00 ? 27 LYS A HA   10 
ATOM 8459  H HB2  . LYS A 1 27 ? 4.126   17.284 24.959 1.00 0.00 ? 27 LYS A HB2  10 
ATOM 8460  H HB3  . LYS A 1 27 ? 5.100   15.897 25.446 1.00 0.00 ? 27 LYS A HB3  10 
ATOM 8461  H HG2  . LYS A 1 27 ? 6.626   16.331 23.529 1.00 0.00 ? 27 LYS A HG2  10 
ATOM 8462  H HG3  . LYS A 1 27 ? 5.675   17.760 23.123 1.00 0.00 ? 27 LYS A HG3  10 
ATOM 8463  H HD2  . LYS A 1 27 ? 6.139   18.650 25.423 1.00 0.00 ? 27 LYS A HD2  10 
ATOM 8464  H HD3  . LYS A 1 27 ? 7.208   17.274 25.694 1.00 0.00 ? 27 LYS A HD3  10 
ATOM 8465  H HE2  . LYS A 1 27 ? 8.476   17.998 23.598 1.00 0.00 ? 27 LYS A HE2  10 
ATOM 8466  H HE3  . LYS A 1 27 ? 7.534   19.500 23.659 1.00 0.00 ? 27 LYS A HE3  10 
ATOM 8467  H HZ1  . LYS A 1 27 ? 8.833   18.481 26.100 1.00 0.00 ? 27 LYS A HZ1  10 
ATOM 8468  H HZ2  . LYS A 1 27 ? 9.762   19.335 24.963 1.00 0.00 ? 27 LYS A HZ2  10 
ATOM 8469  H HZ3  . LYS A 1 27 ? 8.420   20.075 25.695 1.00 0.00 ? 27 LYS A HZ3  10 
ATOM 8470  N N    . PHE A 1 28 ? 1.913   15.001 24.631 1.00 0.00 ? 28 PHE A N    10 
ATOM 8471  C CA   . PHE A 1 28 ? 0.985   14.072 25.337 1.00 0.00 ? 28 PHE A CA   10 
ATOM 8472  C C    . PHE A 1 28 ? 0.944   12.719 24.620 1.00 0.00 ? 28 PHE A C    10 
ATOM 8473  O O    . PHE A 1 28 ? 0.563   11.715 25.189 1.00 0.00 ? 28 PHE A O    10 
ATOM 8474  C CB   . PHE A 1 28 ? -0.380  14.758 25.274 1.00 0.00 ? 28 PHE A CB   10 
ATOM 8475  C CG   . PHE A 1 28 ? -0.285  16.130 25.901 1.00 0.00 ? 28 PHE A CG   10 
ATOM 8476  C CD1  . PHE A 1 28 ? 0.326   16.288 27.152 1.00 0.00 ? 28 PHE A CD1  10 
ATOM 8477  C CD2  . PHE A 1 28 ? -0.807  17.245 25.232 1.00 0.00 ? 28 PHE A CD2  10 
ATOM 8478  C CE1  . PHE A 1 28 ? 0.414   17.559 27.732 1.00 0.00 ? 28 PHE A CE1  10 
ATOM 8479  C CE2  . PHE A 1 28 ? -0.718  18.516 25.813 1.00 0.00 ? 28 PHE A CE2  10 
ATOM 8480  C CZ   . PHE A 1 28 ? -0.107  18.673 27.063 1.00 0.00 ? 28 PHE A CZ   10 
ATOM 8481  H H    . PHE A 1 28 ? 1.608   15.898 24.381 1.00 0.00 ? 28 PHE A H    10 
ATOM 8482  H HA   . PHE A 1 28 ? 1.288   13.947 26.365 1.00 0.00 ? 28 PHE A HA   10 
ATOM 8483  H HB2  . PHE A 1 28 ? -0.686  14.855 24.243 1.00 0.00 ? 28 PHE A HB2  10 
ATOM 8484  H HB3  . PHE A 1 28 ? -1.104  14.167 25.811 1.00 0.00 ? 28 PHE A HB3  10 
ATOM 8485  H HD1  . PHE A 1 28 ? 0.728   15.429 27.667 1.00 0.00 ? 28 PHE A HD1  10 
ATOM 8486  H HD2  . PHE A 1 28 ? -1.278  17.124 24.268 1.00 0.00 ? 28 PHE A HD2  10 
ATOM 8487  H HE1  . PHE A 1 28 ? 0.885   17.681 28.696 1.00 0.00 ? 28 PHE A HE1  10 
ATOM 8488  H HE2  . PHE A 1 28 ? -1.120  19.376 25.296 1.00 0.00 ? 28 PHE A HE2  10 
ATOM 8489  H HZ   . PHE A 1 28 ? -0.039  19.653 27.511 1.00 0.00 ? 28 PHE A HZ   10 
ATOM 8490  N N    . PHE A 1 29 ? 1.335   12.682 23.373 1.00 0.00 ? 29 PHE A N    10 
ATOM 8491  C CA   . PHE A 1 29 ? 1.318   11.393 22.621 1.00 0.00 ? 29 PHE A CA   10 
ATOM 8492  C C    . PHE A 1 29 ? 1.887   10.266 23.488 1.00 0.00 ? 29 PHE A C    10 
ATOM 8493  O O    . PHE A 1 29 ? 1.580   9.105  23.297 1.00 0.00 ? 29 PHE A O    10 
ATOM 8494  C CB   . PHE A 1 29 ? 2.214   11.632 21.406 1.00 0.00 ? 29 PHE A CB   10 
ATOM 8495  C CG   . PHE A 1 29 ? 2.128   10.447 20.474 1.00 0.00 ? 29 PHE A CG   10 
ATOM 8496  C CD1  . PHE A 1 29 ? 2.729   9.234  20.826 1.00 0.00 ? 29 PHE A CD1  10 
ATOM 8497  C CD2  . PHE A 1 29 ? 1.447   10.564 19.256 1.00 0.00 ? 29 PHE A CD2  10 
ATOM 8498  C CE1  . PHE A 1 29 ? 2.649   8.135  19.961 1.00 0.00 ? 29 PHE A CE1  10 
ATOM 8499  C CE2  . PHE A 1 29 ? 1.367   9.466  18.391 1.00 0.00 ? 29 PHE A CE2  10 
ATOM 8500  C CZ   . PHE A 1 29 ? 1.969   8.252  18.743 1.00 0.00 ? 29 PHE A CZ   10 
ATOM 8501  H H    . PHE A 1 29 ? 1.638   13.502 22.931 1.00 0.00 ? 29 PHE A H    10 
ATOM 8502  H HA   . PHE A 1 29 ? 0.317   11.155 22.300 1.00 0.00 ? 29 PHE A HA   10 
ATOM 8503  H HB2  . PHE A 1 29 ? 1.888   12.522 20.888 1.00 0.00 ? 29 PHE A HB2  10 
ATOM 8504  H HB3  . PHE A 1 29 ? 3.235   11.761 21.732 1.00 0.00 ? 29 PHE A HB3  10 
ATOM 8505  H HD1  . PHE A 1 29 ? 3.254   9.143  21.766 1.00 0.00 ? 29 PHE A HD1  10 
ATOM 8506  H HD2  . PHE A 1 29 ? 0.984   11.501 18.984 1.00 0.00 ? 29 PHE A HD2  10 
ATOM 8507  H HE1  . PHE A 1 29 ? 3.113   7.199  20.233 1.00 0.00 ? 29 PHE A HE1  10 
ATOM 8508  H HE2  . PHE A 1 29 ? 0.842   9.557  17.452 1.00 0.00 ? 29 PHE A HE2  10 
ATOM 8509  H HZ   . PHE A 1 29 ? 1.907   7.406  18.076 1.00 0.00 ? 29 PHE A HZ   10 
ATOM 8510  N N    . GLN A 1 30 ? 2.718   10.599 24.436 1.00 0.00 ? 30 GLN A N    10 
ATOM 8511  C CA   . GLN A 1 30 ? 3.313   9.550  25.314 1.00 0.00 ? 30 GLN A CA   10 
ATOM 8512  C C    . GLN A 1 30 ? 2.244   8.942  26.229 1.00 0.00 ? 30 GLN A C    10 
ATOM 8513  O O    . GLN A 1 30 ? 2.510   8.025  26.980 1.00 0.00 ? 30 GLN A O    10 
ATOM 8514  C CB   . GLN A 1 30 ? 4.369   10.286 26.139 1.00 0.00 ? 30 GLN A CB   10 
ATOM 8515  C CG   . GLN A 1 30 ? 5.657   10.408 25.322 1.00 0.00 ? 30 GLN A CG   10 
ATOM 8516  C CD   . GLN A 1 30 ? 6.861   10.411 26.265 1.00 0.00 ? 30 GLN A CD   10 
ATOM 8517  O OE1  . GLN A 1 30 ? 7.191   9.400  26.851 1.00 0.00 ? 30 GLN A OE1  10 
ATOM 8518  N NE2  . GLN A 1 30 ? 7.537   11.514 26.436 1.00 0.00 ? 30 GLN A NE2  10 
ATOM 8519  H H    . GLN A 1 30 ? 2.955   11.540 24.571 1.00 0.00 ? 30 GLN A H    10 
ATOM 8520  H HA   . GLN A 1 30 ? 3.781   8.783  24.720 1.00 0.00 ? 30 GLN A HA   10 
ATOM 8521  H HB2  . GLN A 1 30 ? 4.008   11.273 26.389 1.00 0.00 ? 30 GLN A HB2  10 
ATOM 8522  H HB3  . GLN A 1 30 ? 4.569   9.735  27.046 1.00 0.00 ? 30 GLN A HB3  10 
ATOM 8523  H HG2  . GLN A 1 30 ? 5.732   9.572  24.643 1.00 0.00 ? 30 GLN A HG2  10 
ATOM 8524  H HG3  . GLN A 1 30 ? 5.641   11.329 24.758 1.00 0.00 ? 30 GLN A HG3  10 
ATOM 8525  H HE21 . GLN A 1 30 ? 7.271   12.331 25.964 1.00 0.00 ? 30 GLN A HE21 10 
ATOM 8526  H HE22 . GLN A 1 30 ? 8.309   11.527 27.038 1.00 0.00 ? 30 GLN A HE22 10 
ATOM 8527  N N    . SER A 1 31 ? 1.039   9.440  26.174 1.00 0.00 ? 31 SER A N    10 
ATOM 8528  C CA   . SER A 1 31 ? -0.037  8.882  27.044 1.00 0.00 ? 31 SER A CA   10 
ATOM 8529  C C    . SER A 1 31 ? -1.320  8.676  26.235 1.00 0.00 ? 31 SER A C    10 
ATOM 8530  O O    . SER A 1 31 ? -1.527  9.302  25.214 1.00 0.00 ? 31 SER A O    10 
ATOM 8531  C CB   . SER A 1 31 ? -0.253  9.937  28.129 1.00 0.00 ? 31 SER A CB   10 
ATOM 8532  O OG   . SER A 1 31 ? -1.363  9.569  28.934 1.00 0.00 ? 31 SER A OG   10 
ATOM 8533  H H    . SER A 1 31 ? 0.841   10.179 25.564 1.00 0.00 ? 31 SER A H    10 
ATOM 8534  H HA   . SER A 1 31 ? 0.282   7.955  27.491 1.00 0.00 ? 31 SER A HA   10 
ATOM 8535  H HB2  . SER A 1 31 ? 0.632   10.006 28.746 1.00 0.00 ? 31 SER A HB2  10 
ATOM 8536  H HB3  . SER A 1 31 ? -0.445  10.895 27.667 1.00 0.00 ? 31 SER A HB3  10 
ATOM 8537  H HG   . SER A 1 31 ? -1.045  8.991  29.632 1.00 0.00 ? 31 SER A HG   10 
ATOM 8538  N N    . LEU A 1 32 ? -2.184  7.807  26.684 1.00 0.00 ? 32 LEU A N    10 
ATOM 8539  C CA   . LEU A 1 32 ? -3.453  7.569  25.937 1.00 0.00 ? 32 LEU A CA   10 
ATOM 8540  C C    . LEU A 1 32 ? -4.214  8.882  25.771 1.00 0.00 ? 32 LEU A C    10 
ATOM 8541  O O    . LEU A 1 32 ? -4.655  9.225  24.692 1.00 0.00 ? 32 LEU A O    10 
ATOM 8542  C CB   . LEU A 1 32 ? -4.252  6.598  26.803 1.00 0.00 ? 32 LEU A CB   10 
ATOM 8543  C CG   . LEU A 1 32 ? -5.348  5.943  25.958 1.00 0.00 ? 32 LEU A CG   10 
ATOM 8544  C CD1  . LEU A 1 32 ? -6.380  6.998  25.556 1.00 0.00 ? 32 LEU A CD1  10 
ATOM 8545  C CD2  . LEU A 1 32 ? -4.728  5.331  24.700 1.00 0.00 ? 32 LEU A CD2  10 
ATOM 8546  H H    . LEU A 1 32 ? -2.002  7.314  27.511 1.00 0.00 ? 32 LEU A H    10 
ATOM 8547  H HA   . LEU A 1 32 ? -3.249  7.128  24.978 1.00 0.00 ? 32 LEU A HA   10 
ATOM 8548  H HB2  . LEU A 1 32 ? -3.593  5.836  27.192 1.00 0.00 ? 32 LEU A HB2  10 
ATOM 8549  H HB3  . LEU A 1 32 ? -4.704  7.138  27.621 1.00 0.00 ? 32 LEU A HB3  10 
ATOM 8550  H HG   . LEU A 1 32 ? -5.831  5.169  26.535 1.00 0.00 ? 32 LEU A HG   10 
ATOM 8551  H HD11 . LEU A 1 32 ? -6.593  7.635  26.403 1.00 0.00 ? 32 LEU A HD11 10 
ATOM 8552  H HD12 . LEU A 1 32 ? -5.988  7.596  24.746 1.00 0.00 ? 32 LEU A HD12 10 
ATOM 8553  H HD13 . LEU A 1 32 ? -7.289  6.509  25.236 1.00 0.00 ? 32 LEU A HD13 10 
ATOM 8554  H HD21 . LEU A 1 32 ? -3.828  4.797  24.966 1.00 0.00 ? 32 LEU A HD21 10 
ATOM 8555  H HD22 . LEU A 1 32 ? -5.432  4.649  24.248 1.00 0.00 ? 32 LEU A HD22 10 
ATOM 8556  H HD23 . LEU A 1 32 ? -4.486  6.117  24.000 1.00 0.00 ? 32 LEU A HD23 10 
ATOM 8557  N N    . ASP A 1 33 ? -4.360  9.625  26.830 1.00 0.00 ? 33 ASP A N    10 
ATOM 8558  C CA   . ASP A 1 33 ? -5.083  10.922 26.730 1.00 0.00 ? 33 ASP A CA   10 
ATOM 8559  C C    . ASP A 1 33 ? -4.438  11.763 25.636 1.00 0.00 ? 33 ASP A C    10 
ATOM 8560  O O    . ASP A 1 33 ? -5.107  12.424 24.866 1.00 0.00 ? 33 ASP A O    10 
ATOM 8561  C CB   . ASP A 1 33 ? -4.914  11.584 28.097 1.00 0.00 ? 33 ASP A CB   10 
ATOM 8562  C CG   . ASP A 1 33 ? -5.648  10.760 29.156 1.00 0.00 ? 33 ASP A CG   10 
ATOM 8563  O OD1  . ASP A 1 33 ? -6.440  9.913  28.777 1.00 0.00 ? 33 ASP A OD1  10 
ATOM 8564  O OD2  . ASP A 1 33 ? -5.407  10.990 30.330 1.00 0.00 ? 33 ASP A OD2  10 
ATOM 8565  H H    . ASP A 1 33 ? -3.987  9.334  27.686 1.00 0.00 ? 33 ASP A H    10 
ATOM 8566  H HA   . ASP A 1 33 ? -6.127  10.759 26.517 1.00 0.00 ? 33 ASP A HA   10 
ATOM 8567  H HB2  . ASP A 1 33 ? -3.865  11.635 28.345 1.00 0.00 ? 33 ASP A HB2  10 
ATOM 8568  H HB3  . ASP A 1 33 ? -5.326  12.582 28.067 1.00 0.00 ? 33 ASP A HB3  10 
ATOM 8569  N N    . GLY A 1 34 ? -3.139  11.725 25.549 1.00 0.00 ? 34 GLY A N    10 
ATOM 8570  C CA   . GLY A 1 34 ? -2.447  12.501 24.490 1.00 0.00 ? 34 GLY A CA   10 
ATOM 8571  C C    . GLY A 1 34 ? -2.756  11.850 23.146 1.00 0.00 ? 34 GLY A C    10 
ATOM 8572  O O    . GLY A 1 34 ? -3.192  12.494 22.213 1.00 0.00 ? 34 GLY A O    10 
ATOM 8573  H H    . GLY A 1 34 ? -2.622  11.170 26.172 1.00 0.00 ? 34 GLY A H    10 
ATOM 8574  H HA2  . GLY A 1 34 ? -2.805  13.516 24.492 1.00 0.00 ? 34 GLY A HA2  10 
ATOM 8575  H HA3  . GLY A 1 34 ? -1.383  12.489 24.665 1.00 0.00 ? 34 GLY A HA3  10 
ATOM 8576  N N    . ILE A 1 35 ? -2.553  10.569 23.050 1.00 0.00 ? 35 ILE A N    10 
ATOM 8577  C CA   . ILE A 1 35 ? -2.853  9.866  21.774 1.00 0.00 ? 35 ILE A CA   10 
ATOM 8578  C C    . ILE A 1 35 ? -4.291  10.173 21.360 1.00 0.00 ? 35 ILE A C    10 
ATOM 8579  O O    . ILE A 1 35 ? -4.610  10.250 20.190 1.00 0.00 ? 35 ILE A O    10 
ATOM 8580  C CB   . ILE A 1 35 ? -2.672  8.378  22.082 1.00 0.00 ? 35 ILE A CB   10 
ATOM 8581  C CG1  . ILE A 1 35 ? -1.185  8.030  22.028 1.00 0.00 ? 35 ILE A CG1  10 
ATOM 8582  C CG2  . ILE A 1 35 ? -3.426  7.538  21.047 1.00 0.00 ? 35 ILE A CG2  10 
ATOM 8583  C CD1  . ILE A 1 35 ? -0.639  8.353  20.636 1.00 0.00 ? 35 ILE A CD1  10 
ATOM 8584  H H    . ILE A 1 35 ? -2.217  10.068 23.820 1.00 0.00 ? 35 ILE A H    10 
ATOM 8585  H HA   . ILE A 1 35 ? -2.166  10.173 21.003 1.00 0.00 ? 35 ILE A HA   10 
ATOM 8586  H HB   . ILE A 1 35 ? -3.057  8.164  23.069 1.00 0.00 ? 35 ILE A HB   10 
ATOM 8587  H HG12 . ILE A 1 35 ? -0.652  8.610  22.767 1.00 0.00 ? 35 ILE A HG12 10 
ATOM 8588  H HG13 . ILE A 1 35 ? -1.053  6.978  22.231 1.00 0.00 ? 35 ILE A HG13 10 
ATOM 8589  H HG21 . ILE A 1 35 ? -3.044  7.754  20.061 1.00 0.00 ? 35 ILE A HG21 10 
ATOM 8590  H HG22 . ILE A 1 35 ? -3.287  6.489  21.265 1.00 0.00 ? 35 ILE A HG22 10 
ATOM 8591  H HG23 . ILE A 1 35 ? -4.479  7.777  21.087 1.00 0.00 ? 35 ILE A HG23 10 
ATOM 8592  H HD11 . ILE A 1 35 ? -1.448  8.684  19.999 1.00 0.00 ? 35 ILE A HD11 10 
ATOM 8593  H HD12 . ILE A 1 35 ? 0.102   9.136  20.712 1.00 0.00 ? 35 ILE A HD12 10 
ATOM 8594  H HD13 . ILE A 1 35 ? -0.186  7.470  20.212 1.00 0.00 ? 35 ILE A HD13 10 
ATOM 8595  N N    . MET A 1 36 ? -5.162  10.360 22.314 1.00 0.00 ? 36 MET A N    10 
ATOM 8596  C CA   . MET A 1 36 ? -6.578  10.674 21.971 1.00 0.00 ? 36 MET A CA   10 
ATOM 8597  C C    . MET A 1 36 ? -6.693  12.126 21.504 1.00 0.00 ? 36 MET A C    10 
ATOM 8598  O O    . MET A 1 36 ? -7.000  12.397 20.359 1.00 0.00 ? 36 MET A O    10 
ATOM 8599  C CB   . MET A 1 36 ? -7.364  10.478 23.262 1.00 0.00 ? 36 MET A CB   10 
ATOM 8600  C CG   . MET A 1 36 ? -8.204  9.205  23.161 1.00 0.00 ? 36 MET A CG   10 
ATOM 8601  S SD   . MET A 1 36 ? -9.371  9.141  24.544 1.00 0.00 ? 36 MET A SD   10 
ATOM 8602  C CE   . MET A 1 36 ? -10.844 8.714  23.581 1.00 0.00 ? 36 MET A CE   10 
ATOM 8603  H H    . MET A 1 36 ? -4.882  10.300 23.255 1.00 0.00 ? 36 MET A H    10 
ATOM 8604  H HA   . MET A 1 36 ? -6.941  10.001 21.211 1.00 0.00 ? 36 MET A HA   10 
ATOM 8605  H HB2  . MET A 1 36 ? -6.680  10.397 24.094 1.00 0.00 ? 36 MET A HB2  10 
ATOM 8606  H HB3  . MET A 1 36 ? -8.013  11.330 23.410 1.00 0.00 ? 36 MET A HB3  10 
ATOM 8607  H HG2  . MET A 1 36 ? -8.751  9.207  22.228 1.00 0.00 ? 36 MET A HG2  10 
ATOM 8608  H HG3  . MET A 1 36 ? -7.556  8.341  23.196 1.00 0.00 ? 36 MET A HG3  10 
ATOM 8609  H HE1  . MET A 1 36 ? -10.602 8.735  22.527 1.00 0.00 ? 36 MET A HE1  10 
ATOM 8610  H HE2  . MET A 1 36 ? -11.180 7.724  23.859 1.00 0.00 ? 36 MET A HE2  10 
ATOM 8611  H HE3  . MET A 1 36 ? -11.626 9.428  23.782 1.00 0.00 ? 36 MET A HE3  10 
ATOM 8612  N N    . PHE A 1 37 ? -6.450  13.064 22.382 1.00 0.00 ? 37 PHE A N    10 
ATOM 8613  C CA   . PHE A 1 37 ? -6.548  14.492 21.977 1.00 0.00 ? 37 PHE A CA   10 
ATOM 8614  C C    . PHE A 1 37 ? -5.740  14.706 20.688 1.00 0.00 ? 37 PHE A C    10 
ATOM 8615  O O    . PHE A 1 37 ? -6.224  15.280 19.733 1.00 0.00 ? 37 PHE A O    10 
ATOM 8616  C CB   . PHE A 1 37 ? -6.004  15.291 23.185 1.00 0.00 ? 37 PHE A CB   10 
ATOM 8617  C CG   . PHE A 1 37 ? -4.776  16.094 22.817 1.00 0.00 ? 37 PHE A CG   10 
ATOM 8618  C CD1  . PHE A 1 37 ? -3.523  15.476 22.768 1.00 0.00 ? 37 PHE A CD1  10 
ATOM 8619  C CD2  . PHE A 1 37 ? -4.895  17.458 22.526 1.00 0.00 ? 37 PHE A CD2  10 
ATOM 8620  C CE1  . PHE A 1 37 ? -2.390  16.217 22.424 1.00 0.00 ? 37 PHE A CE1  10 
ATOM 8621  C CE2  . PHE A 1 37 ? -3.760  18.200 22.184 1.00 0.00 ? 37 PHE A CE2  10 
ATOM 8622  C CZ   . PHE A 1 37 ? -2.508  17.577 22.130 1.00 0.00 ? 37 PHE A CZ   10 
ATOM 8623  H H    . PHE A 1 37 ? -6.202  12.828 23.300 1.00 0.00 ? 37 PHE A H    10 
ATOM 8624  H HA   . PHE A 1 37 ? -7.582  14.753 21.806 1.00 0.00 ? 37 PHE A HA   10 
ATOM 8625  H HB2  . PHE A 1 37 ? -6.773  15.966 23.532 1.00 0.00 ? 37 PHE A HB2  10 
ATOM 8626  H HB3  . PHE A 1 37 ? -5.752  14.603 23.977 1.00 0.00 ? 37 PHE A HB3  10 
ATOM 8627  H HD1  . PHE A 1 37 ? -3.432  14.424 22.992 1.00 0.00 ? 37 PHE A HD1  10 
ATOM 8628  H HD2  . PHE A 1 37 ? -5.859  17.937 22.573 1.00 0.00 ? 37 PHE A HD2  10 
ATOM 8629  H HE1  . PHE A 1 37 ? -1.422  15.740 22.388 1.00 0.00 ? 37 PHE A HE1  10 
ATOM 8630  H HE2  . PHE A 1 37 ? -3.851  19.252 21.957 1.00 0.00 ? 37 PHE A HE2  10 
ATOM 8631  H HZ   . PHE A 1 37 ? -1.634  18.144 21.861 1.00 0.00 ? 37 PHE A HZ   10 
ATOM 8632  N N    . ILE A 1 38 ? -4.527  14.221 20.636 1.00 0.00 ? 38 ILE A N    10 
ATOM 8633  C CA   . ILE A 1 38 ? -3.729  14.383 19.387 1.00 0.00 ? 38 ILE A CA   10 
ATOM 8634  C C    . ILE A 1 38 ? -4.539  13.847 18.207 1.00 0.00 ? 38 ILE A C    10 
ATOM 8635  O O    . ILE A 1 38 ? -4.506  14.383 17.117 1.00 0.00 ? 38 ILE A O    10 
ATOM 8636  C CB   . ILE A 1 38 ? -2.468  13.543 19.593 1.00 0.00 ? 38 ILE A CB   10 
ATOM 8637  C CG1  . ILE A 1 38 ? -1.567  14.214 20.632 1.00 0.00 ? 38 ILE A CG1  10 
ATOM 8638  C CG2  . ILE A 1 38 ? -1.718  13.430 18.265 1.00 0.00 ? 38 ILE A CG2  10 
ATOM 8639  C CD1  . ILE A 1 38 ? -0.176  13.577 20.595 1.00 0.00 ? 38 ILE A CD1  10 
ATOM 8640  H H    . ILE A 1 38 ? -4.152  13.741 21.401 1.00 0.00 ? 38 ILE A H    10 
ATOM 8641  H HA   . ILE A 1 38 ? -3.471  15.417 19.232 1.00 0.00 ? 38 ILE A HA   10 
ATOM 8642  H HB   . ILE A 1 38 ? -2.743  12.558 19.937 1.00 0.00 ? 38 ILE A HB   10 
ATOM 8643  H HG12 . ILE A 1 38 ? -1.487  15.268 20.411 1.00 0.00 ? 38 ILE A HG12 10 
ATOM 8644  H HG13 . ILE A 1 38 ? -1.993  14.082 21.614 1.00 0.00 ? 38 ILE A HG13 10 
ATOM 8645  H HG21 . ILE A 1 38 ? -2.312  13.869 17.477 1.00 0.00 ? 38 ILE A HG21 10 
ATOM 8646  H HG22 . ILE A 1 38 ? -0.775  13.953 18.339 1.00 0.00 ? 38 ILE A HG22 10 
ATOM 8647  H HG23 . ILE A 1 38 ? -1.535  12.389 18.042 1.00 0.00 ? 38 ILE A HG23 10 
ATOM 8648  H HD11 . ILE A 1 38 ? -0.208  12.677 20.000 1.00 0.00 ? 38 ILE A HD11 10 
ATOM 8649  H HD12 . ILE A 1 38 ? 0.526   14.272 20.159 1.00 0.00 ? 38 ILE A HD12 10 
ATOM 8650  H HD13 . ILE A 1 38 ? 0.135   13.334 21.600 1.00 0.00 ? 38 ILE A HD13 10 
ATOM 8651  N N    . ASN A 1 39 ? -5.276  12.792 18.427 1.00 0.00 ? 39 ASN A N    10 
ATOM 8652  C CA   . ASN A 1 39 ? -6.104  12.214 17.330 1.00 0.00 ? 39 ASN A CA   10 
ATOM 8653  C C    . ASN A 1 39 ? -7.322  13.104 17.086 1.00 0.00 ? 39 ASN A C    10 
ATOM 8654  O O    . ASN A 1 39 ? -7.840  13.182 15.989 1.00 0.00 ? 39 ASN A O    10 
ATOM 8655  C CB   . ASN A 1 39 ? -6.537  10.840 17.841 1.00 0.00 ? 39 ASN A CB   10 
ATOM 8656  C CG   . ASN A 1 39 ? -5.502  9.792  17.431 1.00 0.00 ? 39 ASN A CG   10 
ATOM 8657  O OD1  . ASN A 1 39 ? -5.853  8.698  17.036 1.00 0.00 ? 39 ASN A OD1  10 
ATOM 8658  N ND2  . ASN A 1 39 ? -4.232  10.081 17.510 1.00 0.00 ? 39 ASN A ND2  10 
ATOM 8659  H H    . ASN A 1 39 ? -5.291  12.384 19.318 1.00 0.00 ? 39 ASN A H    10 
ATOM 8660  H HA   . ASN A 1 39 ? -5.522  12.111 16.429 1.00 0.00 ? 39 ASN A HA   10 
ATOM 8661  H HB2  . ASN A 1 39 ? -6.618  10.865 18.918 1.00 0.00 ? 39 ASN A HB2  10 
ATOM 8662  H HB3  . ASN A 1 39 ? -7.496  10.584 17.414 1.00 0.00 ? 39 ASN A HB3  10 
ATOM 8663  H HD21 . ASN A 1 39 ? -3.949  10.963 17.829 1.00 0.00 ? 39 ASN A HD21 10 
ATOM 8664  H HD22 . ASN A 1 39 ? -3.561  9.416  17.250 1.00 0.00 ? 39 ASN A HD22 10 
ATOM 8665  N N    . LYS A 1 40 ? -7.779  13.782 18.102 1.00 0.00 ? 40 LYS A N    10 
ATOM 8666  C CA   . LYS A 1 40 ? -8.959  14.675 17.934 1.00 0.00 ? 40 LYS A CA   10 
ATOM 8667  C C    . LYS A 1 40 ? -8.498  16.064 17.492 1.00 0.00 ? 40 LYS A C    10 
ATOM 8668  O O    . LYS A 1 40 ? -9.224  16.798 16.860 1.00 0.00 ? 40 LYS A O    10 
ATOM 8669  C CB   . LYS A 1 40 ? -9.612  14.739 19.315 1.00 0.00 ? 40 LYS A CB   10 
ATOM 8670  C CG   . LYS A 1 40 ? -10.583 13.567 19.474 1.00 0.00 ? 40 LYS A CG   10 
ATOM 8671  C CD   . LYS A 1 40 ? -11.082 13.512 20.918 1.00 0.00 ? 40 LYS A CD   10 
ATOM 8672  C CE   . LYS A 1 40 ? -10.866 12.105 21.479 1.00 0.00 ? 40 LYS A CE   10 
ATOM 8673  N NZ   . LYS A 1 40 ? -11.571 12.105 22.792 1.00 0.00 ? 40 LYS A NZ   10 
ATOM 8674  H H    . LYS A 1 40 ? -7.342  13.708 18.976 1.00 0.00 ? 40 LYS A H    10 
ATOM 8675  H HA   . LYS A 1 40 ? -9.649  14.258 17.218 1.00 0.00 ? 40 LYS A HA   10 
ATOM 8676  H HB2  . LYS A 1 40 ? -8.848  14.680 20.076 1.00 0.00 ? 40 LYS A HB2  10 
ATOM 8677  H HB3  . LYS A 1 40 ? -10.150 15.669 19.415 1.00 0.00 ? 40 LYS A HB3  10 
ATOM 8678  H HG2  . LYS A 1 40 ? -11.422 13.703 18.807 1.00 0.00 ? 40 LYS A HG2  10 
ATOM 8679  H HG3  . LYS A 1 40 ? -10.076 12.645 19.232 1.00 0.00 ? 40 LYS A HG3  10 
ATOM 8680  H HD2  . LYS A 1 40 ? -10.534 14.227 21.515 1.00 0.00 ? 40 LYS A HD2  10 
ATOM 8681  H HD3  . LYS A 1 40 ? -12.134 13.754 20.944 1.00 0.00 ? 40 LYS A HD3  10 
ATOM 8682  H HE2  . LYS A 1 40 ? -11.299 11.368 20.820 1.00 0.00 ? 40 LYS A HE2  10 
ATOM 8683  H HE3  . LYS A 1 40 ? -9.813  11.914 21.618 1.00 0.00 ? 40 LYS A HE3  10 
ATOM 8684  H HZ1  . LYS A 1 40 ? -12.335 12.809 22.775 1.00 0.00 ? 40 LYS A HZ1  10 
ATOM 8685  H HZ2  . LYS A 1 40 ? -11.971 11.161 22.969 1.00 0.00 ? 40 LYS A HZ2  10 
ATOM 8686  H HZ3  . LYS A 1 40 ? -10.898 12.344 23.547 1.00 0.00 ? 40 LYS A HZ3  10 
ATOM 8687  N N    . CYS A 1 41 ? -7.289  16.426 17.817 1.00 0.00 ? 41 CYS A N    10 
ATOM 8688  C CA   . CYS A 1 41 ? -6.774  17.766 17.412 1.00 0.00 ? 41 CYS A CA   10 
ATOM 8689  C C    . CYS A 1 41 ? -7.177  18.072 15.968 1.00 0.00 ? 41 CYS A C    10 
ATOM 8690  O O    . CYS A 1 41 ? -8.039  18.888 15.709 1.00 0.00 ? 41 CYS A O    10 
ATOM 8691  C CB   . CYS A 1 41 ? -5.252  17.644 17.533 1.00 0.00 ? 41 CYS A CB   10 
ATOM 8692  S SG   . CYS A 1 41 ? -4.438  18.968 16.598 1.00 0.00 ? 41 CYS A SG   10 
ATOM 8693  H H    . CYS A 1 41 ? -6.716  15.815 18.326 1.00 0.00 ? 41 CYS A H    10 
ATOM 8694  H HA   . CYS A 1 41 ? -7.139  18.530 18.077 1.00 0.00 ? 41 CYS A HA   10 
ATOM 8695  H HB2  . CYS A 1 41 ? -4.970  17.714 18.570 1.00 0.00 ? 41 CYS A HB2  10 
ATOM 8696  H HB3  . CYS A 1 41 ? -4.940  16.687 17.141 1.00 0.00 ? 41 CYS A HB3  10 
ATOM 8697  N N    . ALA A 1 42 ? -6.545  17.427 15.033 1.00 0.00 ? 42 ALA A N    10 
ATOM 8698  C CA   . ALA A 1 42 ? -6.870  17.677 13.597 1.00 0.00 ? 42 ALA A CA   10 
ATOM 8699  C C    . ALA A 1 42 ? -8.303  17.239 13.280 1.00 0.00 ? 42 ALA A C    10 
ATOM 8700  O O    . ALA A 1 42 ? -8.973  17.826 12.454 1.00 0.00 ? 42 ALA A O    10 
ATOM 8701  C CB   . ALA A 1 42 ? -5.868  16.829 12.814 1.00 0.00 ? 42 ALA A CB   10 
ATOM 8702  H H    . ALA A 1 42 ? -5.848  16.780 15.276 1.00 0.00 ? 42 ALA A H    10 
ATOM 8703  H HA   . ALA A 1 42 ? -6.733  18.720 13.357 1.00 0.00 ? 42 ALA A HA   10 
ATOM 8704  H HB1  . ALA A 1 42 ? -5.123  16.437 13.490 1.00 0.00 ? 42 ALA A HB1  10 
ATOM 8705  H HB2  . ALA A 1 42 ? -5.388  17.441 12.063 1.00 0.00 ? 42 ALA A HB2  10 
ATOM 8706  H HB3  . ALA A 1 42 ? -6.386  16.012 12.335 1.00 0.00 ? 42 ALA A HB3  10 
ATOM 8707  N N    . THR A 1 43 ? -8.776  16.212 13.928 1.00 0.00 ? 43 THR A N    10 
ATOM 8708  C CA   . THR A 1 43 ? -10.163 15.735 13.663 1.00 0.00 ? 43 THR A CA   10 
ATOM 8709  C C    . THR A 1 43 ? -11.182 16.725 14.230 1.00 0.00 ? 43 THR A C    10 
ATOM 8710  O O    . THR A 1 43 ? -12.318 16.774 13.803 1.00 0.00 ? 43 THR A O    10 
ATOM 8711  C CB   . THR A 1 43 ? -10.264 14.388 14.382 1.00 0.00 ? 43 THR A CB   10 
ATOM 8712  O OG1  . THR A 1 43 ? -9.248  13.518 13.902 1.00 0.00 ? 43 THR A OG1  10 
ATOM 8713  C CG2  . THR A 1 43 ? -11.637 13.768 14.114 1.00 0.00 ? 43 THR A CG2  10 
ATOM 8714  H H    . THR A 1 43 ? -8.219  15.754 14.588 1.00 0.00 ? 43 THR A H    10 
ATOM 8715  H HA   . THR A 1 43 ? -10.319 15.600 12.604 1.00 0.00 ? 43 THR A HA   10 
ATOM 8716  H HB   . THR A 1 43 ? -10.142 14.536 15.442 1.00 0.00 ? 43 THR A HB   10 
ATOM 8717  H HG1  . THR A 1 43 ? -8.496  14.054 13.641 1.00 0.00 ? 43 THR A HG1  10 
ATOM 8718  H HG21 . THR A 1 43 ? -12.409 14.454 14.431 1.00 0.00 ? 43 THR A HG21 10 
ATOM 8719  H HG22 . THR A 1 43 ? -11.743 13.570 13.058 1.00 0.00 ? 43 THR A HG22 10 
ATOM 8720  H HG23 . THR A 1 43 ? -11.728 12.843 14.665 1.00 0.00 ? 43 THR A HG23 10 
ATOM 8721  N N    . CYS A 1 44 ? -10.784 17.516 15.187 1.00 0.00 ? 44 CYS A N    10 
ATOM 8722  C CA   . CYS A 1 44 ? -11.725 18.508 15.778 1.00 0.00 ? 44 CYS A CA   10 
ATOM 8723  C C    . CYS A 1 44 ? -11.652 19.815 14.989 1.00 0.00 ? 44 CYS A C    10 
ATOM 8724  O O    . CYS A 1 44 ? -12.656 20.357 14.572 1.00 0.00 ? 44 CYS A O    10 
ATOM 8725  C CB   . CYS A 1 44 ? -11.238 18.715 17.212 1.00 0.00 ? 44 CYS A CB   10 
ATOM 8726  S SG   . CYS A 1 44 ? -12.597 19.358 18.220 1.00 0.00 ? 44 CYS A SG   10 
ATOM 8727  H H    . CYS A 1 44 ? -9.862  17.463 15.513 1.00 0.00 ? 44 CYS A H    10 
ATOM 8728  H HA   . CYS A 1 44 ? -12.731 18.120 15.779 1.00 0.00 ? 44 CYS A HA   10 
ATOM 8729  H HB2  . CYS A 1 44 ? -10.906 17.773 17.619 1.00 0.00 ? 44 CYS A HB2  10 
ATOM 8730  H HB3  . CYS A 1 44 ? -10.420 19.420 17.217 1.00 0.00 ? 44 CYS A HB3  10 
ATOM 8731  N N    . LYS A 1 45 ? -10.467 20.317 14.768 1.00 0.00 ? 45 LYS A N    10 
ATOM 8732  C CA   . LYS A 1 45 ? -10.331 21.579 13.990 1.00 0.00 ? 45 LYS A CA   10 
ATOM 8733  C C    . LYS A 1 45 ? -11.195 21.489 12.733 1.00 0.00 ? 45 LYS A C    10 
ATOM 8734  O O    . LYS A 1 45 ? -11.885 22.422 12.370 1.00 0.00 ? 45 LYS A O    10 
ATOM 8735  C CB   . LYS A 1 45 ? -8.847  21.663 13.625 1.00 0.00 ? 45 LYS A CB   10 
ATOM 8736  C CG   . LYS A 1 45 ? -8.631  22.743 12.561 1.00 0.00 ? 45 LYS A CG   10 
ATOM 8737  C CD   . LYS A 1 45 ? -7.693  22.208 11.478 1.00 0.00 ? 45 LYS A CD   10 
ATOM 8738  C CE   . LYS A 1 45 ? -7.215  23.367 10.601 1.00 0.00 ? 45 LYS A CE   10 
ATOM 8739  N NZ   . LYS A 1 45 ? -6.068  22.813 9.829  1.00 0.00 ? 45 LYS A NZ   10 
ATOM 8740  H H    . LYS A 1 45 ? -9.668  19.857 15.102 1.00 0.00 ? 45 LYS A H    10 
ATOM 8741  H HA   . LYS A 1 45 ? -10.617 22.428 14.591 1.00 0.00 ? 45 LYS A HA   10 
ATOM 8742  H HB2  . LYS A 1 45 ? -8.274  21.910 14.508 1.00 0.00 ? 45 LYS A HB2  10 
ATOM 8743  H HB3  . LYS A 1 45 ? -8.517  20.709 13.240 1.00 0.00 ? 45 LYS A HB3  10 
ATOM 8744  H HG2  . LYS A 1 45 ? -9.578  23.010 12.115 1.00 0.00 ? 45 LYS A HG2  10 
ATOM 8745  H HG3  . LYS A 1 45 ? -8.191  23.616 13.019 1.00 0.00 ? 45 LYS A HG3  10 
ATOM 8746  H HD2  . LYS A 1 45 ? -6.841  21.733 11.942 1.00 0.00 ? 45 LYS A HD2  10 
ATOM 8747  H HD3  . LYS A 1 45 ? -8.220  21.489 10.869 1.00 0.00 ? 45 LYS A HD3  10 
ATOM 8748  H HE2  . LYS A 1 45 ? -8.002  23.681 9.931  1.00 0.00 ? 45 LYS A HE2  10 
ATOM 8749  H HE3  . LYS A 1 45 ? -6.891  24.194 11.215 1.00 0.00 ? 45 LYS A HE3  10 
ATOM 8750  H HZ1  . LYS A 1 45 ? -6.376  21.966 9.310  1.00 0.00 ? 45 LYS A HZ1  10 
ATOM 8751  H HZ2  . LYS A 1 45 ? -5.728  23.525 9.153  1.00 0.00 ? 45 LYS A HZ2  10 
ATOM 8752  H HZ3  . LYS A 1 45 ? -5.300  22.559 10.484 1.00 0.00 ? 45 LYS A HZ3  10 
ATOM 8753  N N    . MET A 1 46 ? -11.164 20.367 12.066 1.00 0.00 ? 46 MET A N    10 
ATOM 8754  C CA   . MET A 1 46 ? -11.985 20.210 10.834 1.00 0.00 ? 46 MET A CA   10 
ATOM 8755  C C    . MET A 1 46 ? -13.470 20.357 11.177 1.00 0.00 ? 46 MET A C    10 
ATOM 8756  O O    . MET A 1 46 ? -14.265 20.789 10.365 1.00 0.00 ? 46 MET A O    10 
ATOM 8757  C CB   . MET A 1 46 ? -11.686 18.796 10.332 1.00 0.00 ? 46 MET A CB   10 
ATOM 8758  C CG   . MET A 1 46 ? -11.797 17.804 11.492 1.00 0.00 ? 46 MET A CG   10 
ATOM 8759  S SD   . MET A 1 46 ? -13.206 16.701 11.213 1.00 0.00 ? 46 MET A SD   10 
ATOM 8760  C CE   . MET A 1 46 ? -12.778 16.202 9.527  1.00 0.00 ? 46 MET A CE   10 
ATOM 8761  H H    . MET A 1 46 ? -10.602 19.627 12.380 1.00 0.00 ? 46 MET A H    10 
ATOM 8762  H HA   . MET A 1 46 ? -11.694 20.937 10.093 1.00 0.00 ? 46 MET A HA   10 
ATOM 8763  H HB2  . MET A 1 46 ? -12.397 18.531 9.562  1.00 0.00 ? 46 MET A HB2  10 
ATOM 8764  H HB3  . MET A 1 46 ? -10.687 18.763 9.924  1.00 0.00 ? 46 MET A HB3  10 
ATOM 8765  H HG2  . MET A 1 46 ? -10.890 17.220 11.553 1.00 0.00 ? 46 MET A HG2  10 
ATOM 8766  H HG3  . MET A 1 46 ? -11.942 18.343 12.416 1.00 0.00 ? 46 MET A HG3  10 
ATOM 8767  H HE1  . MET A 1 46 ? -11.706 16.253 9.398  1.00 0.00 ? 46 MET A HE1  10 
ATOM 8768  H HE2  . MET A 1 46 ? -13.112 15.191 9.354  1.00 0.00 ? 46 MET A HE2  10 
ATOM 8769  H HE3  . MET A 1 46 ? -13.264 16.864 8.823  1.00 0.00 ? 46 MET A HE3  10 
ATOM 8770  N N    . ILE A 1 47 ? -13.848 20.009 12.378 1.00 0.00 ? 47 ILE A N    10 
ATOM 8771  C CA   . ILE A 1 47 ? -15.279 20.139 12.773 1.00 0.00 ? 47 ILE A CA   10 
ATOM 8772  C C    . ILE A 1 47 ? -15.703 21.606 12.688 1.00 0.00 ? 47 ILE A C    10 
ATOM 8773  O O    . ILE A 1 47 ? -16.810 21.924 12.301 1.00 0.00 ? 47 ILE A O    10 
ATOM 8774  C CB   . ILE A 1 47 ? -15.349 19.646 14.220 1.00 0.00 ? 47 ILE A CB   10 
ATOM 8775  C CG1  . ILE A 1 47 ? -14.725 18.252 14.323 1.00 0.00 ? 47 ILE A CG1  10 
ATOM 8776  C CG2  . ILE A 1 47 ? -16.811 19.582 14.666 1.00 0.00 ? 47 ILE A CG2  10 
ATOM 8777  C CD1  . ILE A 1 47 ? -15.315 17.344 13.244 1.00 0.00 ? 47 ILE A CD1  10 
ATOM 8778  H H    . ILE A 1 47 ? -13.190 19.671 13.018 1.00 0.00 ? 47 ILE A H    10 
ATOM 8779  H HA   . ILE A 1 47 ? -15.904 19.528 12.141 1.00 0.00 ? 47 ILE A HA   10 
ATOM 8780  H HB   . ILE A 1 47 ? -14.809 20.330 14.858 1.00 0.00 ? 47 ILE A HB   10 
ATOM 8781  H HG12 . ILE A 1 47 ? -13.658 18.327 14.187 1.00 0.00 ? 47 ILE A HG12 10 
ATOM 8782  H HG13 . ILE A 1 47 ? -14.935 17.837 15.297 1.00 0.00 ? 47 ILE A HG13 10 
ATOM 8783  H HG21 . ILE A 1 47 ? -17.449 19.513 13.798 1.00 0.00 ? 47 ILE A HG21 10 
ATOM 8784  H HG22 . ILE A 1 47 ? -16.959 18.714 15.291 1.00 0.00 ? 47 ILE A HG22 10 
ATOM 8785  H HG23 . ILE A 1 47 ? -17.056 20.473 15.224 1.00 0.00 ? 47 ILE A HG23 10 
ATOM 8786  H HD11 . ILE A 1 47 ? -15.192 17.807 12.276 1.00 0.00 ? 47 ILE A HD11 10 
ATOM 8787  H HD12 . ILE A 1 47 ? -14.801 16.393 13.255 1.00 0.00 ? 47 ILE A HD12 10 
ATOM 8788  H HD13 . ILE A 1 47 ? -16.365 17.187 13.440 1.00 0.00 ? 47 ILE A HD13 10 
ATOM 8789  N N    . LEU A 1 48 ? -14.823 22.501 13.045 1.00 0.00 ? 48 LEU A N    10 
ATOM 8790  C CA   . LEU A 1 48 ? -15.165 23.949 12.983 1.00 0.00 ? 48 LEU A CA   10 
ATOM 8791  C C    . LEU A 1 48 ? -15.334 24.382 11.527 1.00 0.00 ? 48 LEU A C    10 
ATOM 8792  O O    . LEU A 1 48 ? -16.148 25.227 11.210 1.00 0.00 ? 48 LEU A O    10 
ATOM 8793  C CB   . LEU A 1 48 ? -13.976 24.665 13.624 1.00 0.00 ? 48 LEU A CB   10 
ATOM 8794  C CG   . LEU A 1 48 ? -13.881 24.269 15.097 1.00 0.00 ? 48 LEU A CG   10 
ATOM 8795  C CD1  . LEU A 1 48 ? -12.437 23.890 15.433 1.00 0.00 ? 48 LEU A CD1  10 
ATOM 8796  C CD2  . LEU A 1 48 ? -14.315 25.448 15.970 1.00 0.00 ? 48 LEU A CD2  10 
ATOM 8797  H H    . LEU A 1 48 ? -13.936 22.220 13.352 1.00 0.00 ? 48 LEU A H    10 
ATOM 8798  H HA   . LEU A 1 48 ? -16.064 24.150 13.545 1.00 0.00 ? 48 LEU A HA   10 
ATOM 8799  H HB2  . LEU A 1 48 ? -13.067 24.379 13.114 1.00 0.00 ? 48 LEU A HB2  10 
ATOM 8800  H HB3  . LEU A 1 48 ? -14.113 25.733 13.545 1.00 0.00 ? 48 LEU A HB3  10 
ATOM 8801  H HG   . LEU A 1 48 ? -14.527 23.425 15.286 1.00 0.00 ? 48 LEU A HG   10 
ATOM 8802  H HD11 . LEU A 1 48 ? -11.763 24.426 14.781 1.00 0.00 ? 48 LEU A HD11 10 
ATOM 8803  H HD12 . LEU A 1 48 ? -12.226 24.148 16.460 1.00 0.00 ? 48 LEU A HD12 10 
ATOM 8804  H HD13 . LEU A 1 48 ? -12.303 22.827 15.294 1.00 0.00 ? 48 LEU A HD13 10 
ATOM 8805  H HD21 . LEU A 1 48 ? -15.235 25.862 15.584 1.00 0.00 ? 48 LEU A HD21 10 
ATOM 8806  H HD22 . LEU A 1 48 ? -14.470 25.108 16.983 1.00 0.00 ? 48 LEU A HD22 10 
ATOM 8807  H HD23 . LEU A 1 48 ? -13.547 26.207 15.958 1.00 0.00 ? 48 LEU A HD23 10 
ATOM 8808  N N    . GLU A 1 49 ? -14.575 23.805 10.634 1.00 0.00 ? 49 GLU A N    10 
ATOM 8809  C CA   . GLU A 1 49 ? -14.701 24.184 9.198  1.00 0.00 ? 49 GLU A CA   10 
ATOM 8810  C C    . GLU A 1 49 ? -16.150 23.999 8.738  1.00 0.00 ? 49 GLU A C    10 
ATOM 8811  O O    . GLU A 1 49 ? -16.568 24.540 7.735  1.00 0.00 ? 49 GLU A O    10 
ATOM 8812  C CB   . GLU A 1 49 ? -13.776 23.224 8.450  1.00 0.00 ? 49 GLU A CB   10 
ATOM 8813  C CG   . GLU A 1 49 ? -12.333 23.454 8.900  1.00 0.00 ? 49 GLU A CG   10 
ATOM 8814  C CD   . GLU A 1 49 ? -11.379 22.734 7.943  1.00 0.00 ? 49 GLU A CD   10 
ATOM 8815  O OE1  . GLU A 1 49 ? -11.714 21.642 7.515  1.00 0.00 ? 49 GLU A OE1  10 
ATOM 8816  O OE2  . GLU A 1 49 ? -10.330 23.289 7.656  1.00 0.00 ? 49 GLU A OE2  10 
ATOM 8817  H H    . GLU A 1 49 ? -13.926 23.120 10.908 1.00 0.00 ? 49 GLU A H    10 
ATOM 8818  H HA   . GLU A 1 49 ? -14.382 25.202 9.045  1.00 0.00 ? 49 GLU A HA   10 
ATOM 8819  H HB2  . GLU A 1 49 ? -14.063 22.205 8.666  1.00 0.00 ? 49 GLU A HB2  10 
ATOM 8820  H HB3  . GLU A 1 49 ? -13.855 23.403 7.387  1.00 0.00 ? 49 GLU A HB3  10 
ATOM 8821  H HG2  . GLU A 1 49 ? -12.118 24.513 8.894  1.00 0.00 ? 49 GLU A HG2  10 
ATOM 8822  H HG3  . GLU A 1 49 ? -12.200 23.066 9.899  1.00 0.00 ? 49 GLU A HG3  10 
ATOM 8823  N N    . LYS A 1 50 ? -16.916 23.237 9.469  1.00 0.00 ? 50 LYS A N    10 
ATOM 8824  C CA   . LYS A 1 50 ? -18.338 23.013 9.082  1.00 0.00 ? 50 LYS A CA   10 
ATOM 8825  C C    . LYS A 1 50 ? -19.233 24.070 9.737  1.00 0.00 ? 50 LYS A C    10 
ATOM 8826  O O    . LYS A 1 50 ? -20.284 24.407 9.230  1.00 0.00 ? 50 LYS A O    10 
ATOM 8827  C CB   . LYS A 1 50 ? -18.683 21.619 9.612  1.00 0.00 ? 50 LYS A CB   10 
ATOM 8828  C CG   . LYS A 1 50 ? -17.611 20.616 9.176  1.00 0.00 ? 50 LYS A CG   10 
ATOM 8829  C CD   . LYS A 1 50 ? -17.961 20.061 7.793  1.00 0.00 ? 50 LYS A CD   10 
ATOM 8830  C CE   . LYS A 1 50 ? -17.055 18.868 7.478  1.00 0.00 ? 50 LYS A CE   10 
ATOM 8831  N NZ   . LYS A 1 50 ? -17.286 18.584 6.033  1.00 0.00 ? 50 LYS A NZ   10 
ATOM 8832  H H    . LYS A 1 50 ? -16.556 22.812 10.276 1.00 0.00 ? 50 LYS A H    10 
ATOM 8833  H HA   . LYS A 1 50 ? -18.445 23.038 8.009  1.00 0.00 ? 50 LYS A HA   10 
ATOM 8834  H HB2  . LYS A 1 50 ? -18.730 21.647 10.691 1.00 0.00 ? 50 LYS A HB2  10 
ATOM 8835  H HB3  . LYS A 1 50 ? -19.640 21.313 9.219  1.00 0.00 ? 50 LYS A HB3  10 
ATOM 8836  H HG2  . LYS A 1 50 ? -16.650 21.106 9.133  1.00 0.00 ? 50 LYS A HG2  10 
ATOM 8837  H HG3  . LYS A 1 50 ? -17.568 19.804 9.887  1.00 0.00 ? 50 LYS A HG3  10 
ATOM 8838  H HD2  . LYS A 1 50 ? -18.992 19.742 7.784  1.00 0.00 ? 50 LYS A HD2  10 
ATOM 8839  H HD3  . LYS A 1 50 ? -17.815 20.831 7.049  1.00 0.00 ? 50 LYS A HD3  10 
ATOM 8840  H HE2  . LYS A 1 50 ? -16.020 19.127 7.650  1.00 0.00 ? 50 LYS A HE2  10 
ATOM 8841  H HE3  . LYS A 1 50 ? -17.335 18.016 8.078  1.00 0.00 ? 50 LYS A HE3  10 
ATOM 8842  H HZ1  . LYS A 1 50 ? -18.299 18.680 5.818  1.00 0.00 ? 50 LYS A HZ1  10 
ATOM 8843  H HZ2  . LYS A 1 50 ? -16.747 19.258 5.456  1.00 0.00 ? 50 LYS A HZ2  10 
ATOM 8844  H HZ3  . LYS A 1 50 ? -16.975 17.614 5.818  1.00 0.00 ? 50 LYS A HZ3  10 
ATOM 8845  N N    . GLU A 1 51 ? -18.823 24.592 10.860 1.00 0.00 ? 51 GLU A N    10 
ATOM 8846  C CA   . GLU A 1 51 ? -19.649 25.624 11.549 1.00 0.00 ? 51 GLU A CA   10 
ATOM 8847  C C    . GLU A 1 51 ? -19.657 26.923 10.739 1.00 0.00 ? 51 GLU A C    10 
ATOM 8848  O O    . GLU A 1 51 ? -20.588 27.702 10.804 1.00 0.00 ? 51 GLU A O    10 
ATOM 8849  C CB   . GLU A 1 51 ? -18.968 25.840 12.900 1.00 0.00 ? 51 GLU A CB   10 
ATOM 8850  C CG   . GLU A 1 51 ? -19.134 24.585 13.759 1.00 0.00 ? 51 GLU A CG   10 
ATOM 8851  C CD   . GLU A 1 51 ? -18.534 24.832 15.145 1.00 0.00 ? 51 GLU A CD   10 
ATOM 8852  O OE1  . GLU A 1 51 ? -17.866 25.840 15.309 1.00 0.00 ? 51 GLU A OE1  10 
ATOM 8853  O OE2  . GLU A 1 51 ? -18.753 24.009 16.020 1.00 0.00 ? 51 GLU A OE2  10 
ATOM 8854  H H    . GLU A 1 51 ? -17.971 24.304 11.252 1.00 0.00 ? 51 GLU A H    10 
ATOM 8855  H HA   . GLU A 1 51 ? -20.655 25.266 11.696 1.00 0.00 ? 51 GLU A HA   10 
ATOM 8856  H HB2  . GLU A 1 51 ? -17.917 26.034 12.747 1.00 0.00 ? 51 GLU A HB2  10 
ATOM 8857  H HB3  . GLU A 1 51 ? -19.421 26.683 13.402 1.00 0.00 ? 51 GLU A HB3  10 
ATOM 8858  H HG2  . GLU A 1 51 ? -20.184 24.352 13.858 1.00 0.00 ? 51 GLU A HG2  10 
ATOM 8859  H HG3  . GLU A 1 51 ? -18.624 23.756 13.290 1.00 0.00 ? 51 GLU A HG3  10 
ATOM 8860  N N    . ALA A 1 52 ? -18.627 27.162 9.975  1.00 0.00 ? 52 ALA A N    10 
ATOM 8861  C CA   . ALA A 1 52 ? -18.575 28.410 9.161  1.00 0.00 ? 52 ALA A CA   10 
ATOM 8862  C C    . ALA A 1 52 ? -19.419 28.249 7.894  1.00 0.00 ? 52 ALA A C    10 
ATOM 8863  O O    . ALA A 1 52 ? -19.596 27.157 7.390  1.00 0.00 ? 52 ALA A O    10 
ATOM 8864  C CB   . ALA A 1 52 ? -17.099 28.590 8.804  1.00 0.00 ? 52 ALA A CB   10 
ATOM 8865  H H    . ALA A 1 52 ? -17.887 26.521 9.937  1.00 0.00 ? 52 ALA A H    10 
ATOM 8866  H HA   . ALA A 1 52 ? -18.920 29.252 9.740  1.00 0.00 ? 52 ALA A HA   10 
ATOM 8867  H HB1  . ALA A 1 52 ? -16.543 27.722 9.127  1.00 0.00 ? 52 ALA A HB1  10 
ATOM 8868  H HB2  . ALA A 1 52 ? -16.999 28.705 7.735  1.00 0.00 ? 52 ALA A HB2  10 
ATOM 8869  H HB3  . ALA A 1 52 ? -16.714 29.469 9.300  1.00 0.00 ? 52 ALA A HB3  10 
ATOM 8870  N N    . LYS A 1 53 ? -19.942 29.326 7.376  1.00 0.00 ? 53 LYS A N    10 
ATOM 8871  C CA   . LYS A 1 53 ? -20.775 29.232 6.142  1.00 0.00 ? 53 LYS A CA   10 
ATOM 8872  C C    . LYS A 1 53 ? -19.905 28.837 4.945  1.00 0.00 ? 53 LYS A C    10 
ATOM 8873  O O    . LYS A 1 53 ? -20.401 28.562 3.870  1.00 0.00 ? 53 LYS A O    10 
ATOM 8874  C CB   . LYS A 1 53 ? -21.352 30.633 5.946  1.00 0.00 ? 53 LYS A CB   10 
ATOM 8875  C CG   . LYS A 1 53 ? -22.337 30.617 4.775  1.00 0.00 ? 53 LYS A CG   10 
ATOM 8876  C CD   . LYS A 1 53 ? -22.783 32.047 4.464  1.00 0.00 ? 53 LYS A CD   10 
ATOM 8877  C CE   . LYS A 1 53 ? -23.957 32.014 3.484  1.00 0.00 ? 53 LYS A CE   10 
ATOM 8878  N NZ   . LYS A 1 53 ? -24.245 33.444 3.184  1.00 0.00 ? 53 LYS A NZ   10 
ATOM 8879  H H    . LYS A 1 53 ? -19.788 30.197 7.798  1.00 0.00 ? 53 LYS A H    10 
ATOM 8880  H HA   . LYS A 1 53 ? -21.572 28.520 6.280  1.00 0.00 ? 53 LYS A HA   10 
ATOM 8881  H HB2  . LYS A 1 53 ? -21.866 30.939 6.845  1.00 0.00 ? 53 LYS A HB2  10 
ATOM 8882  H HB3  . LYS A 1 53 ? -20.552 31.327 5.734  1.00 0.00 ? 53 LYS A HB3  10 
ATOM 8883  H HG2  . LYS A 1 53 ? -21.857 30.194 3.906  1.00 0.00 ? 53 LYS A HG2  10 
ATOM 8884  H HG3  . LYS A 1 53 ? -23.198 30.021 5.037  1.00 0.00 ? 53 LYS A HG3  10 
ATOM 8885  H HD2  . LYS A 1 53 ? -23.092 32.535 5.378  1.00 0.00 ? 53 LYS A HD2  10 
ATOM 8886  H HD3  . LYS A 1 53 ? -21.963 32.594 4.024  1.00 0.00 ? 53 LYS A HD3  10 
ATOM 8887  H HE2  . LYS A 1 53 ? -23.677 31.489 2.581  1.00 0.00 ? 53 LYS A HE2  10 
ATOM 8888  H HE3  . LYS A 1 53 ? -24.816 31.545 3.941  1.00 0.00 ? 53 LYS A HE3  10 
ATOM 8889  H HZ1  . LYS A 1 53 ? -23.355 33.944 2.989  1.00 0.00 ? 53 LYS A HZ1  10 
ATOM 8890  H HZ2  . LYS A 1 53 ? -24.868 33.506 2.352  1.00 0.00 ? 53 LYS A HZ2  10 
ATOM 8891  H HZ3  . LYS A 1 53 ? -24.714 33.882 4.002  1.00 0.00 ? 53 LYS A HZ3  10 
ATOM 8892  N N    . SER A 1 54 ? -18.613 28.804 5.122  1.00 0.00 ? 54 SER A N    10 
ATOM 8893  C CA   . SER A 1 54 ? -17.715 28.425 3.993  1.00 0.00 ? 54 SER A CA   10 
ATOM 8894  C C    . SER A 1 54 ? -17.824 26.925 3.712  1.00 0.00 ? 54 SER A C    10 
ATOM 8895  O O    . SER A 1 54 ? -17.283 26.422 2.748  1.00 0.00 ? 54 SER A O    10 
ATOM 8896  C CB   . SER A 1 54 ? -16.307 28.781 4.471  1.00 0.00 ? 54 SER A CB   10 
ATOM 8897  O OG   . SER A 1 54 ? -15.952 27.944 5.561  1.00 0.00 ? 54 SER A OG   10 
ATOM 8898  H H    . SER A 1 54 ? -18.233 29.027 5.997  1.00 0.00 ? 54 SER A H    10 
ATOM 8899  H HA   . SER A 1 54 ? -17.960 28.994 3.110  1.00 0.00 ? 54 SER A HA   10 
ATOM 8900  H HB2  . SER A 1 54 ? -15.606 28.636 3.662  1.00 0.00 ? 54 SER A HB2  10 
ATOM 8901  H HB3  . SER A 1 54 ? -16.284 29.814 4.787  1.00 0.00 ? 54 SER A HB3  10 
ATOM 8902  H HG   . SER A 1 54 ? -15.062 27.620 5.409  1.00 0.00 ? 54 SER A HG   10 
ATOM 8903  N N    . GLN A 1 55 ? -18.522 26.205 4.548  1.00 0.00 ? 55 GLN A N    10 
ATOM 8904  C CA   . GLN A 1 55 ? -18.666 24.737 4.328  1.00 0.00 ? 55 GLN A CA   10 
ATOM 8905  C C    . GLN A 1 55 ? -19.335 24.467 2.978  1.00 0.00 ? 55 GLN A C    10 
ATOM 8906  O O    . GLN A 1 55 ? -20.314 25.132 2.680  1.00 0.00 ? 55 GLN A O    10 
ATOM 8907  C CB   . GLN A 1 55 ? -19.554 24.251 5.474  1.00 0.00 ? 55 GLN A CB   10 
ATOM 8908  C CG   . GLN A 1 55 ? -19.753 22.739 5.357  1.00 0.00 ? 55 GLN A CG   10 
ATOM 8909  C CD   . GLN A 1 55 ? -20.731 22.269 6.434  1.00 0.00 ? 55 GLN A CD   10 
ATOM 8910  O OE1  . GLN A 1 55 ? -21.020 22.992 7.367  1.00 0.00 ? 55 GLN A OE1  10 
ATOM 8911  N NE2  . GLN A 1 55 ? -21.259 21.078 6.345  1.00 0.00 ? 55 GLN A NE2  10 
ATOM 8912  O OXT  . GLN A 1 55 ? -18.858 23.600 2.265  1.00 0.00 ? 55 GLN A OXT  10 
ATOM 8913  H H    . GLN A 1 55 ? -18.952 26.629 5.320  1.00 0.00 ? 55 GLN A H    10 
ATOM 8914  H HA   . GLN A 1 55 ? -17.704 24.253 4.375  1.00 0.00 ? 55 GLN A HA   10 
ATOM 8915  H HB2  . GLN A 1 55 ? -19.081 24.479 6.418  1.00 0.00 ? 55 GLN A HB2  10 
ATOM 8916  H HB3  . GLN A 1 55 ? -20.513 24.745 5.421  1.00 0.00 ? 55 GLN A HB3  10 
ATOM 8917  H HG2  . GLN A 1 55 ? -20.151 22.503 4.381  1.00 0.00 ? 55 GLN A HG2  10 
ATOM 8918  H HG3  . GLN A 1 55 ? -18.804 22.239 5.488  1.00 0.00 ? 55 GLN A HG3  10 
ATOM 8919  H HE21 . GLN A 1 55 ? -21.026 20.495 5.593  1.00 0.00 ? 55 GLN A HE21 10 
ATOM 8920  H HE22 . GLN A 1 55 ? -21.886 20.767 7.031  1.00 0.00 ? 55 GLN A HE22 10 
ATOM 8921  N N    . LYS A 1 1  ? -26.165 23.416 24.352 1.00 0.00 ? 1  LYS A N    11 
ATOM 8922  C CA   . LYS A 1 1  ? -25.904 23.945 22.982 1.00 0.00 ? 1  LYS A CA   11 
ATOM 8923  C C    . LYS A 1 1  ? -25.910 22.801 21.965 1.00 0.00 ? 1  LYS A C    11 
ATOM 8924  O O    . LYS A 1 1  ? -26.209 21.669 22.291 1.00 0.00 ? 1  LYS A O    11 
ATOM 8925  C CB   . LYS A 1 1  ? -24.519 24.587 23.063 1.00 0.00 ? 1  LYS A CB   11 
ATOM 8926  C CG   . LYS A 1 1  ? -24.545 25.727 24.083 1.00 0.00 ? 1  LYS A CG   11 
ATOM 8927  C CD   . LYS A 1 1  ? -23.164 26.380 24.152 1.00 0.00 ? 1  LYS A CD   11 
ATOM 8928  C CE   . LYS A 1 1  ? -23.160 27.449 25.248 1.00 0.00 ? 1  LYS A CE   11 
ATOM 8929  N NZ   . LYS A 1 1  ? -21.764 27.969 25.267 1.00 0.00 ? 1  LYS A NZ   11 
ATOM 8930  H H1   . LYS A 1 1  ? -26.804 22.599 24.293 1.00 0.00 ? 1  LYS A H1   11 
ATOM 8931  H H2   . LYS A 1 1  ? -25.267 23.120 24.785 1.00 0.00 ? 1  LYS A H2   11 
ATOM 8932  H H3   . LYS A 1 1  ? -26.603 24.160 24.932 1.00 0.00 ? 1  LYS A H3   11 
ATOM 8933  H HA   . LYS A 1 1  ? -26.640 24.689 22.719 1.00 0.00 ? 1  LYS A HA   11 
ATOM 8934  H HB2  . LYS A 1 1  ? -23.797 23.845 23.370 1.00 0.00 ? 1  LYS A HB2  11 
ATOM 8935  H HB3  . LYS A 1 1  ? -24.246 24.977 22.093 1.00 0.00 ? 1  LYS A HB3  11 
ATOM 8936  H HG2  . LYS A 1 1  ? -25.277 26.462 23.782 1.00 0.00 ? 1  LYS A HG2  11 
ATOM 8937  H HG3  . LYS A 1 1  ? -24.808 25.335 25.055 1.00 0.00 ? 1  LYS A HG3  11 
ATOM 8938  H HD2  . LYS A 1 1  ? -22.421 25.630 24.379 1.00 0.00 ? 1  LYS A HD2  11 
ATOM 8939  H HD3  . LYS A 1 1  ? -22.934 26.838 23.202 1.00 0.00 ? 1  LYS A HD3  11 
ATOM 8940  H HE2  . LYS A 1 1  ? -23.852 28.241 25.003 1.00 0.00 ? 1  LYS A HE2  11 
ATOM 8941  H HE3  . LYS A 1 1  ? -23.411 27.011 26.202 1.00 0.00 ? 1  LYS A HE3  11 
ATOM 8942  H HZ1  . LYS A 1 1  ? -21.470 28.214 24.299 1.00 0.00 ? 1  LYS A HZ1  11 
ATOM 8943  H HZ2  . LYS A 1 1  ? -21.717 28.818 25.866 1.00 0.00 ? 1  LYS A HZ2  11 
ATOM 8944  H HZ3  . LYS A 1 1  ? -21.127 27.239 25.648 1.00 0.00 ? 1  LYS A HZ3  11 
ATOM 8945  N N    . ASN A 1 2  ? -25.583 23.086 20.734 1.00 0.00 ? 2  ASN A N    11 
ATOM 8946  C CA   . ASN A 1 2  ? -25.571 22.014 19.699 1.00 0.00 ? 2  ASN A CA   11 
ATOM 8947  C C    . ASN A 1 2  ? -24.190 21.357 19.631 1.00 0.00 ? 2  ASN A C    11 
ATOM 8948  O O    . ASN A 1 2  ? -23.173 22.018 19.716 1.00 0.00 ? 2  ASN A O    11 
ATOM 8949  C CB   . ASN A 1 2  ? -25.891 22.727 18.386 1.00 0.00 ? 2  ASN A CB   11 
ATOM 8950  C CG   . ASN A 1 2  ? -27.301 23.316 18.455 1.00 0.00 ? 2  ASN A CG   11 
ATOM 8951  O OD1  . ASN A 1 2  ? -28.161 22.783 19.128 1.00 0.00 ? 2  ASN A OD1  11 
ATOM 8952  N ND2  . ASN A 1 2  ? -27.578 24.399 17.783 1.00 0.00 ? 2  ASN A ND2  11 
ATOM 8953  H H    . ASN A 1 2  ? -25.346 24.006 20.490 1.00 0.00 ? 2  ASN A H    11 
ATOM 8954  H HA   . ASN A 1 2  ? -26.330 21.277 19.911 1.00 0.00 ? 2  ASN A HA   11 
ATOM 8955  H HB2  . ASN A 1 2  ? -25.177 23.520 18.223 1.00 0.00 ? 2  ASN A HB2  11 
ATOM 8956  H HB3  . ASN A 1 2  ? -25.835 22.021 17.570 1.00 0.00 ? 2  ASN A HB3  11 
ATOM 8957  H HD21 . ASN A 1 2  ? -26.884 24.829 17.239 1.00 0.00 ? 2  ASN A HD21 11 
ATOM 8958  H HD22 . ASN A 1 2  ? -28.478 24.783 17.821 1.00 0.00 ? 2  ASN A HD22 11 
ATOM 8959  N N    . GLU A 1 3  ? -24.146 20.062 19.477 1.00 0.00 ? 3  GLU A N    11 
ATOM 8960  C CA   . GLU A 1 3  ? -22.830 19.365 19.403 1.00 0.00 ? 3  GLU A CA   11 
ATOM 8961  C C    . GLU A 1 3  ? -22.208 19.562 18.018 1.00 0.00 ? 3  GLU A C    11 
ATOM 8962  O O    . GLU A 1 3  ? -21.033 19.330 17.815 1.00 0.00 ? 3  GLU A O    11 
ATOM 8963  C CB   . GLU A 1 3  ? -23.148 17.890 19.646 1.00 0.00 ? 3  GLU A CB   11 
ATOM 8964  C CG   . GLU A 1 3  ? -21.843 17.098 19.746 1.00 0.00 ? 3  GLU A CG   11 
ATOM 8965  C CD   . GLU A 1 3  ? -22.159 15.629 20.032 1.00 0.00 ? 3  GLU A CD   11 
ATOM 8966  O OE1  . GLU A 1 3  ? -23.332 15.303 20.127 1.00 0.00 ? 3  GLU A OE1  11 
ATOM 8967  O OE2  . GLU A 1 3  ? -21.224 14.854 20.151 1.00 0.00 ? 3  GLU A OE2  11 
ATOM 8968  H H    . GLU A 1 3  ? -24.977 19.548 19.410 1.00 0.00 ? 3  GLU A H    11 
ATOM 8969  H HA   . GLU A 1 3  ? -22.166 19.731 20.170 1.00 0.00 ? 3  GLU A HA   11 
ATOM 8970  H HB2  . GLU A 1 3  ? -23.702 17.789 20.566 1.00 0.00 ? 3  GLU A HB2  11 
ATOM 8971  H HB3  . GLU A 1 3  ? -23.738 17.509 18.826 1.00 0.00 ? 3  GLU A HB3  11 
ATOM 8972  H HG2  . GLU A 1 3  ? -21.302 17.175 18.815 1.00 0.00 ? 3  GLU A HG2  11 
ATOM 8973  H HG3  . GLU A 1 3  ? -21.239 17.499 20.548 1.00 0.00 ? 3  GLU A HG3  11 
ATOM 8974  N N    . ASP A 1 4  ? -22.989 19.988 17.063 1.00 0.00 ? 4  ASP A N    11 
ATOM 8975  C CA   . ASP A 1 4  ? -22.444 20.200 15.691 1.00 0.00 ? 4  ASP A CA   11 
ATOM 8976  C C    . ASP A 1 4  ? -21.687 21.528 15.624 1.00 0.00 ? 4  ASP A C    11 
ATOM 8977  O O    . ASP A 1 4  ? -21.231 21.942 14.576 1.00 0.00 ? 4  ASP A O    11 
ATOM 8978  C CB   . ASP A 1 4  ? -23.671 20.239 14.781 1.00 0.00 ? 4  ASP A CB   11 
ATOM 8979  C CG   . ASP A 1 4  ? -23.254 19.906 13.347 1.00 0.00 ? 4  ASP A CG   11 
ATOM 8980  O OD1  . ASP A 1 4  ? -22.582 18.904 13.163 1.00 0.00 ? 4  ASP A OD1  11 
ATOM 8981  O OD2  . ASP A 1 4  ? -23.615 20.658 12.456 1.00 0.00 ? 4  ASP A OD2  11 
ATOM 8982  H H    . ASP A 1 4  ? -23.934 20.169 17.247 1.00 0.00 ? 4  ASP A H    11 
ATOM 8983  H HA   . ASP A 1 4  ? -21.801 19.382 15.409 1.00 0.00 ? 4  ASP A HA   11 
ATOM 8984  H HB2  . ASP A 1 4  ? -24.395 19.514 15.122 1.00 0.00 ? 4  ASP A HB2  11 
ATOM 8985  H HB3  . ASP A 1 4  ? -24.108 21.226 14.809 1.00 0.00 ? 4  ASP A HB3  11 
ATOM 8986  N N    . GLN A 1 5  ? -21.546 22.197 16.735 1.00 0.00 ? 5  GLN A N    11 
ATOM 8987  C CA   . GLN A 1 5  ? -20.815 23.497 16.737 1.00 0.00 ? 5  GLN A CA   11 
ATOM 8988  C C    . GLN A 1 5  ? -19.556 23.378 17.597 1.00 0.00 ? 5  GLN A C    11 
ATOM 8989  O O    . GLN A 1 5  ? -18.581 24.074 17.393 1.00 0.00 ? 5  GLN A O    11 
ATOM 8990  C CB   . GLN A 1 5  ? -21.790 24.503 17.348 1.00 0.00 ? 5  GLN A CB   11 
ATOM 8991  C CG   . GLN A 1 5  ? -21.146 25.891 17.368 1.00 0.00 ? 5  GLN A CG   11 
ATOM 8992  C CD   . GLN A 1 5  ? -22.013 26.845 18.192 1.00 0.00 ? 5  GLN A CD   11 
ATOM 8993  O OE1  . GLN A 1 5  ? -23.101 27.200 17.785 1.00 0.00 ? 5  GLN A OE1  11 
ATOM 8994  N NE2  . GLN A 1 5  ? -21.573 27.278 19.341 1.00 0.00 ? 5  GLN A NE2  11 
ATOM 8995  H H    . GLN A 1 5  ? -21.918 21.843 17.570 1.00 0.00 ? 5  GLN A H    11 
ATOM 8996  H HA   . GLN A 1 5  ? -20.560 23.790 15.731 1.00 0.00 ? 5  GLN A HA   11 
ATOM 8997  H HB2  . GLN A 1 5  ? -22.694 24.533 16.757 1.00 0.00 ? 5  GLN A HB2  11 
ATOM 8998  H HB3  . GLN A 1 5  ? -22.032 24.204 18.357 1.00 0.00 ? 5  GLN A HB3  11 
ATOM 8999  H HG2  . GLN A 1 5  ? -20.163 25.825 17.810 1.00 0.00 ? 5  GLN A HG2  11 
ATOM 9000  H HG3  . GLN A 1 5  ? -21.062 26.263 16.357 1.00 0.00 ? 5  GLN A HG3  11 
ATOM 9001  H HE21 . GLN A 1 5  ? -20.694 26.992 19.670 1.00 0.00 ? 5  GLN A HE21 11 
ATOM 9002  H HE22 . GLN A 1 5  ? -22.120 27.889 19.877 1.00 0.00 ? 5  GLN A HE22 11 
ATOM 9003  N N    . GLU A 1 6  ? -19.573 22.495 18.554 1.00 0.00 ? 6  GLU A N    11 
ATOM 9004  C CA   . GLU A 1 6  ? -18.382 22.314 19.432 1.00 0.00 ? 6  GLU A CA   11 
ATOM 9005  C C    . GLU A 1 6  ? -18.195 20.829 19.747 1.00 0.00 ? 6  GLU A C    11 
ATOM 9006  O O    . GLU A 1 6  ? -17.953 20.447 20.874 1.00 0.00 ? 6  GLU A O    11 
ATOM 9007  C CB   . GLU A 1 6  ? -18.703 23.100 20.704 1.00 0.00 ? 6  GLU A CB   11 
ATOM 9008  C CG   . GLU A 1 6  ? -18.805 24.590 20.370 1.00 0.00 ? 6  GLU A CG   11 
ATOM 9009  C CD   . GLU A 1 6  ? -19.129 25.377 21.641 1.00 0.00 ? 6  GLU A CD   11 
ATOM 9010  O OE1  . GLU A 1 6  ? -19.786 24.823 22.507 1.00 0.00 ? 6  GLU A OE1  11 
ATOM 9011  O OE2  . GLU A 1 6  ? -18.712 26.520 21.729 1.00 0.00 ? 6  GLU A OE2  11 
ATOM 9012  H H    . GLU A 1 6  ? -20.372 21.943 18.694 1.00 0.00 ? 6  GLU A H    11 
ATOM 9013  H HA   . GLU A 1 6  ? -17.499 22.716 18.960 1.00 0.00 ? 6  GLU A HA   11 
ATOM 9014  H HB2  . GLU A 1 6  ? -19.643 22.757 21.112 1.00 0.00 ? 6  GLU A HB2  11 
ATOM 9015  H HB3  . GLU A 1 6  ? -17.918 22.946 21.430 1.00 0.00 ? 6  GLU A HB3  11 
ATOM 9016  H HG2  . GLU A 1 6  ? -17.865 24.933 19.963 1.00 0.00 ? 6  GLU A HG2  11 
ATOM 9017  H HG3  . GLU A 1 6  ? -19.589 24.743 19.643 1.00 0.00 ? 6  GLU A HG3  11 
ATOM 9018  N N    . MET A 1 7  ? -18.313 19.990 18.753 1.00 0.00 ? 7  MET A N    11 
ATOM 9019  C CA   . MET A 1 7  ? -18.151 18.526 18.983 1.00 0.00 ? 7  MET A CA   11 
ATOM 9020  C C    . MET A 1 7  ? -16.987 18.259 19.942 1.00 0.00 ? 7  MET A C    11 
ATOM 9021  O O    . MET A 1 7  ? -17.000 17.308 20.698 1.00 0.00 ? 7  MET A O    11 
ATOM 9022  C CB   . MET A 1 7  ? -17.849 17.942 17.602 1.00 0.00 ? 7  MET A CB   11 
ATOM 9023  C CG   . MET A 1 7  ? -19.092 18.048 16.717 1.00 0.00 ? 7  MET A CG   11 
ATOM 9024  S SD   . MET A 1 7  ? -18.773 17.242 15.129 1.00 0.00 ? 7  MET A SD   11 
ATOM 9025  C CE   . MET A 1 7  ? -19.096 15.544 15.664 1.00 0.00 ? 7  MET A CE   11 
ATOM 9026  H H    . MET A 1 7  ? -18.514 20.324 17.854 1.00 0.00 ? 7  MET A H    11 
ATOM 9027  H HA   . MET A 1 7  ? -19.065 18.104 19.368 1.00 0.00 ? 7  MET A HA   11 
ATOM 9028  H HB2  . MET A 1 7  ? -17.037 18.491 17.149 1.00 0.00 ? 7  MET A HB2  11 
ATOM 9029  H HB3  . MET A 1 7  ? -17.568 16.904 17.705 1.00 0.00 ? 7  MET A HB3  11 
ATOM 9030  H HG2  . MET A 1 7  ? -19.925 17.562 17.206 1.00 0.00 ? 7  MET A HG2  11 
ATOM 9031  H HG3  . MET A 1 7  ? -19.328 19.089 16.552 1.00 0.00 ? 7  MET A HG3  11 
ATOM 9032  H HE1  . MET A 1 7  ? -19.030 15.489 16.742 1.00 0.00 ? 7  MET A HE1  11 
ATOM 9033  H HE2  . MET A 1 7  ? -20.085 15.249 15.351 1.00 0.00 ? 7  MET A HE2  11 
ATOM 9034  H HE3  . MET A 1 7  ? -18.367 14.881 15.218 1.00 0.00 ? 7  MET A HE3  11 
ATOM 9035  N N    . CYS A 1 8  ? -15.980 19.088 19.914 1.00 0.00 ? 8  CYS A N    11 
ATOM 9036  C CA   . CYS A 1 8  ? -14.817 18.876 20.823 1.00 0.00 ? 8  CYS A CA   11 
ATOM 9037  C C    . CYS A 1 8  ? -14.842 19.890 21.970 1.00 0.00 ? 8  CYS A C    11 
ATOM 9038  O O    . CYS A 1 8  ? -14.679 21.076 21.767 1.00 0.00 ? 8  CYS A O    11 
ATOM 9039  C CB   . CYS A 1 8  ? -13.585 19.093 19.943 1.00 0.00 ? 8  CYS A CB   11 
ATOM 9040  S SG   . CYS A 1 8  ? -13.399 17.695 18.810 1.00 0.00 ? 8  CYS A SG   11 
ATOM 9041  H H    . CYS A 1 8  ? -15.987 19.847 19.295 1.00 0.00 ? 8  CYS A H    11 
ATOM 9042  H HA   . CYS A 1 8  ? -14.818 17.869 21.209 1.00 0.00 ? 8  CYS A HA   11 
ATOM 9043  H HB2  . CYS A 1 8  ? -13.705 20.004 19.374 1.00 0.00 ? 8  CYS A HB2  11 
ATOM 9044  H HB3  . CYS A 1 8  ? -12.706 19.171 20.566 1.00 0.00 ? 8  CYS A HB3  11 
ATOM 9045  N N    . HIS A 1 9  ? -15.042 19.430 23.175 1.00 0.00 ? 9  HIS A N    11 
ATOM 9046  C CA   . HIS A 1 9  ? -15.074 20.365 24.336 1.00 0.00 ? 9  HIS A CA   11 
ATOM 9047  C C    . HIS A 1 9  ? -13.665 20.540 24.907 1.00 0.00 ? 9  HIS A C    11 
ATOM 9048  O O    . HIS A 1 9  ? -13.403 21.445 25.674 1.00 0.00 ? 9  HIS A O    11 
ATOM 9049  C CB   . HIS A 1 9  ? -15.989 19.693 25.362 1.00 0.00 ? 9  HIS A CB   11 
ATOM 9050  C CG   . HIS A 1 9  ? -17.370 19.547 24.784 1.00 0.00 ? 9  HIS A CG   11 
ATOM 9051  N ND1  . HIS A 1 9  ? -17.732 18.462 24.003 1.00 0.00 ? 9  HIS A ND1  11 
ATOM 9052  C CD2  . HIS A 1 9  ? -18.487 20.340 24.867 1.00 0.00 ? 9  HIS A CD2  11 
ATOM 9053  C CE1  . HIS A 1 9  ? -19.020 18.630 23.648 1.00 0.00 ? 9  HIS A CE1  11 
ATOM 9054  N NE2  . HIS A 1 9  ? -19.528 19.760 24.148 1.00 0.00 ? 9  HIS A NE2  11 
ATOM 9055  H H    . HIS A 1 9  ? -15.169 18.468 23.317 1.00 0.00 ? 9  HIS A H    11 
ATOM 9056  H HA   . HIS A 1 9  ? -15.486 21.317 24.043 1.00 0.00 ? 9  HIS A HA   11 
ATOM 9057  H HB2  . HIS A 1 9  ? -15.597 18.718 25.609 1.00 0.00 ? 9  HIS A HB2  11 
ATOM 9058  H HB3  . HIS A 1 9  ? -16.034 20.299 26.255 1.00 0.00 ? 9  HIS A HB3  11 
ATOM 9059  H HD1  . HIS A 1 9  ? -17.157 17.709 23.753 1.00 0.00 ? 9  HIS A HD1  11 
ATOM 9060  H HD2  . HIS A 1 9  ? -18.548 21.274 25.407 1.00 0.00 ? 9  HIS A HD2  11 
ATOM 9061  H HE1  . HIS A 1 9  ? -19.575 17.936 23.035 1.00 0.00 ? 9  HIS A HE1  11 
ATOM 9062  N N    . GLU A 1 10 ? -12.756 19.681 24.535 1.00 0.00 ? 10 GLU A N    11 
ATOM 9063  C CA   . GLU A 1 10 ? -11.362 19.797 25.055 1.00 0.00 ? 10 GLU A CA   11 
ATOM 9064  C C    . GLU A 1 10 ? -10.553 20.759 24.183 1.00 0.00 ? 10 GLU A C    11 
ATOM 9065  O O    . GLU A 1 10 ? -9.759  21.537 24.673 1.00 0.00 ? 10 GLU A O    11 
ATOM 9066  C CB   . GLU A 1 10 ? -10.789 18.384 24.971 1.00 0.00 ? 10 GLU A CB   11 
ATOM 9067  C CG   . GLU A 1 10 ? -11.547 17.468 25.934 1.00 0.00 ? 10 GLU A CG   11 
ATOM 9068  C CD   . GLU A 1 10 ? -11.014 16.040 25.805 1.00 0.00 ? 10 GLU A CD   11 
ATOM 9069  O OE1  . GLU A 1 10 ? -10.260 15.792 24.880 1.00 0.00 ? 10 GLU A OE1  11 
ATOM 9070  O OE2  . GLU A 1 10 ? -11.370 15.219 26.636 1.00 0.00 ? 10 GLU A OE2  11 
ATOM 9071  H H    . GLU A 1 10 ? -12.988 18.959 23.914 1.00 0.00 ? 10 GLU A H    11 
ATOM 9072  H HA   . GLU A 1 10 ? -11.371 20.132 26.080 1.00 0.00 ? 10 GLU A HA   11 
ATOM 9073  H HB2  . GLU A 1 10 ? -10.894 18.012 23.963 1.00 0.00 ? 10 GLU A HB2  11 
ATOM 9074  H HB3  . GLU A 1 10 ? -9.744  18.403 25.240 1.00 0.00 ? 10 GLU A HB3  11 
ATOM 9075  H HG2  . GLU A 1 10 ? -11.405 17.815 26.947 1.00 0.00 ? 10 GLU A HG2  11 
ATOM 9076  H HG3  . GLU A 1 10 ? -12.600 17.483 25.693 1.00 0.00 ? 10 GLU A HG3  11 
ATOM 9077  N N    . PHE A 1 11 ? -10.748 20.715 22.892 1.00 0.00 ? 11 PHE A N    11 
ATOM 9078  C CA   . PHE A 1 11 ? -9.989  21.630 21.993 1.00 0.00 ? 11 PHE A CA   11 
ATOM 9079  C C    . PHE A 1 11 ? -10.675 22.995 21.935 1.00 0.00 ? 11 PHE A C    11 
ATOM 9080  O O    . PHE A 1 11 ? -10.045 24.004 21.693 1.00 0.00 ? 11 PHE A O    11 
ATOM 9081  C CB   . PHE A 1 11 ? -10.029 20.967 20.620 1.00 0.00 ? 11 PHE A CB   11 
ATOM 9082  C CG   . PHE A 1 11 ? -9.067  19.801 20.580 1.00 0.00 ? 11 PHE A CG   11 
ATOM 9083  C CD1  . PHE A 1 11 ? -7.700  20.030 20.378 1.00 0.00 ? 11 PHE A CD1  11 
ATOM 9084  C CD2  . PHE A 1 11 ? -9.540  18.493 20.737 1.00 0.00 ? 11 PHE A CD2  11 
ATOM 9085  C CE1  . PHE A 1 11 ? -6.809  18.952 20.331 1.00 0.00 ? 11 PHE A CE1  11 
ATOM 9086  C CE2  . PHE A 1 11 ? -8.648  17.415 20.692 1.00 0.00 ? 11 PHE A CE2  11 
ATOM 9087  C CZ   . PHE A 1 11 ? -7.283  17.646 20.488 1.00 0.00 ? 11 PHE A CZ   11 
ATOM 9088  H H    . PHE A 1 11 ? -11.394 20.082 22.517 1.00 0.00 ? 11 PHE A H    11 
ATOM 9089  H HA   . PHE A 1 11 ? -8.971  21.730 22.327 1.00 0.00 ? 11 PHE A HA   11 
ATOM 9090  H HB2  . PHE A 1 11 ? -11.028 20.620 20.424 1.00 0.00 ? 11 PHE A HB2  11 
ATOM 9091  H HB3  . PHE A 1 11 ? -9.747  21.688 19.867 1.00 0.00 ? 11 PHE A HB3  11 
ATOM 9092  H HD1  . PHE A 1 11 ? -7.333  21.037 20.259 1.00 0.00 ? 11 PHE A HD1  11 
ATOM 9093  H HD2  . PHE A 1 11 ? -10.592 18.313 20.897 1.00 0.00 ? 11 PHE A HD2  11 
ATOM 9094  H HE1  . PHE A 1 11 ? -5.755  19.130 20.174 1.00 0.00 ? 11 PHE A HE1  11 
ATOM 9095  H HE2  . PHE A 1 11 ? -9.013  16.406 20.811 1.00 0.00 ? 11 PHE A HE2  11 
ATOM 9096  H HZ   . PHE A 1 11 ? -6.594  16.815 20.452 1.00 0.00 ? 11 PHE A HZ   11 
ATOM 9097  N N    . GLN A 1 12 ? -11.962 23.038 22.151 1.00 0.00 ? 12 GLN A N    11 
ATOM 9098  C CA   . GLN A 1 12 ? -12.674 24.345 22.105 1.00 0.00 ? 12 GLN A CA   11 
ATOM 9099  C C    . GLN A 1 12 ? -11.884 25.384 22.899 1.00 0.00 ? 12 GLN A C    11 
ATOM 9100  O O    . GLN A 1 12 ? -11.702 26.503 22.467 1.00 0.00 ? 12 GLN A O    11 
ATOM 9101  C CB   . GLN A 1 12 ? -14.031 24.088 22.760 1.00 0.00 ? 12 GLN A CB   11 
ATOM 9102  C CG   . GLN A 1 12 ? -14.829 25.394 22.802 1.00 0.00 ? 12 GLN A CG   11 
ATOM 9103  C CD   . GLN A 1 12 ? -15.780 25.372 24.001 1.00 0.00 ? 12 GLN A CD   11 
ATOM 9104  O OE1  . GLN A 1 12 ? -15.790 24.429 24.767 1.00 0.00 ? 12 GLN A OE1  11 
ATOM 9105  N NE2  . GLN A 1 12 ? -16.586 26.380 24.197 1.00 0.00 ? 12 GLN A NE2  11 
ATOM 9106  H H    . GLN A 1 12 ? -12.457 22.213 22.341 1.00 0.00 ? 12 GLN A H    11 
ATOM 9107  H HA   . GLN A 1 12 ? -12.809 24.669 21.085 1.00 0.00 ? 12 GLN A HA   11 
ATOM 9108  H HB2  . GLN A 1 12 ? -14.575 23.353 22.187 1.00 0.00 ? 12 GLN A HB2  11 
ATOM 9109  H HB3  . GLN A 1 12 ? -13.883 23.724 23.765 1.00 0.00 ? 12 GLN A HB3  11 
ATOM 9110  H HG2  . GLN A 1 12 ? -14.149 26.228 22.897 1.00 0.00 ? 12 GLN A HG2  11 
ATOM 9111  H HG3  . GLN A 1 12 ? -15.400 25.497 21.892 1.00 0.00 ? 12 GLN A HG3  11 
ATOM 9112  H HE21 . GLN A 1 12 ? -16.579 27.140 23.580 1.00 0.00 ? 12 GLN A HE21 11 
ATOM 9113  H HE22 . GLN A 1 12 ? -17.198 26.375 24.962 1.00 0.00 ? 12 GLN A HE22 11 
ATOM 9114  N N    . ALA A 1 13 ? -11.402 25.017 24.052 1.00 0.00 ? 13 ALA A N    11 
ATOM 9115  C CA   . ALA A 1 13 ? -10.615 25.981 24.868 1.00 0.00 ? 13 ALA A CA   11 
ATOM 9116  C C    . ALA A 1 13 ? -9.353  26.394 24.107 1.00 0.00 ? 13 ALA A C    11 
ATOM 9117  O O    . ALA A 1 13 ? -8.737  27.398 24.406 1.00 0.00 ? 13 ALA A O    11 
ATOM 9118  C CB   . ALA A 1 13 ? -10.250 25.222 26.144 1.00 0.00 ? 13 ALA A CB   11 
ATOM 9119  H H    . ALA A 1 13 ? -11.552 24.105 24.380 1.00 0.00 ? 13 ALA A H    11 
ATOM 9120  H HA   . ALA A 1 13 ? -11.211 26.847 25.110 1.00 0.00 ? 13 ALA A HA   11 
ATOM 9121  H HB1  . ALA A 1 13 ? -9.399  25.693 26.613 1.00 0.00 ? 13 ALA A HB1  11 
ATOM 9122  H HB2  . ALA A 1 13 ? -11.090 25.237 26.823 1.00 0.00 ? 13 ALA A HB2  11 
ATOM 9123  H HB3  . ALA A 1 13 ? -10.006 24.199 25.897 1.00 0.00 ? 13 ALA A HB3  11 
ATOM 9124  N N    . PHE A 1 14 ? -8.962  25.629 23.122 1.00 0.00 ? 14 PHE A N    11 
ATOM 9125  C CA   . PHE A 1 14 ? -7.743  25.984 22.346 1.00 0.00 ? 14 PHE A CA   11 
ATOM 9126  C C    . PHE A 1 14 ? -8.108  26.888 21.167 1.00 0.00 ? 14 PHE A C    11 
ATOM 9127  O O    . PHE A 1 14 ? -7.341  27.051 20.239 1.00 0.00 ? 14 PHE A O    11 
ATOM 9128  C CB   . PHE A 1 14 ? -7.195  24.648 21.844 1.00 0.00 ? 14 PHE A CB   11 
ATOM 9129  C CG   . PHE A 1 14 ? -6.924  23.726 23.011 1.00 0.00 ? 14 PHE A CG   11 
ATOM 9130  C CD1  . PHE A 1 14 ? -6.830  24.236 24.313 1.00 0.00 ? 14 PHE A CD1  11 
ATOM 9131  C CD2  . PHE A 1 14 ? -6.770  22.354 22.788 1.00 0.00 ? 14 PHE A CD2  11 
ATOM 9132  C CE1  . PHE A 1 14 ? -6.583  23.374 25.387 1.00 0.00 ? 14 PHE A CE1  11 
ATOM 9133  C CE2  . PHE A 1 14 ? -6.521  21.491 23.859 1.00 0.00 ? 14 PHE A CE2  11 
ATOM 9134  C CZ   . PHE A 1 14 ? -6.428  22.000 25.160 1.00 0.00 ? 14 PHE A CZ   11 
ATOM 9135  H H    . PHE A 1 14 ? -9.470  24.819 22.891 1.00 0.00 ? 14 PHE A H    11 
ATOM 9136  H HA   . PHE A 1 14 ? -7.018  26.463 22.982 1.00 0.00 ? 14 PHE A HA   11 
ATOM 9137  H HB2  . PHE A 1 14 ? -7.916  24.190 21.184 1.00 0.00 ? 14 PHE A HB2  11 
ATOM 9138  H HB3  . PHE A 1 14 ? -6.278  24.821 21.305 1.00 0.00 ? 14 PHE A HB3  11 
ATOM 9139  H HD1  . PHE A 1 14 ? -6.951  25.295 24.488 1.00 0.00 ? 14 PHE A HD1  11 
ATOM 9140  H HD2  . PHE A 1 14 ? -6.841  21.961 21.786 1.00 0.00 ? 14 PHE A HD2  11 
ATOM 9141  H HE1  . PHE A 1 14 ? -6.510  23.767 26.391 1.00 0.00 ? 14 PHE A HE1  11 
ATOM 9142  H HE2  . PHE A 1 14 ? -6.402  20.433 23.682 1.00 0.00 ? 14 PHE A HE2  11 
ATOM 9143  H HZ   . PHE A 1 14 ? -6.236  21.334 25.989 1.00 0.00 ? 14 PHE A HZ   11 
ATOM 9144  N N    . MET A 1 15 ? -9.275  27.472 21.189 1.00 0.00 ? 15 MET A N    11 
ATOM 9145  C CA   . MET A 1 15 ? -9.683  28.359 20.068 1.00 0.00 ? 15 MET A CA   11 
ATOM 9146  C C    . MET A 1 15 ? -9.551  29.832 20.476 1.00 0.00 ? 15 MET A C    11 
ATOM 9147  O O    . MET A 1 15 ? -10.219 30.304 21.374 1.00 0.00 ? 15 MET A O    11 
ATOM 9148  C CB   . MET A 1 15 ? -11.144 27.991 19.803 1.00 0.00 ? 15 MET A CB   11 
ATOM 9149  C CG   . MET A 1 15 ? -12.038 28.587 20.892 1.00 0.00 ? 15 MET A CG   11 
ATOM 9150  S SD   . MET A 1 15 ? -13.618 27.705 20.928 1.00 0.00 ? 15 MET A SD   11 
ATOM 9151  C CE   . MET A 1 15 ? -14.256 28.315 19.349 1.00 0.00 ? 15 MET A CE   11 
ATOM 9152  H H    . MET A 1 15 ? -9.885  27.326 21.938 1.00 0.00 ? 15 MET A H    11 
ATOM 9153  H HA   . MET A 1 15 ? -9.089  28.155 19.192 1.00 0.00 ? 15 MET A HA   11 
ATOM 9154  H HB2  . MET A 1 15 ? -11.440 28.379 18.846 1.00 0.00 ? 15 MET A HB2  11 
ATOM 9155  H HB3  . MET A 1 15 ? -11.249 26.916 19.802 1.00 0.00 ? 15 MET A HB3  11 
ATOM 9156  H HG2  . MET A 1 15 ? -11.551 28.492 21.851 1.00 0.00 ? 15 MET A HG2  11 
ATOM 9157  H HG3  . MET A 1 15 ? -12.215 29.630 20.681 1.00 0.00 ? 15 MET A HG3  11 
ATOM 9158  H HE1  . MET A 1 15 ? -13.781 29.257 19.110 1.00 0.00 ? 15 MET A HE1  11 
ATOM 9159  H HE2  . MET A 1 15 ? -14.045 27.592 18.574 1.00 0.00 ? 15 MET A HE2  11 
ATOM 9160  H HE3  . MET A 1 15 ? -15.322 28.461 19.422 1.00 0.00 ? 15 MET A HE3  11 
ATOM 9161  N N    . LYS A 1 16 ? -8.690  30.564 19.821 1.00 0.00 ? 16 LYS A N    11 
ATOM 9162  C CA   . LYS A 1 16 ? -8.517  32.004 20.171 1.00 0.00 ? 16 LYS A CA   11 
ATOM 9163  C C    . LYS A 1 16 ? -9.417  32.870 19.287 1.00 0.00 ? 16 LYS A C    11 
ATOM 9164  O O    . LYS A 1 16 ? -9.011  33.342 18.244 1.00 0.00 ? 16 LYS A O    11 
ATOM 9165  C CB   . LYS A 1 16 ? -7.044  32.309 19.897 1.00 0.00 ? 16 LYS A CB   11 
ATOM 9166  C CG   . LYS A 1 16 ? -6.756  33.774 20.233 1.00 0.00 ? 16 LYS A CG   11 
ATOM 9167  C CD   . LYS A 1 16 ? -5.974  34.418 19.087 1.00 0.00 ? 16 LYS A CD   11 
ATOM 9168  C CE   . LYS A 1 16 ? -5.318  35.710 19.578 1.00 0.00 ? 16 LYS A CE   11 
ATOM 9169  N NZ   . LYS A 1 16 ? -4.336  36.067 18.518 1.00 0.00 ? 16 LYS A NZ   11 
ATOM 9170  H H    . LYS A 1 16 ? -8.158  30.167 19.101 1.00 0.00 ? 16 LYS A H    11 
ATOM 9171  H HA   . LYS A 1 16 ? -8.740  32.168 21.213 1.00 0.00 ? 16 LYS A HA   11 
ATOM 9172  H HB2  . LYS A 1 16 ? -6.423  31.672 20.508 1.00 0.00 ? 16 LYS A HB2  11 
ATOM 9173  H HB3  . LYS A 1 16 ? -6.826  32.131 18.855 1.00 0.00 ? 16 LYS A HB3  11 
ATOM 9174  H HG2  . LYS A 1 16 ? -7.689  34.300 20.373 1.00 0.00 ? 16 LYS A HG2  11 
ATOM 9175  H HG3  . LYS A 1 16 ? -6.174  33.827 21.142 1.00 0.00 ? 16 LYS A HG3  11 
ATOM 9176  H HD2  . LYS A 1 16 ? -5.209  33.735 18.745 1.00 0.00 ? 16 LYS A HD2  11 
ATOM 9177  H HD3  . LYS A 1 16 ? -6.646  34.641 18.273 1.00 0.00 ? 16 LYS A HD3  11 
ATOM 9178  H HE2  . LYS A 1 16 ? -6.058  36.490 19.683 1.00 0.00 ? 16 LYS A HE2  11 
ATOM 9179  H HE3  . LYS A 1 16 ? -4.813  35.543 20.518 1.00 0.00 ? 16 LYS A HE3  11 
ATOM 9180  H HZ1  . LYS A 1 16 ? -4.774  35.947 17.582 1.00 0.00 ? 16 LYS A HZ1  11 
ATOM 9181  H HZ2  . LYS A 1 16 ? -4.039  37.058 18.638 1.00 0.00 ? 16 LYS A HZ2  11 
ATOM 9182  H HZ3  . LYS A 1 16 ? -3.505  35.446 18.591 1.00 0.00 ? 16 LYS A HZ3  11 
ATOM 9183  N N    . ASN A 1 17 ? -10.637 33.080 19.697 1.00 0.00 ? 17 ASN A N    11 
ATOM 9184  C CA   . ASN A 1 17 ? -11.568 33.915 18.884 1.00 0.00 ? 17 ASN A CA   11 
ATOM 9185  C C    . ASN A 1 17 ? -11.731 33.321 17.482 1.00 0.00 ? 17 ASN A C    11 
ATOM 9186  O O    . ASN A 1 17 ? -11.558 33.995 16.487 1.00 0.00 ? 17 ASN A O    11 
ATOM 9187  C CB   . ASN A 1 17 ? -10.909 35.293 18.812 1.00 0.00 ? 17 ASN A CB   11 
ATOM 9188  C CG   . ASN A 1 17 ? -10.677 35.824 20.227 1.00 0.00 ? 17 ASN A CG   11 
ATOM 9189  O OD1  . ASN A 1 17 ? -11.556 35.766 21.062 1.00 0.00 ? 17 ASN A OD1  11 
ATOM 9190  N ND2  . ASN A 1 17 ? -9.520  36.344 20.532 1.00 0.00 ? 17 ASN A ND2  11 
ATOM 9191  H H    . ASN A 1 17 ? -10.943 32.689 20.541 1.00 0.00 ? 17 ASN A H    11 
ATOM 9192  H HA   . ASN A 1 17 ? -12.526 33.990 19.372 1.00 0.00 ? 17 ASN A HA   11 
ATOM 9193  H HB2  . ASN A 1 17 ? -9.963  35.213 18.300 1.00 0.00 ? 17 ASN A HB2  11 
ATOM 9194  H HB3  . ASN A 1 17 ? -11.553 35.972 18.273 1.00 0.00 ? 17 ASN A HB3  11 
ATOM 9195  H HD21 . ASN A 1 17 ? -8.811  36.391 19.857 1.00 0.00 ? 17 ASN A HD21 11 
ATOM 9196  H HD22 . ASN A 1 17 ? -9.361  36.688 21.435 1.00 0.00 ? 17 ASN A HD22 11 
ATOM 9197  N N    . GLY A 1 18 ? -12.072 32.065 17.398 1.00 0.00 ? 18 GLY A N    11 
ATOM 9198  C CA   . GLY A 1 18 ? -12.256 31.429 16.062 1.00 0.00 ? 18 GLY A CA   11 
ATOM 9199  C C    . GLY A 1 18 ? -10.936 30.815 15.588 1.00 0.00 ? 18 GLY A C    11 
ATOM 9200  O O    . GLY A 1 18 ? -10.907 30.025 14.664 1.00 0.00 ? 18 GLY A O    11 
ATOM 9201  H H    . GLY A 1 18 ? -12.213 31.541 18.214 1.00 0.00 ? 18 GLY A H    11 
ATOM 9202  H HA2  . GLY A 1 18 ? -13.007 30.656 16.134 1.00 0.00 ? 18 GLY A HA2  11 
ATOM 9203  H HA3  . GLY A 1 18 ? -12.579 32.175 15.351 1.00 0.00 ? 18 GLY A HA3  11 
ATOM 9204  N N    . LYS A 1 19 ? -9.843  31.168 16.207 1.00 0.00 ? 19 LYS A N    11 
ATOM 9205  C CA   . LYS A 1 19 ? -8.532  30.597 15.781 1.00 0.00 ? 19 LYS A CA   11 
ATOM 9206  C C    . LYS A 1 19 ? -8.193  29.359 16.613 1.00 0.00 ? 19 LYS A C    11 
ATOM 9207  O O    . LYS A 1 19 ? -7.810  29.457 17.761 1.00 0.00 ? 19 LYS A O    11 
ATOM 9208  C CB   . LYS A 1 19 ? -7.512  31.707 16.035 1.00 0.00 ? 19 LYS A CB   11 
ATOM 9209  C CG   . LYS A 1 19 ? -6.234  31.416 15.244 1.00 0.00 ? 19 LYS A CG   11 
ATOM 9210  C CD   . LYS A 1 19 ? -5.525  30.199 15.843 1.00 0.00 ? 19 LYS A CD   11 
ATOM 9211  C CE   . LYS A 1 19 ? -4.124  30.077 15.240 1.00 0.00 ? 19 LYS A CE   11 
ATOM 9212  N NZ   . LYS A 1 19 ? -4.327  29.364 13.948 1.00 0.00 ? 19 LYS A NZ   11 
ATOM 9213  H H    . LYS A 1 19 ? -9.883  31.806 16.950 1.00 0.00 ? 19 LYS A H    11 
ATOM 9214  H HA   . LYS A 1 19 ? -8.552  30.351 14.731 1.00 0.00 ? 19 LYS A HA   11 
ATOM 9215  H HB2  . LYS A 1 19 ? -7.924  32.654 15.719 1.00 0.00 ? 19 LYS A HB2  11 
ATOM 9216  H HB3  . LYS A 1 19 ? -7.281  31.748 17.089 1.00 0.00 ? 19 LYS A HB3  11 
ATOM 9217  H HG2  . LYS A 1 19 ? -6.487  31.215 14.213 1.00 0.00 ? 19 LYS A HG2  11 
ATOM 9218  H HG3  . LYS A 1 19 ? -5.579  32.274 15.292 1.00 0.00 ? 19 LYS A HG3  11 
ATOM 9219  H HD2  . LYS A 1 19 ? -5.448  30.317 16.914 1.00 0.00 ? 19 LYS A HD2  11 
ATOM 9220  H HD3  . LYS A 1 19 ? -6.089  29.306 15.617 1.00 0.00 ? 19 LYS A HD3  11 
ATOM 9221  H HE2  . LYS A 1 19 ? -3.702  31.056 15.068 1.00 0.00 ? 19 LYS A HE2  11 
ATOM 9222  H HE3  . LYS A 1 19 ? -3.483  29.500 15.892 1.00 0.00 ? 19 LYS A HE3  11 
ATOM 9223  H HZ1  . LYS A 1 19 ? -5.008  28.590 14.083 1.00 0.00 ? 19 LYS A HZ1  11 
ATOM 9224  H HZ2  . LYS A 1 19 ? -4.694  30.031 13.239 1.00 0.00 ? 19 LYS A HZ2  11 
ATOM 9225  H HZ3  . LYS A 1 19 ? -3.421  28.973 13.622 1.00 0.00 ? 19 LYS A HZ3  11 
ATOM 9226  N N    . LEU A 1 20 ? -8.324  28.194 16.042 1.00 0.00 ? 20 LEU A N    11 
ATOM 9227  C CA   . LEU A 1 20 ? -8.004  26.952 16.802 1.00 0.00 ? 20 LEU A CA   11 
ATOM 9228  C C    . LEU A 1 20 ? -6.511  26.635 16.687 1.00 0.00 ? 20 LEU A C    11 
ATOM 9229  O O    . LEU A 1 20 ? -6.024  26.271 15.634 1.00 0.00 ? 20 LEU A O    11 
ATOM 9230  C CB   . LEU A 1 20 ? -8.838  25.855 16.137 1.00 0.00 ? 20 LEU A CB   11 
ATOM 9231  C CG   . LEU A 1 20 ? -8.310  24.483 16.562 1.00 0.00 ? 20 LEU A CG   11 
ATOM 9232  C CD1  . LEU A 1 20 ? -8.551  24.285 18.059 1.00 0.00 ? 20 LEU A CD1  11 
ATOM 9233  C CD2  . LEU A 1 20 ? -9.042  23.389 15.780 1.00 0.00 ? 20 LEU A CD2  11 
ATOM 9234  H H    . LEU A 1 20 ? -8.631  28.136 15.113 1.00 0.00 ? 20 LEU A H    11 
ATOM 9235  H HA   . LEU A 1 20 ? -8.290  27.057 17.836 1.00 0.00 ? 20 LEU A HA   11 
ATOM 9236  H HB2  . LEU A 1 20 ? -9.870  25.954 16.439 1.00 0.00 ? 20 LEU A HB2  11 
ATOM 9237  H HB3  . LEU A 1 20 ? -8.766  25.951 15.063 1.00 0.00 ? 20 LEU A HB3  11 
ATOM 9238  H HG   . LEU A 1 20 ? -7.252  24.425 16.356 1.00 0.00 ? 20 LEU A HG   11 
ATOM 9239  H HD11 . LEU A 1 20 ? -9.580  24.516 18.293 1.00 0.00 ? 20 LEU A HD11 11 
ATOM 9240  H HD12 . LEU A 1 20 ? -8.342  23.259 18.326 1.00 0.00 ? 20 LEU A HD12 11 
ATOM 9241  H HD13 . LEU A 1 20 ? -7.900  24.941 18.618 1.00 0.00 ? 20 LEU A HD13 11 
ATOM 9242  H HD21 . LEU A 1 20 ? -9.169  23.704 14.754 1.00 0.00 ? 20 LEU A HD21 11 
ATOM 9243  H HD22 . LEU A 1 20 ? -8.462  22.478 15.807 1.00 0.00 ? 20 LEU A HD22 11 
ATOM 9244  H HD23 . LEU A 1 20 ? -10.010 23.213 16.225 1.00 0.00 ? 20 LEU A HD23 11 
ATOM 9245  N N    . PHE A 1 21 ? -5.777  26.763 17.761 1.00 0.00 ? 21 PHE A N    11 
ATOM 9246  C CA   . PHE A 1 21 ? -4.316  26.458 17.698 1.00 0.00 ? 21 PHE A CA   11 
ATOM 9247  C C    . PHE A 1 21 ? -4.047  25.051 18.239 1.00 0.00 ? 21 PHE A C    11 
ATOM 9248  O O    . PHE A 1 21 ? -3.462  24.876 19.289 1.00 0.00 ? 21 PHE A O    11 
ATOM 9249  C CB   . PHE A 1 21 ? -3.614  27.520 18.556 1.00 0.00 ? 21 PHE A CB   11 
ATOM 9250  C CG   . PHE A 1 21 ? -4.397  27.791 19.819 1.00 0.00 ? 21 PHE A CG   11 
ATOM 9251  C CD1  . PHE A 1 21 ? -4.202  26.992 20.954 1.00 0.00 ? 21 PHE A CD1  11 
ATOM 9252  C CD2  . PHE A 1 21 ? -5.314  28.848 19.858 1.00 0.00 ? 21 PHE A CD2  11 
ATOM 9253  C CE1  . PHE A 1 21 ? -4.924  27.252 22.125 1.00 0.00 ? 21 PHE A CE1  11 
ATOM 9254  C CE2  . PHE A 1 21 ? -6.036  29.107 21.030 1.00 0.00 ? 21 PHE A CE2  11 
ATOM 9255  C CZ   . PHE A 1 21 ? -5.841  28.308 22.162 1.00 0.00 ? 21 PHE A CZ   11 
ATOM 9256  H H    . PHE A 1 21 ? -6.188  27.050 18.602 1.00 0.00 ? 21 PHE A H    11 
ATOM 9257  H HA   . PHE A 1 21 ? -3.970  26.529 16.678 1.00 0.00 ? 21 PHE A HA   11 
ATOM 9258  H HB2  . PHE A 1 21 ? -2.627  27.169 18.818 1.00 0.00 ? 21 PHE A HB2  11 
ATOM 9259  H HB3  . PHE A 1 21 ? -3.527  28.435 17.988 1.00 0.00 ? 21 PHE A HB3  11 
ATOM 9260  H HD1  . PHE A 1 21 ? -3.495  26.178 20.925 1.00 0.00 ? 21 PHE A HD1  11 
ATOM 9261  H HD2  . PHE A 1 21 ? -5.464  29.465 18.984 1.00 0.00 ? 21 PHE A HD2  11 
ATOM 9262  H HE1  . PHE A 1 21 ? -4.773  26.636 22.999 1.00 0.00 ? 21 PHE A HE1  11 
ATOM 9263  H HE2  . PHE A 1 21 ? -6.744  29.921 21.059 1.00 0.00 ? 21 PHE A HE2  11 
ATOM 9264  H HZ   . PHE A 1 21 ? -6.398  28.508 23.066 1.00 0.00 ? 21 PHE A HZ   11 
ATOM 9265  N N    . CYS A 1 22 ? -4.470  24.049 17.520 1.00 0.00 ? 22 CYS A N    11 
ATOM 9266  C CA   . CYS A 1 22 ? -4.245  22.647 17.972 1.00 0.00 ? 22 CYS A CA   11 
ATOM 9267  C C    . CYS A 1 22 ? -2.777  22.417 18.369 1.00 0.00 ? 22 CYS A C    11 
ATOM 9268  O O    . CYS A 1 22 ? -2.511  21.858 19.414 1.00 0.00 ? 22 CYS A O    11 
ATOM 9269  C CB   . CYS A 1 22 ? -4.615  21.777 16.769 1.00 0.00 ? 22 CYS A CB   11 
ATOM 9270  S SG   . CYS A 1 22 ? -5.611  20.372 17.326 1.00 0.00 ? 22 CYS A SG   11 
ATOM 9271  H H    . CYS A 1 22 ? -4.936  24.220 16.674 1.00 0.00 ? 22 CYS A H    11 
ATOM 9272  H HA   . CYS A 1 22 ? -4.894  22.413 18.800 1.00 0.00 ? 22 CYS A HA   11 
ATOM 9273  H HB2  . CYS A 1 22 ? -5.182  22.364 16.062 1.00 0.00 ? 22 CYS A HB2  11 
ATOM 9274  H HB3  . CYS A 1 22 ? -3.715  21.414 16.296 1.00 0.00 ? 22 CYS A HB3  11 
ATOM 9275  N N    . PRO A 1 23 ? -1.862  22.840 17.525 1.00 0.00 ? 23 PRO A N    11 
ATOM 9276  C CA   . PRO A 1 23 ? -0.422  22.649 17.819 1.00 0.00 ? 23 PRO A CA   11 
ATOM 9277  C C    . PRO A 1 23 ? -0.022  23.394 19.096 1.00 0.00 ? 23 PRO A C    11 
ATOM 9278  O O    . PRO A 1 23 ? 0.640   24.411 19.055 1.00 0.00 ? 23 PRO A O    11 
ATOM 9279  C CB   . PRO A 1 23 ? 0.260   23.245 16.585 1.00 0.00 ? 23 PRO A CB   11 
ATOM 9280  C CG   . PRO A 1 23 ? -0.825  23.752 15.617 1.00 0.00 ? 23 PRO A CG   11 
ATOM 9281  C CD   . PRO A 1 23 ? -2.204  23.523 16.252 1.00 0.00 ? 23 PRO A CD   11 
ATOM 9282  H HA   . PRO A 1 23 ? -0.186  21.600 17.900 1.00 0.00 ? 23 PRO A HA   11 
ATOM 9283  H HB2  . PRO A 1 23 ? 0.892   24.068 16.883 1.00 0.00 ? 23 PRO A HB2  11 
ATOM 9284  H HB3  . PRO A 1 23 ? 0.856   22.487 16.098 1.00 0.00 ? 23 PRO A HB3  11 
ATOM 9285  H HG2  . PRO A 1 23 ? -0.682  24.806 15.432 1.00 0.00 ? 23 PRO A HG2  11 
ATOM 9286  H HG3  . PRO A 1 23 ? -0.762  23.208 14.685 1.00 0.00 ? 23 PRO A HG3  11 
ATOM 9287  H HD2  . PRO A 1 23 ? -2.687  24.468 16.439 1.00 0.00 ? 23 PRO A HD2  11 
ATOM 9288  H HD3  . PRO A 1 23 ? -2.816  22.892 15.626 1.00 0.00 ? 23 PRO A HD3  11 
ATOM 9289  N N    . GLN A 1 24 ? -0.415  22.883 20.231 1.00 0.00 ? 24 GLN A N    11 
ATOM 9290  C CA   . GLN A 1 24 ? -0.055  23.545 21.519 1.00 0.00 ? 24 GLN A CA   11 
ATOM 9291  C C    . GLN A 1 24 ? 0.972   22.686 22.263 1.00 0.00 ? 24 GLN A C    11 
ATOM 9292  O O    . GLN A 1 24 ? 1.937   23.182 22.811 1.00 0.00 ? 24 GLN A O    11 
ATOM 9293  C CB   . GLN A 1 24 ? -1.375  23.629 22.296 1.00 0.00 ? 24 GLN A CB   11 
ATOM 9294  C CG   . GLN A 1 24 ? -1.102  23.667 23.804 1.00 0.00 ? 24 GLN A CG   11 
ATOM 9295  C CD   . GLN A 1 24 ? -2.426  23.810 24.556 1.00 0.00 ? 24 GLN A CD   11 
ATOM 9296  O OE1  . GLN A 1 24 ? -2.679  24.822 25.179 1.00 0.00 ? 24 GLN A OE1  11 
ATOM 9297  N NE2  . GLN A 1 24 ? -3.285  22.830 24.524 1.00 0.00 ? 24 GLN A NE2  11 
ATOM 9298  H H    . GLN A 1 24 ? -0.942  22.057 20.238 1.00 0.00 ? 24 GLN A H    11 
ATOM 9299  H HA   . GLN A 1 24 ? 0.335   24.531 21.341 1.00 0.00 ? 24 GLN A HA   11 
ATOM 9300  H HB2  . GLN A 1 24 ? -1.904  24.526 22.006 1.00 0.00 ? 24 GLN A HB2  11 
ATOM 9301  H HB3  . GLN A 1 24 ? -1.983  22.767 22.065 1.00 0.00 ? 24 GLN A HB3  11 
ATOM 9302  H HG2  . GLN A 1 24 ? -0.615  22.751 24.104 1.00 0.00 ? 24 GLN A HG2  11 
ATOM 9303  H HG3  . GLN A 1 24 ? -0.464  24.506 24.034 1.00 0.00 ? 24 GLN A HG3  11 
ATOM 9304  H HE21 . GLN A 1 24 ? -3.080  22.014 24.022 1.00 0.00 ? 24 GLN A HE21 11 
ATOM 9305  H HE22 . GLN A 1 24 ? -4.137  22.908 25.003 1.00 0.00 ? 24 GLN A HE22 11 
ATOM 9306  N N    . ASP A 1 25 ? 0.764   21.402 22.278 1.00 0.00 ? 25 ASP A N    11 
ATOM 9307  C CA   . ASP A 1 25 ? 1.713   20.490 22.976 1.00 0.00 ? 25 ASP A CA   11 
ATOM 9308  C C    . ASP A 1 25 ? 1.345   19.037 22.666 1.00 0.00 ? 25 ASP A C    11 
ATOM 9309  O O    . ASP A 1 25 ? 1.020   18.265 23.546 1.00 0.00 ? 25 ASP A O    11 
ATOM 9310  C CB   . ASP A 1 25 ? 1.529   20.791 24.463 1.00 0.00 ? 25 ASP A CB   11 
ATOM 9311  C CG   . ASP A 1 25 ? 2.504   19.942 25.283 1.00 0.00 ? 25 ASP A CG   11 
ATOM 9312  O OD1  . ASP A 1 25 ? 3.408   19.375 24.691 1.00 0.00 ? 25 ASP A OD1  11 
ATOM 9313  O OD2  . ASP A 1 25 ? 2.332   19.874 26.488 1.00 0.00 ? 25 ASP A OD2  11 
ATOM 9314  H H    . ASP A 1 25 ? -0.022  21.034 21.826 1.00 0.00 ? 25 ASP A H    11 
ATOM 9315  H HA   . ASP A 1 25 ? 2.728   20.698 22.677 1.00 0.00 ? 25 ASP A HA   11 
ATOM 9316  H HB2  . ASP A 1 25 ? 1.724   21.838 24.645 1.00 0.00 ? 25 ASP A HB2  11 
ATOM 9317  H HB3  . ASP A 1 25 ? 0.516   20.558 24.755 1.00 0.00 ? 25 ASP A HB3  11 
ATOM 9318  N N    . LYS A 1 26 ? 1.386   18.665 21.415 1.00 0.00 ? 26 LYS A N    11 
ATOM 9319  C CA   . LYS A 1 26 ? 1.028   17.267 21.033 1.00 0.00 ? 26 LYS A CA   11 
ATOM 9320  C C    . LYS A 1 26 ? 1.876   16.254 21.811 1.00 0.00 ? 26 LYS A C    11 
ATOM 9321  O O    . LYS A 1 26 ? 1.561   15.082 21.855 1.00 0.00 ? 26 LYS A O    11 
ATOM 9322  C CB   . LYS A 1 26 ? 1.327   17.179 19.536 1.00 0.00 ? 26 LYS A CB   11 
ATOM 9323  C CG   . LYS A 1 26 ? 0.174   17.805 18.749 1.00 0.00 ? 26 LYS A CG   11 
ATOM 9324  C CD   . LYS A 1 26 ? 0.532   17.846 17.263 1.00 0.00 ? 26 LYS A CD   11 
ATOM 9325  C CE   . LYS A 1 26 ? -0.465  18.737 16.521 1.00 0.00 ? 26 LYS A CE   11 
ATOM 9326  N NZ   . LYS A 1 26 ? 0.021   18.764 15.113 1.00 0.00 ? 26 LYS A NZ   11 
ATOM 9327  H H    . LYS A 1 26 ? 1.645   19.308 20.723 1.00 0.00 ? 26 LYS A H    11 
ATOM 9328  H HA   . LYS A 1 26 ? -0.020  17.089 21.207 1.00 0.00 ? 26 LYS A HA   11 
ATOM 9329  H HB2  . LYS A 1 26 ? 2.241   17.709 19.319 1.00 0.00 ? 26 LYS A HB2  11 
ATOM 9330  H HB3  . LYS A 1 26 ? 1.436   16.142 19.251 1.00 0.00 ? 26 LYS A HB3  11 
ATOM 9331  H HG2  . LYS A 1 26 ? -0.720  17.214 18.888 1.00 0.00 ? 26 LYS A HG2  11 
ATOM 9332  H HG3  . LYS A 1 26 ? 0.000   18.810 19.105 1.00 0.00 ? 26 LYS A HG3  11 
ATOM 9333  H HD2  . LYS A 1 26 ? 1.530   18.244 17.143 1.00 0.00 ? 26 LYS A HD2  11 
ATOM 9334  H HD3  . LYS A 1 26 ? 0.494   16.846 16.855 1.00 0.00 ? 26 LYS A HD3  11 
ATOM 9335  H HE2  . LYS A 1 26 ? -1.457  18.312 16.568 1.00 0.00 ? 26 LYS A HE2  11 
ATOM 9336  H HE3  . LYS A 1 26 ? -0.462  19.733 16.939 1.00 0.00 ? 26 LYS A HE3  11 
ATOM 9337  H HZ1  . LYS A 1 26 ? 1.060   18.773 15.104 1.00 0.00 ? 26 LYS A HZ1  11 
ATOM 9338  H HZ2  . LYS A 1 26 ? -0.321  17.920 14.611 1.00 0.00 ? 26 LYS A HZ2  11 
ATOM 9339  H HZ3  . LYS A 1 26 ? -0.338  19.619 14.639 1.00 0.00 ? 26 LYS A HZ3  11 
ATOM 9340  N N    . LYS A 1 27 ? 2.943   16.693 22.423 1.00 0.00 ? 27 LYS A N    11 
ATOM 9341  C CA   . LYS A 1 27 ? 3.801   15.751 23.196 1.00 0.00 ? 27 LYS A CA   11 
ATOM 9342  C C    . LYS A 1 27 ? 2.933   14.768 23.986 1.00 0.00 ? 27 LYS A C    11 
ATOM 9343  O O    . LYS A 1 27 ? 3.334   13.657 24.267 1.00 0.00 ? 27 LYS A O    11 
ATOM 9344  C CB   . LYS A 1 27 ? 4.603   16.641 24.143 1.00 0.00 ? 27 LYS A CB   11 
ATOM 9345  C CG   . LYS A 1 27 ? 5.651   17.419 23.345 1.00 0.00 ? 27 LYS A CG   11 
ATOM 9346  C CD   . LYS A 1 27 ? 6.569   18.172 24.310 1.00 0.00 ? 27 LYS A CD   11 
ATOM 9347  C CE   . LYS A 1 27 ? 7.655   18.902 23.518 1.00 0.00 ? 27 LYS A CE   11 
ATOM 9348  N NZ   . LYS A 1 27 ? 8.373   19.726 24.530 1.00 0.00 ? 27 LYS A NZ   11 
ATOM 9349  H H    . LYS A 1 27 ? 3.182   17.641 22.375 1.00 0.00 ? 27 LYS A H    11 
ATOM 9350  H HA   . LYS A 1 27 ? 4.469   15.220 22.537 1.00 0.00 ? 27 LYS A HA   11 
ATOM 9351  H HB2  . LYS A 1 27 ? 3.937   17.334 24.636 1.00 0.00 ? 27 LYS A HB2  11 
ATOM 9352  H HB3  . LYS A 1 27 ? 5.094   16.029 24.882 1.00 0.00 ? 27 LYS A HB3  11 
ATOM 9353  H HG2  . LYS A 1 27 ? 6.236   16.731 22.754 1.00 0.00 ? 27 LYS A HG2  11 
ATOM 9354  H HG3  . LYS A 1 27 ? 5.157   18.124 22.694 1.00 0.00 ? 27 LYS A HG3  11 
ATOM 9355  H HD2  . LYS A 1 27 ? 5.989   18.890 24.872 1.00 0.00 ? 27 LYS A HD2  11 
ATOM 9356  H HD3  . LYS A 1 27 ? 7.029   17.470 24.990 1.00 0.00 ? 27 LYS A HD3  11 
ATOM 9357  H HE2  . LYS A 1 27 ? 8.329   18.192 23.063 1.00 0.00 ? 27 LYS A HE2  11 
ATOM 9358  H HE3  . LYS A 1 27 ? 7.209   19.535 22.765 1.00 0.00 ? 27 LYS A HE3  11 
ATOM 9359  H HZ1  . LYS A 1 27 ? 8.660   19.124 25.327 1.00 0.00 ? 27 LYS A HZ1  11 
ATOM 9360  H HZ2  . LYS A 1 27 ? 9.217   20.150 24.093 1.00 0.00 ? 27 LYS A HZ2  11 
ATOM 9361  H HZ3  . LYS A 1 27 ? 7.744   20.478 24.875 1.00 0.00 ? 27 LYS A HZ3  11 
ATOM 9362  N N    . PHE A 1 28 ? 1.742   15.168 24.341 1.00 0.00 ? 28 PHE A N    11 
ATOM 9363  C CA   . PHE A 1 28 ? 0.846   14.255 25.104 1.00 0.00 ? 28 PHE A CA   11 
ATOM 9364  C C    . PHE A 1 28 ? 0.767   12.895 24.403 1.00 0.00 ? 28 PHE A C    11 
ATOM 9365  O O    . PHE A 1 28 ? 0.525   11.877 25.022 1.00 0.00 ? 28 PHE A O    11 
ATOM 9366  C CB   . PHE A 1 28 ? -0.520  14.943 25.096 1.00 0.00 ? 28 PHE A CB   11 
ATOM 9367  C CG   . PHE A 1 28 ? -0.371  16.374 25.557 1.00 0.00 ? 28 PHE A CG   11 
ATOM 9368  C CD1  . PHE A 1 28 ? 0.414   16.670 26.679 1.00 0.00 ? 28 PHE A CD1  11 
ATOM 9369  C CD2  . PHE A 1 28 ? -1.015  17.405 24.861 1.00 0.00 ? 28 PHE A CD2  11 
ATOM 9370  C CE1  . PHE A 1 28 ? 0.552   17.997 27.105 1.00 0.00 ? 28 PHE A CE1  11 
ATOM 9371  C CE2  . PHE A 1 28 ? -0.875  18.733 25.287 1.00 0.00 ? 28 PHE A CE2  11 
ATOM 9372  C CZ   . PHE A 1 28 ? -0.092  19.027 26.410 1.00 0.00 ? 28 PHE A CZ   11 
ATOM 9373  H H    . PHE A 1 28 ? 1.433   16.067 24.100 1.00 0.00 ? 28 PHE A H    11 
ATOM 9374  H HA   . PHE A 1 28 ? 1.197   14.140 26.118 1.00 0.00 ? 28 PHE A HA   11 
ATOM 9375  H HB2  . PHE A 1 28 ? -0.925  14.929 24.095 1.00 0.00 ? 28 PHE A HB2  11 
ATOM 9376  H HB3  . PHE A 1 28 ? -1.191  14.420 25.761 1.00 0.00 ? 28 PHE A HB3  11 
ATOM 9377  H HD1  . PHE A 1 28 ? 0.910   15.876 27.216 1.00 0.00 ? 28 PHE A HD1  11 
ATOM 9378  H HD2  . PHE A 1 28 ? -1.620  17.177 23.997 1.00 0.00 ? 28 PHE A HD2  11 
ATOM 9379  H HE1  . PHE A 1 28 ? 1.156   18.226 27.970 1.00 0.00 ? 28 PHE A HE1  11 
ATOM 9380  H HE2  . PHE A 1 28 ? -1.372  19.529 24.752 1.00 0.00 ? 28 PHE A HE2  11 
ATOM 9381  H HZ   . PHE A 1 28 ? 0.016   20.051 26.738 1.00 0.00 ? 28 PHE A HZ   11 
ATOM 9382  N N    . PHE A 1 29 ? 0.969   12.874 23.114 1.00 0.00 ? 29 PHE A N    11 
ATOM 9383  C CA   . PHE A 1 29 ? 0.907   11.587 22.359 1.00 0.00 ? 29 PHE A CA   11 
ATOM 9384  C C    . PHE A 1 29 ? 1.627   10.475 23.129 1.00 0.00 ? 29 PHE A C    11 
ATOM 9385  O O    . PHE A 1 29 ? 1.335   9.307  22.967 1.00 0.00 ? 29 PHE A O    11 
ATOM 9386  C CB   . PHE A 1 29 ? 1.627   11.873 21.040 1.00 0.00 ? 29 PHE A CB   11 
ATOM 9387  C CG   . PHE A 1 29 ? 1.394   10.734 20.076 1.00 0.00 ? 29 PHE A CG   11 
ATOM 9388  C CD1  . PHE A 1 29 ? 0.193   10.658 19.361 1.00 0.00 ? 29 PHE A CD1  11 
ATOM 9389  C CD2  . PHE A 1 29 ? 2.381   9.758  19.894 1.00 0.00 ? 29 PHE A CD2  11 
ATOM 9390  C CE1  . PHE A 1 29 ? -0.022  9.605  18.465 1.00 0.00 ? 29 PHE A CE1  11 
ATOM 9391  C CE2  . PHE A 1 29 ? 2.165   8.704  18.997 1.00 0.00 ? 29 PHE A CE2  11 
ATOM 9392  C CZ   . PHE A 1 29 ? 0.964   8.627  18.282 1.00 0.00 ? 29 PHE A CZ   11 
ATOM 9393  H H    . PHE A 1 29 ? 1.162   13.709 22.638 1.00 0.00 ? 29 PHE A H    11 
ATOM 9394  H HA   . PHE A 1 29 ? -0.117  11.311 22.167 1.00 0.00 ? 29 PHE A HA   11 
ATOM 9395  H HB2  . PHE A 1 29 ? 1.245   12.789 20.615 1.00 0.00 ? 29 PHE A HB2  11 
ATOM 9396  H HB3  . PHE A 1 29 ? 2.686   11.977 21.225 1.00 0.00 ? 29 PHE A HB3  11 
ATOM 9397  H HD1  . PHE A 1 29 ? -0.567  11.411 19.502 1.00 0.00 ? 29 PHE A HD1  11 
ATOM 9398  H HD2  . PHE A 1 29 ? 3.308   9.816  20.446 1.00 0.00 ? 29 PHE A HD2  11 
ATOM 9399  H HE1  . PHE A 1 29 ? -0.949  9.546  17.913 1.00 0.00 ? 29 PHE A HE1  11 
ATOM 9400  H HE2  . PHE A 1 29 ? 2.926   7.951  18.857 1.00 0.00 ? 29 PHE A HE2  11 
ATOM 9401  H HZ   . PHE A 1 29 ? 0.798   7.815  17.590 1.00 0.00 ? 29 PHE A HZ   11 
ATOM 9402  N N    . GLN A 1 30 ? 2.566   10.830 23.962 1.00 0.00 ? 30 GLN A N    11 
ATOM 9403  C CA   . GLN A 1 30 ? 3.308   9.793  24.735 1.00 0.00 ? 30 GLN A CA   11 
ATOM 9404  C C    . GLN A 1 30 ? 2.372   9.078  25.716 1.00 0.00 ? 30 GLN A C    11 
ATOM 9405  O O    . GLN A 1 30 ? 2.747   8.110  26.348 1.00 0.00 ? 30 GLN A O    11 
ATOM 9406  C CB   . GLN A 1 30 ? 4.390   10.566 25.492 1.00 0.00 ? 30 GLN A CB   11 
ATOM 9407  C CG   . GLN A 1 30 ? 5.418   11.111 24.500 1.00 0.00 ? 30 GLN A CG   11 
ATOM 9408  C CD   . GLN A 1 30 ? 6.725   11.416 25.234 1.00 0.00 ? 30 GLN A CD   11 
ATOM 9409  O OE1  . GLN A 1 30 ? 7.274   10.562 25.901 1.00 0.00 ? 30 GLN A OE1  11 
ATOM 9410  N NE2  . GLN A 1 30 ? 7.249   12.607 25.140 1.00 0.00 ? 30 GLN A NE2  11 
ATOM 9411  H H    . GLN A 1 30 ? 2.789   11.776 24.074 1.00 0.00 ? 30 GLN A H    11 
ATOM 9412  H HA   . GLN A 1 30 ? 3.767   9.082  24.067 1.00 0.00 ? 30 GLN A HA   11 
ATOM 9413  H HB2  . GLN A 1 30 ? 3.936   11.386 26.029 1.00 0.00 ? 30 GLN A HB2  11 
ATOM 9414  H HB3  . GLN A 1 30 ? 4.880   9.905  26.192 1.00 0.00 ? 30 GLN A HB3  11 
ATOM 9415  H HG2  . GLN A 1 30 ? 5.602   10.376 23.730 1.00 0.00 ? 30 GLN A HG2  11 
ATOM 9416  H HG3  . GLN A 1 30 ? 5.040   12.017 24.050 1.00 0.00 ? 30 GLN A HG3  11 
ATOM 9417  H HE21 . GLN A 1 30 ? 6.806   13.297 24.603 1.00 0.00 ? 30 GLN A HE21 11 
ATOM 9418  H HE22 . GLN A 1 30 ? 8.084   12.813 25.607 1.00 0.00 ? 30 GLN A HE22 11 
ATOM 9419  N N    . SER A 1 31 ? 1.159   9.542  25.849 1.00 0.00 ? 31 SER A N    11 
ATOM 9420  C CA   . SER A 1 31 ? 0.211   8.880  26.793 1.00 0.00 ? 31 SER A CA   11 
ATOM 9421  C C    . SER A 1 31 ? -1.109  8.568  26.083 1.00 0.00 ? 31 SER A C    11 
ATOM 9422  O O    . SER A 1 31 ? -1.377  9.060  25.006 1.00 0.00 ? 31 SER A O    11 
ATOM 9423  C CB   . SER A 1 31 ? -0.010  9.897  27.913 1.00 0.00 ? 31 SER A CB   11 
ATOM 9424  O OG   . SER A 1 31 ? 1.224   10.157 28.567 1.00 0.00 ? 31 SER A OG   11 
ATOM 9425  H H    . SER A 1 31 ? 0.872   10.324 25.332 1.00 0.00 ? 31 SER A H    11 
ATOM 9426  H HA   . SER A 1 31 ? 0.647   7.979  27.193 1.00 0.00 ? 31 SER A HA   11 
ATOM 9427  H HB2  . SER A 1 31 ? -0.396  10.815 27.495 1.00 0.00 ? 31 SER A HB2  11 
ATOM 9428  H HB3  . SER A 1 31 ? -0.718  9.499  28.625 1.00 0.00 ? 31 SER A HB3  11 
ATOM 9429  H HG   . SER A 1 31 ? 1.133   9.894  29.485 1.00 0.00 ? 31 SER A HG   11 
ATOM 9430  N N    . LEU A 1 32 ? -1.937  7.754  26.681 1.00 0.00 ? 32 LEU A N    11 
ATOM 9431  C CA   . LEU A 1 32 ? -3.238  7.414  26.038 1.00 0.00 ? 32 LEU A CA   11 
ATOM 9432  C C    . LEU A 1 32 ? -4.074  8.676  25.842 1.00 0.00 ? 32 LEU A C    11 
ATOM 9433  O O    . LEU A 1 32 ? -4.504  8.986  24.748 1.00 0.00 ? 32 LEU A O    11 
ATOM 9434  C CB   . LEU A 1 32 ? -3.930  6.462  27.010 1.00 0.00 ? 32 LEU A CB   11 
ATOM 9435  C CG   . LEU A 1 32 ? -4.764  5.451  26.222 1.00 0.00 ? 32 LEU A CG   11 
ATOM 9436  C CD1  . LEU A 1 32 ? -5.106  4.260  27.120 1.00 0.00 ? 32 LEU A CD1  11 
ATOM 9437  C CD2  . LEU A 1 32 ? -6.056  6.121  25.745 1.00 0.00 ? 32 LEU A CD2  11 
ATOM 9438  H H    . LEU A 1 32 ? -1.703  7.367  27.550 1.00 0.00 ? 32 LEU A H    11 
ATOM 9439  H HA   . LEU A 1 32 ? -3.075  6.922  25.095 1.00 0.00 ? 32 LEU A HA   11 
ATOM 9440  H HB2  . LEU A 1 32 ? -3.187  5.939  27.594 1.00 0.00 ? 32 LEU A HB2  11 
ATOM 9441  H HB3  . LEU A 1 32 ? -4.574  7.027  27.668 1.00 0.00 ? 32 LEU A HB3  11 
ATOM 9442  H HG   . LEU A 1 32 ? -4.201  5.108  25.367 1.00 0.00 ? 32 LEU A HG   11 
ATOM 9443  H HD11 . LEU A 1 32 ? -4.194  3.826  27.502 1.00 0.00 ? 32 LEU A HD11 11 
ATOM 9444  H HD12 . LEU A 1 32 ? -5.720  4.594  27.944 1.00 0.00 ? 32 LEU A HD12 11 
ATOM 9445  H HD13 . LEU A 1 32 ? -5.645  3.520  26.546 1.00 0.00 ? 32 LEU A HD13 11 
ATOM 9446  H HD21 . LEU A 1 32 ? -6.558  6.575  26.586 1.00 0.00 ? 32 LEU A HD21 11 
ATOM 9447  H HD22 . LEU A 1 32 ? -5.819  6.882  25.014 1.00 0.00 ? 32 LEU A HD22 11 
ATOM 9448  H HD23 . LEU A 1 32 ? -6.702  5.380  25.297 1.00 0.00 ? 32 LEU A HD23 11 
ATOM 9449  N N    . ASP A 1 33 ? -4.302  9.412  26.892 1.00 0.00 ? 33 ASP A N    11 
ATOM 9450  C CA   . ASP A 1 33 ? -5.103  10.659 26.758 1.00 0.00 ? 33 ASP A CA   11 
ATOM 9451  C C    . ASP A 1 33 ? -4.499  11.517 25.652 1.00 0.00 ? 33 ASP A C    11 
ATOM 9452  O O    . ASP A 1 33 ? -5.198  12.156 24.891 1.00 0.00 ? 33 ASP A O    11 
ATOM 9453  C CB   . ASP A 1 33 ? -4.991  11.360 28.112 1.00 0.00 ? 33 ASP A CB   11 
ATOM 9454  C CG   . ASP A 1 33 ? -5.710  10.531 29.178 1.00 0.00 ? 33 ASP A CG   11 
ATOM 9455  O OD1  . ASP A 1 33 ? -6.561  9.739  28.809 1.00 0.00 ? 33 ASP A OD1  11 
ATOM 9456  O OD2  . ASP A 1 33 ? -5.399  10.704 30.345 1.00 0.00 ? 33 ASP A OD2  11 
ATOM 9457  H H    . ASP A 1 33 ? -3.939  9.150  27.760 1.00 0.00 ? 33 ASP A H    11 
ATOM 9458  H HA   . ASP A 1 33 ? -6.132  10.427 26.537 1.00 0.00 ? 33 ASP A HA   11 
ATOM 9459  H HB2  . ASP A 1 33 ? -3.950  11.464 28.379 1.00 0.00 ? 33 ASP A HB2  11 
ATOM 9460  H HB3  . ASP A 1 33 ? -5.445  12.339 28.049 1.00 0.00 ? 33 ASP A HB3  11 
ATOM 9461  N N    . GLY A 1 34 ? -3.202  11.514 25.547 1.00 0.00 ? 34 GLY A N    11 
ATOM 9462  C CA   . GLY A 1 34 ? -2.545  12.306 24.477 1.00 0.00 ? 34 GLY A CA   11 
ATOM 9463  C C    . GLY A 1 34 ? -2.791  11.602 23.146 1.00 0.00 ? 34 GLY A C    11 
ATOM 9464  O O    . GLY A 1 34 ? -3.158  12.208 22.162 1.00 0.00 ? 34 GLY A O    11 
ATOM 9465  H H    . GLY A 1 34 ? -2.661  10.975 26.164 1.00 0.00 ? 34 GLY A H    11 
ATOM 9466  H HA2  . GLY A 1 34 ? -2.968  13.296 24.446 1.00 0.00 ? 34 GLY A HA2  11 
ATOM 9467  H HA3  . GLY A 1 34 ? -1.487  12.368 24.667 1.00 0.00 ? 34 GLY A HA3  11 
ATOM 9468  N N    . ILE A 1 35 ? -2.609  10.313 23.116 1.00 0.00 ? 35 ILE A N    11 
ATOM 9469  C CA   . ILE A 1 35 ? -2.853  9.566  21.856 1.00 0.00 ? 35 ILE A CA   11 
ATOM 9470  C C    . ILE A 1 35 ? -4.276  9.852  21.376 1.00 0.00 ? 35 ILE A C    11 
ATOM 9471  O O    . ILE A 1 35 ? -4.541  9.927  20.193 1.00 0.00 ? 35 ILE A O    11 
ATOM 9472  C CB   . ILE A 1 35 ? -2.672  8.088  22.224 1.00 0.00 ? 35 ILE A CB   11 
ATOM 9473  C CG1  . ILE A 1 35 ? -1.196  7.716  22.082 1.00 0.00 ? 35 ILE A CG1  11 
ATOM 9474  C CG2  . ILE A 1 35 ? -3.505  7.203  21.291 1.00 0.00 ? 35 ILE A CG2  11 
ATOM 9475  C CD1  . ILE A 1 35 ? -0.743  7.989  20.646 1.00 0.00 ? 35 ILE A CD1  11 
ATOM 9476  H H    . ILE A 1 35 ? -2.326  9.840  23.925 1.00 0.00 ? 35 ILE A H    11 
ATOM 9477  H HA   . ILE A 1 35 ? -2.137  9.854  21.103 1.00 0.00 ? 35 ILE A HA   11 
ATOM 9478  H HB   . ILE A 1 35 ? -2.986  7.931  23.245 1.00 0.00 ? 35 ILE A HB   11 
ATOM 9479  H HG12 . ILE A 1 35 ? -0.606  8.308  22.766 1.00 0.00 ? 35 ILE A HG12 11 
ATOM 9480  H HG13 . ILE A 1 35 ? -1.066  6.667  22.308 1.00 0.00 ? 35 ILE A HG13 11 
ATOM 9481  H HG21 . ILE A 1 35 ? -3.243  7.416  20.264 1.00 0.00 ? 35 ILE A HG21 11 
ATOM 9482  H HG22 . ILE A 1 35 ? -3.303  6.163  21.505 1.00 0.00 ? 35 ILE A HG22 11 
ATOM 9483  H HG23 . ILE A 1 35 ? -4.555  7.405  21.444 1.00 0.00 ? 35 ILE A HG23 11 
ATOM 9484  H HD11 . ILE A 1 35 ? -1.565  8.406  20.082 1.00 0.00 ? 35 ILE A HD11 11 
ATOM 9485  H HD12 . ILE A 1 35 ? 0.079   8.690  20.656 1.00 0.00 ? 35 ILE A HD12 11 
ATOM 9486  H HD13 . ILE A 1 35 ? -0.423  7.065  20.188 1.00 0.00 ? 35 ILE A HD13 11 
ATOM 9487  N N    . MET A 1 36 ? -5.192  10.020 22.290 1.00 0.00 ? 36 MET A N    11 
ATOM 9488  C CA   . MET A 1 36 ? -6.594  10.309 21.882 1.00 0.00 ? 36 MET A CA   11 
ATOM 9489  C C    . MET A 1 36 ? -6.721  11.762 21.424 1.00 0.00 ? 36 MET A C    11 
ATOM 9490  O O    . MET A 1 36 ? -7.006  12.034 20.274 1.00 0.00 ? 36 MET A O    11 
ATOM 9491  C CB   . MET A 1 36 ? -7.433  10.082 23.132 1.00 0.00 ? 36 MET A CB   11 
ATOM 9492  C CG   . MET A 1 36 ? -8.078  8.697  23.068 1.00 0.00 ? 36 MET A CG   11 
ATOM 9493  S SD   . MET A 1 36 ? -8.961  8.369  24.612 1.00 0.00 ? 36 MET A SD   11 
ATOM 9494  C CE   . MET A 1 36 ? -10.630 8.672  23.983 1.00 0.00 ? 36 MET A CE   11 
ATOM 9495  H H    . MET A 1 36 ? -4.955  9.959  23.243 1.00 0.00 ? 36 MET A H    11 
ATOM 9496  H HA   . MET A 1 36 ? -6.907  9.636  21.100 1.00 0.00 ? 36 MET A HA   11 
ATOM 9497  H HB2  . MET A 1 36 ? -6.804  10.148 24.009 1.00 0.00 ? 36 MET A HB2  11 
ATOM 9498  H HB3  . MET A 1 36 ? -8.202  10.838 23.181 1.00 0.00 ? 36 MET A HB3  11 
ATOM 9499  H HG2  . MET A 1 36 ? -8.773  8.662  22.241 1.00 0.00 ? 36 MET A HG2  11 
ATOM 9500  H HG3  . MET A 1 36 ? -7.311  7.950  22.925 1.00 0.00 ? 36 MET A HG3  11 
ATOM 9501  H HE1  . MET A 1 36 ? -10.649 8.498  22.916 1.00 0.00 ? 36 MET A HE1  11 
ATOM 9502  H HE2  . MET A 1 36 ? -11.326 8.006  24.474 1.00 0.00 ? 36 MET A HE2  11 
ATOM 9503  H HE3  . MET A 1 36 ? -10.912 9.694  24.183 1.00 0.00 ? 36 MET A HE3  11 
ATOM 9504  N N    . PHE A 1 37 ? -6.517  12.698 22.311 1.00 0.00 ? 37 PHE A N    11 
ATOM 9505  C CA   . PHE A 1 37 ? -6.631  14.126 21.908 1.00 0.00 ? 37 PHE A CA   11 
ATOM 9506  C C    . PHE A 1 37 ? -5.870  14.339 20.591 1.00 0.00 ? 37 PHE A C    11 
ATOM 9507  O O    . PHE A 1 37 ? -6.395  14.898 19.650 1.00 0.00 ? 37 PHE A O    11 
ATOM 9508  C CB   . PHE A 1 37 ? -6.047  14.930 23.092 1.00 0.00 ? 37 PHE A CB   11 
ATOM 9509  C CG   . PHE A 1 37 ? -4.855  15.758 22.666 1.00 0.00 ? 37 PHE A CG   11 
ATOM 9510  C CD1  . PHE A 1 37 ? -3.588  15.174 22.598 1.00 0.00 ? 37 PHE A CD1  11 
ATOM 9511  C CD2  . PHE A 1 37 ? -5.022  17.106 22.333 1.00 0.00 ? 37 PHE A CD2  11 
ATOM 9512  C CE1  . PHE A 1 37 ? -2.487  15.934 22.196 1.00 0.00 ? 37 PHE A CE1  11 
ATOM 9513  C CE2  . PHE A 1 37 ? -3.921  17.867 21.926 1.00 0.00 ? 37 PHE A CE2  11 
ATOM 9514  C CZ   . PHE A 1 37 ? -2.654  17.279 21.859 1.00 0.00 ? 37 PHE A CZ   11 
ATOM 9515  H H    . PHE A 1 37 ? -6.288  12.463 23.235 1.00 0.00 ? 37 PHE A H    11 
ATOM 9516  H HA   . PHE A 1 37 ? -7.672  14.383 21.773 1.00 0.00 ? 37 PHE A HA   11 
ATOM 9517  H HB2  . PHE A 1 37 ? -6.813  15.589 23.478 1.00 0.00 ? 37 PHE A HB2  11 
ATOM 9518  H HB3  . PHE A 1 37 ? -5.744  14.245 23.870 1.00 0.00 ? 37 PHE A HB3  11 
ATOM 9519  H HD1  . PHE A 1 37 ? -3.458  14.136 22.859 1.00 0.00 ? 37 PHE A HD1  11 
ATOM 9520  H HD2  . PHE A 1 37 ? -5.999  17.558 22.391 1.00 0.00 ? 37 PHE A HD2  11 
ATOM 9521  H HE1  . PHE A 1 37 ? -1.509  15.482 22.143 1.00 0.00 ? 37 PHE A HE1  11 
ATOM 9522  H HE2  . PHE A 1 37 ? -4.048  18.908 21.668 1.00 0.00 ? 37 PHE A HE2  11 
ATOM 9523  H HZ   . PHE A 1 37 ? -1.806  17.859 21.541 1.00 0.00 ? 37 PHE A HZ   11 
ATOM 9524  N N    . ILE A 1 38 ? -4.650  13.874 20.501 1.00 0.00 ? 38 ILE A N    11 
ATOM 9525  C CA   . ILE A 1 38 ? -3.900  14.040 19.223 1.00 0.00 ? 38 ILE A CA   11 
ATOM 9526  C C    . ILE A 1 38 ? -4.779  13.582 18.062 1.00 0.00 ? 38 ILE A C    11 
ATOM 9527  O O    . ILE A 1 38 ? -4.824  14.199 17.017 1.00 0.00 ? 38 ILE A O    11 
ATOM 9528  C CB   . ILE A 1 38 ? -2.671  13.135 19.337 1.00 0.00 ? 38 ILE A CB   11 
ATOM 9529  C CG1  . ILE A 1 38 ? -1.686  13.715 20.349 1.00 0.00 ? 38 ILE A CG1  11 
ATOM 9530  C CG2  . ILE A 1 38 ? -1.989  13.043 17.970 1.00 0.00 ? 38 ILE A CG2  11 
ATOM 9531  C CD1  . ILE A 1 38 ? -1.191  15.076 19.855 1.00 0.00 ? 38 ILE A CD1  11 
ATOM 9532  H H    . ILE A 1 38 ? -4.240  13.407 21.256 1.00 0.00 ? 38 ILE A H    11 
ATOM 9533  H HA   . ILE A 1 38 ? -3.598  15.065 19.090 1.00 0.00 ? 38 ILE A HA   11 
ATOM 9534  H HB   . ILE A 1 38 ? -2.977  12.149 19.654 1.00 0.00 ? 38 ILE A HB   11 
ATOM 9535  H HG12 . ILE A 1 38 ? -2.175  13.831 21.302 1.00 0.00 ? 38 ILE A HG12 11 
ATOM 9536  H HG13 . ILE A 1 38 ? -0.845  13.046 20.457 1.00 0.00 ? 38 ILE A HG13 11 
ATOM 9537  H HG21 . ILE A 1 38 ? -2.727  12.815 17.215 1.00 0.00 ? 38 ILE A HG21 11 
ATOM 9538  H HG22 . ILE A 1 38 ? -1.520  13.989 17.741 1.00 0.00 ? 38 ILE A HG22 11 
ATOM 9539  H HG23 . ILE A 1 38 ? -1.242  12.265 17.992 1.00 0.00 ? 38 ILE A HG23 11 
ATOM 9540  H HD11 . ILE A 1 38 ? -0.861  14.988 18.831 1.00 0.00 ? 38 ILE A HD11 11 
ATOM 9541  H HD12 . ILE A 1 38 ? -1.996  15.794 19.913 1.00 0.00 ? 38 ILE A HD12 11 
ATOM 9542  H HD13 . ILE A 1 38 ? -0.369  15.406 20.472 1.00 0.00 ? 38 ILE A HD13 11 
ATOM 9543  N N    . ASN A 1 39 ? -5.484  12.499 18.244 1.00 0.00 ? 39 ASN A N    11 
ATOM 9544  C CA   . ASN A 1 39 ? -6.369  11.993 17.157 1.00 0.00 ? 39 ASN A CA   11 
ATOM 9545  C C    . ASN A 1 39 ? -7.542  12.950 16.950 1.00 0.00 ? 39 ASN A C    11 
ATOM 9546  O O    . ASN A 1 39 ? -8.018  13.139 15.849 1.00 0.00 ? 39 ASN A O    11 
ATOM 9547  C CB   . ASN A 1 39 ? -6.864  10.631 17.647 1.00 0.00 ? 39 ASN A CB   11 
ATOM 9548  C CG   . ASN A 1 39 ? -5.695  9.644  17.676 1.00 0.00 ? 39 ASN A CG   11 
ATOM 9549  O OD1  . ASN A 1 39 ? -4.736  9.798  16.946 1.00 0.00 ? 39 ASN A OD1  11 
ATOM 9550  N ND2  . ASN A 1 39 ? -5.736  8.630  18.495 1.00 0.00 ? 39 ASN A ND2  11 
ATOM 9551  H H    . ASN A 1 39 ? -5.432  12.019 19.101 1.00 0.00 ? 39 ASN A H    11 
ATOM 9552  H HA   . ASN A 1 39 ? -5.812  11.876 16.242 1.00 0.00 ? 39 ASN A HA   11 
ATOM 9553  H HB2  . ASN A 1 39 ? -7.273  10.734 18.640 1.00 0.00 ? 39 ASN A HB2  11 
ATOM 9554  H HB3  . ASN A 1 39 ? -7.628  10.265 16.978 1.00 0.00 ? 39 ASN A HB3  11 
ATOM 9555  H HD21 . ASN A 1 39 ? -6.509  8.507  19.084 1.00 0.00 ? 39 ASN A HD21 11 
ATOM 9556  H HD22 . ASN A 1 39 ? -4.992  7.991  18.521 1.00 0.00 ? 39 ASN A HD22 11 
ATOM 9557  N N    . LYS A 1 40 ? -8.008  13.559 18.003 1.00 0.00 ? 40 LYS A N    11 
ATOM 9558  C CA   . LYS A 1 40 ? -9.148  14.510 17.873 1.00 0.00 ? 40 LYS A CA   11 
ATOM 9559  C C    . LYS A 1 40 ? -8.631  15.898 17.490 1.00 0.00 ? 40 LYS A C    11 
ATOM 9560  O O    . LYS A 1 40 ? -9.331  16.690 16.892 1.00 0.00 ? 40 LYS A O    11 
ATOM 9561  C CB   . LYS A 1 40 ? -9.800  14.542 19.255 1.00 0.00 ? 40 LYS A CB   11 
ATOM 9562  C CG   . LYS A 1 40 ? -10.679 13.304 19.432 1.00 0.00 ? 40 LYS A CG   11 
ATOM 9563  C CD   . LYS A 1 40 ? -11.410 13.388 20.773 1.00 0.00 ? 40 LYS A CD   11 
ATOM 9564  C CE   . LYS A 1 40 ? -11.903 11.996 21.172 1.00 0.00 ? 40 LYS A CE   11 
ATOM 9565  N NZ   . LYS A 1 40 ? -13.182 12.238 21.898 1.00 0.00 ? 40 LYS A NZ   11 
ATOM 9566  H H    . LYS A 1 40 ? -7.605  13.393 18.881 1.00 0.00 ? 40 LYS A H    11 
ATOM 9567  H HA   . LYS A 1 40 ? -9.855  14.153 17.140 1.00 0.00 ? 40 LYS A HA   11 
ATOM 9568  H HB2  . LYS A 1 40 ? -9.032  14.552 20.014 1.00 0.00 ? 40 LYS A HB2  11 
ATOM 9569  H HB3  . LYS A 1 40 ? -10.408 15.431 19.345 1.00 0.00 ? 40 LYS A HB3  11 
ATOM 9570  H HG2  . LYS A 1 40 ? -11.402 13.257 18.631 1.00 0.00 ? 40 LYS A HG2  11 
ATOM 9571  H HG3  . LYS A 1 40 ? -10.062 12.418 19.413 1.00 0.00 ? 40 LYS A HG3  11 
ATOM 9572  H HD2  . LYS A 1 40 ? -10.735 13.761 21.528 1.00 0.00 ? 40 LYS A HD2  11 
ATOM 9573  H HD3  . LYS A 1 40 ? -12.254 14.056 20.681 1.00 0.00 ? 40 LYS A HD3  11 
ATOM 9574  H HE2  . LYS A 1 40 ? -12.078 11.393 20.293 1.00 0.00 ? 40 LYS A HE2  11 
ATOM 9575  H HE3  . LYS A 1 40 ? -11.187 11.515 21.822 1.00 0.00 ? 40 LYS A HE3  11 
ATOM 9576  H HZ1  . LYS A 1 40 ? -13.113 13.125 22.436 1.00 0.00 ? 40 LYS A HZ1  11 
ATOM 9577  H HZ2  . LYS A 1 40 ? -13.962 12.310 21.214 1.00 0.00 ? 40 LYS A HZ2  11 
ATOM 9578  H HZ3  . LYS A 1 40 ? -13.365 11.449 22.551 1.00 0.00 ? 40 LYS A HZ3  11 
ATOM 9579  N N    . CYS A 1 41 ? -7.408  16.197 17.827 1.00 0.00 ? 41 CYS A N    11 
ATOM 9580  C CA   . CYS A 1 41 ? -6.839  17.531 17.480 1.00 0.00 ? 41 CYS A CA   11 
ATOM 9581  C C    . CYS A 1 41 ? -7.139  17.862 16.019 1.00 0.00 ? 41 CYS A C    11 
ATOM 9582  O O    . CYS A 1 41 ? -7.956  18.709 15.714 1.00 0.00 ? 41 CYS A O    11 
ATOM 9583  C CB   . CYS A 1 41 ? -5.333  17.377 17.694 1.00 0.00 ? 41 CYS A CB   11 
ATOM 9584  S SG   . CYS A 1 41 ? -4.457  18.763 16.924 1.00 0.00 ? 41 CYS A SG   11 
ATOM 9585  H H    . CYS A 1 41 ? -6.859  15.542 18.306 1.00 0.00 ? 41 CYS A H    11 
ATOM 9586  H HA   . CYS A 1 41 ? -7.231  18.293 18.132 1.00 0.00 ? 41 CYS A HA   11 
ATOM 9587  H HB2  . CYS A 1 41 ? -5.121  17.360 18.749 1.00 0.00 ? 41 CYS A HB2  11 
ATOM 9588  H HB3  . CYS A 1 41 ? -5.000  16.452 17.247 1.00 0.00 ? 41 CYS A HB3  11 
ATOM 9589  N N    . ALA A 1 42 ? -6.478  17.199 15.115 1.00 0.00 ? 42 ALA A N    11 
ATOM 9590  C CA   . ALA A 1 42 ? -6.713  17.470 13.667 1.00 0.00 ? 42 ALA A CA   11 
ATOM 9591  C C    . ALA A 1 42 ? -8.196  17.297 13.327 1.00 0.00 ? 42 ALA A C    11 
ATOM 9592  O O    . ALA A 1 42 ? -8.732  17.985 12.482 1.00 0.00 ? 42 ALA A O    11 
ATOM 9593  C CB   . ALA A 1 42 ? -5.868  16.432 12.929 1.00 0.00 ? 42 ALA A CB   11 
ATOM 9594  H H    . ALA A 1 42 ? -5.824  16.523 15.390 1.00 0.00 ? 42 ALA A H    11 
ATOM 9595  H HA   . ALA A 1 42 ? -6.381  18.463 13.412 1.00 0.00 ? 42 ALA A HA   11 
ATOM 9596  H HB1  . ALA A 1 42 ? -6.002  15.465 13.391 1.00 0.00 ? 42 ALA A HB1  11 
ATOM 9597  H HB2  . ALA A 1 42 ? -6.177  16.383 11.896 1.00 0.00 ? 42 ALA A HB2  11 
ATOM 9598  H HB3  . ALA A 1 42 ? -4.826  16.714 12.980 1.00 0.00 ? 42 ALA A HB3  11 
ATOM 9599  N N    . THR A 1 43 ? -8.862  16.385 13.978 1.00 0.00 ? 43 THR A N    11 
ATOM 9600  C CA   . THR A 1 43 ? -10.309 16.170 13.691 1.00 0.00 ? 43 THR A CA   11 
ATOM 9601  C C    . THR A 1 43 ? -11.122 17.386 14.144 1.00 0.00 ? 43 THR A C    11 
ATOM 9602  O O    . THR A 1 43 ? -11.811 18.010 13.363 1.00 0.00 ? 43 THR A O    11 
ATOM 9603  C CB   . THR A 1 43 ? -10.697 14.933 14.503 1.00 0.00 ? 43 THR A CB   11 
ATOM 9604  O OG1  . THR A 1 43 ? -9.796  13.875 14.208 1.00 0.00 ? 43 THR A OG1  11 
ATOM 9605  C CG2  . THR A 1 43 ? -12.121 14.510 14.142 1.00 0.00 ? 43 THR A CG2  11 
ATOM 9606  H H    . THR A 1 43 ? -8.412  15.841 14.656 1.00 0.00 ? 43 THR A H    11 
ATOM 9607  H HA   . THR A 1 43 ? -10.462 15.984 12.640 1.00 0.00 ? 43 THR A HA   11 
ATOM 9608  H HB   . THR A 1 43 ? -10.650 15.164 15.555 1.00 0.00 ? 43 THR A HB   11 
ATOM 9609  H HG1  . THR A 1 43 ? -9.813  13.726 13.259 1.00 0.00 ? 43 THR A HG1  11 
ATOM 9610  H HG21 . THR A 1 43 ? -12.358 14.855 13.147 1.00 0.00 ? 43 THR A HG21 11 
ATOM 9611  H HG22 . THR A 1 43 ? -12.198 13.433 14.178 1.00 0.00 ? 43 THR A HG22 11 
ATOM 9612  H HG23 . THR A 1 43 ? -12.815 14.944 14.848 1.00 0.00 ? 43 THR A HG23 11 
ATOM 9613  N N    . CYS A 1 44 ? -11.047 17.729 15.399 1.00 0.00 ? 44 CYS A N    11 
ATOM 9614  C CA   . CYS A 1 44 ? -11.814 18.905 15.896 1.00 0.00 ? 44 CYS A CA   11 
ATOM 9615  C C    . CYS A 1 44 ? -11.587 20.103 14.973 1.00 0.00 ? 44 CYS A C    11 
ATOM 9616  O O    . CYS A 1 44 ? -12.464 20.919 14.768 1.00 0.00 ? 44 CYS A O    11 
ATOM 9617  C CB   . CYS A 1 44 ? -11.252 19.186 17.289 1.00 0.00 ? 44 CYS A CB   11 
ATOM 9618  S SG   . CYS A 1 44 ? -11.438 17.711 18.322 1.00 0.00 ? 44 CYS A SG   11 
ATOM 9619  H H    . CYS A 1 44 ? -10.485 17.216 16.014 1.00 0.00 ? 44 CYS A H    11 
ATOM 9620  H HA   . CYS A 1 44 ? -12.865 18.671 15.961 1.00 0.00 ? 44 CYS A HA   11 
ATOM 9621  H HB2  . CYS A 1 44 ? -10.206 19.440 17.212 1.00 0.00 ? 44 CYS A HB2  11 
ATOM 9622  H HB3  . CYS A 1 44 ? -11.790 20.009 17.737 1.00 0.00 ? 44 CYS A HB3  11 
ATOM 9623  N N    . LYS A 1 45 ? -10.415 20.212 14.411 1.00 0.00 ? 45 LYS A N    11 
ATOM 9624  C CA   . LYS A 1 45 ? -10.127 21.354 13.498 1.00 0.00 ? 45 LYS A CA   11 
ATOM 9625  C C    . LYS A 1 45 ? -11.085 21.327 12.302 1.00 0.00 ? 45 LYS A C    11 
ATOM 9626  O O    . LYS A 1 45 ? -11.670 22.330 11.943 1.00 0.00 ? 45 LYS A O    11 
ATOM 9627  C CB   . LYS A 1 45 ? -8.685  21.139 13.039 1.00 0.00 ? 45 LYS A CB   11 
ATOM 9628  C CG   . LYS A 1 45 ? -8.329  22.174 11.971 1.00 0.00 ? 45 LYS A CG   11 
ATOM 9629  C CD   . LYS A 1 45 ? -7.325  21.566 10.991 1.00 0.00 ? 45 LYS A CD   11 
ATOM 9630  C CE   . LYS A 1 45 ? -6.832  22.650 10.030 1.00 0.00 ? 45 LYS A CE   11 
ATOM 9631  N NZ   . LYS A 1 45 ? -6.255  23.705 10.910 1.00 0.00 ? 45 LYS A NZ   11 
ATOM 9632  H H    . LYS A 1 45 ? -9.723  19.541 14.588 1.00 0.00 ? 45 LYS A H    11 
ATOM 9633  H HA   . LYS A 1 45 ? -10.210 22.290 14.027 1.00 0.00 ? 45 LYS A HA   11 
ATOM 9634  H HB2  . LYS A 1 45 ? -8.020  21.247 13.882 1.00 0.00 ? 45 LYS A HB2  11 
ATOM 9635  H HB3  . LYS A 1 45 ? -8.584  20.146 12.626 1.00 0.00 ? 45 LYS A HB3  11 
ATOM 9636  H HG2  . LYS A 1 45 ? -9.222  22.464 11.439 1.00 0.00 ? 45 LYS A HG2  11 
ATOM 9637  H HG3  . LYS A 1 45 ? -7.892  23.041 12.442 1.00 0.00 ? 45 LYS A HG3  11 
ATOM 9638  H HD2  . LYS A 1 45 ? -6.486  21.162 11.538 1.00 0.00 ? 45 LYS A HD2  11 
ATOM 9639  H HD3  . LYS A 1 45 ? -7.802  20.777 10.429 1.00 0.00 ? 45 LYS A HD3  11 
ATOM 9640  H HE2  . LYS A 1 45 ? -6.072  22.253 9.373  1.00 0.00 ? 45 LYS A HE2  11 
ATOM 9641  H HE3  . LYS A 1 45 ? -7.656  23.048 9.457  1.00 0.00 ? 45 LYS A HE3  11 
ATOM 9642  H HZ1  . LYS A 1 45 ? -5.750  23.256 11.702 1.00 0.00 ? 45 LYS A HZ1  11 
ATOM 9643  H HZ2  . LYS A 1 45 ? -5.593  24.290 10.363 1.00 0.00 ? 45 LYS A HZ2  11 
ATOM 9644  H HZ3  . LYS A 1 45 ? -7.019  24.304 11.281 1.00 0.00 ? 45 LYS A HZ3  11 
ATOM 9645  N N    . MET A 1 46 ? -11.251 20.188 11.684 1.00 0.00 ? 46 MET A N    11 
ATOM 9646  C CA   . MET A 1 46 ? -12.173 20.107 10.516 1.00 0.00 ? 46 MET A CA   11 
ATOM 9647  C C    . MET A 1 46 ? -13.607 20.410 10.958 1.00 0.00 ? 46 MET A C    11 
ATOM 9648  O O    . MET A 1 46 ? -14.436 20.819 10.171 1.00 0.00 ? 46 MET A O    11 
ATOM 9649  C CB   . MET A 1 46 ? -12.048 18.671 9.999  1.00 0.00 ? 46 MET A CB   11 
ATOM 9650  C CG   . MET A 1 46 ? -12.704 17.695 10.979 1.00 0.00 ? 46 MET A CG   11 
ATOM 9651  S SD   . MET A 1 46 ? -13.958 16.720 10.109 1.00 0.00 ? 46 MET A SD   11 
ATOM 9652  C CE   . MET A 1 46 ? -12.825 15.786 9.053  1.00 0.00 ? 46 MET A CE   11 
ATOM 9653  H H    . MET A 1 46 ? -10.772 19.390 11.989 1.00 0.00 ? 46 MET A H    11 
ATOM 9654  H HA   . MET A 1 46 ? -11.866 20.800 9.748  1.00 0.00 ? 46 MET A HA   11 
ATOM 9655  H HB2  . MET A 1 46 ? -12.535 18.593 9.040  1.00 0.00 ? 46 MET A HB2  11 
ATOM 9656  H HB3  . MET A 1 46 ? -11.004 18.421 9.894  1.00 0.00 ? 46 MET A HB3  11 
ATOM 9657  H HG2  . MET A 1 46 ? -11.952 17.034 11.384 1.00 0.00 ? 46 MET A HG2  11 
ATOM 9658  H HG3  . MET A 1 46 ? -13.169 18.242 11.782 1.00 0.00 ? 46 MET A HG3  11 
ATOM 9659  H HE1  . MET A 1 46 ? -12.008 15.405 9.645  1.00 0.00 ? 46 MET A HE1  11 
ATOM 9660  H HE2  . MET A 1 46 ? -13.355 14.959 8.601  1.00 0.00 ? 46 MET A HE2  11 
ATOM 9661  H HE3  . MET A 1 46 ? -12.435 16.435 8.281  1.00 0.00 ? 46 MET A HE3  11 
ATOM 9662  N N    . ILE A 1 47 ? -13.899 20.220 12.214 1.00 0.00 ? 47 ILE A N    11 
ATOM 9663  C CA   . ILE A 1 47 ? -15.276 20.505 12.711 1.00 0.00 ? 47 ILE A CA   11 
ATOM 9664  C C    . ILE A 1 47 ? -15.581 21.995 12.551 1.00 0.00 ? 47 ILE A C    11 
ATOM 9665  O O    . ILE A 1 47 ? -16.659 22.379 12.142 1.00 0.00 ? 47 ILE A O    11 
ATOM 9666  C CB   . ILE A 1 47 ? -15.255 20.115 14.189 1.00 0.00 ? 47 ILE A CB   11 
ATOM 9667  C CG1  . ILE A 1 47 ? -14.804 18.660 14.324 1.00 0.00 ? 47 ILE A CG1  11 
ATOM 9668  C CG2  . ILE A 1 47 ? -16.659 20.271 14.778 1.00 0.00 ? 47 ILE A CG2  11 
ATOM 9669  C CD1  . ILE A 1 47 ? -15.605 17.786 13.358 1.00 0.00 ? 47 ILE A CD1  11 
ATOM 9670  H H    . ILE A 1 47 ? -13.212 19.893 12.830 1.00 0.00 ? 47 ILE A H    11 
ATOM 9671  H HA   . ILE A 1 47 ? -16.001 19.909 12.179 1.00 0.00 ? 47 ILE A HA   11 
ATOM 9672  H HB   . ILE A 1 47 ? -14.569 20.755 14.721 1.00 0.00 ? 47 ILE A HB   11 
ATOM 9673  H HG12 . ILE A 1 47 ? -13.753 18.586 14.091 1.00 0.00 ? 47 ILE A HG12 11 
ATOM 9674  H HG13 . ILE A 1 47 ? -14.973 18.323 15.337 1.00 0.00 ? 47 ILE A HG13 11 
ATOM 9675  H HG21 . ILE A 1 47 ? -17.393 19.975 14.042 1.00 0.00 ? 47 ILE A HG21 11 
ATOM 9676  H HG22 . ILE A 1 47 ? -16.754 19.642 15.652 1.00 0.00 ? 47 ILE A HG22 11 
ATOM 9677  H HG23 . ILE A 1 47 ? -16.821 21.301 15.056 1.00 0.00 ? 47 ILE A HG23 11 
ATOM 9678  H HD11 . ILE A 1 47 ? -16.659 17.880 13.575 1.00 0.00 ? 47 ILE A HD11 11 
ATOM 9679  H HD12 . ILE A 1 47 ? -15.417 18.106 12.343 1.00 0.00 ? 47 ILE A HD12 11 
ATOM 9680  H HD13 . ILE A 1 47 ? -15.306 16.754 13.472 1.00 0.00 ? 47 ILE A HD13 11 
ATOM 9681  N N    . LEU A 1 48 ? -14.632 22.836 12.859 1.00 0.00 ? 48 LEU A N    11 
ATOM 9682  C CA   . LEU A 1 48 ? -14.860 24.301 12.713 1.00 0.00 ? 48 LEU A CA   11 
ATOM 9683  C C    . LEU A 1 48 ? -15.010 24.650 11.232 1.00 0.00 ? 48 LEU A C    11 
ATOM 9684  O O    . LEU A 1 48 ? -15.833 25.459 10.851 1.00 0.00 ? 48 LEU A O    11 
ATOM 9685  C CB   . LEU A 1 48 ? -13.607 24.961 13.290 1.00 0.00 ? 48 LEU A CB   11 
ATOM 9686  C CG   . LEU A 1 48 ? -13.656 24.914 14.819 1.00 0.00 ? 48 LEU A CG   11 
ATOM 9687  C CD1  . LEU A 1 48 ? -14.989 25.484 15.307 1.00 0.00 ? 48 LEU A CD1  11 
ATOM 9688  C CD2  . LEU A 1 48 ? -13.517 23.465 15.292 1.00 0.00 ? 48 LEU A CD2  11 
ATOM 9689  H H    . LEU A 1 48 ? -13.767 22.504 13.177 1.00 0.00 ? 48 LEU A H    11 
ATOM 9690  H HA   . LEU A 1 48 ? -15.733 24.608 13.268 1.00 0.00 ? 48 LEU A HA   11 
ATOM 9691  H HB2  . LEU A 1 48 ? -12.731 24.433 12.943 1.00 0.00 ? 48 LEU A HB2  11 
ATOM 9692  H HB3  . LEU A 1 48 ? -13.561 25.989 12.964 1.00 0.00 ? 48 LEU A HB3  11 
ATOM 9693  H HG   . LEU A 1 48 ? -12.845 25.501 15.220 1.00 0.00 ? 48 LEU A HG   11 
ATOM 9694  H HD11 . LEU A 1 48 ? -15.417 26.109 14.536 1.00 0.00 ? 48 LEU A HD11 11 
ATOM 9695  H HD12 . LEU A 1 48 ? -15.666 24.674 15.533 1.00 0.00 ? 48 LEU A HD12 11 
ATOM 9696  H HD13 . LEU A 1 48 ? -14.823 26.073 16.197 1.00 0.00 ? 48 LEU A HD13 11 
ATOM 9697  H HD21 . LEU A 1 48 ? -12.673 23.006 14.800 1.00 0.00 ? 48 LEU A HD21 11 
ATOM 9698  H HD22 . LEU A 1 48 ? -13.363 23.449 16.361 1.00 0.00 ? 48 LEU A HD22 11 
ATOM 9699  H HD23 . LEU A 1 48 ? -14.417 22.920 15.050 1.00 0.00 ? 48 LEU A HD23 11 
ATOM 9700  N N    . GLU A 1 49 ? -14.219 24.038 10.392 1.00 0.00 ? 49 GLU A N    11 
ATOM 9701  C CA   . GLU A 1 49 ? -14.312 24.327 8.933  1.00 0.00 ? 49 GLU A CA   11 
ATOM 9702  C C    . GLU A 1 49 ? -15.736 24.066 8.435  1.00 0.00 ? 49 GLU A C    11 
ATOM 9703  O O    . GLU A 1 49 ? -16.182 24.648 7.465  1.00 0.00 ? 49 GLU A O    11 
ATOM 9704  C CB   . GLU A 1 49 ? -13.329 23.358 8.276  1.00 0.00 ? 49 GLU A CB   11 
ATOM 9705  C CG   . GLU A 1 49 ? -11.912 23.659 8.769  1.00 0.00 ? 49 GLU A CG   11 
ATOM 9706  C CD   . GLU A 1 49 ? -11.393 24.925 8.085  1.00 0.00 ? 49 GLU A CD   11 
ATOM 9707  O OE1  . GLU A 1 49 ? -12.180 25.583 7.424  1.00 0.00 ? 49 GLU A OE1  11 
ATOM 9708  O OE2  . GLU A 1 49 ? -10.217 25.217 8.236  1.00 0.00 ? 49 GLU A OE2  11 
ATOM 9709  H H    . GLU A 1 49 ? -13.564 23.387 10.724 1.00 0.00 ? 49 GLU A H    11 
ATOM 9710  H HA   . GLU A 1 49 ? -14.021 25.344 8.730  1.00 0.00 ? 49 GLU A HA   11 
ATOM 9711  H HB2  . GLU A 1 49 ? -13.593 22.344 8.537  1.00 0.00 ? 49 GLU A HB2  11 
ATOM 9712  H HB3  . GLU A 1 49 ? -13.370 23.476 7.203  1.00 0.00 ? 49 GLU A HB3  11 
ATOM 9713  H HG2  . GLU A 1 49 ? -11.926 23.807 9.838  1.00 0.00 ? 49 GLU A HG2  11 
ATOM 9714  H HG3  . GLU A 1 49 ? -11.263 22.830 8.529  1.00 0.00 ? 49 GLU A HG3  11 
ATOM 9715  N N    . LYS A 1 50 ? -16.454 23.197 9.092  1.00 0.00 ? 50 LYS A N    11 
ATOM 9716  C CA   . LYS A 1 50 ? -17.849 22.901 8.657  1.00 0.00 ? 50 LYS A CA   11 
ATOM 9717  C C    . LYS A 1 50 ? -18.726 24.145 8.812  1.00 0.00 ? 50 LYS A C    11 
ATOM 9718  O O    . LYS A 1 50 ? -19.570 24.430 7.985  1.00 0.00 ? 50 LYS A O    11 
ATOM 9719  C CB   . LYS A 1 50 ? -18.327 21.788 9.591  1.00 0.00 ? 50 LYS A CB   11 
ATOM 9720  C CG   . LYS A 1 50 ? -17.484 20.532 9.360  1.00 0.00 ? 50 LYS A CG   11 
ATOM 9721  C CD   . LYS A 1 50 ? -18.123 19.349 10.091 1.00 0.00 ? 50 LYS A CD   11 
ATOM 9722  C CE   . LYS A 1 50 ? -17.479 18.047 9.613  1.00 0.00 ? 50 LYS A CE   11 
ATOM 9723  N NZ   . LYS A 1 50 ? -17.985 17.005 10.550 1.00 0.00 ? 50 LYS A NZ   11 
ATOM 9724  H H    . LYS A 1 50 ? -16.075 22.739 9.871  1.00 0.00 ? 50 LYS A H    11 
ATOM 9725  H HA   . LYS A 1 50 ? -17.860 22.554 7.635  1.00 0.00 ? 50 LYS A HA   11 
ATOM 9726  H HB2  . LYS A 1 50 ? -18.222 22.109 10.616 1.00 0.00 ? 50 LYS A HB2  11 
ATOM 9727  H HB3  . LYS A 1 50 ? -19.365 21.568 9.386  1.00 0.00 ? 50 LYS A HB3  11 
ATOM 9728  H HG2  . LYS A 1 50 ? -17.437 20.319 8.304  1.00 0.00 ? 50 LYS A HG2  11 
ATOM 9729  H HG3  . LYS A 1 50 ? -16.487 20.694 9.741  1.00 0.00 ? 50 LYS A HG3  11 
ATOM 9730  H HD2  . LYS A 1 50 ? -17.970 19.458 11.155 1.00 0.00 ? 50 LYS A HD2  11 
ATOM 9731  H HD3  . LYS A 1 50 ? -19.182 19.325 9.881  1.00 0.00 ? 50 LYS A HD3  11 
ATOM 9732  H HE2  . LYS A 1 50 ? -17.785 17.824 8.602  1.00 0.00 ? 50 LYS A HE2  11 
ATOM 9733  H HE3  . LYS A 1 50 ? -16.402 18.115 9.674  1.00 0.00 ? 50 LYS A HE3  11 
ATOM 9734  H HZ1  . LYS A 1 50 ? -17.912 17.354 11.528 1.00 0.00 ? 50 LYS A HZ1  11 
ATOM 9735  H HZ2  . LYS A 1 50 ? -18.979 16.793 10.330 1.00 0.00 ? 50 LYS A HZ2  11 
ATOM 9736  H HZ3  . LYS A 1 50 ? -17.418 16.140 10.447 1.00 0.00 ? 50 LYS A HZ3  11 
ATOM 9737  N N    . GLU A 1 51 ? -18.532 24.889 9.866  1.00 0.00 ? 51 GLU A N    11 
ATOM 9738  C CA   . GLU A 1 51 ? -19.354 26.116 10.074 1.00 0.00 ? 51 GLU A CA   11 
ATOM 9739  C C    . GLU A 1 51 ? -19.207 27.059 8.879  1.00 0.00 ? 51 GLU A C    11 
ATOM 9740  O O    . GLU A 1 51 ? -20.085 27.846 8.584  1.00 0.00 ? 51 GLU A O    11 
ATOM 9741  C CB   . GLU A 1 51 ? -18.790 26.762 11.340 1.00 0.00 ? 51 GLU A CB   11 
ATOM 9742  C CG   . GLU A 1 51 ? -19.112 25.882 12.549 1.00 0.00 ? 51 GLU A CG   11 
ATOM 9743  C CD   . GLU A 1 51 ? -18.455 26.472 13.799 1.00 0.00 ? 51 GLU A CD   11 
ATOM 9744  O OE1  . GLU A 1 51 ? -17.267 26.741 13.749 1.00 0.00 ? 51 GLU A OE1  11 
ATOM 9745  O OE2  . GLU A 1 51 ? -19.153 26.644 14.785 1.00 0.00 ? 51 GLU A OE2  11 
ATOM 9746  H H    . GLU A 1 51 ? -17.847 24.642 10.522 1.00 0.00 ? 51 GLU A H    11 
ATOM 9747  H HA   . GLU A 1 51 ? -20.390 25.855 10.224 1.00 0.00 ? 51 GLU A HA   11 
ATOM 9748  H HB2  . GLU A 1 51 ? -17.718 26.864 11.244 1.00 0.00 ? 51 GLU A HB2  11 
ATOM 9749  H HB3  . GLU A 1 51 ? -19.233 27.736 11.475 1.00 0.00 ? 51 GLU A HB3  11 
ATOM 9750  H HG2  . GLU A 1 51 ? -20.182 25.841 12.690 1.00 0.00 ? 51 GLU A HG2  11 
ATOM 9751  H HG3  . GLU A 1 51 ? -18.732 24.885 12.381 1.00 0.00 ? 51 GLU A HG3  11 
ATOM 9752  N N    . ALA A 1 52 ? -18.103 26.987 8.187  1.00 0.00 ? 52 ALA A N    11 
ATOM 9753  C CA   . ALA A 1 52 ? -17.900 27.881 7.011  1.00 0.00 ? 52 ALA A CA   11 
ATOM 9754  C C    . ALA A 1 52 ? -18.675 27.350 5.802  1.00 0.00 ? 52 ALA A C    11 
ATOM 9755  O O    . ALA A 1 52 ? -18.952 28.071 4.865  1.00 0.00 ? 52 ALA A O    11 
ATOM 9756  C CB   . ALA A 1 52 ? -16.396 27.847 6.742  1.00 0.00 ? 52 ALA A CB   11 
ATOM 9757  H H    . ALA A 1 52 ? -17.407 26.346 8.441  1.00 0.00 ? 52 ALA A H    11 
ATOM 9758  H HA   . ALA A 1 52 ? -18.210 28.887 7.245  1.00 0.00 ? 52 ALA A HA   11 
ATOM 9759  H HB1  . ALA A 1 52 ? -15.865 28.164 7.627  1.00 0.00 ? 52 ALA A HB1  11 
ATOM 9760  H HB2  . ALA A 1 52 ? -16.161 28.512 5.924  1.00 0.00 ? 52 ALA A HB2  11 
ATOM 9761  H HB3  . ALA A 1 52 ? -16.099 26.841 6.484  1.00 0.00 ? 52 ALA A HB3  11 
ATOM 9762  N N    . LYS A 1 53 ? -19.026 26.093 5.816  1.00 0.00 ? 53 LYS A N    11 
ATOM 9763  C CA   . LYS A 1 53 ? -19.782 25.517 4.666  1.00 0.00 ? 53 LYS A CA   11 
ATOM 9764  C C    . LYS A 1 53 ? -21.284 25.751 4.851  1.00 0.00 ? 53 LYS A C    11 
ATOM 9765  O O    . LYS A 1 53 ? -22.038 25.787 3.899  1.00 0.00 ? 53 LYS A O    11 
ATOM 9766  C CB   . LYS A 1 53 ? -19.465 24.022 4.692  1.00 0.00 ? 53 LYS A CB   11 
ATOM 9767  C CG   . LYS A 1 53 ? -20.203 23.325 3.548  1.00 0.00 ? 53 LYS A CG   11 
ATOM 9768  C CD   . LYS A 1 53 ? -19.951 21.818 3.620  1.00 0.00 ? 53 LYS A CD   11 
ATOM 9769  C CE   . LYS A 1 53 ? -20.727 21.116 2.504  1.00 0.00 ? 53 LYS A CE   11 
ATOM 9770  N NZ   . LYS A 1 53 ? -20.360 19.677 2.631  1.00 0.00 ? 53 LYS A NZ   11 
ATOM 9771  H H    . LYS A 1 53 ? -18.792 25.526 6.580  1.00 0.00 ? 53 LYS A H    11 
ATOM 9772  H HA   . LYS A 1 53 ? -19.444 25.950 3.738  1.00 0.00 ? 53 LYS A HA   11 
ATOM 9773  H HB2  . LYS A 1 53 ? -18.401 23.878 4.574  1.00 0.00 ? 53 LYS A HB2  11 
ATOM 9774  H HB3  . LYS A 1 53 ? -19.784 23.603 5.635  1.00 0.00 ? 53 LYS A HB3  11 
ATOM 9775  H HG2  . LYS A 1 53 ? -21.263 23.517 3.634  1.00 0.00 ? 53 LYS A HG2  11 
ATOM 9776  H HG3  . LYS A 1 53 ? -19.844 23.705 2.603  1.00 0.00 ? 53 LYS A HG3  11 
ATOM 9777  H HD2  . LYS A 1 53 ? -18.895 21.624 3.503  1.00 0.00 ? 53 LYS A HD2  11 
ATOM 9778  H HD3  . LYS A 1 53 ? -20.281 21.443 4.579  1.00 0.00 ? 53 LYS A HD3  11 
ATOM 9779  H HE2  . LYS A 1 53 ? -21.790 21.247 2.645  1.00 0.00 ? 53 LYS A HE2  11 
ATOM 9780  H HE3  . LYS A 1 53 ? -20.425 21.498 1.539  1.00 0.00 ? 53 LYS A HE3  11 
ATOM 9781  H HZ1  . LYS A 1 53 ? -19.345 19.595 2.842  1.00 0.00 ? 53 LYS A HZ1  11 
ATOM 9782  H HZ2  . LYS A 1 53 ? -20.912 19.246 3.400  1.00 0.00 ? 53 LYS A HZ2  11 
ATOM 9783  H HZ3  . LYS A 1 53 ? -20.567 19.186 1.738  1.00 0.00 ? 53 LYS A HZ3  11 
ATOM 9784  N N    . SER A 1 54 ? -21.723 25.911 6.070  1.00 0.00 ? 54 SER A N    11 
ATOM 9785  C CA   . SER A 1 54 ? -23.176 26.143 6.313  1.00 0.00 ? 54 SER A CA   11 
ATOM 9786  C C    . SER A 1 54 ? -23.535 27.604 6.027  1.00 0.00 ? 54 SER A C    11 
ATOM 9787  O O    . SER A 1 54 ? -24.688 27.949 5.865  1.00 0.00 ? 54 SER A O    11 
ATOM 9788  C CB   . SER A 1 54 ? -23.385 25.819 7.792  1.00 0.00 ? 54 SER A CB   11 
ATOM 9789  O OG   . SER A 1 54 ? -23.035 24.464 8.035  1.00 0.00 ? 54 SER A OG   11 
ATOM 9790  H H    . SER A 1 54 ? -21.098 25.880 6.824  1.00 0.00 ? 54 SER A H    11 
ATOM 9791  H HA   . SER A 1 54 ? -23.771 25.481 5.704  1.00 0.00 ? 54 SER A HA   11 
ATOM 9792  H HB2  . SER A 1 54 ? -22.763 26.466 8.394  1.00 0.00 ? 54 SER A HB2  11 
ATOM 9793  H HB3  . SER A 1 54 ? -24.423 25.974 8.052  1.00 0.00 ? 54 SER A HB3  11 
ATOM 9794  H HG   . SER A 1 54 ? -22.901 24.357 8.980  1.00 0.00 ? 54 SER A HG   11 
ATOM 9795  N N    . GLN A 1 55 ? -22.555 28.463 5.960  1.00 0.00 ? 55 GLN A N    11 
ATOM 9796  C CA   . GLN A 1 55 ? -22.840 29.900 5.683  1.00 0.00 ? 55 GLN A CA   11 
ATOM 9797  C C    . GLN A 1 55 ? -21.531 30.680 5.541  1.00 0.00 ? 55 GLN A C    11 
ATOM 9798  O O    . GLN A 1 55 ? -20.585 30.345 6.235  1.00 0.00 ? 55 GLN A O    11 
ATOM 9799  C CB   . GLN A 1 55 ? -23.628 30.390 6.898  1.00 0.00 ? 55 GLN A CB   11 
ATOM 9800  C CG   . GLN A 1 55 ? -22.737 30.333 8.142  1.00 0.00 ? 55 GLN A CG   11 
ATOM 9801  C CD   . GLN A 1 55 ? -23.451 31.012 9.311  1.00 0.00 ? 55 GLN A CD   11 
ATOM 9802  O OE1  . GLN A 1 55 ? -24.204 31.947 9.119  1.00 0.00 ? 55 GLN A OE1  11 
ATOM 9803  N NE2  . GLN A 1 55 ? -23.248 30.578 10.526 1.00 0.00 ? 55 GLN A NE2  11 
ATOM 9804  O OXT  . GLN A 1 55 ? -21.497 31.600 4.740  1.00 0.00 ? 55 GLN A OXT  11 
ATOM 9805  H H    . GLN A 1 55 ? -21.631 28.163 6.093  1.00 0.00 ? 55 GLN A H    11 
ATOM 9806  H HA   . GLN A 1 55 ? -23.438 30.001 4.792  1.00 0.00 ? 55 GLN A HA   11 
ATOM 9807  H HB2  . GLN A 1 55 ? -23.949 31.407 6.733  1.00 0.00 ? 55 GLN A HB2  11 
ATOM 9808  H HB3  . GLN A 1 55 ? -24.492 29.758 7.046  1.00 0.00 ? 55 GLN A HB3  11 
ATOM 9809  H HG2  . GLN A 1 55 ? -22.534 29.303 8.393  1.00 0.00 ? 55 GLN A HG2  11 
ATOM 9810  H HG3  . GLN A 1 55 ? -21.807 30.845 7.942  1.00 0.00 ? 55 GLN A HG3  11 
ATOM 9811  H HE21 . GLN A 1 55 ? -22.642 29.824 10.681 1.00 0.00 ? 55 GLN A HE21 11 
ATOM 9812  H HE22 . GLN A 1 55 ? -23.701 31.007 11.281 1.00 0.00 ? 55 GLN A HE22 11 
ATOM 9813  N N    . LYS A 1 1  ? -26.480 24.805 11.279 1.00 0.00 ? 1  LYS A N    12 
ATOM 9814  C CA   . LYS A 1 1  ? -25.532 24.900 12.428 1.00 0.00 ? 1  LYS A CA   12 
ATOM 9815  C C    . LYS A 1 1  ? -26.005 24.008 13.579 1.00 0.00 ? 1  LYS A C    12 
ATOM 9816  O O    . LYS A 1 1  ? -26.723 24.443 14.458 1.00 0.00 ? 1  LYS A O    12 
ATOM 9817  C CB   . LYS A 1 1  ? -25.560 26.371 12.842 1.00 0.00 ? 1  LYS A CB   12 
ATOM 9818  C CG   . LYS A 1 1  ? -24.498 26.617 13.917 1.00 0.00 ? 1  LYS A CG   12 
ATOM 9819  C CD   . LYS A 1 1  ? -23.114 26.662 13.268 1.00 0.00 ? 1  LYS A CD   12 
ATOM 9820  C CE   . LYS A 1 1  ? -22.052 26.890 14.345 1.00 0.00 ? 1  LYS A CE   12 
ATOM 9821  N NZ   . LYS A 1 1  ? -22.545 28.060 15.126 1.00 0.00 ? 1  LYS A NZ   12 
ATOM 9822  H H1   . LYS A 1 1  ? -27.442 24.640 11.637 1.00 0.00 ? 1  LYS A H1   12 
ATOM 9823  H H2   . LYS A 1 1  ? -26.461 25.692 10.739 1.00 0.00 ? 1  LYS A H2   12 
ATOM 9824  H H3   . LYS A 1 1  ? -26.199 24.016 10.663 1.00 0.00 ? 1  LYS A H3   12 
ATOM 9825  H HA   . LYS A 1 1  ? -24.537 24.623 12.119 1.00 0.00 ? 1  LYS A HA   12 
ATOM 9826  H HB2  . LYS A 1 1  ? -25.351 26.991 11.982 1.00 0.00 ? 1  LYS A HB2  12 
ATOM 9827  H HB3  . LYS A 1 1  ? -26.534 26.617 13.235 1.00 0.00 ? 1  LYS A HB3  12 
ATOM 9828  H HG2  . LYS A 1 1  ? -24.696 27.559 14.408 1.00 0.00 ? 1  LYS A HG2  12 
ATOM 9829  H HG3  . LYS A 1 1  ? -24.529 25.818 14.643 1.00 0.00 ? 1  LYS A HG3  12 
ATOM 9830  H HD2  . LYS A 1 1  ? -22.922 25.726 12.764 1.00 0.00 ? 1  LYS A HD2  12 
ATOM 9831  H HD3  . LYS A 1 1  ? -23.078 27.469 12.550 1.00 0.00 ? 1  LYS A HD3  12 
ATOM 9832  H HE2  . LYS A 1 1  ? -21.970 26.021 14.981 1.00 0.00 ? 1  LYS A HE2  12 
ATOM 9833  H HE3  . LYS A 1 1  ? -21.099 27.116 13.891 1.00 0.00 ? 1  LYS A HE3  12 
ATOM 9834  H HZ1  . LYS A 1 1  ? -23.112 28.675 14.507 1.00 0.00 ? 1  LYS A HZ1  12 
ATOM 9835  H HZ2  . LYS A 1 1  ? -23.132 27.726 15.916 1.00 0.00 ? 1  LYS A HZ2  12 
ATOM 9836  H HZ3  . LYS A 1 1  ? -21.735 28.593 15.499 1.00 0.00 ? 1  LYS A HZ3  12 
ATOM 9837  N N    . ASN A 1 2  ? -25.607 22.766 13.582 1.00 0.00 ? 2  ASN A N    12 
ATOM 9838  C CA   . ASN A 1 2  ? -26.033 21.849 14.678 1.00 0.00 ? 2  ASN A CA   12 
ATOM 9839  C C    . ASN A 1 2  ? -24.893 21.660 15.682 1.00 0.00 ? 2  ASN A C    12 
ATOM 9840  O O    . ASN A 1 2  ? -23.860 21.105 15.367 1.00 0.00 ? 2  ASN A O    12 
ATOM 9841  C CB   . ASN A 1 2  ? -26.360 20.527 13.983 1.00 0.00 ? 2  ASN A CB   12 
ATOM 9842  C CG   . ASN A 1 2  ? -26.973 19.557 14.995 1.00 0.00 ? 2  ASN A CG   12 
ATOM 9843  O OD1  . ASN A 1 2  ? -26.911 19.784 16.187 1.00 0.00 ? 2  ASN A OD1  12 
ATOM 9844  N ND2  . ASN A 1 2  ? -27.568 18.477 14.567 1.00 0.00 ? 2  ASN A ND2  12 
ATOM 9845  H H    . ASN A 1 2  ? -25.027 22.435 12.865 1.00 0.00 ? 2  ASN A H    12 
ATOM 9846  H HA   . ASN A 1 2  ? -26.912 22.233 15.170 1.00 0.00 ? 2  ASN A HA   12 
ATOM 9847  H HB2  . ASN A 1 2  ? -27.062 20.704 13.182 1.00 0.00 ? 2  ASN A HB2  12 
ATOM 9848  H HB3  . ASN A 1 2  ? -25.454 20.100 13.579 1.00 0.00 ? 2  ASN A HB3  12 
ATOM 9849  H HD21 . ASN A 1 2  ? -27.619 18.294 13.605 1.00 0.00 ? 2  ASN A HD21 12 
ATOM 9850  H HD22 . ASN A 1 2  ? -27.965 17.849 15.206 1.00 0.00 ? 2  ASN A HD22 12 
ATOM 9851  N N    . GLU A 1 3  ? -25.074 22.121 16.891 1.00 0.00 ? 3  GLU A N    12 
ATOM 9852  C CA   . GLU A 1 3  ? -24.000 21.968 17.914 1.00 0.00 ? 3  GLU A CA   12 
ATOM 9853  C C    . GLU A 1 3  ? -23.790 20.487 18.246 1.00 0.00 ? 3  GLU A C    12 
ATOM 9854  O O    . GLU A 1 3  ? -22.863 20.123 18.941 1.00 0.00 ? 3  GLU A O    12 
ATOM 9855  C CB   . GLU A 1 3  ? -24.511 22.726 19.140 1.00 0.00 ? 3  GLU A CB   12 
ATOM 9856  C CG   . GLU A 1 3  ? -25.745 22.014 19.701 1.00 0.00 ? 3  GLU A CG   12 
ATOM 9857  C CD   . GLU A 1 3  ? -26.439 22.922 20.718 1.00 0.00 ? 3  GLU A CD   12 
ATOM 9858  O OE1  . GLU A 1 3  ? -25.863 23.941 21.063 1.00 0.00 ? 3  GLU A OE1  12 
ATOM 9859  O OE2  . GLU A 1 3  ? -27.535 22.583 21.134 1.00 0.00 ? 3  GLU A OE2  12 
ATOM 9860  H H    . GLU A 1 3  ? -25.915 22.566 17.125 1.00 0.00 ? 3  GLU A H    12 
ATOM 9861  H HA   . GLU A 1 3  ? -23.081 22.410 17.565 1.00 0.00 ? 3  GLU A HA   12 
ATOM 9862  H HB2  . GLU A 1 3  ? -23.739 22.754 19.894 1.00 0.00 ? 3  GLU A HB2  12 
ATOM 9863  H HB3  . GLU A 1 3  ? -24.775 23.733 18.856 1.00 0.00 ? 3  GLU A HB3  12 
ATOM 9864  H HG2  . GLU A 1 3  ? -26.428 21.789 18.894 1.00 0.00 ? 3  GLU A HG2  12 
ATOM 9865  H HG3  . GLU A 1 3  ? -25.443 21.096 20.184 1.00 0.00 ? 3  GLU A HG3  12 
ATOM 9866  N N    . ASP A 1 4  ? -24.646 19.633 17.755 1.00 0.00 ? 4  ASP A N    12 
ATOM 9867  C CA   . ASP A 1 4  ? -24.494 18.177 18.044 1.00 0.00 ? 4  ASP A CA   12 
ATOM 9868  C C    . ASP A 1 4  ? -24.072 17.426 16.778 1.00 0.00 ? 4  ASP A C    12 
ATOM 9869  O O    . ASP A 1 4  ? -24.721 16.490 16.355 1.00 0.00 ? 4  ASP A O    12 
ATOM 9870  C CB   . ASP A 1 4  ? -25.879 17.719 18.502 1.00 0.00 ? 4  ASP A CB   12 
ATOM 9871  C CG   . ASP A 1 4  ? -25.769 16.339 19.152 1.00 0.00 ? 4  ASP A CG   12 
ATOM 9872  O OD1  . ASP A 1 4  ? -24.945 15.558 18.705 1.00 0.00 ? 4  ASP A OD1  12 
ATOM 9873  O OD2  . ASP A 1 4  ? -26.512 16.085 20.087 1.00 0.00 ? 4  ASP A OD2  12 
ATOM 9874  H H    . ASP A 1 4  ? -25.387 19.947 17.197 1.00 0.00 ? 4  ASP A H    12 
ATOM 9875  H HA   . ASP A 1 4  ? -23.776 18.022 18.832 1.00 0.00 ? 4  ASP A HA   12 
ATOM 9876  H HB2  . ASP A 1 4  ? -26.273 18.425 19.218 1.00 0.00 ? 4  ASP A HB2  12 
ATOM 9877  H HB3  . ASP A 1 4  ? -26.540 17.664 17.649 1.00 0.00 ? 4  ASP A HB3  12 
ATOM 9878  N N    . GLN A 1 5  ? -22.989 17.827 16.172 1.00 0.00 ? 5  GLN A N    12 
ATOM 9879  C CA   . GLN A 1 5  ? -22.527 17.134 14.934 1.00 0.00 ? 5  GLN A CA   12 
ATOM 9880  C C    . GLN A 1 5  ? -21.184 16.443 15.187 1.00 0.00 ? 5  GLN A C    12 
ATOM 9881  O O    . GLN A 1 5  ? -20.177 16.792 14.605 1.00 0.00 ? 5  GLN A O    12 
ATOM 9882  C CB   . GLN A 1 5  ? -22.374 18.242 13.892 1.00 0.00 ? 5  GLN A CB   12 
ATOM 9883  C CG   . GLN A 1 5  ? -21.431 19.321 14.426 1.00 0.00 ? 5  GLN A CG   12 
ATOM 9884  C CD   . GLN A 1 5  ? -21.122 20.325 13.314 1.00 0.00 ? 5  GLN A CD   12 
ATOM 9885  O OE1  . GLN A 1 5  ? -21.956 20.592 12.472 1.00 0.00 ? 5  GLN A OE1  12 
ATOM 9886  N NE2  . GLN A 1 5  ? -19.950 20.898 13.275 1.00 0.00 ? 5  GLN A NE2  12 
ATOM 9887  H H    . GLN A 1 5  ? -22.479 18.584 16.528 1.00 0.00 ? 5  GLN A H    12 
ATOM 9888  H HA   . GLN A 1 5  ? -23.264 16.418 14.607 1.00 0.00 ? 5  GLN A HA   12 
ATOM 9889  H HB2  . GLN A 1 5  ? -21.967 17.826 12.982 1.00 0.00 ? 5  GLN A HB2  12 
ATOM 9890  H HB3  . GLN A 1 5  ? -23.341 18.679 13.686 1.00 0.00 ? 5  GLN A HB3  12 
ATOM 9891  H HG2  . GLN A 1 5  ? -21.900 19.832 15.254 1.00 0.00 ? 5  GLN A HG2  12 
ATOM 9892  H HG3  . GLN A 1 5  ? -20.512 18.862 14.762 1.00 0.00 ? 5  GLN A HG3  12 
ATOM 9893  H HE21 . GLN A 1 5  ? -19.277 20.685 13.955 1.00 0.00 ? 5  GLN A HE21 12 
ATOM 9894  H HE22 . GLN A 1 5  ? -19.744 21.543 12.566 1.00 0.00 ? 5  GLN A HE22 12 
ATOM 9895  N N    . GLU A 1 6  ? -21.163 15.465 16.051 1.00 0.00 ? 6  GLU A N    12 
ATOM 9896  C CA   . GLU A 1 6  ? -19.885 14.754 16.341 1.00 0.00 ? 6  GLU A CA   12 
ATOM 9897  C C    . GLU A 1 6  ? -18.858 15.731 16.920 1.00 0.00 ? 6  GLU A C    12 
ATOM 9898  O O    . GLU A 1 6  ? -17.665 15.540 16.794 1.00 0.00 ? 6  GLU A O    12 
ATOM 9899  C CB   . GLU A 1 6  ? -19.416 14.218 14.989 1.00 0.00 ? 6  GLU A CB   12 
ATOM 9900  C CG   . GLU A 1 6  ? -20.589 13.552 14.268 1.00 0.00 ? 6  GLU A CG   12 
ATOM 9901  C CD   . GLU A 1 6  ? -20.108 12.979 12.933 1.00 0.00 ? 6  GLU A CD   12 
ATOM 9902  O OE1  . GLU A 1 6  ? -19.772 13.764 12.061 1.00 0.00 ? 6  GLU A OE1  12 
ATOM 9903  O OE2  . GLU A 1 6  ? -20.085 11.765 12.806 1.00 0.00 ? 6  GLU A OE2  12 
ATOM 9904  H H    . GLU A 1 6  ? -21.987 15.199 16.510 1.00 0.00 ? 6  GLU A H    12 
ATOM 9905  H HA   . GLU A 1 6  ? -20.055 13.936 17.023 1.00 0.00 ? 6  GLU A HA   12 
ATOM 9906  H HB2  . GLU A 1 6  ? -19.041 15.034 14.388 1.00 0.00 ? 6  GLU A HB2  12 
ATOM 9907  H HB3  . GLU A 1 6  ? -18.630 13.493 15.142 1.00 0.00 ? 6  GLU A HB3  12 
ATOM 9908  H HG2  . GLU A 1 6  ? -20.982 12.755 14.881 1.00 0.00 ? 6  GLU A HG2  12 
ATOM 9909  H HG3  . GLU A 1 6  ? -21.363 14.283 14.088 1.00 0.00 ? 6  GLU A HG3  12 
ATOM 9910  N N    . MET A 1 7  ? -19.313 16.776 17.553 1.00 0.00 ? 7  MET A N    12 
ATOM 9911  C CA   . MET A 1 7  ? -18.364 17.766 18.139 1.00 0.00 ? 7  MET A CA   12 
ATOM 9912  C C    . MET A 1 7  ? -17.740 17.203 19.420 1.00 0.00 ? 7  MET A C    12 
ATOM 9913  O O    . MET A 1 7  ? -18.401 16.565 20.214 1.00 0.00 ? 7  MET A O    12 
ATOM 9914  C CB   . MET A 1 7  ? -19.216 18.994 18.453 1.00 0.00 ? 7  MET A CB   12 
ATOM 9915  C CG   . MET A 1 7  ? -19.580 19.709 17.149 1.00 0.00 ? 7  MET A CG   12 
ATOM 9916  S SD   . MET A 1 7  ? -20.227 21.357 17.523 1.00 0.00 ? 7  MET A SD   12 
ATOM 9917  C CE   . MET A 1 7  ? -18.635 22.159 17.838 1.00 0.00 ? 7  MET A CE   12 
ATOM 9918  H H    . MET A 1 7  ? -20.279 16.913 17.643 1.00 0.00 ? 7  MET A H    12 
ATOM 9919  H HA   . MET A 1 7  ? -17.596 18.021 17.427 1.00 0.00 ? 7  MET A HA   12 
ATOM 9920  H HB2  . MET A 1 7  ? -20.119 18.687 18.958 1.00 0.00 ? 7  MET A HB2  12 
ATOM 9921  H HB3  . MET A 1 7  ? -18.659 19.667 19.088 1.00 0.00 ? 7  MET A HB3  12 
ATOM 9922  H HG2  . MET A 1 7  ? -18.699 19.800 16.531 1.00 0.00 ? 7  MET A HG2  12 
ATOM 9923  H HG3  . MET A 1 7  ? -20.331 19.138 16.622 1.00 0.00 ? 7  MET A HG3  12 
ATOM 9924  H HE1  . MET A 1 7  ? -17.976 21.991 16.997 1.00 0.00 ? 7  MET A HE1  12 
ATOM 9925  H HE2  . MET A 1 7  ? -18.789 23.220 17.977 1.00 0.00 ? 7  MET A HE2  12 
ATOM 9926  H HE3  . MET A 1 7  ? -18.191 21.744 18.729 1.00 0.00 ? 7  MET A HE3  12 
ATOM 9927  N N    . CYS A 1 8  ? -16.472 17.436 19.626 1.00 0.00 ? 8  CYS A N    12 
ATOM 9928  C CA   . CYS A 1 8  ? -15.810 16.913 20.855 1.00 0.00 ? 8  CYS A CA   12 
ATOM 9929  C C    . CYS A 1 8  ? -15.861 17.959 21.972 1.00 0.00 ? 8  CYS A C    12 
ATOM 9930  O O    . CYS A 1 8  ? -15.869 17.633 23.141 1.00 0.00 ? 8  CYS A O    12 
ATOM 9931  C CB   . CYS A 1 8  ? -14.363 16.641 20.439 1.00 0.00 ? 8  CYS A CB   12 
ATOM 9932  S SG   . CYS A 1 8  ? -13.595 18.182 19.882 1.00 0.00 ? 8  CYS A SG   12 
ATOM 9933  H H    . CYS A 1 8  ? -15.956 17.952 18.973 1.00 0.00 ? 8  CYS A H    12 
ATOM 9934  H HA   . CYS A 1 8  ? -16.279 15.996 21.175 1.00 0.00 ? 8  CYS A HA   12 
ATOM 9935  H HB2  . CYS A 1 8  ? -13.814 16.249 21.283 1.00 0.00 ? 8  CYS A HB2  12 
ATOM 9936  H HB3  . CYS A 1 8  ? -14.349 15.921 19.635 1.00 0.00 ? 8  CYS A HB3  12 
ATOM 9937  N N    . HIS A 1 9  ? -15.897 19.216 21.619 1.00 0.00 ? 9  HIS A N    12 
ATOM 9938  C CA   . HIS A 1 9  ? -15.949 20.280 22.661 1.00 0.00 ? 9  HIS A CA   12 
ATOM 9939  C C    . HIS A 1 9  ? -14.792 20.110 23.649 1.00 0.00 ? 9  HIS A C    12 
ATOM 9940  O O    . HIS A 1 9  ? -14.873 20.517 24.792 1.00 0.00 ? 9  HIS A O    12 
ATOM 9941  C CB   . HIS A 1 9  ? -17.291 20.079 23.367 1.00 0.00 ? 9  HIS A CB   12 
ATOM 9942  C CG   . HIS A 1 9  ? -18.408 20.213 22.368 1.00 0.00 ? 9  HIS A CG   12 
ATOM 9943  N ND1  . HIS A 1 9  ? -18.541 21.326 21.554 1.00 0.00 ? 9  HIS A ND1  12 
ATOM 9944  C CD2  . HIS A 1 9  ? -19.450 19.382 22.042 1.00 0.00 ? 9  HIS A CD2  12 
ATOM 9945  C CE1  . HIS A 1 9  ? -19.629 21.139 20.785 1.00 0.00 ? 9  HIS A CE1  12 
ATOM 9946  N NE2  . HIS A 1 9  ? -20.220 19.968 21.041 1.00 0.00 ? 9  HIS A NE2  12 
ATOM 9947  H H    . HIS A 1 9  ? -15.891 19.459 20.670 1.00 0.00 ? 9  HIS A H    12 
ATOM 9948  H HA   . HIS A 1 9  ? -15.916 21.257 22.206 1.00 0.00 ? 9  HIS A HA   12 
ATOM 9949  H HB2  . HIS A 1 9  ? -17.320 19.093 23.809 1.00 0.00 ? 9  HIS A HB2  12 
ATOM 9950  H HB3  . HIS A 1 9  ? -17.408 20.824 24.140 1.00 0.00 ? 9  HIS A HB3  12 
ATOM 9951  H HD1  . HIS A 1 9  ? -17.951 22.109 21.541 1.00 0.00 ? 9  HIS A HD1  12 
ATOM 9952  H HD2  . HIS A 1 9  ? -19.643 18.419 22.492 1.00 0.00 ? 9  HIS A HD2  12 
ATOM 9953  H HE1  . HIS A 1 9  ? -19.981 21.847 20.050 1.00 0.00 ? 9  HIS A HE1  12 
ATOM 9954  N N    . GLU A 1 10 ? -13.717 19.510 23.220 1.00 0.00 ? 10 GLU A N    12 
ATOM 9955  C CA   . GLU A 1 10 ? -12.557 19.313 24.135 1.00 0.00 ? 10 GLU A CA   12 
ATOM 9956  C C    . GLU A 1 10 ? -11.423 20.274 23.766 1.00 0.00 ? 10 GLU A C    12 
ATOM 9957  O O    . GLU A 1 10 ? -10.589 20.607 24.585 1.00 0.00 ? 10 GLU A O    12 
ATOM 9958  C CB   . GLU A 1 10 ? -12.122 17.863 23.916 1.00 0.00 ? 10 GLU A CB   12 
ATOM 9959  C CG   . GLU A 1 10 ? -13.129 16.922 24.581 1.00 0.00 ? 10 GLU A CG   12 
ATOM 9960  C CD   . GLU A 1 10 ? -12.772 15.473 24.247 1.00 0.00 ? 10 GLU A CD   12 
ATOM 9961  O OE1  . GLU A 1 10 ? -11.638 15.236 23.868 1.00 0.00 ? 10 GLU A OE1  12 
ATOM 9962  O OE2  . GLU A 1 10 ? -13.640 14.624 24.377 1.00 0.00 ? 10 GLU A OE2  12 
ATOM 9963  H H    . GLU A 1 10 ? -13.671 19.188 22.294 1.00 0.00 ? 10 GLU A H    12 
ATOM 9964  H HA   . GLU A 1 10 ? -12.856 19.458 25.160 1.00 0.00 ? 10 GLU A HA   12 
ATOM 9965  H HB2  . GLU A 1 10 ? -12.081 17.656 22.857 1.00 0.00 ? 10 GLU A HB2  12 
ATOM 9966  H HB3  . GLU A 1 10 ? -11.146 17.710 24.352 1.00 0.00 ? 10 GLU A HB3  12 
ATOM 9967  H HG2  . GLU A 1 10 ? -13.102 17.064 25.651 1.00 0.00 ? 10 GLU A HG2  12 
ATOM 9968  H HG3  . GLU A 1 10 ? -14.122 17.142 24.215 1.00 0.00 ? 10 GLU A HG3  12 
ATOM 9969  N N    . PHE A 1 11 ? -11.385 20.722 22.541 1.00 0.00 ? 11 PHE A N    12 
ATOM 9970  C CA   . PHE A 1 11 ? -10.304 21.659 22.124 1.00 0.00 ? 11 PHE A CA   12 
ATOM 9971  C C    . PHE A 1 11 ? -10.826 23.097 22.109 1.00 0.00 ? 11 PHE A C    12 
ATOM 9972  O O    . PHE A 1 11 ? -10.089 24.030 21.854 1.00 0.00 ? 11 PHE A O    12 
ATOM 9973  C CB   . PHE A 1 11 ? -9.928  21.222 20.710 1.00 0.00 ? 11 PHE A CB   12 
ATOM 9974  C CG   . PHE A 1 11 ? -9.026  20.011 20.774 1.00 0.00 ? 11 PHE A CG   12 
ATOM 9975  C CD1  . PHE A 1 11 ? -9.571  18.738 20.992 1.00 0.00 ? 11 PHE A CD1  12 
ATOM 9976  C CD2  . PHE A 1 11 ? -7.645  20.162 20.609 1.00 0.00 ? 11 PHE A CD2  12 
ATOM 9977  C CE1  . PHE A 1 11 ? -8.733  17.620 21.046 1.00 0.00 ? 11 PHE A CE1  12 
ATOM 9978  C CE2  . PHE A 1 11 ? -6.808  19.042 20.664 1.00 0.00 ? 11 PHE A CE2  12 
ATOM 9979  C CZ   . PHE A 1 11 ? -7.353  17.773 20.881 1.00 0.00 ? 11 PHE A CZ   12 
ATOM 9980  H H    . PHE A 1 11 ? -12.065 20.441 21.895 1.00 0.00 ? 11 PHE A H    12 
ATOM 9981  H HA   . PHE A 1 11 ? -9.452  21.571 22.777 1.00 0.00 ? 11 PHE A HA   12 
ATOM 9982  H HB2  . PHE A 1 11 ? -10.823 20.978 20.161 1.00 0.00 ? 11 PHE A HB2  12 
ATOM 9983  H HB3  . PHE A 1 11 ? -9.411  22.028 20.212 1.00 0.00 ? 11 PHE A HB3  12 
ATOM 9984  H HD1  . PHE A 1 11 ? -10.635 18.620 21.122 1.00 0.00 ? 11 PHE A HD1  12 
ATOM 9985  H HD2  . PHE A 1 11 ? -7.225  21.141 20.441 1.00 0.00 ? 11 PHE A HD2  12 
ATOM 9986  H HE1  . PHE A 1 11 ? -9.151  16.639 21.213 1.00 0.00 ? 11 PHE A HE1  12 
ATOM 9987  H HE2  . PHE A 1 11 ? -5.742  19.159 20.540 1.00 0.00 ? 11 PHE A HE2  12 
ATOM 9988  H HZ   . PHE A 1 11 ? -6.705  16.912 20.925 1.00 0.00 ? 11 PHE A HZ   12 
ATOM 9989  N N    . GLN A 1 12 ? -12.088 23.287 22.372 1.00 0.00 ? 12 GLN A N    12 
ATOM 9990  C CA   . GLN A 1 12 ? -12.646 24.669 22.367 1.00 0.00 ? 12 GLN A CA   12 
ATOM 9991  C C    . GLN A 1 12 ? -11.724 25.610 23.147 1.00 0.00 ? 12 GLN A C    12 
ATOM 9992  O O    . GLN A 1 12 ? -11.463 26.722 22.734 1.00 0.00 ? 12 GLN A O    12 
ATOM 9993  C CB   . GLN A 1 12 ? -14.004 24.557 23.057 1.00 0.00 ? 12 GLN A CB   12 
ATOM 9994  C CG   . GLN A 1 12 ? -14.771 25.869 22.879 1.00 0.00 ? 12 GLN A CG   12 
ATOM 9995  C CD   . GLN A 1 12 ? -16.218 25.680 23.339 1.00 0.00 ? 12 GLN A CD   12 
ATOM 9996  O OE1  . GLN A 1 12 ? -16.600 24.603 23.751 1.00 0.00 ? 12 GLN A OE1  12 
ATOM 9997  N NE2  . GLN A 1 12 ? -17.045 26.687 23.283 1.00 0.00 ? 12 GLN A NE2  12 
ATOM 9998  H H    . GLN A 1 12 ? -12.669 22.523 22.572 1.00 0.00 ? 12 GLN A H    12 
ATOM 9999  H HA   . GLN A 1 12 ? -12.774 25.021 21.355 1.00 0.00 ? 12 GLN A HA   12 
ATOM 10000 H HB2  . GLN A 1 12 ? -14.566 23.748 22.616 1.00 0.00 ? 12 GLN A HB2  12 
ATOM 10001 H HB3  . GLN A 1 12 ? -13.859 24.365 24.110 1.00 0.00 ? 12 GLN A HB3  12 
ATOM 10002 H HG2  . GLN A 1 12 ? -14.303 26.643 23.470 1.00 0.00 ? 12 GLN A HG2  12 
ATOM 10003 H HG3  . GLN A 1 12 ? -14.758 26.154 21.838 1.00 0.00 ? 12 GLN A HG3  12 
ATOM 10004 H HE21 . GLN A 1 12 ? -16.736 27.556 22.950 1.00 0.00 ? 12 GLN A HE21 12 
ATOM 10005 H HE22 . GLN A 1 12 ? -17.973 26.576 23.575 1.00 0.00 ? 12 GLN A HE22 12 
ATOM 10006 N N    . ALA A 1 13 ? -11.227 25.169 24.269 1.00 0.00 ? 13 ALA A N    12 
ATOM 10007 C CA   . ALA A 1 13 ? -10.319 26.037 25.072 1.00 0.00 ? 13 ALA A CA   12 
ATOM 10008 C C    . ALA A 1 13 ? -9.089  26.415 24.246 1.00 0.00 ? 13 ALA A C    12 
ATOM 10009 O O    . ALA A 1 13 ? -8.345  27.309 24.595 1.00 0.00 ? 13 ALA A O    12 
ATOM 10010 C CB   . ALA A 1 13 ? -9.916  25.183 26.274 1.00 0.00 ? 13 ALA A CB   12 
ATOM 10011 H H    . ALA A 1 13 ? -11.446 24.268 24.583 1.00 0.00 ? 13 ALA A H    12 
ATOM 10012 H HA   . ALA A 1 13 ? -10.837 26.921 25.405 1.00 0.00 ? 13 ALA A HA   12 
ATOM 10013 H HB1  . ALA A 1 13 ? -8.848  25.025 26.261 1.00 0.00 ? 13 ALA A HB1  12 
ATOM 10014 H HB2  . ALA A 1 13 ? -10.193 25.692 27.186 1.00 0.00 ? 13 ALA A HB2  12 
ATOM 10015 H HB3  . ALA A 1 13 ? -10.421 24.230 26.224 1.00 0.00 ? 13 ALA A HB3  12 
ATOM 10016 N N    . PHE A 1 14 ? -8.866  25.736 23.154 1.00 0.00 ? 14 PHE A N    12 
ATOM 10017 C CA   . PHE A 1 14 ? -7.683  26.052 22.312 1.00 0.00 ? 14 PHE A CA   12 
ATOM 10018 C C    . PHE A 1 14 ? -8.075  26.987 21.163 1.00 0.00 ? 14 PHE A C    12 
ATOM 10019 O O    . PHE A 1 14 ? -7.381  27.089 20.171 1.00 0.00 ? 14 PHE A O    12 
ATOM 10020 C CB   . PHE A 1 14 ? -7.223  24.700 21.781 1.00 0.00 ? 14 PHE A CB   12 
ATOM 10021 C CG   . PHE A 1 14 ? -6.930  23.784 22.945 1.00 0.00 ? 14 PHE A CG   12 
ATOM 10022 C CD1  . PHE A 1 14 ? -6.313  24.290 24.095 1.00 0.00 ? 14 PHE A CD1  12 
ATOM 10023 C CD2  . PHE A 1 14 ? -7.277  22.431 22.874 1.00 0.00 ? 14 PHE A CD2  12 
ATOM 10024 C CE1  . PHE A 1 14 ? -6.042  23.441 25.174 1.00 0.00 ? 14 PHE A CE1  12 
ATOM 10025 C CE2  . PHE A 1 14 ? -7.005  21.581 23.953 1.00 0.00 ? 14 PHE A CE2  12 
ATOM 10026 C CZ   . PHE A 1 14 ? -6.387  22.086 25.103 1.00 0.00 ? 14 PHE A CZ   12 
ATOM 10027 H H    . PHE A 1 14 ? -9.472  25.013 22.889 1.00 0.00 ? 14 PHE A H    12 
ATOM 10028 H HA   . PHE A 1 14 ? -6.903  26.496 22.910 1.00 0.00 ? 14 PHE A HA   12 
ATOM 10029 H HB2  . PHE A 1 14 ? -8.001  24.268 21.168 1.00 0.00 ? 14 PHE A HB2  12 
ATOM 10030 H HB3  . PHE A 1 14 ? -6.332  24.831 21.191 1.00 0.00 ? 14 PHE A HB3  12 
ATOM 10031 H HD1  . PHE A 1 14 ? -6.049  25.335 24.149 1.00 0.00 ? 14 PHE A HD1  12 
ATOM 10032 H HD2  . PHE A 1 14 ? -7.754  22.041 21.988 1.00 0.00 ? 14 PHE A HD2  12 
ATOM 10033 H HE1  . PHE A 1 14 ? -5.564  23.831 26.061 1.00 0.00 ? 14 PHE A HE1  12 
ATOM 10034 H HE2  . PHE A 1 14 ? -7.272  20.536 23.899 1.00 0.00 ? 14 PHE A HE2  12 
ATOM 10035 H HZ   . PHE A 1 14 ? -6.177  21.432 25.936 1.00 0.00 ? 14 PHE A HZ   12 
ATOM 10036 N N    . MET A 1 15 ? -9.180  27.670 21.288 1.00 0.00 ? 15 MET A N    12 
ATOM 10037 C CA   . MET A 1 15 ? -9.608  28.598 20.208 1.00 0.00 ? 15 MET A CA   12 
ATOM 10038 C C    . MET A 1 15 ? -9.122  30.014 20.508 1.00 0.00 ? 15 MET A C    12 
ATOM 10039 O O    . MET A 1 15 ? -9.747  30.758 21.238 1.00 0.00 ? 15 MET A O    12 
ATOM 10040 C CB   . MET A 1 15 ? -11.130 28.536 20.227 1.00 0.00 ? 15 MET A CB   12 
ATOM 10041 C CG   . MET A 1 15 ? -11.569 27.108 19.921 1.00 0.00 ? 15 MET A CG   12 
ATOM 10042 S SD   . MET A 1 15 ? -13.376 27.010 19.931 1.00 0.00 ? 15 MET A SD   12 
ATOM 10043 C CE   . MET A 1 15 ? -13.660 27.893 18.376 1.00 0.00 ? 15 MET A CE   12 
ATOM 10044 H H    . MET A 1 15 ? -9.729  27.575 22.091 1.00 0.00 ? 15 MET A H    12 
ATOM 10045 H HA   . MET A 1 15 ? -9.236  28.263 19.252 1.00 0.00 ? 15 MET A HA   12 
ATOM 10046 H HB2  . MET A 1 15 ? -11.492 28.826 21.202 1.00 0.00 ? 15 MET A HB2  12 
ATOM 10047 H HB3  . MET A 1 15 ? -11.528 29.205 19.482 1.00 0.00 ? 15 MET A HB3  12 
ATOM 10048 H HG2  . MET A 1 15 ? -11.196 26.820 18.952 1.00 0.00 ? 15 MET A HG2  12 
ATOM 10049 H HG3  . MET A 1 15 ? -11.165 26.446 20.671 1.00 0.00 ? 15 MET A HG3  12 
ATOM 10050 H HE1  . MET A 1 15 ? -12.988 27.514 17.620 1.00 0.00 ? 15 MET A HE1  12 
ATOM 10051 H HE2  . MET A 1 15 ? -14.684 27.744 18.062 1.00 0.00 ? 15 MET A HE2  12 
ATOM 10052 H HE3  . MET A 1 15 ? -13.480 28.945 18.521 1.00 0.00 ? 15 MET A HE3  12 
ATOM 10053 N N    . LYS A 1 16 ? -8.009  30.389 19.950 1.00 0.00 ? 16 LYS A N    12 
ATOM 10054 C CA   . LYS A 1 16 ? -7.473  31.758 20.200 1.00 0.00 ? 16 LYS A CA   12 
ATOM 10055 C C    . LYS A 1 16 ? -8.201  32.779 19.324 1.00 0.00 ? 16 LYS A C    12 
ATOM 10056 O O    . LYS A 1 16 ? -7.877  32.962 18.167 1.00 0.00 ? 16 LYS A O    12 
ATOM 10057 C CB   . LYS A 1 16 ? -5.993  31.683 19.820 1.00 0.00 ? 16 LYS A CB   12 
ATOM 10058 C CG   . LYS A 1 16 ? -5.406  33.094 19.775 1.00 0.00 ? 16 LYS A CG   12 
ATOM 10059 C CD   . LYS A 1 16 ? -3.904  33.014 19.497 1.00 0.00 ? 16 LYS A CD   12 
ATOM 10060 C CE   . LYS A 1 16 ? -3.256  34.365 19.804 1.00 0.00 ? 16 LYS A CE   12 
ATOM 10061 N NZ   . LYS A 1 16 ? -1.810  34.169 19.506 1.00 0.00 ? 16 LYS A NZ   12 
ATOM 10062 H H    . LYS A 1 16 ? -7.525  29.768 19.368 1.00 0.00 ? 16 LYS A H    12 
ATOM 10063 H HA   . LYS A 1 16 ? -7.572  32.018 21.243 1.00 0.00 ? 16 LYS A HA   12 
ATOM 10064 H HB2  . LYS A 1 16 ? -5.462  31.094 20.553 1.00 0.00 ? 16 LYS A HB2  12 
ATOM 10065 H HB3  . LYS A 1 16 ? -5.896  31.220 18.848 1.00 0.00 ? 16 LYS A HB3  12 
ATOM 10066 H HG2  . LYS A 1 16 ? -5.888  33.660 18.992 1.00 0.00 ? 16 LYS A HG2  12 
ATOM 10067 H HG3  . LYS A 1 16 ? -5.571  33.582 20.725 1.00 0.00 ? 16 LYS A HG3  12 
ATOM 10068 H HD2  . LYS A 1 16 ? -3.462  32.252 20.122 1.00 0.00 ? 16 LYS A HD2  12 
ATOM 10069 H HD3  . LYS A 1 16 ? -3.744  32.765 18.458 1.00 0.00 ? 16 LYS A HD3  12 
ATOM 10070 H HE2  . LYS A 1 16 ? -3.671  35.133 19.169 1.00 0.00 ? 16 LYS A HE2  12 
ATOM 10071 H HE3  . LYS A 1 16 ? -3.395  34.619 20.844 1.00 0.00 ? 16 LYS A HE3  12 
ATOM 10072 H HZ1  . LYS A 1 16 ? -1.511  33.232 19.844 1.00 0.00 ? 16 LYS A HZ1  12 
ATOM 10073 H HZ2  . LYS A 1 16 ? -1.654  34.234 18.480 1.00 0.00 ? 16 LYS A HZ2  12 
ATOM 10074 H HZ3  . LYS A 1 16 ? -1.254  34.905 19.985 1.00 0.00 ? 16 LYS A HZ3  12 
ATOM 10075 N N    . ASN A 1 17 ? -9.183  33.445 19.865 1.00 0.00 ? 17 ASN A N    12 
ATOM 10076 C CA   . ASN A 1 17 ? -9.933  34.453 19.061 1.00 0.00 ? 17 ASN A CA   12 
ATOM 10077 C C    . ASN A 1 17 ? -10.602 33.778 17.861 1.00 0.00 ? 17 ASN A C    12 
ATOM 10078 O O    . ASN A 1 17 ? -10.349 34.123 16.724 1.00 0.00 ? 17 ASN A O    12 
ATOM 10079 C CB   . ASN A 1 17 ? -8.874  35.451 18.593 1.00 0.00 ? 17 ASN A CB   12 
ATOM 10080 C CG   . ASN A 1 17 ? -9.555  36.751 18.164 1.00 0.00 ? 17 ASN A CG   12 
ATOM 10081 O OD1  . ASN A 1 17 ? -10.424 36.744 17.316 1.00 0.00 ? 17 ASN A OD1  12 
ATOM 10082 N ND2  . ASN A 1 17 ? -9.194  37.874 18.719 1.00 0.00 ? 17 ASN A ND2  12 
ATOM 10083 H H    . ASN A 1 17 ? -9.430  33.283 20.800 1.00 0.00 ? 17 ASN A H    12 
ATOM 10084 H HA   . ASN A 1 17 ? -10.667 34.953 19.671 1.00 0.00 ? 17 ASN A HA   12 
ATOM 10085 H HB2  . ASN A 1 17 ? -8.188  35.654 19.402 1.00 0.00 ? 17 ASN A HB2  12 
ATOM 10086 H HB3  . ASN A 1 17 ? -8.332  35.036 17.757 1.00 0.00 ? 17 ASN A HB3  12 
ATOM 10087 H HD21 . ASN A 1 17 ? -8.493  37.880 19.405 1.00 0.00 ? 17 ASN A HD21 12 
ATOM 10088 H HD22 . ASN A 1 17 ? -9.624  38.713 18.451 1.00 0.00 ? 17 ASN A HD22 12 
ATOM 10089 N N    . GLY A 1 18 ? -11.452 32.820 18.104 1.00 0.00 ? 18 GLY A N    12 
ATOM 10090 C CA   . GLY A 1 18 ? -12.135 32.125 16.977 1.00 0.00 ? 18 GLY A CA   12 
ATOM 10091 C C    . GLY A 1 18 ? -11.098 31.384 16.130 1.00 0.00 ? 18 GLY A C    12 
ATOM 10092 O O    . GLY A 1 18 ? -11.346 31.035 14.993 1.00 0.00 ? 18 GLY A O    12 
ATOM 10093 H H    . GLY A 1 18 ? -11.641 32.556 19.030 1.00 0.00 ? 18 GLY A H    12 
ATOM 10094 H HA2  . GLY A 1 18 ? -12.850 31.417 17.370 1.00 0.00 ? 18 GLY A HA2  12 
ATOM 10095 H HA3  . GLY A 1 18 ? -12.648 32.852 16.364 1.00 0.00 ? 18 GLY A HA3  12 
ATOM 10096 N N    . LYS A 1 19 ? -9.937  31.141 16.674 1.00 0.00 ? 19 LYS A N    12 
ATOM 10097 C CA   . LYS A 1 19 ? -8.886  30.424 15.901 1.00 0.00 ? 19 LYS A CA   12 
ATOM 10098 C C    . LYS A 1 19 ? -8.376  29.222 16.699 1.00 0.00 ? 19 LYS A C    12 
ATOM 10099 O O    . LYS A 1 19 ? -7.770  29.369 17.743 1.00 0.00 ? 19 LYS A O    12 
ATOM 10100 C CB   . LYS A 1 19 ? -7.774  31.452 15.706 1.00 0.00 ? 19 LYS A CB   12 
ATOM 10101 C CG   . LYS A 1 19 ? -6.862  31.011 14.559 1.00 0.00 ? 19 LYS A CG   12 
ATOM 10102 C CD   . LYS A 1 19 ? -5.919  29.910 15.048 1.00 0.00 ? 19 LYS A CD   12 
ATOM 10103 C CE   . LYS A 1 19 ? -4.929  29.557 13.936 1.00 0.00 ? 19 LYS A CE   12 
ATOM 10104 N NZ   . LYS A 1 19 ? -3.951  30.683 13.923 1.00 0.00 ? 19 LYS A NZ   12 
ATOM 10105 H H    . LYS A 1 19 ? -9.755  31.431 17.593 1.00 0.00 ? 19 LYS A H    12 
ATOM 10106 H HA   . LYS A 1 19 ? -9.269  30.108 14.943 1.00 0.00 ? 19 LYS A HA   12 
ATOM 10107 H HB2  . LYS A 1 19 ? -8.210  32.412 15.470 1.00 0.00 ? 19 LYS A HB2  12 
ATOM 10108 H HB3  . LYS A 1 19 ? -7.198  31.534 16.616 1.00 0.00 ? 19 LYS A HB3  12 
ATOM 10109 H HG2  . LYS A 1 19 ? -7.465  30.633 13.747 1.00 0.00 ? 19 LYS A HG2  12 
ATOM 10110 H HG3  . LYS A 1 19 ? -6.283  31.855 14.215 1.00 0.00 ? 19 LYS A HG3  12 
ATOM 10111 H HD2  . LYS A 1 19 ? -5.379  30.258 15.916 1.00 0.00 ? 19 LYS A HD2  12 
ATOM 10112 H HD3  . LYS A 1 19 ? -6.494  29.034 15.310 1.00 0.00 ? 19 LYS A HD3  12 
ATOM 10113 H HE2  . LYS A 1 19 ? -4.428  28.627 14.160 1.00 0.00 ? 19 LYS A HE2  12 
ATOM 10114 H HE3  . LYS A 1 19 ? -5.438  29.491 12.986 1.00 0.00 ? 19 LYS A HE3  12 
ATOM 10115 H HZ1  . LYS A 1 19 ? -4.428  31.559 14.217 1.00 0.00 ? 19 LYS A HZ1  12 
ATOM 10116 H HZ2  . LYS A 1 19 ? -3.172  30.473 14.579 1.00 0.00 ? 19 LYS A HZ2  12 
ATOM 10117 H HZ3  . LYS A 1 19 ? -3.570  30.800 12.963 1.00 0.00 ? 19 LYS A HZ3  12 
ATOM 10118 N N    . LEU A 1 20 ? -8.619  28.033 16.219 1.00 0.00 ? 20 LEU A N    12 
ATOM 10119 C CA   . LEU A 1 20 ? -8.153  26.822 16.954 1.00 0.00 ? 20 LEU A CA   12 
ATOM 10120 C C    . LEU A 1 20 ? -6.691  26.518 16.613 1.00 0.00 ? 20 LEU A C    12 
ATOM 10121 O O    . LEU A 1 20 ? -6.359  26.207 15.486 1.00 0.00 ? 20 LEU A O    12 
ATOM 10122 C CB   . LEU A 1 20 ? -9.061  25.693 16.465 1.00 0.00 ? 20 LEU A CB   12 
ATOM 10123 C CG   . LEU A 1 20 ? -9.025  24.534 17.464 1.00 0.00 ? 20 LEU A CG   12 
ATOM 10124 C CD1  . LEU A 1 20 ? -9.867  23.373 16.929 1.00 0.00 ? 20 LEU A CD1  12 
ATOM 10125 C CD2  . LEU A 1 20 ? -7.579  24.068 17.655 1.00 0.00 ? 20 LEU A CD2  12 
ATOM 10126 H H    . LEU A 1 20 ? -9.111  27.937 15.378 1.00 0.00 ? 20 LEU A H    12 
ATOM 10127 H HA   . LEU A 1 20 ? -8.273  26.957 18.017 1.00 0.00 ? 20 LEU A HA   12 
ATOM 10128 H HB2  . LEU A 1 20 ? -10.074 26.060 16.378 1.00 0.00 ? 20 LEU A HB2  12 
ATOM 10129 H HB3  . LEU A 1 20 ? -8.720  25.348 15.501 1.00 0.00 ? 20 LEU A HB3  12 
ATOM 10130 H HG   . LEU A 1 20 ? -9.425  24.863 18.412 1.00 0.00 ? 20 LEU A HG   12 
ATOM 10131 H HD11 . LEU A 1 20 ? -10.638 23.759 16.278 1.00 0.00 ? 20 LEU A HD11 12 
ATOM 10132 H HD12 . LEU A 1 20 ? -9.235  22.695 16.377 1.00 0.00 ? 20 LEU A HD12 12 
ATOM 10133 H HD13 . LEU A 1 20 ? -10.323 22.849 17.756 1.00 0.00 ? 20 LEU A HD13 12 
ATOM 10134 H HD21 . LEU A 1 20 ? -7.048  24.149 16.718 1.00 0.00 ? 20 LEU A HD21 12 
ATOM 10135 H HD22 . LEU A 1 20 ? -7.097  24.688 18.397 1.00 0.00 ? 20 LEU A HD22 12 
ATOM 10136 H HD23 . LEU A 1 20 ? -7.573  23.040 17.984 1.00 0.00 ? 20 LEU A HD23 12 
ATOM 10137 N N    . PHE A 1 21 ? -5.817  26.591 17.580 1.00 0.00 ? 21 PHE A N    12 
ATOM 10138 C CA   . PHE A 1 21 ? -4.381  26.288 17.304 1.00 0.00 ? 21 PHE A CA   12 
ATOM 10139 C C    . PHE A 1 21 ? -4.049  24.873 17.788 1.00 0.00 ? 21 PHE A C    12 
ATOM 10140 O O    . PHE A 1 21 ? -3.407  24.683 18.800 1.00 0.00 ? 21 PHE A O    12 
ATOM 10141 C CB   . PHE A 1 21 ? -3.564  27.338 18.072 1.00 0.00 ? 21 PHE A CB   12 
ATOM 10142 C CG   . PHE A 1 21 ? -4.137  27.554 19.455 1.00 0.00 ? 21 PHE A CG   12 
ATOM 10143 C CD1  . PHE A 1 21 ? -3.711  26.756 20.525 1.00 0.00 ? 21 PHE A CD1  12 
ATOM 10144 C CD2  . PHE A 1 21 ? -5.087  28.560 19.668 1.00 0.00 ? 21 PHE A CD2  12 
ATOM 10145 C CE1  . PHE A 1 21 ? -4.237  26.964 21.806 1.00 0.00 ? 21 PHE A CE1  12 
ATOM 10146 C CE2  . PHE A 1 21 ? -5.612  28.767 20.950 1.00 0.00 ? 21 PHE A CE2  12 
ATOM 10147 C CZ   . PHE A 1 21 ? -5.188  27.969 22.018 1.00 0.00 ? 21 PHE A CZ   12 
ATOM 10148 H H    . PHE A 1 21 ? -6.108  26.832 18.484 1.00 0.00 ? 21 PHE A H    12 
ATOM 10149 H HA   . PHE A 1 21 ? -4.182  26.373 16.247 1.00 0.00 ? 21 PHE A HA   12 
ATOM 10150 H HB2  . PHE A 1 21 ? -2.542  27.001 18.158 1.00 0.00 ? 21 PHE A HB2  12 
ATOM 10151 H HB3  . PHE A 1 21 ? -3.587  28.271 17.528 1.00 0.00 ? 21 PHE A HB3  12 
ATOM 10152 H HD1  . PHE A 1 21 ? -2.978  25.981 20.364 1.00 0.00 ? 21 PHE A HD1  12 
ATOM 10153 H HD2  . PHE A 1 21 ? -5.415  29.177 18.844 1.00 0.00 ? 21 PHE A HD2  12 
ATOM 10154 H HE1  . PHE A 1 21 ? -3.910  26.348 22.630 1.00 0.00 ? 21 PHE A HE1  12 
ATOM 10155 H HE2  . PHE A 1 21 ? -6.346  29.543 21.114 1.00 0.00 ? 21 PHE A HE2  12 
ATOM 10156 H HZ   . PHE A 1 21 ? -5.593  28.129 23.007 1.00 0.00 ? 21 PHE A HZ   12 
ATOM 10157 N N    . CYS A 1 22 ? -4.488  23.879 17.066 1.00 0.00 ? 22 CYS A N    12 
ATOM 10158 C CA   . CYS A 1 22 ? -4.211  22.472 17.476 1.00 0.00 ? 22 CYS A CA   12 
ATOM 10159 C C    . CYS A 1 22 ? -2.699  22.210 17.628 1.00 0.00 ? 22 CYS A C    12 
ATOM 10160 O O    . CYS A 1 22 ? -2.295  21.561 18.571 1.00 0.00 ? 22 CYS A O    12 
ATOM 10161 C CB   . CYS A 1 22 ? -4.821  21.603 16.368 1.00 0.00 ? 22 CYS A CB   12 
ATOM 10162 S SG   . CYS A 1 22 ? -4.186  19.911 16.495 1.00 0.00 ? 22 CYS A SG   12 
ATOM 10163 H H    . CYS A 1 22 ? -5.007  24.058 16.254 1.00 0.00 ? 22 CYS A H    12 
ATOM 10164 H HA   . CYS A 1 22 ? -4.710  22.262 18.408 1.00 0.00 ? 22 CYS A HA   12 
ATOM 10165 H HB2  . CYS A 1 22 ? -5.894  21.589 16.479 1.00 0.00 ? 22 CYS A HB2  12 
ATOM 10166 H HB3  . CYS A 1 22 ? -4.569  22.010 15.405 1.00 0.00 ? 22 CYS A HB3  12 
ATOM 10167 N N    . PRO A 1 23 ? -1.897  22.703 16.708 1.00 0.00 ? 23 PRO A N    12 
ATOM 10168 C CA   . PRO A 1 23 ? -0.433  22.478 16.795 1.00 0.00 ? 23 PRO A CA   12 
ATOM 10169 C C    . PRO A 1 23 ? 0.160   23.177 18.024 1.00 0.00 ? 23 PRO A C    12 
ATOM 10170 O O    . PRO A 1 23 ? 0.805   24.201 17.913 1.00 0.00 ? 23 PRO A O    12 
ATOM 10171 C CB   . PRO A 1 23 ? 0.086   23.119 15.504 1.00 0.00 ? 23 PRO A CB   12 
ATOM 10172 C CG   . PRO A 1 23 ? -1.109  23.696 14.723 1.00 0.00 ? 23 PRO A CG   12 
ATOM 10173 C CD   . PRO A 1 23 ? -2.385  23.491 15.548 1.00 0.00 ? 23 PRO A CD   12 
ATOM 10174 H HA   . PRO A 1 23 ? -0.205  21.425 16.802 1.00 0.00 ? 23 PRO A HA   12 
ATOM 10175 H HB2  . PRO A 1 23 ? 0.779   23.911 15.745 1.00 0.00 ? 23 PRO A HB2  12 
ATOM 10176 H HB3  . PRO A 1 23 ? 0.585   22.372 14.905 1.00 0.00 ? 23 PRO A HB3  12 
ATOM 10177 H HG2  . PRO A 1 23 ? -0.954  24.751 14.552 1.00 0.00 ? 23 PRO A HG2  12 
ATOM 10178 H HG3  . PRO A 1 23 ? -1.204  23.185 13.776 1.00 0.00 ? 23 PRO A HG3  12 
ATOM 10179 H HD2  . PRO A 1 23 ? -2.784  24.441 15.868 1.00 0.00 ? 23 PRO A HD2  12 
ATOM 10180 H HD3  . PRO A 1 23 ? -3.115  22.936 14.984 1.00 0.00 ? 23 PRO A HD3  12 
ATOM 10181 N N    . GLN A 1 24 ? -0.039  22.631 19.195 1.00 0.00 ? 24 GLN A N    12 
ATOM 10182 C CA   . GLN A 1 24 ? 0.529   23.266 20.415 1.00 0.00 ? 24 GLN A CA   12 
ATOM 10183 C C    . GLN A 1 24 ? 1.487   22.284 21.105 1.00 0.00 ? 24 GLN A C    12 
ATOM 10184 O O    . GLN A 1 24 ? 2.524   21.945 20.570 1.00 0.00 ? 24 GLN A O    12 
ATOM 10185 C CB   . GLN A 1 24 ? -0.680  23.590 21.300 1.00 0.00 ? 24 GLN A CB   12 
ATOM 10186 C CG   . GLN A 1 24 ? -1.583  22.358 21.424 1.00 0.00 ? 24 GLN A CG   12 
ATOM 10187 C CD   . GLN A 1 24 ? -2.506  22.525 22.633 1.00 0.00 ? 24 GLN A CD   12 
ATOM 10188 O OE1  . GLN A 1 24 ? -3.684  22.780 22.482 1.00 0.00 ? 24 GLN A OE1  12 
ATOM 10189 N NE2  . GLN A 1 24 ? -2.017  22.391 23.836 1.00 0.00 ? 24 GLN A NE2  12 
ATOM 10190 H H    . GLN A 1 24 ? -0.553  21.801 19.272 1.00 0.00 ? 24 GLN A H    12 
ATOM 10191 H HA   . GLN A 1 24 ? 1.049   24.175 20.156 1.00 0.00 ? 24 GLN A HA   12 
ATOM 10192 H HB2  . GLN A 1 24 ? -0.338  23.885 22.281 1.00 0.00 ? 24 GLN A HB2  12 
ATOM 10193 H HB3  . GLN A 1 24 ? -1.240  24.401 20.857 1.00 0.00 ? 24 GLN A HB3  12 
ATOM 10194 H HG2  . GLN A 1 24 ? -2.178  22.255 20.532 1.00 0.00 ? 24 GLN A HG2  12 
ATOM 10195 H HG3  . GLN A 1 24 ? -0.974  21.475 21.556 1.00 0.00 ? 24 GLN A HG3  12 
ATOM 10196 H HE21 . GLN A 1 24 ? -1.067  22.186 23.959 1.00 0.00 ? 24 GLN A HE21 12 
ATOM 10197 H HE22 . GLN A 1 24 ? -2.601  22.497 24.617 1.00 0.00 ? 24 GLN A HE22 12 
ATOM 10198 N N    . ASP A 1 25 ? 1.154   21.817 22.277 1.00 0.00 ? 25 ASP A N    12 
ATOM 10199 C CA   . ASP A 1 25 ? 2.050   20.855 22.978 1.00 0.00 ? 25 ASP A CA   12 
ATOM 10200 C C    . ASP A 1 25 ? 1.559   19.424 22.746 1.00 0.00 ? 25 ASP A C    12 
ATOM 10201 O O    . ASP A 1 25 ? 1.082   18.769 23.649 1.00 0.00 ? 25 ASP A O    12 
ATOM 10202 C CB   . ASP A 1 25 ? 1.937   21.226 24.455 1.00 0.00 ? 25 ASP A CB   12 
ATOM 10203 C CG   . ASP A 1 25 ? 2.612   20.148 25.306 1.00 0.00 ? 25 ASP A CG   12 
ATOM 10204 O OD1  . ASP A 1 25 ? 3.640   19.646 24.883 1.00 0.00 ? 25 ASP A OD1  12 
ATOM 10205 O OD2  . ASP A 1 25 ? 2.088   19.843 26.365 1.00 0.00 ? 25 ASP A OD2  12 
ATOM 10206 H H    . ASP A 1 25 ? 0.318   22.092 22.697 1.00 0.00 ? 25 ASP A H    12 
ATOM 10207 H HA   . ASP A 1 25 ? 3.069   20.969 22.643 1.00 0.00 ? 25 ASP A HA   12 
ATOM 10208 H HB2  . ASP A 1 25 ? 2.420   22.176 24.626 1.00 0.00 ? 25 ASP A HB2  12 
ATOM 10209 H HB3  . ASP A 1 25 ? 0.893   21.298 24.726 1.00 0.00 ? 25 ASP A HB3  12 
ATOM 10210 N N    . LYS A 1 26 ? 1.667   18.935 21.541 1.00 0.00 ? 26 LYS A N    12 
ATOM 10211 C CA   . LYS A 1 26 ? 1.197   17.548 21.253 1.00 0.00 ? 26 LYS A CA   12 
ATOM 10212 C C    . LYS A 1 26 ? 2.028   16.516 22.025 1.00 0.00 ? 26 LYS A C    12 
ATOM 10213 O O    . LYS A 1 26 ? 1.732   15.337 22.006 1.00 0.00 ? 26 LYS A O    12 
ATOM 10214 C CB   . LYS A 1 26 ? 1.383   17.373 19.746 1.00 0.00 ? 26 LYS A CB   12 
ATOM 10215 C CG   . LYS A 1 26 ? 0.240   18.077 19.011 1.00 0.00 ? 26 LYS A CG   12 
ATOM 10216 C CD   . LYS A 1 26 ? 0.247   17.663 17.539 1.00 0.00 ? 26 LYS A CD   12 
ATOM 10217 C CE   . LYS A 1 26 ? -0.887  18.382 16.804 1.00 0.00 ? 26 LYS A CE   12 
ATOM 10218 N NZ   . LYS A 1 26 ? -0.762  17.939 15.387 1.00 0.00 ? 26 LYS A NZ   12 
ATOM 10219 H H    . LYS A 1 26 ? 2.052   19.480 20.824 1.00 0.00 ? 26 LYS A H    12 
ATOM 10220 H HA   . LYS A 1 26 ? 0.153   17.450 21.505 1.00 0.00 ? 26 LYS A HA   12 
ATOM 10221 H HB2  . LYS A 1 26 ? 2.326   17.807 19.447 1.00 0.00 ? 26 LYS A HB2  12 
ATOM 10222 H HB3  . LYS A 1 26 ? 1.376   16.322 19.501 1.00 0.00 ? 26 LYS A HB3  12 
ATOM 10223 H HG2  . LYS A 1 26 ? -0.703  17.796 19.460 1.00 0.00 ? 26 LYS A HG2  12 
ATOM 10224 H HG3  . LYS A 1 26 ? 0.368   19.146 19.085 1.00 0.00 ? 26 LYS A HG3  12 
ATOM 10225 H HD2  . LYS A 1 26 ? 1.193   17.933 17.094 1.00 0.00 ? 26 LYS A HD2  12 
ATOM 10226 H HD3  . LYS A 1 26 ? 0.104   16.595 17.465 1.00 0.00 ? 26 LYS A HD3  12 
ATOM 10227 H HE2  . LYS A 1 26 ? -1.843  18.085 17.208 1.00 0.00 ? 26 LYS A HE2  12 
ATOM 10228 H HE3  . LYS A 1 26 ? -0.763  19.452 16.875 1.00 0.00 ? 26 LYS A HE3  12 
ATOM 10229 H HZ1  . LYS A 1 26 ? 0.229   18.017 15.085 1.00 0.00 ? 26 LYS A HZ1  12 
ATOM 10230 H HZ2  . LYS A 1 26 ? -1.071  16.951 15.303 1.00 0.00 ? 26 LYS A HZ2  12 
ATOM 10231 H HZ3  . LYS A 1 26 ? -1.358  18.541 14.783 1.00 0.00 ? 26 LYS A HZ3  12 
ATOM 10232 N N    . LYS A 1 27 ? 3.059   16.943 22.705 1.00 0.00 ? 27 LYS A N    12 
ATOM 10233 C CA   . LYS A 1 27 ? 3.896   15.981 23.477 1.00 0.00 ? 27 LYS A CA   12 
ATOM 10234 C C    . LYS A 1 27 ? 3.007   14.958 24.194 1.00 0.00 ? 27 LYS A C    12 
ATOM 10235 O O    . LYS A 1 27 ? 3.417   13.847 24.461 1.00 0.00 ? 27 LYS A O    12 
ATOM 10236 C CB   . LYS A 1 27 ? 4.649   16.843 24.490 1.00 0.00 ? 27 LYS A CB   12 
ATOM 10237 C CG   . LYS A 1 27 ? 5.798   17.569 23.787 1.00 0.00 ? 27 LYS A CG   12 
ATOM 10238 C CD   . LYS A 1 27 ? 6.491   18.508 24.777 1.00 0.00 ? 27 LYS A CD   12 
ATOM 10239 C CE   . LYS A 1 27 ? 7.566   19.316 24.047 1.00 0.00 ? 27 LYS A CE   12 
ATOM 10240 N NZ   . LYS A 1 27 ? 8.279   20.061 25.122 1.00 0.00 ? 27 LYS A NZ   12 
ATOM 10241 H H    . LYS A 1 27 ? 3.284   17.896 22.711 1.00 0.00 ? 27 LYS A H    12 
ATOM 10242 H HA   . LYS A 1 27 ? 4.596   15.482 22.826 1.00 0.00 ? 27 LYS A HA   12 
ATOM 10243 H HB2  . LYS A 1 27 ? 3.973   17.568 24.919 1.00 0.00 ? 27 LYS A HB2  12 
ATOM 10244 H HB3  . LYS A 1 27 ? 5.044   16.215 25.272 1.00 0.00 ? 27 LYS A HB3  12 
ATOM 10245 H HG2  . LYS A 1 27 ? 6.510   16.844 23.420 1.00 0.00 ? 27 LYS A HG2  12 
ATOM 10246 H HG3  . LYS A 1 27 ? 5.409   18.141 22.959 1.00 0.00 ? 27 LYS A HG3  12 
ATOM 10247 H HD2  . LYS A 1 27 ? 5.762   19.182 25.204 1.00 0.00 ? 27 LYS A HD2  12 
ATOM 10248 H HD3  . LYS A 1 27 ? 6.948   17.927 25.564 1.00 0.00 ? 27 LYS A HD3  12 
ATOM 10249 H HE2  . LYS A 1 27 ? 8.247   18.655 23.532 1.00 0.00 ? 27 LYS A HE2  12 
ATOM 10250 H HE3  . LYS A 1 27 ? 7.111   20.005 23.350 1.00 0.00 ? 27 LYS A HE3  12 
ATOM 10251 H HZ1  . LYS A 1 27 ? 7.612   20.284 25.889 1.00 0.00 ? 27 LYS A HZ1  12 
ATOM 10252 H HZ2  . LYS A 1 27 ? 9.054   19.476 25.495 1.00 0.00 ? 27 LYS A HZ2  12 
ATOM 10253 H HZ3  . LYS A 1 27 ? 8.670   20.943 24.734 1.00 0.00 ? 27 LYS A HZ3  12 
ATOM 10254 N N    . PHE A 1 28 ? 1.792   15.324 24.502 1.00 0.00 ? 28 PHE A N    12 
ATOM 10255 C CA   . PHE A 1 28 ? 0.879   14.371 25.194 1.00 0.00 ? 28 PHE A CA   12 
ATOM 10256 C C    . PHE A 1 28 ? 0.963   12.989 24.537 1.00 0.00 ? 28 PHE A C    12 
ATOM 10257 O O    . PHE A 1 28 ? 0.685   11.979 25.154 1.00 0.00 ? 28 PHE A O    12 
ATOM 10258 C CB   . PHE A 1 28 ? -0.518  14.962 25.013 1.00 0.00 ? 28 PHE A CB   12 
ATOM 10259 C CG   . PHE A 1 28 ? -0.565  16.353 25.600 1.00 0.00 ? 28 PHE A CG   12 
ATOM 10260 C CD1  . PHE A 1 28 ? -0.363  16.543 26.971 1.00 0.00 ? 28 PHE A CD1  12 
ATOM 10261 C CD2  . PHE A 1 28 ? -0.815  17.452 24.771 1.00 0.00 ? 28 PHE A CD2  12 
ATOM 10262 C CE1  . PHE A 1 28 ? -0.412  17.834 27.514 1.00 0.00 ? 28 PHE A CE1  12 
ATOM 10263 C CE2  . PHE A 1 28 ? -0.864  18.742 25.311 1.00 0.00 ? 28 PHE A CE2  12 
ATOM 10264 C CZ   . PHE A 1 28 ? -0.662  18.933 26.683 1.00 0.00 ? 28 PHE A CZ   12 
ATOM 10265 H H    . PHE A 1 28 ? 1.477   16.223 24.276 1.00 0.00 ? 28 PHE A H    12 
ATOM 10266 H HA   . PHE A 1 28 ? 1.122   14.308 26.243 1.00 0.00 ? 28 PHE A HA   12 
ATOM 10267 H HB2  . PHE A 1 28 ? -0.755  15.008 23.960 1.00 0.00 ? 28 PHE A HB2  12 
ATOM 10268 H HB3  . PHE A 1 28 ? -1.240  14.336 25.515 1.00 0.00 ? 28 PHE A HB3  12 
ATOM 10269 H HD1  . PHE A 1 28 ? -0.170  15.695 27.612 1.00 0.00 ? 28 PHE A HD1  12 
ATOM 10270 H HD2  . PHE A 1 28 ? -0.968  17.306 23.712 1.00 0.00 ? 28 PHE A HD2  12 
ATOM 10271 H HE1  . PHE A 1 28 ? -0.258  17.980 28.572 1.00 0.00 ? 28 PHE A HE1  12 
ATOM 10272 H HE2  . PHE A 1 28 ? -1.057  19.591 24.669 1.00 0.00 ? 28 PHE A HE2  12 
ATOM 10273 H HZ   . PHE A 1 28 ? -0.700  19.929 27.100 1.00 0.00 ? 28 PHE A HZ   12 
ATOM 10274 N N    . PHE A 1 29 ? 1.343   12.939 23.289 1.00 0.00 ? 29 PHE A N    12 
ATOM 10275 C CA   . PHE A 1 29 ? 1.445   11.627 22.584 1.00 0.00 ? 29 PHE A CA   12 
ATOM 10276 C C    . PHE A 1 29 ? 2.113   10.578 23.479 1.00 0.00 ? 29 PHE A C    12 
ATOM 10277 O O    . PHE A 1 29 ? 1.927   9.390  23.303 1.00 0.00 ? 29 PHE A O    12 
ATOM 10278 C CB   . PHE A 1 29 ? 2.309   11.910 21.355 1.00 0.00 ? 29 PHE A CB   12 
ATOM 10279 C CG   . PHE A 1 29 ? 2.309   10.703 20.448 1.00 0.00 ? 29 PHE A CG   12 
ATOM 10280 C CD1  . PHE A 1 29 ? 2.955   9.528  20.848 1.00 0.00 ? 29 PHE A CD1  12 
ATOM 10281 C CD2  . PHE A 1 29 ? 1.666   10.761 19.207 1.00 0.00 ? 29 PHE A CD2  12 
ATOM 10282 C CE1  . PHE A 1 29 ? 2.956   8.409  20.008 1.00 0.00 ? 29 PHE A CE1  12 
ATOM 10283 C CE2  . PHE A 1 29 ? 1.667   9.642  18.365 1.00 0.00 ? 29 PHE A CE2  12 
ATOM 10284 C CZ   . PHE A 1 29 ? 2.312   8.466  18.766 1.00 0.00 ? 29 PHE A CZ   12 
ATOM 10285 H H    . PHE A 1 29 ? 1.559   13.767 22.811 1.00 0.00 ? 29 PHE A H    12 
ATOM 10286 H HA   . PHE A 1 29 ? 0.468   11.290 22.274 1.00 0.00 ? 29 PHE A HA   12 
ATOM 10287 H HB2  . PHE A 1 29 ? 1.911   12.761 20.823 1.00 0.00 ? 29 PHE A HB2  12 
ATOM 10288 H HB3  . PHE A 1 29 ? 3.320   12.124 21.669 1.00 0.00 ? 29 PHE A HB3  12 
ATOM 10289 H HD1  . PHE A 1 29 ? 3.452   9.485  21.807 1.00 0.00 ? 29 PHE A HD1  12 
ATOM 10290 H HD2  . PHE A 1 29 ? 1.167   11.668 18.898 1.00 0.00 ? 29 PHE A HD2  12 
ATOM 10291 H HE1  . PHE A 1 29 ? 3.454   7.502  20.317 1.00 0.00 ? 29 PHE A HE1  12 
ATOM 10292 H HE2  . PHE A 1 29 ? 1.170   9.687  17.407 1.00 0.00 ? 29 PHE A HE2  12 
ATOM 10293 H HZ   . PHE A 1 29 ? 2.314   7.603  18.117 1.00 0.00 ? 29 PHE A HZ   12 
ATOM 10294 N N    . GLN A 1 30 ? 2.896   11.004 24.432 1.00 0.00 ? 30 GLN A N    12 
ATOM 10295 C CA   . GLN A 1 30 ? 3.580   10.028 25.331 1.00 0.00 ? 30 GLN A CA   12 
ATOM 10296 C C    . GLN A 1 30 ? 2.568   9.328  26.245 1.00 0.00 ? 30 GLN A C    12 
ATOM 10297 O O    . GLN A 1 30 ? 2.921   8.462  27.022 1.00 0.00 ? 30 GLN A O    12 
ATOM 10298 C CB   . GLN A 1 30 ? 4.552   10.871 26.156 1.00 0.00 ? 30 GLN A CB   12 
ATOM 10299 C CG   . GLN A 1 30 ? 3.765   11.809 27.072 1.00 0.00 ? 30 GLN A CG   12 
ATOM 10300 C CD   . GLN A 1 30 ? 4.738   12.683 27.867 1.00 0.00 ? 30 GLN A CD   12 
ATOM 10301 O OE1  . GLN A 1 30 ? 5.638   12.179 28.511 1.00 0.00 ? 30 GLN A OE1  12 
ATOM 10302 N NE2  . GLN A 1 30 ? 4.595   13.979 27.849 1.00 0.00 ? 30 GLN A NE2  12 
ATOM 10303 H H    . GLN A 1 30 ? 3.040   11.963 24.555 1.00 0.00 ? 30 GLN A H    12 
ATOM 10304 H HA   . GLN A 1 30 ? 4.126   9.303  24.750 1.00 0.00 ? 30 GLN A HA   12 
ATOM 10305 H HB2  . GLN A 1 30 ? 5.174   10.222 26.753 1.00 0.00 ? 30 GLN A HB2  12 
ATOM 10306 H HB3  . GLN A 1 30 ? 5.175   11.454 25.493 1.00 0.00 ? 30 GLN A HB3  12 
ATOM 10307 H HG2  . GLN A 1 30 ? 3.122   12.439 26.476 1.00 0.00 ? 30 GLN A HG2  12 
ATOM 10308 H HG3  . GLN A 1 30 ? 3.165   11.225 27.754 1.00 0.00 ? 30 GLN A HG3  12 
ATOM 10309 H HE21 . GLN A 1 30 ? 3.868   14.384 27.329 1.00 0.00 ? 30 GLN A HE21 12 
ATOM 10310 H HE22 . GLN A 1 30 ? 5.212   14.547 28.353 1.00 0.00 ? 30 GLN A HE22 12 
ATOM 10311 N N    . SER A 1 31 ? 1.315   9.692  26.167 1.00 0.00 ? 31 SER A N    12 
ATOM 10312 C CA   . SER A 1 31 ? 0.299   9.038  27.042 1.00 0.00 ? 31 SER A CA   12 
ATOM 10313 C C    . SER A 1 31 ? -0.981  8.751  26.253 1.00 0.00 ? 31 SER A C    12 
ATOM 10314 O O    . SER A 1 31 ? -1.299  9.431  25.298 1.00 0.00 ? 31 SER A O    12 
ATOM 10315 C CB   . SER A 1 31 ? 0.025   10.050 28.155 1.00 0.00 ? 31 SER A CB   12 
ATOM 10316 O OG   . SER A 1 31 ? -1.005  9.557  28.999 1.00 0.00 ? 31 SER A OG   12 
ATOM 10317 H H    . SER A 1 31 ? 1.044   10.394 25.538 1.00 0.00 ? 31 SER A H    12 
ATOM 10318 H HA   . SER A 1 31 ? 0.695   8.127  27.463 1.00 0.00 ? 31 SER A HA   12 
ATOM 10319 H HB2  . SER A 1 31 ? 0.924   10.199 28.733 1.00 0.00 ? 31 SER A HB2  12 
ATOM 10320 H HB3  . SER A 1 31 ? -0.283  10.988 27.719 1.00 0.00 ? 31 SER A HB3  12 
ATOM 10321 H HG   . SER A 1 31 ? -1.846  9.711  28.561 1.00 0.00 ? 31 SER A HG   12 
ATOM 10322 N N    . LEU A 1 32 ? -1.721  7.749  26.647 1.00 0.00 ? 32 LEU A N    12 
ATOM 10323 C CA   . LEU A 1 32 ? -2.982  7.424  25.919 1.00 0.00 ? 32 LEU A CA   12 
ATOM 10324 C C    . LEU A 1 32 ? -3.842  8.677  25.779 1.00 0.00 ? 32 LEU A C    12 
ATOM 10325 O O    . LEU A 1 32 ? -4.336  8.989  24.713 1.00 0.00 ? 32 LEU A O    12 
ATOM 10326 C CB   . LEU A 1 32 ? -3.689  6.386  26.788 1.00 0.00 ? 32 LEU A CB   12 
ATOM 10327 C CG   . LEU A 1 32 ? -4.546  5.479  25.903 1.00 0.00 ? 32 LEU A CG   12 
ATOM 10328 C CD1  . LEU A 1 32 ? -4.862  4.183  26.652 1.00 0.00 ? 32 LEU A CD1  12 
ATOM 10329 C CD2  . LEU A 1 32 ? -5.850  6.196  25.550 1.00 0.00 ? 32 LEU A CD2  12 
ATOM 10330 H H    . LEU A 1 32 ? -1.449  7.213  27.421 1.00 0.00 ? 32 LEU A H    12 
ATOM 10331 H HA   . LEU A 1 32 ? -2.761  7.008  24.953 1.00 0.00 ? 32 LEU A HA   12 
ATOM 10332 H HB2  . LEU A 1 32 ? -2.955  5.791  27.311 1.00 0.00 ? 32 LEU A HB2  12 
ATOM 10333 H HB3  . LEU A 1 32 ? -4.321  6.890  27.504 1.00 0.00 ? 32 LEU A HB3  12 
ATOM 10334 H HG   . LEU A 1 32 ? -4.006  5.247  24.996 1.00 0.00 ? 32 LEU A HG   12 
ATOM 10335 H HD11 . LEU A 1 32 ? -3.946  3.755  27.033 1.00 0.00 ? 32 LEU A HD11 12 
ATOM 10336 H HD12 . LEU A 1 32 ? -5.528  4.398  27.475 1.00 0.00 ? 32 LEU A HD12 12 
ATOM 10337 H HD13 . LEU A 1 32 ? -5.334  3.484  25.979 1.00 0.00 ? 32 LEU A HD13 12 
ATOM 10338 H HD21 . LEU A 1 32 ? -6.317  6.559  26.455 1.00 0.00 ? 32 LEU A HD21 12 
ATOM 10339 H HD22 . LEU A 1 32 ? -5.639  7.028  24.895 1.00 0.00 ? 32 LEU A HD22 12 
ATOM 10340 H HD23 . LEU A 1 32 ? -6.516  5.507  25.053 1.00 0.00 ? 32 LEU A HD23 12 
ATOM 10341 N N    . ASP A 1 33 ? -4.019  9.404  26.845 1.00 0.00 ? 33 ASP A N    12 
ATOM 10342 C CA   . ASP A 1 33 ? -4.841  10.643 26.768 1.00 0.00 ? 33 ASP A CA   12 
ATOM 10343 C C    . ASP A 1 33 ? -4.283  11.541 25.670 1.00 0.00 ? 33 ASP A C    12 
ATOM 10344 O O    . ASP A 1 33 ? -5.014  12.166 24.929 1.00 0.00 ? 33 ASP A O    12 
ATOM 10345 C CB   . ASP A 1 33 ? -4.699  11.306 28.138 1.00 0.00 ? 33 ASP A CB   12 
ATOM 10346 C CG   . ASP A 1 33 ? -5.443  10.477 29.187 1.00 0.00 ? 33 ASP A CG   12 
ATOM 10347 O OD1  . ASP A 1 33 ? -6.235  9.637  28.796 1.00 0.00 ? 33 ASP A OD1  12 
ATOM 10348 O OD2  . ASP A 1 33 ? -5.207  10.698 30.364 1.00 0.00 ? 33 ASP A OD2  12 
ATOM 10349 H H    . ASP A 1 33 ? -3.605  9.139  27.690 1.00 0.00 ? 33 ASP A H    12 
ATOM 10350 H HA   . ASP A 1 33 ? -5.874  10.402 26.572 1.00 0.00 ? 33 ASP A HA   12 
ATOM 10351 H HB2  . ASP A 1 33 ? -3.653  11.366 28.402 1.00 0.00 ? 33 ASP A HB2  12 
ATOM 10352 H HB3  . ASP A 1 33 ? -5.118  12.301 28.102 1.00 0.00 ? 33 ASP A HB3  12 
ATOM 10353 N N    . GLY A 1 34 ? -2.987  11.591 25.551 1.00 0.00 ? 34 GLY A N    12 
ATOM 10354 C CA   . GLY A 1 34 ? -2.375  12.429 24.488 1.00 0.00 ? 34 GLY A CA   12 
ATOM 10355 C C    . GLY A 1 34 ? -2.693  11.794 23.138 1.00 0.00 ? 34 GLY A C    12 
ATOM 10356 O O    . GLY A 1 34 ? -3.230  12.424 22.249 1.00 0.00 ? 34 GLY A O    12 
ATOM 10357 H H    . GLY A 1 34 ? -2.417  11.064 26.151 1.00 0.00 ? 34 GLY A H    12 
ATOM 10358 H HA2  . GLY A 1 34 ? -2.787  13.423 24.526 1.00 0.00 ? 34 GLY A HA2  12 
ATOM 10359 H HA3  . GLY A 1 34 ? -1.307  12.472 24.627 1.00 0.00 ? 34 GLY A HA3  12 
ATOM 10360 N N    . ILE A 1 35 ? -2.383  10.539 22.984 1.00 0.00 ? 35 ILE A N    12 
ATOM 10361 C CA   . ILE A 1 35 ? -2.686  9.857  21.699 1.00 0.00 ? 35 ILE A CA   12 
ATOM 10362 C C    . ILE A 1 35 ? -4.160  10.075 21.356 1.00 0.00 ? 35 ILE A C    12 
ATOM 10363 O O    . ILE A 1 35 ? -4.538  10.143 20.203 1.00 0.00 ? 35 ILE A O    12 
ATOM 10364 C CB   . ILE A 1 35 ? -2.387  8.375  21.950 1.00 0.00 ? 35 ILE A CB   12 
ATOM 10365 C CG1  . ILE A 1 35 ? -0.891  8.124  21.754 1.00 0.00 ? 35 ILE A CG1  12 
ATOM 10366 C CG2  . ILE A 1 35 ? -3.174  7.507  20.964 1.00 0.00 ? 35 ILE A CG2  12 
ATOM 10367 C CD1  . ILE A 1 35 ? -0.481  8.587  20.355 1.00 0.00 ? 35 ILE A CD1  12 
ATOM 10368 H H    . ILE A 1 35 ? -1.965  10.046 23.720 1.00 0.00 ? 35 ILE A H    12 
ATOM 10369 H HA   . ILE A 1 35 ? -2.055  10.237 20.912 1.00 0.00 ? 35 ILE A HA   12 
ATOM 10370 H HB   . ILE A 1 35 ? -2.666  8.117  22.961 1.00 0.00 ? 35 ILE A HB   12 
ATOM 10371 H HG12 . ILE A 1 35 ? -0.332  8.678  22.495 1.00 0.00 ? 35 ILE A HG12 12 
ATOM 10372 H HG13 . ILE A 1 35 ? -0.685  7.070  21.860 1.00 0.00 ? 35 ILE A HG13 12 
ATOM 10373 H HG21 . ILE A 1 35 ? -2.959  7.824  19.954 1.00 0.00 ? 35 ILE A HG21 12 
ATOM 10374 H HG22 . ILE A 1 35 ? -2.887  6.473  21.086 1.00 0.00 ? 35 ILE A HG22 12 
ATOM 10375 H HG23 . ILE A 1 35 ? -4.231  7.612  21.157 1.00 0.00 ? 35 ILE A HG23 12 
ATOM 10376 H HD11 . ILE A 1 35 ? -1.358  8.899  19.807 1.00 0.00 ? 35 ILE A HD11 12 
ATOM 10377 H HD12 . ILE A 1 35 ? 0.205   9.417  20.437 1.00 0.00 ? 35 ILE A HD12 12 
ATOM 10378 H HD13 . ILE A 1 35 ? 0.000   7.773  19.832 1.00 0.00 ? 35 ILE A HD13 12 
ATOM 10379 N N    . MET A 1 36 ? -4.993  10.194 22.354 1.00 0.00 ? 36 MET A N    12 
ATOM 10380 C CA   . MET A 1 36 ? -6.440  10.420 22.086 1.00 0.00 ? 36 MET A CA   12 
ATOM 10381 C C    . MET A 1 36 ? -6.674  11.866 21.645 1.00 0.00 ? 36 MET A C    12 
ATOM 10382 O O    . MET A 1 36 ? -7.036  12.128 20.516 1.00 0.00 ? 36 MET A O    12 
ATOM 10383 C CB   . MET A 1 36 ? -7.145  10.158 23.413 1.00 0.00 ? 36 MET A CB   12 
ATOM 10384 C CG   . MET A 1 36 ? -7.838  8.796  23.365 1.00 0.00 ? 36 MET A CG   12 
ATOM 10385 S SD   . MET A 1 36 ? -8.964  8.640  24.773 1.00 0.00 ? 36 MET A SD   12 
ATOM 10386 C CE   . MET A 1 36 ? -10.482 8.378  23.823 1.00 0.00 ? 36 MET A CE   12 
ATOM 10387 H H    . MET A 1 36 ? -4.663  10.141 23.279 1.00 0.00 ? 36 MET A H    12 
ATOM 10388 H HA   . MET A 1 36 ? -6.800  9.732  21.336 1.00 0.00 ? 36 MET A HA   12 
ATOM 10389 H HB2  . MET A 1 36 ? -6.421  10.169 24.215 1.00 0.00 ? 36 MET A HB2  12 
ATOM 10390 H HB3  . MET A 1 36 ? -7.879  10.933 23.580 1.00 0.00 ? 36 MET A HB3  12 
ATOM 10391 H HG2  . MET A 1 36 ? -8.398  8.710  22.445 1.00 0.00 ? 36 MET A HG2  12 
ATOM 10392 H HG3  . MET A 1 36 ? -7.096  8.012  23.409 1.00 0.00 ? 36 MET A HG3  12 
ATOM 10393 H HE1  . MET A 1 36 ? -10.291 7.669  23.029 1.00 0.00 ? 36 MET A HE1  12 
ATOM 10394 H HE2  . MET A 1 36 ? -11.253 7.995  24.477 1.00 0.00 ? 36 MET A HE2  12 
ATOM 10395 H HE3  . MET A 1 36 ? -10.806 9.313  23.396 1.00 0.00 ? 36 MET A HE3  12 
ATOM 10396 N N    . PHE A 1 37 ? -6.471  12.809 22.529 1.00 0.00 ? 37 PHE A N    12 
ATOM 10397 C CA   . PHE A 1 37 ? -6.686  14.231 22.146 1.00 0.00 ? 37 PHE A CA   12 
ATOM 10398 C C    . PHE A 1 37 ? -5.918  14.528 20.849 1.00 0.00 ? 37 PHE A C    12 
ATOM 10399 O O    . PHE A 1 37 ? -6.448  15.115 19.926 1.00 0.00 ? 37 PHE A O    12 
ATOM 10400 C CB   . PHE A 1 37 ? -6.188  15.056 23.357 1.00 0.00 ? 37 PHE A CB   12 
ATOM 10401 C CG   . PHE A 1 37 ? -5.000  15.921 22.993 1.00 0.00 ? 37 PHE A CG   12 
ATOM 10402 C CD1  . PHE A 1 37 ? -3.726  15.354 22.892 1.00 0.00 ? 37 PHE A CD1  12 
ATOM 10403 C CD2  . PHE A 1 37 ? -5.179  17.286 22.749 1.00 0.00 ? 37 PHE A CD2  12 
ATOM 10404 C CE1  . PHE A 1 37 ? -2.632  16.151 22.545 1.00 0.00 ? 37 PHE A CE1  12 
ATOM 10405 C CE2  . PHE A 1 37 ? -4.084  18.082 22.397 1.00 0.00 ? 37 PHE A CE2  12 
ATOM 10406 C CZ   . PHE A 1 37 ? -2.810  17.513 22.296 1.00 0.00 ? 37 PHE A CZ   12 
ATOM 10407 H H    . PHE A 1 37 ? -6.179  12.580 23.436 1.00 0.00 ? 37 PHE A H    12 
ATOM 10408 H HA   . PHE A 1 37 ? -7.740  14.411 21.994 1.00 0.00 ? 37 PHE A HA   12 
ATOM 10409 H HB2  . PHE A 1 37 ? -6.993  15.694 23.700 1.00 0.00 ? 37 PHE A HB2  12 
ATOM 10410 H HB3  . PHE A 1 37 ? -5.905  14.384 24.153 1.00 0.00 ? 37 PHE A HB3  12 
ATOM 10411 H HD1  . PHE A 1 37 ? -3.587  14.303 23.087 1.00 0.00 ? 37 PHE A HD1  12 
ATOM 10412 H HD2  . PHE A 1 37 ? -6.160  17.725 22.833 1.00 0.00 ? 37 PHE A HD2  12 
ATOM 10413 H HE1  . PHE A 1 37 ? -1.648  15.712 22.469 1.00 0.00 ? 37 PHE A HE1  12 
ATOM 10414 H HE2  . PHE A 1 37 ? -4.221  19.137 22.207 1.00 0.00 ? 37 PHE A HE2  12 
ATOM 10415 H HZ   . PHE A 1 37 ? -1.967  18.121 22.021 1.00 0.00 ? 37 PHE A HZ   12 
ATOM 10416 N N    . ILE A 1 38 ? -4.685  14.105 20.754 1.00 0.00 ? 38 ILE A N    12 
ATOM 10417 C CA   . ILE A 1 38 ? -3.918  14.351 19.502 1.00 0.00 ? 38 ILE A CA   12 
ATOM 10418 C C    . ILE A 1 38 ? -4.730  13.850 18.309 1.00 0.00 ? 38 ILE A C    12 
ATOM 10419 O O    . ILE A 1 38 ? -4.703  14.424 17.238 1.00 0.00 ? 38 ILE A O    12 
ATOM 10420 C CB   . ILE A 1 38 ? -2.625  13.546 19.648 1.00 0.00 ? 38 ILE A CB   12 
ATOM 10421 C CG1  . ILE A 1 38 ? -1.708  14.230 20.665 1.00 0.00 ? 38 ILE A CG1  12 
ATOM 10422 C CG2  . ILE A 1 38 ? -1.919  13.476 18.292 1.00 0.00 ? 38 ILE A CG2  12 
ATOM 10423 C CD1  . ILE A 1 38 ? -0.297  13.641 20.566 1.00 0.00 ? 38 ILE A CD1  12 
ATOM 10424 H H    . ILE A 1 38 ? -4.272  13.614 21.494 1.00 0.00 ? 38 ILE A H    12 
ATOM 10425 H HA   . ILE A 1 38 ? -3.695  15.399 19.395 1.00 0.00 ? 38 ILE A HA   12 
ATOM 10426 H HB   . ILE A 1 38 ? -2.857  12.548 19.986 1.00 0.00 ? 38 ILE A HB   12 
ATOM 10427 H HG12 . ILE A 1 38 ? -1.670  15.289 20.461 1.00 0.00 ? 38 ILE A HG12 12 
ATOM 10428 H HG13 . ILE A 1 38 ? -2.092  14.069 21.660 1.00 0.00 ? 38 ILE A HG13 12 
ATOM 10429 H HG21 . ILE A 1 38 ? -2.621  13.155 17.537 1.00 0.00 ? 38 ILE A HG21 12 
ATOM 10430 H HG22 . ILE A 1 38 ? -1.537  14.453 18.035 1.00 0.00 ? 38 ILE A HG22 12 
ATOM 10431 H HG23 . ILE A 1 38 ? -1.102  12.772 18.347 1.00 0.00 ? 38 ILE A HG23 12 
ATOM 10432 H HD11 . ILE A 1 38 ? -0.362  12.595 20.307 1.00 0.00 ? 38 ILE A HD11 12 
ATOM 10433 H HD12 . ILE A 1 38 ? 0.259   14.167 19.804 1.00 0.00 ? 38 ILE A HD12 12 
ATOM 10434 H HD13 . ILE A 1 38 ? 0.204   13.747 21.516 1.00 0.00 ? 38 ILE A HD13 12 
ATOM 10435 N N    . ASN A 1 39 ? -5.464  12.785 18.493 1.00 0.00 ? 39 ASN A N    12 
ATOM 10436 C CA   . ASN A 1 39 ? -6.292  12.250 17.376 1.00 0.00 ? 39 ASN A CA   12 
ATOM 10437 C C    . ASN A 1 39 ? -7.550  13.105 17.215 1.00 0.00 ? 39 ASN A C    12 
ATOM 10438 O O    . ASN A 1 39 ? -8.023  13.337 16.120 1.00 0.00 ? 39 ASN A O    12 
ATOM 10439 C CB   . ASN A 1 39 ? -6.655  10.825 17.793 1.00 0.00 ? 39 ASN A CB   12 
ATOM 10440 C CG   . ASN A 1 39 ? -5.570  9.862  17.309 1.00 0.00 ? 39 ASN A CG   12 
ATOM 10441 O OD1  . ASN A 1 39 ? -5.853  8.731  16.966 1.00 0.00 ? 39 ASN A OD1  12 
ATOM 10442 N ND2  . ASN A 1 39 ? -4.329  10.266 17.266 1.00 0.00 ? 39 ASN A ND2  12 
ATOM 10443 H H    . ASN A 1 39 ? -5.477  12.345 19.370 1.00 0.00 ? 39 ASN A H    12 
ATOM 10444 H HA   . ASN A 1 39 ? -5.727  12.236 16.460 1.00 0.00 ? 39 ASN A HA   12 
ATOM 10445 H HB2  . ASN A 1 39 ? -6.729  10.772 18.869 1.00 0.00 ? 39 ASN A HB2  12 
ATOM 10446 H HB3  . ASN A 1 39 ? -7.603  10.551 17.353 1.00 0.00 ? 39 ASN A HB3  12 
ATOM 10447 H HD21 . ASN A 1 39 ? -4.101  11.178 17.542 1.00 0.00 ? 39 ASN A HD21 12 
ATOM 10448 H HD22 . ASN A 1 39 ? -3.626  9.656  16.957 1.00 0.00 ? 39 ASN A HD22 12 
ATOM 10449 N N    . LYS A 1 40 ? -8.087  13.583 18.303 1.00 0.00 ? 40 LYS A N    12 
ATOM 10450 C CA   . LYS A 1 40 ? -9.305  14.436 18.221 1.00 0.00 ? 40 LYS A CA   12 
ATOM 10451 C C    . LYS A 1 40 ? -8.919  15.842 17.754 1.00 0.00 ? 40 LYS A C    12 
ATOM 10452 O O    . LYS A 1 40 ? -9.742  16.599 17.277 1.00 0.00 ? 40 LYS A O    12 
ATOM 10453 C CB   . LYS A 1 40 ? -9.860  14.476 19.646 1.00 0.00 ? 40 LYS A CB   12 
ATOM 10454 C CG   . LYS A 1 40 ? -10.588 13.165 19.949 1.00 0.00 ? 40 LYS A CG   12 
ATOM 10455 C CD   . LYS A 1 40 ? -11.206 13.235 21.346 1.00 0.00 ? 40 LYS A CD   12 
ATOM 10456 C CE   . LYS A 1 40 ? -11.225 11.838 21.966 1.00 0.00 ? 40 LYS A CE   12 
ATOM 10457 N NZ   . LYS A 1 40 ? -11.877 12.015 23.295 1.00 0.00 ? 40 LYS A NZ   12 
ATOM 10458 H H    . LYS A 1 40 ? -7.681  13.389 19.173 1.00 0.00 ? 40 LYS A H    12 
ATOM 10459 H HA   . LYS A 1 40 ? -10.030 13.999 17.552 1.00 0.00 ? 40 LYS A HA   12 
ATOM 10460 H HB2  . LYS A 1 40 ? -9.048  14.606 20.345 1.00 0.00 ? 40 LYS A HB2  12 
ATOM 10461 H HB3  . LYS A 1 40 ? -10.552 15.301 19.740 1.00 0.00 ? 40 LYS A HB3  12 
ATOM 10462 H HG2  . LYS A 1 40 ? -11.368 13.008 19.218 1.00 0.00 ? 40 LYS A HG2  12 
ATOM 10463 H HG3  . LYS A 1 40 ? -9.886  12.345 19.907 1.00 0.00 ? 40 LYS A HG3  12 
ATOM 10464 H HD2  . LYS A 1 40 ? -10.618 13.897 21.967 1.00 0.00 ? 40 LYS A HD2  12 
ATOM 10465 H HD3  . LYS A 1 40 ? -12.216 13.612 21.275 1.00 0.00 ? 40 LYS A HD3  12 
ATOM 10466 H HE2  . LYS A 1 40 ? -11.801 11.162 21.353 1.00 0.00 ? 40 LYS A HE2  12 
ATOM 10467 H HE3  . LYS A 1 40 ? -10.217 11.467 22.090 1.00 0.00 ? 40 LYS A HE3  12 
ATOM 10468 H HZ1  . LYS A 1 40 ? -12.471 12.869 23.279 1.00 0.00 ? 40 LYS A HZ1  12 
ATOM 10469 H HZ2  . LYS A 1 40 ? -12.466 11.185 23.506 1.00 0.00 ? 40 LYS A HZ2  12 
ATOM 10470 H HZ3  . LYS A 1 40 ? -11.147 12.118 24.029 1.00 0.00 ? 40 LYS A HZ3  12 
ATOM 10471 N N    . CYS A 1 41 ? -7.667  16.194 17.887 1.00 0.00 ? 41 CYS A N    12 
ATOM 10472 C CA   . CYS A 1 41 ? -7.219  17.548 17.449 1.00 0.00 ? 41 CYS A CA   12 
ATOM 10473 C C    . CYS A 1 41 ? -7.613  17.781 15.990 1.00 0.00 ? 41 CYS A C    12 
ATOM 10474 O O    . CYS A 1 41 ? -8.434  18.622 15.684 1.00 0.00 ? 41 CYS A O    12 
ATOM 10475 C CB   . CYS A 1 41 ? -5.696  17.528 17.595 1.00 0.00 ? 41 CYS A CB   12 
ATOM 10476 S SG   . CYS A 1 41 ? -5.117  19.160 18.121 1.00 0.00 ? 41 CYS A SG   12 
ATOM 10477 H H    . CYS A 1 41 ? -7.021  15.566 18.272 1.00 0.00 ? 41 CYS A H    12 
ATOM 10478 H HA   . CYS A 1 41 ? -7.643  18.310 18.083 1.00 0.00 ? 41 CYS A HA   12 
ATOM 10479 H HB2  . CYS A 1 41 ? -5.416  16.792 18.335 1.00 0.00 ? 41 CYS A HB2  12 
ATOM 10480 H HB3  . CYS A 1 41 ? -5.246  17.274 16.647 1.00 0.00 ? 41 CYS A HB3  12 
ATOM 10481 N N    . ALA A 1 42 ? -7.036  17.035 15.088 1.00 0.00 ? 42 ALA A N    12 
ATOM 10482 C CA   . ALA A 1 42 ? -7.381  17.210 13.649 1.00 0.00 ? 42 ALA A CA   12 
ATOM 10483 C C    . ALA A 1 42 ? -8.885  17.020 13.450 1.00 0.00 ? 42 ALA A C    12 
ATOM 10484 O O    . ALA A 1 42 ? -9.495  17.643 12.604 1.00 0.00 ? 42 ALA A O    12 
ATOM 10485 C CB   . ALA A 1 42 ? -6.603  16.115 12.921 1.00 0.00 ? 42 ALA A CB   12 
ATOM 10486 H H    . ALA A 1 42 ? -6.380  16.359 15.357 1.00 0.00 ? 42 ALA A H    12 
ATOM 10487 H HA   . ALA A 1 42 ? -7.071  18.181 13.298 1.00 0.00 ? 42 ALA A HA   12 
ATOM 10488 H HB1  . ALA A 1 42 ? -6.166  15.443 13.645 1.00 0.00 ? 42 ALA A HB1  12 
ATOM 10489 H HB2  . ALA A 1 42 ? -5.822  16.563 12.326 1.00 0.00 ? 42 ALA A HB2  12 
ATOM 10490 H HB3  . ALA A 1 42 ? -7.274  15.564 12.280 1.00 0.00 ? 42 ALA A HB3  12 
ATOM 10491 N N    . THR A 1 43 ? -9.486  16.162 14.227 1.00 0.00 ? 43 THR A N    12 
ATOM 10492 C CA   . THR A 1 43 ? -10.951 15.927 14.087 1.00 0.00 ? 43 THR A CA   12 
ATOM 10493 C C    . THR A 1 43 ? -11.731 17.169 14.528 1.00 0.00 ? 43 THR A C    12 
ATOM 10494 O O    . THR A 1 43 ? -12.528 17.707 13.788 1.00 0.00 ? 43 THR A O    12 
ATOM 10495 C CB   . THR A 1 43 ? -11.253 14.748 15.013 1.00 0.00 ? 43 THR A CB   12 
ATOM 10496 O OG1  . THR A 1 43 ? -10.527 13.608 14.575 1.00 0.00 ? 43 THR A OG1  12 
ATOM 10497 C CG2  . THR A 1 43 ? -12.752 14.445 14.984 1.00 0.00 ? 43 THR A CG2  12 
ATOM 10498 H H    . THR A 1 43 ? -8.974  15.671 14.902 1.00 0.00 ? 43 THR A H    12 
ATOM 10499 H HA   . THR A 1 43 ? -11.197 15.669 13.070 1.00 0.00 ? 43 THR A HA   12 
ATOM 10500 H HB   . THR A 1 43 ? -10.960 14.997 16.021 1.00 0.00 ? 43 THR A HB   12 
ATOM 10501 H HG1  . THR A 1 43 ? -9.681  13.908 14.234 1.00 0.00 ? 43 THR A HG1  12 
ATOM 10502 H HG21 . THR A 1 43 ? -13.174 14.808 14.058 1.00 0.00 ? 43 THR A HG21 12 
ATOM 10503 H HG22 . THR A 1 43 ? -12.905 13.378 15.055 1.00 0.00 ? 43 THR A HG22 12 
ATOM 10504 H HG23 . THR A 1 43 ? -13.235 14.934 15.816 1.00 0.00 ? 43 THR A HG23 12 
ATOM 10505 N N    . CYS A 1 44 ? -11.508 17.629 15.730 1.00 0.00 ? 44 CYS A N    12 
ATOM 10506 C CA   . CYS A 1 44 ? -12.239 18.835 16.214 1.00 0.00 ? 44 CYS A CA   12 
ATOM 10507 C C    . CYS A 1 44 ? -11.897 20.049 15.345 1.00 0.00 ? 44 CYS A C    12 
ATOM 10508 O O    . CYS A 1 44 ? -12.680 20.969 15.213 1.00 0.00 ? 44 CYS A O    12 
ATOM 10509 C CB   . CYS A 1 44 ? -11.748 19.047 17.646 1.00 0.00 ? 44 CYS A CB   12 
ATOM 10510 S SG   . CYS A 1 44 ? -12.123 17.579 18.636 1.00 0.00 ? 44 CYS A SG   12 
ATOM 10511 H H    . CYS A 1 44 ? -10.861 17.181 16.312 1.00 0.00 ? 44 CYS A H    12 
ATOM 10512 H HA   . CYS A 1 44 ? -13.302 18.657 16.211 1.00 0.00 ? 44 CYS A HA   12 
ATOM 10513 H HB2  . CYS A 1 44 ? -10.680 19.215 17.641 1.00 0.00 ? 44 CYS A HB2  12 
ATOM 10514 H HB3  . CYS A 1 44 ? -12.245 19.906 18.073 1.00 0.00 ? 44 CYS A HB3  12 
ATOM 10515 N N    . LYS A 1 45 ? -10.734 20.060 14.753 1.00 0.00 ? 45 LYS A N    12 
ATOM 10516 C CA   . LYS A 1 45 ? -10.346 21.217 13.895 1.00 0.00 ? 45 LYS A CA   12 
ATOM 10517 C C    . LYS A 1 45 ? -11.273 21.315 12.682 1.00 0.00 ? 45 LYS A C    12 
ATOM 10518 O O    . LYS A 1 45 ? -11.812 22.363 12.385 1.00 0.00 ? 45 LYS A O    12 
ATOM 10519 C CB   . LYS A 1 45 ? -8.913  20.919 13.450 1.00 0.00 ? 45 LYS A CB   12 
ATOM 10520 C CG   . LYS A 1 45 ? -8.452  21.995 12.466 1.00 0.00 ? 45 LYS A CG   12 
ATOM 10521 C CD   . LYS A 1 45 ? -7.448  21.394 11.482 1.00 0.00 ? 45 LYS A CD   12 
ATOM 10522 C CE   . LYS A 1 45 ? -6.875  22.502 10.598 1.00 0.00 ? 45 LYS A CE   12 
ATOM 10523 N NZ   . LYS A 1 45 ? -5.904  21.814 9.702  1.00 0.00 ? 45 LYS A NZ   12 
ATOM 10524 H H    . LYS A 1 45 ? -10.116 19.310 14.873 1.00 0.00 ? 45 LYS A H    12 
ATOM 10525 H HA   . LYS A 1 45 ? -10.371 22.133 14.463 1.00 0.00 ? 45 LYS A HA   12 
ATOM 10526 H HB2  . LYS A 1 45 ? -8.262  20.916 14.312 1.00 0.00 ? 45 LYS A HB2  12 
ATOM 10527 H HB3  . LYS A 1 45 ? -8.879  19.952 12.969 1.00 0.00 ? 45 LYS A HB3  12 
ATOM 10528 H HG2  . LYS A 1 45 ? -9.306  22.375 11.923 1.00 0.00 ? 45 LYS A HG2  12 
ATOM 10529 H HG3  . LYS A 1 45 ? -7.984  22.802 13.009 1.00 0.00 ? 45 LYS A HG3  12 
ATOM 10530 H HD2  . LYS A 1 45 ? -6.646  20.919 12.029 1.00 0.00 ? 45 LYS A HD2  12 
ATOM 10531 H HD3  . LYS A 1 45 ? -7.944  20.660 10.863 1.00 0.00 ? 45 LYS A HD3  12 
ATOM 10532 H HE2  . LYS A 1 45 ? -7.661  22.964 10.018 1.00 0.00 ? 45 LYS A HE2  12 
ATOM 10533 H HE3  . LYS A 1 45 ? -6.371  23.241 11.202 1.00 0.00 ? 45 LYS A HE3  12 
ATOM 10534 H HZ1  . LYS A 1 45 ? -5.429  21.052 10.226 1.00 0.00 ? 45 LYS A HZ1  12 
ATOM 10535 H HZ2  . LYS A 1 45 ? -6.408  21.410 8.888  1.00 0.00 ? 45 LYS A HZ2  12 
ATOM 10536 H HZ3  . LYS A 1 45 ? -5.196  22.499 9.367  1.00 0.00 ? 45 LYS A HZ3  12 
ATOM 10537 N N    . MET A 1 46 ? -11.464 20.234 11.976 1.00 0.00 ? 46 MET A N    12 
ATOM 10538 C CA   . MET A 1 46 ? -12.356 20.276 10.782 1.00 0.00 ? 46 MET A CA   12 
ATOM 10539 C C    . MET A 1 46 ? -13.765 20.708 11.195 1.00 0.00 ? 46 MET A C    12 
ATOM 10540 O O    . MET A 1 46 ? -14.511 21.253 10.407 1.00 0.00 ? 46 MET A O    12 
ATOM 10541 C CB   . MET A 1 46 ? -12.361 18.849 10.230 1.00 0.00 ? 46 MET A CB   12 
ATOM 10542 C CG   . MET A 1 46 ? -12.958 17.892 11.264 1.00 0.00 ? 46 MET A CG   12 
ATOM 10543 S SD   . MET A 1 46 ? -14.197 16.841 10.467 1.00 0.00 ? 46 MET A SD   12 
ATOM 10544 C CE   . MET A 1 46 ? -13.063 15.561 9.877  1.00 0.00 ? 46 MET A CE   12 
ATOM 10545 H H    . MET A 1 46 ? -11.019 19.398 12.228 1.00 0.00 ? 46 MET A H    12 
ATOM 10546 H HA   . MET A 1 46 ? -11.959 20.954 10.042 1.00 0.00 ? 46 MET A HA   12 
ATOM 10547 H HB2  . MET A 1 46 ? -12.953 18.817 9.329  1.00 0.00 ? 46 MET A HB2  12 
ATOM 10548 H HB3  . MET A 1 46 ? -11.349 18.549 10.007 1.00 0.00 ? 46 MET A HB3  12 
ATOM 10549 H HG2  . MET A 1 46 ? -12.175 17.274 11.677 1.00 0.00 ? 46 MET A HG2  12 
ATOM 10550 H HG3  . MET A 1 46 ? -13.423 18.458 12.054 1.00 0.00 ? 46 MET A HG3  12 
ATOM 10551 H HE1  . MET A 1 46 ? -12.304 15.380 10.625 1.00 0.00 ? 46 MET A HE1  12 
ATOM 10552 H HE2  . MET A 1 46 ? -13.610 14.650 9.694  1.00 0.00 ? 46 MET A HE2  12 
ATOM 10553 H HE3  . MET A 1 46 ? -12.598 15.889 8.958  1.00 0.00 ? 46 MET A HE3  12 
ATOM 10554 N N    . ILE A 1 47 ? -14.132 20.474 12.424 1.00 0.00 ? 47 ILE A N    12 
ATOM 10555 C CA   . ILE A 1 47 ? -15.491 20.881 12.883 1.00 0.00 ? 47 ILE A CA   12 
ATOM 10556 C C    . ILE A 1 47 ? -15.671 22.385 12.679 1.00 0.00 ? 47 ILE A C    12 
ATOM 10557 O O    . ILE A 1 47 ? -16.707 22.844 12.241 1.00 0.00 ? 47 ILE A O    12 
ATOM 10558 C CB   . ILE A 1 47 ? -15.537 20.530 14.372 1.00 0.00 ? 47 ILE A CB   12 
ATOM 10559 C CG1  . ILE A 1 47 ? -15.184 19.053 14.564 1.00 0.00 ? 47 ILE A CG1  12 
ATOM 10560 C CG2  . ILE A 1 47 ? -16.944 20.793 14.913 1.00 0.00 ? 47 ILE A CG2  12 
ATOM 10561 C CD1  . ILE A 1 47 ? -15.970 18.202 13.563 1.00 0.00 ? 47 ILE A CD1  12 
ATOM 10562 H H    . ILE A 1 47 ? -13.513 20.039 13.045 1.00 0.00 ? 47 ILE A H    12 
ATOM 10563 H HA   . ILE A 1 47 ? -16.250 20.333 12.349 1.00 0.00 ? 47 ILE A HA   12 
ATOM 10564 H HB   . ILE A 1 47 ? -14.826 21.141 14.908 1.00 0.00 ? 47 ILE A HB   12 
ATOM 10565 H HG12 . ILE A 1 47 ? -14.127 18.911 14.403 1.00 0.00 ? 47 ILE A HG12 12 
ATOM 10566 H HG13 . ILE A 1 47 ? -15.438 18.751 15.569 1.00 0.00 ? 47 ILE A HG13 12 
ATOM 10567 H HG21 . ILE A 1 47 ? -17.285 21.760 14.574 1.00 0.00 ? 47 ILE A HG21 12 
ATOM 10568 H HG22 . ILE A 1 47 ? -17.617 20.028 14.554 1.00 0.00 ? 47 ILE A HG22 12 
ATOM 10569 H HG23 . ILE A 1 47 ? -16.924 20.776 15.992 1.00 0.00 ? 47 ILE A HG23 12 
ATOM 10570 H HD11 . ILE A 1 47 ? -15.757 18.539 12.559 1.00 0.00 ? 47 ILE A HD11 12 
ATOM 10571 H HD12 . ILE A 1 47 ? -15.679 17.166 13.665 1.00 0.00 ? 47 ILE A HD12 12 
ATOM 10572 H HD13 . ILE A 1 47 ? -17.027 18.300 13.759 1.00 0.00 ? 47 ILE A HD13 12 
ATOM 10573 N N    . LEU A 1 48 ? -14.662 23.155 12.982 1.00 0.00 ? 48 LEU A N    12 
ATOM 10574 C CA   . LEU A 1 48 ? -14.768 24.629 12.794 1.00 0.00 ? 48 LEU A CA   12 
ATOM 10575 C C    . LEU A 1 48 ? -14.863 24.948 11.302 1.00 0.00 ? 48 LEU A C    12 
ATOM 10576 O O    . LEU A 1 48 ? -15.592 25.828 10.888 1.00 0.00 ? 48 LEU A O    12 
ATOM 10577 C CB   . LEU A 1 48 ? -13.478 25.199 13.382 1.00 0.00 ? 48 LEU A CB   12 
ATOM 10578 C CG   . LEU A 1 48 ? -13.576 25.222 14.908 1.00 0.00 ? 48 LEU A CG   12 
ATOM 10579 C CD1  . LEU A 1 48 ? -14.752 26.104 15.330 1.00 0.00 ? 48 LEU A CD1  12 
ATOM 10580 C CD2  . LEU A 1 48 ? -13.791 23.799 15.427 1.00 0.00 ? 48 LEU A CD2  12 
ATOM 10581 H H    . LEU A 1 48 ? -13.832 22.763 13.325 1.00 0.00 ? 48 LEU A H    12 
ATOM 10582 H HA   . LEU A 1 48 ? -15.623 25.019 13.323 1.00 0.00 ? 48 LEU A HA   12 
ATOM 10583 H HB2  . LEU A 1 48 ? -12.643 24.581 13.085 1.00 0.00 ? 48 LEU A HB2  12 
ATOM 10584 H HB3  . LEU A 1 48 ? -13.330 26.203 13.016 1.00 0.00 ? 48 LEU A HB3  12 
ATOM 10585 H HG   . LEU A 1 48 ? -12.661 25.620 15.319 1.00 0.00 ? 48 LEU A HG   12 
ATOM 10586 H HD11 . LEU A 1 48 ? -14.941 26.843 14.566 1.00 0.00 ? 48 LEU A HD11 12 
ATOM 10587 H HD12 . LEU A 1 48 ? -15.631 25.493 15.465 1.00 0.00 ? 48 LEU A HD12 12 
ATOM 10588 H HD13 . LEU A 1 48 ? -14.514 26.601 16.260 1.00 0.00 ? 48 LEU A HD13 12 
ATOM 10589 H HD21 . LEU A 1 48 ? -13.056 23.141 14.989 1.00 0.00 ? 48 LEU A HD21 12 
ATOM 10590 H HD22 . LEU A 1 48 ? -13.687 23.789 16.502 1.00 0.00 ? 48 LEU A HD22 12 
ATOM 10591 H HD23 . LEU A 1 48 ? -14.782 23.464 15.158 1.00 0.00 ? 48 LEU A HD23 12 
ATOM 10592 N N    . GLU A 1 49 ? -14.132 24.232 10.492 1.00 0.00 ? 49 GLU A N    12 
ATOM 10593 C CA   . GLU A 1 49 ? -14.179 24.486 9.023  1.00 0.00 ? 49 GLU A CA   12 
ATOM 10594 C C    . GLU A 1 49 ? -15.587 24.214 8.487  1.00 0.00 ? 49 GLU A C    12 
ATOM 10595 O O    . GLU A 1 49 ? -15.992 24.755 7.477  1.00 0.00 ? 49 GLU A O    12 
ATOM 10596 C CB   . GLU A 1 49 ? -13.175 23.504 8.419  1.00 0.00 ? 49 GLU A CB   12 
ATOM 10597 C CG   . GLU A 1 49 ? -11.783 23.778 8.994  1.00 0.00 ? 49 GLU A CG   12 
ATOM 10598 C CD   . GLU A 1 49 ? -10.775 22.812 8.369  1.00 0.00 ? 49 GLU A CD   12 
ATOM 10599 O OE1  . GLU A 1 49 ? -11.043 22.327 7.282  1.00 0.00 ? 49 GLU A OE1  12 
ATOM 10600 O OE2  . GLU A 1 49 ? -9.751  22.572 8.989  1.00 0.00 ? 49 GLU A OE2  12 
ATOM 10601 H H    . GLU A 1 49 ? -13.553 23.525 10.850 1.00 0.00 ? 49 GLU A H    12 
ATOM 10602 H HA   . GLU A 1 49 ? -13.881 25.500 8.806  1.00 0.00 ? 49 GLU A HA   12 
ATOM 10603 H HB2  . GLU A 1 49 ? -13.471 22.494 8.659  1.00 0.00 ? 49 GLU A HB2  12 
ATOM 10604 H HB3  . GLU A 1 49 ? -13.152 23.627 7.347  1.00 0.00 ? 49 GLU A HB3  12 
ATOM 10605 H HG2  . GLU A 1 49 ? -11.495 24.793 8.770  1.00 0.00 ? 49 GLU A HG2  12 
ATOM 10606 H HG3  . GLU A 1 49 ? -11.802 23.636 10.065 1.00 0.00 ? 49 GLU A HG3  12 
ATOM 10607 N N    . LYS A 1 50 ? -16.334 23.378 9.155  1.00 0.00 ? 50 LYS A N    12 
ATOM 10608 C CA   . LYS A 1 50 ? -17.716 23.073 8.683  1.00 0.00 ? 50 LYS A CA   12 
ATOM 10609 C C    . LYS A 1 50 ? -18.595 24.321 8.781  1.00 0.00 ? 50 LYS A C    12 
ATOM 10610 O O    . LYS A 1 50 ? -19.397 24.599 7.911  1.00 0.00 ? 50 LYS A O    12 
ATOM 10611 C CB   . LYS A 1 50 ? -18.226 21.983 9.627  1.00 0.00 ? 50 LYS A CB   12 
ATOM 10612 C CG   . LYS A 1 50 ? -17.449 20.687 9.380  1.00 0.00 ? 50 LYS A CG   12 
ATOM 10613 C CD   . LYS A 1 50 ? -17.981 19.590 10.304 1.00 0.00 ? 50 LYS A CD   12 
ATOM 10614 C CE   . LYS A 1 50 ? -19.420 19.249 9.916  1.00 0.00 ? 50 LYS A CE   12 
ATOM 10615 N NZ   . LYS A 1 50 ? -19.807 18.137 10.828 1.00 0.00 ? 50 LYS A NZ   12 
ATOM 10616 H H    . LYS A 1 50 ? -15.989 22.954 9.967  1.00 0.00 ? 50 LYS A H    12 
ATOM 10617 H HA   . LYS A 1 50 ? -17.695 22.704 7.670  1.00 0.00 ? 50 LYS A HA   12 
ATOM 10618 H HB2  . LYS A 1 50 ? -18.084 22.297 10.650 1.00 0.00 ? 50 LYS A HB2  12 
ATOM 10619 H HB3  . LYS A 1 50 ? -19.277 21.812 9.445  1.00 0.00 ? 50 LYS A HB3  12 
ATOM 10620 H HG2  . LYS A 1 50 ? -17.574 20.383 8.351  1.00 0.00 ? 50 LYS A HG2  12 
ATOM 10621 H HG3  . LYS A 1 50 ? -16.402 20.851 9.582  1.00 0.00 ? 50 LYS A HG3  12 
ATOM 10622 H HD2  . LYS A 1 50 ? -17.363 18.709 10.209 1.00 0.00 ? 50 LYS A HD2  12 
ATOM 10623 H HD3  . LYS A 1 50 ? -17.956 19.938 11.327 1.00 0.00 ? 50 LYS A HD3  12 
ATOM 10624 H HE2  . LYS A 1 50 ? -20.064 20.102 10.070 1.00 0.00 ? 50 LYS A HE2  12 
ATOM 10625 H HE3  . LYS A 1 50 ? -19.465 18.924 8.887  1.00 0.00 ? 50 LYS A HE3  12 
ATOM 10626 H HZ1  . LYS A 1 50 ? -19.034 17.441 10.874 1.00 0.00 ? 50 LYS A HZ1  12 
ATOM 10627 H HZ2  . LYS A 1 50 ? -19.991 18.515 11.779 1.00 0.00 ? 50 LYS A HZ2  12 
ATOM 10628 H HZ3  . LYS A 1 50 ? -20.667 17.676 10.468 1.00 0.00 ? 50 LYS A HZ3  12 
ATOM 10629 N N    . GLU A 1 51 ? -18.452 25.079 9.835  1.00 0.00 ? 51 GLU A N    12 
ATOM 10630 C CA   . GLU A 1 51 ? -19.280 26.310 9.988  1.00 0.00 ? 51 GLU A CA   12 
ATOM 10631 C C    . GLU A 1 51 ? -18.967 27.301 8.864  1.00 0.00 ? 51 GLU A C    12 
ATOM 10632 O O    . GLU A 1 51 ? -19.782 28.130 8.509  1.00 0.00 ? 51 GLU A O    12 
ATOM 10633 C CB   . GLU A 1 51 ? -18.878 26.890 11.344 1.00 0.00 ? 51 GLU A CB   12 
ATOM 10634 C CG   . GLU A 1 51 ? -19.207 25.883 12.447 1.00 0.00 ? 51 GLU A CG   12 
ATOM 10635 C CD   . GLU A 1 51 ? -18.826 26.473 13.806 1.00 0.00 ? 51 GLU A CD   12 
ATOM 10636 O OE1  . GLU A 1 51 ? -18.008 27.377 13.829 1.00 0.00 ? 51 GLU A OE1  12 
ATOM 10637 O OE2  . GLU A 1 51 ? -19.358 26.009 14.801 1.00 0.00 ? 51 GLU A OE2  12 
ATOM 10638 H H    . GLU A 1 51 ? -17.799 24.839 10.525 1.00 0.00 ? 51 GLU A H    12 
ATOM 10639 H HA   . GLU A 1 51 ? -20.329 26.060 9.989  1.00 0.00 ? 51 GLU A HA   12 
ATOM 10640 H HB2  . GLU A 1 51 ? -17.818 27.095 11.347 1.00 0.00 ? 51 GLU A HB2  12 
ATOM 10641 H HB3  . GLU A 1 51 ? -19.423 27.806 11.518 1.00 0.00 ? 51 GLU A HB3  12 
ATOM 10642 H HG2  . GLU A 1 51 ? -20.265 25.666 12.433 1.00 0.00 ? 51 GLU A HG2  12 
ATOM 10643 H HG3  . GLU A 1 51 ? -18.651 24.973 12.280 1.00 0.00 ? 51 GLU A HG3  12 
ATOM 10644 N N    . ALA A 1 52 ? -17.793 27.221 8.299  1.00 0.00 ? 52 ALA A N    12 
ATOM 10645 C CA   . ALA A 1 52 ? -17.430 28.160 7.198  1.00 0.00 ? 52 ALA A CA   12 
ATOM 10646 C C    . ALA A 1 52 ? -18.149 27.759 5.907  1.00 0.00 ? 52 ALA A C    12 
ATOM 10647 O O    . ALA A 1 52 ? -18.332 28.560 5.013  1.00 0.00 ? 52 ALA A O    12 
ATOM 10648 C CB   . ALA A 1 52 ? -15.917 28.014 7.036  1.00 0.00 ? 52 ALA A CB   12 
ATOM 10649 H H    . ALA A 1 52 ? -17.150 26.546 8.599  1.00 0.00 ? 52 ALA A H    12 
ATOM 10650 H HA   . ALA A 1 52 ? -17.676 29.173 7.470  1.00 0.00 ? 52 ALA A HA   12 
ATOM 10651 H HB1  . ALA A 1 52 ? -15.550 27.270 7.726  1.00 0.00 ? 52 ALA A HB1  12 
ATOM 10652 H HB2  . ALA A 1 52 ? -15.690 27.710 6.024  1.00 0.00 ? 52 ALA A HB2  12 
ATOM 10653 H HB3  . ALA A 1 52 ? -15.441 28.961 7.242  1.00 0.00 ? 52 ALA A HB3  12 
ATOM 10654 N N    . LYS A 1 53 ? -18.556 26.524 5.803  1.00 0.00 ? 53 LYS A N    12 
ATOM 10655 C CA   . LYS A 1 53 ? -19.262 26.073 4.569  1.00 0.00 ? 53 LYS A CA   12 
ATOM 10656 C C    . LYS A 1 53 ? -20.720 26.539 4.594  1.00 0.00 ? 53 LYS A C    12 
ATOM 10657 O O    . LYS A 1 53 ? -21.287 26.891 3.579  1.00 0.00 ? 53 LYS A O    12 
ATOM 10658 C CB   . LYS A 1 53 ? -19.186 24.546 4.606  1.00 0.00 ? 53 LYS A CB   12 
ATOM 10659 C CG   . LYS A 1 53 ? -17.744 24.102 4.347  1.00 0.00 ? 53 LYS A CG   12 
ATOM 10660 C CD   . LYS A 1 53 ? -17.696 22.578 4.217  1.00 0.00 ? 53 LYS A CD   12 
ATOM 10661 C CE   . LYS A 1 53 ? -16.252 22.130 3.990  1.00 0.00 ? 53 LYS A CE   12 
ATOM 10662 N NZ   . LYS A 1 53 ? -16.306 20.641 4.004  1.00 0.00 ? 53 LYS A NZ   12 
ATOM 10663 H H    . LYS A 1 53 ? -18.398 25.892 6.536  1.00 0.00 ? 53 LYS A H    12 
ATOM 10664 H HA   . LYS A 1 53 ? -18.760 26.447 3.690  1.00 0.00 ? 53 LYS A HA   12 
ATOM 10665 H HB2  . LYS A 1 53 ? -19.502 24.193 5.575  1.00 0.00 ? 53 LYS A HB2  12 
ATOM 10666 H HB3  . LYS A 1 53 ? -19.831 24.136 3.843  1.00 0.00 ? 53 LYS A HB3  12 
ATOM 10667 H HG2  . LYS A 1 53 ? -17.387 24.553 3.432  1.00 0.00 ? 53 LYS A HG2  12 
ATOM 10668 H HG3  . LYS A 1 53 ? -17.119 24.413 5.170  1.00 0.00 ? 53 LYS A HG3  12 
ATOM 10669 H HD2  . LYS A 1 53 ? -18.075 22.128 5.122  1.00 0.00 ? 53 LYS A HD2  12 
ATOM 10670 H HD3  . LYS A 1 53 ? -18.305 22.270 3.379  1.00 0.00 ? 53 LYS A HD3  12 
ATOM 10671 H HE2  . LYS A 1 53 ? -15.894 22.485 3.035  1.00 0.00 ? 53 LYS A HE2  12 
ATOM 10672 H HE3  . LYS A 1 53 ? -15.617 22.491 4.786  1.00 0.00 ? 53 LYS A HE3  12 
ATOM 10673 H HZ1  . LYS A 1 53 ? -16.733 20.319 4.895  1.00 0.00 ? 53 LYS A HZ1  12 
ATOM 10674 H HZ2  . LYS A 1 53 ? -16.884 20.308 3.206  1.00 0.00 ? 53 LYS A HZ2  12 
ATOM 10675 H HZ3  . LYS A 1 53 ? -15.342 20.258 3.920  1.00 0.00 ? 53 LYS A HZ3  12 
ATOM 10676 N N    . SER A 1 54 ? -21.331 26.545 5.748  1.00 0.00 ? 54 SER A N    12 
ATOM 10677 C CA   . SER A 1 54 ? -22.752 26.989 5.836  1.00 0.00 ? 54 SER A CA   12 
ATOM 10678 C C    . SER A 1 54 ? -22.861 28.482 5.515  1.00 0.00 ? 54 SER A C    12 
ATOM 10679 O O    . SER A 1 54 ? -23.922 28.984 5.203  1.00 0.00 ? 54 SER A O    12 
ATOM 10680 C CB   . SER A 1 54 ? -23.161 26.720 7.283  1.00 0.00 ? 54 SER A CB   12 
ATOM 10681 O OG   . SER A 1 54 ? -23.125 25.323 7.534  1.00 0.00 ? 54 SER A OG   12 
ATOM 10682 H H    . SER A 1 54 ? -20.856 26.259 6.555  1.00 0.00 ? 54 SER A H    12 
ATOM 10683 H HA   . SER A 1 54 ? -23.369 26.413 5.165  1.00 0.00 ? 54 SER A HA   12 
ATOM 10684 H HB2  . SER A 1 54 ? -22.477 27.224 7.950  1.00 0.00 ? 54 SER A HB2  12 
ATOM 10685 H HB3  . SER A 1 54 ? -24.163 27.090 7.449  1.00 0.00 ? 54 SER A HB3  12 
ATOM 10686 H HG   . SER A 1 54 ? -24.022 24.986 7.467  1.00 0.00 ? 54 SER A HG   12 
ATOM 10687 N N    . GLN A 1 55 ? -21.770 29.195 5.589  1.00 0.00 ? 55 GLN A N    12 
ATOM 10688 C CA   . GLN A 1 55 ? -21.811 30.654 5.289  1.00 0.00 ? 55 GLN A CA   12 
ATOM 10689 C C    . GLN A 1 55 ? -21.202 30.928 3.911  1.00 0.00 ? 55 GLN A C    12 
ATOM 10690 O O    . GLN A 1 55 ? -19.998 30.783 3.778  1.00 0.00 ? 55 GLN A O    12 
ATOM 10691 C CB   . GLN A 1 55 ? -20.972 31.309 6.386  1.00 0.00 ? 55 GLN A CB   12 
ATOM 10692 C CG   . GLN A 1 55 ? -20.991 32.828 6.207  1.00 0.00 ? 55 GLN A CG   12 
ATOM 10693 C CD   . GLN A 1 55 ? -20.251 33.488 7.372  1.00 0.00 ? 55 GLN A CD   12 
ATOM 10694 O OE1  . GLN A 1 55 ? -19.289 32.948 7.879  1.00 0.00 ? 55 GLN A OE1  12 
ATOM 10695 N NE2  . GLN A 1 55 ? -20.663 34.643 7.819  1.00 0.00 ? 55 GLN A NE2  12 
ATOM 10696 O OXT  . GLN A 1 55 ? -21.951 31.277 3.013  1.00 0.00 ? 55 GLN A OXT  12 
ATOM 10697 H H    . GLN A 1 55 ? -20.924 28.771 5.843  1.00 0.00 ? 55 GLN A H    12 
ATOM 10698 H HA   . GLN A 1 55 ? -22.825 31.021 5.333  1.00 0.00 ? 55 GLN A HA   12 
ATOM 10699 H HB2  . GLN A 1 55 ? -21.383 31.055 7.352  1.00 0.00 ? 55 GLN A HB2  12 
ATOM 10700 H HB3  . GLN A 1 55 ? -19.955 30.952 6.322  1.00 0.00 ? 55 GLN A HB3  12 
ATOM 10701 H HG2  . GLN A 1 55 ? -20.505 33.087 5.277  1.00 0.00 ? 55 GLN A HG2  12 
ATOM 10702 H HG3  . GLN A 1 55 ? -22.013 33.175 6.186  1.00 0.00 ? 55 GLN A HG3  12 
ATOM 10703 H HE21 . GLN A 1 55 ? -21.439 35.079 7.409  1.00 0.00 ? 55 GLN A HE21 12 
ATOM 10704 H HE22 . GLN A 1 55 ? -20.196 35.074 8.565  1.00 0.00 ? 55 GLN A HE22 12 
ATOM 10705 N N    . LYS A 1 1  ? -24.499 8.356  15.576 1.00 0.00 ? 1  LYS A N    13 
ATOM 10706 C CA   . LYS A 1 1  ? -23.307 8.927  16.268 1.00 0.00 ? 1  LYS A CA   13 
ATOM 10707 C C    . LYS A 1 1  ? -22.390 9.622  15.258 1.00 0.00 ? 1  LYS A C    13 
ATOM 10708 O O    . LYS A 1 1  ? -21.546 9.002  14.641 1.00 0.00 ? 1  LYS A O    13 
ATOM 10709 C CB   . LYS A 1 1  ? -22.601 7.724  16.897 1.00 0.00 ? 1  LYS A CB   13 
ATOM 10710 C CG   . LYS A 1 1  ? -21.583 8.211  17.930 1.00 0.00 ? 1  LYS A CG   13 
ATOM 10711 C CD   . LYS A 1 1  ? -20.993 7.010  18.672 1.00 0.00 ? 1  LYS A CD   13 
ATOM 10712 C CE   . LYS A 1 1  ? -19.948 7.497  19.680 1.00 0.00 ? 1  LYS A CE   13 
ATOM 10713 N NZ   . LYS A 1 1  ? -19.259 6.259  20.144 1.00 0.00 ? 1  LYS A NZ   13 
ATOM 10714 H H1   . LYS A 1 1  ? -24.939 9.088  14.983 1.00 0.00 ? 1  LYS A H1   13 
ATOM 10715 H H2   . LYS A 1 1  ? -24.204 7.559  14.977 1.00 0.00 ? 1  LYS A H2   13 
ATOM 10716 H H3   . LYS A 1 1  ? -25.184 8.024  16.284 1.00 0.00 ? 1  LYS A H3   13 
ATOM 10717 H HA   . LYS A 1 1  ? -23.613 9.617  17.039 1.00 0.00 ? 1  LYS A HA   13 
ATOM 10718 H HB2  . LYS A 1 1  ? -23.330 7.091  17.380 1.00 0.00 ? 1  LYS A HB2  13 
ATOM 10719 H HB3  . LYS A 1 1  ? -22.091 7.163  16.127 1.00 0.00 ? 1  LYS A HB3  13 
ATOM 10720 H HG2  . LYS A 1 1  ? -20.791 8.750  17.430 1.00 0.00 ? 1  LYS A HG2  13 
ATOM 10721 H HG3  . LYS A 1 1  ? -22.072 8.865  18.636 1.00 0.00 ? 1  LYS A HG3  13 
ATOM 10722 H HD2  . LYS A 1 1  ? -21.779 6.486  19.194 1.00 0.00 ? 1  LYS A HD2  13 
ATOM 10723 H HD3  . LYS A 1 1  ? -20.525 6.343  17.963 1.00 0.00 ? 1  LYS A HD3  13 
ATOM 10724 H HE2  . LYS A 1 1  ? -19.244 8.161  19.200 1.00 0.00 ? 1  LYS A HE2  13 
ATOM 10725 H HE3  . LYS A 1 1  ? -20.429 7.993  20.509 1.00 0.00 ? 1  LYS A HE3  13 
ATOM 10726 H HZ1  . LYS A 1 1  ? -19.970 5.544  20.404 1.00 0.00 ? 1  LYS A HZ1  13 
ATOM 10727 H HZ2  . LYS A 1 1  ? -18.658 5.891  19.381 1.00 0.00 ? 1  LYS A HZ2  13 
ATOM 10728 H HZ3  . LYS A 1 1  ? -18.670 6.480  20.971 1.00 0.00 ? 1  LYS A HZ3  13 
ATOM 10729 N N    . ASN A 1 2  ? -22.546 10.907 15.085 1.00 0.00 ? 2  ASN A N    13 
ATOM 10730 C CA   . ASN A 1 2  ? -21.680 11.639 14.115 1.00 0.00 ? 2  ASN A CA   13 
ATOM 10731 C C    . ASN A 1 2  ? -20.913 12.756 14.828 1.00 0.00 ? 2  ASN A C    13 
ATOM 10732 O O    . ASN A 1 2  ? -21.489 13.578 15.513 1.00 0.00 ? 2  ASN A O    13 
ATOM 10733 C CB   . ASN A 1 2  ? -22.645 12.227 13.083 1.00 0.00 ? 2  ASN A CB   13 
ATOM 10734 C CG   . ASN A 1 2  ? -21.845 12.891 11.959 1.00 0.00 ? 2  ASN A CG   13 
ATOM 10735 O OD1  . ASN A 1 2  ? -20.667 12.639 11.807 1.00 0.00 ? 2  ASN A OD1  13 
ATOM 10736 N ND2  . ASN A 1 2  ? -22.440 13.735 11.160 1.00 0.00 ? 2  ASN A ND2  13 
ATOM 10737 H H    . ASN A 1 2  ? -23.231 11.391 15.592 1.00 0.00 ? 2  ASN A H    13 
ATOM 10738 H HA   . ASN A 1 2  ? -20.996 10.959 13.633 1.00 0.00 ? 2  ASN A HA   13 
ATOM 10739 H HB2  . ASN A 1 2  ? -23.257 11.438 12.672 1.00 0.00 ? 2  ASN A HB2  13 
ATOM 10740 H HB3  . ASN A 1 2  ? -23.276 12.962 13.559 1.00 0.00 ? 2  ASN A HB3  13 
ATOM 10741 H HD21 . ASN A 1 2  ? -23.391 13.938 11.283 1.00 0.00 ? 2  ASN A HD21 13 
ATOM 10742 H HD22 . ASN A 1 2  ? -21.936 14.164 10.438 1.00 0.00 ? 2  ASN A HD22 13 
ATOM 10743 N N    . GLU A 1 3  ? -19.619 12.793 14.671 1.00 0.00 ? 3  GLU A N    13 
ATOM 10744 C CA   . GLU A 1 3  ? -18.819 13.860 15.339 1.00 0.00 ? 3  GLU A CA   13 
ATOM 10745 C C    . GLU A 1 3  ? -19.295 15.239 14.875 1.00 0.00 ? 3  GLU A C    13 
ATOM 10746 O O    . GLU A 1 3  ? -19.240 16.206 15.609 1.00 0.00 ? 3  GLU A O    13 
ATOM 10747 C CB   . GLU A 1 3  ? -17.376 13.612 14.898 1.00 0.00 ? 3  GLU A CB   13 
ATOM 10748 C CG   . GLU A 1 3  ? -16.938 12.215 15.342 1.00 0.00 ? 3  GLU A CG   13 
ATOM 10749 C CD   . GLU A 1 3  ? -15.572 11.892 14.731 1.00 0.00 ? 3  GLU A CD   13 
ATOM 10750 O OE1  . GLU A 1 3  ? -15.236 12.497 13.727 1.00 0.00 ? 3  GLU A OE1  13 
ATOM 10751 O OE2  . GLU A 1 3  ? -14.886 11.045 15.279 1.00 0.00 ? 3  GLU A OE2  13 
ATOM 10752 H H    . GLU A 1 3  ? -19.173 12.122 14.112 1.00 0.00 ? 3  GLU A H    13 
ATOM 10753 H HA   . GLU A 1 3  ? -18.897 13.774 16.409 1.00 0.00 ? 3  GLU A HA   13 
ATOM 10754 H HB2  . GLU A 1 3  ? -17.311 13.686 13.822 1.00 0.00 ? 3  GLU A HB2  13 
ATOM 10755 H HB3  . GLU A 1 3  ? -16.731 14.352 15.349 1.00 0.00 ? 3  GLU A HB3  13 
ATOM 10756 H HG2  . GLU A 1 3  ? -16.867 12.184 16.418 1.00 0.00 ? 3  GLU A HG2  13 
ATOM 10757 H HG3  . GLU A 1 3  ? -17.662 11.486 15.008 1.00 0.00 ? 3  GLU A HG3  13 
ATOM 10758 N N    . ASP A 1 4  ? -19.768 15.333 13.663 1.00 0.00 ? 4  ASP A N    13 
ATOM 10759 C CA   . ASP A 1 4  ? -20.256 16.646 13.150 1.00 0.00 ? 4  ASP A CA   13 
ATOM 10760 C C    . ASP A 1 4  ? -21.521 17.060 13.904 1.00 0.00 ? 4  ASP A C    13 
ATOM 10761 O O    . ASP A 1 4  ? -21.971 18.185 13.816 1.00 0.00 ? 4  ASP A O    13 
ATOM 10762 C CB   . ASP A 1 4  ? -20.570 16.403 11.675 1.00 0.00 ? 4  ASP A CB   13 
ATOM 10763 C CG   . ASP A 1 4  ? -19.264 16.297 10.885 1.00 0.00 ? 4  ASP A CG   13 
ATOM 10764 O OD1  . ASP A 1 4  ? -18.270 16.832 11.347 1.00 0.00 ? 4  ASP A OD1  13 
ATOM 10765 O OD2  . ASP A 1 4  ? -19.281 15.682 9.832  1.00 0.00 ? 4  ASP A OD2  13 
ATOM 10766 H H    . ASP A 1 4  ? -19.807 14.539 13.091 1.00 0.00 ? 4  ASP A H    13 
ATOM 10767 H HA   . ASP A 1 4  ? -19.491 17.400 13.248 1.00 0.00 ? 4  ASP A HA   13 
ATOM 10768 H HB2  . ASP A 1 4  ? -21.129 15.485 11.574 1.00 0.00 ? 4  ASP A HB2  13 
ATOM 10769 H HB3  . ASP A 1 4  ? -21.156 17.225 11.293 1.00 0.00 ? 4  ASP A HB3  13 
ATOM 10770 N N    . GLN A 1 5  ? -22.090 16.155 14.650 1.00 0.00 ? 5  GLN A N    13 
ATOM 10771 C CA   . GLN A 1 5  ? -23.322 16.485 15.422 1.00 0.00 ? 5  GLN A CA   13 
ATOM 10772 C C    . GLN A 1 5  ? -22.935 16.899 16.838 1.00 0.00 ? 5  GLN A C    13 
ATOM 10773 O O    . GLN A 1 5  ? -23.432 17.869 17.376 1.00 0.00 ? 5  GLN A O    13 
ATOM 10774 C CB   . GLN A 1 5  ? -24.140 15.194 15.441 1.00 0.00 ? 5  GLN A CB   13 
ATOM 10775 C CG   . GLN A 1 5  ? -24.903 15.055 14.121 1.00 0.00 ? 5  GLN A CG   13 
ATOM 10776 C CD   . GLN A 1 5  ? -25.823 13.835 14.190 1.00 0.00 ? 5  GLN A CD   13 
ATOM 10777 O OE1  . GLN A 1 5  ? -26.480 13.611 15.187 1.00 0.00 ? 5  GLN A OE1  13 
ATOM 10778 N NE2  . GLN A 1 5  ? -25.897 13.031 13.165 1.00 0.00 ? 5  GLN A NE2  13 
ATOM 10779 H H    . GLN A 1 5  ? -21.702 15.259 14.710 1.00 0.00 ? 5  GLN A H    13 
ATOM 10780 H HA   . GLN A 1 5  ? -23.875 17.270 14.936 1.00 0.00 ? 5  GLN A HA   13 
ATOM 10781 H HB2  . GLN A 1 5  ? -23.478 14.350 15.564 1.00 0.00 ? 5  GLN A HB2  13 
ATOM 10782 H HB3  . GLN A 1 5  ? -24.842 15.225 16.260 1.00 0.00 ? 5  GLN A HB3  13 
ATOM 10783 H HG2  . GLN A 1 5  ? -25.494 15.942 13.951 1.00 0.00 ? 5  GLN A HG2  13 
ATOM 10784 H HG3  . GLN A 1 5  ? -24.200 14.931 13.311 1.00 0.00 ? 5  GLN A HG3  13 
ATOM 10785 H HE21 . GLN A 1 5  ? -25.366 13.212 12.361 1.00 0.00 ? 5  GLN A HE21 13 
ATOM 10786 H HE22 . GLN A 1 5  ? -26.482 12.246 13.199 1.00 0.00 ? 5  GLN A HE22 13 
ATOM 10787 N N    . GLU A 1 6  ? -22.034 16.176 17.436 1.00 0.00 ? 6  GLU A N    13 
ATOM 10788 C CA   . GLU A 1 6  ? -21.587 16.527 18.812 1.00 0.00 ? 6  GLU A CA   13 
ATOM 10789 C C    . GLU A 1 6  ? -20.499 17.599 18.732 1.00 0.00 ? 6  GLU A C    13 
ATOM 10790 O O    . GLU A 1 6  ? -20.119 18.193 19.722 1.00 0.00 ? 6  GLU A O    13 
ATOM 10791 C CB   . GLU A 1 6  ? -21.023 15.229 19.391 1.00 0.00 ? 6  GLU A CB   13 
ATOM 10792 C CG   . GLU A 1 6  ? -22.143 14.196 19.520 1.00 0.00 ? 6  GLU A CG   13 
ATOM 10793 C CD   . GLU A 1 6  ? -21.540 12.791 19.553 1.00 0.00 ? 6  GLU A CD   13 
ATOM 10794 O OE1  . GLU A 1 6  ? -20.346 12.675 19.327 1.00 0.00 ? 6  GLU A OE1  13 
ATOM 10795 O OE2  . GLU A 1 6  ? -22.281 11.855 19.805 1.00 0.00 ? 6  GLU A OE2  13 
ATOM 10796 H H    . GLU A 1 6  ? -21.640 15.408 16.971 1.00 0.00 ? 6  GLU A H    13 
ATOM 10797 H HA   . GLU A 1 6  ? -22.419 16.870 19.407 1.00 0.00 ? 6  GLU A HA   13 
ATOM 10798 H HB2  . GLU A 1 6  ? -20.254 14.846 18.735 1.00 0.00 ? 6  GLU A HB2  13 
ATOM 10799 H HB3  . GLU A 1 6  ? -20.599 15.424 20.366 1.00 0.00 ? 6  GLU A HB3  13 
ATOM 10800 H HG2  . GLU A 1 6  ? -22.693 14.374 20.432 1.00 0.00 ? 6  GLU A HG2  13 
ATOM 10801 H HG3  . GLU A 1 6  ? -22.810 14.281 18.676 1.00 0.00 ? 6  GLU A HG3  13 
ATOM 10802 N N    . MET A 1 7  ? -20.001 17.850 17.551 1.00 0.00 ? 7  MET A N    13 
ATOM 10803 C CA   . MET A 1 7  ? -18.941 18.881 17.381 1.00 0.00 ? 7  MET A CA   13 
ATOM 10804 C C    . MET A 1 7  ? -17.711 18.531 18.223 1.00 0.00 ? 7  MET A C    13 
ATOM 10805 O O    . MET A 1 7  ? -17.523 17.400 18.627 1.00 0.00 ? 7  MET A O    13 
ATOM 10806 C CB   . MET A 1 7  ? -19.571 20.187 17.867 1.00 0.00 ? 7  MET A CB   13 
ATOM 10807 C CG   . MET A 1 7  ? -20.859 20.453 17.087 1.00 0.00 ? 7  MET A CG   13 
ATOM 10808 S SD   . MET A 1 7  ? -21.525 22.070 17.558 1.00 0.00 ? 7  MET A SD   13 
ATOM 10809 C CE   . MET A 1 7  ? -22.836 22.144 16.314 1.00 0.00 ? 7  MET A CE   13 
ATOM 10810 H H    . MET A 1 7  ? -20.327 17.357 16.770 1.00 0.00 ? 7  MET A H    13 
ATOM 10811 H HA   . MET A 1 7  ? -18.672 18.967 16.340 1.00 0.00 ? 7  MET A HA   13 
ATOM 10812 H HB2  . MET A 1 7  ? -19.796 20.107 18.920 1.00 0.00 ? 7  MET A HB2  13 
ATOM 10813 H HB3  . MET A 1 7  ? -18.879 21.001 17.707 1.00 0.00 ? 7  MET A HB3  13 
ATOM 10814 H HG2  . MET A 1 7  ? -20.648 20.446 16.029 1.00 0.00 ? 7  MET A HG2  13 
ATOM 10815 H HG3  . MET A 1 7  ? -21.584 19.686 17.316 1.00 0.00 ? 7  MET A HG3  13 
ATOM 10816 H HE1  . MET A 1 7  ? -23.190 21.148 16.102 1.00 0.00 ? 7  MET A HE1  13 
ATOM 10817 H HE2  . MET A 1 7  ? -23.655 22.743 16.690 1.00 0.00 ? 7  MET A HE2  13 
ATOM 10818 H HE3  . MET A 1 7  ? -22.447 22.586 15.407 1.00 0.00 ? 7  MET A HE3  13 
ATOM 10819 N N    . CYS A 1 8  ? -16.874 19.494 18.487 1.00 0.00 ? 8  CYS A N    13 
ATOM 10820 C CA   . CYS A 1 8  ? -15.653 19.224 19.300 1.00 0.00 ? 8  CYS A CA   13 
ATOM 10821 C C    . CYS A 1 8  ? -15.487 20.307 20.371 1.00 0.00 ? 8  CYS A C    13 
ATOM 10822 O O    . CYS A 1 8  ? -15.377 21.478 20.070 1.00 0.00 ? 8  CYS A O    13 
ATOM 10823 C CB   . CYS A 1 8  ? -14.501 19.271 18.293 1.00 0.00 ? 8  CYS A CB   13 
ATOM 10824 S SG   . CYS A 1 8  ? -12.923 19.389 19.172 1.00 0.00 ? 8  CYS A SG   13 
ATOM 10825 H H    . CYS A 1 8  ? -17.046 20.398 18.149 1.00 0.00 ? 8  CYS A H    13 
ATOM 10826 H HA   . CYS A 1 8  ? -15.708 18.248 19.752 1.00 0.00 ? 8  CYS A HA   13 
ATOM 10827 H HB2  . CYS A 1 8  ? -14.511 18.373 17.694 1.00 0.00 ? 8  CYS A HB2  13 
ATOM 10828 H HB3  . CYS A 1 8  ? -14.620 20.133 17.652 1.00 0.00 ? 8  CYS A HB3  13 
ATOM 10829 N N    . HIS A 1 9  ? -15.472 19.924 21.618 1.00 0.00 ? 9  HIS A N    13 
ATOM 10830 C CA   . HIS A 1 9  ? -15.318 20.934 22.706 1.00 0.00 ? 9  HIS A CA   13 
ATOM 10831 C C    . HIS A 1 9  ? -13.992 20.728 23.443 1.00 0.00 ? 9  HIS A C    13 
ATOM 10832 O O    . HIS A 1 9  ? -13.526 21.593 24.157 1.00 0.00 ? 9  HIS A O    13 
ATOM 10833 C CB   . HIS A 1 9  ? -16.496 20.685 23.647 1.00 0.00 ? 9  HIS A CB   13 
ATOM 10834 C CG   . HIS A 1 9  ? -17.784 20.770 22.874 1.00 0.00 ? 9  HIS A CG   13 
ATOM 10835 N ND1  . HIS A 1 9  ? -18.416 21.978 22.621 1.00 0.00 ? 9  HIS A ND1  13 
ATOM 10836 C CD2  . HIS A 1 9  ? -18.572 19.806 22.295 1.00 0.00 ? 9  HIS A CD2  13 
ATOM 10837 C CE1  . HIS A 1 9  ? -19.533 21.711 21.918 1.00 0.00 ? 9  HIS A CE1  13 
ATOM 10838 N NE2  . HIS A 1 9  ? -19.676 20.402 21.692 1.00 0.00 ? 9  HIS A NE2  13 
ATOM 10839 H H    . HIS A 1 9  ? -15.565 18.975 21.842 1.00 0.00 ? 9  HIS A H    13 
ATOM 10840 H HA   . HIS A 1 9  ? -15.373 21.934 22.303 1.00 0.00 ? 9  HIS A HA   13 
ATOM 10841 H HB2  . HIS A 1 9  ? -16.405 19.703 24.087 1.00 0.00 ? 9  HIS A HB2  13 
ATOM 10842 H HB3  . HIS A 1 9  ? -16.496 21.431 24.429 1.00 0.00 ? 9  HIS A HB3  13 
ATOM 10843 H HD1  . HIS A 1 9  ? -18.107 22.864 22.903 1.00 0.00 ? 9  HIS A HD1  13 
ATOM 10844 H HD2  . HIS A 1 9  ? -18.365 18.746 22.305 1.00 0.00 ? 9  HIS A HD2  13 
ATOM 10845 H HE1  . HIS A 1 9  ? -20.229 22.463 21.579 1.00 0.00 ? 9  HIS A HE1  13 
ATOM 10846 N N    . GLU A 1 10 ? -13.381 19.586 23.277 1.00 0.00 ? 10 GLU A N    13 
ATOM 10847 C CA   . GLU A 1 10 ? -12.088 19.326 23.973 1.00 0.00 ? 10 GLU A CA   13 
ATOM 10848 C C    . GLU A 1 10 ? -11.050 20.383 23.584 1.00 0.00 ? 10 GLU A C    13 
ATOM 10849 O O    . GLU A 1 10 ? -10.364 20.930 24.425 1.00 0.00 ? 10 GLU A O    13 
ATOM 10850 C CB   . GLU A 1 10 ? -11.649 17.944 23.488 1.00 0.00 ? 10 GLU A CB   13 
ATOM 10851 C CG   . GLU A 1 10 ? -10.428 17.488 24.289 1.00 0.00 ? 10 GLU A CG   13 
ATOM 10852 C CD   . GLU A 1 10 ? -9.915  16.162 23.726 1.00 0.00 ? 10 GLU A CD   13 
ATOM 10853 O OE1  . GLU A 1 10 ? -10.609 15.579 22.910 1.00 0.00 ? 10 GLU A OE1  13 
ATOM 10854 O OE2  . GLU A 1 10 ? -8.834  15.751 24.119 1.00 0.00 ? 10 GLU A OE2  13 
ATOM 10855 H H    . GLU A 1 10 ? -13.773 18.900 22.699 1.00 0.00 ? 10 GLU A H    13 
ATOM 10856 H HA   . GLU A 1 10 ? -12.231 19.313 25.042 1.00 0.00 ? 10 GLU A HA   13 
ATOM 10857 H HB2  . GLU A 1 10 ? -12.456 17.239 23.631 1.00 0.00 ? 10 GLU A HB2  13 
ATOM 10858 H HB3  . GLU A 1 10 ? -11.395 17.993 22.440 1.00 0.00 ? 10 GLU A HB3  13 
ATOM 10859 H HG2  . GLU A 1 10 ? -9.651  18.235 24.217 1.00 0.00 ? 10 GLU A HG2  13 
ATOM 10860 H HG3  . GLU A 1 10 ? -10.705 17.356 25.324 1.00 0.00 ? 10 GLU A HG3  13 
ATOM 10861 N N    . PHE A 1 11 ? -10.928 20.671 22.319 1.00 0.00 ? 11 PHE A N    13 
ATOM 10862 C CA   . PHE A 1 11 ? -9.932  21.689 21.880 1.00 0.00 ? 11 PHE A CA   13 
ATOM 10863 C C    . PHE A 1 11 ? -10.551 23.088 21.904 1.00 0.00 ? 11 PHE A C    13 
ATOM 10864 O O    . PHE A 1 11 ? -9.876  24.077 21.699 1.00 0.00 ? 11 PHE A O    13 
ATOM 10865 C CB   . PHE A 1 11 ? -9.572  21.301 20.450 1.00 0.00 ? 11 PHE A CB   13 
ATOM 10866 C CG   . PHE A 1 11 ? -8.645  20.111 20.458 1.00 0.00 ? 11 PHE A CG   13 
ATOM 10867 C CD1  . PHE A 1 11 ? -9.121  18.849 20.838 1.00 0.00 ? 11 PHE A CD1  13 
ATOM 10868 C CD2  . PHE A 1 11 ? -7.307  20.267 20.078 1.00 0.00 ? 11 PHE A CD2  13 
ATOM 10869 C CE1  . PHE A 1 11 ? -8.260  17.748 20.836 1.00 0.00 ? 11 PHE A CE1  13 
ATOM 10870 C CE2  . PHE A 1 11 ? -6.447  19.165 20.076 1.00 0.00 ? 11 PHE A CE2  13 
ATOM 10871 C CZ   . PHE A 1 11 ? -6.924  17.906 20.454 1.00 0.00 ? 11 PHE A CZ   13 
ATOM 10872 H H    . PHE A 1 11 ? -11.489 20.218 21.656 1.00 0.00 ? 11 PHE A H    13 
ATOM 10873 H HA   . PHE A 1 11 ? -9.054  21.653 22.505 1.00 0.00 ? 11 PHE A HA   13 
ATOM 10874 H HB2  . PHE A 1 11 ? -10.473 21.051 19.913 1.00 0.00 ? 11 PHE A HB2  13 
ATOM 10875 H HB3  . PHE A 1 11 ? -9.085  22.132 19.964 1.00 0.00 ? 11 PHE A HB3  13 
ATOM 10876 H HD1  . PHE A 1 11 ? -10.151 18.727 21.134 1.00 0.00 ? 11 PHE A HD1  13 
ATOM 10877 H HD2  . PHE A 1 11 ? -6.939  21.239 19.787 1.00 0.00 ? 11 PHE A HD2  13 
ATOM 10878 H HE1  . PHE A 1 11 ? -8.627  16.775 21.128 1.00 0.00 ? 11 PHE A HE1  13 
ATOM 10879 H HE2  . PHE A 1 11 ? -5.414  19.286 19.783 1.00 0.00 ? 11 PHE A HE2  13 
ATOM 10880 H HZ   . PHE A 1 11 ? -6.258  17.058 20.457 1.00 0.00 ? 11 PHE A HZ   13 
ATOM 10881 N N    . GLN A 1 12 ? -11.830 23.182 22.143 1.00 0.00 ? 12 GLN A N    13 
ATOM 10882 C CA   . GLN A 1 12 ? -12.481 24.522 22.168 1.00 0.00 ? 12 GLN A CA   13 
ATOM 10883 C C    . GLN A 1 12 ? -11.617 25.515 22.950 1.00 0.00 ? 12 GLN A C    13 
ATOM 10884 O O    . GLN A 1 12 ? -11.366 26.616 22.505 1.00 0.00 ? 12 GLN A O    13 
ATOM 10885 C CB   . GLN A 1 12 ? -13.818 24.304 22.875 1.00 0.00 ? 12 GLN A CB   13 
ATOM 10886 C CG   . GLN A 1 12 ? -14.610 25.614 22.872 1.00 0.00 ? 12 GLN A CG   13 
ATOM 10887 C CD   . GLN A 1 12 ? -15.871 25.449 23.723 1.00 0.00 ? 12 GLN A CD   13 
ATOM 10888 O OE1  . GLN A 1 12 ? -15.956 24.552 24.537 1.00 0.00 ? 12 GLN A OE1  13 
ATOM 10889 N NE2  . GLN A 1 12 ? -16.861 26.284 23.565 1.00 0.00 ? 12 GLN A NE2  13 
ATOM 10890 H H    . GLN A 1 12 ? -12.361 22.374 22.300 1.00 0.00 ? 12 GLN A H    13 
ATOM 10891 H HA   . GLN A 1 12 ? -12.650 24.878 21.165 1.00 0.00 ? 12 GLN A HA   13 
ATOM 10892 H HB2  . GLN A 1 12 ? -14.380 23.542 22.357 1.00 0.00 ? 12 GLN A HB2  13 
ATOM 10893 H HB3  . GLN A 1 12 ? -13.641 23.992 23.894 1.00 0.00 ? 12 GLN A HB3  13 
ATOM 10894 H HG2  . GLN A 1 12 ? -13.998 26.405 23.282 1.00 0.00 ? 12 GLN A HG2  13 
ATOM 10895 H HG3  . GLN A 1 12 ? -14.889 25.863 21.859 1.00 0.00 ? 12 GLN A HG3  13 
ATOM 10896 H HE21 . GLN A 1 12 ? -16.794 27.007 22.907 1.00 0.00 ? 12 GLN A HE21 13 
ATOM 10897 H HE22 . GLN A 1 12 ? -17.675 26.187 24.104 1.00 0.00 ? 12 GLN A HE22 13 
ATOM 10898 N N    . ALA A 1 13 ? -11.159 25.133 24.109 1.00 0.00 ? 13 ALA A N    13 
ATOM 10899 C CA   . ALA A 1 13 ? -10.311 26.057 24.915 1.00 0.00 ? 13 ALA A CA   13 
ATOM 10900 C C    . ALA A 1 13 ? -9.076  26.473 24.111 1.00 0.00 ? 13 ALA A C    13 
ATOM 10901 O O    . ALA A 1 13 ? -8.415  27.442 24.426 1.00 0.00 ? 13 ALA A O    13 
ATOM 10902 C CB   . ALA A 1 13 ? -9.903  25.250 26.147 1.00 0.00 ? 13 ALA A CB   13 
ATOM 10903 H H    . ALA A 1 13 ? -11.371 24.240 24.451 1.00 0.00 ? 13 ALA A H    13 
ATOM 10904 H HA   . ALA A 1 13 ? -10.876 26.926 25.213 1.00 0.00 ? 13 ALA A HA   13 
ATOM 10905 H HB1  . ALA A 1 13 ? -9.809  25.912 26.995 1.00 0.00 ? 13 ALA A HB1  13 
ATOM 10906 H HB2  . ALA A 1 13 ? -8.954  24.767 25.963 1.00 0.00 ? 13 ALA A HB2  13 
ATOM 10907 H HB3  . ALA A 1 13 ? -10.654 24.503 26.353 1.00 0.00 ? 13 ALA A HB3  13 
ATOM 10908 N N    . PHE A 1 14 ? -8.761  25.743 23.075 1.00 0.00 ? 14 PHE A N    13 
ATOM 10909 C CA   . PHE A 1 14 ? -7.569  26.091 22.252 1.00 0.00 ? 14 PHE A CA   13 
ATOM 10910 C C    . PHE A 1 14 ? -7.959  27.041 21.119 1.00 0.00 ? 14 PHE A C    13 
ATOM 10911 O O    . PHE A 1 14 ? -7.207  27.249 20.188 1.00 0.00 ? 14 PHE A O    13 
ATOM 10912 C CB   . PHE A 1 14 ? -7.090  24.762 21.676 1.00 0.00 ? 14 PHE A CB   13 
ATOM 10913 C CG   . PHE A 1 14 ? -6.797  23.790 22.794 1.00 0.00 ? 14 PHE A CG   13 
ATOM 10914 C CD1  . PHE A 1 14 ? -6.473  24.260 24.072 1.00 0.00 ? 14 PHE A CD1  13 
ATOM 10915 C CD2  . PHE A 1 14 ? -6.847  22.415 22.546 1.00 0.00 ? 14 PHE A CD2  13 
ATOM 10916 C CE1  . PHE A 1 14 ? -6.200  23.351 25.102 1.00 0.00 ? 14 PHE A CE1  13 
ATOM 10917 C CE2  . PHE A 1 14 ? -6.576  21.507 23.574 1.00 0.00 ? 14 PHE A CE2  13 
ATOM 10918 C CZ   . PHE A 1 14 ? -6.252  21.975 24.853 1.00 0.00 ? 14 PHE A CZ   13 
ATOM 10919 H H    . PHE A 1 14 ? -9.305  24.963 22.839 1.00 0.00 ? 14 PHE A H    13 
ATOM 10920 H HA   . PHE A 1 14 ? -6.799  26.526 22.868 1.00 0.00 ? 14 PHE A HA   13 
ATOM 10921 H HB2  . PHE A 1 14 ? -7.858  24.351 21.036 1.00 0.00 ? 14 PHE A HB2  13 
ATOM 10922 H HB3  . PHE A 1 14 ? -6.195  24.925 21.100 1.00 0.00 ? 14 PHE A HB3  13 
ATOM 10923 H HD1  . PHE A 1 14 ? -6.434  25.322 24.264 1.00 0.00 ? 14 PHE A HD1  13 
ATOM 10924 H HD2  . PHE A 1 14 ? -7.098  22.055 21.559 1.00 0.00 ? 14 PHE A HD2  13 
ATOM 10925 H HE1  . PHE A 1 14 ? -5.950  23.713 26.088 1.00 0.00 ? 14 PHE A HE1  13 
ATOM 10926 H HE2  . PHE A 1 14 ? -6.616  20.445 23.380 1.00 0.00 ? 14 PHE A HE2  13 
ATOM 10927 H HZ   . PHE A 1 14 ? -6.041  21.273 25.647 1.00 0.00 ? 14 PHE A HZ   13 
ATOM 10928 N N    . MET A 1 15 ? -9.131  27.611 21.174 1.00 0.00 ? 15 MET A N    13 
ATOM 10929 C CA   . MET A 1 15 ? -9.553  28.529 20.086 1.00 0.00 ? 15 MET A CA   13 
ATOM 10930 C C    . MET A 1 15 ? -9.396  29.991 20.519 1.00 0.00 ? 15 MET A C    13 
ATOM 10931 O O    . MET A 1 15 ? -10.008 30.441 21.469 1.00 0.00 ? 15 MET A O    13 
ATOM 10932 C CB   . MET A 1 15 ? -11.022 28.189 19.841 1.00 0.00 ? 15 MET A CB   13 
ATOM 10933 C CG   . MET A 1 15 ? -11.883 28.768 20.966 1.00 0.00 ? 15 MET A CG   13 
ATOM 10934 S SD   . MET A 1 15 ? -13.484 27.921 20.998 1.00 0.00 ? 15 MET A SD   13 
ATOM 10935 C CE   . MET A 1 15 ? -14.156 28.641 19.479 1.00 0.00 ? 15 MET A CE   13 
ATOM 10936 H H    . MET A 1 15 ? -9.736  27.427 21.920 1.00 0.00 ? 15 MET A H    13 
ATOM 10937 H HA   . MET A 1 15 ? -8.978  28.337 19.194 1.00 0.00 ? 15 MET A HA   13 
ATOM 10938 H HB2  . MET A 1 15 ? -11.331 28.608 18.902 1.00 0.00 ? 15 MET A HB2  13 
ATOM 10939 H HB3  . MET A 1 15 ? -11.143 27.116 19.813 1.00 0.00 ? 15 MET A HB3  13 
ATOM 10940 H HG2  . MET A 1 15 ? -11.384 28.627 21.913 1.00 0.00 ? 15 MET A HG2  13 
ATOM 10941 H HG3  . MET A 1 15 ? -12.037 29.824 20.793 1.00 0.00 ? 15 MET A HG3  13 
ATOM 10942 H HE1  . MET A 1 15 ? -14.146 29.719 19.558 1.00 0.00 ? 15 MET A HE1  13 
ATOM 10943 H HE2  . MET A 1 15 ? -13.554 28.330 18.637 1.00 0.00 ? 15 MET A HE2  13 
ATOM 10944 H HE3  . MET A 1 15 ? -15.170 28.303 19.338 1.00 0.00 ? 15 MET A HE3  13 
ATOM 10945 N N    . LYS A 1 16 ? -8.583  30.738 19.823 1.00 0.00 ? 16 LYS A N    13 
ATOM 10946 C CA   . LYS A 1 16 ? -8.386  32.170 20.179 1.00 0.00 ? 16 LYS A CA   13 
ATOM 10947 C C    . LYS A 1 16 ? -9.275  33.053 19.297 1.00 0.00 ? 16 LYS A C    13 
ATOM 10948 O O    . LYS A 1 16 ? -8.848  33.554 18.276 1.00 0.00 ? 16 LYS A O    13 
ATOM 10949 C CB   . LYS A 1 16 ? -6.908  32.446 19.901 1.00 0.00 ? 16 LYS A CB   13 
ATOM 10950 C CG   . LYS A 1 16 ? -6.609  33.923 20.158 1.00 0.00 ? 16 LYS A CG   13 
ATOM 10951 C CD   . LYS A 1 16 ? -7.132  34.315 21.541 1.00 0.00 ? 16 LYS A CD   13 
ATOM 10952 C CE   . LYS A 1 16 ? -6.576  35.688 21.927 1.00 0.00 ? 16 LYS A CE   13 
ATOM 10953 N NZ   . LYS A 1 16 ? -7.163  35.973 23.267 1.00 0.00 ? 16 LYS A NZ   13 
ATOM 10954 H H    . LYS A 1 16 ? -8.103  30.355 19.062 1.00 0.00 ? 16 LYS A H    13 
ATOM 10955 H HA   . LYS A 1 16 ? -8.605  32.334 21.222 1.00 0.00 ? 16 LYS A HA   13 
ATOM 10956 H HB2  . LYS A 1 16 ? -6.299  31.836 20.552 1.00 0.00 ? 16 LYS A HB2  13 
ATOM 10957 H HB3  . LYS A 1 16 ? -6.685  32.207 18.871 1.00 0.00 ? 16 LYS A HB3  13 
ATOM 10958 H HG2  . LYS A 1 16 ? -5.542  34.088 20.116 1.00 0.00 ? 16 LYS A HG2  13 
ATOM 10959 H HG3  . LYS A 1 16 ? -7.094  34.526 19.404 1.00 0.00 ? 16 LYS A HG3  13 
ATOM 10960 H HD2  . LYS A 1 16 ? -8.211  34.357 21.518 1.00 0.00 ? 16 LYS A HD2  13 
ATOM 10961 H HD3  . LYS A 1 16 ? -6.815  33.582 22.266 1.00 0.00 ? 16 LYS A HD3  13 
ATOM 10962 H HE2  . LYS A 1 16 ? -5.498  35.654 21.987 1.00 0.00 ? 16 LYS A HE2  13 
ATOM 10963 H HE3  . LYS A 1 16 ? -6.890  36.435 21.212 1.00 0.00 ? 16 LYS A HE3  13 
ATOM 10964 H HZ1  . LYS A 1 16 ? -7.117  35.117 23.854 1.00 0.00 ? 16 LYS A HZ1  13 
ATOM 10965 H HZ2  . LYS A 1 16 ? -6.626  36.738 23.724 1.00 0.00 ? 16 LYS A HZ2  13 
ATOM 10966 H HZ3  . LYS A 1 16 ? -8.155  36.262 23.156 1.00 0.00 ? 16 LYS A HZ3  13 
ATOM 10967 N N    . ASN A 1 17 ? -10.507 33.239 19.683 1.00 0.00 ? 17 ASN A N    13 
ATOM 10968 C CA   . ASN A 1 17 ? -11.432 34.085 18.872 1.00 0.00 ? 17 ASN A CA   13 
ATOM 10969 C C    . ASN A 1 17 ? -11.573 33.525 17.453 1.00 0.00 ? 17 ASN A C    13 
ATOM 10970 O O    . ASN A 1 17 ? -11.363 34.220 16.478 1.00 0.00 ? 17 ASN A O    13 
ATOM 10971 C CB   . ASN A 1 17 ? -10.789 35.473 18.842 1.00 0.00 ? 17 ASN A CB   13 
ATOM 10972 C CG   . ASN A 1 17 ? -10.689 36.019 20.267 1.00 0.00 ? 17 ASN A CG   13 
ATOM 10973 O OD1  . ASN A 1 17 ? -11.634 35.945 21.027 1.00 0.00 ? 17 ASN A OD1  13 
ATOM 10974 N ND2  . ASN A 1 17 ? -9.574  36.568 20.663 1.00 0.00 ? 17 ASN A ND2  13 
ATOM 10975 H H    . ASN A 1 17 ? -10.829 32.820 20.509 1.00 0.00 ? 17 ASN A H    13 
ATOM 10976 H HA   . ASN A 1 17 ? -12.399 34.141 19.347 1.00 0.00 ? 17 ASN A HA   13 
ATOM 10977 H HB2  . ASN A 1 17 ? -9.800  35.405 18.414 1.00 0.00 ? 17 ASN A HB2  13 
ATOM 10978 H HB3  . ASN A 1 17 ? -11.395 36.137 18.245 1.00 0.00 ? 17 ASN A HB3  13 
ATOM 10979 H HD21 . ASN A 1 17 ? -8.812  36.628 20.051 1.00 0.00 ? 17 ASN A HD21 13 
ATOM 10980 H HD22 . ASN A 1 17 ? -9.500  36.921 21.574 1.00 0.00 ? 17 ASN A HD22 13 
ATOM 10981 N N    . GLY A 1 18 ? -11.940 32.278 17.328 1.00 0.00 ? 18 GLY A N    13 
ATOM 10982 C CA   . GLY A 1 18 ? -12.108 31.683 15.970 1.00 0.00 ? 18 GLY A CA   13 
ATOM 10983 C C    . GLY A 1 18 ? -10.791 31.061 15.500 1.00 0.00 ? 18 GLY A C    13 
ATOM 10984 O O    . GLY A 1 18 ? -10.762 30.293 14.559 1.00 0.00 ? 18 GLY A O    13 
ATOM 10985 H H    . GLY A 1 18 ? -12.114 31.737 18.127 1.00 0.00 ? 18 GLY A H    13 
ATOM 10986 H HA2  . GLY A 1 18 ? -12.871 30.920 16.007 1.00 0.00 ? 18 GLY A HA2  13 
ATOM 10987 H HA3  . GLY A 1 18 ? -12.406 32.455 15.277 1.00 0.00 ? 18 GLY A HA3  13 
ATOM 10988 N N    . LYS A 1 19 ? -9.702  31.382 16.141 1.00 0.00 ? 19 LYS A N    13 
ATOM 10989 C CA   . LYS A 1 19 ? -8.394  30.800 15.715 1.00 0.00 ? 19 LYS A CA   13 
ATOM 10990 C C    . LYS A 1 19 ? -8.077  29.552 16.542 1.00 0.00 ? 19 LYS A C    13 
ATOM 10991 O O    . LYS A 1 19 ? -8.116  29.576 17.752 1.00 0.00 ? 19 LYS A O    13 
ATOM 10992 C CB   . LYS A 1 19 ? -7.363  31.894 15.984 1.00 0.00 ? 19 LYS A CB   13 
ATOM 10993 C CG   . LYS A 1 19 ? -6.058  31.551 15.262 1.00 0.00 ? 19 LYS A CG   13 
ATOM 10994 C CD   . LYS A 1 19 ? -5.371  30.382 15.973 1.00 0.00 ? 19 LYS A CD   13 
ATOM 10995 C CE   . LYS A 1 19 ? -3.881  30.383 15.630 1.00 0.00 ? 19 LYS A CE   13 
ATOM 10996 N NZ   . LYS A 1 19 ? -3.785  29.638 14.343 1.00 0.00 ? 19 LYS A NZ   13 
ATOM 10997 H H    . LYS A 1 19 ? -9.741  32.002 16.898 1.00 0.00 ? 19 LYS A H    13 
ATOM 10998 H HA   . LYS A 1 19 ? -8.413  30.561 14.664 1.00 0.00 ? 19 LYS A HA   13 
ATOM 10999 H HB2  . LYS A 1 19 ? -7.737  32.840 15.620 1.00 0.00 ? 19 LYS A HB2  13 
ATOM 11000 H HB3  . LYS A 1 19 ? -7.179  31.964 17.046 1.00 0.00 ? 19 LYS A HB3  13 
ATOM 11001 H HG2  . LYS A 1 19 ? -6.273  31.274 14.241 1.00 0.00 ? 19 LYS A HG2  13 
ATOM 11002 H HG3  . LYS A 1 19 ? -5.405  32.411 15.272 1.00 0.00 ? 19 LYS A HG3  13 
ATOM 11003 H HD2  . LYS A 1 19 ? -5.495  30.485 17.040 1.00 0.00 ? 19 LYS A HD2  13 
ATOM 11004 H HD3  . LYS A 1 19 ? -5.814  29.451 15.647 1.00 0.00 ? 19 LYS A HD3  13 
ATOM 11005 H HE2  . LYS A 1 19 ? -3.525  31.396 15.506 1.00 0.00 ? 19 LYS A HE2  13 
ATOM 11006 H HE3  . LYS A 1 19 ? -3.317  29.877 16.401 1.00 0.00 ? 19 LYS A HE3  13 
ATOM 11007 H HZ1  . LYS A 1 19 ? -4.607  29.869 13.748 1.00 0.00 ? 19 LYS A HZ1  13 
ATOM 11008 H HZ2  . LYS A 1 19 ? -2.911  29.909 13.849 1.00 0.00 ? 19 LYS A HZ2  13 
ATOM 11009 H HZ3  . LYS A 1 19 ? -3.770  28.617 14.534 1.00 0.00 ? 19 LYS A HZ3  13 
ATOM 11010 N N    . LEU A 1 20 ? -7.762  28.463 15.900 1.00 0.00 ? 20 LEU A N    13 
ATOM 11011 C CA   . LEU A 1 20 ? -7.444  27.221 16.663 1.00 0.00 ? 20 LEU A CA   13 
ATOM 11012 C C    . LEU A 1 20 ? -5.948  26.911 16.572 1.00 0.00 ? 20 LEU A C    13 
ATOM 11013 O O    . LEU A 1 20 ? -5.424  26.640 15.509 1.00 0.00 ? 20 LEU A O    13 
ATOM 11014 C CB   . LEU A 1 20 ? -8.261  26.121 15.986 1.00 0.00 ? 20 LEU A CB   13 
ATOM 11015 C CG   . LEU A 1 20 ? -7.776  24.753 16.474 1.00 0.00 ? 20 LEU A CG   13 
ATOM 11016 C CD1  . LEU A 1 20 ? -8.086  24.605 17.965 1.00 0.00 ? 20 LEU A CD1  13 
ATOM 11017 C CD2  . LEU A 1 20 ? -8.493  23.650 15.694 1.00 0.00 ? 20 LEU A CD2  13 
ATOM 11018 H H    . LEU A 1 20 ? -7.734  28.459 14.921 1.00 0.00 ? 20 LEU A H    13 
ATOM 11019 H HA   . LEU A 1 20 ? -7.746  27.323 17.693 1.00 0.00 ? 20 LEU A HA   13 
ATOM 11020 H HB2  . LEU A 1 20 ? -9.305  26.242 16.235 1.00 0.00 ? 20 LEU A HB2  13 
ATOM 11021 H HB3  . LEU A 1 20 ? -8.136  26.185 14.915 1.00 0.00 ? 20 LEU A HB3  13 
ATOM 11022 H HG   . LEU A 1 20 ? -6.711  24.672 16.317 1.00 0.00 ? 20 LEU A HG   13 
ATOM 11023 H HD11 . LEU A 1 20 ? -9.106  24.903 18.153 1.00 0.00 ? 20 LEU A HD11 13 
ATOM 11024 H HD12 . LEU A 1 20 ? -7.951  23.574 18.259 1.00 0.00 ? 20 LEU A HD12 13 
ATOM 11025 H HD13 . LEU A 1 20 ? -7.416  25.232 18.535 1.00 0.00 ? 20 LEU A HD13 13 
ATOM 11026 H HD21 . LEU A 1 20 ? -8.439  23.864 14.637 1.00 0.00 ? 20 LEU A HD21 13 
ATOM 11027 H HD22 . LEU A 1 20 ? -8.017  22.702 15.893 1.00 0.00 ? 20 LEU A HD22 13 
ATOM 11028 H HD23 . LEU A 1 20 ? -9.527  23.606 16.001 1.00 0.00 ? 20 LEU A HD23 13 
ATOM 11029 N N    . PHE A 1 21 ? -5.254  26.941 17.678 1.00 0.00 ? 21 PHE A N    13 
ATOM 11030 C CA   . PHE A 1 21 ? -3.792  26.637 17.638 1.00 0.00 ? 21 PHE A CA   13 
ATOM 11031 C C    . PHE A 1 21 ? -3.532  25.223 18.165 1.00 0.00 ? 21 PHE A C    13 
ATOM 11032 O O    . PHE A 1 21 ? -2.970  25.032 19.224 1.00 0.00 ? 21 PHE A O    13 
ATOM 11033 C CB   . PHE A 1 21 ? -3.113  27.694 18.522 1.00 0.00 ? 21 PHE A CB   13 
ATOM 11034 C CG   . PHE A 1 21 ? -3.792  27.785 19.871 1.00 0.00 ? 21 PHE A CG   13 
ATOM 11035 C CD1  . PHE A 1 21 ? -4.858  28.675 20.060 1.00 0.00 ? 21 PHE A CD1  13 
ATOM 11036 C CD2  . PHE A 1 21 ? -3.346  26.992 20.937 1.00 0.00 ? 21 PHE A CD2  13 
ATOM 11037 C CE1  . PHE A 1 21 ? -5.478  28.768 21.311 1.00 0.00 ? 21 PHE A CE1  13 
ATOM 11038 C CE2  . PHE A 1 21 ? -3.968  27.087 22.187 1.00 0.00 ? 21 PHE A CE2  13 
ATOM 11039 C CZ   . PHE A 1 21 ? -5.033  27.975 22.375 1.00 0.00 ? 21 PHE A CZ   13 
ATOM 11040 H H    . PHE A 1 21 ? -5.694  27.154 18.528 1.00 0.00 ? 21 PHE A H    13 
ATOM 11041 H HA   . PHE A 1 21 ? -3.427  26.724 16.627 1.00 0.00 ? 21 PHE A HA   13 
ATOM 11042 H HB2  . PHE A 1 21 ? -2.076  27.424 18.664 1.00 0.00 ? 21 PHE A HB2  13 
ATOM 11043 H HB3  . PHE A 1 21 ? -3.166  28.655 18.031 1.00 0.00 ? 21 PHE A HB3  13 
ATOM 11044 H HD1  . PHE A 1 21 ? -5.201  29.287 19.239 1.00 0.00 ? 21 PHE A HD1  13 
ATOM 11045 H HD2  . PHE A 1 21 ? -2.524  26.309 20.795 1.00 0.00 ? 21 PHE A HD2  13 
ATOM 11046 H HE1  . PHE A 1 21 ? -6.301  29.453 21.456 1.00 0.00 ? 21 PHE A HE1  13 
ATOM 11047 H HE2  . PHE A 1 21 ? -3.624  26.475 23.008 1.00 0.00 ? 21 PHE A HE2  13 
ATOM 11048 H HZ   . PHE A 1 21 ? -5.512  28.048 23.340 1.00 0.00 ? 21 PHE A HZ   13 
ATOM 11049 N N    . CYS A 1 22 ? -3.940  24.230 17.422 1.00 0.00 ? 22 CYS A N    13 
ATOM 11050 C CA   . CYS A 1 22 ? -3.724  22.819 17.860 1.00 0.00 ? 22 CYS A CA   13 
ATOM 11051 C C    . CYS A 1 22 ? -2.238  22.535 18.141 1.00 0.00 ? 22 CYS A C    13 
ATOM 11052 O O    . CYS A 1 22 ? -1.913  21.954 19.157 1.00 0.00 ? 22 CYS A O    13 
ATOM 11053 C CB   . CYS A 1 22 ? -4.219  21.959 16.696 1.00 0.00 ? 22 CYS A CB   13 
ATOM 11054 S SG   . CYS A 1 22 ? -5.167  20.558 17.338 1.00 0.00 ? 22 CYS A SG   13 
ATOM 11055 H H    . CYS A 1 22 ? -4.390  24.413 16.571 1.00 0.00 ? 22 CYS A H    13 
ATOM 11056 H HA   . CYS A 1 22 ? -4.313  22.609 18.739 1.00 0.00 ? 22 CYS A HA   13 
ATOM 11057 H HB2  . CYS A 1 22 ? -4.846  22.553 16.049 1.00 0.00 ? 22 CYS A HB2  13 
ATOM 11058 H HB3  . CYS A 1 22 ? -3.373  21.588 16.135 1.00 0.00 ? 22 CYS A HB3  13 
ATOM 11059 N N    . PRO A 1 23 ? -1.376  22.932 17.231 1.00 0.00 ? 23 PRO A N    13 
ATOM 11060 C CA   . PRO A 1 23 ? 0.075   22.682 17.406 1.00 0.00 ? 23 PRO A CA   13 
ATOM 11061 C C    . PRO A 1 23 ? 0.612   23.401 18.646 1.00 0.00 ? 23 PRO A C    13 
ATOM 11062 O O    . PRO A 1 23 ? 1.157   24.484 18.564 1.00 0.00 ? 23 PRO A O    13 
ATOM 11063 C CB   . PRO A 1 23 ? 0.676   23.259 16.123 1.00 0.00 ? 23 PRO A CB   13 
ATOM 11064 C CG   . PRO A 1 23 ? -0.464  23.815 15.249 1.00 0.00 ? 23 PRO A CG   13 
ATOM 11065 C CD   . PRO A 1 23 ? -1.792  23.643 15.998 1.00 0.00 ? 23 PRO A CD   13 
ATOM 11066 H HA   . PRO A 1 23 ? 0.275   21.624 17.462 1.00 0.00 ? 23 PRO A HA   13 
ATOM 11067 H HB2  . PRO A 1 23 ? 1.363   24.054 16.371 1.00 0.00 ? 23 PRO A HB2  13 
ATOM 11068 H HB3  . PRO A 1 23 ? 1.199   22.483 15.586 1.00 0.00 ? 23 PRO A HB3  13 
ATOM 11069 H HG2  . PRO A 1 23 ? -0.291  24.864 15.052 1.00 0.00 ? 23 PRO A HG2  13 
ATOM 11070 H HG3  . PRO A 1 23 ? -0.502  23.273 14.316 1.00 0.00 ? 23 PRO A HG3  13 
ATOM 11071 H HD2  . PRO A 1 23 ? -2.214  24.606 16.236 1.00 0.00 ? 23 PRO A HD2  13 
ATOM 11072 H HD3  . PRO A 1 23 ? -2.484  23.049 15.422 1.00 0.00 ? 23 PRO A HD3  13 
ATOM 11073 N N    . GLN A 1 24 ? 0.472   22.795 19.793 1.00 0.00 ? 24 GLN A N    13 
ATOM 11074 C CA   . GLN A 1 24 ? 0.980   23.425 21.044 1.00 0.00 ? 24 GLN A CA   13 
ATOM 11075 C C    . GLN A 1 24 ? 1.911   22.453 21.772 1.00 0.00 ? 24 GLN A C    13 
ATOM 11076 O O    . GLN A 1 24 ? 3.119   22.563 21.706 1.00 0.00 ? 24 GLN A O    13 
ATOM 11077 C CB   . GLN A 1 24 ? -0.268  23.703 21.885 1.00 0.00 ? 24 GLN A CB   13 
ATOM 11078 C CG   . GLN A 1 24 ? 0.147   24.021 23.324 1.00 0.00 ? 24 GLN A CG   13 
ATOM 11079 C CD   . GLN A 1 24 ? -1.090  24.015 24.226 1.00 0.00 ? 24 GLN A CD   13 
ATOM 11080 O OE1  . GLN A 1 24 ? -1.612  25.057 24.567 1.00 0.00 ? 24 GLN A OE1  13 
ATOM 11081 N NE2  . GLN A 1 24 ? -1.582  22.876 24.631 1.00 0.00 ? 24 GLN A NE2  13 
ATOM 11082 H H    . GLN A 1 24 ? 0.035   21.918 19.829 1.00 0.00 ? 24 GLN A H    13 
ATOM 11083 H HA   . GLN A 1 24 ? 1.491   24.346 20.824 1.00 0.00 ? 24 GLN A HA   13 
ATOM 11084 H HB2  . GLN A 1 24 ? -0.801  24.545 21.470 1.00 0.00 ? 24 GLN A HB2  13 
ATOM 11085 H HB3  . GLN A 1 24 ? -0.908  22.833 21.878 1.00 0.00 ? 24 GLN A HB3  13 
ATOM 11086 H HG2  . GLN A 1 24 ? 0.846   23.275 23.672 1.00 0.00 ? 24 GLN A HG2  13 
ATOM 11087 H HG3  . GLN A 1 24 ? 0.612   24.994 23.358 1.00 0.00 ? 24 GLN A HG3  13 
ATOM 11088 H HE21 . GLN A 1 24 ? -1.159  22.035 24.356 1.00 0.00 ? 24 GLN A HE21 13 
ATOM 11089 H HE22 . GLN A 1 24 ? -2.373  22.861 25.208 1.00 0.00 ? 24 GLN A HE22 13 
ATOM 11090 N N    . ASP A 1 25 ? 1.352   21.500 22.464 1.00 0.00 ? 25 ASP A N    13 
ATOM 11091 C CA   . ASP A 1 25 ? 2.192   20.511 23.198 1.00 0.00 ? 25 ASP A CA   13 
ATOM 11092 C C    . ASP A 1 25 ? 1.646   19.098 22.973 1.00 0.00 ? 25 ASP A C    13 
ATOM 11093 O O    . ASP A 1 25 ? 0.994   18.530 23.827 1.00 0.00 ? 25 ASP A O    13 
ATOM 11094 C CB   . ASP A 1 25 ? 2.074   20.905 24.671 1.00 0.00 ? 25 ASP A CB   13 
ATOM 11095 C CG   . ASP A 1 25 ? 3.341   20.480 25.417 1.00 0.00 ? 25 ASP A CG   13 
ATOM 11096 O OD1  . ASP A 1 25 ? 4.152   19.790 24.822 1.00 0.00 ? 25 ASP A OD1  13 
ATOM 11097 O OD2  . ASP A 1 25 ? 3.477   20.852 26.571 1.00 0.00 ? 25 ASP A OD2  13 
ATOM 11098 H H    . ASP A 1 25 ? 0.376   21.434 22.499 1.00 0.00 ? 25 ASP A H    13 
ATOM 11099 H HA   . ASP A 1 25 ? 3.220   20.575 22.878 1.00 0.00 ? 25 ASP A HA   13 
ATOM 11100 H HB2  . ASP A 1 25 ? 1.953   21.976 24.748 1.00 0.00 ? 25 ASP A HB2  13 
ATOM 11101 H HB3  . ASP A 1 25 ? 1.218   20.414 25.107 1.00 0.00 ? 25 ASP A HB3  13 
ATOM 11102 N N    . LYS A 1 26 ? 1.900   18.531 21.826 1.00 0.00 ? 26 LYS A N    13 
ATOM 11103 C CA   . LYS A 1 26 ? 1.391   17.159 21.538 1.00 0.00 ? 26 LYS A CA   13 
ATOM 11104 C C    . LYS A 1 26 ? 2.121   16.117 22.393 1.00 0.00 ? 26 LYS A C    13 
ATOM 11105 O O    . LYS A 1 26 ? 1.819   14.943 22.340 1.00 0.00 ? 26 LYS A O    13 
ATOM 11106 C CB   . LYS A 1 26 ? 1.685   16.933 20.055 1.00 0.00 ? 26 LYS A CB   13 
ATOM 11107 C CG   . LYS A 1 26 ? 0.517   17.457 19.218 1.00 0.00 ? 26 LYS A CG   13 
ATOM 11108 C CD   . LYS A 1 26 ? 0.815   17.236 17.733 1.00 0.00 ? 26 LYS A CD   13 
ATOM 11109 C CE   . LYS A 1 26 ? 0.008   18.232 16.898 1.00 0.00 ? 26 LYS A CE   13 
ATOM 11110 N NZ   . LYS A 1 26 ? 0.255   17.831 15.483 1.00 0.00 ? 26 LYS A NZ   13 
ATOM 11111 H H    . LYS A 1 26 ? 2.424   19.010 21.150 1.00 0.00 ? 26 LYS A H    13 
ATOM 11112 H HA   . LYS A 1 26 ? 0.328   17.110 21.711 1.00 0.00 ? 26 LYS A HA   13 
ATOM 11113 H HB2  . LYS A 1 26 ? 2.587   17.459 19.783 1.00 0.00 ? 26 LYS A HB2  13 
ATOM 11114 H HB3  . LYS A 1 26 ? 1.815   15.877 19.871 1.00 0.00 ? 26 LYS A HB3  13 
ATOM 11115 H HG2  . LYS A 1 26 ? -0.386  16.927 19.487 1.00 0.00 ? 26 LYS A HG2  13 
ATOM 11116 H HG3  . LYS A 1 26 ? 0.384   18.512 19.405 1.00 0.00 ? 26 LYS A HG3  13 
ATOM 11117 H HD2  . LYS A 1 26 ? 1.869   17.385 17.551 1.00 0.00 ? 26 LYS A HD2  13 
ATOM 11118 H HD3  . LYS A 1 26 ? 0.540   16.229 17.457 1.00 0.00 ? 26 LYS A HD3  13 
ATOM 11119 H HE2  . LYS A 1 26 ? -1.043  18.153 17.132 1.00 0.00 ? 26 LYS A HE2  13 
ATOM 11120 H HE3  . LYS A 1 26 ? 0.358   19.239 17.070 1.00 0.00 ? 26 LYS A HE3  13 
ATOM 11121 H HZ1  . LYS A 1 26 ? 0.094   16.810 15.378 1.00 0.00 ? 26 LYS A HZ1  13 
ATOM 11122 H HZ2  . LYS A 1 26 ? -0.395  18.348 14.858 1.00 0.00 ? 26 LYS A HZ2  13 
ATOM 11123 H HZ3  . LYS A 1 26 ? 1.238   18.058 15.227 1.00 0.00 ? 26 LYS A HZ3  13 
ATOM 11124 N N    . LYS A 1 27 ? 3.077   16.535 23.180 1.00 0.00 ? 27 LYS A N    13 
ATOM 11125 C CA   . LYS A 1 27 ? 3.818   15.565 24.035 1.00 0.00 ? 27 LYS A CA   13 
ATOM 11126 C C    . LYS A 1 27 ? 2.844   14.560 24.658 1.00 0.00 ? 27 LYS A C    13 
ATOM 11127 O O    . LYS A 1 27 ? 3.199   13.436 24.953 1.00 0.00 ? 27 LYS A O    13 
ATOM 11128 C CB   . LYS A 1 27 ? 4.475   16.420 25.117 1.00 0.00 ? 27 LYS A CB   13 
ATOM 11129 C CG   . LYS A 1 27 ? 5.650   17.194 24.512 1.00 0.00 ? 27 LYS A CG   13 
ATOM 11130 C CD   . LYS A 1 27 ? 6.674   16.210 23.942 1.00 0.00 ? 27 LYS A CD   13 
ATOM 11131 C CE   . LYS A 1 27 ? 7.973   16.955 23.622 1.00 0.00 ? 27 LYS A CE   13 
ATOM 11132 N NZ   . LYS A 1 27 ? 8.720   16.046 22.707 1.00 0.00 ? 27 LYS A NZ   13 
ATOM 11133 H H    . LYS A 1 27 ? 3.307   17.486 23.211 1.00 0.00 ? 27 LYS A H    13 
ATOM 11134 H HA   . LYS A 1 27 ? 4.571   15.053 23.459 1.00 0.00 ? 27 LYS A HA   13 
ATOM 11135 H HB2  . LYS A 1 27 ? 3.753   17.117 25.514 1.00 0.00 ? 27 LYS A HB2  13 
ATOM 11136 H HB3  . LYS A 1 27 ? 4.834   15.783 25.908 1.00 0.00 ? 27 LYS A HB3  13 
ATOM 11137 H HG2  . LYS A 1 27 ? 5.290   17.837 23.722 1.00 0.00 ? 27 LYS A HG2  13 
ATOM 11138 H HG3  . LYS A 1 27 ? 6.116   17.795 25.280 1.00 0.00 ? 27 LYS A HG3  13 
ATOM 11139 H HD2  . LYS A 1 27 ? 6.873   15.436 24.670 1.00 0.00 ? 27 LYS A HD2  13 
ATOM 11140 H HD3  . LYS A 1 27 ? 6.282   15.765 23.041 1.00 0.00 ? 27 LYS A HD3  13 
ATOM 11141 H HE2  . LYS A 1 27 ? 7.757   17.891 23.128 1.00 0.00 ? 27 LYS A HE2  13 
ATOM 11142 H HE3  . LYS A 1 27 ? 8.538   17.128 24.525 1.00 0.00 ? 27 LYS A HE3  13 
ATOM 11143 H HZ1  . LYS A 1 27 ? 8.045   15.461 22.173 1.00 0.00 ? 27 LYS A HZ1  13 
ATOM 11144 H HZ2  . LYS A 1 27 ? 9.290   16.611 22.047 1.00 0.00 ? 27 LYS A HZ2  13 
ATOM 11145 H HZ3  . LYS A 1 27 ? 9.346   15.432 23.264 1.00 0.00 ? 27 LYS A HZ3  13 
ATOM 11146 N N    . PHE A 1 28 ? 1.616   14.956 24.855 1.00 0.00 ? 28 PHE A N    13 
ATOM 11147 C CA   . PHE A 1 28 ? 0.615   14.026 25.453 1.00 0.00 ? 28 PHE A CA   13 
ATOM 11148 C C    . PHE A 1 28 ? 0.687   12.659 24.765 1.00 0.00 ? 28 PHE A C    13 
ATOM 11149 O O    . PHE A 1 28 ? 0.305   11.651 25.324 1.00 0.00 ? 28 PHE A O    13 
ATOM 11150 C CB   . PHE A 1 28 ? -0.737  14.692 25.197 1.00 0.00 ? 28 PHE A CB   13 
ATOM 11151 C CG   . PHE A 1 28 ? -0.715  16.107 25.722 1.00 0.00 ? 28 PHE A CG   13 
ATOM 11152 C CD1  . PHE A 1 28 ? -0.344  16.354 27.050 1.00 0.00 ? 28 PHE A CD1  13 
ATOM 11153 C CD2  . PHE A 1 28 ? -1.069  17.171 24.885 1.00 0.00 ? 28 PHE A CD2  13 
ATOM 11154 C CE1  . PHE A 1 28 ? -0.327  17.665 27.540 1.00 0.00 ? 28 PHE A CE1  13 
ATOM 11155 C CE2  . PHE A 1 28 ? -1.052  18.483 25.374 1.00 0.00 ? 28 PHE A CE2  13 
ATOM 11156 C CZ   . PHE A 1 28 ? -0.682  18.730 26.701 1.00 0.00 ? 28 PHE A CZ   13 
ATOM 11157 H H    . PHE A 1 28 ? 1.349   15.866 24.606 1.00 0.00 ? 28 PHE A H    13 
ATOM 11158 H HA   . PHE A 1 28 ? 0.780   13.924 26.514 1.00 0.00 ? 28 PHE A HA   13 
ATOM 11159 H HB2  . PHE A 1 28 ? -0.938  14.704 24.136 1.00 0.00 ? 28 PHE A HB2  13 
ATOM 11160 H HB3  . PHE A 1 28 ? -1.511  14.137 25.702 1.00 0.00 ? 28 PHE A HB3  13 
ATOM 11161 H HD1  . PHE A 1 28 ? -0.070  15.533 27.696 1.00 0.00 ? 28 PHE A HD1  13 
ATOM 11162 H HD2  . PHE A 1 28 ? -1.354  16.981 23.861 1.00 0.00 ? 28 PHE A HD2  13 
ATOM 11163 H HE1  . PHE A 1 28 ? -0.042  17.857 28.564 1.00 0.00 ? 28 PHE A HE1  13 
ATOM 11164 H HE2  . PHE A 1 28 ? -1.325  19.304 24.728 1.00 0.00 ? 28 PHE A HE2  13 
ATOM 11165 H HZ   . PHE A 1 28 ? -0.670  19.742 27.080 1.00 0.00 ? 28 PHE A HZ   13 
ATOM 11166 N N    . PHE A 1 29 ? 1.179   12.615 23.555 1.00 0.00 ? 29 PHE A N    13 
ATOM 11167 C CA   . PHE A 1 29 ? 1.279   11.312 22.830 1.00 0.00 ? 29 PHE A CA   13 
ATOM 11168 C C    . PHE A 1 29 ? 1.950   10.254 23.713 1.00 0.00 ? 29 PHE A C    13 
ATOM 11169 O O    . PHE A 1 29 ? 1.826   9.069  23.477 1.00 0.00 ? 29 PHE A O    13 
ATOM 11170 C CB   . PHE A 1 29 ? 2.147   11.607 21.605 1.00 0.00 ? 29 PHE A CB   13 
ATOM 11171 C CG   . PHE A 1 29 ? 2.221   10.377 20.731 1.00 0.00 ? 29 PHE A CG   13 
ATOM 11172 C CD1  . PHE A 1 29 ? 2.975   9.270  21.143 1.00 0.00 ? 29 PHE A CD1  13 
ATOM 11173 C CD2  . PHE A 1 29 ? 1.536   10.342 19.511 1.00 0.00 ? 29 PHE A CD2  13 
ATOM 11174 C CE1  . PHE A 1 29 ? 3.043   8.130  20.333 1.00 0.00 ? 29 PHE A CE1  13 
ATOM 11175 C CE2  . PHE A 1 29 ? 1.603   9.201  18.702 1.00 0.00 ? 29 PHE A CE2  13 
ATOM 11176 C CZ   . PHE A 1 29 ? 2.358   8.095  19.112 1.00 0.00 ? 29 PHE A CZ   13 
ATOM 11177 H H    . PHE A 1 29 ? 1.484   13.440 23.122 1.00 0.00 ? 29 PHE A H    13 
ATOM 11178 H HA   . PHE A 1 29 ? 0.302   10.979 22.517 1.00 0.00 ? 29 PHE A HA   13 
ATOM 11179 H HB2  . PHE A 1 29 ? 1.714   12.421 21.045 1.00 0.00 ? 29 PHE A HB2  13 
ATOM 11180 H HB3  . PHE A 1 29 ? 3.141   11.881 21.926 1.00 0.00 ? 29 PHE A HB3  13 
ATOM 11181 H HD1  . PHE A 1 29 ? 3.503   9.297  22.083 1.00 0.00 ? 29 PHE A HD1  13 
ATOM 11182 H HD2  . PHE A 1 29 ? 0.954   11.196 19.193 1.00 0.00 ? 29 PHE A HD2  13 
ATOM 11183 H HE1  . PHE A 1 29 ? 3.624   7.277  20.649 1.00 0.00 ? 29 PHE A HE1  13 
ATOM 11184 H HE2  . PHE A 1 29 ? 1.074   9.175  17.760 1.00 0.00 ? 29 PHE A HE2  13 
ATOM 11185 H HZ   . PHE A 1 29 ? 2.409   7.216  18.488 1.00 0.00 ? 29 PHE A HZ   13 
ATOM 11186 N N    . GLN A 1 30 ? 2.662   10.670 24.725 1.00 0.00 ? 30 GLN A N    13 
ATOM 11187 C CA   . GLN A 1 30 ? 3.343   9.688  25.616 1.00 0.00 ? 30 GLN A CA   13 
ATOM 11188 C C    . GLN A 1 30 ? 2.314   8.810  26.336 1.00 0.00 ? 30 GLN A C    13 
ATOM 11189 O O    . GLN A 1 30 ? 2.663   7.846  26.989 1.00 0.00 ? 30 GLN A O    13 
ATOM 11190 C CB   . GLN A 1 30 ? 4.114   10.542 26.624 1.00 0.00 ? 30 GLN A CB   13 
ATOM 11191 C CG   . GLN A 1 30 ? 5.367   11.114 25.958 1.00 0.00 ? 30 GLN A CG   13 
ATOM 11192 C CD   . GLN A 1 30 ? 6.450   11.340 27.016 1.00 0.00 ? 30 GLN A CD   13 
ATOM 11193 O OE1  . GLN A 1 30 ? 6.942   10.401 27.611 1.00 0.00 ? 30 GLN A OE1  13 
ATOM 11194 N NE2  . GLN A 1 30 ? 6.844   12.557 27.278 1.00 0.00 ? 30 GLN A NE2  13 
ATOM 11195 H H    . GLN A 1 30 ? 2.754   11.629 24.897 1.00 0.00 ? 30 GLN A H    13 
ATOM 11196 H HA   . GLN A 1 30 ? 4.028   9.079  25.049 1.00 0.00 ? 30 GLN A HA   13 
ATOM 11197 H HB2  . GLN A 1 30 ? 3.487   11.351 26.964 1.00 0.00 ? 30 GLN A HB2  13 
ATOM 11198 H HB3  . GLN A 1 30 ? 4.401   9.930  27.466 1.00 0.00 ? 30 GLN A HB3  13 
ATOM 11199 H HG2  . GLN A 1 30 ? 5.730   10.420 25.215 1.00 0.00 ? 30 GLN A HG2  13 
ATOM 11200 H HG3  . GLN A 1 30 ? 5.126   12.054 25.485 1.00 0.00 ? 30 GLN A HG3  13 
ATOM 11201 H HE21 . GLN A 1 30 ? 6.449   13.314 26.799 1.00 0.00 ? 30 GLN A HE21 13 
ATOM 11202 H HE22 . GLN A 1 30 ? 7.535   12.712 27.954 1.00 0.00 ? 30 GLN A HE22 13 
ATOM 11203 N N    . SER A 1 31 ? 1.052   9.132  26.232 1.00 0.00 ? 31 SER A N    13 
ATOM 11204 C CA   . SER A 1 31 ? 0.018   8.306  26.923 1.00 0.00 ? 31 SER A CA   13 
ATOM 11205 C C    . SER A 1 31 ? -1.237  8.172  26.055 1.00 0.00 ? 31 SER A C    13 
ATOM 11206 O O    . SER A 1 31 ? -1.441  8.919  25.120 1.00 0.00 ? 31 SER A O    13 
ATOM 11207 C CB   . SER A 1 31 ? -0.298  9.070  28.208 1.00 0.00 ? 31 SER A CB   13 
ATOM 11208 O OG   . SER A 1 31 ? 0.804   8.972  29.099 1.00 0.00 ? 31 SER A OG   13 
ATOM 11209 H H    . SER A 1 31 ? 0.786   9.915  25.706 1.00 0.00 ? 31 SER A H    13 
ATOM 11210 H HA   . SER A 1 31 ? 0.415   7.332  27.164 1.00 0.00 ? 31 SER A HA   13 
ATOM 11211 H HB2  . SER A 1 31 ? -0.481  10.108 27.974 1.00 0.00 ? 31 SER A HB2  13 
ATOM 11212 H HB3  . SER A 1 31 ? -1.176  8.645  28.674 1.00 0.00 ? 31 SER A HB3  13 
ATOM 11213 H HG   . SER A 1 31 ? 0.501   9.224  29.975 1.00 0.00 ? 31 SER A HG   13 
ATOM 11214 N N    . LEU A 1 32 ? -2.081  7.221  26.363 1.00 0.00 ? 32 LEU A N    13 
ATOM 11215 C CA   . LEU A 1 32 ? -3.325  7.035  25.561 1.00 0.00 ? 32 LEU A CA   13 
ATOM 11216 C C    . LEU A 1 32 ? -4.189  8.292  25.622 1.00 0.00 ? 32 LEU A C    13 
ATOM 11217 O O    . LEU A 1 32 ? -4.544  8.865  24.611 1.00 0.00 ? 32 LEU A O    13 
ATOM 11218 C CB   . LEU A 1 32 ? -4.052  5.862  26.216 1.00 0.00 ? 32 LEU A CB   13 
ATOM 11219 C CG   . LEU A 1 32 ? -4.790  5.056  25.146 1.00 0.00 ? 32 LEU A CG   13 
ATOM 11220 C CD1  . LEU A 1 32 ? -5.278  3.736  25.748 1.00 0.00 ? 32 LEU A CD1  13 
ATOM 11221 C CD2  . LEU A 1 32 ? -5.989  5.858  24.639 1.00 0.00 ? 32 LEU A CD2  13 
ATOM 11222 H H    . LEU A 1 32 ? -1.897  6.631  27.123 1.00 0.00 ? 32 LEU A H    13 
ATOM 11223 H HA   . LEU A 1 32 ? -3.084  6.794  24.541 1.00 0.00 ? 32 LEU A HA   13 
ATOM 11224 H HB2  . LEU A 1 32 ? -3.336  5.229  26.716 1.00 0.00 ? 32 LEU A HB2  13 
ATOM 11225 H HB3  . LEU A 1 32 ? -4.764  6.240  26.935 1.00 0.00 ? 32 LEU A HB3  13 
ATOM 11226 H HG   . LEU A 1 32 ? -4.120  4.851  24.323 1.00 0.00 ? 32 LEU A HG   13 
ATOM 11227 H HD11 . LEU A 1 32 ? -5.515  3.882  26.791 1.00 0.00 ? 32 LEU A HD11 13 
ATOM 11228 H HD12 . LEU A 1 32 ? -6.160  3.405  25.221 1.00 0.00 ? 32 LEU A HD12 13 
ATOM 11229 H HD13 . LEU A 1 32 ? -4.503  2.990  25.656 1.00 0.00 ? 32 LEU A HD13 13 
ATOM 11230 H HD21 . LEU A 1 32 ? -6.506  6.302  25.478 1.00 0.00 ? 32 LEU A HD21 13 
ATOM 11231 H HD22 . LEU A 1 32 ? -5.647  6.637  23.974 1.00 0.00 ? 32 LEU A HD22 13 
ATOM 11232 H HD23 . LEU A 1 32 ? -6.663  5.202  24.109 1.00 0.00 ? 32 LEU A HD23 13 
ATOM 11233 N N    . ASP A 1 33 ? -4.524  8.730  26.801 1.00 0.00 ? 33 ASP A N    13 
ATOM 11234 C CA   . ASP A 1 33 ? -5.359  9.956  26.922 1.00 0.00 ? 33 ASP A CA   13 
ATOM 11235 C C    . ASP A 1 33 ? -4.712  11.072 26.113 1.00 0.00 ? 33 ASP A C    13 
ATOM 11236 O O    . ASP A 1 33 ? -5.377  11.848 25.457 1.00 0.00 ? 33 ASP A O    13 
ATOM 11237 C CB   . ASP A 1 33 ? -5.365  10.296 28.413 1.00 0.00 ? 33 ASP A CB   13 
ATOM 11238 C CG   . ASP A 1 33 ? -6.262  9.306  29.159 1.00 0.00 ? 33 ASP A CG   13 
ATOM 11239 O OD1  . ASP A 1 33 ? -7.119  8.715  28.521 1.00 0.00 ? 33 ASP A OD1  13 
ATOM 11240 O OD2  . ASP A 1 33 ? -6.078  9.155  30.356 1.00 0.00 ? 33 ASP A OD2  13 
ATOM 11241 H H    . ASP A 1 33 ? -4.220  8.259  27.601 1.00 0.00 ? 33 ASP A H    13 
ATOM 11242 H HA   . ASP A 1 33 ? -6.361  9.768  26.574 1.00 0.00 ? 33 ASP A HA   13 
ATOM 11243 H HB2  . ASP A 1 33 ? -4.359  10.232 28.802 1.00 0.00 ? 33 ASP A HB2  13 
ATOM 11244 H HB3  . ASP A 1 33 ? -5.742  11.298 28.553 1.00 0.00 ? 33 ASP A HB3  13 
ATOM 11245 N N    . GLY A 1 34 ? -3.413  11.140 26.139 1.00 0.00 ? 34 GLY A N    13 
ATOM 11246 C CA   . GLY A 1 34 ? -2.716  12.186 25.352 1.00 0.00 ? 34 GLY A CA   13 
ATOM 11247 C C    . GLY A 1 34 ? -2.817  11.818 23.876 1.00 0.00 ? 34 GLY A C    13 
ATOM 11248 O O    . GLY A 1 34 ? -3.081  12.647 23.032 1.00 0.00 ? 34 GLY A O    13 
ATOM 11249 H H    . GLY A 1 34 ? -2.897  10.491 26.662 1.00 0.00 ? 34 GLY A H    13 
ATOM 11250 H HA2  . GLY A 1 34 ? -3.187  13.142 25.521 1.00 0.00 ? 34 GLY A HA2  13 
ATOM 11251 H HA3  . GLY A 1 34 ? -1.678  12.235 25.647 1.00 0.00 ? 34 GLY A HA3  13 
ATOM 11252 N N    . ILE A 1 35 ? -2.626  10.569 23.564 1.00 0.00 ? 35 ILE A N    13 
ATOM 11253 C CA   . ILE A 1 35 ? -2.727  10.136 22.144 1.00 0.00 ? 35 ILE A CA   13 
ATOM 11254 C C    . ILE A 1 35 ? -4.105  10.508 21.594 1.00 0.00 ? 35 ILE A C    13 
ATOM 11255 O O    . ILE A 1 35 ? -4.255  10.834 20.433 1.00 0.00 ? 35 ILE A O    13 
ATOM 11256 C CB   . ILE A 1 35 ? -2.534  8.616  22.179 1.00 0.00 ? 35 ILE A CB   13 
ATOM 11257 C CG1  . ILE A 1 35 ? -1.038  8.299  22.178 1.00 0.00 ? 35 ILE A CG1  13 
ATOM 11258 C CG2  . ILE A 1 35 ? -3.186  7.975  20.948 1.00 0.00 ? 35 ILE A CG2  13 
ATOM 11259 C CD1  . ILE A 1 35 ? -0.454  8.617  20.801 1.00 0.00 ? 35 ILE A CD1  13 
ATOM 11260 H H    . ILE A 1 35 ? -2.427  9.915  24.265 1.00 0.00 ? 35 ILE A H    13 
ATOM 11261 H HA   . ILE A 1 35 ? -1.951  10.595 21.557 1.00 0.00 ? 35 ILE A HA   13 
ATOM 11262 H HB   . ILE A 1 35 ? -2.986  8.216  23.074 1.00 0.00 ? 35 ILE A HB   13 
ATOM 11263 H HG12 . ILE A 1 35 ? -0.543  8.899  22.927 1.00 0.00 ? 35 ILE A HG12 13 
ATOM 11264 H HG13 . ILE A 1 35 ? -0.891  7.253  22.400 1.00 0.00 ? 35 ILE A HG13 13 
ATOM 11265 H HG21 . ILE A 1 35 ? -3.320  8.723  20.182 1.00 0.00 ? 35 ILE A HG21 13 
ATOM 11266 H HG22 . ILE A 1 35 ? -2.550  7.186  20.575 1.00 0.00 ? 35 ILE A HG22 13 
ATOM 11267 H HG23 . ILE A 1 35 ? -4.145  7.565  21.223 1.00 0.00 ? 35 ILE A HG23 13 
ATOM 11268 H HD11 . ILE A 1 35 ? -0.841  9.564  20.454 1.00 0.00 ? 35 ILE A HD11 13 
ATOM 11269 H HD12 . ILE A 1 35 ? 0.622   8.672  20.871 1.00 0.00 ? 35 ILE A HD12 13 
ATOM 11270 H HD13 . ILE A 1 35 ? -0.729  7.839  20.105 1.00 0.00 ? 35 ILE A HD13 13 
ATOM 11271 N N    . MET A 1 36 ? -5.116  10.465 22.420 1.00 0.00 ? 36 MET A N    13 
ATOM 11272 C CA   . MET A 1 36 ? -6.480  10.818 21.936 1.00 0.00 ? 36 MET A CA   13 
ATOM 11273 C C    . MET A 1 36 ? -6.501  12.258 21.414 1.00 0.00 ? 36 MET A C    13 
ATOM 11274 O O    . MET A 1 36 ? -6.802  12.503 20.263 1.00 0.00 ? 36 MET A O    13 
ATOM 11275 C CB   . MET A 1 36 ? -7.392  10.685 23.154 1.00 0.00 ? 36 MET A CB   13 
ATOM 11276 C CG   . MET A 1 36 ? -7.724  9.209  23.391 1.00 0.00 ? 36 MET A CG   13 
ATOM 11277 S SD   . MET A 1 36 ? -8.556  8.529  21.932 1.00 0.00 ? 36 MET A SD   13 
ATOM 11278 C CE   . MET A 1 36 ? -10.253 8.885  22.448 1.00 0.00 ? 36 MET A CE   13 
ATOM 11279 H H    . MET A 1 36 ? -4.975  10.199 23.357 1.00 0.00 ? 36 MET A H    13 
ATOM 11280 H HA   . MET A 1 36 ? -6.795  10.135 21.163 1.00 0.00 ? 36 MET A HA   13 
ATOM 11281 H HB2  . MET A 1 36 ? -6.893  11.087 24.022 1.00 0.00 ? 36 MET A HB2  13 
ATOM 11282 H HB3  . MET A 1 36 ? -8.303  11.236 22.975 1.00 0.00 ? 36 MET A HB3  13 
ATOM 11283 H HG2  . MET A 1 36 ? -6.811  8.661  23.572 1.00 0.00 ? 36 MET A HG2  13 
ATOM 11284 H HG3  . MET A 1 36 ? -8.373  9.121  24.249 1.00 0.00 ? 36 MET A HG3  13 
ATOM 11285 H HE1  . MET A 1 36 ? -10.252 9.244  23.469 1.00 0.00 ? 36 MET A HE1  13 
ATOM 11286 H HE2  . MET A 1 36 ? -10.676 9.638  21.797 1.00 0.00 ? 36 MET A HE2  13 
ATOM 11287 H HE3  . MET A 1 36 ? -10.846 7.986  22.387 1.00 0.00 ? 36 MET A HE3  13 
ATOM 11288 N N    . PHE A 1 37 ? -6.189  13.213 22.251 1.00 0.00 ? 37 PHE A N    13 
ATOM 11289 C CA   . PHE A 1 37 ? -6.195  14.632 21.793 1.00 0.00 ? 37 PHE A CA   13 
ATOM 11290 C C    . PHE A 1 37 ? -5.532  14.724 20.406 1.00 0.00 ? 37 PHE A C    13 
ATOM 11291 O O    . PHE A 1 37 ? -6.105  15.249 19.471 1.00 0.00 ? 37 PHE A O    13 
ATOM 11292 C CB   . PHE A 1 37 ? -5.430  15.411 22.891 1.00 0.00 ? 37 PHE A CB   13 
ATOM 11293 C CG   . PHE A 1 37 ? -4.288  16.215 22.309 1.00 0.00 ? 37 PHE A CG   13 
ATOM 11294 C CD1  . PHE A 1 37 ? -3.046  15.611 22.091 1.00 0.00 ? 37 PHE A CD1  13 
ATOM 11295 C CD2  . PHE A 1 37 ? -4.476  17.559 21.977 1.00 0.00 ? 37 PHE A CD2  13 
ATOM 11296 C CE1  . PHE A 1 37 ? -1.997  16.345 21.537 1.00 0.00 ? 37 PHE A CE1  13 
ATOM 11297 C CE2  . PHE A 1 37 ? -3.425  18.297 21.426 1.00 0.00 ? 37 PHE A CE2  13 
ATOM 11298 C CZ   . PHE A 1 37 ? -2.186  17.685 21.203 1.00 0.00 ? 37 PHE A CZ   13 
ATOM 11299 H H    . PHE A 1 37 ? -5.950  12.997 23.177 1.00 0.00 ? 37 PHE A H    13 
ATOM 11300 H HA   . PHE A 1 37 ? -7.212  14.991 21.735 1.00 0.00 ? 37 PHE A HA   13 
ATOM 11301 H HB2  . PHE A 1 37 ? -6.118  16.084 23.384 1.00 0.00 ? 37 PHE A HB2  13 
ATOM 11302 H HB3  . PHE A 1 37 ? -5.039  14.711 23.614 1.00 0.00 ? 37 PHE A HB3  13 
ATOM 11303 H HD1  . PHE A 1 37 ? -2.899  14.575 22.348 1.00 0.00 ? 37 PHE A HD1  13 
ATOM 11304 H HD2  . PHE A 1 37 ? -5.428  18.031 22.159 1.00 0.00 ? 37 PHE A HD2  13 
ATOM 11305 H HE1  . PHE A 1 37 ? -1.038  15.878 21.371 1.00 0.00 ? 37 PHE A HE1  13 
ATOM 11306 H HE2  . PHE A 1 37 ? -3.569  19.335 21.167 1.00 0.00 ? 37 PHE A HE2  13 
ATOM 11307 H HZ   . PHE A 1 37 ? -1.380  18.245 20.771 1.00 0.00 ? 37 PHE A HZ   13 
ATOM 11308 N N    . ILE A 1 38 ? -4.343  14.203 20.257 1.00 0.00 ? 38 ILE A N    13 
ATOM 11309 C CA   . ILE A 1 38 ? -3.678  14.257 18.925 1.00 0.00 ? 38 ILE A CA   13 
ATOM 11310 C C    . ILE A 1 38 ? -4.617  13.698 17.855 1.00 0.00 ? 38 ILE A C    13 
ATOM 11311 O O    . ILE A 1 38 ? -4.677  14.192 16.746 1.00 0.00 ? 38 ILE A O    13 
ATOM 11312 C CB   . ILE A 1 38 ? -2.435  13.374 19.058 1.00 0.00 ? 38 ILE A CB   13 
ATOM 11313 C CG1  . ILE A 1 38 ? -1.413  14.063 19.966 1.00 0.00 ? 38 ILE A CG1  13 
ATOM 11314 C CG2  . ILE A 1 38 ? -1.822  13.154 17.673 1.00 0.00 ? 38 ILE A CG2  13 
ATOM 11315 C CD1  . ILE A 1 38 ? -0.057  13.362 19.845 1.00 0.00 ? 38 ILE A CD1  13 
ATOM 11316 H H    . ILE A 1 38 ? -3.896  13.772 21.010 1.00 0.00 ? 38 ILE A H    13 
ATOM 11317 H HA   . ILE A 1 38 ? -3.392  15.266 18.685 1.00 0.00 ? 38 ILE A HA   13 
ATOM 11318 H HB   . ILE A 1 38 ? -2.712  12.422 19.484 1.00 0.00 ? 38 ILE A HB   13 
ATOM 11319 H HG12 . ILE A 1 38 ? -1.311  15.097 19.672 1.00 0.00 ? 38 ILE A HG12 13 
ATOM 11320 H HG13 . ILE A 1 38 ? -1.751  14.011 20.989 1.00 0.00 ? 38 ILE A HG13 13 
ATOM 11321 H HG21 . ILE A 1 38 ? -2.600  12.883 16.974 1.00 0.00 ? 38 ILE A HG21 13 
ATOM 11322 H HG22 . ILE A 1 38 ? -1.341  14.063 17.344 1.00 0.00 ? 38 ILE A HG22 13 
ATOM 11323 H HG23 . ILE A 1 38 ? -1.092  12.360 17.725 1.00 0.00 ? 38 ILE A HG23 13 
ATOM 11324 H HD11 . ILE A 1 38 ? 0.209   13.265 18.803 1.00 0.00 ? 38 ILE A HD11 13 
ATOM 11325 H HD12 . ILE A 1 38 ? 0.695   13.944 20.355 1.00 0.00 ? 38 ILE A HD12 13 
ATOM 11326 H HD13 . ILE A 1 38 ? -0.118  12.382 20.293 1.00 0.00 ? 38 ILE A HD13 13 
ATOM 11327 N N    . ASN A 1 39 ? -5.353  12.672 18.182 1.00 0.00 ? 39 ASN A N    13 
ATOM 11328 C CA   . ASN A 1 39 ? -6.293  12.083 17.185 1.00 0.00 ? 39 ASN A CA   13 
ATOM 11329 C C    . ASN A 1 39 ? -7.478  13.026 16.965 1.00 0.00 ? 39 ASN A C    13 
ATOM 11330 O O    . ASN A 1 39 ? -8.095  13.032 15.918 1.00 0.00 ? 39 ASN A O    13 
ATOM 11331 C CB   . ASN A 1 39 ? -6.763  10.766 17.805 1.00 0.00 ? 39 ASN A CB   13 
ATOM 11332 C CG   . ASN A 1 39 ? -5.553  9.891  18.136 1.00 0.00 ? 39 ASN A CG   13 
ATOM 11333 O OD1  . ASN A 1 39 ? -5.637  9.006  18.963 1.00 0.00 ? 39 ASN A OD1  13 
ATOM 11334 N ND2  . ASN A 1 39 ? -4.422  10.101 17.521 1.00 0.00 ? 39 ASN A ND2  13 
ATOM 11335 H H    . ASN A 1 39 ? -5.289  12.291 19.083 1.00 0.00 ? 39 ASN A H    13 
ATOM 11336 H HA   . ASN A 1 39 ? -5.785  11.892 16.254 1.00 0.00 ? 39 ASN A HA   13 
ATOM 11337 H HB2  . ASN A 1 39 ? -7.317  10.972 18.710 1.00 0.00 ? 39 ASN A HB2  13 
ATOM 11338 H HB3  . ASN A 1 39 ? -7.400  10.247 17.104 1.00 0.00 ? 39 ASN A HB3  13 
ATOM 11339 H HD21 . ASN A 1 39 ? -4.353  10.814 16.853 1.00 0.00 ? 39 ASN A HD21 13 
ATOM 11340 H HD22 . ASN A 1 39 ? -3.642  9.543  17.726 1.00 0.00 ? 39 ASN A HD22 13 
ATOM 11341 N N    . LYS A 1 40 ? -7.796  13.827 17.944 1.00 0.00 ? 40 LYS A N    13 
ATOM 11342 C CA   . LYS A 1 40 ? -8.937  14.775 17.793 1.00 0.00 ? 40 LYS A CA   13 
ATOM 11343 C C    . LYS A 1 40 ? -8.414  16.154 17.389 1.00 0.00 ? 40 LYS A C    13 
ATOM 11344 O O    . LYS A 1 40 ? -9.145  16.988 16.895 1.00 0.00 ? 40 LYS A O    13 
ATOM 11345 C CB   . LYS A 1 40 ? -9.592  14.831 19.174 1.00 0.00 ? 40 LYS A CB   13 
ATOM 11346 C CG   . LYS A 1 40 ? -10.711 13.791 19.250 1.00 0.00 ? 40 LYS A CG   13 
ATOM 11347 C CD   . LYS A 1 40 ? -11.123 13.594 20.710 1.00 0.00 ? 40 LYS A CD   13 
ATOM 11348 C CE   . LYS A 1 40 ? -11.003 12.115 21.080 1.00 0.00 ? 40 LYS A CE   13 
ATOM 11349 N NZ   . LYS A 1 40 ? -11.681 11.995 22.402 1.00 0.00 ? 40 LYS A NZ   13 
ATOM 11350 H H    . LYS A 1 40 ? -7.281  13.809 18.778 1.00 0.00 ? 40 LYS A H    13 
ATOM 11351 H HA   . LYS A 1 40 ? -9.641  14.407 17.063 1.00 0.00 ? 40 LYS A HA   13 
ATOM 11352 H HB2  . LYS A 1 40 ? -8.852  14.621 19.932 1.00 0.00 ? 40 LYS A HB2  13 
ATOM 11353 H HB3  . LYS A 1 40 ? -10.004 15.816 19.336 1.00 0.00 ? 40 LYS A HB3  13 
ATOM 11354 H HG2  . LYS A 1 40 ? -11.561 14.134 18.679 1.00 0.00 ? 40 LYS A HG2  13 
ATOM 11355 H HG3  . LYS A 1 40 ? -10.359 12.853 18.846 1.00 0.00 ? 40 LYS A HG3  13 
ATOM 11356 H HD2  . LYS A 1 40 ? -10.475 14.179 21.348 1.00 0.00 ? 40 LYS A HD2  13 
ATOM 11357 H HD3  . LYS A 1 40 ? -12.146 13.917 20.842 1.00 0.00 ? 40 LYS A HD3  13 
ATOM 11358 H HE2  . LYS A 1 40 ? -11.503 11.503 20.344 1.00 0.00 ? 40 LYS A HE2  13 
ATOM 11359 H HE3  . LYS A 1 40 ? -9.964  11.832 21.163 1.00 0.00 ? 40 LYS A HE3  13 
ATOM 11360 H HZ1  . LYS A 1 40 ? -11.332 12.738 23.040 1.00 0.00 ? 40 LYS A HZ1  13 
ATOM 11361 H HZ2  . LYS A 1 40 ? -12.708 12.104 22.276 1.00 0.00 ? 40 LYS A HZ2  13 
ATOM 11362 H HZ3  . LYS A 1 40 ? -11.478 11.061 22.812 1.00 0.00 ? 40 LYS A HZ3  13 
ATOM 11363 N N    . CYS A 1 41 ? -7.150  16.396 17.595 1.00 0.00 ? 41 CYS A N    13 
ATOM 11364 C CA   . CYS A 1 41 ? -6.572  17.718 17.221 1.00 0.00 ? 41 CYS A CA   13 
ATOM 11365 C C    . CYS A 1 41 ? -6.944  18.068 15.779 1.00 0.00 ? 41 CYS A C    13 
ATOM 11366 O O    . CYS A 1 41 ? -7.786  18.907 15.529 1.00 0.00 ? 41 CYS A O    13 
ATOM 11367 C CB   . CYS A 1 41 ? -5.061  17.535 17.354 1.00 0.00 ? 41 CYS A CB   13 
ATOM 11368 S SG   . CYS A 1 41 ? -4.212  18.941 16.595 1.00 0.00 ? 41 CYS A SG   13 
ATOM 11369 H H    . CYS A 1 41 ? -6.578  15.707 17.993 1.00 0.00 ? 41 CYS A H    13 
ATOM 11370 H HA   . CYS A 1 41 ? -6.912  18.484 17.897 1.00 0.00 ? 41 CYS A HA   13 
ATOM 11371 H HB2  . CYS A 1 41 ? -4.796  17.474 18.398 1.00 0.00 ? 41 CYS A HB2  13 
ATOM 11372 H HB3  . CYS A 1 41 ? -4.763  16.624 16.854 1.00 0.00 ? 41 CYS A HB3  13 
ATOM 11373 N N    . ALA A 1 42 ? -6.317  17.431 14.832 1.00 0.00 ? 42 ALA A N    13 
ATOM 11374 C CA   . ALA A 1 42 ? -6.628  17.726 13.401 1.00 0.00 ? 42 ALA A CA   13 
ATOM 11375 C C    . ALA A 1 42 ? -8.072  17.332 13.080 1.00 0.00 ? 42 ALA A C    13 
ATOM 11376 O O    . ALA A 1 42 ? -8.706  17.910 12.218 1.00 0.00 ? 42 ALA A O    13 
ATOM 11377 C CB   . ALA A 1 42 ? -5.648  16.870 12.598 1.00 0.00 ? 42 ALA A CB   13 
ATOM 11378 H H    . ALA A 1 42 ? -5.640  16.761 15.060 1.00 0.00 ? 42 ALA A H    13 
ATOM 11379 H HA   . ALA A 1 42 ? -6.464  18.770 13.188 1.00 0.00 ? 42 ALA A HA   13 
ATOM 11380 H HB1  . ALA A 1 42 ? -5.660  15.859 12.976 1.00 0.00 ? 42 ALA A HB1  13 
ATOM 11381 H HB2  . ALA A 1 42 ? -5.939  16.869 11.558 1.00 0.00 ? 42 ALA A HB2  13 
ATOM 11382 H HB3  . ALA A 1 42 ? -4.652  17.278 12.692 1.00 0.00 ? 42 ALA A HB3  13 
ATOM 11383 N N    . THR A 1 43 ? -8.599  16.357 13.767 1.00 0.00 ? 43 THR A N    13 
ATOM 11384 C CA   . THR A 1 43 ? -10.002 15.928 13.502 1.00 0.00 ? 43 THR A CA   13 
ATOM 11385 C C    . THR A 1 43 ? -10.979 16.929 14.121 1.00 0.00 ? 43 THR A C    13 
ATOM 11386 O O    . THR A 1 43 ? -12.141 16.975 13.771 1.00 0.00 ? 43 THR A O    13 
ATOM 11387 C CB   . THR A 1 43 ? -10.137 14.563 14.177 1.00 0.00 ? 43 THR A CB   13 
ATOM 11388 O OG1  . THR A 1 43 ? -9.209  13.657 13.597 1.00 0.00 ? 43 THR A OG1  13 
ATOM 11389 C CG2  . THR A 1 43 ? -11.560 14.037 13.985 1.00 0.00 ? 43 THR A CG2  13 
ATOM 11390 H H    . THR A 1 43 ? -8.073  15.907 14.457 1.00 0.00 ? 43 THR A H    13 
ATOM 11391 H HA   . THR A 1 43 ? -10.176 15.836 12.442 1.00 0.00 ? 43 THR A HA   13 
ATOM 11392 H HB   . THR A 1 43 ? -9.933  14.662 15.233 1.00 0.00 ? 43 THR A HB   13 
ATOM 11393 H HG1  . THR A 1 43 ? -9.306  13.704 12.643 1.00 0.00 ? 43 THR A HG1  13 
ATOM 11394 H HG21 . THR A 1 43 ? -12.258 14.859 14.038 1.00 0.00 ? 43 THR A HG21 13 
ATOM 11395 H HG22 . THR A 1 43 ? -11.639 13.559 13.020 1.00 0.00 ? 43 THR A HG22 13 
ATOM 11396 H HG23 . THR A 1 43 ? -11.787 13.320 14.761 1.00 0.00 ? 43 THR A HG23 13 
ATOM 11397 N N    . CYS A 1 44 ? -10.512 17.734 15.035 1.00 0.00 ? 44 CYS A N    13 
ATOM 11398 C CA   . CYS A 1 44 ? -11.408 18.737 15.673 1.00 0.00 ? 44 CYS A CA   13 
ATOM 11399 C C    . CYS A 1 44 ? -11.417 20.021 14.842 1.00 0.00 ? 44 CYS A C    13 
ATOM 11400 O O    . CYS A 1 44 ? -12.455 20.591 14.572 1.00 0.00 ? 44 CYS A O    13 
ATOM 11401 C CB   . CYS A 1 44 ? -10.801 18.993 17.053 1.00 0.00 ? 44 CYS A CB   13 
ATOM 11402 S SG   . CYS A 1 44 ? -11.706 20.333 17.866 1.00 0.00 ? 44 CYS A SG   13 
ATOM 11403 H H    . CYS A 1 44 ? -9.571  17.680 15.299 1.00 0.00 ? 44 CYS A H    13 
ATOM 11404 H HA   . CYS A 1 44 ? -12.407 18.343 15.775 1.00 0.00 ? 44 CYS A HA   13 
ATOM 11405 H HB2  . CYS A 1 44 ? -10.872 18.096 17.650 1.00 0.00 ? 44 CYS A HB2  13 
ATOM 11406 H HB3  . CYS A 1 44 ? -9.764  19.273 16.943 1.00 0.00 ? 44 CYS A HB3  13 
ATOM 11407 N N    . LYS A 1 45 ? -10.266 20.476 14.429 1.00 0.00 ? 45 LYS A N    13 
ATOM 11408 C CA   . LYS A 1 45 ? -10.210 21.717 13.607 1.00 0.00 ? 45 LYS A CA   13 
ATOM 11409 C C    . LYS A 1 45 ? -11.079 21.546 12.362 1.00 0.00 ? 45 LYS A C    13 
ATOM 11410 O O    . LYS A 1 45 ? -11.569 22.504 11.796 1.00 0.00 ? 45 LYS A O    13 
ATOM 11411 C CB   . LYS A 1 45 ? -8.738  21.878 13.225 1.00 0.00 ? 45 LYS A CB   13 
ATOM 11412 C CG   . LYS A 1 45 ? -8.371  20.859 12.142 1.00 0.00 ? 45 LYS A CG   13 
ATOM 11413 C CD   . LYS A 1 45 ? -8.332  21.552 10.780 1.00 0.00 ? 45 LYS A CD   13 
ATOM 11414 C CE   . LYS A 1 45 ? -7.578  20.673 9.781  1.00 0.00 ? 45 LYS A CE   13 
ATOM 11415 N NZ   . LYS A 1 45 ? -6.873  21.632 8.886  1.00 0.00 ? 45 LYS A NZ   13 
ATOM 11416 H H    . LYS A 1 45 ? -9.438  19.998 14.652 1.00 0.00 ? 45 LYS A H    13 
ATOM 11417 H HA   . LYS A 1 45 ? -10.538 22.567 14.183 1.00 0.00 ? 45 LYS A HA   13 
ATOM 11418 H HB2  . LYS A 1 45 ? -8.572  22.876 12.848 1.00 0.00 ? 45 LYS A HB2  13 
ATOM 11419 H HB3  . LYS A 1 45 ? -8.121  21.715 14.095 1.00 0.00 ? 45 LYS A HB3  13 
ATOM 11420 H HG2  . LYS A 1 45 ? -7.401  20.438 12.360 1.00 0.00 ? 45 LYS A HG2  13 
ATOM 11421 H HG3  . LYS A 1 45 ? -9.109  20.071 12.123 1.00 0.00 ? 45 LYS A HG3  13 
ATOM 11422 H HD2  . LYS A 1 45 ? -9.341  21.712 10.429 1.00 0.00 ? 45 LYS A HD2  13 
ATOM 11423 H HD3  . LYS A 1 45 ? -7.830  22.504 10.874 1.00 0.00 ? 45 LYS A HD3  13 
ATOM 11424 H HE2  . LYS A 1 45 ? -6.864  20.046 10.297 1.00 0.00 ? 45 LYS A HE2  13 
ATOM 11425 H HE3  . LYS A 1 45 ? -8.270  20.067 9.215  1.00 0.00 ? 45 LYS A HE3  13 
ATOM 11426 H HZ1  . LYS A 1 45 ? -7.517  22.408 8.632  1.00 0.00 ? 45 LYS A HZ1  13 
ATOM 11427 H HZ2  . LYS A 1 45 ? -6.043  22.020 9.376  1.00 0.00 ? 45 LYS A HZ2  13 
ATOM 11428 H HZ3  . LYS A 1 45 ? -6.566  21.139 8.022  1.00 0.00 ? 45 LYS A HZ3  13 
ATOM 11429 N N    . MET A 1 46 ? -11.280 20.330 11.937 1.00 0.00 ? 46 MET A N    13 
ATOM 11430 C CA   . MET A 1 46 ? -12.124 20.093 10.734 1.00 0.00 ? 46 MET A CA   13 
ATOM 11431 C C    . MET A 1 46 ? -13.600 20.182 11.124 1.00 0.00 ? 46 MET A C    13 
ATOM 11432 O O    . MET A 1 46 ? -14.455 20.457 10.306 1.00 0.00 ? 46 MET A O    13 
ATOM 11433 C CB   . MET A 1 46 ? -11.768 18.684 10.263 1.00 0.00 ? 46 MET A CB   13 
ATOM 11434 C CG   . MET A 1 46 ? -12.241 17.659 11.293 1.00 0.00 ? 46 MET A CG   13 
ATOM 11435 S SD   . MET A 1 46 ? -13.475 16.572 10.536 1.00 0.00 ? 46 MET A SD   13 
ATOM 11436 C CE   . MET A 1 46 ? -12.396 15.844 9.280  1.00 0.00 ? 46 MET A CE   13 
ATOM 11437 H H    . MET A 1 46 ? -10.880 19.572 12.413 1.00 0.00 ? 46 MET A H    13 
ATOM 11438 H HA   . MET A 1 46 ? -11.891 20.811 9.966  1.00 0.00 ? 46 MET A HA   13 
ATOM 11439 H HB2  . MET A 1 46 ? -12.252 18.491 9.318  1.00 0.00 ? 46 MET A HB2  13 
ATOM 11440 H HB3  . MET A 1 46 ? -10.699 18.606 10.142 1.00 0.00 ? 46 MET A HB3  13 
ATOM 11441 H HG2  . MET A 1 46 ? -11.399 17.070 11.627 1.00 0.00 ? 46 MET A HG2  13 
ATOM 11442 H HG3  . MET A 1 46 ? -12.678 18.171 12.137 1.00 0.00 ? 46 MET A HG3  13 
ATOM 11443 H HE1  . MET A 1 46 ? -11.375 15.851 9.634  1.00 0.00 ? 46 MET A HE1  13 
ATOM 11444 H HE2  . MET A 1 46 ? -12.700 14.827 9.087  1.00 0.00 ? 46 MET A HE2  13 
ATOM 11445 H HE3  . MET A 1 46 ? -12.470 16.419 8.367  1.00 0.00 ? 46 MET A HE3  13 
ATOM 11446 N N    . ILE A 1 47 ? -13.901 19.963 12.374 1.00 0.00 ? 47 ILE A N    13 
ATOM 11447 C CA   . ILE A 1 47 ? -15.317 20.046 12.825 1.00 0.00 ? 47 ILE A CA   13 
ATOM 11448 C C    . ILE A 1 47 ? -15.825 21.475 12.636 1.00 0.00 ? 47 ILE A C    13 
ATOM 11449 O O    . ILE A 1 47 ? -16.908 21.701 12.134 1.00 0.00 ? 47 ILE A O    13 
ATOM 11450 C CB   . ILE A 1 47 ? -15.291 19.683 14.313 1.00 0.00 ? 47 ILE A CB   13 
ATOM 11451 C CG1  . ILE A 1 47 ? -14.592 18.336 14.504 1.00 0.00 ? 47 ILE A CG1  13 
ATOM 11452 C CG2  . ILE A 1 47 ? -16.724 19.595 14.840 1.00 0.00 ? 47 ILE A CG2  13 
ATOM 11453 C CD1  . ILE A 1 47 ? -15.199 17.302 13.555 1.00 0.00 ? 47 ILE A CD1  13 
ATOM 11454 H H    . ILE A 1 47 ? -13.192 19.751 13.015 1.00 0.00 ? 47 ILE A H    13 
ATOM 11455 H HA   . ILE A 1 47 ? -15.933 19.349 12.282 1.00 0.00 ? 47 ILE A HA   13 
ATOM 11456 H HB   . ILE A 1 47 ? -14.755 20.446 14.858 1.00 0.00 ? 47 ILE A HB   13 
ATOM 11457 H HG12 . ILE A 1 47 ? -13.539 18.444 14.292 1.00 0.00 ? 47 ILE A HG12 13 
ATOM 11458 H HG13 . ILE A 1 47 ? -14.721 18.006 15.524 1.00 0.00 ? 47 ILE A HG13 13 
ATOM 11459 H HG21 . ILE A 1 47 ? -17.237 20.526 14.649 1.00 0.00 ? 47 ILE A HG21 13 
ATOM 11460 H HG22 . ILE A 1 47 ? -17.242 18.789 14.341 1.00 0.00 ? 47 ILE A HG22 13 
ATOM 11461 H HG23 . ILE A 1 47 ? -16.705 19.405 15.904 1.00 0.00 ? 47 ILE A HG23 13 
ATOM 11462 H HD11 . ILE A 1 47 ? -16.104 17.699 13.118 1.00 0.00 ? 47 ILE A HD11 13 
ATOM 11463 H HD12 . ILE A 1 47 ? -14.491 17.075 12.772 1.00 0.00 ? 47 ILE A HD12 13 
ATOM 11464 H HD13 . ILE A 1 47 ? -15.429 16.402 14.104 1.00 0.00 ? 47 ILE A HD13 13 
ATOM 11465 N N    . LEU A 1 48 ? -15.042 22.441 13.029 1.00 0.00 ? 48 LEU A N    13 
ATOM 11466 C CA   . LEU A 1 48 ? -15.468 23.858 12.867 1.00 0.00 ? 48 LEU A CA   13 
ATOM 11467 C C    . LEU A 1 48 ? -15.731 24.152 11.392 1.00 0.00 ? 48 LEU A C    13 
ATOM 11468 O O    . LEU A 1 48 ? -16.642 24.879 11.048 1.00 0.00 ? 48 LEU A O    13 
ATOM 11469 C CB   . LEU A 1 48 ? -14.292 24.685 13.380 1.00 0.00 ? 48 LEU A CB   13 
ATOM 11470 C CG   . LEU A 1 48 ? -14.005 24.305 14.832 1.00 0.00 ? 48 LEU A CG   13 
ATOM 11471 C CD1  . LEU A 1 48 ? -12.537 23.899 14.973 1.00 0.00 ? 48 LEU A CD1  13 
ATOM 11472 C CD2  . LEU A 1 48 ? -14.298 25.503 15.736 1.00 0.00 ? 48 LEU A CD2  13 
ATOM 11473 H H    . LEU A 1 48 ? -14.170 22.234 13.426 1.00 0.00 ? 48 LEU A H    13 
ATOM 11474 H HA   . LEU A 1 48 ? -16.347 24.058 13.457 1.00 0.00 ? 48 LEU A HA   13 
ATOM 11475 H HB2  . LEU A 1 48 ? -13.420 24.487 12.775 1.00 0.00 ? 48 LEU A HB2  13 
ATOM 11476 H HB3  . LEU A 1 48 ? -14.538 25.736 13.323 1.00 0.00 ? 48 LEU A HB3  13 
ATOM 11477 H HG   . LEU A 1 48 ? -14.636 23.476 15.117 1.00 0.00 ? 48 LEU A HG   13 
ATOM 11478 H HD11 . LEU A 1 48 ? -11.924 24.546 14.363 1.00 0.00 ? 48 LEU A HD11 13 
ATOM 11479 H HD12 . LEU A 1 48 ? -12.236 23.986 16.006 1.00 0.00 ? 48 LEU A HD12 13 
ATOM 11480 H HD13 . LEU A 1 48 ? -12.414 22.875 14.648 1.00 0.00 ? 48 LEU A HD13 13 
ATOM 11481 H HD21 . LEU A 1 48 ? -15.220 25.971 15.423 1.00 0.00 ? 48 LEU A HD21 13 
ATOM 11482 H HD22 . LEU A 1 48 ? -14.391 25.168 16.758 1.00 0.00 ? 48 LEU A HD22 13 
ATOM 11483 H HD23 . LEU A 1 48 ? -13.490 26.216 15.663 1.00 0.00 ? 48 LEU A HD23 13 
ATOM 11484 N N    . GLU A 1 49 ? -14.949 23.585 10.514 1.00 0.00 ? 49 GLU A N    13 
ATOM 11485 C CA   . GLU A 1 49 ? -15.173 23.833 9.062  1.00 0.00 ? 49 GLU A CA   13 
ATOM 11486 C C    . GLU A 1 49 ? -16.664 23.695 8.748  1.00 0.00 ? 49 GLU A C    13 
ATOM 11487 O O    . GLU A 1 49 ? -17.169 24.271 7.805  1.00 0.00 ? 49 GLU A O    13 
ATOM 11488 C CB   . GLU A 1 49 ? -14.368 22.752 8.341  1.00 0.00 ? 49 GLU A CB   13 
ATOM 11489 C CG   . GLU A 1 49 ? -12.877 22.955 8.619  1.00 0.00 ? 49 GLU A CG   13 
ATOM 11490 C CD   . GLU A 1 49 ? -12.294 23.925 7.589  1.00 0.00 ? 49 GLU A CD   13 
ATOM 11491 O OE1  . GLU A 1 49 ? -13.040 24.363 6.729  1.00 0.00 ? 49 GLU A OE1  13 
ATOM 11492 O OE2  . GLU A 1 49 ? -11.112 24.212 7.676  1.00 0.00 ? 49 GLU A OE2  13 
ATOM 11493 H H    . GLU A 1 49 ? -14.221 22.994 10.809 1.00 0.00 ? 49 GLU A H    13 
ATOM 11494 H HA   . GLU A 1 49 ? -14.815 24.811 8.785  1.00 0.00 ? 49 GLU A HA   13 
ATOM 11495 H HB2  . GLU A 1 49 ? -14.671 21.779 8.697  1.00 0.00 ? 49 GLU A HB2  13 
ATOM 11496 H HB3  . GLU A 1 49 ? -14.548 22.817 7.279  1.00 0.00 ? 49 GLU A HB3  13 
ATOM 11497 H HG2  . GLU A 1 49 ? -12.749 23.364 9.611  1.00 0.00 ? 49 GLU A HG2  13 
ATOM 11498 H HG3  . GLU A 1 49 ? -12.365 22.008 8.551  1.00 0.00 ? 49 GLU A HG3  13 
ATOM 11499 N N    . LYS A 1 50 ? -17.372 22.936 9.540  1.00 0.00 ? 50 LYS A N    13 
ATOM 11500 C CA   . LYS A 1 50 ? -18.832 22.759 9.301  1.00 0.00 ? 50 LYS A CA   13 
ATOM 11501 C C    . LYS A 1 50 ? -19.603 23.966 9.845  1.00 0.00 ? 50 LYS A C    13 
ATOM 11502 O O    . LYS A 1 50 ? -20.632 24.343 9.321  1.00 0.00 ? 50 LYS A O    13 
ATOM 11503 C CB   . LYS A 1 50 ? -19.207 21.493 10.073 1.00 0.00 ? 50 LYS A CB   13 
ATOM 11504 C CG   . LYS A 1 50 ? -18.270 20.351 9.671  1.00 0.00 ? 50 LYS A CG   13 
ATOM 11505 C CD   . LYS A 1 50 ? -18.991 19.421 8.694  1.00 0.00 ? 50 LYS A CD   13 
ATOM 11506 C CE   . LYS A 1 50 ? -18.052 18.286 8.282  1.00 0.00 ? 50 LYS A CE   13 
ATOM 11507 N NZ   . LYS A 1 50 ? -18.466 17.932 6.895  1.00 0.00 ? 50 LYS A NZ   13 
ATOM 11508 H H    . LYS A 1 50 ? -16.942 22.485 10.297 1.00 0.00 ? 50 LYS A H    13 
ATOM 11509 H HA   . LYS A 1 50 ? -19.029 22.624 8.250  1.00 0.00 ? 50 LYS A HA   13 
ATOM 11510 H HB2  . LYS A 1 50 ? -19.116 21.677 11.133 1.00 0.00 ? 50 LYS A HB2  13 
ATOM 11511 H HB3  . LYS A 1 50 ? -20.227 21.219 9.842  1.00 0.00 ? 50 LYS A HB3  13 
ATOM 11512 H HG2  . LYS A 1 50 ? -17.389 20.758 9.198  1.00 0.00 ? 50 LYS A HG2  13 
ATOM 11513 H HG3  . LYS A 1 50 ? -17.981 19.795 10.552 1.00 0.00 ? 50 LYS A HG3  13 
ATOM 11514 H HD2  . LYS A 1 50 ? -19.868 19.006 9.171  1.00 0.00 ? 50 LYS A HD2  13 
ATOM 11515 H HD3  . LYS A 1 50 ? -19.288 19.978 7.819  1.00 0.00 ? 50 LYS A HD3  13 
ATOM 11516 H HE2  . LYS A 1 50 ? -17.026 18.623 8.292  1.00 0.00 ? 50 LYS A HE2  13 
ATOM 11517 H HE3  . LYS A 1 50 ? -18.176 17.437 8.939  1.00 0.00 ? 50 LYS A HE3  13 
ATOM 11518 H HZ1  . LYS A 1 50 ? -19.471 18.165 6.764  1.00 0.00 ? 50 LYS A HZ1  13 
ATOM 11519 H HZ2  . LYS A 1 50 ? -17.894 18.470 6.214  1.00 0.00 ? 50 LYS A HZ2  13 
ATOM 11520 H HZ3  . LYS A 1 50 ? -18.322 16.914 6.738  1.00 0.00 ? 50 LYS A HZ3  13 
ATOM 11521 N N    . GLU A 1 51 ? -19.114 24.574 10.893 1.00 0.00 ? 51 GLU A N    13 
ATOM 11522 C CA   . GLU A 1 51 ? -19.822 25.755 11.467 1.00 0.00 ? 51 GLU A CA   13 
ATOM 11523 C C    . GLU A 1 51 ? -19.911 26.876 10.427 1.00 0.00 ? 51 GLU A C    13 
ATOM 11524 O O    . GLU A 1 51 ? -20.793 27.711 10.475 1.00 0.00 ? 51 GLU A O    13 
ATOM 11525 C CB   . GLU A 1 51 ? -18.964 26.193 12.655 1.00 0.00 ? 51 GLU A CB   13 
ATOM 11526 C CG   . GLU A 1 51 ? -19.139 25.199 13.805 1.00 0.00 ? 51 GLU A CG   13 
ATOM 11527 C CD   . GLU A 1 51 ? -18.104 25.493 14.894 1.00 0.00 ? 51 GLU A CD   13 
ATOM 11528 O OE1  . GLU A 1 51 ? -17.196 26.262 14.629 1.00 0.00 ? 51 GLU A OE1  13 
ATOM 11529 O OE2  . GLU A 1 51 ? -18.239 24.942 15.975 1.00 0.00 ? 51 GLU A OE2  13 
ATOM 11530 H H    . GLU A 1 51 ? -18.282 24.255 11.303 1.00 0.00 ? 51 GLU A H    13 
ATOM 11531 H HA   . GLU A 1 51 ? -20.806 25.476 11.807 1.00 0.00 ? 51 GLU A HA   13 
ATOM 11532 H HB2  . GLU A 1 51 ? -17.926 26.220 12.357 1.00 0.00 ? 51 GLU A HB2  13 
ATOM 11533 H HB3  . GLU A 1 51 ? -19.272 27.176 12.978 1.00 0.00 ? 51 GLU A HB3  13 
ATOM 11534 H HG2  . GLU A 1 51 ? -20.133 25.296 14.217 1.00 0.00 ? 51 GLU A HG2  13 
ATOM 11535 H HG3  . GLU A 1 51 ? -18.998 24.193 13.438 1.00 0.00 ? 51 GLU A HG3  13 
ATOM 11536 N N    . ALA A 1 52 ? -19.004 26.901 9.490  1.00 0.00 ? 52 ALA A N    13 
ATOM 11537 C CA   . ALA A 1 52 ? -19.037 27.970 8.450  1.00 0.00 ? 52 ALA A CA   13 
ATOM 11538 C C    . ALA A 1 52 ? -20.078 27.634 7.378  1.00 0.00 ? 52 ALA A C    13 
ATOM 11539 O O    . ALA A 1 52 ? -20.568 28.501 6.683  1.00 0.00 ? 52 ALA A O    13 
ATOM 11540 C CB   . ALA A 1 52 ? -17.631 27.978 7.850  1.00 0.00 ? 52 ALA A CB   13 
ATOM 11541 H H    . ALA A 1 52 ? -18.302 26.219 9.471  1.00 0.00 ? 52 ALA A H    13 
ATOM 11542 H HA   . ALA A 1 52 ? -19.252 28.926 8.899  1.00 0.00 ? 52 ALA A HA   13 
ATOM 11543 H HB1  . ALA A 1 52 ? -16.902 27.894 8.642  1.00 0.00 ? 52 ALA A HB1  13 
ATOM 11544 H HB2  . ALA A 1 52 ? -17.474 28.902 7.314  1.00 0.00 ? 52 ALA A HB2  13 
ATOM 11545 H HB3  . ALA A 1 52 ? -17.524 27.145 7.172  1.00 0.00 ? 52 ALA A HB3  13 
ATOM 11546 N N    . LYS A 1 53 ? -20.419 26.382 7.239  1.00 0.00 ? 53 LYS A N    13 
ATOM 11547 C CA   . LYS A 1 53 ? -21.428 25.995 6.211  1.00 0.00 ? 53 LYS A CA   13 
ATOM 11548 C C    . LYS A 1 53 ? -22.839 26.322 6.707  1.00 0.00 ? 53 LYS A C    13 
ATOM 11549 O O    . LYS A 1 53 ? -23.716 26.656 5.935  1.00 0.00 ? 53 LYS A O    13 
ATOM 11550 C CB   . LYS A 1 53 ? -21.257 24.486 6.038  1.00 0.00 ? 53 LYS A CB   13 
ATOM 11551 C CG   . LYS A 1 53 ? -19.952 24.203 5.292  1.00 0.00 ? 53 LYS A CG   13 
ATOM 11552 C CD   . LYS A 1 53 ? -19.709 22.694 5.244  1.00 0.00 ? 53 LYS A CD   13 
ATOM 11553 C CE   . LYS A 1 53 ? -18.495 22.401 4.358  1.00 0.00 ? 53 LYS A CE   13 
ATOM 11554 N NZ   . LYS A 1 53 ? -18.255 20.939 4.508  1.00 0.00 ? 53 LYS A NZ   13 
ATOM 11555 H H    . LYS A 1 53 ? -20.012 25.698 7.810  1.00 0.00 ? 53 LYS A H    13 
ATOM 11556 H HA   . LYS A 1 53 ? -21.229 26.498 5.279  1.00 0.00 ? 53 LYS A HA   13 
ATOM 11557 H HB2  . LYS A 1 53 ? -21.228 24.013 7.008  1.00 0.00 ? 53 LYS A HB2  13 
ATOM 11558 H HB3  . LYS A 1 53 ? -22.088 24.092 5.471  1.00 0.00 ? 53 LYS A HB3  13 
ATOM 11559 H HG2  . LYS A 1 53 ? -20.021 24.588 4.286  1.00 0.00 ? 53 LYS A HG2  13 
ATOM 11560 H HG3  . LYS A 1 53 ? -19.133 24.684 5.806  1.00 0.00 ? 53 LYS A HG3  13 
ATOM 11561 H HD2  . LYS A 1 53 ? -19.522 22.327 6.243  1.00 0.00 ? 53 LYS A HD2  13 
ATOM 11562 H HD3  . LYS A 1 53 ? -20.579 22.201 4.836  1.00 0.00 ? 53 LYS A HD3  13 
ATOM 11563 H HE2  . LYS A 1 53 ? -18.715 22.643 3.329  1.00 0.00 ? 53 LYS A HE2  13 
ATOM 11564 H HE3  . LYS A 1 53 ? -17.636 22.960 4.702  1.00 0.00 ? 53 LYS A HE3  13 
ATOM 11565 H HZ1  . LYS A 1 53 ? -19.164 20.434 4.490  1.00 0.00 ? 53 LYS A HZ1  13 
ATOM 11566 H HZ2  . LYS A 1 53 ? -17.657 20.604 3.725  1.00 0.00 ? 53 LYS A HZ2  13 
ATOM 11567 H HZ3  . LYS A 1 53 ? -17.778 20.756 5.413  1.00 0.00 ? 53 LYS A HZ3  13 
ATOM 11568 N N    . SER A 1 54 ? -23.064 26.229 7.989  1.00 0.00 ? 54 SER A N    13 
ATOM 11569 C CA   . SER A 1 54 ? -24.419 26.536 8.532  1.00 0.00 ? 54 SER A CA   13 
ATOM 11570 C C    . SER A 1 54 ? -24.655 28.048 8.543  1.00 0.00 ? 54 SER A C    13 
ATOM 11571 O O    . SER A 1 54 ? -25.768 28.510 8.696  1.00 0.00 ? 54 SER A O    13 
ATOM 11572 C CB   . SER A 1 54 ? -24.406 25.983 9.958  1.00 0.00 ? 54 SER A CB   13 
ATOM 11573 O OG   . SER A 1 54 ? -24.060 24.606 9.930  1.00 0.00 ? 54 SER A OG   13 
ATOM 11574 H H    . SER A 1 54 ? -22.343 25.958 8.594  1.00 0.00 ? 54 SER A H    13 
ATOM 11575 H HA   . SER A 1 54 ? -25.179 26.038 7.952  1.00 0.00 ? 54 SER A HA   13 
ATOM 11576 H HB2  . SER A 1 54 ? -23.681 26.525 10.548 1.00 0.00 ? 54 SER A HB2  13 
ATOM 11577 H HB3  . SER A 1 54 ? -25.386 26.099 10.398 1.00 0.00 ? 54 SER A HB3  13 
ATOM 11578 H HG   . SER A 1 54 ? -23.654 24.385 10.771 1.00 0.00 ? 54 SER A HG   13 
ATOM 11579 N N    . GLN A 1 55 ? -23.617 28.823 8.380  1.00 0.00 ? 55 GLN A N    13 
ATOM 11580 C CA   . GLN A 1 55 ? -23.784 30.304 8.380  1.00 0.00 ? 55 GLN A CA   13 
ATOM 11581 C C    . GLN A 1 55 ? -23.695 30.846 6.951  1.00 0.00 ? 55 GLN A C    13 
ATOM 11582 O O    . GLN A 1 55 ? -22.932 30.293 6.175  1.00 0.00 ? 55 GLN A O    13 
ATOM 11583 C CB   . GLN A 1 55 ? -22.628 30.835 9.227  1.00 0.00 ? 55 GLN A CB   13 
ATOM 11584 C CG   . GLN A 1 55 ? -22.718 32.360 9.312  1.00 0.00 ? 55 GLN A CG   13 
ATOM 11585 C CD   . GLN A 1 55 ? -21.426 32.916 9.914  1.00 0.00 ? 55 GLN A CD   13 
ATOM 11586 O OE1  . GLN A 1 55 ? -20.745 32.234 10.655 1.00 0.00 ? 55 GLN A OE1  13 
ATOM 11587 N NE2  . GLN A 1 55 ? -21.059 34.135 9.628  1.00 0.00 ? 55 GLN A NE2  13 
ATOM 11588 O OXT  . GLN A 1 55 ? -24.389 31.805 6.658  1.00 0.00 ? 55 GLN A OXT  13 
ATOM 11589 H H    . GLN A 1 55 ? -22.728 28.429 8.257  1.00 0.00 ? 55 GLN A H    13 
ATOM 11590 H HA   . GLN A 1 55 ? -24.726 30.577 8.828  1.00 0.00 ? 55 GLN A HA   13 
ATOM 11591 H HB2  . GLN A 1 55 ? -22.687 30.415 10.220 1.00 0.00 ? 55 GLN A HB2  13 
ATOM 11592 H HB3  . GLN A 1 55 ? -21.690 30.554 8.772  1.00 0.00 ? 55 GLN A HB3  13 
ATOM 11593 H HG2  . GLN A 1 55 ? -22.857 32.768 8.321  1.00 0.00 ? 55 GLN A HG2  13 
ATOM 11594 H HG3  . GLN A 1 55 ? -23.555 32.637 9.936  1.00 0.00 ? 55 GLN A HG3  13 
ATOM 11595 H HE21 . GLN A 1 55 ? -21.609 34.685 9.032  1.00 0.00 ? 55 GLN A HE21 13 
ATOM 11596 H HE22 . GLN A 1 55 ? -20.233 34.501 10.008 1.00 0.00 ? 55 GLN A HE22 13 
ATOM 11597 N N    . LYS A 1 1  ? -30.477 18.432 18.733 1.00 0.00 ? 1  LYS A N    14 
ATOM 11598 C CA   . LYS A 1 1  ? -30.408 19.865 18.325 1.00 0.00 ? 1  LYS A CA   14 
ATOM 11599 C C    . LYS A 1 1  ? -28.961 20.256 18.012 1.00 0.00 ? 1  LYS A C    14 
ATOM 11600 O O    . LYS A 1 1  ? -28.466 21.264 18.474 1.00 0.00 ? 1  LYS A O    14 
ATOM 11601 C CB   . LYS A 1 1  ? -30.924 20.645 19.535 1.00 0.00 ? 1  LYS A CB   14 
ATOM 11602 C CG   . LYS A 1 1  ? -31.211 22.092 19.125 1.00 0.00 ? 1  LYS A CG   14 
ATOM 11603 C CD   . LYS A 1 1  ? -31.723 22.872 20.337 1.00 0.00 ? 1  LYS A CD   14 
ATOM 11604 C CE   . LYS A 1 1  ? -31.871 24.350 19.967 1.00 0.00 ? 1  LYS A CE   14 
ATOM 11605 N NZ   . LYS A 1 1  ? -32.330 25.013 21.220 1.00 0.00 ? 1  LYS A NZ   14 
ATOM 11606 H H1   . LYS A 1 1  ? -29.648 18.197 19.315 1.00 0.00 ? 1  LYS A H1   14 
ATOM 11607 H H2   . LYS A 1 1  ? -31.345 18.269 19.281 1.00 0.00 ? 1  LYS A H2   14 
ATOM 11608 H H3   . LYS A 1 1  ? -30.488 17.830 17.885 1.00 0.00 ? 1  LYS A H3   14 
ATOM 11609 H HA   . LYS A 1 1  ? -31.042 20.046 17.471 1.00 0.00 ? 1  LYS A HA   14 
ATOM 11610 H HB2  . LYS A 1 1  ? -31.834 20.187 19.897 1.00 0.00 ? 1  LYS A HB2  14 
ATOM 11611 H HB3  . LYS A 1 1  ? -30.179 20.632 20.316 1.00 0.00 ? 1  LYS A HB3  14 
ATOM 11612 H HG2  . LYS A 1 1  ? -30.302 22.549 18.760 1.00 0.00 ? 1  LYS A HG2  14 
ATOM 11613 H HG3  . LYS A 1 1  ? -31.958 22.104 18.346 1.00 0.00 ? 1  LYS A HG3  14 
ATOM 11614 H HD2  . LYS A 1 1  ? -32.683 22.479 20.639 1.00 0.00 ? 1  LYS A HD2  14 
ATOM 11615 H HD3  . LYS A 1 1  ? -31.022 22.774 21.152 1.00 0.00 ? 1  LYS A HD3  14 
ATOM 11616 H HE2  . LYS A 1 1  ? -30.920 24.755 19.654 1.00 0.00 ? 1  LYS A HE2  14 
ATOM 11617 H HE3  . LYS A 1 1  ? -32.607 24.469 19.186 1.00 0.00 ? 1  LYS A HE3  14 
ATOM 11618 H HZ1  . LYS A 1 1  ? -33.197 24.551 21.560 1.00 0.00 ? 1  LYS A HZ1  14 
ATOM 11619 H HZ2  . LYS A 1 1  ? -31.587 24.934 21.945 1.00 0.00 ? 1  LYS A HZ2  14 
ATOM 11620 H HZ3  . LYS A 1 1  ? -32.525 26.016 21.030 1.00 0.00 ? 1  LYS A HZ3  14 
ATOM 11621 N N    . ASN A 1 2  ? -28.278 19.465 17.228 1.00 0.00 ? 2  ASN A N    14 
ATOM 11622 C CA   . ASN A 1 2  ? -26.864 19.793 16.886 1.00 0.00 ? 2  ASN A CA   14 
ATOM 11623 C C    . ASN A 1 2  ? -26.793 20.462 15.511 1.00 0.00 ? 2  ASN A C    14 
ATOM 11624 O O    . ASN A 1 2  ? -27.364 19.988 14.550 1.00 0.00 ? 2  ASN A O    14 
ATOM 11625 C CB   . ASN A 1 2  ? -26.139 18.448 16.866 1.00 0.00 ? 2  ASN A CB   14 
ATOM 11626 C CG   . ASN A 1 2  ? -24.628 18.683 16.907 1.00 0.00 ? 2  ASN A CG   14 
ATOM 11627 O OD1  . ASN A 1 2  ? -24.176 19.740 17.300 1.00 0.00 ? 2  ASN A OD1  14 
ATOM 11628 N ND2  . ASN A 1 2  ? -23.821 17.735 16.515 1.00 0.00 ? 2  ASN A ND2  14 
ATOM 11629 H H    . ASN A 1 2  ? -28.696 18.656 16.865 1.00 0.00 ? 2  ASN A H    14 
ATOM 11630 H HA   . ASN A 1 2  ? -26.433 20.433 17.640 1.00 0.00 ? 2  ASN A HA   14 
ATOM 11631 H HB2  . ASN A 1 2  ? -26.436 17.865 17.726 1.00 0.00 ? 2  ASN A HB2  14 
ATOM 11632 H HB3  . ASN A 1 2  ? -26.397 17.914 15.963 1.00 0.00 ? 2  ASN A HB3  14 
ATOM 11633 H HD21 . ASN A 1 2  ? -24.185 16.882 16.197 1.00 0.00 ? 2  ASN A HD21 14 
ATOM 11634 H HD22 . ASN A 1 2  ? -22.852 17.876 16.537 1.00 0.00 ? 2  ASN A HD22 14 
ATOM 11635 N N    . GLU A 1 3  ? -26.098 21.562 15.412 1.00 0.00 ? 3  GLU A N    14 
ATOM 11636 C CA   . GLU A 1 3  ? -25.991 22.261 14.098 1.00 0.00 ? 3  GLU A CA   14 
ATOM 11637 C C    . GLU A 1 3  ? -24.943 21.575 13.216 1.00 0.00 ? 3  GLU A C    14 
ATOM 11638 O O    . GLU A 1 3  ? -24.931 21.736 12.012 1.00 0.00 ? 3  GLU A O    14 
ATOM 11639 C CB   . GLU A 1 3  ? -25.554 23.685 14.442 1.00 0.00 ? 3  GLU A CB   14 
ATOM 11640 C CG   . GLU A 1 3  ? -24.106 23.670 14.937 1.00 0.00 ? 3  GLU A CG   14 
ATOM 11641 C CD   . GLU A 1 3  ? -23.649 25.102 15.218 1.00 0.00 ? 3  GLU A CD   14 
ATOM 11642 O OE1  . GLU A 1 3  ? -23.677 25.904 14.298 1.00 0.00 ? 3  GLU A OE1  14 
ATOM 11643 O OE2  . GLU A 1 3  ? -23.276 25.374 16.348 1.00 0.00 ? 3  GLU A OE2  14 
ATOM 11644 H H    . GLU A 1 3  ? -25.645 21.928 16.199 1.00 0.00 ? 3  GLU A H    14 
ATOM 11645 H HA   . GLU A 1 3  ? -26.948 22.278 13.602 1.00 0.00 ? 3  GLU A HA   14 
ATOM 11646 H HB2  . GLU A 1 3  ? -25.628 24.306 13.562 1.00 0.00 ? 3  GLU A HB2  14 
ATOM 11647 H HB3  . GLU A 1 3  ? -26.195 24.081 15.216 1.00 0.00 ? 3  GLU A HB3  14 
ATOM 11648 H HG2  . GLU A 1 3  ? -24.043 23.087 15.844 1.00 0.00 ? 3  GLU A HG2  14 
ATOM 11649 H HG3  . GLU A 1 3  ? -23.473 23.231 14.181 1.00 0.00 ? 3  GLU A HG3  14 
ATOM 11650 N N    . ASP A 1 4  ? -24.063 20.812 13.805 1.00 0.00 ? 4  ASP A N    14 
ATOM 11651 C CA   . ASP A 1 4  ? -23.018 20.120 12.997 1.00 0.00 ? 4  ASP A CA   14 
ATOM 11652 C C    . ASP A 1 4  ? -23.144 18.598 13.159 1.00 0.00 ? 4  ASP A C    14 
ATOM 11653 O O    . ASP A 1 4  ? -24.008 17.977 12.573 1.00 0.00 ? 4  ASP A O    14 
ATOM 11654 C CB   . ASP A 1 4  ? -21.687 20.626 13.555 1.00 0.00 ? 4  ASP A CB   14 
ATOM 11655 C CG   . ASP A 1 4  ? -20.532 19.944 12.820 1.00 0.00 ? 4  ASP A CG   14 
ATOM 11656 O OD1  . ASP A 1 4  ? -20.803 19.199 11.892 1.00 0.00 ? 4  ASP A OD1  14 
ATOM 11657 O OD2  . ASP A 1 4  ? -19.396 20.178 13.196 1.00 0.00 ? 4  ASP A OD2  14 
ATOM 11658 H H    . ASP A 1 4  ? -24.088 20.694 14.778 1.00 0.00 ? 4  ASP A H    14 
ATOM 11659 H HA   . ASP A 1 4  ? -23.107 20.394 11.957 1.00 0.00 ? 4  ASP A HA   14 
ATOM 11660 H HB2  . ASP A 1 4  ? -21.621 21.695 13.416 1.00 0.00 ? 4  ASP A HB2  14 
ATOM 11661 H HB3  . ASP A 1 4  ? -21.629 20.396 14.609 1.00 0.00 ? 4  ASP A HB3  14 
ATOM 11662 N N    . GLN A 1 5  ? -22.295 17.990 13.947 1.00 0.00 ? 5  GLN A N    14 
ATOM 11663 C CA   . GLN A 1 5  ? -22.381 16.512 14.135 1.00 0.00 ? 5  GLN A CA   14 
ATOM 11664 C C    . GLN A 1 5  ? -21.239 16.025 15.028 1.00 0.00 ? 5  GLN A C    14 
ATOM 11665 O O    . GLN A 1 5  ? -21.392 15.102 15.803 1.00 0.00 ? 5  GLN A O    14 
ATOM 11666 C CB   . GLN A 1 5  ? -22.252 15.923 12.730 1.00 0.00 ? 5  GLN A CB   14 
ATOM 11667 C CG   . GLN A 1 5  ? -23.253 14.779 12.563 1.00 0.00 ? 5  GLN A CG   14 
ATOM 11668 C CD   . GLN A 1 5  ? -22.795 13.861 11.428 1.00 0.00 ? 5  GLN A CD   14 
ATOM 11669 O OE1  . GLN A 1 5  ? -21.637 13.504 11.350 1.00 0.00 ? 5  GLN A OE1  14 
ATOM 11670 N NE2  . GLN A 1 5  ? -23.663 13.460 10.540 1.00 0.00 ? 5  GLN A NE2  14 
ATOM 11671 H H    . GLN A 1 5  ? -21.605 18.501 14.416 1.00 0.00 ? 5  GLN A H    14 
ATOM 11672 H HA   . GLN A 1 5  ? -23.332 16.243 14.561 1.00 0.00 ? 5  GLN A HA   14 
ATOM 11673 H HB2  . GLN A 1 5  ? -22.453 16.689 11.996 1.00 0.00 ? 5  GLN A HB2  14 
ATOM 11674 H HB3  . GLN A 1 5  ? -21.249 15.546 12.590 1.00 0.00 ? 5  GLN A HB3  14 
ATOM 11675 H HG2  . GLN A 1 5  ? -23.311 14.214 13.482 1.00 0.00 ? 5  GLN A HG2  14 
ATOM 11676 H HG3  . GLN A 1 5  ? -24.227 15.184 12.329 1.00 0.00 ? 5  GLN A HG3  14 
ATOM 11677 H HE21 . GLN A 1 5  ? -24.598 13.747 10.603 1.00 0.00 ? 5  GLN A HE21 14 
ATOM 11678 H HE22 . GLN A 1 5  ? -23.379 12.872 9.808  1.00 0.00 ? 5  GLN A HE22 14 
ATOM 11679 N N    . GLU A 1 6  ? -20.094 16.639 14.923 1.00 0.00 ? 6  GLU A N    14 
ATOM 11680 C CA   . GLU A 1 6  ? -18.939 16.211 15.765 1.00 0.00 ? 6  GLU A CA   14 
ATOM 11681 C C    . GLU A 1 6  ? -18.447 17.380 16.623 1.00 0.00 ? 6  GLU A C    14 
ATOM 11682 O O    . GLU A 1 6  ? -17.557 18.112 16.240 1.00 0.00 ? 6  GLU A O    14 
ATOM 11683 C CB   . GLU A 1 6  ? -17.859 15.785 14.770 1.00 0.00 ? 6  GLU A CB   14 
ATOM 11684 C CG   . GLU A 1 6  ? -17.175 14.513 15.275 1.00 0.00 ? 6  GLU A CG   14 
ATOM 11685 C CD   . GLU A 1 6  ? -15.943 14.221 14.417 1.00 0.00 ? 6  GLU A CD   14 
ATOM 11686 O OE1  . GLU A 1 6  ? -15.962 14.570 13.248 1.00 0.00 ? 6  GLU A OE1  14 
ATOM 11687 O OE2  . GLU A 1 6  ? -15.000 13.652 14.944 1.00 0.00 ? 6  GLU A OE2  14 
ATOM 11688 H H    . GLU A 1 6  ? -19.992 17.380 14.291 1.00 0.00 ? 6  GLU A H    14 
ATOM 11689 H HA   . GLU A 1 6  ? -19.216 15.376 16.388 1.00 0.00 ? 6  GLU A HA   14 
ATOM 11690 H HB2  . GLU A 1 6  ? -18.310 15.594 13.808 1.00 0.00 ? 6  GLU A HB2  14 
ATOM 11691 H HB3  . GLU A 1 6  ? -17.126 16.573 14.674 1.00 0.00 ? 6  GLU A HB3  14 
ATOM 11692 H HG2  . GLU A 1 6  ? -16.873 14.650 16.303 1.00 0.00 ? 6  GLU A HG2  14 
ATOM 11693 H HG3  . GLU A 1 6  ? -17.864 13.684 15.210 1.00 0.00 ? 6  GLU A HG3  14 
ATOM 11694 N N    . MET A 1 7  ? -19.022 17.559 17.780 1.00 0.00 ? 7  MET A N    14 
ATOM 11695 C CA   . MET A 1 7  ? -18.588 18.679 18.664 1.00 0.00 ? 7  MET A CA   14 
ATOM 11696 C C    . MET A 1 7  ? -17.303 18.300 19.404 1.00 0.00 ? 7  MET A C    14 
ATOM 11697 O O    . MET A 1 7  ? -17.096 17.157 19.763 1.00 0.00 ? 7  MET A O    14 
ATOM 11698 C CB   . MET A 1 7  ? -19.739 18.873 19.651 1.00 0.00 ? 7  MET A CB   14 
ATOM 11699 C CG   . MET A 1 7  ? -21.041 19.095 18.879 1.00 0.00 ? 7  MET A CG   14 
ATOM 11700 S SD   . MET A 1 7  ? -22.337 19.630 20.024 1.00 0.00 ? 7  MET A SD   14 
ATOM 11701 C CE   . MET A 1 7  ? -22.625 18.025 20.807 1.00 0.00 ? 7  MET A CE   14 
ATOM 11702 H H    . MET A 1 7  ? -19.738 16.956 18.070 1.00 0.00 ? 7  MET A H    14 
ATOM 11703 H HA   . MET A 1 7  ? -18.440 19.578 18.088 1.00 0.00 ? 7  MET A HA   14 
ATOM 11704 H HB2  . MET A 1 7  ? -19.833 17.994 20.271 1.00 0.00 ? 7  MET A HB2  14 
ATOM 11705 H HB3  . MET A 1 7  ? -19.538 19.733 20.273 1.00 0.00 ? 7  MET A HB3  14 
ATOM 11706 H HG2  . MET A 1 7  ? -20.889 19.854 18.126 1.00 0.00 ? 7  MET A HG2  14 
ATOM 11707 H HG3  . MET A 1 7  ? -21.340 18.171 18.404 1.00 0.00 ? 7  MET A HG3  14 
ATOM 11708 H HE1  . MET A 1 7  ? -22.339 17.236 20.124 1.00 0.00 ? 7  MET A HE1  14 
ATOM 11709 H HE2  . MET A 1 7  ? -22.039 17.956 21.712 1.00 0.00 ? 7  MET A HE2  14 
ATOM 11710 H HE3  . MET A 1 7  ? -23.671 17.924 21.050 1.00 0.00 ? 7  MET A HE3  14 
ATOM 11711 N N    . CYS A 1 8  ? -16.438 19.249 19.637 1.00 0.00 ? 8  CYS A N    14 
ATOM 11712 C CA   . CYS A 1 8  ? -15.169 18.939 20.355 1.00 0.00 ? 8  CYS A CA   14 
ATOM 11713 C C    . CYS A 1 8  ? -14.960 19.924 21.509 1.00 0.00 ? 8  CYS A C    14 
ATOM 11714 O O    . CYS A 1 8  ? -14.627 21.075 21.304 1.00 0.00 ? 8  CYS A O    14 
ATOM 11715 C CB   . CYS A 1 8  ? -14.070 19.102 19.305 1.00 0.00 ? 8  CYS A CB   14 
ATOM 11716 S SG   . CYS A 1 8  ? -12.472 18.654 20.029 1.00 0.00 ? 8  CYS A SG   14 
ATOM 11717 H H    . CYS A 1 8  ? -16.624 20.164 19.341 1.00 0.00 ? 8  CYS A H    14 
ATOM 11718 H HA   . CYS A 1 8  ? -15.181 17.925 20.722 1.00 0.00 ? 8  CYS A HA   14 
ATOM 11719 H HB2  . CYS A 1 8  ? -14.277 18.458 18.464 1.00 0.00 ? 8  CYS A HB2  14 
ATOM 11720 H HB3  . CYS A 1 8  ? -14.039 20.130 18.973 1.00 0.00 ? 8  CYS A HB3  14 
ATOM 11721 N N    . HIS A 1 9  ? -15.155 19.483 22.721 1.00 0.00 ? 9  HIS A N    14 
ATOM 11722 C CA   . HIS A 1 9  ? -14.970 20.395 23.887 1.00 0.00 ? 9  HIS A CA   14 
ATOM 11723 C C    . HIS A 1 9  ? -13.541 20.283 24.424 1.00 0.00 ? 9  HIS A C    14 
ATOM 11724 O O    . HIS A 1 9  ? -13.079 21.129 25.165 1.00 0.00 ? 9  HIS A O    14 
ATOM 11725 C CB   . HIS A 1 9  ? -15.976 19.910 24.932 1.00 0.00 ? 9  HIS A CB   14 
ATOM 11726 C CG   . HIS A 1 9  ? -17.352 19.872 24.324 1.00 0.00 ? 9  HIS A CG   14 
ATOM 11727 N ND1  . HIS A 1 9  ? -18.165 20.993 24.265 1.00 0.00 ? 9  HIS A ND1  14 
ATOM 11728 C CD2  . HIS A 1 9  ? -18.071 18.855 23.746 1.00 0.00 ? 9  HIS A CD2  14 
ATOM 11729 C CE1  . HIS A 1 9  ? -19.316 20.627 23.670 1.00 0.00 ? 9  HIS A CE1  14 
ATOM 11730 N NE2  . HIS A 1 9  ? -19.310 19.334 23.334 1.00 0.00 ? 9  HIS A NE2  14 
ATOM 11731 H H    . HIS A 1 9  ? -15.425 18.551 22.866 1.00 0.00 ? 9  HIS A H    14 
ATOM 11732 H HA   . HIS A 1 9  ? -15.190 21.413 23.607 1.00 0.00 ? 9  HIS A HA   14 
ATOM 11733 H HB2  . HIS A 1 9  ? -15.701 18.921 25.265 1.00 0.00 ? 9  HIS A HB2  14 
ATOM 11734 H HB3  . HIS A 1 9  ? -15.973 20.587 25.773 1.00 0.00 ? 9  HIS A HB3  14 
ATOM 11735 H HD1  . HIS A 1 9  ? -17.942 21.888 24.595 1.00 0.00 ? 9  HIS A HD1  14 
ATOM 11736 H HD2  . HIS A 1 9  ? -17.727 17.837 23.631 1.00 0.00 ? 9  HIS A HD2  14 
ATOM 11737 H HE1  . HIS A 1 9  ? -20.142 21.297 23.486 1.00 0.00 ? 9  HIS A HE1  14 
ATOM 11738 N N    . GLU A 1 10 ? -12.837 19.247 24.060 1.00 0.00 ? 10 GLU A N    14 
ATOM 11739 C CA   . GLU A 1 10 ? -11.438 19.084 24.552 1.00 0.00 ? 10 GLU A CA   14 
ATOM 11740 C C    . GLU A 1 10 ? -10.544 20.185 23.976 1.00 0.00 ? 10 GLU A C    14 
ATOM 11741 O O    . GLU A 1 10 ? -9.767  20.799 24.681 1.00 0.00 ? 10 GLU A O    14 
ATOM 11742 C CB   . GLU A 1 10 ? -10.996 17.712 24.045 1.00 0.00 ? 10 GLU A CB   14 
ATOM 11743 C CG   . GLU A 1 10 ? -11.428 16.635 25.042 1.00 0.00 ? 10 GLU A CG   14 
ATOM 11744 C CD   . GLU A 1 10 ? -10.814 16.932 26.411 1.00 0.00 ? 10 GLU A CD   14 
ATOM 11745 O OE1  . GLU A 1 10 ? -9.597  16.954 26.500 1.00 0.00 ? 10 GLU A OE1  14 
ATOM 11746 O OE2  . GLU A 1 10 ? -11.570 17.133 27.347 1.00 0.00 ? 10 GLU A OE2  14 
ATOM 11747 H H    . GLU A 1 10 ? -13.228 18.575 23.463 1.00 0.00 ? 10 GLU A H    14 
ATOM 11748 H HA   . GLU A 1 10 ? -11.414 19.104 25.631 1.00 0.00 ? 10 GLU A HA   14 
ATOM 11749 H HB2  . GLU A 1 10 ? -11.452 17.518 23.085 1.00 0.00 ? 10 GLU A HB2  14 
ATOM 11750 H HB3  . GLU A 1 10 ? -9.921  17.696 23.942 1.00 0.00 ? 10 GLU A HB3  14 
ATOM 11751 H HG2  . GLU A 1 10 ? -12.505 16.632 25.124 1.00 0.00 ? 10 GLU A HG2  14 
ATOM 11752 H HG3  . GLU A 1 10 ? -11.091 15.669 24.697 1.00 0.00 ? 10 GLU A HG3  14 
ATOM 11753 N N    . PHE A 1 11 ? -10.645 20.439 22.700 1.00 0.00 ? 11 PHE A N    14 
ATOM 11754 C CA   . PHE A 1 11 ? -9.799  21.499 22.083 1.00 0.00 ? 11 PHE A CA   14 
ATOM 11755 C C    . PHE A 1 11 ? -10.551 22.831 22.054 1.00 0.00 ? 11 PHE A C    14 
ATOM 11756 O O    . PHE A 1 11 ? -9.969  23.876 21.845 1.00 0.00 ? 11 PHE A O    14 
ATOM 11757 C CB   . PHE A 1 11 ? -9.533  21.016 20.659 1.00 0.00 ? 11 PHE A CB   14 
ATOM 11758 C CG   . PHE A 1 11 ? -8.521  19.894 20.680 1.00 0.00 ? 11 PHE A CG   14 
ATOM 11759 C CD1  . PHE A 1 11 ? -8.936  18.576 20.907 1.00 0.00 ? 11 PHE A CD1  14 
ATOM 11760 C CD2  . PHE A 1 11 ? -7.166  20.173 20.465 1.00 0.00 ? 11 PHE A CD2  14 
ATOM 11761 C CE1  . PHE A 1 11 ? -7.997  17.539 20.916 1.00 0.00 ? 11 PHE A CE1  14 
ATOM 11762 C CE2  . PHE A 1 11 ? -6.227  19.136 20.476 1.00 0.00 ? 11 PHE A CE2  14 
ATOM 11763 C CZ   . PHE A 1 11 ? -6.643  17.819 20.700 1.00 0.00 ? 11 PHE A CZ   14 
ATOM 11764 H H    . PHE A 1 11 ? -11.276 19.934 22.146 1.00 0.00 ? 11 PHE A H    14 
ATOM 11765 H HA   . PHE A 1 11 ? -8.868  21.600 22.618 1.00 0.00 ? 11 PHE A HA   14 
ATOM 11766 H HB2  . PHE A 1 11 ? -10.455 20.663 20.223 1.00 0.00 ? 11 PHE A HB2  14 
ATOM 11767 H HB3  . PHE A 1 11 ? -9.148  21.834 20.070 1.00 0.00 ? 11 PHE A HB3  14 
ATOM 11768 H HD1  . PHE A 1 11 ? -9.980  18.359 21.075 1.00 0.00 ? 11 PHE A HD1  14 
ATOM 11769 H HD2  . PHE A 1 11 ? -6.845  21.189 20.292 1.00 0.00 ? 11 PHE A HD2  14 
ATOM 11770 H HE1  . PHE A 1 11 ? -8.317  16.522 21.090 1.00 0.00 ? 11 PHE A HE1  14 
ATOM 11771 H HE2  . PHE A 1 11 ? -5.181  19.351 20.309 1.00 0.00 ? 11 PHE A HE2  14 
ATOM 11772 H HZ   . PHE A 1 11 ? -5.919  17.019 20.709 1.00 0.00 ? 11 PHE A HZ   14 
ATOM 11773 N N    . GLN A 1 12 ? -11.840 22.806 22.257 1.00 0.00 ? 12 GLN A N    14 
ATOM 11774 C CA   . GLN A 1 12 ? -12.617 24.077 22.234 1.00 0.00 ? 12 GLN A CA   14 
ATOM 11775 C C    . GLN A 1 12 ? -11.882 25.154 23.032 1.00 0.00 ? 12 GLN A C    14 
ATOM 11776 O O    . GLN A 1 12 ? -11.889 26.316 22.678 1.00 0.00 ? 12 GLN A O    14 
ATOM 11777 C CB   . GLN A 1 12 ? -13.956 23.745 22.891 1.00 0.00 ? 12 GLN A CB   14 
ATOM 11778 C CG   . GLN A 1 12 ? -14.830 25.000 22.915 1.00 0.00 ? 12 GLN A CG   14 
ATOM 11779 C CD   . GLN A 1 12 ? -15.826 24.906 24.073 1.00 0.00 ? 12 GLN A CD   14 
ATOM 11780 O OE1  . GLN A 1 12 ? -15.980 23.861 24.675 1.00 0.00 ? 12 GLN A OE1  14 
ATOM 11781 N NE2  . GLN A 1 12 ? -16.515 25.961 24.412 1.00 0.00 ? 12 GLN A NE2  14 
ATOM 11782 H H    . GLN A 1 12 ? -12.295 21.953 22.420 1.00 0.00 ? 12 GLN A H    14 
ATOM 11783 H HA   . GLN A 1 12 ? -12.775 24.403 21.218 1.00 0.00 ? 12 GLN A HA   14 
ATOM 11784 H HB2  . GLN A 1 12 ? -14.452 22.970 22.326 1.00 0.00 ? 12 GLN A HB2  14 
ATOM 11785 H HB3  . GLN A 1 12 ? -13.786 23.403 23.901 1.00 0.00 ? 12 GLN A HB3  14 
ATOM 11786 H HG2  . GLN A 1 12 ? -14.205 25.871 23.047 1.00 0.00 ? 12 GLN A HG2  14 
ATOM 11787 H HG3  . GLN A 1 12 ? -15.368 25.082 21.983 1.00 0.00 ? 12 GLN A HG3  14 
ATOM 11788 H HE21 . GLN A 1 12 ? -16.392 26.803 23.926 1.00 0.00 ? 12 GLN A HE21 14 
ATOM 11789 H HE22 . GLN A 1 12 ? -17.156 25.910 25.151 1.00 0.00 ? 12 GLN A HE22 14 
ATOM 11790 N N    . ALA A 1 13 ? -11.245 24.779 24.107 1.00 0.00 ? 13 ALA A N    14 
ATOM 11791 C CA   . ALA A 1 13 ? -10.508 25.785 24.924 1.00 0.00 ? 13 ALA A CA   14 
ATOM 11792 C C    . ALA A 1 13 ? -9.320  26.335 24.131 1.00 0.00 ? 13 ALA A C    14 
ATOM 11793 O O    . ALA A 1 13 ? -8.820  27.408 24.408 1.00 0.00 ? 13 ALA A O    14 
ATOM 11794 C CB   . ALA A 1 13 ? -10.025 25.019 26.156 1.00 0.00 ? 13 ALA A CB   14 
ATOM 11795 H H    . ALA A 1 13 ? -11.250 23.837 24.376 1.00 0.00 ? 13 ALA A H    14 
ATOM 11796 H HA   . ALA A 1 13 ? -11.167 26.585 25.221 1.00 0.00 ? 13 ALA A HA   14 
ATOM 11797 H HB1  . ALA A 1 13 ? -8.946  25.015 26.176 1.00 0.00 ? 13 ALA A HB1  14 
ATOM 11798 H HB2  . ALA A 1 13 ? -10.401 25.499 27.047 1.00 0.00 ? 13 ALA A HB2  14 
ATOM 11799 H HB3  . ALA A 1 13 ? -10.388 24.003 26.114 1.00 0.00 ? 13 ALA A HB3  14 
ATOM 11800 N N    . PHE A 1 14 ? -8.862  25.608 23.148 1.00 0.00 ? 14 PHE A N    14 
ATOM 11801 C CA   . PHE A 1 14 ? -7.708  26.089 22.341 1.00 0.00 ? 14 PHE A CA   14 
ATOM 11802 C C    . PHE A 1 14 ? -8.201  26.869 21.119 1.00 0.00 ? 14 PHE A C    14 
ATOM 11803 O O    . PHE A 1 14 ? -7.477  27.063 20.164 1.00 0.00 ? 14 PHE A O    14 
ATOM 11804 C CB   . PHE A 1 14 ? -6.983  24.819 21.902 1.00 0.00 ? 14 PHE A CB   14 
ATOM 11805 C CG   . PHE A 1 14 ? -6.788  23.909 23.091 1.00 0.00 ? 14 PHE A CG   14 
ATOM 11806 C CD1  . PHE A 1 14 ? -6.656  24.448 24.375 1.00 0.00 ? 14 PHE A CD1  14 
ATOM 11807 C CD2  . PHE A 1 14 ? -6.738  22.524 22.904 1.00 0.00 ? 14 PHE A CD2  14 
ATOM 11808 C CE1  . PHE A 1 14 ? -6.474  23.601 25.474 1.00 0.00 ? 14 PHE A CE1  14 
ATOM 11809 C CE2  . PHE A 1 14 ? -6.556  21.675 24.002 1.00 0.00 ? 14 PHE A CE2  14 
ATOM 11810 C CZ   . PHE A 1 14 ? -6.423  22.213 25.288 1.00 0.00 ? 14 PHE A CZ   14 
ATOM 11811 H H    . PHE A 1 14 ? -9.276  24.745 22.939 1.00 0.00 ? 14 PHE A H    14 
ATOM 11812 H HA   . PHE A 1 14 ? -7.054  26.699 22.942 1.00 0.00 ? 14 PHE A HA   14 
ATOM 11813 H HB2  . PHE A 1 14 ? -7.572  24.311 21.152 1.00 0.00 ? 14 PHE A HB2  14 
ATOM 11814 H HB3  . PHE A 1 14 ? -6.025  25.080 21.490 1.00 0.00 ? 14 PHE A HB3  14 
ATOM 11815 H HD1  . PHE A 1 14 ? -6.696  25.518 24.519 1.00 0.00 ? 14 PHE A HD1  14 
ATOM 11816 H HD2  . PHE A 1 14 ? -6.839  22.108 21.913 1.00 0.00 ? 14 PHE A HD2  14 
ATOM 11817 H HE1  . PHE A 1 14 ? -6.373  24.016 26.466 1.00 0.00 ? 14 PHE A HE1  14 
ATOM 11818 H HE2  . PHE A 1 14 ? -6.517  20.606 23.855 1.00 0.00 ? 14 PHE A HE2  14 
ATOM 11819 H HZ   . PHE A 1 14 ? -6.282  21.559 26.135 1.00 0.00 ? 14 PHE A HZ   14 
ATOM 11820 N N    . MET A 1 15 ? -9.427  27.314 21.136 1.00 0.00 ? 15 MET A N    14 
ATOM 11821 C CA   . MET A 1 15 ? -9.955  28.073 19.971 1.00 0.00 ? 15 MET A CA   14 
ATOM 11822 C C    . MET A 1 15 ? -9.847  29.582 20.224 1.00 0.00 ? 15 MET A C    14 
ATOM 11823 O O    . MET A 1 15 ? -10.453 30.117 21.131 1.00 0.00 ? 15 MET A O    14 
ATOM 11824 C CB   . MET A 1 15 ? -11.417 27.643 19.855 1.00 0.00 ? 15 MET A CB   14 
ATOM 11825 C CG   . MET A 1 15 ? -12.245 28.305 20.959 1.00 0.00 ? 15 MET A CG   14 
ATOM 11826 S SD   . MET A 1 15 ? -13.836 27.455 21.110 1.00 0.00 ? 15 MET A SD   14 
ATOM 11827 C CE   . MET A 1 15 ? -14.515 27.956 19.509 1.00 0.00 ? 15 MET A CE   14 
ATOM 11828 H H    . MET A 1 15 ? -10.003 27.145 21.908 1.00 0.00 ? 15 MET A H    14 
ATOM 11829 H HA   . MET A 1 15 ? -9.419  27.804 19.074 1.00 0.00 ? 15 MET A HA   14 
ATOM 11830 H HB2  . MET A 1 15 ? -11.799 27.939 18.894 1.00 0.00 ? 15 MET A HB2  14 
ATOM 11831 H HB3  . MET A 1 15 ? -11.483 26.570 19.951 1.00 0.00 ? 15 MET A HB3  14 
ATOM 11832 H HG2  . MET A 1 15 ? -11.713 28.243 21.895 1.00 0.00 ? 15 MET A HG2  14 
ATOM 11833 H HG3  . MET A 1 15 ? -12.413 29.342 20.709 1.00 0.00 ? 15 MET A HG3  14 
ATOM 11834 H HE1  . MET A 1 15 ? -13.765 27.814 18.742 1.00 0.00 ? 15 MET A HE1  14 
ATOM 11835 H HE2  . MET A 1 15 ? -15.385 27.357 19.285 1.00 0.00 ? 15 MET A HE2  14 
ATOM 11836 H HE3  . MET A 1 15 ? -14.796 28.996 19.545 1.00 0.00 ? 15 MET A HE3  14 
ATOM 11837 N N    . LYS A 1 16 ? -9.078  30.271 19.426 1.00 0.00 ? 16 LYS A N    14 
ATOM 11838 C CA   . LYS A 1 16 ? -8.934  31.741 19.616 1.00 0.00 ? 16 LYS A CA   14 
ATOM 11839 C C    . LYS A 1 16 ? -9.903  32.485 18.693 1.00 0.00 ? 16 LYS A C    14 
ATOM 11840 O O    . LYS A 1 16 ? -9.592  32.773 17.554 1.00 0.00 ? 16 LYS A O    14 
ATOM 11841 C CB   . LYS A 1 16 ? -7.485  32.052 19.238 1.00 0.00 ? 16 LYS A CB   14 
ATOM 11842 C CG   . LYS A 1 16 ? -7.153  33.492 19.632 1.00 0.00 ? 16 LYS A CG   14 
ATOM 11843 C CD   . LYS A 1 16 ? -6.464  34.195 18.461 1.00 0.00 ? 16 LYS A CD   14 
ATOM 11844 C CE   . LYS A 1 16 ? -6.122  35.632 18.857 1.00 0.00 ? 16 LYS A CE   14 
ATOM 11845 N NZ   . LYS A 1 16 ? -5.095  36.067 17.869 1.00 0.00 ? 16 LYS A NZ   14 
ATOM 11846 H H    . LYS A 1 16 ? -8.599  29.822 18.701 1.00 0.00 ? 16 LYS A H    14 
ATOM 11847 H HA   . LYS A 1 16 ? -9.113  32.009 20.646 1.00 0.00 ? 16 LYS A HA   14 
ATOM 11848 H HB2  . LYS A 1 16 ? -6.824  31.374 19.759 1.00 0.00 ? 16 LYS A HB2  14 
ATOM 11849 H HB3  . LYS A 1 16 ? -7.357  31.931 18.172 1.00 0.00 ? 16 LYS A HB3  14 
ATOM 11850 H HG2  . LYS A 1 16 ? -8.064  34.016 19.880 1.00 0.00 ? 16 LYS A HG2  14 
ATOM 11851 H HG3  . LYS A 1 16 ? -6.494  33.489 20.488 1.00 0.00 ? 16 LYS A HG3  14 
ATOM 11852 H HD2  . LYS A 1 16 ? -5.556  33.667 18.207 1.00 0.00 ? 16 LYS A HD2  14 
ATOM 11853 H HD3  . LYS A 1 16 ? -7.125  34.205 17.607 1.00 0.00 ? 16 LYS A HD3  14 
ATOM 11854 H HE2  . LYS A 1 16 ? -6.998  36.259 18.790 1.00 0.00 ? 16 LYS A HE2  14 
ATOM 11855 H HE3  . LYS A 1 16 ? -5.716  35.660 19.859 1.00 0.00 ? 16 LYS A HE3  14 
ATOM 11856 H HZ1  . LYS A 1 16 ? -4.507  35.253 17.598 1.00 0.00 ? 16 LYS A HZ1  14 
ATOM 11857 H HZ2  . LYS A 1 16 ? -5.567  36.451 17.025 1.00 0.00 ? 16 LYS A HZ2  14 
ATOM 11858 H HZ3  . LYS A 1 16 ? -4.492  36.800 18.294 1.00 0.00 ? 16 LYS A HZ3  14 
ATOM 11859 N N    . ASN A 1 17 ? -11.075 32.791 19.175 1.00 0.00 ? 17 ASN A N    14 
ATOM 11860 C CA   . ASN A 1 17 ? -12.067 33.510 18.327 1.00 0.00 ? 17 ASN A CA   14 
ATOM 11861 C C    . ASN A 1 17 ? -12.364 32.704 17.060 1.00 0.00 ? 17 ASN A C    14 
ATOM 11862 O O    . ASN A 1 17 ? -12.299 33.211 15.958 1.00 0.00 ? 17 ASN A O    14 
ATOM 11863 C CB   . ASN A 1 17 ? -11.403 34.841 17.977 1.00 0.00 ? 17 ASN A CB   14 
ATOM 11864 C CG   . ASN A 1 17 ? -11.046 35.588 19.264 1.00 0.00 ? 17 ASN A CG   14 
ATOM 11865 O OD1  . ASN A 1 17 ? -11.873 35.742 20.139 1.00 0.00 ? 17 ASN A OD1  14 
ATOM 11866 N ND2  . ASN A 1 17 ? -9.839  36.059 19.414 1.00 0.00 ? 17 ASN A ND2  14 
ATOM 11867 H H    . ASN A 1 17 ? -11.305 32.545 20.095 1.00 0.00 ? 17 ASN A H    14 
ATOM 11868 H HA   . ASN A 1 17 ? -12.976 33.685 18.879 1.00 0.00 ? 17 ASN A HA   14 
ATOM 11869 H HB2  . ASN A 1 17 ? -10.504 34.658 17.408 1.00 0.00 ? 17 ASN A HB2  14 
ATOM 11870 H HB3  . ASN A 1 17 ? -12.083 35.441 17.390 1.00 0.00 ? 17 ASN A HB3  14 
ATOM 11871 H HD21 . ASN A 1 17 ? -9.172  35.935 18.707 1.00 0.00 ? 17 ASN A HD21 14 
ATOM 11872 H HD22 . ASN A 1 17 ? -9.599  36.538 20.235 1.00 0.00 ? 17 ASN A HD22 14 
ATOM 11873 N N    . GLY A 1 18 ? -12.692 31.450 17.212 1.00 0.00 ? 18 GLY A N    14 
ATOM 11874 C CA   . GLY A 1 18 ? -13.000 30.609 16.020 1.00 0.00 ? 18 GLY A CA   14 
ATOM 11875 C C    . GLY A 1 18 ? -11.704 30.037 15.440 1.00 0.00 ? 18 GLY A C    14 
ATOM 11876 O O    . GLY A 1 18 ? -11.724 29.128 14.634 1.00 0.00 ? 18 GLY A O    14 
ATOM 11877 H H    . GLY A 1 18 ? -12.742 31.065 18.111 1.00 0.00 ? 18 GLY A H    14 
ATOM 11878 H HA2  . GLY A 1 18 ? -13.651 29.798 16.312 1.00 0.00 ? 18 GLY A HA2  14 
ATOM 11879 H HA3  . GLY A 1 18 ? -13.492 31.212 15.272 1.00 0.00 ? 18 GLY A HA3  14 
ATOM 11880 N N    . LYS A 1 19 ? -10.577 30.562 15.838 1.00 0.00 ? 19 LYS A N    14 
ATOM 11881 C CA   . LYS A 1 19 ? -9.284  30.045 15.300 1.00 0.00 ? 19 LYS A CA   14 
ATOM 11882 C C    . LYS A 1 19 ? -8.701  28.987 16.241 1.00 0.00 ? 19 LYS A C    14 
ATOM 11883 O O    . LYS A 1 19 ? -8.193  29.298 17.299 1.00 0.00 ? 19 LYS A O    14 
ATOM 11884 C CB   . LYS A 1 19 ? -8.364  31.263 15.235 1.00 0.00 ? 19 LYS A CB   14 
ATOM 11885 C CG   . LYS A 1 19 ? -7.138  30.930 14.382 1.00 0.00 ? 19 LYS A CG   14 
ATOM 11886 C CD   . LYS A 1 19 ? -6.129  30.144 15.223 1.00 0.00 ? 19 LYS A CD   14 
ATOM 11887 C CE   . LYS A 1 19 ? -4.823  30.936 15.321 1.00 0.00 ? 19 LYS A CE   14 
ATOM 11888 N NZ   . LYS A 1 19 ? -5.215  32.242 15.921 1.00 0.00 ? 19 LYS A NZ   14 
ATOM 11889 H H    . LYS A 1 19 ? -10.580 31.297 16.486 1.00 0.00 ? 19 LYS A H    14 
ATOM 11890 H HA   . LYS A 1 19 ? -9.423  29.635 14.313 1.00 0.00 ? 19 LYS A HA   14 
ATOM 11891 H HB2  . LYS A 1 19 ? -8.896  32.092 14.794 1.00 0.00 ? 19 LYS A HB2  14 
ATOM 11892 H HB3  . LYS A 1 19 ? -8.048  31.529 16.233 1.00 0.00 ? 19 LYS A HB3  14 
ATOM 11893 H HG2  . LYS A 1 19 ? -7.441  30.335 13.534 1.00 0.00 ? 19 LYS A HG2  14 
ATOM 11894 H HG3  . LYS A 1 19 ? -6.683  31.845 14.036 1.00 0.00 ? 19 LYS A HG3  14 
ATOM 11895 H HD2  . LYS A 1 19 ? -6.530  29.986 16.213 1.00 0.00 ? 19 LYS A HD2  14 
ATOM 11896 H HD3  . LYS A 1 19 ? -5.937  29.189 14.756 1.00 0.00 ? 19 LYS A HD3  14 
ATOM 11897 H HE2  . LYS A 1 19 ? -4.121  30.423 15.962 1.00 0.00 ? 19 LYS A HE2  14 
ATOM 11898 H HE3  . LYS A 1 19 ? -4.399  31.084 14.340 1.00 0.00 ? 19 LYS A HE3  14 
ATOM 11899 H HZ1  . LYS A 1 19 ? -6.057  32.113 16.516 1.00 0.00 ? 19 LYS A HZ1  14 
ATOM 11900 H HZ2  . LYS A 1 19 ? -4.431  32.605 16.502 1.00 0.00 ? 19 LYS A HZ2  14 
ATOM 11901 H HZ3  . LYS A 1 19 ? -5.429  32.922 15.164 1.00 0.00 ? 19 LYS A HZ3  14 
ATOM 11902 N N    . LEU A 1 20 ? -8.766  27.740 15.864 1.00 0.00 ? 20 LEU A N    14 
ATOM 11903 C CA   . LEU A 1 20 ? -8.211  26.670 16.741 1.00 0.00 ? 20 LEU A CA   14 
ATOM 11904 C C    . LEU A 1 20 ? -6.748  26.399 16.385 1.00 0.00 ? 20 LEU A C    14 
ATOM 11905 O O    . LEU A 1 20 ? -6.427  26.034 15.271 1.00 0.00 ? 20 LEU A O    14 
ATOM 11906 C CB   . LEU A 1 20 ? -9.067  25.436 16.456 1.00 0.00 ? 20 LEU A CB   14 
ATOM 11907 C CG   . LEU A 1 20 ? -8.498  24.236 17.218 1.00 0.00 ? 20 LEU A CG   14 
ATOM 11908 C CD1  . LEU A 1 20 ? -8.518  24.530 18.719 1.00 0.00 ? 20 LEU A CD1  14 
ATOM 11909 C CD2  . LEU A 1 20 ? -9.347  22.997 16.929 1.00 0.00 ? 20 LEU A CD2  14 
ATOM 11910 H H    . LEU A 1 20 ? -9.177  27.507 15.006 1.00 0.00 ? 20 LEU A H    14 
ATOM 11911 H HA   . LEU A 1 20 ? -8.298  26.947 17.778 1.00 0.00 ? 20 LEU A HA   14 
ATOM 11912 H HB2  . LEU A 1 20 ? -10.082 25.618 16.779 1.00 0.00 ? 20 LEU A HB2  14 
ATOM 11913 H HB3  . LEU A 1 20 ? -9.058  25.227 15.397 1.00 0.00 ? 20 LEU A HB3  14 
ATOM 11914 H HG   . LEU A 1 20 ? -7.481  24.058 16.900 1.00 0.00 ? 20 LEU A HG   14 
ATOM 11915 H HD11 . LEU A 1 20 ? -9.486  24.920 18.997 1.00 0.00 ? 20 LEU A HD11 14 
ATOM 11916 H HD12 . LEU A 1 20 ? -8.326  23.618 19.267 1.00 0.00 ? 20 LEU A HD12 14 
ATOM 11917 H HD13 . LEU A 1 20 ? -7.755  25.258 18.953 1.00 0.00 ? 20 LEU A HD13 14 
ATOM 11918 H HD21 . LEU A 1 20 ? -10.301 23.300 16.525 1.00 0.00 ? 20 LEU A HD21 14 
ATOM 11919 H HD22 . LEU A 1 20 ? -8.836  22.370 16.214 1.00 0.00 ? 20 LEU A HD22 14 
ATOM 11920 H HD23 . LEU A 1 20 ? -9.502  22.446 17.844 1.00 0.00 ? 20 LEU A HD23 14 
ATOM 11921 N N    . PHE A 1 21 ? -5.858  26.566 17.325 1.00 0.00 ? 21 PHE A N    14 
ATOM 11922 C CA   . PHE A 1 21 ? -4.416  26.304 17.031 1.00 0.00 ? 21 PHE A CA   14 
ATOM 11923 C C    . PHE A 1 21 ? -4.046  24.886 17.475 1.00 0.00 ? 21 PHE A C    14 
ATOM 11924 O O    . PHE A 1 21 ? -3.574  24.665 18.572 1.00 0.00 ? 21 PHE A O    14 
ATOM 11925 C CB   . PHE A 1 21 ? -3.609  27.353 17.813 1.00 0.00 ? 21 PHE A CB   14 
ATOM 11926 C CG   . PHE A 1 21 ? -4.210  27.586 19.180 1.00 0.00 ? 21 PHE A CG   14 
ATOM 11927 C CD1  . PHE A 1 21 ? -3.834  26.779 20.261 1.00 0.00 ? 21 PHE A CD1  14 
ATOM 11928 C CD2  . PHE A 1 21 ? -5.139  28.616 19.367 1.00 0.00 ? 21 PHE A CD2  14 
ATOM 11929 C CE1  . PHE A 1 21 ? -4.389  27.002 21.527 1.00 0.00 ? 21 PHE A CE1  14 
ATOM 11930 C CE2  . PHE A 1 21 ? -5.692  28.841 20.633 1.00 0.00 ? 21 PHE A CE2  14 
ATOM 11931 C CZ   . PHE A 1 21 ? -5.317  28.032 21.713 1.00 0.00 ? 21 PHE A CZ   14 
ATOM 11932 H H    . PHE A 1 21 ? -6.140  26.849 18.218 1.00 0.00 ? 21 PHE A H    14 
ATOM 11933 H HA   . PHE A 1 21 ? -4.232  26.416 15.974 1.00 0.00 ? 21 PHE A HA   14 
ATOM 11934 H HB2  . PHE A 1 21 ? -2.592  27.009 17.925 1.00 0.00 ? 21 PHE A HB2  14 
ATOM 11935 H HB3  . PHE A 1 21 ? -3.610  28.282 17.262 1.00 0.00 ? 21 PHE A HB3  14 
ATOM 11936 H HD1  . PHE A 1 21 ? -3.116  25.985 20.119 1.00 0.00 ? 21 PHE A HD1  14 
ATOM 11937 H HD2  . PHE A 1 21 ? -5.430  29.239 18.533 1.00 0.00 ? 21 PHE A HD2  14 
ATOM 11938 H HE1  . PHE A 1 21 ? -4.100  26.379 22.360 1.00 0.00 ? 21 PHE A HE1  14 
ATOM 11939 H HE2  . PHE A 1 21 ? -6.410  29.635 20.776 1.00 0.00 ? 21 PHE A HE2  14 
ATOM 11940 H HZ   . PHE A 1 21 ? -5.745  28.205 22.690 1.00 0.00 ? 21 PHE A HZ   14 
ATOM 11941 N N    . CYS A 1 22 ? -4.266  23.923 16.622 1.00 0.00 ? 22 CYS A N    14 
ATOM 11942 C CA   . CYS A 1 22 ? -3.939  22.511 16.978 1.00 0.00 ? 22 CYS A CA   14 
ATOM 11943 C C    . CYS A 1 22 ? -2.454  22.339 17.356 1.00 0.00 ? 22 CYS A C    14 
ATOM 11944 O O    . CYS A 1 22 ? -2.157  21.634 18.300 1.00 0.00 ? 22 CYS A O    14 
ATOM 11945 C CB   . CYS A 1 22 ? -4.285  21.690 15.733 1.00 0.00 ? 22 CYS A CB   14 
ATOM 11946 S SG   . CYS A 1 22 ? -4.020  19.932 16.078 1.00 0.00 ? 22 CYS A SG   14 
ATOM 11947 H H    . CYS A 1 22 ? -4.654  24.129 15.746 1.00 0.00 ? 22 CYS A H    14 
ATOM 11948 H HA   . CYS A 1 22 ? -4.562  22.191 17.798 1.00 0.00 ? 22 CYS A HA   14 
ATOM 11949 H HB2  . CYS A 1 22 ? -5.320  21.851 15.471 1.00 0.00 ? 22 CYS A HB2  14 
ATOM 11950 H HB3  . CYS A 1 22 ? -3.657  21.989 14.911 1.00 0.00 ? 22 CYS A HB3  14 
ATOM 11951 N N    . PRO A 1 23 ? -1.555  22.967 16.625 1.00 0.00 ? 23 PRO A N    14 
ATOM 11952 C CA   . PRO A 1 23 ? -0.112  22.826 16.940 1.00 0.00 ? 23 PRO A CA   14 
ATOM 11953 C C    . PRO A 1 23 ? 0.199   23.394 18.329 1.00 0.00 ? 23 PRO A C    14 
ATOM 11954 O O    . PRO A 1 23 ? 0.805   24.439 18.462 1.00 0.00 ? 23 PRO A O    14 
ATOM 11955 C CB   . PRO A 1 23 ? 0.561   23.653 15.841 1.00 0.00 ? 23 PRO A CB   14 
ATOM 11956 C CG   . PRO A 1 23 ? -0.530  24.240 14.927 1.00 0.00 ? 23 PRO A CG   14 
ATOM 11957 C CD   . PRO A 1 23 ? -1.906  23.834 15.469 1.00 0.00 ? 23 PRO A CD   14 
ATOM 11958 H HA   . PRO A 1 23 ? 0.198   21.796 16.869 1.00 0.00 ? 23 PRO A HA   14 
ATOM 11959 H HB2  . PRO A 1 23 ? 1.131   24.454 16.288 1.00 0.00 ? 23 PRO A HB2  14 
ATOM 11960 H HB3  . PRO A 1 23 ? 1.218   23.021 15.263 1.00 0.00 ? 23 PRO A HB3  14 
ATOM 11961 H HG2  . PRO A 1 23 ? -0.450  25.318 14.914 1.00 0.00 ? 23 PRO A HG2  14 
ATOM 11962 H HG3  . PRO A 1 23 ? -0.406  23.857 13.924 1.00 0.00 ? 23 PRO A HG3  14 
ATOM 11963 H HD2  . PRO A 1 23 ? -2.452  24.705 15.791 1.00 0.00 ? 23 PRO A HD2  14 
ATOM 11964 H HD3  . PRO A 1 23 ? -2.458  23.285 14.726 1.00 0.00 ? 23 PRO A HD3  14 
ATOM 11965 N N    . GLN A 1 24 ? -0.206  22.708 19.362 1.00 0.00 ? 24 GLN A N    14 
ATOM 11966 C CA   . GLN A 1 24 ? 0.070   23.200 20.742 1.00 0.00 ? 24 GLN A CA   14 
ATOM 11967 C C    . GLN A 1 24 ? 1.190   22.368 21.375 1.00 0.00 ? 24 GLN A C    14 
ATOM 11968 O O    . GLN A 1 24 ? 2.358   22.674 21.235 1.00 0.00 ? 24 GLN A O    14 
ATOM 11969 C CB   . GLN A 1 24 ? -1.243  23.007 21.501 1.00 0.00 ? 24 GLN A CB   14 
ATOM 11970 C CG   . GLN A 1 24 ? -1.020  23.281 22.991 1.00 0.00 ? 24 GLN A CG   14 
ATOM 11971 C CD   . GLN A 1 24 ? -2.371  23.341 23.707 1.00 0.00 ? 24 GLN A CD   14 
ATOM 11972 O OE1  . GLN A 1 24 ? -2.784  24.388 24.163 1.00 0.00 ? 24 GLN A OE1  14 
ATOM 11973 N NE2  . GLN A 1 24 ? -3.081  22.252 23.825 1.00 0.00 ? 24 GLN A NE2  14 
ATOM 11974 H H    . GLN A 1 24 ? -0.690  21.865 19.231 1.00 0.00 ? 24 GLN A H    14 
ATOM 11975 H HA   . GLN A 1 24 ? 0.338   24.245 20.725 1.00 0.00 ? 24 GLN A HA   14 
ATOM 11976 H HB2  . GLN A 1 24 ? -1.985  23.692 21.117 1.00 0.00 ? 24 GLN A HB2  14 
ATOM 11977 H HB3  . GLN A 1 24 ? -1.590  21.993 21.370 1.00 0.00 ? 24 GLN A HB3  14 
ATOM 11978 H HG2  . GLN A 1 24 ? -0.423  22.489 23.417 1.00 0.00 ? 24 GLN A HG2  14 
ATOM 11979 H HG3  . GLN A 1 24 ? -0.507  24.223 23.111 1.00 0.00 ? 24 GLN A HG3  14 
ATOM 11980 H HE21 . GLN A 1 24 ? -2.748  21.408 23.457 1.00 0.00 ? 24 GLN A HE21 14 
ATOM 11981 H HE22 . GLN A 1 24 ? -3.947  22.280 24.283 1.00 0.00 ? 24 GLN A HE22 14 
ATOM 11982 N N    . ASP A 1 25 ? 0.844   21.316 22.064 1.00 0.00 ? 25 ASP A N    14 
ATOM 11983 C CA   . ASP A 1 25 ? 1.887   20.461 22.697 1.00 0.00 ? 25 ASP A CA   14 
ATOM 11984 C C    . ASP A 1 25 ? 1.520   18.985 22.530 1.00 0.00 ? 25 ASP A C    14 
ATOM 11985 O O    . ASP A 1 25 ? 1.084   18.337 23.456 1.00 0.00 ? 25 ASP A O    14 
ATOM 11986 C CB   . ASP A 1 25 ? 1.879   20.853 24.175 1.00 0.00 ? 25 ASP A CB   14 
ATOM 11987 C CG   . ASP A 1 25 ? 3.013   20.126 24.902 1.00 0.00 ? 25 ASP A CG   14 
ATOM 11988 O OD1  . ASP A 1 25 ? 3.794   19.469 24.233 1.00 0.00 ? 25 ASP A OD1  14 
ATOM 11989 O OD2  . ASP A 1 25 ? 3.082   20.241 26.115 1.00 0.00 ? 25 ASP A OD2  14 
ATOM 11990 H H    . ASP A 1 25 ? -0.103  21.082 22.162 1.00 0.00 ? 25 ASP A H    14 
ATOM 11991 H HA   . ASP A 1 25 ? 2.855   20.663 22.266 1.00 0.00 ? 25 ASP A HA   14 
ATOM 11992 H HB2  . ASP A 1 25 ? 2.018   21.919 24.266 1.00 0.00 ? 25 ASP A HB2  14 
ATOM 11993 H HB3  . ASP A 1 25 ? 0.933   20.573 24.616 1.00 0.00 ? 25 ASP A HB3  14 
ATOM 11994 N N    . LYS A 1 26 ? 1.686   18.451 21.351 1.00 0.00 ? 26 LYS A N    14 
ATOM 11995 C CA   . LYS A 1 26 ? 1.336   17.017 21.123 1.00 0.00 ? 26 LYS A CA   14 
ATOM 11996 C C    . LYS A 1 26 ? 2.165   16.096 22.027 1.00 0.00 ? 26 LYS A C    14 
ATOM 11997 O O    . LYS A 1 26 ? 1.916   14.909 22.102 1.00 0.00 ? 26 LYS A O    14 
ATOM 11998 C CB   . LYS A 1 26 ? 1.661   16.762 19.651 1.00 0.00 ? 26 LYS A CB   14 
ATOM 11999 C CG   . LYS A 1 26 ? 0.575   17.391 18.776 1.00 0.00 ? 26 LYS A CG   14 
ATOM 12000 C CD   . LYS A 1 26 ? 0.987   17.298 17.305 1.00 0.00 ? 26 LYS A CD   14 
ATOM 12001 C CE   . LYS A 1 26 ? 0.137   18.263 16.476 1.00 0.00 ? 26 LYS A CE   14 
ATOM 12002 N NZ   . LYS A 1 26 ? 0.486   17.959 15.060 1.00 0.00 ? 26 LYS A NZ   14 
ATOM 12003 H H    . LYS A 1 26 ? 2.035   18.994 20.611 1.00 0.00 ? 26 LYS A H    14 
ATOM 12004 H HA   . LYS A 1 26 ? 0.284   16.860 21.294 1.00 0.00 ? 26 LYS A HA   14 
ATOM 12005 H HB2  . LYS A 1 26 ? 2.617   17.202 19.411 1.00 0.00 ? 26 LYS A HB2  14 
ATOM 12006 H HB3  . LYS A 1 26 ? 1.699   15.698 19.471 1.00 0.00 ? 26 LYS A HB3  14 
ATOM 12007 H HG2  . LYS A 1 26 ? -0.356  16.864 18.922 1.00 0.00 ? 26 LYS A HG2  14 
ATOM 12008 H HG3  . LYS A 1 26 ? 0.448   18.428 19.049 1.00 0.00 ? 26 LYS A HG3  14 
ATOM 12009 H HD2  . LYS A 1 26 ? 2.030   17.561 17.206 1.00 0.00 ? 26 LYS A HD2  14 
ATOM 12010 H HD3  . LYS A 1 26 ? 0.835   16.289 16.952 1.00 0.00 ? 26 LYS A HD3  14 
ATOM 12011 H HE2  . LYS A 1 26 ? -0.913  18.084 16.651 1.00 0.00 ? 26 LYS A HE2  14 
ATOM 12012 H HE3  . LYS A 1 26 ? 0.389   19.286 16.715 1.00 0.00 ? 26 LYS A HE3  14 
ATOM 12013 H HZ1  . LYS A 1 26 ? 0.402   16.936 14.893 1.00 0.00 ? 26 LYS A HZ1  14 
ATOM 12014 H HZ2  . LYS A 1 26 ? -0.163  18.469 14.427 1.00 0.00 ? 26 LYS A HZ2  14 
ATOM 12015 H HZ3  . LYS A 1 26 ? 1.463   18.259 14.871 1.00 0.00 ? 26 LYS A HZ3  14 
ATOM 12016 N N    . LYS A 1 27 ? 3.146   16.623 22.712 1.00 0.00 ? 27 LYS A N    14 
ATOM 12017 C CA   . LYS A 1 27 ? 3.980   15.769 23.607 1.00 0.00 ? 27 LYS A CA   14 
ATOM 12018 C C    . LYS A 1 27 ? 3.104   14.767 24.366 1.00 0.00 ? 27 LYS A C    14 
ATOM 12019 O O    . LYS A 1 27 ? 3.549   13.701 24.740 1.00 0.00 ? 27 LYS A O    14 
ATOM 12020 C CB   . LYS A 1 27 ? 4.639   16.748 24.578 1.00 0.00 ? 27 LYS A CB   14 
ATOM 12021 C CG   . LYS A 1 27 ? 5.707   17.559 23.841 1.00 0.00 ? 27 LYS A CG   14 
ATOM 12022 C CD   . LYS A 1 27 ? 6.890   16.651 23.492 1.00 0.00 ? 27 LYS A CD   14 
ATOM 12023 C CE   . LYS A 1 27 ? 7.884   17.421 22.622 1.00 0.00 ? 27 LYS A CE   14 
ATOM 12024 N NZ   . LYS A 1 27 ? 8.765   16.375 22.030 1.00 0.00 ? 27 LYS A NZ   14 
ATOM 12025 H H    . LYS A 1 27 ? 3.337   17.580 22.640 1.00 0.00 ? 27 LYS A H    14 
ATOM 12026 H HA   . LYS A 1 27 ? 4.736   15.252 23.037 1.00 0.00 ? 27 LYS A HA   14 
ATOM 12027 H HB2  . LYS A 1 27 ? 3.892   17.417 24.976 1.00 0.00 ? 27 LYS A HB2  14 
ATOM 12028 H HB3  . LYS A 1 27 ? 5.098   16.199 25.384 1.00 0.00 ? 27 LYS A HB3  14 
ATOM 12029 H HG2  . LYS A 1 27 ? 5.287   17.967 22.934 1.00 0.00 ? 27 LYS A HG2  14 
ATOM 12030 H HG3  . LYS A 1 27 ? 6.048   18.364 24.475 1.00 0.00 ? 27 LYS A HG3  14 
ATOM 12031 H HD2  . LYS A 1 27 ? 7.377   16.330 24.401 1.00 0.00 ? 27 LYS A HD2  14 
ATOM 12032 H HD3  . LYS A 1 27 ? 6.532   15.787 22.952 1.00 0.00 ? 27 LYS A HD3  14 
ATOM 12033 H HE2  . LYS A 1 27 ? 7.365   17.960 21.844 1.00 0.00 ? 27 LYS A HE2  14 
ATOM 12034 H HE3  . LYS A 1 27 ? 8.465   18.102 23.229 1.00 0.00 ? 27 LYS A HE3  14 
ATOM 12035 H HZ1  . LYS A 1 27 ? 8.223   15.498 21.904 1.00 0.00 ? 27 LYS A HZ1  14 
ATOM 12036 H HZ2  . LYS A 1 27 ? 9.119   16.702 21.107 1.00 0.00 ? 27 LYS A HZ2  14 
ATOM 12037 H HZ3  . LYS A 1 27 ? 9.568   16.196 22.666 1.00 0.00 ? 27 LYS A HZ3  14 
ATOM 12038 N N    . PHE A 1 28 ? 1.861   15.099 24.594 1.00 0.00 ? 28 PHE A N    14 
ATOM 12039 C CA   . PHE A 1 28 ? 0.960   14.160 25.326 1.00 0.00 ? 28 PHE A CA   14 
ATOM 12040 C C    . PHE A 1 28 ? 0.864   12.829 24.573 1.00 0.00 ? 28 PHE A C    14 
ATOM 12041 O O    . PHE A 1 28 ? 0.406   11.836 25.103 1.00 0.00 ? 28 PHE A O    14 
ATOM 12042 C CB   . PHE A 1 28 ? -0.396  14.863 25.363 1.00 0.00 ? 28 PHE A CB   14 
ATOM 12043 C CG   . PHE A 1 28 ? -0.214  16.287 25.838 1.00 0.00 ? 28 PHE A CG   14 
ATOM 12044 C CD1  . PHE A 1 28 ? 0.387   16.542 27.077 1.00 0.00 ? 28 PHE A CD1  14 
ATOM 12045 C CD2  . PHE A 1 28 ? -0.647  17.351 25.040 1.00 0.00 ? 28 PHE A CD2  14 
ATOM 12046 C CE1  . PHE A 1 28 ? 0.557   17.862 27.514 1.00 0.00 ? 28 PHE A CE1  14 
ATOM 12047 C CE2  . PHE A 1 28 ? -0.478  18.670 25.475 1.00 0.00 ? 28 PHE A CE2  14 
ATOM 12048 C CZ   . PHE A 1 28 ? 0.123   18.926 26.712 1.00 0.00 ? 28 PHE A CZ   14 
ATOM 12049 H H    . PHE A 1 28 ? 1.520   15.962 24.283 1.00 0.00 ? 28 PHE A H    14 
ATOM 12050 H HA   . PHE A 1 28 ? 1.319   13.997 26.331 1.00 0.00 ? 28 PHE A HA   14 
ATOM 12051 H HB2  . PHE A 1 28 ? -0.827  14.867 24.372 1.00 0.00 ? 28 PHE A HB2  14 
ATOM 12052 H HB3  . PHE A 1 28 ? -1.055  14.340 26.040 1.00 0.00 ? 28 PHE A HB3  14 
ATOM 12053 H HD1  . PHE A 1 28 ? 0.722   15.722 27.693 1.00 0.00 ? 28 PHE A HD1  14 
ATOM 12054 H HD2  . PHE A 1 28 ? -1.109  17.155 24.086 1.00 0.00 ? 28 PHE A HD2  14 
ATOM 12055 H HE1  . PHE A 1 28 ? 1.021   18.059 28.468 1.00 0.00 ? 28 PHE A HE1  14 
ATOM 12056 H HE2  . PHE A 1 28 ? -0.812  19.491 24.858 1.00 0.00 ? 28 PHE A HE2  14 
ATOM 12057 H HZ   . PHE A 1 28 ? 0.253   19.944 27.048 1.00 0.00 ? 28 PHE A HZ   14 
ATOM 12058 N N    . PHE A 1 29 ? 1.296   12.802 23.341 1.00 0.00 ? 29 PHE A N    14 
ATOM 12059 C CA   . PHE A 1 29 ? 1.238   11.537 22.552 1.00 0.00 ? 29 PHE A CA   14 
ATOM 12060 C C    . PHE A 1 29 ? 1.889   10.394 23.334 1.00 0.00 ? 29 PHE A C    14 
ATOM 12061 O O    . PHE A 1 29 ? 1.657   9.232  23.065 1.00 0.00 ? 29 PHE A O    14 
ATOM 12062 C CB   . PHE A 1 29 ? 2.032   11.836 21.279 1.00 0.00 ? 29 PHE A CB   14 
ATOM 12063 C CG   . PHE A 1 29 ? 1.978   10.642 20.355 1.00 0.00 ? 29 PHE A CG   14 
ATOM 12064 C CD1  . PHE A 1 29 ? 2.701   9.483  20.664 1.00 0.00 ? 29 PHE A CD1  14 
ATOM 12065 C CD2  . PHE A 1 29 ? 1.203   10.693 19.189 1.00 0.00 ? 29 PHE A CD2  14 
ATOM 12066 C CE1  . PHE A 1 29 ? 2.652   8.378  19.807 1.00 0.00 ? 29 PHE A CE1  14 
ATOM 12067 C CE2  . PHE A 1 29 ? 1.154   9.587  18.332 1.00 0.00 ? 29 PHE A CE2  14 
ATOM 12068 C CZ   . PHE A 1 29 ? 1.878   8.429  18.641 1.00 0.00 ? 29 PHE A CZ   14 
ATOM 12069 H H    . PHE A 1 29 ? 1.665   13.613 22.936 1.00 0.00 ? 29 PHE A H    14 
ATOM 12070 H HA   . PHE A 1 29 ? 0.217   11.294 22.302 1.00 0.00 ? 29 PHE A HA   14 
ATOM 12071 H HB2  . PHE A 1 29 ? 1.607   12.694 20.781 1.00 0.00 ? 29 PHE A HB2  14 
ATOM 12072 H HB3  . PHE A 1 29 ? 3.059   12.043 21.536 1.00 0.00 ? 29 PHE A HB3  14 
ATOM 12073 H HD1  . PHE A 1 29 ? 3.297   9.444  21.563 1.00 0.00 ? 29 PHE A HD1  14 
ATOM 12074 H HD2  . PHE A 1 29 ? 0.645   11.587 18.951 1.00 0.00 ? 29 PHE A HD2  14 
ATOM 12075 H HE1  . PHE A 1 29 ? 3.210   7.485  20.045 1.00 0.00 ? 29 PHE A HE1  14 
ATOM 12076 H HE2  . PHE A 1 29 ? 0.558   9.627  17.434 1.00 0.00 ? 29 PHE A HE2  14 
ATOM 12077 H HZ   . PHE A 1 29 ? 1.840   7.576  17.981 1.00 0.00 ? 29 PHE A HZ   14 
ATOM 12078 N N    . GLN A 1 30 ? 2.709   10.717 24.297 1.00 0.00 ? 30 GLN A N    14 
ATOM 12079 C CA   . GLN A 1 30 ? 3.383   9.653  25.095 1.00 0.00 ? 30 GLN A CA   14 
ATOM 12080 C C    . GLN A 1 30 ? 2.385   8.971  26.036 1.00 0.00 ? 30 GLN A C    14 
ATOM 12081 O O    . GLN A 1 30 ? 2.728   8.061  26.764 1.00 0.00 ? 30 GLN A O    14 
ATOM 12082 C CB   . GLN A 1 30 ? 4.456   10.390 25.896 1.00 0.00 ? 30 GLN A CB   14 
ATOM 12083 C CG   . GLN A 1 30 ? 5.617   10.760 24.971 1.00 0.00 ? 30 GLN A CG   14 
ATOM 12084 C CD   . GLN A 1 30 ? 6.889   10.950 25.797 1.00 0.00 ? 30 GLN A CD   14 
ATOM 12085 O OE1  . GLN A 1 30 ? 7.290   10.066 26.529 1.00 0.00 ? 30 GLN A OE1  14 
ATOM 12086 N NE2  . GLN A 1 30 ? 7.545   12.074 25.712 1.00 0.00 ? 30 GLN A NE2  14 
ATOM 12087 H H    . GLN A 1 30 ? 2.885   11.660 24.493 1.00 0.00 ? 30 GLN A H    14 
ATOM 12088 H HA   . GLN A 1 30 ? 3.845   8.928  24.444 1.00 0.00 ? 30 GLN A HA   14 
ATOM 12089 H HB2  . GLN A 1 30 ? 4.035   11.289 26.321 1.00 0.00 ? 30 GLN A HB2  14 
ATOM 12090 H HB3  . GLN A 1 30 ? 4.818   9.751  26.688 1.00 0.00 ? 30 GLN A HB3  14 
ATOM 12091 H HG2  . GLN A 1 30 ? 5.768   9.969  24.251 1.00 0.00 ? 30 GLN A HG2  14 
ATOM 12092 H HG3  . GLN A 1 30 ? 5.384   11.679 24.453 1.00 0.00 ? 30 GLN A HG3  14 
ATOM 12093 H HE21 . GLN A 1 30 ? 7.222   12.787 25.122 1.00 0.00 ? 30 GLN A HE21 14 
ATOM 12094 H HE22 . GLN A 1 30 ? 8.361   12.206 26.237 1.00 0.00 ? 30 GLN A HE22 14 
ATOM 12095 N N    . SER A 1 31 ? 1.153   9.402  26.028 1.00 0.00 ? 31 SER A N    14 
ATOM 12096 C CA   . SER A 1 31 ? 0.140   8.774  26.925 1.00 0.00 ? 31 SER A CA   14 
ATOM 12097 C C    . SER A 1 31 ? -1.151  8.490  26.152 1.00 0.00 ? 31 SER A C    14 
ATOM 12098 O O    . SER A 1 31 ? -1.496  9.191  25.221 1.00 0.00 ? 31 SER A O    14 
ATOM 12099 C CB   . SER A 1 31 ? -0.109  9.805  28.025 1.00 0.00 ? 31 SER A CB   14 
ATOM 12100 O OG   . SER A 1 31 ? 1.037   9.896  28.858 1.00 0.00 ? 31 SER A OG   14