data_1HOV
# 
_entry.id   1HOV 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1HOV         
RCSB  RCSB012486   
WWPDB D_1000012486 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1HOV 
_pdbx_database_status.recvd_initial_deposition_date   2000-12-11 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Feng, Y.'           1  
'Likos, J.J.'        2  
'Zhu, L.'            3  
'Woodward, H.'       4  
'Munie, G.'          5  
'McDonald, J.J.'     6  
'Stevens, A.M.'      7  
'Howard, C.P.'       8  
'De Crescenzo, G.A.' 9  
'Welsch, D.'         10 
'Shieh, H.-S.'       11 
'Stallings, W.C.'    12 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;Solution structure and backbone dynamics of the catalytic domain of matrix metalloproteinase-2 complexed with a hydroxamic acid inhibitor
;
Biochim.Biophys.Acta 1598 10 23 2002 BBACAQ NE 0006-3002 0113 ? 12147339 '10.1016/S0167-4838(02)00307-2' 
1       '1H, 13C and 15N resonance assignments for a truncated and inhibited catalytic domain of matrix metalloproteinase-2' 
J.Biomol.NMR         17   85 86 2000 JBNME9 NE 0925-2738 0800 ? ?        ?                               
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Feng, Y.'           1  
primary 'Likos, J.J.'        2  
primary 'Zhu, L.'            3  
primary 'Woodward, H.'       4  
primary 'Munie, G.'          5  
primary 'McDonald, J.J.'     6  
primary 'Stevens, A.M.'      7  
primary 'Howard, C.P.'       8  
primary 'De Crescenzo, G.A.' 9  
primary 'Welsch, D.'         10 
primary 'Shieh, H.-S.'       11 
primary 'Stallings, W.C.'    12 
# 
_cell.entry_id           1HOV 
_cell.length_a           1 
_cell.length_b           1 
_cell.length_c           1 
_cell.angle_alpha        90 
_cell.angle_beta         90 
_cell.angle_gamma        90 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1HOV 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'MATRIX METALLOPROTEINASE-2'                                                                        18491.391 1 
3.4.24.24 ? 'CATALYTIC DOMAIN' ? 
2 non-polymer syn 'ZINC ION'                                                                                          65.409    2 
?         ? ?                  ? 
3 non-polymer syn 'CALCIUM ION'                                                                                       40.078    2 
?         ? ?                  ? 
4 non-polymer syn 'N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE' 574.732   1 
?         ? ?                  ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKD
GLLAHAFAPGTGVGGDSHFDDDELWTNTSANYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQE
LYG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKD
GLLAHAFAPGTGVGGDSHFDDDELWTNTSANYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQE
LYG
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   TYR n 
1 3   ASN n 
1 4   PHE n 
1 5   PHE n 
1 6   PRO n 
1 7   ARG n 
1 8   LYS n 
1 9   PRO n 
1 10  LYS n 
1 11  TRP n 
1 12  ASP n 
1 13  LYS n 
1 14  ASN n 
1 15  GLN n 
1 16  ILE n 
1 17  THR n 
1 18  TYR n 
1 19  ARG n 
1 20  ILE n 
1 21  ILE n 
1 22  GLY n 
1 23  TYR n 
1 24  THR n 
1 25  PRO n 
1 26  ASP n 
1 27  LEU n 
1 28  ASP n 
1 29  PRO n 
1 30  GLU n 
1 31  THR n 
1 32  VAL n 
1 33  ASP n 
1 34  ASP n 
1 35  ALA n 
1 36  PHE n 
1 37  ALA n 
1 38  ARG n 
1 39  ALA n 
1 40  PHE n 
1 41  GLN n 
1 42  VAL n 
1 43  TRP n 
1 44  SER n 
1 45  ASP n 
1 46  VAL n 
1 47  THR n 
1 48  PRO n 
1 49  LEU n 
1 50  ARG n 
1 51  PHE n 
1 52  SER n 
1 53  ARG n 
1 54  ILE n 
1 55  HIS n 
1 56  ASP n 
1 57  GLY n 
1 58  GLU n 
1 59  ALA n 
1 60  ASP n 
1 61  ILE n 
1 62  MET n 
1 63  ILE n 
1 64  ASN n 
1 65  PHE n 
1 66  GLY n 
1 67  ARG n 
1 68  TRP n 
1 69  GLU n 
1 70  HIS n 
1 71  GLY n 
1 72  ASP n 
1 73  GLY n 
1 74  TYR n 
1 75  PRO n 
1 76  PHE n 
1 77  ASP n 
1 78  GLY n 
1 79  LYS n 
1 80  ASP n 
1 81  GLY n 
1 82  LEU n 
1 83  LEU n 
1 84  ALA n 
1 85  HIS n 
1 86  ALA n 
1 87  PHE n 
1 88  ALA n 
1 89  PRO n 
1 90  GLY n 
1 91  THR n 
1 92  GLY n 
1 93  VAL n 
1 94  GLY n 
1 95  GLY n 
1 96  ASP n 
1 97  SER n 
1 98  HIS n 
1 99  PHE n 
1 100 ASP n 
1 101 ASP n 
1 102 ASP n 
1 103 GLU n 
1 104 LEU n 
1 105 TRP n 
1 106 THR n 
1 107 ASN n 
1 108 THR n 
1 109 SER n 
1 110 ALA n 
1 111 ASN n 
1 112 TYR n 
1 113 SER n 
1 114 LEU n 
1 115 PHE n 
1 116 LEU n 
1 117 VAL n 
1 118 ALA n 
1 119 ALA n 
1 120 HIS n 
1 121 GLU n 
1 122 PHE n 
1 123 GLY n 
1 124 HIS n 
1 125 ALA n 
1 126 MET n 
1 127 GLY n 
1 128 LEU n 
1 129 GLU n 
1 130 HIS n 
1 131 SER n 
1 132 GLN n 
1 133 ASP n 
1 134 PRO n 
1 135 GLY n 
1 136 ALA n 
1 137 LEU n 
1 138 MET n 
1 139 ALA n 
1 140 PRO n 
1 141 ILE n 
1 142 TYR n 
1 143 THR n 
1 144 TYR n 
1 145 THR n 
1 146 LYS n 
1 147 ASN n 
1 148 PHE n 
1 149 ARG n 
1 150 LEU n 
1 151 SER n 
1 152 GLN n 
1 153 ASP n 
1 154 ASP n 
1 155 ILE n 
1 156 LYS n 
1 157 GLY n 
1 158 ILE n 
1 159 GLN n 
1 160 GLU n 
1 161 LEU n 
1 162 TYR n 
1 163 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               W3110-II5 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          RECA 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    MMP2_HUMAN 
_struct_ref.pdbx_db_accession          P08253 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_align_begin           110 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1HOV 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 2 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 148 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P08253 
_struct_ref_seq.db_align_beg                  110 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  256 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       2 
_struct_ref_seq.pdbx_auth_seq_align_end       148 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                                                             ? 
'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                                                                                            ? 
'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                                          ? 
'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                                     ? 
'C4 H7 N O4'      133.103 
CA  non-polymer         . 'CALCIUM ION'                                                                                       ? 
'Ca 2'            40.078  
GLN 'L-peptide linking' y GLUTAMINE                                                                                           ? 
'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                                     ? 
'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                                                                             ? 
'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                                           ? 
'C6 H10 N3 O2 1'  156.162 
I52 non-polymer         . 'N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE' 
SC-74020 'C29 H42 N4 O6 S' 574.732 
ILE 'L-peptide linking' y ISOLEUCINE                                                                                          ? 
'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                                                                                             ? 
'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                                                                              ? 
'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                                                                                          ? 
'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                                                       ? 
'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                                                                                             ? 
'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                                                                                              ? 
'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                                                                                           ? 
'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                                          ? 
'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                                                                                            ? 
'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                                                                                              ? 
'C5 H11 N O2'     117.146 
ZN  non-polymer         . 'ZINC ION'                                                                                          ? 
'Zn 2'            65.409  
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         303 
_pdbx_nmr_exptl_sample_conditions.pressure            1 
_pdbx_nmr_exptl_sample_conditions.pH                  7.4 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      50 
_pdbx_nmr_exptl_sample_conditions.pressure_units      atm 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         
'0.3-0.4mM U-15N, 13C MMP-2C: unlabeled SC-74020 in 20mM TRIS-d11-HCl, 5mM CaCl2, 10uM ZnCl2, 20uM unlabeled SC-74020' 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.field_strength 
1 ? Varian INOVA 600 
2 ? Varian UNITY 500 
# 
_pdbx_nmr_refine.entry_id           1HOV 
_pdbx_nmr_refine.method             
;distance geometry, 
simulated annealing, 
molecular dynamics, 
torsion angle dynamics
;
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      1HOV 
_pdbx_nmr_ensemble.conformers_calculated_total_number            14 
_pdbx_nmr_ensemble.conformers_submitted_total_number             11 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the least restraint violations' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             1HOV 
_pdbx_nmr_representative.conformer_id         3 
_pdbx_nmr_representative.selection_criteria   'reasonable inhibitor conformation' 
# 
loop_
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
X-PLOR 98.1 refinement      MSI    1 
VNMR   6.1b collection      Varian 2 
FELIX  97   'data analysis' MSI    3 
# 
_exptl.entry_id          1HOV 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_struct.entry_id                  1HOV 
_struct.title                     'SOLUTION STRUCTURE OF A CATALYTIC DOMAIN OF MMP-2 COMPLEXED WITH SC-74020' 
_struct.pdbx_descriptor           'MATRIX METALLOPROTEINASE-2' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1HOV 
_struct_keywords.pdbx_keywords   'HYDROLASE/HYDROLASE INHIBITOR' 
_struct_keywords.text            'enzyme-inhibitor complex, HYDROLASE-HYDROLASE INHIBITOR COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 3 ? 
E N N 3 ? 
F N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASP A 28  ? ASP A 45  ? ASP A 28  ASP A 45  1 ? 18 
HELX_P HELX_P2 2 SER A 113 ? ALA A 125 ? SER A 113 ALA A 125 1 ? 13 
HELX_P HELX_P3 3 SER A 151 ? TYR A 162 ? SER A 151 TYR A 162 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? B ZN  .   ZN  ? ? ? 1_555 A HIS 85  NE2 ? ? A ZN  165 A HIS 85  1_555 ? ? ? ? ? ? ? 2.070 ? 
metalc2  metalc ? ? B ZN  .   ZN  ? ? ? 1_555 A HIS 98  ND1 ? ? A ZN  165 A HIS 98  1_555 ? ? ? ? ? ? ? 2.264 ? 
metalc3  metalc ? ? B ZN  .   ZN  ? ? ? 1_555 A HIS 70  NE2 ? ? A ZN  165 A HIS 70  1_555 ? ? ? ? ? ? ? 2.134 ? 
metalc4  metalc ? ? B ZN  .   ZN  ? ? ? 1_555 A ASP 72  OD2 ? ? A ZN  165 A ASP 72  1_555 ? ? ? ? ? ? ? 2.285 ? 
metalc5  metalc ? ? D CA  .   CA  ? ? ? 1_555 A ASP 77  OD2 ? ? A CA  167 A ASP 77  1_555 ? ? ? ? ? ? ? 2.636 ? 
metalc6  metalc ? ? D CA  .   CA  ? ? ? 1_555 A ASP 100 OD1 ? ? A CA  167 A ASP 100 1_555 ? ? ? ? ? ? ? 2.865 ? 
metalc7  metalc ? ? D CA  .   CA  ? ? ? 1_555 A ASP 100 OD2 ? ? A CA  167 A ASP 100 1_555 ? ? ? ? ? ? ? 2.672 ? 
metalc8  metalc ? ? D CA  .   CA  ? ? ? 1_555 A GLU 103 OE1 ? ? A CA  167 A GLU 103 1_555 ? ? ? ? ? ? ? 3.134 ? 
metalc9  metalc ? ? D CA  .   CA  ? ? ? 1_555 A GLU 103 OE2 ? ? A CA  167 A GLU 103 1_555 ? ? ? ? ? ? ? 2.483 ? 
metalc10 metalc ? ? D CA  .   CA  ? ? ? 1_555 A ASP 77  OD1 ? ? A CA  167 A ASP 77  1_555 ? ? ? ? ? ? ? 2.904 ? 
metalc11 metalc ? ? D CA  .   CA  ? ? ? 1_555 A GLY 78  O   ? ? A CA  167 A GLY 78  1_555 ? ? ? ? ? ? ? 2.593 ? 
metalc12 metalc ? ? D CA  .   CA  ? ? ? 1_555 A LYS 79  O   ? ? A CA  167 A LYS 79  1_555 ? ? ? ? ? ? ? 2.503 ? 
metalc13 metalc ? ? D CA  .   CA  ? ? ? 1_555 A ASP 80  O   ? ? A CA  167 A ASP 80  1_555 ? ? ? ? ? ? ? 2.572 ? 
metalc14 metalc ? ? D CA  .   CA  ? ? ? 1_555 A LEU 82  O   ? ? A CA  167 A LEU 82  1_555 ? ? ? ? ? ? ? 2.573 ? 
metalc15 metalc ? ? A ASP 60  O   ? ? ? 1_555 E CA  .   CA  ? ? A ASP 60  A CA  168 1_555 ? ? ? ? ? ? ? 2.451 ? 
metalc16 metalc ? ? A GLY 92  O   ? ? ? 1_555 E CA  .   CA  ? ? A GLY 92  A CA  168 1_555 ? ? ? ? ? ? ? 2.470 ? 
metalc17 metalc ? ? A GLY 94  O   ? ? ? 1_555 E CA  .   CA  ? ? A GLY 94  A CA  168 1_555 ? ? ? ? ? ? ? 2.538 ? 
metalc18 metalc ? ? A GLY 95  N   ? ? ? 1_555 E CA  .   CA  ? ? A GLY 95  A CA  168 1_555 ? ? ? ? ? ? ? 2.826 ? 
metalc19 metalc ? ? A ASP 96  N   ? ? ? 1_555 E CA  .   CA  ? ? A ASP 96  A CA  168 1_555 ? ? ? ? ? ? ? 2.840 ? 
metalc20 metalc ? ? A ASP 96  OD1 ? ? ? 1_555 E CA  .   CA  ? ? A ASP 96  A CA  168 1_555 ? ? ? ? ? ? ? 2.443 ? 
metalc21 metalc ? ? A HIS 120 NE2 ? ? ? 1_555 C ZN  .   ZN  ? ? A HIS 120 A ZN  166 1_555 ? ? ? ? ? ? ? 2.162 ? 
metalc22 metalc ? ? A HIS 124 NE2 ? ? ? 1_555 C ZN  .   ZN  ? ? A HIS 124 A ZN  166 1_555 ? ? ? ? ? ? ? 2.298 ? 
metalc23 metalc ? ? A HIS 130 NE2 ? ? ? 1_555 C ZN  .   ZN  ? ? A HIS 130 A ZN  166 1_555 ? ? ? ? ? ? ? 2.058 ? 
metalc24 metalc ? ? C ZN  .   ZN  ? ? ? 1_555 F I52 .   O26 ? ? A ZN  166 A I52 800 1_555 ? ? ? ? ? ? ? 2.134 ? 
metalc25 metalc ? ? C ZN  .   ZN  ? ? ? 1_555 F I52 .   O1  ? ? A ZN  166 A I52 800 1_555 ? ? ? ? ? ? ? 2.081 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   5 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 51 ? ARG A 53 ? PHE A 51 ARG A 53 
A 2 ILE A 16 ? ILE A 20 ? ILE A 16 ILE A 20 
A 3 ILE A 61 ? PHE A 65 ? ILE A 61 PHE A 65 
A 4 SER A 97 ? PHE A 99 ? SER A 97 PHE A 99 
A 5 ALA A 84 ? ALA A 86 ? ALA A 84 ALA A 86 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N SER A 52 ? N SER A 52 O ILE A 16 ? O ILE A 16 
A 2 3 O THR A 17 ? O THR A 17 N ILE A 61 ? N ILE A 61 
A 3 4 O MET A 62 ? O MET A 62 N SER A 97 ? N SER A 97 
A 4 5 N HIS A 98 ? N HIS A 98 O HIS A 85 ? O HIS A 85 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN A 165'  
AC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN A 166'  
AC3 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE CA A 167'  
AC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA A 168'  
AC5 Software ? ? ? ? 19 'BINDING SITE FOR RESIDUE I52 A 800' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4  HIS A 70  ? HIS A 70  . ? 1_555 ? 
2  AC1 4  ASP A 72  ? ASP A 72  . ? 1_555 ? 
3  AC1 4  HIS A 85  ? HIS A 85  . ? 1_555 ? 
4  AC1 4  HIS A 98  ? HIS A 98  . ? 1_555 ? 
5  AC2 4  HIS A 120 ? HIS A 120 . ? 1_555 ? 
6  AC2 4  HIS A 124 ? HIS A 124 . ? 1_555 ? 
7  AC2 4  HIS A 130 ? HIS A 130 . ? 1_555 ? 
8  AC2 4  I52 F .   ? I52 A 800 . ? 1_555 ? 
9  AC3 7  ASP A 77  ? ASP A 77  . ? 1_555 ? 
10 AC3 7  GLY A 78  ? GLY A 78  . ? 1_555 ? 
11 AC3 7  LYS A 79  ? LYS A 79  . ? 1_555 ? 
12 AC3 7  ASP A 80  ? ASP A 80  . ? 1_555 ? 
13 AC3 7  LEU A 82  ? LEU A 82  . ? 1_555 ? 
14 AC3 7  ASP A 100 ? ASP A 100 . ? 1_555 ? 
15 AC3 7  GLU A 103 ? GLU A 103 . ? 1_555 ? 
16 AC4 6  ASP A 60  ? ASP A 60  . ? 1_555 ? 
17 AC4 6  GLY A 92  ? GLY A 92  . ? 1_555 ? 
18 AC4 6  VAL A 93  ? VAL A 93  . ? 1_555 ? 
19 AC4 6  GLY A 94  ? GLY A 94  . ? 1_555 ? 
20 AC4 6  GLY A 95  ? GLY A 95  . ? 1_555 ? 
21 AC4 6  ASP A 96  ? ASP A 96  . ? 1_555 ? 
22 AC5 19 GLY A 81  ? GLY A 81  . ? 1_555 ? 
23 AC5 19 LEU A 82  ? LEU A 82  . ? 1_555 ? 
24 AC5 19 LEU A 83  ? LEU A 83  . ? 1_555 ? 
25 AC5 19 ALA A 84  ? ALA A 84  . ? 1_555 ? 
26 AC5 19 HIS A 85  ? HIS A 85  . ? 1_555 ? 
27 AC5 19 HIS A 120 ? HIS A 120 . ? 1_555 ? 
28 AC5 19 GLU A 121 ? GLU A 121 . ? 1_555 ? 
29 AC5 19 HIS A 124 ? HIS A 124 . ? 1_555 ? 
30 AC5 19 HIS A 130 ? HIS A 130 . ? 1_555 ? 
31 AC5 19 ALA A 136 ? ALA A 136 . ? 1_555 ? 
32 AC5 19 LEU A 137 ? LEU A 137 . ? 1_555 ? 
33 AC5 19 ALA A 139 ? ALA A 139 . ? 1_555 ? 
34 AC5 19 ILE A 141 ? ILE A 141 . ? 1_555 ? 
35 AC5 19 TYR A 142 ? TYR A 142 . ? 1_555 ? 
36 AC5 19 THR A 143 ? THR A 143 . ? 1_555 ? 
37 AC5 19 THR A 145 ? THR A 145 . ? 1_555 ? 
38 AC5 19 PHE A 148 ? PHE A 148 . ? 1_555 ? 
39 AC5 19 ARG A 149 ? ARG A 149 . ? 1_555 ? 
40 AC5 19 ZN  C .   ? ZN  A 166 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1HOV 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1HOV 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
H  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N    . MET A 1 1   ? -4.496  44.762 0.326   1.00 0.00  ? 1   MET A N    1  
ATOM   2     C  CA   . MET A 1 1   ? -3.558  43.900 1.100   1.00 0.00  ? 1   MET A CA   1  
ATOM   3     C  C    . MET A 1 1   ? -4.277  43.350 2.334   1.00 0.00  ? 1   MET A C    1  
ATOM   4     O  O    . MET A 1 1   ? -3.720  43.291 3.411   1.00 0.00  ? 1   MET A O    1  
ATOM   5     C  CB   . MET A 1 1   ? -2.349  44.734 1.539   1.00 0.00  ? 1   MET A CB   1  
ATOM   6     C  CG   . MET A 1 1   ? -1.080  44.177 0.894   1.00 0.00  ? 1   MET A CG   1  
ATOM   7     S  SD   . MET A 1 1   ? -0.914  42.422 1.304   1.00 0.00  ? 1   MET A SD   1  
ATOM   8     C  CE   . MET A 1 1   ? 0.481   42.589 2.444   1.00 0.00  ? 1   MET A CE   1  
ATOM   9     H  H1   . MET A 1 1   ? -5.401  44.830 0.831   1.00 0.00  ? 1   MET A H1   1  
ATOM   10    H  H2   . MET A 1 1   ? -4.652  44.346 -0.615  1.00 0.00  ? 1   MET A H2   1  
ATOM   11    H  H3   . MET A 1 1   ? -4.087  45.713 0.222   1.00 0.00  ? 1   MET A H3   1  
ATOM   12    H  HA   . MET A 1 1   ? -3.225  43.082 0.480   1.00 0.00  ? 1   MET A HA   1  
ATOM   13    H  HB2  . MET A 1 1   ? -2.491  45.761 1.230   1.00 0.00  ? 1   MET A HB2  1  
ATOM   14    H  HB3  . MET A 1 1   ? -2.253  44.692 2.613   1.00 0.00  ? 1   MET A HB3  1  
ATOM   15    H  HG2  . MET A 1 1   ? -1.141  44.293 -0.178  1.00 0.00  ? 1   MET A HG2  1  
ATOM   16    H  HG3  . MET A 1 1   ? -0.221  44.716 1.265   1.00 0.00  ? 1   MET A HG3  1  
ATOM   17    H  HE1  . MET A 1 1   ? 0.288   43.402 3.131   1.00 0.00  ? 1   MET A HE1  1  
ATOM   18    H  HE2  . MET A 1 1   ? 1.379   42.798 1.885   1.00 0.00  ? 1   MET A HE2  1  
ATOM   19    H  HE3  . MET A 1 1   ? 0.606   41.666 2.995   1.00 0.00  ? 1   MET A HE3  1  
ATOM   20    N  N    . TYR A 1 2   ? -5.514  42.951 2.188   1.00 0.00  ? 2   TYR A N    1  
ATOM   21    C  CA   . TYR A 1 2   ? -6.268  42.412 3.358   1.00 0.00  ? 2   TYR A CA   1  
ATOM   22    C  C    . TYR A 1 2   ? -6.205  43.427 4.499   1.00 0.00  ? 2   TYR A C    1  
ATOM   23    O  O    . TYR A 1 2   ? -7.047  44.294 4.627   1.00 0.00  ? 2   TYR A O    1  
ATOM   24    C  CB   . TYR A 1 2   ? -5.632  41.102 3.829   1.00 0.00  ? 2   TYR A CB   1  
ATOM   25    C  CG   . TYR A 1 2   ? -6.064  39.961 2.940   1.00 0.00  ? 2   TYR A CG   1  
ATOM   26    C  CD1  . TYR A 1 2   ? -7.412  39.811 2.590   1.00 0.00  ? 2   TYR A CD1  1  
ATOM   27    C  CD2  . TYR A 1 2   ? -5.113  39.048 2.472   1.00 0.00  ? 2   TYR A CD2  1  
ATOM   28    C  CE1  . TYR A 1 2   ? -7.806  38.747 1.770   1.00 0.00  ? 2   TYR A CE1  1  
ATOM   29    C  CE2  . TYR A 1 2   ? -5.507  37.984 1.653   1.00 0.00  ? 2   TYR A CE2  1  
ATOM   30    C  CZ   . TYR A 1 2   ? -6.853  37.834 1.301   1.00 0.00  ? 2   TYR A CZ   1  
ATOM   31    O  OH   . TYR A 1 2   ? -7.242  36.784 0.494   1.00 0.00  ? 2   TYR A OH   1  
ATOM   32    H  H    . TYR A 1 2   ? -5.948  43.009 1.311   1.00 0.00  ? 2   TYR A H    1  
ATOM   33    H  HA   . TYR A 1 2   ? -7.297  42.239 3.080   1.00 0.00  ? 2   TYR A HA   1  
ATOM   34    H  HB2  . TYR A 1 2   ? -4.557  41.194 3.795   1.00 0.00  ? 2   TYR A HB2  1  
ATOM   35    H  HB3  . TYR A 1 2   ? -5.940  40.901 4.845   1.00 0.00  ? 2   TYR A HB3  1  
ATOM   36    H  HD1  . TYR A 1 2   ? -8.148  40.515 2.953   1.00 0.00  ? 2   TYR A HD1  1  
ATOM   37    H  HD2  . TYR A 1 2   ? -4.074  39.162 2.744   1.00 0.00  ? 2   TYR A HD2  1  
ATOM   38    H  HE1  . TYR A 1 2   ? -8.846  38.630 1.499   1.00 0.00  ? 2   TYR A HE1  1  
ATOM   39    H  HE2  . TYR A 1 2   ? -4.773  37.279 1.291   1.00 0.00  ? 2   TYR A HE2  1  
ATOM   40    H  HH   . TYR A 1 2   ? -7.840  36.229 0.999   1.00 0.00  ? 2   TYR A HH   1  
ATOM   41    N  N    . ASN A 1 3   ? -5.202  43.324 5.326   1.00 0.00  ? 3   ASN A N    1  
ATOM   42    C  CA   . ASN A 1 3   ? -5.062  44.275 6.461   1.00 0.00  ? 3   ASN A CA   1  
ATOM   43    C  C    . ASN A 1 3   ? -3.577  44.483 6.760   1.00 0.00  ? 3   ASN A C    1  
ATOM   44    O  O    . ASN A 1 3   ? -2.720  43.934 6.098   1.00 0.00  ? 3   ASN A O    1  
ATOM   45    C  CB   . ASN A 1 3   ? -5.755  43.701 7.698   1.00 0.00  ? 3   ASN A CB   1  
ATOM   46    C  CG   . ASN A 1 3   ? -7.011  44.519 8.006   1.00 0.00  ? 3   ASN A CG   1  
ATOM   47    O  OD1  . ASN A 1 3   ? -6.959  45.731 8.075   1.00 0.00  ? 3   ASN A OD1  1  
ATOM   48    N  ND2  . ASN A 1 3   ? -8.146  43.902 8.191   1.00 0.00  ? 3   ASN A ND2  1  
ATOM   49    H  H    . ASN A 1 3   ? -4.533  42.619 5.198   1.00 0.00  ? 3   ASN A H    1  
ATOM   50    H  HA   . ASN A 1 3   ? -5.513  45.220 6.198   1.00 0.00  ? 3   ASN A HA   1  
ATOM   51    H  HB2  . ASN A 1 3   ? -6.031  42.672 7.513   1.00 0.00  ? 3   ASN A HB2  1  
ATOM   52    H  HB3  . ASN A 1 3   ? -5.081  43.748 8.541   1.00 0.00  ? 3   ASN A HB3  1  
ATOM   53    H  HD21 . ASN A 1 3   ? -8.187  42.924 8.131   1.00 0.00  ? 3   ASN A HD21 1  
ATOM   54    H  HD22 . ASN A 1 3   ? -8.956  44.415 8.390   1.00 0.00  ? 3   ASN A HD22 1  
ATOM   55    N  N    . PHE A 1 4   ? -3.267  45.271 7.753   1.00 0.00  ? 4   PHE A N    1  
ATOM   56    C  CA   . PHE A 1 4   ? -1.837  45.511 8.092   1.00 0.00  ? 4   PHE A CA   1  
ATOM   57    C  C    . PHE A 1 4   ? -1.266  44.280 8.799   1.00 0.00  ? 4   PHE A C    1  
ATOM   58    O  O    . PHE A 1 4   ? -1.973  43.558 9.471   1.00 0.00  ? 4   PHE A O    1  
ATOM   59    C  CB   . PHE A 1 4   ? -1.734  46.725 9.015   1.00 0.00  ? 4   PHE A CB   1  
ATOM   60    C  CG   . PHE A 1 4   ? -0.322  47.251 8.988   1.00 0.00  ? 4   PHE A CG   1  
ATOM   61    C  CD1  . PHE A 1 4   ? 0.070   48.152 7.992   1.00 0.00  ? 4   PHE A CD1  1  
ATOM   62    C  CD2  . PHE A 1 4   ? 0.595   46.839 9.962   1.00 0.00  ? 4   PHE A CD2  1  
ATOM   63    C  CE1  . PHE A 1 4   ? 1.380   48.642 7.968   1.00 0.00  ? 4   PHE A CE1  1  
ATOM   64    C  CE2  . PHE A 1 4   ? 1.906   47.328 9.939   1.00 0.00  ? 4   PHE A CE2  1  
ATOM   65    C  CZ   . PHE A 1 4   ? 2.298   48.230 8.941   1.00 0.00  ? 4   PHE A CZ   1  
ATOM   66    H  H    . PHE A 1 4   ? -3.974  45.706 8.274   1.00 0.00  ? 4   PHE A H    1  
ATOM   67    H  HA   . PHE A 1 4   ? -1.279  45.698 7.187   1.00 0.00  ? 4   PHE A HA   1  
ATOM   68    H  HB2  . PHE A 1 4   ? -2.413  47.495 8.677   1.00 0.00  ? 4   PHE A HB2  1  
ATOM   69    H  HB3  . PHE A 1 4   ? -1.990  46.435 10.022  1.00 0.00  ? 4   PHE A HB3  1  
ATOM   70    H  HD1  . PHE A 1 4   ? -0.637  48.468 7.240   1.00 0.00  ? 4   PHE A HD1  1  
ATOM   71    H  HD2  . PHE A 1 4   ? 0.290   46.144 10.731  1.00 0.00  ? 4   PHE A HD2  1  
ATOM   72    H  HE1  . PHE A 1 4   ? 1.684   49.338 7.199   1.00 0.00  ? 4   PHE A HE1  1  
ATOM   73    H  HE2  . PHE A 1 4   ? 2.615   47.010 10.689  1.00 0.00  ? 4   PHE A HE2  1  
ATOM   74    H  HZ   . PHE A 1 4   ? 3.309   48.608 8.922   1.00 0.00  ? 4   PHE A HZ   1  
ATOM   75    N  N    . PHE A 1 5   ? 0.007   44.031 8.649   1.00 0.00  ? 5   PHE A N    1  
ATOM   76    C  CA   . PHE A 1 5   ? 0.611   42.840 9.312   1.00 0.00  ? 5   PHE A CA   1  
ATOM   77    C  C    . PHE A 1 5   ? 1.844   43.265 10.122  1.00 0.00  ? 5   PHE A C    1  
ATOM   78    O  O    . PHE A 1 5   ? 2.339   44.363 9.963   1.00 0.00  ? 5   PHE A O    1  
ATOM   79    C  CB   . PHE A 1 5   ? 1.010   41.820 8.247   1.00 0.00  ? 5   PHE A CB   1  
ATOM   80    C  CG   . PHE A 1 5   ? -0.136  40.862 8.026   1.00 0.00  ? 5   PHE A CG   1  
ATOM   81    C  CD1  . PHE A 1 5   ? -0.788  40.288 9.122   1.00 0.00  ? 5   PHE A CD1  1  
ATOM   82    C  CD2  . PHE A 1 5   ? -0.547  40.550 6.726   1.00 0.00  ? 5   PHE A CD2  1  
ATOM   83    C  CE1  . PHE A 1 5   ? -1.850  39.401 8.920   1.00 0.00  ? 5   PHE A CE1  1  
ATOM   84    C  CE2  . PHE A 1 5   ? -1.610  39.662 6.523   1.00 0.00  ? 5   PHE A CE2  1  
ATOM   85    C  CZ   . PHE A 1 5   ? -2.262  39.088 7.619   1.00 0.00  ? 5   PHE A CZ   1  
ATOM   86    H  H    . PHE A 1 5   ? 0.562   44.623 8.100   1.00 0.00  ? 5   PHE A H    1  
ATOM   87    H  HA   . PHE A 1 5   ? -0.115  42.396 9.977   1.00 0.00  ? 5   PHE A HA   1  
ATOM   88    H  HB2  . PHE A 1 5   ? 1.237   42.331 7.323   1.00 0.00  ? 5   PHE A HB2  1  
ATOM   89    H  HB3  . PHE A 1 5   ? 1.878   41.272 8.580   1.00 0.00  ? 5   PHE A HB3  1  
ATOM   90    H  HD1  . PHE A 1 5   ? -0.471  40.530 10.124  1.00 0.00  ? 5   PHE A HD1  1  
ATOM   91    H  HD2  . PHE A 1 5   ? -0.045  40.994 5.880   1.00 0.00  ? 5   PHE A HD2  1  
ATOM   92    H  HE1  . PHE A 1 5   ? -2.354  38.958 9.768   1.00 0.00  ? 5   PHE A HE1  1  
ATOM   93    H  HE2  . PHE A 1 5   ? -1.927  39.420 5.520   1.00 0.00  ? 5   PHE A HE2  1  
ATOM   94    H  HZ   . PHE A 1 5   ? -3.082  38.403 7.462   1.00 0.00  ? 5   PHE A HZ   1  
ATOM   95    N  N    . PRO A 1 6   ? 2.290   42.380 10.981  1.00 0.00  ? 6   PRO A N    1  
ATOM   96    C  CA   . PRO A 1 6   ? 3.455   42.629 11.857  1.00 0.00  ? 6   PRO A CA   1  
ATOM   97    C  C    . PRO A 1 6   ? 4.784   42.522 11.093  1.00 0.00  ? 6   PRO A C    1  
ATOM   98    O  O    . PRO A 1 6   ? 5.751   41.984 11.594  1.00 0.00  ? 6   PRO A O    1  
ATOM   99    C  CB   . PRO A 1 6   ? 3.347   41.526 12.914  1.00 0.00  ? 6   PRO A CB   1  
ATOM   100   C  CG   . PRO A 1 6   ? 2.496   40.399 12.286  1.00 0.00  ? 6   PRO A CG   1  
ATOM   101   C  CD   . PRO A 1 6   ? 1.673   41.049 11.160  1.00 0.00  ? 6   PRO A CD   1  
ATOM   102   H  HA   . PRO A 1 6   ? 3.370   43.592 12.332  1.00 0.00  ? 6   PRO A HA   1  
ATOM   103   H  HB2  . PRO A 1 6   ? 4.332   41.157 13.164  1.00 0.00  ? 6   PRO A HB2  1  
ATOM   104   H  HB3  . PRO A 1 6   ? 2.855   41.902 13.798  1.00 0.00  ? 6   PRO A HB3  1  
ATOM   105   H  HG2  . PRO A 1 6   ? 3.141   39.631 11.882  1.00 0.00  ? 6   PRO A HG2  1  
ATOM   106   H  HG3  . PRO A 1 6   ? 1.833   39.978 13.026  1.00 0.00  ? 6   PRO A HG3  1  
ATOM   107   H  HD2  . PRO A 1 6   ? 1.750   40.466 10.253  1.00 0.00  ? 6   PRO A HD2  1  
ATOM   108   H  HD3  . PRO A 1 6   ? 0.642   41.154 11.459  1.00 0.00  ? 6   PRO A HD3  1  
ATOM   109   N  N    . ARG A 1 7   ? 4.854   43.048 9.900   1.00 0.00  ? 7   ARG A N    1  
ATOM   110   C  CA   . ARG A 1 7   ? 6.134   42.997 9.128   1.00 0.00  ? 7   ARG A CA   1  
ATOM   111   C  C    . ARG A 1 7   ? 6.429   41.574 8.634   1.00 0.00  ? 7   ARG A C    1  
ATOM   112   O  O    . ARG A 1 7   ? 6.742   41.368 7.478   1.00 0.00  ? 7   ARG A O    1  
ATOM   113   C  CB   . ARG A 1 7   ? 7.281   43.476 10.020  1.00 0.00  ? 7   ARG A CB   1  
ATOM   114   C  CG   . ARG A 1 7   ? 7.834   44.792 9.473   1.00 0.00  ? 7   ARG A CG   1  
ATOM   115   C  CD   . ARG A 1 7   ? 9.216   44.555 8.862   1.00 0.00  ? 7   ARG A CD   1  
ATOM   116   N  NE   . ARG A 1 7   ? 9.108   44.558 7.375   1.00 0.00  ? 7   ARG A NE   1  
ATOM   117   C  CZ   . ARG A 1 7   ? 8.779   45.651 6.741   1.00 0.00  ? 7   ARG A CZ   1  
ATOM   118   N  NH1  . ARG A 1 7   ? 8.535   46.747 7.407   1.00 0.00  ? 7   ARG A NH1  1  
ATOM   119   N  NH2  . ARG A 1 7   ? 8.689   45.646 5.438   1.00 0.00  ? 7   ARG A NH2  1  
ATOM   120   H  H    . ARG A 1 7   ? 4.072   43.494 9.517   1.00 0.00  ? 7   ARG A H    1  
ATOM   121   H  HA   . ARG A 1 7   ? 6.058   43.654 8.276   1.00 0.00  ? 7   ARG A HA   1  
ATOM   122   H  HB2  . ARG A 1 7   ? 6.917   43.629 11.026  1.00 0.00  ? 7   ARG A HB2  1  
ATOM   123   H  HB3  . ARG A 1 7   ? 8.064   42.735 10.030  1.00 0.00  ? 7   ARG A HB3  1  
ATOM   124   H  HG2  . ARG A 1 7   ? 7.165   45.174 8.715   1.00 0.00  ? 7   ARG A HG2  1  
ATOM   125   H  HG3  . ARG A 1 7   ? 7.915   45.510 10.276  1.00 0.00  ? 7   ARG A HG3  1  
ATOM   126   H  HD2  . ARG A 1 7   ? 9.888   45.339 9.177   1.00 0.00  ? 7   ARG A HD2  1  
ATOM   127   H  HD3  . ARG A 1 7   ? 9.596   43.600 9.195   1.00 0.00  ? 7   ARG A HD3  1  
ATOM   128   H  HE   . ARG A 1 7   ? 9.287   43.737 6.871   1.00 0.00  ? 7   ARG A HE   1  
ATOM   129   H  HH11 . ARG A 1 7   ? 8.598   46.751 8.405   1.00 0.00  ? 7   ARG A HH11 1  
ATOM   130   H  HH12 . ARG A 1 7   ? 8.289   47.584 6.919   1.00 0.00  ? 7   ARG A HH12 1  
ATOM   131   H  HH21 . ARG A 1 7   ? 8.874   44.807 4.927   1.00 0.00  ? 7   ARG A HH21 1  
ATOM   132   H  HH22 . ARG A 1 7   ? 8.433   46.482 4.951   1.00 0.00  ? 7   ARG A HH22 1  
ATOM   133   N  N    . LYS A 1 8   ? 6.352   40.591 9.490   1.00 0.00  ? 8   LYS A N    1  
ATOM   134   C  CA   . LYS A 1 8   ? 6.648   39.201 9.042   1.00 0.00  ? 8   LYS A CA   1  
ATOM   135   C  C    . LYS A 1 8   ? 5.447   38.630 8.279   1.00 0.00  ? 8   LYS A C    1  
ATOM   136   O  O    . LYS A 1 8   ? 4.388   38.455 8.847   1.00 0.00  ? 8   LYS A O    1  
ATOM   137   C  CB   . LYS A 1 8   ? 6.922   38.313 10.258  1.00 0.00  ? 8   LYS A CB   1  
ATOM   138   C  CG   . LYS A 1 8   ? 8.093   38.891 11.060  1.00 0.00  ? 8   LYS A CG   1  
ATOM   139   C  CD   . LYS A 1 8   ? 8.687   37.803 11.960  1.00 0.00  ? 8   LYS A CD   1  
ATOM   140   C  CE   . LYS A 1 8   ? 9.677   38.436 12.937  1.00 0.00  ? 8   LYS A CE   1  
ATOM   141   N  NZ   . LYS A 1 8   ? 9.729   37.627 14.189  1.00 0.00  ? 8   LYS A NZ   1  
ATOM   142   H  H    . LYS A 1 8   ? 6.113   40.764 10.422  1.00 0.00  ? 8   LYS A H    1  
ATOM   143   H  HA   . LYS A 1 8   ? 7.520   39.208 8.407   1.00 0.00  ? 8   LYS A HA   1  
ATOM   144   H  HB2  . LYS A 1 8   ? 6.037   38.270 10.878  1.00 0.00  ? 8   LYS A HB2  1  
ATOM   145   H  HB3  . LYS A 1 8   ? 7.173   37.316 9.924   1.00 0.00  ? 8   LYS A HB3  1  
ATOM   146   H  HG2  . LYS A 1 8   ? 8.852   39.247 10.378  1.00 0.00  ? 8   LYS A HG2  1  
ATOM   147   H  HG3  . LYS A 1 8   ? 7.743   39.712 11.671  1.00 0.00  ? 8   LYS A HG3  1  
ATOM   148   H  HD2  . LYS A 1 8   ? 7.895   37.318 12.514  1.00 0.00  ? 8   LYS A HD2  1  
ATOM   149   H  HD3  . LYS A 1 8   ? 9.200   37.074 11.353  1.00 0.00  ? 8   LYS A HD3  1  
ATOM   150   H  HE2  . LYS A 1 8   ? 10.657  38.469 12.486  1.00 0.00  ? 8   LYS A HE2  1  
ATOM   151   H  HE3  . LYS A 1 8   ? 9.355   39.438 13.170  1.00 0.00  ? 8   LYS A HE3  1  
ATOM   152   H  HZ1  . LYS A 1 8   ? 10.600  37.060 14.200  1.00 0.00  ? 8   LYS A HZ1  1  
ATOM   153   H  HZ2  . LYS A 1 8   ? 8.902   36.995 14.227  1.00 0.00  ? 8   LYS A HZ2  1  
ATOM   154   H  HZ3  . LYS A 1 8   ? 9.719   38.260 15.013  1.00 0.00  ? 8   LYS A HZ3  1  
ATOM   155   N  N    . PRO A 1 9   ? 5.652   38.329 7.021   1.00 0.00  ? 9   PRO A N    1  
ATOM   156   C  CA   . PRO A 1 9   ? 4.601   37.743 6.175   1.00 0.00  ? 9   PRO A CA   1  
ATOM   157   C  C    . PRO A 1 9   ? 4.390   36.285 6.588   1.00 0.00  ? 9   PRO A C    1  
ATOM   158   O  O    . PRO A 1 9   ? 4.916   35.379 5.976   1.00 0.00  ? 9   PRO A O    1  
ATOM   159   C  CB   . PRO A 1 9   ? 5.172   37.853 4.756   1.00 0.00  ? 9   PRO A CB   1  
ATOM   160   C  CG   . PRO A 1 9   ? 6.701   37.978 4.916   1.00 0.00  ? 9   PRO A CG   1  
ATOM   161   C  CD   . PRO A 1 9   ? 6.941   38.538 6.327   1.00 0.00  ? 9   PRO A CD   1  
ATOM   162   H  HA   . PRO A 1 9   ? 3.684   38.304 6.257   1.00 0.00  ? 9   PRO A HA   1  
ATOM   163   H  HB2  . PRO A 1 9   ? 4.927   36.966 4.188   1.00 0.00  ? 9   PRO A HB2  1  
ATOM   164   H  HB3  . PRO A 1 9   ? 4.785   38.731 4.264   1.00 0.00  ? 9   PRO A HB3  1  
ATOM   165   H  HG2  . PRO A 1 9   ? 7.163   37.005 4.818   1.00 0.00  ? 9   PRO A HG2  1  
ATOM   166   H  HG3  . PRO A 1 9   ? 7.100   38.658 4.180   1.00 0.00  ? 9   PRO A HG3  1  
ATOM   167   H  HD2  . PRO A 1 9   ? 7.735   37.994 6.819   1.00 0.00  ? 9   PRO A HD2  1  
ATOM   168   H  HD3  . PRO A 1 9   ? 7.172   39.591 6.282   1.00 0.00  ? 9   PRO A HD3  1  
ATOM   169   N  N    . LYS A 1 10  ? 3.642   36.073 7.645   1.00 0.00  ? 10  LYS A N    1  
ATOM   170   C  CA   . LYS A 1 10  ? 3.392   34.688 8.154   1.00 0.00  ? 10  LYS A CA   1  
ATOM   171   C  C    . LYS A 1 10  ? 3.403   33.678 7.003   1.00 0.00  ? 10  LYS A C    1  
ATOM   172   O  O    . LYS A 1 10  ? 2.804   33.892 5.968   1.00 0.00  ? 10  LYS A O    1  
ATOM   173   C  CB   . LYS A 1 10  ? 2.028   34.627 8.857   1.00 0.00  ? 10  LYS A CB   1  
ATOM   174   C  CG   . LYS A 1 10  ? 1.136   35.773 8.374   1.00 0.00  ? 10  LYS A CG   1  
ATOM   175   C  CD   . LYS A 1 10  ? -0.324  35.314 8.360   1.00 0.00  ? 10  LYS A CD   1  
ATOM   176   C  CE   . LYS A 1 10  ? -0.630  34.632 7.025   1.00 0.00  ? 10  LYS A CE   1  
ATOM   177   N  NZ   . LYS A 1 10  ? -1.495  33.440 7.258   1.00 0.00  ? 10  LYS A NZ   1  
ATOM   178   H  H    . LYS A 1 10  ? 3.254   36.838 8.120   1.00 0.00  ? 10  LYS A H    1  
ATOM   179   H  HA   . LYS A 1 10  ? 4.168   34.432 8.863   1.00 0.00  ? 10  LYS A HA   1  
ATOM   180   H  HB2  . LYS A 1 10  ? 1.550   33.683 8.631   1.00 0.00  ? 10  LYS A HB2  1  
ATOM   181   H  HB3  . LYS A 1 10  ? 2.168   34.709 9.924   1.00 0.00  ? 10  LYS A HB3  1  
ATOM   182   H  HG2  . LYS A 1 10  ? 1.243   36.617 9.040   1.00 0.00  ? 10  LYS A HG2  1  
ATOM   183   H  HG3  . LYS A 1 10  ? 1.430   36.064 7.376   1.00 0.00  ? 10  LYS A HG3  1  
ATOM   184   H  HD2  . LYS A 1 10  ? -0.491  34.618 9.170   1.00 0.00  ? 10  LYS A HD2  1  
ATOM   185   H  HD3  . LYS A 1 10  ? -0.970  36.171 8.481   1.00 0.00  ? 10  LYS A HD3  1  
ATOM   186   H  HE2  . LYS A 1 10  ? -1.142  35.325 6.376   1.00 0.00  ? 10  LYS A HE2  1  
ATOM   187   H  HE3  . LYS A 1 10  ? 0.295   34.320 6.561   1.00 0.00  ? 10  LYS A HE3  1  
ATOM   188   H  HZ1  . LYS A 1 10  ? -1.865  33.463 8.230   1.00 0.00  ? 10  LYS A HZ1  1  
ATOM   189   H  HZ2  . LYS A 1 10  ? -0.935  32.574 7.119   1.00 0.00  ? 10  LYS A HZ2  1  
ATOM   190   H  HZ3  . LYS A 1 10  ? -2.289  33.451 6.587   1.00 0.00  ? 10  LYS A HZ3  1  
ATOM   191   N  N    . TRP A 1 11  ? 4.081   32.576 7.179   1.00 0.00  ? 11  TRP A N    1  
ATOM   192   C  CA   . TRP A 1 11  ? 4.133   31.548 6.104   1.00 0.00  ? 11  TRP A CA   1  
ATOM   193   C  C    . TRP A 1 11  ? 2.710   31.103 5.763   1.00 0.00  ? 11  TRP A C    1  
ATOM   194   O  O    . TRP A 1 11  ? 1.906   30.845 6.637   1.00 0.00  ? 11  TRP A O    1  
ATOM   195   C  CB   . TRP A 1 11  ? 4.935   30.337 6.593   1.00 0.00  ? 11  TRP A CB   1  
ATOM   196   C  CG   . TRP A 1 11  ? 6.367   30.469 6.178   1.00 0.00  ? 11  TRP A CG   1  
ATOM   197   C  CD1  . TRP A 1 11  ? 7.427   30.151 6.957   1.00 0.00  ? 11  TRP A CD1  1  
ATOM   198   C  CD2  . TRP A 1 11  ? 6.918   30.939 4.910   1.00 0.00  ? 11  TRP A CD2  1  
ATOM   199   N  NE1  . TRP A 1 11  ? 8.591   30.399 6.253   1.00 0.00  ? 11  TRP A NE1  1  
ATOM   200   C  CE2  . TRP A 1 11  ? 8.331   30.885 4.987   1.00 0.00  ? 11  TRP A CE2  1  
ATOM   201   C  CE3  . TRP A 1 11  ? 6.339   31.404 3.714   1.00 0.00  ? 11  TRP A CE3  1  
ATOM   202   C  CZ2  . TRP A 1 11  ? 9.139   31.278 3.919   1.00 0.00  ? 11  TRP A CZ2  1  
ATOM   203   C  CZ3  . TRP A 1 11  ? 7.151   31.800 2.637   1.00 0.00  ? 11  TRP A CZ3  1  
ATOM   204   C  CH2  . TRP A 1 11  ? 8.547   31.737 2.741   1.00 0.00  ? 11  TRP A CH2  1  
ATOM   205   H  H    . TRP A 1 11  ? 4.554   32.424 8.021   1.00 0.00  ? 11  TRP A H    1  
ATOM   206   H  HA   . TRP A 1 11  ? 4.604   31.965 5.230   1.00 0.00  ? 11  TRP A HA   1  
ATOM   207   H  HB2  . TRP A 1 11  ? 4.879   30.281 7.671   1.00 0.00  ? 11  TRP A HB2  1  
ATOM   208   H  HB3  . TRP A 1 11  ? 4.519   29.437 6.168   1.00 0.00  ? 11  TRP A HB3  1  
ATOM   209   H  HD1  . TRP A 1 11  ? 7.373   29.767 7.966   1.00 0.00  ? 11  TRP A HD1  1  
ATOM   210   H  HE1  . TRP A 1 11  ? 9.499   30.253 6.593   1.00 0.00  ? 11  TRP A HE1  1  
ATOM   211   H  HE3  . TRP A 1 11  ? 5.265   31.454 3.620   1.00 0.00  ? 11  TRP A HE3  1  
ATOM   212   H  HZ2  . TRP A 1 11  ? 10.215  31.227 4.003   1.00 0.00  ? 11  TRP A HZ2  1  
ATOM   213   H  HZ3  . TRP A 1 11  ? 6.696   32.157 1.724   1.00 0.00  ? 11  TRP A HZ3  1  
ATOM   214   H  HH2  . TRP A 1 11  ? 9.166   32.042 1.910   1.00 0.00  ? 11  TRP A HH2  1  
ATOM   215   N  N    . ASP A 1 12  ? 2.392   31.009 4.504   1.00 0.00  ? 12  ASP A N    1  
ATOM   216   C  CA   . ASP A 1 12  ? 1.020   30.576 4.113   1.00 0.00  ? 12  ASP A CA   1  
ATOM   217   C  C    . ASP A 1 12  ? 0.940   30.450 2.592   1.00 0.00  ? 12  ASP A C    1  
ATOM   218   O  O    . ASP A 1 12  ? 0.370   31.283 1.918   1.00 0.00  ? 12  ASP A O    1  
ATOM   219   C  CB   . ASP A 1 12  ? -0.001  31.608 4.597   1.00 0.00  ? 12  ASP A CB   1  
ATOM   220   C  CG   . ASP A 1 12  ? -1.394  30.971 4.621   1.00 0.00  ? 12  ASP A CG   1  
ATOM   221   O  OD1  . ASP A 1 12  ? -1.680  30.252 5.566   1.00 0.00  ? 12  ASP A OD1  1  
ATOM   222   O  OD2  . ASP A 1 12  ? -2.151  31.213 3.695   1.00 0.00  ? 12  ASP A OD2  1  
ATOM   223   H  H    . ASP A 1 12  ? 3.055   31.219 3.814   1.00 0.00  ? 12  ASP A H    1  
ATOM   224   H  HA   . ASP A 1 12  ? 0.804   29.619 4.564   1.00 0.00  ? 12  ASP A HA   1  
ATOM   225   H  HB2  . ASP A 1 12  ? 0.265   31.935 5.592   1.00 0.00  ? 12  ASP A HB2  1  
ATOM   226   H  HB3  . ASP A 1 12  ? -0.004  32.455 3.927   1.00 0.00  ? 12  ASP A HB3  1  
ATOM   227   N  N    . LYS A 1 13  ? 1.520   29.416 2.046   1.00 0.00  ? 13  LYS A N    1  
ATOM   228   C  CA   . LYS A 1 13  ? 1.495   29.238 0.574   1.00 0.00  ? 13  LYS A CA   1  
ATOM   229   C  C    . LYS A 1 13  ? 1.873   27.800 0.217   1.00 0.00  ? 13  LYS A C    1  
ATOM   230   O  O    . LYS A 1 13  ? 2.773   27.222 0.796   1.00 0.00  ? 13  LYS A O    1  
ATOM   231   C  CB   . LYS A 1 13  ? 2.511   30.186 -0.060  1.00 0.00  ? 13  LYS A CB   1  
ATOM   232   C  CG   . LYS A 1 13  ? 3.795   30.217 0.780   1.00 0.00  ? 13  LYS A CG   1  
ATOM   233   C  CD   . LYS A 1 13  ? 4.886   29.397 0.088   1.00 0.00  ? 13  LYS A CD   1  
ATOM   234   C  CE   . LYS A 1 13  ? 6.145   29.387 0.958   1.00 0.00  ? 13  LYS A CE   1  
ATOM   235   N  NZ   . LYS A 1 13  ? 6.694   28.004 1.017   1.00 0.00  ? 13  LYS A NZ   1  
ATOM   236   H  H    . LYS A 1 13  ? 1.984   28.766 2.604   1.00 0.00  ? 13  LYS A H    1  
ATOM   237   H  HA   . LYS A 1 13  ? 0.508   29.460 0.195   1.00 0.00  ? 13  LYS A HA   1  
ATOM   238   H  HB2  . LYS A 1 13  ? 2.744   29.843 -1.054  1.00 0.00  ? 13  LYS A HB2  1  
ATOM   239   H  HB3  . LYS A 1 13  ? 2.092   31.177 -0.107  1.00 0.00  ? 13  LYS A HB3  1  
ATOM   240   H  HG2  . LYS A 1 13  ? 4.127   31.239 0.886   1.00 0.00  ? 13  LYS A HG2  1  
ATOM   241   H  HG3  . LYS A 1 13  ? 3.603   29.801 1.755   1.00 0.00  ? 13  LYS A HG3  1  
ATOM   242   H  HD2  . LYS A 1 13  ? 4.538   28.383 -0.055  1.00 0.00  ? 13  LYS A HD2  1  
ATOM   243   H  HD3  . LYS A 1 13  ? 5.118   29.837 -0.870  1.00 0.00  ? 13  LYS A HD3  1  
ATOM   244   H  HE2  . LYS A 1 13  ? 6.884   30.048 0.531   1.00 0.00  ? 13  LYS A HE2  1  
ATOM   245   H  HE3  . LYS A 1 13  ? 5.900   29.719 1.957   1.00 0.00  ? 13  LYS A HE3  1  
ATOM   246   H  HZ1  . LYS A 1 13  ? 7.070   27.740 0.085   1.00 0.00  ? 13  LYS A HZ1  1  
ATOM   247   H  HZ2  . LYS A 1 13  ? 5.938   27.344 1.288   1.00 0.00  ? 13  LYS A HZ2  1  
ATOM   248   H  HZ3  . LYS A 1 13  ? 7.458   27.965 1.720   1.00 0.00  ? 13  LYS A HZ3  1  
ATOM   249   N  N    . ASN A 1 14  ? 1.210   27.223 -0.748  1.00 0.00  ? 14  ASN A N    1  
ATOM   250   C  CA   . ASN A 1 14  ? 1.559   25.834 -1.152  1.00 0.00  ? 14  ASN A CA   1  
ATOM   251   C  C    . ASN A 1 14  ? 3.055   25.794 -1.467  1.00 0.00  ? 14  ASN A C    1  
ATOM   252   O  O    . ASN A 1 14  ? 3.760   26.765 -1.274  1.00 0.00  ? 14  ASN A O    1  
ATOM   253   C  CB   . ASN A 1 14  ? 0.759   25.451 -2.402  1.00 0.00  ? 14  ASN A CB   1  
ATOM   254   C  CG   . ASN A 1 14  ? 0.762   26.622 -3.386  1.00 0.00  ? 14  ASN A CG   1  
ATOM   255   O  OD1  . ASN A 1 14  ? 0.491   27.746 -3.011  1.00 0.00  ? 14  ASN A OD1  1  
ATOM   256   N  ND2  . ASN A 1 14  ? 1.058   26.406 -4.638  1.00 0.00  ? 14  ASN A ND2  1  
ATOM   257   H  H    . ASN A 1 14  ? 0.498   27.708 -1.215  1.00 0.00  ? 14  ASN A H    1  
ATOM   258   H  HA   . ASN A 1 14  ? 1.333   25.146 -0.346  1.00 0.00  ? 14  ASN A HA   1  
ATOM   259   H  HB2  . ASN A 1 14  ? 1.209   24.586 -2.867  1.00 0.00  ? 14  ASN A HB2  1  
ATOM   260   H  HB3  . ASN A 1 14  ? -0.257  25.222 -2.122  1.00 0.00  ? 14  ASN A HB3  1  
ATOM   261   H  HD21 . ASN A 1 14  ? 1.273   25.499 -4.941  1.00 0.00  ? 14  ASN A HD21 1  
ATOM   262   H  HD22 . ASN A 1 14  ? 1.067   27.150 -5.275  1.00 0.00  ? 14  ASN A HD22 1  
ATOM   263   N  N    . GLN A 1 15  ? 3.549   24.695 -1.961  1.00 0.00  ? 15  GLN A N    1  
ATOM   264   C  CA   . GLN A 1 15  ? 5.000   24.621 -2.298  1.00 0.00  ? 15  GLN A CA   1  
ATOM   265   C  C    . GLN A 1 15  ? 5.843   25.161 -1.139  1.00 0.00  ? 15  GLN A C    1  
ATOM   266   O  O    . GLN A 1 15  ? 6.029   26.352 -0.993  1.00 0.00  ? 15  GLN A O    1  
ATOM   267   C  CB   . GLN A 1 15  ? 5.267   25.461 -3.546  1.00 0.00  ? 15  GLN A CB   1  
ATOM   268   C  CG   . GLN A 1 15  ? 5.304   24.551 -4.772  1.00 0.00  ? 15  GLN A CG   1  
ATOM   269   C  CD   . GLN A 1 15  ? 6.177   25.190 -5.852  1.00 0.00  ? 15  GLN A CD   1  
ATOM   270   O  OE1  . GLN A 1 15  ? 7.388   25.138 -5.778  1.00 0.00  ? 15  GLN A OE1  1  
ATOM   271   N  NE2  . GLN A 1 15  ? 5.611   25.794 -6.860  1.00 0.00  ? 15  GLN A NE2  1  
ATOM   272   H  H    . GLN A 1 15  ? 2.967   23.925 -2.123  1.00 0.00  ? 15  GLN A H    1  
ATOM   273   H  HA   . GLN A 1 15  ? 5.272   23.595 -2.492  1.00 0.00  ? 15  GLN A HA   1  
ATOM   274   H  HB2  . GLN A 1 15  ? 4.479   26.192 -3.662  1.00 0.00  ? 15  GLN A HB2  1  
ATOM   275   H  HB3  . GLN A 1 15  ? 6.215   25.965 -3.445  1.00 0.00  ? 15  GLN A HB3  1  
ATOM   276   H  HG2  . GLN A 1 15  ? 5.715   23.592 -4.494  1.00 0.00  ? 15  GLN A HG2  1  
ATOM   277   H  HG3  . GLN A 1 15  ? 4.302   24.419 -5.152  1.00 0.00  ? 15  GLN A HG3  1  
ATOM   278   H  HE21 . GLN A 1 15  ? 4.634   25.835 -6.921  1.00 0.00  ? 15  GLN A HE21 1  
ATOM   279   H  HE22 . GLN A 1 15  ? 6.163   26.208 -7.556  1.00 0.00  ? 15  GLN A HE22 1  
ATOM   280   N  N    . ILE A 1 16  ? 6.367   24.290 -0.322  1.00 0.00  ? 16  ILE A N    1  
ATOM   281   C  CA   . ILE A 1 16  ? 7.212   24.743 0.816   1.00 0.00  ? 16  ILE A CA   1  
ATOM   282   C  C    . ILE A 1 16  ? 8.637   24.228 0.597   1.00 0.00  ? 16  ILE A C    1  
ATOM   283   O  O    . ILE A 1 16  ? 8.844   23.189 0.001   1.00 0.00  ? 16  ILE A O    1  
ATOM   284   C  CB   . ILE A 1 16  ? 6.666   24.177 2.135   1.00 0.00  ? 16  ILE A CB   1  
ATOM   285   C  CG1  . ILE A 1 16  ? 5.114   24.158 2.094   1.00 0.00  ? 16  ILE A CG1  1  
ATOM   286   C  CG2  . ILE A 1 16  ? 7.187   25.027 3.303   1.00 0.00  ? 16  ILE A CG2  1  
ATOM   287   C  CD1  . ILE A 1 16  ? 4.496   25.111 3.129   1.00 0.00  ? 16  ILE A CD1  1  
ATOM   288   H  H    . ILE A 1 16  ? 6.216   23.334 -0.464  1.00 0.00  ? 16  ILE A H    1  
ATOM   289   H  HA   . ILE A 1 16  ? 7.219   25.823 0.857   1.00 0.00  ? 16  ILE A HA   1  
ATOM   290   H  HB   . ILE A 1 16  ? 7.030   23.167 2.254   1.00 0.00  ? 16  ILE A HB   1  
ATOM   291   H  HG12 . ILE A 1 16  ? 4.778   24.454 1.113   1.00 0.00  ? 16  ILE A HG12 1  
ATOM   292   H  HG13 . ILE A 1 16  ? 4.771   23.155 2.294   1.00 0.00  ? 16  ILE A HG13 1  
ATOM   293   H  HG21 . ILE A 1 16  ? 6.801   26.032 3.218   1.00 0.00  ? 16  ILE A HG21 1  
ATOM   294   H  HG22 . ILE A 1 16  ? 8.266   25.053 3.278   1.00 0.00  ? 16  ILE A HG22 1  
ATOM   295   H  HG23 . ILE A 1 16  ? 6.859   24.593 4.237   1.00 0.00  ? 16  ILE A HG23 1  
ATOM   296   H  HD11 . ILE A 1 16  ? 3.452   24.865 3.261   1.00 0.00  ? 16  ILE A HD11 1  
ATOM   297   H  HD12 . ILE A 1 16  ? 4.583   26.127 2.778   1.00 0.00  ? 16  ILE A HD12 1  
ATOM   298   H  HD13 . ILE A 1 16  ? 5.011   25.009 4.073   1.00 0.00  ? 16  ILE A HD13 1  
ATOM   299   N  N    . THR A 1 17  ? 9.625   24.935 1.072   1.00 0.00  ? 17  THR A N    1  
ATOM   300   C  CA   . THR A 1 17  ? 11.023  24.461 0.881   1.00 0.00  ? 17  THR A CA   1  
ATOM   301   C  C    . THR A 1 17  ? 11.667  24.217 2.246   1.00 0.00  ? 17  THR A C    1  
ATOM   302   O  O    . THR A 1 17  ? 11.584  25.037 3.138   1.00 0.00  ? 17  THR A O    1  
ATOM   303   C  CB   . THR A 1 17  ? 11.831  25.517 0.120   1.00 0.00  ? 17  THR A CB   1  
ATOM   304   O  OG1  . THR A 1 17  ? 11.188  26.781 0.233   1.00 0.00  ? 17  THR A OG1  1  
ATOM   305   C  CG2  . THR A 1 17  ? 11.932  25.123 -1.354  1.00 0.00  ? 17  THR A CG2  1  
ATOM   306   H  H    . THR A 1 17  ? 9.448   25.770 1.552   1.00 0.00  ? 17  THR A H    1  
ATOM   307   H  HA   . THR A 1 17  ? 11.012  23.542 0.319   1.00 0.00  ? 17  THR A HA   1  
ATOM   308   H  HB   . THR A 1 17  ? 12.824  25.581 0.539   1.00 0.00  ? 17  THR A HB   1  
ATOM   309   H  HG1  . THR A 1 17  ? 11.868  27.458 0.273   1.00 0.00  ? 17  THR A HG1  1  
ATOM   310   H  HG21 . THR A 1 17  ? 11.008  25.370 -1.855  1.00 0.00  ? 17  THR A HG21 1  
ATOM   311   H  HG22 . THR A 1 17  ? 12.112  24.062 -1.432  1.00 0.00  ? 17  THR A HG22 1  
ATOM   312   H  HG23 . THR A 1 17  ? 12.746  25.662 -1.815  1.00 0.00  ? 17  THR A HG23 1  
ATOM   313   N  N    . TYR A 1 18  ? 12.308  23.093 2.417   1.00 0.00  ? 18  TYR A N    1  
ATOM   314   C  CA   . TYR A 1 18  ? 12.954  22.807 3.725   1.00 0.00  ? 18  TYR A CA   1  
ATOM   315   C  C    . TYR A 1 18  ? 14.302  22.125 3.501   1.00 0.00  ? 18  TYR A C    1  
ATOM   316   O  O    . TYR A 1 18  ? 14.520  21.445 2.514   1.00 0.00  ? 18  TYR A O    1  
ATOM   317   C  CB   . TYR A 1 18  ? 12.051  21.902 4.562   1.00 0.00  ? 18  TYR A CB   1  
ATOM   318   C  CG   . TYR A 1 18  ? 11.940  20.538 3.924   1.00 0.00  ? 18  TYR A CG   1  
ATOM   319   C  CD1  . TYR A 1 18  ? 11.017  20.321 2.896   1.00 0.00  ? 18  TYR A CD1  1  
ATOM   320   C  CD2  . TYR A 1 18  ? 12.748  19.488 4.373   1.00 0.00  ? 18  TYR A CD2  1  
ATOM   321   C  CE1  . TYR A 1 18  ? 10.903  19.052 2.315   1.00 0.00  ? 18  TYR A CE1  1  
ATOM   322   C  CE2  . TYR A 1 18  ? 12.632  18.219 3.793   1.00 0.00  ? 18  TYR A CE2  1  
ATOM   323   C  CZ   . TYR A 1 18  ? 11.711  18.001 2.765   1.00 0.00  ? 18  TYR A CZ   1  
ATOM   324   O  OH   . TYR A 1 18  ? 11.597  16.750 2.194   1.00 0.00  ? 18  TYR A OH   1  
ATOM   325   H  H    . TYR A 1 18  ? 12.366  22.442 1.686   1.00 0.00  ? 18  TYR A H    1  
ATOM   326   H  HA   . TYR A 1 18  ? 13.112  23.736 4.252   1.00 0.00  ? 18  TYR A HA   1  
ATOM   327   H  HB2  . TYR A 1 18  ? 12.469  21.799 5.552   1.00 0.00  ? 18  TYR A HB2  1  
ATOM   328   H  HB3  . TYR A 1 18  ? 11.069  22.345 4.632   1.00 0.00  ? 18  TYR A HB3  1  
ATOM   329   H  HD1  . TYR A 1 18  ? 10.395  21.132 2.550   1.00 0.00  ? 18  TYR A HD1  1  
ATOM   330   H  HD2  . TYR A 1 18  ? 13.461  19.656 5.165   1.00 0.00  ? 18  TYR A HD2  1  
ATOM   331   H  HE1  . TYR A 1 18  ? 10.191  18.885 1.522   1.00 0.00  ? 18  TYR A HE1  1  
ATOM   332   H  HE2  . TYR A 1 18  ? 13.254  17.408 4.140   1.00 0.00  ? 18  TYR A HE2  1  
ATOM   333   H  HH   . TYR A 1 18  ? 12.316  16.643 1.568   1.00 0.00  ? 18  TYR A HH   1  
ATOM   334   N  N    . ARG A 1 19  ? 15.211  22.308 4.415   1.00 0.00  ? 19  ARG A N    1  
ATOM   335   C  CA   . ARG A 1 19  ? 16.552  21.685 4.268   1.00 0.00  ? 19  ARG A CA   1  
ATOM   336   C  C    . ARG A 1 19  ? 17.139  21.410 5.655   1.00 0.00  ? 19  ARG A C    1  
ATOM   337   O  O    . ARG A 1 19  ? 17.347  22.318 6.437   1.00 0.00  ? 19  ARG A O    1  
ATOM   338   C  CB   . ARG A 1 19  ? 17.468  22.654 3.515   1.00 0.00  ? 19  ARG A CB   1  
ATOM   339   C  CG   . ARG A 1 19  ? 18.910  22.138 3.544   1.00 0.00  ? 19  ARG A CG   1  
ATOM   340   C  CD   . ARG A 1 19  ? 18.945  20.680 3.086   1.00 0.00  ? 19  ARG A CD   1  
ATOM   341   N  NE   . ARG A 1 19  ? 20.358  20.269 2.840   1.00 0.00  ? 19  ARG A NE   1  
ATOM   342   C  CZ   . ARG A 1 19  ? 20.615  19.124 2.266   1.00 0.00  ? 19  ARG A CZ   1  
ATOM   343   N  NH1  . ARG A 1 19  ? 19.636  18.336 1.912   1.00 0.00  ? 19  ARG A NH1  1  
ATOM   344   N  NH2  . ARG A 1 19  ? 21.853  18.767 2.045   1.00 0.00  ? 19  ARG A NH2  1  
ATOM   345   H  H    . ARG A 1 19  ? 15.012  22.864 5.198   1.00 0.00  ? 19  ARG A H    1  
ATOM   346   H  HA   . ARG A 1 19  ? 16.466  20.762 3.712   1.00 0.00  ? 19  ARG A HA   1  
ATOM   347   H  HB2  . ARG A 1 19  ? 17.136  22.739 2.491   1.00 0.00  ? 19  ARG A HB2  1  
ATOM   348   H  HB3  . ARG A 1 19  ? 17.427  23.625 3.987   1.00 0.00  ? 19  ARG A HB3  1  
ATOM   349   H  HG2  . ARG A 1 19  ? 19.521  22.738 2.884   1.00 0.00  ? 19  ARG A HG2  1  
ATOM   350   H  HG3  . ARG A 1 19  ? 19.296  22.206 4.550   1.00 0.00  ? 19  ARG A HG3  1  
ATOM   351   H  HD2  . ARG A 1 19  ? 18.515  20.052 3.852   1.00 0.00  ? 19  ARG A HD2  1  
ATOM   352   H  HD3  . ARG A 1 19  ? 18.375  20.576 2.173   1.00 0.00  ? 19  ARG A HD3  1  
ATOM   353   H  HE   . ARG A 1 19  ? 21.094  20.859 3.106   1.00 0.00  ? 19  ARG A HE   1  
ATOM   354   H  HH11 . ARG A 1 19  ? 18.688  18.606 2.080   1.00 0.00  ? 19  ARG A HH11 1  
ATOM   355   H  HH12 . ARG A 1 19  ? 19.835  17.460 1.473   1.00 0.00  ? 19  ARG A HH12 1  
ATOM   356   H  HH21 . ARG A 1 19  ? 22.604  19.370 2.316   1.00 0.00  ? 19  ARG A HH21 1  
ATOM   357   H  HH22 . ARG A 1 19  ? 22.050  17.890 1.608   1.00 0.00  ? 19  ARG A HH22 1  
ATOM   358   N  N    . ILE A 1 20  ? 17.423  20.175 5.971   1.00 0.00  ? 20  ILE A N    1  
ATOM   359   C  CA   . ILE A 1 20  ? 18.014  19.886 7.305   1.00 0.00  ? 20  ILE A CA   1  
ATOM   360   C  C    . ILE A 1 20  ? 19.443  20.422 7.311   1.00 0.00  ? 20  ILE A C    1  
ATOM   361   O  O    . ILE A 1 20  ? 20.160  20.307 6.338   1.00 0.00  ? 20  ILE A O    1  
ATOM   362   C  CB   . ILE A 1 20  ? 18.031  18.379 7.571   1.00 0.00  ? 20  ILE A CB   1  
ATOM   363   C  CG1  . ILE A 1 20  ? 16.653  17.788 7.271   1.00 0.00  ? 20  ILE A CG1  1  
ATOM   364   C  CG2  . ILE A 1 20  ? 18.382  18.129 9.039   1.00 0.00  ? 20  ILE A CG2  1  
ATOM   365   C  CD1  . ILE A 1 20  ? 16.711  17.005 5.958   1.00 0.00  ? 20  ILE A CD1  1  
ATOM   366   H  H    . ILE A 1 20  ? 17.263  19.449 5.333   1.00 0.00  ? 20  ILE A H    1  
ATOM   367   H  HA   . ILE A 1 20  ? 17.438  20.385 8.071   1.00 0.00  ? 20  ILE A HA   1  
ATOM   368   H  HB   . ILE A 1 20  ? 18.773  17.908 6.941   1.00 0.00  ? 20  ILE A HB   1  
ATOM   369   H  HG12 . ILE A 1 20  ? 16.366  17.125 8.075   1.00 0.00  ? 20  ILE A HG12 1  
ATOM   370   H  HG13 . ILE A 1 20  ? 15.929  18.584 7.184   1.00 0.00  ? 20  ILE A HG13 1  
ATOM   371   H  HG21 . ILE A 1 20  ? 18.520  19.076 9.540   1.00 0.00  ? 20  ILE A HG21 1  
ATOM   372   H  HG22 . ILE A 1 20  ? 19.293  17.554 9.099   1.00 0.00  ? 20  ILE A HG22 1  
ATOM   373   H  HG23 . ILE A 1 20  ? 17.579  17.584 9.514   1.00 0.00  ? 20  ILE A HG23 1  
ATOM   374   H  HD11 . ILE A 1 20  ? 15.784  17.135 5.419   1.00 0.00  ? 20  ILE A HD11 1  
ATOM   375   H  HD12 . ILE A 1 20  ? 16.860  15.956 6.170   1.00 0.00  ? 20  ILE A HD12 1  
ATOM   376   H  HD13 . ILE A 1 20  ? 17.531  17.370 5.357   1.00 0.00  ? 20  ILE A HD13 1  
ATOM   377   N  N    . ILE A 1 21  ? 19.855  21.026 8.385   1.00 0.00  ? 21  ILE A N    1  
ATOM   378   C  CA   . ILE A 1 21  ? 21.230  21.590 8.437   1.00 0.00  ? 21  ILE A CA   1  
ATOM   379   C  C    . ILE A 1 21  ? 22.245  20.498 8.799   1.00 0.00  ? 21  ILE A C    1  
ATOM   380   O  O    . ILE A 1 21  ? 23.438  20.731 8.794   1.00 0.00  ? 21  ILE A O    1  
ATOM   381   C  CB   . ILE A 1 21  ? 21.266  22.701 9.483   1.00 0.00  ? 21  ILE A CB   1  
ATOM   382   C  CG1  . ILE A 1 21  ? 20.425  23.884 8.999   1.00 0.00  ? 21  ILE A CG1  1  
ATOM   383   C  CG2  . ILE A 1 21  ? 22.708  23.156 9.710   1.00 0.00  ? 21  ILE A CG2  1  
ATOM   384   C  CD1  . ILE A 1 21  ? 21.077  24.508 7.766   1.00 0.00  ? 21  ILE A CD1  1  
ATOM   385   H  H    . ILE A 1 21  ? 19.256  21.125 9.152   1.00 0.00  ? 21  ILE A H    1  
ATOM   386   H  HA   . ILE A 1 21  ? 21.482  22.005 7.471   1.00 0.00  ? 21  ILE A HA   1  
ATOM   387   H  HB   . ILE A 1 21  ? 20.859  22.328 10.408  1.00 0.00  ? 21  ILE A HB   1  
ATOM   388   H  HG12 . ILE A 1 21  ? 19.433  23.538 8.747   1.00 0.00  ? 21  ILE A HG12 1  
ATOM   389   H  HG13 . ILE A 1 21  ? 20.360  24.623 9.783   1.00 0.00  ? 21  ILE A HG13 1  
ATOM   390   H  HG21 . ILE A 1 21  ? 23.231  23.186 8.766   1.00 0.00  ? 21  ILE A HG21 1  
ATOM   391   H  HG22 . ILE A 1 21  ? 23.202  22.462 10.373  1.00 0.00  ? 21  ILE A HG22 1  
ATOM   392   H  HG23 . ILE A 1 21  ? 22.710  24.140 10.155  1.00 0.00  ? 21  ILE A HG23 1  
ATOM   393   H  HD11 . ILE A 1 21  ? 21.338  25.534 7.978   1.00 0.00  ? 21  ILE A HD11 1  
ATOM   394   H  HD12 . ILE A 1 21  ? 20.386  24.476 6.937   1.00 0.00  ? 21  ILE A HD12 1  
ATOM   395   H  HD13 . ILE A 1 21  ? 21.969  23.955 7.512   1.00 0.00  ? 21  ILE A HD13 1  
ATOM   396   N  N    . GLY A 1 22  ? 21.797  19.308 9.111   1.00 0.00  ? 22  GLY A N    1  
ATOM   397   C  CA   . GLY A 1 22  ? 22.769  18.232 9.461   1.00 0.00  ? 22  GLY A CA   1  
ATOM   398   C  C    . GLY A 1 22  ? 22.035  16.982 9.963   1.00 0.00  ? 22  GLY A C    1  
ATOM   399   O  O    . GLY A 1 22  ? 21.548  16.938 11.075  1.00 0.00  ? 22  GLY A O    1  
ATOM   400   H  H    . GLY A 1 22  ? 20.835  19.124 9.113   1.00 0.00  ? 22  GLY A H    1  
ATOM   401   H  HA2  . GLY A 1 22  ? 23.348  17.978 8.584   1.00 0.00  ? 22  GLY A HA2  1  
ATOM   402   H  HA3  . GLY A 1 22  ? 23.432  18.589 10.234  1.00 0.00  ? 22  GLY A HA3  1  
ATOM   403   N  N    . TYR A 1 23  ? 21.970  15.960 9.152   1.00 0.00  ? 23  TYR A N    1  
ATOM   404   C  CA   . TYR A 1 23  ? 21.287  14.701 9.580   1.00 0.00  ? 23  TYR A CA   1  
ATOM   405   C  C    . TYR A 1 23  ? 21.854  14.251 10.933  1.00 0.00  ? 23  TYR A C    1  
ATOM   406   O  O    . TYR A 1 23  ? 22.861  14.756 11.390  1.00 0.00  ? 23  TYR A O    1  
ATOM   407   C  CB   . TYR A 1 23  ? 21.541  13.602 8.540   1.00 0.00  ? 23  TYR A CB   1  
ATOM   408   C  CG   . TYR A 1 23  ? 20.574  13.743 7.381   1.00 0.00  ? 23  TYR A CG   1  
ATOM   409   C  CD1  . TYR A 1 23  ? 20.102  15.008 7.006   1.00 0.00  ? 23  TYR A CD1  1  
ATOM   410   C  CD2  . TYR A 1 23  ? 20.157  12.606 6.673   1.00 0.00  ? 23  TYR A CD2  1  
ATOM   411   C  CE1  . TYR A 1 23  ? 19.218  15.134 5.928   1.00 0.00  ? 23  TYR A CE1  1  
ATOM   412   C  CE2  . TYR A 1 23  ? 19.270  12.736 5.597   1.00 0.00  ? 23  TYR A CE2  1  
ATOM   413   C  CZ   . TYR A 1 23  ? 18.801  14.000 5.224   1.00 0.00  ? 23  TYR A CZ   1  
ATOM   414   O  OH   . TYR A 1 23  ? 17.931  14.129 4.159   1.00 0.00  ? 23  TYR A OH   1  
ATOM   415   H  H    . TYR A 1 23  ? 22.379  16.017 8.265   1.00 0.00  ? 23  TYR A H    1  
ATOM   416   H  HA   . TYR A 1 23  ? 20.225  14.876 9.671   1.00 0.00  ? 23  TYR A HA   1  
ATOM   417   H  HB2  . TYR A 1 23  ? 22.554  13.686 8.172   1.00 0.00  ? 23  TYR A HB2  1  
ATOM   418   H  HB3  . TYR A 1 23  ? 21.408  12.636 9.002   1.00 0.00  ? 23  TYR A HB3  1  
ATOM   419   H  HD1  . TYR A 1 23  ? 20.416  15.885 7.546   1.00 0.00  ? 23  TYR A HD1  1  
ATOM   420   H  HD2  . TYR A 1 23  ? 20.512  11.628 6.959   1.00 0.00  ? 23  TYR A HD2  1  
ATOM   421   H  HE1  . TYR A 1 23  ? 18.856  16.108 5.639   1.00 0.00  ? 23  TYR A HE1  1  
ATOM   422   H  HE2  . TYR A 1 23  ? 18.948  11.859 5.054   1.00 0.00  ? 23  TYR A HE2  1  
ATOM   423   H  HH   . TYR A 1 23  ? 18.288  13.626 3.423   1.00 0.00  ? 23  TYR A HH   1  
ATOM   424   N  N    . THR A 1 24  ? 21.219  13.306 11.577  1.00 0.00  ? 24  THR A N    1  
ATOM   425   C  CA   . THR A 1 24  ? 21.733  12.829 12.898  1.00 0.00  ? 24  THR A CA   1  
ATOM   426   C  C    . THR A 1 24  ? 22.294  11.404 12.754  1.00 0.00  ? 24  THR A C    1  
ATOM   427   O  O    . THR A 1 24  ? 21.828  10.637 11.935  1.00 0.00  ? 24  THR A O    1  
ATOM   428   C  CB   . THR A 1 24  ? 20.597  12.841 13.925  1.00 0.00  ? 24  THR A CB   1  
ATOM   429   O  OG1  . THR A 1 24  ? 21.148  12.781 15.231  1.00 0.00  ? 24  THR A OG1  1  
ATOM   430   C  CG2  . THR A 1 24  ? 19.684  11.637 13.702  1.00 0.00  ? 24  THR A CG2  1  
ATOM   431   H  H    . THR A 1 24  ? 20.409  12.911 11.194  1.00 0.00  ? 24  THR A H    1  
ATOM   432   H  HA   . THR A 1 24  ? 22.521  13.487 13.230  1.00 0.00  ? 24  THR A HA   1  
ATOM   433   H  HB   . THR A 1 24  ? 20.023  13.749 13.818  1.00 0.00  ? 24  THR A HB   1  
ATOM   434   H  HG1  . THR A 1 24  ? 21.181  13.673 15.581  1.00 0.00  ? 24  THR A HG1  1  
ATOM   435   H  HG21 . THR A 1 24  ? 18.894  11.639 14.439  1.00 0.00  ? 24  THR A HG21 1  
ATOM   436   H  HG22 . THR A 1 24  ? 20.262  10.730 13.797  1.00 0.00  ? 24  THR A HG22 1  
ATOM   437   H  HG23 . THR A 1 24  ? 19.255  11.690 12.713  1.00 0.00  ? 24  THR A HG23 1  
ATOM   438   N  N    . PRO A 1 25  ? 23.290  11.100 13.550  1.00 0.00  ? 25  PRO A N    1  
ATOM   439   C  CA   . PRO A 1 25  ? 23.956  9.781  13.534  1.00 0.00  ? 25  PRO A CA   1  
ATOM   440   C  C    . PRO A 1 25  ? 23.174  8.743  14.349  1.00 0.00  ? 25  PRO A C    1  
ATOM   441   O  O    . PRO A 1 25  ? 23.122  7.580  14.000  1.00 0.00  ? 25  PRO A O    1  
ATOM   442   C  CB   . PRO A 1 25  ? 25.305  10.062 14.197  1.00 0.00  ? 25  PRO A CB   1  
ATOM   443   C  CG   . PRO A 1 25  ? 25.122  11.339 15.053  1.00 0.00  ? 25  PRO A CG   1  
ATOM   444   C  CD   . PRO A 1 25  ? 23.855  12.047 14.532  1.00 0.00  ? 25  PRO A CD   1  
ATOM   445   H  HA   . PRO A 1 25  ? 24.105  9.442  12.526  1.00 0.00  ? 25  PRO A HA   1  
ATOM   446   H  HB2  . PRO A 1 25  ? 25.584  9.228  14.827  1.00 0.00  ? 25  PRO A HB2  1  
ATOM   447   H  HB3  . PRO A 1 25  ? 26.060  10.232 13.447  1.00 0.00  ? 25  PRO A HB3  1  
ATOM   448   H  HG2  . PRO A 1 25  ? 25.001  11.071 16.093  1.00 0.00  ? 25  PRO A HG2  1  
ATOM   449   H  HG3  . PRO A 1 25  ? 25.976  11.988 14.933  1.00 0.00  ? 25  PRO A HG3  1  
ATOM   450   H  HD2  . PRO A 1 25  ? 23.159  12.218 15.341  1.00 0.00  ? 25  PRO A HD2  1  
ATOM   451   H  HD3  . PRO A 1 25  ? 24.110  12.976 14.048  1.00 0.00  ? 25  PRO A HD3  1  
ATOM   452   N  N    . ASP A 1 26  ? 22.583  9.148  15.435  1.00 0.00  ? 26  ASP A N    1  
ATOM   453   C  CA   . ASP A 1 26  ? 21.821  8.177  16.275  1.00 0.00  ? 26  ASP A CA   1  
ATOM   454   C  C    . ASP A 1 26  ? 20.994  7.248  15.382  1.00 0.00  ? 26  ASP A C    1  
ATOM   455   O  O    . ASP A 1 26  ? 20.690  6.130  15.750  1.00 0.00  ? 26  ASP A O    1  
ATOM   456   C  CB   . ASP A 1 26  ? 20.890  8.936  17.219  1.00 0.00  ? 26  ASP A CB   1  
ATOM   457   C  CG   . ASP A 1 26  ? 20.264  10.112 16.479  1.00 0.00  ? 26  ASP A CG   1  
ATOM   458   O  OD1  . ASP A 1 26  ? 19.505  9.869  15.555  1.00 0.00  ? 26  ASP A OD1  1  
ATOM   459   O  OD2  . ASP A 1 26  ? 20.555  11.235 16.849  1.00 0.00  ? 26  ASP A OD2  1  
ATOM   460   H  H    . ASP A 1 26  ? 22.652  10.087 15.704  1.00 0.00  ? 26  ASP A H    1  
ATOM   461   H  HA   . ASP A 1 26  ? 22.515  7.588  16.858  1.00 0.00  ? 26  ASP A HA   1  
ATOM   462   H  HB2  . ASP A 1 26  ? 20.112  8.272  17.567  1.00 0.00  ? 26  ASP A HB2  1  
ATOM   463   H  HB3  . ASP A 1 26  ? 21.455  9.304  18.062  1.00 0.00  ? 26  ASP A HB3  1  
ATOM   464   N  N    . LEU A 1 27  ? 20.626  7.694  14.213  1.00 0.00  ? 27  LEU A N    1  
ATOM   465   C  CA   . LEU A 1 27  ? 19.819  6.828  13.312  1.00 0.00  ? 27  LEU A CA   1  
ATOM   466   C  C    . LEU A 1 27  ? 20.449  6.825  11.916  1.00 0.00  ? 27  LEU A C    1  
ATOM   467   O  O    . LEU A 1 27  ? 21.309  7.627  11.610  1.00 0.00  ? 27  LEU A O    1  
ATOM   468   C  CB   . LEU A 1 27  ? 18.379  7.368  13.266  1.00 0.00  ? 27  LEU A CB   1  
ATOM   469   C  CG   . LEU A 1 27  ? 18.133  8.138  11.970  1.00 0.00  ? 27  LEU A CG   1  
ATOM   470   C  CD1  . LEU A 1 27  ? 16.709  8.683  11.973  1.00 0.00  ? 27  LEU A CD1  1  
ATOM   471   C  CD2  . LEU A 1 27  ? 19.129  9.295  11.867  1.00 0.00  ? 27  LEU A CD2  1  
ATOM   472   H  H    . LEU A 1 27  ? 20.873  8.598  13.929  1.00 0.00  ? 27  LEU A H    1  
ATOM   473   H  HA   . LEU A 1 27  ? 19.806  5.824  13.693  1.00 0.00  ? 27  LEU A HA   1  
ATOM   474   H  HB2  . LEU A 1 27  ? 17.685  6.543  13.324  1.00 0.00  ? 27  LEU A HB2  1  
ATOM   475   H  HB3  . LEU A 1 27  ? 18.219  8.027  14.106  1.00 0.00  ? 27  LEU A HB3  1  
ATOM   476   H  HG   . LEU A 1 27  ? 18.264  7.468  11.134  1.00 0.00  ? 27  LEU A HG   1  
ATOM   477   H  HD11 . LEU A 1 27  ? 16.348  8.742  10.960  1.00 0.00  ? 27  LEU A HD11 1  
ATOM   478   H  HD12 . LEU A 1 27  ? 16.702  9.666  12.420  1.00 0.00  ? 27  LEU A HD12 1  
ATOM   479   H  HD13 . LEU A 1 27  ? 16.074  8.022  12.546  1.00 0.00  ? 27  LEU A HD13 1  
ATOM   480   H  HD21 . LEU A 1 27  ? 18.593  10.225 11.764  1.00 0.00  ? 27  LEU A HD21 1  
ATOM   481   H  HD22 . LEU A 1 27  ? 19.767  9.147  11.007  1.00 0.00  ? 27  LEU A HD22 1  
ATOM   482   H  HD23 . LEU A 1 27  ? 19.733  9.326  12.756  1.00 0.00  ? 27  LEU A HD23 1  
ATOM   483   N  N    . ASP A 1 28  ? 20.015  5.944  11.062  1.00 0.00  ? 28  ASP A N    1  
ATOM   484   C  CA   . ASP A 1 28  ? 20.579  5.913  9.690   1.00 0.00  ? 28  ASP A CA   1  
ATOM   485   C  C    . ASP A 1 28  ? 20.376  7.276  9.046   1.00 0.00  ? 28  ASP A C    1  
ATOM   486   O  O    . ASP A 1 28  ? 19.403  7.951  9.314   1.00 0.00  ? 28  ASP A O    1  
ATOM   487   C  CB   . ASP A 1 28  ? 19.879  4.827  8.871   1.00 0.00  ? 28  ASP A CB   1  
ATOM   488   C  CG   . ASP A 1 28  ? 20.925  3.935  8.203   1.00 0.00  ? 28  ASP A CG   1  
ATOM   489   O  OD1  . ASP A 1 28  ? 22.075  4.002  8.601   1.00 0.00  ? 28  ASP A OD1  1  
ATOM   490   O  OD2  . ASP A 1 28  ? 20.556  3.200  7.304   1.00 0.00  ? 28  ASP A OD2  1  
ATOM   491   H  H    . ASP A 1 28  ? 19.310  5.312  11.318  1.00 0.00  ? 28  ASP A H    1  
ATOM   492   H  HA   . ASP A 1 28  ? 21.624  5.709  9.723   1.00 0.00  ? 28  ASP A HA   1  
ATOM   493   H  HB2  . ASP A 1 28  ? 19.261  4.227  9.522   1.00 0.00  ? 28  ASP A HB2  1  
ATOM   494   H  HB3  . ASP A 1 28  ? 19.266  5.282  8.115   1.00 0.00  ? 28  ASP A HB3  1  
ATOM   495   N  N    . PRO A 1 29  ? 21.303  7.638  8.204   1.00 0.00  ? 29  PRO A N    1  
ATOM   496   C  CA   . PRO A 1 29  ? 21.249  8.918  7.495   1.00 0.00  ? 29  PRO A CA   1  
ATOM   497   C  C    . PRO A 1 29  ? 20.122  8.822  6.491   1.00 0.00  ? 29  PRO A C    1  
ATOM   498   O  O    . PRO A 1 29  ? 19.273  9.686  6.393   1.00 0.00  ? 29  PRO A O    1  
ATOM   499   C  CB   . PRO A 1 29  ? 22.624  9.028  6.831   1.00 0.00  ? 29  PRO A CB   1  
ATOM   500   C  CG   . PRO A 1 29  ? 23.180  7.586  6.753   1.00 0.00  ? 29  PRO A CG   1  
ATOM   501   C  CD   . PRO A 1 29  ? 22.464  6.792  7.857   1.00 0.00  ? 29  PRO A CD   1  
ATOM   502   H  HA   . PRO A 1 29  ? 21.089  9.733  8.181   1.00 0.00  ? 29  PRO A HA   1  
ATOM   503   H  HB2  . PRO A 1 29  ? 22.523  9.447  5.838   1.00 0.00  ? 29  PRO A HB2  1  
ATOM   504   H  HB3  . PRO A 1 29  ? 23.279  9.638  7.431   1.00 0.00  ? 29  PRO A HB3  1  
ATOM   505   H  HG2  . PRO A 1 29  ? 22.966  7.155  5.784   1.00 0.00  ? 29  PRO A HG2  1  
ATOM   506   H  HG3  . PRO A 1 29  ? 24.242  7.586  6.936   1.00 0.00  ? 29  PRO A HG3  1  
ATOM   507   H  HD2  . PRO A 1 29  ? 22.138  5.831  7.481   1.00 0.00  ? 29  PRO A HD2  1  
ATOM   508   H  HD3  . PRO A 1 29  ? 23.106  6.668  8.714   1.00 0.00  ? 29  PRO A HD3  1  
ATOM   509   N  N    . GLU A 1 30  ? 20.077  7.733  5.786   1.00 0.00  ? 30  GLU A N    1  
ATOM   510   C  CA   . GLU A 1 30  ? 18.973  7.527  4.834   1.00 0.00  ? 30  GLU A CA   1  
ATOM   511   C  C    . GLU A 1 30  ? 17.707  7.309  5.659   1.00 0.00  ? 30  GLU A C    1  
ATOM   512   O  O    . GLU A 1 30  ? 16.605  7.497  5.181   1.00 0.00  ? 30  GLU A O    1  
ATOM   513   C  CB   . GLU A 1 30  ? 19.247  6.288  3.979   1.00 0.00  ? 30  GLU A CB   1  
ATOM   514   C  CG   . GLU A 1 30  ? 19.602  5.115  4.893   1.00 0.00  ? 30  GLU A CG   1  
ATOM   515   C  CD   . GLU A 1 30  ? 19.011  3.826  4.322   1.00 0.00  ? 30  GLU A CD   1  
ATOM   516   O  OE1  . GLU A 1 30  ? 19.394  3.459  3.223   1.00 0.00  ? 30  GLU A OE1  1  
ATOM   517   O  OE2  . GLU A 1 30  ? 18.186  3.225  4.992   1.00 0.00  ? 30  GLU A OE2  1  
ATOM   518   H  H    . GLU A 1 30  ? 20.750  7.034  5.920   1.00 0.00  ? 30  GLU A H    1  
ATOM   519   H  HA   . GLU A 1 30  ? 18.860  8.396  4.203   1.00 0.00  ? 30  GLU A HA   1  
ATOM   520   H  HB2  . GLU A 1 30  ? 18.366  6.045  3.403   1.00 0.00  ? 30  GLU A HB2  1  
ATOM   521   H  HB3  . GLU A 1 30  ? 20.072  6.483  3.312   1.00 0.00  ? 30  GLU A HB3  1  
ATOM   522   H  HG2  . GLU A 1 30  ? 20.676  5.022  4.956   1.00 0.00  ? 30  GLU A HG2  1  
ATOM   523   H  HG3  . GLU A 1 30  ? 19.196  5.290  5.878   1.00 0.00  ? 30  GLU A HG3  1  
ATOM   524   N  N    . THR A 1 31  ? 17.854  6.919  6.911   1.00 0.00  ? 31  THR A N    1  
ATOM   525   C  CA   . THR A 1 31  ? 16.640  6.702  7.750   1.00 0.00  ? 31  THR A CA   1  
ATOM   526   C  C    . THR A 1 31  ? 16.088  8.052  8.188   1.00 0.00  ? 31  THR A C    1  
ATOM   527   O  O    . THR A 1 31  ? 14.918  8.334  8.023   1.00 0.00  ? 31  THR A O    1  
ATOM   528   C  CB   . THR A 1 31  ? 16.977  5.869  8.982   1.00 0.00  ? 31  THR A CB   1  
ATOM   529   O  OG1  . THR A 1 31  ? 17.348  4.557  8.580   1.00 0.00  ? 31  THR A OG1  1  
ATOM   530   C  CG2  . THR A 1 31  ? 15.745  5.806  9.887   1.00 0.00  ? 31  THR A CG2  1  
ATOM   531   H  H    . THR A 1 31  ? 18.761  6.777  7.297   1.00 0.00  ? 31  THR A H    1  
ATOM   532   H  HA   . THR A 1 31  ? 15.892  6.187  7.166   1.00 0.00  ? 31  THR A HA   1  
ATOM   533   H  HB   . THR A 1 31  ? 17.790  6.330  9.518   1.00 0.00  ? 31  THR A HB   1  
ATOM   534   H  HG1  . THR A 1 31  ? 16.572  3.997  8.645   1.00 0.00  ? 31  THR A HG1  1  
ATOM   535   H  HG21 . THR A 1 31  ? 15.733  6.665  10.543  1.00 0.00  ? 31  THR A HG21 1  
ATOM   536   H  HG22 . THR A 1 31  ? 15.775  4.903  10.477  1.00 0.00  ? 31  THR A HG22 1  
ATOM   537   H  HG23 . THR A 1 31  ? 14.851  5.808  9.278   1.00 0.00  ? 31  THR A HG23 1  
ATOM   538   N  N    . VAL A 1 32  ? 16.922  8.906  8.722   1.00 0.00  ? 32  VAL A N    1  
ATOM   539   C  CA   . VAL A 1 32  ? 16.433  10.241 9.131   1.00 0.00  ? 32  VAL A CA   1  
ATOM   540   C  C    . VAL A 1 32  ? 15.785  10.860 7.895   1.00 0.00  ? 32  VAL A C    1  
ATOM   541   O  O    . VAL A 1 32  ? 14.803  11.571 7.966   1.00 0.00  ? 32  VAL A O    1  
ATOM   542   C  CB   . VAL A 1 32  ? 17.631  11.077 9.620   1.00 0.00  ? 32  VAL A CB   1  
ATOM   543   C  CG1  . VAL A 1 32  ? 18.167  11.958 8.495   1.00 0.00  ? 32  VAL A CG1  1  
ATOM   544   C  CG2  . VAL A 1 32  ? 17.198  11.957 10.793  1.00 0.00  ? 32  VAL A CG2  1  
ATOM   545   H  H    . VAL A 1 32  ? 17.868  8.679  8.827   1.00 0.00  ? 32  VAL A H    1  
ATOM   546   H  HA   . VAL A 1 32  ? 15.702  10.142 9.919   1.00 0.00  ? 32  VAL A HA   1  
ATOM   547   H  HB   . VAL A 1 32  ? 18.417  10.411 9.943   1.00 0.00  ? 32  VAL A HB   1  
ATOM   548   H  HG11 . VAL A 1 32  ? 19.053  12.475 8.833   1.00 0.00  ? 32  VAL A HG11 1  
ATOM   549   H  HG12 . VAL A 1 32  ? 17.413  12.677 8.212   1.00 0.00  ? 32  VAL A HG12 1  
ATOM   550   H  HG13 . VAL A 1 32  ? 18.413  11.339 7.644   1.00 0.00  ? 32  VAL A HG13 1  
ATOM   551   H  HG21 . VAL A 1 32  ? 16.709  11.347 11.538  1.00 0.00  ? 32  VAL A HG21 1  
ATOM   552   H  HG22 . VAL A 1 32  ? 16.515  12.715 10.441  1.00 0.00  ? 32  VAL A HG22 1  
ATOM   553   H  HG23 . VAL A 1 32  ? 18.067  12.428 11.228  1.00 0.00  ? 32  VAL A HG23 1  
ATOM   554   N  N    . ASP A 1 33  ? 16.345  10.556 6.757   1.00 0.00  ? 33  ASP A N    1  
ATOM   555   C  CA   . ASP A 1 33  ? 15.805  11.073 5.477   1.00 0.00  ? 33  ASP A CA   1  
ATOM   556   C  C    . ASP A 1 33  ? 14.374  10.560 5.295   1.00 0.00  ? 33  ASP A C    1  
ATOM   557   O  O    . ASP A 1 33  ? 13.502  11.268 4.830   1.00 0.00  ? 33  ASP A O    1  
ATOM   558   C  CB   . ASP A 1 33  ? 16.667  10.543 4.329   1.00 0.00  ? 33  ASP A CB   1  
ATOM   559   C  CG   . ASP A 1 33  ? 16.538  11.463 3.118   1.00 0.00  ? 33  ASP A CG   1  
ATOM   560   O  OD1  . ASP A 1 33  ? 16.018  12.553 3.280   1.00 0.00  ? 33  ASP A OD1  1  
ATOM   561   O  OD2  . ASP A 1 33  ? 16.960  11.059 2.046   1.00 0.00  ? 33  ASP A OD2  1  
ATOM   562   H  H    . ASP A 1 33  ? 17.127  9.966  6.747   1.00 0.00  ? 33  ASP A H    1  
ATOM   563   H  HA   . ASP A 1 33  ? 15.825  12.156 5.481   1.00 0.00  ? 33  ASP A HA   1  
ATOM   564   H  HB2  . ASP A 1 33  ? 17.699  10.501 4.643   1.00 0.00  ? 33  ASP A HB2  1  
ATOM   565   H  HB3  . ASP A 1 33  ? 16.332  9.552  4.060   1.00 0.00  ? 33  ASP A HB3  1  
ATOM   566   N  N    . ASP A 1 34  ? 14.132  9.322  5.650   1.00 0.00  ? 34  ASP A N    1  
ATOM   567   C  CA   . ASP A 1 34  ? 12.767  8.753  5.491   1.00 0.00  ? 34  ASP A CA   1  
ATOM   568   C  C    . ASP A 1 34  ? 11.871  9.260  6.617   1.00 0.00  ? 34  ASP A C    1  
ATOM   569   O  O    . ASP A 1 34  ? 10.743  9.654  6.396   1.00 0.00  ? 34  ASP A O    1  
ATOM   570   C  CB   . ASP A 1 34  ? 12.848  7.228  5.552   1.00 0.00  ? 34  ASP A CB   1  
ATOM   571   C  CG   . ASP A 1 34  ? 12.162  6.627  4.327   1.00 0.00  ? 34  ASP A CG   1  
ATOM   572   O  OD1  . ASP A 1 34  ? 11.005  6.941  4.107   1.00 0.00  ? 34  ASP A OD1  1  
ATOM   573   O  OD2  . ASP A 1 34  ? 12.806  5.859  3.632   1.00 0.00  ? 34  ASP A OD2  1  
ATOM   574   H  H    . ASP A 1 34  ? 14.853  8.764  6.018   1.00 0.00  ? 34  ASP A H    1  
ATOM   575   H  HA   . ASP A 1 34  ? 12.358  9.056  4.538   1.00 0.00  ? 34  ASP A HA   1  
ATOM   576   H  HB2  . ASP A 1 34  ? 13.886  6.925  5.568   1.00 0.00  ? 34  ASP A HB2  1  
ATOM   577   H  HB3  . ASP A 1 34  ? 12.356  6.878  6.446   1.00 0.00  ? 34  ASP A HB3  1  
ATOM   578   N  N    . ALA A 1 35  ? 12.363  9.256  7.824   1.00 0.00  ? 35  ALA A N    1  
ATOM   579   C  CA   . ALA A 1 35  ? 11.535  9.741  8.963   1.00 0.00  ? 35  ALA A CA   1  
ATOM   580   C  C    . ALA A 1 35  ? 11.012  11.140 8.643   1.00 0.00  ? 35  ALA A C    1  
ATOM   581   O  O    . ALA A 1 35  ? 9.955   11.537 9.091   1.00 0.00  ? 35  ALA A O    1  
ATOM   582   C  CB   . ALA A 1 35  ? 12.385  9.790  10.233  1.00 0.00  ? 35  ALA A CB   1  
ATOM   583   H  H    . ALA A 1 35  ? 13.277  8.935  7.982   1.00 0.00  ? 35  ALA A H    1  
ATOM   584   H  HA   . ALA A 1 35  ? 10.701  9.071  9.113   1.00 0.00  ? 35  ALA A HA   1  
ATOM   585   H  HB1  . ALA A 1 35  ? 13.130  10.566 10.138  1.00 0.00  ? 35  ALA A HB1  1  
ATOM   586   H  HB2  . ALA A 1 35  ? 12.873  8.837  10.375  1.00 0.00  ? 35  ALA A HB2  1  
ATOM   587   H  HB3  . ALA A 1 35  ? 11.751  10.000 11.081  1.00 0.00  ? 35  ALA A HB3  1  
ATOM   588   N  N    . PHE A 1 36  ? 11.743  11.890 7.865   1.00 0.00  ? 36  PHE A N    1  
ATOM   589   C  CA   . PHE A 1 36  ? 11.282  13.260 7.513   1.00 0.00  ? 36  PHE A CA   1  
ATOM   590   C  C    . PHE A 1 36  ? 10.293  13.168 6.352   1.00 0.00  ? 36  PHE A C    1  
ATOM   591   O  O    . PHE A 1 36  ? 9.254   13.797 6.361   1.00 0.00  ? 36  PHE A O    1  
ATOM   592   C  CB   . PHE A 1 36  ? 12.482  14.122 7.110   1.00 0.00  ? 36  PHE A CB   1  
ATOM   593   C  CG   . PHE A 1 36  ? 12.950  14.911 8.309   1.00 0.00  ? 36  PHE A CG   1  
ATOM   594   C  CD1  . PHE A 1 36  ? 12.020  15.586 9.108   1.00 0.00  ? 36  PHE A CD1  1  
ATOM   595   C  CD2  . PHE A 1 36  ? 14.313  14.965 8.625   1.00 0.00  ? 36  PHE A CD2  1  
ATOM   596   C  CE1  . PHE A 1 36  ? 12.451  16.316 10.223  1.00 0.00  ? 36  PHE A CE1  1  
ATOM   597   C  CE2  . PHE A 1 36  ? 14.744  15.696 9.739   1.00 0.00  ? 36  PHE A CE2  1  
ATOM   598   C  CZ   . PHE A 1 36  ? 13.814  16.371 10.538  1.00 0.00  ? 36  PHE A CZ   1  
ATOM   599   H  H    . PHE A 1 36  ? 12.590  11.551 7.509   1.00 0.00  ? 36  PHE A H    1  
ATOM   600   H  HA   . PHE A 1 36  ? 10.792  13.703 8.367   1.00 0.00  ? 36  PHE A HA   1  
ATOM   601   H  HB2  . PHE A 1 36  ? 13.282  13.487 6.759   1.00 0.00  ? 36  PHE A HB2  1  
ATOM   602   H  HB3  . PHE A 1 36  ? 12.189  14.802 6.324   1.00 0.00  ? 36  PHE A HB3  1  
ATOM   603   H  HD1  . PHE A 1 36  ? 10.968  15.545 8.864   1.00 0.00  ? 36  PHE A HD1  1  
ATOM   604   H  HD2  . PHE A 1 36  ? 15.031  14.443 8.010   1.00 0.00  ? 36  PHE A HD2  1  
ATOM   605   H  HE1  . PHE A 1 36  ? 11.734  16.834 10.839  1.00 0.00  ? 36  PHE A HE1  1  
ATOM   606   H  HE2  . PHE A 1 36  ? 15.795  15.739 9.980   1.00 0.00  ? 36  PHE A HE2  1  
ATOM   607   H  HZ   . PHE A 1 36  ? 14.146  16.934 11.399  1.00 0.00  ? 36  PHE A HZ   1  
ATOM   608   N  N    . ALA A 1 37  ? 10.594  12.375 5.357   1.00 0.00  ? 37  ALA A N    1  
ATOM   609   C  CA   . ALA A 1 37  ? 9.650   12.239 4.216   1.00 0.00  ? 37  ALA A CA   1  
ATOM   610   C  C    . ALA A 1 37  ? 8.330   11.686 4.755   1.00 0.00  ? 37  ALA A C    1  
ATOM   611   O  O    . ALA A 1 37  ? 7.279   12.261 4.555   1.00 0.00  ? 37  ALA A O    1  
ATOM   612   C  CB   . ALA A 1 37  ? 10.229  11.284 3.172   1.00 0.00  ? 37  ALA A CB   1  
ATOM   613   H  H    . ALA A 1 37  ? 11.430  11.862 5.369   1.00 0.00  ? 37  ALA A H    1  
ATOM   614   H  HA   . ALA A 1 37  ? 9.481   13.210 3.770   1.00 0.00  ? 37  ALA A HA   1  
ATOM   615   H  HB1  . ALA A 1 37  ? 10.765  11.851 2.424   1.00 0.00  ? 37  ALA A HB1  1  
ATOM   616   H  HB2  . ALA A 1 37  ? 9.428   10.736 2.701   1.00 0.00  ? 37  ALA A HB2  1  
ATOM   617   H  HB3  . ALA A 1 37  ? 10.905  10.593 3.652   1.00 0.00  ? 37  ALA A HB3  1  
ATOM   618   N  N    . ARG A 1 38  ? 8.377   10.590 5.470   1.00 0.00  ? 38  ARG A N    1  
ATOM   619   C  CA   . ARG A 1 38  ? 7.119   10.041 6.043   1.00 0.00  ? 38  ARG A CA   1  
ATOM   620   C  C    . ARG A 1 38  ? 6.426   11.179 6.785   1.00 0.00  ? 38  ARG A C    1  
ATOM   621   O  O    . ARG A 1 38  ? 5.315   11.557 6.470   1.00 0.00  ? 38  ARG A O    1  
ATOM   622   C  CB   . ARG A 1 38  ? 7.436   8.907  7.024   1.00 0.00  ? 38  ARG A CB   1  
ATOM   623   C  CG   . ARG A 1 38  ? 6.605   7.672  6.669   1.00 0.00  ? 38  ARG A CG   1  
ATOM   624   C  CD   . ARG A 1 38  ? 7.387   6.409  7.036   1.00 0.00  ? 38  ARG A CD   1  
ATOM   625   N  NE   . ARG A 1 38  ? 8.172   5.954  5.857   1.00 0.00  ? 38  ARG A NE   1  
ATOM   626   C  CZ   . ARG A 1 38  ? 7.556   5.441  4.824   1.00 0.00  ? 38  ARG A CZ   1  
ATOM   627   N  NH1  . ARG A 1 38  ? 6.255   5.317  4.837   1.00 0.00  ? 38  ARG A NH1  1  
ATOM   628   N  NH2  . ARG A 1 38  ? 8.237   5.051  3.780   1.00 0.00  ? 38  ARG A NH2  1  
ATOM   629   H  H    . ARG A 1 38  ? 9.234   10.151 5.647   1.00 0.00  ? 38  ARG A H    1  
ATOM   630   H  HA   . ARG A 1 38  ? 6.481   9.676  5.250   1.00 0.00  ? 38  ARG A HA   1  
ATOM   631   H  HB2  . ARG A 1 38  ? 8.487   8.663  6.970   1.00 0.00  ? 38  ARG A HB2  1  
ATOM   632   H  HB3  . ARG A 1 38  ? 7.191   9.223  8.027   1.00 0.00  ? 38  ARG A HB3  1  
ATOM   633   H  HG2  . ARG A 1 38  ? 5.676   7.693  7.220   1.00 0.00  ? 38  ARG A HG2  1  
ATOM   634   H  HG3  . ARG A 1 38  ? 6.398   7.669  5.610   1.00 0.00  ? 38  ARG A HG3  1  
ATOM   635   H  HD2  . ARG A 1 38  ? 8.057   6.622  7.856   1.00 0.00  ? 38  ARG A HD2  1  
ATOM   636   H  HD3  . ARG A 1 38  ? 6.697   5.631  7.329   1.00 0.00  ? 38  ARG A HD3  1  
ATOM   637   H  HE   . ARG A 1 38  ? 9.148   6.044  5.854   1.00 0.00  ? 38  ARG A HE   1  
ATOM   638   H  HH11 . ARG A 1 38  ? 5.730   5.614  5.633   1.00 0.00  ? 38  ARG A HH11 1  
ATOM   639   H  HH12 . ARG A 1 38  ? 5.784   4.918  4.049   1.00 0.00  ? 38  ARG A HH12 1  
ATOM   640   H  HH21 . ARG A 1 38  ? 9.233   5.143  3.767   1.00 0.00  ? 38  ARG A HH21 1  
ATOM   641   H  HH22 . ARG A 1 38  ? 7.762   4.659  2.991   1.00 0.00  ? 38  ARG A HH22 1  
ATOM   642   N  N    . ALA A 1 39  ? 7.096   11.751 7.752   1.00 0.00  ? 39  ALA A N    1  
ATOM   643   C  CA   . ALA A 1 39  ? 6.495   12.888 8.496   1.00 0.00  ? 39  ALA A CA   1  
ATOM   644   C  C    . ALA A 1 39  ? 5.876   13.846 7.481   1.00 0.00  ? 39  ALA A C    1  
ATOM   645   O  O    . ALA A 1 39  ? 4.725   14.217 7.583   1.00 0.00  ? 39  ALA A O    1  
ATOM   646   C  CB   . ALA A 1 39  ? 7.584   13.615 9.289   1.00 0.00  ? 39  ALA A CB   1  
ATOM   647   H  H    . ALA A 1 39  ? 8.001   11.442 7.971   1.00 0.00  ? 39  ALA A H    1  
ATOM   648   H  HA   . ALA A 1 39  ? 5.733   12.524 9.169   1.00 0.00  ? 39  ALA A HA   1  
ATOM   649   H  HB1  . ALA A 1 39  ? 8.500   13.045 9.248   1.00 0.00  ? 39  ALA A HB1  1  
ATOM   650   H  HB2  . ALA A 1 39  ? 7.271   13.721 10.317  1.00 0.00  ? 39  ALA A HB2  1  
ATOM   651   H  HB3  . ALA A 1 39  ? 7.748   14.592 8.859   1.00 0.00  ? 39  ALA A HB3  1  
ATOM   652   N  N    . PHE A 1 40  ? 6.630   14.232 6.489   1.00 0.00  ? 40  PHE A N    1  
ATOM   653   C  CA   . PHE A 1 40  ? 6.079   15.147 5.457   1.00 0.00  ? 40  PHE A CA   1  
ATOM   654   C  C    . PHE A 1 40  ? 4.697   14.627 5.042   1.00 0.00  ? 40  PHE A C    1  
ATOM   655   O  O    . PHE A 1 40  ? 3.729   15.359 5.026   1.00 0.00  ? 40  PHE A O    1  
ATOM   656   C  CB   . PHE A 1 40  ? 7.050   15.191 4.255   1.00 0.00  ? 40  PHE A CB   1  
ATOM   657   C  CG   . PHE A 1 40  ? 6.301   15.220 2.939   1.00 0.00  ? 40  PHE A CG   1  
ATOM   658   C  CD1  . PHE A 1 40  ? 5.408   16.262 2.658   1.00 0.00  ? 40  PHE A CD1  1  
ATOM   659   C  CD2  . PHE A 1 40  ? 6.507   14.204 2.000   1.00 0.00  ? 40  PHE A CD2  1  
ATOM   660   C  CE1  . PHE A 1 40  ? 4.721   16.284 1.438   1.00 0.00  ? 40  PHE A CE1  1  
ATOM   661   C  CE2  . PHE A 1 40  ? 5.820   14.226 0.782   1.00 0.00  ? 40  PHE A CE2  1  
ATOM   662   C  CZ   . PHE A 1 40  ? 4.928   15.265 0.501   1.00 0.00  ? 40  PHE A CZ   1  
ATOM   663   H  H    . PHE A 1 40  ? 7.552   13.909 6.417   1.00 0.00  ? 40  PHE A H    1  
ATOM   664   H  HA   . PHE A 1 40  ? 5.977   16.139 5.874   1.00 0.00  ? 40  PHE A HA   1  
ATOM   665   H  HB2  . PHE A 1 40  ? 7.663   16.076 4.328   1.00 0.00  ? 40  PHE A HB2  1  
ATOM   666   H  HB3  . PHE A 1 40  ? 7.685   14.318 4.282   1.00 0.00  ? 40  PHE A HB3  1  
ATOM   667   H  HD1  . PHE A 1 40  ? 5.247   17.047 3.383   1.00 0.00  ? 40  PHE A HD1  1  
ATOM   668   H  HD2  . PHE A 1 40  ? 7.197   13.402 2.216   1.00 0.00  ? 40  PHE A HD2  1  
ATOM   669   H  HE1  . PHE A 1 40  ? 4.032   17.087 1.220   1.00 0.00  ? 40  PHE A HE1  1  
ATOM   670   H  HE2  . PHE A 1 40  ? 5.979   13.441 0.059   1.00 0.00  ? 40  PHE A HE2  1  
ATOM   671   H  HZ   . PHE A 1 40  ? 4.400   15.279 -0.441  1.00 0.00  ? 40  PHE A HZ   1  
ATOM   672   N  N    . GLN A 1 41  ? 4.600   13.364 4.716   1.00 0.00  ? 41  GLN A N    1  
ATOM   673   C  CA   . GLN A 1 41  ? 3.282   12.794 4.305   1.00 0.00  ? 41  GLN A CA   1  
ATOM   674   C  C    . GLN A 1 41  ? 2.358   12.678 5.523   1.00 0.00  ? 41  GLN A C    1  
ATOM   675   O  O    . GLN A 1 41  ? 1.150   12.671 5.394   1.00 0.00  ? 41  GLN A O    1  
ATOM   676   C  CB   . GLN A 1 41  ? 3.496   11.406 3.695   1.00 0.00  ? 41  GLN A CB   1  
ATOM   677   C  CG   . GLN A 1 41  ? 2.246   10.987 2.915   1.00 0.00  ? 41  GLN A CG   1  
ATOM   678   C  CD   . GLN A 1 41  ? 2.642   10.625 1.481   1.00 0.00  ? 41  GLN A CD   1  
ATOM   679   O  OE1  . GLN A 1 41  ? 3.033   9.507  1.210   1.00 0.00  ? 41  GLN A OE1  1  
ATOM   680   N  NE2  . GLN A 1 41  ? 2.559   11.531 0.546   1.00 0.00  ? 41  GLN A NE2  1  
ATOM   681   H  H    . GLN A 1 41  ? 5.394   12.791 4.741   1.00 0.00  ? 41  GLN A H    1  
ATOM   682   H  HA   . GLN A 1 41  ? 2.826   13.440 3.572   1.00 0.00  ? 41  GLN A HA   1  
ATOM   683   H  HB2  . GLN A 1 41  ? 4.345   11.433 3.027   1.00 0.00  ? 41  GLN A HB2  1  
ATOM   684   H  HB3  . GLN A 1 41  ? 3.680   10.691 4.483   1.00 0.00  ? 41  GLN A HB3  1  
ATOM   685   H  HG2  . GLN A 1 41  ? 1.794   10.129 3.393   1.00 0.00  ? 41  GLN A HG2  1  
ATOM   686   H  HG3  . GLN A 1 41  ? 1.540   11.804 2.897   1.00 0.00  ? 41  GLN A HG3  1  
ATOM   687   H  HE21 . GLN A 1 41  ? 2.245   12.433 0.764   1.00 0.00  ? 41  GLN A HE21 1  
ATOM   688   H  HE22 . GLN A 1 41  ? 2.815   11.311 -0.374  1.00 0.00  ? 41  GLN A HE22 1  
ATOM   689   N  N    . VAL A 1 42  ? 2.907   12.588 6.705   1.00 0.00  ? 42  VAL A N    1  
ATOM   690   C  CA   . VAL A 1 42  ? 2.044   12.475 7.914   1.00 0.00  ? 42  VAL A CA   1  
ATOM   691   C  C    . VAL A 1 42  ? 1.234   13.763 8.067   1.00 0.00  ? 42  VAL A C    1  
ATOM   692   O  O    . VAL A 1 42  ? 0.110   13.758 8.527   1.00 0.00  ? 42  VAL A O    1  
ATOM   693   C  CB   . VAL A 1 42  ? 2.927   12.236 9.148   1.00 0.00  ? 42  VAL A CB   1  
ATOM   694   C  CG1  . VAL A 1 42  ? 3.259   13.550 9.862   1.00 0.00  ? 42  VAL A CG1  1  
ATOM   695   C  CG2  . VAL A 1 42  ? 2.195   11.309 10.121  1.00 0.00  ? 42  VAL A CG2  1  
ATOM   696   H  H    . VAL A 1 42  ? 3.883   12.597 6.798   1.00 0.00  ? 42  VAL A H    1  
ATOM   697   H  HA   . VAL A 1 42  ? 1.367   11.642 7.792   1.00 0.00  ? 42  VAL A HA   1  
ATOM   698   H  HB   . VAL A 1 42  ? 3.843   11.774 8.830   1.00 0.00  ? 42  VAL A HB   1  
ATOM   699   H  HG11 . VAL A 1 42  ? 4.196   13.448 10.388  1.00 0.00  ? 42  VAL A HG11 1  
ATOM   700   H  HG12 . VAL A 1 42  ? 2.476   13.784 10.568  1.00 0.00  ? 42  VAL A HG12 1  
ATOM   701   H  HG13 . VAL A 1 42  ? 3.338   14.347 9.139   1.00 0.00  ? 42  VAL A HG13 1  
ATOM   702   H  HG21 . VAL A 1 42  ? 2.747   11.252 11.047  1.00 0.00  ? 42  VAL A HG21 1  
ATOM   703   H  HG22 . VAL A 1 42  ? 2.114   10.323 9.689   1.00 0.00  ? 42  VAL A HG22 1  
ATOM   704   H  HG23 . VAL A 1 42  ? 1.207   11.700 10.315  1.00 0.00  ? 42  VAL A HG23 1  
ATOM   705   N  N    . TRP A 1 43  ? 1.805   14.862 7.673   1.00 0.00  ? 43  TRP A N    1  
ATOM   706   C  CA   . TRP A 1 43  ? 1.078   16.159 7.781   1.00 0.00  ? 43  TRP A CA   1  
ATOM   707   C  C    . TRP A 1 43  ? 0.509   16.529 6.408   1.00 0.00  ? 43  TRP A C    1  
ATOM   708   O  O    . TRP A 1 43  ? -0.473  17.236 6.303   1.00 0.00  ? 43  TRP A O    1  
ATOM   709   C  CB   . TRP A 1 43  ? 2.034   17.262 8.245   1.00 0.00  ? 43  TRP A CB   1  
ATOM   710   C  CG   . TRP A 1 43  ? 1.904   17.445 9.724   1.00 0.00  ? 43  TRP A CG   1  
ATOM   711   C  CD1  . TRP A 1 43  ? 2.429   16.616 10.649  1.00 0.00  ? 43  TRP A CD1  1  
ATOM   712   C  CD2  . TRP A 1 43  ? 1.221   18.500 10.463  1.00 0.00  ? 43  TRP A CD2  1  
ATOM   713   N  NE1  . TRP A 1 43  ? 2.118   17.090 11.909  1.00 0.00  ? 43  TRP A NE1  1  
ATOM   714   C  CE2  . TRP A 1 43  ? 1.372   18.249 11.848  1.00 0.00  ? 43  TRP A CE2  1  
ATOM   715   C  CE3  . TRP A 1 43  ? 0.493   19.638 10.072  1.00 0.00  ? 43  TRP A CE3  1  
ATOM   716   C  CZ2  . TRP A 1 43  ? 0.821   19.094 12.811  1.00 0.00  ? 43  TRP A CZ2  1  
ATOM   717   C  CZ3  . TRP A 1 43  ? -0.063  20.493 11.038  1.00 0.00  ? 43  TRP A CZ3  1  
ATOM   718   C  CH2  . TRP A 1 43  ? 0.101   20.221 12.406  1.00 0.00  ? 43  TRP A CH2  1  
ATOM   719   H  H    . TRP A 1 43  ? 2.710   14.830 7.304   1.00 0.00  ? 43  TRP A H    1  
ATOM   720   H  HA   . TRP A 1 43  ? 0.274   16.057 8.495   1.00 0.00  ? 43  TRP A HA   1  
ATOM   721   H  HB2  . TRP A 1 43  ? 3.052   16.986 8.003   1.00 0.00  ? 43  TRP A HB2  1  
ATOM   722   H  HB3  . TRP A 1 43  ? 1.786   18.187 7.745   1.00 0.00  ? 43  TRP A HB3  1  
ATOM   723   H  HD1  . TRP A 1 43  ? 3.000   15.732 10.437  1.00 0.00  ? 43  TRP A HD1  1  
ATOM   724   H  HE1  . TRP A 1 43  ? 2.383   16.667 12.753  1.00 0.00  ? 43  TRP A HE1  1  
ATOM   725   H  HE3  . TRP A 1 43  ? 0.359   19.855 9.022   1.00 0.00  ? 43  TRP A HE3  1  
ATOM   726   H  HZ2  . TRP A 1 43  ? 0.949   18.878 13.863  1.00 0.00  ? 43  TRP A HZ2  1  
ATOM   727   H  HZ3  . TRP A 1 43  ? -0.620  21.364 10.727  1.00 0.00  ? 43  TRP A HZ3  1  
ATOM   728   H  HH2  . TRP A 1 43  ? -0.328  20.882 13.144  1.00 0.00  ? 43  TRP A HH2  1  
ATOM   729   N  N    . SER A 1 44  ? 1.105   16.040 5.352   1.00 0.00  ? 44  SER A N    1  
ATOM   730   C  CA   . SER A 1 44  ? 0.578   16.352 3.994   1.00 0.00  ? 44  SER A CA   1  
ATOM   731   C  C    . SER A 1 44  ? -0.647  15.477 3.740   1.00 0.00  ? 44  SER A C    1  
ATOM   732   O  O    . SER A 1 44  ? -1.452  15.750 2.874   1.00 0.00  ? 44  SER A O    1  
ATOM   733   C  CB   . SER A 1 44  ? 1.642   16.061 2.932   1.00 0.00  ? 44  SER A CB   1  
ATOM   734   O  OG   . SER A 1 44  ? 1.908   17.248 2.196   1.00 0.00  ? 44  SER A OG   1  
ATOM   735   H  H    . SER A 1 44  ? 1.888   15.459 5.454   1.00 0.00  ? 44  SER A H    1  
ATOM   736   H  HA   . SER A 1 44  ? 0.294   17.394 3.948   1.00 0.00  ? 44  SER A HA   1  
ATOM   737   H  HB2  . SER A 1 44  ? 2.545   15.730 3.405   1.00 0.00  ? 44  SER A HB2  1  
ATOM   738   H  HB3  . SER A 1 44  ? 1.283   15.286 2.267   1.00 0.00  ? 44  SER A HB3  1  
ATOM   739   H  HG   . SER A 1 44  ? 1.134   17.447 1.662   1.00 0.00  ? 44  SER A HG   1  
ATOM   740   N  N    . ASP A 1 45  ? -0.794  14.425 4.497   1.00 0.00  ? 45  ASP A N    1  
ATOM   741   C  CA   . ASP A 1 45  ? -1.972  13.532 4.308   1.00 0.00  ? 45  ASP A CA   1  
ATOM   742   C  C    . ASP A 1 45  ? -3.229  14.250 4.805   1.00 0.00  ? 45  ASP A C    1  
ATOM   743   O  O    . ASP A 1 45  ? -4.341  13.846 4.526   1.00 0.00  ? 45  ASP A O    1  
ATOM   744   C  CB   . ASP A 1 45  ? -1.766  12.235 5.096   1.00 0.00  ? 45  ASP A CB   1  
ATOM   745   C  CG   . ASP A 1 45  ? -2.803  11.198 4.658   1.00 0.00  ? 45  ASP A CG   1  
ATOM   746   O  OD1  . ASP A 1 45  ? -3.827  11.598 4.131   1.00 0.00  ? 45  ASP A OD1  1  
ATOM   747   O  OD2  . ASP A 1 45  ? -2.554  10.020 4.860   1.00 0.00  ? 45  ASP A OD2  1  
ATOM   748   H  H    . ASP A 1 45  ? -0.129  14.225 5.196   1.00 0.00  ? 45  ASP A H    1  
ATOM   749   H  HA   . ASP A 1 45  ? -2.084  13.301 3.258   1.00 0.00  ? 45  ASP A HA   1  
ATOM   750   H  HB2  . ASP A 1 45  ? -0.773  11.853 4.907   1.00 0.00  ? 45  ASP A HB2  1  
ATOM   751   H  HB3  . ASP A 1 45  ? -1.882  12.433 6.151   1.00 0.00  ? 45  ASP A HB3  1  
ATOM   752   N  N    . VAL A 1 46  ? -3.061  15.316 5.537   1.00 0.00  ? 46  VAL A N    1  
ATOM   753   C  CA   . VAL A 1 46  ? -4.244  16.066 6.047   1.00 0.00  ? 46  VAL A CA   1  
ATOM   754   C  C    . VAL A 1 46  ? -4.444  17.327 5.205   1.00 0.00  ? 46  VAL A C    1  
ATOM   755   O  O    . VAL A 1 46  ? -5.224  18.194 5.542   1.00 0.00  ? 46  VAL A O    1  
ATOM   756   C  CB   . VAL A 1 46  ? -4.010  16.458 7.508   1.00 0.00  ? 46  VAL A CB   1  
ATOM   757   C  CG1  . VAL A 1 46  ? -2.670  17.185 7.637   1.00 0.00  ? 46  VAL A CG1  1  
ATOM   758   C  CG2  . VAL A 1 46  ? -5.135  17.385 7.976   1.00 0.00  ? 46  VAL A CG2  1  
ATOM   759   H  H    . VAL A 1 46  ? -2.156  15.627 5.747   1.00 0.00  ? 46  VAL A H    1  
ATOM   760   H  HA   . VAL A 1 46  ? -5.123  15.443 5.978   1.00 0.00  ? 46  VAL A HA   1  
ATOM   761   H  HB   . VAL A 1 46  ? -3.995  15.567 8.120   1.00 0.00  ? 46  VAL A HB   1  
ATOM   762   H  HG11 . VAL A 1 46  ? -2.709  17.867 8.474   1.00 0.00  ? 46  VAL A HG11 1  
ATOM   763   H  HG12 . VAL A 1 46  ? -2.472  17.737 6.731   1.00 0.00  ? 46  VAL A HG12 1  
ATOM   764   H  HG13 . VAL A 1 46  ? -1.881  16.463 7.798   1.00 0.00  ? 46  VAL A HG13 1  
ATOM   765   H  HG21 . VAL A 1 46  ? -4.834  18.413 7.839   1.00 0.00  ? 46  VAL A HG21 1  
ATOM   766   H  HG22 . VAL A 1 46  ? -5.338  17.206 9.020   1.00 0.00  ? 46  VAL A HG22 1  
ATOM   767   H  HG23 . VAL A 1 46  ? -6.026  17.191 7.397   1.00 0.00  ? 46  VAL A HG23 1  
ATOM   768   N  N    . THR A 1 47  ? -3.744  17.433 4.108   1.00 0.00  ? 47  THR A N    1  
ATOM   769   C  CA   . THR A 1 47  ? -3.890  18.633 3.239   1.00 0.00  ? 47  THR A CA   1  
ATOM   770   C  C    . THR A 1 47  ? -2.994  18.473 2.008   1.00 0.00  ? 47  THR A C    1  
ATOM   771   O  O    . THR A 1 47  ? -1.948  17.862 2.081   1.00 0.00  ? 47  THR A O    1  
ATOM   772   C  CB   . THR A 1 47  ? -3.476  19.882 4.015   1.00 0.00  ? 47  THR A CB   1  
ATOM   773   O  OG1  . THR A 1 47  ? -3.618  21.032 3.190   1.00 0.00  ? 47  THR A OG1  1  
ATOM   774   C  CG2  . THR A 1 47  ? -2.025  19.734 4.454   1.00 0.00  ? 47  THR A CG2  1  
ATOM   775   H  H    . THR A 1 47  ? -3.122  16.721 3.855   1.00 0.00  ? 47  THR A H    1  
ATOM   776   H  HA   . THR A 1 47  ? -4.914  18.729 2.929   1.00 0.00  ? 47  THR A HA   1  
ATOM   777   H  HB   . THR A 1 47  ? -4.104  19.985 4.883   1.00 0.00  ? 47  THR A HB   1  
ATOM   778   H  HG1  . THR A 1 47  ? -2.745  21.399 3.029   1.00 0.00  ? 47  THR A HG1  1  
ATOM   779   H  HG21 . THR A 1 47  ? -1.439  20.535 4.032   1.00 0.00  ? 47  THR A HG21 1  
ATOM   780   H  HG22 . THR A 1 47  ? -1.643  18.785 4.106   1.00 0.00  ? 47  THR A HG22 1  
ATOM   781   H  HG23 . THR A 1 47  ? -1.970  19.772 5.530   1.00 0.00  ? 47  THR A HG23 1  
ATOM   782   N  N    . PRO A 1 48  ? -3.435  19.026 0.912   1.00 0.00  ? 48  PRO A N    1  
ATOM   783   C  CA   . PRO A 1 48  ? -2.699  18.959 -0.360  1.00 0.00  ? 48  PRO A CA   1  
ATOM   784   C  C    . PRO A 1 48  ? -1.514  19.927 -0.342  1.00 0.00  ? 48  PRO A C    1  
ATOM   785   O  O    . PRO A 1 48  ? -1.387  20.791 -1.187  1.00 0.00  ? 48  PRO A O    1  
ATOM   786   C  CB   . PRO A 1 48  ? -3.743  19.373 -1.401  1.00 0.00  ? 48  PRO A CB   1  
ATOM   787   C  CG   . PRO A 1 48  ? -4.820  20.181 -0.639  1.00 0.00  ? 48  PRO A CG   1  
ATOM   788   C  CD   . PRO A 1 48  ? -4.702  19.778 0.843   1.00 0.00  ? 48  PRO A CD   1  
ATOM   789   H  HA   . PRO A 1 48  ? -2.367  17.952 -0.553  1.00 0.00  ? 48  PRO A HA   1  
ATOM   790   H  HB2  . PRO A 1 48  ? -3.282  19.987 -2.163  1.00 0.00  ? 48  PRO A HB2  1  
ATOM   791   H  HB3  . PRO A 1 48  ? -4.192  18.499 -1.847  1.00 0.00  ? 48  PRO A HB3  1  
ATOM   792   H  HG2  . PRO A 1 48  ? -4.636  21.240 -0.754  1.00 0.00  ? 48  PRO A HG2  1  
ATOM   793   H  HG3  . PRO A 1 48  ? -5.803  19.931 -1.008  1.00 0.00  ? 48  PRO A HG3  1  
ATOM   794   H  HD2  . PRO A 1 48  ? -4.657  20.657 1.469   1.00 0.00  ? 48  PRO A HD2  1  
ATOM   795   H  HD3  . PRO A 1 48  ? -5.526  19.146 1.136   1.00 0.00  ? 48  PRO A HD3  1  
ATOM   796   N  N    . LEU A 1 49  ? -0.642  19.784 0.618   1.00 0.00  ? 49  LEU A N    1  
ATOM   797   C  CA   . LEU A 1 49  ? 0.540   20.688 0.695   1.00 0.00  ? 49  LEU A CA   1  
ATOM   798   C  C    . LEU A 1 49  ? 1.661   20.132 -0.182  1.00 0.00  ? 49  LEU A C    1  
ATOM   799   O  O    . LEU A 1 49  ? 1.807   18.936 -0.336  1.00 0.00  ? 49  LEU A O    1  
ATOM   800   C  CB   . LEU A 1 49  ? 1.020   20.777 2.145   1.00 0.00  ? 49  LEU A CB   1  
ATOM   801   C  CG   . LEU A 1 49  ? 1.700   22.126 2.377   1.00 0.00  ? 49  LEU A CG   1  
ATOM   802   C  CD1  . LEU A 1 49  ? 0.655   23.241 2.334   1.00 0.00  ? 49  LEU A CD1  1  
ATOM   803   C  CD2  . LEU A 1 49  ? 2.385   22.127 3.746   1.00 0.00  ? 49  LEU A CD2  1  
ATOM   804   H  H    . LEU A 1 49  ? -0.762  19.077 1.287   1.00 0.00  ? 49  LEU A H    1  
ATOM   805   H  HA   . LEU A 1 49  ? 0.267   21.674 0.344   1.00 0.00  ? 49  LEU A HA   1  
ATOM   806   H  HB2  . LEU A 1 49  ? 0.174   20.679 2.809   1.00 0.00  ? 49  LEU A HB2  1  
ATOM   807   H  HB3  . LEU A 1 49  ? 1.725   19.982 2.340   1.00 0.00  ? 49  LEU A HB3  1  
ATOM   808   H  HG   . LEU A 1 49  ? 2.437   22.294 1.605   1.00 0.00  ? 49  LEU A HG   1  
ATOM   809   H  HD11 . LEU A 1 49  ? 1.153   24.196 2.280   1.00 0.00  ? 49  LEU A HD11 1  
ATOM   810   H  HD12 . LEU A 1 49  ? 0.049   23.201 3.228   1.00 0.00  ? 49  LEU A HD12 1  
ATOM   811   H  HD13 . LEU A 1 49  ? 0.025   23.113 1.468   1.00 0.00  ? 49  LEU A HD13 1  
ATOM   812   H  HD21 . LEU A 1 49  ? 1.868   22.808 4.408   1.00 0.00  ? 49  LEU A HD21 1  
ATOM   813   H  HD22 . LEU A 1 49  ? 3.412   22.445 3.636   1.00 0.00  ? 49  LEU A HD22 1  
ATOM   814   H  HD23 . LEU A 1 49  ? 2.359   21.132 4.163   1.00 0.00  ? 49  LEU A HD23 1  
ATOM   815   N  N    . ARG A 1 50  ? 2.455   20.992 -0.756  1.00 0.00  ? 50  ARG A N    1  
ATOM   816   C  CA   . ARG A 1 50  ? 3.566   20.517 -1.624  1.00 0.00  ? 50  ARG A CA   1  
ATOM   817   C  C    . ARG A 1 50  ? 4.904   20.854 -0.954  1.00 0.00  ? 50  ARG A C    1  
ATOM   818   O  O    . ARG A 1 50  ? 5.278   22.004 -0.848  1.00 0.00  ? 50  ARG A O    1  
ATOM   819   C  CB   . ARG A 1 50  ? 3.486   21.217 -2.986  1.00 0.00  ? 50  ARG A CB   1  
ATOM   820   C  CG   . ARG A 1 50  ? 2.163   20.868 -3.677  1.00 0.00  ? 50  ARG A CG   1  
ATOM   821   C  CD   . ARG A 1 50  ? 2.008   19.348 -3.742  1.00 0.00  ? 50  ARG A CD   1  
ATOM   822   N  NE   . ARG A 1 50  ? 1.208   18.978 -4.943  1.00 0.00  ? 50  ARG A NE   1  
ATOM   823   C  CZ   . ARG A 1 50  ? -0.088  19.151 -4.946  1.00 0.00  ? 50  ARG A CZ   1  
ATOM   824   N  NH1  . ARG A 1 50  ? -0.684  19.689 -3.915  1.00 0.00  ? 50  ARG A NH1  1  
ATOM   825   N  NH2  . ARG A 1 50  ? -0.791  18.793 -5.987  1.00 0.00  ? 50  ARG A NH2  1  
ATOM   826   H  H    . ARG A 1 50  ? 2.319   21.953 -0.617  1.00 0.00  ? 50  ARG A H    1  
ATOM   827   H  HA   . ARG A 1 50  ? 3.487   19.449 -1.761  1.00 0.00  ? 50  ARG A HA   1  
ATOM   828   H  HB2  . ARG A 1 50  ? 3.545   22.286 -2.843  1.00 0.00  ? 50  ARG A HB2  1  
ATOM   829   H  HB3  . ARG A 1 50  ? 4.308   20.892 -3.605  1.00 0.00  ? 50  ARG A HB3  1  
ATOM   830   H  HG2  . ARG A 1 50  ? 1.341   21.292 -3.118  1.00 0.00  ? 50  ARG A HG2  1  
ATOM   831   H  HG3  . ARG A 1 50  ? 2.164   21.270 -4.679  1.00 0.00  ? 50  ARG A HG3  1  
ATOM   832   H  HD2  . ARG A 1 50  ? 2.984   18.889 -3.804  1.00 0.00  ? 50  ARG A HD2  1  
ATOM   833   H  HD3  . ARG A 1 50  ? 1.503   18.998 -2.853  1.00 0.00  ? 50  ARG A HD3  1  
ATOM   834   H  HE   . ARG A 1 50  ? 1.652   18.585 -5.725  1.00 0.00  ? 50  ARG A HE   1  
ATOM   835   H  HH11 . ARG A 1 50  ? -0.149  19.974 -3.119  1.00 0.00  ? 50  ARG A HH11 1  
ATOM   836   H  HH12 . ARG A 1 50  ? -1.676  19.815 -3.921  1.00 0.00  ? 50  ARG A HH12 1  
ATOM   837   H  HH21 . ARG A 1 50  ? -0.338  18.388 -6.782  1.00 0.00  ? 50  ARG A HH21 1  
ATOM   838   H  HH22 . ARG A 1 50  ? -1.782  18.924 -5.990  1.00 0.00  ? 50  ARG A HH22 1  
ATOM   839   N  N    . PHE A 1 51  ? 5.625   19.861 -0.498  1.00 0.00  ? 51  PHE A N    1  
ATOM   840   C  CA   . PHE A 1 51  ? 6.933   20.135 0.168   1.00 0.00  ? 51  PHE A CA   1  
ATOM   841   C  C    . PHE A 1 51  ? 8.066   19.958 -0.842  1.00 0.00  ? 51  PHE A C    1  
ATOM   842   O  O    . PHE A 1 51  ? 8.044   19.066 -1.667  1.00 0.00  ? 51  PHE A O    1  
ATOM   843   C  CB   . PHE A 1 51  ? 7.147   19.151 1.322   1.00 0.00  ? 51  PHE A CB   1  
ATOM   844   C  CG   . PHE A 1 51  ? 6.312   19.557 2.514   1.00 0.00  ? 51  PHE A CG   1  
ATOM   845   C  CD1  . PHE A 1 51  ? 4.933   19.323 2.515   1.00 0.00  ? 51  PHE A CD1  1  
ATOM   846   C  CD2  . PHE A 1 51  ? 6.921   20.160 3.623   1.00 0.00  ? 51  PHE A CD2  1  
ATOM   847   C  CE1  . PHE A 1 51  ? 4.161   19.691 3.621   1.00 0.00  ? 51  PHE A CE1  1  
ATOM   848   C  CE2  . PHE A 1 51  ? 6.148   20.528 4.732   1.00 0.00  ? 51  PHE A CE2  1  
ATOM   849   C  CZ   . PHE A 1 51  ? 4.768   20.292 4.730   1.00 0.00  ? 51  PHE A CZ   1  
ATOM   850   H  H    . PHE A 1 51  ? 5.305   18.939 -0.590  1.00 0.00  ? 51  PHE A H    1  
ATOM   851   H  HA   . PHE A 1 51  ? 6.940   21.145 0.548   1.00 0.00  ? 51  PHE A HA   1  
ATOM   852   H  HB2  . PHE A 1 51  ? 6.863   18.160 1.005   1.00 0.00  ? 51  PHE A HB2  1  
ATOM   853   H  HB3  . PHE A 1 51  ? 8.191   19.151 1.602   1.00 0.00  ? 51  PHE A HB3  1  
ATOM   854   H  HD1  . PHE A 1 51  ? 4.465   18.859 1.661   1.00 0.00  ? 51  PHE A HD1  1  
ATOM   855   H  HD2  . PHE A 1 51  ? 7.985   20.341 3.621   1.00 0.00  ? 51  PHE A HD2  1  
ATOM   856   H  HE1  . PHE A 1 51  ? 3.096   19.507 3.620   1.00 0.00  ? 51  PHE A HE1  1  
ATOM   857   H  HE2  . PHE A 1 51  ? 6.616   20.992 5.588   1.00 0.00  ? 51  PHE A HE2  1  
ATOM   858   H  HZ   . PHE A 1 51  ? 4.171   20.574 5.583   1.00 0.00  ? 51  PHE A HZ   1  
ATOM   859   N  N    . SER A 1 52  ? 9.063   20.794 -0.775  1.00 0.00  ? 52  SER A N    1  
ATOM   860   C  CA   . SER A 1 52  ? 10.208  20.670 -1.721  1.00 0.00  ? 52  SER A CA   1  
ATOM   861   C  C    . SER A 1 52  ? 11.517  20.751 -0.934  1.00 0.00  ? 52  SER A C    1  
ATOM   862   O  O    . SER A 1 52  ? 11.752  21.687 -0.200  1.00 0.00  ? 52  SER A O    1  
ATOM   863   C  CB   . SER A 1 52  ? 10.155  21.802 -2.749  1.00 0.00  ? 52  SER A CB   1  
ATOM   864   O  OG   . SER A 1 52  ? 10.134  21.247 -4.059  1.00 0.00  ? 52  SER A OG   1  
ATOM   865   H  H    . SER A 1 52  ? 9.063   21.500 -0.094  1.00 0.00  ? 52  SER A H    1  
ATOM   866   H  HA   . SER A 1 52  ? 10.151  19.718 -2.229  1.00 0.00  ? 52  SER A HA   1  
ATOM   867   H  HB2  . SER A 1 52  ? 9.264   22.389 -2.597  1.00 0.00  ? 52  SER A HB2  1  
ATOM   868   H  HB3  . SER A 1 52  ? 11.025  22.434 -2.628  1.00 0.00  ? 52  SER A HB3  1  
ATOM   869   H  HG   . SER A 1 52  ? 9.727   21.888 -4.647  1.00 0.00  ? 52  SER A HG   1  
ATOM   870   N  N    . ARG A 1 53  ? 12.370  19.776 -1.073  1.00 0.00  ? 53  ARG A N    1  
ATOM   871   C  CA   . ARG A 1 53  ? 13.656  19.805 -0.320  1.00 0.00  ? 53  ARG A CA   1  
ATOM   872   C  C    . ARG A 1 53  ? 14.742  20.444 -1.187  1.00 0.00  ? 53  ARG A C    1  
ATOM   873   O  O    . ARG A 1 53  ? 14.815  20.206 -2.377  1.00 0.00  ? 53  ARG A O    1  
ATOM   874   C  CB   . ARG A 1 53  ? 14.064  18.374 0.035   1.00 0.00  ? 53  ARG A CB   1  
ATOM   875   C  CG   . ARG A 1 53  ? 14.038  17.509 -1.227  1.00 0.00  ? 53  ARG A CG   1  
ATOM   876   C  CD   . ARG A 1 53  ? 13.023  16.376 -1.051  1.00 0.00  ? 53  ARG A CD   1  
ATOM   877   N  NE   . ARG A 1 53  ? 12.337  16.117 -2.348  1.00 0.00  ? 53  ARG A NE   1  
ATOM   878   C  CZ   . ARG A 1 53  ? 11.329  15.288 -2.403  1.00 0.00  ? 53  ARG A CZ   1  
ATOM   879   N  NH1  . ARG A 1 53  ? 10.923  14.673 -1.323  1.00 0.00  ? 53  ARG A NH1  1  
ATOM   880   N  NH2  . ARG A 1 53  ? 10.727  15.068 -3.540  1.00 0.00  ? 53  ARG A NH2  1  
ATOM   881   H  H    . ARG A 1 53  ? 12.165  19.024 -1.667  1.00 0.00  ? 53  ARG A H    1  
ATOM   882   H  HA   . ARG A 1 53  ? 13.532  20.379 0.585   1.00 0.00  ? 53  ARG A HA   1  
ATOM   883   H  HB2  . ARG A 1 53  ? 15.062  18.377 0.448   1.00 0.00  ? 53  ARG A HB2  1  
ATOM   884   H  HB3  . ARG A 1 53  ? 13.374  17.970 0.761   1.00 0.00  ? 53  ARG A HB3  1  
ATOM   885   H  HG2  . ARG A 1 53  ? 13.758  18.117 -2.075  1.00 0.00  ? 53  ARG A HG2  1  
ATOM   886   H  HG3  . ARG A 1 53  ? 15.017  17.088 -1.392  1.00 0.00  ? 53  ARG A HG3  1  
ATOM   887   H  HD2  . ARG A 1 53  ? 13.534  15.481 -0.730  1.00 0.00  ? 53  ARG A HD2  1  
ATOM   888   H  HD3  . ARG A 1 53  ? 12.292  16.660 -0.309  1.00 0.00  ? 53  ARG A HD3  1  
ATOM   889   H  HE   . ARG A 1 53  ? 12.640  16.574 -3.160  1.00 0.00  ? 53  ARG A HE   1  
ATOM   890   H  HH11 . ARG A 1 53  ? 11.383  14.836 -0.450  1.00 0.00  ? 53  ARG A HH11 1  
ATOM   891   H  HH12 . ARG A 1 53  ? 10.149  14.042 -1.369  1.00 0.00  ? 53  ARG A HH12 1  
ATOM   892   H  HH21 . ARG A 1 53  ? 11.038  15.534 -4.369  1.00 0.00  ? 53  ARG A HH21 1  
ATOM   893   H  HH22 . ARG A 1 53  ? 9.953   14.437 -3.582  1.00 0.00  ? 53  ARG A HH22 1  
ATOM   894   N  N    . ILE A 1 54  ? 15.592  21.249 -0.605  1.00 0.00  ? 54  ILE A N    1  
ATOM   895   C  CA   . ILE A 1 54  ? 16.673  21.889 -1.413  1.00 0.00  ? 54  ILE A CA   1  
ATOM   896   C  C    . ILE A 1 54  ? 18.037  21.568 -0.799  1.00 0.00  ? 54  ILE A C    1  
ATOM   897   O  O    . ILE A 1 54  ? 18.157  20.726 0.071   1.00 0.00  ? 54  ILE A O    1  
ATOM   898   C  CB   . ILE A 1 54  ? 16.484  23.410 -1.453  1.00 0.00  ? 54  ILE A CB   1  
ATOM   899   C  CG1  . ILE A 1 54  ? 16.344  23.952 -0.025  1.00 0.00  ? 54  ILE A CG1  1  
ATOM   900   C  CG2  . ILE A 1 54  ? 15.238  23.757 -2.272  1.00 0.00  ? 54  ILE A CG2  1  
ATOM   901   C  CD1  . ILE A 1 54  ? 14.935  23.678 0.502   1.00 0.00  ? 54  ILE A CD1  1  
ATOM   902   H  H    . ILE A 1 54  ? 15.523  21.426 0.362   1.00 0.00  ? 54  ILE A H    1  
ATOM   903   H  HA   . ILE A 1 54  ? 16.639  21.500 -2.420  1.00 0.00  ? 54  ILE A HA   1  
ATOM   904   H  HB   . ILE A 1 54  ? 17.347  23.859 -1.922  1.00 0.00  ? 54  ILE A HB   1  
ATOM   905   H  HG12 . ILE A 1 54  ? 17.067  23.465 0.615   1.00 0.00  ? 54  ILE A HG12 1  
ATOM   906   H  HG13 . ILE A 1 54  ? 16.525  25.015 -0.025  1.00 0.00  ? 54  ILE A HG13 1  
ATOM   907   H  HG21 . ILE A 1 54  ? 14.355  23.433 -1.743  1.00 0.00  ? 54  ILE A HG21 1  
ATOM   908   H  HG22 . ILE A 1 54  ? 15.287  23.258 -3.229  1.00 0.00  ? 54  ILE A HG22 1  
ATOM   909   H  HG23 . ILE A 1 54  ? 15.195  24.825 -2.426  1.00 0.00  ? 54  ILE A HG23 1  
ATOM   910   H  HD11 . ILE A 1 54  ? 14.418  24.614 0.654   1.00 0.00  ? 54  ILE A HD11 1  
ATOM   911   H  HD12 . ILE A 1 54  ? 15.001  23.148 1.438   1.00 0.00  ? 54  ILE A HD12 1  
ATOM   912   H  HD13 . ILE A 1 54  ? 14.393  23.079 -0.213  1.00 0.00  ? 54  ILE A HD13 1  
ATOM   913   N  N    . HIS A 1 55  ? 19.067  22.233 -1.249  1.00 0.00  ? 55  HIS A N    1  
ATOM   914   C  CA   . HIS A 1 55  ? 20.428  21.970 -0.700  1.00 0.00  ? 55  HIS A CA   1  
ATOM   915   C  C    . HIS A 1 55  ? 21.433  22.944 -1.326  1.00 0.00  ? 55  HIS A C    1  
ATOM   916   O  O    . HIS A 1 55  ? 22.596  22.632 -1.490  1.00 0.00  ? 55  HIS A O    1  
ATOM   917   C  CB   . HIS A 1 55  ? 20.837  20.533 -1.031  1.00 0.00  ? 55  HIS A CB   1  
ATOM   918   C  CG   . HIS A 1 55  ? 20.475  20.226 -2.460  1.00 0.00  ? 55  HIS A CG   1  
ATOM   919   N  ND1  . HIS A 1 55  ? 21.185  20.747 -3.532  1.00 0.00  ? 55  HIS A ND1  1  
ATOM   920   C  CD2  . HIS A 1 55  ? 19.478  19.458 -3.010  1.00 0.00  ? 55  HIS A CD2  1  
ATOM   921   C  CE1  . HIS A 1 55  ? 20.610  20.290 -4.660  1.00 0.00  ? 55  HIS A CE1  1  
ATOM   922   N  NE2  . HIS A 1 55  ? 19.567  19.499 -4.398  1.00 0.00  ? 55  HIS A NE2  1  
ATOM   923   H  H    . HIS A 1 55  ? 18.946  22.904 -1.952  1.00 0.00  ? 55  HIS A H    1  
ATOM   924   H  HA   . HIS A 1 55  ? 20.416  22.104 0.370   1.00 0.00  ? 55  HIS A HA   1  
ATOM   925   H  HB2  . HIS A 1 55  ? 21.903  20.422 -0.897  1.00 0.00  ? 55  HIS A HB2  1  
ATOM   926   H  HB3  . HIS A 1 55  ? 20.317  19.852 -0.373  1.00 0.00  ? 55  HIS A HB3  1  
ATOM   927   H  HD1  . HIS A 1 55  ? 21.963  21.341 -3.478  1.00 0.00  ? 55  HIS A HD1  1  
ATOM   928   H  HD2  . HIS A 1 55  ? 18.733  18.912 -2.451  1.00 0.00  ? 55  HIS A HD2  1  
ATOM   929   H  HE1  . HIS A 1 55  ? 20.948  20.538 -5.655  1.00 0.00  ? 55  HIS A HE1  1  
ATOM   930   N  N    . ASP A 1 56  ? 20.995  24.121 -1.679  1.00 0.00  ? 56  ASP A N    1  
ATOM   931   C  CA   . ASP A 1 56  ? 21.931  25.108 -2.296  1.00 0.00  ? 56  ASP A CA   1  
ATOM   932   C  C    . ASP A 1 56  ? 21.327  26.514 -2.243  1.00 0.00  ? 56  ASP A C    1  
ATOM   933   O  O    . ASP A 1 56  ? 22.035  27.493 -2.118  1.00 0.00  ? 56  ASP A O    1  
ATOM   934   C  CB   . ASP A 1 56  ? 22.192  24.719 -3.753  1.00 0.00  ? 56  ASP A CB   1  
ATOM   935   C  CG   . ASP A 1 56  ? 23.684  24.850 -4.055  1.00 0.00  ? 56  ASP A CG   1  
ATOM   936   O  OD1  . ASP A 1 56  ? 24.457  24.908 -3.112  1.00 0.00  ? 56  ASP A OD1  1  
ATOM   937   O  OD2  . ASP A 1 56  ? 24.030  24.890 -5.224  1.00 0.00  ? 56  ASP A OD2  1  
ATOM   938   H  H    . ASP A 1 56  ? 20.054  24.355 -1.540  1.00 0.00  ? 56  ASP A H    1  
ATOM   939   H  HA   . ASP A 1 56  ? 22.864  25.103 -1.753  1.00 0.00  ? 56  ASP A HA   1  
ATOM   940   H  HB2  . ASP A 1 56  ? 21.881  23.697 -3.913  1.00 0.00  ? 56  ASP A HB2  1  
ATOM   941   H  HB3  . ASP A 1 56  ? 21.635  25.373 -4.408  1.00 0.00  ? 56  ASP A HB3  1  
ATOM   942   N  N    . GLY A 1 57  ? 20.029  26.628 -2.340  1.00 0.00  ? 57  GLY A N    1  
ATOM   943   C  CA   . GLY A 1 57  ? 19.396  27.978 -2.296  1.00 0.00  ? 57  GLY A CA   1  
ATOM   944   C  C    . GLY A 1 57  ? 18.760  28.206 -0.923  1.00 0.00  ? 57  GLY A C    1  
ATOM   945   O  O    . GLY A 1 57  ? 17.803  28.941 -0.784  1.00 0.00  ? 57  GLY A O    1  
ATOM   946   H  H    . GLY A 1 57  ? 19.472  25.829 -2.443  1.00 0.00  ? 57  GLY A H    1  
ATOM   947   H  HA2  . GLY A 1 57  ? 20.149  28.732 -2.476  1.00 0.00  ? 57  GLY A HA2  1  
ATOM   948   H  HA3  . GLY A 1 57  ? 18.633  28.043 -3.058  1.00 0.00  ? 57  GLY A HA3  1  
ATOM   949   N  N    . GLU A 1 58  ? 19.283  27.579 0.094   1.00 0.00  ? 58  GLU A N    1  
ATOM   950   C  CA   . GLU A 1 58  ? 18.708  27.757 1.456   1.00 0.00  ? 58  GLU A CA   1  
ATOM   951   C  C    . GLU A 1 58  ? 17.235  27.349 1.436   1.00 0.00  ? 58  GLU A C    1  
ATOM   952   O  O    . GLU A 1 58  ? 16.665  27.102 0.391   1.00 0.00  ? 58  GLU A O    1  
ATOM   953   C  CB   . GLU A 1 58  ? 18.843  29.220 1.886   1.00 0.00  ? 58  GLU A CB   1  
ATOM   954   C  CG   . GLU A 1 58  ? 19.689  29.297 3.160   1.00 0.00  ? 58  GLU A CG   1  
ATOM   955   C  CD   . GLU A 1 58  ? 19.366  30.586 3.916   1.00 0.00  ? 58  GLU A CD   1  
ATOM   956   O  OE1  . GLU A 1 58  ? 18.540  31.342 3.433   1.00 0.00  ? 58  GLU A OE1  1  
ATOM   957   O  OE2  . GLU A 1 58  ? 19.951  30.794 4.966   1.00 0.00  ? 58  GLU A OE2  1  
ATOM   958   H  H    . GLU A 1 58  ? 20.055  26.989 -0.039  1.00 0.00  ? 58  GLU A H    1  
ATOM   959   H  HA   . GLU A 1 58  ? 19.240  27.128 2.154   1.00 0.00  ? 58  GLU A HA   1  
ATOM   960   H  HB2  . GLU A 1 58  ? 19.323  29.783 1.099   1.00 0.00  ? 58  GLU A HB2  1  
ATOM   961   H  HB3  . GLU A 1 58  ? 17.864  29.631 2.079   1.00 0.00  ? 58  GLU A HB3  1  
ATOM   962   H  HG2  . GLU A 1 58  ? 19.470  28.447 3.790   1.00 0.00  ? 58  GLU A HG2  1  
ATOM   963   H  HG3  . GLU A 1 58  ? 20.737  29.289 2.899   1.00 0.00  ? 58  GLU A HG3  1  
ATOM   964   N  N    . ALA A 1 59  ? 16.614  27.256 2.579   1.00 0.00  ? 59  ALA A N    1  
ATOM   965   C  CA   . ALA A 1 59  ? 15.182  26.840 2.607   1.00 0.00  ? 59  ALA A CA   1  
ATOM   966   C  C    . ALA A 1 59  ? 14.384  27.717 3.572   1.00 0.00  ? 59  ALA A C    1  
ATOM   967   O  O    . ALA A 1 59  ? 14.914  28.264 4.519   1.00 0.00  ? 59  ALA A O    1  
ATOM   968   C  CB   . ALA A 1 59  ? 15.092  25.386 3.072   1.00 0.00  ? 59  ALA A CB   1  
ATOM   969   H  H    . ALA A 1 59  ? 17.090  27.447 3.415   1.00 0.00  ? 59  ALA A H    1  
ATOM   970   H  HA   . ALA A 1 59  ? 14.765  26.924 1.616   1.00 0.00  ? 59  ALA A HA   1  
ATOM   971   H  HB1  . ALA A 1 59  ? 15.706  24.765 2.437   1.00 0.00  ? 59  ALA A HB1  1  
ATOM   972   H  HB2  . ALA A 1 59  ? 14.065  25.056 3.019   1.00 0.00  ? 59  ALA A HB2  1  
ATOM   973   H  HB3  . ALA A 1 59  ? 15.441  25.314 4.092   1.00 0.00  ? 59  ALA A HB3  1  
ATOM   974   N  N    . ASP A 1 60  ? 13.102  27.831 3.348   1.00 0.00  ? 60  ASP A N    1  
ATOM   975   C  CA   . ASP A 1 60  ? 12.254  28.645 4.259   1.00 0.00  ? 60  ASP A CA   1  
ATOM   976   C  C    . ASP A 1 60  ? 12.373  28.064 5.666   1.00 0.00  ? 60  ASP A C    1  
ATOM   977   O  O    . ASP A 1 60  ? 12.599  28.771 6.626   1.00 0.00  ? 60  ASP A O    1  
ATOM   978   C  CB   . ASP A 1 60  ? 10.795  28.573 3.797   1.00 0.00  ? 60  ASP A CB   1  
ATOM   979   C  CG   . ASP A 1 60  ? 10.631  29.364 2.497   1.00 0.00  ? 60  ASP A CG   1  
ATOM   980   O  OD1  . ASP A 1 60  ? 11.603  29.959 2.063   1.00 0.00  ? 60  ASP A OD1  1  
ATOM   981   O  OD2  . ASP A 1 60  ? 9.537   29.357 1.956   1.00 0.00  ? 60  ASP A OD2  1  
ATOM   982   H  H    . ASP A 1 60  ? 12.696  27.363 2.589   1.00 0.00  ? 60  ASP A H    1  
ATOM   983   H  HA   . ASP A 1 60  ? 12.591  29.670 4.256   1.00 0.00  ? 60  ASP A HA   1  
ATOM   984   H  HB2  . ASP A 1 60  ? 10.523  27.541 3.627   1.00 0.00  ? 60  ASP A HB2  1  
ATOM   985   H  HB3  . ASP A 1 60  ? 10.154  28.994 4.557   1.00 0.00  ? 60  ASP A HB3  1  
ATOM   986   N  N    . ILE A 1 61  ? 12.237  26.770 5.780   1.00 0.00  ? 61  ILE A N    1  
ATOM   987   C  CA   . ILE A 1 61  ? 12.352  26.106 7.112   1.00 0.00  ? 61  ILE A CA   1  
ATOM   988   C  C    . ILE A 1 61  ? 13.733  25.452 7.217   1.00 0.00  ? 61  ILE A C    1  
ATOM   989   O  O    . ILE A 1 61  ? 14.129  24.682 6.363   1.00 0.00  ? 61  ILE A O    1  
ATOM   990   C  CB   . ILE A 1 61  ? 11.260  25.031 7.269   1.00 0.00  ? 61  ILE A CB   1  
ATOM   991   C  CG1  . ILE A 1 61  ? 10.792  24.545 5.891   1.00 0.00  ? 61  ILE A CG1  1  
ATOM   992   C  CG2  . ILE A 1 61  ? 10.062  25.613 8.023   1.00 0.00  ? 61  ILE A CG2  1  
ATOM   993   C  CD1  . ILE A 1 61  ? 9.616   23.581 6.057   1.00 0.00  ? 61  ILE A CD1  1  
ATOM   994   H  H    . ILE A 1 61  ? 12.072  26.231 4.980   1.00 0.00  ? 61  ILE A H    1  
ATOM   995   H  HA   . ILE A 1 61  ? 12.246  26.847 7.889   1.00 0.00  ? 61  ILE A HA   1  
ATOM   996   H  HB   . ILE A 1 61  ? 11.661  24.197 7.826   1.00 0.00  ? 61  ILE A HB   1  
ATOM   997   H  HG12 . ILE A 1 61  ? 10.477  25.393 5.301   1.00 0.00  ? 61  ILE A HG12 1  
ATOM   998   H  HG13 . ILE A 1 61  ? 11.604  24.039 5.390   1.00 0.00  ? 61  ILE A HG13 1  
ATOM   999   H  HG21 . ILE A 1 61  ? 10.027  25.202 9.021   1.00 0.00  ? 61  ILE A HG21 1  
ATOM   1000  H  HG22 . ILE A 1 61  ? 9.151   25.365 7.499   1.00 0.00  ? 61  ILE A HG22 1  
ATOM   1001  H  HG23 . ILE A 1 61  ? 10.160  26.684 8.079   1.00 0.00  ? 61  ILE A HG23 1  
ATOM   1002  H  HD11 . ILE A 1 61  ? 8.745   24.130 6.384   1.00 0.00  ? 61  ILE A HD11 1  
ATOM   1003  H  HD12 . ILE A 1 61  ? 9.865   22.831 6.792   1.00 0.00  ? 61  ILE A HD12 1  
ATOM   1004  H  HD13 . ILE A 1 61  ? 9.405   23.102 5.112   1.00 0.00  ? 61  ILE A HD13 1  
ATOM   1005  N  N    . MET A 1 62  ? 14.477  25.751 8.250   1.00 0.00  ? 62  MET A N    1  
ATOM   1006  C  CA   . MET A 1 62  ? 15.835  25.139 8.383   1.00 0.00  ? 62  MET A CA   1  
ATOM   1007  C  C    . MET A 1 62  ? 15.880  24.258 9.634   1.00 0.00  ? 62  MET A C    1  
ATOM   1008  O  O    . MET A 1 62  ? 15.567  24.692 10.724  1.00 0.00  ? 62  MET A O    1  
ATOM   1009  C  CB   . MET A 1 62  ? 16.890  26.245 8.477   1.00 0.00  ? 62  MET A CB   1  
ATOM   1010  C  CG   . MET A 1 62  ? 16.880  27.065 7.182   1.00 0.00  ? 62  MET A CG   1  
ATOM   1011  S  SD   . MET A 1 62  ? 16.992  28.829 7.572   1.00 0.00  ? 62  MET A SD   1  
ATOM   1012  C  CE   . MET A 1 62  ? 18.550  28.755 8.484   1.00 0.00  ? 62  MET A CE   1  
ATOM   1013  H  H    . MET A 1 62  ? 14.146  26.376 8.936   1.00 0.00  ? 62  MET A H    1  
ATOM   1014  H  HA   . MET A 1 62  ? 16.035  24.528 7.514   1.00 0.00  ? 62  MET A HA   1  
ATOM   1015  H  HB2  . MET A 1 62  ? 16.668  26.886 9.316   1.00 0.00  ? 62  MET A HB2  1  
ATOM   1016  H  HB3  . MET A 1 62  ? 17.865  25.801 8.610   1.00 0.00  ? 62  MET A HB3  1  
ATOM   1017  H  HG2  . MET A 1 62  ? 17.722  26.782 6.568   1.00 0.00  ? 62  MET A HG2  1  
ATOM   1018  H  HG3  . MET A 1 62  ? 15.963  26.873 6.645   1.00 0.00  ? 62  MET A HG3  1  
ATOM   1019  H  HE1  . MET A 1 62  ? 19.086  27.858 8.205   1.00 0.00  ? 62  MET A HE1  1  
ATOM   1020  H  HE2  . MET A 1 62  ? 18.347  28.735 9.542   1.00 0.00  ? 62  MET A HE2  1  
ATOM   1021  H  HE3  . MET A 1 62  ? 19.146  29.626 8.249   1.00 0.00  ? 62  MET A HE3  1  
ATOM   1022  N  N    . ILE A 1 63  ? 16.249  23.015 9.483   1.00 0.00  ? 63  ILE A N    1  
ATOM   1023  C  CA   . ILE A 1 63  ? 16.287  22.102 10.663  1.00 0.00  ? 63  ILE A CA   1  
ATOM   1024  C  C    . ILE A 1 63  ? 17.733  21.853 11.110  1.00 0.00  ? 63  ILE A C    1  
ATOM   1025  O  O    . ILE A 1 63  ? 18.667  22.009 10.346  1.00 0.00  ? 63  ILE A O    1  
ATOM   1026  C  CB   . ILE A 1 63  ? 15.630  20.775 10.278  1.00 0.00  ? 63  ILE A CB   1  
ATOM   1027  C  CG1  . ILE A 1 63  ? 14.124  20.988 10.092  1.00 0.00  ? 63  ILE A CG1  1  
ATOM   1028  C  CG2  . ILE A 1 63  ? 15.865  19.746 11.384  1.00 0.00  ? 63  ILE A CG2  1  
ATOM   1029  C  CD1  . ILE A 1 63  ? 13.782  20.981 8.598   1.00 0.00  ? 63  ILE A CD1  1  
ATOM   1030  H  H    . ILE A 1 63  ? 16.485  22.678 8.591   1.00 0.00  ? 63  ILE A H    1  
ATOM   1031  H  HA   . ILE A 1 63  ? 15.735  22.549 11.476  1.00 0.00  ? 63  ILE A HA   1  
ATOM   1032  H  HB   . ILE A 1 63  ? 16.062  20.416 9.355   1.00 0.00  ? 63  ILE A HB   1  
ATOM   1033  H  HG12 . ILE A 1 63  ? 13.588  20.193 10.589  1.00 0.00  ? 63  ILE A HG12 1  
ATOM   1034  H  HG13 . ILE A 1 63  ? 13.837  21.937 10.520  1.00 0.00  ? 63  ILE A HG13 1  
ATOM   1035  H  HG21 . ILE A 1 63  ? 16.924  19.654 11.572  1.00 0.00  ? 63  ILE A HG21 1  
ATOM   1036  H  HG22 . ILE A 1 63  ? 15.469  18.791 11.073  1.00 0.00  ? 63  ILE A HG22 1  
ATOM   1037  H  HG23 . ILE A 1 63  ? 15.365  20.067 12.286  1.00 0.00  ? 63  ILE A HG23 1  
ATOM   1038  H  HD11 . ILE A 1 63  ? 14.044  20.024 8.171   1.00 0.00  ? 63  ILE A HD11 1  
ATOM   1039  H  HD12 . ILE A 1 63  ? 14.336  21.761 8.098   1.00 0.00  ? 63  ILE A HD12 1  
ATOM   1040  H  HD13 . ILE A 1 63  ? 12.723  21.155 8.470   1.00 0.00  ? 63  ILE A HD13 1  
ATOM   1041  N  N    . ASN A 1 64  ? 17.926  21.452 12.346  1.00 0.00  ? 64  ASN A N    1  
ATOM   1042  C  CA   . ASN A 1 64  ? 19.297  21.180 12.835  1.00 0.00  ? 64  ASN A CA   1  
ATOM   1043  C  C    . ASN A 1 64  ? 19.249  20.756 14.311  1.00 0.00  ? 64  ASN A C    1  
ATOM   1044  O  O    . ASN A 1 64  ? 18.397  19.991 14.717  1.00 0.00  ? 64  ASN A O    1  
ATOM   1045  C  CB   . ASN A 1 64  ? 20.166  22.432 12.682  1.00 0.00  ? 64  ASN A CB   1  
ATOM   1046  C  CG   . ASN A 1 64  ? 21.638  22.016 12.566  1.00 0.00  ? 64  ASN A CG   1  
ATOM   1047  O  OD1  . ASN A 1 64  ? 22.498  22.597 13.198  1.00 0.00  ? 64  ASN A OD1  1  
ATOM   1048  N  ND2  . ASN A 1 64  ? 21.965  21.027 11.779  1.00 0.00  ? 64  ASN A ND2  1  
ATOM   1049  H  H    . ASN A 1 64  ? 17.171  21.318 12.944  1.00 0.00  ? 64  ASN A H    1  
ATOM   1050  H  HA   . ASN A 1 64  ? 19.706  20.382 12.251  1.00 0.00  ? 64  ASN A HA   1  
ATOM   1051  H  HB2  . ASN A 1 64  ? 19.869  22.976 11.797  1.00 0.00  ? 64  ASN A HB2  1  
ATOM   1052  H  HB3  . ASN A 1 64  ? 20.042  23.064 13.549  1.00 0.00  ? 64  ASN A HB3  1  
ATOM   1053  H  HD21 . ASN A 1 64  ? 21.274  20.557 11.268  1.00 0.00  ? 64  ASN A HD21 1  
ATOM   1054  H  HD22 . ASN A 1 64  ? 22.903  20.754 11.701  1.00 0.00  ? 64  ASN A HD22 1  
ATOM   1055  N  N    . PHE A 1 65  ? 20.165  21.234 15.117  1.00 0.00  ? 65  PHE A N    1  
ATOM   1056  C  CA   . PHE A 1 65  ? 20.174  20.842 16.554  1.00 0.00  ? 65  PHE A CA   1  
ATOM   1057  C  C    . PHE A 1 65  ? 20.060  22.090 17.435  1.00 0.00  ? 65  PHE A C    1  
ATOM   1058  O  O    . PHE A 1 65  ? 19.877  23.190 16.952  1.00 0.00  ? 65  PHE A O    1  
ATOM   1059  C  CB   . PHE A 1 65  ? 21.484  20.116 16.855  1.00 0.00  ? 65  PHE A CB   1  
ATOM   1060  C  CG   . PHE A 1 65  ? 21.749  19.107 15.763  1.00 0.00  ? 65  PHE A CG   1  
ATOM   1061  C  CD1  . PHE A 1 65  ? 20.946  17.968 15.658  1.00 0.00  ? 65  PHE A CD1  1  
ATOM   1062  C  CD2  . PHE A 1 65  ? 22.792  19.315 14.854  1.00 0.00  ? 65  PHE A CD2  1  
ATOM   1063  C  CE1  . PHE A 1 65  ? 21.185  17.035 14.642  1.00 0.00  ? 65  PHE A CE1  1  
ATOM   1064  C  CE2  . PHE A 1 65  ? 23.032  18.383 13.838  1.00 0.00  ? 65  PHE A CE2  1  
ATOM   1065  C  CZ   . PHE A 1 65  ? 22.229  17.243 13.732  1.00 0.00  ? 65  PHE A CZ   1  
ATOM   1066  H  H    . PHE A 1 65  ? 20.855  21.839 14.775  1.00 0.00  ? 65  PHE A H    1  
ATOM   1067  H  HA   . PHE A 1 65  ? 19.343  20.182 16.755  1.00 0.00  ? 65  PHE A HA   1  
ATOM   1068  H  HB2  . PHE A 1 65  ? 22.293  20.830 16.889  1.00 0.00  ? 65  PHE A HB2  1  
ATOM   1069  H  HB3  . PHE A 1 65  ? 21.408  19.608 17.804  1.00 0.00  ? 65  PHE A HB3  1  
ATOM   1070  H  HD1  . PHE A 1 65  ? 20.141  17.807 16.361  1.00 0.00  ? 65  PHE A HD1  1  
ATOM   1071  H  HD2  . PHE A 1 65  ? 23.410  20.195 14.936  1.00 0.00  ? 65  PHE A HD2  1  
ATOM   1072  H  HE1  . PHE A 1 65  ? 20.565  16.155 14.560  1.00 0.00  ? 65  PHE A HE1  1  
ATOM   1073  H  HE2  . PHE A 1 65  ? 23.838  18.544 13.138  1.00 0.00  ? 65  PHE A HE2  1  
ATOM   1074  H  HZ   . PHE A 1 65  ? 22.414  16.523 12.947  1.00 0.00  ? 65  PHE A HZ   1  
ATOM   1075  N  N    . GLY A 1 66  ? 20.159  21.926 18.729  1.00 0.00  ? 66  GLY A N    1  
ATOM   1076  C  CA   . GLY A 1 66  ? 20.049  23.101 19.643  1.00 0.00  ? 66  GLY A CA   1  
ATOM   1077  C  C    . GLY A 1 66  ? 21.429  23.454 20.207  1.00 0.00  ? 66  GLY A C    1  
ATOM   1078  O  O    . GLY A 1 66  ? 21.658  24.552 20.671  1.00 0.00  ? 66  GLY A O    1  
ATOM   1079  H  H    . GLY A 1 66  ? 20.300  21.030 19.099  1.00 0.00  ? 66  GLY A H    1  
ATOM   1080  H  HA2  . GLY A 1 66  ? 19.657  23.944 19.094  1.00 0.00  ? 66  GLY A HA2  1  
ATOM   1081  H  HA3  . GLY A 1 66  ? 19.382  22.859 20.456  1.00 0.00  ? 66  GLY A HA3  1  
ATOM   1082  N  N    . ARG A 1 67  ? 22.354  22.535 20.160  1.00 0.00  ? 67  ARG A N    1  
ATOM   1083  C  CA   . ARG A 1 67  ? 23.724  22.822 20.680  1.00 0.00  ? 67  ARG A CA   1  
ATOM   1084  C  C    . ARG A 1 67  ? 23.669  23.169 22.170  1.00 0.00  ? 67  ARG A C    1  
ATOM   1085  O  O    . ARG A 1 67  ? 22.612  23.360 22.739  1.00 0.00  ? 67  ARG A O    1  
ATOM   1086  C  CB   . ARG A 1 67  ? 24.318  24.001 19.908  1.00 0.00  ? 67  ARG A CB   1  
ATOM   1087  C  CG   . ARG A 1 67  ? 24.786  23.518 18.535  1.00 0.00  ? 67  ARG A CG   1  
ATOM   1088  C  CD   . ARG A 1 67  ? 24.985  24.714 17.606  1.00 0.00  ? 67  ARG A CD   1  
ATOM   1089  N  NE   . ARG A 1 67  ? 26.126  24.433 16.691  1.00 0.00  ? 67  ARG A NE   1  
ATOM   1090  C  CZ   . ARG A 1 67  ? 26.409  25.258 15.719  1.00 0.00  ? 67  ARG A CZ   1  
ATOM   1091  N  NH1  . ARG A 1 67  ? 25.696  26.338 15.544  1.00 0.00  ? 67  ARG A NH1  1  
ATOM   1092  N  NH2  . ARG A 1 67  ? 27.411  25.005 14.924  1.00 0.00  ? 67  ARG A NH2  1  
ATOM   1093  H  H    . ARG A 1 67  ? 22.152  21.658 19.773  1.00 0.00  ? 67  ARG A H    1  
ATOM   1094  H  HA   . ARG A 1 67  ? 24.350  21.955 20.538  1.00 0.00  ? 67  ARG A HA   1  
ATOM   1095  H  HB2  . ARG A 1 67  ? 23.567  24.769 19.787  1.00 0.00  ? 67  ARG A HB2  1  
ATOM   1096  H  HB3  . ARG A 1 67  ? 25.159  24.403 20.453  1.00 0.00  ? 67  ARG A HB3  1  
ATOM   1097  H  HG2  . ARG A 1 67  ? 25.721  22.986 18.641  1.00 0.00  ? 67  ARG A HG2  1  
ATOM   1098  H  HG3  . ARG A 1 67  ? 24.042  22.858 18.112  1.00 0.00  ? 67  ARG A HG3  1  
ATOM   1099  H  HD2  . ARG A 1 67  ? 24.087  24.873 17.026  1.00 0.00  ? 67  ARG A HD2  1  
ATOM   1100  H  HD3  . ARG A 1 67  ? 25.199  25.595 18.191  1.00 0.00  ? 67  ARG A HD3  1  
ATOM   1101  H  HE   . ARG A 1 67  ? 26.666  23.623 16.818  1.00 0.00  ? 67  ARG A HE   1  
ATOM   1102  H  HH11 . ARG A 1 67  ? 24.928  26.538 16.152  1.00 0.00  ? 67  ARG A HH11 1  
ATOM   1103  H  HH12 . ARG A 1 67  ? 25.919  26.966 14.798  1.00 0.00  ? 67  ARG A HH12 1  
ATOM   1104  H  HH21 . ARG A 1 67  ? 27.961  24.182 15.061  1.00 0.00  ? 67  ARG A HH21 1  
ATOM   1105  H  HH22 . ARG A 1 67  ? 27.625  25.631 14.175  1.00 0.00  ? 67  ARG A HH22 1  
ATOM   1106  N  N    . TRP A 1 68  ? 24.811  23.256 22.802  1.00 0.00  ? 68  TRP A N    1  
ATOM   1107  C  CA   . TRP A 1 68  ? 24.851  23.595 24.253  1.00 0.00  ? 68  TRP A CA   1  
ATOM   1108  C  C    . TRP A 1 68  ? 24.722  25.110 24.418  1.00 0.00  ? 68  TRP A C    1  
ATOM   1109  O  O    . TRP A 1 68  ? 24.011  25.592 25.277  1.00 0.00  ? 68  TRP A O    1  
ATOM   1110  C  CB   . TRP A 1 68  ? 26.185  23.139 24.847  1.00 0.00  ? 68  TRP A CB   1  
ATOM   1111  C  CG   . TRP A 1 68  ? 26.216  21.647 24.956  1.00 0.00  ? 68  TRP A CG   1  
ATOM   1112  C  CD1  . TRP A 1 68  ? 25.127  20.845 24.972  1.00 0.00  ? 68  TRP A CD1  1  
ATOM   1113  C  CD2  . TRP A 1 68  ? 27.373  20.768 25.070  1.00 0.00  ? 68  TRP A CD2  1  
ATOM   1114  N  NE1  . TRP A 1 68  ? 25.542  19.530 25.086  1.00 0.00  ? 68  TRP A NE1  1  
ATOM   1115  C  CE2  . TRP A 1 68  ? 26.918  19.431 25.150  1.00 0.00  ? 68  TRP A CE2  1  
ATOM   1116  C  CE3  . TRP A 1 68  ? 28.761  20.999 25.110  1.00 0.00  ? 68  TRP A CE3  1  
ATOM   1117  C  CZ2  . TRP A 1 68  ? 27.806  18.361 25.266  1.00 0.00  ? 68  TRP A CZ2  1  
ATOM   1118  C  CZ3  . TRP A 1 68  ? 29.659  19.923 25.226  1.00 0.00  ? 68  TRP A CZ3  1  
ATOM   1119  C  CH2  . TRP A 1 68  ? 29.182  18.607 25.305  1.00 0.00  ? 68  TRP A CH2  1  
ATOM   1120  H  H    . TRP A 1 68  ? 25.648  23.101 22.317  1.00 0.00  ? 68  TRP A H    1  
ATOM   1121  H  HA   . TRP A 1 68  ? 24.037  23.102 24.765  1.00 0.00  ? 68  TRP A HA   1  
ATOM   1122  H  HB2  . TRP A 1 68  ? 26.990  23.469 24.209  1.00 0.00  ? 68  TRP A HB2  1  
ATOM   1123  H  HB3  . TRP A 1 68  ? 26.304  23.571 25.829  1.00 0.00  ? 68  TRP A HB3  1  
ATOM   1124  H  HD1  . TRP A 1 68  ? 24.102  21.176 24.906  1.00 0.00  ? 68  TRP A HD1  1  
ATOM   1125  H  HE1  . TRP A 1 68  ? 24.949  18.751 25.120  1.00 0.00  ? 68  TRP A HE1  1  
ATOM   1126  H  HE3  . TRP A 1 68  ? 29.139  22.010 25.050  1.00 0.00  ? 68  TRP A HE3  1  
ATOM   1127  H  HZ2  . TRP A 1 68  ? 27.433  17.348 25.326  1.00 0.00  ? 68  TRP A HZ2  1  
ATOM   1128  H  HZ3  . TRP A 1 68  ? 30.722  20.113 25.256  1.00 0.00  ? 68  TRP A HZ3  1  
ATOM   1129  H  HH2  . TRP A 1 68  ? 29.876  17.784 25.394  1.00 0.00  ? 68  TRP A HH2  1  
ATOM   1130  N  N    . GLU A 1 69  ? 25.407  25.865 23.599  1.00 0.00  ? 69  GLU A N    1  
ATOM   1131  C  CA   . GLU A 1 69  ? 25.324  27.351 23.702  1.00 0.00  ? 69  GLU A CA   1  
ATOM   1132  C  C    . GLU A 1 69  ? 23.991  27.821 23.107  1.00 0.00  ? 69  GLU A C    1  
ATOM   1133  O  O    . GLU A 1 69  ? 22.972  27.804 23.767  1.00 0.00  ? 69  GLU A O    1  
ATOM   1134  C  CB   . GLU A 1 69  ? 26.491  27.981 22.934  1.00 0.00  ? 69  GLU A CB   1  
ATOM   1135  C  CG   . GLU A 1 69  ? 27.787  27.786 23.724  1.00 0.00  ? 69  GLU A CG   1  
ATOM   1136  C  CD   . GLU A 1 69  ? 28.847  28.760 23.210  1.00 0.00  ? 69  GLU A CD   1  
ATOM   1137  O  OE1  . GLU A 1 69  ? 28.470  29.759 22.621  1.00 0.00  ? 69  GLU A OE1  1  
ATOM   1138  O  OE2  . GLU A 1 69  ? 30.020  28.489 23.413  1.00 0.00  ? 69  GLU A OE2  1  
ATOM   1139  H  H    . GLU A 1 69  ? 25.975  25.453 22.915  1.00 0.00  ? 69  GLU A H    1  
ATOM   1140  H  HA   . GLU A 1 69  ? 25.376  27.643 24.741  1.00 0.00  ? 69  GLU A HA   1  
ATOM   1141  H  HB2  . GLU A 1 69  ? 26.586  27.507 21.967  1.00 0.00  ? 69  GLU A HB2  1  
ATOM   1142  H  HB3  . GLU A 1 69  ? 26.309  29.038 22.800  1.00 0.00  ? 69  GLU A HB3  1  
ATOM   1143  H  HG2  . GLU A 1 69  ? 27.602  27.972 24.773  1.00 0.00  ? 69  GLU A HG2  1  
ATOM   1144  H  HG3  . GLU A 1 69  ? 28.139  26.774 23.593  1.00 0.00  ? 69  GLU A HG3  1  
ATOM   1145  N  N    . HIS A 1 70  ? 23.988  28.226 21.864  1.00 0.00  ? 70  HIS A N    1  
ATOM   1146  C  CA   . HIS A 1 70  ? 22.718  28.680 21.222  1.00 0.00  ? 70  HIS A CA   1  
ATOM   1147  C  C    . HIS A 1 70  ? 22.371  30.106 21.671  1.00 0.00  ? 70  HIS A C    1  
ATOM   1148  O  O    . HIS A 1 70  ? 22.610  31.061 20.960  1.00 0.00  ? 70  HIS A O    1  
ATOM   1149  C  CB   . HIS A 1 70  ? 21.584  27.722 21.600  1.00 0.00  ? 70  HIS A CB   1  
ATOM   1150  C  CG   . HIS A 1 70  ? 20.443  27.894 20.637  1.00 0.00  ? 70  HIS A CG   1  
ATOM   1151  N  ND1  . HIS A 1 70  ? 20.264  29.057 19.905  1.00 0.00  ? 70  HIS A ND1  1  
ATOM   1152  C  CD2  . HIS A 1 70  ? 19.412  27.061 20.278  1.00 0.00  ? 70  HIS A CD2  1  
ATOM   1153  C  CE1  . HIS A 1 70  ? 19.163  28.894 19.150  1.00 0.00  ? 70  HIS A CE1  1  
ATOM   1154  N  NE2  . HIS A 1 70  ? 18.604  27.695 19.338  1.00 0.00  ? 70  HIS A NE2  1  
ATOM   1155  H  H    . HIS A 1 70  ? 24.819  28.222 21.346  1.00 0.00  ? 70  HIS A H    1  
ATOM   1156  H  HA   . HIS A 1 70  ? 22.843  28.670 20.148  1.00 0.00  ? 70  HIS A HA   1  
ATOM   1157  H  HB2  . HIS A 1 70  ? 21.944  26.706 21.551  1.00 0.00  ? 70  HIS A HB2  1  
ATOM   1158  H  HB3  . HIS A 1 70  ? 21.244  27.933 22.601  1.00 0.00  ? 70  HIS A HB3  1  
ATOM   1159  H  HD1  . HIS A 1 70  ? 20.839  29.850 19.926  1.00 0.00  ? 70  HIS A HD1  1  
ATOM   1160  H  HD2  . HIS A 1 70  ? 19.258  26.064 20.658  1.00 0.00  ? 70  HIS A HD2  1  
ATOM   1161  H  HE1  . HIS A 1 70  ? 18.778  29.642 18.473  1.00 0.00  ? 70  HIS A HE1  1  
ATOM   1162  N  N    . GLY A 1 71  ? 21.804  30.264 22.838  1.00 0.00  ? 71  GLY A N    1  
ATOM   1163  C  CA   . GLY A 1 71  ? 21.444  31.631 23.308  1.00 0.00  ? 71  GLY A CA   1  
ATOM   1164  C  C    . GLY A 1 71  ? 19.938  31.709 23.568  1.00 0.00  ? 71  GLY A C    1  
ATOM   1165  O  O    . GLY A 1 71  ? 19.474  32.555 24.307  1.00 0.00  ? 71  GLY A O    1  
ATOM   1166  H  H    . GLY A 1 71  ? 21.612  29.487 23.403  1.00 0.00  ? 71  GLY A H    1  
ATOM   1167  H  HA2  . GLY A 1 71  ? 21.980  31.850 24.220  1.00 0.00  ? 71  GLY A HA2  1  
ATOM   1168  H  HA3  . GLY A 1 71  ? 21.710  32.354 22.552  1.00 0.00  ? 71  GLY A HA3  1  
ATOM   1169  N  N    . ASP A 1 72  ? 19.174  30.840 22.955  1.00 0.00  ? 72  ASP A N    1  
ATOM   1170  C  CA   . ASP A 1 72  ? 17.700  30.857 23.146  1.00 0.00  ? 72  ASP A CA   1  
ATOM   1171  C  C    . ASP A 1 72  ? 17.364  31.197 24.600  1.00 0.00  ? 72  ASP A C    1  
ATOM   1172  O  O    . ASP A 1 72  ? 17.209  32.348 24.960  1.00 0.00  ? 72  ASP A O    1  
ATOM   1173  C  CB   . ASP A 1 72  ? 17.121  29.482 22.797  1.00 0.00  ? 72  ASP A CB   1  
ATOM   1174  C  CG   . ASP A 1 72  ? 16.590  29.500 21.363  1.00 0.00  ? 72  ASP A CG   1  
ATOM   1175  O  OD1  . ASP A 1 72  ? 16.591  30.563 20.765  1.00 0.00  ? 72  ASP A OD1  1  
ATOM   1176  O  OD2  . ASP A 1 72  ? 16.190  28.449 20.886  1.00 0.00  ? 72  ASP A OD2  1  
ATOM   1177  H  H    . ASP A 1 72  ? 19.569  30.181 22.357  1.00 0.00  ? 72  ASP A H    1  
ATOM   1178  H  HA   . ASP A 1 72  ? 17.279  31.597 22.493  1.00 0.00  ? 72  ASP A HA   1  
ATOM   1179  H  HB2  . ASP A 1 72  ? 17.894  28.733 22.884  1.00 0.00  ? 72  ASP A HB2  1  
ATOM   1180  H  HB3  . ASP A 1 72  ? 16.314  29.246 23.474  1.00 0.00  ? 72  ASP A HB3  1  
ATOM   1181  N  N    . GLY A 1 73  ? 17.252  30.204 25.438  1.00 0.00  ? 73  GLY A N    1  
ATOM   1182  C  CA   . GLY A 1 73  ? 16.928  30.468 26.870  1.00 0.00  ? 73  GLY A CA   1  
ATOM   1183  C  C    . GLY A 1 73  ? 16.955  29.151 27.649  1.00 0.00  ? 73  GLY A C    1  
ATOM   1184  O  O    . GLY A 1 73  ? 16.231  28.967 28.607  1.00 0.00  ? 73  GLY A O    1  
ATOM   1185  H  H    . GLY A 1 73  ? 17.383  29.284 25.126  1.00 0.00  ? 73  GLY A H    1  
ATOM   1186  H  HA2  . GLY A 1 73  ? 17.658  31.149 27.284  1.00 0.00  ? 73  GLY A HA2  1  
ATOM   1187  H  HA3  . GLY A 1 73  ? 15.944  30.905 26.942  1.00 0.00  ? 73  GLY A HA3  1  
ATOM   1188  N  N    . TYR A 1 74  ? 17.783  28.234 27.237  1.00 0.00  ? 74  TYR A N    1  
ATOM   1189  C  CA   . TYR A 1 74  ? 17.863  26.921 27.937  1.00 0.00  ? 74  TYR A CA   1  
ATOM   1190  C  C    . TYR A 1 74  ? 18.920  26.063 27.236  1.00 0.00  ? 74  TYR A C    1  
ATOM   1191  O  O    . TYR A 1 74  ? 18.589  25.148 26.509  1.00 0.00  ? 74  TYR A O    1  
ATOM   1192  C  CB   . TYR A 1 74  ? 16.498  26.228 27.858  1.00 0.00  ? 74  TYR A CB   1  
ATOM   1193  C  CG   . TYR A 1 74  ? 16.256  25.417 29.110  1.00 0.00  ? 74  TYR A CG   1  
ATOM   1194  C  CD1  . TYR A 1 74  ? 15.921  26.059 30.309  1.00 0.00  ? 74  TYR A CD1  1  
ATOM   1195  C  CD2  . TYR A 1 74  ? 16.355  24.022 29.067  1.00 0.00  ? 74  TYR A CD2  1  
ATOM   1196  C  CE1  . TYR A 1 74  ? 15.687  25.304 31.464  1.00 0.00  ? 74  TYR A CE1  1  
ATOM   1197  C  CE2  . TYR A 1 74  ? 16.123  23.267 30.222  1.00 0.00  ? 74  TYR A CE2  1  
ATOM   1198  C  CZ   . TYR A 1 74  ? 15.788  23.908 31.421  1.00 0.00  ? 74  TYR A CZ   1  
ATOM   1199  O  OH   . TYR A 1 74  ? 15.553  23.163 32.559  1.00 0.00  ? 74  TYR A OH   1  
ATOM   1200  H  H    . TYR A 1 74  ? 18.355  28.406 26.460  1.00 0.00  ? 74  TYR A H    1  
ATOM   1201  H  HA   . TYR A 1 74  ? 18.138  27.072 28.972  1.00 0.00  ? 74  TYR A HA   1  
ATOM   1202  H  HB2  . TYR A 1 74  ? 15.723  26.973 27.760  1.00 0.00  ? 74  TYR A HB2  1  
ATOM   1203  H  HB3  . TYR A 1 74  ? 16.478  25.575 26.999  1.00 0.00  ? 74  TYR A HB3  1  
ATOM   1204  H  HD1  . TYR A 1 74  ? 15.844  27.136 30.344  1.00 0.00  ? 74  TYR A HD1  1  
ATOM   1205  H  HD2  . TYR A 1 74  ? 16.612  23.529 28.141  1.00 0.00  ? 74  TYR A HD2  1  
ATOM   1206  H  HE1  . TYR A 1 74  ? 15.427  25.797 32.389  1.00 0.00  ? 74  TYR A HE1  1  
ATOM   1207  H  HE2  . TYR A 1 74  ? 16.203  22.191 30.189  1.00 0.00  ? 74  TYR A HE2  1  
ATOM   1208  H  HH   . TYR A 1 74  ? 16.240  23.368 33.197  1.00 0.00  ? 74  TYR A HH   1  
ATOM   1209  N  N    . PRO A 1 75  ? 20.165  26.402 27.464  1.00 0.00  ? 75  PRO A N    1  
ATOM   1210  C  CA   . PRO A 1 75  ? 21.306  25.698 26.849  1.00 0.00  ? 75  PRO A CA   1  
ATOM   1211  C  C    . PRO A 1 75  ? 21.527  24.317 27.473  1.00 0.00  ? 75  PRO A C    1  
ATOM   1212  O  O    . PRO A 1 75  ? 21.517  24.152 28.676  1.00 0.00  ? 75  PRO A O    1  
ATOM   1213  C  CB   . PRO A 1 75  ? 22.491  26.626 27.118  1.00 0.00  ? 75  PRO A CB   1  
ATOM   1214  C  CG   . PRO A 1 75  ? 22.089  27.510 28.320  1.00 0.00  ? 75  PRO A CG   1  
ATOM   1215  C  CD   . PRO A 1 75  ? 20.551  27.510 28.363  1.00 0.00  ? 75  PRO A CD   1  
ATOM   1216  H  HA   . PRO A 1 75  ? 21.159  25.607 25.785  1.00 0.00  ? 75  PRO A HA   1  
ATOM   1217  H  HB2  . PRO A 1 75  ? 23.371  26.043 27.358  1.00 0.00  ? 75  PRO A HB2  1  
ATOM   1218  H  HB3  . PRO A 1 75  ? 22.677  27.245 26.257  1.00 0.00  ? 75  PRO A HB3  1  
ATOM   1219  H  HG2  . PRO A 1 75  ? 22.487  27.093 29.235  1.00 0.00  ? 75  PRO A HG2  1  
ATOM   1220  H  HG3  . PRO A 1 75  ? 22.450  28.517 28.181  1.00 0.00  ? 75  PRO A HG3  1  
ATOM   1221  H  HD2  . PRO A 1 75  ? 20.202  27.327 29.370  1.00 0.00  ? 75  PRO A HD2  1  
ATOM   1222  H  HD3  . PRO A 1 75  ? 20.164  28.445 27.989  1.00 0.00  ? 75  PRO A HD3  1  
ATOM   1223  N  N    . PHE A 1 76  ? 21.732  23.335 26.633  1.00 0.00  ? 76  PHE A N    1  
ATOM   1224  C  CA   . PHE A 1 76  ? 21.967  21.931 27.094  1.00 0.00  ? 76  PHE A CA   1  
ATOM   1225  C  C    . PHE A 1 76  ? 20.894  21.489 28.087  1.00 0.00  ? 76  PHE A C    1  
ATOM   1226  O  O    . PHE A 1 76  ? 20.208  22.283 28.698  1.00 0.00  ? 76  PHE A O    1  
ATOM   1227  C  CB   . PHE A 1 76  ? 23.363  21.797 27.717  1.00 0.00  ? 76  PHE A CB   1  
ATOM   1228  C  CG   . PHE A 1 76  ? 23.434  22.509 29.046  1.00 0.00  ? 76  PHE A CG   1  
ATOM   1229  C  CD1  . PHE A 1 76  ? 22.731  22.015 30.149  1.00 0.00  ? 76  PHE A CD1  1  
ATOM   1230  C  CD2  . PHE A 1 76  ? 24.219  23.660 29.175  1.00 0.00  ? 76  PHE A CD2  1  
ATOM   1231  C  CE1  . PHE A 1 76  ? 22.813  22.673 31.382  1.00 0.00  ? 76  PHE A CE1  1  
ATOM   1232  C  CE2  . PHE A 1 76  ? 24.303  24.316 30.407  1.00 0.00  ? 76  PHE A CE2  1  
ATOM   1233  C  CZ   . PHE A 1 76  ? 23.600  23.823 31.511  1.00 0.00  ? 76  PHE A CZ   1  
ATOM   1234  H  H    . PHE A 1 76  ? 21.733  23.529 25.673  1.00 0.00  ? 76  PHE A H    1  
ATOM   1235  H  HA   . PHE A 1 76  ? 21.913  21.275 26.234  1.00 0.00  ? 76  PHE A HA   1  
ATOM   1236  H  HB2  . PHE A 1 76  ? 23.587  20.751 27.865  1.00 0.00  ? 76  PHE A HB2  1  
ATOM   1237  H  HB3  . PHE A 1 76  ? 24.094  22.224 27.046  1.00 0.00  ? 76  PHE A HB3  1  
ATOM   1238  H  HD1  . PHE A 1 76  ? 22.124  21.129 30.050  1.00 0.00  ? 76  PHE A HD1  1  
ATOM   1239  H  HD2  . PHE A 1 76  ? 24.763  24.040 28.323  1.00 0.00  ? 76  PHE A HD2  1  
ATOM   1240  H  HE1  . PHE A 1 76  ? 22.272  22.292 32.235  1.00 0.00  ? 76  PHE A HE1  1  
ATOM   1241  H  HE2  . PHE A 1 76  ? 24.908  25.204 30.506  1.00 0.00  ? 76  PHE A HE2  1  
ATOM   1242  H  HZ   . PHE A 1 76  ? 23.665  24.329 32.463  1.00 0.00  ? 76  PHE A HZ   1  
ATOM   1243  N  N    . ASP A 1 77  ? 20.741  20.206 28.225  1.00 0.00  ? 77  ASP A N    1  
ATOM   1244  C  CA   . ASP A 1 77  ? 19.719  19.654 29.145  1.00 0.00  ? 77  ASP A CA   1  
ATOM   1245  C  C    . ASP A 1 77  ? 19.755  18.125 29.064  1.00 0.00  ? 77  ASP A C    1  
ATOM   1246  O  O    . ASP A 1 77  ? 19.445  17.435 30.014  1.00 0.00  ? 77  ASP A O    1  
ATOM   1247  C  CB   . ASP A 1 77  ? 18.338  20.177 28.731  1.00 0.00  ? 77  ASP A CB   1  
ATOM   1248  C  CG   . ASP A 1 77  ? 17.752  19.317 27.601  1.00 0.00  ? 77  ASP A CG   1  
ATOM   1249  O  OD1  . ASP A 1 77  ? 18.402  19.197 26.575  1.00 0.00  ? 77  ASP A OD1  1  
ATOM   1250  O  OD2  . ASP A 1 77  ? 16.664  18.794 27.784  1.00 0.00  ? 77  ASP A OD2  1  
ATOM   1251  H  H    . ASP A 1 77  ? 21.299  19.600 27.710  1.00 0.00  ? 77  ASP A H    1  
ATOM   1252  H  HA   . ASP A 1 77  ? 19.937  19.966 30.155  1.00 0.00  ? 77  ASP A HA   1  
ATOM   1253  H  HB2  . ASP A 1 77  ? 17.679  20.147 29.582  1.00 0.00  ? 77  ASP A HB2  1  
ATOM   1254  H  HB3  . ASP A 1 77  ? 18.436  21.196 28.387  1.00 0.00  ? 77  ASP A HB3  1  
ATOM   1255  N  N    . GLY A 1 78  ? 20.130  17.591 27.929  1.00 0.00  ? 78  GLY A N    1  
ATOM   1256  C  CA   . GLY A 1 78  ? 20.180  16.110 27.789  1.00 0.00  ? 78  GLY A CA   1  
ATOM   1257  C  C    . GLY A 1 78  ? 18.840  15.527 28.234  1.00 0.00  ? 78  GLY A C    1  
ATOM   1258  O  O    . GLY A 1 78  ? 17.833  16.211 28.236  1.00 0.00  ? 78  GLY A O    1  
ATOM   1259  H  H    . GLY A 1 78  ? 20.372  18.165 27.169  1.00 0.00  ? 78  GLY A H    1  
ATOM   1260  H  HA2  . GLY A 1 78  ? 20.369  15.849 26.757  1.00 0.00  ? 78  GLY A HA2  1  
ATOM   1261  H  HA3  . GLY A 1 78  ? 20.967  15.716 28.413  1.00 0.00  ? 78  GLY A HA3  1  
ATOM   1262  N  N    . LYS A 1 79  ? 18.820  14.278 28.626  1.00 0.00  ? 79  LYS A N    1  
ATOM   1263  C  CA   . LYS A 1 79  ? 17.546  13.661 29.087  1.00 0.00  ? 79  LYS A CA   1  
ATOM   1264  C  C    . LYS A 1 79  ? 16.402  14.045 28.161  1.00 0.00  ? 79  LYS A C    1  
ATOM   1265  O  O    . LYS A 1 79  ? 16.581  14.670 27.135  1.00 0.00  ? 79  LYS A O    1  
ATOM   1266  C  CB   . LYS A 1 79  ? 17.235  14.165 30.494  1.00 0.00  ? 79  LYS A CB   1  
ATOM   1267  C  CG   . LYS A 1 79  ? 17.800  13.184 31.516  1.00 0.00  ? 79  LYS A CG   1  
ATOM   1268  C  CD   . LYS A 1 79  ? 18.332  13.959 32.719  1.00 0.00  ? 79  LYS A CD   1  
ATOM   1269  C  CE   . LYS A 1 79  ? 19.503  13.196 33.330  1.00 0.00  ? 79  LYS A CE   1  
ATOM   1270  N  NZ   . LYS A 1 79  ? 20.783  13.828 32.901  1.00 0.00  ? 79  LYS A NZ   1  
ATOM   1271  H  H    . LYS A 1 79  ? 19.644  13.750 28.631  1.00 0.00  ? 79  LYS A H    1  
ATOM   1272  H  HA   . LYS A 1 79  ? 17.636  12.589 29.109  1.00 0.00  ? 79  LYS A HA   1  
ATOM   1273  H  HB2  . LYS A 1 79  ? 17.688  15.136 30.637  1.00 0.00  ? 79  LYS A HB2  1  
ATOM   1274  H  HB3  . LYS A 1 79  ? 16.167  14.243 30.624  1.00 0.00  ? 79  LYS A HB3  1  
ATOM   1275  H  HG2  . LYS A 1 79  ? 17.020  12.509 31.835  1.00 0.00  ? 79  LYS A HG2  1  
ATOM   1276  H  HG3  . LYS A 1 79  ? 18.605  12.621 31.068  1.00 0.00  ? 79  LYS A HG3  1  
ATOM   1277  H  HD2  . LYS A 1 79  ? 18.663  14.938 32.400  1.00 0.00  ? 79  LYS A HD2  1  
ATOM   1278  H  HD3  . LYS A 1 79  ? 17.550  14.064 33.455  1.00 0.00  ? 79  LYS A HD3  1  
ATOM   1279  H  HE2  . LYS A 1 79  ? 19.427  13.224 34.406  1.00 0.00  ? 79  LYS A HE2  1  
ATOM   1280  H  HE3  . LYS A 1 79  ? 19.477  12.168 32.993  1.00 0.00  ? 79  LYS A HE3  1  
ATOM   1281  H  HZ1  . LYS A 1 79  ? 20.654  14.279 31.973  1.00 0.00  ? 79  LYS A HZ1  1  
ATOM   1282  H  HZ2  . LYS A 1 79  ? 21.523  13.099 32.834  1.00 0.00  ? 79  LYS A HZ2  1  
ATOM   1283  H  HZ3  . LYS A 1 79  ? 21.066  14.547 33.597  1.00 0.00  ? 79  LYS A HZ3  1  
ATOM   1284  N  N    . ASP A 1 80  ? 15.221  13.673 28.534  1.00 0.00  ? 80  ASP A N    1  
ATOM   1285  C  CA   . ASP A 1 80  ? 14.039  14.017 27.705  1.00 0.00  ? 80  ASP A CA   1  
ATOM   1286  C  C    . ASP A 1 80  ? 13.849  15.537 27.750  1.00 0.00  ? 80  ASP A C    1  
ATOM   1287  O  O    . ASP A 1 80  ? 14.483  16.270 27.010  1.00 0.00  ? 80  ASP A O    1  
ATOM   1288  C  CB   . ASP A 1 80  ? 12.800  13.315 28.265  1.00 0.00  ? 80  ASP A CB   1  
ATOM   1289  C  CG   . ASP A 1 80  ? 12.962  11.801 28.131  1.00 0.00  ? 80  ASP A CG   1  
ATOM   1290  O  OD1  . ASP A 1 80  ? 13.895  11.271 28.711  1.00 0.00  ? 80  ASP A OD1  1  
ATOM   1291  O  OD2  . ASP A 1 80  ? 12.152  11.197 27.449  1.00 0.00  ? 80  ASP A OD2  1  
ATOM   1292  H  H    . ASP A 1 80  ? 15.116  13.170 29.368  1.00 0.00  ? 80  ASP A H    1  
ATOM   1293  H  HA   . ASP A 1 80  ? 14.208  13.704 26.684  1.00 0.00  ? 80  ASP A HA   1  
ATOM   1294  H  HB2  . ASP A 1 80  ? 12.685  13.571 29.308  1.00 0.00  ? 80  ASP A HB2  1  
ATOM   1295  H  HB3  . ASP A 1 80  ? 11.926  13.632 27.717  1.00 0.00  ? 80  ASP A HB3  1  
ATOM   1296  N  N    . GLY A 1 81  ? 12.997  16.018 28.623  1.00 0.00  ? 81  GLY A N    1  
ATOM   1297  C  CA   . GLY A 1 81  ? 12.777  17.489 28.726  1.00 0.00  ? 81  GLY A CA   1  
ATOM   1298  C  C    . GLY A 1 81  ? 12.734  18.093 27.331  1.00 0.00  ? 81  GLY A C    1  
ATOM   1299  O  O    . GLY A 1 81  ? 12.170  17.529 26.417  1.00 0.00  ? 81  GLY A O    1  
ATOM   1300  H  H    . GLY A 1 81  ? 12.509  15.412 29.216  1.00 0.00  ? 81  GLY A H    1  
ATOM   1301  H  HA2  . GLY A 1 81  ? 11.842  17.683 29.232  1.00 0.00  ? 81  GLY A HA2  1  
ATOM   1302  H  HA3  . GLY A 1 81  ? 13.587  17.938 29.280  1.00 0.00  ? 81  GLY A HA3  1  
ATOM   1303  N  N    . LEU A 1 82  ? 13.335  19.230 27.157  1.00 0.00  ? 82  LEU A N    1  
ATOM   1304  C  CA   . LEU A 1 82  ? 13.343  19.863 25.823  1.00 0.00  ? 82  LEU A CA   1  
ATOM   1305  C  C    . LEU A 1 82  ? 13.789  18.822 24.789  1.00 0.00  ? 82  LEU A C    1  
ATOM   1306  O  O    . LEU A 1 82  ? 14.843  18.221 24.897  1.00 0.00  ? 82  LEU A O    1  
ATOM   1307  C  CB   . LEU A 1 82  ? 14.277  21.088 25.879  1.00 0.00  ? 82  LEU A CB   1  
ATOM   1308  C  CG   . LEU A 1 82  ? 15.602  20.846 25.144  1.00 0.00  ? 82  LEU A CG   1  
ATOM   1309  C  CD1  . LEU A 1 82  ? 15.400  21.024 23.636  1.00 0.00  ? 82  LEU A CD1  1  
ATOM   1310  C  CD2  . LEU A 1 82  ? 16.636  21.860 25.638  1.00 0.00  ? 82  LEU A CD2  1  
ATOM   1311  H  H    . LEU A 1 82  ? 13.790  19.666 27.906  1.00 0.00  ? 82  LEU A H    1  
ATOM   1312  H  HA   . LEU A 1 82  ? 12.343  20.189 25.576  1.00 0.00  ? 82  LEU A HA   1  
ATOM   1313  H  HB2  . LEU A 1 82  ? 13.775  21.930 25.435  1.00 0.00  ? 82  LEU A HB2  1  
ATOM   1314  H  HB3  . LEU A 1 82  ? 14.487  21.312 26.917  1.00 0.00  ? 82  LEU A HB3  1  
ATOM   1315  H  HG   . LEU A 1 82  ? 15.954  19.849 25.350  1.00 0.00  ? 82  LEU A HG   1  
ATOM   1316  H  HD11 . LEU A 1 82  ? 15.227  22.067 23.417  1.00 0.00  ? 82  LEU A HD11 1  
ATOM   1317  H  HD12 . LEU A 1 82  ? 14.549  20.444 23.313  1.00 0.00  ? 82  LEU A HD12 1  
ATOM   1318  H  HD13 . LEU A 1 82  ? 16.283  20.688 23.112  1.00 0.00  ? 82  LEU A HD13 1  
ATOM   1319  H  HD21 . LEU A 1 82  ? 16.130  22.741 26.003  1.00 0.00  ? 82  LEU A HD21 1  
ATOM   1320  H  HD22 . LEU A 1 82  ? 17.290  22.131 24.824  1.00 0.00  ? 82  LEU A HD22 1  
ATOM   1321  H  HD23 . LEU A 1 82  ? 17.216  21.421 26.437  1.00 0.00  ? 82  LEU A HD23 1  
ATOM   1322  N  N    . LEU A 1 83  ? 12.974  18.595 23.797  1.00 0.00  ? 83  LEU A N    1  
ATOM   1323  C  CA   . LEU A 1 83  ? 13.321  17.592 22.756  1.00 0.00  ? 83  LEU A CA   1  
ATOM   1324  C  C    . LEU A 1 83  ? 13.584  18.322 21.438  1.00 0.00  ? 83  LEU A C    1  
ATOM   1325  O  O    . LEU A 1 83  ? 14.251  17.817 20.558  1.00 0.00  ? 83  LEU A O    1  
ATOM   1326  C  CB   . LEU A 1 83  ? 12.153  16.614 22.579  1.00 0.00  ? 83  LEU A CB   1  
ATOM   1327  C  CG   . LEU A 1 83  ? 11.617  16.195 23.951  1.00 0.00  ? 83  LEU A CG   1  
ATOM   1328  C  CD1  . LEU A 1 83  ? 10.334  15.378 23.775  1.00 0.00  ? 83  LEU A CD1  1  
ATOM   1329  C  CD2  . LEU A 1 83  ? 12.664  15.341 24.673  1.00 0.00  ? 83  LEU A CD2  1  
ATOM   1330  H  H    . LEU A 1 83  ? 12.124  19.081 23.742  1.00 0.00  ? 83  LEU A H    1  
ATOM   1331  H  HA   . LEU A 1 83  ? 14.206  17.051 23.056  1.00 0.00  ? 83  LEU A HA   1  
ATOM   1332  H  HB2  . LEU A 1 83  ? 11.365  17.095 22.018  1.00 0.00  ? 83  LEU A HB2  1  
ATOM   1333  H  HB3  . LEU A 1 83  ? 12.491  15.738 22.045  1.00 0.00  ? 83  LEU A HB3  1  
ATOM   1334  H  HG   . LEU A 1 83  ? 11.403  17.077 24.534  1.00 0.00  ? 83  LEU A HG   1  
ATOM   1335  H  HD11 . LEU A 1 83  ? 9.902   15.588 22.808  1.00 0.00  ? 83  LEU A HD11 1  
ATOM   1336  H  HD12 . LEU A 1 83  ? 9.628   15.643 24.549  1.00 0.00  ? 83  LEU A HD12 1  
ATOM   1337  H  HD13 . LEU A 1 83  ? 10.564  14.325 23.844  1.00 0.00  ? 83  LEU A HD13 1  
ATOM   1338  H  HD21 . LEU A 1 83  ? 12.178  14.499 25.143  1.00 0.00  ? 83  LEU A HD21 1  
ATOM   1339  H  HD22 . LEU A 1 83  ? 13.158  15.936 25.426  1.00 0.00  ? 83  LEU A HD22 1  
ATOM   1340  H  HD23 . LEU A 1 83  ? 13.394  14.982 23.962  1.00 0.00  ? 83  LEU A HD23 1  
ATOM   1341  N  N    . ALA A 1 84  ? 13.061  19.512 21.299  1.00 0.00  ? 84  ALA A N    1  
ATOM   1342  C  CA   . ALA A 1 84  ? 13.279  20.281 20.038  1.00 0.00  ? 84  ALA A CA   1  
ATOM   1343  C  C    . ALA A 1 84  ? 12.360  21.510 20.014  1.00 0.00  ? 84  ALA A C    1  
ATOM   1344  O  O    . ALA A 1 84  ? 11.625  21.765 20.948  1.00 0.00  ? 84  ALA A O    1  
ATOM   1345  C  CB   . ALA A 1 84  ? 12.967  19.381 18.840  1.00 0.00  ? 84  ALA A CB   1  
ATOM   1346  H  H    . ALA A 1 84  ? 12.525  19.899 22.024  1.00 0.00  ? 84  ALA A H    1  
ATOM   1347  H  HA   . ALA A 1 84  ? 14.310  20.602 19.989  1.00 0.00  ? 84  ALA A HA   1  
ATOM   1348  H  HB1  . ALA A 1 84  ? 12.861  19.988 17.953  1.00 0.00  ? 84  ALA A HB1  1  
ATOM   1349  H  HB2  . ALA A 1 84  ? 12.048  18.845 19.023  1.00 0.00  ? 84  ALA A HB2  1  
ATOM   1350  H  HB3  . ALA A 1 84  ? 13.773  18.675 18.699  1.00 0.00  ? 84  ALA A HB3  1  
ATOM   1351  N  N    . HIS A 1 85  ? 12.395  22.279 18.954  1.00 0.00  ? 85  HIS A N    1  
ATOM   1352  C  CA   . HIS A 1 85  ? 11.521  23.490 18.885  1.00 0.00  ? 85  HIS A CA   1  
ATOM   1353  C  C    . HIS A 1 85  ? 11.754  24.238 17.568  1.00 0.00  ? 85  HIS A C    1  
ATOM   1354  O  O    . HIS A 1 85  ? 12.612  23.885 16.782  1.00 0.00  ? 85  HIS A O    1  
ATOM   1355  C  CB   . HIS A 1 85  ? 11.854  24.422 20.052  1.00 0.00  ? 85  HIS A CB   1  
ATOM   1356  C  CG   . HIS A 1 85  ? 13.223  25.005 19.850  1.00 0.00  ? 85  HIS A CG   1  
ATOM   1357  N  ND1  . HIS A 1 85  ? 14.297  24.662 20.655  1.00 0.00  ? 85  HIS A ND1  1  
ATOM   1358  C  CD2  . HIS A 1 85  ? 13.707  25.911 18.941  1.00 0.00  ? 85  HIS A CD2  1  
ATOM   1359  C  CE1  . HIS A 1 85  ? 15.365  25.352 20.219  1.00 0.00  ? 85  HIS A CE1  1  
ATOM   1360  N  NE2  . HIS A 1 85  ? 15.061  26.128 19.175  1.00 0.00  ? 85  HIS A NE2  1  
ATOM   1361  H  H    . HIS A 1 85  ? 12.995  22.062 18.210  1.00 0.00  ? 85  HIS A H    1  
ATOM   1362  H  HA   . HIS A 1 85  ? 10.486  23.190 18.951  1.00 0.00  ? 85  HIS A HA   1  
ATOM   1363  H  HB2  . HIS A 1 85  ? 11.129  25.220 20.094  1.00 0.00  ? 85  HIS A HB2  1  
ATOM   1364  H  HB3  . HIS A 1 85  ? 11.836  23.865 20.977  1.00 0.00  ? 85  HIS A HB3  1  
ATOM   1365  H  HD1  . HIS A 1 85  ? 14.280  24.033 21.407  1.00 0.00  ? 85  HIS A HD1  1  
ATOM   1366  H  HD2  . HIS A 1 85  ? 13.126  26.385 18.165  1.00 0.00  ? 85  HIS A HD2  1  
ATOM   1367  H  HE1  . HIS A 1 85  ? 16.347  25.292 20.664  1.00 0.00  ? 85  HIS A HE1  1  
ATOM   1368  N  N    . ALA A 1 86  ? 10.996  25.278 17.328  1.00 0.00  ? 86  ALA A N    1  
ATOM   1369  C  CA   . ALA A 1 86  ? 11.169  26.065 16.070  1.00 0.00  ? 86  ALA A CA   1  
ATOM   1370  C  C    . ALA A 1 86  ? 10.814  27.533 16.335  1.00 0.00  ? 86  ALA A C    1  
ATOM   1371  O  O    . ALA A 1 86  ? 10.229  27.865 17.347  1.00 0.00  ? 86  ALA A O    1  
ATOM   1372  C  CB   . ALA A 1 86  ? 10.249  25.509 14.980  1.00 0.00  ? 86  ALA A CB   1  
ATOM   1373  H  H    . ALA A 1 86  ? 10.315  25.545 17.980  1.00 0.00  ? 86  ALA A H    1  
ATOM   1374  H  HA   . ALA A 1 86  ? 12.196  25.999 15.742  1.00 0.00  ? 86  ALA A HA   1  
ATOM   1375  H  HB1  . ALA A 1 86  ? 10.482  24.468 14.806  1.00 0.00  ? 86  ALA A HB1  1  
ATOM   1376  H  HB2  . ALA A 1 86  ? 10.395  26.068 14.067  1.00 0.00  ? 86  ALA A HB2  1  
ATOM   1377  H  HB3  . ALA A 1 86  ? 9.220   25.600 15.295  1.00 0.00  ? 86  ALA A HB3  1  
ATOM   1378  N  N    . PHE A 1 87  ? 11.164  28.414 15.437  1.00 0.00  ? 87  PHE A N    1  
ATOM   1379  C  CA   . PHE A 1 87  ? 10.847  29.856 15.643  1.00 0.00  ? 87  PHE A CA   1  
ATOM   1380  C  C    . PHE A 1 87  ? 9.522   30.195 14.958  1.00 0.00  ? 87  PHE A C    1  
ATOM   1381  O  O    . PHE A 1 87  ? 9.076   29.503 14.063  1.00 0.00  ? 87  PHE A O    1  
ATOM   1382  C  CB   . PHE A 1 87  ? 11.960  30.708 15.031  1.00 0.00  ? 87  PHE A CB   1  
ATOM   1383  C  CG   . PHE A 1 87  ? 12.451  31.715 16.040  1.00 0.00  ? 87  PHE A CG   1  
ATOM   1384  C  CD1  . PHE A 1 87  ? 12.820  31.301 17.325  1.00 0.00  ? 87  PHE A CD1  1  
ATOM   1385  C  CD2  . PHE A 1 87  ? 12.545  33.063 15.683  1.00 0.00  ? 87  PHE A CD2  1  
ATOM   1386  C  CE1  . PHE A 1 87  ? 13.282  32.240 18.255  1.00 0.00  ? 87  PHE A CE1  1  
ATOM   1387  C  CE2  . PHE A 1 87  ? 13.007  34.004 16.610  1.00 0.00  ? 87  PHE A CE2  1  
ATOM   1388  C  CZ   . PHE A 1 87  ? 13.376  33.592 17.899  1.00 0.00  ? 87  PHE A CZ   1  
ATOM   1389  H  H    . PHE A 1 87  ? 11.637  28.130 14.629  1.00 0.00  ? 87  PHE A H    1  
ATOM   1390  H  HA   . PHE A 1 87  ? 10.774  30.063 16.700  1.00 0.00  ? 87  PHE A HA   1  
ATOM   1391  H  HB2  . PHE A 1 87  ? 12.778  30.070 14.734  1.00 0.00  ? 87  PHE A HB2  1  
ATOM   1392  H  HB3  . PHE A 1 87  ? 11.577  31.228 14.165  1.00 0.00  ? 87  PHE A HB3  1  
ATOM   1393  H  HD1  . PHE A 1 87  ? 12.746  30.258 17.598  1.00 0.00  ? 87  PHE A HD1  1  
ATOM   1394  H  HD2  . PHE A 1 87  ? 12.258  33.376 14.689  1.00 0.00  ? 87  PHE A HD2  1  
ATOM   1395  H  HE1  . PHE A 1 87  ? 13.568  31.923 19.246  1.00 0.00  ? 87  PHE A HE1  1  
ATOM   1396  H  HE2  . PHE A 1 87  ? 13.078  35.046 16.332  1.00 0.00  ? 87  PHE A HE2  1  
ATOM   1397  H  HZ   . PHE A 1 87  ? 13.734  34.316 18.616  1.00 0.00  ? 87  PHE A HZ   1  
ATOM   1398  N  N    . ALA A 1 88  ? 8.895   31.263 15.363  1.00 0.00  ? 88  ALA A N    1  
ATOM   1399  C  CA   . ALA A 1 88  ? 7.607   31.658 14.729  1.00 0.00  ? 88  ALA A CA   1  
ATOM   1400  C  C    . ALA A 1 88  ? 7.779   31.621 13.207  1.00 0.00  ? 88  ALA A C    1  
ATOM   1401  O  O    . ALA A 1 88  ? 8.875   31.433 12.721  1.00 0.00  ? 88  ALA A O    1  
ATOM   1402  C  CB   . ALA A 1 88  ? 7.247   33.077 15.175  1.00 0.00  ? 88  ALA A CB   1  
ATOM   1403  H  H    . ALA A 1 88  ? 9.277   31.811 16.078  1.00 0.00  ? 88  ALA A H    1  
ATOM   1404  H  HA   . ALA A 1 88  ? 6.827   30.972 15.027  1.00 0.00  ? 88  ALA A HA   1  
ATOM   1405  H  HB1  . ALA A 1 88  ? 6.466   33.033 15.919  1.00 0.00  ? 88  ALA A HB1  1  
ATOM   1406  H  HB2  . ALA A 1 88  ? 6.906   33.649 14.325  1.00 0.00  ? 88  ALA A HB2  1  
ATOM   1407  H  HB3  . ALA A 1 88  ? 8.121   33.551 15.599  1.00 0.00  ? 88  ALA A HB3  1  
ATOM   1408  N  N    . PRO A 1 89  ? 6.696   31.801 12.497  1.00 0.00  ? 89  PRO A N    1  
ATOM   1409  C  CA   . PRO A 1 89  ? 6.715   31.794 11.022  1.00 0.00  ? 89  PRO A CA   1  
ATOM   1410  C  C    . PRO A 1 89  ? 7.346   33.080 10.478  1.00 0.00  ? 89  PRO A C    1  
ATOM   1411  O  O    . PRO A 1 89  ? 7.098   34.164 10.968  1.00 0.00  ? 89  PRO A O    1  
ATOM   1412  C  CB   . PRO A 1 89  ? 5.238   31.692 10.643  1.00 0.00  ? 89  PRO A CB   1  
ATOM   1413  C  CG   . PRO A 1 89  ? 4.438   32.196 11.865  1.00 0.00  ? 89  PRO A CG   1  
ATOM   1414  C  CD   . PRO A 1 89  ? 5.360   32.032 13.086  1.00 0.00  ? 89  PRO A CD   1  
ATOM   1415  H  HA   . PRO A 1 89  ? 7.245   30.932 10.656  1.00 0.00  ? 89  PRO A HA   1  
ATOM   1416  H  HB2  . PRO A 1 89  ? 5.036   32.313 9.782   1.00 0.00  ? 89  PRO A HB2  1  
ATOM   1417  H  HB3  . PRO A 1 89  ? 4.977   30.667 10.435  1.00 0.00  ? 89  PRO A HB3  1  
ATOM   1418  H  HG2  . PRO A 1 89  ? 4.175   33.237 11.731  1.00 0.00  ? 89  PRO A HG2  1  
ATOM   1419  H  HG3  . PRO A 1 89  ? 3.548   31.601 11.996  1.00 0.00  ? 89  PRO A HG3  1  
ATOM   1420  H  HD2  . PRO A 1 89  ? 5.352   32.931 13.684  1.00 0.00  ? 89  PRO A HD2  1  
ATOM   1421  H  HD3  . PRO A 1 89  ? 5.060   31.180 13.675  1.00 0.00  ? 89  PRO A HD3  1  
ATOM   1422  N  N    . GLY A 1 90  ? 8.167   32.961 9.471   1.00 0.00  ? 90  GLY A N    1  
ATOM   1423  C  CA   . GLY A 1 90  ? 8.824   34.169 8.893   1.00 0.00  ? 90  GLY A CA   1  
ATOM   1424  C  C    . GLY A 1 90  ? 9.812   33.748 7.800   1.00 0.00  ? 90  GLY A C    1  
ATOM   1425  O  O    . GLY A 1 90  ? 9.826   32.614 7.363   1.00 0.00  ? 90  GLY A O    1  
ATOM   1426  H  H    . GLY A 1 90  ? 8.354   32.074 9.096   1.00 0.00  ? 90  GLY A H    1  
ATOM   1427  H  HA2  . GLY A 1 90  ? 8.071   34.820 8.470   1.00 0.00  ? 90  GLY A HA2  1  
ATOM   1428  H  HA3  . GLY A 1 90  ? 9.358   34.692 9.672   1.00 0.00  ? 90  GLY A HA3  1  
ATOM   1429  N  N    . THR A 1 91  ? 10.638  34.656 7.355   1.00 0.00  ? 91  THR A N    1  
ATOM   1430  C  CA   . THR A 1 91  ? 11.624  34.315 6.289   1.00 0.00  ? 91  THR A CA   1  
ATOM   1431  C  C    . THR A 1 91  ? 12.997  34.035 6.913   1.00 0.00  ? 91  THR A C    1  
ATOM   1432  O  O    . THR A 1 91  ? 13.467  34.770 7.759   1.00 0.00  ? 91  THR A O    1  
ATOM   1433  C  CB   . THR A 1 91  ? 11.739  35.488 5.313   1.00 0.00  ? 91  THR A CB   1  
ATOM   1434  O  OG1  . THR A 1 91  ? 12.283  36.614 5.993   1.00 0.00  ? 91  THR A OG1  1  
ATOM   1435  C  CG2  . THR A 1 91  ? 10.351  35.828 4.761   1.00 0.00  ? 91  THR A CG2  1  
ATOM   1436  H  H    . THR A 1 91  ? 10.608  35.565 7.722   1.00 0.00  ? 91  THR A H    1  
ATOM   1437  H  HA   . THR A 1 91  ? 11.287  33.440 5.755   1.00 0.00  ? 91  THR A HA   1  
ATOM   1438  H  HB   . THR A 1 91  ? 12.388  35.212 4.497   1.00 0.00  ? 91  THR A HB   1  
ATOM   1439  H  HG1  . THR A 1 91  ? 11.616  37.304 6.016   1.00 0.00  ? 91  THR A HG1  1  
ATOM   1440  H  HG21 . THR A 1 91  ? 9.769   36.320 5.525   1.00 0.00  ? 91  THR A HG21 1  
ATOM   1441  H  HG22 . THR A 1 91  ? 9.851   34.919 4.457   1.00 0.00  ? 91  THR A HG22 1  
ATOM   1442  H  HG23 . THR A 1 91  ? 10.454  36.483 3.909   1.00 0.00  ? 91  THR A HG23 1  
ATOM   1443  N  N    . GLY A 1 92  ? 13.647  32.982 6.494   1.00 0.00  ? 92  GLY A N    1  
ATOM   1444  C  CA   . GLY A 1 92  ? 14.993  32.662 7.054   1.00 0.00  ? 92  GLY A CA   1  
ATOM   1445  C  C    . GLY A 1 92  ? 14.858  32.126 8.483   1.00 0.00  ? 92  GLY A C    1  
ATOM   1446  O  O    . GLY A 1 92  ? 14.876  30.933 8.713   1.00 0.00  ? 92  GLY A O    1  
ATOM   1447  H  H    . GLY A 1 92  ? 13.253  32.406 5.805   1.00 0.00  ? 92  GLY A H    1  
ATOM   1448  H  HA2  . GLY A 1 92  ? 15.470  31.916 6.434   1.00 0.00  ? 92  GLY A HA2  1  
ATOM   1449  H  HA3  . GLY A 1 92  ? 15.597  33.556 7.067   1.00 0.00  ? 92  GLY A HA3  1  
ATOM   1450  N  N    . VAL A 1 93  ? 14.738  33.000 9.446   1.00 0.00  ? 93  VAL A N    1  
ATOM   1451  C  CA   . VAL A 1 93  ? 14.618  32.543 10.860  1.00 0.00  ? 93  VAL A CA   1  
ATOM   1452  C  C    . VAL A 1 93  ? 13.266  31.860 11.082  1.00 0.00  ? 93  VAL A C    1  
ATOM   1453  O  O    . VAL A 1 93  ? 13.173  30.856 11.759  1.00 0.00  ? 93  VAL A O    1  
ATOM   1454  C  CB   . VAL A 1 93  ? 14.731  33.742 11.810  1.00 0.00  ? 93  VAL A CB   1  
ATOM   1455  C  CG1  . VAL A 1 93  ? 16.203  34.061 12.070  1.00 0.00  ? 93  VAL A CG1  1  
ATOM   1456  C  CG2  . VAL A 1 93  ? 14.048  34.967 11.196  1.00 0.00  ? 93  VAL A CG2  1  
ATOM   1457  H  H    . VAL A 1 93  ? 14.738  33.955 9.239   1.00 0.00  ? 93  VAL A H    1  
ATOM   1458  H  HA   . VAL A 1 93  ? 15.410  31.843 11.076  1.00 0.00  ? 93  VAL A HA   1  
ATOM   1459  H  HB   . VAL A 1 93  ? 14.251  33.498 12.744  1.00 0.00  ? 93  VAL A HB   1  
ATOM   1460  H  HG11 . VAL A 1 93  ? 16.294  35.080 12.417  1.00 0.00  ? 93  VAL A HG11 1  
ATOM   1461  H  HG12 . VAL A 1 93  ? 16.765  33.940 11.156  1.00 0.00  ? 93  VAL A HG12 1  
ATOM   1462  H  HG13 . VAL A 1 93  ? 16.589  33.389 12.822  1.00 0.00  ? 93  VAL A HG13 1  
ATOM   1463  H  HG21 . VAL A 1 93  ? 14.668  35.368 10.409  1.00 0.00  ? 93  VAL A HG21 1  
ATOM   1464  H  HG22 . VAL A 1 93  ? 13.906  35.717 11.959  1.00 0.00  ? 93  VAL A HG22 1  
ATOM   1465  H  HG23 . VAL A 1 93  ? 13.089  34.681 10.791  1.00 0.00  ? 93  VAL A HG23 1  
ATOM   1466  N  N    . GLY A 1 94  ? 12.215  32.401 10.532  1.00 0.00  ? 94  GLY A N    1  
ATOM   1467  C  CA   . GLY A 1 94  ? 10.873  31.784 10.733  1.00 0.00  ? 94  GLY A CA   1  
ATOM   1468  C  C    . GLY A 1 94  ? 10.774  30.472 9.956   1.00 0.00  ? 94  GLY A C    1  
ATOM   1469  O  O    . GLY A 1 94  ? 10.736  30.465 8.742   1.00 0.00  ? 94  GLY A O    1  
ATOM   1470  H  H    . GLY A 1 94  ? 12.305  33.216 9.995   1.00 0.00  ? 94  GLY A H    1  
ATOM   1471  H  HA2  . GLY A 1 94  ? 10.726  31.589 11.783  1.00 0.00  ? 94  GLY A HA2  1  
ATOM   1472  H  HA3  . GLY A 1 94  ? 10.109  32.463 10.381  1.00 0.00  ? 94  GLY A HA3  1  
ATOM   1473  N  N    . GLY A 1 95  ? 10.721  29.358 10.642  1.00 0.00  ? 95  GLY A N    1  
ATOM   1474  C  CA   . GLY A 1 95  ? 10.606  28.056 9.926   1.00 0.00  ? 95  GLY A CA   1  
ATOM   1475  C  C    . GLY A 1 95  ? 11.782  27.137 10.278  1.00 0.00  ? 95  GLY A C    1  
ATOM   1476  O  O    . GLY A 1 95  ? 11.905  26.044 9.759   1.00 0.00  ? 95  GLY A O    1  
ATOM   1477  H  H    . GLY A 1 95  ? 10.744  29.382 11.621  1.00 0.00  ? 95  GLY A H    1  
ATOM   1478  H  HA2  . GLY A 1 95  ? 9.679   27.576 10.208  1.00 0.00  ? 95  GLY A HA2  1  
ATOM   1479  H  HA3  . GLY A 1 95  ? 10.605  28.240 8.865   1.00 0.00  ? 95  GLY A HA3  1  
ATOM   1480  N  N    . ASP A 1 96  ? 12.653  27.554 11.149  1.00 0.00  ? 96  ASP A N    1  
ATOM   1481  C  CA   . ASP A 1 96  ? 13.799  26.673 11.506  1.00 0.00  ? 96  ASP A CA   1  
ATOM   1482  C  C    . ASP A 1 96  ? 13.475  25.889 12.777  1.00 0.00  ? 96  ASP A C    1  
ATOM   1483  O  O    . ASP A 1 96  ? 12.887  26.408 13.706  1.00 0.00  ? 96  ASP A O    1  
ATOM   1484  C  CB   . ASP A 1 96  ? 15.057  27.509 11.715  1.00 0.00  ? 96  ASP A CB   1  
ATOM   1485  C  CG   . ASP A 1 96  ? 15.112  28.615 10.666  1.00 0.00  ? 96  ASP A CG   1  
ATOM   1486  O  OD1  . ASP A 1 96  ? 15.141  28.287 9.493   1.00 0.00  ? 96  ASP A OD1  1  
ATOM   1487  O  OD2  . ASP A 1 96  ? 15.125  29.770 11.053  1.00 0.00  ? 96  ASP A OD2  1  
ATOM   1488  H  H    . ASP A 1 96  ? 12.554  28.434 11.566  1.00 0.00  ? 96  ASP A H    1  
ATOM   1489  H  HA   . ASP A 1 96  ? 13.964  25.976 10.701  1.00 0.00  ? 96  ASP A HA   1  
ATOM   1490  H  HB2  . ASP A 1 96  ? 15.039  27.946 12.699  1.00 0.00  ? 96  ASP A HB2  1  
ATOM   1491  H  HB3  . ASP A 1 96  ? 15.926  26.877 11.612  1.00 0.00  ? 96  ASP A HB3  1  
ATOM   1492  N  N    . SER A 1 97  ? 13.851  24.637 12.824  1.00 0.00  ? 97  SER A N    1  
ATOM   1493  C  CA   . SER A 1 97  ? 13.562  23.814 14.035  1.00 0.00  ? 97  SER A CA   1  
ATOM   1494  C  C    . SER A 1 97  ? 14.872  23.283 14.621  1.00 0.00  ? 97  SER A C    1  
ATOM   1495  O  O    . SER A 1 97  ? 15.791  22.936 13.904  1.00 0.00  ? 97  SER A O    1  
ATOM   1496  C  CB   . SER A 1 97  ? 12.660  22.642 13.646  1.00 0.00  ? 97  SER A CB   1  
ATOM   1497  O  OG   . SER A 1 97  ? 12.548  22.591 12.230  1.00 0.00  ? 97  SER A OG   1  
ATOM   1498  H  H    . SER A 1 97  ? 14.322  24.239 12.062  1.00 0.00  ? 97  SER A H    1  
ATOM   1499  H  HA   . SER A 1 97  ? 13.061  24.425 14.771  1.00 0.00  ? 97  SER A HA   1  
ATOM   1500  H  HB2  . SER A 1 97  ? 13.086  21.719 14.004  1.00 0.00  ? 97  SER A HB2  1  
ATOM   1501  H  HB3  . SER A 1 97  ? 11.682  22.780 14.090  1.00 0.00  ? 97  SER A HB3  1  
ATOM   1502  H  HG   . SER A 1 97  ? 12.602  21.672 11.961  1.00 0.00  ? 97  SER A HG   1  
ATOM   1503  N  N    . HIS A 1 98  ? 14.965  23.225 15.924  1.00 0.00  ? 98  HIS A N    1  
ATOM   1504  C  CA   . HIS A 1 98  ? 16.215  22.727 16.564  1.00 0.00  ? 98  HIS A CA   1  
ATOM   1505  C  C    . HIS A 1 98  ? 15.935  21.422 17.312  1.00 0.00  ? 98  HIS A C    1  
ATOM   1506  O  O    . HIS A 1 98  ? 15.007  21.328 18.091  1.00 0.00  ? 98  HIS A O    1  
ATOM   1507  C  CB   . HIS A 1 98  ? 16.730  23.770 17.562  1.00 0.00  ? 98  HIS A CB   1  
ATOM   1508  C  CG   . HIS A 1 98  ? 17.288  24.955 16.823  1.00 0.00  ? 98  HIS A CG   1  
ATOM   1509  N  ND1  . HIS A 1 98  ? 17.680  26.113 17.475  1.00 0.00  ? 98  HIS A ND1  1  
ATOM   1510  C  CD2  . HIS A 1 98  ? 17.529  25.175 15.489  1.00 0.00  ? 98  HIS A CD2  1  
ATOM   1511  C  CE1  . HIS A 1 98  ? 18.133  26.970 16.541  1.00 0.00  ? 98  HIS A CE1  1  
ATOM   1512  N  NE2  . HIS A 1 98  ? 18.063  26.448 15.313  1.00 0.00  ? 98  HIS A NE2  1  
ATOM   1513  H  H    . HIS A 1 98  ? 14.211  23.515 16.480  1.00 0.00  ? 98  HIS A H    1  
ATOM   1514  H  HA   . HIS A 1 98  ? 16.964  22.554 15.805  1.00 0.00  ? 98  HIS A HA   1  
ATOM   1515  H  HB2  . HIS A 1 98  ? 15.918  24.093 18.196  1.00 0.00  ? 98  HIS A HB2  1  
ATOM   1516  H  HB3  . HIS A 1 98  ? 17.506  23.329 18.170  1.00 0.00  ? 98  HIS A HB3  1  
ATOM   1517  H  HD1  . HIS A 1 98  ? 17.642  26.274 18.440  1.00 0.00  ? 98  HIS A HD1  1  
ATOM   1518  H  HD2  . HIS A 1 98  ? 17.335  24.467 14.696  1.00 0.00  ? 98  HIS A HD2  1  
ATOM   1519  H  HE1  . HIS A 1 98  ? 18.505  27.961 16.759  1.00 0.00  ? 98  HIS A HE1  1  
ATOM   1520  N  N    . PHE A 1 99  ? 16.739  20.417 17.092  1.00 0.00  ? 99  PHE A N    1  
ATOM   1521  C  CA   . PHE A 1 99  ? 16.525  19.120 17.805  1.00 0.00  ? 99  PHE A CA   1  
ATOM   1522  C  C    . PHE A 1 99  ? 17.558  18.981 18.927  1.00 0.00  ? 99  PHE A C    1  
ATOM   1523  O  O    . PHE A 1 99  ? 18.645  19.519 18.845  1.00 0.00  ? 99  PHE A O    1  
ATOM   1524  C  CB   . PHE A 1 99  ? 16.694  17.961 16.820  1.00 0.00  ? 99  PHE A CB   1  
ATOM   1525  C  CG   . PHE A 1 99  ? 15.434  17.808 16.005  1.00 0.00  ? 99  PHE A CG   1  
ATOM   1526  C  CD1  . PHE A 1 99  ? 15.287  18.517 14.808  1.00 0.00  ? 99  PHE A CD1  1  
ATOM   1527  C  CD2  . PHE A 1 99  ? 14.410  16.965 16.449  1.00 0.00  ? 99  PHE A CD2  1  
ATOM   1528  C  CE1  . PHE A 1 99  ? 14.115  18.383 14.054  1.00 0.00  ? 99  PHE A CE1  1  
ATOM   1529  C  CE2  . PHE A 1 99  ? 13.239  16.829 15.694  1.00 0.00  ? 99  PHE A CE2  1  
ATOM   1530  C  CZ   . PHE A 1 99  ? 13.091  17.538 14.497  1.00 0.00  ? 99  PHE A CZ   1  
ATOM   1531  H  H    . PHE A 1 99  ? 17.486  20.518 16.460  1.00 0.00  ? 99  PHE A H    1  
ATOM   1532  H  HA   . PHE A 1 99  ? 15.530  19.097 18.224  1.00 0.00  ? 99  PHE A HA   1  
ATOM   1533  H  HB2  . PHE A 1 99  ? 17.526  18.168 16.162  1.00 0.00  ? 99  PHE A HB2  1  
ATOM   1534  H  HB3  . PHE A 1 99  ? 16.884  17.048 17.365  1.00 0.00  ? 99  PHE A HB3  1  
ATOM   1535  H  HD1  . PHE A 1 99  ? 16.080  19.166 14.464  1.00 0.00  ? 99  PHE A HD1  1  
ATOM   1536  H  HD2  . PHE A 1 99  ? 14.522  16.418 17.372  1.00 0.00  ? 99  PHE A HD2  1  
ATOM   1537  H  HE1  . PHE A 1 99  ? 14.000  18.932 13.130  1.00 0.00  ? 99  PHE A HE1  1  
ATOM   1538  H  HE2  . PHE A 1 99  ? 12.452  16.176 16.034  1.00 0.00  ? 99  PHE A HE2  1  
ATOM   1539  H  HZ   . PHE A 1 99  ? 12.187  17.436 13.916  1.00 0.00  ? 99  PHE A HZ   1  
ATOM   1540  N  N    . ASP A 1 100 ? 17.237  18.264 19.976  1.00 0.00  ? 100 ASP A N    1  
ATOM   1541  C  CA   . ASP A 1 100 ? 18.217  18.104 21.089  1.00 0.00  ? 100 ASP A CA   1  
ATOM   1542  C  C    . ASP A 1 100 ? 19.480  17.439 20.546  1.00 0.00  ? 100 ASP A C    1  
ATOM   1543  O  O    . ASP A 1 100 ? 19.419  16.528 19.744  1.00 0.00  ? 100 ASP A O    1  
ATOM   1544  C  CB   . ASP A 1 100 ? 17.619  17.231 22.198  1.00 0.00  ? 100 ASP A CB   1  
ATOM   1545  C  CG   . ASP A 1 100 ? 17.713  17.959 23.541  1.00 0.00  ? 100 ASP A CG   1  
ATOM   1546  O  OD1  . ASP A 1 100 ? 16.842  18.765 23.818  1.00 0.00  ? 100 ASP A OD1  1  
ATOM   1547  O  OD2  . ASP A 1 100 ? 18.652  17.691 24.273  1.00 0.00  ? 100 ASP A OD2  1  
ATOM   1548  H  H    . ASP A 1 100 ? 16.359  17.834 20.029  1.00 0.00  ? 100 ASP A H    1  
ATOM   1549  H  HA   . ASP A 1 100 ? 18.467  19.076 21.489  1.00 0.00  ? 100 ASP A HA   1  
ATOM   1550  H  HB2  . ASP A 1 100 ? 16.584  17.021 21.973  1.00 0.00  ? 100 ASP A HB2  1  
ATOM   1551  H  HB3  . ASP A 1 100 ? 18.170  16.306 22.263  1.00 0.00  ? 100 ASP A HB3  1  
ATOM   1552  N  N    . ASP A 1 101 ? 20.624  17.893 20.970  1.00 0.00  ? 101 ASP A N    1  
ATOM   1553  C  CA   . ASP A 1 101 ? 21.892  17.295 20.472  1.00 0.00  ? 101 ASP A CA   1  
ATOM   1554  C  C    . ASP A 1 101 ? 22.129  15.947 21.157  1.00 0.00  ? 101 ASP A C    1  
ATOM   1555  O  O    . ASP A 1 101 ? 21.893  14.905 20.580  1.00 0.00  ? 101 ASP A O    1  
ATOM   1556  C  CB   . ASP A 1 101 ? 23.059  18.248 20.755  1.00 0.00  ? 101 ASP A CB   1  
ATOM   1557  C  CG   . ASP A 1 101 ? 24.229  17.919 19.820  1.00 0.00  ? 101 ASP A CG   1  
ATOM   1558  O  OD1  . ASP A 1 101 ? 24.211  18.384 18.692  1.00 0.00  ? 101 ASP A OD1  1  
ATOM   1559  O  OD2  . ASP A 1 101 ? 25.124  17.210 20.251  1.00 0.00  ? 101 ASP A OD2  1  
ATOM   1560  H  H    . ASP A 1 101 ? 20.649  18.630 21.614  1.00 0.00  ? 101 ASP A H    1  
ATOM   1561  H  HA   . ASP A 1 101 ? 21.815  17.138 19.406  1.00 0.00  ? 101 ASP A HA   1  
ATOM   1562  H  HB2  . ASP A 1 101 ? 22.738  19.266 20.585  1.00 0.00  ? 101 ASP A HB2  1  
ATOM   1563  H  HB3  . ASP A 1 101 ? 23.378  18.140 21.778  1.00 0.00  ? 101 ASP A HB3  1  
ATOM   1564  N  N    . ASP A 1 102 ? 22.599  15.950 22.375  1.00 0.00  ? 102 ASP A N    1  
ATOM   1565  C  CA   . ASP A 1 102 ? 22.861  14.658 23.073  1.00 0.00  ? 102 ASP A CA   1  
ATOM   1566  C  C    . ASP A 1 102 ? 21.550  13.905 23.328  1.00 0.00  ? 102 ASP A C    1  
ATOM   1567  O  O    . ASP A 1 102 ? 20.916  14.067 24.352  1.00 0.00  ? 102 ASP A O    1  
ATOM   1568  C  CB   . ASP A 1 102 ? 23.554  14.928 24.409  1.00 0.00  ? 102 ASP A CB   1  
ATOM   1569  C  CG   . ASP A 1 102 ? 24.201  13.635 24.912  1.00 0.00  ? 102 ASP A CG   1  
ATOM   1570  O  OD1  . ASP A 1 102 ? 23.467  12.732 25.276  1.00 0.00  ? 102 ASP A OD1  1  
ATOM   1571  O  OD2  . ASP A 1 102 ? 25.421  13.569 24.921  1.00 0.00  ? 102 ASP A OD2  1  
ATOM   1572  H  H    . ASP A 1 102 ? 22.793  16.798 22.826  1.00 0.00  ? 102 ASP A H    1  
ATOM   1573  H  HA   . ASP A 1 102 ? 23.504  14.048 22.458  1.00 0.00  ? 102 ASP A HA   1  
ATOM   1574  H  HB2  . ASP A 1 102 ? 24.313  15.685 24.273  1.00 0.00  ? 102 ASP A HB2  1  
ATOM   1575  H  HB3  . ASP A 1 102 ? 22.828  15.271 25.131  1.00 0.00  ? 102 ASP A HB3  1  
ATOM   1576  N  N    . GLU A 1 103 ? 21.158  13.062 22.412  1.00 0.00  ? 103 GLU A N    1  
ATOM   1577  C  CA   . GLU A 1 103 ? 19.909  12.270 22.600  1.00 0.00  ? 103 GLU A CA   1  
ATOM   1578  C  C    . GLU A 1 103 ? 19.959  11.049 21.672  1.00 0.00  ? 103 GLU A C    1  
ATOM   1579  O  O    . GLU A 1 103 ? 20.985  10.752 21.094  1.00 0.00  ? 103 GLU A O    1  
ATOM   1580  C  CB   . GLU A 1 103 ? 18.687  13.139 22.285  1.00 0.00  ? 103 GLU A CB   1  
ATOM   1581  C  CG   . GLU A 1 103 ? 17.716  13.099 23.471  1.00 0.00  ? 103 GLU A CG   1  
ATOM   1582  C  CD   . GLU A 1 103 ? 17.692  14.463 24.178  1.00 0.00  ? 103 GLU A CD   1  
ATOM   1583  O  OE1  . GLU A 1 103 ? 18.757  14.950 24.526  1.00 0.00  ? 103 GLU A OE1  1  
ATOM   1584  O  OE2  . GLU A 1 103 ? 16.609  14.995 24.364  1.00 0.00  ? 103 GLU A OE2  1  
ATOM   1585  H  H    . GLU A 1 103 ? 21.696  12.936 21.605  1.00 0.00  ? 103 GLU A H    1  
ATOM   1586  H  HA   . GLU A 1 103 ? 19.855  11.933 23.625  1.00 0.00  ? 103 GLU A HA   1  
ATOM   1587  H  HB2  . GLU A 1 103 ? 19.005  14.157 22.115  1.00 0.00  ? 103 GLU A HB2  1  
ATOM   1588  H  HB3  . GLU A 1 103 ? 18.193  12.762 21.404  1.00 0.00  ? 103 GLU A HB3  1  
ATOM   1589  H  HG2  . GLU A 1 103 ? 16.725  12.861 23.114  1.00 0.00  ? 103 GLU A HG2  1  
ATOM   1590  H  HG3  . GLU A 1 103 ? 18.037  12.342 24.170  1.00 0.00  ? 103 GLU A HG3  1  
ATOM   1591  N  N    . LEU A 1 104 ? 18.880  10.321 21.535  1.00 0.00  ? 104 LEU A N    1  
ATOM   1592  C  CA   . LEU A 1 104 ? 18.916  9.114  20.658  1.00 0.00  ? 104 LEU A CA   1  
ATOM   1593  C  C    . LEU A 1 104 ? 17.634  9.009  19.819  1.00 0.00  ? 104 LEU A C    1  
ATOM   1594  O  O    . LEU A 1 104 ? 16.716  8.290  20.160  1.00 0.00  ? 104 LEU A O    1  
ATOM   1595  C  CB   . LEU A 1 104 ? 19.066  7.858  21.521  1.00 0.00  ? 104 LEU A CB   1  
ATOM   1596  C  CG   . LEU A 1 104 ? 18.438  8.106  22.884  1.00 0.00  ? 104 LEU A CG   1  
ATOM   1597  C  CD1  . LEU A 1 104 ? 16.919  8.162  22.727  1.00 0.00  ? 104 LEU A CD1  1  
ATOM   1598  C  CD2  . LEU A 1 104 ? 18.822  6.979  23.846  1.00 0.00  ? 104 LEU A CD2  1  
ATOM   1599  H  H    . LEU A 1 104 ? 18.063  10.553 22.017  1.00 0.00  ? 104 LEU A H    1  
ATOM   1600  H  HA   . LEU A 1 104 ? 19.763  9.185  20.009  1.00 0.00  ? 104 LEU A HA   1  
ATOM   1601  H  HB2  . LEU A 1 104 ? 18.569  7.031  21.040  1.00 0.00  ? 104 LEU A HB2  1  
ATOM   1602  H  HB3  . LEU A 1 104 ? 20.113  7.632  21.646  1.00 0.00  ? 104 LEU A HB3  1  
ATOM   1603  H  HG   . LEU A 1 104 ? 18.794  9.050  23.265  1.00 0.00  ? 104 LEU A HG   1  
ATOM   1604  H  HD11 . LEU A 1 104 ? 16.654  9.014  22.120  1.00 0.00  ? 104 LEU A HD11 1  
ATOM   1605  H  HD12 . LEU A 1 104 ? 16.458  8.255  23.698  1.00 0.00  ? 104 LEU A HD12 1  
ATOM   1606  H  HD13 . LEU A 1 104 ? 16.574  7.259  22.246  1.00 0.00  ? 104 LEU A HD13 1  
ATOM   1607  H  HD21 . LEU A 1 104 ? 19.829  7.139  24.205  1.00 0.00  ? 104 LEU A HD21 1  
ATOM   1608  H  HD22 . LEU A 1 104 ? 18.769  6.032  23.331  1.00 0.00  ? 104 LEU A HD22 1  
ATOM   1609  H  HD23 . LEU A 1 104 ? 18.138  6.974  24.682  1.00 0.00  ? 104 LEU A HD23 1  
ATOM   1610  N  N    . TRP A 1 105 ? 17.569  9.710  18.717  1.00 0.00  ? 105 TRP A N    1  
ATOM   1611  C  CA   . TRP A 1 105 ? 16.348  9.642  17.852  1.00 0.00  ? 105 TRP A CA   1  
ATOM   1612  C  C    . TRP A 1 105 ? 16.566  8.614  16.745  1.00 0.00  ? 105 TRP A C    1  
ATOM   1613  O  O    . TRP A 1 105 ? 17.567  8.641  16.060  1.00 0.00  ? 105 TRP A O    1  
ATOM   1614  C  CB   . TRP A 1 105 ? 16.085  11.000 17.191  1.00 0.00  ? 105 TRP A CB   1  
ATOM   1615  C  CG   . TRP A 1 105 ? 16.764  12.086 17.955  1.00 0.00  ? 105 TRP A CG   1  
ATOM   1616  C  CD1  . TRP A 1 105 ? 18.022  12.519 17.728  1.00 0.00  ? 105 TRP A CD1  1  
ATOM   1617  C  CD2  . TRP A 1 105 ? 16.247  12.881 19.055  1.00 0.00  ? 105 TRP A CD2  1  
ATOM   1618  N  NE1  . TRP A 1 105 ? 18.315  13.526 18.627  1.00 0.00  ? 105 TRP A NE1  1  
ATOM   1619  C  CE2  . TRP A 1 105 ? 17.250  13.785 19.465  1.00 0.00  ? 105 TRP A CE2  1  
ATOM   1620  C  CE3  . TRP A 1 105 ? 15.017  12.901 19.732  1.00 0.00  ? 105 TRP A CE3  1  
ATOM   1621  C  CZ2  . TRP A 1 105 ? 17.040  14.680 20.510  1.00 0.00  ? 105 TRP A CZ2  1  
ATOM   1622  C  CZ3  . TRP A 1 105 ? 14.800  13.801 20.787  1.00 0.00  ? 105 TRP A CZ3  1  
ATOM   1623  C  CH2  . TRP A 1 105 ? 15.811  14.690 21.176  1.00 0.00  ? 105 TRP A CH2  1  
ATOM   1624  H  H    . TRP A 1 105 ? 18.323  10.277 18.456  1.00 0.00  ? 105 TRP A H    1  
ATOM   1625  H  HA   . TRP A 1 105 ? 15.494  9.358  18.449  1.00 0.00  ? 105 TRP A HA   1  
ATOM   1626  H  HB2  . TRP A 1 105 ? 16.468  10.983 16.181  1.00 0.00  ? 105 TRP A HB2  1  
ATOM   1627  H  HB3  . TRP A 1 105 ? 15.022  11.189 17.166  1.00 0.00  ? 105 TRP A HB3  1  
ATOM   1628  H  HD1  . TRP A 1 105 ? 18.690  12.139 16.970  1.00 0.00  ? 105 TRP A HD1  1  
ATOM   1629  H  HE1  . TRP A 1 105 ? 19.167  14.008 18.679  1.00 0.00  ? 105 TRP A HE1  1  
ATOM   1630  H  HE3  . TRP A 1 105 ? 14.233  12.222 19.436  1.00 0.00  ? 105 TRP A HE3  1  
ATOM   1631  H  HZ2  . TRP A 1 105 ? 17.822  15.361 20.800  1.00 0.00  ? 105 TRP A HZ2  1  
ATOM   1632  H  HZ3  . TRP A 1 105 ? 13.851  13.806 21.303  1.00 0.00  ? 105 TRP A HZ3  1  
ATOM   1633  H  HH2  . TRP A 1 105 ? 15.640  15.379 21.990  1.00 0.00  ? 105 TRP A HH2  1  
ATOM   1634  N  N    . THR A 1 106 ? 15.637  7.717  16.547  1.00 0.00  ? 106 THR A N    1  
ATOM   1635  C  CA   . THR A 1 106 ? 15.821  6.711  15.464  1.00 0.00  ? 106 THR A CA   1  
ATOM   1636  C  C    . THR A 1 106 ? 14.470  6.195  14.970  1.00 0.00  ? 106 THR A C    1  
ATOM   1637  O  O    . THR A 1 106 ? 13.492  6.191  15.689  1.00 0.00  ? 106 THR A O    1  
ATOM   1638  C  CB   . THR A 1 106 ? 16.642  5.526  15.984  1.00 0.00  ? 106 THR A CB   1  
ATOM   1639  O  OG1  . THR A 1 106 ? 15.760  4.544  16.513  1.00 0.00  ? 106 THR A OG1  1  
ATOM   1640  C  CG2  . THR A 1 106 ? 17.604  5.989  17.081  1.00 0.00  ? 106 THR A CG2  1  
ATOM   1641  H  H    . THR A 1 106 ? 14.826  7.710  17.099  1.00 0.00  ? 106 THR A H    1  
ATOM   1642  H  HA   . THR A 1 106 ? 16.337  7.176  14.642  1.00 0.00  ? 106 THR A HA   1  
ATOM   1643  H  HB   . THR A 1 106 ? 17.207  5.100  15.171  1.00 0.00  ? 106 THR A HB   1  
ATOM   1644  H  HG1  . THR A 1 106 ? 16.269  3.958  17.079  1.00 0.00  ? 106 THR A HG1  1  
ATOM   1645  H  HG21 . THR A 1 106 ? 18.215  5.155  17.396  1.00 0.00  ? 106 THR A HG21 1  
ATOM   1646  H  HG22 . THR A 1 106 ? 17.042  6.360  17.924  1.00 0.00  ? 106 THR A HG22 1  
ATOM   1647  H  HG23 . THR A 1 106 ? 18.239  6.773  16.698  1.00 0.00  ? 106 THR A HG23 1  
ATOM   1648  N  N    . ASN A 1 107 ? 14.420  5.742  13.744  1.00 0.00  ? 107 ASN A N    1  
ATOM   1649  C  CA   . ASN A 1 107 ? 13.144  5.208  13.196  1.00 0.00  ? 107 ASN A CA   1  
ATOM   1650  C  C    . ASN A 1 107 ? 12.979  3.749  13.642  1.00 0.00  ? 107 ASN A C    1  
ATOM   1651  O  O    . ASN A 1 107 ? 12.048  3.069  13.256  1.00 0.00  ? 107 ASN A O    1  
ATOM   1652  C  CB   . ASN A 1 107 ? 13.173  5.281  11.666  1.00 0.00  ? 107 ASN A CB   1  
ATOM   1653  C  CG   . ASN A 1 107 ? 12.047  4.426  11.085  1.00 0.00  ? 107 ASN A CG   1  
ATOM   1654  O  OD1  . ASN A 1 107 ? 10.891  4.798  11.145  1.00 0.00  ? 107 ASN A OD1  1  
ATOM   1655  N  ND2  . ASN A 1 107 ? 12.337  3.287  10.521  1.00 0.00  ? 107 ASN A ND2  1  
ATOM   1656  H  H    . ASN A 1 107 ? 15.228  5.743  13.189  1.00 0.00  ? 107 ASN A H    1  
ATOM   1657  H  HA   . ASN A 1 107 ? 12.323  5.796  13.566  1.00 0.00  ? 107 ASN A HA   1  
ATOM   1658  H  HB2  . ASN A 1 107 ? 13.043  6.307  11.353  1.00 0.00  ? 107 ASN A HB2  1  
ATOM   1659  H  HB3  . ASN A 1 107 ? 14.121  4.913  11.307  1.00 0.00  ? 107 ASN A HB3  1  
ATOM   1660  H  HD21 . ASN A 1 107 ? 13.269  2.987  10.474  1.00 0.00  ? 107 ASN A HD21 1  
ATOM   1661  H  HD22 . ASN A 1 107 ? 11.624  2.730  10.144  1.00 0.00  ? 107 ASN A HD22 1  
ATOM   1662  N  N    . THR A 1 108 ? 13.878  3.266  14.460  1.00 0.00  ? 108 THR A N    1  
ATOM   1663  C  CA   . THR A 1 108 ? 13.776  1.858  14.936  1.00 0.00  ? 108 THR A CA   1  
ATOM   1664  C  C    . THR A 1 108 ? 12.992  1.827  16.248  1.00 0.00  ? 108 THR A C    1  
ATOM   1665  O  O    . THR A 1 108 ? 12.080  2.604  16.451  1.00 0.00  ? 108 THR A O    1  
ATOM   1666  C  CB   . THR A 1 108 ? 15.182  1.297  15.168  1.00 0.00  ? 108 THR A CB   1  
ATOM   1667  O  OG1  . THR A 1 108 ? 15.621  1.651  16.477  1.00 0.00  ? 108 THR A OG1  1  
ATOM   1668  C  CG2  . THR A 1 108 ? 16.144  1.869  14.124  1.00 0.00  ? 108 THR A CG2  1  
ATOM   1669  H  H    . THR A 1 108 ? 14.619  3.830  14.764  1.00 0.00  ? 108 THR A H    1  
ATOM   1670  H  HA   . THR A 1 108 ? 13.266  1.262  14.196  1.00 0.00  ? 108 THR A HA   1  
ATOM   1671  H  HB   . THR A 1 108 ? 15.157  0.223  15.076  1.00 0.00  ? 108 THR A HB   1  
ATOM   1672  H  HG1  . THR A 1 108 ? 16.426  2.169  16.397  1.00 0.00  ? 108 THR A HG1  1  
ATOM   1673  H  HG21 . THR A 1 108 ? 15.602  2.093  13.218  1.00 0.00  ? 108 THR A HG21 1  
ATOM   1674  H  HG22 . THR A 1 108 ? 16.915  1.144  13.913  1.00 0.00  ? 108 THR A HG22 1  
ATOM   1675  H  HG23 . THR A 1 108 ? 16.596  2.773  14.506  1.00 0.00  ? 108 THR A HG23 1  
ATOM   1676  N  N    . SER A 1 109 ? 13.339  0.945  17.147  1.00 0.00  ? 109 SER A N    1  
ATOM   1677  C  CA   . SER A 1 109 ? 12.611  0.885  18.444  1.00 0.00  ? 109 SER A CA   1  
ATOM   1678  C  C    . SER A 1 109 ? 13.303  1.815  19.444  1.00 0.00  ? 109 SER A C    1  
ATOM   1679  O  O    . SER A 1 109 ? 13.420  1.509  20.614  1.00 0.00  ? 109 SER A O    1  
ATOM   1680  C  CB   . SER A 1 109 ? 12.629  -0.548 18.978  1.00 0.00  ? 109 SER A CB   1  
ATOM   1681  O  OG   . SER A 1 109 ? 11.617  -0.692 19.965  1.00 0.00  ? 109 SER A OG   1  
ATOM   1682  H  H    . SER A 1 109 ? 14.080  0.327  16.973  1.00 0.00  ? 109 SER A H    1  
ATOM   1683  H  HA   . SER A 1 109 ? 11.588  1.205  18.301  1.00 0.00  ? 109 SER A HA   1  
ATOM   1684  H  HB2  . SER A 1 109 ? 12.440  -1.238 18.173  1.00 0.00  ? 109 SER A HB2  1  
ATOM   1685  H  HB3  . SER A 1 109 ? 13.600  -0.757 19.408  1.00 0.00  ? 109 SER A HB3  1  
ATOM   1686  H  HG   . SER A 1 109 ? 12.043  -0.925 20.793  1.00 0.00  ? 109 SER A HG   1  
ATOM   1687  N  N    . ALA A 1 110 ? 13.769  2.947  18.988  1.00 0.00  ? 110 ALA A N    1  
ATOM   1688  C  CA   . ALA A 1 110 ? 14.462  3.899  19.904  1.00 0.00  ? 110 ALA A CA   1  
ATOM   1689  C  C    . ALA A 1 110 ? 13.480  4.407  20.966  1.00 0.00  ? 110 ALA A C    1  
ATOM   1690  O  O    . ALA A 1 110 ? 13.248  3.758  21.967  1.00 0.00  ? 110 ALA A O    1  
ATOM   1691  C  CB   . ALA A 1 110 ? 15.001  5.083  19.096  1.00 0.00  ? 110 ALA A CB   1  
ATOM   1692  H  H    . ALA A 1 110 ? 13.667  3.169  18.038  1.00 0.00  ? 110 ALA A H    1  
ATOM   1693  H  HA   . ALA A 1 110 ? 15.285  3.394  20.389  1.00 0.00  ? 110 ALA A HA   1  
ATOM   1694  H  HB1  . ALA A 1 110 ? 15.061  5.955  19.731  1.00 0.00  ? 110 ALA A HB1  1  
ATOM   1695  H  HB2  . ALA A 1 110 ? 14.339  5.285  18.268  1.00 0.00  ? 110 ALA A HB2  1  
ATOM   1696  H  HB3  . ALA A 1 110 ? 15.985  4.844  18.720  1.00 0.00  ? 110 ALA A HB3  1  
ATOM   1697  N  N    . ASN A 1 111 ? 12.904  5.563  20.763  1.00 0.00  ? 111 ASN A N    1  
ATOM   1698  C  CA   . ASN A 1 111 ? 11.950  6.100  21.769  1.00 0.00  ? 111 ASN A CA   1  
ATOM   1699  C  C    . ASN A 1 111 ? 11.386  7.436  21.281  1.00 0.00  ? 111 ASN A C    1  
ATOM   1700  O  O    . ASN A 1 111 ? 10.196  7.670  21.337  1.00 0.00  ? 111 ASN A O    1  
ATOM   1701  C  CB   . ASN A 1 111 ? 12.678  6.310  23.095  1.00 0.00  ? 111 ASN A CB   1  
ATOM   1702  C  CG   . ASN A 1 111 ? 11.655  6.532  24.206  1.00 0.00  ? 111 ASN A CG   1  
ATOM   1703  O  OD1  . ASN A 1 111 ? 10.848  7.437  24.132  1.00 0.00  ? 111 ASN A OD1  1  
ATOM   1704  N  ND2  . ASN A 1 111 ? 11.655  5.739  25.241  1.00 0.00  ? 111 ASN A ND2  1  
ATOM   1705  H  H    . ASN A 1 111 ? 13.100  6.079  19.954  1.00 0.00  ? 111 ASN A H    1  
ATOM   1706  H  HA   . ASN A 1 111 ? 11.141  5.397  21.909  1.00 0.00  ? 111 ASN A HA   1  
ATOM   1707  H  HB2  . ASN A 1 111 ? 13.274  5.437  23.322  1.00 0.00  ? 111 ASN A HB2  1  
ATOM   1708  H  HB3  . ASN A 1 111 ? 13.319  7.175  23.019  1.00 0.00  ? 111 ASN A HB3  1  
ATOM   1709  H  HD21 . ASN A 1 111 ? 12.307  5.011  25.300  1.00 0.00  ? 111 ASN A HD21 1  
ATOM   1710  H  HD22 . ASN A 1 111 ? 11.001  5.871  25.958  1.00 0.00  ? 111 ASN A HD22 1  
ATOM   1711  N  N    . TYR A 1 112 ? 12.226  8.317  20.803  1.00 0.00  ? 112 TYR A N    1  
ATOM   1712  C  CA   . TYR A 1 112 ? 11.723  9.632  20.316  1.00 0.00  ? 112 TYR A CA   1  
ATOM   1713  C  C    . TYR A 1 112 ? 11.276  9.491  18.861  1.00 0.00  ? 112 TYR A C    1  
ATOM   1714  O  O    . TYR A 1 112 ? 10.302  10.080 18.437  1.00 0.00  ? 112 TYR A O    1  
ATOM   1715  C  CB   . TYR A 1 112 ? 12.837  10.672 20.423  1.00 0.00  ? 112 TYR A CB   1  
ATOM   1716  C  CG   . TYR A 1 112 ? 13.188  10.875 21.876  1.00 0.00  ? 112 TYR A CG   1  
ATOM   1717  C  CD1  . TYR A 1 112 ? 12.375  11.673 22.689  1.00 0.00  ? 112 TYR A CD1  1  
ATOM   1718  C  CD2  . TYR A 1 112 ? 14.328  10.265 22.410  1.00 0.00  ? 112 TYR A CD2  1  
ATOM   1719  C  CE1  . TYR A 1 112 ? 12.702  11.861 24.036  1.00 0.00  ? 112 TYR A CE1  1  
ATOM   1720  C  CE2  . TYR A 1 112 ? 14.656  10.452 23.758  1.00 0.00  ? 112 TYR A CE2  1  
ATOM   1721  C  CZ   . TYR A 1 112 ? 13.843  11.251 24.571  1.00 0.00  ? 112 TYR A CZ   1  
ATOM   1722  O  OH   . TYR A 1 112 ? 14.165  11.437 25.900  1.00 0.00  ? 112 TYR A OH   1  
ATOM   1723  H  H    . TYR A 1 112 ? 13.184  8.113  20.764  1.00 0.00  ? 112 TYR A H    1  
ATOM   1724  H  HA   . TYR A 1 112 ? 10.883  9.941  20.919  1.00 0.00  ? 112 TYR A HA   1  
ATOM   1725  H  HB2  . TYR A 1 112 ? 13.709  10.325 19.885  1.00 0.00  ? 112 TYR A HB2  1  
ATOM   1726  H  HB3  . TYR A 1 112 ? 12.501  11.608 20.001  1.00 0.00  ? 112 TYR A HB3  1  
ATOM   1727  H  HD1  . TYR A 1 112 ? 11.495  12.142 22.277  1.00 0.00  ? 112 TYR A HD1  1  
ATOM   1728  H  HD2  . TYR A 1 112 ? 14.951  9.649  21.781  1.00 0.00  ? 112 TYR A HD2  1  
ATOM   1729  H  HE1  . TYR A 1 112 ? 12.075  12.477 24.664  1.00 0.00  ? 112 TYR A HE1  1  
ATOM   1730  H  HE2  . TYR A 1 112 ? 15.537  9.981  24.171  1.00 0.00  ? 112 TYR A HE2  1  
ATOM   1731  H  HH   . TYR A 1 112 ? 14.477  10.599 26.251  1.00 0.00  ? 112 TYR A HH   1  
ATOM   1732  N  N    . SER A 1 113 ? 11.976  8.696  18.100  1.00 0.00  ? 113 SER A N    1  
ATOM   1733  C  CA   . SER A 1 113 ? 11.594  8.487  16.675  1.00 0.00  ? 113 SER A CA   1  
ATOM   1734  C  C    . SER A 1 113 ? 11.676  9.803  15.897  1.00 0.00  ? 113 SER A C    1  
ATOM   1735  O  O    . SER A 1 113 ? 10.878  10.699 16.091  1.00 0.00  ? 113 SER A O    1  
ATOM   1736  C  CB   . SER A 1 113 ? 10.165  7.948  16.614  1.00 0.00  ? 113 SER A CB   1  
ATOM   1737  O  OG   . SER A 1 113 ? 9.533   8.425  15.436  1.00 0.00  ? 113 SER A OG   1  
ATOM   1738  H  H    . SER A 1 113 ? 12.748  8.223  18.473  1.00 0.00  ? 113 SER A H    1  
ATOM   1739  H  HA   . SER A 1 113 ? 12.262  7.770  16.229  1.00 0.00  ? 113 SER A HA   1  
ATOM   1740  H  HB2  . SER A 1 113 ? 10.185  6.870  16.595  1.00 0.00  ? 113 SER A HB2  1  
ATOM   1741  H  HB3  . SER A 1 113 ? 9.618   8.281  17.488  1.00 0.00  ? 113 SER A HB3  1  
ATOM   1742  H  HG   . SER A 1 113 ? 8.697   7.962  15.342  1.00 0.00  ? 113 SER A HG   1  
ATOM   1743  N  N    . LEU A 1 114 ? 12.631  9.925  15.009  1.00 0.00  ? 114 LEU A N    1  
ATOM   1744  C  CA   . LEU A 1 114 ? 12.749  11.183 14.214  1.00 0.00  ? 114 LEU A CA   1  
ATOM   1745  C  C    . LEU A 1 114 ? 11.393  11.528 13.590  1.00 0.00  ? 114 LEU A C    1  
ATOM   1746  O  O    . LEU A 1 114 ? 11.028  12.681 13.475  1.00 0.00  ? 114 LEU A O    1  
ATOM   1747  C  CB   . LEU A 1 114 ? 13.775  10.987 13.098  1.00 0.00  ? 114 LEU A CB   1  
ATOM   1748  C  CG   . LEU A 1 114 ? 14.553  12.284 12.891  1.00 0.00  ? 114 LEU A CG   1  
ATOM   1749  C  CD1  . LEU A 1 114 ? 13.579  13.455 12.744  1.00 0.00  ? 114 LEU A CD1  1  
ATOM   1750  C  CD2  . LEU A 1 114 ? 15.462  12.526 14.098  1.00 0.00  ? 114 LEU A CD2  1  
ATOM   1751  H  H    . LEU A 1 114 ? 13.269  9.185  14.862  1.00 0.00  ? 114 LEU A H    1  
ATOM   1752  H  HA   . LEU A 1 114 ? 13.065  11.991 14.856  1.00 0.00  ? 114 LEU A HA   1  
ATOM   1753  H  HB2  . LEU A 1 114 ? 14.459  10.195 13.370  1.00 0.00  ? 114 LEU A HB2  1  
ATOM   1754  H  HB3  . LEU A 1 114 ? 13.267  10.725 12.182  1.00 0.00  ? 114 LEU A HB3  1  
ATOM   1755  H  HG   . LEU A 1 114 ? 15.152  12.204 11.997  1.00 0.00  ? 114 LEU A HG   1  
ATOM   1756  H  HD11 . LEU A 1 114 ? 13.227  13.755 13.719  1.00 0.00  ? 114 LEU A HD11 1  
ATOM   1757  H  HD12 . LEU A 1 114 ? 12.741  13.154 12.133  1.00 0.00  ? 114 LEU A HD12 1  
ATOM   1758  H  HD13 . LEU A 1 114 ? 14.086  14.285 12.274  1.00 0.00  ? 114 LEU A HD13 1  
ATOM   1759  H  HD21 . LEU A 1 114 ? 14.878  12.469 15.006  1.00 0.00  ? 114 LEU A HD21 1  
ATOM   1760  H  HD22 . LEU A 1 114 ? 15.911  13.504 14.020  1.00 0.00  ? 114 LEU A HD22 1  
ATOM   1761  H  HD23 . LEU A 1 114 ? 16.237  11.774 14.122  1.00 0.00  ? 114 LEU A HD23 1  
ATOM   1762  N  N    . PHE A 1 115 ? 10.647  10.537 13.176  1.00 0.00  ? 115 PHE A N    1  
ATOM   1763  C  CA   . PHE A 1 115 ? 9.319   10.809 12.550  1.00 0.00  ? 115 PHE A CA   1  
ATOM   1764  C  C    . PHE A 1 115 ? 8.371   11.424 13.587  1.00 0.00  ? 115 PHE A C    1  
ATOM   1765  O  O    . PHE A 1 115 ? 7.549   12.260 13.268  1.00 0.00  ? 115 PHE A O    1  
ATOM   1766  C  CB   . PHE A 1 115 ? 8.729   9.487  12.019  1.00 0.00  ? 115 PHE A CB   1  
ATOM   1767  C  CG   . PHE A 1 115 ? 7.214   9.553  12.003  1.00 0.00  ? 115 PHE A CG   1  
ATOM   1768  C  CD1  . PHE A 1 115 ? 6.564   10.572 11.296  1.00 0.00  ? 115 PHE A CD1  1  
ATOM   1769  C  CD2  . PHE A 1 115 ? 6.464   8.600  12.704  1.00 0.00  ? 115 PHE A CD2  1  
ATOM   1770  C  CE1  . PHE A 1 115 ? 5.166   10.639 11.290  1.00 0.00  ? 115 PHE A CE1  1  
ATOM   1771  C  CE2  . PHE A 1 115 ? 5.066   8.667  12.696  1.00 0.00  ? 115 PHE A CE2  1  
ATOM   1772  C  CZ   . PHE A 1 115 ? 4.416   9.687  11.990  1.00 0.00  ? 115 PHE A CZ   1  
ATOM   1773  H  H    . PHE A 1 115 ? 10.963  9.614  13.272  1.00 0.00  ? 115 PHE A H    1  
ATOM   1774  H  HA   . PHE A 1 115 ? 9.446   11.498 11.728  1.00 0.00  ? 115 PHE A HA   1  
ATOM   1775  H  HB2  . PHE A 1 115 ? 9.087   9.315  11.015  1.00 0.00  ? 115 PHE A HB2  1  
ATOM   1776  H  HB3  . PHE A 1 115 ? 9.045   8.674  12.655  1.00 0.00  ? 115 PHE A HB3  1  
ATOM   1777  H  HD1  . PHE A 1 115 ? 7.142   11.308 10.757  1.00 0.00  ? 115 PHE A HD1  1  
ATOM   1778  H  HD2  . PHE A 1 115 ? 6.965   7.813  13.249  1.00 0.00  ? 115 PHE A HD2  1  
ATOM   1779  H  HE1  . PHE A 1 115 ? 4.665   11.424 10.743  1.00 0.00  ? 115 PHE A HE1  1  
ATOM   1780  H  HE2  . PHE A 1 115 ? 4.487   7.934  13.239  1.00 0.00  ? 115 PHE A HE2  1  
ATOM   1781  H  HZ   . PHE A 1 115 ? 3.337   9.740  11.984  1.00 0.00  ? 115 PHE A HZ   1  
ATOM   1782  N  N    . LEU A 1 116 ? 8.461   11.004 14.815  1.00 0.00  ? 116 LEU A N    1  
ATOM   1783  C  CA   . LEU A 1 116 ? 7.550   11.545 15.850  1.00 0.00  ? 116 LEU A CA   1  
ATOM   1784  C  C    . LEU A 1 116 ? 8.068   12.904 16.332  1.00 0.00  ? 116 LEU A C    1  
ATOM   1785  O  O    . LEU A 1 116 ? 7.378   13.902 16.251  1.00 0.00  ? 116 LEU A O    1  
ATOM   1786  C  CB   . LEU A 1 116 ? 7.493   10.542 17.009  1.00 0.00  ? 116 LEU A CB   1  
ATOM   1787  C  CG   . LEU A 1 116 ? 6.263   10.788 17.889  1.00 0.00  ? 116 LEU A CG   1  
ATOM   1788  C  CD1  . LEU A 1 116 ? 6.581   11.904 18.870  1.00 0.00  ? 116 LEU A CD1  1  
ATOM   1789  C  CD2  . LEU A 1 116 ? 5.056   11.186 17.035  1.00 0.00  ? 116 LEU A CD2  1  
ATOM   1790  H  H    . LEU A 1 116 ? 9.114   10.320 15.056  1.00 0.00  ? 116 LEU A H    1  
ATOM   1791  H  HA   . LEU A 1 116 ? 6.568   11.667 15.423  1.00 0.00  ? 116 LEU A HA   1  
ATOM   1792  H  HB2  . LEU A 1 116 ? 7.448   9.540  16.609  1.00 0.00  ? 116 LEU A HB2  1  
ATOM   1793  H  HB3  . LEU A 1 116 ? 8.384   10.644 17.610  1.00 0.00  ? 116 LEU A HB3  1  
ATOM   1794  H  HG   . LEU A 1 116 ? 6.033   9.887  18.440  1.00 0.00  ? 116 LEU A HG   1  
ATOM   1795  H  HD11 . LEU A 1 116 ? 7.604   12.220 18.731  1.00 0.00  ? 116 LEU A HD11 1  
ATOM   1796  H  HD12 . LEU A 1 116 ? 6.448   11.540 19.876  1.00 0.00  ? 116 LEU A HD12 1  
ATOM   1797  H  HD13 . LEU A 1 116 ? 5.918   12.737 18.693  1.00 0.00  ? 116 LEU A HD13 1  
ATOM   1798  H  HD21 . LEU A 1 116 ? 4.146   10.949 17.567  1.00 0.00  ? 116 LEU A HD21 1  
ATOM   1799  H  HD22 . LEU A 1 116 ? 5.081   10.643 16.102  1.00 0.00  ? 116 LEU A HD22 1  
ATOM   1800  H  HD23 . LEU A 1 116 ? 5.090   12.248 16.836  1.00 0.00  ? 116 LEU A HD23 1  
ATOM   1801  N  N    . VAL A 1 117 ? 9.277   12.964 16.818  1.00 0.00  ? 117 VAL A N    1  
ATOM   1802  C  CA   . VAL A 1 117 ? 9.819   14.270 17.281  1.00 0.00  ? 117 VAL A CA   1  
ATOM   1803  C  C    . VAL A 1 117 ? 9.609   15.313 16.181  1.00 0.00  ? 117 VAL A C    1  
ATOM   1804  O  O    . VAL A 1 117 ? 9.259   16.448 16.442  1.00 0.00  ? 117 VAL A O    1  
ATOM   1805  C  CB   . VAL A 1 117 ? 11.317  14.138 17.570  1.00 0.00  ? 117 VAL A CB   1  
ATOM   1806  C  CG1  . VAL A 1 117 ? 11.528  13.664 19.008  1.00 0.00  ? 117 VAL A CG1  1  
ATOM   1807  C  CG2  . VAL A 1 117 ? 11.947  13.129 16.605  1.00 0.00  ? 117 VAL A CG2  1  
ATOM   1808  H  H    . VAL A 1 117 ? 9.830   12.158 16.871  1.00 0.00  ? 117 VAL A H    1  
ATOM   1809  H  HA   . VAL A 1 117 ? 9.301   14.579 18.177  1.00 0.00  ? 117 VAL A HA   1  
ATOM   1810  H  HB   . VAL A 1 117 ? 11.788  15.099 17.439  1.00 0.00  ? 117 VAL A HB   1  
ATOM   1811  H  HG11 . VAL A 1 117 ? 10.906  12.802 19.198  1.00 0.00  ? 117 VAL A HG11 1  
ATOM   1812  H  HG12 . VAL A 1 117 ? 11.262  14.457 19.692  1.00 0.00  ? 117 VAL A HG12 1  
ATOM   1813  H  HG13 . VAL A 1 117 ? 12.564  13.399 19.150  1.00 0.00  ? 117 VAL A HG13 1  
ATOM   1814  H  HG21 . VAL A 1 117 ? 12.272  12.261 17.157  1.00 0.00  ? 117 VAL A HG21 1  
ATOM   1815  H  HG22 . VAL A 1 117 ? 12.796  13.583 16.116  1.00 0.00  ? 117 VAL A HG22 1  
ATOM   1816  H  HG23 . VAL A 1 117 ? 11.222  12.835 15.862  1.00 0.00  ? 117 VAL A HG23 1  
ATOM   1817  N  N    . ALA A 1 118 ? 9.824   14.934 14.947  1.00 0.00  ? 118 ALA A N    1  
ATOM   1818  C  CA   . ALA A 1 118 ? 9.642   15.899 13.826  1.00 0.00  ? 118 ALA A CA   1  
ATOM   1819  C  C    . ALA A 1 118 ? 8.155   16.223 13.663  1.00 0.00  ? 118 ALA A C    1  
ATOM   1820  O  O    . ALA A 1 118 ? 7.776   17.369 13.591  1.00 0.00  ? 118 ALA A O    1  
ATOM   1821  C  CB   . ALA A 1 118 ? 10.175  15.289 12.527  1.00 0.00  ? 118 ALA A CB   1  
ATOM   1822  H  H    . ALA A 1 118 ? 10.108  14.014 14.760  1.00 0.00  ? 118 ALA A H    1  
ATOM   1823  H  HA   . ALA A 1 118 ? 10.184  16.808 14.045  1.00 0.00  ? 118 ALA A HA   1  
ATOM   1824  H  HB1  . ALA A 1 118 ? 11.204  14.986 12.662  1.00 0.00  ? 118 ALA A HB1  1  
ATOM   1825  H  HB2  . ALA A 1 118 ? 10.118  16.021 11.736  1.00 0.00  ? 118 ALA A HB2  1  
ATOM   1826  H  HB3  . ALA A 1 118 ? 9.580   14.429 12.264  1.00 0.00  ? 118 ALA A HB3  1  
ATOM   1827  N  N    . ALA A 1 119 ? 7.309   15.226 13.605  1.00 0.00  ? 119 ALA A N    1  
ATOM   1828  C  CA   . ALA A 1 119 ? 5.846   15.496 13.447  1.00 0.00  ? 119 ALA A CA   1  
ATOM   1829  C  C    . ALA A 1 119 ? 5.449   16.664 14.354  1.00 0.00  ? 119 ALA A C    1  
ATOM   1830  O  O    . ALA A 1 119 ? 4.981   17.695 13.900  1.00 0.00  ? 119 ALA A O    1  
ATOM   1831  C  CB   . ALA A 1 119 ? 5.049   14.249 13.838  1.00 0.00  ? 119 ALA A CB   1  
ATOM   1832  H  H    . ALA A 1 119 ? 7.633   14.303 13.665  1.00 0.00  ? 119 ALA A H    1  
ATOM   1833  H  HA   . ALA A 1 119 ? 5.635   15.752 12.418  1.00 0.00  ? 119 ALA A HA   1  
ATOM   1834  H  HB1  . ALA A 1 119 ? 4.906   13.624 12.970  1.00 0.00  ? 119 ALA A HB1  1  
ATOM   1835  H  HB2  . ALA A 1 119 ? 4.087   14.545 14.229  1.00 0.00  ? 119 ALA A HB2  1  
ATOM   1836  H  HB3  . ALA A 1 119 ? 5.589   13.699 14.593  1.00 0.00  ? 119 ALA A HB3  1  
ATOM   1837  N  N    . HIS A 1 120 ? 5.647   16.519 15.635  1.00 0.00  ? 120 HIS A N    1  
ATOM   1838  C  CA   . HIS A 1 120 ? 5.296   17.624 16.563  1.00 0.00  ? 120 HIS A CA   1  
ATOM   1839  C  C    . HIS A 1 120 ? 5.896   18.924 16.028  1.00 0.00  ? 120 HIS A C    1  
ATOM   1840  O  O    . HIS A 1 120 ? 5.198   19.893 15.796  1.00 0.00  ? 120 HIS A O    1  
ATOM   1841  C  CB   . HIS A 1 120 ? 5.868   17.337 17.952  1.00 0.00  ? 120 HIS A CB   1  
ATOM   1842  C  CG   . HIS A 1 120 ? 5.362   18.373 18.919  1.00 0.00  ? 120 HIS A CG   1  
ATOM   1843  N  ND1  . HIS A 1 120 ? 4.293   18.132 19.767  1.00 0.00  ? 120 HIS A ND1  1  
ATOM   1844  C  CD2  . HIS A 1 120 ? 5.760   19.663 19.176  1.00 0.00  ? 120 HIS A CD2  1  
ATOM   1845  C  CE1  . HIS A 1 120 ? 4.086   19.249 20.488  1.00 0.00  ? 120 HIS A CE1  1  
ATOM   1846  N  NE2  . HIS A 1 120 ? 4.953   20.213 20.167  1.00 0.00  ? 120 HIS A NE2  1  
ATOM   1847  H  H    . HIS A 1 120 ? 6.037   15.690 15.982  1.00 0.00  ? 120 HIS A H    1  
ATOM   1848  H  HA   . HIS A 1 120 ? 4.222   17.717 16.625  1.00 0.00  ? 120 HIS A HA   1  
ATOM   1849  H  HB2  . HIS A 1 120 ? 5.555   16.354 18.276  1.00 0.00  ? 120 HIS A HB2  1  
ATOM   1850  H  HB3  . HIS A 1 120 ? 6.946   17.377 17.913  1.00 0.00  ? 120 HIS A HB3  1  
ATOM   1851  H  HD1  . HIS A 1 120 ? 3.781   17.299 19.829  1.00 0.00  ? 120 HIS A HD1  1  
ATOM   1852  H  HD2  . HIS A 1 120 ? 6.573   20.175 18.682  1.00 0.00  ? 120 HIS A HD2  1  
ATOM   1853  H  HE1  . HIS A 1 120 ? 3.310   19.355 21.232  1.00 0.00  ? 120 HIS A HE1  1  
ATOM   1854  N  N    . GLU A 1 121 ? 7.187   18.949 15.824  1.00 0.00  ? 121 GLU A N    1  
ATOM   1855  C  CA   . GLU A 1 121 ? 7.840   20.181 15.297  1.00 0.00  ? 121 GLU A CA   1  
ATOM   1856  C  C    . GLU A 1 121 ? 7.364   20.432 13.867  1.00 0.00  ? 121 GLU A C    1  
ATOM   1857  O  O    . GLU A 1 121 ? 7.572   21.492 13.312  1.00 0.00  ? 121 GLU A O    1  
ATOM   1858  C  CB   . GLU A 1 121 ? 9.357   19.995 15.319  1.00 0.00  ? 121 GLU A CB   1  
ATOM   1859  C  CG   . GLU A 1 121 ? 9.822   19.822 16.766  1.00 0.00  ? 121 GLU A CG   1  
ATOM   1860  C  CD   . GLU A 1 121 ? 9.322   20.998 17.607  1.00 0.00  ? 121 GLU A CD   1  
ATOM   1861  O  OE1  . GLU A 1 121 ? 9.047   22.039 17.033  1.00 0.00  ? 121 GLU A OE1  1  
ATOM   1862  O  OE2  . GLU A 1 121 ? 9.219   20.836 18.812  1.00 0.00  ? 121 GLU A OE2  1  
ATOM   1863  H  H    . GLU A 1 121 ? 7.729   18.154 16.014  1.00 0.00  ? 121 GLU A H    1  
ATOM   1864  H  HA   . GLU A 1 121 ? 7.570   21.025 15.914  1.00 0.00  ? 121 GLU A HA   1  
ATOM   1865  H  HB2  . GLU A 1 121 ? 9.620   19.116 14.747  1.00 0.00  ? 121 GLU A HB2  1  
ATOM   1866  H  HB3  . GLU A 1 121 ? 9.837   20.862 14.890  1.00 0.00  ? 121 GLU A HB3  1  
ATOM   1867  H  HG2  . GLU A 1 121 ? 9.423   18.898 17.163  1.00 0.00  ? 121 GLU A HG2  1  
ATOM   1868  H  HG3  . GLU A 1 121 ? 10.900  19.791 16.797  1.00 0.00  ? 121 GLU A HG3  1  
ATOM   1869  N  N    . PHE A 1 122 ? 6.709   19.472 13.271  1.00 0.00  ? 122 PHE A N    1  
ATOM   1870  C  CA   . PHE A 1 122 ? 6.202   19.672 11.889  1.00 0.00  ? 122 PHE A CA   1  
ATOM   1871  C  C    . PHE A 1 122 ? 4.902   20.470 11.980  1.00 0.00  ? 122 PHE A C    1  
ATOM   1872  O  O    . PHE A 1 122 ? 4.426   21.027 11.011  1.00 0.00  ? 122 PHE A O    1  
ATOM   1873  C  CB   . PHE A 1 122 ? 5.922   18.312 11.242  1.00 0.00  ? 122 PHE A CB   1  
ATOM   1874  C  CG   . PHE A 1 122 ? 6.962   18.027 10.185  1.00 0.00  ? 122 PHE A CG   1  
ATOM   1875  C  CD1  . PHE A 1 122 ? 8.308   17.883 10.546  1.00 0.00  ? 122 PHE A CD1  1  
ATOM   1876  C  CD2  . PHE A 1 122 ? 6.581   17.905 8.843   1.00 0.00  ? 122 PHE A CD2  1  
ATOM   1877  C  CE1  . PHE A 1 122 ? 9.270   17.618 9.565   1.00 0.00  ? 122 PHE A CE1  1  
ATOM   1878  C  CE2  . PHE A 1 122 ? 7.545   17.640 7.864   1.00 0.00  ? 122 PHE A CE2  1  
ATOM   1879  C  CZ   . PHE A 1 122 ? 8.888   17.496 8.226   1.00 0.00  ? 122 PHE A CZ   1  
ATOM   1880  H  H    . PHE A 1 122 ? 6.541   18.628 13.739  1.00 0.00  ? 122 PHE A H    1  
ATOM   1881  H  HA   . PHE A 1 122 ? 6.931   20.216 11.305  1.00 0.00  ? 122 PHE A HA   1  
ATOM   1882  H  HB2  . PHE A 1 122 ? 5.954   17.541 11.996  1.00 0.00  ? 122 PHE A HB2  1  
ATOM   1883  H  HB3  . PHE A 1 122 ? 4.944   18.328 10.785  1.00 0.00  ? 122 PHE A HB3  1  
ATOM   1884  H  HD1  . PHE A 1 122 ? 8.604   17.977 11.580  1.00 0.00  ? 122 PHE A HD1  1  
ATOM   1885  H  HD2  . PHE A 1 122 ? 5.543   18.015 8.563   1.00 0.00  ? 122 PHE A HD2  1  
ATOM   1886  H  HE1  . PHE A 1 122 ? 10.306  17.508 9.842   1.00 0.00  ? 122 PHE A HE1  1  
ATOM   1887  H  HE2  . PHE A 1 122 ? 7.251   17.544 6.829   1.00 0.00  ? 122 PHE A HE2  1  
ATOM   1888  H  HZ   . PHE A 1 122 ? 9.630   17.291 7.472   1.00 0.00  ? 122 PHE A HZ   1  
ATOM   1889  N  N    . GLY A 1 123 ? 4.341   20.545 13.159  1.00 0.00  ? 123 GLY A N    1  
ATOM   1890  C  CA   . GLY A 1 123 ? 3.088   21.324 13.350  1.00 0.00  ? 123 GLY A CA   1  
ATOM   1891  C  C    . GLY A 1 123 ? 3.455   22.731 13.830  1.00 0.00  ? 123 GLY A C    1  
ATOM   1892  O  O    . GLY A 1 123 ? 2.899   23.718 13.390  1.00 0.00  ? 123 GLY A O    1  
ATOM   1893  H  H    . GLY A 1 123 ? 4.754   20.094 13.926  1.00 0.00  ? 123 GLY A H    1  
ATOM   1894  H  HA2  . GLY A 1 123 ? 2.550   21.381 12.413  1.00 0.00  ? 123 GLY A HA2  1  
ATOM   1895  H  HA3  . GLY A 1 123 ? 2.475   20.842 14.094  1.00 0.00  ? 123 GLY A HA3  1  
ATOM   1896  N  N    . HIS A 1 124 ? 4.398   22.827 14.731  1.00 0.00  ? 124 HIS A N    1  
ATOM   1897  C  CA   . HIS A 1 124 ? 4.816   24.163 15.242  1.00 0.00  ? 124 HIS A CA   1  
ATOM   1898  C  C    . HIS A 1 124 ? 5.413   24.980 14.097  1.00 0.00  ? 124 HIS A C    1  
ATOM   1899  O  O    . HIS A 1 124 ? 5.050   26.119 13.883  1.00 0.00  ? 124 HIS A O    1  
ATOM   1900  C  CB   . HIS A 1 124 ? 5.872   23.982 16.329  1.00 0.00  ? 124 HIS A CB   1  
ATOM   1901  C  CG   . HIS A 1 124 ? 5.215   23.996 17.680  1.00 0.00  ? 124 HIS A CG   1  
ATOM   1902  N  ND1  . HIS A 1 124 ? 5.049   25.162 18.411  1.00 0.00  ? 124 HIS A ND1  1  
ATOM   1903  C  CD2  . HIS A 1 124 ? 4.697   22.990 18.459  1.00 0.00  ? 124 HIS A CD2  1  
ATOM   1904  C  CE1  . HIS A 1 124 ? 4.457   24.832 19.574  1.00 0.00  ? 124 HIS A CE1  1  
ATOM   1905  N  NE2  . HIS A 1 124 ? 4.221   23.519 19.655  1.00 0.00  ? 124 HIS A NE2  1  
ATOM   1906  H  H    . HIS A 1 124 ? 4.834   22.017 15.069  1.00 0.00  ? 124 HIS A H    1  
ATOM   1907  H  HA   . HIS A 1 124 ? 3.961   24.679 15.651  1.00 0.00  ? 124 HIS A HA   1  
ATOM   1908  H  HB2  . HIS A 1 124 ? 6.377   23.038 16.183  1.00 0.00  ? 124 HIS A HB2  1  
ATOM   1909  H  HB3  . HIS A 1 124 ? 6.590   24.786 16.271  1.00 0.00  ? 124 HIS A HB3  1  
ATOM   1910  H  HD1  . HIS A 1 124 ? 5.313   26.064 18.132  1.00 0.00  ? 124 HIS A HD1  1  
ATOM   1911  H  HD2  . HIS A 1 124 ? 4.663   21.946 18.184  1.00 0.00  ? 124 HIS A HD2  1  
ATOM   1912  H  HE1  . HIS A 1 124 ? 4.208   25.542 20.350  1.00 0.00  ? 124 HIS A HE1  1  
ATOM   1913  N  N    . ALA A 1 125 ? 6.324   24.403 13.355  1.00 0.00  ? 125 ALA A N    1  
ATOM   1914  C  CA   . ALA A 1 125 ? 6.944   25.143 12.215  1.00 0.00  ? 125 ALA A CA   1  
ATOM   1915  C  C    . ALA A 1 125 ? 5.864   25.923 11.465  1.00 0.00  ? 125 ALA A C    1  
ATOM   1916  O  O    . ALA A 1 125 ? 6.134   26.928 10.837  1.00 0.00  ? 125 ALA A O    1  
ATOM   1917  C  CB   . ALA A 1 125 ? 7.596   24.144 11.258  1.00 0.00  ? 125 ALA A CB   1  
ATOM   1918  H  H    . ALA A 1 125 ? 6.599   23.481 13.548  1.00 0.00  ? 125 ALA A H    1  
ATOM   1919  H  HA   . ALA A 1 125 ? 7.693   25.828 12.585  1.00 0.00  ? 125 ALA A HA   1  
ATOM   1920  H  HB1  . ALA A 1 125 ? 6.830   23.643 10.685  1.00 0.00  ? 125 ALA A HB1  1  
ATOM   1921  H  HB2  . ALA A 1 125 ? 8.157   23.417 11.824  1.00 0.00  ? 125 ALA A HB2  1  
ATOM   1922  H  HB3  . ALA A 1 125 ? 8.260   24.670 10.588  1.00 0.00  ? 125 ALA A HB3  1  
ATOM   1923  N  N    . MET A 1 126 ? 4.640   25.467 11.522  1.00 0.00  ? 126 MET A N    1  
ATOM   1924  C  CA   . MET A 1 126 ? 3.547   26.184 10.808  1.00 0.00  ? 126 MET A CA   1  
ATOM   1925  C  C    . MET A 1 126 ? 3.106   27.407 11.621  1.00 0.00  ? 126 MET A C    1  
ATOM   1926  O  O    . MET A 1 126 ? 3.701   28.463 11.539  1.00 0.00  ? 126 MET A O    1  
ATOM   1927  C  CB   . MET A 1 126 ? 2.359   25.242 10.615  1.00 0.00  ? 126 MET A CB   1  
ATOM   1928  C  CG   . MET A 1 126 ? 2.710   24.190 9.563   1.00 0.00  ? 126 MET A CG   1  
ATOM   1929  S  SD   . MET A 1 126 ? 2.487   24.896 7.910   1.00 0.00  ? 126 MET A SD   1  
ATOM   1930  C  CE   . MET A 1 126 ? 4.238   25.019 7.466   1.00 0.00  ? 126 MET A CE   1  
ATOM   1931  H  H    . MET A 1 126 ? 4.443   24.651 12.028  1.00 0.00  ? 126 MET A H    1  
ATOM   1932  H  HA   . MET A 1 126 ? 3.906   26.509 9.844   1.00 0.00  ? 126 MET A HA   1  
ATOM   1933  H  HB2  . MET A 1 126 ? 2.131   24.753 11.552  1.00 0.00  ? 126 MET A HB2  1  
ATOM   1934  H  HB3  . MET A 1 126 ? 1.500   25.806 10.284  1.00 0.00  ? 126 MET A HB3  1  
ATOM   1935  H  HG2  . MET A 1 126 ? 3.738   23.883 9.688   1.00 0.00  ? 126 MET A HG2  1  
ATOM   1936  H  HG3  . MET A 1 126 ? 2.062   23.335 9.680   1.00 0.00  ? 126 MET A HG3  1  
ATOM   1937  H  HE1  . MET A 1 126 ? 4.783   24.204 7.922   1.00 0.00  ? 126 MET A HE1  1  
ATOM   1938  H  HE2  . MET A 1 126 ? 4.637   25.957 7.819   1.00 0.00  ? 126 MET A HE2  1  
ATOM   1939  H  HE3  . MET A 1 126 ? 4.340   24.970 6.391   1.00 0.00  ? 126 MET A HE3  1  
ATOM   1940  N  N    . GLY A 1 127 ? 2.065   27.280 12.401  1.00 0.00  ? 127 GLY A N    1  
ATOM   1941  C  CA   . GLY A 1 127 ? 1.597   28.448 13.202  1.00 0.00  ? 127 GLY A CA   1  
ATOM   1942  C  C    . GLY A 1 127 ? 0.771   27.972 14.401  1.00 0.00  ? 127 GLY A C    1  
ATOM   1943  O  O    . GLY A 1 127 ? 0.815   28.557 15.466  1.00 0.00  ? 127 GLY A O    1  
ATOM   1944  H  H    . GLY A 1 127 ? 1.590   26.425 12.456  1.00 0.00  ? 127 GLY A H    1  
ATOM   1945  H  HA2  . GLY A 1 127 ? 2.453   29.004 13.554  1.00 0.00  ? 127 GLY A HA2  1  
ATOM   1946  H  HA3  . GLY A 1 127 ? 0.986   29.086 12.582  1.00 0.00  ? 127 GLY A HA3  1  
ATOM   1947  N  N    . LEU A 1 128 ? 0.012   26.923 14.242  1.00 0.00  ? 128 LEU A N    1  
ATOM   1948  C  CA   . LEU A 1 128 ? -0.813  26.431 15.381  1.00 0.00  ? 128 LEU A CA   1  
ATOM   1949  C  C    . LEU A 1 128 ? 0.040   26.383 16.648  1.00 0.00  ? 128 LEU A C    1  
ATOM   1950  O  O    . LEU A 1 128 ? 1.235   26.163 16.601  1.00 0.00  ? 128 LEU A O    1  
ATOM   1951  C  CB   . LEU A 1 128 ? -1.330  25.025 15.075  1.00 0.00  ? 128 LEU A CB   1  
ATOM   1952  C  CG   . LEU A 1 128 ? -2.832  25.077 14.783  1.00 0.00  ? 128 LEU A CG   1  
ATOM   1953  C  CD1  . LEU A 1 128 ? -3.178  24.033 13.720  1.00 0.00  ? 128 LEU A CD1  1  
ATOM   1954  C  CD2  . LEU A 1 128 ? -3.615  24.773 16.065  1.00 0.00  ? 128 LEU A CD2  1  
ATOM   1955  H  H    . LEU A 1 128 ? -0.020  26.464 13.376  1.00 0.00  ? 128 LEU A H    1  
ATOM   1956  H  HA   . LEU A 1 128 ? -1.650  27.095 15.536  1.00 0.00  ? 128 LEU A HA   1  
ATOM   1957  H  HB2  . LEU A 1 128 ? -0.809  24.631 14.216  1.00 0.00  ? 128 LEU A HB2  1  
ATOM   1958  H  HB3  . LEU A 1 128 ? -1.153  24.387 15.928  1.00 0.00  ? 128 LEU A HB3  1  
ATOM   1959  H  HG   . LEU A 1 128 ? -3.098  26.060 14.422  1.00 0.00  ? 128 LEU A HG   1  
ATOM   1960  H  HD11 . LEU A 1 128 ? -2.297  23.455 13.482  1.00 0.00  ? 128 LEU A HD11 1  
ATOM   1961  H  HD12 . LEU A 1 128 ? -3.534  24.530 12.830  1.00 0.00  ? 128 LEU A HD12 1  
ATOM   1962  H  HD13 . LEU A 1 128 ? -3.947  23.377 14.099  1.00 0.00  ? 128 LEU A HD13 1  
ATOM   1963  H  HD21 . LEU A 1 128 ? -4.663  24.661 15.829  1.00 0.00  ? 128 LEU A HD21 1  
ATOM   1964  H  HD22 . LEU A 1 128 ? -3.490  25.586 16.766  1.00 0.00  ? 128 LEU A HD22 1  
ATOM   1965  H  HD23 . LEU A 1 128 ? -3.245  23.859 16.505  1.00 0.00  ? 128 LEU A HD23 1  
ATOM   1966  N  N    . GLU A 1 129 ? -0.571  26.574 17.779  1.00 0.00  ? 129 GLU A N    1  
ATOM   1967  C  CA   . GLU A 1 129 ? 0.184   26.525 19.059  1.00 0.00  ? 129 GLU A CA   1  
ATOM   1968  C  C    . GLU A 1 129 ? -0.545  25.583 20.014  1.00 0.00  ? 129 GLU A C    1  
ATOM   1969  O  O    . GLU A 1 129 ? -1.698  25.257 19.811  1.00 0.00  ? 129 GLU A O    1  
ATOM   1970  C  CB   . GLU A 1 129 ? 0.260   27.928 19.669  1.00 0.00  ? 129 GLU A CB   1  
ATOM   1971  C  CG   . GLU A 1 129 ? 1.696   28.444 19.573  1.00 0.00  ? 129 GLU A CG   1  
ATOM   1972  C  CD   . GLU A 1 129 ? 1.850   29.294 18.314  1.00 0.00  ? 129 GLU A CD   1  
ATOM   1973  O  OE1  . GLU A 1 129 ? 1.217   30.336 18.243  1.00 0.00  ? 129 GLU A OE1  1  
ATOM   1974  O  OE2  . GLU A 1 129 ? 2.601   28.891 17.442  1.00 0.00  ? 129 GLU A OE2  1  
ATOM   1975  H  H    . GLU A 1 129 ? -1.536  26.737 17.787  1.00 0.00  ? 129 GLU A H    1  
ATOM   1976  H  HA   . GLU A 1 129 ? 1.181   26.154 18.876  1.00 0.00  ? 129 GLU A HA   1  
ATOM   1977  H  HB2  . GLU A 1 129 ? -0.400  28.592 19.129  1.00 0.00  ? 129 GLU A HB2  1  
ATOM   1978  H  HB3  . GLU A 1 129 ? -0.037  27.889 20.707  1.00 0.00  ? 129 GLU A HB3  1  
ATOM   1979  H  HG2  . GLU A 1 129 ? 1.924   29.042 20.443  1.00 0.00  ? 129 GLU A HG2  1  
ATOM   1980  H  HG3  . GLU A 1 129 ? 2.375   27.606 19.523  1.00 0.00  ? 129 GLU A HG3  1  
ATOM   1981  N  N    . HIS A 1 130 ? 0.108   25.136 21.050  1.00 0.00  ? 130 HIS A N    1  
ATOM   1982  C  CA   . HIS A 1 130 ? -0.564  24.212 22.001  1.00 0.00  ? 130 HIS A CA   1  
ATOM   1983  C  C    . HIS A 1 130 ? -1.974  24.730 22.296  1.00 0.00  ? 130 HIS A C    1  
ATOM   1984  O  O    . HIS A 1 130 ? -2.186  25.913 22.474  1.00 0.00  ? 130 HIS A O    1  
ATOM   1985  C  CB   . HIS A 1 130 ? 0.253   24.131 23.291  1.00 0.00  ? 130 HIS A CB   1  
ATOM   1986  C  CG   . HIS A 1 130 ? 1.613   23.576 22.970  1.00 0.00  ? 130 HIS A CG   1  
ATOM   1987  N  ND1  . HIS A 1 130 ? 2.516   23.207 23.954  1.00 0.00  ? 130 HIS A ND1  1  
ATOM   1988  C  CD2  . HIS A 1 130 ? 2.234   23.315 21.774  1.00 0.00  ? 130 HIS A CD2  1  
ATOM   1989  C  CE1  . HIS A 1 130 ? 3.622   22.752 23.338  1.00 0.00  ? 130 HIS A CE1  1  
ATOM   1990  N  NE2  . HIS A 1 130 ? 3.503   22.798 22.008  1.00 0.00  ? 130 HIS A NE2  1  
ATOM   1991  H  H    . HIS A 1 130 ? 1.039   25.406 21.200  1.00 0.00  ? 130 HIS A H    1  
ATOM   1992  H  HA   . HIS A 1 130 ? -0.630  23.230 21.557  1.00 0.00  ? 130 HIS A HA   1  
ATOM   1993  H  HB2  . HIS A 1 130 ? 0.355   25.119 23.717  1.00 0.00  ? 130 HIS A HB2  1  
ATOM   1994  H  HB3  . HIS A 1 130 ? -0.245  23.481 23.995  1.00 0.00  ? 130 HIS A HB3  1  
ATOM   1995  H  HD1  . HIS A 1 130 ? 2.374   23.263 24.922  1.00 0.00  ? 130 HIS A HD1  1  
ATOM   1996  H  HD2  . HIS A 1 130 ? 1.799   23.478 20.798  1.00 0.00  ? 130 HIS A HD2  1  
ATOM   1997  H  HE1  . HIS A 1 130 ? 4.498   22.386 23.855  1.00 0.00  ? 130 HIS A HE1  1  
ATOM   1998  N  N    . SER A 1 131 ? -2.945  23.858 22.331  1.00 0.00  ? 131 SER A N    1  
ATOM   1999  C  CA   . SER A 1 131 ? -4.338  24.316 22.592  1.00 0.00  ? 131 SER A CA   1  
ATOM   2000  C  C    . SER A 1 131 ? -4.823  23.791 23.946  1.00 0.00  ? 131 SER A C    1  
ATOM   2001  O  O    . SER A 1 131 ? -5.991  23.880 24.266  1.00 0.00  ? 131 SER A O    1  
ATOM   2002  C  CB   . SER A 1 131 ? -5.258  23.804 21.483  1.00 0.00  ? 131 SER A CB   1  
ATOM   2003  O  OG   . SER A 1 131 ? -6.550  23.556 22.019  1.00 0.00  ? 131 SER A OG   1  
ATOM   2004  H  H    . SER A 1 131 ? -2.760  22.909 22.171  1.00 0.00  ? 131 SER A H    1  
ATOM   2005  H  HA   . SER A 1 131 ? -4.359  25.396 22.602  1.00 0.00  ? 131 SER A HA   1  
ATOM   2006  H  HB2  . SER A 1 131 ? -5.335  24.545 20.705  1.00 0.00  ? 131 SER A HB2  1  
ATOM   2007  H  HB3  . SER A 1 131 ? -4.849  22.892 21.069  1.00 0.00  ? 131 SER A HB3  1  
ATOM   2008  H  HG   . SER A 1 131 ? -6.955  22.857 21.501  1.00 0.00  ? 131 SER A HG   1  
ATOM   2009  N  N    . GLN A 1 132 ? -3.930  23.264 24.747  1.00 0.00  ? 132 GLN A N    1  
ATOM   2010  C  CA   . GLN A 1 132 ? -4.321  22.749 26.098  1.00 0.00  ? 132 GLN A CA   1  
ATOM   2011  C  C    . GLN A 1 132 ? -4.895  21.330 26.006  1.00 0.00  ? 132 GLN A C    1  
ATOM   2012  O  O    . GLN A 1 132 ? -4.862  20.585 26.964  1.00 0.00  ? 132 GLN A O    1  
ATOM   2013  C  CB   . GLN A 1 132 ? -5.368  23.673 26.725  1.00 0.00  ? 132 GLN A CB   1  
ATOM   2014  C  CG   . GLN A 1 132 ? -4.971  25.133 26.499  1.00 0.00  ? 132 GLN A CG   1  
ATOM   2015  C  CD   . GLN A 1 132 ? -4.771  25.825 27.850  1.00 0.00  ? 132 GLN A CD   1  
ATOM   2016  O  OE1  . GLN A 1 132 ? -3.662  26.158 28.216  1.00 0.00  ? 132 GLN A OE1  1  
ATOM   2017  N  NE2  . GLN A 1 132 ? -5.807  26.059 28.611  1.00 0.00  ? 132 GLN A NE2  1  
ATOM   2018  H  H    . GLN A 1 132 ? -2.993  23.219 24.465  1.00 0.00  ? 132 GLN A H    1  
ATOM   2019  H  HA   . GLN A 1 132 ? -3.446  22.732 26.730  1.00 0.00  ? 132 GLN A HA   1  
ATOM   2020  H  HB2  . GLN A 1 132 ? -6.331  23.486 26.273  1.00 0.00  ? 132 GLN A HB2  1  
ATOM   2021  H  HB3  . GLN A 1 132 ? -5.425  23.478 27.784  1.00 0.00  ? 132 GLN A HB3  1  
ATOM   2022  H  HG2  . GLN A 1 132 ? -4.051  25.172 25.933  1.00 0.00  ? 132 GLN A HG2  1  
ATOM   2023  H  HG3  . GLN A 1 132 ? -5.752  25.638 25.952  1.00 0.00  ? 132 GLN A HG3  1  
ATOM   2024  H  HE21 . GLN A 1 132 ? -6.703  25.794 28.315  1.00 0.00  ? 132 GLN A HE21 1  
ATOM   2025  H  HE22 . GLN A 1 132 ? -5.688  26.503 29.477  1.00 0.00  ? 132 GLN A HE22 1  
ATOM   2026  N  N    . ASP A 1 133 ? -5.429  20.944 24.882  1.00 0.00  ? 133 ASP A N    1  
ATOM   2027  C  CA   . ASP A 1 133 ? -6.004  19.570 24.780  1.00 0.00  ? 133 ASP A CA   1  
ATOM   2028  C  C    . ASP A 1 133 ? -4.881  18.528 24.893  1.00 0.00  ? 133 ASP A C    1  
ATOM   2029  O  O    . ASP A 1 133 ? -3.925  18.567 24.141  1.00 0.00  ? 133 ASP A O    1  
ATOM   2030  C  CB   . ASP A 1 133 ? -6.712  19.410 23.433  1.00 0.00  ? 133 ASP A CB   1  
ATOM   2031  C  CG   . ASP A 1 133 ? -8.224  19.370 23.654  1.00 0.00  ? 133 ASP A CG   1  
ATOM   2032  O  OD1  . ASP A 1 133 ? -8.720  20.216 24.380  1.00 0.00  ? 133 ASP A OD1  1  
ATOM   2033  O  OD2  . ASP A 1 133 ? -8.860  18.493 23.094  1.00 0.00  ? 133 ASP A OD2  1  
ATOM   2034  H  H    . ASP A 1 133 ? -5.460  21.551 24.115  1.00 0.00  ? 133 ASP A H    1  
ATOM   2035  H  HA   . ASP A 1 133 ? -6.717  19.428 25.576  1.00 0.00  ? 133 ASP A HA   1  
ATOM   2036  H  HB2  . ASP A 1 133 ? -6.461  20.242 22.791  1.00 0.00  ? 133 ASP A HB2  1  
ATOM   2037  H  HB3  . ASP A 1 133 ? -6.396  18.488 22.971  1.00 0.00  ? 133 ASP A HB3  1  
ATOM   2038  N  N    . PRO A 1 134 ? -5.027  17.619 25.827  1.00 0.00  ? 134 PRO A N    1  
ATOM   2039  C  CA   . PRO A 1 134 ? -4.027  16.561 26.058  1.00 0.00  ? 134 PRO A CA   1  
ATOM   2040  C  C    . PRO A 1 134 ? -4.073  15.527 24.938  1.00 0.00  ? 134 PRO A C    1  
ATOM   2041  O  O    . PRO A 1 134 ? -3.060  15.003 24.520  1.00 0.00  ? 134 PRO A O    1  
ATOM   2042  C  CB   . PRO A 1 134 ? -4.446  15.950 27.397  1.00 0.00  ? 134 PRO A CB   1  
ATOM   2043  C  CG   . PRO A 1 134 ? -5.939  16.303 27.590  1.00 0.00  ? 134 PRO A CG   1  
ATOM   2044  C  CD   . PRO A 1 134 ? -6.202  17.548 26.723  1.00 0.00  ? 134 PRO A CD   1  
ATOM   2045  H  HA   . PRO A 1 134 ? -3.042  16.984 26.141  1.00 0.00  ? 134 PRO A HA   1  
ATOM   2046  H  HB2  . PRO A 1 134 ? -4.317  14.876 27.368  1.00 0.00  ? 134 PRO A HB2  1  
ATOM   2047  H  HB3  . PRO A 1 134 ? -3.865  16.376 28.198  1.00 0.00  ? 134 PRO A HB3  1  
ATOM   2048  H  HG2  . PRO A 1 134 ? -6.560  15.480 27.263  1.00 0.00  ? 134 PRO A HG2  1  
ATOM   2049  H  HG3  . PRO A 1 134 ? -6.137  16.531 28.625  1.00 0.00  ? 134 PRO A HG3  1  
ATOM   2050  H  HD2  . PRO A 1 134 ? -7.113  17.425 26.153  1.00 0.00  ? 134 PRO A HD2  1  
ATOM   2051  H  HD3  . PRO A 1 134 ? -6.256  18.432 27.338  1.00 0.00  ? 134 PRO A HD3  1  
ATOM   2052  N  N    . GLY A 1 135 ? -5.237  15.236 24.444  1.00 0.00  ? 135 GLY A N    1  
ATOM   2053  C  CA   . GLY A 1 135 ? -5.346  14.241 23.343  1.00 0.00  ? 135 GLY A CA   1  
ATOM   2054  C  C    . GLY A 1 135 ? -5.026  14.916 22.005  1.00 0.00  ? 135 GLY A C    1  
ATOM   2055  O  O    . GLY A 1 135 ? -5.250  14.353 20.952  1.00 0.00  ? 135 GLY A O    1  
ATOM   2056  H  H    . GLY A 1 135 ? -6.039  15.674 24.795  1.00 0.00  ? 135 GLY A H    1  
ATOM   2057  H  HA2  . GLY A 1 135 ? -4.648  13.434 23.519  1.00 0.00  ? 135 GLY A HA2  1  
ATOM   2058  H  HA3  . GLY A 1 135 ? -6.350  13.849 23.313  1.00 0.00  ? 135 GLY A HA3  1  
ATOM   2059  N  N    . ALA A 1 136 ? -4.510  16.120 22.030  1.00 0.00  ? 136 ALA A N    1  
ATOM   2060  C  CA   . ALA A 1 136 ? -4.187  16.817 20.751  1.00 0.00  ? 136 ALA A CA   1  
ATOM   2061  C  C    . ALA A 1 136 ? -2.737  16.539 20.358  1.00 0.00  ? 136 ALA A C    1  
ATOM   2062  O  O    . ALA A 1 136 ? -1.987  15.933 21.097  1.00 0.00  ? 136 ALA A O    1  
ATOM   2063  C  CB   . ALA A 1 136 ? -4.365  18.325 20.932  1.00 0.00  ? 136 ALA A CB   1  
ATOM   2064  H  H    . ALA A 1 136 ? -4.339  16.568 22.888  1.00 0.00  ? 136 ALA A H    1  
ATOM   2065  H  HA   . ALA A 1 136 ? -4.848  16.466 19.971  1.00 0.00  ? 136 ALA A HA   1  
ATOM   2066  H  HB1  . ALA A 1 136 ? -5.242  18.516 21.529  1.00 0.00  ? 136 ALA A HB1  1  
ATOM   2067  H  HB2  . ALA A 1 136 ? -4.478  18.793 19.966  1.00 0.00  ? 136 ALA A HB2  1  
ATOM   2068  H  HB3  . ALA A 1 136 ? -3.495  18.732 21.429  1.00 0.00  ? 136 ALA A HB3  1  
ATOM   2069  N  N    . LEU A 1 137 ? -2.335  16.995 19.203  1.00 0.00  ? 137 LEU A N    1  
ATOM   2070  C  CA   . LEU A 1 137 ? -0.929  16.780 18.760  1.00 0.00  ? 137 LEU A CA   1  
ATOM   2071  C  C    . LEU A 1 137 ? -0.076  17.936 19.284  1.00 0.00  ? 137 LEU A C    1  
ATOM   2072  O  O    . LEU A 1 137 ? 1.064   17.759 19.667  1.00 0.00  ? 137 LEU A O    1  
ATOM   2073  C  CB   . LEU A 1 137 ? -0.880  16.748 17.228  1.00 0.00  ? 137 LEU A CB   1  
ATOM   2074  C  CG   . LEU A 1 137 ? 0.571   16.680 16.737  1.00 0.00  ? 137 LEU A CG   1  
ATOM   2075  C  CD1  . LEU A 1 137 ? 1.312   15.537 17.434  1.00 0.00  ? 137 LEU A CD1  1  
ATOM   2076  C  CD2  . LEU A 1 137 ? 0.572   16.434 15.226  1.00 0.00  ? 137 LEU A CD2  1  
ATOM   2077  H  H    . LEU A 1 137 ? -2.957  17.490 18.630  1.00 0.00  ? 137 LEU A H    1  
ATOM   2078  H  HA   . LEU A 1 137 ? -0.564  15.846 19.161  1.00 0.00  ? 137 LEU A HA   1  
ATOM   2079  H  HB2  . LEU A 1 137 ? -1.419  15.883 16.870  1.00 0.00  ? 137 LEU A HB2  1  
ATOM   2080  H  HB3  . LEU A 1 137 ? -1.343  17.642 16.839  1.00 0.00  ? 137 LEU A HB3  1  
ATOM   2081  H  HG   . LEU A 1 137 ? 1.069   17.614 16.951  1.00 0.00  ? 137 LEU A HG   1  
ATOM   2082  H  HD11 . LEU A 1 137 ? 1.682   14.845 16.692  1.00 0.00  ? 137 LEU A HD11 1  
ATOM   2083  H  HD12 . LEU A 1 137 ? 0.641   15.025 18.099  1.00 0.00  ? 137 LEU A HD12 1  
ATOM   2084  H  HD13 . LEU A 1 137 ? 2.143   15.937 17.997  1.00 0.00  ? 137 LEU A HD13 1  
ATOM   2085  H  HD21 . LEU A 1 137 ? 0.176   17.302 14.719  1.00 0.00  ? 137 LEU A HD21 1  
ATOM   2086  H  HD22 . LEU A 1 137 ? -0.042  15.575 15.001  1.00 0.00  ? 137 LEU A HD22 1  
ATOM   2087  H  HD23 . LEU A 1 137 ? 1.582   16.252 14.892  1.00 0.00  ? 137 LEU A HD23 1  
ATOM   2088  N  N    . MET A 1 138 ? -0.633  19.119 19.322  1.00 0.00  ? 138 MET A N    1  
ATOM   2089  C  CA   . MET A 1 138 ? 0.133   20.284 19.842  1.00 0.00  ? 138 MET A CA   1  
ATOM   2090  C  C    . MET A 1 138 ? 0.024   20.307 21.365  1.00 0.00  ? 138 MET A C    1  
ATOM   2091  O  O    . MET A 1 138 ? 0.456   21.240 22.013  1.00 0.00  ? 138 MET A O    1  
ATOM   2092  C  CB   . MET A 1 138 ? -0.452  21.583 19.285  1.00 0.00  ? 138 MET A CB   1  
ATOM   2093  C  CG   . MET A 1 138 ? -0.335  21.592 17.763  1.00 0.00  ? 138 MET A CG   1  
ATOM   2094  S  SD   . MET A 1 138 ? 0.788   22.915 17.253  1.00 0.00  ? 138 MET A SD   1  
ATOM   2095  C  CE   . MET A 1 138 ? 1.555   22.035 15.874  1.00 0.00  ? 138 MET A CE   1  
ATOM   2096  H  H    . MET A 1 138 ? -1.559  19.234 19.022  1.00 0.00  ? 138 MET A H    1  
ATOM   2097  H  HA   . MET A 1 138 ? 1.169   20.198 19.554  1.00 0.00  ? 138 MET A HA   1  
ATOM   2098  H  HB2  . MET A 1 138 ? -1.493  21.655 19.565  1.00 0.00  ? 138 MET A HB2  1  
ATOM   2099  H  HB3  . MET A 1 138 ? 0.089   22.425 19.690  1.00 0.00  ? 138 MET A HB3  1  
ATOM   2100  H  HG2  . MET A 1 138 ? 0.050   20.642 17.425  1.00 0.00  ? 138 MET A HG2  1  
ATOM   2101  H  HG3  . MET A 1 138 ? -1.310  21.759 17.330  1.00 0.00  ? 138 MET A HG3  1  
ATOM   2102  H  HE1  . MET A 1 138 ? 1.224   21.005 15.875  1.00 0.00  ? 138 MET A HE1  1  
ATOM   2103  H  HE2  . MET A 1 138 ? 2.628   22.065 15.977  1.00 0.00  ? 138 MET A HE2  1  
ATOM   2104  H  HE3  . MET A 1 138 ? 1.272   22.509 14.944  1.00 0.00  ? 138 MET A HE3  1  
ATOM   2105  N  N    . ALA A 1 139 ? -0.553  19.287 21.943  1.00 0.00  ? 139 ALA A N    1  
ATOM   2106  C  CA   . ALA A 1 139 ? -0.691  19.253 23.425  1.00 0.00  ? 139 ALA A CA   1  
ATOM   2107  C  C    . ALA A 1 139 ? 0.690   19.423 24.072  1.00 0.00  ? 139 ALA A C    1  
ATOM   2108  O  O    . ALA A 1 139 ? 1.699   19.125 23.463  1.00 0.00  ? 139 ALA A O    1  
ATOM   2109  C  CB   . ALA A 1 139 ? -1.301  17.917 23.850  1.00 0.00  ? 139 ALA A CB   1  
ATOM   2110  H  H    . ALA A 1 139 ? -0.900  18.545 21.402  1.00 0.00  ? 139 ALA A H    1  
ATOM   2111  H  HA   . ALA A 1 139 ? -1.335  20.059 23.742  1.00 0.00  ? 139 ALA A HA   1  
ATOM   2112  H  HB1  . ALA A 1 139 ? -1.607  17.974 24.884  1.00 0.00  ? 139 ALA A HB1  1  
ATOM   2113  H  HB2  . ALA A 1 139 ? -0.567  17.134 23.734  1.00 0.00  ? 139 ALA A HB2  1  
ATOM   2114  H  HB3  . ALA A 1 139 ? -2.160  17.700 23.232  1.00 0.00  ? 139 ALA A HB3  1  
ATOM   2115  N  N    . PRO A 1 140 ? 0.688   19.919 25.285  1.00 0.00  ? 140 PRO A N    1  
ATOM   2116  C  CA   . PRO A 1 140 ? 1.923   20.169 26.050  1.00 0.00  ? 140 PRO A CA   1  
ATOM   2117  C  C    . PRO A 1 140 ? 2.492   18.886 26.670  1.00 0.00  ? 140 PRO A C    1  
ATOM   2118  O  O    . PRO A 1 140 ? 3.257   18.941 27.611  1.00 0.00  ? 140 PRO A O    1  
ATOM   2119  C  CB   . PRO A 1 140 ? 1.475   21.142 27.143  1.00 0.00  ? 140 PRO A CB   1  
ATOM   2120  C  CG   . PRO A 1 140 ? -0.054  20.956 27.297  1.00 0.00  ? 140 PRO A CG   1  
ATOM   2121  C  CD   . PRO A 1 140 ? -0.550  20.282 26.004  1.00 0.00  ? 140 PRO A CD   1  
ATOM   2122  H  HA   . PRO A 1 140 ? 2.662   20.643 25.426  1.00 0.00  ? 140 PRO A HA   1  
ATOM   2123  H  HB2  . PRO A 1 140 ? 1.976   20.908 28.073  1.00 0.00  ? 140 PRO A HB2  1  
ATOM   2124  H  HB3  . PRO A 1 140 ? 1.690   22.157 26.849  1.00 0.00  ? 140 PRO A HB3  1  
ATOM   2125  H  HG2  . PRO A 1 140 ? -0.265  20.328 28.151  1.00 0.00  ? 140 PRO A HG2  1  
ATOM   2126  H  HG3  . PRO A 1 140 ? -0.533  21.915 27.414  1.00 0.00  ? 140 PRO A HG3  1  
ATOM   2127  H  HD2  . PRO A 1 140 ? -1.128  19.400 26.239  1.00 0.00  ? 140 PRO A HD2  1  
ATOM   2128  H  HD3  . PRO A 1 140 ? -1.133  20.974 25.416  1.00 0.00  ? 140 PRO A HD3  1  
ATOM   2129  N  N    . ILE A 1 141 ? 2.153   17.734 26.155  1.00 0.00  ? 141 ILE A N    1  
ATOM   2130  C  CA   . ILE A 1 141 ? 2.721   16.485 26.744  1.00 0.00  ? 141 ILE A CA   1  
ATOM   2131  C  C    . ILE A 1 141 ? 3.190   15.558 25.622  1.00 0.00  ? 141 ILE A C    1  
ATOM   2132  O  O    . ILE A 1 141 ? 2.500   15.342 24.647  1.00 0.00  ? 141 ILE A O    1  
ATOM   2133  C  CB   . ILE A 1 141 ? 1.685   15.754 27.609  1.00 0.00  ? 141 ILE A CB   1  
ATOM   2134  C  CG1  . ILE A 1 141 ? 0.457   16.638 27.850  1.00 0.00  ? 141 ILE A CG1  1  
ATOM   2135  C  CG2  . ILE A 1 141 ? 2.313   15.404 28.961  1.00 0.00  ? 141 ILE A CG2  1  
ATOM   2136  C  CD1  . ILE A 1 141 ? -0.591  16.369 26.769  1.00 0.00  ? 141 ILE A CD1  1  
ATOM   2137  H  H    . ILE A 1 141 ? 1.546   17.690 25.387  1.00 0.00  ? 141 ILE A H    1  
ATOM   2138  H  HA   . ILE A 1 141 ? 3.572   16.747 27.357  1.00 0.00  ? 141 ILE A HA   1  
ATOM   2139  H  HB   . ILE A 1 141 ? 1.388   14.845 27.108  1.00 0.00  ? 141 ILE A HB   1  
ATOM   2140  H  HG12 . ILE A 1 141 ? 0.039   16.408 28.820  1.00 0.00  ? 141 ILE A HG12 1  
ATOM   2141  H  HG13 . ILE A 1 141 ? 0.744   17.680 27.823  1.00 0.00  ? 141 ILE A HG13 1  
ATOM   2142  H  HG21 . ILE A 1 141 ? 2.131   16.208 29.660  1.00 0.00  ? 141 ILE A HG21 1  
ATOM   2143  H  HG22 . ILE A 1 141 ? 3.377   15.265 28.840  1.00 0.00  ? 141 ILE A HG22 1  
ATOM   2144  H  HG23 . ILE A 1 141 ? 1.870   14.493 29.338  1.00 0.00  ? 141 ILE A HG23 1  
ATOM   2145  H  HD11 . ILE A 1 141 ? -1.089  15.433 26.978  1.00 0.00  ? 141 ILE A HD11 1  
ATOM   2146  H  HD12 . ILE A 1 141 ? -0.108  16.313 25.806  1.00 0.00  ? 141 ILE A HD12 1  
ATOM   2147  H  HD13 . ILE A 1 141 ? -1.314  17.169 26.764  1.00 0.00  ? 141 ILE A HD13 1  
ATOM   2148  N  N    . TYR A 1 142 ? 4.368   15.017 25.758  1.00 0.00  ? 142 TYR A N    1  
ATOM   2149  C  CA   . TYR A 1 142 ? 4.912   14.107 24.707  1.00 0.00  ? 142 TYR A CA   1  
ATOM   2150  C  C    . TYR A 1 142 ? 4.190   12.761 24.752  1.00 0.00  ? 142 TYR A C    1  
ATOM   2151  O  O    . TYR A 1 142 ? 4.190   12.079 25.755  1.00 0.00  ? 142 TYR A O    1  
ATOM   2152  C  CB   . TYR A 1 142 ? 6.411   13.896 24.945  1.00 0.00  ? 142 TYR A CB   1  
ATOM   2153  C  CG   . TYR A 1 142 ? 7.002   13.084 23.814  1.00 0.00  ? 142 TYR A CG   1  
ATOM   2154  C  CD1  . TYR A 1 142 ? 7.250   13.680 22.570  1.00 0.00  ? 142 TYR A CD1  1  
ATOM   2155  C  CD2  . TYR A 1 142 ? 7.306   11.733 24.011  1.00 0.00  ? 142 TYR A CD2  1  
ATOM   2156  C  CE1  . TYR A 1 142 ? 7.800   12.922 21.527  1.00 0.00  ? 142 TYR A CE1  1  
ATOM   2157  C  CE2  . TYR A 1 142 ? 7.856   10.976 22.970  1.00 0.00  ? 142 TYR A CE2  1  
ATOM   2158  C  CZ   . TYR A 1 142 ? 8.103   11.569 21.728  1.00 0.00  ? 142 TYR A CZ   1  
ATOM   2159  O  OH   . TYR A 1 142 ? 8.647   10.821 20.703  1.00 0.00  ? 142 TYR A OH   1  
ATOM   2160  H  H    . TYR A 1 142 ? 4.901   15.215 26.555  1.00 0.00  ? 142 TYR A H    1  
ATOM   2161  H  HA   . TYR A 1 142 ? 4.767   14.554 23.738  1.00 0.00  ? 142 TYR A HA   1  
ATOM   2162  H  HB2  . TYR A 1 142 ? 6.903   14.856 24.994  1.00 0.00  ? 142 TYR A HB2  1  
ATOM   2163  H  HB3  . TYR A 1 142 ? 6.557   13.370 25.877  1.00 0.00  ? 142 TYR A HB3  1  
ATOM   2164  H  HD1  . TYR A 1 142 ? 7.016   14.724 22.414  1.00 0.00  ? 142 TYR A HD1  1  
ATOM   2165  H  HD2  . TYR A 1 142 ? 7.117   11.273 24.968  1.00 0.00  ? 142 TYR A HD2  1  
ATOM   2166  H  HE1  . TYR A 1 142 ? 7.989   13.381 20.567  1.00 0.00  ? 142 TYR A HE1  1  
ATOM   2167  H  HE2  . TYR A 1 142 ? 8.088   9.933  23.125  1.00 0.00  ? 142 TYR A HE2  1  
ATOM   2168  H  HH   . TYR A 1 142 ? 7.929   10.377 20.245  1.00 0.00  ? 142 TYR A HH   1  
ATOM   2169  N  N    . THR A 1 143 ? 3.581   12.371 23.664  1.00 0.00  ? 143 THR A N    1  
ATOM   2170  C  CA   . THR A 1 143 ? 2.865   11.066 23.631  1.00 0.00  ? 143 THR A CA   1  
ATOM   2171  C  C    . THR A 1 143 ? 3.403   10.235 22.467  1.00 0.00  ? 143 THR A C    1  
ATOM   2172  O  O    . THR A 1 143 ? 3.200   10.563 21.315  1.00 0.00  ? 143 THR A O    1  
ATOM   2173  C  CB   . THR A 1 143 ? 1.367   11.303 23.436  1.00 0.00  ? 143 THR A CB   1  
ATOM   2174  O  OG1  . THR A 1 143 ? 0.861   12.053 24.531  1.00 0.00  ? 143 THR A OG1  1  
ATOM   2175  C  CG2  . THR A 1 143 ? 0.644   9.957  23.357  1.00 0.00  ? 143 THR A CG2  1  
ATOM   2176  H  H    . THR A 1 143 ? 3.602   12.936 22.863  1.00 0.00  ? 143 THR A H    1  
ATOM   2177  H  HA   . THR A 1 143 ? 3.030   10.541 24.559  1.00 0.00  ? 143 THR A HA   1  
ATOM   2178  H  HB   . THR A 1 143 ? 1.205   11.847 22.518  1.00 0.00  ? 143 THR A HB   1  
ATOM   2179  H  HG1  . THR A 1 143 ? 0.742   11.455 25.271  1.00 0.00  ? 143 THR A HG1  1  
ATOM   2180  H  HG21 . THR A 1 143 ? 0.931   9.347  24.200  1.00 0.00  ? 143 THR A HG21 1  
ATOM   2181  H  HG22 . THR A 1 143 ? 0.916   9.455  22.440  1.00 0.00  ? 143 THR A HG22 1  
ATOM   2182  H  HG23 . THR A 1 143 ? -0.423  10.119 23.376  1.00 0.00  ? 143 THR A HG23 1  
ATOM   2183  N  N    . TYR A 1 144 ? 4.096   9.168  22.751  1.00 0.00  ? 144 TYR A N    1  
ATOM   2184  C  CA   . TYR A 1 144 ? 4.653   8.334  21.653  1.00 0.00  ? 144 TYR A CA   1  
ATOM   2185  C  C    . TYR A 1 144 ? 3.526   7.807  20.767  1.00 0.00  ? 144 TYR A C    1  
ATOM   2186  O  O    . TYR A 1 144 ? 2.375   7.765  21.157  1.00 0.00  ? 144 TYR A O    1  
ATOM   2187  C  CB   . TYR A 1 144 ? 5.418   7.149  22.233  1.00 0.00  ? 144 TYR A CB   1  
ATOM   2188  C  CG   . TYR A 1 144 ? 6.126   6.428  21.114  1.00 0.00  ? 144 TYR A CG   1  
ATOM   2189  C  CD1  . TYR A 1 144 ? 7.316   6.947  20.589  1.00 0.00  ? 144 TYR A CD1  1  
ATOM   2190  C  CD2  . TYR A 1 144 ? 5.587   5.247  20.591  1.00 0.00  ? 144 TYR A CD2  1  
ATOM   2191  C  CE1  . TYR A 1 144 ? 7.967   6.284  19.542  1.00 0.00  ? 144 TYR A CE1  1  
ATOM   2192  C  CE2  . TYR A 1 144 ? 6.239   4.583  19.545  1.00 0.00  ? 144 TYR A CE2  1  
ATOM   2193  C  CZ   . TYR A 1 144 ? 7.428   5.102  19.020  1.00 0.00  ? 144 TYR A CZ   1  
ATOM   2194  O  OH   . TYR A 1 144 ? 8.070   4.450  17.986  1.00 0.00  ? 144 TYR A OH   1  
ATOM   2195  H  H    . TYR A 1 144 ? 4.258   8.921  23.685  1.00 0.00  ? 144 TYR A H    1  
ATOM   2196  H  HA   . TYR A 1 144 ? 5.324   8.933  21.056  1.00 0.00  ? 144 TYR A HA   1  
ATOM   2197  H  HB2  . TYR A 1 144 ? 6.140   7.501  22.952  1.00 0.00  ? 144 TYR A HB2  1  
ATOM   2198  H  HB3  . TYR A 1 144 ? 4.725   6.475  22.711  1.00 0.00  ? 144 TYR A HB3  1  
ATOM   2199  H  HD1  . TYR A 1 144 ? 7.732   7.858  20.993  1.00 0.00  ? 144 TYR A HD1  1  
ATOM   2200  H  HD2  . TYR A 1 144 ? 4.670   4.847  20.997  1.00 0.00  ? 144 TYR A HD2  1  
ATOM   2201  H  HE1  . TYR A 1 144 ? 8.884   6.684  19.137  1.00 0.00  ? 144 TYR A HE1  1  
ATOM   2202  H  HE2  . TYR A 1 144 ? 5.822   3.673  19.141  1.00 0.00  ? 144 TYR A HE2  1  
ATOM   2203  H  HH   . TYR A 1 144 ? 8.379   5.111  17.364  1.00 0.00  ? 144 TYR A HH   1  
ATOM   2204  N  N    . THR A 1 145 ? 3.858   7.406  19.575  1.00 0.00  ? 145 THR A N    1  
ATOM   2205  C  CA   . THR A 1 145 ? 2.824   6.875  18.644  1.00 0.00  ? 145 THR A CA   1  
ATOM   2206  C  C    . THR A 1 145 ? 2.831   5.345  18.652  1.00 0.00  ? 145 THR A C    1  
ATOM   2207  O  O    . THR A 1 145 ? 3.406   4.719  17.784  1.00 0.00  ? 145 THR A O    1  
ATOM   2208  C  CB   . THR A 1 145 ? 3.131   7.355  17.228  1.00 0.00  ? 145 THR A CB   1  
ATOM   2209  O  OG1  . THR A 1 145 ? 4.534   7.314  17.011  1.00 0.00  ? 145 THR A OG1  1  
ATOM   2210  C  CG2  . THR A 1 145 ? 2.630   8.782  17.056  1.00 0.00  ? 145 THR A CG2  1  
ATOM   2211  H  H    . THR A 1 145 ? 4.793   7.459  19.290  1.00 0.00  ? 145 THR A H    1  
ATOM   2212  H  HA   . THR A 1 145 ? 1.850   7.234  18.941  1.00 0.00  ? 145 THR A HA   1  
ATOM   2213  H  HB   . THR A 1 145 ? 2.636   6.715  16.514  1.00 0.00  ? 145 THR A HB   1  
ATOM   2214  H  HG1  . THR A 1 145 ? 4.902   8.156  17.293  1.00 0.00  ? 145 THR A HG1  1  
ATOM   2215  H  HG21 . THR A 1 145 ? 3.333   9.337  16.454  1.00 0.00  ? 145 THR A HG21 1  
ATOM   2216  H  HG22 . THR A 1 145 ? 2.538   9.247  18.027  1.00 0.00  ? 145 THR A HG22 1  
ATOM   2217  H  HG23 . THR A 1 145 ? 1.667   8.767  16.569  1.00 0.00  ? 145 THR A HG23 1  
ATOM   2218  N  N    . LYS A 1 146 ? 2.174   4.730  19.597  1.00 0.00  ? 146 LYS A N    1  
ATOM   2219  C  CA   . LYS A 1 146 ? 2.136   3.243  19.603  1.00 0.00  ? 146 LYS A CA   1  
ATOM   2220  C  C    . LYS A 1 146 ? 1.186   2.782  18.492  1.00 0.00  ? 146 LYS A C    1  
ATOM   2221  O  O    . LYS A 1 146 ? 1.026   1.604  18.245  1.00 0.00  ? 146 LYS A O    1  
ATOM   2222  C  CB   . LYS A 1 146 ? 1.632   2.737  20.956  1.00 0.00  ? 146 LYS A CB   1  
ATOM   2223  C  CG   . LYS A 1 146 ? 2.679   1.809  21.576  1.00 0.00  ? 146 LYS A CG   1  
ATOM   2224  C  CD   . LYS A 1 146 ? 2.947   2.232  23.021  1.00 0.00  ? 146 LYS A CD   1  
ATOM   2225  C  CE   . LYS A 1 146 ? 1.926   1.564  23.946  1.00 0.00  ? 146 LYS A CE   1  
ATOM   2226  N  NZ   . LYS A 1 146 ? 0.927   2.572  24.391  1.00 0.00  ? 146 LYS A NZ   1  
ATOM   2227  H  H    . LYS A 1 146 ? 1.692   5.241  20.280  1.00 0.00  ? 146 LYS A H    1  
ATOM   2228  H  HA   . LYS A 1 146 ? 3.128   2.855  19.414  1.00 0.00  ? 146 LYS A HA   1  
ATOM   2229  H  HB2  . LYS A 1 146 ? 1.458   3.576  21.613  1.00 0.00  ? 146 LYS A HB2  1  
ATOM   2230  H  HB3  . LYS A 1 146 ? 0.711   2.191  20.815  1.00 0.00  ? 146 LYS A HB3  1  
ATOM   2231  H  HG2  . LYS A 1 146 ? 2.313   0.793  21.560  1.00 0.00  ? 146 LYS A HG2  1  
ATOM   2232  H  HG3  . LYS A 1 146 ? 3.597   1.871  21.009  1.00 0.00  ? 146 LYS A HG3  1  
ATOM   2233  H  HD2  . LYS A 1 146 ? 3.945   1.930  23.305  1.00 0.00  ? 146 LYS A HD2  1  
ATOM   2234  H  HD3  . LYS A 1 146 ? 2.857   3.304  23.104  1.00 0.00  ? 146 LYS A HD3  1  
ATOM   2235  H  HE2  . LYS A 1 146 ? 1.421   0.770  23.414  1.00 0.00  ? 146 LYS A HE2  1  
ATOM   2236  H  HE3  . LYS A 1 146 ? 2.434   1.156  24.807  1.00 0.00  ? 146 LYS A HE3  1  
ATOM   2237  H  HZ1  . LYS A 1 146 ? 0.962   2.661  25.425  1.00 0.00  ? 146 LYS A HZ1  1  
ATOM   2238  H  HZ2  . LYS A 1 146 ? -0.023  2.268  24.099  1.00 0.00  ? 146 LYS A HZ2  1  
ATOM   2239  H  HZ3  . LYS A 1 146 ? 1.146   3.492  23.958  1.00 0.00  ? 146 LYS A HZ3  1  
ATOM   2240  N  N    . ASN A 1 147 ? 0.555   3.715  17.821  1.00 0.00  ? 147 ASN A N    1  
ATOM   2241  C  CA   . ASN A 1 147 ? -0.386  3.353  16.722  1.00 0.00  ? 147 ASN A CA   1  
ATOM   2242  C  C    . ASN A 1 147 ? -0.584  4.571  15.808  1.00 0.00  ? 147 ASN A C    1  
ATOM   2243  O  O    . ASN A 1 147 ? -1.554  4.659  15.083  1.00 0.00  ? 147 ASN A O    1  
ATOM   2244  C  CB   . ASN A 1 147 ? -1.743  2.928  17.304  1.00 0.00  ? 147 ASN A CB   1  
ATOM   2245  C  CG   . ASN A 1 147 ? -1.686  2.905  18.837  1.00 0.00  ? 147 ASN A CG   1  
ATOM   2246  O  OD1  . ASN A 1 147 ? -1.882  3.917  19.480  1.00 0.00  ? 147 ASN A OD1  1  
ATOM   2247  N  ND2  . ASN A 1 147 ? -1.421  1.787  19.452  1.00 0.00  ? 147 ASN A ND2  1  
ATOM   2248  H  H    . ASN A 1 147 ? 0.698   4.655  18.041  1.00 0.00  ? 147 ASN A H    1  
ATOM   2249  H  HA   . ASN A 1 147 ? 0.031   2.538  16.147  1.00 0.00  ? 147 ASN A HA   1  
ATOM   2250  H  HB2  . ASN A 1 147 ? -2.502  3.626  16.985  1.00 0.00  ? 147 ASN A HB2  1  
ATOM   2251  H  HB3  . ASN A 1 147 ? -1.992  1.940  16.944  1.00 0.00  ? 147 ASN A HB3  1  
ATOM   2252  H  HD21 . ASN A 1 147 ? -1.260  0.970  18.936  1.00 0.00  ? 147 ASN A HD21 1  
ATOM   2253  H  HD22 . ASN A 1 147 ? -1.384  1.763  20.431  1.00 0.00  ? 147 ASN A HD22 1  
ATOM   2254  N  N    . PHE A 1 148 ? 0.333   5.509  15.842  1.00 0.00  ? 148 PHE A N    1  
ATOM   2255  C  CA   . PHE A 1 148 ? 0.218   6.732  14.984  1.00 0.00  ? 148 PHE A CA   1  
ATOM   2256  C  C    . PHE A 1 148 ? -1.246  7.167  14.862  1.00 0.00  ? 148 PHE A C    1  
ATOM   2257  O  O    . PHE A 1 148 ? -1.970  6.699  14.005  1.00 0.00  ? 148 PHE A O    1  
ATOM   2258  C  CB   . PHE A 1 148 ? 0.774   6.438  13.587  1.00 0.00  ? 148 PHE A CB   1  
ATOM   2259  C  CG   . PHE A 1 148 ? 0.444   7.587  12.662  1.00 0.00  ? 148 PHE A CG   1  
ATOM   2260  C  CD1  . PHE A 1 148 ? 0.336   8.884  13.176  1.00 0.00  ? 148 PHE A CD1  1  
ATOM   2261  C  CD2  . PHE A 1 148 ? 0.246   7.357  11.293  1.00 0.00  ? 148 PHE A CD2  1  
ATOM   2262  C  CE1  . PHE A 1 148 ? 0.031   9.954  12.325  1.00 0.00  ? 148 PHE A CE1  1  
ATOM   2263  C  CE2  . PHE A 1 148 ? -0.059  8.427  10.441  1.00 0.00  ? 148 PHE A CE2  1  
ATOM   2264  C  CZ   . PHE A 1 148 ? -0.167  9.726  10.957  1.00 0.00  ? 148 PHE A CZ   1  
ATOM   2265  H  H    . PHE A 1 148 ? 1.106   5.408  16.435  1.00 0.00  ? 148 PHE A H    1  
ATOM   2266  H  HA   . PHE A 1 148 ? 0.789   7.532  15.430  1.00 0.00  ? 148 PHE A HA   1  
ATOM   2267  H  HB2  . PHE A 1 148 ? 1.847   6.322  13.646  1.00 0.00  ? 148 PHE A HB2  1  
ATOM   2268  H  HB3  . PHE A 1 148 ? 0.332   5.532  13.205  1.00 0.00  ? 148 PHE A HB3  1  
ATOM   2269  H  HD1  . PHE A 1 148 ? 0.487   9.060  14.231  1.00 0.00  ? 148 PHE A HD1  1  
ATOM   2270  H  HD2  . PHE A 1 148 ? 0.329   6.356  10.895  1.00 0.00  ? 148 PHE A HD2  1  
ATOM   2271  H  HE1  . PHE A 1 148 ? -0.051  10.954 12.725  1.00 0.00  ? 148 PHE A HE1  1  
ATOM   2272  H  HE2  . PHE A 1 148 ? -0.212  8.252  9.386   1.00 0.00  ? 148 PHE A HE2  1  
ATOM   2273  H  HZ   . PHE A 1 148 ? -0.402  10.552 10.300  1.00 0.00  ? 148 PHE A HZ   1  
ATOM   2274  N  N    . ARG A 1 149 ? -1.687  8.068  15.698  1.00 0.00  ? 149 ARG A N    1  
ATOM   2275  C  CA   . ARG A 1 149 ? -3.101  8.532  15.604  1.00 0.00  ? 149 ARG A CA   1  
ATOM   2276  C  C    . ARG A 1 149 ? -3.123  10.034 15.306  1.00 0.00  ? 149 ARG A C    1  
ATOM   2277  O  O    . ARG A 1 149 ? -2.428  10.811 15.928  1.00 0.00  ? 149 ARG A O    1  
ATOM   2278  C  CB   . ARG A 1 149 ? -3.837  8.259  16.916  1.00 0.00  ? 149 ARG A CB   1  
ATOM   2279  C  CG   . ARG A 1 149 ? -2.889  8.470  18.101  1.00 0.00  ? 149 ARG A CG   1  
ATOM   2280  C  CD   . ARG A 1 149 ? -3.673  9.047  19.278  1.00 0.00  ? 149 ARG A CD   1  
ATOM   2281  N  NE   . ARG A 1 149 ? -4.026  7.956  20.232  1.00 0.00  ? 149 ARG A NE   1  
ATOM   2282  C  CZ   . ARG A 1 149 ? -5.016  8.117  21.072  1.00 0.00  ? 149 ARG A CZ   1  
ATOM   2283  N  NH1  . ARG A 1 149 ? -5.689  9.235  21.082  1.00 0.00  ? 149 ARG A NH1  1  
ATOM   2284  N  NH2  . ARG A 1 149 ? -5.333  7.159  21.905  1.00 0.00  ? 149 ARG A NH2  1  
ATOM   2285  H  H    . ARG A 1 149 ? -1.090  8.443  16.377  1.00 0.00  ? 149 ARG A H    1  
ATOM   2286  H  HA   . ARG A 1 149 ? -3.594  8.003  14.801  1.00 0.00  ? 149 ARG A HA   1  
ATOM   2287  H  HB2  . ARG A 1 149 ? -4.674  8.937  17.000  1.00 0.00  ? 149 ARG A HB2  1  
ATOM   2288  H  HB3  . ARG A 1 149 ? -4.197  7.241  16.920  1.00 0.00  ? 149 ARG A HB3  1  
ATOM   2289  H  HG2  . ARG A 1 149 ? -2.451  7.525  18.386  1.00 0.00  ? 149 ARG A HG2  1  
ATOM   2290  H  HG3  . ARG A 1 149 ? -2.110  9.161  17.819  1.00 0.00  ? 149 ARG A HG3  1  
ATOM   2291  H  HD2  . ARG A 1 149 ? -3.071  9.787  19.785  1.00 0.00  ? 149 ARG A HD2  1  
ATOM   2292  H  HD3  . ARG A 1 149 ? -4.577  9.507  18.909  1.00 0.00  ? 149 ARG A HD3  1  
ATOM   2293  H  HE   . ARG A 1 149 ? -3.518  7.118  20.228  1.00 0.00  ? 149 ARG A HE   1  
ATOM   2294  H  HH11 . ARG A 1 149 ? -5.449  9.972  20.452  1.00 0.00  ? 149 ARG A HH11 1  
ATOM   2295  H  HH12 . ARG A 1 149 ? -6.447  9.355  21.723  1.00 0.00  ? 149 ARG A HH12 1  
ATOM   2296  H  HH21 . ARG A 1 149 ? -4.817  6.303  21.903  1.00 0.00  ? 149 ARG A HH21 1  
ATOM   2297  H  HH22 . ARG A 1 149 ? -6.094  7.283  22.543  1.00 0.00  ? 149 ARG A HH22 1  
ATOM   2298  N  N    . LEU A 1 150 ? -3.914  10.443 14.354  1.00 0.00  ? 150 LEU A N    1  
ATOM   2299  C  CA   . LEU A 1 150 ? -3.982  11.893 14.001  1.00 0.00  ? 150 LEU A CA   1  
ATOM   2300  C  C    . LEU A 1 150 ? -5.043  12.589 14.862  1.00 0.00  ? 150 LEU A C    1  
ATOM   2301  O  O    . LEU A 1 150 ? -5.478  12.066 15.870  1.00 0.00  ? 150 LEU A O    1  
ATOM   2302  C  CB   . LEU A 1 150 ? -4.364  12.031 12.524  1.00 0.00  ? 150 LEU A CB   1  
ATOM   2303  C  CG   . LEU A 1 150 ? -3.209  11.562 11.639  1.00 0.00  ? 150 LEU A CG   1  
ATOM   2304  C  CD1  . LEU A 1 150 ? -3.578  11.781 10.169  1.00 0.00  ? 150 LEU A CD1  1  
ATOM   2305  C  CD2  . LEU A 1 150 ? -1.953  12.369 11.973  1.00 0.00  ? 150 LEU A CD2  1  
ATOM   2306  H  H    . LEU A 1 150 ? -4.464  9.794  13.866  1.00 0.00  ? 150 LEU A H    1  
ATOM   2307  H  HA   . LEU A 1 150 ? -3.018  12.351 14.169  1.00 0.00  ? 150 LEU A HA   1  
ATOM   2308  H  HB2  . LEU A 1 150 ? -5.238  11.428 12.324  1.00 0.00  ? 150 LEU A HB2  1  
ATOM   2309  H  HB3  . LEU A 1 150 ? -4.583  13.062 12.302  1.00 0.00  ? 150 LEU A HB3  1  
ATOM   2310  H  HG   . LEU A 1 150 ? -3.024  10.513 11.811  1.00 0.00  ? 150 LEU A HG   1  
ATOM   2311  H  HD11 . LEU A 1 150 ? -3.383  10.878 9.610   1.00 0.00  ? 150 LEU A HD11 1  
ATOM   2312  H  HD12 . LEU A 1 150 ? -2.986  12.589 9.766   1.00 0.00  ? 150 LEU A HD12 1  
ATOM   2313  H  HD13 . LEU A 1 150 ? -4.626  12.032 10.095  1.00 0.00  ? 150 LEU A HD13 1  
ATOM   2314  H  HD21 . LEU A 1 150 ? -2.182  13.424 11.933  1.00 0.00  ? 150 LEU A HD21 1  
ATOM   2315  H  HD22 . LEU A 1 150 ? -1.177  12.141 11.257  1.00 0.00  ? 150 LEU A HD22 1  
ATOM   2316  H  HD23 . LEU A 1 150 ? -1.613  12.112 12.965  1.00 0.00  ? 150 LEU A HD23 1  
ATOM   2317  N  N    . SER A 1 151 ? -5.468  13.763 14.468  1.00 0.00  ? 151 SER A N    1  
ATOM   2318  C  CA   . SER A 1 151 ? -6.506  14.490 15.256  1.00 0.00  ? 151 SER A CA   1  
ATOM   2319  C  C    . SER A 1 151 ? -7.053  15.659 14.432  1.00 0.00  ? 151 SER A C    1  
ATOM   2320  O  O    . SER A 1 151 ? -6.308  16.440 13.872  1.00 0.00  ? 151 SER A O    1  
ATOM   2321  C  CB   . SER A 1 151 ? -5.895  15.027 16.549  1.00 0.00  ? 151 SER A CB   1  
ATOM   2322  O  OG   . SER A 1 151 ? -4.554  15.433 16.304  1.00 0.00  ? 151 SER A OG   1  
ATOM   2323  H  H    . SER A 1 151 ? -5.108  14.165 13.652  1.00 0.00  ? 151 SER A H    1  
ATOM   2324  H  HA   . SER A 1 151 ? -7.313  13.813 15.494  1.00 0.00  ? 151 SER A HA   1  
ATOM   2325  H  HB2  . SER A 1 151 ? -6.466  15.873 16.891  1.00 0.00  ? 151 SER A HB2  1  
ATOM   2326  H  HB3  . SER A 1 151 ? -5.917  14.252 17.304  1.00 0.00  ? 151 SER A HB3  1  
ATOM   2327  H  HG   . SER A 1 151 ? -4.072  15.378 17.131  1.00 0.00  ? 151 SER A HG   1  
ATOM   2328  N  N    . GLN A 1 152 ? -8.350  15.787 14.356  1.00 0.00  ? 152 GLN A N    1  
ATOM   2329  C  CA   . GLN A 1 152 ? -8.944  16.907 13.569  1.00 0.00  ? 152 GLN A CA   1  
ATOM   2330  C  C    . GLN A 1 152 ? -8.463  18.238 14.147  1.00 0.00  ? 152 GLN A C    1  
ATOM   2331  O  O    . GLN A 1 152 ? -8.329  19.217 13.446  1.00 0.00  ? 152 GLN A O    1  
ATOM   2332  C  CB   . GLN A 1 152 ? -10.470 16.833 13.638  1.00 0.00  ? 152 GLN A CB   1  
ATOM   2333  C  CG   . GLN A 1 152 ? -10.943 17.228 15.038  1.00 0.00  ? 152 GLN A CG   1  
ATOM   2334  C  CD   . GLN A 1 152 ? -12.076 16.296 15.468  1.00 0.00  ? 152 GLN A CD   1  
ATOM   2335  O  OE1  . GLN A 1 152 ? -11.848 15.317 16.151  1.00 0.00  ? 152 GLN A OE1  1  
ATOM   2336  N  NE2  . GLN A 1 152 ? -13.297 16.558 15.091  1.00 0.00  ? 152 GLN A NE2  1  
ATOM   2337  H  H    . GLN A 1 152 ? -8.931  15.148 14.819  1.00 0.00  ? 152 GLN A H    1  
ATOM   2338  H  HA   . GLN A 1 152 ? -8.628  16.830 12.535  1.00 0.00  ? 152 GLN A HA   1  
ATOM   2339  H  HB2  . GLN A 1 152 ? -10.896 17.507 12.909  1.00 0.00  ? 152 GLN A HB2  1  
ATOM   2340  H  HB3  . GLN A 1 152 ? -10.790 15.823 13.426  1.00 0.00  ? 152 GLN A HB3  1  
ATOM   2341  H  HG2  . GLN A 1 152 ? -10.121 17.147 15.735  1.00 0.00  ? 152 GLN A HG2  1  
ATOM   2342  H  HG3  . GLN A 1 152 ? -11.304 18.245 15.022  1.00 0.00  ? 152 GLN A HG3  1  
ATOM   2343  H  HE21 . GLN A 1 152 ? -13.481 17.346 14.538  1.00 0.00  ? 152 GLN A HE21 1  
ATOM   2344  H  HE22 . GLN A 1 152 ? -14.031 15.966 15.358  1.00 0.00  ? 152 GLN A HE22 1  
ATOM   2345  N  N    . ASP A 1 153 ? -8.186  18.286 15.421  1.00 0.00  ? 153 ASP A N    1  
ATOM   2346  C  CA   . ASP A 1 153 ? -7.697  19.561 16.017  1.00 0.00  ? 153 ASP A CA   1  
ATOM   2347  C  C    . ASP A 1 153 ? -6.659  20.160 15.064  1.00 0.00  ? 153 ASP A C    1  
ATOM   2348  O  O    . ASP A 1 153 ? -6.599  21.359 14.850  1.00 0.00  ? 153 ASP A O    1  
ATOM   2349  C  CB   . ASP A 1 153 ? -7.051  19.274 17.376  1.00 0.00  ? 153 ASP A CB   1  
ATOM   2350  C  CG   . ASP A 1 153 ? -8.105  19.389 18.481  1.00 0.00  ? 153 ASP A CG   1  
ATOM   2351  O  OD1  . ASP A 1 153 ? -8.822  20.377 18.486  1.00 0.00  ? 153 ASP A OD1  1  
ATOM   2352  O  OD2  . ASP A 1 153 ? -8.177  18.489 19.301  1.00 0.00  ? 153 ASP A OD2  1  
ATOM   2353  H  H    . ASP A 1 153 ? -8.287  17.487 15.978  1.00 0.00  ? 153 ASP A H    1  
ATOM   2354  H  HA   . ASP A 1 153 ? -8.523  20.247 16.138  1.00 0.00  ? 153 ASP A HA   1  
ATOM   2355  H  HB2  . ASP A 1 153 ? -6.641  18.274 17.372  1.00 0.00  ? 153 ASP A HB2  1  
ATOM   2356  H  HB3  . ASP A 1 153 ? -6.261  19.987 17.558  1.00 0.00  ? 153 ASP A HB3  1  
ATOM   2357  N  N    . ASP A 1 154 ? -5.865  19.313 14.466  1.00 0.00  ? 154 ASP A N    1  
ATOM   2358  C  CA   . ASP A 1 154 ? -4.842  19.786 13.498  1.00 0.00  ? 154 ASP A CA   1  
ATOM   2359  C  C    . ASP A 1 154 ? -5.486  19.918 12.117  1.00 0.00  ? 154 ASP A C    1  
ATOM   2360  O  O    . ASP A 1 154 ? -5.305  20.903 11.429  1.00 0.00  ? 154 ASP A O    1  
ATOM   2361  C  CB   . ASP A 1 154 ? -3.701  18.768 13.428  1.00 0.00  ? 154 ASP A CB   1  
ATOM   2362  C  CG   . ASP A 1 154 ? -2.910  18.793 14.734  1.00 0.00  ? 154 ASP A CG   1  
ATOM   2363  O  OD1  . ASP A 1 154 ? -3.376  18.205 15.695  1.00 0.00  ? 154 ASP A OD1  1  
ATOM   2364  O  OD2  . ASP A 1 154 ? -1.850  19.396 14.750  1.00 0.00  ? 154 ASP A OD2  1  
ATOM   2365  H  H    . ASP A 1 154 ? -5.958  18.352 14.641  1.00 0.00  ? 154 ASP A H    1  
ATOM   2366  H  HA   . ASP A 1 154 ? -4.455  20.743 13.814  1.00 0.00  ? 154 ASP A HA   1  
ATOM   2367  H  HB2  . ASP A 1 154 ? -4.112  17.780 13.274  1.00 0.00  ? 154 ASP A HB2  1  
ATOM   2368  H  HB3  . ASP A 1 154 ? -3.046  19.017 12.608  1.00 0.00  ? 154 ASP A HB3  1  
ATOM   2369  N  N    . ILE A 1 155 ? -6.240  18.930 11.705  1.00 0.00  ? 155 ILE A N    1  
ATOM   2370  C  CA   . ILE A 1 155 ? -6.894  19.006 10.369  1.00 0.00  ? 155 ILE A CA   1  
ATOM   2371  C  C    . ILE A 1 155 ? -7.653  20.333 10.269  1.00 0.00  ? 155 ILE A C    1  
ATOM   2372  O  O    . ILE A 1 155 ? -7.756  20.930 9.215   1.00 0.00  ? 155 ILE A O    1  
ATOM   2373  C  CB   . ILE A 1 155 ? -7.873  17.827 10.166  1.00 0.00  ? 155 ILE A CB   1  
ATOM   2374  C  CG1  . ILE A 1 155 ? -9.228  18.138 10.814  1.00 0.00  ? 155 ILE A CG1  1  
ATOM   2375  C  CG2  . ILE A 1 155 ? -7.300  16.521 10.730  1.00 0.00  ? 155 ILE A CG2  1  
ATOM   2376  C  CD1  . ILE A 1 155 ? -10.077 18.963 9.847   1.00 0.00  ? 155 ILE A CD1  1  
ATOM   2377  H  H    . ILE A 1 155 ? -6.375  18.150 12.276  1.00 0.00  ? 155 ILE A H    1  
ATOM   2378  H  HA   . ILE A 1 155 ? -6.133  18.974 9.602   1.00 0.00  ? 155 ILE A HA   1  
ATOM   2379  H  HB   . ILE A 1 155 ? -8.025  17.688 9.125   1.00 0.00  ? 155 ILE A HB   1  
ATOM   2380  H  HG12 . ILE A 1 155 ? -9.739  17.215 11.045  1.00 0.00  ? 155 ILE A HG12 1  
ATOM   2381  H  HG13 . ILE A 1 155 ? -9.077  18.699 11.715  1.00 0.00  ? 155 ILE A HG13 1  
ATOM   2382  H  HG21 . ILE A 1 155 ? -6.452  16.213 10.135  1.00 0.00  ? 155 ILE A HG21 1  
ATOM   2383  H  HG22 . ILE A 1 155 ? -8.060  15.754 10.689  1.00 0.00  ? 155 ILE A HG22 1  
ATOM   2384  H  HG23 . ILE A 1 155 ? -6.991  16.659 11.751  1.00 0.00  ? 155 ILE A HG23 1  
ATOM   2385  H  HD11 . ILE A 1 155 ? -9.661  18.896 8.852   1.00 0.00  ? 155 ILE A HD11 1  
ATOM   2386  H  HD12 . ILE A 1 155 ? -10.084 19.996 10.165  1.00 0.00  ? 155 ILE A HD12 1  
ATOM   2387  H  HD13 . ILE A 1 155 ? -11.086 18.581 9.842   1.00 0.00  ? 155 ILE A HD13 1  
ATOM   2388  N  N    . LYS A 1 156 ? -8.186  20.793 11.366  1.00 0.00  ? 156 LYS A N    1  
ATOM   2389  C  CA   . LYS A 1 156 ? -8.943  22.074 11.355  1.00 0.00  ? 156 LYS A CA   1  
ATOM   2390  C  C    . LYS A 1 156 ? -7.969  23.252 11.278  1.00 0.00  ? 156 LYS A C    1  
ATOM   2391  O  O    . LYS A 1 156 ? -8.045  24.075 10.386  1.00 0.00  ? 156 LYS A O    1  
ATOM   2392  C  CB   . LYS A 1 156 ? -9.773  22.182 12.636  1.00 0.00  ? 156 LYS A CB   1  
ATOM   2393  C  CG   . LYS A 1 156 ? -10.621 23.453 12.586  1.00 0.00  ? 156 LYS A CG   1  
ATOM   2394  C  CD   . LYS A 1 156 ? -10.248 24.360 13.759  1.00 0.00  ? 156 LYS A CD   1  
ATOM   2395  C  CE   . LYS A 1 156 ? -11.511 24.742 14.525  1.00 0.00  ? 156 LYS A CE   1  
ATOM   2396  N  NZ   . LYS A 1 156 ? -12.104 23.519 15.134  1.00 0.00  ? 156 LYS A NZ   1  
ATOM   2397  H  H    . LYS A 1 156 ? -8.091  20.291 12.199  1.00 0.00  ? 156 LYS A H    1  
ATOM   2398  H  HA   . LYS A 1 156 ? -9.601  22.096 10.499  1.00 0.00  ? 156 LYS A HA   1  
ATOM   2399  H  HB2  . LYS A 1 156 ? -10.418 21.319 12.719  1.00 0.00  ? 156 LYS A HB2  1  
ATOM   2400  H  HB3  . LYS A 1 156 ? -9.115  22.222 13.490  1.00 0.00  ? 156 LYS A HB3  1  
ATOM   2401  H  HG2  . LYS A 1 156 ? -10.437 23.972 11.656  1.00 0.00  ? 156 LYS A HG2  1  
ATOM   2402  H  HG3  . LYS A 1 156 ? -11.666 23.194 12.653  1.00 0.00  ? 156 LYS A HG3  1  
ATOM   2403  H  HD2  . LYS A 1 156 ? -9.572  23.836 14.418  1.00 0.00  ? 156 LYS A HD2  1  
ATOM   2404  H  HD3  . LYS A 1 156 ? -9.770  25.255 13.388  1.00 0.00  ? 156 LYS A HD3  1  
ATOM   2405  H  HE2  . LYS A 1 156 ? -11.258 25.448 15.302  1.00 0.00  ? 156 LYS A HE2  1  
ATOM   2406  H  HE3  . LYS A 1 156 ? -12.222 25.190 13.847  1.00 0.00  ? 156 LYS A HE3  1  
ATOM   2407  H  HZ1  . LYS A 1 156 ? -13.121 23.484 14.923  1.00 0.00  ? 156 LYS A HZ1  1  
ATOM   2408  H  HZ2  . LYS A 1 156 ? -11.964 23.544 16.165  1.00 0.00  ? 156 LYS A HZ2  1  
ATOM   2409  H  HZ3  . LYS A 1 156 ? -11.642 22.676 14.741  1.00 0.00  ? 156 LYS A HZ3  1  
ATOM   2410  N  N    . GLY A 1 157 ? -7.056  23.347 12.206  1.00 0.00  ? 157 GLY A N    1  
ATOM   2411  C  CA   . GLY A 1 157 ? -6.089  24.480 12.175  1.00 0.00  ? 157 GLY A CA   1  
ATOM   2412  C  C    . GLY A 1 157 ? -5.340  24.485 10.839  1.00 0.00  ? 157 GLY A C    1  
ATOM   2413  O  O    . GLY A 1 157 ? -5.081  25.525 10.263  1.00 0.00  ? 157 GLY A O    1  
ATOM   2414  H  H    . GLY A 1 157 ? -7.008  22.677 12.924  1.00 0.00  ? 157 GLY A H    1  
ATOM   2415  H  HA2  . GLY A 1 157 ? -6.625  25.412 12.291  1.00 0.00  ? 157 GLY A HA2  1  
ATOM   2416  H  HA3  . GLY A 1 157 ? -5.379  24.370 12.980  1.00 0.00  ? 157 GLY A HA3  1  
ATOM   2417  N  N    . ILE A 1 158 ? -4.985  23.330 10.340  1.00 0.00  ? 158 ILE A N    1  
ATOM   2418  C  CA   . ILE A 1 158 ? -4.243  23.274 9.047   1.00 0.00  ? 158 ILE A CA   1  
ATOM   2419  C  C    . ILE A 1 158 ? -5.215  23.475 7.883   1.00 0.00  ? 158 ILE A C    1  
ATOM   2420  O  O    . ILE A 1 158 ? -4.820  23.817 6.784   1.00 0.00  ? 158 ILE A O    1  
ATOM   2421  C  CB   . ILE A 1 158 ? -3.558  21.907 8.920   1.00 0.00  ? 158 ILE A CB   1  
ATOM   2422  C  CG1  . ILE A 1 158 ? -2.474  21.976 7.842   1.00 0.00  ? 158 ILE A CG1  1  
ATOM   2423  C  CG2  . ILE A 1 158 ? -4.587  20.843 8.535   1.00 0.00  ? 158 ILE A CG2  1  
ATOM   2424  C  CD1  . ILE A 1 158 ? -1.466  23.069 8.199   1.00 0.00  ? 158 ILE A CD1  1  
ATOM   2425  H  H    . ILE A 1 158 ? -5.199  22.502 10.820  1.00 0.00  ? 158 ILE A H    1  
ATOM   2426  H  HA   . ILE A 1 158 ? -3.495  24.051 9.028   1.00 0.00  ? 158 ILE A HA   1  
ATOM   2427  H  HB   . ILE A 1 158 ? -3.109  21.643 9.867   1.00 0.00  ? 158 ILE A HB   1  
ATOM   2428  H  HG12 . ILE A 1 158 ? -1.967  21.023 7.780   1.00 0.00  ? 158 ILE A HG12 1  
ATOM   2429  H  HG13 . ILE A 1 158 ? -2.928  22.204 6.890   1.00 0.00  ? 158 ILE A HG13 1  
ATOM   2430  H  HG21 . ILE A 1 158 ? -5.551  21.110 8.943   1.00 0.00  ? 158 ILE A HG21 1  
ATOM   2431  H  HG22 . ILE A 1 158 ? -4.280  19.887 8.932   1.00 0.00  ? 158 ILE A HG22 1  
ATOM   2432  H  HG23 . ILE A 1 158 ? -4.655  20.782 7.459   1.00 0.00  ? 158 ILE A HG23 1  
ATOM   2433  H  HD11 . ILE A 1 158 ? -1.829  24.021 7.844   1.00 0.00  ? 158 ILE A HD11 1  
ATOM   2434  H  HD12 . ILE A 1 158 ? -0.517  22.850 7.733   1.00 0.00  ? 158 ILE A HD12 1  
ATOM   2435  H  HD13 . ILE A 1 158 ? -1.340  23.108 9.271   1.00 0.00  ? 158 ILE A HD13 1  
ATOM   2436  N  N    . GLN A 1 159 ? -6.483  23.282 8.117   1.00 0.00  ? 159 GLN A N    1  
ATOM   2437  C  CA   . GLN A 1 159 ? -7.473  23.476 7.024   1.00 0.00  ? 159 GLN A CA   1  
ATOM   2438  C  C    . GLN A 1 159 ? -7.622  24.972 6.750   1.00 0.00  ? 159 GLN A C    1  
ATOM   2439  O  O    . GLN A 1 159 ? -7.568  25.415 5.619   1.00 0.00  ? 159 GLN A O    1  
ATOM   2440  C  CB   . GLN A 1 159 ? -8.819  22.883 7.444   1.00 0.00  ? 159 GLN A CB   1  
ATOM   2441  C  CG   . GLN A 1 159 ? -9.007  21.525 6.765   1.00 0.00  ? 159 GLN A CG   1  
ATOM   2442  C  CD   . GLN A 1 159 ? -10.172 21.609 5.776   1.00 0.00  ? 159 GLN A CD   1  
ATOM   2443  O  OE1  . GLN A 1 159 ? -9.967  21.588 4.579   1.00 0.00  ? 159 GLN A OE1  1  
ATOM   2444  N  NE2  . GLN A 1 159 ? -11.393 21.706 6.228   1.00 0.00  ? 159 GLN A NE2  1  
ATOM   2445  H  H    . GLN A 1 159 ? -6.784  23.015 9.011   1.00 0.00  ? 159 GLN A H    1  
ATOM   2446  H  HA   . GLN A 1 159 ? -7.123  22.982 6.129   1.00 0.00  ? 159 GLN A HA   1  
ATOM   2447  H  HB2  . GLN A 1 159 ? -8.839  22.759 8.516   1.00 0.00  ? 159 GLN A HB2  1  
ATOM   2448  H  HB3  . GLN A 1 159 ? -9.614  23.548 7.142   1.00 0.00  ? 159 GLN A HB3  1  
ATOM   2449  H  HG2  . GLN A 1 159 ? -8.103  21.261 6.237   1.00 0.00  ? 159 GLN A HG2  1  
ATOM   2450  H  HG3  . GLN A 1 159 ? -9.221  20.773 7.510   1.00 0.00  ? 159 GLN A HG3  1  
ATOM   2451  H  HE21 . GLN A 1 159 ? -11.559 21.726 7.194   1.00 0.00  ? 159 GLN A HE21 1  
ATOM   2452  H  HE22 . GLN A 1 159 ? -12.145 21.757 5.601   1.00 0.00  ? 159 GLN A HE22 1  
ATOM   2453  N  N    . GLU A 1 160 ? -7.797  25.757 7.778   1.00 0.00  ? 160 GLU A N    1  
ATOM   2454  C  CA   . GLU A 1 160 ? -7.937  27.226 7.577   1.00 0.00  ? 160 GLU A CA   1  
ATOM   2455  C  C    . GLU A 1 160 ? -6.563  27.820 7.246   1.00 0.00  ? 160 GLU A C    1  
ATOM   2456  O  O    . GLU A 1 160 ? -6.460  28.887 6.673   1.00 0.00  ? 160 GLU A O    1  
ATOM   2457  C  CB   . GLU A 1 160 ? -8.480  27.875 8.854   1.00 0.00  ? 160 GLU A CB   1  
ATOM   2458  C  CG   . GLU A 1 160 ? -9.946  27.480 9.042   1.00 0.00  ? 160 GLU A CG   1  
ATOM   2459  C  CD   . GLU A 1 160 ? -10.664 28.556 9.857   1.00 0.00  ? 160 GLU A CD   1  
ATOM   2460  O  OE1  . GLU A 1 160 ? -10.475 28.583 11.062  1.00 0.00  ? 160 GLU A OE1  1  
ATOM   2461  O  OE2  . GLU A 1 160 ? -11.391 29.332 9.263   1.00 0.00  ? 160 GLU A OE2  1  
ATOM   2462  H  H    . GLU A 1 160 ? -7.829  25.381 8.681   1.00 0.00  ? 160 GLU A H    1  
ATOM   2463  H  HA   . GLU A 1 160 ? -8.617  27.414 6.759   1.00 0.00  ? 160 GLU A HA   1  
ATOM   2464  H  HB2  . GLU A 1 160 ? -7.902  27.539 9.704   1.00 0.00  ? 160 GLU A HB2  1  
ATOM   2465  H  HB3  . GLU A 1 160 ? -8.407  28.949 8.771   1.00 0.00  ? 160 GLU A HB3  1  
ATOM   2466  H  HG2  . GLU A 1 160 ? -10.419 27.383 8.076   1.00 0.00  ? 160 GLU A HG2  1  
ATOM   2467  H  HG3  . GLU A 1 160 ? -10.000 26.538 9.567   1.00 0.00  ? 160 GLU A HG3  1  
ATOM   2468  N  N    . LEU A 1 161 ? -5.507  27.137 7.606   1.00 0.00  ? 161 LEU A N    1  
ATOM   2469  C  CA   . LEU A 1 161 ? -4.144  27.665 7.313   1.00 0.00  ? 161 LEU A CA   1  
ATOM   2470  C  C    . LEU A 1 161 ? -3.727  27.265 5.895   1.00 0.00  ? 161 LEU A C    1  
ATOM   2471  O  O    . LEU A 1 161 ? -2.798  27.814 5.336   1.00 0.00  ? 161 LEU A O    1  
ATOM   2472  C  CB   . LEU A 1 161 ? -3.146  27.086 8.314   1.00 0.00  ? 161 LEU A CB   1  
ATOM   2473  C  CG   . LEU A 1 161 ? -2.429  28.229 9.036   1.00 0.00  ? 161 LEU A CG   1  
ATOM   2474  C  CD1  . LEU A 1 161 ? -1.597  29.032 8.033   1.00 0.00  ? 161 LEU A CD1  1  
ATOM   2475  C  CD2  . LEU A 1 161 ? -3.463  29.149 9.689   1.00 0.00  ? 161 LEU A CD2  1  
ATOM   2476  H  H    . LEU A 1 161 ? -5.611  26.278 8.074   1.00 0.00  ? 161 LEU A H    1  
ATOM   2477  H  HA   . LEU A 1 161 ? -4.150  28.741 7.394   1.00 0.00  ? 161 LEU A HA   1  
ATOM   2478  H  HB2  . LEU A 1 161 ? -3.671  26.477 9.035   1.00 0.00  ? 161 LEU A HB2  1  
ATOM   2479  H  HB3  . LEU A 1 161 ? -2.421  26.482 7.791   1.00 0.00  ? 161 LEU A HB3  1  
ATOM   2480  H  HG   . LEU A 1 161 ? -1.777  27.820 9.794   1.00 0.00  ? 161 LEU A HG   1  
ATOM   2481  H  HD11 . LEU A 1 161 ? -1.494  28.468 7.118   1.00 0.00  ? 161 LEU A HD11 1  
ATOM   2482  H  HD12 . LEU A 1 161 ? -0.619  29.226 8.448   1.00 0.00  ? 161 LEU A HD12 1  
ATOM   2483  H  HD13 . LEU A 1 161 ? -2.091  29.969 7.825   1.00 0.00  ? 161 LEU A HD13 1  
ATOM   2484  H  HD21 . LEU A 1 161 ? -3.112  29.450 10.666  1.00 0.00  ? 161 LEU A HD21 1  
ATOM   2485  H  HD22 . LEU A 1 161 ? -4.401  28.623 9.790   1.00 0.00  ? 161 LEU A HD22 1  
ATOM   2486  H  HD23 . LEU A 1 161 ? -3.607  30.025 9.073   1.00 0.00  ? 161 LEU A HD23 1  
ATOM   2487  N  N    . TYR A 1 162 ? -4.405  26.316 5.304   1.00 0.00  ? 162 TYR A N    1  
ATOM   2488  C  CA   . TYR A 1 162 ? -4.039  25.898 3.919   1.00 0.00  ? 162 TYR A CA   1  
ATOM   2489  C  C    . TYR A 1 162 ? -5.314  25.638 3.112   1.00 0.00  ? 162 TYR A C    1  
ATOM   2490  O  O    . TYR A 1 162 ? -5.883  26.538 2.526   1.00 0.00  ? 162 TYR A O    1  
ATOM   2491  C  CB   . TYR A 1 162 ? -3.197  24.618 3.963   1.00 0.00  ? 162 TYR A CB   1  
ATOM   2492  C  CG   . TYR A 1 162 ? -1.760  24.942 4.316   1.00 0.00  ? 162 TYR A CG   1  
ATOM   2493  C  CD1  . TYR A 1 162 ? -1.152  26.111 3.832   1.00 0.00  ? 162 TYR A CD1  1  
ATOM   2494  C  CD2  . TYR A 1 162 ? -1.029  24.064 5.129   1.00 0.00  ? 162 TYR A CD2  1  
ATOM   2495  C  CE1  . TYR A 1 162 ? 0.178   26.398 4.163   1.00 0.00  ? 162 TYR A CE1  1  
ATOM   2496  C  CE2  . TYR A 1 162 ? 0.300   24.354 5.458   1.00 0.00  ? 162 TYR A CE2  1  
ATOM   2497  C  CZ   . TYR A 1 162 ? 0.903   25.521 4.977   1.00 0.00  ? 162 TYR A CZ   1  
ATOM   2498  O  OH   . TYR A 1 162 ? 2.214   25.806 5.303   1.00 0.00  ? 162 TYR A OH   1  
ATOM   2499  H  H    . TYR A 1 162 ? -5.153  25.883 5.767   1.00 0.00  ? 162 TYR A H    1  
ATOM   2500  H  HA   . TYR A 1 162 ? -3.475  26.685 3.446   1.00 0.00  ? 162 TYR A HA   1  
ATOM   2501  H  HB2  . TYR A 1 162 ? -3.605  23.948 4.704   1.00 0.00  ? 162 TYR A HB2  1  
ATOM   2502  H  HB3  . TYR A 1 162 ? -3.225  24.140 2.995   1.00 0.00  ? 162 TYR A HB3  1  
ATOM   2503  H  HD1  . TYR A 1 162 ? -1.704  26.789 3.202   1.00 0.00  ? 162 TYR A HD1  1  
ATOM   2504  H  HD2  . TYR A 1 162 ? -1.492  23.163 5.502   1.00 0.00  ? 162 TYR A HD2  1  
ATOM   2505  H  HE1  . TYR A 1 162 ? 0.644   27.299 3.792   1.00 0.00  ? 162 TYR A HE1  1  
ATOM   2506  H  HE2  . TYR A 1 162 ? 0.861   23.675 6.084   1.00 0.00  ? 162 TYR A HE2  1  
ATOM   2507  H  HH   . TYR A 1 162 ? 2.278   26.747 5.483   1.00 0.00  ? 162 TYR A HH   1  
ATOM   2508  N  N    . GLY A 1 163 ? -5.768  24.415 3.077   1.00 0.00  ? 163 GLY A N    1  
ATOM   2509  C  CA   . GLY A 1 163 ? -7.005  24.098 2.308   1.00 0.00  ? 163 GLY A CA   1  
ATOM   2510  C  C    . GLY A 1 163 ? -8.237  24.445 3.145   1.00 0.00  ? 163 GLY A C    1  
ATOM   2511  O  O    . GLY A 1 163 ? -8.455  23.783 4.146   1.00 0.00  ? 163 GLY A O    1  
ATOM   2512  O  OXT  . GLY A 1 163 ? -8.941  25.365 2.767   1.00 0.00  ? 163 GLY A OXT  1  
ATOM   2513  H  H    . GLY A 1 163 ? -5.297  23.703 3.558   1.00 0.00  ? 163 GLY A H    1  
ATOM   2514  H  HA2  . GLY A 1 163 ? -7.017  24.675 1.395   1.00 0.00  ? 163 GLY A HA2  1  
ATOM   2515  H  HA3  . GLY A 1 163 ? -7.021  23.044 2.069   1.00 0.00  ? 163 GLY A HA3  1  
HETATM 2516  ZN ZN   . ZN  B 2 .   ? 16.540  27.532 18.822  1.00 11.59 ? 165 ZN  A ZN   1  
HETATM 2517  ZN ZN   . ZN  C 2 .   ? 5.247   22.113 21.156  1.00 10.57 ? 166 ZN  A ZN   1  
HETATM 2518  CA CA   . CA  D 3 .   ? 16.757  16.880 25.974  1.00 9.12  ? 167 CA  A CA   1  
HETATM 2519  CA CA   . CA  E 3 .   ? 13.002  29.346 8.974   1.00 8.09  ? 168 CA  A CA   1  
HETATM 2520  C  C38  . I52 F 4 .   ? 0.253   11.466 15.730  1.00 20.00 ? 800 I52 A C38  1  
HETATM 2521  C  C39  . I52 F 4 .   ? 1.617   11.066 15.206  1.00 20.00 ? 800 I52 A C39  1  
HETATM 2522  C  C37  . I52 F 4 .   ? 0.139   11.271 17.236  1.00 20.00 ? 800 I52 A C37  1  
HETATM 2523  C  C35  . I52 F 4 .   ? 0.526   12.317 19.495  1.00 20.00 ? 800 I52 A C35  1  
HETATM 2524  C  C36  . I52 F 4 .   ? 0.421   12.558 17.995  1.00 20.00 ? 800 I52 A C36  1  
HETATM 2525  C  C25  . I52 F 4 .   ? 9.833   25.032 22.409  1.00 20.00 ? 800 I52 A C25  1  
HETATM 2526  C  C24  . I52 F 4 .   ? 10.307  24.042 24.642  1.00 20.00 ? 800 I52 A C24  1  
HETATM 2527  N  N8   . I52 F 4 .   ? 7.874   22.544 27.656  1.00 20.00 ? 800 I52 A N8   1  
HETATM 2528  C  C7   . I52 F 4 .   ? 8.574   21.993 26.488  1.00 20.00 ? 800 I52 A C7   1  
HETATM 2529  C  C9   . I52 F 4 .   ? 6.524   21.961 27.926  1.00 20.00 ? 800 I52 A C9   1  
HETATM 2530  C  C13  . I52 F 4 .   ? 7.809   24.039 27.629  1.00 20.00 ? 800 I52 A C13  1  
HETATM 2531  O  O11  . I52 F 4 .   ? 5.777   23.635 26.237  1.00 20.00 ? 800 I52 A O11  1  
HETATM 2532  C  C12  . I52 F 4 .   ? 6.658   24.650 26.787  1.00 20.00 ? 800 I52 A C12  1  
HETATM 2533  C  C10  . I52 F 4 .   ? 5.333   22.663 27.217  1.00 20.00 ? 800 I52 A C10  1  
HETATM 2534  C  C31  . I52 F 4 .   ? 0.796   14.240 21.156  1.00 20.00 ? 800 I52 A C31  1  
HETATM 2535  C  C23  . I52 F 4 .   ? 9.292   24.112 23.505  1.00 20.00 ? 800 I52 A C23  1  
HETATM 2536  O  O26  . I52 F 4 .   ? 6.608   23.304 22.288  1.00 20.00 ? 800 I52 A O26  1  
HETATM 2537  C  C4   . I52 F 4 .   ? 8.913   22.704 22.924  1.00 20.00 ? 800 I52 A C4   1  
HETATM 2538  C  C6   . I52 F 4 .   ? 7.861   21.933 25.126  1.00 20.00 ? 800 I52 A C6   1  
HETATM 2539  S  S14  . I52 F 4 .   ? 9.534   20.127 23.835  1.00 20.00 ? 800 I52 A S14  1  
HETATM 2540  N  N5   . I52 F 4 .   ? 8.758   21.634 23.970  1.00 20.00 ? 800 I52 A N5   1  
HETATM 2541  C  C3   . I52 F 4 .   ? 7.697   22.816 21.989  1.00 20.00 ? 800 I52 A C3   1  
HETATM 2542  O  O1   . I52 F 4 .   ? 6.832   22.382 19.835  1.00 20.00 ? 800 I52 A O1   1  
HETATM 2543  N  N2   . I52 F 4 .   ? 7.928   22.299 20.726  1.00 20.00 ? 800 I52 A N2   1  
HETATM 2544  O  O21  . I52 F 4 .   ? 10.595  20.259 22.852  1.00 20.00 ? 800 I52 A O21  1  
HETATM 2545  O  O41  . I52 F 4 .   ? 3.394   16.939 23.146  1.00 20.00 ? 800 I52 A O41  1  
HETATM 2546  C  C28  . I52 F 4 .   ? 3.883   16.290 22.230  1.00 20.00 ? 800 I52 A C28  1  
HETATM 2547  N  N27  . I52 F 4 .   ? 5.197   16.373 21.760  1.00 20.00 ? 800 I52 A N27  1  
HETATM 2548  C  C29  . I52 F 4 .   ? 3.009   15.308 21.529  1.00 20.00 ? 800 I52 A C29  1  
HETATM 2549  C  C33  . I52 F 4 .   ? 2.783   13.453 19.889  1.00 20.00 ? 800 I52 A C33  1  
HETATM 2550  C  C34  . I52 F 4 .   ? 3.596   14.428 20.558  1.00 20.00 ? 800 I52 A C34  1  
HETATM 2551  C  C30  . I52 F 4 .   ? 1.605   15.215 21.826  1.00 20.00 ? 800 I52 A C30  1  
HETATM 2552  C  C32  . I52 F 4 .   ? 1.377   13.351 20.184  1.00 20.00 ? 800 I52 A C32  1  
HETATM 2553  C  C16  . I52 F 4 .   ? 7.005   18.984 23.838  1.00 20.00 ? 800 I52 A C16  1  
HETATM 2554  C  C18  . I52 F 4 .   ? 6.259   17.209 22.229  1.00 20.00 ? 800 I52 A C18  1  
HETATM 2555  C  C15  . I52 F 4 .   ? 8.305   18.991 23.237  1.00 20.00 ? 800 I52 A C15  1  
HETATM 2556  O  O22  . I52 F 4 .   ? 9.860   19.684 25.169  1.00 20.00 ? 800 I52 A O22  1  
HETATM 2557  C  C20  . I52 F 4 .   ? 8.592   18.114 22.141  1.00 20.00 ? 800 I52 A C20  1  
HETATM 2558  C  C17  . I52 F 4 .   ? 5.992   18.102 23.341  1.00 20.00 ? 800 I52 A C17  1  
HETATM 2559  C  C19  . I52 F 4 .   ? 7.571   17.227 21.641  1.00 20.00 ? 800 I52 A C19  1  
HETATM 2560  H  H381 . I52 F 4 .   ? -0.496  10.818 15.239  1.00 20.00 ? 800 I52 A H381 1  
HETATM 2561  H  H382 . I52 F 4 .   ? 0.034   12.504 15.456  1.00 20.00 ? 800 I52 A H382 1  
HETATM 2562  H  H391 . I52 F 4 .   ? 1.654   11.172 14.118  1.00 20.00 ? 800 I52 A H391 1  
HETATM 2563  H  H392 . I52 F 4 .   ? 1.823   10.014 15.441  1.00 20.00 ? 800 I52 A H392 1  
HETATM 2564  H  H393 . I52 F 4 .   ? 2.408   11.684 15.643  1.00 20.00 ? 800 I52 A H393 1  
HETATM 2565  H  H371 . I52 F 4 .   ? -0.898  10.962 17.461  1.00 20.00 ? 800 I52 A H371 1  
HETATM 2566  H  H372 . I52 F 4 .   ? 0.811   10.473 17.571  1.00 20.00 ? 800 I52 A H372 1  
HETATM 2567  H  H351 . I52 F 4 .   ? -0.489  12.373 19.930  1.00 20.00 ? 800 I52 A H351 1  
HETATM 2568  H  H352 . I52 F 4 .   ? 0.905   11.309 19.707  1.00 20.00 ? 800 I52 A H352 1  
HETATM 2569  H  H361 . I52 F 4 .   ? -0.424  13.250 17.817  1.00 20.00 ? 800 I52 A H361 1  
HETATM 2570  H  H362 . I52 F 4 .   ? 1.330   13.038 17.612  1.00 20.00 ? 800 I52 A H362 1  
HETATM 2571  H  H251 . I52 F 4 .   ? 9.319   25.995 22.397  1.00 20.00 ? 800 I52 A H251 1  
HETATM 2572  H  H252 . I52 F 4 .   ? 9.679   24.575 21.425  1.00 20.00 ? 800 I52 A H252 1  
HETATM 2573  H  H253 . I52 F 4 .   ? 10.905  25.209 22.531  1.00 20.00 ? 800 I52 A H253 1  
HETATM 2574  H  H241 . I52 F 4 .   ? 10.601  25.038 24.980  1.00 20.00 ? 800 I52 A H241 1  
HETATM 2575  H  H242 . I52 F 4 .   ? 11.223  23.543 24.298  1.00 20.00 ? 800 I52 A H242 1  
HETATM 2576  H  H243 . I52 F 4 .   ? 9.928   23.473 25.497  1.00 20.00 ? 800 I52 A H243 1  
HETATM 2577  H  H71  . I52 F 4 .   ? 8.879   20.964 26.752  1.00 20.00 ? 800 I52 A H71  1  
HETATM 2578  H  H72  . I52 F 4 .   ? 9.506   22.557 26.389  1.00 20.00 ? 800 I52 A H72  1  
HETATM 2579  H  H91  . I52 F 4 .   ? 6.361   22.078 29.010  6.00 20.00 ? 800 I52 A H91  1  
HETATM 2580  H  H92  . I52 F 4 .   ? 6.505   20.883 27.732  6.00 20.00 ? 800 I52 A H92  1  
HETATM 2581  H  H131 . I52 F 4 .   ? 8.764   24.432 27.233  6.00 20.00 ? 800 I52 A H131 1  
HETATM 2582  H  H132 . I52 F 4 .   ? 7.718   24.393 28.664  6.00 20.00 ? 800 I52 A H132 1  
HETATM 2583  H  H121 . I52 F 4 .   ? 6.036   25.273 27.448  7.00 20.00 ? 800 I52 A H121 1  
HETATM 2584  H  H122 . I52 F 4 .   ? 7.029   25.287 25.980  7.00 20.00 ? 800 I52 A H122 1  
HETATM 2585  H  H101 . I52 F 4 .   ? 4.716   21.920 26.683  7.00 20.00 ? 800 I52 A H101 1  
HETATM 2586  H  H102 . I52 F 4 .   ? 4.696   23.173 27.948  7.00 20.00 ? 800 I52 A H102 1  
HETATM 2587  H  H31  . I52 F 4 .   ? -0.268  14.180 21.386  3.00 20.00 ? 800 I52 A H31  1  
HETATM 2588  H  H23  . I52 F 4 .   ? 8.379   24.583 23.899  1.00 20.00 ? 800 I52 A H23  1  
HETATM 2589  H  H4   . I52 F 4 .   ? 9.725   22.415 22.238  1.00 20.00 ? 800 I52 A H4   1  
HETATM 2590  H  H61  . I52 F 4 .   ? 7.125   21.120 25.183  1.00 20.00 ? 800 I52 A H61  1  
HETATM 2591  H  H62  . I52 F 4 .   ? 7.295   22.848 24.925  1.00 20.00 ? 800 I52 A H62  1  
HETATM 2592  H  H1   . I52 F 4 .   ? 7.168   21.914 19.036  1.00 20.00 ? 800 I52 A H1   1  
HETATM 2593  H  H2   . I52 F 4 .   ? 8.830   21.884 20.455  1.00 20.00 ? 800 I52 A H2   1  
HETATM 2594  H  H27  . I52 F 4 .   ? 5.430   15.752 20.972  1.00 20.00 ? 800 I52 A H27  1  
HETATM 2595  H  H33  . I52 F 4 .   ? 3.241   12.793 19.154  3.00 20.00 ? 800 I52 A H33  1  
HETATM 2596  H  H34  . I52 F 4 .   ? 4.656   14.498 20.324  3.00 20.00 ? 800 I52 A H34  1  
HETATM 2597  H  H30  . I52 F 4 .   ? 1.140   15.874 22.555  3.00 20.00 ? 800 I52 A H30  1  
HETATM 2598  H  H16  . I52 F 4 .   ? 6.772   19.638 24.674  2.00 20.00 ? 800 I52 A H16  1  
HETATM 2599  H  H20  . I52 F 4 .   ? 9.574   18.100 21.672  2.00 20.00 ? 800 I52 A H20  1  
HETATM 2600  H  H17  . I52 F 4 .   ? 5.014   18.114 23.820  2.00 20.00 ? 800 I52 A H17  1  
HETATM 2601  H  H19  . I52 F 4 .   ? 7.831   16.580 20.807  2.00 20.00 ? 800 I52 A H19  1  
ATOM   2602  N  N    . MET A 1 1   ? 24.096  17.106 49.859  1.00 0.00  ? 1   MET A N    2  
ATOM   2603  C  CA   . MET A 1 1   ? 23.864  18.345 49.064  1.00 0.00  ? 1   MET A CA   2  
ATOM   2604  C  C    . MET A 1 1   ? 23.887  18.006 47.571  1.00 0.00  ? 1   MET A C    2  
ATOM   2605  O  O    . MET A 1 1   ? 24.054  16.864 47.188  1.00 0.00  ? 1   MET A O    2  
ATOM   2606  C  CB   . MET A 1 1   ? 24.961  19.364 49.382  1.00 0.00  ? 1   MET A CB   2  
ATOM   2607  C  CG   . MET A 1 1   ? 24.611  20.094 50.678  1.00 0.00  ? 1   MET A CG   2  
ATOM   2608  S  SD   . MET A 1 1   ? 25.928  21.266 51.085  1.00 0.00  ? 1   MET A SD   2  
ATOM   2609  C  CE   . MET A 1 1   ? 24.894  22.475 51.948  1.00 0.00  ? 1   MET A CE   2  
ATOM   2610  H  H1   . MET A 1 1   ? 24.444  17.362 50.804  1.00 0.00  ? 1   MET A H1   2  
ATOM   2611  H  H2   . MET A 1 1   ? 24.803  16.512 49.378  1.00 0.00  ? 1   MET A H2   2  
ATOM   2612  H  H3   . MET A 1 1   ? 23.203  16.582 49.952  1.00 0.00  ? 1   MET A H3   2  
ATOM   2613  H  HA   . MET A 1 1   ? 22.902  18.763 49.322  1.00 0.00  ? 1   MET A HA   2  
ATOM   2614  H  HB2  . MET A 1 1   ? 25.903  18.852 49.501  1.00 0.00  ? 1   MET A HB2  2  
ATOM   2615  H  HB3  . MET A 1 1   ? 25.037  20.078 48.577  1.00 0.00  ? 1   MET A HB3  2  
ATOM   2616  H  HG2  . MET A 1 1   ? 23.680  20.627 50.552  1.00 0.00  ? 1   MET A HG2  2  
ATOM   2617  H  HG3  . MET A 1 1   ? 24.509  19.377 51.478  1.00 0.00  ? 1   MET A HG3  2  
ATOM   2618  H  HE1  . MET A 1 1   ? 23.854  22.204 51.831  1.00 0.00  ? 1   MET A HE1  2  
ATOM   2619  H  HE2  . MET A 1 1   ? 25.057  23.454 51.529  1.00 0.00  ? 1   MET A HE2  2  
ATOM   2620  H  HE3  . MET A 1 1   ? 25.153  22.486 52.998  1.00 0.00  ? 1   MET A HE3  2  
ATOM   2621  N  N    . TYR A 1 2   ? 23.716  18.983 46.725  1.00 0.00  ? 2   TYR A N    2  
ATOM   2622  C  CA   . TYR A 1 2   ? 23.722  18.706 45.261  1.00 0.00  ? 2   TYR A CA   2  
ATOM   2623  C  C    . TYR A 1 2   ? 25.058  18.065 44.871  1.00 0.00  ? 2   TYR A C    2  
ATOM   2624  O  O    . TYR A 1 2   ? 25.232  16.867 44.968  1.00 0.00  ? 2   TYR A O    2  
ATOM   2625  C  CB   . TYR A 1 2   ? 23.529  20.017 44.493  1.00 0.00  ? 2   TYR A CB   2  
ATOM   2626  C  CG   . TYR A 1 2   ? 22.077  20.166 44.106  1.00 0.00  ? 2   TYR A CG   2  
ATOM   2627  C  CD1  . TYR A 1 2   ? 21.186  20.805 44.975  1.00 0.00  ? 2   TYR A CD1  2  
ATOM   2628  C  CD2  . TYR A 1 2   ? 21.621  19.667 42.879  1.00 0.00  ? 2   TYR A CD2  2  
ATOM   2629  C  CE1  . TYR A 1 2   ? 19.839  20.946 44.618  1.00 0.00  ? 2   TYR A CE1  2  
ATOM   2630  C  CE2  . TYR A 1 2   ? 20.274  19.807 42.524  1.00 0.00  ? 2   TYR A CE2  2  
ATOM   2631  C  CZ   . TYR A 1 2   ? 19.384  20.447 43.392  1.00 0.00  ? 2   TYR A CZ   2  
ATOM   2632  O  OH   . TYR A 1 2   ? 18.058  20.586 43.039  1.00 0.00  ? 2   TYR A OH   2  
ATOM   2633  H  H    . TYR A 1 2   ? 23.579  19.897 47.052  1.00 0.00  ? 2   TYR A H    2  
ATOM   2634  H  HA   . TYR A 1 2   ? 22.916  18.028 45.022  1.00 0.00  ? 2   TYR A HA   2  
ATOM   2635  H  HB2  . TYR A 1 2   ? 23.822  20.846 45.122  1.00 0.00  ? 2   TYR A HB2  2  
ATOM   2636  H  HB3  . TYR A 1 2   ? 24.140  20.007 43.602  1.00 0.00  ? 2   TYR A HB3  2  
ATOM   2637  H  HD1  . TYR A 1 2   ? 21.537  21.192 45.919  1.00 0.00  ? 2   TYR A HD1  2  
ATOM   2638  H  HD2  . TYR A 1 2   ? 22.307  19.172 42.208  1.00 0.00  ? 2   TYR A HD2  2  
ATOM   2639  H  HE1  . TYR A 1 2   ? 19.150  21.438 45.290  1.00 0.00  ? 2   TYR A HE1  2  
ATOM   2640  H  HE2  . TYR A 1 2   ? 19.922  19.424 41.576  1.00 0.00  ? 2   TYR A HE2  2  
ATOM   2641  H  HH   . TYR A 1 2   ? 18.001  21.253 42.349  1.00 0.00  ? 2   TYR A HH   2  
ATOM   2642  N  N    . ASN A 1 3   ? 26.003  18.855 44.439  1.00 0.00  ? 3   ASN A N    2  
ATOM   2643  C  CA   . ASN A 1 3   ? 27.332  18.301 44.052  1.00 0.00  ? 3   ASN A CA   2  
ATOM   2644  C  C    . ASN A 1 3   ? 27.173  17.294 42.912  1.00 0.00  ? 3   ASN A C    2  
ATOM   2645  O  O    . ASN A 1 3   ? 26.860  16.140 43.127  1.00 0.00  ? 3   ASN A O    2  
ATOM   2646  C  CB   . ASN A 1 3   ? 27.966  17.606 45.260  1.00 0.00  ? 3   ASN A CB   2  
ATOM   2647  C  CG   . ASN A 1 3   ? 28.096  18.604 46.409  1.00 0.00  ? 3   ASN A CG   2  
ATOM   2648  O  OD1  . ASN A 1 3   ? 27.145  19.275 46.755  1.00 0.00  ? 3   ASN A OD1  2  
ATOM   2649  N  ND2  . ASN A 1 3   ? 29.241  18.732 47.020  1.00 0.00  ? 3   ASN A ND2  2  
ATOM   2650  H  H    . ASN A 1 3   ? 25.841  19.818 44.376  1.00 0.00  ? 3   ASN A H    2  
ATOM   2651  H  HA   . ASN A 1 3   ? 27.973  19.106 43.729  1.00 0.00  ? 3   ASN A HA   2  
ATOM   2652  H  HB2  . ASN A 1 3   ? 27.341  16.779 45.571  1.00 0.00  ? 3   ASN A HB2  2  
ATOM   2653  H  HB3  . ASN A 1 3   ? 28.945  17.238 44.991  1.00 0.00  ? 3   ASN A HB3  2  
ATOM   2654  H  HD21 . ASN A 1 3   ? 30.008  18.191 46.741  1.00 0.00  ? 3   ASN A HD21 2  
ATOM   2655  H  HD22 . ASN A 1 3   ? 29.333  19.369 47.757  1.00 0.00  ? 3   ASN A HD22 2  
ATOM   2656  N  N    . PHE A 1 4   ? 27.401  17.720 41.699  1.00 0.00  ? 4   PHE A N    2  
ATOM   2657  C  CA   . PHE A 1 4   ? 27.280  16.787 40.547  1.00 0.00  ? 4   PHE A CA   2  
ATOM   2658  C  C    . PHE A 1 4   ? 28.646  16.631 39.882  1.00 0.00  ? 4   PHE A C    2  
ATOM   2659  O  O    . PHE A 1 4   ? 29.608  17.278 40.250  1.00 0.00  ? 4   PHE A O    2  
ATOM   2660  C  CB   . PHE A 1 4   ? 26.285  17.347 39.529  1.00 0.00  ? 4   PHE A CB   2  
ATOM   2661  C  CG   . PHE A 1 4   ? 24.907  16.810 39.824  1.00 0.00  ? 4   PHE A CG   2  
ATOM   2662  C  CD1  . PHE A 1 4   ? 24.311  17.062 41.065  1.00 0.00  ? 4   PHE A CD1  2  
ATOM   2663  C  CD2  . PHE A 1 4   ? 24.224  16.062 38.858  1.00 0.00  ? 4   PHE A CD2  2  
ATOM   2664  C  CE1  . PHE A 1 4   ? 23.032  16.565 41.340  1.00 0.00  ? 4   PHE A CE1  2  
ATOM   2665  C  CE2  . PHE A 1 4   ? 22.944  15.567 39.134  1.00 0.00  ? 4   PHE A CE2  2  
ATOM   2666  C  CZ   . PHE A 1 4   ? 22.349  15.818 40.376  1.00 0.00  ? 4   PHE A CZ   2  
ATOM   2667  H  H    . PHE A 1 4   ? 27.663  18.653 41.547  1.00 0.00  ? 4   PHE A H    2  
ATOM   2668  H  HA   . PHE A 1 4   ? 26.936  15.825 40.895  1.00 0.00  ? 4   PHE A HA   2  
ATOM   2669  H  HB2  . PHE A 1 4   ? 26.274  18.425 39.591  1.00 0.00  ? 4   PHE A HB2  2  
ATOM   2670  H  HB3  . PHE A 1 4   ? 26.581  17.047 38.533  1.00 0.00  ? 4   PHE A HB3  2  
ATOM   2671  H  HD1  . PHE A 1 4   ? 24.838  17.639 41.809  1.00 0.00  ? 4   PHE A HD1  2  
ATOM   2672  H  HD2  . PHE A 1 4   ? 24.685  15.865 37.900  1.00 0.00  ? 4   PHE A HD2  2  
ATOM   2673  H  HE1  . PHE A 1 4   ? 22.573  16.757 42.299  1.00 0.00  ? 4   PHE A HE1  2  
ATOM   2674  H  HE2  . PHE A 1 4   ? 22.417  14.990 38.389  1.00 0.00  ? 4   PHE A HE2  2  
ATOM   2675  H  HZ   . PHE A 1 4   ? 21.362  15.436 40.588  1.00 0.00  ? 4   PHE A HZ   2  
ATOM   2676  N  N    . PHE A 1 5   ? 28.736  15.787 38.897  1.00 0.00  ? 5   PHE A N    2  
ATOM   2677  C  CA   . PHE A 1 5   ? 30.042  15.603 38.197  1.00 0.00  ? 5   PHE A CA   2  
ATOM   2678  C  C    . PHE A 1 5   ? 30.198  16.705 37.146  1.00 0.00  ? 5   PHE A C    2  
ATOM   2679  O  O    . PHE A 1 5   ? 29.243  17.379 36.810  1.00 0.00  ? 5   PHE A O    2  
ATOM   2680  C  CB   . PHE A 1 5   ? 30.106  14.226 37.509  1.00 0.00  ? 5   PHE A CB   2  
ATOM   2681  C  CG   . PHE A 1 5   ? 28.712  13.716 37.216  1.00 0.00  ? 5   PHE A CG   2  
ATOM   2682  C  CD1  . PHE A 1 5   ? 27.992  14.221 36.126  1.00 0.00  ? 5   PHE A CD1  2  
ATOM   2683  C  CD2  . PHE A 1 5   ? 28.137  12.740 38.040  1.00 0.00  ? 5   PHE A CD2  2  
ATOM   2684  C  CE1  . PHE A 1 5   ? 26.698  13.751 35.860  1.00 0.00  ? 5   PHE A CE1  2  
ATOM   2685  C  CE2  . PHE A 1 5   ? 26.845  12.270 37.773  1.00 0.00  ? 5   PHE A CE2  2  
ATOM   2686  C  CZ   . PHE A 1 5   ? 26.126  12.775 36.684  1.00 0.00  ? 5   PHE A CZ   2  
ATOM   2687  H  H    . PHE A 1 5   ? 27.944  15.287 38.615  1.00 0.00  ? 5   PHE A H    2  
ATOM   2688  H  HA   . PHE A 1 5   ? 30.844  15.684 38.917  1.00 0.00  ? 5   PHE A HA   2  
ATOM   2689  H  HB2  . PHE A 1 5   ? 30.654  14.315 36.582  1.00 0.00  ? 5   PHE A HB2  2  
ATOM   2690  H  HB3  . PHE A 1 5   ? 30.615  13.528 38.157  1.00 0.00  ? 5   PHE A HB3  2  
ATOM   2691  H  HD1  . PHE A 1 5   ? 28.434  14.972 35.489  1.00 0.00  ? 5   PHE A HD1  2  
ATOM   2692  H  HD2  . PHE A 1 5   ? 28.691  12.349 38.880  1.00 0.00  ? 5   PHE A HD2  2  
ATOM   2693  H  HE1  . PHE A 1 5   ? 26.143  14.141 35.020  1.00 0.00  ? 5   PHE A HE1  2  
ATOM   2694  H  HE2  . PHE A 1 5   ? 26.402  11.517 38.408  1.00 0.00  ? 5   PHE A HE2  2  
ATOM   2695  H  HZ   . PHE A 1 5   ? 25.130  12.413 36.479  1.00 0.00  ? 5   PHE A HZ   2  
ATOM   2696  N  N    . PRO A 1 6   ? 31.398  16.854 36.653  1.00 0.00  ? 6   PRO A N    2  
ATOM   2697  C  CA   . PRO A 1 6   ? 31.710  17.865 35.629  1.00 0.00  ? 6   PRO A CA   2  
ATOM   2698  C  C    . PRO A 1 6   ? 31.151  17.424 34.273  1.00 0.00  ? 6   PRO A C    2  
ATOM   2699  O  O    . PRO A 1 6   ? 30.276  16.581 34.205  1.00 0.00  ? 6   PRO A O    2  
ATOM   2700  C  CB   . PRO A 1 6   ? 33.242  17.912 35.623  1.00 0.00  ? 6   PRO A CB   2  
ATOM   2701  C  CG   . PRO A 1 6   ? 33.722  16.569 36.222  1.00 0.00  ? 6   PRO A CG   2  
ATOM   2702  C  CD   . PRO A 1 6   ? 32.551  16.025 37.063  1.00 0.00  ? 6   PRO A CD   2  
ATOM   2703  H  HA   . PRO A 1 6   ? 31.313  18.826 35.911  1.00 0.00  ? 6   PRO A HA   2  
ATOM   2704  H  HB2  . PRO A 1 6   ? 33.604  18.022 34.610  1.00 0.00  ? 6   PRO A HB2  2  
ATOM   2705  H  HB3  . PRO A 1 6   ? 33.593  18.729 36.235  1.00 0.00  ? 6   PRO A HB3  2  
ATOM   2706  H  HG2  . PRO A 1 6   ? 33.967  15.877 35.429  1.00 0.00  ? 6   PRO A HG2  2  
ATOM   2707  H  HG3  . PRO A 1 6   ? 34.580  16.730 36.855  1.00 0.00  ? 6   PRO A HG3  2  
ATOM   2708  H  HD2  . PRO A 1 6   ? 32.374  14.983 36.835  1.00 0.00  ? 6   PRO A HD2  2  
ATOM   2709  H  HD3  . PRO A 1 6   ? 32.747  16.157 38.115  1.00 0.00  ? 6   PRO A HD3  2  
ATOM   2710  N  N    . ARG A 1 7   ? 31.639  17.983 33.197  1.00 0.00  ? 7   ARG A N    2  
ATOM   2711  C  CA   . ARG A 1 7   ? 31.123  17.586 31.855  1.00 0.00  ? 7   ARG A CA   2  
ATOM   2712  C  C    . ARG A 1 7   ? 29.767  18.255 31.608  1.00 0.00  ? 7   ARG A C    2  
ATOM   2713  O  O    . ARG A 1 7   ? 28.786  17.601 31.313  1.00 0.00  ? 7   ARG A O    2  
ATOM   2714  C  CB   . ARG A 1 7   ? 30.953  16.067 31.811  1.00 0.00  ? 7   ARG A CB   2  
ATOM   2715  C  CG   . ARG A 1 7   ? 31.255  15.549 30.404  1.00 0.00  ? 7   ARG A CG   2  
ATOM   2716  C  CD   . ARG A 1 7   ? 31.247  14.019 30.415  1.00 0.00  ? 7   ARG A CD   2  
ATOM   2717  N  NE   . ARG A 1 7   ? 29.982  13.537 31.035  1.00 0.00  ? 7   ARG A NE   2  
ATOM   2718  C  CZ   . ARG A 1 7   ? 29.680  12.267 31.006  1.00 0.00  ? 7   ARG A CZ   2  
ATOM   2719  N  NH1  . ARG A 1 7   ? 30.485  11.414 30.431  1.00 0.00  ? 7   ARG A NH1  2  
ATOM   2720  N  NH2  . ARG A 1 7   ? 28.570  11.851 31.548  1.00 0.00  ? 7   ARG A NH2  2  
ATOM   2721  H  H    . ARG A 1 7   ? 32.341  18.663 33.272  1.00 0.00  ? 7   ARG A H    2  
ATOM   2722  H  HA   . ARG A 1 7   ? 31.822  17.893 31.091  1.00 0.00  ? 7   ARG A HA   2  
ATOM   2723  H  HB2  . ARG A 1 7   ? 31.634  15.611 32.516  1.00 0.00  ? 7   ARG A HB2  2  
ATOM   2724  H  HB3  . ARG A 1 7   ? 29.939  15.814 32.077  1.00 0.00  ? 7   ARG A HB3  2  
ATOM   2725  H  HG2  . ARG A 1 7   ? 30.504  15.910 29.717  1.00 0.00  ? 7   ARG A HG2  2  
ATOM   2726  H  HG3  . ARG A 1 7   ? 32.228  15.900 30.092  1.00 0.00  ? 7   ARG A HG3  2  
ATOM   2727  H  HD2  . ARG A 1 7   ? 31.317  13.650 29.401  1.00 0.00  ? 7   ARG A HD2  2  
ATOM   2728  H  HD3  . ARG A 1 7   ? 32.089  13.660 30.991  1.00 0.00  ? 7   ARG A HD3  2  
ATOM   2729  H  HE   . ARG A 1 7   ? 29.374  14.173 31.464  1.00 0.00  ? 7   ARG A HE   2  
ATOM   2730  H  HH11 . ARG A 1 7   ? 31.337  11.730 30.011  1.00 0.00  ? 7   ARG A HH11 2  
ATOM   2731  H  HH12 . ARG A 1 7   ? 30.247  10.444 30.407  1.00 0.00  ? 7   ARG A HH12 2  
ATOM   2732  H  HH21 . ARG A 1 7   ? 27.950  12.505 31.983  1.00 0.00  ? 7   ARG A HH21 2  
ATOM   2733  H  HH22 . ARG A 1 7   ? 28.339  10.878 31.532  1.00 0.00  ? 7   ARG A HH22 2  
ATOM   2734  N  N    . LYS A 1 8   ? 29.706  19.553 31.729  1.00 0.00  ? 8   LYS A N    2  
ATOM   2735  C  CA   . LYS A 1 8   ? 28.415  20.267 31.504  1.00 0.00  ? 8   LYS A CA   2  
ATOM   2736  C  C    . LYS A 1 8   ? 27.369  19.771 32.501  1.00 0.00  ? 8   LYS A C    2  
ATOM   2737  O  O    . LYS A 1 8   ? 27.334  18.602 32.833  1.00 0.00  ? 8   LYS A O    2  
ATOM   2738  C  CB   . LYS A 1 8   ? 27.903  19.990 30.087  1.00 0.00  ? 8   LYS A CB   2  
ATOM   2739  C  CG   . LYS A 1 8   ? 29.004  20.308 29.072  1.00 0.00  ? 8   LYS A CG   2  
ATOM   2740  C  CD   . LYS A 1 8   ? 29.126  19.161 28.066  1.00 0.00  ? 8   LYS A CD   2  
ATOM   2741  C  CE   . LYS A 1 8   ? 30.485  19.241 27.367  1.00 0.00  ? 8   LYS A CE   2  
ATOM   2742  N  NZ   . LYS A 1 8   ? 31.534  18.650 28.248  1.00 0.00  ? 8   LYS A NZ   2  
ATOM   2743  H  H    . LYS A 1 8   ? 30.510  20.060 31.969  1.00 0.00  ? 8   LYS A H    2  
ATOM   2744  H  HA   . LYS A 1 8   ? 28.566  21.328 31.632  1.00 0.00  ? 8   LYS A HA   2  
ATOM   2745  H  HB2  . LYS A 1 8   ? 27.620  18.949 30.006  1.00 0.00  ? 8   LYS A HB2  2  
ATOM   2746  H  HB3  . LYS A 1 8   ? 27.038  20.611 29.891  1.00 0.00  ? 8   LYS A HB3  2  
ATOM   2747  H  HG2  . LYS A 1 8   ? 28.759  21.224 28.549  1.00 0.00  ? 8   LYS A HG2  2  
ATOM   2748  H  HG3  . LYS A 1 8   ? 29.944  20.430 29.589  1.00 0.00  ? 8   LYS A HG3  2  
ATOM   2749  H  HD2  . LYS A 1 8   ? 29.043  18.216 28.586  1.00 0.00  ? 8   LYS A HD2  2  
ATOM   2750  H  HD3  . LYS A 1 8   ? 28.339  19.239 27.332  1.00 0.00  ? 8   LYS A HD3  2  
ATOM   2751  H  HE2  . LYS A 1 8   ? 30.444  18.693 26.438  1.00 0.00  ? 8   LYS A HE2  2  
ATOM   2752  H  HE3  . LYS A 1 8   ? 30.726  20.275 27.165  1.00 0.00  ? 8   LYS A HE3  2  
ATOM   2753  H  HZ1  . LYS A 1 8   ? 31.638  17.638 28.032  1.00 0.00  ? 8   LYS A HZ1  2  
ATOM   2754  H  HZ2  . LYS A 1 8   ? 31.257  18.767 29.244  1.00 0.00  ? 8   LYS A HZ2  2  
ATOM   2755  H  HZ3  . LYS A 1 8   ? 32.439  19.131 28.081  1.00 0.00  ? 8   LYS A HZ3  2  
ATOM   2756  N  N    . PRO A 1 9   ? 26.527  20.671 32.932  1.00 0.00  ? 9   PRO A N    2  
ATOM   2757  C  CA   . PRO A 1 9   ? 25.448  20.343 33.868  1.00 0.00  ? 9   PRO A CA   2  
ATOM   2758  C  C    . PRO A 1 9   ? 24.307  19.691 33.099  1.00 0.00  ? 9   PRO A C    2  
ATOM   2759  O  O    . PRO A 1 9   ? 23.175  20.129 33.137  1.00 0.00  ? 9   PRO A O    2  
ATOM   2760  C  CB   . PRO A 1 9   ? 25.036  21.700 34.438  1.00 0.00  ? 9   PRO A CB   2  
ATOM   2761  C  CG   . PRO A 1 9   ? 25.488  22.760 33.401  1.00 0.00  ? 9   PRO A CG   2  
ATOM   2762  C  CD   . PRO A 1 9   ? 26.572  22.094 32.533  1.00 0.00  ? 9   PRO A CD   2  
ATOM   2763  H  HA   . PRO A 1 9   ? 25.801  19.691 34.645  1.00 0.00  ? 9   PRO A HA   2  
ATOM   2764  H  HB2  . PRO A 1 9   ? 23.963  21.735 34.570  1.00 0.00  ? 9   PRO A HB2  2  
ATOM   2765  H  HB3  . PRO A 1 9   ? 25.535  21.874 35.377  1.00 0.00  ? 9   PRO A HB3  2  
ATOM   2766  H  HG2  . PRO A 1 9   ? 24.651  23.056 32.786  1.00 0.00  ? 9   PRO A HG2  2  
ATOM   2767  H  HG3  . PRO A 1 9   ? 25.903  23.619 33.905  1.00 0.00  ? 9   PRO A HG3  2  
ATOM   2768  H  HD2  . PRO A 1 9   ? 26.332  22.205 31.484  1.00 0.00  ? 9   PRO A HD2  2  
ATOM   2769  H  HD3  . PRO A 1 9   ? 27.543  22.512 32.751  1.00 0.00  ? 9   PRO A HD3  2  
ATOM   2770  N  N    . LYS A 1 10  ? 24.614  18.644 32.397  1.00 0.00  ? 10  LYS A N    2  
ATOM   2771  C  CA   . LYS A 1 10  ? 23.573  17.941 31.605  1.00 0.00  ? 10  LYS A CA   2  
ATOM   2772  C  C    . LYS A 1 10  ? 22.500  17.394 32.563  1.00 0.00  ? 10  LYS A C    2  
ATOM   2773  O  O    . LYS A 1 10  ? 22.091  18.063 33.492  1.00 0.00  ? 10  LYS A O    2  
ATOM   2774  C  CB   . LYS A 1 10  ? 24.227  16.794 30.826  1.00 0.00  ? 10  LYS A CB   2  
ATOM   2775  C  CG   . LYS A 1 10  ? 25.528  17.292 30.186  1.00 0.00  ? 10  LYS A CG   2  
ATOM   2776  C  CD   . LYS A 1 10  ? 25.611  16.806 28.734  1.00 0.00  ? 10  LYS A CD   2  
ATOM   2777  C  CE   . LYS A 1 10  ? 25.598  18.009 27.787  1.00 0.00  ? 10  LYS A CE   2  
ATOM   2778  N  NZ   . LYS A 1 10  ? 25.380  17.542 26.389  1.00 0.00  ? 10  LYS A NZ   2  
ATOM   2779  H  H    . LYS A 1 10  ? 25.539  18.323 32.392  1.00 0.00  ? 10  LYS A H    2  
ATOM   2780  H  HA   . LYS A 1 10  ? 23.129  18.638 30.911  1.00 0.00  ? 10  LYS A HA   2  
ATOM   2781  H  HB2  . LYS A 1 10  ? 24.447  15.978 31.500  1.00 0.00  ? 10  LYS A HB2  2  
ATOM   2782  H  HB3  . LYS A 1 10  ? 23.555  16.452 30.055  1.00 0.00  ? 10  LYS A HB3  2  
ATOM   2783  H  HG2  . LYS A 1 10  ? 25.551  18.372 30.209  1.00 0.00  ? 10  LYS A HG2  2  
ATOM   2784  H  HG3  . LYS A 1 10  ? 26.369  16.905 30.740  1.00 0.00  ? 10  LYS A HG3  2  
ATOM   2785  H  HD2  . LYS A 1 10  ? 26.528  16.250 28.594  1.00 0.00  ? 10  LYS A HD2  2  
ATOM   2786  H  HD3  . LYS A 1 10  ? 24.767  16.169 28.516  1.00 0.00  ? 10  LYS A HD3  2  
ATOM   2787  H  HE2  . LYS A 1 10  ? 24.803  18.683 28.069  1.00 0.00  ? 10  LYS A HE2  2  
ATOM   2788  H  HE3  . LYS A 1 10  ? 26.546  18.524 27.848  1.00 0.00  ? 10  LYS A HE3  2  
ATOM   2789  H  HZ1  . LYS A 1 10  ? 24.769  16.701 26.395  1.00 0.00  ? 10  LYS A HZ1  2  
ATOM   2790  H  HZ2  . LYS A 1 10  ? 26.298  17.302 25.958  1.00 0.00  ? 10  LYS A HZ2  2  
ATOM   2791  H  HZ3  . LYS A 1 10  ? 24.924  18.296 25.837  1.00 0.00  ? 10  LYS A HZ3  2  
ATOM   2792  N  N    . TRP A 1 11  ? 22.048  16.183 32.356  1.00 0.00  ? 11  TRP A N    2  
ATOM   2793  C  CA   . TRP A 1 11  ? 21.018  15.598 33.265  1.00 0.00  ? 11  TRP A CA   2  
ATOM   2794  C  C    . TRP A 1 11  ? 20.990  14.079 33.064  1.00 0.00  ? 11  TRP A C    2  
ATOM   2795  O  O    . TRP A 1 11  ? 19.941  13.474 32.972  1.00 0.00  ? 11  TRP A O    2  
ATOM   2796  C  CB   . TRP A 1 11  ? 19.634  16.181 32.946  1.00 0.00  ? 11  TRP A CB   2  
ATOM   2797  C  CG   . TRP A 1 11  ? 19.240  17.189 33.990  1.00 0.00  ? 11  TRP A CG   2  
ATOM   2798  C  CD1  . TRP A 1 11  ? 18.537  18.323 33.745  1.00 0.00  ? 11  TRP A CD1  2  
ATOM   2799  C  CD2  . TRP A 1 11  ? 19.495  17.173 35.432  1.00 0.00  ? 11  TRP A CD2  2  
ATOM   2800  N  NE1  . TRP A 1 11  ? 18.361  19.008 34.934  1.00 0.00  ? 11  TRP A NE1  2  
ATOM   2801  C  CE2  . TRP A 1 11  ? 18.931  18.343 36.001  1.00 0.00  ? 11  TRP A CE2  2  
ATOM   2802  C  CE3  . TRP A 1 11  ? 20.158  16.277 36.293  1.00 0.00  ? 11  TRP A CE3  2  
ATOM   2803  C  CZ2  . TRP A 1 11  ? 19.021  18.610 37.371  1.00 0.00  ? 11  TRP A CZ2  2  
ATOM   2804  C  CZ3  . TRP A 1 11  ? 20.247  16.543 37.670  1.00 0.00  ? 11  TRP A CZ3  2  
ATOM   2805  C  CH2  . TRP A 1 11  ? 19.682  17.707 38.207  1.00 0.00  ? 11  TRP A CH2  2  
ATOM   2806  H  H    . TRP A 1 11  ? 22.392  15.651 31.611  1.00 0.00  ? 11  TRP A H    2  
ATOM   2807  H  HA   . TRP A 1 11  ? 21.279  15.822 34.288  1.00 0.00  ? 11  TRP A HA   2  
ATOM   2808  H  HB2  . TRP A 1 11  ? 19.664  16.659 31.979  1.00 0.00  ? 11  TRP A HB2  2  
ATOM   2809  H  HB3  . TRP A 1 11  ? 18.906  15.382 32.927  1.00 0.00  ? 11  TRP A HB3  2  
ATOM   2810  H  HD1  . TRP A 1 11  ? 18.173  18.645 32.776  1.00 0.00  ? 11  TRP A HD1  2  
ATOM   2811  H  HE1  . TRP A 1 11  ? 17.889  19.864 35.027  1.00 0.00  ? 11  TRP A HE1  2  
ATOM   2812  H  HE3  . TRP A 1 11  ? 20.595  15.374 35.895  1.00 0.00  ? 11  TRP A HE3  2  
ATOM   2813  H  HZ2  . TRP A 1 11  ? 18.584  19.509 37.781  1.00 0.00  ? 11  TRP A HZ2  2  
ATOM   2814  H  HZ3  . TRP A 1 11  ? 20.757  15.846 38.318  1.00 0.00  ? 11  TRP A HZ3  2  
ATOM   2815  H  HH2  . TRP A 1 11  ? 19.755  17.904 39.268  1.00 0.00  ? 11  TRP A HH2  2  
ATOM   2816  N  N    . ASP A 1 12  ? 22.141  13.461 32.991  1.00 0.00  ? 12  ASP A N    2  
ATOM   2817  C  CA   . ASP A 1 12  ? 22.191  11.980 32.792  1.00 0.00  ? 12  ASP A CA   2  
ATOM   2818  C  C    . ASP A 1 12  ? 21.971  11.282 34.133  1.00 0.00  ? 12  ASP A C    2  
ATOM   2819  O  O    . ASP A 1 12  ? 22.909  10.933 34.823  1.00 0.00  ? 12  ASP A O    2  
ATOM   2820  C  CB   . ASP A 1 12  ? 23.564  11.587 32.238  1.00 0.00  ? 12  ASP A CB   2  
ATOM   2821  C  CG   . ASP A 1 12  ? 23.760  10.072 32.354  1.00 0.00  ? 12  ASP A CG   2  
ATOM   2822  O  OD1  . ASP A 1 12  ? 22.888  9.346  31.908  1.00 0.00  ? 12  ASP A OD1  2  
ATOM   2823  O  OD2  . ASP A 1 12  ? 24.781  9.665  32.886  1.00 0.00  ? 12  ASP A OD2  2  
ATOM   2824  H  H    . ASP A 1 12  ? 22.975  13.971 33.065  1.00 0.00  ? 12  ASP A H    2  
ATOM   2825  H  HA   . ASP A 1 12  ? 21.422  11.680 32.095  1.00 0.00  ? 12  ASP A HA   2  
ATOM   2826  H  HB2  . ASP A 1 12  ? 23.630  11.880 31.202  1.00 0.00  ? 12  ASP A HB2  2  
ATOM   2827  H  HB3  . ASP A 1 12  ? 24.333  12.089 32.804  1.00 0.00  ? 12  ASP A HB3  2  
ATOM   2828  N  N    . LYS A 1 13  ? 20.743  11.079 34.512  1.00 0.00  ? 13  LYS A N    2  
ATOM   2829  C  CA   . LYS A 1 13  ? 20.473  10.404 35.810  1.00 0.00  ? 13  LYS A CA   2  
ATOM   2830  C  C    . LYS A 1 13  ? 19.272  9.469  35.654  1.00 0.00  ? 13  LYS A C    2  
ATOM   2831  O  O    . LYS A 1 13  ? 18.140  9.908  35.640  1.00 0.00  ? 13  LYS A O    2  
ATOM   2832  C  CB   . LYS A 1 13  ? 20.171  11.460 36.876  1.00 0.00  ? 13  LYS A CB   2  
ATOM   2833  C  CG   . LYS A 1 13  ? 19.032  12.358 36.393  1.00 0.00  ? 13  LYS A CG   2  
ATOM   2834  C  CD   . LYS A 1 13  ? 17.841  12.219 37.342  1.00 0.00  ? 13  LYS A CD   2  
ATOM   2835  C  CE   . LYS A 1 13  ? 17.171  13.583 37.521  1.00 0.00  ? 13  LYS A CE   2  
ATOM   2836  N  NZ   . LYS A 1 13  ? 17.785  14.282 38.685  1.00 0.00  ? 13  LYS A NZ   2  
ATOM   2837  H  H    . LYS A 1 13  ? 19.998  11.371 33.946  1.00 0.00  ? 13  LYS A H    2  
ATOM   2838  H  HA   . LYS A 1 13  ? 21.340  9.832  36.104  1.00 0.00  ? 13  LYS A HA   2  
ATOM   2839  H  HB2  . LYS A 1 13  ? 19.883  10.973 37.795  1.00 0.00  ? 13  LYS A HB2  2  
ATOM   2840  H  HB3  . LYS A 1 13  ? 21.051  12.060 37.047  1.00 0.00  ? 13  LYS A HB3  2  
ATOM   2841  H  HG2  . LYS A 1 13  ? 19.364  13.387 36.376  1.00 0.00  ? 13  LYS A HG2  2  
ATOM   2842  H  HG3  . LYS A 1 13  ? 18.735  12.057 35.401  1.00 0.00  ? 13  LYS A HG3  2  
ATOM   2843  H  HD2  . LYS A 1 13  ? 17.135  11.518 36.926  1.00 0.00  ? 13  LYS A HD2  2  
ATOM   2844  H  HD3  . LYS A 1 13  ? 18.184  11.861 38.300  1.00 0.00  ? 13  LYS A HD3  2  
ATOM   2845  H  HE2  . LYS A 1 13  ? 17.315  14.175 36.629  1.00 0.00  ? 13  LYS A HE2  2  
ATOM   2846  H  HE3  . LYS A 1 13  ? 16.115  13.447 37.699  1.00 0.00  ? 13  LYS A HE3  2  
ATOM   2847  H  HZ1  . LYS A 1 13  ? 18.472  14.983 38.343  1.00 0.00  ? 13  LYS A HZ1  2  
ATOM   2848  H  HZ2  . LYS A 1 13  ? 18.268  13.587 39.290  1.00 0.00  ? 13  LYS A HZ2  2  
ATOM   2849  H  HZ3  . LYS A 1 13  ? 17.044  14.764 39.233  1.00 0.00  ? 13  LYS A HZ3  2  
ATOM   2850  N  N    . ASN A 1 14  ? 19.520  8.186  35.528  1.00 0.00  ? 14  ASN A N    2  
ATOM   2851  C  CA   . ASN A 1 14  ? 18.403  7.202  35.366  1.00 0.00  ? 14  ASN A CA   2  
ATOM   2852  C  C    . ASN A 1 14  ? 17.182  7.659  36.168  1.00 0.00  ? 14  ASN A C    2  
ATOM   2853  O  O    . ASN A 1 14  ? 16.305  8.319  35.647  1.00 0.00  ? 14  ASN A O    2  
ATOM   2854  C  CB   . ASN A 1 14  ? 18.860  5.825  35.862  1.00 0.00  ? 14  ASN A CB   2  
ATOM   2855  C  CG   . ASN A 1 14  ? 19.713  5.152  34.783  1.00 0.00  ? 14  ASN A CG   2  
ATOM   2856  O  OD1  . ASN A 1 14  ? 20.312  5.822  33.965  1.00 0.00  ? 14  ASN A OD1  2  
ATOM   2857  N  ND2  . ASN A 1 14  ? 19.795  3.848  34.744  1.00 0.00  ? 14  ASN A ND2  2  
ATOM   2858  H  H    . ASN A 1 14  ? 20.446  7.868  35.535  1.00 0.00  ? 14  ASN A H    2  
ATOM   2859  H  HA   . ASN A 1 14  ? 18.136  7.135  34.322  1.00 0.00  ? 14  ASN A HA   2  
ATOM   2860  H  HB2  . ASN A 1 14  ? 19.447  5.944  36.763  1.00 0.00  ? 14  ASN A HB2  2  
ATOM   2861  H  HB3  . ASN A 1 14  ? 17.997  5.210  36.073  1.00 0.00  ? 14  ASN A HB3  2  
ATOM   2862  H  HD21 . ASN A 1 14  ? 19.311  3.305  35.402  1.00 0.00  ? 14  ASN A HD21 2  
ATOM   2863  H  HD22 . ASN A 1 14  ? 20.344  3.412  34.060  1.00 0.00  ? 14  ASN A HD22 2  
ATOM   2864  N  N    . GLN A 1 15  ? 17.113  7.331  37.429  1.00 0.00  ? 15  GLN A N    2  
ATOM   2865  C  CA   . GLN A 1 15  ? 15.942  7.773  38.234  1.00 0.00  ? 15  GLN A CA   2  
ATOM   2866  C  C    . GLN A 1 15  ? 15.757  9.283  38.067  1.00 0.00  ? 15  GLN A C    2  
ATOM   2867  O  O    . GLN A 1 15  ? 16.518  10.069 38.597  1.00 0.00  ? 15  GLN A O    2  
ATOM   2868  C  CB   . GLN A 1 15  ? 16.170  7.445  39.715  1.00 0.00  ? 15  GLN A CB   2  
ATOM   2869  C  CG   . GLN A 1 15  ? 17.492  8.054  40.185  1.00 0.00  ? 15  GLN A CG   2  
ATOM   2870  C  CD   . GLN A 1 15  ? 18.064  7.215  41.332  1.00 0.00  ? 15  GLN A CD   2  
ATOM   2871  O  OE1  . GLN A 1 15  ? 17.616  7.316  42.456  1.00 0.00  ? 15  GLN A OE1  2  
ATOM   2872  N  NE2  . GLN A 1 15  ? 19.044  6.387  41.093  1.00 0.00  ? 15  GLN A NE2  2  
ATOM   2873  H  H    . GLN A 1 15  ? 17.829  6.805  37.845  1.00 0.00  ? 15  GLN A H    2  
ATOM   2874  H  HA   . GLN A 1 15  ? 15.057  7.266  37.887  1.00 0.00  ? 15  GLN A HA   2  
ATOM   2875  H  HB2  . GLN A 1 15  ? 15.361  7.855  40.300  1.00 0.00  ? 15  GLN A HB2  2  
ATOM   2876  H  HB3  . GLN A 1 15  ? 16.204  6.374  39.847  1.00 0.00  ? 15  GLN A HB3  2  
ATOM   2877  H  HG2  . GLN A 1 15  ? 18.192  8.069  39.366  1.00 0.00  ? 15  GLN A HG2  2  
ATOM   2878  H  HG3  . GLN A 1 15  ? 17.319  9.062  40.531  1.00 0.00  ? 15  GLN A HG3  2  
ATOM   2879  H  HE21 . GLN A 1 15  ? 19.407  6.304  40.186  1.00 0.00  ? 15  GLN A HE21 2  
ATOM   2880  H  HE22 . GLN A 1 15  ? 19.420  5.850  41.822  1.00 0.00  ? 15  GLN A HE22 2  
ATOM   2881  N  N    . ILE A 1 16  ? 14.753  9.702  37.339  1.00 0.00  ? 16  ILE A N    2  
ATOM   2882  C  CA   . ILE A 1 16  ? 14.540  11.165 37.160  1.00 0.00  ? 16  ILE A CA   2  
ATOM   2883  C  C    . ILE A 1 16  ? 13.371  11.620 38.028  1.00 0.00  ? 16  ILE A C    2  
ATOM   2884  O  O    . ILE A 1 16  ? 12.572  10.825 38.481  1.00 0.00  ? 16  ILE A O    2  
ATOM   2885  C  CB   . ILE A 1 16  ? 14.235  11.497 35.699  1.00 0.00  ? 16  ILE A CB   2  
ATOM   2886  C  CG1  . ILE A 1 16  ? 15.261  10.802 34.791  1.00 0.00  ? 16  ILE A CG1  2  
ATOM   2887  C  CG2  . ILE A 1 16  ? 14.317  13.018 35.524  1.00 0.00  ? 16  ILE A CG2  2  
ATOM   2888  C  CD1  . ILE A 1 16  ? 15.292  11.471 33.412  1.00 0.00  ? 16  ILE A CD1  2  
ATOM   2889  H  H    . ILE A 1 16  ? 14.140  9.059  36.920  1.00 0.00  ? 16  ILE A H    2  
ATOM   2890  H  HA   . ILE A 1 16  ? 15.431  11.693 37.461  1.00 0.00  ? 16  ILE A HA   2  
ATOM   2891  H  HB   . ILE A 1 16  ? 13.238  11.159 35.451  1.00 0.00  ? 16  ILE A HB   2  
ATOM   2892  H  HG12 . ILE A 1 16  ? 16.239  10.868 35.242  1.00 0.00  ? 16  ILE A HG12 2  
ATOM   2893  H  HG13 . ILE A 1 16  ? 14.989  9.763  34.675  1.00 0.00  ? 16  ILE A HG13 2  
ATOM   2894  H  HG21 . ILE A 1 16  ? 13.480  13.481 36.024  1.00 0.00  ? 16  ILE A HG21 2  
ATOM   2895  H  HG22 . ILE A 1 16  ? 14.292  13.268 34.474  1.00 0.00  ? 16  ILE A HG22 2  
ATOM   2896  H  HG23 . ILE A 1 16  ? 15.239  13.378 35.959  1.00 0.00  ? 16  ILE A HG23 2  
ATOM   2897  H  HD11 . ILE A 1 16  ? 14.531  12.235 33.361  1.00 0.00  ? 16  ILE A HD11 2  
ATOM   2898  H  HD12 . ILE A 1 16  ? 15.108  10.731 32.648  1.00 0.00  ? 16  ILE A HD12 2  
ATOM   2899  H  HD13 . ILE A 1 16  ? 16.262  11.918 33.253  1.00 0.00  ? 16  ILE A HD13 2  
ATOM   2900  N  N    . THR A 1 17  ? 13.269  12.898 38.256  1.00 0.00  ? 17  THR A N    2  
ATOM   2901  C  CA   . THR A 1 17  ? 12.157  13.426 39.088  1.00 0.00  ? 17  THR A CA   2  
ATOM   2902  C  C    . THR A 1 17  ? 11.575  14.665 38.402  1.00 0.00  ? 17  THR A C    2  
ATOM   2903  O  O    . THR A 1 17  ? 12.301  15.514 37.923  1.00 0.00  ? 17  THR A O    2  
ATOM   2904  C  CB   . THR A 1 17  ? 12.698  13.806 40.468  1.00 0.00  ? 17  THR A CB   2  
ATOM   2905  O  OG1  . THR A 1 17  ? 14.115  13.916 40.404  1.00 0.00  ? 17  THR A OG1  2  
ATOM   2906  C  CG2  . THR A 1 17  ? 12.313  12.729 41.482  1.00 0.00  ? 17  THR A CG2  2  
ATOM   2907  H  H    . THR A 1 17  ? 13.929  13.514 37.873  1.00 0.00  ? 17  THR A H    2  
ATOM   2908  H  HA   . THR A 1 17  ? 11.390  12.671 39.194  1.00 0.00  ? 17  THR A HA   2  
ATOM   2909  H  HB   . THR A 1 17  ? 12.276  14.750 40.774  1.00 0.00  ? 17  THR A HB   2  
ATOM   2910  H  HG1  . THR A 1 17  ? 14.375  14.689 40.910  1.00 0.00  ? 17  THR A HG1  2  
ATOM   2911  H  HG21 . THR A 1 17  ? 11.485  12.152 41.098  1.00 0.00  ? 17  THR A HG21 2  
ATOM   2912  H  HG22 . THR A 1 17  ? 12.026  13.197 42.411  1.00 0.00  ? 17  THR A HG22 2  
ATOM   2913  H  HG23 . THR A 1 17  ? 13.157  12.076 41.654  1.00 0.00  ? 17  THR A HG23 2  
ATOM   2914  N  N    . TYR A 1 18  ? 10.275  14.778 38.344  1.00 0.00  ? 18  TYR A N    2  
ATOM   2915  C  CA   . TYR A 1 18  ? 9.667   15.969 37.681  1.00 0.00  ? 18  TYR A CA   2  
ATOM   2916  C  C    . TYR A 1 18  ? 8.413   16.415 38.435  1.00 0.00  ? 18  TYR A C    2  
ATOM   2917  O  O    . TYR A 1 18  ? 7.858   15.681 39.227  1.00 0.00  ? 18  TYR A O    2  
ATOM   2918  C  CB   . TYR A 1 18  ? 9.327   15.633 36.225  1.00 0.00  ? 18  TYR A CB   2  
ATOM   2919  C  CG   . TYR A 1 18  ? 7.971   14.961 36.108  1.00 0.00  ? 18  TYR A CG   2  
ATOM   2920  C  CD1  . TYR A 1 18  ? 7.519   14.087 37.103  1.00 0.00  ? 18  TYR A CD1  2  
ATOM   2921  C  CD2  . TYR A 1 18  ? 7.176   15.203 34.980  1.00 0.00  ? 18  TYR A CD2  2  
ATOM   2922  C  CE1  . TYR A 1 18  ? 6.277   13.456 36.970  1.00 0.00  ? 18  TYR A CE1  2  
ATOM   2923  C  CE2  . TYR A 1 18  ? 5.931   14.575 34.850  1.00 0.00  ? 18  TYR A CE2  2  
ATOM   2924  C  CZ   . TYR A 1 18  ? 5.483   13.700 35.845  1.00 0.00  ? 18  TYR A CZ   2  
ATOM   2925  O  OH   . TYR A 1 18  ? 4.261   13.070 35.714  1.00 0.00  ? 18  TYR A OH   2  
ATOM   2926  H  H    . TYR A 1 18  ? 9.706   14.085 38.734  1.00 0.00  ? 18  TYR A H    2  
ATOM   2927  H  HA   . TYR A 1 18  ? 10.386  16.776 37.693  1.00 0.00  ? 18  TYR A HA   2  
ATOM   2928  H  HB2  . TYR A 1 18  ? 9.319   16.545 35.649  1.00 0.00  ? 18  TYR A HB2  2  
ATOM   2929  H  HB3  . TYR A 1 18  ? 10.082  14.971 35.831  1.00 0.00  ? 18  TYR A HB3  2  
ATOM   2930  H  HD1  . TYR A 1 18  ? 8.125   13.896 37.970  1.00 0.00  ? 18  TYR A HD1  2  
ATOM   2931  H  HD2  . TYR A 1 18  ? 7.522   15.879 34.211  1.00 0.00  ? 18  TYR A HD2  2  
ATOM   2932  H  HE1  . TYR A 1 18  ? 5.932   12.782 37.739  1.00 0.00  ? 18  TYR A HE1  2  
ATOM   2933  H  HE2  . TYR A 1 18  ? 5.318   14.764 33.980  1.00 0.00  ? 18  TYR A HE2  2  
ATOM   2934  H  HH   . TYR A 1 18  ? 3.579   13.682 35.994  1.00 0.00  ? 18  TYR A HH   2  
ATOM   2935  N  N    . ARG A 1 19  ? 7.974   17.623 38.201  1.00 0.00  ? 19  ARG A N    2  
ATOM   2936  C  CA   . ARG A 1 19  ? 6.770   18.133 38.914  1.00 0.00  ? 19  ARG A CA   2  
ATOM   2937  C  C    . ARG A 1 19  ? 5.985   19.061 37.973  1.00 0.00  ? 19  ARG A C    2  
ATOM   2938  O  O    . ARG A 1 19  ? 6.496   20.060 37.499  1.00 0.00  ? 19  ARG A O    2  
ATOM   2939  C  CB   . ARG A 1 19  ? 7.241   18.900 40.157  1.00 0.00  ? 19  ARG A CB   2  
ATOM   2940  C  CG   . ARG A 1 19  ? 6.134   19.820 40.674  1.00 0.00  ? 19  ARG A CG   2  
ATOM   2941  C  CD   . ARG A 1 19  ? 5.005   18.978 41.270  1.00 0.00  ? 19  ARG A CD   2  
ATOM   2942  N  NE   . ARG A 1 19  ? 3.713   19.377 40.647  1.00 0.00  ? 19  ARG A NE   2  
ATOM   2943  C  CZ   . ARG A 1 19  ? 2.581   19.052 41.210  1.00 0.00  ? 19  ARG A CZ   2  
ATOM   2944  N  NH1  . ARG A 1 19  ? 2.572   18.388 42.336  1.00 0.00  ? 19  ARG A NH1  2  
ATOM   2945  N  NH2  . ARG A 1 19  ? 1.457   19.403 40.652  1.00 0.00  ? 19  ARG A NH2  2  
ATOM   2946  H  H    . ARG A 1 19  ? 8.445   18.202 37.565  1.00 0.00  ? 19  ARG A H    2  
ATOM   2947  H  HA   . ARG A 1 19  ? 6.147   17.300 39.215  1.00 0.00  ? 19  ARG A HA   2  
ATOM   2948  H  HB2  . ARG A 1 19  ? 7.511   18.196 40.930  1.00 0.00  ? 19  ARG A HB2  2  
ATOM   2949  H  HB3  . ARG A 1 19  ? 8.106   19.493 39.900  1.00 0.00  ? 19  ARG A HB3  2  
ATOM   2950  H  HG2  . ARG A 1 19  ? 6.537   20.471 41.437  1.00 0.00  ? 19  ARG A HG2  2  
ATOM   2951  H  HG3  . ARG A 1 19  ? 5.749   20.415 39.861  1.00 0.00  ? 19  ARG A HG3  2  
ATOM   2952  H  HD2  . ARG A 1 19  ? 5.194   17.933 41.074  1.00 0.00  ? 19  ARG A HD2  2  
ATOM   2953  H  HD3  . ARG A 1 19  ? 4.957   19.142 42.337  1.00 0.00  ? 19  ARG A HD3  2  
ATOM   2954  H  HE   . ARG A 1 19  ? 3.713   19.884 39.808  1.00 0.00  ? 19  ARG A HE   2  
ATOM   2955  H  HH11 . ARG A 1 19  ? 3.434   18.128 42.771  1.00 0.00  ? 19  ARG A HH11 2  
ATOM   2956  H  HH12 . ARG A 1 19  ? 1.702   18.137 42.762  1.00 0.00  ? 19  ARG A HH12 2  
ATOM   2957  H  HH21 . ARG A 1 19  ? 1.465   19.922 39.795  1.00 0.00  ? 19  ARG A HH21 2  
ATOM   2958  H  HH22 . ARG A 1 19  ? 0.588   19.149 41.074  1.00 0.00  ? 19  ARG A HH22 2  
ATOM   2959  N  N    . ILE A 1 20  ? 4.749   18.737 37.690  1.00 0.00  ? 20  ILE A N    2  
ATOM   2960  C  CA   . ILE A 1 20  ? 3.941   19.598 36.775  1.00 0.00  ? 20  ILE A CA   2  
ATOM   2961  C  C    . ILE A 1 20  ? 3.341   20.763 37.568  1.00 0.00  ? 20  ILE A C    2  
ATOM   2962  O  O    . ILE A 1 20  ? 2.494   20.574 38.420  1.00 0.00  ? 20  ILE A O    2  
ATOM   2963  C  CB   . ILE A 1 20  ? 2.809   18.770 36.158  1.00 0.00  ? 20  ILE A CB   2  
ATOM   2964  C  CG1  . ILE A 1 20  ? 3.393   17.561 35.425  1.00 0.00  ? 20  ILE A CG1  2  
ATOM   2965  C  CG2  . ILE A 1 20  ? 2.017   19.627 35.168  1.00 0.00  ? 20  ILE A CG2  2  
ATOM   2966  C  CD1  . ILE A 1 20  ? 2.873   16.280 36.077  1.00 0.00  ? 20  ILE A CD1  2  
ATOM   2967  H  H    . ILE A 1 20  ? 4.354   17.927 38.075  1.00 0.00  ? 20  ILE A H    2  
ATOM   2968  H  HA   . ILE A 1 20  ? 4.577   19.984 35.991  1.00 0.00  ? 20  ILE A HA   2  
ATOM   2969  H  HB   . ILE A 1 20  ? 2.148   18.428 36.942  1.00 0.00  ? 20  ILE A HB   2  
ATOM   2970  H  HG12 . ILE A 1 20  ? 3.090   17.587 34.389  1.00 0.00  ? 20  ILE A HG12 2  
ATOM   2971  H  HG13 . ILE A 1 20  ? 4.471   17.583 35.488  1.00 0.00  ? 20  ILE A HG13 2  
ATOM   2972  H  HG21 . ILE A 1 20  ? 1.205   20.116 35.685  1.00 0.00  ? 20  ILE A HG21 2  
ATOM   2973  H  HG22 . ILE A 1 20  ? 1.617   18.996 34.387  1.00 0.00  ? 20  ILE A HG22 2  
ATOM   2974  H  HG23 . ILE A 1 20  ? 2.667   20.370 34.733  1.00 0.00  ? 20  ILE A HG23 2  
ATOM   2975  H  HD11 . ILE A 1 20  ? 2.692   15.535 35.316  1.00 0.00  ? 20  ILE A HD11 2  
ATOM   2976  H  HD12 . ILE A 1 20  ? 1.951   16.493 36.598  1.00 0.00  ? 20  ILE A HD12 2  
ATOM   2977  H  HD13 . ILE A 1 20  ? 3.607   15.910 36.777  1.00 0.00  ? 20  ILE A HD13 2  
ATOM   2978  N  N    . ILE A 1 21  ? 3.770   21.965 37.297  1.00 0.00  ? 21  ILE A N    2  
ATOM   2979  C  CA   . ILE A 1 21  ? 3.219   23.135 38.036  1.00 0.00  ? 21  ILE A CA   2  
ATOM   2980  C  C    . ILE A 1 21  ? 1.991   23.672 37.299  1.00 0.00  ? 21  ILE A C    2  
ATOM   2981  O  O    . ILE A 1 21  ? 1.556   24.785 37.520  1.00 0.00  ? 21  ILE A O    2  
ATOM   2982  C  CB   . ILE A 1 21  ? 4.284   24.226 38.124  1.00 0.00  ? 21  ILE A CB   2  
ATOM   2983  C  CG1  . ILE A 1 21  ? 5.645   23.580 38.392  1.00 0.00  ? 21  ILE A CG1  2  
ATOM   2984  C  CG2  . ILE A 1 21  ? 3.938   25.186 39.264  1.00 0.00  ? 21  ILE A CG2  2  
ATOM   2985  C  CD1  . ILE A 1 21  ? 6.733   24.655 38.359  1.00 0.00  ? 21  ILE A CD1  2  
ATOM   2986  H  H    . ILE A 1 21  ? 4.454   22.097 36.606  1.00 0.00  ? 21  ILE A H    2  
ATOM   2987  H  HA   . ILE A 1 21  ? 2.936   22.830 39.033  1.00 0.00  ? 21  ILE A HA   2  
ATOM   2988  H  HB   . ILE A 1 21  ? 4.318   24.771 37.193  1.00 0.00  ? 21  ILE A HB   2  
ATOM   2989  H  HG12 . ILE A 1 21  ? 5.636   23.103 39.363  1.00 0.00  ? 21  ILE A HG12 2  
ATOM   2990  H  HG13 . ILE A 1 21  ? 5.848   22.840 37.631  1.00 0.00  ? 21  ILE A HG13 2  
ATOM   2991  H  HG21 . ILE A 1 21  ? 3.664   24.620 40.141  1.00 0.00  ? 21  ILE A HG21 2  
ATOM   2992  H  HG22 . ILE A 1 21  ? 3.111   25.811 38.966  1.00 0.00  ? 21  ILE A HG22 2  
ATOM   2993  H  HG23 . ILE A 1 21  ? 4.795   25.806 39.488  1.00 0.00  ? 21  ILE A HG23 2  
ATOM   2994  H  HD11 . ILE A 1 21  ? 7.272   24.651 39.294  1.00 0.00  ? 21  ILE A HD11 2  
ATOM   2995  H  HD12 . ILE A 1 21  ? 6.276   25.623 38.212  1.00 0.00  ? 21  ILE A HD12 2  
ATOM   2996  H  HD13 . ILE A 1 21  ? 7.416   24.451 37.547  1.00 0.00  ? 21  ILE A HD13 2  
ATOM   2997  N  N    . GLY A 1 22  ? 1.426   22.884 36.427  1.00 0.00  ? 22  GLY A N    2  
ATOM   2998  C  CA   . GLY A 1 22  ? 0.222   23.341 35.675  1.00 0.00  ? 22  GLY A CA   2  
ATOM   2999  C  C    . GLY A 1 22  ? -0.043  22.396 34.499  1.00 0.00  ? 22  GLY A C    2  
ATOM   3000  O  O    . GLY A 1 22  ? 0.533   22.533 33.437  1.00 0.00  ? 22  GLY A O    2  
ATOM   3001  H  H    . GLY A 1 22  ? 1.791   21.990 36.267  1.00 0.00  ? 22  GLY A H    2  
ATOM   3002  H  HA2  . GLY A 1 22  ? -0.633  23.342 36.337  1.00 0.00  ? 22  GLY A HA2  2  
ATOM   3003  H  HA3  . GLY A 1 22  ? 0.390   24.340 35.300  1.00 0.00  ? 22  GLY A HA3  2  
ATOM   3004  N  N    . TYR A 1 23  ? -0.917  21.441 34.681  1.00 0.00  ? 23  TYR A N    2  
ATOM   3005  C  CA   . TYR A 1 23  ? -1.232  20.486 33.576  1.00 0.00  ? 23  TYR A CA   2  
ATOM   3006  C  C    . TYR A 1 23  ? -1.737  21.283 32.358  1.00 0.00  ? 23  TYR A C    2  
ATOM   3007  O  O    . TYR A 1 23  ? -1.005  22.055 31.771  1.00 0.00  ? 23  TYR A O    2  
ATOM   3008  C  CB   . TYR A 1 23  ? -2.307  19.497 34.052  1.00 0.00  ? 23  TYR A CB   2  
ATOM   3009  C  CG   . TYR A 1 23  ? -1.683  18.416 34.910  1.00 0.00  ? 23  TYR A CG   2  
ATOM   3010  C  CD1  . TYR A 1 23  ? -0.616  17.654 34.419  1.00 0.00  ? 23  TYR A CD1  2  
ATOM   3011  C  CD2  . TYR A 1 23  ? -2.180  18.177 36.198  1.00 0.00  ? 23  TYR A CD2  2  
ATOM   3012  C  CE1  . TYR A 1 23  ? -0.047  16.654 35.218  1.00 0.00  ? 23  TYR A CE1  2  
ATOM   3013  C  CE2  . TYR A 1 23  ? -1.610  17.178 36.994  1.00 0.00  ? 23  TYR A CE2  2  
ATOM   3014  C  CZ   . TYR A 1 23  ? -0.544  16.418 36.505  1.00 0.00  ? 23  TYR A CZ   2  
ATOM   3015  O  OH   . TYR A 1 23  ? 0.018   15.435 37.291  1.00 0.00  ? 23  TYR A OH   2  
ATOM   3016  H  H    . TYR A 1 23  ? -1.370  21.356 35.544  1.00 0.00  ? 23  TYR A H    2  
ATOM   3017  H  HA   . TYR A 1 23  ? -0.337  19.944 33.305  1.00 0.00  ? 23  TYR A HA   2  
ATOM   3018  H  HB2  . TYR A 1 23  ? -3.049  20.027 34.629  1.00 0.00  ? 23  TYR A HB2  2  
ATOM   3019  H  HB3  . TYR A 1 23  ? -2.778  19.041 33.197  1.00 0.00  ? 23  TYR A HB3  2  
ATOM   3020  H  HD1  . TYR A 1 23  ? -0.238  17.831 33.424  1.00 0.00  ? 23  TYR A HD1  2  
ATOM   3021  H  HD2  . TYR A 1 23  ? -3.008  18.760 36.576  1.00 0.00  ? 23  TYR A HD2  2  
ATOM   3022  H  HE1  . TYR A 1 23  ? 0.778   16.065 34.841  1.00 0.00  ? 23  TYR A HE1  2  
ATOM   3023  H  HE2  . TYR A 1 23  ? -1.990  16.994 37.988  1.00 0.00  ? 23  TYR A HE2  2  
ATOM   3024  H  HH   . TYR A 1 23  ? -0.236  15.603 38.202  1.00 0.00  ? 23  TYR A HH   2  
ATOM   3025  N  N    . THR A 1 24  ? -2.979  21.120 31.972  1.00 0.00  ? 24  THR A N    2  
ATOM   3026  C  CA   . THR A 1 24  ? -3.496  21.890 30.810  1.00 0.00  ? 24  THR A CA   2  
ATOM   3027  C  C    . THR A 1 24  ? -4.551  22.883 31.326  1.00 0.00  ? 24  THR A C    2  
ATOM   3028  O  O    . THR A 1 24  ? -4.835  22.905 32.507  1.00 0.00  ? 24  THR A O    2  
ATOM   3029  C  CB   . THR A 1 24  ? -4.072  20.893 29.780  1.00 0.00  ? 24  THR A CB   2  
ATOM   3030  O  OG1  . THR A 1 24  ? -3.642  21.260 28.477  1.00 0.00  ? 24  THR A OG1  2  
ATOM   3031  C  CG2  . THR A 1 24  ? -5.605  20.850 29.822  1.00 0.00  ? 24  THR A CG2  2  
ATOM   3032  H  H    . THR A 1 24  ? -3.574  20.507 32.448  1.00 0.00  ? 24  THR A H    2  
ATOM   3033  H  HA   . THR A 1 24  ? -2.682  22.442 30.362  1.00 0.00  ? 24  THR A HA   2  
ATOM   3034  H  HB   . THR A 1 24  ? -3.694  19.907 30.005  1.00 0.00  ? 24  THR A HB   2  
ATOM   3035  H  HG1  . THR A 1 24  ? -3.563  20.458 27.954  1.00 0.00  ? 24  THR A HG1  2  
ATOM   3036  H  HG21 . THR A 1 24  ? -5.957  21.142 30.800  1.00 0.00  ? 24  THR A HG21 2  
ATOM   3037  H  HG22 . THR A 1 24  ? -5.929  19.850 29.611  1.00 0.00  ? 24  THR A HG22 2  
ATOM   3038  H  HG23 . THR A 1 24  ? -6.010  21.512 29.080  1.00 0.00  ? 24  THR A HG23 2  
ATOM   3039  N  N    . PRO A 1 25  ? -5.098  23.679 30.443  1.00 0.00  ? 25  PRO A N    2  
ATOM   3040  C  CA   . PRO A 1 25  ? -6.113  24.678 30.823  1.00 0.00  ? 25  PRO A CA   2  
ATOM   3041  C  C    . PRO A 1 25  ? -7.488  24.047 31.067  1.00 0.00  ? 25  PRO A C    2  
ATOM   3042  O  O    . PRO A 1 25  ? -8.240  24.504 31.904  1.00 0.00  ? 25  PRO A O    2  
ATOM   3043  C  CB   . PRO A 1 25  ? -6.166  25.616 29.619  1.00 0.00  ? 25  PRO A CB   2  
ATOM   3044  C  CG   . PRO A 1 25  ? -5.613  24.820 28.418  1.00 0.00  ? 25  PRO A CG   2  
ATOM   3045  C  CD   . PRO A 1 25  ? -4.755  23.682 29.003  1.00 0.00  ? 25  PRO A CD   2  
ATOM   3046  H  HA   . PRO A 1 25  ? -5.796  25.224 31.691  1.00 0.00  ? 25  PRO A HA   2  
ATOM   3047  H  HB2  . PRO A 1 25  ? -7.189  25.909 29.429  1.00 0.00  ? 25  PRO A HB2  2  
ATOM   3048  H  HB3  . PRO A 1 25  ? -5.555  26.483 29.796  1.00 0.00  ? 25  PRO A HB3  2  
ATOM   3049  H  HG2  . PRO A 1 25  ? -6.434  24.411 27.841  1.00 0.00  ? 25  PRO A HG2  2  
ATOM   3050  H  HG3  . PRO A 1 25  ? -5.001  25.458 27.799  1.00 0.00  ? 25  PRO A HG3  2  
ATOM   3051  H  HD2  . PRO A 1 25  ? -5.019  22.751 28.539  1.00 0.00  ? 25  PRO A HD2  2  
ATOM   3052  H  HD3  . PRO A 1 25  ? -3.706  23.891 28.867  1.00 0.00  ? 25  PRO A HD3  2  
ATOM   3053  N  N    . ASP A 1 26  ? -7.844  23.031 30.336  1.00 0.00  ? 26  ASP A N    2  
ATOM   3054  C  CA   . ASP A 1 26  ? -9.198  22.433 30.547  1.00 0.00  ? 26  ASP A CA   2  
ATOM   3055  C  C    . ASP A 1 26  ? -9.281  20.992 30.032  1.00 0.00  ? 26  ASP A C    2  
ATOM   3056  O  O    . ASP A 1 26  ? -9.787  20.737 28.958  1.00 0.00  ? 26  ASP A O    2  
ATOM   3057  C  CB   . ASP A 1 26  ? -10.222 23.290 29.804  1.00 0.00  ? 26  ASP A CB   2  
ATOM   3058  C  CG   . ASP A 1 26  ? -11.556 22.544 29.683  1.00 0.00  ? 26  ASP A CG   2  
ATOM   3059  O  OD1  . ASP A 1 26  ? -12.333 22.602 30.622  1.00 0.00  ? 26  ASP A OD1  2  
ATOM   3060  O  OD2  . ASP A 1 26  ? -11.778 21.932 28.650  1.00 0.00  ? 26  ASP A OD2  2  
ATOM   3061  H  H    . ASP A 1 26  ? -7.246  22.688 29.648  1.00 0.00  ? 26  ASP A H    2  
ATOM   3062  H  HA   . ASP A 1 26  ? -9.429  22.444 31.600  1.00 0.00  ? 26  ASP A HA   2  
ATOM   3063  H  HB2  . ASP A 1 26  ? -10.372 24.209 30.346  1.00 0.00  ? 26  ASP A HB2  2  
ATOM   3064  H  HB3  . ASP A 1 26  ? -9.847  23.512 28.816  1.00 0.00  ? 26  ASP A HB3  2  
ATOM   3065  N  N    . LEU A 1 27  ? -8.827  20.050 30.802  1.00 0.00  ? 27  LEU A N    2  
ATOM   3066  C  CA   . LEU A 1 27  ? -8.923  18.633 30.378  1.00 0.00  ? 27  LEU A CA   2  
ATOM   3067  C  C    . LEU A 1 27  ? -8.906  17.747 31.621  1.00 0.00  ? 27  LEU A C    2  
ATOM   3068  O  O    . LEU A 1 27  ? -8.823  18.226 32.735  1.00 0.00  ? 27  LEU A O    2  
ATOM   3069  C  CB   . LEU A 1 27  ? -7.759  18.289 29.448  1.00 0.00  ? 27  LEU A CB   2  
ATOM   3070  C  CG   . LEU A 1 27  ? -6.602  17.697 30.248  1.00 0.00  ? 27  LEU A CG   2  
ATOM   3071  C  CD1  . LEU A 1 27  ? -5.378  17.574 29.348  1.00 0.00  ? 27  LEU A CD1  2  
ATOM   3072  C  CD2  . LEU A 1 27  ? -6.275  18.587 31.458  1.00 0.00  ? 27  LEU A CD2  2  
ATOM   3073  H  H    . LEU A 1 27  ? -8.440  20.269 31.674  1.00 0.00  ? 27  LEU A H    2  
ATOM   3074  H  HA   . LEU A 1 27  ? -9.844  18.478 29.855  1.00 0.00  ? 27  LEU A HA   2  
ATOM   3075  H  HB2  . LEU A 1 27  ? -8.094  17.563 28.719  1.00 0.00  ? 27  LEU A HB2  2  
ATOM   3076  H  HB3  . LEU A 1 27  ? -7.432  19.181 28.938  1.00 0.00  ? 27  LEU A HB3  2  
ATOM   3077  H  HG   . LEU A 1 27  ? -6.897  16.720 30.592  1.00 0.00  ? 27  LEU A HG   2  
ATOM   3078  H  HD11 . LEU A 1 27  ? -5.537  18.147 28.447  1.00 0.00  ? 27  LEU A HD11 2  
ATOM   3079  H  HD12 . LEU A 1 27  ? -5.224  16.537 29.092  1.00 0.00  ? 27  LEU A HD12 2  
ATOM   3080  H  HD13 . LEU A 1 27  ? -4.511  17.952 29.867  1.00 0.00  ? 27  LEU A HD13 2  
ATOM   3081  H  HD21 . LEU A 1 27  ? -5.209  18.751 31.507  1.00 0.00  ? 27  LEU A HD21 2  
ATOM   3082  H  HD22 . LEU A 1 27  ? -6.611  18.102 32.363  1.00 0.00  ? 27  LEU A HD22 2  
ATOM   3083  H  HD23 . LEU A 1 27  ? -6.779  19.534 31.357  1.00 0.00  ? 27  LEU A HD23 2  
ATOM   3084  N  N    . ASP A 1 28  ? -8.962  16.464 31.439  1.00 0.00  ? 28  ASP A N    2  
ATOM   3085  C  CA   . ASP A 1 28  ? -8.921  15.556 32.607  1.00 0.00  ? 28  ASP A CA   2  
ATOM   3086  C  C    . ASP A 1 28  ? -7.509  15.560 33.174  1.00 0.00  ? 28  ASP A C    2  
ATOM   3087  O  O    . ASP A 1 28  ? -6.554  15.488 32.435  1.00 0.00  ? 28  ASP A O    2  
ATOM   3088  C  CB   . ASP A 1 28  ? -9.308  14.147 32.164  1.00 0.00  ? 28  ASP A CB   2  
ATOM   3089  C  CG   . ASP A 1 28  ? -10.830 14.024 32.199  1.00 0.00  ? 28  ASP A CG   2  
ATOM   3090  O  OD1  . ASP A 1 28  ? -11.457 14.401 31.221  1.00 0.00  ? 28  ASP A OD1  2  
ATOM   3091  O  OD2  . ASP A 1 28  ? -11.343 13.567 33.206  1.00 0.00  ? 28  ASP A OD2  2  
ATOM   3092  H  H    . ASP A 1 28  ? -9.010  16.096 30.530  1.00 0.00  ? 28  ASP A H    2  
ATOM   3093  H  HA   . ASP A 1 28  ? -9.603  15.890 33.358  1.00 0.00  ? 28  ASP A HA   2  
ATOM   3094  H  HB2  . ASP A 1 28  ? -8.953  13.973 31.160  1.00 0.00  ? 28  ASP A HB2  2  
ATOM   3095  H  HB3  . ASP A 1 28  ? -8.873  13.423 32.834  1.00 0.00  ? 28  ASP A HB3  2  
ATOM   3096  N  N    . PRO A 1 29  ? -7.412  15.626 34.475  1.00 0.00  ? 29  PRO A N    2  
ATOM   3097  C  CA   . PRO A 1 29  ? -6.112  15.618 35.148  1.00 0.00  ? 29  PRO A CA   2  
ATOM   3098  C  C    . PRO A 1 29  ? -5.548  14.230 34.971  1.00 0.00  ? 29  PRO A C    2  
ATOM   3099  O  O    . PRO A 1 29  ? -4.357  14.027 34.839  1.00 0.00  ? 29  PRO A O    2  
ATOM   3100  C  CB   . PRO A 1 29  ? -6.446  15.940 36.604  1.00 0.00  ? 29  PRO A CB   2  
ATOM   3101  C  CG   . PRO A 1 29  ? -7.944  15.608 36.788  1.00 0.00  ? 29  PRO A CG   2  
ATOM   3102  C  CD   . PRO A 1 29  ? -8.573  15.673 35.385  1.00 0.00  ? 29  PRO A CD   2  
ATOM   3103  H  HA   . PRO A 1 29  ? -5.449  16.364 34.730  1.00 0.00  ? 29  PRO A HA   2  
ATOM   3104  H  HB2  . PRO A 1 29  ? -5.845  15.323 37.260  1.00 0.00  ? 29  PRO A HB2  2  
ATOM   3105  H  HB3  . PRO A 1 29  ? -6.275  16.983 36.805  1.00 0.00  ? 29  PRO A HB3  2  
ATOM   3106  H  HG2  . PRO A 1 29  ? -8.059  14.616 37.204  1.00 0.00  ? 29  PRO A HG2  2  
ATOM   3107  H  HG3  . PRO A 1 29  ? -8.411  16.339 37.428  1.00 0.00  ? 29  PRO A HG3  2  
ATOM   3108  H  HD2  . PRO A 1 29  ? -9.219  14.820 35.223  1.00 0.00  ? 29  PRO A HD2  2  
ATOM   3109  H  HD3  . PRO A 1 29  ? -9.116  16.596 35.252  1.00 0.00  ? 29  PRO A HD3  2  
ATOM   3110  N  N    . GLU A 1 30  ? -6.428  13.278 34.900  1.00 0.00  ? 30  GLU A N    2  
ATOM   3111  C  CA   . GLU A 1 30  ? -5.994  11.892 34.650  1.00 0.00  ? 30  GLU A CA   2  
ATOM   3112  C  C    . GLU A 1 30  ? -5.607  11.824 33.179  1.00 0.00  ? 30  GLU A C    2  
ATOM   3113  O  O    . GLU A 1 30  ? -4.685  11.129 32.798  1.00 0.00  ? 30  GLU A O    2  
ATOM   3114  C  CB   . GLU A 1 30  ? -7.133  10.921 34.949  1.00 0.00  ? 30  GLU A CB   2  
ATOM   3115  C  CG   . GLU A 1 30  ? -7.312  10.803 36.464  1.00 0.00  ? 30  GLU A CG   2  
ATOM   3116  C  CD   . GLU A 1 30  ? -6.347  9.750  37.013  1.00 0.00  ? 30  GLU A CD   2  
ATOM   3117  O  OE1  . GLU A 1 30  ? -5.167  9.843  36.716  1.00 0.00  ? 30  GLU A OE1  2  
ATOM   3118  O  OE2  . GLU A 1 30  ? -6.804  8.868  37.719  1.00 0.00  ? 30  GLU A OE2  2  
ATOM   3119  H  H    . GLU A 1 30  ? -7.384  13.491 34.966  1.00 0.00  ? 30  GLU A H    2  
ATOM   3120  H  HA   . GLU A 1 30  ? -5.136  11.661 35.262  1.00 0.00  ? 30  GLU A HA   2  
ATOM   3121  H  HB2  . GLU A 1 30  ? -8.046  11.288 34.503  1.00 0.00  ? 30  GLU A HB2  2  
ATOM   3122  H  HB3  . GLU A 1 30  ? -6.896  9.950  34.540  1.00 0.00  ? 30  GLU A HB3  2  
ATOM   3123  H  HG2  . GLU A 1 30  ? -7.104  11.759 36.925  1.00 0.00  ? 30  GLU A HG2  2  
ATOM   3124  H  HG3  . GLU A 1 30  ? -8.326  10.510 36.687  1.00 0.00  ? 30  GLU A HG3  2  
ATOM   3125  N  N    . THR A 1 31  ? -6.277  12.587 32.344  1.00 0.00  ? 31  THR A N    2  
ATOM   3126  C  CA   . THR A 1 31  ? -5.890  12.589 30.907  1.00 0.00  ? 31  THR A CA   2  
ATOM   3127  C  C    . THR A 1 31  ? -4.544  13.301 30.806  1.00 0.00  ? 31  THR A C    2  
ATOM   3128  O  O    . THR A 1 31  ? -3.546  12.724 30.429  1.00 0.00  ? 31  THR A O    2  
ATOM   3129  C  CB   . THR A 1 31  ? -6.926  13.345 30.068  1.00 0.00  ? 31  THR A CB   2  
ATOM   3130  O  OG1  . THR A 1 31  ? -8.064  12.518 29.860  1.00 0.00  ? 31  THR A OG1  2  
ATOM   3131  C  CG2  . THR A 1 31  ? -6.305  13.717 28.720  1.00 0.00  ? 31  THR A CG2  2  
ATOM   3132  H  H    . THR A 1 31  ? -7.002  13.182 32.673  1.00 0.00  ? 31  THR A H    2  
ATOM   3133  H  HA   . THR A 1 31  ? -5.796  11.574 30.551  1.00 0.00  ? 31  THR A HA   2  
ATOM   3134  H  HB   . THR A 1 31  ? -7.219  14.245 30.582  1.00 0.00  ? 31  THR A HB   2  
ATOM   3135  H  HG1  . THR A 1 31  ? -7.926  12.019 29.051  1.00 0.00  ? 31  THR A HG1  2  
ATOM   3136  H  HG21 . THR A 1 31  ? -6.994  13.478 27.925  1.00 0.00  ? 31  THR A HG21 2  
ATOM   3137  H  HG22 . THR A 1 31  ? -5.390  13.159 28.583  1.00 0.00  ? 31  THR A HG22 2  
ATOM   3138  H  HG23 . THR A 1 31  ? -6.087  14.774 28.706  1.00 0.00  ? 31  THR A HG23 2  
ATOM   3139  N  N    . VAL A 1 32  ? -4.515  14.554 31.167  1.00 0.00  ? 32  VAL A N    2  
ATOM   3140  C  CA   . VAL A 1 32  ? -3.247  15.315 31.124  1.00 0.00  ? 32  VAL A CA   2  
ATOM   3141  C  C    . VAL A 1 32  ? -2.166  14.496 31.833  1.00 0.00  ? 32  VAL A C    2  
ATOM   3142  O  O    . VAL A 1 32  ? -1.051  14.380 31.370  1.00 0.00  ? 32  VAL A O    2  
ATOM   3143  C  CB   . VAL A 1 32  ? -3.464  16.661 31.832  1.00 0.00  ? 32  VAL A CB   2  
ATOM   3144  C  CG1  . VAL A 1 32  ? -3.251  16.511 33.342  1.00 0.00  ? 32  VAL A CG1  2  
ATOM   3145  C  CG2  . VAL A 1 32  ? -2.482  17.695 31.273  1.00 0.00  ? 32  VAL A CG2  2  
ATOM   3146  H  H    . VAL A 1 32  ? -5.331  14.991 31.484  1.00 0.00  ? 32  VAL A H    2  
ATOM   3147  H  HA   . VAL A 1 32  ? -2.960  15.487 30.098  1.00 0.00  ? 32  VAL A HA   2  
ATOM   3148  H  HB   . VAL A 1 32  ? -4.475  16.992 31.655  1.00 0.00  ? 32  VAL A HB   2  
ATOM   3149  H  HG11 . VAL A 1 32  ? -3.906  15.745 33.724  1.00 0.00  ? 32  VAL A HG11 2  
ATOM   3150  H  HG12 . VAL A 1 32  ? -3.476  17.444 33.829  1.00 0.00  ? 32  VAL A HG12 2  
ATOM   3151  H  HG13 . VAL A 1 32  ? -2.225  16.236 33.534  1.00 0.00  ? 32  VAL A HG13 2  
ATOM   3152  H  HG21 . VAL A 1 32  ? -1.545  17.622 31.803  1.00 0.00  ? 32  VAL A HG21 2  
ATOM   3153  H  HG22 . VAL A 1 32  ? -2.892  18.688 31.395  1.00 0.00  ? 32  VAL A HG22 2  
ATOM   3154  H  HG23 . VAL A 1 32  ? -2.317  17.505 30.223  1.00 0.00  ? 32  VAL A HG23 2  
ATOM   3155  N  N    . ASP A 1 33  ? -2.502  13.921 32.954  1.00 0.00  ? 33  ASP A N    2  
ATOM   3156  C  CA   . ASP A 1 33  ? -1.509  13.098 33.700  1.00 0.00  ? 33  ASP A CA   2  
ATOM   3157  C  C    . ASP A 1 33  ? -1.139  11.876 32.859  1.00 0.00  ? 33  ASP A C    2  
ATOM   3158  O  O    . ASP A 1 33  ? -0.103  11.272 33.052  1.00 0.00  ? 33  ASP A O    2  
ATOM   3159  C  CB   . ASP A 1 33  ? -2.114  12.639 35.036  1.00 0.00  ? 33  ASP A CB   2  
ATOM   3160  C  CG   . ASP A 1 33  ? -1.319  11.452 35.590  1.00 0.00  ? 33  ASP A CG   2  
ATOM   3161  O  OD1  . ASP A 1 33  ? -0.109  11.569 35.691  1.00 0.00  ? 33  ASP A OD1  2  
ATOM   3162  O  OD2  . ASP A 1 33  ? -1.936  10.444 35.899  1.00 0.00  ? 33  ASP A OD2  2  
ATOM   3163  H  H    . ASP A 1 33  ? -3.414  14.027 33.301  1.00 0.00  ? 33  ASP A H    2  
ATOM   3164  H  HA   . ASP A 1 33  ? -0.623  13.687 33.889  1.00 0.00  ? 33  ASP A HA   2  
ATOM   3165  H  HB2  . ASP A 1 33  ? -2.080  13.455 35.745  1.00 0.00  ? 33  ASP A HB2  2  
ATOM   3166  H  HB3  . ASP A 1 33  ? -3.138  12.338 34.881  1.00 0.00  ? 33  ASP A HB3  2  
ATOM   3167  N  N    . ASP A 1 34  ? -1.980  11.494 31.936  1.00 0.00  ? 34  ASP A N    2  
ATOM   3168  C  CA   . ASP A 1 34  ? -1.665  10.300 31.107  1.00 0.00  ? 34  ASP A CA   2  
ATOM   3169  C  C    . ASP A 1 34  ? -0.652  10.664 30.022  1.00 0.00  ? 34  ASP A C    2  
ATOM   3170  O  O    . ASP A 1 34  ? 0.260   9.915  29.741  1.00 0.00  ? 34  ASP A O    2  
ATOM   3171  C  CB   . ASP A 1 34  ? -2.944  9.776  30.456  1.00 0.00  ? 34  ASP A CB   2  
ATOM   3172  C  CG   . ASP A 1 34  ? -2.955  8.249  30.522  1.00 0.00  ? 34  ASP A CG   2  
ATOM   3173  O  OD1  . ASP A 1 34  ? -2.435  7.714  31.487  1.00 0.00  ? 34  ASP A OD1  2  
ATOM   3174  O  OD2  . ASP A 1 34  ? -3.484  7.640  29.606  1.00 0.00  ? 34  ASP A OD2  2  
ATOM   3175  H  H    . ASP A 1 34  ? -2.820  11.988 31.794  1.00 0.00  ? 34  ASP A H    2  
ATOM   3176  H  HA   . ASP A 1 34  ? -1.248  9.531  31.740  1.00 0.00  ? 34  ASP A HA   2  
ATOM   3177  H  HB2  . ASP A 1 34  ? -3.803  10.167 30.982  1.00 0.00  ? 34  ASP A HB2  2  
ATOM   3178  H  HB3  . ASP A 1 34  ? -2.980  10.092 29.426  1.00 0.00  ? 34  ASP A HB3  2  
ATOM   3179  N  N    . ALA A 1 35  ? -0.796  11.804 29.409  1.00 0.00  ? 35  ALA A N    2  
ATOM   3180  C  CA   . ALA A 1 35  ? 0.172   12.192 28.347  1.00 0.00  ? 35  ALA A CA   2  
ATOM   3181  C  C    . ALA A 1 35  ? 1.582   12.196 28.932  1.00 0.00  ? 35  ALA A C    2  
ATOM   3182  O  O    . ALA A 1 35  ? 2.515   11.703 28.331  1.00 0.00  ? 35  ALA A O    2  
ATOM   3183  C  CB   . ALA A 1 35  ? -0.170  13.584 27.829  1.00 0.00  ? 35  ALA A CB   2  
ATOM   3184  H  H    . ALA A 1 35  ? -1.536  12.401 29.645  1.00 0.00  ? 35  ALA A H    2  
ATOM   3185  H  HA   . ALA A 1 35  ? 0.120   11.481 27.535  1.00 0.00  ? 35  ALA A HA   2  
ATOM   3186  H  HB1  . ALA A 1 35  ? 0.107   14.323 28.568  1.00 0.00  ? 35  ALA A HB1  2  
ATOM   3187  H  HB2  . ALA A 1 35  ? -1.233  13.642 27.640  1.00 0.00  ? 35  ALA A HB2  2  
ATOM   3188  H  HB3  . ALA A 1 35  ? 0.368   13.771 26.912  1.00 0.00  ? 35  ALA A HB3  2  
ATOM   3189  N  N    . PHE A 1 36  ? 1.745   12.742 30.104  1.00 0.00  ? 36  PHE A N    2  
ATOM   3190  C  CA   . PHE A 1 36  ? 3.095   12.762 30.724  1.00 0.00  ? 36  PHE A CA   2  
ATOM   3191  C  C    . PHE A 1 36  ? 3.454   11.344 31.156  1.00 0.00  ? 36  PHE A C    2  
ATOM   3192  O  O    . PHE A 1 36  ? 4.519   10.846 30.856  1.00 0.00  ? 36  PHE A O    2  
ATOM   3193  C  CB   . PHE A 1 36  ? 3.085   13.692 31.937  1.00 0.00  ? 36  PHE A CB   2  
ATOM   3194  C  CG   . PHE A 1 36  ? 3.033   15.121 31.460  1.00 0.00  ? 36  PHE A CG   2  
ATOM   3195  C  CD1  . PHE A 1 36  ? 1.799   15.728 31.200  1.00 0.00  ? 36  PHE A CD1  2  
ATOM   3196  C  CD2  . PHE A 1 36  ? 4.218   15.840 31.277  1.00 0.00  ? 36  PHE A CD2  2  
ATOM   3197  C  CE1  . PHE A 1 36  ? 1.749   17.054 30.758  1.00 0.00  ? 36  PHE A CE1  2  
ATOM   3198  C  CE2  . PHE A 1 36  ? 4.169   17.166 30.834  1.00 0.00  ? 36  PHE A CE2  2  
ATOM   3199  C  CZ   . PHE A 1 36  ? 2.935   17.774 30.574  1.00 0.00  ? 36  PHE A CZ   2  
ATOM   3200  H  H    . PHE A 1 36  ? 0.980   13.130 30.577  1.00 0.00  ? 36  PHE A H    2  
ATOM   3201  H  HA   . PHE A 1 36  ? 3.820   13.113 30.004  1.00 0.00  ? 36  PHE A HA   2  
ATOM   3202  H  HB2  . PHE A 1 36  ? 2.220   13.482 32.548  1.00 0.00  ? 36  PHE A HB2  2  
ATOM   3203  H  HB3  . PHE A 1 36  ? 3.983   13.542 32.517  1.00 0.00  ? 36  PHE A HB3  2  
ATOM   3204  H  HD1  . PHE A 1 36  ? 0.885   15.172 31.341  1.00 0.00  ? 36  PHE A HD1  2  
ATOM   3205  H  HD2  . PHE A 1 36  ? 5.170   15.371 31.476  1.00 0.00  ? 36  PHE A HD2  2  
ATOM   3206  H  HE1  . PHE A 1 36  ? 0.797   17.521 30.556  1.00 0.00  ? 36  PHE A HE1  2  
ATOM   3207  H  HE2  . PHE A 1 36  ? 5.080   17.719 30.691  1.00 0.00  ? 36  PHE A HE2  2  
ATOM   3208  H  HZ   . PHE A 1 36  ? 2.897   18.797 30.234  1.00 0.00  ? 36  PHE A HZ   2  
ATOM   3209  N  N    . ALA A 1 37  ? 2.563   10.679 31.839  1.00 0.00  ? 37  ALA A N    2  
ATOM   3210  C  CA   . ALA A 1 37  ? 2.850   9.285  32.264  1.00 0.00  ? 37  ALA A CA   2  
ATOM   3211  C  C    . ALA A 1 37  ? 3.258   8.477  31.032  1.00 0.00  ? 37  ALA A C    2  
ATOM   3212  O  O    . ALA A 1 37  ? 4.281   7.821  31.016  1.00 0.00  ? 37  ALA A O    2  
ATOM   3213  C  CB   . ALA A 1 37  ? 1.592   8.677  32.885  1.00 0.00  ? 37  ALA A CB   2  
ATOM   3214  H  H    . ALA A 1 37  ? 1.702   11.092 32.057  1.00 0.00  ? 37  ALA A H    2  
ATOM   3215  H  HA   . ALA A 1 37  ? 3.653   9.281  32.987  1.00 0.00  ? 37  ALA A HA   2  
ATOM   3216  H  HB1  . ALA A 1 37  ? 1.449   7.676  32.505  1.00 0.00  ? 37  ALA A HB1  2  
ATOM   3217  H  HB2  . ALA A 1 37  ? 0.736   9.283  32.628  1.00 0.00  ? 37  ALA A HB2  2  
ATOM   3218  H  HB3  . ALA A 1 37  ? 1.703   8.643  33.958  1.00 0.00  ? 37  ALA A HB3  2  
ATOM   3219  N  N    . ARG A 1 38  ? 2.469   8.533  29.994  1.00 0.00  ? 38  ARG A N    2  
ATOM   3220  C  CA   . ARG A 1 38  ? 2.811   7.782  28.757  1.00 0.00  ? 38  ARG A CA   2  
ATOM   3221  C  C    . ARG A 1 38  ? 4.064   8.396  28.136  1.00 0.00  ? 38  ARG A C    2  
ATOM   3222  O  O    . ARG A 1 38  ? 4.997   7.694  27.809  1.00 0.00  ? 38  ARG A O    2  
ATOM   3223  C  CB   . ARG A 1 38  ? 1.644   7.862  27.768  1.00 0.00  ? 38  ARG A CB   2  
ATOM   3224  C  CG   . ARG A 1 38  ? 0.393   7.246  28.405  1.00 0.00  ? 38  ARG A CG   2  
ATOM   3225  C  CD   . ARG A 1 38  ? -0.841  7.619  27.580  1.00 0.00  ? 38  ARG A CD   2  
ATOM   3226  N  NE   . ARG A 1 38  ? -0.932  6.731  26.385  1.00 0.00  ? 38  ARG A NE   2  
ATOM   3227  C  CZ   . ARG A 1 38  ? -1.928  6.852  25.546  1.00 0.00  ? 38  ARG A CZ   2  
ATOM   3228  N  NH1  . ARG A 1 38  ? -2.854  7.754  25.748  1.00 0.00  ? 38  ARG A NH1  2  
ATOM   3229  N  NH2  . ARG A 1 38  ? -2.002  6.071  24.504  1.00 0.00  ? 38  ARG A NH2  2  
ATOM   3230  H  H    . ARG A 1 38  ? 1.657   9.076  30.027  1.00 0.00  ? 38  ARG A H    2  
ATOM   3231  H  HA   . ARG A 1 38  ? 3.003   6.748  29.005  1.00 0.00  ? 38  ARG A HA   2  
ATOM   3232  H  HB2  . ARG A 1 38  ? 1.451   8.895  27.520  1.00 0.00  ? 38  ARG A HB2  2  
ATOM   3233  H  HB3  . ARG A 1 38  ? 1.893   7.318  26.870  1.00 0.00  ? 38  ARG A HB3  2  
ATOM   3234  H  HG2  . ARG A 1 38  ? 0.495   6.171  28.436  1.00 0.00  ? 38  ARG A HG2  2  
ATOM   3235  H  HG3  . ARG A 1 38  ? 0.279   7.627  29.409  1.00 0.00  ? 38  ARG A HG3  2  
ATOM   3236  H  HD2  . ARG A 1 38  ? -1.727  7.500  28.187  1.00 0.00  ? 38  ARG A HD2  2  
ATOM   3237  H  HD3  . ARG A 1 38  ? -0.759  8.647  27.260  1.00 0.00  ? 38  ARG A HD3  2  
ATOM   3238  H  HE   . ARG A 1 38  ? -0.242  6.052  26.228  1.00 0.00  ? 38  ARG A HE   2  
ATOM   3239  H  HH11 . ARG A 1 38  ? -2.803  8.355  26.545  1.00 0.00  ? 38  ARG A HH11 2  
ATOM   3240  H  HH12 . ARG A 1 38  ? -3.614  7.842  25.104  1.00 0.00  ? 38  ARG A HH12 2  
ATOM   3241  H  HH21 . ARG A 1 38  ? -1.298  5.378  24.347  1.00 0.00  ? 38  ARG A HH21 2  
ATOM   3242  H  HH22 . ARG A 1 38  ? -2.761  6.167  23.859  1.00 0.00  ? 38  ARG A HH22 2  
ATOM   3243  N  N    . ALA A 1 39  ? 4.099   9.700  27.983  1.00 0.00  ? 39  ALA A N    2  
ATOM   3244  C  CA   . ALA A 1 39  ? 5.305   10.353 27.392  1.00 0.00  ? 39  ALA A CA   2  
ATOM   3245  C  C    . ALA A 1 39  ? 6.557   9.700  27.979  1.00 0.00  ? 39  ALA A C    2  
ATOM   3246  O  O    . ALA A 1 39  ? 7.502   9.404  27.278  1.00 0.00  ? 39  ALA A O    2  
ATOM   3247  C  CB   . ALA A 1 39  ? 5.308   11.848 27.719  1.00 0.00  ? 39  ALA A CB   2  
ATOM   3248  H  H    . ALA A 1 39  ? 3.336   10.245 28.263  1.00 0.00  ? 39  ALA A H    2  
ATOM   3249  H  HA   . ALA A 1 39  ? 5.298   10.224 26.321  1.00 0.00  ? 39  ALA A HA   2  
ATOM   3250  H  HB1  . ALA A 1 39  ? 4.369   12.286 27.410  1.00 0.00  ? 39  ALA A HB1  2  
ATOM   3251  H  HB2  . ALA A 1 39  ? 6.120   12.331 27.191  1.00 0.00  ? 39  ALA A HB2  2  
ATOM   3252  H  HB3  . ALA A 1 39  ? 5.439   11.986 28.780  1.00 0.00  ? 39  ALA A HB3  2  
ATOM   3253  N  N    . PHE A 1 40  ? 6.565   9.463  29.264  1.00 0.00  ? 40  PHE A N    2  
ATOM   3254  C  CA   . PHE A 1 40  ? 7.750   8.818  29.894  1.00 0.00  ? 40  PHE A CA   2  
ATOM   3255  C  C    . PHE A 1 40  ? 7.845   7.369  29.414  1.00 0.00  ? 40  PHE A C    2  
ATOM   3256  O  O    . PHE A 1 40  ? 8.916   6.871  29.151  1.00 0.00  ? 40  PHE A O    2  
ATOM   3257  C  CB   . PHE A 1 40  ? 7.619   8.858  31.421  1.00 0.00  ? 40  PHE A CB   2  
ATOM   3258  C  CG   . PHE A 1 40  ? 7.742   10.288 31.900  1.00 0.00  ? 40  PHE A CG   2  
ATOM   3259  C  CD1  . PHE A 1 40  ? 8.940   10.999 31.719  1.00 0.00  ? 40  PHE A CD1  2  
ATOM   3260  C  CD2  . PHE A 1 40  ? 6.650   10.905 32.518  1.00 0.00  ? 40  PHE A CD2  2  
ATOM   3261  C  CE1  . PHE A 1 40  ? 9.039   12.327 32.159  1.00 0.00  ? 40  PHE A CE1  2  
ATOM   3262  C  CE2  . PHE A 1 40  ? 6.749   12.231 32.955  1.00 0.00  ? 40  PHE A CE2  2  
ATOM   3263  C  CZ   . PHE A 1 40  ? 7.942   12.942 32.777  1.00 0.00  ? 40  PHE A CZ   2  
ATOM   3264  H  H    . PHE A 1 40  ? 5.789   9.701  29.811  1.00 0.00  ? 40  PHE A H    2  
ATOM   3265  H  HA   . PHE A 1 40  ? 8.642   9.350  29.597  1.00 0.00  ? 40  PHE A HA   2  
ATOM   3266  H  HB2  . PHE A 1 40  ? 6.655   8.463  31.712  1.00 0.00  ? 40  PHE A HB2  2  
ATOM   3267  H  HB3  . PHE A 1 40  ? 8.400   8.261  31.867  1.00 0.00  ? 40  PHE A HB3  2  
ATOM   3268  H  HD1  . PHE A 1 40  ? 9.787   10.523 31.243  1.00 0.00  ? 40  PHE A HD1  2  
ATOM   3269  H  HD2  . PHE A 1 40  ? 5.730   10.358 32.658  1.00 0.00  ? 40  PHE A HD2  2  
ATOM   3270  H  HE1  . PHE A 1 40  ? 9.960   12.877 32.021  1.00 0.00  ? 40  PHE A HE1  2  
ATOM   3271  H  HE2  . PHE A 1 40  ? 5.903   12.705 33.433  1.00 0.00  ? 40  PHE A HE2  2  
ATOM   3272  H  HZ   . PHE A 1 40  ? 8.014   13.967 33.112  1.00 0.00  ? 40  PHE A HZ   2  
ATOM   3273  N  N    . GLN A 1 41  ? 6.732   6.690  29.284  1.00 0.00  ? 41  GLN A N    2  
ATOM   3274  C  CA   . GLN A 1 41  ? 6.775   5.276  28.804  1.00 0.00  ? 41  GLN A CA   2  
ATOM   3275  C  C    . GLN A 1 41  ? 7.131   5.265  27.312  1.00 0.00  ? 41  GLN A C    2  
ATOM   3276  O  O    . GLN A 1 41  ? 8.139   4.720  26.905  1.00 0.00  ? 41  GLN A O    2  
ATOM   3277  C  CB   . GLN A 1 41  ? 5.405   4.620  29.019  1.00 0.00  ? 41  GLN A CB   2  
ATOM   3278  C  CG   . GLN A 1 41  ? 5.469   3.148  28.602  1.00 0.00  ? 41  GLN A CG   2  
ATOM   3279  C  CD   . GLN A 1 41  ? 4.070   2.643  28.232  1.00 0.00  ? 41  GLN A CD   2  
ATOM   3280  O  OE1  . GLN A 1 41  ? 3.931   1.579  27.664  1.00 0.00  ? 41  GLN A OE1  2  
ATOM   3281  N  NE2  . GLN A 1 41  ? 3.019   3.361  28.532  1.00 0.00  ? 41  GLN A NE2  2  
ATOM   3282  H  H    . GLN A 1 41  ? 5.871   7.112  29.493  1.00 0.00  ? 41  GLN A H    2  
ATOM   3283  H  HA   . GLN A 1 41  ? 7.527   4.731  29.357  1.00 0.00  ? 41  GLN A HA   2  
ATOM   3284  H  HB2  . GLN A 1 41  ? 5.134   4.686  30.065  1.00 0.00  ? 41  GLN A HB2  2  
ATOM   3285  H  HB3  . GLN A 1 41  ? 4.663   5.129  28.422  1.00 0.00  ? 41  GLN A HB3  2  
ATOM   3286  H  HG2  . GLN A 1 41  ? 6.123   3.045  27.748  1.00 0.00  ? 41  GLN A HG2  2  
ATOM   3287  H  HG3  . GLN A 1 41  ? 5.856   2.560  29.422  1.00 0.00  ? 41  GLN A HG3  2  
ATOM   3288  H  HE21 . GLN A 1 41  ? 3.124   4.218  28.993  1.00 0.00  ? 41  GLN A HE21 2  
ATOM   3289  H  HE22 . GLN A 1 41  ? 2.124   3.039  28.296  1.00 0.00  ? 41  GLN A HE22 2  
ATOM   3290  N  N    . VAL A 1 42  ? 6.316   5.881  26.498  1.00 0.00  ? 42  VAL A N    2  
ATOM   3291  C  CA   . VAL A 1 42  ? 6.593   5.939  25.035  1.00 0.00  ? 42  VAL A CA   2  
ATOM   3292  C  C    . VAL A 1 42  ? 8.058   6.317  24.812  1.00 0.00  ? 42  VAL A C    2  
ATOM   3293  O  O    . VAL A 1 42  ? 8.668   5.943  23.832  1.00 0.00  ? 42  VAL A O    2  
ATOM   3294  C  CB   . VAL A 1 42  ? 5.682   7.006  24.419  1.00 0.00  ? 42  VAL A CB   2  
ATOM   3295  C  CG1  . VAL A 1 42  ? 4.288   6.423  24.168  1.00 0.00  ? 42  VAL A CG1  2  
ATOM   3296  C  CG2  . VAL A 1 42  ? 5.569   8.184  25.377  1.00 0.00  ? 42  VAL A CG2  2  
ATOM   3297  H  H    . VAL A 1 42  ? 5.520   6.324  26.852  1.00 0.00  ? 42  VAL A H    2  
ATOM   3298  H  HA   . VAL A 1 42  ? 6.393   4.980  24.579  1.00 0.00  ? 42  VAL A HA   2  
ATOM   3299  H  HB   . VAL A 1 42  ? 6.098   7.352  23.496  1.00 0.00  ? 42  VAL A HB   2  
ATOM   3300  H  HG11 . VAL A 1 42  ? 4.031   6.541  23.125  1.00 0.00  ? 42  VAL A HG11 2  
ATOM   3301  H  HG12 . VAL A 1 42  ? 3.565   6.944  24.778  1.00 0.00  ? 42  VAL A HG12 2  
ATOM   3302  H  HG13 . VAL A 1 42  ? 4.285   5.374  24.423  1.00 0.00  ? 42  VAL A HG13 2  
ATOM   3303  H  HG21 . VAL A 1 42  ? 4.555   8.258  25.744  1.00 0.00  ? 42  VAL A HG21 2  
ATOM   3304  H  HG22 . VAL A 1 42  ? 5.832   9.094  24.859  1.00 0.00  ? 42  VAL A HG22 2  
ATOM   3305  H  HG23 . VAL A 1 42  ? 6.244   8.039  26.206  1.00 0.00  ? 42  VAL A HG23 2  
ATOM   3306  N  N    . TRP A 1 43  ? 8.621   7.060  25.719  1.00 0.00  ? 43  TRP A N    2  
ATOM   3307  C  CA   . TRP A 1 43  ? 10.048  7.476  25.572  1.00 0.00  ? 43  TRP A CA   2  
ATOM   3308  C  C    . TRP A 1 43  ? 10.946  6.613  26.475  1.00 0.00  ? 43  TRP A C    2  
ATOM   3309  O  O    . TRP A 1 43  ? 12.139  6.516  26.266  1.00 0.00  ? 43  TRP A O    2  
ATOM   3310  C  CB   . TRP A 1 43  ? 10.186  8.954  25.949  1.00 0.00  ? 43  TRP A CB   2  
ATOM   3311  C  CG   . TRP A 1 43  ? 9.861   9.801  24.756  1.00 0.00  ? 43  TRP A CG   2  
ATOM   3312  C  CD1  . TRP A 1 43  ? 8.648   9.874  24.161  1.00 0.00  ? 43  TRP A CD1  2  
ATOM   3313  C  CD2  . TRP A 1 43  ? 10.739  10.688 24.002  1.00 0.00  ? 43  TRP A CD2  2  
ATOM   3314  N  NE1  . TRP A 1 43  ? 8.725   10.753 23.093  1.00 0.00  ? 43  TRP A NE1  2  
ATOM   3315  C  CE2  . TRP A 1 43  ? 9.994   11.281 22.956  1.00 0.00  ? 43  TRP A CE2  2  
ATOM   3316  C  CE3  . TRP A 1 43  ? 12.096  11.033 24.128  1.00 0.00  ? 43  TRP A CE3  2  
ATOM   3317  C  CZ2  . TRP A 1 43  ? 10.575  12.184 22.064  1.00 0.00  ? 43  TRP A CZ2  2  
ATOM   3318  C  CZ3  . TRP A 1 43  ? 12.685  11.939 23.232  1.00 0.00  ? 43  TRP A CZ3  2  
ATOM   3319  C  CH2  . TRP A 1 43  ? 11.926  12.515 22.204  1.00 0.00  ? 43  TRP A CH2  2  
ATOM   3320  H  H    . TRP A 1 43  ? 8.103   7.347  26.491  1.00 0.00  ? 43  TRP A H    2  
ATOM   3321  H  HA   . TRP A 1 43  ? 10.350  7.343  24.544  1.00 0.00  ? 43  TRP A HA   2  
ATOM   3322  H  HB2  . TRP A 1 43  ? 9.504   9.187  26.752  1.00 0.00  ? 43  TRP A HB2  2  
ATOM   3323  H  HB3  . TRP A 1 43  ? 11.198  9.155  26.268  1.00 0.00  ? 43  TRP A HB3  2  
ATOM   3324  H  HD1  . TRP A 1 43  ? 7.764   9.334  24.467  1.00 0.00  ? 43  TRP A HD1  2  
ATOM   3325  H  HE1  . TRP A 1 43  ? 7.981   10.985 22.497  1.00 0.00  ? 43  TRP A HE1  2  
ATOM   3326  H  HE3  . TRP A 1 43  ? 12.690  10.595 24.916  1.00 0.00  ? 43  TRP A HE3  2  
ATOM   3327  H  HZ2  . TRP A 1 43  ? 9.986   12.626 21.273  1.00 0.00  ? 43  TRP A HZ2  2  
ATOM   3328  H  HZ3  . TRP A 1 43  ? 13.729  12.197 23.338  1.00 0.00  ? 43  TRP A HZ3  2  
ATOM   3329  H  HH2  . TRP A 1 43  ? 12.385  13.210 21.519  1.00 0.00  ? 43  TRP A HH2  2  
ATOM   3330  N  N    . SER A 1 44  ? 10.381  5.970  27.462  1.00 0.00  ? 44  SER A N    2  
ATOM   3331  C  CA   . SER A 1 44  ? 11.199  5.094  28.355  1.00 0.00  ? 44  SER A CA   2  
ATOM   3332  C  C    . SER A 1 44  ? 11.238  3.698  27.748  1.00 0.00  ? 44  SER A C    2  
ATOM   3333  O  O    . SER A 1 44  ? 12.132  2.918  28.003  1.00 0.00  ? 44  SER A O    2  
ATOM   3334  C  CB   . SER A 1 44  ? 10.559  5.024  29.740  1.00 0.00  ? 44  SER A CB   2  
ATOM   3335  O  OG   . SER A 1 44  ? 11.125  3.942  30.466  1.00 0.00  ? 44  SER A OG   2  
ATOM   3336  H  H    . SER A 1 44  ? 9.415   6.048  27.606  1.00 0.00  ? 44  SER A H    2  
ATOM   3337  H  HA   . SER A 1 44  ? 12.206  5.480  28.434  1.00 0.00  ? 44  SER A HA   2  
ATOM   3338  H  HB2  . SER A 1 44  ? 10.741  5.944  30.270  1.00 0.00  ? 44  SER A HB2  2  
ATOM   3339  H  HB3  . SER A 1 44  ? 9.492   4.878  29.631  1.00 0.00  ? 44  SER A HB3  2  
ATOM   3340  H  HG   . SER A 1 44  ? 10.789  3.126  30.090  1.00 0.00  ? 44  SER A HG   2  
ATOM   3341  N  N    . ASP A 1 45  ? 10.265  3.386  26.938  1.00 0.00  ? 45  ASP A N    2  
ATOM   3342  C  CA   . ASP A 1 45  ? 10.226  2.043  26.296  1.00 0.00  ? 45  ASP A CA   2  
ATOM   3343  C  C    . ASP A 1 45  ? 11.488  1.837  25.451  1.00 0.00  ? 45  ASP A C    2  
ATOM   3344  O  O    . ASP A 1 45  ? 11.779  0.741  25.013  1.00 0.00  ? 45  ASP A O    2  
ATOM   3345  C  CB   . ASP A 1 45  ? 8.995   1.950  25.396  1.00 0.00  ? 45  ASP A CB   2  
ATOM   3346  C  CG   . ASP A 1 45  ? 9.128   2.948  24.245  1.00 0.00  ? 45  ASP A CG   2  
ATOM   3347  O  OD1  . ASP A 1 45  ? 9.977   3.820  24.338  1.00 0.00  ? 45  ASP A OD1  2  
ATOM   3348  O  OD2  . ASP A 1 45  ? 8.379   2.825  23.290  1.00 0.00  ? 45  ASP A OD2  2  
ATOM   3349  H  H    . ASP A 1 45  ? 9.558   4.045  26.749  1.00 0.00  ? 45  ASP A H    2  
ATOM   3350  H  HA   . ASP A 1 45  ? 10.174  1.280  27.057  1.00 0.00  ? 45  ASP A HA   2  
ATOM   3351  H  HB2  . ASP A 1 45  ? 8.915   0.949  25.001  1.00 0.00  ? 45  ASP A HB2  2  
ATOM   3352  H  HB3  . ASP A 1 45  ? 8.111   2.183  25.971  1.00 0.00  ? 45  ASP A HB3  2  
ATOM   3353  N  N    . VAL A 1 46  ? 12.236  2.880  25.210  1.00 0.00  ? 46  VAL A N    2  
ATOM   3354  C  CA   . VAL A 1 46  ? 13.469  2.733  24.388  1.00 0.00  ? 46  VAL A CA   2  
ATOM   3355  C  C    . VAL A 1 46  ? 14.704  2.924  25.272  1.00 0.00  ? 46  VAL A C    2  
ATOM   3356  O  O    . VAL A 1 46  ? 15.789  3.192  24.792  1.00 0.00  ? 46  VAL A O    2  
ATOM   3357  C  CB   . VAL A 1 46  ? 13.464  3.779  23.276  1.00 0.00  ? 46  VAL A CB   2  
ATOM   3358  C  CG1  . VAL A 1 46  ? 13.340  5.178  23.885  1.00 0.00  ? 46  VAL A CG1  2  
ATOM   3359  C  CG2  . VAL A 1 46  ? 14.767  3.672  22.477  1.00 0.00  ? 46  VAL A CG2  2  
ATOM   3360  H  H    . VAL A 1 46  ? 11.986  3.758  25.563  1.00 0.00  ? 46  VAL A H    2  
ATOM   3361  H  HA   . VAL A 1 46  ? 13.493  1.747  23.950  1.00 0.00  ? 46  VAL A HA   2  
ATOM   3362  H  HB   . VAL A 1 46  ? 12.624  3.600  22.620  1.00 0.00  ? 46  VAL A HB   2  
ATOM   3363  H  HG11 . VAL A 1 46  ? 13.353  5.916  23.095  1.00 0.00  ? 46  VAL A HG11 2  
ATOM   3364  H  HG12 . VAL A 1 46  ? 14.166  5.355  24.558  1.00 0.00  ? 46  VAL A HG12 2  
ATOM   3365  H  HG13 . VAL A 1 46  ? 12.410  5.252  24.430  1.00 0.00  ? 46  VAL A HG13 2  
ATOM   3366  H  HG21 . VAL A 1 46  ? 15.507  4.336  22.898  1.00 0.00  ? 46  VAL A HG21 2  
ATOM   3367  H  HG22 . VAL A 1 46  ? 14.582  3.946  21.449  1.00 0.00  ? 46  VAL A HG22 2  
ATOM   3368  H  HG23 . VAL A 1 46  ? 15.131  2.655  22.519  1.00 0.00  ? 46  VAL A HG23 2  
ATOM   3369  N  N    . THR A 1 47  ? 14.550  2.785  26.559  1.00 0.00  ? 47  THR A N    2  
ATOM   3370  C  CA   . THR A 1 47  ? 15.714  2.951  27.475  1.00 0.00  ? 47  THR A CA   2  
ATOM   3371  C  C    . THR A 1 47  ? 15.252  2.718  28.915  1.00 0.00  ? 47  THR A C    2  
ATOM   3372  O  O    . THR A 1 47  ? 14.112  2.979  29.247  1.00 0.00  ? 47  THR A O    2  
ATOM   3373  C  CB   . THR A 1 47  ? 16.277  4.362  27.324  1.00 0.00  ? 47  THR A CB   2  
ATOM   3374  O  OG1  . THR A 1 47  ? 17.327  4.567  28.254  1.00 0.00  ? 47  THR A OG1  2  
ATOM   3375  C  CG2  . THR A 1 47  ? 15.170  5.368  27.579  1.00 0.00  ? 47  THR A CG2  2  
ATOM   3376  H  H    . THR A 1 47  ? 13.665  2.571  26.927  1.00 0.00  ? 47  THR A H    2  
ATOM   3377  H  HA   . THR A 1 47  ? 16.476  2.236  27.221  1.00 0.00  ? 47  THR A HA   2  
ATOM   3378  H  HB   . THR A 1 47  ? 16.653  4.495  26.322  1.00 0.00  ? 47  THR A HB   2  
ATOM   3379  H  HG1  . THR A 1 47  ? 18.146  4.660  27.761  1.00 0.00  ? 47  THR A HG1  2  
ATOM   3380  H  HG21 . THR A 1 47  ? 14.913  5.354  28.626  1.00 0.00  ? 47  THR A HG21 2  
ATOM   3381  H  HG22 . THR A 1 47  ? 14.306  5.100  26.990  1.00 0.00  ? 47  THR A HG22 2  
ATOM   3382  H  HG23 . THR A 1 47  ? 15.511  6.352  27.301  1.00 0.00  ? 47  THR A HG23 2  
ATOM   3383  N  N    . PRO A 1 48  ? 16.148  2.219  29.726  1.00 0.00  ? 48  PRO A N    2  
ATOM   3384  C  CA   . PRO A 1 48  ? 15.854  1.923  31.137  1.00 0.00  ? 48  PRO A CA   2  
ATOM   3385  C  C    . PRO A 1 48  ? 15.819  3.212  31.958  1.00 0.00  ? 48  PRO A C    2  
ATOM   3386  O  O    . PRO A 1 48  ? 16.545  3.370  32.920  1.00 0.00  ? 48  PRO A O    2  
ATOM   3387  C  CB   . PRO A 1 48  ? 17.010  1.013  31.565  1.00 0.00  ? 48  PRO A CB   2  
ATOM   3388  C  CG   . PRO A 1 48  ? 18.167  1.282  30.573  1.00 0.00  ? 48  PRO A CG   2  
ATOM   3389  C  CD   . PRO A 1 48  ? 17.534  1.914  29.318  1.00 0.00  ? 48  PRO A CD   2  
ATOM   3390  H  HA   . PRO A 1 48  ? 14.919  1.395  31.227  1.00 0.00  ? 48  PRO A HA   2  
ATOM   3391  H  HB2  . PRO A 1 48  ? 17.316  1.255  32.572  1.00 0.00  ? 48  PRO A HB2  2  
ATOM   3392  H  HB3  . PRO A 1 48  ? 16.712  -0.022 31.506  1.00 0.00  ? 48  PRO A HB3  2  
ATOM   3393  H  HG2  . PRO A 1 48  ? 18.880  1.964  31.015  1.00 0.00  ? 48  PRO A HG2  2  
ATOM   3394  H  HG3  . PRO A 1 48  ? 18.652  0.356  30.310  1.00 0.00  ? 48  PRO A HG3  2  
ATOM   3395  H  HD2  . PRO A 1 48  ? 18.059  2.819  29.050  1.00 0.00  ? 48  PRO A HD2  2  
ATOM   3396  H  HD3  . PRO A 1 48  ? 17.535  1.219  28.495  1.00 0.00  ? 48  PRO A HD3  2  
ATOM   3397  N  N    . LEU A 1 49  ? 14.971  4.131  31.588  1.00 0.00  ? 49  LEU A N    2  
ATOM   3398  C  CA   . LEU A 1 49  ? 14.877  5.405  32.350  1.00 0.00  ? 49  LEU A CA   2  
ATOM   3399  C  C    . LEU A 1 49  ? 13.662  5.336  33.274  1.00 0.00  ? 49  LEU A C    2  
ATOM   3400  O  O    . LEU A 1 49  ? 12.546  5.158  32.829  1.00 0.00  ? 49  LEU A O    2  
ATOM   3401  C  CB   . LEU A 1 49  ? 14.709  6.574  31.374  1.00 0.00  ? 49  LEU A CB   2  
ATOM   3402  C  CG   . LEU A 1 49  ? 16.058  6.916  30.740  1.00 0.00  ? 49  LEU A CG   2  
ATOM   3403  C  CD1  . LEU A 1 49  ? 15.914  8.176  29.882  1.00 0.00  ? 49  LEU A CD1  2  
ATOM   3404  C  CD2  . LEU A 1 49  ? 17.091  7.162  31.843  1.00 0.00  ? 49  LEU A CD2  2  
ATOM   3405  H  H    . LEU A 1 49  ? 14.388  3.980  30.811  1.00 0.00  ? 49  LEU A H    2  
ATOM   3406  H  HA   . LEU A 1 49  ? 15.774  5.544  32.935  1.00 0.00  ? 49  LEU A HA   2  
ATOM   3407  H  HB2  . LEU A 1 49  ? 14.007  6.297  30.600  1.00 0.00  ? 49  LEU A HB2  2  
ATOM   3408  H  HB3  . LEU A 1 49  ? 14.334  7.436  31.906  1.00 0.00  ? 49  LEU A HB3  2  
ATOM   3409  H  HG   . LEU A 1 49  ? 16.382  6.092  30.118  1.00 0.00  ? 49  LEU A HG   2  
ATOM   3410  H  HD11 . LEU A 1 49  ? 16.358  8.004  28.912  1.00 0.00  ? 49  LEU A HD11 2  
ATOM   3411  H  HD12 . LEU A 1 49  ? 16.415  9.002  30.367  1.00 0.00  ? 49  LEU A HD12 2  
ATOM   3412  H  HD13 . LEU A 1 49  ? 14.868  8.414  29.761  1.00 0.00  ? 49  LEU A HD13 2  
ATOM   3413  H  HD21 . LEU A 1 49  ? 17.885  7.787  31.460  1.00 0.00  ? 49  LEU A HD21 2  
ATOM   3414  H  HD22 . LEU A 1 49  ? 17.503  6.218  32.166  1.00 0.00  ? 49  LEU A HD22 2  
ATOM   3415  H  HD23 . LEU A 1 49  ? 16.617  7.655  32.678  1.00 0.00  ? 49  LEU A HD23 2  
ATOM   3416  N  N    . ARG A 1 50  ? 13.859  5.475  34.554  1.00 0.00  ? 50  ARG A N    2  
ATOM   3417  C  CA   . ARG A 1 50  ? 12.698  5.414  35.479  1.00 0.00  ? 50  ARG A CA   2  
ATOM   3418  C  C    . ARG A 1 50  ? 12.394  6.819  35.992  1.00 0.00  ? 50  ARG A C    2  
ATOM   3419  O  O    . ARG A 1 50  ? 13.168  7.410  36.717  1.00 0.00  ? 50  ARG A O    2  
ATOM   3420  C  CB   . ARG A 1 50  ? 13.021  4.487  36.653  1.00 0.00  ? 50  ARG A CB   2  
ATOM   3421  C  CG   . ARG A 1 50  ? 11.767  3.697  37.039  1.00 0.00  ? 50  ARG A CG   2  
ATOM   3422  C  CD   . ARG A 1 50  ? 11.464  2.652  35.966  1.00 0.00  ? 50  ARG A CD   2  
ATOM   3423  N  NE   . ARG A 1 50  ? 10.624  1.576  36.559  1.00 0.00  ? 50  ARG A NE   2  
ATOM   3424  C  CZ   . ARG A 1 50  ? 11.125  0.776  37.461  1.00 0.00  ? 50  ARG A CZ   2  
ATOM   3425  N  NH1  . ARG A 1 50  ? 12.373  0.898  37.826  1.00 0.00  ? 50  ARG A NH1  2  
ATOM   3426  N  NH2  . ARG A 1 50  ? 10.379  -0.147 37.999  1.00 0.00  ? 50  ARG A NH2  2  
ATOM   3427  H  H    . ARG A 1 50  ? 14.764  5.622  34.903  1.00 0.00  ? 50  ARG A H    2  
ATOM   3428  H  HA   . ARG A 1 50  ? 11.838  5.033  34.947  1.00 0.00  ? 50  ARG A HA   2  
ATOM   3429  H  HB2  . ARG A 1 50  ? 13.806  3.801  36.366  1.00 0.00  ? 50  ARG A HB2  2  
ATOM   3430  H  HB3  . ARG A 1 50  ? 13.347  5.075  37.498  1.00 0.00  ? 50  ARG A HB3  2  
ATOM   3431  H  HG2  . ARG A 1 50  ? 11.928  3.202  37.986  1.00 0.00  ? 50  ARG A HG2  2  
ATOM   3432  H  HG3  . ARG A 1 50  ? 10.930  4.372  37.125  1.00 0.00  ? 50  ARG A HG3  2  
ATOM   3433  H  HD2  . ARG A 1 50  ? 10.931  3.119  35.151  1.00 0.00  ? 50  ARG A HD2  2  
ATOM   3434  H  HD3  . ARG A 1 50  ? 12.388  2.230  35.598  1.00 0.00  ? 50  ARG A HD3  2  
ATOM   3435  H  HE   . ARG A 1 50  ? 9.689   1.478  36.285  1.00 0.00  ? 50  ARG A HE   2  
ATOM   3436  H  HH11 . ARG A 1 50  ? 12.949  1.605  37.416  1.00 0.00  ? 50  ARG A HH11 2  
ATOM   3437  H  HH12 . ARG A 1 50  ? 12.754  0.281  38.516  1.00 0.00  ? 50  ARG A HH12 2  
ATOM   3438  H  HH21 . ARG A 1 50  ? 9.424   -0.244 37.720  1.00 0.00  ? 50  ARG A HH21 2  
ATOM   3439  H  HH22 . ARG A 1 50  ? 10.763  -0.756 38.694  1.00 0.00  ? 50  ARG A HH22 2  
ATOM   3440  N  N    . PHE A 1 51  ? 11.272  7.361  35.610  1.00 0.00  ? 51  PHE A N    2  
ATOM   3441  C  CA   . PHE A 1 51  ? 10.914  8.732  36.061  1.00 0.00  ? 51  PHE A CA   2  
ATOM   3442  C  C    . PHE A 1 51  ? 10.164  8.653  37.388  1.00 0.00  ? 51  PHE A C    2  
ATOM   3443  O  O    . PHE A 1 51  ? 9.385   7.749  37.621  1.00 0.00  ? 51  PHE A O    2  
ATOM   3444  C  CB   . PHE A 1 51  ? 10.016  9.395  35.014  1.00 0.00  ? 51  PHE A CB   2  
ATOM   3445  C  CG   . PHE A 1 51  ? 10.841  9.834  33.827  1.00 0.00  ? 51  PHE A CG   2  
ATOM   3446  C  CD1  . PHE A 1 51  ? 11.190  8.911  32.833  1.00 0.00  ? 51  PHE A CD1  2  
ATOM   3447  C  CD2  . PHE A 1 51  ? 11.251  11.167 33.718  1.00 0.00  ? 51  PHE A CD2  2  
ATOM   3448  C  CE1  . PHE A 1 51  ? 11.950  9.321  31.731  1.00 0.00  ? 51  PHE A CE1  2  
ATOM   3449  C  CE2  . PHE A 1 51  ? 12.011  11.577 32.615  1.00 0.00  ? 51  PHE A CE2  2  
ATOM   3450  C  CZ   . PHE A 1 51  ? 12.360  10.654 31.621  1.00 0.00  ? 51  PHE A CZ   2  
ATOM   3451  H  H    . PHE A 1 51  ? 10.667  6.867  35.019  1.00 0.00  ? 51  PHE A H    2  
ATOM   3452  H  HA   . PHE A 1 51  ? 11.812  9.317  36.190  1.00 0.00  ? 51  PHE A HA   2  
ATOM   3453  H  HB2  . PHE A 1 51  ? 9.265   8.690  34.687  1.00 0.00  ? 51  PHE A HB2  2  
ATOM   3454  H  HB3  . PHE A 1 51  ? 9.533   10.257 35.452  1.00 0.00  ? 51  PHE A HB3  2  
ATOM   3455  H  HD1  . PHE A 1 51  ? 10.876  7.882  32.918  1.00 0.00  ? 51  PHE A HD1  2  
ATOM   3456  H  HD2  . PHE A 1 51  ? 10.981  11.878 34.485  1.00 0.00  ? 51  PHE A HD2  2  
ATOM   3457  H  HE1  . PHE A 1 51  ? 12.219  8.610  30.965  1.00 0.00  ? 51  PHE A HE1  2  
ATOM   3458  H  HE2  . PHE A 1 51  ? 12.327  12.607 32.531  1.00 0.00  ? 51  PHE A HE2  2  
ATOM   3459  H  HZ   . PHE A 1 51  ? 12.945  10.970 30.770  1.00 0.00  ? 51  PHE A HZ   2  
ATOM   3460  N  N    . SER A 1 52  ? 10.392  9.597  38.257  1.00 0.00  ? 52  SER A N    2  
ATOM   3461  C  CA   . SER A 1 52  ? 9.692   9.589  39.573  1.00 0.00  ? 52  SER A CA   2  
ATOM   3462  C  C    . SER A 1 52  ? 8.839   10.853 39.701  1.00 0.00  ? 52  SER A C    2  
ATOM   3463  O  O    . SER A 1 52  ? 9.257   11.933 39.331  1.00 0.00  ? 52  SER A O    2  
ATOM   3464  C  CB   . SER A 1 52  ? 10.726  9.557  40.696  1.00 0.00  ? 52  SER A CB   2  
ATOM   3465  O  OG   . SER A 1 52  ? 10.910  8.215  41.126  1.00 0.00  ? 52  SER A OG   2  
ATOM   3466  H  H    . SER A 1 52  ? 11.024  10.314 38.042  1.00 0.00  ? 52  SER A H    2  
ATOM   3467  H  HA   . SER A 1 52  ? 9.061   8.717  39.641  1.00 0.00  ? 52  SER A HA   2  
ATOM   3468  H  HB2  . SER A 1 52  ? 11.663  9.947  40.337  1.00 0.00  ? 52  SER A HB2  2  
ATOM   3469  H  HB3  . SER A 1 52  ? 10.377  10.165 41.520  1.00 0.00  ? 52  SER A HB3  2  
ATOM   3470  H  HG   . SER A 1 52  ? 10.832  7.645  40.359  1.00 0.00  ? 52  SER A HG   2  
ATOM   3471  N  N    . ARG A 1 53  ? 7.647   10.734 40.224  1.00 0.00  ? 53  ARG A N    2  
ATOM   3472  C  CA   . ARG A 1 53  ? 6.783   11.937 40.374  1.00 0.00  ? 53  ARG A CA   2  
ATOM   3473  C  C    . ARG A 1 53  ? 7.063   12.580 41.731  1.00 0.00  ? 53  ARG A C    2  
ATOM   3474  O  O    . ARG A 1 53  ? 7.053   11.917 42.751  1.00 0.00  ? 53  ARG A O    2  
ATOM   3475  C  CB   . ARG A 1 53  ? 5.308   11.524 40.303  1.00 0.00  ? 53  ARG A CB   2  
ATOM   3476  C  CG   . ARG A 1 53  ? 5.074   10.620 39.092  1.00 0.00  ? 53  ARG A CG   2  
ATOM   3477  C  CD   . ARG A 1 53  ? 3.857   9.732  39.354  1.00 0.00  ? 53  ARG A CD   2  
ATOM   3478  N  NE   . ARG A 1 53  ? 4.011   8.446  38.617  1.00 0.00  ? 53  ARG A NE   2  
ATOM   3479  C  CZ   . ARG A 1 53  ? 3.857   8.413  37.322  1.00 0.00  ? 53  ARG A CZ   2  
ATOM   3480  N  NH1  . ARG A 1 53  ? 3.572   9.507  36.670  1.00 0.00  ? 53  ARG A NH1  2  
ATOM   3481  N  NH2  . ARG A 1 53  ? 3.986   7.284  36.680  1.00 0.00  ? 53  ARG A NH2  2  
ATOM   3482  H  H    . ARG A 1 53  ? 7.324   9.857  40.523  1.00 0.00  ? 53  ARG A H    2  
ATOM   3483  H  HA   . ARG A 1 53  ? 7.003   12.643 39.586  1.00 0.00  ? 53  ARG A HA   2  
ATOM   3484  H  HB2  . ARG A 1 53  ? 5.043   10.989 41.201  1.00 0.00  ? 53  ARG A HB2  2  
ATOM   3485  H  HB3  . ARG A 1 53  ? 4.692   12.405 40.214  1.00 0.00  ? 53  ARG A HB3  2  
ATOM   3486  H  HG2  . ARG A 1 53  ? 4.895   11.227 38.217  1.00 0.00  ? 53  ARG A HG2  2  
ATOM   3487  H  HG3  . ARG A 1 53  ? 5.940   10.001 38.930  1.00 0.00  ? 53  ARG A HG3  2  
ATOM   3488  H  HD2  . ARG A 1 53  ? 3.779   9.534  40.411  1.00 0.00  ? 53  ARG A HD2  2  
ATOM   3489  H  HD3  . ARG A 1 53  ? 2.963   10.236 39.014  1.00 0.00  ? 53  ARG A HD3  2  
ATOM   3490  H  HE   . ARG A 1 53  ? 4.226   7.624  39.106  1.00 0.00  ? 53  ARG A HE   2  
ATOM   3491  H  HH11 . ARG A 1 53  ? 3.472   10.372 37.161  1.00 0.00  ? 53  ARG A HH11 2  
ATOM   3492  H  HH12 . ARG A 1 53  ? 3.456   9.481  35.681  1.00 0.00  ? 53  ARG A HH12 2  
ATOM   3493  H  HH21 . ARG A 1 53  ? 4.201   6.447  37.181  1.00 0.00  ? 53  ARG A HH21 2  
ATOM   3494  H  HH22 . ARG A 1 53  ? 3.875   7.257  35.687  1.00 0.00  ? 53  ARG A HH22 2  
ATOM   3495  N  N    . ILE A 1 54  ? 7.311   13.860 41.761  1.00 0.00  ? 54  ILE A N    2  
ATOM   3496  C  CA   . ILE A 1 54  ? 7.586   14.522 43.066  1.00 0.00  ? 54  ILE A CA   2  
ATOM   3497  C  C    . ILE A 1 54  ? 6.575   15.647 43.287  1.00 0.00  ? 54  ILE A C    2  
ATOM   3498  O  O    . ILE A 1 54  ? 6.327   16.456 42.413  1.00 0.00  ? 54  ILE A O    2  
ATOM   3499  C  CB   . ILE A 1 54  ? 9.006   15.092 43.070  1.00 0.00  ? 54  ILE A CB   2  
ATOM   3500  C  CG1  . ILE A 1 54  ? 9.335   15.652 41.686  1.00 0.00  ? 54  ILE A CG1  2  
ATOM   3501  C  CG2  . ILE A 1 54  ? 10.004  13.986 43.416  1.00 0.00  ? 54  ILE A CG2  2  
ATOM   3502  C  CD1  . ILE A 1 54  ? 10.739  16.257 41.705  1.00 0.00  ? 54  ILE A CD1  2  
ATOM   3503  H  H    . ILE A 1 54  ? 7.314   14.385 40.930  1.00 0.00  ? 54  ILE A H    2  
ATOM   3504  H  HA   . ILE A 1 54  ? 7.489   13.798 43.860  1.00 0.00  ? 54  ILE A HA   2  
ATOM   3505  H  HB   . ILE A 1 54  ? 9.074   15.879 43.804  1.00 0.00  ? 54  ILE A HB   2  
ATOM   3506  H  HG12 . ILE A 1 54  ? 9.294   14.855 40.957  1.00 0.00  ? 54  ILE A HG12 2  
ATOM   3507  H  HG13 . ILE A 1 54  ? 8.618   16.415 41.426  1.00 0.00  ? 54  ILE A HG13 2  
ATOM   3508  H  HG21 . ILE A 1 54  ? 9.703   13.499 44.333  1.00 0.00  ? 54  ILE A HG21 2  
ATOM   3509  H  HG22 . ILE A 1 54  ? 10.987  14.415 43.540  1.00 0.00  ? 54  ILE A HG22 2  
ATOM   3510  H  HG23 . ILE A 1 54  ? 10.028  13.261 42.616  1.00 0.00  ? 54  ILE A HG23 2  
ATOM   3511  H  HD11 . ILE A 1 54  ? 11.375  15.676 42.357  1.00 0.00  ? 54  ILE A HD11 2  
ATOM   3512  H  HD12 . ILE A 1 54  ? 10.686  17.273 42.066  1.00 0.00  ? 54  ILE A HD12 2  
ATOM   3513  H  HD13 . ILE A 1 54  ? 11.146  16.250 40.704  1.00 0.00  ? 54  ILE A HD13 2  
ATOM   3514  N  N    . HIS A 1 55  ? 5.980   15.699 44.446  1.00 0.00  ? 55  HIS A N    2  
ATOM   3515  C  CA   . HIS A 1 55  ? 4.980   16.764 44.723  1.00 0.00  ? 55  HIS A CA   2  
ATOM   3516  C  C    . HIS A 1 55  ? 5.650   18.132 44.595  1.00 0.00  ? 55  HIS A C    2  
ATOM   3517  O  O    . HIS A 1 55  ? 6.553   18.320 43.802  1.00 0.00  ? 55  HIS A O    2  
ATOM   3518  C  CB   . HIS A 1 55  ? 4.428   16.582 46.140  1.00 0.00  ? 55  HIS A CB   2  
ATOM   3519  C  CG   . HIS A 1 55  ? 5.502   16.893 47.150  1.00 0.00  ? 55  HIS A CG   2  
ATOM   3520  N  ND1  . HIS A 1 55  ? 5.367   17.904 48.093  1.00 0.00  ? 55  HIS A ND1  2  
ATOM   3521  C  CD2  . HIS A 1 55  ? 6.731   16.327 47.383  1.00 0.00  ? 55  HIS A CD2  2  
ATOM   3522  C  CE1  . HIS A 1 55  ? 6.487   17.912 48.841  1.00 0.00  ? 55  HIS A CE1  2  
ATOM   3523  N  NE2  . HIS A 1 55  ? 7.351   16.971 48.451  1.00 0.00  ? 55  HIS A NE2  2  
ATOM   3524  H  H    . HIS A 1 55  ? 6.187   15.033 45.134  1.00 0.00  ? 55  HIS A H    2  
ATOM   3525  H  HA   . HIS A 1 55  ? 4.172   16.692 44.012  1.00 0.00  ? 55  HIS A HA   2  
ATOM   3526  H  HB2  . HIS A 1 55  ? 3.588   17.241 46.288  1.00 0.00  ? 55  HIS A HB2  2  
ATOM   3527  H  HB3  . HIS A 1 55  ? 4.105   15.560 46.264  1.00 0.00  ? 55  HIS A HB3  2  
ATOM   3528  H  HD1  . HIS A 1 55  ? 4.597   18.503 48.197  1.00 0.00  ? 55  HIS A HD1  2  
ATOM   3529  H  HD2  . HIS A 1 55  ? 7.150   15.506 46.826  1.00 0.00  ? 55  HIS A HD2  2  
ATOM   3530  H  HE1  . HIS A 1 55  ? 6.666   18.596 49.659  1.00 0.00  ? 55  HIS A HE1  2  
ATOM   3531  N  N    . ASP A 1 56  ? 5.218   19.088 45.367  1.00 0.00  ? 56  ASP A N    2  
ATOM   3532  C  CA   . ASP A 1 56  ? 5.830   20.443 45.290  1.00 0.00  ? 56  ASP A CA   2  
ATOM   3533  C  C    . ASP A 1 56  ? 7.250   20.383 45.860  1.00 0.00  ? 56  ASP A C    2  
ATOM   3534  O  O    . ASP A 1 56  ? 7.644   19.399 46.455  1.00 0.00  ? 56  ASP A O    2  
ATOM   3535  C  CB   . ASP A 1 56  ? 4.983   21.418 46.112  1.00 0.00  ? 56  ASP A CB   2  
ATOM   3536  C  CG   . ASP A 1 56  ? 4.802   22.724 45.339  1.00 0.00  ? 56  ASP A CG   2  
ATOM   3537  O  OD1  . ASP A 1 56  ? 3.899   22.786 44.522  1.00 0.00  ? 56  ASP A OD1  2  
ATOM   3538  O  OD2  . ASP A 1 56  ? 5.570   23.640 45.581  1.00 0.00  ? 56  ASP A OD2  2  
ATOM   3539  H  H    . ASP A 1 56  ? 4.490   18.916 45.999  1.00 0.00  ? 56  ASP A H    2  
ATOM   3540  H  HA   . ASP A 1 56  ? 5.865   20.770 44.261  1.00 0.00  ? 56  ASP A HA   2  
ATOM   3541  H  HB2  . ASP A 1 56  ? 4.015   20.978 46.306  1.00 0.00  ? 56  ASP A HB2  2  
ATOM   3542  H  HB3  . ASP A 1 56  ? 5.479   21.622 47.047  1.00 0.00  ? 56  ASP A HB3  2  
ATOM   3543  N  N    . GLY A 1 57  ? 8.022   21.422 45.684  1.00 0.00  ? 57  GLY A N    2  
ATOM   3544  C  CA   . GLY A 1 57  ? 9.417   21.416 46.217  1.00 0.00  ? 57  GLY A CA   2  
ATOM   3545  C  C    . GLY A 1 57  ? 10.415  21.451 45.055  1.00 0.00  ? 57  GLY A C    2  
ATOM   3546  O  O    . GLY A 1 57  ? 10.162  22.041 44.023  1.00 0.00  ? 57  GLY A O    2  
ATOM   3547  H  H    . GLY A 1 57  ? 7.687   22.206 45.200  1.00 0.00  ? 57  GLY A H    2  
ATOM   3548  H  HA2  . GLY A 1 57  ? 9.564   22.285 46.846  1.00 0.00  ? 57  GLY A HA2  2  
ATOM   3549  H  HA3  . GLY A 1 57  ? 9.578   20.520 46.798  1.00 0.00  ? 57  GLY A HA3  2  
ATOM   3550  N  N    . GLU A 1 58  ? 11.553  20.827 45.214  1.00 0.00  ? 58  GLU A N    2  
ATOM   3551  C  CA   . GLU A 1 58  ? 12.562  20.831 44.116  1.00 0.00  ? 58  GLU A CA   2  
ATOM   3552  C  C    . GLU A 1 58  ? 12.223  19.738 43.105  1.00 0.00  ? 58  GLU A C    2  
ATOM   3553  O  O    . GLU A 1 58  ? 11.643  18.722 43.438  1.00 0.00  ? 58  GLU A O    2  
ATOM   3554  C  CB   . GLU A 1 58  ? 13.959  20.574 44.688  1.00 0.00  ? 58  GLU A CB   2  
ATOM   3555  C  CG   . GLU A 1 58  ? 14.848  21.795 44.442  1.00 0.00  ? 58  GLU A CG   2  
ATOM   3556  C  CD   . GLU A 1 58  ? 15.732  22.042 45.666  1.00 0.00  ? 58  GLU A CD   2  
ATOM   3557  O  OE1  . GLU A 1 58  ? 15.481  21.430 46.691  1.00 0.00  ? 58  GLU A OE1  2  
ATOM   3558  O  OE2  . GLU A 1 58  ? 16.649  22.838 45.555  1.00 0.00  ? 58  GLU A OE2  2  
ATOM   3559  H  H    . GLU A 1 58  ? 11.742  20.359 46.052  1.00 0.00  ? 58  GLU A H    2  
ATOM   3560  H  HA   . GLU A 1 58  ? 12.549  21.790 43.620  1.00 0.00  ? 58  GLU A HA   2  
ATOM   3561  H  HB2  . GLU A 1 58  ? 13.886  20.389 45.747  1.00 0.00  ? 58  GLU A HB2  2  
ATOM   3562  H  HB3  . GLU A 1 58  ? 14.393  19.714 44.199  1.00 0.00  ? 58  GLU A HB3  2  
ATOM   3563  H  HG2  . GLU A 1 58  ? 15.472  21.616 43.578  1.00 0.00  ? 58  GLU A HG2  2  
ATOM   3564  H  HG3  . GLU A 1 58  ? 14.228  22.662 44.266  1.00 0.00  ? 58  GLU A HG3  2  
ATOM   3565  N  N    . ALA A 1 59  ? 12.584  19.943 41.870  1.00 0.00  ? 59  ALA A N    2  
ATOM   3566  C  CA   . ALA A 1 59  ? 12.292  18.926 40.821  1.00 0.00  ? 59  ALA A CA   2  
ATOM   3567  C  C    . ALA A 1 59  ? 13.203  19.168 39.616  1.00 0.00  ? 59  ALA A C    2  
ATOM   3568  O  O    . ALA A 1 59  ? 13.601  20.284 39.343  1.00 0.00  ? 59  ALA A O    2  
ATOM   3569  C  CB   . ALA A 1 59  ? 10.832  19.050 40.385  1.00 0.00  ? 59  ALA A CB   2  
ATOM   3570  H  H    . ALA A 1 59  ? 13.055  20.769 41.634  1.00 0.00  ? 59  ALA A H    2  
ATOM   3571  H  HA   . ALA A 1 59  ? 12.469  17.936 41.217  1.00 0.00  ? 59  ALA A HA   2  
ATOM   3572  H  HB1  . ALA A 1 59  ? 10.782  19.580 39.447  1.00 0.00  ? 59  ALA A HB1  2  
ATOM   3573  H  HB2  . ALA A 1 59  ? 10.278  19.592 41.135  1.00 0.00  ? 59  ALA A HB2  2  
ATOM   3574  H  HB3  . ALA A 1 59  ? 10.406  18.066 40.263  1.00 0.00  ? 59  ALA A HB3  2  
ATOM   3575  N  N    . ASP A 1 60  ? 13.540  18.135 38.891  1.00 0.00  ? 60  ASP A N    2  
ATOM   3576  C  CA   . ASP A 1 60  ? 14.424  18.318 37.704  1.00 0.00  ? 60  ASP A CA   2  
ATOM   3577  C  C    . ASP A 1 60  ? 13.602  18.878 36.545  1.00 0.00  ? 60  ASP A C    2  
ATOM   3578  O  O    . ASP A 1 60  ? 13.737  20.025 36.166  1.00 0.00  ? 60  ASP A O    2  
ATOM   3579  C  CB   . ASP A 1 60  ? 15.011  16.970 37.288  1.00 0.00  ? 60  ASP A CB   2  
ATOM   3580  C  CG   . ASP A 1 60  ? 16.444  16.853 37.806  1.00 0.00  ? 60  ASP A CG   2  
ATOM   3581  O  OD1  . ASP A 1 60  ? 16.641  17.045 38.994  1.00 0.00  ? 60  ASP A OD1  2  
ATOM   3582  O  OD2  . ASP A 1 60  ? 17.322  16.574 37.005  1.00 0.00  ? 60  ASP A OD2  2  
ATOM   3583  H  H    . ASP A 1 60  ? 13.209  17.242 39.126  1.00 0.00  ? 60  ASP A H    2  
ATOM   3584  H  HA   . ASP A 1 60  ? 15.223  19.002 37.949  1.00 0.00  ? 60  ASP A HA   2  
ATOM   3585  H  HB2  . ASP A 1 60  ? 14.411  16.174 37.703  1.00 0.00  ? 60  ASP A HB2  2  
ATOM   3586  H  HB3  . ASP A 1 60  ? 15.013  16.897 36.211  1.00 0.00  ? 60  ASP A HB3  2  
ATOM   3587  N  N    . ILE A 1 61  ? 12.732  18.078 35.995  1.00 0.00  ? 61  ILE A N    2  
ATOM   3588  C  CA   . ILE A 1 61  ? 11.881  18.570 34.872  1.00 0.00  ? 61  ILE A CA   2  
ATOM   3589  C  C    . ILE A 1 61  ? 10.711  19.333 35.476  1.00 0.00  ? 61  ILE A C    2  
ATOM   3590  O  O    . ILE A 1 61  ? 10.001  18.830 36.323  1.00 0.00  ? 61  ILE A O    2  
ATOM   3591  C  CB   . ILE A 1 61  ? 11.336  17.413 34.010  1.00 0.00  ? 61  ILE A CB   2  
ATOM   3592  C  CG1  . ILE A 1 61  ? 11.836  16.057 34.521  1.00 0.00  ? 61  ILE A CG1  2  
ATOM   3593  C  CG2  . ILE A 1 61  ? 11.799  17.588 32.562  1.00 0.00  ? 61  ILE A CG2  2  
ATOM   3594  C  CD1  . ILE A 1 61  ? 13.351  15.969 34.334  1.00 0.00  ? 61  ILE A CD1  2  
ATOM   3595  H  H    . ILE A 1 61  ? 12.629  17.168 36.337  1.00 0.00  ? 61  ILE A H    2  
ATOM   3596  H  HA   . ILE A 1 61  ? 12.462  19.240 34.252  1.00 0.00  ? 61  ILE A HA   2  
ATOM   3597  H  HB   . ILE A 1 61  ? 10.257  17.436 34.041  1.00 0.00  ? 61  ILE A HB   2  
ATOM   3598  H  HG12 . ILE A 1 61  ? 11.593  15.952 35.567  1.00 0.00  ? 61  ILE A HG12 2  
ATOM   3599  H  HG13 . ILE A 1 61  ? 11.363  15.264 33.961  1.00 0.00  ? 61  ILE A HG13 2  
ATOM   3600  H  HG21 . ILE A 1 61  ? 11.031  18.093 31.995  1.00 0.00  ? 61  ILE A HG21 2  
ATOM   3601  H  HG22 . ILE A 1 61  ? 11.987  16.618 32.124  1.00 0.00  ? 61  ILE A HG22 2  
ATOM   3602  H  HG23 . ILE A 1 61  ? 12.706  18.173 32.543  1.00 0.00  ? 61  ILE A HG23 2  
ATOM   3603  H  HD11 . ILE A 1 61  ? 13.582  15.176 33.637  1.00 0.00  ? 61  ILE A HD11 2  
ATOM   3604  H  HD12 . ILE A 1 61  ? 13.818  15.761 35.284  1.00 0.00  ? 61  ILE A HD12 2  
ATOM   3605  H  HD13 . ILE A 1 61  ? 13.723  16.907 33.946  1.00 0.00  ? 61  ILE A HD13 2  
ATOM   3606  N  N    . MET A 1 62  ? 10.506  20.543 35.058  1.00 0.00  ? 62  MET A N    2  
ATOM   3607  C  CA   . MET A 1 62  ? 9.379   21.332 35.622  1.00 0.00  ? 62  MET A CA   2  
ATOM   3608  C  C    . MET A 1 62  ? 8.437   21.738 34.493  1.00 0.00  ? 62  MET A C    2  
ATOM   3609  O  O    . MET A 1 62  ? 8.803   22.464 33.592  1.00 0.00  ? 62  MET A O    2  
ATOM   3610  C  CB   . MET A 1 62  ? 9.921   22.573 36.333  1.00 0.00  ? 62  MET A CB   2  
ATOM   3611  C  CG   . MET A 1 62  ? 9.286   22.671 37.723  1.00 0.00  ? 62  MET A CG   2  
ATOM   3612  S  SD   . MET A 1 62  ? 10.432  22.005 38.955  1.00 0.00  ? 62  MET A SD   2  
ATOM   3613  C  CE   . MET A 1 62  ? 11.566  23.413 38.983  1.00 0.00  ? 62  MET A CE   2  
ATOM   3614  H  H    . MET A 1 62  ? 11.093  20.930 34.373  1.00 0.00  ? 62  MET A H    2  
ATOM   3615  H  HA   . MET A 1 62  ? 8.840   20.721 36.334  1.00 0.00  ? 62  MET A HA   2  
ATOM   3616  H  HB2  . MET A 1 62  ? 10.994  22.490 36.431  1.00 0.00  ? 62  MET A HB2  2  
ATOM   3617  H  HB3  . MET A 1 62  ? 9.678   23.455 35.761  1.00 0.00  ? 62  MET A HB3  2  
ATOM   3618  H  HG2  . MET A 1 62  ? 9.073   23.704 37.951  1.00 0.00  ? 62  MET A HG2  2  
ATOM   3619  H  HG3  . MET A 1 62  ? 8.368   22.102 37.742  1.00 0.00  ? 62  MET A HG3  2  
ATOM   3620  H  HE1  . MET A 1 62  ? 11.815  23.693 37.968  1.00 0.00  ? 62  MET A HE1  2  
ATOM   3621  H  HE2  . MET A 1 62  ? 12.464  23.141 39.509  1.00 0.00  ? 62  MET A HE2  2  
ATOM   3622  H  HE3  . MET A 1 62  ? 11.092  24.245 39.486  1.00 0.00  ? 62  MET A HE3  2  
ATOM   3623  N  N    . ILE A 1 63  ? 7.230   21.255 34.526  1.00 0.00  ? 63  ILE A N    2  
ATOM   3624  C  CA   . ILE A 1 63  ? 6.266   21.589 33.443  1.00 0.00  ? 63  ILE A CA   2  
ATOM   3625  C  C    . ILE A 1 63  ? 5.265   22.634 33.941  1.00 0.00  ? 63  ILE A C    2  
ATOM   3626  O  O    . ILE A 1 63  ? 4.880   22.640 35.093  1.00 0.00  ? 63  ILE A O    2  
ATOM   3627  C  CB   . ILE A 1 63  ? 5.538   20.307 33.039  1.00 0.00  ? 63  ILE A CB   2  
ATOM   3628  C  CG1  . ILE A 1 63  ? 6.571   19.277 32.568  1.00 0.00  ? 63  ILE A CG1  2  
ATOM   3629  C  CG2  . ILE A 1 63  ? 4.550   20.605 31.910  1.00 0.00  ? 63  ILE A CG2  2  
ATOM   3630  C  CD1  . ILE A 1 63  ? 6.921   18.341 33.728  1.00 0.00  ? 63  ILE A CD1  2  
ATOM   3631  H  H    . ILE A 1 63  ? 6.960   20.660 35.258  1.00 0.00  ? 63  ILE A H    2  
ATOM   3632  H  HA   . ILE A 1 63  ? 6.802   21.981 32.592  1.00 0.00  ? 63  ILE A HA   2  
ATOM   3633  H  HB   . ILE A 1 63  ? 5.002   19.913 33.890  1.00 0.00  ? 63  ILE A HB   2  
ATOM   3634  H  HG12 . ILE A 1 63  ? 6.163   18.702 31.751  1.00 0.00  ? 63  ILE A HG12 2  
ATOM   3635  H  HG13 . ILE A 1 63  ? 7.464   19.786 32.239  1.00 0.00  ? 63  ILE A HG13 2  
ATOM   3636  H  HG21 . ILE A 1 63  ? 4.092   21.569 32.079  1.00 0.00  ? 63  ILE A HG21 2  
ATOM   3637  H  HG22 . ILE A 1 63  ? 3.787   19.842 31.891  1.00 0.00  ? 63  ILE A HG22 2  
ATOM   3638  H  HG23 . ILE A 1 63  ? 5.073   20.615 30.965  1.00 0.00  ? 63  ILE A HG23 2  
ATOM   3639  H  HD11 . ILE A 1 63  ? 7.938   17.995 33.617  1.00 0.00  ? 63  ILE A HD11 2  
ATOM   3640  H  HD12 . ILE A 1 63  ? 6.250   17.495 33.723  1.00 0.00  ? 63  ILE A HD12 2  
ATOM   3641  H  HD13 . ILE A 1 63  ? 6.821   18.873 34.662  1.00 0.00  ? 63  ILE A HD13 2  
ATOM   3642  N  N    . ASN A 1 64  ? 4.837   23.522 33.080  1.00 0.00  ? 64  ASN A N    2  
ATOM   3643  C  CA   . ASN A 1 64  ? 3.866   24.553 33.503  1.00 0.00  ? 64  ASN A CA   2  
ATOM   3644  C  C    . ASN A 1 64  ? 3.321   25.274 32.267  1.00 0.00  ? 64  ASN A C    2  
ATOM   3645  O  O    . ASN A 1 64  ? 3.779   25.056 31.164  1.00 0.00  ? 64  ASN A O    2  
ATOM   3646  C  CB   . ASN A 1 64  ? 4.553   25.548 34.443  1.00 0.00  ? 64  ASN A CB   2  
ATOM   3647  C  CG   . ASN A 1 64  ? 3.498   26.382 35.177  1.00 0.00  ? 64  ASN A CG   2  
ATOM   3648  O  OD1  . ASN A 1 64  ? 2.475   25.867 35.583  1.00 0.00  ? 64  ASN A OD1  2  
ATOM   3649  N  ND2  . ASN A 1 64  ? 3.704   27.657 35.368  1.00 0.00  ? 64  ASN A ND2  2  
ATOM   3650  H  H    . ASN A 1 64  ? 5.143   23.505 32.159  1.00 0.00  ? 64  ASN A H    2  
ATOM   3651  H  HA   . ASN A 1 64  ? 3.063   24.070 34.012  1.00 0.00  ? 64  ASN A HA   2  
ATOM   3652  H  HB2  . ASN A 1 64  ? 5.142   25.003 35.166  1.00 0.00  ? 64  ASN A HB2  2  
ATOM   3653  H  HB3  . ASN A 1 64  ? 5.196   26.200 33.874  1.00 0.00  ? 64  ASN A HB3  2  
ATOM   3654  H  HD21 . ASN A 1 64  ? 4.528   28.077 35.041  1.00 0.00  ? 64  ASN A HD21 2  
ATOM   3655  H  HD22 . ASN A 1 64  ? 3.037   28.194 35.844  1.00 0.00  ? 64  ASN A HD22 2  
ATOM   3656  N  N    . PHE A 1 65  ? 2.341   26.119 32.436  1.00 0.00  ? 65  PHE A N    2  
ATOM   3657  C  CA   . PHE A 1 65  ? 1.762   26.836 31.261  1.00 0.00  ? 65  PHE A CA   2  
ATOM   3658  C  C    . PHE A 1 65  ? 1.922   28.347 31.444  1.00 0.00  ? 65  PHE A C    2  
ATOM   3659  O  O    . PHE A 1 65  ? 2.123   28.833 32.541  1.00 0.00  ? 65  PHE A O    2  
ATOM   3660  C  CB   . PHE A 1 65  ? 0.276   26.491 31.154  1.00 0.00  ? 65  PHE A CB   2  
ATOM   3661  C  CG   . PHE A 1 65  ? -0.432  26.991 32.388  1.00 0.00  ? 65  PHE A CG   2  
ATOM   3662  C  CD1  . PHE A 1 65  ? -0.772  28.343 32.501  1.00 0.00  ? 65  PHE A CD1  2  
ATOM   3663  C  CD2  . PHE A 1 65  ? -0.741  26.102 33.424  1.00 0.00  ? 65  PHE A CD2  2  
ATOM   3664  C  CE1  . PHE A 1 65  ? -1.423  28.808 33.651  1.00 0.00  ? 65  PHE A CE1  2  
ATOM   3665  C  CE2  . PHE A 1 65  ? -1.392  26.565 34.573  1.00 0.00  ? 65  PHE A CE2  2  
ATOM   3666  C  CZ   . PHE A 1 65  ? -1.733  27.920 34.685  1.00 0.00  ? 65  PHE A CZ   2  
ATOM   3667  H  H    . PHE A 1 65  ? 1.978   26.275 33.332  1.00 0.00  ? 65  PHE A H    2  
ATOM   3668  H  HA   . PHE A 1 65  ? 2.270   26.526 30.362  1.00 0.00  ? 65  PHE A HA   2  
ATOM   3669  H  HB2  . PHE A 1 65  ? -0.142  26.962 30.276  1.00 0.00  ? 65  PHE A HB2  2  
ATOM   3670  H  HB3  . PHE A 1 65  ? 0.158   25.420 31.080  1.00 0.00  ? 65  PHE A HB3  2  
ATOM   3671  H  HD1  . PHE A 1 65  ? -0.533  29.027 31.701  1.00 0.00  ? 65  PHE A HD1  2  
ATOM   3672  H  HD2  . PHE A 1 65  ? -0.476  25.058 33.336  1.00 0.00  ? 65  PHE A HD2  2  
ATOM   3673  H  HE1  . PHE A 1 65  ? -1.686  29.852 33.739  1.00 0.00  ? 65  PHE A HE1  2  
ATOM   3674  H  HE2  . PHE A 1 65  ? -1.630  25.878 35.372  1.00 0.00  ? 65  PHE A HE2  2  
ATOM   3675  H  HZ   . PHE A 1 65  ? -2.235  28.279 35.572  1.00 0.00  ? 65  PHE A HZ   2  
ATOM   3676  N  N    . GLY A 1 66  ? 1.831   29.099 30.375  1.00 0.00  ? 66  GLY A N    2  
ATOM   3677  C  CA   . GLY A 1 66  ? 1.977   30.578 30.495  1.00 0.00  ? 66  GLY A CA   2  
ATOM   3678  C  C    . GLY A 1 66  ? 1.583   31.258 29.179  1.00 0.00  ? 66  GLY A C    2  
ATOM   3679  O  O    . GLY A 1 66  ? 2.060   30.909 28.118  1.00 0.00  ? 66  GLY A O    2  
ATOM   3680  H  H    . GLY A 1 66  ? 1.668   28.691 29.499  1.00 0.00  ? 66  GLY A H    2  
ATOM   3681  H  HA2  . GLY A 1 66  ? 1.335   30.938 31.288  1.00 0.00  ? 66  GLY A HA2  2  
ATOM   3682  H  HA3  . GLY A 1 66  ? 3.004   30.819 30.728  1.00 0.00  ? 66  GLY A HA3  2  
ATOM   3683  N  N    . ARG A 1 67  ? 0.719   32.234 29.258  1.00 0.00  ? 67  ARG A N    2  
ATOM   3684  C  CA   . ARG A 1 67  ? 0.277   32.973 28.036  1.00 0.00  ? 67  ARG A CA   2  
ATOM   3685  C  C    . ARG A 1 67  ? 1.110   34.256 27.916  1.00 0.00  ? 67  ARG A C    2  
ATOM   3686  O  O    . ARG A 1 67  ? 2.310   34.233 28.102  1.00 0.00  ? 67  ARG A O    2  
ATOM   3687  C  CB   . ARG A 1 67  ? -1.220  33.318 28.157  1.00 0.00  ? 67  ARG A CB   2  
ATOM   3688  C  CG   . ARG A 1 67  ? -1.475  34.112 29.451  1.00 0.00  ? 67  ARG A CG   2  
ATOM   3689  C  CD   . ARG A 1 67  ? -2.982  34.259 29.716  1.00 0.00  ? 67  ARG A CD   2  
ATOM   3690  N  NE   . ARG A 1 67  ? -3.771  33.659 28.602  1.00 0.00  ? 67  ARG A NE   2  
ATOM   3691  C  CZ   . ARG A 1 67  ? -3.924  34.315 27.484  1.00 0.00  ? 67  ARG A CZ   2  
ATOM   3692  N  NH1  . ARG A 1 67  ? -3.366  35.484 27.328  1.00 0.00  ? 67  ARG A NH1  2  
ATOM   3693  N  NH2  . ARG A 1 67  ? -4.632  33.799 26.517  1.00 0.00  ? 67  ARG A NH2  2  
ATOM   3694  H  H    . ARG A 1 67  ? 0.367   32.489 30.131  1.00 0.00  ? 67  ARG A H    2  
ATOM   3695  H  HA   . ARG A 1 67  ? 0.439   32.356 27.164  1.00 0.00  ? 67  ARG A HA   2  
ATOM   3696  H  HB2  . ARG A 1 67  ? -1.520  33.910 27.306  1.00 0.00  ? 67  ARG A HB2  2  
ATOM   3697  H  HB3  . ARG A 1 67  ? -1.797  32.406 28.177  1.00 0.00  ? 67  ARG A HB3  2  
ATOM   3698  H  HG2  . ARG A 1 67  ? -1.025  33.594 30.284  1.00 0.00  ? 67  ARG A HG2  2  
ATOM   3699  H  HG3  . ARG A 1 67  ? -1.036  35.093 29.360  1.00 0.00  ? 67  ARG A HG3  2  
ATOM   3700  H  HD2  . ARG A 1 67  ? -3.233  33.757 30.638  1.00 0.00  ? 67  ARG A HD2  2  
ATOM   3701  H  HD3  . ARG A 1 67  ? -3.227  35.308 29.803  1.00 0.00  ? 67  ARG A HD3  2  
ATOM   3702  H  HE   . ARG A 1 67  ? -4.184  32.778 28.714  1.00 0.00  ? 67  ARG A HE   2  
ATOM   3703  H  HH11 . ARG A 1 67  ? -2.817  35.879 28.064  1.00 0.00  ? 67  ARG A HH11 2  
ATOM   3704  H  HH12 . ARG A 1 67  ? -3.492  35.987 26.472  1.00 0.00  ? 67  ARG A HH12 2  
ATOM   3705  H  HH21 . ARG A 1 67  ? -5.059  32.902 26.631  1.00 0.00  ? 67  ARG A HH21 2  
ATOM   3706  H  HH22 . ARG A 1 67  ? -4.744  34.301 25.660  1.00 0.00  ? 67  ARG A HH22 2  
ATOM   3707  N  N    . TRP A 1 68  ? 0.504   35.379 27.627  1.00 0.00  ? 68  TRP A N    2  
ATOM   3708  C  CA   . TRP A 1 68  ? 1.314   36.625 27.533  1.00 0.00  ? 68  TRP A CA   2  
ATOM   3709  C  C    . TRP A 1 68  ? 2.175   36.719 28.789  1.00 0.00  ? 68  TRP A C    2  
ATOM   3710  O  O    . TRP A 1 68  ? 3.342   37.052 28.735  1.00 0.00  ? 68  TRP A O    2  
ATOM   3711  C  CB   . TRP A 1 68  ? 0.405   37.855 27.444  1.00 0.00  ? 68  TRP A CB   2  
ATOM   3712  C  CG   . TRP A 1 68  ? 1.094   38.921 26.645  1.00 0.00  ? 68  TRP A CG   2  
ATOM   3713  C  CD1  . TRP A 1 68  ? 1.064   39.023 25.295  1.00 0.00  ? 68  TRP A CD1  2  
ATOM   3714  C  CD2  . TRP A 1 68  ? 1.916   40.033 27.118  1.00 0.00  ? 68  TRP A CD2  2  
ATOM   3715  N  NE1  . TRP A 1 68  ? 1.814   40.121 24.911  1.00 0.00  ? 68  TRP A NE1  2  
ATOM   3716  C  CE2  . TRP A 1 68  ? 2.359   40.775 25.998  1.00 0.00  ? 68  TRP A CE2  2  
ATOM   3717  C  CE3  . TRP A 1 68  ? 2.317   40.463 28.397  1.00 0.00  ? 68  TRP A CE3  2  
ATOM   3718  C  CZ2  . TRP A 1 68  ? 3.169   41.904 26.138  1.00 0.00  ? 68  TRP A CZ2  2  
ATOM   3719  C  CZ3  . TRP A 1 68  ? 3.133   41.601 28.543  1.00 0.00  ? 68  TRP A CZ3  2  
ATOM   3720  C  CH2  . TRP A 1 68  ? 3.558   42.318 27.415  1.00 0.00  ? 68  TRP A CH2  2  
ATOM   3721  H  H    . TRP A 1 68  ? -0.465  35.406 27.489  1.00 0.00  ? 68  TRP A H    2  
ATOM   3722  H  HA   . TRP A 1 68  ? 1.950   36.578 26.660  1.00 0.00  ? 68  TRP A HA   2  
ATOM   3723  H  HB2  . TRP A 1 68  ? -0.521  37.584 26.963  1.00 0.00  ? 68  TRP A HB2  2  
ATOM   3724  H  HB3  . TRP A 1 68  ? 0.202   38.225 28.437  1.00 0.00  ? 68  TRP A HB3  2  
ATOM   3725  H  HD1  . TRP A 1 68  ? 0.542   38.354 24.625  1.00 0.00  ? 68  TRP A HD1  2  
ATOM   3726  H  HE1  . TRP A 1 68  ? 1.953   40.416 23.987  1.00 0.00  ? 68  TRP A HE1  2  
ATOM   3727  H  HE3  . TRP A 1 68  ? 1.992   39.919 29.272  1.00 0.00  ? 68  TRP A HE3  2  
ATOM   3728  H  HZ2  . TRP A 1 68  ? 3.494   42.452 25.266  1.00 0.00  ? 68  TRP A HZ2  2  
ATOM   3729  H  HZ3  . TRP A 1 68  ? 3.433   41.923 29.530  1.00 0.00  ? 68  TRP A HZ3  2  
ATOM   3730  H  HH2  . TRP A 1 68  ? 4.186   43.191 27.533  1.00 0.00  ? 68  TRP A HH2  2  
ATOM   3731  N  N    . GLU A 1 69  ? 1.608   36.401 29.922  1.00 0.00  ? 69  GLU A N    2  
ATOM   3732  C  CA   . GLU A 1 69  ? 2.388   36.444 31.188  1.00 0.00  ? 69  GLU A CA   2  
ATOM   3733  C  C    . GLU A 1 69  ? 3.347   35.251 31.219  1.00 0.00  ? 69  GLU A C    2  
ATOM   3734  O  O    . GLU A 1 69  ? 3.341   34.460 32.141  1.00 0.00  ? 69  GLU A O    2  
ATOM   3735  C  CB   . GLU A 1 69  ? 1.428   36.351 32.376  1.00 0.00  ? 69  GLU A CB   2  
ATOM   3736  C  CG   . GLU A 1 69  ? 2.219   36.429 33.683  1.00 0.00  ? 69  GLU A CG   2  
ATOM   3737  C  CD   . GLU A 1 69  ? 1.482   37.335 34.672  1.00 0.00  ? 69  GLU A CD   2  
ATOM   3738  O  OE1  . GLU A 1 69  ? 1.315   38.502 34.364  1.00 0.00  ? 69  GLU A OE1  2  
ATOM   3739  O  OE2  . GLU A 1 69  ? 1.098   36.846 35.720  1.00 0.00  ? 69  GLU A OE2  2  
ATOM   3740  H  H    . GLU A 1 69  ? 0.670   36.117 29.935  1.00 0.00  ? 69  GLU A H    2  
ATOM   3741  H  HA   . GLU A 1 69  ? 2.949   37.366 31.241  1.00 0.00  ? 69  GLU A HA   2  
ATOM   3742  H  HB2  . GLU A 1 69  ? 0.721   37.167 32.332  1.00 0.00  ? 69  GLU A HB2  2  
ATOM   3743  H  HB3  . GLU A 1 69  ? 0.899   35.412 32.335  1.00 0.00  ? 69  GLU A HB3  2  
ATOM   3744  H  HG2  . GLU A 1 69  ? 2.317   35.438 34.105  1.00 0.00  ? 69  GLU A HG2  2  
ATOM   3745  H  HG3  . GLU A 1 69  ? 3.200   36.836 33.488  1.00 0.00  ? 69  GLU A HG3  2  
ATOM   3746  N  N    . HIS A 1 70  ? 4.168   35.110 30.212  1.00 0.00  ? 70  HIS A N    2  
ATOM   3747  C  CA   . HIS A 1 70  ? 5.119   33.967 30.177  1.00 0.00  ? 70  HIS A CA   2  
ATOM   3748  C  C    . HIS A 1 70  ? 5.758   33.802 31.551  1.00 0.00  ? 70  HIS A C    2  
ATOM   3749  O  O    . HIS A 1 70  ? 5.789   32.723 32.110  1.00 0.00  ? 70  HIS A O    2  
ATOM   3750  C  CB   . HIS A 1 70  ? 6.208   34.246 29.141  1.00 0.00  ? 70  HIS A CB   2  
ATOM   3751  C  CG   . HIS A 1 70  ? 6.832   32.949 28.707  1.00 0.00  ? 70  HIS A CG   2  
ATOM   3752  N  ND1  . HIS A 1 70  ? 7.470   32.810 27.485  1.00 0.00  ? 70  HIS A ND1  2  
ATOM   3753  C  CD2  . HIS A 1 70  ? 6.927   31.724 29.322  1.00 0.00  ? 70  HIS A CD2  2  
ATOM   3754  C  CE1  . HIS A 1 70  ? 7.916   31.543 27.404  1.00 0.00  ? 70  HIS A CE1  2  
ATOM   3755  N  NE2  . HIS A 1 70  ? 7.612   30.838 28.497  1.00 0.00  ? 70  HIS A NE2  2  
ATOM   3756  H  H    . HIS A 1 70  ? 4.157   35.755 29.476  1.00 0.00  ? 70  HIS A H    2  
ATOM   3757  H  HA   . HIS A 1 70  ? 4.591   33.063 29.912  1.00 0.00  ? 70  HIS A HA   2  
ATOM   3758  H  HB2  . HIS A 1 70  ? 5.773   34.740 28.285  1.00 0.00  ? 70  HIS A HB2  2  
ATOM   3759  H  HB3  . HIS A 1 70  ? 6.965   34.881 29.576  1.00 0.00  ? 70  HIS A HB3  2  
ATOM   3760  H  HD1  . HIS A 1 70  ? 7.580   33.508 26.806  1.00 0.00  ? 70  HIS A HD1  2  
ATOM   3761  H  HD2  . HIS A 1 70  ? 6.537   31.488 30.302  1.00 0.00  ? 70  HIS A HD2  2  
ATOM   3762  H  HE1  . HIS A 1 70  ? 8.456   31.144 26.558  1.00 0.00  ? 70  HIS A HE1  2  
ATOM   3763  N  N    . GLY A 1 71  ? 6.277   34.863 32.098  1.00 0.00  ? 71  GLY A N    2  
ATOM   3764  C  CA   . GLY A 1 71  ? 6.923   34.767 33.430  1.00 0.00  ? 71  GLY A CA   2  
ATOM   3765  C  C    . GLY A 1 71  ? 8.411   34.492 33.235  1.00 0.00  ? 71  GLY A C    2  
ATOM   3766  O  O    . GLY A 1 71  ? 9.098   34.061 34.139  1.00 0.00  ? 71  GLY A O    2  
ATOM   3767  H  H    . GLY A 1 71  ? 6.247   35.722 31.628  1.00 0.00  ? 71  GLY A H    2  
ATOM   3768  H  HA2  . GLY A 1 71  ? 6.791   35.698 33.963  1.00 0.00  ? 71  GLY A HA2  2  
ATOM   3769  H  HA3  . GLY A 1 71  ? 6.478   33.958 33.992  1.00 0.00  ? 71  GLY A HA3  2  
ATOM   3770  N  N    . ASP A 1 72  ? 8.918   34.747 32.058  1.00 0.00  ? 72  ASP A N    2  
ATOM   3771  C  CA   . ASP A 1 72  ? 10.350  34.513 31.804  1.00 0.00  ? 72  ASP A CA   2  
ATOM   3772  C  C    . ASP A 1 72  ? 10.852  35.476 30.722  1.00 0.00  ? 72  ASP A C    2  
ATOM   3773  O  O    . ASP A 1 72  ? 11.797  35.191 30.011  1.00 0.00  ? 72  ASP A O    2  
ATOM   3774  C  CB   . ASP A 1 72  ? 10.577  33.059 31.381  1.00 0.00  ? 72  ASP A CB   2  
ATOM   3775  C  CG   . ASP A 1 72  ? 10.017  32.827 29.974  1.00 0.00  ? 72  ASP A CG   2  
ATOM   3776  O  OD1  . ASP A 1 72  ? 9.480   33.763 29.407  1.00 0.00  ? 72  ASP A OD1  2  
ATOM   3777  O  OD2  . ASP A 1 72  ? 10.133  31.711 29.489  1.00 0.00  ? 72  ASP A OD2  2  
ATOM   3778  H  H    . ASP A 1 72  ? 8.363   35.098 31.352  1.00 0.00  ? 72  ASP A H    2  
ATOM   3779  H  HA   . ASP A 1 72  ? 10.876  34.705 32.710  1.00 0.00  ? 72  ASP A HA   2  
ATOM   3780  H  HB2  . ASP A 1 72  ? 11.635  32.845 31.386  1.00 0.00  ? 72  ASP A HB2  2  
ATOM   3781  H  HB3  . ASP A 1 72  ? 10.075  32.403 32.076  1.00 0.00  ? 72  ASP A HB3  2  
ATOM   3782  N  N    . GLY A 1 73  ? 10.236  36.627 30.610  1.00 0.00  ? 73  GLY A N    2  
ATOM   3783  C  CA   . GLY A 1 73  ? 10.687  37.630 29.599  1.00 0.00  ? 73  GLY A CA   2  
ATOM   3784  C  C    . GLY A 1 73  ? 9.905   37.477 28.291  1.00 0.00  ? 73  GLY A C    2  
ATOM   3785  O  O    . GLY A 1 73  ? 9.428   36.410 27.959  1.00 0.00  ? 73  GLY A O    2  
ATOM   3786  H  H    . GLY A 1 73  ? 9.488   36.838 31.207  1.00 0.00  ? 73  GLY A H    2  
ATOM   3787  H  HA2  . GLY A 1 73  ? 10.529  38.624 29.992  1.00 0.00  ? 73  GLY A HA2  2  
ATOM   3788  H  HA3  . GLY A 1 73  ? 11.737  37.490 29.400  1.00 0.00  ? 73  GLY A HA3  2  
ATOM   3789  N  N    . TYR A 1 74  ? 9.793   38.540 27.536  1.00 0.00  ? 74  TYR A N    2  
ATOM   3790  C  CA   . TYR A 1 74  ? 9.069   38.472 26.239  1.00 0.00  ? 74  TYR A CA   2  
ATOM   3791  C  C    . TYR A 1 74  ? 7.654   37.934 26.456  1.00 0.00  ? 74  TYR A C    2  
ATOM   3792  O  O    . TYR A 1 74  ? 7.365   37.355 27.485  1.00 0.00  ? 74  TYR A O    2  
ATOM   3793  C  CB   . TYR A 1 74  ? 9.829   37.525 25.320  1.00 0.00  ? 74  TYR A CB   2  
ATOM   3794  C  CG   . TYR A 1 74  ? 11.122  38.169 24.893  1.00 0.00  ? 74  TYR A CG   2  
ATOM   3795  C  CD1  . TYR A 1 74  ? 11.099  39.303 24.076  1.00 0.00  ? 74  TYR A CD1  2  
ATOM   3796  C  CD2  . TYR A 1 74  ? 12.342  37.633 25.317  1.00 0.00  ? 74  TYR A CD2  2  
ATOM   3797  C  CE1  . TYR A 1 74  ? 12.298  39.904 23.681  1.00 0.00  ? 74  TYR A CE1  2  
ATOM   3798  C  CE2  . TYR A 1 74  ? 13.543  38.234 24.922  1.00 0.00  ? 74  TYR A CE2  2  
ATOM   3799  C  CZ   . TYR A 1 74  ? 13.520  39.370 24.104  1.00 0.00  ? 74  TYR A CZ   2  
ATOM   3800  O  OH   . TYR A 1 74  ? 14.704  39.966 23.717  1.00 0.00  ? 74  TYR A OH   2  
ATOM   3801  H  H    . TYR A 1 74  ? 10.202  39.378 27.814  1.00 0.00  ? 74  TYR A H    2  
ATOM   3802  H  HA   . TYR A 1 74  ? 9.024   39.453 25.790  1.00 0.00  ? 74  TYR A HA   2  
ATOM   3803  H  HB2  . TYR A 1 74  ? 10.044  36.611 25.851  1.00 0.00  ? 74  TYR A HB2  2  
ATOM   3804  H  HB3  . TYR A 1 74  ? 9.233   37.306 24.455  1.00 0.00  ? 74  TYR A HB3  2  
ATOM   3805  H  HD1  . TYR A 1 74  ? 10.156  39.715 23.751  1.00 0.00  ? 74  TYR A HD1  2  
ATOM   3806  H  HD2  . TYR A 1 74  ? 12.358  36.756 25.947  1.00 0.00  ? 74  TYR A HD2  2  
ATOM   3807  H  HE1  . TYR A 1 74  ? 12.280  40.779 23.049  1.00 0.00  ? 74  TYR A HE1  2  
ATOM   3808  H  HE2  . TYR A 1 74  ? 14.486  37.820 25.248  1.00 0.00  ? 74  TYR A HE2  2  
ATOM   3809  H  HH   . TYR A 1 74  ? 14.998  39.543 22.908  1.00 0.00  ? 74  TYR A HH   2  
ATOM   3810  N  N    . PRO A 1 75  ? 6.815   38.120 25.468  1.00 0.00  ? 75  PRO A N    2  
ATOM   3811  C  CA   . PRO A 1 75  ? 5.433   37.633 25.520  1.00 0.00  ? 75  PRO A CA   2  
ATOM   3812  C  C    . PRO A 1 75  ? 5.439   36.126 25.271  1.00 0.00  ? 75  PRO A C    2  
ATOM   3813  O  O    . PRO A 1 75  ? 6.449   35.473 25.445  1.00 0.00  ? 75  PRO A O    2  
ATOM   3814  C  CB   . PRO A 1 75  ? 4.733   38.396 24.391  1.00 0.00  ? 75  PRO A CB   2  
ATOM   3815  C  CG   . PRO A 1 75  ? 5.846   38.841 23.413  1.00 0.00  ? 75  PRO A CG   2  
ATOM   3816  C  CD   . PRO A 1 75  ? 7.163   38.824 24.214  1.00 0.00  ? 75  PRO A CD   2  
ATOM   3817  H  HA   . PRO A 1 75  ? 4.979   37.865 26.470  1.00 0.00  ? 75  PRO A HA   2  
ATOM   3818  H  HB2  . PRO A 1 75  ? 4.025   37.749 23.886  1.00 0.00  ? 75  PRO A HB2  2  
ATOM   3819  H  HB3  . PRO A 1 75  ? 4.229   39.265 24.785  1.00 0.00  ? 75  PRO A HB3  2  
ATOM   3820  H  HG2  . PRO A 1 75  ? 5.905   38.152 22.581  1.00 0.00  ? 75  PRO A HG2  2  
ATOM   3821  H  HG3  . PRO A 1 75  ? 5.651   39.840 23.055  1.00 0.00  ? 75  PRO A HG3  2  
ATOM   3822  H  HD2  . PRO A 1 75  ? 7.924   38.288 23.668  1.00 0.00  ? 75  PRO A HD2  2  
ATOM   3823  H  HD3  . PRO A 1 75  ? 7.485   39.829 24.429  1.00 0.00  ? 75  PRO A HD3  2  
ATOM   3824  N  N    . PHE A 1 76  ? 4.340   35.561 24.868  1.00 0.00  ? 76  PHE A N    2  
ATOM   3825  C  CA   . PHE A 1 76  ? 4.331   34.094 24.621  1.00 0.00  ? 76  PHE A CA   2  
ATOM   3826  C  C    . PHE A 1 76  ? 2.927   33.647 24.217  1.00 0.00  ? 76  PHE A C    2  
ATOM   3827  O  O    . PHE A 1 76  ? 1.969   34.387 24.321  1.00 0.00  ? 76  PHE A O    2  
ATOM   3828  C  CB   . PHE A 1 76  ? 4.752   33.364 25.901  1.00 0.00  ? 76  PHE A CB   2  
ATOM   3829  C  CG   . PHE A 1 76  ? 4.823   31.885 25.640  1.00 0.00  ? 76  PHE A CG   2  
ATOM   3830  C  CD1  . PHE A 1 76  ? 6.000   31.311 25.147  1.00 0.00  ? 76  PHE A CD1  2  
ATOM   3831  C  CD2  . PHE A 1 76  ? 3.706   31.087 25.892  1.00 0.00  ? 76  PHE A CD2  2  
ATOM   3832  C  CE1  . PHE A 1 76  ? 6.057   29.934 24.909  1.00 0.00  ? 76  PHE A CE1  2  
ATOM   3833  C  CE2  . PHE A 1 76  ? 3.761   29.711 25.655  1.00 0.00  ? 76  PHE A CE2  2  
ATOM   3834  C  CZ   . PHE A 1 76  ? 4.937   29.134 25.164  1.00 0.00  ? 76  PHE A CZ   2  
ATOM   3835  H  H    . PHE A 1 76  ? 3.529   36.093 24.727  1.00 0.00  ? 76  PHE A H    2  
ATOM   3836  H  HA   . PHE A 1 76  ? 5.024   33.858 23.827  1.00 0.00  ? 76  PHE A HA   2  
ATOM   3837  H  HB2  . PHE A 1 76  ? 5.720   33.716 26.222  1.00 0.00  ? 76  PHE A HB2  2  
ATOM   3838  H  HB3  . PHE A 1 76  ? 4.026   33.554 26.676  1.00 0.00  ? 76  PHE A HB3  2  
ATOM   3839  H  HD1  . PHE A 1 76  ? 6.864   31.928 24.952  1.00 0.00  ? 76  PHE A HD1  2  
ATOM   3840  H  HD2  . PHE A 1 76  ? 2.799   31.537 26.268  1.00 0.00  ? 76  PHE A HD2  2  
ATOM   3841  H  HE1  . PHE A 1 76  ? 6.963   29.490 24.528  1.00 0.00  ? 76  PHE A HE1  2  
ATOM   3842  H  HE2  . PHE A 1 76  ? 2.897   29.095 25.853  1.00 0.00  ? 76  PHE A HE2  2  
ATOM   3843  H  HZ   . PHE A 1 76  ? 4.981   28.071 24.982  1.00 0.00  ? 76  PHE A HZ   2  
ATOM   3844  N  N    . ASP A 1 77  ? 2.809   32.435 23.753  1.00 0.00  ? 77  ASP A N    2  
ATOM   3845  C  CA   . ASP A 1 77  ? 1.483   31.909 23.331  1.00 0.00  ? 77  ASP A CA   2  
ATOM   3846  C  C    . ASP A 1 77  ? 0.804   32.886 22.380  1.00 0.00  ? 77  ASP A C    2  
ATOM   3847  O  O    . ASP A 1 77  ? -0.389  33.096 22.453  1.00 0.00  ? 77  ASP A O    2  
ATOM   3848  C  CB   . ASP A 1 77  ? 0.585   31.694 24.549  1.00 0.00  ? 77  ASP A CB   2  
ATOM   3849  C  CG   . ASP A 1 77  ? -0.771  31.149 24.084  1.00 0.00  ? 77  ASP A CG   2  
ATOM   3850  O  OD1  . ASP A 1 77  ? -0.869  29.953 23.881  1.00 0.00  ? 77  ASP A OD1  2  
ATOM   3851  O  OD2  . ASP A 1 77  ? -1.688  31.937 23.931  1.00 0.00  ? 77  ASP A OD2  2  
ATOM   3852  H  H    . ASP A 1 77  ? 3.601   31.865 23.679  1.00 0.00  ? 77  ASP A H    2  
ATOM   3853  H  HA   . ASP A 1 77  ? 1.624   30.966 22.826  1.00 0.00  ? 77  ASP A HA   2  
ATOM   3854  H  HB2  . ASP A 1 77  ? 1.050   30.986 25.220  1.00 0.00  ? 77  ASP A HB2  2  
ATOM   3855  H  HB3  . ASP A 1 77  ? 0.437   32.634 25.058  1.00 0.00  ? 77  ASP A HB3  2  
ATOM   3856  N  N    . GLY A 1 78  ? 1.526   33.480 21.472  1.00 0.00  ? 78  GLY A N    2  
ATOM   3857  C  CA   . GLY A 1 78  ? 0.852   34.409 20.525  1.00 0.00  ? 78  GLY A CA   2  
ATOM   3858  C  C    . GLY A 1 78  ? -0.375  33.682 19.970  1.00 0.00  ? 78  GLY A C    2  
ATOM   3859  O  O    . GLY A 1 78  ? -0.565  32.497 20.227  1.00 0.00  ? 78  GLY A O    2  
ATOM   3860  H  H    . GLY A 1 78  ? 2.490   33.304 21.403  1.00 0.00  ? 78  GLY A H    2  
ATOM   3861  H  HA2  . GLY A 1 78  ? 0.546   35.306 21.050  1.00 0.00  ? 78  GLY A HA2  2  
ATOM   3862  H  HA3  . GLY A 1 78  ? 1.519   34.664 19.717  1.00 0.00  ? 78  GLY A HA3  2  
ATOM   3863  N  N    . LYS A 1 79  ? -1.213  34.346 19.215  1.00 0.00  ? 79  LYS A N    2  
ATOM   3864  C  CA   . LYS A 1 79  ? -2.395  33.629 18.681  1.00 0.00  ? 79  LYS A CA   2  
ATOM   3865  C  C    . LYS A 1 79  ? -1.890  32.361 18.016  1.00 0.00  ? 79  LYS A C    2  
ATOM   3866  O  O    . LYS A 1 79  ? -0.842  32.350 17.400  1.00 0.00  ? 79  LYS A O    2  
ATOM   3867  C  CB   . LYS A 1 79  ? -3.178  34.511 17.696  1.00 0.00  ? 79  LYS A CB   2  
ATOM   3868  C  CG   . LYS A 1 79  ? -2.788  34.196 16.252  1.00 0.00  ? 79  LYS A CG   2  
ATOM   3869  C  CD   . LYS A 1 79  ? -3.451  35.206 15.305  1.00 0.00  ? 79  LYS A CD   2  
ATOM   3870  C  CE   . LYS A 1 79  ? -4.650  34.555 14.608  1.00 0.00  ? 79  LYS A CE   2  
ATOM   3871  N  NZ   . LYS A 1 79  ? -4.853  35.186 13.272  1.00 0.00  ? 79  LYS A NZ   2  
ATOM   3872  H  H    . LYS A 1 79  ? -1.063  35.290 19.003  1.00 0.00  ? 79  LYS A H    2  
ATOM   3873  H  HA   . LYS A 1 79  ? -3.041  33.356 19.506  1.00 0.00  ? 79  LYS A HA   2  
ATOM   3874  H  HB2  . LYS A 1 79  ? -4.233  34.325 17.825  1.00 0.00  ? 79  LYS A HB2  2  
ATOM   3875  H  HB3  . LYS A 1 79  ? -2.970  35.546 17.906  1.00 0.00  ? 79  LYS A HB3  2  
ATOM   3876  H  HG2  . LYS A 1 79  ? -1.715  34.253 16.156  1.00 0.00  ? 79  LYS A HG2  2  
ATOM   3877  H  HG3  . LYS A 1 79  ? -3.121  33.198 16.009  1.00 0.00  ? 79  LYS A HG3  2  
ATOM   3878  H  HD2  . LYS A 1 79  ? -3.786  36.060 15.872  1.00 0.00  ? 79  LYS A HD2  2  
ATOM   3879  H  HD3  . LYS A 1 79  ? -2.736  35.527 14.561  1.00 0.00  ? 79  LYS A HD3  2  
ATOM   3880  H  HE2  . LYS A 1 79  ? -4.466  33.499 14.484  1.00 0.00  ? 79  LYS A HE2  2  
ATOM   3881  H  HE3  . LYS A 1 79  ? -5.537  34.698 15.209  1.00 0.00  ? 79  LYS A HE3  2  
ATOM   3882  H  HZ1  . LYS A 1 79  ? -5.241  34.482 12.611  1.00 0.00  ? 79  LYS A HZ1  2  
ATOM   3883  H  HZ2  . LYS A 1 79  ? -3.942  35.537 12.913  1.00 0.00  ? 79  LYS A HZ2  2  
ATOM   3884  H  HZ3  . LYS A 1 79  ? -5.519  35.978 13.361  1.00 0.00  ? 79  LYS A HZ3  2  
ATOM   3885  N  N    . ASP A 1 80  ? -2.613  31.297 18.160  1.00 0.00  ? 80  ASP A N    2  
ATOM   3886  C  CA   . ASP A 1 80  ? -2.171  30.001 17.570  1.00 0.00  ? 80  ASP A CA   2  
ATOM   3887  C  C    . ASP A 1 80  ? -0.646  29.880 17.760  1.00 0.00  ? 80  ASP A C    2  
ATOM   3888  O  O    . ASP A 1 80  ? -0.170  29.765 18.877  1.00 0.00  ? 80  ASP A O    2  
ATOM   3889  C  CB   . ASP A 1 80  ? -2.540  29.963 16.081  1.00 0.00  ? 80  ASP A CB   2  
ATOM   3890  C  CG   . ASP A 1 80  ? -2.184  28.594 15.497  1.00 0.00  ? 80  ASP A CG   2  
ATOM   3891  O  OD1  . ASP A 1 80  ? -3.012  27.700 15.589  1.00 0.00  ? 80  ASP A OD1  2  
ATOM   3892  O  OD2  . ASP A 1 80  ? -1.094  28.460 14.968  1.00 0.00  ? 80  ASP A OD2  2  
ATOM   3893  H  H    . ASP A 1 80  ? -3.444  31.354 18.668  1.00 0.00  ? 80  ASP A H    2  
ATOM   3894  H  HA   . ASP A 1 80  ? -2.662  29.188 18.086  1.00 0.00  ? 80  ASP A HA   2  
ATOM   3895  H  HB2  . ASP A 1 80  ? -3.598  30.136 15.969  1.00 0.00  ? 80  ASP A HB2  2  
ATOM   3896  H  HB3  . ASP A 1 80  ? -1.994  30.730 15.553  1.00 0.00  ? 80  ASP A HB3  2  
ATOM   3897  N  N    . GLY A 1 81  ? 0.109   29.947 16.683  1.00 0.00  ? 81  GLY A N    2  
ATOM   3898  C  CA   . GLY A 1 81  ? 1.602   29.880 16.755  1.00 0.00  ? 81  GLY A CA   2  
ATOM   3899  C  C    . GLY A 1 81  ? 2.088   29.128 17.994  1.00 0.00  ? 81  GLY A C    2  
ATOM   3900  O  O    . GLY A 1 81  ? 1.626   28.051 18.301  1.00 0.00  ? 81  GLY A O    2  
ATOM   3901  H  H    . GLY A 1 81  ? -0.309  30.070 15.810  1.00 0.00  ? 81  GLY A H    2  
ATOM   3902  H  HA2  . GLY A 1 81  ? 1.973   29.376 15.876  1.00 0.00  ? 81  GLY A HA2  2  
ATOM   3903  H  HA3  . GLY A 1 81  ? 1.999   30.884 16.778  1.00 0.00  ? 81  GLY A HA3  2  
ATOM   3904  N  N    . LEU A 1 82  ? 3.037   29.708 18.686  1.00 0.00  ? 82  LEU A N    2  
ATOM   3905  C  CA   . LEU A 1 82  ? 3.621   29.081 19.906  1.00 0.00  ? 82  LEU A CA   2  
ATOM   3906  C  C    . LEU A 1 82  ? 2.631   28.141 20.594  1.00 0.00  ? 82  LEU A C    2  
ATOM   3907  O  O    . LEU A 1 82  ? 1.531   28.518 20.961  1.00 0.00  ? 82  LEU A O    2  
ATOM   3908  C  CB   . LEU A 1 82  ? 4.031   30.188 20.868  1.00 0.00  ? 82  LEU A CB   2  
ATOM   3909  C  CG   . LEU A 1 82  ? 5.418   29.876 21.429  1.00 0.00  ? 82  LEU A CG   2  
ATOM   3910  C  CD1  . LEU A 1 82  ? 5.389   28.513 22.118  1.00 0.00  ? 82  LEU A CD1  2  
ATOM   3911  C  CD2  . LEU A 1 82  ? 6.432   29.842 20.282  1.00 0.00  ? 82  LEU A CD2  2  
ATOM   3912  H  H    . LEU A 1 82  ? 3.382   30.575 18.391  1.00 0.00  ? 82  LEU A H    2  
ATOM   3913  H  HA   . LEU A 1 82  ? 4.501   28.518 19.630  1.00 0.00  ? 82  LEU A HA   2  
ATOM   3914  H  HB2  . LEU A 1 82  ? 4.055   31.130 20.338  1.00 0.00  ? 82  LEU A HB2  2  
ATOM   3915  H  HB3  . LEU A 1 82  ? 3.319   30.246 21.674  1.00 0.00  ? 82  LEU A HB3  2  
ATOM   3916  H  HG   . LEU A 1 82  ? 5.699   30.637 22.142  1.00 0.00  ? 82  LEU A HG   2  
ATOM   3917  H  HD11 . LEU A 1 82  ? 6.204   28.448 22.824  1.00 0.00  ? 82  LEU A HD11 2  
ATOM   3918  H  HD12 . LEU A 1 82  ? 5.491   27.734 21.377  1.00 0.00  ? 82  LEU A HD12 2  
ATOM   3919  H  HD13 . LEU A 1 82  ? 4.451   28.394 22.638  1.00 0.00  ? 82  LEU A HD13 2  
ATOM   3920  H  HD21 . LEU A 1 82  ? 5.996   30.289 19.401  1.00 0.00  ? 82  LEU A HD21 2  
ATOM   3921  H  HD22 . LEU A 1 82  ? 6.701   28.818 20.070  1.00 0.00  ? 82  LEU A HD22 2  
ATOM   3922  H  HD23 . LEU A 1 82  ? 7.315   30.394 20.567  1.00 0.00  ? 82  LEU A HD23 2  
ATOM   3923  N  N    . LEU A 1 83  ? 3.041   26.912 20.772  1.00 0.00  ? 83  LEU A N    2  
ATOM   3924  C  CA   . LEU A 1 83  ? 2.179   25.899 21.436  1.00 0.00  ? 83  LEU A CA   2  
ATOM   3925  C  C    . LEU A 1 83  ? 2.882   25.409 22.705  1.00 0.00  ? 83  LEU A C    2  
ATOM   3926  O  O    . LEU A 1 83  ? 2.253   25.011 23.666  1.00 0.00  ? 83  LEU A O    2  
ATOM   3927  C  CB   . LEU A 1 83  ? 1.972   24.718 20.485  1.00 0.00  ? 83  LEU A CB   2  
ATOM   3928  C  CG   . LEU A 1 83  ? 1.294   25.212 19.208  1.00 0.00  ? 83  LEU A CG   2  
ATOM   3929  C  CD1  . LEU A 1 83  ? 1.290   24.095 18.166  1.00 0.00  ? 83  LEU A CD1  2  
ATOM   3930  C  CD2  . LEU A 1 83  ? -0.144  25.624 19.531  1.00 0.00  ? 83  LEU A CD2  2  
ATOM   3931  H  H    . LEU A 1 83  ? 3.935   26.656 20.466  1.00 0.00  ? 83  LEU A H    2  
ATOM   3932  H  HA   . LEU A 1 83  ? 1.226   26.338 21.689  1.00 0.00  ? 83  LEU A HA   2  
ATOM   3933  H  HB2  . LEU A 1 83  ? 2.931   24.279 20.242  1.00 0.00  ? 83  LEU A HB2  2  
ATOM   3934  H  HB3  . LEU A 1 83  ? 1.345   23.978 20.959  1.00 0.00  ? 83  LEU A HB3  2  
ATOM   3935  H  HG   . LEU A 1 83  ? 1.836   26.061 18.819  1.00 0.00  ? 83  LEU A HG   2  
ATOM   3936  H  HD11 . LEU A 1 83  ? 2.126   24.229 17.496  1.00 0.00  ? 83  LEU A HD11 2  
ATOM   3937  H  HD12 . LEU A 1 83  ? 0.367   24.128 17.606  1.00 0.00  ? 83  LEU A HD12 2  
ATOM   3938  H  HD13 . LEU A 1 83  ? 1.375   23.140 18.662  1.00 0.00  ? 83  LEU A HD13 2  
ATOM   3939  H  HD21 . LEU A 1 83  ? -0.135  26.371 20.310  1.00 0.00  ? 83  LEU A HD21 2  
ATOM   3940  H  HD22 . LEU A 1 83  ? -0.699  24.762 19.869  1.00 0.00  ? 83  LEU A HD22 2  
ATOM   3941  H  HD23 . LEU A 1 83  ? -0.613  26.031 18.648  1.00 0.00  ? 83  LEU A HD23 2  
ATOM   3942  N  N    . ALA A 1 84  ? 4.188   25.440 22.709  1.00 0.00  ? 84  ALA A N    2  
ATOM   3943  C  CA   . ALA A 1 84  ? 4.946   24.982 23.905  1.00 0.00  ? 84  ALA A CA   2  
ATOM   3944  C  C    . ALA A 1 84  ? 6.439   24.948 23.576  1.00 0.00  ? 84  ALA A C    2  
ATOM   3945  O  O    . ALA A 1 84  ? 6.834   24.672 22.463  1.00 0.00  ? 84  ALA A O    2  
ATOM   3946  C  CB   . ALA A 1 84  ? 4.479   23.583 24.304  1.00 0.00  ? 84  ALA A CB   2  
ATOM   3947  H  H    . ALA A 1 84  ? 4.671   25.768 21.919  1.00 0.00  ? 84  ALA A H    2  
ATOM   3948  H  HA   . ALA A 1 84  ? 4.776   25.666 24.723  1.00 0.00  ? 84  ALA A HA   2  
ATOM   3949  H  HB1  . ALA A 1 84  ? 5.296   23.051 24.767  1.00 0.00  ? 84  ALA A HB1  2  
ATOM   3950  H  HB2  . ALA A 1 84  ? 4.154   23.049 23.425  1.00 0.00  ? 84  ALA A HB2  2  
ATOM   3951  H  HB3  . ALA A 1 84  ? 3.659   23.664 25.002  1.00 0.00  ? 84  ALA A HB3  2  
ATOM   3952  N  N    . HIS A 1 85  ? 7.269   25.232 24.538  1.00 0.00  ? 85  HIS A N    2  
ATOM   3953  C  CA   . HIS A 1 85  ? 8.739   25.226 24.284  1.00 0.00  ? 85  HIS A CA   2  
ATOM   3954  C  C    . HIS A 1 85  ? 9.465   24.722 25.533  1.00 0.00  ? 85  HIS A C    2  
ATOM   3955  O  O    . HIS A 1 85  ? 9.009   24.912 26.642  1.00 0.00  ? 85  HIS A O    2  
ATOM   3956  C  CB   . HIS A 1 85  ? 9.193   26.650 23.967  1.00 0.00  ? 85  HIS A CB   2  
ATOM   3957  C  CG   . HIS A 1 85  ? 8.927   27.530 25.158  1.00 0.00  ? 85  HIS A CG   2  
ATOM   3958  N  ND1  . HIS A 1 85  ? 7.647   27.749 25.641  1.00 0.00  ? 85  HIS A ND1  2  
ATOM   3959  C  CD2  . HIS A 1 85  ? 9.765   28.246 25.979  1.00 0.00  ? 85  HIS A CD2  2  
ATOM   3960  C  CE1  . HIS A 1 85  ? 7.749   28.565 26.706  1.00 0.00  ? 85  HIS A CE1  2  
ATOM   3961  N  NE2  . HIS A 1 85  ? 9.019   28.899 26.956  1.00 0.00  ? 85  HIS A NE2  2  
ATOM   3962  H  H    . HIS A 1 85  ? 6.926   25.455 25.429  1.00 0.00  ? 85  HIS A H    2  
ATOM   3963  H  HA   . HIS A 1 85  ? 8.963   24.579 23.449  1.00 0.00  ? 85  HIS A HA   2  
ATOM   3964  H  HB2  . HIS A 1 85  ? 10.249  26.649 23.742  1.00 0.00  ? 85  HIS A HB2  2  
ATOM   3965  H  HB3  . HIS A 1 85  ? 8.642   27.020 23.115  1.00 0.00  ? 85  HIS A HB3  2  
ATOM   3966  H  HD1  . HIS A 1 85  ? 6.817   27.382 25.270  1.00 0.00  ? 85  HIS A HD1  2  
ATOM   3967  H  HD2  . HIS A 1 85  ? 10.839  28.299 25.878  1.00 0.00  ? 85  HIS A HD2  2  
ATOM   3968  H  HE1  . HIS A 1 85  ? 6.907   28.906 27.291  1.00 0.00  ? 85  HIS A HE1  2  
ATOM   3969  N  N    . ALA A 1 86  ? 10.588  24.078 25.366  1.00 0.00  ? 86  ALA A N    2  
ATOM   3970  C  CA   . ALA A 1 86  ? 11.325  23.562 26.554  1.00 0.00  ? 86  ALA A CA   2  
ATOM   3971  C  C    . ALA A 1 86  ? 12.747  24.118 26.565  1.00 0.00  ? 86  ALA A C    2  
ATOM   3972  O  O    . ALA A 1 86  ? 13.259  24.556 25.553  1.00 0.00  ? 86  ALA A O    2  
ATOM   3973  C  CB   . ALA A 1 86  ? 11.376  22.035 26.493  1.00 0.00  ? 86  ALA A CB   2  
ATOM   3974  H  H    . ALA A 1 86  ? 10.944  23.931 24.463  1.00 0.00  ? 86  ALA A H    2  
ATOM   3975  H  HA   . ALA A 1 86  ? 10.813  23.867 27.454  1.00 0.00  ? 86  ALA A HA   2  
ATOM   3976  H  HB1  . ALA A 1 86  ? 10.404  21.653 26.219  1.00 0.00  ? 86  ALA A HB1  2  
ATOM   3977  H  HB2  . ALA A 1 86  ? 11.656  21.645 27.460  1.00 0.00  ? 86  ALA A HB2  2  
ATOM   3978  H  HB3  . ALA A 1 86  ? 12.104  21.728 25.757  1.00 0.00  ? 86  ALA A HB3  2  
ATOM   3979  N  N    . PHE A 1 87  ? 13.386  24.114 27.706  1.00 0.00  ? 87  PHE A N    2  
ATOM   3980  C  CA   . PHE A 1 87  ? 14.775  24.650 27.784  1.00 0.00  ? 87  PHE A CA   2  
ATOM   3981  C  C    . PHE A 1 87  ? 15.769  23.505 27.999  1.00 0.00  ? 87  PHE A C    2  
ATOM   3982  O  O    . PHE A 1 87  ? 15.440  22.481 28.568  1.00 0.00  ? 87  PHE A O    2  
ATOM   3983  C  CB   . PHE A 1 87  ? 14.868  25.640 28.945  1.00 0.00  ? 87  PHE A CB   2  
ATOM   3984  C  CG   . PHE A 1 87  ? 14.653  27.040 28.424  1.00 0.00  ? 87  PHE A CG   2  
ATOM   3985  C  CD1  . PHE A 1 87  ? 13.726  27.269 27.399  1.00 0.00  ? 87  PHE A CD1  2  
ATOM   3986  C  CD2  . PHE A 1 87  ? 15.382  28.109 28.959  1.00 0.00  ? 87  PHE A CD2  2  
ATOM   3987  C  CE1  . PHE A 1 87  ? 13.527  28.566 26.910  1.00 0.00  ? 87  PHE A CE1  2  
ATOM   3988  C  CE2  . PHE A 1 87  ? 15.183  29.406 28.471  1.00 0.00  ? 87  PHE A CE2  2  
ATOM   3989  C  CZ   . PHE A 1 87  ? 14.257  29.635 27.447  1.00 0.00  ? 87  PHE A CZ   2  
ATOM   3990  H  H    . PHE A 1 87  ? 12.949  23.762 28.515  1.00 0.00  ? 87  PHE A H    2  
ATOM   3991  H  HA   . PHE A 1 87  ? 15.012  25.160 26.862  1.00 0.00  ? 87  PHE A HA   2  
ATOM   3992  H  HB2  . PHE A 1 87  ? 14.109  25.407 29.677  1.00 0.00  ? 87  PHE A HB2  2  
ATOM   3993  H  HB3  . PHE A 1 87  ? 15.845  25.571 29.402  1.00 0.00  ? 87  PHE A HB3  2  
ATOM   3994  H  HD1  . PHE A 1 87  ? 13.165  26.444 26.986  1.00 0.00  ? 87  PHE A HD1  2  
ATOM   3995  H  HD2  . PHE A 1 87  ? 16.098  27.933 29.748  1.00 0.00  ? 87  PHE A HD2  2  
ATOM   3996  H  HE1  . PHE A 1 87  ? 12.814  28.741 26.119  1.00 0.00  ? 87  PHE A HE1  2  
ATOM   3997  H  HE2  . PHE A 1 87  ? 15.745  30.231 28.883  1.00 0.00  ? 87  PHE A HE2  2  
ATOM   3998  H  HZ   . PHE A 1 87  ? 14.106  30.636 27.071  1.00 0.00  ? 87  PHE A HZ   2  
ATOM   3999  N  N    . ALA A 1 88  ? 16.985  23.671 27.544  1.00 0.00  ? 88  ALA A N    2  
ATOM   4000  C  CA   . ALA A 1 88  ? 18.006  22.599 27.715  1.00 0.00  ? 88  ALA A CA   2  
ATOM   4001  C  C    . ALA A 1 88  ? 18.161  22.269 29.202  1.00 0.00  ? 88  ALA A C    2  
ATOM   4002  O  O    . ALA A 1 88  ? 17.658  22.981 30.047  1.00 0.00  ? 88  ALA A O    2  
ATOM   4003  C  CB   . ALA A 1 88  ? 19.345  23.084 27.158  1.00 0.00  ? 88  ALA A CB   2  
ATOM   4004  H  H    . ALA A 1 88  ? 17.226  24.504 27.088  1.00 0.00  ? 88  ALA A H    2  
ATOM   4005  H  HA   . ALA A 1 88  ? 17.693  21.715 27.181  1.00 0.00  ? 88  ALA A HA   2  
ATOM   4006  H  HB1  . ALA A 1 88  ? 19.226  24.079 26.755  1.00 0.00  ? 88  ALA A HB1  2  
ATOM   4007  H  HB2  . ALA A 1 88  ? 19.676  22.415 26.376  1.00 0.00  ? 88  ALA A HB2  2  
ATOM   4008  H  HB3  . ALA A 1 88  ? 20.079  23.102 27.949  1.00 0.00  ? 88  ALA A HB3  2  
ATOM   4009  N  N    . PRO A 1 89  ? 18.857  21.195 29.473  1.00 0.00  ? 89  PRO A N    2  
ATOM   4010  C  CA   . PRO A 1 89  ? 19.106  20.732 30.850  1.00 0.00  ? 89  PRO A CA   2  
ATOM   4011  C  C    . PRO A 1 89  ? 20.222  21.555 31.501  1.00 0.00  ? 89  PRO A C    2  
ATOM   4012  O  O    . PRO A 1 89  ? 21.094  22.069 30.831  1.00 0.00  ? 89  PRO A O    2  
ATOM   4013  C  CB   . PRO A 1 89  ? 19.547  19.279 30.666  1.00 0.00  ? 89  PRO A CB   2  
ATOM   4014  C  CG   . PRO A 1 89  ? 20.072  19.163 29.215  1.00 0.00  ? 89  PRO A CG   2  
ATOM   4015  C  CD   . PRO A 1 89  ? 19.463  20.341 28.430  1.00 0.00  ? 89  PRO A CD   2  
ATOM   4016  H  HA   . PRO A 1 89  ? 18.205  20.772 31.439  1.00 0.00  ? 89  PRO A HA   2  
ATOM   4017  H  HB2  . PRO A 1 89  ? 20.333  19.039 31.371  1.00 0.00  ? 89  PRO A HB2  2  
ATOM   4018  H  HB3  . PRO A 1 89  ? 18.707  18.616 30.803  1.00 0.00  ? 89  PRO A HB3  2  
ATOM   4019  H  HG2  . PRO A 1 89  ? 21.151  19.225 29.207  1.00 0.00  ? 89  PRO A HG2  2  
ATOM   4020  H  HG3  . PRO A 1 89  ? 19.752  18.229 28.780  1.00 0.00  ? 89  PRO A HG3  2  
ATOM   4021  H  HD2  . PRO A 1 89  ? 20.234  20.879 27.896  1.00 0.00  ? 89  PRO A HD2  2  
ATOM   4022  H  HD3  . PRO A 1 89  ? 18.704  19.989 27.750  1.00 0.00  ? 89  PRO A HD3  2  
ATOM   4023  N  N    . GLY A 1 90  ? 20.205  21.683 32.802  1.00 0.00  ? 90  GLY A N    2  
ATOM   4024  C  CA   . GLY A 1 90  ? 21.272  22.469 33.487  1.00 0.00  ? 90  GLY A CA   2  
ATOM   4025  C  C    . GLY A 1 90  ? 21.021  22.476 34.997  1.00 0.00  ? 90  GLY A C    2  
ATOM   4026  O  O    . GLY A 1 90  ? 21.285  21.509 35.686  1.00 0.00  ? 90  GLY A O    2  
ATOM   4027  H  H    . GLY A 1 90  ? 19.493  21.261 33.327  1.00 0.00  ? 90  GLY A H    2  
ATOM   4028  H  HA2  . GLY A 1 90  ? 22.234  22.021 33.283  1.00 0.00  ? 90  GLY A HA2  2  
ATOM   4029  H  HA3  . GLY A 1 90  ? 21.264  23.482 33.119  1.00 0.00  ? 90  GLY A HA3  2  
ATOM   4030  N  N    . THR A 1 91  ? 20.516  23.564 35.517  1.00 0.00  ? 91  THR A N    2  
ATOM   4031  C  CA   . THR A 1 91  ? 20.249  23.641 36.984  1.00 0.00  ? 91  THR A CA   2  
ATOM   4032  C  C    . THR A 1 91  ? 19.286  24.800 37.265  1.00 0.00  ? 91  THR A C    2  
ATOM   4033  O  O    . THR A 1 91  ? 19.691  25.863 37.689  1.00 0.00  ? 91  THR A O    2  
ATOM   4034  C  CB   . THR A 1 91  ? 21.561  23.887 37.733  1.00 0.00  ? 91  THR A CB   2  
ATOM   4035  O  OG1  . THR A 1 91  ? 22.488  24.514 36.860  1.00 0.00  ? 91  THR A OG1  2  
ATOM   4036  C  CG2  . THR A 1 91  ? 22.139  22.558 38.225  1.00 0.00  ? 91  THR A CG2  2  
ATOM   4037  H  H    . THR A 1 91  ? 20.314  24.332 34.941  1.00 0.00  ? 91  THR A H    2  
ATOM   4038  H  HA   . THR A 1 91  ? 19.808  22.713 37.321  1.00 0.00  ? 91  THR A HA   2  
ATOM   4039  H  HB   . THR A 1 91  ? 21.375  24.529 38.581  1.00 0.00  ? 91  THR A HB   2  
ATOM   4040  H  HG1  . THR A 1 91  ? 23.373  24.276 37.146  1.00 0.00  ? 91  THR A HG1  2  
ATOM   4041  H  HG21 . THR A 1 91  ? 22.819  22.744 39.044  1.00 0.00  ? 91  THR A HG21 2  
ATOM   4042  H  HG22 . THR A 1 91  ? 22.670  22.073 37.419  1.00 0.00  ? 91  THR A HG22 2  
ATOM   4043  H  HG23 . THR A 1 91  ? 21.338  21.919 38.564  1.00 0.00  ? 91  THR A HG23 2  
ATOM   4044  N  N    . GLY A 1 92  ? 18.017  24.606 37.028  1.00 0.00  ? 92  GLY A N    2  
ATOM   4045  C  CA   . GLY A 1 92  ? 17.032  25.700 37.280  1.00 0.00  ? 92  GLY A CA   2  
ATOM   4046  C  C    . GLY A 1 92  ? 15.935  25.656 36.215  1.00 0.00  ? 92  GLY A C    2  
ATOM   4047  O  O    . GLY A 1 92  ? 15.049  24.827 36.261  1.00 0.00  ? 92  GLY A O    2  
ATOM   4048  H  H    . GLY A 1 92  ? 17.709  23.743 36.682  1.00 0.00  ? 92  GLY A H    2  
ATOM   4049  H  HA2  . GLY A 1 92  ? 16.592  25.570 38.259  1.00 0.00  ? 92  GLY A HA2  2  
ATOM   4050  H  HA3  . GLY A 1 92  ? 17.535  26.655 37.234  1.00 0.00  ? 92  GLY A HA3  2  
ATOM   4051  N  N    . VAL A 1 93  ? 15.987  26.539 35.253  1.00 0.00  ? 93  VAL A N    2  
ATOM   4052  C  CA   . VAL A 1 93  ? 14.947  26.539 34.184  1.00 0.00  ? 93  VAL A CA   2  
ATOM   4053  C  C    . VAL A 1 93  ? 15.205  25.370 33.225  1.00 0.00  ? 93  VAL A C    2  
ATOM   4054  O  O    . VAL A 1 93  ? 14.464  25.149 32.289  1.00 0.00  ? 93  VAL A O    2  
ATOM   4055  C  CB   . VAL A 1 93  ? 15.021  27.849 33.392  1.00 0.00  ? 93  VAL A CB   2  
ATOM   4056  C  CG1  . VAL A 1 93  ? 13.763  27.999 32.535  1.00 0.00  ? 93  VAL A CG1  2  
ATOM   4057  C  CG2  . VAL A 1 93  ? 15.125  29.039 34.351  1.00 0.00  ? 93  VAL A CG2  2  
ATOM   4058  H  H    . VAL A 1 93  ? 16.712  27.199 35.231  1.00 0.00  ? 93  VAL A H    2  
ATOM   4059  H  HA   . VAL A 1 93  ? 13.969  26.439 34.628  1.00 0.00  ? 93  VAL A HA   2  
ATOM   4060  H  HB   . VAL A 1 93  ? 15.889  27.827 32.750  1.00 0.00  ? 93  VAL A HB   2  
ATOM   4061  H  HG11 . VAL A 1 93  ? 14.033  27.970 31.489  1.00 0.00  ? 93  VAL A HG11 2  
ATOM   4062  H  HG12 . VAL A 1 93  ? 13.286  28.941 32.758  1.00 0.00  ? 93  VAL A HG12 2  
ATOM   4063  H  HG13 . VAL A 1 93  ? 13.082  27.190 32.753  1.00 0.00  ? 93  VAL A HG13 2  
ATOM   4064  H  HG21 . VAL A 1 93  ? 16.086  29.519 34.226  1.00 0.00  ? 93  VAL A HG21 2  
ATOM   4065  H  HG22 . VAL A 1 93  ? 15.022  28.695 35.369  1.00 0.00  ? 93  VAL A HG22 2  
ATOM   4066  H  HG23 . VAL A 1 93  ? 14.340  29.746 34.130  1.00 0.00  ? 93  VAL A HG23 2  
ATOM   4067  N  N    . GLY A 1 94  ? 16.263  24.634 33.442  1.00 0.00  ? 94  GLY A N    2  
ATOM   4068  C  CA   . GLY A 1 94  ? 16.589  23.495 32.533  1.00 0.00  ? 94  GLY A CA   2  
ATOM   4069  C  C    . GLY A 1 94  ? 15.667  22.307 32.801  1.00 0.00  ? 94  GLY A C    2  
ATOM   4070  O  O    . GLY A 1 94  ? 15.305  22.028 33.926  1.00 0.00  ? 94  GLY A O    2  
ATOM   4071  H  H    . GLY A 1 94  ? 16.852  24.838 34.195  1.00 0.00  ? 94  GLY A H    2  
ATOM   4072  H  HA2  . GLY A 1 94  ? 16.465  23.817 31.510  1.00 0.00  ? 94  GLY A HA2  2  
ATOM   4073  H  HA3  . GLY A 1 94  ? 17.613  23.193 32.689  1.00 0.00  ? 94  GLY A HA3  2  
ATOM   4074  N  N    . GLY A 1 95  ? 15.285  21.603 31.767  1.00 0.00  ? 95  GLY A N    2  
ATOM   4075  C  CA   . GLY A 1 95  ? 14.389  20.428 31.948  1.00 0.00  ? 95  GLY A CA   2  
ATOM   4076  C  C    . GLY A 1 95  ? 12.955  20.912 32.195  1.00 0.00  ? 95  GLY A C    2  
ATOM   4077  O  O    . GLY A 1 95  ? 12.027  20.132 32.295  1.00 0.00  ? 95  GLY A O    2  
ATOM   4078  H  H    . GLY A 1 95  ? 15.590  21.850 30.870  1.00 0.00  ? 95  GLY A H    2  
ATOM   4079  H  HA2  . GLY A 1 95  ? 14.419  19.815 31.055  1.00 0.00  ? 95  GLY A HA2  2  
ATOM   4080  H  HA3  . GLY A 1 95  ? 14.725  19.849 32.794  1.00 0.00  ? 95  GLY A HA3  2  
ATOM   4081  N  N    . ASP A 1 96  ? 12.764  22.197 32.296  1.00 0.00  ? 96  ASP A N    2  
ATOM   4082  C  CA   . ASP A 1 96  ? 11.398  22.728 32.523  1.00 0.00  ? 96  ASP A CA   2  
ATOM   4083  C  C    . ASP A 1 96  ? 10.845  23.242 31.193  1.00 0.00  ? 96  ASP A C    2  
ATOM   4084  O  O    . ASP A 1 96  ? 11.527  23.914 30.439  1.00 0.00  ? 96  ASP A O    2  
ATOM   4085  C  CB   . ASP A 1 96  ? 11.456  23.853 33.557  1.00 0.00  ? 96  ASP A CB   2  
ATOM   4086  C  CG   . ASP A 1 96  ? 12.319  23.408 34.740  1.00 0.00  ? 96  ASP A CG   2  
ATOM   4087  O  OD1  . ASP A 1 96  ? 12.766  22.272 34.726  1.00 0.00  ? 96  ASP A OD1  2  
ATOM   4088  O  OD2  . ASP A 1 96  ? 12.517  24.205 35.640  1.00 0.00  ? 96  ASP A OD2  2  
ATOM   4089  H  H    . ASP A 1 96  ? 13.517  22.815 32.213  1.00 0.00  ? 96  ASP A H    2  
ATOM   4090  H  HA   . ASP A 1 96  ? 10.762  21.937 32.888  1.00 0.00  ? 96  ASP A HA   2  
ATOM   4091  H  HB2  . ASP A 1 96  ? 11.886  24.733 33.106  1.00 0.00  ? 96  ASP A HB2  2  
ATOM   4092  H  HB3  . ASP A 1 96  ? 10.459  24.073 33.906  1.00 0.00  ? 96  ASP A HB3  2  
ATOM   4093  N  N    . SER A 1 97  ? 9.621   22.917 30.887  1.00 0.00  ? 97  SER A N    2  
ATOM   4094  C  CA   . SER A 1 97  ? 9.036   23.376 29.600  1.00 0.00  ? 97  SER A CA   2  
ATOM   4095  C  C    . SER A 1 97  ? 7.664   24.003 29.849  1.00 0.00  ? 97  SER A C    2  
ATOM   4096  O  O    . SER A 1 97  ? 6.799   23.416 30.474  1.00 0.00  ? 97  SER A O    2  
ATOM   4097  C  CB   . SER A 1 97  ? 8.894   22.182 28.659  1.00 0.00  ? 97  SER A CB   2  
ATOM   4098  O  OG   . SER A 1 97  ? 8.106   22.556 27.538  1.00 0.00  ? 97  SER A OG   2  
ATOM   4099  H  H    . SER A 1 97  ? 9.090   22.363 31.497  1.00 0.00  ? 97  SER A H    2  
ATOM   4100  H  HA   . SER A 1 97  ? 9.689   24.111 29.151  1.00 0.00  ? 97  SER A HA   2  
ATOM   4101  H  HB2  . SER A 1 97  ? 9.869   21.872 28.319  1.00 0.00  ? 97  SER A HB2  2  
ATOM   4102  H  HB3  . SER A 1 97  ? 8.424   21.363 29.187  1.00 0.00  ? 97  SER A HB3  2  
ATOM   4103  H  HG   . SER A 1 97  ? 7.949   21.768 27.013  1.00 0.00  ? 97  SER A HG   2  
ATOM   4104  N  N    . HIS A 1 98  ? 7.461   25.197 29.364  1.00 0.00  ? 98  HIS A N    2  
ATOM   4105  C  CA   . HIS A 1 98  ? 6.151   25.872 29.564  1.00 0.00  ? 98  HIS A CA   2  
ATOM   4106  C  C    . HIS A 1 98  ? 5.219   25.512 28.403  1.00 0.00  ? 98  HIS A C    2  
ATOM   4107  O  O    . HIS A 1 98  ? 5.650   25.347 27.279  1.00 0.00  ? 98  HIS A O    2  
ATOM   4108  C  CB   . HIS A 1 98  ? 6.358   27.389 29.596  1.00 0.00  ? 98  HIS A CB   2  
ATOM   4109  C  CG   . HIS A 1 98  ? 7.173   27.771 30.804  1.00 0.00  ? 98  HIS A CG   2  
ATOM   4110  N  ND1  . HIS A 1 98  ? 8.460   28.278 30.708  1.00 0.00  ? 98  HIS A ND1  2  
ATOM   4111  C  CD2  . HIS A 1 98  ? 6.882   27.742 32.145  1.00 0.00  ? 98  HIS A CD2  2  
ATOM   4112  C  CE1  . HIS A 1 98  ? 8.888   28.538 31.959  1.00 0.00  ? 98  HIS A CE1  2  
ATOM   4113  N  NE2  . HIS A 1 98  ? 7.964   28.228 32.871  1.00 0.00  ? 98  HIS A NE2  2  
ATOM   4114  H  H    . HIS A 1 98  ? 8.173   25.651 28.866  1.00 0.00  ? 98  HIS A H    2  
ATOM   4115  H  HA   . HIS A 1 98  ? 5.715   25.546 30.497  1.00 0.00  ? 98  HIS A HA   2  
ATOM   4116  H  HB2  . HIS A 1 98  ? 6.873   27.698 28.700  1.00 0.00  ? 98  HIS A HB2  2  
ATOM   4117  H  HB3  . HIS A 1 98  ? 5.396   27.877 29.643  1.00 0.00  ? 98  HIS A HB3  2  
ATOM   4118  H  HD1  . HIS A 1 98  ? 8.973   28.397 29.888  1.00 0.00  ? 98  HIS A HD1  2  
ATOM   4119  H  HD2  . HIS A 1 98  ? 5.953   27.393 32.572  1.00 0.00  ? 98  HIS A HD2  2  
ATOM   4120  H  HE1  . HIS A 1 98  ? 9.857   28.953 32.195  1.00 0.00  ? 98  HIS A HE1  2  
ATOM   4121  N  N    . PHE A 1 99  ? 3.947   25.380 28.661  1.00 0.00  ? 99  PHE A N    2  
ATOM   4122  C  CA   . PHE A 1 99  ? 3.002   25.022 27.560  1.00 0.00  ? 99  PHE A CA   2  
ATOM   4123  C  C    . PHE A 1 99  ? 1.991   26.154 27.329  1.00 0.00  ? 99  PHE A C    2  
ATOM   4124  O  O    . PHE A 1 99  ? 1.772   26.995 28.178  1.00 0.00  ? 99  PHE A O    2  
ATOM   4125  C  CB   . PHE A 1 99  ? 2.251   23.743 27.934  1.00 0.00  ? 99  PHE A CB   2  
ATOM   4126  C  CG   . PHE A 1 99  ? 3.134   22.539 27.682  1.00 0.00  ? 99  PHE A CG   2  
ATOM   4127  C  CD1  . PHE A 1 99  ? 4.373   22.429 28.329  1.00 0.00  ? 99  PHE A CD1  2  
ATOM   4128  C  CD2  . PHE A 1 99  ? 2.712   21.532 26.803  1.00 0.00  ? 99  PHE A CD2  2  
ATOM   4129  C  CE1  . PHE A 1 99  ? 5.188   21.312 28.097  1.00 0.00  ? 99  PHE A CE1  2  
ATOM   4130  C  CE2  . PHE A 1 99  ? 3.526   20.415 26.573  1.00 0.00  ? 99  PHE A CE2  2  
ATOM   4131  C  CZ   . PHE A 1 99  ? 4.764   20.306 27.220  1.00 0.00  ? 99  PHE A CZ   2  
ATOM   4132  H  H    . PHE A 1 99  ? 3.617   25.505 29.576  1.00 0.00  ? 99  PHE A H    2  
ATOM   4133  H  HA   . PHE A 1 99  ? 3.561   24.855 26.653  1.00 0.00  ? 99  PHE A HA   2  
ATOM   4134  H  HB2  . PHE A 1 99  ? 1.980   23.779 28.978  1.00 0.00  ? 99  PHE A HB2  2  
ATOM   4135  H  HB3  . PHE A 1 99  ? 1.358   23.663 27.334  1.00 0.00  ? 99  PHE A HB3  2  
ATOM   4136  H  HD1  . PHE A 1 99  ? 4.700   23.205 29.005  1.00 0.00  ? 99  PHE A HD1  2  
ATOM   4137  H  HD2  . PHE A 1 99  ? 1.758   21.617 26.303  1.00 0.00  ? 99  PHE A HD2  2  
ATOM   4138  H  HE1  . PHE A 1 99  ? 6.143   21.227 28.595  1.00 0.00  ? 99  PHE A HE1  2  
ATOM   4139  H  HE2  . PHE A 1 99  ? 3.199   19.638 25.895  1.00 0.00  ? 99  PHE A HE2  2  
ATOM   4140  H  HZ   . PHE A 1 99  ? 5.392   19.445 27.042  1.00 0.00  ? 99  PHE A HZ   2  
ATOM   4141  N  N    . ASP A 1 100 ? 1.372   26.172 26.175  1.00 0.00  ? 100 ASP A N    2  
ATOM   4142  C  CA   . ASP A 1 100 ? 0.369   27.235 25.863  1.00 0.00  ? 100 ASP A CA   2  
ATOM   4143  C  C    . ASP A 1 100 ? -0.685  27.301 26.978  1.00 0.00  ? 100 ASP A C    2  
ATOM   4144  O  O    . ASP A 1 100 ? -1.366  26.332 27.254  1.00 0.00  ? 100 ASP A O    2  
ATOM   4145  C  CB   . ASP A 1 100 ? -0.324  26.903 24.534  1.00 0.00  ? 100 ASP A CB   2  
ATOM   4146  C  CG   . ASP A 1 100 ? 0.247   27.772 23.406  1.00 0.00  ? 100 ASP A CG   2  
ATOM   4147  O  OD1  . ASP A 1 100 ? 1.170   28.526 23.672  1.00 0.00  ? 100 ASP A OD1  2  
ATOM   4148  O  OD2  . ASP A 1 100 ? -0.261  27.681 22.297  1.00 0.00  ? 100 ASP A OD2  2  
ATOM   4149  H  H    . ASP A 1 100 ? 1.568   25.480 25.509  1.00 0.00  ? 100 ASP A H    2  
ATOM   4150  H  HA   . ASP A 1 100 ? 0.868   28.189 25.780  1.00 0.00  ? 100 ASP A HA   2  
ATOM   4151  H  HB2  . ASP A 1 100 ? -0.167  25.861 24.298  1.00 0.00  ? 100 ASP A HB2  2  
ATOM   4152  H  HB3  . ASP A 1 100 ? -1.383  27.093 24.629  1.00 0.00  ? 100 ASP A HB3  2  
ATOM   4153  N  N    . ASP A 1 101 ? -0.831  28.439 27.612  1.00 0.00  ? 101 ASP A N    2  
ATOM   4154  C  CA   . ASP A 1 101 ? -1.848  28.567 28.701  1.00 0.00  ? 101 ASP A CA   2  
ATOM   4155  C  C    . ASP A 1 101 ? -3.158  27.920 28.250  1.00 0.00  ? 101 ASP A C    2  
ATOM   4156  O  O    . ASP A 1 101 ? -3.410  26.760 28.514  1.00 0.00  ? 101 ASP A O    2  
ATOM   4157  C  CB   . ASP A 1 101 ? -2.093  30.049 29.001  1.00 0.00  ? 101 ASP A CB   2  
ATOM   4158  C  CG   . ASP A 1 101 ? -3.311  30.190 29.917  1.00 0.00  ? 101 ASP A CG   2  
ATOM   4159  O  OD1  . ASP A 1 101 ? -3.701  29.196 30.510  1.00 0.00  ? 101 ASP A OD1  2  
ATOM   4160  O  OD2  . ASP A 1 101 ? -3.831  31.289 30.013  1.00 0.00  ? 101 ASP A OD2  2  
ATOM   4161  H  H    . ASP A 1 101 ? -0.277  29.209 27.369  1.00 0.00  ? 101 ASP A H    2  
ATOM   4162  H  HA   . ASP A 1 101 ? -1.491  28.074 29.592  1.00 0.00  ? 101 ASP A HA   2  
ATOM   4163  H  HB2  . ASP A 1 101 ? -1.227  30.466 29.491  1.00 0.00  ? 101 ASP A HB2  2  
ATOM   4164  H  HB3  . ASP A 1 101 ? -2.276  30.579 28.078  1.00 0.00  ? 101 ASP A HB3  2  
ATOM   4165  N  N    . ASP A 1 102 ? -3.988  28.660 27.567  1.00 0.00  ? 102 ASP A N    2  
ATOM   4166  C  CA   . ASP A 1 102 ? -5.278  28.088 27.091  1.00 0.00  ? 102 ASP A CA   2  
ATOM   4167  C  C    . ASP A 1 102 ? -5.005  27.207 25.864  1.00 0.00  ? 102 ASP A C    2  
ATOM   4168  O  O    . ASP A 1 102 ? -4.160  26.335 25.912  1.00 0.00  ? 102 ASP A O    2  
ATOM   4169  C  CB   . ASP A 1 102 ? -6.242  29.223 26.736  1.00 0.00  ? 102 ASP A CB   2  
ATOM   4170  C  CG   . ASP A 1 102 ? -6.407  30.144 27.949  1.00 0.00  ? 102 ASP A CG   2  
ATOM   4171  O  OD1  . ASP A 1 102 ? -6.012  29.740 29.031  1.00 0.00  ? 102 ASP A OD1  2  
ATOM   4172  O  OD2  . ASP A 1 102 ? -6.926  31.233 27.775  1.00 0.00  ? 102 ASP A OD2  2  
ATOM   4173  H  H    . ASP A 1 102 ? -3.759  29.591 27.363  1.00 0.00  ? 102 ASP A H    2  
ATOM   4174  H  HA   . ASP A 1 102 ? -5.712  27.483 27.875  1.00 0.00  ? 102 ASP A HA   2  
ATOM   4175  H  HB2  . ASP A 1 102 ? -5.846  29.786 25.902  1.00 0.00  ? 102 ASP A HB2  2  
ATOM   4176  H  HB3  . ASP A 1 102 ? -7.204  28.810 26.467  1.00 0.00  ? 102 ASP A HB3  2  
ATOM   4177  N  N    . GLU A 1 103 ? -5.711  27.411 24.775  1.00 0.00  ? 103 GLU A N    2  
ATOM   4178  C  CA   . GLU A 1 103 ? -5.485  26.573 23.555  1.00 0.00  ? 103 GLU A CA   2  
ATOM   4179  C  C    . GLU A 1 103 ? -6.287  25.265 23.676  1.00 0.00  ? 103 GLU A C    2  
ATOM   4180  O  O    . GLU A 1 103 ? -6.732  24.711 22.692  1.00 0.00  ? 103 GLU A O    2  
ATOM   4181  C  CB   . GLU A 1 103 ? -3.988  26.273 23.394  1.00 0.00  ? 103 GLU A CB   2  
ATOM   4182  C  CG   . GLU A 1 103 ? -3.558  26.548 21.949  1.00 0.00  ? 103 GLU A CG   2  
ATOM   4183  C  CD   . GLU A 1 103 ? -2.897  27.933 21.859  1.00 0.00  ? 103 GLU A CD   2  
ATOM   4184  O  OE1  . GLU A 1 103 ? -2.991  28.679 22.820  1.00 0.00  ? 103 GLU A OE1  2  
ATOM   4185  O  OE2  . GLU A 1 103 ? -2.300  28.222 20.832  1.00 0.00  ? 103 GLU A OE2  2  
ATOM   4186  H  H    . GLU A 1 103 ? -6.395  28.112 24.757  1.00 0.00  ? 103 GLU A H    2  
ATOM   4187  H  HA   . GLU A 1 103 ? -5.833  27.117 22.688  1.00 0.00  ? 103 GLU A HA   2  
ATOM   4188  H  HB2  . GLU A 1 103 ? -3.421  26.909 24.058  1.00 0.00  ? 103 GLU A HB2  2  
ATOM   4189  H  HB3  . GLU A 1 103 ? -3.795  25.240 23.635  1.00 0.00  ? 103 GLU A HB3  2  
ATOM   4190  H  HG2  . GLU A 1 103 ? -2.854  25.791 21.635  1.00 0.00  ? 103 GLU A HG2  2  
ATOM   4191  H  HG3  . GLU A 1 103 ? -4.425  26.522 21.306  1.00 0.00  ? 103 GLU A HG3  2  
ATOM   4192  N  N    . LEU A 1 104 ? -6.500  24.789 24.876  1.00 0.00  ? 104 LEU A N    2  
ATOM   4193  C  CA   . LEU A 1 104 ? -7.303  23.544 25.068  1.00 0.00  ? 104 LEU A CA   2  
ATOM   4194  C  C    . LEU A 1 104 ? -6.554  22.314 24.534  1.00 0.00  ? 104 LEU A C    2  
ATOM   4195  O  O    . LEU A 1 104 ? -6.896  21.764 23.504  1.00 0.00  ? 104 LEU A O    2  
ATOM   4196  C  CB   . LEU A 1 104 ? -8.640  23.697 24.340  1.00 0.00  ? 104 LEU A CB   2  
ATOM   4197  C  CG   . LEU A 1 104 ? -9.617  22.624 24.825  1.00 0.00  ? 104 LEU A CG   2  
ATOM   4198  C  CD1  . LEU A 1 104 ? -10.062 22.940 26.256  1.00 0.00  ? 104 LEU A CD1  2  
ATOM   4199  C  CD2  . LEU A 1 104 ? -10.842 22.606 23.907  1.00 0.00  ? 104 LEU A CD2  2  
ATOM   4200  H  H    . LEU A 1 104 ? -6.154  25.262 25.656  1.00 0.00  ? 104 LEU A H    2  
ATOM   4201  H  HA   . LEU A 1 104 ? -7.492  23.410 26.123  1.00 0.00  ? 104 LEU A HA   2  
ATOM   4202  H  HB2  . LEU A 1 104 ? -9.050  24.675 24.545  1.00 0.00  ? 104 LEU A HB2  2  
ATOM   4203  H  HB3  . LEU A 1 104 ? -8.486  23.588 23.280  1.00 0.00  ? 104 LEU A HB3  2  
ATOM   4204  H  HG   . LEU A 1 104 ? -9.133  21.658 24.801  1.00 0.00  ? 104 LEU A HG   2  
ATOM   4205  H  HD11 . LEU A 1 104 ? -10.968 23.528 26.229  1.00 0.00  ? 104 LEU A HD11 2  
ATOM   4206  H  HD12 . LEU A 1 104 ? -9.286  23.495 26.762  1.00 0.00  ? 104 LEU A HD12 2  
ATOM   4207  H  HD13 . LEU A 1 104 ? -10.248 22.019 26.788  1.00 0.00  ? 104 LEU A HD13 2  
ATOM   4208  H  HD21 . LEU A 1 104 ? -11.048 21.591 23.600  1.00 0.00  ? 104 LEU A HD21 2  
ATOM   4209  H  HD22 . LEU A 1 104 ? -10.650 23.215 23.036  1.00 0.00  ? 104 LEU A HD22 2  
ATOM   4210  H  HD23 . LEU A 1 104 ? -11.695 23.000 24.439  1.00 0.00  ? 104 LEU A HD23 2  
ATOM   4211  N  N    . TRP A 1 105 ? -5.553  21.862 25.243  1.00 0.00  ? 105 TRP A N    2  
ATOM   4212  C  CA   . TRP A 1 105 ? -4.796  20.647 24.805  1.00 0.00  ? 105 TRP A CA   2  
ATOM   4213  C  C    . TRP A 1 105 ? -5.416  19.441 25.505  1.00 0.00  ? 105 TRP A C    2  
ATOM   4214  O  O    . TRP A 1 105 ? -6.136  19.600 26.467  1.00 0.00  ? 105 TRP A O    2  
ATOM   4215  C  CB   . TRP A 1 105 ? -3.335  20.768 25.238  1.00 0.00  ? 105 TRP A CB   2  
ATOM   4216  C  CG   . TRP A 1 105 ? -2.464  21.184 24.094  1.00 0.00  ? 105 TRP A CG   2  
ATOM   4217  C  CD1  . TRP A 1 105 ? -1.175  20.802 23.948  1.00 0.00  ? 105 TRP A CD1  2  
ATOM   4218  C  CD2  . TRP A 1 105 ? -2.766  22.045 22.951  1.00 0.00  ? 105 TRP A CD2  2  
ATOM   4219  N  NE1  . TRP A 1 105 ? -0.662  21.376 22.803  1.00 0.00  ? 105 TRP A NE1  2  
ATOM   4220  C  CE2  . TRP A 1 105 ? -1.600  22.149 22.153  1.00 0.00  ? 105 TRP A CE2  2  
ATOM   4221  C  CE3  . TRP A 1 105 ? -3.915  22.741 22.529  1.00 0.00  ? 105 TRP A CE3  2  
ATOM   4222  C  CZ2  . TRP A 1 105 ? -1.573  22.912 20.989  1.00 0.00  ? 105 TRP A CZ2  2  
ATOM   4223  C  CZ3  . TRP A 1 105 ? -3.891  23.509 21.353  1.00 0.00  ? 105 TRP A CZ3  2  
ATOM   4224  C  CH2  . TRP A 1 105 ? -2.722  23.595 20.586  1.00 0.00  ? 105 TRP A CH2  2  
ATOM   4225  H  H    . TRP A 1 105 ? -5.309  22.310 26.081  1.00 0.00  ? 105 TRP A H    2  
ATOM   4226  H  HA   . TRP A 1 105 ? -4.866  20.523 23.734  1.00 0.00  ? 105 TRP A HA   2  
ATOM   4227  H  HB2  . TRP A 1 105 ? -3.256  21.500 26.027  1.00 0.00  ? 105 TRP A HB2  2  
ATOM   4228  H  HB3  . TRP A 1 105 ? -2.997  19.812 25.609  1.00 0.00  ? 105 TRP A HB3  2  
ATOM   4229  H  HD1  . TRP A 1 105 ? -0.631  20.154 24.622  1.00 0.00  ? 105 TRP A HD1  2  
ATOM   4230  H  HE1  . TRP A 1 105 ? 0.254   21.259 22.474  1.00 0.00  ? 105 TRP A HE1  2  
ATOM   4231  H  HE3  . TRP A 1 105 ? -4.818  22.680 23.106  1.00 0.00  ? 105 TRP A HE3  2  
ATOM   4232  H  HZ2  . TRP A 1 105 ? -0.667  22.978 20.403  1.00 0.00  ? 105 TRP A HZ2  2  
ATOM   4233  H  HZ3  . TRP A 1 105 ? -4.779  24.037 21.037  1.00 0.00  ? 105 TRP A HZ3  2  
ATOM   4234  H  HH2  . TRP A 1 105 ? -2.711  24.188 19.684  1.00 0.00  ? 105 TRP A HH2  2  
ATOM   4235  N  N    . THR A 1 106 ? -5.158  18.241 25.043  1.00 0.00  ? 106 THR A N    2  
ATOM   4236  C  CA   . THR A 1 106 ? -5.775  17.052 25.711  1.00 0.00  ? 106 THR A CA   2  
ATOM   4237  C  C    . THR A 1 106 ? -5.515  15.791 24.893  1.00 0.00  ? 106 THR A C    2  
ATOM   4238  O  O    . THR A 1 106 ? -4.870  15.837 23.873  1.00 0.00  ? 106 THR A O    2  
ATOM   4239  C  CB   . THR A 1 106 ? -7.291  17.275 25.766  1.00 0.00  ? 106 THR A CB   2  
ATOM   4240  O  OG1  . THR A 1 106 ? -7.922  16.218 26.469  1.00 0.00  ? 106 THR A OG1  2  
ATOM   4241  C  CG2  . THR A 1 106 ? -7.827  17.352 24.365  1.00 0.00  ? 106 THR A CG2  2  
ATOM   4242  H  H    . THR A 1 106 ? -4.578  18.123 24.261  1.00 0.00  ? 106 THR A H    2  
ATOM   4243  H  HA   . THR A 1 106 ? -5.380  16.934 26.697  1.00 0.00  ? 106 THR A HA   2  
ATOM   4244  H  HB   . THR A 1 106 ? -7.506  18.195 26.223  1.00 0.00  ? 106 THR A HB   2  
ATOM   4245  H  HG1  . THR A 1 106 ? -7.677  16.291 27.394  1.00 0.00  ? 106 THR A HG1  2  
ATOM   4246  H  HG21 . THR A 1 106 ? -7.107  16.935 23.706  1.00 0.00  ? 106 THR A HG21 2  
ATOM   4247  H  HG22 . THR A 1 106 ? -7.999  18.386 24.106  1.00 0.00  ? 106 THR A HG22 2  
ATOM   4248  H  HG23 . THR A 1 106 ? -8.749  16.800 24.299  1.00 0.00  ? 106 THR A HG23 2  
ATOM   4249  N  N    . ASN A 1 107 ? -6.100  14.674 25.282  1.00 0.00  ? 107 ASN A N    2  
ATOM   4250  C  CA   . ASN A 1 107 ? -5.960  13.440 24.430  1.00 0.00  ? 107 ASN A CA   2  
ATOM   4251  C  C    . ASN A 1 107 ? -6.336  13.929 23.033  1.00 0.00  ? 107 ASN A C    2  
ATOM   4252  O  O    . ASN A 1 107 ? -5.791  13.540 22.022  1.00 0.00  ? 107 ASN A O    2  
ATOM   4253  C  CB   . ASN A 1 107 ? -6.932  12.355 24.904  1.00 0.00  ? 107 ASN A CB   2  
ATOM   4254  C  CG   . ASN A 1 107 ? -8.296  12.986 25.192  1.00 0.00  ? 107 ASN A CG   2  
ATOM   4255  O  OD1  . ASN A 1 107 ? -8.464  14.182 25.068  1.00 0.00  ? 107 ASN A OD1  2  
ATOM   4256  N  ND2  . ASN A 1 107 ? -9.286  12.229 25.580  1.00 0.00  ? 107 ASN A ND2  2  
ATOM   4257  H  H    . ASN A 1 107 ? -6.684  14.679 26.070  1.00 0.00  ? 107 ASN A H    2  
ATOM   4258  H  HA   . ASN A 1 107 ? -4.937  13.082 24.444  1.00 0.00  ? 107 ASN A HA   2  
ATOM   4259  H  HB2  . ASN A 1 107 ? -7.036  11.602 24.137  1.00 0.00  ? 107 ASN A HB2  2  
ATOM   4260  H  HB3  . ASN A 1 107 ? -6.550  11.902 25.806  1.00 0.00  ? 107 ASN A HB3  2  
ATOM   4261  H  HD21 . ASN A 1 107 ? -9.154  11.264 25.686  1.00 0.00  ? 107 ASN A HD21 2  
ATOM   4262  H  HD22 . ASN A 1 107 ? -10.163 12.627 25.765  1.00 0.00  ? 107 ASN A HD22 2  
ATOM   4263  N  N    . THR A 1 108 ? -7.216  14.893 23.072  1.00 0.00  ? 108 THR A N    2  
ATOM   4264  C  CA   . THR A 1 108 ? -7.695  15.680 21.910  1.00 0.00  ? 108 THR A CA   2  
ATOM   4265  C  C    . THR A 1 108 ? -8.628  15.003 20.943  1.00 0.00  ? 108 THR A C    2  
ATOM   4266  O  O    . THR A 1 108 ? -9.814  14.909 21.196  1.00 0.00  ? 108 THR A O    2  
ATOM   4267  C  CB   . THR A 1 108 ? -6.538  16.366 21.173  1.00 0.00  ? 108 THR A CB   2  
ATOM   4268  O  OG1  . THR A 1 108 ? -5.398  15.530 21.143  1.00 0.00  ? 108 THR A OG1  2  
ATOM   4269  C  CG2  . THR A 1 108 ? -6.208  17.675 21.906  1.00 0.00  ? 108 THR A CG2  2  
ATOM   4270  H  H    . THR A 1 108 ? -7.538  15.165 23.948  1.00 0.00  ? 108 THR A H    2  
ATOM   4271  H  HA   . THR A 1 108 ? -8.279  16.480 22.331  1.00 0.00  ? 108 THR A HA   2  
ATOM   4272  H  HB   . THR A 1 108 ? -6.841  16.598 20.166  1.00 0.00  ? 108 THR A HB   2  
ATOM   4273  H  HG1  . THR A 1 108 ? -5.574  14.815 20.527  1.00 0.00  ? 108 THR A HG1  2  
ATOM   4274  H  HG21 . THR A 1 108 ? -5.714  18.355 21.238  1.00 0.00  ? 108 THR A HG21 2  
ATOM   4275  H  HG22 . THR A 1 108 ? -5.562  17.462 22.749  1.00 0.00  ? 108 THR A HG22 2  
ATOM   4276  H  HG23 . THR A 1 108 ? -7.124  18.127 22.270  1.00 0.00  ? 108 THR A HG23 2  
ATOM   4277  N  N    . SER A 1 109 ? -8.185  14.731 19.748  1.00 0.00  ? 109 SER A N    2  
ATOM   4278  C  CA   . SER A 1 109 ? -9.193  14.318 18.760  1.00 0.00  ? 109 SER A CA   2  
ATOM   4279  C  C    . SER A 1 109 ? -10.095 15.579 18.713  1.00 0.00  ? 109 SER A C    2  
ATOM   4280  O  O    . SER A 1 109 ? -11.272 15.542 18.411  1.00 0.00  ? 109 SER A O    2  
ATOM   4281  C  CB   . SER A 1 109 ? -9.968  13.096 19.260  1.00 0.00  ? 109 SER A CB   2  
ATOM   4282  O  OG   . SER A 1 109 ? -11.241 13.505 19.739  1.00 0.00  ? 109 SER A OG   2  
ATOM   4283  H  H    . SER A 1 109 ? -7.273  14.956 19.477  1.00 0.00  ? 109 SER A H    2  
ATOM   4284  H  HA   . SER A 1 109 ? -8.736  14.133 17.795  1.00 0.00  ? 109 SER A HA   2  
ATOM   4285  H  HB2  . SER A 1 109 ? -10.103 12.398 18.451  1.00 0.00  ? 109 SER A HB2  2  
ATOM   4286  H  HB3  . SER A 1 109 ? -9.409  12.618 20.055  1.00 0.00  ? 109 SER A HB3  2  
ATOM   4287  H  HG   . SER A 1 109 ? -11.903 13.198 19.116  1.00 0.00  ? 109 SER A HG   2  
ATOM   4288  N  N    . ALA A 1 110 ? -9.478  16.702 19.108  1.00 0.00  ? 110 ALA A N    2  
ATOM   4289  C  CA   . ALA A 1 110 ? -10.139 18.028 19.226  1.00 0.00  ? 110 ALA A CA   2  
ATOM   4290  C  C    . ALA A 1 110 ? -9.211  19.085 18.616  1.00 0.00  ? 110 ALA A C    2  
ATOM   4291  O  O    . ALA A 1 110 ? -9.628  19.956 17.876  1.00 0.00  ? 110 ALA A O    2  
ATOM   4292  C  CB   . ALA A 1 110 ? -10.294 18.344 20.734  1.00 0.00  ? 110 ALA A CB   2  
ATOM   4293  H  H    . ALA A 1 110 ? -8.541  16.652 19.372  1.00 0.00  ? 110 ALA A H    2  
ATOM   4294  H  HA   . ALA A 1 110 ? -11.094 18.032 18.736  1.00 0.00  ? 110 ALA A HA   2  
ATOM   4295  H  HB1  . ALA A 1 110 ? -9.311  18.393 21.194  1.00 0.00  ? 110 ALA A HB1  2  
ATOM   4296  H  HB2  . ALA A 1 110 ? -10.867 17.567 21.219  1.00 0.00  ? 110 ALA A HB2  2  
ATOM   4297  H  HB3  . ALA A 1 110 ? -10.790 19.294 20.865  1.00 0.00  ? 110 ALA A HB3  2  
ATOM   4298  N  N    . ASN A 1 111 ? -7.948  19.011 18.950  1.00 0.00  ? 111 ASN A N    2  
ATOM   4299  C  CA   . ASN A 1 111 ? -6.961  20.004 18.430  1.00 0.00  ? 111 ASN A CA   2  
ATOM   4300  C  C    . ASN A 1 111 ? -5.536  19.427 18.501  1.00 0.00  ? 111 ASN A C    2  
ATOM   4301  O  O    . ASN A 1 111 ? -5.035  18.863 17.546  1.00 0.00  ? 111 ASN A O    2  
ATOM   4302  C  CB   . ASN A 1 111 ? -7.024  21.260 19.297  1.00 0.00  ? 111 ASN A CB   2  
ATOM   4303  C  CG   . ASN A 1 111 ? -7.969  22.284 18.669  1.00 0.00  ? 111 ASN A CG   2  
ATOM   4304  O  OD1  . ASN A 1 111 ? -7.777  22.702 17.544  1.00 0.00  ? 111 ASN A OD1  2  
ATOM   4305  N  ND2  . ASN A 1 111 ? -8.988  22.712 19.363  1.00 0.00  ? 111 ASN A ND2  2  
ATOM   4306  H  H    . ASN A 1 111 ? -7.653  18.304 19.557  1.00 0.00  ? 111 ASN A H    2  
ATOM   4307  H  HA   . ASN A 1 111 ? -7.202  20.258 17.408  1.00 0.00  ? 111 ASN A HA   2  
ATOM   4308  H  HB2  . ASN A 1 111 ? -7.385  20.994 20.278  1.00 0.00  ? 111 ASN A HB2  2  
ATOM   4309  H  HB3  . ASN A 1 111 ? -6.037  21.688 19.382  1.00 0.00  ? 111 ASN A HB3  2  
ATOM   4310  H  HD21 . ASN A 1 111 ? -9.136  22.374 20.272  1.00 0.00  ? 111 ASN A HD21 2  
ATOM   4311  H  HD22 . ASN A 1 111 ? -9.602  23.370 18.979  1.00 0.00  ? 111 ASN A HD22 2  
ATOM   4312  N  N    . TYR A 1 112 ? -4.872  19.583 19.624  1.00 0.00  ? 112 TYR A N    2  
ATOM   4313  C  CA   . TYR A 1 112 ? -3.472  19.062 19.754  1.00 0.00  ? 112 TYR A CA   2  
ATOM   4314  C  C    . TYR A 1 112 ? -3.385  18.057 20.906  1.00 0.00  ? 112 TYR A C    2  
ATOM   4315  O  O    . TYR A 1 112 ? -3.775  18.336 22.023  1.00 0.00  ? 112 TYR A O    2  
ATOM   4316  C  CB   . TYR A 1 112 ? -2.528  20.230 20.021  1.00 0.00  ? 112 TYR A CB   2  
ATOM   4317  C  CG   . TYR A 1 112 ? -2.234  20.928 18.718  1.00 0.00  ? 112 TYR A CG   2  
ATOM   4318  C  CD1  . TYR A 1 112 ? -3.281  21.477 17.969  1.00 0.00  ? 112 TYR A CD1  2  
ATOM   4319  C  CD2  . TYR A 1 112 ? -0.916  21.020 18.256  1.00 0.00  ? 112 TYR A CD2  2  
ATOM   4320  C  CE1  . TYR A 1 112 ? -3.010  22.118 16.756  1.00 0.00  ? 112 TYR A CE1  2  
ATOM   4321  C  CE2  . TYR A 1 112 ? -0.646  21.661 17.042  1.00 0.00  ? 112 TYR A CE2  2  
ATOM   4322  C  CZ   . TYR A 1 112 ? -1.694  22.209 16.292  1.00 0.00  ? 112 TYR A CZ   2  
ATOM   4323  O  OH   . TYR A 1 112 ? -1.427  22.839 15.094  1.00 0.00  ? 112 TYR A OH   2  
ATOM   4324  H  H    . TYR A 1 112 ? -5.291  20.051 20.378  1.00 0.00  ? 112 TYR A H    2  
ATOM   4325  H  HA   . TYR A 1 112 ? -3.185  18.575 18.833  1.00 0.00  ? 112 TYR A HA   2  
ATOM   4326  H  HB2  . TYR A 1 112 ? -2.996  20.922 20.704  1.00 0.00  ? 112 TYR A HB2  2  
ATOM   4327  H  HB3  . TYR A 1 112 ? -1.608  19.863 20.450  1.00 0.00  ? 112 TYR A HB3  2  
ATOM   4328  H  HD1  . TYR A 1 112 ? -4.297  21.408 18.329  1.00 0.00  ? 112 TYR A HD1  2  
ATOM   4329  H  HD2  . TYR A 1 112 ? -0.109  20.594 18.834  1.00 0.00  ? 112 TYR A HD2  2  
ATOM   4330  H  HE1  . TYR A 1 112 ? -3.817  22.537 16.176  1.00 0.00  ? 112 TYR A HE1  2  
ATOM   4331  H  HE2  . TYR A 1 112 ? 0.371   21.735 16.686  1.00 0.00  ? 112 TYR A HE2  2  
ATOM   4332  H  HH   . TYR A 1 112 ? -0.675  22.398 14.691  1.00 0.00  ? 112 TYR A HH   2  
ATOM   4333  N  N    . SER A 1 113 ? -2.879  16.884 20.637  1.00 0.00  ? 113 SER A N    2  
ATOM   4334  C  CA   . SER A 1 113 ? -2.783  15.847 21.702  1.00 0.00  ? 113 SER A CA   2  
ATOM   4335  C  C    . SER A 1 113 ? -1.621  16.131 22.662  1.00 0.00  ? 113 SER A C    2  
ATOM   4336  O  O    . SER A 1 113 ? -0.497  16.358 22.256  1.00 0.00  ? 113 SER A O    2  
ATOM   4337  C  CB   . SER A 1 113 ? -2.597  14.476 21.049  1.00 0.00  ? 113 SER A CB   2  
ATOM   4338  O  OG   . SER A 1 113 ? -1.690  13.704 21.821  1.00 0.00  ? 113 SER A OG   2  
ATOM   4339  H  H    . SER A 1 113 ? -2.575  16.679 19.728  1.00 0.00  ? 113 SER A H    2  
ATOM   4340  H  HA   . SER A 1 113 ? -3.697  15.841 22.259  1.00 0.00  ? 113 SER A HA   2  
ATOM   4341  H  HB2  . SER A 1 113 ? -3.546  13.967 21.006  1.00 0.00  ? 113 SER A HB2  2  
ATOM   4342  H  HB3  . SER A 1 113 ? -2.218  14.604 20.045  1.00 0.00  ? 113 SER A HB3  2  
ATOM   4343  H  HG   . SER A 1 113 ? -2.150  13.416 22.613  1.00 0.00  ? 113 SER A HG   2  
ATOM   4344  N  N    . LEU A 1 114 ? -1.899  16.113 23.942  1.00 0.00  ? 114 LEU A N    2  
ATOM   4345  C  CA   . LEU A 1 114 ? -0.839  16.369 24.962  1.00 0.00  ? 114 LEU A CA   2  
ATOM   4346  C  C    . LEU A 1 114 ? 0.326   15.366 24.795  1.00 0.00  ? 114 LEU A C    2  
ATOM   4347  O  O    . LEU A 1 114 ? 1.439   15.641 25.198  1.00 0.00  ? 114 LEU A O    2  
ATOM   4348  C  CB   . LEU A 1 114 ? -1.464  16.206 26.355  1.00 0.00  ? 114 LEU A CB   2  
ATOM   4349  C  CG   . LEU A 1 114 ? -0.857  17.203 27.355  1.00 0.00  ? 114 LEU A CG   2  
ATOM   4350  C  CD1  . LEU A 1 114 ? 0.660   17.026 27.424  1.00 0.00  ? 114 LEU A CD1  2  
ATOM   4351  C  CD2  . LEU A 1 114 ? -1.181  18.632 26.920  1.00 0.00  ? 114 LEU A CD2  2  
ATOM   4352  H  H    . LEU A 1 114 ? -2.822  15.928 24.240  1.00 0.00  ? 114 LEU A H    2  
ATOM   4353  H  HA   . LEU A 1 114 ? -0.468  17.377 24.852  1.00 0.00  ? 114 LEU A HA   2  
ATOM   4354  H  HB2  . LEU A 1 114 ? -2.529  16.378 26.287  1.00 0.00  ? 114 LEU A HB2  2  
ATOM   4355  H  HB3  . LEU A 1 114 ? -1.292  15.206 26.703  1.00 0.00  ? 114 LEU A HB3  2  
ATOM   4356  H  HG   . LEU A 1 114 ? -1.280  17.023 28.334  1.00 0.00  ? 114 LEU A HG   2  
ATOM   4357  H  HD11 . LEU A 1 114 ? 0.897   15.985 27.586  1.00 0.00  ? 114 LEU A HD11 2  
ATOM   4358  H  HD12 . LEU A 1 114 ? 1.052   17.615 28.241  1.00 0.00  ? 114 LEU A HD12 2  
ATOM   4359  H  HD13 . LEU A 1 114 ? 1.104   17.357 26.498  1.00 0.00  ? 114 LEU A HD13 2  
ATOM   4360  H  HD21 . LEU A 1 114 ? -2.017  19.003 27.496  1.00 0.00  ? 114 LEU A HD21 2  
ATOM   4361  H  HD22 . LEU A 1 114 ? -1.433  18.642 25.871  1.00 0.00  ? 114 LEU A HD22 2  
ATOM   4362  H  HD23 . LEU A 1 114 ? -0.320  19.262 27.090  1.00 0.00  ? 114 LEU A HD23 2  
ATOM   4363  N  N    . PHE A 1 115 ? 0.092   14.204 24.214  1.00 0.00  ? 115 PHE A N    2  
ATOM   4364  C  CA   . PHE A 1 115 ? 1.217   13.214 24.053  1.00 0.00  ? 115 PHE A CA   2  
ATOM   4365  C  C    . PHE A 1 115 ? 2.177   13.671 22.953  1.00 0.00  ? 115 PHE A C    2  
ATOM   4366  O  O    . PHE A 1 115 ? 3.365   13.783 23.172  1.00 0.00  ? 115 PHE A O    2  
ATOM   4367  C  CB   . PHE A 1 115 ? 0.686   11.813 23.698  1.00 0.00  ? 115 PHE A CB   2  
ATOM   4368  C  CG   . PHE A 1 115 ? 1.862   10.890 23.387  1.00 0.00  ? 115 PHE A CG   2  
ATOM   4369  C  CD1  . PHE A 1 115 ? 3.151   11.198 23.860  1.00 0.00  ? 115 PHE A CD1  2  
ATOM   4370  C  CD2  . PHE A 1 115 ? 1.671   9.724  22.624  1.00 0.00  ? 115 PHE A CD2  2  
ATOM   4371  C  CE1  . PHE A 1 115 ? 4.228   10.352 23.570  1.00 0.00  ? 115 PHE A CE1  2  
ATOM   4372  C  CE2  . PHE A 1 115 ? 2.753   8.883  22.340  1.00 0.00  ? 115 PHE A CE2  2  
ATOM   4373  C  CZ   . PHE A 1 115 ? 4.029   9.197  22.811  1.00 0.00  ? 115 PHE A CZ   2  
ATOM   4374  H  H    . PHE A 1 115 ? -0.809  13.984 23.897  1.00 0.00  ? 115 PHE A H    2  
ATOM   4375  H  HA   . PHE A 1 115 ? 1.762   13.154 24.985  1.00 0.00  ? 115 PHE A HA   2  
ATOM   4376  H  HB2  . PHE A 1 115 ? 0.129   11.418 24.537  1.00 0.00  ? 115 PHE A HB2  2  
ATOM   4377  H  HB3  . PHE A 1 115 ? 0.037   11.876 22.834  1.00 0.00  ? 115 PHE A HB3  2  
ATOM   4378  H  HD1  . PHE A 1 115 ? 3.317   12.085 24.448  1.00 0.00  ? 115 PHE A HD1  2  
ATOM   4379  H  HD2  . PHE A 1 115 ? 0.692   9.466  22.261  1.00 0.00  ? 115 PHE A HD2  2  
ATOM   4380  H  HE1  . PHE A 1 115 ? 5.216   10.592 23.937  1.00 0.00  ? 115 PHE A HE1  2  
ATOM   4381  H  HE2  . PHE A 1 115 ? 2.602   7.990  21.752  1.00 0.00  ? 115 PHE A HE2  2  
ATOM   4382  H  HZ   . PHE A 1 115 ? 4.861   8.545  22.590  1.00 0.00  ? 115 PHE A HZ   2  
ATOM   4383  N  N    . LEU A 1 116 ? 1.686   13.924 21.770  1.00 0.00  ? 116 LEU A N    2  
ATOM   4384  C  CA   . LEU A 1 116 ? 2.605   14.363 20.676  1.00 0.00  ? 116 LEU A CA   2  
ATOM   4385  C  C    . LEU A 1 116 ? 3.232   15.700 21.056  1.00 0.00  ? 116 LEU A C    2  
ATOM   4386  O  O    . LEU A 1 116 ? 4.432   15.870 21.003  1.00 0.00  ? 116 LEU A O    2  
ATOM   4387  C  CB   . LEU A 1 116 ? 1.843   14.529 19.348  1.00 0.00  ? 116 LEU A CB   2  
ATOM   4388  C  CG   . LEU A 1 116 ? 1.116   13.235 18.952  1.00 0.00  ? 116 LEU A CG   2  
ATOM   4389  C  CD1  . LEU A 1 116 ? 1.827   12.003 19.519  1.00 0.00  ? 116 LEU A CD1  2  
ATOM   4390  C  CD2  . LEU A 1 116 ? -0.316  13.308 19.477  1.00 0.00  ? 116 LEU A CD2  2  
ATOM   4391  H  H    . LEU A 1 116 ? 0.729   13.820 21.603  1.00 0.00  ? 116 LEU A H    2  
ATOM   4392  H  HA   . LEU A 1 116 ? 3.388   13.631 20.552  1.00 0.00  ? 116 LEU A HA   2  
ATOM   4393  H  HB2  . LEU A 1 116 ? 1.115   15.321 19.452  1.00 0.00  ? 116 LEU A HB2  2  
ATOM   4394  H  HB3  . LEU A 1 116 ? 2.543   14.793 18.569  1.00 0.00  ? 116 LEU A HB3  2  
ATOM   4395  H  HG   . LEU A 1 116 ? 1.098   13.150 17.876  1.00 0.00  ? 116 LEU A HG   2  
ATOM   4396  H  HD11 . LEU A 1 116 ? 1.633   11.155 18.881  1.00 0.00  ? 116 LEU A HD11 2  
ATOM   4397  H  HD12 . LEU A 1 116 ? 1.460   11.799 20.512  1.00 0.00  ? 116 LEU A HD12 2  
ATOM   4398  H  HD13 . LEU A 1 116 ? 2.891   12.187 19.555  1.00 0.00  ? 116 LEU A HD13 2  
ATOM   4399  H  HD21 . LEU A 1 116 ? -0.389  14.098 20.210  1.00 0.00  ? 116 LEU A HD21 2  
ATOM   4400  H  HD22 . LEU A 1 116 ? -0.583  12.368 19.932  1.00 0.00  ? 116 LEU A HD22 2  
ATOM   4401  H  HD23 . LEU A 1 116 ? -0.989  13.520 18.660  1.00 0.00  ? 116 LEU A HD23 2  
ATOM   4402  N  N    . VAL A 1 117 ? 2.432   16.656 21.435  1.00 0.00  ? 117 VAL A N    2  
ATOM   4403  C  CA   . VAL A 1 117 ? 2.992   17.975 21.805  1.00 0.00  ? 117 VAL A CA   2  
ATOM   4404  C  C    . VAL A 1 117 ? 4.057   17.803 22.893  1.00 0.00  ? 117 VAL A C    2  
ATOM   4405  O  O    . VAL A 1 117 ? 5.178   18.249 22.742  1.00 0.00  ? 117 VAL A O    2  
ATOM   4406  C  CB   . VAL A 1 117 ? 1.867   18.890 22.295  1.00 0.00  ? 117 VAL A CB   2  
ATOM   4407  C  CG1  . VAL A 1 117 ? 0.799   19.002 21.211  1.00 0.00  ? 117 VAL A CG1  2  
ATOM   4408  C  CG2  . VAL A 1 117 ? 1.229   18.326 23.565  1.00 0.00  ? 117 VAL A CG2  2  
ATOM   4409  H  H    . VAL A 1 117 ? 1.464   16.509 21.468  1.00 0.00  ? 117 VAL A H    2  
ATOM   4410  H  HA   . VAL A 1 117 ? 3.450   18.418 20.932  1.00 0.00  ? 117 VAL A HA   2  
ATOM   4411  H  HB   . VAL A 1 117 ? 2.270   19.864 22.498  1.00 0.00  ? 117 VAL A HB   2  
ATOM   4412  H  HG11 . VAL A 1 117 ? -0.118  19.368 21.648  1.00 0.00  ? 117 VAL A HG11 2  
ATOM   4413  H  HG12 . VAL A 1 117 ? 0.627   18.030 20.772  1.00 0.00  ? 117 VAL A HG12 2  
ATOM   4414  H  HG13 . VAL A 1 117 ? 1.135   19.688 20.448  1.00 0.00  ? 117 VAL A HG13 2  
ATOM   4415  H  HG21 . VAL A 1 117 ? 1.148   17.251 23.482  1.00 0.00  ? 117 VAL A HG21 2  
ATOM   4416  H  HG22 . VAL A 1 117 ? 0.246   18.756 23.691  1.00 0.00  ? 117 VAL A HG22 2  
ATOM   4417  H  HG23 . VAL A 1 117 ? 1.840   18.578 24.417  1.00 0.00  ? 117 VAL A HG23 2  
ATOM   4418  N  N    . ALA A 1 118 ? 3.737   17.155 23.982  1.00 0.00  ? 118 ALA A N    2  
ATOM   4419  C  CA   . ALA A 1 118 ? 4.759   16.968 25.050  1.00 0.00  ? 118 ALA A CA   2  
ATOM   4420  C  C    . ALA A 1 118 ? 5.859   16.048 24.524  1.00 0.00  ? 118 ALA A C    2  
ATOM   4421  O  O    . ALA A 1 118 ? 7.030   16.256 24.771  1.00 0.00  ? 118 ALA A O    2  
ATOM   4422  C  CB   . ALA A 1 118 ? 4.109   16.345 26.289  1.00 0.00  ? 118 ALA A CB   2  
ATOM   4423  H  H    . ALA A 1 118 ? 2.838   16.786 24.093  1.00 0.00  ? 118 ALA A H    2  
ATOM   4424  H  HA   . ALA A 1 118 ? 5.186   17.926 25.311  1.00 0.00  ? 118 ALA A HA   2  
ATOM   4425  H  HB1  . ALA A 1 118 ? 3.296   16.971 26.623  1.00 0.00  ? 118 ALA A HB1  2  
ATOM   4426  H  HB2  . ALA A 1 118 ? 4.844   16.263 27.077  1.00 0.00  ? 118 ALA A HB2  2  
ATOM   4427  H  HB3  . ALA A 1 118 ? 3.732   15.362 26.047  1.00 0.00  ? 118 ALA A HB3  2  
ATOM   4428  N  N    . ALA A 1 119 ? 5.491   15.032 23.796  1.00 0.00  ? 119 ALA A N    2  
ATOM   4429  C  CA   . ALA A 1 119 ? 6.512   14.098 23.245  1.00 0.00  ? 119 ALA A CA   2  
ATOM   4430  C  C    . ALA A 1 119 ? 7.645   14.903 22.598  1.00 0.00  ? 119 ALA A C    2  
ATOM   4431  O  O    . ALA A 1 119 ? 8.795   14.790 22.982  1.00 0.00  ? 119 ALA A O    2  
ATOM   4432  C  CB   . ALA A 1 119 ? 5.859   13.183 22.203  1.00 0.00  ? 119 ALA A CB   2  
ATOM   4433  H  H    . ALA A 1 119 ? 4.541   14.883 23.611  1.00 0.00  ? 119 ALA A H    2  
ATOM   4434  H  HA   . ALA A 1 119 ? 6.914   13.496 24.048  1.00 0.00  ? 119 ALA A HA   2  
ATOM   4435  H  HB1  . ALA A 1 119 ? 5.229   12.460 22.705  1.00 0.00  ? 119 ALA A HB1  2  
ATOM   4436  H  HB2  . ALA A 1 119 ? 6.625   12.667 21.646  1.00 0.00  ? 119 ALA A HB2  2  
ATOM   4437  H  HB3  . ALA A 1 119 ? 5.260   13.773 21.527  1.00 0.00  ? 119 ALA A HB3  2  
ATOM   4438  N  N    . HIS A 1 120 ? 7.340   15.724 21.628  1.00 0.00  ? 120 HIS A N    2  
ATOM   4439  C  CA   . HIS A 1 120 ? 8.416   16.527 20.988  1.00 0.00  ? 120 HIS A CA   2  
ATOM   4440  C  C    . HIS A 1 120 ? 9.158   17.300 22.077  1.00 0.00  ? 120 HIS A C    2  
ATOM   4441  O  O    . HIS A 1 120 ? 10.371  17.377 22.083  1.00 0.00  ? 120 HIS A O    2  
ATOM   4442  C  CB   . HIS A 1 120 ? 7.808   17.516 19.994  1.00 0.00  ? 120 HIS A CB   2  
ATOM   4443  C  CG   . HIS A 1 120 ? 8.895   18.407 19.464  1.00 0.00  ? 120 HIS A CG   2  
ATOM   4444  N  ND1  . HIS A 1 120 ? 9.512   18.171 18.248  1.00 0.00  ? 120 HIS A ND1  2  
ATOM   4445  C  CD2  . HIS A 1 120 ? 9.498   19.527 19.982  1.00 0.00  ? 120 HIS A CD2  2  
ATOM   4446  C  CE1  . HIS A 1 120 ? 10.444  19.126 18.075  1.00 0.00  ? 120 HIS A CE1  2  
ATOM   4447  N  NE2  . HIS A 1 120 ? 10.477  19.979 19.104  1.00 0.00  ? 120 HIS A NE2  2  
ATOM   4448  H  H    . HIS A 1 120 ? 6.411   15.816 21.331  1.00 0.00  ? 120 HIS A H    2  
ATOM   4449  H  HA   . HIS A 1 120 ? 9.105   15.866 20.473  1.00 0.00  ? 120 HIS A HA   2  
ATOM   4450  H  HB2  . HIS A 1 120 ? 7.352   16.975 19.179  1.00 0.00  ? 120 HIS A HB2  2  
ATOM   4451  H  HB3  . HIS A 1 120 ? 7.061   18.117 20.492  1.00 0.00  ? 120 HIS A HB3  2  
ATOM   4452  H  HD1  . HIS A 1 120 ? 9.304   17.445 17.623  1.00 0.00  ? 120 HIS A HD1  2  
ATOM   4453  H  HD2  . HIS A 1 120 ? 9.246   19.988 20.924  1.00 0.00  ? 120 HIS A HD2  2  
ATOM   4454  H  HE1  . HIS A 1 120 ? 11.091  19.190 17.212  1.00 0.00  ? 120 HIS A HE1  2  
ATOM   4455  N  N    . GLU A 1 121 ? 8.437   17.862 23.010  1.00 0.00  ? 121 GLU A N    2  
ATOM   4456  C  CA   . GLU A 1 121 ? 9.104   18.614 24.110  1.00 0.00  ? 121 GLU A CA   2  
ATOM   4457  C  C    . GLU A 1 121 ? 9.794   17.616 25.033  1.00 0.00  ? 121 GLU A C    2  
ATOM   4458  O  O    . GLU A 1 121 ? 10.588  17.978 25.878  1.00 0.00  ? 121 GLU A O    2  
ATOM   4459  C  CB   . GLU A 1 121 ? 8.065   19.421 24.887  1.00 0.00  ? 121 GLU A CB   2  
ATOM   4460  C  CG   . GLU A 1 121 ? 7.242   20.260 23.906  1.00 0.00  ? 121 GLU A CG   2  
ATOM   4461  C  CD   . GLU A 1 121 ? 8.182   21.101 23.041  1.00 0.00  ? 121 GLU A CD   2  
ATOM   4462  O  OE1  . GLU A 1 121 ? 9.311   21.311 23.457  1.00 0.00  ? 121 GLU A OE1  2  
ATOM   4463  O  OE2  . GLU A 1 121 ? 7.758   21.518 21.975  1.00 0.00  ? 121 GLU A OE2  2  
ATOM   4464  H  H    . GLU A 1 121 ? 7.459   17.780 22.994  1.00 0.00  ? 121 GLU A H    2  
ATOM   4465  H  HA   . GLU A 1 121 ? 9.848   19.281 23.694  1.00 0.00  ? 121 GLU A HA   2  
ATOM   4466  H  HB2  . GLU A 1 121 ? 7.412   18.747 25.423  1.00 0.00  ? 121 GLU A HB2  2  
ATOM   4467  H  HB3  . GLU A 1 121 ? 8.563   20.074 25.586  1.00 0.00  ? 121 GLU A HB3  2  
ATOM   4468  H  HG2  . GLU A 1 121 ? 6.663   19.606 23.271  1.00 0.00  ? 121 GLU A HG2  2  
ATOM   4469  H  HG3  . GLU A 1 121 ? 6.579   20.913 24.453  1.00 0.00  ? 121 GLU A HG3  2  
ATOM   4470  N  N    . PHE A 1 122 ? 9.522   16.354 24.853  1.00 0.00  ? 122 PHE A N    2  
ATOM   4471  C  CA   . PHE A 1 122 ? 10.189  15.331 25.690  1.00 0.00  ? 122 PHE A CA   2  
ATOM   4472  C  C    . PHE A 1 122 ? 11.507  14.974 25.005  1.00 0.00  ? 122 PHE A C    2  
ATOM   4473  O  O    . PHE A 1 122 ? 12.404  14.411 25.600  1.00 0.00  ? 122 PHE A O    2  
ATOM   4474  C  CB   . PHE A 1 122 ? 9.300   14.093 25.785  1.00 0.00  ? 122 PHE A CB   2  
ATOM   4475  C  CG   . PHE A 1 122 ? 8.709   14.009 27.169  1.00 0.00  ? 122 PHE A CG   2  
ATOM   4476  C  CD1  . PHE A 1 122 ? 8.300   15.173 27.833  1.00 0.00  ? 122 PHE A CD1  2  
ATOM   4477  C  CD2  . PHE A 1 122 ? 8.574   12.765 27.790  1.00 0.00  ? 122 PHE A CD2  2  
ATOM   4478  C  CE1  . PHE A 1 122 ? 7.756   15.089 29.120  1.00 0.00  ? 122 PHE A CE1  2  
ATOM   4479  C  CE2  . PHE A 1 122 ? 8.031   12.680 29.076  1.00 0.00  ? 122 PHE A CE2  2  
ATOM   4480  C  CZ   . PHE A 1 122 ? 7.622   13.842 29.740  1.00 0.00  ? 122 PHE A CZ   2  
ATOM   4481  H  H    . PHE A 1 122 ? 8.898   16.080 24.153  1.00 0.00  ? 122 PHE A H    2  
ATOM   4482  H  HA   . PHE A 1 122 ? 10.380  15.730 26.677  1.00 0.00  ? 122 PHE A HA   2  
ATOM   4483  H  HB2  . PHE A 1 122 ? 8.508   14.163 25.054  1.00 0.00  ? 122 PHE A HB2  2  
ATOM   4484  H  HB3  . PHE A 1 122 ? 9.891   13.209 25.594  1.00 0.00  ? 122 PHE A HB3  2  
ATOM   4485  H  HD1  . PHE A 1 122 ? 8.403   16.134 27.353  1.00 0.00  ? 122 PHE A HD1  2  
ATOM   4486  H  HD2  . PHE A 1 122 ? 8.889   11.869 27.275  1.00 0.00  ? 122 PHE A HD2  2  
ATOM   4487  H  HE1  . PHE A 1 122 ? 7.441   15.986 29.634  1.00 0.00  ? 122 PHE A HE1  2  
ATOM   4488  H  HE2  . PHE A 1 122 ? 7.927   11.718 29.557  1.00 0.00  ? 122 PHE A HE2  2  
ATOM   4489  H  HZ   . PHE A 1 122 ? 7.204   13.776 30.731  1.00 0.00  ? 122 PHE A HZ   2  
ATOM   4490  N  N    . GLY A 1 123 ? 11.638  15.342 23.755  1.00 0.00  ? 123 GLY A N    2  
ATOM   4491  C  CA   . GLY A 1 123 ? 12.903  15.075 23.021  1.00 0.00  ? 123 GLY A CA   2  
ATOM   4492  C  C    . GLY A 1 123 ? 13.826  16.272 23.235  1.00 0.00  ? 123 GLY A C    2  
ATOM   4493  O  O    . GLY A 1 123 ? 14.994  16.129 23.533  1.00 0.00  ? 123 GLY A O    2  
ATOM   4494  H  H    . GLY A 1 123 ? 10.907  15.817 23.306  1.00 0.00  ? 123 GLY A H    2  
ATOM   4495  H  HA2  . GLY A 1 123 ? 13.366  14.176 23.403  1.00 0.00  ? 123 GLY A HA2  2  
ATOM   4496  H  HA3  . GLY A 1 123 ? 12.699  14.964 21.968  1.00 0.00  ? 123 GLY A HA3  2  
ATOM   4497  N  N    . HIS A 1 124 ? 13.297  17.459 23.099  1.00 0.00  ? 124 HIS A N    2  
ATOM   4498  C  CA   . HIS A 1 124 ? 14.129  18.674 23.310  1.00 0.00  ? 124 HIS A CA   2  
ATOM   4499  C  C    . HIS A 1 124 ? 14.622  18.677 24.760  1.00 0.00  ? 124 HIS A C    2  
ATOM   4500  O  O    . HIS A 1 124 ? 15.784  18.908 25.026  1.00 0.00  ? 124 HIS A O    2  
ATOM   4501  C  CB   . HIS A 1 124 ? 13.286  19.927 23.054  1.00 0.00  ? 124 HIS A CB   2  
ATOM   4502  C  CG   . HIS A 1 124 ? 13.204  20.208 21.576  1.00 0.00  ? 124 HIS A CG   2  
ATOM   4503  N  ND1  . HIS A 1 124 ? 13.752  19.366 20.621  1.00 0.00  ? 124 HIS A ND1  2  
ATOM   4504  C  CD2  . HIS A 1 124 ? 12.626  21.239 20.877  1.00 0.00  ? 124 HIS A CD2  2  
ATOM   4505  C  CE1  . HIS A 1 124 ? 13.494  19.903 19.411  1.00 0.00  ? 124 HIS A CE1  2  
ATOM   4506  N  NE2  . HIS A 1 124 ? 12.811  21.044 19.512  1.00 0.00  ? 124 HIS A NE2  2  
ATOM   4507  H  H    . HIS A 1 124 ? 12.349  17.548 22.869  1.00 0.00  ? 124 HIS A H    2  
ATOM   4508  H  HA   . HIS A 1 124 ? 14.975  18.659 22.636  1.00 0.00  ? 124 HIS A HA   2  
ATOM   4509  H  HB2  . HIS A 1 124 ? 12.290  19.776 23.442  1.00 0.00  ? 124 HIS A HB2  2  
ATOM   4510  H  HB3  . HIS A 1 124 ? 13.741  20.770 23.553  1.00 0.00  ? 124 HIS A HB3  2  
ATOM   4511  H  HD1  . HIS A 1 124 ? 14.238  18.533 20.793  1.00 0.00  ? 124 HIS A HD1  2  
ATOM   4512  H  HD2  . HIS A 1 124 ? 12.101  22.073 21.319  1.00 0.00  ? 124 HIS A HD2  2  
ATOM   4513  H  HE1  . HIS A 1 124 ? 13.800  19.461 18.474  1.00 0.00  ? 124 HIS A HE1  2  
ATOM   4514  N  N    . ALA A 1 125 ? 13.746  18.409 25.702  1.00 0.00  ? 125 ALA A N    2  
ATOM   4515  C  CA   . ALA A 1 125 ? 14.174  18.381 27.138  1.00 0.00  ? 125 ALA A CA   2  
ATOM   4516  C  C    . ALA A 1 125 ? 15.378  17.449 27.285  1.00 0.00  ? 125 ALA A C    2  
ATOM   4517  O  O    . ALA A 1 125 ? 16.106  17.508 28.255  1.00 0.00  ? 125 ALA A O    2  
ATOM   4518  C  CB   . ALA A 1 125 ? 13.033  17.853 28.014  1.00 0.00  ? 125 ALA A CB   2  
ATOM   4519  H  H    . ALA A 1 125 ? 12.809  18.219 25.461  1.00 0.00  ? 125 ALA A H    2  
ATOM   4520  H  HA   . ALA A 1 125 ? 14.447  19.376 27.464  1.00 0.00  ? 125 ALA A HA   2  
ATOM   4521  H  HB1  . ALA A 1 125 ? 12.804  16.835 27.735  1.00 0.00  ? 125 ALA A HB1  2  
ATOM   4522  H  HB2  . ALA A 1 125 ? 12.158  18.470 27.881  1.00 0.00  ? 125 ALA A HB2  2  
ATOM   4523  H  HB3  . ALA A 1 125 ? 13.336  17.879 29.052  1.00 0.00  ? 125 ALA A HB3  2  
ATOM   4524  N  N    . MET A 1 126 ? 15.585  16.581 26.332  1.00 0.00  ? 126 MET A N    2  
ATOM   4525  C  CA   . MET A 1 126 ? 16.733  15.638 26.422  1.00 0.00  ? 126 MET A CA   2  
ATOM   4526  C  C    . MET A 1 126 ? 17.880  16.135 25.540  1.00 0.00  ? 126 MET A C    2  
ATOM   4527  O  O    . MET A 1 126 ? 18.958  15.577 25.547  1.00 0.00  ? 126 MET A O    2  
ATOM   4528  C  CB   . MET A 1 126 ? 16.289  14.252 25.948  1.00 0.00  ? 126 MET A CB   2  
ATOM   4529  C  CG   . MET A 1 126 ? 15.420  13.605 27.029  1.00 0.00  ? 126 MET A CG   2  
ATOM   4530  S  SD   . MET A 1 126 ? 14.552  12.177 26.342  1.00 0.00  ? 126 MET A SD   2  
ATOM   4531  C  CE   . MET A 1 126 ? 14.383  11.266 27.896  1.00 0.00  ? 126 MET A CE   2  
ATOM   4532  H  H    . MET A 1 126 ? 14.982  16.543 25.563  1.00 0.00  ? 126 MET A H    2  
ATOM   4533  H  HA   . MET A 1 126 ? 17.067  15.576 27.447  1.00 0.00  ? 126 MET A HA   2  
ATOM   4534  H  HB2  . MET A 1 126 ? 15.722  14.348 25.035  1.00 0.00  ? 126 MET A HB2  2  
ATOM   4535  H  HB3  . MET A 1 126 ? 17.158  13.637 25.768  1.00 0.00  ? 126 MET A HB3  2  
ATOM   4536  H  HG2  . MET A 1 126 ? 16.046  13.282 27.848  1.00 0.00  ? 126 MET A HG2  2  
ATOM   4537  H  HG3  . MET A 1 126 ? 14.700  14.323 27.390  1.00 0.00  ? 126 MET A HG3  2  
ATOM   4538  H  HE1  . MET A 1 126 ? 14.475  11.953 28.728  1.00 0.00  ? 126 MET A HE1  2  
ATOM   4539  H  HE2  . MET A 1 126 ? 15.158  10.521 27.961  1.00 0.00  ? 126 MET A HE2  2  
ATOM   4540  H  HE3  . MET A 1 126 ? 13.417  10.782 27.926  1.00 0.00  ? 126 MET A HE3  2  
ATOM   4541  N  N    . GLY A 1 127 ? 17.665  17.183 24.791  1.00 0.00  ? 127 GLY A N    2  
ATOM   4542  C  CA   . GLY A 1 127 ? 18.761  17.710 23.923  1.00 0.00  ? 127 GLY A CA   2  
ATOM   4543  C  C    . GLY A 1 127 ? 18.410  17.524 22.441  1.00 0.00  ? 127 GLY A C    2  
ATOM   4544  O  O    . GLY A 1 127 ? 18.749  18.347 21.614  1.00 0.00  ? 127 GLY A O    2  
ATOM   4545  H  H    . GLY A 1 127 ? 16.791  17.627 24.804  1.00 0.00  ? 127 GLY A H    2  
ATOM   4546  H  HA2  . GLY A 1 127 ? 18.904  18.762 24.128  1.00 0.00  ? 127 GLY A HA2  2  
ATOM   4547  H  HA3  . GLY A 1 127 ? 19.674  17.176 24.141  1.00 0.00  ? 127 GLY A HA3  2  
ATOM   4548  N  N    . LEU A 1 128 ? 17.747  16.446 22.102  1.00 0.00  ? 128 LEU A N    2  
ATOM   4549  C  CA   . LEU A 1 128 ? 17.379  16.193 20.673  1.00 0.00  ? 128 LEU A CA   2  
ATOM   4550  C  C    . LEU A 1 128 ? 17.011  17.508 19.980  1.00 0.00  ? 128 LEU A C    2  
ATOM   4551  O  O    . LEU A 1 128 ? 16.456  18.407 20.578  1.00 0.00  ? 128 LEU A O    2  
ATOM   4552  C  CB   . LEU A 1 128 ? 16.177  15.244 20.619  1.00 0.00  ? 128 LEU A CB   2  
ATOM   4553  C  CG   . LEU A 1 128 ? 16.651  13.800 20.798  1.00 0.00  ? 128 LEU A CG   2  
ATOM   4554  C  CD1  . LEU A 1 128 ? 15.665  13.050 21.698  1.00 0.00  ? 128 LEU A CD1  2  
ATOM   4555  C  CD2  . LEU A 1 128 ? 16.710  13.111 19.432  1.00 0.00  ? 128 LEU A CD2  2  
ATOM   4556  H  H    . LEU A 1 128 ? 17.494  15.796 22.788  1.00 0.00  ? 128 LEU A H    2  
ATOM   4557  H  HA   . LEU A 1 128 ? 18.216  15.741 20.160  1.00 0.00  ? 128 LEU A HA   2  
ATOM   4558  H  HB2  . LEU A 1 128 ? 15.486  15.497 21.410  1.00 0.00  ? 128 LEU A HB2  2  
ATOM   4559  H  HB3  . LEU A 1 128 ? 15.681  15.342 19.666  1.00 0.00  ? 128 LEU A HB3  2  
ATOM   4560  H  HG   . LEU A 1 128 ? 17.634  13.793 21.251  1.00 0.00  ? 128 LEU A HG   2  
ATOM   4561  H  HD11 . LEU A 1 128 ? 14.669  13.436 21.540  1.00 0.00  ? 128 LEU A HD11 2  
ATOM   4562  H  HD12 . LEU A 1 128 ? 15.943  13.189 22.733  1.00 0.00  ? 128 LEU A HD12 2  
ATOM   4563  H  HD13 . LEU A 1 128 ? 15.686  11.998 21.456  1.00 0.00  ? 128 LEU A HD13 2  
ATOM   4564  H  HD21 . LEU A 1 128 ? 15.773  12.608 19.244  1.00 0.00  ? 128 LEU A HD21 2  
ATOM   4565  H  HD22 . LEU A 1 128 ? 17.512  12.389 19.427  1.00 0.00  ? 128 LEU A HD22 2  
ATOM   4566  H  HD23 . LEU A 1 128 ? 16.883  13.848 18.662  1.00 0.00  ? 128 LEU A HD23 2  
ATOM   4567  N  N    . GLU A 1 129 ? 17.319  17.621 18.719  1.00 0.00  ? 129 GLU A N    2  
ATOM   4568  C  CA   . GLU A 1 129 ? 16.991  18.872 17.976  1.00 0.00  ? 129 GLU A CA   2  
ATOM   4569  C  C    . GLU A 1 129 ? 15.929  18.580 16.920  1.00 0.00  ? 129 GLU A C    2  
ATOM   4570  O  O    . GLU A 1 129 ? 15.457  17.469 16.783  1.00 0.00  ? 129 GLU A O    2  
ATOM   4571  C  CB   . GLU A 1 129 ? 18.251  19.422 17.298  1.00 0.00  ? 129 GLU A CB   2  
ATOM   4572  C  CG   . GLU A 1 129 ? 18.965  18.302 16.536  1.00 0.00  ? 129 GLU A CG   2  
ATOM   4573  C  CD   . GLU A 1 129 ? 18.972  18.617 15.040  1.00 0.00  ? 129 GLU A CD   2  
ATOM   4574  O  OE1  . GLU A 1 129 ? 18.267  19.527 14.640  1.00 0.00  ? 129 GLU A OE1  2  
ATOM   4575  O  OE2  . GLU A 1 129 ? 19.681  17.936 14.319  1.00 0.00  ? 129 GLU A OE2  2  
ATOM   4576  H  H    . GLU A 1 129 ? 17.764  16.880 18.260  1.00 0.00  ? 129 GLU A H    2  
ATOM   4577  H  HA   . GLU A 1 129 ? 16.607  19.609 18.664  1.00 0.00  ? 129 GLU A HA   2  
ATOM   4578  H  HB2  . GLU A 1 129 ? 17.972  20.207 16.608  1.00 0.00  ? 129 GLU A HB2  2  
ATOM   4579  H  HB3  . GLU A 1 129 ? 18.915  19.822 18.049  1.00 0.00  ? 129 GLU A HB3  2  
ATOM   4580  H  HG2  . GLU A 1 129 ? 19.982  18.218 16.890  1.00 0.00  ? 129 GLU A HG2  2  
ATOM   4581  H  HG3  . GLU A 1 129 ? 18.450  17.368 16.699  1.00 0.00  ? 129 GLU A HG3  2  
ATOM   4582  N  N    . HIS A 1 130 ? 15.545  19.579 16.179  1.00 0.00  ? 130 HIS A N    2  
ATOM   4583  C  CA   . HIS A 1 130 ? 14.503  19.384 15.131  1.00 0.00  ? 130 HIS A CA   2  
ATOM   4584  C  C    . HIS A 1 130 ? 14.953  18.320 14.132  1.00 0.00  ? 130 HIS A C    2  
ATOM   4585  O  O    . HIS A 1 130 ? 16.130  18.123 13.902  1.00 0.00  ? 130 HIS A O    2  
ATOM   4586  C  CB   . HIS A 1 130 ? 14.268  20.706 14.402  1.00 0.00  ? 130 HIS A CB   2  
ATOM   4587  C  CG   . HIS A 1 130 ? 13.528  21.632 15.323  1.00 0.00  ? 130 HIS A CG   2  
ATOM   4588  N  ND1  . HIS A 1 130 ? 13.414  22.994 15.087  1.00 0.00  ? 130 HIS A ND1  2  
ATOM   4589  C  CD2  . HIS A 1 130 ? 12.862  21.397 16.495  1.00 0.00  ? 130 HIS A CD2  2  
ATOM   4590  C  CE1  . HIS A 1 130 ? 12.699  23.518 16.103  1.00 0.00  ? 130 HIS A CE1  2  
ATOM   4591  N  NE2  . HIS A 1 130 ? 12.337  22.587 16.987  1.00 0.00  ? 130 HIS A NE2  2  
ATOM   4592  H  H    . HIS A 1 130 ? 15.940  20.466 16.321  1.00 0.00  ? 130 HIS A H    2  
ATOM   4593  H  HA   . HIS A 1 130 ? 13.583  19.069 15.598  1.00 0.00  ? 130 HIS A HA   2  
ATOM   4594  H  HB2  . HIS A 1 130 ? 15.217  21.143 14.128  1.00 0.00  ? 130 HIS A HB2  2  
ATOM   4595  H  HB3  . HIS A 1 130 ? 13.679  20.530 13.514  1.00 0.00  ? 130 HIS A HB3  2  
ATOM   4596  H  HD1  . HIS A 1 130 ? 13.785  23.486 14.324  1.00 0.00  ? 130 HIS A HD1  2  
ATOM   4597  H  HD2  . HIS A 1 130 ? 12.763  20.432 16.970  1.00 0.00  ? 130 HIS A HD2  2  
ATOM   4598  H  HE1  . HIS A 1 130 ? 12.456  24.565 16.195  1.00 0.00  ? 130 HIS A HE1  2  
ATOM   4599  N  N    . SER A 1 131 ? 14.017  17.631 13.538  1.00 0.00  ? 131 SER A N    2  
ATOM   4600  C  CA   . SER A 1 131 ? 14.376  16.576 12.552  1.00 0.00  ? 131 SER A CA   2  
ATOM   4601  C  C    . SER A 1 131 ? 14.291  17.149 11.137  1.00 0.00  ? 131 SER A C    2  
ATOM   4602  O  O    . SER A 1 131 ? 14.014  18.317 10.942  1.00 0.00  ? 131 SER A O    2  
ATOM   4603  C  CB   . SER A 1 131 ? 13.400  15.408 12.682  1.00 0.00  ? 131 SER A CB   2  
ATOM   4604  O  OG   . SER A 1 131 ? 12.153  15.770 12.102  1.00 0.00  ? 131 SER A OG   2  
ATOM   4605  H  H    . SER A 1 131 ? 13.075  17.807 13.743  1.00 0.00  ? 131 SER A H    2  
ATOM   4606  H  HA   . SER A 1 131 ? 15.382  16.229 12.741  1.00 0.00  ? 131 SER A HA   2  
ATOM   4607  H  HB2  . SER A 1 131 ? 13.795  14.548 12.168  1.00 0.00  ? 131 SER A HB2  2  
ATOM   4608  H  HB3  . SER A 1 131 ? 13.266  15.170 13.729  1.00 0.00  ? 131 SER A HB3  2  
ATOM   4609  H  HG   . SER A 1 131 ? 12.005  15.207 11.338  1.00 0.00  ? 131 SER A HG   2  
ATOM   4610  N  N    . GLN A 1 132 ? 14.533  16.335 10.147  1.00 0.00  ? 132 GLN A N    2  
ATOM   4611  C  CA   . GLN A 1 132 ? 14.475  16.822 8.742   1.00 0.00  ? 132 GLN A CA   2  
ATOM   4612  C  C    . GLN A 1 132 ? 13.505  15.956 7.932   1.00 0.00  ? 132 GLN A C    2  
ATOM   4613  O  O    . GLN A 1 132 ? 13.124  16.299 6.829   1.00 0.00  ? 132 GLN A O    2  
ATOM   4614  C  CB   . GLN A 1 132 ? 15.870  16.722 8.124   1.00 0.00  ? 132 GLN A CB   2  
ATOM   4615  C  CG   . GLN A 1 132 ? 16.195  18.013 7.378   1.00 0.00  ? 132 GLN A CG   2  
ATOM   4616  C  CD   . GLN A 1 132 ? 16.580  17.679 5.939   1.00 0.00  ? 132 GLN A CD   2  
ATOM   4617  O  OE1  . GLN A 1 132 ? 17.268  16.709 5.691   1.00 0.00  ? 132 GLN A OE1  2  
ATOM   4618  N  NE2  . GLN A 1 132 ? 16.158  18.445 4.975   1.00 0.00  ? 132 GLN A NE2  2  
ATOM   4619  H  H    . GLN A 1 132 ? 14.758  15.400 10.330  1.00 0.00  ? 132 GLN A H    2  
ATOM   4620  H  HA   . GLN A 1 132 ? 14.146  17.852 8.726   1.00 0.00  ? 132 GLN A HA   2  
ATOM   4621  H  HB2  . GLN A 1 132 ? 16.597  16.564 8.905   1.00 0.00  ? 132 GLN A HB2  2  
ATOM   4622  H  HB3  . GLN A 1 132 ? 15.898  15.892 7.433   1.00 0.00  ? 132 GLN A HB3  2  
ATOM   4623  H  HG2  . GLN A 1 132 ? 15.329  18.658 7.379   1.00 0.00  ? 132 GLN A HG2  2  
ATOM   4624  H  HG3  . GLN A 1 132 ? 17.019  18.514 7.861   1.00 0.00  ? 132 GLN A HG3  2  
ATOM   4625  H  HE21 . GLN A 1 132 ? 15.601  19.225 5.180   1.00 0.00  ? 132 GLN A HE21 2  
ATOM   4626  H  HE22 . GLN A 1 132 ? 16.395  18.242 4.046   1.00 0.00  ? 132 GLN A HE22 2  
ATOM   4627  N  N    . ASP A 1 133 ? 13.111  14.831 8.463   1.00 0.00  ? 133 ASP A N    2  
ATOM   4628  C  CA   . ASP A 1 133 ? 12.179  13.940 7.716   1.00 0.00  ? 133 ASP A CA   2  
ATOM   4629  C  C    . ASP A 1 133 ? 10.751  14.111 8.250   1.00 0.00  ? 133 ASP A C    2  
ATOM   4630  O  O    . ASP A 1 133 ? 10.546  14.267 9.439   1.00 0.00  ? 133 ASP A O    2  
ATOM   4631  C  CB   . ASP A 1 133 ? 12.617  12.485 7.895   1.00 0.00  ? 133 ASP A CB   2  
ATOM   4632  C  CG   . ASP A 1 133 ? 13.066  11.910 6.550   1.00 0.00  ? 133 ASP A CG   2  
ATOM   4633  O  OD1  . ASP A 1 133 ? 12.219  11.736 5.688   1.00 0.00  ? 133 ASP A OD1  2  
ATOM   4634  O  OD2  . ASP A 1 133 ? 14.250  11.651 6.407   1.00 0.00  ? 133 ASP A OD2  2  
ATOM   4635  H  H    . ASP A 1 133 ? 13.433  14.566 9.348   1.00 0.00  ? 133 ASP A H    2  
ATOM   4636  H  HA   . ASP A 1 133 ? 12.205  14.195 6.670   1.00 0.00  ? 133 ASP A HA   2  
ATOM   4637  H  HB2  . ASP A 1 133 ? 13.439  12.444 8.594   1.00 0.00  ? 133 ASP A HB2  2  
ATOM   4638  H  HB3  . ASP A 1 133 ? 11.791  11.904 8.276   1.00 0.00  ? 133 ASP A HB3  2  
ATOM   4639  N  N    . PRO A 1 134 ? 9.801   14.066 7.346   1.00 0.00  ? 134 PRO A N    2  
ATOM   4640  C  CA   . PRO A 1 134 ? 8.389   14.208 7.677   1.00 0.00  ? 134 PRO A CA   2  
ATOM   4641  C  C    . PRO A 1 134 ? 7.877   12.917 8.277   1.00 0.00  ? 134 PRO A C    2  
ATOM   4642  O  O    . PRO A 1 134 ? 7.859   11.867 7.665   1.00 0.00  ? 134 PRO A O    2  
ATOM   4643  C  CB   . PRO A 1 134 ? 7.713   14.506 6.353   1.00 0.00  ? 134 PRO A CB   2  
ATOM   4644  C  CG   . PRO A 1 134 ? 8.667   13.983 5.260   1.00 0.00  ? 134 PRO A CG   2  
ATOM   4645  C  CD   . PRO A 1 134 ? 10.053  13.860 5.921   1.00 0.00  ? 134 PRO A CD   2  
ATOM   4646  H  HA   . PRO A 1 134 ? 8.243   15.028 8.360   1.00 0.00  ? 134 PRO A HA   2  
ATOM   4647  H  HB2  . PRO A 1 134 ? 6.761   13.993 6.310   1.00 0.00  ? 134 PRO A HB2  2  
ATOM   4648  H  HB3  . PRO A 1 134 ? 7.573   15.568 6.247   1.00 0.00  ? 134 PRO A HB3  2  
ATOM   4649  H  HG2  . PRO A 1 134 ? 8.332   13.016 4.906   1.00 0.00  ? 134 PRO A HG2  2  
ATOM   4650  H  HG3  . PRO A 1 134 ? 8.715   14.683 4.441   1.00 0.00  ? 134 PRO A HG3  2  
ATOM   4651  H  HD2  . PRO A 1 134 ? 10.462  12.877 5.761   1.00 0.00  ? 134 PRO A HD2  2  
ATOM   4652  H  HD3  . PRO A 1 134 ? 10.716  14.621 5.558   1.00 0.00  ? 134 PRO A HD3  2  
ATOM   4653  N  N    . GLY A 1 135 ? 7.483   13.023 9.482   1.00 0.00  ? 135 GLY A N    2  
ATOM   4654  C  CA   . GLY A 1 135 ? 6.963   11.846 10.233  1.00 0.00  ? 135 GLY A CA   2  
ATOM   4655  C  C    . GLY A 1 135 ? 7.923   11.513 11.381  1.00 0.00  ? 135 GLY A C    2  
ATOM   4656  O  O    . GLY A 1 135 ? 7.677   10.625 12.172  1.00 0.00  ? 135 GLY A O    2  
ATOM   4657  H  H    . GLY A 1 135 ? 7.544   13.896 9.899   1.00 0.00  ? 135 GLY A H    2  
ATOM   4658  H  HA2  . GLY A 1 135 ? 5.986   12.077 10.634  1.00 0.00  ? 135 GLY A HA2  2  
ATOM   4659  H  HA3  . GLY A 1 135 ? 6.892   10.998 9.569   1.00 0.00  ? 135 GLY A HA3  2  
ATOM   4660  N  N    . ALA A 1 136 ? 9.019   12.218 11.475  1.00 0.00  ? 136 ALA A N    2  
ATOM   4661  C  CA   . ALA A 1 136 ? 9.997   11.943 12.567  1.00 0.00  ? 136 ALA A CA   2  
ATOM   4662  C  C    . ALA A 1 136 ? 9.385   12.324 13.919  1.00 0.00  ? 136 ALA A C    2  
ATOM   4663  O  O    . ALA A 1 136 ? 8.245   12.735 14.001  1.00 0.00  ? 136 ALA A O    2  
ATOM   4664  C  CB   . ALA A 1 136 ? 11.255  12.777 12.324  1.00 0.00  ? 136 ALA A CB   2  
ATOM   4665  H  H    . ALA A 1 136 ? 9.203   12.930 10.824  1.00 0.00  ? 136 ALA A H    2  
ATOM   4666  H  HA   . ALA A 1 136 ? 10.255  10.893 12.571  1.00 0.00  ? 136 ALA A HA   2  
ATOM   4667  H  HB1  . ALA A 1 136 ? 10.982  13.712 11.859  1.00 0.00  ? 136 ALA A HB1  2  
ATOM   4668  H  HB2  . ALA A 1 136 ? 11.924  12.235 11.671  1.00 0.00  ? 136 ALA A HB2  2  
ATOM   4669  H  HB3  . ALA A 1 136 ? 11.748  12.972 13.265  1.00 0.00  ? 136 ALA A HB3  2  
ATOM   4670  N  N    . LEU A 1 137 ? 10.133  12.184 14.981  1.00 0.00  ? 137 LEU A N    2  
ATOM   4671  C  CA   . LEU A 1 137 ? 9.597   12.535 16.328  1.00 0.00  ? 137 LEU A CA   2  
ATOM   4672  C  C    . LEU A 1 137 ? 10.022  13.958 16.697  1.00 0.00  ? 137 LEU A C    2  
ATOM   4673  O  O    . LEU A 1 137 ? 9.341   14.647 17.431  1.00 0.00  ? 137 LEU A O    2  
ATOM   4674  C  CB   . LEU A 1 137 ? 10.140  11.550 17.369  1.00 0.00  ? 137 LEU A CB   2  
ATOM   4675  C  CG   . LEU A 1 137 ? 9.520   11.832 18.750  1.00 0.00  ? 137 LEU A CG   2  
ATOM   4676  C  CD1  . LEU A 1 137 ? 8.027   12.140 18.607  1.00 0.00  ? 137 LEU A CD1  2  
ATOM   4677  C  CD2  . LEU A 1 137 ? 9.690   10.595 19.637  1.00 0.00  ? 137 LEU A CD2  2  
ATOM   4678  H  H    . LEU A 1 137 ? 11.048  11.847 14.891  1.00 0.00  ? 137 LEU A H    2  
ATOM   4679  H  HA   . LEU A 1 137 ? 8.520   12.477 16.306  1.00 0.00  ? 137 LEU A HA   2  
ATOM   4680  H  HB2  . LEU A 1 137 ? 9.896   10.543 17.064  1.00 0.00  ? 137 LEU A HB2  2  
ATOM   4681  H  HB3  . LEU A 1 137 ? 11.214  11.654 17.433  1.00 0.00  ? 137 LEU A HB3  2  
ATOM   4682  H  HG   . LEU A 1 137 ? 10.018  12.679 19.207  1.00 0.00  ? 137 LEU A HG   2  
ATOM   4683  H  HD11 . LEU A 1 137 ? 7.524   11.284 18.181  1.00 0.00  ? 137 LEU A HD11 2  
ATOM   4684  H  HD12 . LEU A 1 137 ? 7.892   12.996 17.963  1.00 0.00  ? 137 LEU A HD12 2  
ATOM   4685  H  HD13 . LEU A 1 137 ? 7.609   12.354 19.579  1.00 0.00  ? 137 LEU A HD13 2  
ATOM   4686  H  HD21 . LEU A 1 137 ? 9.411   9.714  19.077  1.00 0.00  ? 137 LEU A HD21 2  
ATOM   4687  H  HD22 . LEU A 1 137 ? 9.057   10.685 20.507  1.00 0.00  ? 137 LEU A HD22 2  
ATOM   4688  H  HD23 . LEU A 1 137 ? 10.720  10.511 19.950  1.00 0.00  ? 137 LEU A HD23 2  
ATOM   4689  N  N    . MET A 1 138 ? 11.143  14.407 16.196  1.00 0.00  ? 138 MET A N    2  
ATOM   4690  C  CA   . MET A 1 138 ? 11.602  15.788 16.526  1.00 0.00  ? 138 MET A CA   2  
ATOM   4691  C  C    . MET A 1 138 ? 11.142  16.759 15.436  1.00 0.00  ? 138 MET A C    2  
ATOM   4692  O  O    . MET A 1 138 ? 11.445  17.936 15.471  1.00 0.00  ? 138 MET A O    2  
ATOM   4693  C  CB   . MET A 1 138 ? 13.129  15.816 16.604  1.00 0.00  ? 138 MET A CB   2  
ATOM   4694  C  CG   . MET A 1 138 ? 13.601  15.021 17.822  1.00 0.00  ? 138 MET A CG   2  
ATOM   4695  S  SD   . MET A 1 138 ? 13.431  13.249 17.497  1.00 0.00  ? 138 MET A SD   2  
ATOM   4696  C  CE   . MET A 1 138 ? 13.008  12.762 19.187  1.00 0.00  ? 138 MET A CE   2  
ATOM   4697  H  H    . MET A 1 138 ? 11.680  13.838 15.608  1.00 0.00  ? 138 MET A H    2  
ATOM   4698  H  HA   . MET A 1 138 ? 11.187  16.088 17.475  1.00 0.00  ? 138 MET A HA   2  
ATOM   4699  H  HB2  . MET A 1 138 ? 13.542  15.381 15.706  1.00 0.00  ? 138 MET A HB2  2  
ATOM   4700  H  HB3  . MET A 1 138 ? 13.464  16.838 16.693  1.00 0.00  ? 138 MET A HB3  2  
ATOM   4701  H  HG2  . MET A 1 138 ? 14.638  15.251 18.021  1.00 0.00  ? 138 MET A HG2  2  
ATOM   4702  H  HG3  . MET A 1 138 ? 13.002  15.286 18.680  1.00 0.00  ? 138 MET A HG3  2  
ATOM   4703  H  HE1  . MET A 1 138 ? 13.735  12.049 19.548  1.00 0.00  ? 138 MET A HE1  2  
ATOM   4704  H  HE2  . MET A 1 138 ? 12.028  12.311 19.199  1.00 0.00  ? 138 MET A HE2  2  
ATOM   4705  H  HE3  . MET A 1 138 ? 13.007  13.636 19.821  1.00 0.00  ? 138 MET A HE3  2  
ATOM   4706  N  N    . ALA A 1 139 ? 10.408  16.278 14.472  1.00 0.00  ? 139 ALA A N    2  
ATOM   4707  C  CA   . ALA A 1 139 ? 9.926   17.174 13.385  1.00 0.00  ? 139 ALA A CA   2  
ATOM   4708  C  C    . ALA A 1 139 ? 9.365   18.460 14.001  1.00 0.00  ? 139 ALA A C    2  
ATOM   4709  O  O    . ALA A 1 139 ? 8.832   18.440 15.093  1.00 0.00  ? 139 ALA A O    2  
ATOM   4710  C  CB   . ALA A 1 139 ? 8.826   16.461 12.598  1.00 0.00  ? 139 ALA A CB   2  
ATOM   4711  H  H    . ALA A 1 139 ? 10.173  15.328 14.463  1.00 0.00  ? 139 ALA A H    2  
ATOM   4712  H  HA   . ALA A 1 139 ? 10.746  17.415 12.724  1.00 0.00  ? 139 ALA A HA   2  
ATOM   4713  H  HB1  . ALA A 1 139 ? 8.054   16.136 13.278  1.00 0.00  ? 139 ALA A HB1  2  
ATOM   4714  H  HB2  . ALA A 1 139 ? 9.245   15.603 12.092  1.00 0.00  ? 139 ALA A HB2  2  
ATOM   4715  H  HB3  . ALA A 1 139 ? 8.405   17.139 11.871  1.00 0.00  ? 139 ALA A HB3  2  
ATOM   4716  N  N    . PRO A 1 140 ? 9.506   19.543 13.279  1.00 0.00  ? 140 PRO A N    2  
ATOM   4717  C  CA   . PRO A 1 140 ? 9.026   20.862 13.726  1.00 0.00  ? 140 PRO A CA   2  
ATOM   4718  C  C    . PRO A 1 140 ? 7.507   20.989 13.536  1.00 0.00  ? 140 PRO A C    2  
ATOM   4719  O  O    . PRO A 1 140 ? 6.954   22.065 13.642  1.00 0.00  ? 140 PRO A O    2  
ATOM   4720  C  CB   . PRO A 1 140 ? 9.776   21.842 12.820  1.00 0.00  ? 140 PRO A CB   2  
ATOM   4721  C  CG   . PRO A 1 140 ? 10.184  21.045 11.559  1.00 0.00  ? 140 PRO A CG   2  
ATOM   4722  C  CD   . PRO A 1 140 ? 10.161  19.555 11.954  1.00 0.00  ? 140 PRO A CD   2  
ATOM   4723  H  HA   . PRO A 1 140 ? 9.295   21.034 14.754  1.00 0.00  ? 140 PRO A HA   2  
ATOM   4724  H  HB2  . PRO A 1 140 ? 9.131   22.667 12.550  1.00 0.00  ? 140 PRO A HB2  2  
ATOM   4725  H  HB3  . PRO A 1 140 ? 10.660  22.207 13.319  1.00 0.00  ? 140 PRO A HB3  2  
ATOM   4726  H  HG2  . PRO A 1 140 ? 9.477   21.230 10.763  1.00 0.00  ? 140 PRO A HG2  2  
ATOM   4727  H  HG3  . PRO A 1 140 ? 11.177  21.325 11.247  1.00 0.00  ? 140 PRO A HG3  2  
ATOM   4728  H  HD2  . PRO A 1 140 ? 9.585   18.985 11.239  1.00 0.00  ? 140 PRO A HD2  2  
ATOM   4729  H  HD3  . PRO A 1 140 ? 11.165  19.168 12.032  1.00 0.00  ? 140 PRO A HD3  2  
ATOM   4730  N  N    . ILE A 1 141 ? 6.827   19.907 13.260  1.00 0.00  ? 141 ILE A N    2  
ATOM   4731  C  CA   . ILE A 1 141 ? 5.350   19.991 13.074  1.00 0.00  ? 141 ILE A CA   2  
ATOM   4732  C  C    . ILE A 1 141 ? 4.654   18.874 13.852  1.00 0.00  ? 141 ILE A C    2  
ATOM   4733  O  O    . ILE A 1 141 ? 5.229   17.842 14.134  1.00 0.00  ? 141 ILE A O    2  
ATOM   4734  C  CB   . ILE A 1 141 ? 5.002   19.853 11.595  1.00 0.00  ? 141 ILE A CB   2  
ATOM   4735  C  CG1  . ILE A 1 141 ? 6.058   20.561 10.740  1.00 0.00  ? 141 ILE A CG1  2  
ATOM   4736  C  CG2  . ILE A 1 141 ? 3.634   20.485 11.347  1.00 0.00  ? 141 ILE A CG2  2  
ATOM   4737  C  CD1  . ILE A 1 141 ? 5.986   22.070 10.981  1.00 0.00  ? 141 ILE A CD1  2  
ATOM   4738  H  H    . ILE A 1 141 ? 7.282   19.045 13.178  1.00 0.00  ? 141 ILE A H    2  
ATOM   4739  H  HA   . ILE A 1 141 ? 4.998   20.947 13.434  1.00 0.00  ? 141 ILE A HA   2  
ATOM   4740  H  HB   . ILE A 1 141 ? 4.965   18.805 11.333  1.00 0.00  ? 141 ILE A HB   2  
ATOM   4741  H  HG12 . ILE A 1 141 ? 7.041   20.197 11.006  1.00 0.00  ? 141 ILE A HG12 2  
ATOM   4742  H  HG13 . ILE A 1 141 ? 5.871   20.355 9.696   1.00 0.00  ? 141 ILE A HG13 2  
ATOM   4743  H  HG21 . ILE A 1 141 ? 2.858   19.791 11.638  1.00 0.00  ? 141 ILE A HG21 2  
ATOM   4744  H  HG22 . ILE A 1 141 ? 3.532   20.723 10.300  1.00 0.00  ? 141 ILE A HG22 2  
ATOM   4745  H  HG23 . ILE A 1 141 ? 3.544   21.389 11.932  1.00 0.00  ? 141 ILE A HG23 2  
ATOM   4746  H  HD11 . ILE A 1 141 ? 5.578   22.556 10.107  1.00 0.00  ? 141 ILE A HD11 2  
ATOM   4747  H  HD12 . ILE A 1 141 ? 6.978   22.451 11.174  1.00 0.00  ? 141 ILE A HD12 2  
ATOM   4748  H  HD13 . ILE A 1 141 ? 5.352   22.268 11.832  1.00 0.00  ? 141 ILE A HD13 2  
ATOM   4749  N  N    . TYR A 1 142 ? 3.413   19.082 14.193  1.00 0.00  ? 142 TYR A N    2  
ATOM   4750  C  CA   . TYR A 1 142 ? 2.648   18.052 14.949  1.00 0.00  ? 142 TYR A CA   2  
ATOM   4751  C  C    . TYR A 1 142 ? 2.241   16.924 13.997  1.00 0.00  ? 142 TYR A C    2  
ATOM   4752  O  O    . TYR A 1 142 ? 1.233   17.002 13.324  1.00 0.00  ? 142 TYR A O    2  
ATOM   4753  C  CB   . TYR A 1 142 ? 1.402   18.725 15.539  1.00 0.00  ? 142 TYR A CB   2  
ATOM   4754  C  CG   . TYR A 1 142 ? 0.427   17.711 16.106  1.00 0.00  ? 142 TYR A CG   2  
ATOM   4755  C  CD1  . TYR A 1 142 ? 0.803   16.376 16.333  1.00 0.00  ? 142 TYR A CD1  2  
ATOM   4756  C  CD2  . TYR A 1 142 ? -0.878  18.123 16.401  1.00 0.00  ? 142 TYR A CD2  2  
ATOM   4757  C  CE1  . TYR A 1 142 ? -0.134  15.469 16.851  1.00 0.00  ? 142 TYR A CE1  2  
ATOM   4758  C  CE2  . TYR A 1 142 ? -1.806  17.218 16.919  1.00 0.00  ? 142 TYR A CE2  2  
ATOM   4759  C  CZ   . TYR A 1 142 ? -1.436  15.892 17.143  1.00 0.00  ? 142 TYR A CZ   2  
ATOM   4760  O  OH   . TYR A 1 142 ? -2.356  14.998 17.650  1.00 0.00  ? 142 TYR A OH   2  
ATOM   4761  H  H    . TYR A 1 142 ? 2.977   19.924 13.945  1.00 0.00  ? 142 TYR A H    2  
ATOM   4762  H  HA   . TYR A 1 142 ? 3.259   17.658 15.744  1.00 0.00  ? 142 TYR A HA   2  
ATOM   4763  H  HB2  . TYR A 1 142 ? 1.704   19.401 16.324  1.00 0.00  ? 142 TYR A HB2  2  
ATOM   4764  H  HB3  . TYR A 1 142 ? 0.908   19.290 14.760  1.00 0.00  ? 142 TYR A HB3  2  
ATOM   4765  H  HD1  . TYR A 1 142 ? 1.807   16.044 16.113  1.00 0.00  ? 142 TYR A HD1  2  
ATOM   4766  H  HD2  . TYR A 1 142 ? -1.167  19.147 16.233  1.00 0.00  ? 142 TYR A HD2  2  
ATOM   4767  H  HE1  . TYR A 1 142 ? 0.148   14.442 17.024  1.00 0.00  ? 142 TYR A HE1  2  
ATOM   4768  H  HE2  . TYR A 1 142 ? -2.811  17.544 17.142  1.00 0.00  ? 142 TYR A HE2  2  
ATOM   4769  H  HH   . TYR A 1 142 ? -2.857  14.636 16.914  1.00 0.00  ? 142 TYR A HH   2  
ATOM   4770  N  N    . THR A 1 143 ? 3.014   15.871 13.938  1.00 0.00  ? 143 THR A N    2  
ATOM   4771  C  CA   . THR A 1 143 ? 2.656   14.741 13.035  1.00 0.00  ? 143 THR A CA   2  
ATOM   4772  C  C    . THR A 1 143 ? 2.023   13.634 13.868  1.00 0.00  ? 143 THR A C    2  
ATOM   4773  O  O    . THR A 1 143 ? 2.705   12.790 14.416  1.00 0.00  ? 143 THR A O    2  
ATOM   4774  C  CB   . THR A 1 143 ? 3.908   14.191 12.347  1.00 0.00  ? 143 THR A CB   2  
ATOM   4775  O  OG1  . THR A 1 143 ? 5.042   14.959 12.726  1.00 0.00  ? 143 THR A OG1  2  
ATOM   4776  C  CG2  . THR A 1 143 ? 3.727   14.252 10.830  1.00 0.00  ? 143 THR A CG2  2  
ATOM   4777  H  H    . THR A 1 143 ? 3.820   15.821 14.491  1.00 0.00  ? 143 THR A H    2  
ATOM   4778  H  HA   . THR A 1 143 ? 1.952   15.083 12.291  1.00 0.00  ? 143 THR A HA   2  
ATOM   4779  H  HB   . THR A 1 143 ? 4.054   13.163 12.642  1.00 0.00  ? 143 THR A HB   2  
ATOM   4780  H  HG1  . THR A 1 143 ? 5.661   14.958 11.990  1.00 0.00  ? 143 THR A HG1  2  
ATOM   4781  H  HG21 . THR A 1 143 ? 2.929   13.588 10.536  1.00 0.00  ? 143 THR A HG21 2  
ATOM   4782  H  HG22 . THR A 1 143 ? 4.643   13.947 10.346  1.00 0.00  ? 143 THR A HG22 2  
ATOM   4783  H  HG23 . THR A 1 143 ? 3.481   15.263 10.536  1.00 0.00  ? 143 THR A HG23 2  
ATOM   4784  N  N    . TYR A 1 144 ? 0.727   13.628 13.979  1.00 0.00  ? 144 TYR A N    2  
ATOM   4785  C  CA   . TYR A 1 144 ? 0.073   12.572 14.789  1.00 0.00  ? 144 TYR A CA   2  
ATOM   4786  C  C    . TYR A 1 144 ? 0.400   11.203 14.216  1.00 0.00  ? 144 TYR A C    2  
ATOM   4787  O  O    . TYR A 1 144 ? 0.688   11.051 13.045  1.00 0.00  ? 144 TYR A O    2  
ATOM   4788  C  CB   . TYR A 1 144 ? -1.440  12.750 14.785  1.00 0.00  ? 144 TYR A CB   2  
ATOM   4789  C  CG   . TYR A 1 144 ? -2.043  11.877 15.860  1.00 0.00  ? 144 TYR A CG   2  
ATOM   4790  C  CD1  . TYR A 1 144 ? -1.437  11.801 17.120  1.00 0.00  ? 144 TYR A CD1  2  
ATOM   4791  C  CD2  . TYR A 1 144 ? -3.205  11.142 15.597  1.00 0.00  ? 144 TYR A CD2  2  
ATOM   4792  C  CE1  . TYR A 1 144 ? -1.991  10.993 18.117  1.00 0.00  ? 144 TYR A CE1  2  
ATOM   4793  C  CE2  . TYR A 1 144 ? -3.760  10.332 16.595  1.00 0.00  ? 144 TYR A CE2  2  
ATOM   4794  C  CZ   . TYR A 1 144 ? -3.153  10.258 17.854  1.00 0.00  ? 144 TYR A CZ   2  
ATOM   4795  O  OH   . TYR A 1 144 ? -3.703  9.462  18.837  1.00 0.00  ? 144 TYR A OH   2  
ATOM   4796  H  H    . TYR A 1 144 ? 0.190   14.319 13.538  1.00 0.00  ? 144 TYR A H    2  
ATOM   4797  H  HA   . TYR A 1 144 ? 0.437   12.628 15.802  1.00 0.00  ? 144 TYR A HA   2  
ATOM   4798  H  HB2  . TYR A 1 144 ? -1.683  13.782 14.978  1.00 0.00  ? 144 TYR A HB2  2  
ATOM   4799  H  HB3  . TYR A 1 144 ? -1.833  12.455 13.825  1.00 0.00  ? 144 TYR A HB3  2  
ATOM   4800  H  HD1  . TYR A 1 144 ? -0.541  12.366 17.324  1.00 0.00  ? 144 TYR A HD1  2  
ATOM   4801  H  HD2  . TYR A 1 144 ? -3.673  11.199 14.626  1.00 0.00  ? 144 TYR A HD2  2  
ATOM   4802  H  HE1  . TYR A 1 144 ? -1.523  10.936 19.091  1.00 0.00  ? 144 TYR A HE1  2  
ATOM   4803  H  HE2  . TYR A 1 144 ? -4.655  9.763  16.393  1.00 0.00  ? 144 TYR A HE2  2  
ATOM   4804  H  HH   . TYR A 1 144 ? -3.044  9.338  19.523  1.00 0.00  ? 144 TYR A HH   2  
ATOM   4805  N  N    . THR A 1 145 ? 0.338   10.206 15.038  1.00 0.00  ? 145 THR A N    2  
ATOM   4806  C  CA   . THR A 1 145 ? 0.626   8.827  14.561  1.00 0.00  ? 145 THR A CA   2  
ATOM   4807  C  C    . THR A 1 145 ? -0.297  7.835  15.270  1.00 0.00  ? 145 THR A C    2  
ATOM   4808  O  O    . THR A 1 145 ? -0.149  6.635  15.149  1.00 0.00  ? 145 THR A O    2  
ATOM   4809  C  CB   . THR A 1 145 ? 2.083   8.459  14.837  1.00 0.00  ? 145 THR A CB   2  
ATOM   4810  O  OG1  . THR A 1 145 ? 2.169   7.066  15.079  1.00 0.00  ? 145 THR A OG1  2  
ATOM   4811  C  CG2  . THR A 1 145 ? 2.600   9.223  16.053  1.00 0.00  ? 145 THR A CG2  2  
ATOM   4812  H  H    . THR A 1 145 ? 0.089   10.369 15.971  1.00 0.00  ? 145 THR A H    2  
ATOM   4813  H  HA   . THR A 1 145 ? 0.446   8.780  13.501  1.00 0.00  ? 145 THR A HA   2  
ATOM   4814  H  HB   . THR A 1 145 ? 2.685   8.710  13.978  1.00 0.00  ? 145 THR A HB   2  
ATOM   4815  H  HG1  . THR A 1 145 ? 1.625   6.618  14.427  1.00 0.00  ? 145 THR A HG1  2  
ATOM   4816  H  HG21 . THR A 1 145 ? 2.241   8.749  16.954  1.00 0.00  ? 145 THR A HG21 2  
ATOM   4817  H  HG22 . THR A 1 145 ? 2.251   10.243 16.018  1.00 0.00  ? 145 THR A HG22 2  
ATOM   4818  H  HG23 . THR A 1 145 ? 3.680   9.214  16.048  1.00 0.00  ? 145 THR A HG23 2  
ATOM   4819  N  N    . LYS A 1 146 ? -1.260  8.326  15.997  1.00 0.00  ? 146 LYS A N    2  
ATOM   4820  C  CA   . LYS A 1 146 ? -2.203  7.419  16.700  1.00 0.00  ? 146 LYS A CA   2  
ATOM   4821  C  C    . LYS A 1 146 ? -1.429  6.395  17.543  1.00 0.00  ? 146 LYS A C    2  
ATOM   4822  O  O    . LYS A 1 146 ? -0.895  6.722  18.584  1.00 0.00  ? 146 LYS A O    2  
ATOM   4823  C  CB   . LYS A 1 146 ? -3.079  6.712  15.663  1.00 0.00  ? 146 LYS A CB   2  
ATOM   4824  C  CG   . LYS A 1 146 ? -4.266  7.613  15.313  1.00 0.00  ? 146 LYS A CG   2  
ATOM   4825  C  CD   . LYS A 1 146 ? -5.075  6.993  14.170  1.00 0.00  ? 146 LYS A CD   2  
ATOM   4826  C  CE   . LYS A 1 146 ? -6.091  6.009  14.751  1.00 0.00  ? 146 LYS A CE   2  
ATOM   4827  N  NZ   . LYS A 1 146 ? -6.475  5.007  13.713  1.00 0.00  ? 146 LYS A NZ   2  
ATOM   4828  H  H    . LYS A 1 146 ? -1.370  9.295  16.073  1.00 0.00  ? 146 LYS A H    2  
ATOM   4829  H  HA   . LYS A 1 146 ? -2.833  8.002  17.352  1.00 0.00  ? 146 LYS A HA   2  
ATOM   4830  H  HB2  . LYS A 1 146 ? -2.497  6.516  14.772  1.00 0.00  ? 146 LYS A HB2  2  
ATOM   4831  H  HB3  . LYS A 1 146 ? -3.444  5.781  16.070  1.00 0.00  ? 146 LYS A HB3  2  
ATOM   4832  H  HG2  . LYS A 1 146 ? -4.900  7.724  16.182  1.00 0.00  ? 146 LYS A HG2  2  
ATOM   4833  H  HG3  . LYS A 1 146 ? -3.901  8.581  15.008  1.00 0.00  ? 146 LYS A HG3  2  
ATOM   4834  H  HD2  . LYS A 1 146 ? -5.593  7.773  13.631  1.00 0.00  ? 146 LYS A HD2  2  
ATOM   4835  H  HD3  . LYS A 1 146 ? -4.412  6.472  13.498  1.00 0.00  ? 146 LYS A HD3  2  
ATOM   4836  H  HE2  . LYS A 1 146 ? -5.651  5.501  15.595  1.00 0.00  ? 146 LYS A HE2  2  
ATOM   4837  H  HE3  . LYS A 1 146 ? -6.970  6.548  15.075  1.00 0.00  ? 146 LYS A HE3  2  
ATOM   4838  H  HZ1  . LYS A 1 146 ? -7.484  5.112  13.485  1.00 0.00  ? 146 LYS A HZ1  2  
ATOM   4839  H  HZ2  . LYS A 1 146 ? -6.299  4.047  14.077  1.00 0.00  ? 146 LYS A HZ2  2  
ATOM   4840  H  HZ3  . LYS A 1 146 ? -5.910  5.159  12.854  1.00 0.00  ? 146 LYS A HZ3  2  
ATOM   4841  N  N    . ASN A 1 147 ? -1.381  5.159  17.123  1.00 0.00  ? 147 ASN A N    2  
ATOM   4842  C  CA   . ASN A 1 147 ? -0.664  4.127  17.925  1.00 0.00  ? 147 ASN A CA   2  
ATOM   4843  C  C    . ASN A 1 147 ? 0.797   4.536  18.154  1.00 0.00  ? 147 ASN A C    2  
ATOM   4844  O  O    . ASN A 1 147 ? 1.297   4.465  19.258  1.00 0.00  ? 147 ASN A O    2  
ATOM   4845  C  CB   . ASN A 1 147 ? -0.716  2.795  17.185  1.00 0.00  ? 147 ASN A CB   2  
ATOM   4846  C  CG   . ASN A 1 147 ? -0.424  3.030  15.703  1.00 0.00  ? 147 ASN A CG   2  
ATOM   4847  O  OD1  . ASN A 1 147 ? -1.125  3.771  15.042  1.00 0.00  ? 147 ASN A OD1  2  
ATOM   4848  N  ND2  . ASN A 1 147 ? 0.590   2.427  15.151  1.00 0.00  ? 147 ASN A ND2  2  
ATOM   4849  H  H    . ASN A 1 147 ? -1.829  4.902  16.291  1.00 0.00  ? 147 ASN A H    2  
ATOM   4850  H  HA   . ASN A 1 147 ? -1.156  4.022  18.880  1.00 0.00  ? 147 ASN A HA   2  
ATOM   4851  H  HB2  . ASN A 1 147 ? 0.023   2.125  17.599  1.00 0.00  ? 147 ASN A HB2  2  
ATOM   4852  H  HB3  . ASN A 1 147 ? -1.699  2.362  17.292  1.00 0.00  ? 147 ASN A HB3  2  
ATOM   4853  H  HD21 . ASN A 1 147 ? 1.154   1.830  15.686  1.00 0.00  ? 147 ASN A HD21 2  
ATOM   4854  H  HD22 . ASN A 1 147 ? 0.788   2.571  14.202  1.00 0.00  ? 147 ASN A HD22 2  
ATOM   4855  N  N    . PHE A 1 148 ? 1.478   4.959  17.121  1.00 0.00  ? 148 PHE A N    2  
ATOM   4856  C  CA   . PHE A 1 148 ? 2.907   5.380  17.269  1.00 0.00  ? 148 PHE A CA   2  
ATOM   4857  C  C    . PHE A 1 148 ? 3.797   4.178  17.596  1.00 0.00  ? 148 PHE A C    2  
ATOM   4858  O  O    . PHE A 1 148 ? 3.575   3.463  18.551  1.00 0.00  ? 148 PHE A O    2  
ATOM   4859  C  CB   . PHE A 1 148 ? 3.023   6.423  18.386  1.00 0.00  ? 148 PHE A CB   2  
ATOM   4860  C  CG   . PHE A 1 148 ? 4.477   6.762  18.629  1.00 0.00  ? 148 PHE A CG   2  
ATOM   4861  C  CD1  . PHE A 1 148 ? 5.399   6.743  17.574  1.00 0.00  ? 148 PHE A CD1  2  
ATOM   4862  C  CD2  . PHE A 1 148 ? 4.897   7.104  19.918  1.00 0.00  ? 148 PHE A CD2  2  
ATOM   4863  C  CE1  . PHE A 1 148 ? 6.741   7.067  17.813  1.00 0.00  ? 148 PHE A CE1  2  
ATOM   4864  C  CE2  . PHE A 1 148 ? 6.236   7.426  20.157  1.00 0.00  ? 148 PHE A CE2  2  
ATOM   4865  C  CZ   . PHE A 1 148 ? 7.158   7.408  19.106  1.00 0.00  ? 148 PHE A CZ   2  
ATOM   4866  H  H    . PHE A 1 148 ? 1.048   5.005  16.242  1.00 0.00  ? 148 PHE A H    2  
ATOM   4867  H  HA   . PHE A 1 148 ? 3.241   5.819  16.343  1.00 0.00  ? 148 PHE A HA   2  
ATOM   4868  H  HB2  . PHE A 1 148 ? 2.491   7.316  18.099  1.00 0.00  ? 148 PHE A HB2  2  
ATOM   4869  H  HB3  . PHE A 1 148 ? 2.598   6.031  19.296  1.00 0.00  ? 148 PHE A HB3  2  
ATOM   4870  H  HD1  . PHE A 1 148 ? 5.076   6.476  16.578  1.00 0.00  ? 148 PHE A HD1  2  
ATOM   4871  H  HD2  . PHE A 1 148 ? 4.186   7.116  20.729  1.00 0.00  ? 148 PHE A HD2  2  
ATOM   4872  H  HE1  . PHE A 1 148 ? 7.454   7.053  17.002  1.00 0.00  ? 148 PHE A HE1  2  
ATOM   4873  H  HE2  . PHE A 1 148 ? 6.558   7.690  21.153  1.00 0.00  ? 148 PHE A HE2  2  
ATOM   4874  H  HZ   . PHE A 1 148 ? 8.192   7.659  19.291  1.00 0.00  ? 148 PHE A HZ   2  
ATOM   4875  N  N    . ARG A 1 149 ? 4.825   3.978  16.813  1.00 0.00  ? 149 ARG A N    2  
ATOM   4876  C  CA   . ARG A 1 149 ? 5.767   2.852  17.066  1.00 0.00  ? 149 ARG A CA   2  
ATOM   4877  C  C    . ARG A 1 149 ? 7.006   3.427  17.757  1.00 0.00  ? 149 ARG A C    2  
ATOM   4878  O  O    . ARG A 1 149 ? 7.231   3.219  18.933  1.00 0.00  ? 149 ARG A O    2  
ATOM   4879  C  CB   . ARG A 1 149 ? 6.169   2.211  15.733  1.00 0.00  ? 149 ARG A CB   2  
ATOM   4880  C  CG   . ARG A 1 149 ? 7.367   1.281  15.939  1.00 0.00  ? 149 ARG A CG   2  
ATOM   4881  C  CD   . ARG A 1 149 ? 7.358   0.198  14.855  1.00 0.00  ? 149 ARG A CD   2  
ATOM   4882  N  NE   . ARG A 1 149 ? 7.524   -1.145 15.482  1.00 0.00  ? 149 ARG A NE   2  
ATOM   4883  C  CZ   . ARG A 1 149 ? 6.589   -1.635 16.253  1.00 0.00  ? 149 ARG A CZ   2  
ATOM   4884  N  NH1  . ARG A 1 149 ? 5.502   -0.952 16.486  1.00 0.00  ? 149 ARG A NH1  2  
ATOM   4885  N  NH2  . ARG A 1 149 ? 6.740   -2.815 16.786  1.00 0.00  ? 149 ARG A NH2  2  
ATOM   4886  H  H    . ARG A 1 149 ? 4.987   4.585  16.062  1.00 0.00  ? 149 ARG A H    2  
ATOM   4887  H  HA   . ARG A 1 149 ? 5.298   2.118  17.704  1.00 0.00  ? 149 ARG A HA   2  
ATOM   4888  H  HB2  . ARG A 1 149 ? 5.338   1.643  15.343  1.00 0.00  ? 149 ARG A HB2  2  
ATOM   4889  H  HB3  . ARG A 1 149 ? 6.434   2.984  15.028  1.00 0.00  ? 149 ARG A HB3  2  
ATOM   4890  H  HG2  . ARG A 1 149 ? 8.283   1.854  15.873  1.00 0.00  ? 149 ARG A HG2  2  
ATOM   4891  H  HG3  . ARG A 1 149 ? 7.302   0.816  16.912  1.00 0.00  ? 149 ARG A HG3  2  
ATOM   4892  H  HD2  . ARG A 1 149 ? 6.418   0.230  14.322  1.00 0.00  ? 149 ARG A HD2  2  
ATOM   4893  H  HD3  . ARG A 1 149 ? 8.170   0.374  14.163  1.00 0.00  ? 149 ARG A HD3  2  
ATOM   4894  H  HE   . ARG A 1 149 ? 8.336   -1.668 15.310  1.00 0.00  ? 149 ARG A HE   2  
ATOM   4895  H  HH11 . ARG A 1 149 ? 5.379   -0.051 16.073  1.00 0.00  ? 149 ARG A HH11 2  
ATOM   4896  H  HH12 . ARG A 1 149 ? 4.793   -1.330 17.080  1.00 0.00  ? 149 ARG A HH12 2  
ATOM   4897  H  HH21 . ARG A 1 149 ? 7.569   -3.343 16.602  1.00 0.00  ? 149 ARG A HH21 2  
ATOM   4898  H  HH22 . ARG A 1 149 ? 6.029   -3.192 17.380  1.00 0.00  ? 149 ARG A HH22 2  
ATOM   4899  N  N    . LEU A 1 150 ? 7.791   4.178  17.032  1.00 0.00  ? 150 LEU A N    2  
ATOM   4900  C  CA   . LEU A 1 150 ? 9.007   4.814  17.620  1.00 0.00  ? 150 LEU A CA   2  
ATOM   4901  C  C    . LEU A 1 150 ? 9.849   5.395  16.484  1.00 0.00  ? 150 LEU A C    2  
ATOM   4902  O  O    . LEU A 1 150 ? 9.564   5.192  15.321  1.00 0.00  ? 150 LEU A O    2  
ATOM   4903  C  CB   . LEU A 1 150 ? 9.837   3.786  18.407  1.00 0.00  ? 150 LEU A CB   2  
ATOM   4904  C  CG   . LEU A 1 150 ? 10.291  4.390  19.748  1.00 0.00  ? 150 LEU A CG   2  
ATOM   4905  C  CD1  . LEU A 1 150 ? 9.121   5.096  20.442  1.00 0.00  ? 150 LEU A CD1  2  
ATOM   4906  C  CD2  . LEU A 1 150 ? 10.804  3.275  20.661  1.00 0.00  ? 150 LEU A CD2  2  
ATOM   4907  H  H    . LEU A 1 150 ? 7.567   4.346  16.092  1.00 0.00  ? 150 LEU A H    2  
ATOM   4908  H  HA   . LEU A 1 150 ? 8.702   5.613  18.274  1.00 0.00  ? 150 LEU A HA   2  
ATOM   4909  H  HB2  . LEU A 1 150 ? 9.244   2.905  18.591  1.00 0.00  ? 150 LEU A HB2  2  
ATOM   4910  H  HB3  . LEU A 1 150 ? 10.710  3.516  17.827  1.00 0.00  ? 150 LEU A HB3  2  
ATOM   4911  H  HG   . LEU A 1 150 ? 11.085  5.102  19.569  1.00 0.00  ? 150 LEU A HG   2  
ATOM   4912  H  HD11 . LEU A 1 150 ? 9.158   4.899  21.504  1.00 0.00  ? 150 LEU A HD11 2  
ATOM   4913  H  HD12 . LEU A 1 150 ? 8.189   4.729  20.039  1.00 0.00  ? 150 LEU A HD12 2  
ATOM   4914  H  HD13 . LEU A 1 150 ? 9.191   6.160  20.272  1.00 0.00  ? 150 LEU A HD13 2  
ATOM   4915  H  HD21 . LEU A 1 150 ? 10.351  3.372  21.637  1.00 0.00  ? 150 LEU A HD21 2  
ATOM   4916  H  HD22 . LEU A 1 150 ? 11.877  3.351  20.757  1.00 0.00  ? 150 LEU A HD22 2  
ATOM   4917  H  HD23 . LEU A 1 150 ? 10.545  2.315  20.238  1.00 0.00  ? 150 LEU A HD23 2  
ATOM   4918  N  N    . SER A 1 151 ? 10.875  6.129  16.805  1.00 0.00  ? 151 SER A N    2  
ATOM   4919  C  CA   . SER A 1 151 ? 11.714  6.729  15.733  1.00 0.00  ? 151 SER A CA   2  
ATOM   4920  C  C    . SER A 1 151 ? 13.179  6.724  16.164  1.00 0.00  ? 151 SER A C    2  
ATOM   4921  O  O    . SER A 1 151 ? 13.521  7.138  17.256  1.00 0.00  ? 151 SER A O    2  
ATOM   4922  C  CB   . SER A 1 151 ? 11.254  8.164  15.476  1.00 0.00  ? 151 SER A CB   2  
ATOM   4923  O  OG   . SER A 1 151 ? 10.069  8.414  16.220  1.00 0.00  ? 151 SER A OG   2  
ATOM   4924  H  H    . SER A 1 151 ? 11.088  6.292  17.746  1.00 0.00  ? 151 SER A H    2  
ATOM   4925  H  HA   . SER A 1 151 ? 11.605  6.151  14.827  1.00 0.00  ? 151 SER A HA   2  
ATOM   4926  H  HB2  . SER A 1 151 ? 12.021  8.854  15.787  1.00 0.00  ? 151 SER A HB2  2  
ATOM   4927  H  HB3  . SER A 1 151 ? 11.060  8.296  14.418  1.00 0.00  ? 151 SER A HB3  2  
ATOM   4928  H  HG   . SER A 1 151 ? 9.547   9.059  15.738  1.00 0.00  ? 151 SER A HG   2  
ATOM   4929  N  N    . GLN A 1 152 ? 14.047  6.252  15.313  1.00 0.00  ? 152 GLN A N    2  
ATOM   4930  C  CA   . GLN A 1 152 ? 15.491  6.210  15.665  1.00 0.00  ? 152 GLN A CA   2  
ATOM   4931  C  C    . GLN A 1 152 ? 15.951  7.609  16.077  1.00 0.00  ? 152 GLN A C    2  
ATOM   4932  O  O    . GLN A 1 152 ? 16.832  7.764  16.892  1.00 0.00  ? 152 GLN A O    2  
ATOM   4933  C  CB   . GLN A 1 152 ? 16.285  5.731  14.448  1.00 0.00  ? 152 GLN A CB   2  
ATOM   4934  C  CG   . GLN A 1 152 ? 17.781  5.961  14.666  1.00 0.00  ? 152 GLN A CG   2  
ATOM   4935  C  CD   . GLN A 1 152 ? 18.547  5.438  13.448  1.00 0.00  ? 152 GLN A CD   2  
ATOM   4936  O  OE1  . GLN A 1 152 ? 17.952  5.094  12.447  1.00 0.00  ? 152 GLN A OE1  2  
ATOM   4937  N  NE2  . GLN A 1 152 ? 19.849  5.361  13.489  1.00 0.00  ? 152 GLN A NE2  2  
ATOM   4938  H  H    . GLN A 1 152 ? 13.746  5.923  14.440  1.00 0.00  ? 152 GLN A H    2  
ATOM   4939  H  HA   . GLN A 1 152 ? 15.639  5.526  16.490  1.00 0.00  ? 152 GLN A HA   2  
ATOM   4940  H  HB2  . GLN A 1 152 ? 16.104  4.679  14.295  1.00 0.00  ? 152 GLN A HB2  2  
ATOM   4941  H  HB3  . GLN A 1 152 ? 15.966  6.280  13.574  1.00 0.00  ? 152 GLN A HB3  2  
ATOM   4942  H  HG2  . GLN A 1 152 ? 17.969  7.018  14.787  1.00 0.00  ? 152 GLN A HG2  2  
ATOM   4943  H  HG3  . GLN A 1 152 ? 18.105  5.432  15.549  1.00 0.00  ? 152 GLN A HG3  2  
ATOM   4944  H  HE21 . GLN A 1 152 ? 20.332  5.633  14.296  1.00 0.00  ? 152 GLN A HE21 2  
ATOM   4945  H  HE22 . GLN A 1 152 ? 20.344  5.032  12.710  1.00 0.00  ? 152 GLN A HE22 2  
ATOM   4946  N  N    . ASP A 1 153 ? 15.356  8.631  15.535  1.00 0.00  ? 153 ASP A N    2  
ATOM   4947  C  CA   . ASP A 1 153 ? 15.770  10.006 15.926  1.00 0.00  ? 153 ASP A CA   2  
ATOM   4948  C  C    . ASP A 1 153 ? 15.862  10.072 17.452  1.00 0.00  ? 153 ASP A C    2  
ATOM   4949  O  O    . ASP A 1 153 ? 16.780  10.642 18.009  1.00 0.00  ? 153 ASP A O    2  
ATOM   4950  C  CB   . ASP A 1 153 ? 14.738  11.013 15.420  1.00 0.00  ? 153 ASP A CB   2  
ATOM   4951  C  CG   . ASP A 1 153 ? 14.626  10.896 13.899  1.00 0.00  ? 153 ASP A CG   2  
ATOM   4952  O  OD1  . ASP A 1 153 ? 15.623  11.129 13.233  1.00 0.00  ? 153 ASP A OD1  2  
ATOM   4953  O  OD2  . ASP A 1 153 ? 13.549  10.574 13.426  1.00 0.00  ? 153 ASP A OD2  2  
ATOM   4954  H  H    . ASP A 1 153 ? 14.637  8.497  14.883  1.00 0.00  ? 153 ASP A H    2  
ATOM   4955  H  HA   . ASP A 1 153 ? 16.738  10.227 15.497  1.00 0.00  ? 153 ASP A HA   2  
ATOM   4956  H  HB2  . ASP A 1 153 ? 13.779  10.805 15.872  1.00 0.00  ? 153 ASP A HB2  2  
ATOM   4957  H  HB3  . ASP A 1 153 ? 15.050  12.013 15.679  1.00 0.00  ? 153 ASP A HB3  2  
ATOM   4958  N  N    . ASP A 1 154 ? 14.922  9.478  18.133  1.00 0.00  ? 154 ASP A N    2  
ATOM   4959  C  CA   . ASP A 1 154 ? 14.961  9.492  19.620  1.00 0.00  ? 154 ASP A CA   2  
ATOM   4960  C  C    . ASP A 1 154 ? 15.876  8.365  20.113  1.00 0.00  ? 154 ASP A C    2  
ATOM   4961  O  O    . ASP A 1 154 ? 16.585  8.513  21.088  1.00 0.00  ? 154 ASP A O    2  
ATOM   4962  C  CB   . ASP A 1 154 ? 13.548  9.288  20.170  1.00 0.00  ? 154 ASP A CB   2  
ATOM   4963  C  CG   . ASP A 1 154 ? 13.586  9.323  21.699  1.00 0.00  ? 154 ASP A CG   2  
ATOM   4964  O  OD1  . ASP A 1 154 ? 14.285  10.166 22.235  1.00 0.00  ? 154 ASP A OD1  2  
ATOM   4965  O  OD2  . ASP A 1 154 ? 12.914  8.505  22.308  1.00 0.00  ? 154 ASP A OD2  2  
ATOM   4966  H  H    . ASP A 1 154 ? 14.195  9.016  17.664  1.00 0.00  ? 154 ASP A H    2  
ATOM   4967  H  HA   . ASP A 1 154 ? 15.348  10.442 19.961  1.00 0.00  ? 154 ASP A HA   2  
ATOM   4968  H  HB2  . ASP A 1 154 ? 12.906  10.076 19.807  1.00 0.00  ? 154 ASP A HB2  2  
ATOM   4969  H  HB3  . ASP A 1 154 ? 13.167  8.334  19.842  1.00 0.00  ? 154 ASP A HB3  2  
ATOM   4970  N  N    . ILE A 1 155 ? 15.875  7.242  19.442  1.00 0.00  ? 155 ILE A N    2  
ATOM   4971  C  CA   . ILE A 1 155 ? 16.755  6.119  19.876  1.00 0.00  ? 155 ILE A CA   2  
ATOM   4972  C  C    . ILE A 1 155 ? 18.216  6.557  19.751  1.00 0.00  ? 155 ILE A C    2  
ATOM   4973  O  O    . ILE A 1 155 ? 19.065  6.146  20.513  1.00 0.00  ? 155 ILE A O    2  
ATOM   4974  C  CB   . ILE A 1 155 ? 16.490  4.872  19.010  1.00 0.00  ? 155 ILE A CB   2  
ATOM   4975  C  CG1  . ILE A 1 155 ? 17.359  4.889  17.745  1.00 0.00  ? 155 ILE A CG1  2  
ATOM   4976  C  CG2  . ILE A 1 155 ? 15.006  4.796  18.643  1.00 0.00  ? 155 ILE A CG2  2  
ATOM   4977  C  CD1  . ILE A 1 155 ? 18.698  4.218  18.041  1.00 0.00  ? 155 ILE A CD1  2  
ATOM   4978  H  H    . ILE A 1 155 ? 15.306  7.142  18.657  1.00 0.00  ? 155 ILE A H    2  
ATOM   4979  H  HA   . ILE A 1 155 ? 16.545  5.885  20.910  1.00 0.00  ? 155 ILE A HA   2  
ATOM   4980  H  HB   . ILE A 1 155 ? 16.730  4.005  19.574  1.00 0.00  ? 155 ILE A HB   2  
ATOM   4981  H  HG12 . ILE A 1 155 ? 16.859  4.346  16.956  1.00 0.00  ? 155 ILE A HG12 2  
ATOM   4982  H  HG13 . ILE A 1 155 ? 17.531  5.907  17.435  1.00 0.00  ? 155 ILE A HG13 2  
ATOM   4983  H  HG21 . ILE A 1 155 ? 14.746  5.599  17.978  1.00 0.00  ? 155 ILE A HG21 2  
ATOM   4984  H  HG22 . ILE A 1 155 ? 14.414  4.870  19.544  1.00 0.00  ? 155 ILE A HG22 2  
ATOM   4985  H  HG23 . ILE A 1 155 ? 14.807  3.849  18.163  1.00 0.00  ? 155 ILE A HG23 2  
ATOM   4986  H  HD11 . ILE A 1 155 ? 18.818  4.111  19.109  1.00 0.00  ? 155 ILE A HD11 2  
ATOM   4987  H  HD12 . ILE A 1 155 ? 19.499  4.824  17.644  1.00 0.00  ? 155 ILE A HD12 2  
ATOM   4988  H  HD13 . ILE A 1 155 ? 18.720  3.245  17.577  1.00 0.00  ? 155 ILE A HD13 2  
ATOM   4989  N  N    . LYS A 1 156 ? 18.505  7.397  18.794  1.00 0.00  ? 156 LYS A N    2  
ATOM   4990  C  CA   . LYS A 1 156 ? 19.903  7.878  18.611  1.00 0.00  ? 156 LYS A CA   2  
ATOM   4991  C  C    . LYS A 1 156 ? 20.196  8.967  19.644  1.00 0.00  ? 156 LYS A C    2  
ATOM   4992  O  O    . LYS A 1 156 ? 21.237  8.981  20.270  1.00 0.00  ? 156 LYS A O    2  
ATOM   4993  C  CB   . LYS A 1 156 ? 20.059  8.462  17.203  1.00 0.00  ? 156 LYS A CB   2  
ATOM   4994  C  CG   . LYS A 1 156 ? 21.499  8.942  17.001  1.00 0.00  ? 156 LYS A CG   2  
ATOM   4995  C  CD   . LYS A 1 156 ? 21.578  10.449 17.251  1.00 0.00  ? 156 LYS A CD   2  
ATOM   4996  C  CE   . LYS A 1 156 ? 22.612  11.068 16.303  1.00 0.00  ? 156 LYS A CE   2  
ATOM   4997  N  NZ   . LYS A 1 156 ? 23.779  11.570 17.087  1.00 0.00  ? 156 LYS A NZ   2  
ATOM   4998  H  H    . LYS A 1 156 ? 17.800  7.716  18.198  1.00 0.00  ? 156 LYS A H    2  
ATOM   4999  H  HA   . LYS A 1 156 ? 20.591  7.057  18.742  1.00 0.00  ? 156 LYS A HA   2  
ATOM   5000  H  HB2  . LYS A 1 156 ? 19.826  7.703  16.471  1.00 0.00  ? 156 LYS A HB2  2  
ATOM   5001  H  HB3  . LYS A 1 156 ? 19.384  9.295  17.083  1.00 0.00  ? 156 LYS A HB3  2  
ATOM   5002  H  HG2  . LYS A 1 156 ? 22.151  8.428  17.692  1.00 0.00  ? 156 LYS A HG2  2  
ATOM   5003  H  HG3  . LYS A 1 156 ? 21.808  8.731  15.989  1.00 0.00  ? 156 LYS A HG3  2  
ATOM   5004  H  HD2  . LYS A 1 156 ? 20.609  10.895 17.072  1.00 0.00  ? 156 LYS A HD2  2  
ATOM   5005  H  HD3  . LYS A 1 156 ? 21.875  10.629 18.273  1.00 0.00  ? 156 LYS A HD3  2  
ATOM   5006  H  HE2  . LYS A 1 156 ? 22.947  10.319 15.602  1.00 0.00  ? 156 LYS A HE2  2  
ATOM   5007  H  HE3  . LYS A 1 156 ? 22.159  11.888 15.765  1.00 0.00  ? 156 LYS A HE3  2  
ATOM   5008  H  HZ1  . LYS A 1 156 ? 24.139  12.446 16.653  1.00 0.00  ? 156 LYS A HZ1  2  
ATOM   5009  H  HZ2  . LYS A 1 156 ? 24.531  10.850 17.089  1.00 0.00  ? 156 LYS A HZ2  2  
ATOM   5010  H  HZ3  . LYS A 1 156 ? 23.486  11.766 18.063  1.00 0.00  ? 156 LYS A HZ3  2  
ATOM   5011  N  N    . GLY A 1 157 ? 19.283  9.882  19.824  1.00 0.00  ? 157 GLY A N    2  
ATOM   5012  C  CA   . GLY A 1 157 ? 19.507  10.973 20.813  1.00 0.00  ? 157 GLY A CA   2  
ATOM   5013  C  C    . GLY A 1 157 ? 19.318  10.425 22.228  1.00 0.00  ? 157 GLY A C    2  
ATOM   5014  O  O    . GLY A 1 157 ? 19.795  10.993 23.193  1.00 0.00  ? 157 GLY A O    2  
ATOM   5015  H  H    . GLY A 1 157 ? 18.451  9.852  19.308  1.00 0.00  ? 157 GLY A H    2  
ATOM   5016  H  HA2  . GLY A 1 157 ? 20.511  11.359 20.703  1.00 0.00  ? 157 GLY A HA2  2  
ATOM   5017  H  HA3  . GLY A 1 157 ? 18.796  11.766 20.641  1.00 0.00  ? 157 GLY A HA3  2  
ATOM   5018  N  N    . ILE A 1 158 ? 18.633  9.322  22.362  1.00 0.00  ? 158 ILE A N    2  
ATOM   5019  C  CA   . ILE A 1 158 ? 18.421  8.746  23.717  1.00 0.00  ? 158 ILE A CA   2  
ATOM   5020  C  C    . ILE A 1 158 ? 19.510  7.707  24.000  1.00 0.00  ? 158 ILE A C    2  
ATOM   5021  O  O    . ILE A 1 158 ? 19.765  7.357  25.132  1.00 0.00  ? 158 ILE A O    2  
ATOM   5022  C  CB   . ILE A 1 158 ? 17.035  8.095  23.789  1.00 0.00  ? 158 ILE A CB   2  
ATOM   5023  C  CG1  . ILE A 1 158 ? 16.634  7.925  25.256  1.00 0.00  ? 158 ILE A CG1  2  
ATOM   5024  C  CG2  . ILE A 1 158 ? 17.065  6.723  23.109  1.00 0.00  ? 158 ILE A CG2  2  
ATOM   5025  C  CD1  . ILE A 1 158 ? 15.818  9.134  25.716  1.00 0.00  ? 158 ILE A CD1  2  
ATOM   5026  H  H    . ILE A 1 158 ? 18.260  8.875  21.572  1.00 0.00  ? 158 ILE A H    2  
ATOM   5027  H  HA   . ILE A 1 158 ? 18.482  9.536  24.452  1.00 0.00  ? 158 ILE A HA   2  
ATOM   5028  H  HB   . ILE A 1 158 ? 16.315  8.726  23.289  1.00 0.00  ? 158 ILE A HB   2  
ATOM   5029  H  HG12 . ILE A 1 158 ? 16.042  7.030  25.363  1.00 0.00  ? 158 ILE A HG12 2  
ATOM   5030  H  HG13 . ILE A 1 158 ? 17.521  7.842  25.861  1.00 0.00  ? 158 ILE A HG13 2  
ATOM   5031  H  HG21 . ILE A 1 158 ? 17.596  6.796  22.172  1.00 0.00  ? 158 ILE A HG21 2  
ATOM   5032  H  HG22 . ILE A 1 158 ? 16.053  6.391  22.924  1.00 0.00  ? 158 ILE A HG22 2  
ATOM   5033  H  HG23 . ILE A 1 158 ? 17.564  6.013  23.752  1.00 0.00  ? 158 ILE A HG23 2  
ATOM   5034  H  HD11 . ILE A 1 158 ? 15.307  8.891  26.636  1.00 0.00  ? 158 ILE A HD11 2  
ATOM   5035  H  HD12 . ILE A 1 158 ? 15.094  9.391  24.957  1.00 0.00  ? 158 ILE A HD12 2  
ATOM   5036  H  HD13 . ILE A 1 158 ? 16.477  9.973  25.882  1.00 0.00  ? 158 ILE A HD13 2  
ATOM   5037  N  N    . GLN A 1 159 ? 20.177  7.231  22.983  1.00 0.00  ? 159 GLN A N    2  
ATOM   5038  C  CA   . GLN A 1 159 ? 21.266  6.241  23.218  1.00 0.00  ? 159 GLN A CA   2  
ATOM   5039  C  C    . GLN A 1 159 ? 22.578  6.999  23.392  1.00 0.00  ? 159 GLN A C    2  
ATOM   5040  O  O    . GLN A 1 159 ? 23.452  6.584  24.125  1.00 0.00  ? 159 GLN A O    2  
ATOM   5041  C  CB   . GLN A 1 159 ? 21.378  5.272  22.036  1.00 0.00  ? 159 GLN A CB   2  
ATOM   5042  C  CG   . GLN A 1 159 ? 21.778  6.029  20.767  1.00 0.00  ? 159 GLN A CG   2  
ATOM   5043  C  CD   . GLN A 1 159 ? 21.887  5.048  19.592  1.00 0.00  ? 159 GLN A CD   2  
ATOM   5044  O  OE1  . GLN A 1 159 ? 22.157  5.449  18.478  1.00 0.00  ? 159 GLN A OE1  2  
ATOM   5045  N  NE2  . GLN A 1 159 ? 21.690  3.769  19.788  1.00 0.00  ? 159 GLN A NE2  2  
ATOM   5046  H  H    . GLN A 1 159 ? 19.976  7.537  22.075  1.00 0.00  ? 159 GLN A H    2  
ATOM   5047  H  HA   . GLN A 1 159 ? 21.054  5.686  24.121  1.00 0.00  ? 159 GLN A HA   2  
ATOM   5048  H  HB2  . GLN A 1 159 ? 22.129  4.527  22.258  1.00 0.00  ? 159 GLN A HB2  2  
ATOM   5049  H  HB3  . GLN A 1 159 ? 20.427  4.786  21.879  1.00 0.00  ? 159 GLN A HB3  2  
ATOM   5050  H  HG2  . GLN A 1 159 ? 21.033  6.777  20.545  1.00 0.00  ? 159 GLN A HG2  2  
ATOM   5051  H  HG3  . GLN A 1 159 ? 22.733  6.507  20.920  1.00 0.00  ? 159 GLN A HG3  2  
ATOM   5052  H  HE21 . GLN A 1 159 ? 21.474  3.434  20.681  1.00 0.00  ? 159 GLN A HE21 2  
ATOM   5053  H  HE22 . GLN A 1 159 ? 21.758  3.145  19.038  1.00 0.00  ? 159 GLN A HE22 2  
ATOM   5054  N  N    . GLU A 1 160 ? 22.714  8.120  22.737  1.00 0.00  ? 160 GLU A N    2  
ATOM   5055  C  CA   . GLU A 1 160 ? 23.961  8.917  22.883  1.00 0.00  ? 160 GLU A CA   2  
ATOM   5056  C  C    . GLU A 1 160 ? 23.806  9.844  24.089  1.00 0.00  ? 160 GLU A C    2  
ATOM   5057  O  O    . GLU A 1 160 ? 24.765  10.174 24.758  1.00 0.00  ? 160 GLU A O    2  
ATOM   5058  C  CB   . GLU A 1 160 ? 24.203  9.736  21.615  1.00 0.00  ? 160 GLU A CB   2  
ATOM   5059  C  CG   . GLU A 1 160 ? 24.331  8.785  20.426  1.00 0.00  ? 160 GLU A CG   2  
ATOM   5060  C  CD   . GLU A 1 160 ? 25.739  8.885  19.843  1.00 0.00  ? 160 GLU A CD   2  
ATOM   5061  O  OE1  . GLU A 1 160 ? 26.223  9.996  19.707  1.00 0.00  ? 160 GLU A OE1  2  
ATOM   5062  O  OE2  . GLU A 1 160 ? 26.310  7.849  19.546  1.00 0.00  ? 160 GLU A OE2  2  
ATOM   5063  H  H    . GLU A 1 160 ? 21.990  8.442  22.159  1.00 0.00  ? 160 GLU A H    2  
ATOM   5064  H  HA   . GLU A 1 160 ? 24.795  8.250  23.048  1.00 0.00  ? 160 GLU A HA   2  
ATOM   5065  H  HB2  . GLU A 1 160 ? 23.374  10.409 21.453  1.00 0.00  ? 160 GLU A HB2  2  
ATOM   5066  H  HB3  . GLU A 1 160 ? 25.116  10.304 21.719  1.00 0.00  ? 160 GLU A HB3  2  
ATOM   5067  H  HG2  . GLU A 1 160 ? 24.151  7.772  20.758  1.00 0.00  ? 160 GLU A HG2  2  
ATOM   5068  H  HG3  . GLU A 1 160 ? 23.608  9.051  19.670  1.00 0.00  ? 160 GLU A HG3  2  
ATOM   5069  N  N    . LEU A 1 161 ? 22.600  10.255 24.382  1.00 0.00  ? 161 LEU A N    2  
ATOM   5070  C  CA   . LEU A 1 161 ? 22.385  11.144 25.558  1.00 0.00  ? 161 LEU A CA   2  
ATOM   5071  C  C    . LEU A 1 161 ? 21.983  10.291 26.764  1.00 0.00  ? 161 LEU A C    2  
ATOM   5072  O  O    . LEU A 1 161 ? 22.236  10.647 27.896  1.00 0.00  ? 161 LEU A O    2  
ATOM   5073  C  CB   . LEU A 1 161 ? 21.266  12.148 25.258  1.00 0.00  ? 161 LEU A CB   2  
ATOM   5074  C  CG   . LEU A 1 161 ? 21.546  13.461 25.996  1.00 0.00  ? 161 LEU A CG   2  
ATOM   5075  C  CD1  . LEU A 1 161 ? 21.724  13.188 27.492  1.00 0.00  ? 161 LEU A CD1  2  
ATOM   5076  C  CD2  . LEU A 1 161 ? 22.823  14.088 25.440  1.00 0.00  ? 161 LEU A CD2  2  
ATOM   5077  H  H    . LEU A 1 161 ? 21.836  9.970  23.834  1.00 0.00  ? 161 LEU A H    2  
ATOM   5078  H  HA   . LEU A 1 161 ? 23.297  11.676 25.779  1.00 0.00  ? 161 LEU A HA   2  
ATOM   5079  H  HB2  . LEU A 1 161 ? 21.222  12.334 24.194  1.00 0.00  ? 161 LEU A HB2  2  
ATOM   5080  H  HB3  . LEU A 1 161 ? 20.322  11.745 25.593  1.00 0.00  ? 161 LEU A HB3  2  
ATOM   5081  H  HG   . LEU A 1 161 ? 20.718  14.139 25.852  1.00 0.00  ? 161 LEU A HG   2  
ATOM   5082  H  HD11 . LEU A 1 161 ? 22.699  12.756 27.667  1.00 0.00  ? 161 LEU A HD11 2  
ATOM   5083  H  HD12 . LEU A 1 161 ? 20.961  12.503 27.827  1.00 0.00  ? 161 LEU A HD12 2  
ATOM   5084  H  HD13 . LEU A 1 161 ? 21.640  14.117 28.040  1.00 0.00  ? 161 LEU A HD13 2  
ATOM   5085  H  HD21 . LEU A 1 161 ? 22.846  15.138 25.688  1.00 0.00  ? 161 LEU A HD21 2  
ATOM   5086  H  HD22 . LEU A 1 161 ? 22.842  13.972 24.367  1.00 0.00  ? 161 LEU A HD22 2  
ATOM   5087  H  HD23 . LEU A 1 161 ? 23.682  13.596 25.871  1.00 0.00  ? 161 LEU A HD23 2  
ATOM   5088  N  N    . TYR A 1 162 ? 21.361  9.164  26.534  1.00 0.00  ? 162 TYR A N    2  
ATOM   5089  C  CA   . TYR A 1 162 ? 20.952  8.299  27.676  1.00 0.00  ? 162 TYR A CA   2  
ATOM   5090  C  C    . TYR A 1 162 ? 21.581  6.912  27.516  1.00 0.00  ? 162 TYR A C    2  
ATOM   5091  O  O    . TYR A 1 162 ? 22.684  6.669  27.963  1.00 0.00  ? 162 TYR A O    2  
ATOM   5092  C  CB   . TYR A 1 162 ? 19.424  8.191  27.706  1.00 0.00  ? 162 TYR A CB   2  
ATOM   5093  C  CG   . TYR A 1 162 ? 18.885  9.174  28.715  1.00 0.00  ? 162 TYR A CG   2  
ATOM   5094  C  CD1  . TYR A 1 162 ? 19.268  9.078  30.058  1.00 0.00  ? 162 TYR A CD1  2  
ATOM   5095  C  CD2  . TYR A 1 162 ? 18.013  10.191 28.306  1.00 0.00  ? 162 TYR A CD2  2  
ATOM   5096  C  CE1  . TYR A 1 162 ? 18.779  9.999  30.992  1.00 0.00  ? 162 TYR A CE1  2  
ATOM   5097  C  CE2  . TYR A 1 162 ? 17.526  11.111 29.240  1.00 0.00  ? 162 TYR A CE2  2  
ATOM   5098  C  CZ   . TYR A 1 162 ? 17.910  11.016 30.582  1.00 0.00  ? 162 TYR A CZ   2  
ATOM   5099  O  OH   . TYR A 1 162 ? 17.432  11.926 31.501  1.00 0.00  ? 162 TYR A OH   2  
ATOM   5100  H  H    . TYR A 1 162 ? 21.162  8.887  25.613  1.00 0.00  ? 162 TYR A H    2  
ATOM   5101  H  HA   . TYR A 1 162 ? 21.295  8.742  28.600  1.00 0.00  ? 162 TYR A HA   2  
ATOM   5102  H  HB2  . TYR A 1 162 ? 19.029  8.429  26.731  1.00 0.00  ? 162 TYR A HB2  2  
ATOM   5103  H  HB3  . TYR A 1 162 ? 19.131  7.190  27.982  1.00 0.00  ? 162 TYR A HB3  2  
ATOM   5104  H  HD1  . TYR A 1 162 ? 19.936  8.292  30.374  1.00 0.00  ? 162 TYR A HD1  2  
ATOM   5105  H  HD2  . TYR A 1 162 ? 17.719  10.265 27.270  1.00 0.00  ? 162 TYR A HD2  2  
ATOM   5106  H  HE1  . TYR A 1 162 ? 19.075  9.928  32.028  1.00 0.00  ? 162 TYR A HE1  2  
ATOM   5107  H  HE2  . TYR A 1 162 ? 16.853  11.894 28.925  1.00 0.00  ? 162 TYR A HE2  2  
ATOM   5108  H  HH   . TYR A 1 162 ? 18.175  12.228 32.033  1.00 0.00  ? 162 TYR A HH   2  
ATOM   5109  N  N    . GLY A 1 163 ? 20.899  6.001  26.879  1.00 0.00  ? 163 GLY A N    2  
ATOM   5110  C  CA   . GLY A 1 163 ? 21.479  4.639  26.695  1.00 0.00  ? 163 GLY A CA   2  
ATOM   5111  C  C    . GLY A 1 163 ? 20.461  3.581  27.125  1.00 0.00  ? 163 GLY A C    2  
ATOM   5112  O  O    . GLY A 1 163 ? 20.159  2.715  26.320  1.00 0.00  ? 163 GLY A O    2  
ATOM   5113  O  OXT  . GLY A 1 163 ? 20.004  3.652  28.252  1.00 0.00  ? 163 GLY A OXT  2  
ATOM   5114  H  H    . GLY A 1 163 ? 20.012  6.212  26.519  1.00 0.00  ? 163 GLY A H    2  
ATOM   5115  H  HA2  . GLY A 1 163 ? 21.735  4.495  25.654  1.00 0.00  ? 163 GLY A HA2  2  
ATOM   5116  H  HA3  . GLY A 1 163 ? 22.369  4.542  27.300  1.00 0.00  ? 163 GLY A HA3  2  
HETATM 5117  ZN ZN   . ZN  B 2 .   ? 9.298   29.640 28.975  1.00 11.59 ? 165 ZN  A ZN   2  
HETATM 5118  ZN ZN   . ZN  C 2 .   ? 11.131  22.047 18.611  1.00 10.57 ? 166 ZN  A ZN   2  
HETATM 5119  CA CA   . CA  D 3 .   ? -0.542  30.036 21.461  1.00 9.12  ? 167 CA  A CA   2  
HETATM 5120  CA CA   . CA  E 3 .   ? 14.667  22.361 36.333  1.00 8.09  ? 168 CA  A CA   2  
HETATM 5121  C  C38  . I52 F 4 .   ? 4.226   10.960 17.812  1.00 20.00 ? 800 I52 A C38  2  
HETATM 5122  C  C39  . I52 F 4 .   ? 5.048   9.744  18.182  1.00 20.00 ? 800 I52 A C39  2  
HETATM 5123  C  C37  . I52 F 4 .   ? 4.616   11.512 16.451  1.00 20.00 ? 800 I52 A C37  2  
HETATM 5124  C  C35  . I52 F 4 .   ? 5.971   13.405 15.499  1.00 20.00 ? 800 I52 A C35  2  
HETATM 5125  C  C36  . I52 F 4 .   ? 5.919   12.278 16.526  1.00 20.00 ? 800 I52 A C36  2  
HETATM 5126  C  C25  . I52 F 4 .   ? 10.935  26.937 18.740  1.00 20.00 ? 800 I52 A C25  2  
HETATM 5127  C  C24  . I52 F 4 .   ? 10.700  26.528 21.176  1.00 20.00 ? 800 I52 A C24  2  
HETATM 5128  N  N8   . I52 F 4 .   ? 9.971   26.585 15.374  1.00 20.00 ? 800 I52 A N8   2  
HETATM 5129  C  C7   . I52 F 4 .   ? 9.018   25.934 16.275  1.00 20.00 ? 800 I52 A C7   2  
HETATM 5130  C  C9   . I52 F 4 .   ? 9.357   27.582 14.451  1.00 20.00 ? 800 I52 A C9   2  
HETATM 5131  C  C13  . I52 F 4 .   ? 10.787  25.600 14.602  1.00 20.00 ? 800 I52 A C13  2  
HETATM 5132  O  O11  . I52 F 4 .   ? 11.655  27.661 13.489  1.00 20.00 ? 800 I52 A O11  2  
HETATM 5133  C  C12  . I52 F 4 .   ? 11.777  26.213 13.574  1.00 20.00 ? 800 I52 A C12  2  
HETATM 5134  C  C10  . I52 F 4 .   ? 10.286  28.116 13.326  1.00 20.00 ? 800 I52 A C10  2  
HETATM 5135  C  C31  . I52 F 4 .   ? 4.596   15.051 16.913  1.00 20.00 ? 800 I52 A C31  2  
HETATM 5136  C  C23  . I52 F 4 .   ? 9.926   26.798 19.890  1.00 20.00 ? 800 I52 A C23  2  
HETATM 5137  O  O26  . I52 F 4 .   ? 10.019  23.920 18.396  1.00 20.00 ? 800 I52 A O26  2  
HETATM 5138  C  C4   . I52 F 4 .   ? 8.812   25.708 19.600  1.00 20.00 ? 800 I52 A C4   2  
HETATM 5139  C  C6   . I52 F 4 .   ? 8.253   26.791 17.299  1.00 20.00 ? 800 I52 A C6   2  
HETATM 5140  S  S14  . I52 F 4 .   ? 6.166   25.621 18.700  1.00 20.00 ? 800 I52 A S14  2  
HETATM 5141  N  N5   . I52 F 4 .   ? 7.797   26.062 18.527  1.00 20.00 ? 800 I52 A N5   2  
HETATM 5142  C  C3   . I52 F 4 .   ? 9.448   24.311 19.409  1.00 20.00 ? 800 I52 A C3   2  
HETATM 5143  O  O1   . I52 F 4 .   ? 9.887   22.203 20.392  1.00 20.00 ? 800 I52 A O1   2  
HETATM 5144  N  N2   . I52 F 4 .   ? 9.316   23.492 20.521  1.00 20.00 ? 800 I52 A N2   2  
HETATM 5145  O  O21  . I52 F 4 .   ? 5.816   25.761 20.103  1.00 20.00 ? 800 I52 A O21  2  
HETATM 5146  O  O41  . I52 F 4 .   ? 4.680   18.817 18.981  1.00 20.00 ? 800 I52 A O41  2  
HETATM 5147  C  C28  . I52 F 4 .   ? 5.291   18.707 17.926  1.00 20.00 ? 800 I52 A C28  2  
HETATM 5148  N  N27  . I52 F 4 .   ? 5.901   19.727 17.201  1.00 20.00 ? 800 I52 A N27  2  
HETATM 5149  C  C29  . I52 F 4 .   ? 5.424   17.356 17.322  1.00 20.00 ? 800 I52 A C29  2  
HETATM 5150  C  C33  . I52 F 4 .   ? 6.767   15.786 15.944  1.00 20.00 ? 800 I52 A C33  2  
HETATM 5151  C  C34  . I52 F 4 .   ? 6.595   17.076 16.538  1.00 20.00 ? 800 I52 A C34  2  
HETATM 5152  C  C30  . I52 F 4 .   ? 4.421   16.341 17.509  1.00 20.00 ? 800 I52 A C30  2  
HETATM 5153  C  C32  . I52 F 4 .   ? 5.774   14.762 16.125  1.00 20.00 ? 800 I52 A C32  2  
HETATM 5154  C  C16  . I52 F 4 .   ? 5.363   22.987 19.068  1.00 20.00 ? 800 I52 A C16  2  
HETATM 5155  C  C18  . I52 F 4 .   ? 5.960   21.121 17.498  1.00 20.00 ? 800 I52 A C18  2  
HETATM 5156  C  C15  . I52 F 4 .   ? 6.066   23.913 18.233  1.00 20.00 ? 800 I52 A C15  2  
HETATM 5157  O  O22  . I52 F 4 .   ? 5.411   26.344 17.707  1.00 20.00 ? 800 I52 A O22  2  
HETATM 5158  C  C20  . I52 F 4 .   ? 6.709   23.459 17.037  1.00 20.00 ? 800 I52 A C20  2  
HETATM 5159  C  C17  . I52 F 4 .   ? 5.311   21.602 18.705  1.00 20.00 ? 800 I52 A C17  2  
HETATM 5160  C  C19  . I52 F 4 .   ? 6.653   22.069 16.672  1.00 20.00 ? 800 I52 A C19  2  
HETATM 5161  H  H381 . I52 F 4 .   ? 4.421   11.739 18.569  1.00 20.00 ? 800 I52 A H381 2  
HETATM 5162  H  H382 . I52 F 4 .   ? 3.157   10.715 17.841  1.00 20.00 ? 800 I52 A H382 2  
HETATM 5163  H  H391 . I52 F 4 .   ? 4.545   8.831  17.854  1.00 20.00 ? 800 I52 A H391 2  
HETATM 5164  H  H392 . I52 F 4 .   ? 5.169   9.680  19.271  1.00 20.00 ? 800 I52 A H392 2  
HETATM 5165  H  H393 . I52 F 4 .   ? 6.038   9.779  17.720  1.00 20.00 ? 800 I52 A H393 2  
HETATM 5166  H  H371 . I52 F 4 .   ? 4.758   10.659 15.762  1.00 20.00 ? 800 I52 A H371 2  
HETATM 5167  H  H372 . I52 F 4 .   ? 3.818   12.147 16.050  1.00 20.00 ? 800 I52 A H372 2  
HETATM 5168  H  H351 . I52 F 4 .   ? 6.969   13.396 15.022  1.00 20.00 ? 800 I52 A H351 2  
HETATM 5169  H  H352 . I52 F 4 .   ? 5.238   13.245 14.700  1.00 20.00 ? 800 I52 A H352 2  
HETATM 5170  H  H361 . I52 F 4 .   ? 6.738   11.570 16.311  1.00 20.00 ? 800 I52 A H361 2  
HETATM 5171  H  H362 . I52 F 4 .   ? 6.070   12.668 17.543  1.00 20.00 ? 800 I52 A H362 2  
HETATM 5172  H  H251 . I52 F 4 .   ? 11.710  27.671 18.973  1.00 20.00 ? 800 I52 A H251 2  
HETATM 5173  H  H252 . I52 F 4 .   ? 10.427  27.286 17.833  1.00 20.00 ? 800 I52 A H252 2  
HETATM 5174  H  H253 . I52 F 4 .   ? 11.416  25.982 18.507  1.00 20.00 ? 800 I52 A H253 2  
HETATM 5175  H  H241 . I52 F 4 .   ? 11.709  26.163 20.964  1.00 20.00 ? 800 I52 A H241 2  
HETATM 5176  H  H242 . I52 F 4 .   ? 10.195  25.748 21.759  1.00 20.00 ? 800 I52 A H242 2  
HETATM 5177  H  H243 . I52 F 4 .   ? 10.768  27.415 21.810  1.00 20.00 ? 800 I52 A H243 2  
HETATM 5178  H  H71  . I52 F 4 .   ? 9.573   25.157 16.830  1.00 20.00 ? 800 I52 A H71  2  
HETATM 5179  H  H72  . I52 F 4 .   ? 8.309   25.396 15.640  1.00 20.00 ? 800 I52 A H72  2  
HETATM 5180  H  H91  . I52 F 4 .   ? 9.092   28.447 15.079  6.00 20.00 ? 800 I52 A H91  2  
HETATM 5181  H  H92  . I52 F 4 .   ? 8.416   27.213 14.029  6.00 20.00 ? 800 I52 A H92  2  
HETATM 5182  H  H131 . I52 F 4 .   ? 10.106  24.919 14.055  6.00 20.00 ? 800 I52 A H131 2  
HETATM 5183  H  H132 . I52 F 4 .   ? 11.347  24.988 15.317  6.00 20.00 ? 800 I52 A H132 2  
HETATM 5184  H  H121 . I52 F 4 .   ? 12.804  26.011 13.918  7.00 20.00 ? 800 I52 A H121 2  
HETATM 5185  H  H122 . I52 F 4 .   ? 11.666  25.777 12.577  7.00 20.00 ? 800 I52 A H122 2  
HETATM 5186  H  H101 . I52 F 4 .   ? 9.939   27.751 12.344  7.00 20.00 ? 800 I52 A H101 2  
HETATM 5187  H  H102 . I52 F 4 .   ? 10.282  29.212 13.304  7.00 20.00 ? 800 I52 A H102 2  
HETATM 5188  H  H31  . I52 F 4 .   ? 3.834   14.288 17.058  3.00 20.00 ? 800 I52 A H31  2  
HETATM 5189  H  H23  . I52 F 4 .   ? 9.431   27.773 20.000  1.00 20.00 ? 800 I52 A H23  2  
HETATM 5190  H  H4   . I52 F 4 .   ? 8.265   25.578 20.549  1.00 20.00 ? 800 I52 A H4   2  
HETATM 5191  H  H61  . I52 F 4 .   ? 8.938   27.583 17.630  1.00 20.00 ? 800 I52 A H61  2  
HETATM 5192  H  H62  . I52 F 4 .   ? 7.400   27.297 16.839  1.00 20.00 ? 800 I52 A H62  2  
HETATM 5193  H  H1   . I52 F 4 .   ? 9.334   21.659 20.999  1.00 20.00 ? 800 I52 A H1   2  
HETATM 5194  H  H2   . I52 F 4 .   ? 8.832   23.797 21.378  1.00 20.00 ? 800 I52 A H2   2  
HETATM 5195  H  H27  . I52 F 4 .   ? 6.377   19.434 16.336  1.00 20.00 ? 800 I52 A H27  2  
HETATM 5196  H  H33  . I52 F 4 .   ? 7.659   15.590 15.352  3.00 20.00 ? 800 I52 A H33  2  
HETATM 5197  H  H34  . I52 F 4 .   ? 7.354   17.843 16.392  3.00 20.00 ? 800 I52 A H34  2  
HETATM 5198  H  H30  . I52 F 4 .   ? 3.527   16.535 18.093  3.00 20.00 ? 800 I52 A H30  2  
HETATM 5199  H  H16  . I52 F 4 .   ? 4.869   23.317 19.977  2.00 20.00 ? 800 I52 A H16  2  
HETATM 5200  H  H20  . I52 F 4 .   ? 7.246   24.149 16.389  2.00 20.00 ? 800 I52 A H20  2  
HETATM 5201  H  H17  . I52 F 4 .   ? 4.771   20.916 19.353  2.00 20.00 ? 800 I52 A H17  2  
HETATM 5202  H  H19  . I52 F 4 .   ? 7.152   21.771 15.756  2.00 20.00 ? 800 I52 A H19  2  
ATOM   5203  N  N    . MET A 1 1   ? 17.737  46.095 25.757  1.00 0.00  ? 1   MET A N    3  
ATOM   5204  C  CA   . MET A 1 1   ? 16.888  45.064 26.416  1.00 0.00  ? 1   MET A CA   3  
ATOM   5205  C  C    . MET A 1 1   ? 17.750  43.874 26.833  1.00 0.00  ? 1   MET A C    3  
ATOM   5206  O  O    . MET A 1 1   ? 18.258  43.821 27.935  1.00 0.00  ? 1   MET A O    3  
ATOM   5207  C  CB   . MET A 1 1   ? 15.807  44.588 25.445  1.00 0.00  ? 1   MET A CB   3  
ATOM   5208  C  CG   . MET A 1 1   ? 14.555  45.448 25.622  1.00 0.00  ? 1   MET A CG   3  
ATOM   5209  S  SD   . MET A 1 1   ? 13.348  45.025 24.343  1.00 0.00  ? 1   MET A SD   3  
ATOM   5210  C  CE   . MET A 1 1   ? 14.334  45.555 22.924  1.00 0.00  ? 1   MET A CE   3  
ATOM   5211  H  H1   . MET A 1 1   ? 17.183  46.961 25.614  1.00 0.00  ? 1   MET A H1   3  
ATOM   5212  H  H2   . MET A 1 1   ? 18.066  45.737 24.837  1.00 0.00  ? 1   MET A H2   3  
ATOM   5213  H  H3   . MET A 1 1   ? 18.556  46.307 26.359  1.00 0.00  ? 1   MET A H3   3  
ATOM   5214  H  HA   . MET A 1 1   ? 16.420  45.490 27.290  1.00 0.00  ? 1   MET A HA   3  
ATOM   5215  H  HB2  . MET A 1 1   ? 16.167  44.676 24.430  1.00 0.00  ? 1   MET A HB2  3  
ATOM   5216  H  HB3  . MET A 1 1   ? 15.566  43.557 25.653  1.00 0.00  ? 1   MET A HB3  3  
ATOM   5217  H  HG2  . MET A 1 1   ? 14.125  45.267 26.596  1.00 0.00  ? 1   MET A HG2  3  
ATOM   5218  H  HG3  . MET A 1 1   ? 14.821  46.490 25.534  1.00 0.00  ? 1   MET A HG3  3  
ATOM   5219  H  HE1  . MET A 1 1   ? 14.817  44.693 22.481  1.00 0.00  ? 1   MET A HE1  3  
ATOM   5220  H  HE2  . MET A 1 1   ? 15.083  46.260 23.249  1.00 0.00  ? 1   MET A HE2  3  
ATOM   5221  H  HE3  . MET A 1 1   ? 13.690  46.029 22.197  1.00 0.00  ? 1   MET A HE3  3  
ATOM   5222  N  N    . TYR A 1 2   ? 17.905  42.912 25.969  1.00 0.00  ? 2   TYR A N    3  
ATOM   5223  C  CA   . TYR A 1 2   ? 18.716  41.721 26.320  1.00 0.00  ? 2   TYR A CA   3  
ATOM   5224  C  C    . TYR A 1 2   ? 17.914  40.837 27.267  1.00 0.00  ? 2   TYR A C    3  
ATOM   5225  O  O    . TYR A 1 2   ? 17.467  41.257 28.316  1.00 0.00  ? 2   TYR A O    3  
ATOM   5226  C  CB   . TYR A 1 2   ? 20.039  42.144 26.973  1.00 0.00  ? 2   TYR A CB   3  
ATOM   5227  C  CG   . TYR A 1 2   ? 21.174  41.727 26.068  1.00 0.00  ? 2   TYR A CG   3  
ATOM   5228  C  CD1  . TYR A 1 2   ? 20.993  41.764 24.683  1.00 0.00  ? 2   TYR A CD1  3  
ATOM   5229  C  CD2  . TYR A 1 2   ? 22.396  41.290 26.604  1.00 0.00  ? 2   TYR A CD2  3  
ATOM   5230  C  CE1  . TYR A 1 2   ? 22.021  41.362 23.830  1.00 0.00  ? 2   TYR A CE1  3  
ATOM   5231  C  CE2  . TYR A 1 2   ? 23.430  40.892 25.747  1.00 0.00  ? 2   TYR A CE2  3  
ATOM   5232  C  CZ   . TYR A 1 2   ? 23.241  40.926 24.358  1.00 0.00  ? 2   TYR A CZ   3  
ATOM   5233  O  OH   . TYR A 1 2   ? 24.249  40.520 23.509  1.00 0.00  ? 2   TYR A OH   3  
ATOM   5234  H  H    . TYR A 1 2   ? 17.475  42.968 25.090  1.00 0.00  ? 2   TYR A H    3  
ATOM   5235  H  HA   . TYR A 1 2   ? 18.924  41.161 25.422  1.00 0.00  ? 2   TYR A HA   3  
ATOM   5236  H  HB2  . TYR A 1 2   ? 20.055  43.217 27.105  1.00 0.00  ? 2   TYR A HB2  3  
ATOM   5237  H  HB3  . TYR A 1 2   ? 20.145  41.658 27.932  1.00 0.00  ? 2   TYR A HB3  3  
ATOM   5238  H  HD1  . TYR A 1 2   ? 20.052  42.103 24.272  1.00 0.00  ? 2   TYR A HD1  3  
ATOM   5239  H  HD2  . TYR A 1 2   ? 22.543  41.265 27.674  1.00 0.00  ? 2   TYR A HD2  3  
ATOM   5240  H  HE1  . TYR A 1 2   ? 21.875  41.393 22.761  1.00 0.00  ? 2   TYR A HE1  3  
ATOM   5241  H  HE2  . TYR A 1 2   ? 24.372  40.556 26.154  1.00 0.00  ? 2   TYR A HE2  3  
ATOM   5242  H  HH   . TYR A 1 2   ? 24.893  41.228 23.450  1.00 0.00  ? 2   TYR A HH   3  
ATOM   5243  N  N    . ASN A 1 3   ? 17.719  39.614 26.885  1.00 0.00  ? 3   ASN A N    3  
ATOM   5244  C  CA   . ASN A 1 3   ? 16.939  38.674 27.725  1.00 0.00  ? 3   ASN A CA   3  
ATOM   5245  C  C    . ASN A 1 3   ? 17.860  37.536 28.157  1.00 0.00  ? 3   ASN A C    3  
ATOM   5246  O  O    . ASN A 1 3   ? 17.475  36.383 28.180  1.00 0.00  ? 3   ASN A O    3  
ATOM   5247  C  CB   . ASN A 1 3   ? 15.786  38.118 26.886  1.00 0.00  ? 3   ASN A CB   3  
ATOM   5248  C  CG   . ASN A 1 3   ? 14.559  39.021 27.027  1.00 0.00  ? 3   ASN A CG   3  
ATOM   5249  O  OD1  . ASN A 1 3   ? 13.468  38.547 27.276  1.00 0.00  ? 3   ASN A OD1  3  
ATOM   5250  N  ND2  . ASN A 1 3   ? 14.688  40.311 26.873  1.00 0.00  ? 3   ASN A ND2  3  
ATOM   5251  H  H    . ASN A 1 3   ? 18.084  39.311 26.028  1.00 0.00  ? 3   ASN A H    3  
ATOM   5252  H  HA   . ASN A 1 3   ? 16.551  39.189 28.592  1.00 0.00  ? 3   ASN A HA   3  
ATOM   5253  H  HB2  . ASN A 1 3   ? 16.090  38.084 25.848  1.00 0.00  ? 3   ASN A HB2  3  
ATOM   5254  H  HB3  . ASN A 1 3   ? 15.540  37.123 27.225  1.00 0.00  ? 3   ASN A HB3  3  
ATOM   5255  H  HD21 . ASN A 1 3   ? 15.568  40.695 26.669  1.00 0.00  ? 3   ASN A HD21 3  
ATOM   5256  H  HD22 . ASN A 1 3   ? 13.906  40.896 26.960  1.00 0.00  ? 3   ASN A HD22 3  
ATOM   5257  N  N    . PHE A 1 4   ? 19.087  37.852 28.474  1.00 0.00  ? 4   PHE A N    3  
ATOM   5258  C  CA   . PHE A 1 4   ? 20.047  36.789 28.874  1.00 0.00  ? 4   PHE A CA   3  
ATOM   5259  C  C    . PHE A 1 4   ? 20.312  36.848 30.372  1.00 0.00  ? 4   PHE A C    3  
ATOM   5260  O  O    . PHE A 1 4   ? 19.818  37.711 31.070  1.00 0.00  ? 4   PHE A O    3  
ATOM   5261  C  CB   . PHE A 1 4   ? 21.355  36.979 28.111  1.00 0.00  ? 4   PHE A CB   3  
ATOM   5262  C  CG   . PHE A 1 4   ? 21.238  36.321 26.758  1.00 0.00  ? 4   PHE A CG   3  
ATOM   5263  C  CD1  . PHE A 1 4   ? 20.278  36.765 25.841  1.00 0.00  ? 4   PHE A CD1  3  
ATOM   5264  C  CD2  . PHE A 1 4   ? 22.086  35.259 26.422  1.00 0.00  ? 4   PHE A CD2  3  
ATOM   5265  C  CE1  . PHE A 1 4   ? 20.167  36.151 24.590  1.00 0.00  ? 4   PHE A CE1  3  
ATOM   5266  C  CE2  . PHE A 1 4   ? 21.973  34.645 25.169  1.00 0.00  ? 4   PHE A CE2  3  
ATOM   5267  C  CZ   . PHE A 1 4   ? 21.014  35.091 24.254  1.00 0.00  ? 4   PHE A CZ   3  
ATOM   5268  H  H    . PHE A 1 4   ? 19.378  38.785 28.429  1.00 0.00  ? 4   PHE A H    3  
ATOM   5269  H  HA   . PHE A 1 4   ? 19.630  35.824 28.629  1.00 0.00  ? 4   PHE A HA   3  
ATOM   5270  H  HB2  . PHE A 1 4   ? 21.549  38.034 27.984  1.00 0.00  ? 4   PHE A HB2  3  
ATOM   5271  H  HB3  . PHE A 1 4   ? 22.164  36.528 28.664  1.00 0.00  ? 4   PHE A HB3  3  
ATOM   5272  H  HD1  . PHE A 1 4   ? 19.621  37.583 26.100  1.00 0.00  ? 4   PHE A HD1  3  
ATOM   5273  H  HD2  . PHE A 1 4   ? 22.827  34.916 27.127  1.00 0.00  ? 4   PHE A HD2  3  
ATOM   5274  H  HE1  . PHE A 1 4   ? 19.428  36.493 23.884  1.00 0.00  ? 4   PHE A HE1  3  
ATOM   5275  H  HE2  . PHE A 1 4   ? 22.626  33.826 24.908  1.00 0.00  ? 4   PHE A HE2  3  
ATOM   5276  H  HZ   . PHE A 1 4   ? 20.927  34.617 23.288  1.00 0.00  ? 4   PHE A HZ   3  
ATOM   5277  N  N    . PHE A 1 5   ? 21.079  35.922 30.873  1.00 0.00  ? 5   PHE A N    3  
ATOM   5278  C  CA   . PHE A 1 5   ? 21.360  35.908 32.332  1.00 0.00  ? 5   PHE A CA   3  
ATOM   5279  C  C    . PHE A 1 5   ? 22.091  34.614 32.698  1.00 0.00  ? 5   PHE A C    3  
ATOM   5280  O  O    . PHE A 1 5   ? 23.143  34.653 33.301  1.00 0.00  ? 5   PHE A O    3  
ATOM   5281  C  CB   . PHE A 1 5   ? 20.025  35.976 33.085  1.00 0.00  ? 5   PHE A CB   3  
ATOM   5282  C  CG   . PHE A 1 5   ? 19.993  37.146 34.041  1.00 0.00  ? 5   PHE A CG   3  
ATOM   5283  C  CD1  . PHE A 1 5   ? 20.729  38.309 33.778  1.00 0.00  ? 5   PHE A CD1  3  
ATOM   5284  C  CD2  . PHE A 1 5   ? 19.211  37.062 35.198  1.00 0.00  ? 5   PHE A CD2  3  
ATOM   5285  C  CE1  . PHE A 1 5   ? 20.681  39.383 34.673  1.00 0.00  ? 5   PHE A CE1  3  
ATOM   5286  C  CE2  . PHE A 1 5   ? 19.165  38.135 36.092  1.00 0.00  ? 5   PHE A CE2  3  
ATOM   5287  C  CZ   . PHE A 1 5   ? 19.900  39.296 35.829  1.00 0.00  ? 5   PHE A CZ   3  
ATOM   5288  H  H    . PHE A 1 5   ? 21.458  35.230 30.293  1.00 0.00  ? 5   PHE A H    3  
ATOM   5289  H  HA   . PHE A 1 5   ? 21.974  36.750 32.592  1.00 0.00  ? 5   PHE A HA   3  
ATOM   5290  H  HB2  . PHE A 1 5   ? 19.225  36.084 32.371  1.00 0.00  ? 5   PHE A HB2  3  
ATOM   5291  H  HB3  . PHE A 1 5   ? 19.882  35.059 33.637  1.00 0.00  ? 5   PHE A HB3  3  
ATOM   5292  H  HD1  . PHE A 1 5   ? 21.328  38.384 32.884  1.00 0.00  ? 5   PHE A HD1  3  
ATOM   5293  H  HD2  . PHE A 1 5   ? 18.640  36.167 35.399  1.00 0.00  ? 5   PHE A HD2  3  
ATOM   5294  H  HE1  . PHE A 1 5   ? 21.249  40.279 34.472  1.00 0.00  ? 5   PHE A HE1  3  
ATOM   5295  H  HE2  . PHE A 1 5   ? 18.564  38.067 36.986  1.00 0.00  ? 5   PHE A HE2  3  
ATOM   5296  H  HZ   . PHE A 1 5   ? 19.861  40.127 36.516  1.00 0.00  ? 5   PHE A HZ   3  
ATOM   5297  N  N    . PRO A 1 6   ? 21.500  33.500 32.337  1.00 0.00  ? 6   PRO A N    3  
ATOM   5298  C  CA   . PRO A 1 6   ? 22.071  32.175 32.631  1.00 0.00  ? 6   PRO A CA   3  
ATOM   5299  C  C    . PRO A 1 6   ? 23.134  31.775 31.610  1.00 0.00  ? 6   PRO A C    3  
ATOM   5300  O  O    . PRO A 1 6   ? 22.827  31.428 30.486  1.00 0.00  ? 6   PRO A O    3  
ATOM   5301  C  CB   . PRO A 1 6   ? 20.873  31.239 32.505  1.00 0.00  ? 6   PRO A CB   3  
ATOM   5302  C  CG   . PRO A 1 6   ? 19.855  31.954 31.586  1.00 0.00  ? 6   PRO A CG   3  
ATOM   5303  C  CD   . PRO A 1 6   ? 20.214  33.449 31.605  1.00 0.00  ? 6   PRO A CD   3  
ATOM   5304  H  HA   . PRO A 1 6   ? 22.463  32.139 33.636  1.00 0.00  ? 6   PRO A HA   3  
ATOM   5305  H  HB2  . PRO A 1 6   ? 21.186  30.304 32.061  1.00 0.00  ? 6   PRO A HB2  3  
ATOM   5306  H  HB3  . PRO A 1 6   ? 20.431  31.062 33.473  1.00 0.00  ? 6   PRO A HB3  3  
ATOM   5307  H  HG2  . PRO A 1 6   ? 19.934  31.565 30.583  1.00 0.00  ? 6   PRO A HG2  3  
ATOM   5308  H  HG3  . PRO A 1 6   ? 18.855  31.813 31.962  1.00 0.00  ? 6   PRO A HG3  3  
ATOM   5309  H  HD2  . PRO A 1 6   ? 20.325  33.823 30.597  1.00 0.00  ? 6   PRO A HD2  3  
ATOM   5310  H  HD3  . PRO A 1 6   ? 19.460  34.004 32.134  1.00 0.00  ? 6   PRO A HD3  3  
ATOM   5311  N  N    . ARG A 1 7   ? 24.374  31.774 31.994  1.00 0.00  ? 7   ARG A N    3  
ATOM   5312  C  CA   . ARG A 1 7   ? 25.434  31.341 31.044  1.00 0.00  ? 7   ARG A CA   3  
ATOM   5313  C  C    . ARG A 1 7   ? 25.874  29.946 31.472  1.00 0.00  ? 7   ARG A C    3  
ATOM   5314  O  O    . ARG A 1 7   ? 27.046  29.640 31.548  1.00 0.00  ? 7   ARG A O    3  
ATOM   5315  C  CB   . ARG A 1 7   ? 26.622  32.300 31.100  1.00 0.00  ? 7   ARG A CB   3  
ATOM   5316  C  CG   . ARG A 1 7   ? 27.131  32.379 32.535  1.00 0.00  ? 7   ARG A CG   3  
ATOM   5317  C  CD   . ARG A 1 7   ? 28.590  31.918 32.596  1.00 0.00  ? 7   ARG A CD   3  
ATOM   5318  N  NE   . ARG A 1 7   ? 29.143  32.244 33.942  1.00 0.00  ? 7   ARG A NE   3  
ATOM   5319  C  CZ   . ARG A 1 7   ? 30.432  32.341 34.127  1.00 0.00  ? 7   ARG A CZ   3  
ATOM   5320  N  NH1  . ARG A 1 7   ? 31.257  32.161 33.134  1.00 0.00  ? 7   ARG A NH1  3  
ATOM   5321  N  NH2  . ARG A 1 7   ? 30.892  32.621 35.314  1.00 0.00  ? 7   ARG A NH2  3  
ATOM   5322  H  H    . ARG A 1 7   ? 24.608  32.022 32.912  1.00 0.00  ? 7   ARG A H    3  
ATOM   5323  H  HA   . ARG A 1 7   ? 25.031  31.309 30.041  1.00 0.00  ? 7   ARG A HA   3  
ATOM   5324  H  HB2  . ARG A 1 7   ? 27.410  31.936 30.454  1.00 0.00  ? 7   ARG A HB2  3  
ATOM   5325  H  HB3  . ARG A 1 7   ? 26.311  33.282 30.776  1.00 0.00  ? 7   ARG A HB3  3  
ATOM   5326  H  HG2  . ARG A 1 7   ? 27.061  33.398 32.881  1.00 0.00  ? 7   ARG A HG2  3  
ATOM   5327  H  HG3  . ARG A 1 7   ? 26.527  31.745 33.165  1.00 0.00  ? 7   ARG A HG3  3  
ATOM   5328  H  HD2  . ARG A 1 7   ? 28.640  30.850 32.431  1.00 0.00  ? 7   ARG A HD2  3  
ATOM   5329  H  HD3  . ARG A 1 7   ? 29.161  32.427 31.836  1.00 0.00  ? 7   ARG A HD3  3  
ATOM   5330  H  HE   . ARG A 1 7   ? 28.535  32.384 34.696  1.00 0.00  ? 7   ARG A HE   3  
ATOM   5331  H  HH11 . ARG A 1 7   ? 30.906  31.947 32.224  1.00 0.00  ? 7   ARG A HH11 3  
ATOM   5332  H  HH12 . ARG A 1 7   ? 32.243  32.239 33.284  1.00 0.00  ? 7   ARG A HH12 3  
ATOM   5333  H  HH21 . ARG A 1 7   ? 30.259  32.762 36.075  1.00 0.00  ? 7   ARG A HH21 3  
ATOM   5334  H  HH22 . ARG A 1 7   ? 31.877  32.696 35.462  1.00 0.00  ? 7   ARG A HH22 3  
ATOM   5335  N  N    . LYS A 1 8   ? 24.922  29.104 31.780  1.00 0.00  ? 8   LYS A N    3  
ATOM   5336  C  CA   . LYS A 1 8   ? 25.248  27.728 32.234  1.00 0.00  ? 8   LYS A CA   3  
ATOM   5337  C  C    . LYS A 1 8   ? 25.131  26.753 31.063  1.00 0.00  ? 8   LYS A C    3  
ATOM   5338  O  O    . LYS A 1 8   ? 24.318  26.937 30.180  1.00 0.00  ? 8   LYS A O    3  
ATOM   5339  C  CB   . LYS A 1 8   ? 24.258  27.315 33.328  1.00 0.00  ? 8   LYS A CB   3  
ATOM   5340  C  CG   . LYS A 1 8   ? 24.963  27.317 34.687  1.00 0.00  ? 8   LYS A CG   3  
ATOM   5341  C  CD   . LYS A 1 8   ? 24.712  25.980 35.394  1.00 0.00  ? 8   LYS A CD   3  
ATOM   5342  C  CE   . LYS A 1 8   ? 24.333  26.228 36.861  1.00 0.00  ? 8   LYS A CE   3  
ATOM   5343  N  NZ   . LYS A 1 8   ? 25.364  25.621 37.752  1.00 0.00  ? 8   LYS A NZ   3  
ATOM   5344  H  H    . LYS A 1 8   ? 23.985  29.390 31.725  1.00 0.00  ? 8   LYS A H    3  
ATOM   5345  H  HA   . LYS A 1 8   ? 26.252  27.705 32.628  1.00 0.00  ? 8   LYS A HA   3  
ATOM   5346  H  HB2  . LYS A 1 8   ? 23.434  28.015 33.347  1.00 0.00  ? 8   LYS A HB2  3  
ATOM   5347  H  HB3  . LYS A 1 8   ? 23.885  26.324 33.119  1.00 0.00  ? 8   LYS A HB3  3  
ATOM   5348  H  HG2  . LYS A 1 8   ? 26.025  27.455 34.539  1.00 0.00  ? 8   LYS A HG2  3  
ATOM   5349  H  HG3  . LYS A 1 8   ? 24.576  28.122 35.293  1.00 0.00  ? 8   LYS A HG3  3  
ATOM   5350  H  HD2  . LYS A 1 8   ? 23.906  25.457 34.897  1.00 0.00  ? 8   LYS A HD2  3  
ATOM   5351  H  HD3  . LYS A 1 8   ? 25.609  25.379 35.353  1.00 0.00  ? 8   LYS A HD3  3  
ATOM   5352  H  HE2  . LYS A 1 8   ? 24.277  27.290 37.046  1.00 0.00  ? 8   LYS A HE2  3  
ATOM   5353  H  HE3  . LYS A 1 8   ? 23.373  25.777 37.066  1.00 0.00  ? 8   LYS A HE3  3  
ATOM   5354  H  HZ1  . LYS A 1 8   ? 25.126  24.624 37.928  1.00 0.00  ? 8   LYS A HZ1  3  
ATOM   5355  H  HZ2  . LYS A 1 8   ? 25.394  26.136 38.656  1.00 0.00  ? 8   LYS A HZ2  3  
ATOM   5356  H  HZ3  . LYS A 1 8   ? 26.295  25.677 37.292  1.00 0.00  ? 8   LYS A HZ3  3  
ATOM   5357  N  N    . PRO A 1 9   ? 25.940  25.730 31.102  1.00 0.00  ? 9   PRO A N    3  
ATOM   5358  C  CA   . PRO A 1 9   ? 25.936  24.692 30.065  1.00 0.00  ? 9   PRO A CA   3  
ATOM   5359  C  C    . PRO A 1 9   ? 24.709  23.800 30.250  1.00 0.00  ? 9   PRO A C    3  
ATOM   5360  O  O    . PRO A 1 9   ? 24.806  22.602 30.429  1.00 0.00  ? 9   PRO A O    3  
ATOM   5361  C  CB   . PRO A 1 9   ? 27.247  23.933 30.307  1.00 0.00  ? 9   PRO A CB   3  
ATOM   5362  C  CG   . PRO A 1 9   ? 27.640  24.205 31.778  1.00 0.00  ? 9   PRO A CG   3  
ATOM   5363  C  CD   . PRO A 1 9   ? 26.924  25.509 32.182  1.00 0.00  ? 9   PRO A CD   3  
ATOM   5364  H  HA   . PRO A 1 9   ? 25.935  25.140 29.085  1.00 0.00  ? 9   PRO A HA   3  
ATOM   5365  H  HB2  . PRO A 1 9   ? 27.100  22.874 30.148  1.00 0.00  ? 9   PRO A HB2  3  
ATOM   5366  H  HB3  . PRO A 1 9   ? 28.019  24.306 29.653  1.00 0.00  ? 9   PRO A HB3  3  
ATOM   5367  H  HG2  . PRO A 1 9   ? 27.316  23.387 32.406  1.00 0.00  ? 9   PRO A HG2  3  
ATOM   5368  H  HG3  . PRO A 1 9   ? 28.708  24.334 31.859  1.00 0.00  ? 9   PRO A HG3  3  
ATOM   5369  H  HD2  . PRO A 1 9   ? 26.427  25.388 33.131  1.00 0.00  ? 9   PRO A HD2  3  
ATOM   5370  H  HD3  . PRO A 1 9   ? 27.623  26.330 32.220  1.00 0.00  ? 9   PRO A HD3  3  
ATOM   5371  N  N    . LYS A 1 10  ? 23.553  24.401 30.214  1.00 0.00  ? 10  LYS A N    3  
ATOM   5372  C  CA   . LYS A 1 10  ? 22.283  23.636 30.391  1.00 0.00  ? 10  LYS A CA   3  
ATOM   5373  C  C    . LYS A 1 10  ? 22.473  22.582 31.496  1.00 0.00  ? 10  LYS A C    3  
ATOM   5374  O  O    . LYS A 1 10  ? 23.389  22.672 32.291  1.00 0.00  ? 10  LYS A O    3  
ATOM   5375  C  CB   . LYS A 1 10  ? 21.914  22.961 29.063  1.00 0.00  ? 10  LYS A CB   3  
ATOM   5376  C  CG   . LYS A 1 10  ? 20.572  23.506 28.548  1.00 0.00  ? 10  LYS A CG   3  
ATOM   5377  C  CD   . LYS A 1 10  ? 20.797  24.406 27.322  1.00 0.00  ? 10  LYS A CD   3  
ATOM   5378  C  CE   . LYS A 1 10  ? 20.701  25.876 27.739  1.00 0.00  ? 10  LYS A CE   3  
ATOM   5379  N  NZ   . LYS A 1 10  ? 20.479  26.729 26.533  1.00 0.00  ? 10  LYS A NZ   3  
ATOM   5380  H  H    . LYS A 1 10  ? 23.522  25.369 30.072  1.00 0.00  ? 10  LYS A H    3  
ATOM   5381  H  HA   . LYS A 1 10  ? 21.498  24.321 30.682  1.00 0.00  ? 10  LYS A HA   3  
ATOM   5382  H  HB2  . LYS A 1 10  ? 22.686  23.162 28.334  1.00 0.00  ? 10  LYS A HB2  3  
ATOM   5383  H  HB3  . LYS A 1 10  ? 21.833  21.895 29.215  1.00 0.00  ? 10  LYS A HB3  3  
ATOM   5384  H  HG2  . LYS A 1 10  ? 19.933  22.680 28.272  1.00 0.00  ? 10  LYS A HG2  3  
ATOM   5385  H  HG3  . LYS A 1 10  ? 20.097  24.077 29.325  1.00 0.00  ? 10  LYS A HG3  3  
ATOM   5386  H  HD2  . LYS A 1 10  ? 21.773  24.209 26.904  1.00 0.00  ? 10  LYS A HD2  3  
ATOM   5387  H  HD3  . LYS A 1 10  ? 20.040  24.195 26.581  1.00 0.00  ? 10  LYS A HD3  3  
ATOM   5388  H  HE2  . LYS A 1 10  ? 19.875  26.002 28.424  1.00 0.00  ? 10  LYS A HE2  3  
ATOM   5389  H  HE3  . LYS A 1 10  ? 21.619  26.172 28.225  1.00 0.00  ? 10  LYS A HE3  3  
ATOM   5390  H  HZ1  . LYS A 1 10  ? 21.058  27.591 26.607  1.00 0.00  ? 10  LYS A HZ1  3  
ATOM   5391  H  HZ2  . LYS A 1 10  ? 19.474  26.991 26.475  1.00 0.00  ? 10  LYS A HZ2  3  
ATOM   5392  H  HZ3  . LYS A 1 10  ? 20.750  26.203 25.677  1.00 0.00  ? 10  LYS A HZ3  3  
ATOM   5393  N  N    . TRP A 1 11  ? 21.622  21.587 31.562  1.00 0.00  ? 11  TRP A N    3  
ATOM   5394  C  CA   . TRP A 1 11  ? 21.776  20.543 32.627  1.00 0.00  ? 11  TRP A CA   3  
ATOM   5395  C  C    . TRP A 1 11  ? 22.540  19.338 32.073  1.00 0.00  ? 11  TRP A C    3  
ATOM   5396  O  O    . TRP A 1 11  ? 22.012  18.566 31.300  1.00 0.00  ? 11  TRP A O    3  
ATOM   5397  C  CB   . TRP A 1 11  ? 20.400  20.073 33.104  1.00 0.00  ? 11  TRP A CB   3  
ATOM   5398  C  CG   . TRP A 1 11  ? 19.886  21.017 34.139  1.00 0.00  ? 11  TRP A CG   3  
ATOM   5399  C  CD1  . TRP A 1 11  ? 18.679  21.623 34.098  1.00 0.00  ? 11  TRP A CD1  3  
ATOM   5400  C  CD2  . TRP A 1 11  ? 20.533  21.472 35.365  1.00 0.00  ? 11  TRP A CD2  3  
ATOM   5401  N  NE1  . TRP A 1 11  ? 18.548  22.435 35.209  1.00 0.00  ? 11  TRP A NE1  3  
ATOM   5402  C  CE2  . TRP A 1 11  ? 19.662  22.374 36.021  1.00 0.00  ? 11  TRP A CE2  3  
ATOM   5403  C  CE3  . TRP A 1 11  ? 21.778  21.200 35.963  1.00 0.00  ? 11  TRP A CE3  3  
ATOM   5404  C  CZ2  . TRP A 1 11  ? 20.011  22.984 37.224  1.00 0.00  ? 11  TRP A CZ2  3  
ATOM   5405  C  CZ3  . TRP A 1 11  ? 22.132  21.813 37.175  1.00 0.00  ? 11  TRP A CZ3  3  
ATOM   5406  C  CH2  . TRP A 1 11  ? 21.252  22.703 37.803  1.00 0.00  ? 11  TRP A CH2  3  
ATOM   5407  H  H    . TRP A 1 11  ? 20.886  21.525 30.917  1.00 0.00  ? 11  TRP A H    3  
ATOM   5408  H  HA   . TRP A 1 11  ? 22.318  20.961 33.462  1.00 0.00  ? 11  TRP A HA   3  
ATOM   5409  H  HB2  . TRP A 1 11  ? 19.716  20.042 32.267  1.00 0.00  ? 11  TRP A HB2  3  
ATOM   5410  H  HB3  . TRP A 1 11  ? 20.487  19.085 33.533  1.00 0.00  ? 11  TRP A HB3  3  
ATOM   5411  H  HD1  . TRP A 1 11  ? 17.943  21.501 33.320  1.00 0.00  ? 11  TRP A HD1  3  
ATOM   5412  H  HE1  . TRP A 1 11  ? 17.768  22.991 35.414  1.00 0.00  ? 11  TRP A HE1  3  
ATOM   5413  H  HE3  . TRP A 1 11  ? 22.462  20.512 35.490  1.00 0.00  ? 11  TRP A HE3  3  
ATOM   5414  H  HZ2  . TRP A 1 11  ? 19.328  23.669 37.703  1.00 0.00  ? 11  TRP A HZ2  3  
ATOM   5415  H  HZ3  . TRP A 1 11  ? 23.089  21.599 37.625  1.00 0.00  ? 11  TRP A HZ3  3  
ATOM   5416  H  HH2  . TRP A 1 11  ? 21.531  23.172 38.733  1.00 0.00  ? 11  TRP A HH2  3  
ATOM   5417  N  N    . ASP A 1 12  ? 23.774  19.163 32.458  1.00 0.00  ? 12  ASP A N    3  
ATOM   5418  C  CA   . ASP A 1 12  ? 24.547  17.996 31.936  1.00 0.00  ? 12  ASP A CA   3  
ATOM   5419  C  C    . ASP A 1 12  ? 24.673  16.927 33.014  1.00 0.00  ? 12  ASP A C    3  
ATOM   5420  O  O    . ASP A 1 12  ? 25.682  16.826 33.683  1.00 0.00  ? 12  ASP A O    3  
ATOM   5421  C  CB   . ASP A 1 12  ? 25.944  18.436 31.504  1.00 0.00  ? 12  ASP A CB   3  
ATOM   5422  C  CG   . ASP A 1 12  ? 25.838  19.704 30.655  1.00 0.00  ? 12  ASP A CG   3  
ATOM   5423  O  OD1  . ASP A 1 12  ? 25.208  19.643 29.612  1.00 0.00  ? 12  ASP A OD1  3  
ATOM   5424  O  OD2  . ASP A 1 12  ? 26.389  20.715 31.060  1.00 0.00  ? 12  ASP A OD2  3  
ATOM   5425  H  H    . ASP A 1 12  ? 24.190  19.791 33.088  1.00 0.00  ? 12  ASP A H    3  
ATOM   5426  H  HA   . ASP A 1 12  ? 24.028  17.583 31.084  1.00 0.00  ? 12  ASP A HA   3  
ATOM   5427  H  HB2  . ASP A 1 12  ? 26.550  18.630 32.377  1.00 0.00  ? 12  ASP A HB2  3  
ATOM   5428  H  HB3  . ASP A 1 12  ? 26.400  17.651 30.920  1.00 0.00  ? 12  ASP A HB3  3  
ATOM   5429  N  N    . LYS A 1 13  ? 23.666  16.121 33.185  1.00 0.00  ? 13  LYS A N    3  
ATOM   5430  C  CA   . LYS A 1 13  ? 23.740  15.058 34.217  1.00 0.00  ? 13  LYS A CA   3  
ATOM   5431  C  C    . LYS A 1 13  ? 23.348  13.724 33.595  1.00 0.00  ? 13  LYS A C    3  
ATOM   5432  O  O    . LYS A 1 13  ? 22.615  13.670 32.626  1.00 0.00  ? 13  LYS A O    3  
ATOM   5433  C  CB   . LYS A 1 13  ? 22.803  15.416 35.366  1.00 0.00  ? 13  LYS A CB   3  
ATOM   5434  C  CG   . LYS A 1 13  ? 22.904  16.922 35.607  1.00 0.00  ? 13  LYS A CG   3  
ATOM   5435  C  CD   . LYS A 1 13  ? 22.397  17.269 37.001  1.00 0.00  ? 13  LYS A CD   3  
ATOM   5436  C  CE   . LYS A 1 13  ? 20.975  16.744 37.174  1.00 0.00  ? 13  LYS A CE   3  
ATOM   5437  N  NZ   . LYS A 1 13  ? 20.915  15.906 38.400  1.00 0.00  ? 13  LYS A NZ   3  
ATOM   5438  H  H    . LYS A 1 13  ? 22.862  16.211 32.629  1.00 0.00  ? 13  LYS A H    3  
ATOM   5439  H  HA   . LYS A 1 13  ? 24.751  14.993 34.590  1.00 0.00  ? 13  LYS A HA   3  
ATOM   5440  H  HB2  . LYS A 1 13  ? 21.787  15.151 35.106  1.00 0.00  ? 13  LYS A HB2  3  
ATOM   5441  H  HB3  . LYS A 1 13  ? 23.102  14.886 36.258  1.00 0.00  ? 13  LYS A HB3  3  
ATOM   5442  H  HG2  . LYS A 1 13  ? 23.936  17.229 35.517  1.00 0.00  ? 13  LYS A HG2  3  
ATOM   5443  H  HG3  . LYS A 1 13  ? 22.309  17.441 34.871  1.00 0.00  ? 13  LYS A HG3  3  
ATOM   5444  H  HD2  . LYS A 1 13  ? 23.041  16.816 37.741  1.00 0.00  ? 13  LYS A HD2  3  
ATOM   5445  H  HD3  . LYS A 1 13  ? 22.402  18.340 37.128  1.00 0.00  ? 13  LYS A HD3  3  
ATOM   5446  H  HE2  . LYS A 1 13  ? 20.292  17.575 37.270  1.00 0.00  ? 13  LYS A HE2  3  
ATOM   5447  H  HE3  . LYS A 1 13  ? 20.701  16.148 36.315  1.00 0.00  ? 13  LYS A HE3  3  
ATOM   5448  H  HZ1  . LYS A 1 13  ? 20.208  16.297 39.053  1.00 0.00  ? 13  LYS A HZ1  3  
ATOM   5449  H  HZ2  . LYS A 1 13  ? 21.847  15.901 38.860  1.00 0.00  ? 13  LYS A HZ2  3  
ATOM   5450  H  HZ3  . LYS A 1 13  ? 20.648  14.936 38.145  1.00 0.00  ? 13  LYS A HZ3  3  
ATOM   5451  N  N    . ASN A 1 14  ? 23.843  12.647 34.134  1.00 0.00  ? 14  ASN A N    3  
ATOM   5452  C  CA   . ASN A 1 14  ? 23.516  11.311 33.567  1.00 0.00  ? 14  ASN A CA   3  
ATOM   5453  C  C    . ASN A 1 14  ? 22.130  10.881 34.045  1.00 0.00  ? 14  ASN A C    3  
ATOM   5454  O  O    . ASN A 1 14  ? 21.134  11.153 33.407  1.00 0.00  ? 14  ASN A O    3  
ATOM   5455  C  CB   . ASN A 1 14  ? 24.553  10.293 34.039  1.00 0.00  ? 14  ASN A CB   3  
ATOM   5456  C  CG   . ASN A 1 14  ? 25.920  10.619 33.435  1.00 0.00  ? 14  ASN A CG   3  
ATOM   5457  O  OD1  . ASN A 1 14  ? 26.451  11.692 33.640  1.00 0.00  ? 14  ASN A OD1  3  
ATOM   5458  N  ND2  . ASN A 1 14  ? 26.518  9.726  32.698  1.00 0.00  ? 14  ASN A ND2  3  
ATOM   5459  H  H    . ASN A 1 14  ? 24.438  12.717 34.908  1.00 0.00  ? 14  ASN A H    3  
ATOM   5460  H  HA   . ASN A 1 14  ? 23.526  11.366 32.488  1.00 0.00  ? 14  ASN A HA   3  
ATOM   5461  H  HB2  . ASN A 1 14  ? 24.619  10.326 35.116  1.00 0.00  ? 14  ASN A HB2  3  
ATOM   5462  H  HB3  . ASN A 1 14  ? 24.251  9.304  33.726  1.00 0.00  ? 14  ASN A HB3  3  
ATOM   5463  H  HD21 . ASN A 1 14  ? 26.090  8.860  32.538  1.00 0.00  ? 14  ASN A HD21 3  
ATOM   5464  H  HD22 . ASN A 1 14  ? 27.395  9.918  32.308  1.00 0.00  ? 14  ASN A HD22 3  
ATOM   5465  N  N    . GLN A 1 15  ? 22.056  10.214 35.169  1.00 0.00  ? 15  GLN A N    3  
ATOM   5466  C  CA   . GLN A 1 15  ? 20.731  9.774  35.682  1.00 0.00  ? 15  GLN A CA   3  
ATOM   5467  C  C    . GLN A 1 15  ? 19.852  11.000 35.898  1.00 0.00  ? 15  GLN A C    3  
ATOM   5468  O  O    . GLN A 1 15  ? 20.096  11.803 36.777  1.00 0.00  ? 15  GLN A O    3  
ATOM   5469  C  CB   . GLN A 1 15  ? 20.904  9.044  37.015  1.00 0.00  ? 15  GLN A CB   3  
ATOM   5470  C  CG   . GLN A 1 15  ? 21.146  7.559  36.754  1.00 0.00  ? 15  GLN A CG   3  
ATOM   5471  C  CD   . GLN A 1 15  ? 21.463  6.854  38.071  1.00 0.00  ? 15  GLN A CD   3  
ATOM   5472  O  OE1  . GLN A 1 15  ? 20.721  6.966  39.030  1.00 0.00  ? 15  GLN A OE1  3  
ATOM   5473  N  NE2  . GLN A 1 15  ? 22.542  6.132  38.164  1.00 0.00  ? 15  GLN A NE2  3  
ATOM   5474  H  H    . GLN A 1 15  ? 22.871  10.006 35.675  1.00 0.00  ? 15  GLN A H    3  
ATOM   5475  H  HA   . GLN A 1 15  ? 20.268  9.114  34.965  1.00 0.00  ? 15  GLN A HA   3  
ATOM   5476  H  HB2  . GLN A 1 15  ? 21.744  9.462  37.552  1.00 0.00  ? 15  GLN A HB2  3  
ATOM   5477  H  HB3  . GLN A 1 15  ? 20.006  9.161  37.601  1.00 0.00  ? 15  GLN A HB3  3  
ATOM   5478  H  HG2  . GLN A 1 15  ? 20.258  7.126  36.317  1.00 0.00  ? 15  GLN A HG2  3  
ATOM   5479  H  HG3  . GLN A 1 15  ? 21.978  7.443  36.076  1.00 0.00  ? 15  GLN A HG3  3  
ATOM   5480  H  HE21 . GLN A 1 15  ? 23.140  6.045  37.394  1.00 0.00  ? 15  GLN A HE21 3  
ATOM   5481  H  HE22 . GLN A 1 15  ? 22.756  5.677  39.004  1.00 0.00  ? 15  GLN A HE22 3  
ATOM   5482  N  N    . ILE A 1 16  ? 18.830  11.158 35.109  1.00 0.00  ? 16  ILE A N    3  
ATOM   5483  C  CA   . ILE A 1 16  ? 17.955  12.340 35.285  1.00 0.00  ? 16  ILE A CA   3  
ATOM   5484  C  C    . ILE A 1 16  ? 16.546  11.882 35.598  1.00 0.00  ? 16  ILE A C    3  
ATOM   5485  O  O    . ILE A 1 16  ? 16.092  10.871 35.108  1.00 0.00  ? 16  ILE A O    3  
ATOM   5486  C  CB   . ILE A 1 16  ? 17.939  13.167 34.013  1.00 0.00  ? 16  ILE A CB   3  
ATOM   5487  C  CG1  . ILE A 1 16  ? 19.338  13.738 33.791  1.00 0.00  ? 16  ILE A CG1  3  
ATOM   5488  C  CG2  . ILE A 1 16  ? 16.916  14.294 34.162  1.00 0.00  ? 16  ILE A CG2  3  
ATOM   5489  C  CD1  . ILE A 1 16  ? 19.479  14.196 32.346  1.00 0.00  ? 16  ILE A CD1  3  
ATOM   5490  H  H    . ILE A 1 16  ? 18.637  10.502 34.405  1.00 0.00  ? 16  ILE A H    3  
ATOM   5491  H  HA   . ILE A 1 16  ? 18.330  12.945 36.092  1.00 0.00  ? 16  ILE A HA   3  
ATOM   5492  H  HB   . ILE A 1 16  ? 17.662  12.546 33.182  1.00 0.00  ? 16  ILE A HB   3  
ATOM   5493  H  HG12 . ILE A 1 16  ? 19.497  14.575 34.452  1.00 0.00  ? 16  ILE A HG12 3  
ATOM   5494  H  HG13 . ILE A 1 16  ? 20.073  12.975 33.996  1.00 0.00  ? 16  ILE A HG13 3  
ATOM   5495  H  HG21 . ILE A 1 16  ? 16.865  14.599 35.197  1.00 0.00  ? 16  ILE A HG21 3  
ATOM   5496  H  HG22 . ILE A 1 16  ? 15.945  13.943 33.845  1.00 0.00  ? 16  ILE A HG22 3  
ATOM   5497  H  HG23 . ILE A 1 16  ? 17.209  15.133 33.551  1.00 0.00  ? 16  ILE A HG23 3  
ATOM   5498  H  HD11 . ILE A 1 16  ? 20.387  13.788 31.927  1.00 0.00  ? 16  ILE A HD11 3  
ATOM   5499  H  HD12 . ILE A 1 16  ? 19.518  15.274 32.315  1.00 0.00  ? 16  ILE A HD12 3  
ATOM   5500  H  HD13 . ILE A 1 16  ? 18.632  13.850 31.778  1.00 0.00  ? 16  ILE A HD13 3  
ATOM   5501  N  N    . THR A 1 17  ? 15.846  12.614 36.405  1.00 0.00  ? 17  THR A N    3  
ATOM   5502  C  CA   . THR A 1 17  ? 14.463  12.206 36.737  1.00 0.00  ? 17  THR A CA   3  
ATOM   5503  C  C    . THR A 1 17  ? 13.490  13.314 36.331  1.00 0.00  ? 17  THR A C    3  
ATOM   5504  O  O    . THR A 1 17  ? 13.759  14.485 36.502  1.00 0.00  ? 17  THR A O    3  
ATOM   5505  C  CB   . THR A 1 17  ? 14.358  11.949 38.241  1.00 0.00  ? 17  THR A CB   3  
ATOM   5506  O  OG1  . THR A 1 17  ? 14.916  13.048 38.951  1.00 0.00  ? 17  THR A OG1  3  
ATOM   5507  C  CG2  . THR A 1 17  ? 15.119  10.669 38.592  1.00 0.00  ? 17  THR A CG2  3  
ATOM   5508  H  H    . THR A 1 17  ? 16.229  13.431 36.791  1.00 0.00  ? 17  THR A H    3  
ATOM   5509  H  HA   . THR A 1 17  ? 14.221  11.300 36.202  1.00 0.00  ? 17  THR A HA   3  
ATOM   5510  H  HB   . THR A 1 17  ? 13.322  11.832 38.511  1.00 0.00  ? 17  THR A HB   3  
ATOM   5511  H  HG1  . THR A 1 17  ? 14.778  13.839 38.425  1.00 0.00  ? 17  THR A HG1  3  
ATOM   5512  H  HG21 . THR A 1 17  ? 14.780  9.865  37.956  1.00 0.00  ? 17  THR A HG21 3  
ATOM   5513  H  HG22 . THR A 1 17  ? 14.937  10.413 39.626  1.00 0.00  ? 17  THR A HG22 3  
ATOM   5514  H  HG23 . THR A 1 17  ? 16.178  10.826 38.440  1.00 0.00  ? 17  THR A HG23 3  
ATOM   5515  N  N    . TYR A 1 18  ? 12.360  12.944 35.795  1.00 0.00  ? 18  TYR A N    3  
ATOM   5516  C  CA   . TYR A 1 18  ? 11.353  13.961 35.377  1.00 0.00  ? 18  TYR A CA   3  
ATOM   5517  C  C    . TYR A 1 18  ? 9.960   13.460 35.753  1.00 0.00  ? 18  TYR A C    3  
ATOM   5518  O  O    . TYR A 1 18  ? 9.802   12.391 36.307  1.00 0.00  ? 18  TYR A O    3  
ATOM   5519  C  CB   . TYR A 1 18  ? 11.418  14.173 33.859  1.00 0.00  ? 18  TYR A CB   3  
ATOM   5520  C  CG   . TYR A 1 18  ? 11.009  12.910 33.145  1.00 0.00  ? 18  TYR A CG   3  
ATOM   5521  C  CD1  . TYR A 1 18  ? 9.654   12.605 32.979  1.00 0.00  ? 18  TYR A CD1  3  
ATOM   5522  C  CD2  . TYR A 1 18  ? 11.990  12.048 32.640  1.00 0.00  ? 18  TYR A CD2  3  
ATOM   5523  C  CE1  . TYR A 1 18  ? 9.281   11.437 32.310  1.00 0.00  ? 18  TYR A CE1  3  
ATOM   5524  C  CE2  . TYR A 1 18  ? 11.618  10.879 31.971  1.00 0.00  ? 18  TYR A CE2  3  
ATOM   5525  C  CZ   . TYR A 1 18  ? 10.263  10.573 31.804  1.00 0.00  ? 18  TYR A CZ   3  
ATOM   5526  O  OH   . TYR A 1 18  ? 9.892   9.422  31.139  1.00 0.00  ? 18  TYR A OH   3  
ATOM   5527  H  H    . TYR A 1 18  ? 12.169  11.992 35.672  1.00 0.00  ? 18  TYR A H    3  
ATOM   5528  H  HA   . TYR A 1 18  ? 11.553  14.896 35.882  1.00 0.00  ? 18  TYR A HA   3  
ATOM   5529  H  HB2  . TYR A 1 18  ? 10.750  14.973 33.581  1.00 0.00  ? 18  TYR A HB2  3  
ATOM   5530  H  HB3  . TYR A 1 18  ? 12.425  14.431 33.574  1.00 0.00  ? 18  TYR A HB3  3  
ATOM   5531  H  HD1  . TYR A 1 18  ? 8.897   13.271 33.369  1.00 0.00  ? 18  TYR A HD1  3  
ATOM   5532  H  HD2  . TYR A 1 18  ? 13.036  12.283 32.769  1.00 0.00  ? 18  TYR A HD2  3  
ATOM   5533  H  HE1  . TYR A 1 18  ? 8.236   11.200 32.181  1.00 0.00  ? 18  TYR A HE1  3  
ATOM   5534  H  HE2  . TYR A 1 18  ? 12.378  10.214 31.580  1.00 0.00  ? 18  TYR A HE2  3  
ATOM   5535  H  HH   . TYR A 1 18  ? 10.003  8.684  31.739  1.00 0.00  ? 18  TYR A HH   3  
ATOM   5536  N  N    . ARG A 1 19  ? 8.947   14.221 35.451  1.00 0.00  ? 19  ARG A N    3  
ATOM   5537  C  CA   . ARG A 1 19  ? 7.563   13.779 35.783  1.00 0.00  ? 19  ARG A CA   3  
ATOM   5538  C  C    . ARG A 1 19  ? 6.560   14.539 34.909  1.00 0.00  ? 19  ARG A C    3  
ATOM   5539  O  O    . ARG A 1 19  ? 6.721   15.713 34.643  1.00 0.00  ? 19  ARG A O    3  
ATOM   5540  C  CB   . ARG A 1 19  ? 7.286   14.039 37.264  1.00 0.00  ? 19  ARG A CB   3  
ATOM   5541  C  CG   . ARG A 1 19  ? 7.037   15.528 37.512  1.00 0.00  ? 19  ARG A CG   3  
ATOM   5542  C  CD   . ARG A 1 19  ? 7.005   15.771 39.019  1.00 0.00  ? 19  ARG A CD   3  
ATOM   5543  N  NE   . ARG A 1 19  ? 5.592   15.920 39.463  1.00 0.00  ? 19  ARG A NE   3  
ATOM   5544  C  CZ   . ARG A 1 19  ? 5.263   15.710 40.713  1.00 0.00  ? 19  ARG A CZ   3  
ATOM   5545  N  NH1  . ARG A 1 19  ? 6.163   15.328 41.583  1.00 0.00  ? 19  ARG A NH1  3  
ATOM   5546  N  NH2  . ARG A 1 19  ? 4.026   15.873 41.089  1.00 0.00  ? 19  ARG A NH2  3  
ATOM   5547  H  H    . ARG A 1 19  ? 9.097   15.078 35.005  1.00 0.00  ? 19  ARG A H    3  
ATOM   5548  H  HA   . ARG A 1 19  ? 7.475   12.720 35.588  1.00 0.00  ? 19  ARG A HA   3  
ATOM   5549  H  HB2  . ARG A 1 19  ? 6.418   13.476 37.570  1.00 0.00  ? 19  ARG A HB2  3  
ATOM   5550  H  HB3  . ARG A 1 19  ? 8.138   13.720 37.844  1.00 0.00  ? 19  ARG A HB3  3  
ATOM   5551  H  HG2  . ARG A 1 19  ? 7.829   16.113 37.067  1.00 0.00  ? 19  ARG A HG2  3  
ATOM   5552  H  HG3  . ARG A 1 19  ? 6.088   15.816 37.084  1.00 0.00  ? 19  ARG A HG3  3  
ATOM   5553  H  HD2  . ARG A 1 19  ? 7.456   14.929 39.524  1.00 0.00  ? 19  ARG A HD2  3  
ATOM   5554  H  HD3  . ARG A 1 19  ? 7.556   16.668 39.254  1.00 0.00  ? 19  ARG A HD3  3  
ATOM   5555  H  HE   . ARG A 1 19  ? 4.906   16.191 38.816  1.00 0.00  ? 19  ARG A HE   3  
ATOM   5556  H  HH11 . ARG A 1 19  ? 7.110   15.194 41.298  1.00 0.00  ? 19  ARG A HH11 3  
ATOM   5557  H  HH12 . ARG A 1 19  ? 5.902   15.171 42.537  1.00 0.00  ? 19  ARG A HH12 3  
ATOM   5558  H  HH21 . ARG A 1 19  ? 3.336   16.156 40.421  1.00 0.00  ? 19  ARG A HH21 3  
ATOM   5559  H  HH22 . ARG A 1 19  ? 3.767   15.726 42.045  1.00 0.00  ? 19  ARG A HH22 3  
ATOM   5560  N  N    . ILE A 1 20  ? 5.535   13.872 34.442  1.00 0.00  ? 20  ILE A N    3  
ATOM   5561  C  CA   . ILE A 1 20  ? 4.537   14.553 33.570  1.00 0.00  ? 20  ILE A CA   3  
ATOM   5562  C  C    . ILE A 1 20  ? 3.351   15.045 34.407  1.00 0.00  ? 20  ILE A C    3  
ATOM   5563  O  O    . ILE A 1 20  ? 2.948   14.414 35.364  1.00 0.00  ? 20  ILE A O    3  
ATOM   5564  C  CB   . ILE A 1 20  ? 4.036   13.569 32.514  1.00 0.00  ? 20  ILE A CB   3  
ATOM   5565  C  CG1  . ILE A 1 20  ? 5.234   12.897 31.829  1.00 0.00  ? 20  ILE A CG1  3  
ATOM   5566  C  CG2  . ILE A 1 20  ? 3.215   14.335 31.477  1.00 0.00  ? 20  ILE A CG2  3  
ATOM   5567  C  CD1  . ILE A 1 20  ? 4.982   11.391 31.708  1.00 0.00  ? 20  ILE A CD1  3  
ATOM   5568  H  H    . ILE A 1 20  ? 5.430   12.921 34.655  1.00 0.00  ? 20  ILE A H    3  
ATOM   5569  H  HA   . ILE A 1 20  ? 5.003   15.397 33.080  1.00 0.00  ? 20  ILE A HA   3  
ATOM   5570  H  HB   . ILE A 1 20  ? 3.418   12.818 32.986  1.00 0.00  ? 20  ILE A HB   3  
ATOM   5571  H  HG12 . ILE A 1 20  ? 5.371   13.320 30.843  1.00 0.00  ? 20  ILE A HG12 3  
ATOM   5572  H  HG13 . ILE A 1 20  ? 6.122   13.065 32.418  1.00 0.00  ? 20  ILE A HG13 3  
ATOM   5573  H  HG21 . ILE A 1 20  ? 3.559   14.083 30.486  1.00 0.00  ? 20  ILE A HG21 3  
ATOM   5574  H  HG22 . ILE A 1 20  ? 3.337   15.397 31.644  1.00 0.00  ? 20  ILE A HG22 3  
ATOM   5575  H  HG23 . ILE A 1 20  ? 2.171   14.073 31.573  1.00 0.00  ? 20  ILE A HG23 3  
ATOM   5576  H  HD11 . ILE A 1 20  ? 5.921   10.860 31.775  1.00 0.00  ? 20  ILE A HD11 3  
ATOM   5577  H  HD12 . ILE A 1 20  ? 4.516   11.180 30.758  1.00 0.00  ? 20  ILE A HD12 3  
ATOM   5578  H  HD13 . ILE A 1 20  ? 4.329   11.070 32.506  1.00 0.00  ? 20  ILE A HD13 3  
ATOM   5579  N  N    . ILE A 1 21  ? 2.786   16.167 34.048  1.00 0.00  ? 21  ILE A N    3  
ATOM   5580  C  CA   . ILE A 1 21  ? 1.625   16.696 34.819  1.00 0.00  ? 21  ILE A CA   3  
ATOM   5581  C  C    . ILE A 1 21  ? 0.323   16.159 34.231  1.00 0.00  ? 21  ILE A C    3  
ATOM   5582  O  O    . ILE A 1 21  ? -0.745  16.379 34.764  1.00 0.00  ? 21  ILE A O    3  
ATOM   5583  C  CB   . ILE A 1 21  ? 1.623   18.222 34.764  1.00 0.00  ? 21  ILE A CB   3  
ATOM   5584  C  CG1  . ILE A 1 21  ? 2.992   18.728 35.210  1.00 0.00  ? 21  ILE A CG1  3  
ATOM   5585  C  CG2  . ILE A 1 21  ? 0.546   18.764 35.703  1.00 0.00  ? 21  ILE A CG2  3  
ATOM   5586  C  CD1  . ILE A 1 21  ? 2.988   20.256 35.260  1.00 0.00  ? 21  ILE A CD1  3  
ATOM   5587  H  H    . ILE A 1 21  ? 3.124   16.660 33.272  1.00 0.00  ? 21  ILE A H    3  
ATOM   5588  H  HA   . ILE A 1 21  ? 1.705   16.376 35.845  1.00 0.00  ? 21  ILE A HA   3  
ATOM   5589  H  HB   . ILE A 1 21  ? 1.423   18.552 33.754  1.00 0.00  ? 21  ILE A HB   3  
ATOM   5590  H  HG12 . ILE A 1 21  ? 3.213   18.334 36.191  1.00 0.00  ? 21  ILE A HG12 3  
ATOM   5591  H  HG13 . ILE A 1 21  ? 3.745   18.393 34.509  1.00 0.00  ? 21  ILE A HG13 3  
ATOM   5592  H  HG21 . ILE A 1 21  ? 0.612   19.840 35.749  1.00 0.00  ? 21  ILE A HG21 3  
ATOM   5593  H  HG22 . ILE A 1 21  ? 0.694   18.352 36.691  1.00 0.00  ? 21  ILE A HG22 3  
ATOM   5594  H  HG23 . ILE A 1 21  ? -0.427  18.479 35.334  1.00 0.00  ? 21  ILE A HG23 3  
ATOM   5595  H  HD11 . ILE A 1 21  ? 3.463   20.585 36.171  1.00 0.00  ? 21  ILE A HD11 3  
ATOM   5596  H  HD12 . ILE A 1 21  ? 1.969   20.615 35.232  1.00 0.00  ? 21  ILE A HD12 3  
ATOM   5597  H  HD13 . ILE A 1 21  ? 3.531   20.646 34.411  1.00 0.00  ? 21  ILE A HD13 3  
ATOM   5598  N  N    . GLY A 1 22  ? 0.397   15.456 33.141  1.00 0.00  ? 22  GLY A N    3  
ATOM   5599  C  CA   . GLY A 1 22  ? -0.844  14.911 32.540  1.00 0.00  ? 22  GLY A CA   3  
ATOM   5600  C  C    . GLY A 1 22  ? -0.686  14.869 31.027  1.00 0.00  ? 22  GLY A C    3  
ATOM   5601  O  O    . GLY A 1 22  ? -0.655  15.886 30.365  1.00 0.00  ? 22  GLY A O    3  
ATOM   5602  H  H    . GLY A 1 22  ? 1.266   15.284 32.721  1.00 0.00  ? 22  GLY A H    3  
ATOM   5603  H  HA2  . GLY A 1 22  ? -1.016  13.913 32.917  1.00 0.00  ? 22  GLY A HA2  3  
ATOM   5604  H  HA3  . GLY A 1 22  ? -1.679  15.545 32.796  1.00 0.00  ? 22  GLY A HA3  3  
ATOM   5605  N  N    . TYR A 1 23  ? -0.577  13.703 30.468  1.00 0.00  ? 23  TYR A N    3  
ATOM   5606  C  CA   . TYR A 1 23  ? -0.417  13.620 28.992  1.00 0.00  ? 23  TYR A CA   3  
ATOM   5607  C  C    . TYR A 1 23  ? -1.694  14.114 28.332  1.00 0.00  ? 23  TYR A C    3  
ATOM   5608  O  O    . TYR A 1 23  ? -2.521  14.764 28.945  1.00 0.00  ? 23  TYR A O    3  
ATOM   5609  C  CB   . TYR A 1 23  ? -0.150  12.181 28.527  1.00 0.00  ? 23  TYR A CB   3  
ATOM   5610  C  CG   . TYR A 1 23  ? 0.203   11.293 29.695  1.00 0.00  ? 23  TYR A CG   3  
ATOM   5611  C  CD1  . TYR A 1 23  ? 1.523   11.241 30.148  1.00 0.00  ? 23  TYR A CD1  3  
ATOM   5612  C  CD2  . TYR A 1 23  ? -0.788  10.527 30.328  1.00 0.00  ? 23  TYR A CD2  3  
ATOM   5613  C  CE1  . TYR A 1 23  ? 1.860   10.427 31.233  1.00 0.00  ? 23  TYR A CE1  3  
ATOM   5614  C  CE2  . TYR A 1 23  ? -0.450  9.714  31.415  1.00 0.00  ? 23  TYR A CE2  3  
ATOM   5615  C  CZ   . TYR A 1 23  ? 0.875   9.664  31.867  1.00 0.00  ? 23  TYR A CZ   3  
ATOM   5616  O  OH   . TYR A 1 23  ? 1.211   8.862  32.940  1.00 0.00  ? 23  TYR A OH   3  
ATOM   5617  H  H    . TYR A 1 23  ? -0.599  12.895 31.017  1.00 0.00  ? 23  TYR A H    3  
ATOM   5618  H  HA   . TYR A 1 23  ? 0.407   14.253 28.693  1.00 0.00  ? 23  TYR A HA   3  
ATOM   5619  H  HB2  . TYR A 1 23  ? -1.031  11.797 28.040  1.00 0.00  ? 23  TYR A HB2  3  
ATOM   5620  H  HB3  . TYR A 1 23  ? 0.669   12.184 27.826  1.00 0.00  ? 23  TYR A HB3  3  
ATOM   5621  H  HD1  . TYR A 1 23  ? 2.283   11.825 29.658  1.00 0.00  ? 23  TYR A HD1  3  
ATOM   5622  H  HD2  . TYR A 1 23  ? -1.811  10.564 29.977  1.00 0.00  ? 23  TYR A HD2  3  
ATOM   5623  H  HE1  . TYR A 1 23  ? 2.878   10.388 31.581  1.00 0.00  ? 23  TYR A HE1  3  
ATOM   5624  H  HE2  . TYR A 1 23  ? -1.210  9.124  31.903  1.00 0.00  ? 23  TYR A HE2  3  
ATOM   5625  H  HH   . TYR A 1 23  ? 2.164   8.739  32.933  1.00 0.00  ? 23  TYR A HH   3  
ATOM   5626  N  N    . THR A 1 24  ? -1.863  13.807 27.087  1.00 0.00  ? 24  THR A N    3  
ATOM   5627  C  CA   . THR A 1 24  ? -3.079  14.253 26.373  1.00 0.00  ? 24  THR A CA   3  
ATOM   5628  C  C    . THR A 1 24  ? -3.986  13.047 26.119  1.00 0.00  ? 24  THR A C    3  
ATOM   5629  O  O    . THR A 1 24  ? -3.512  11.948 25.911  1.00 0.00  ? 24  THR A O    3  
ATOM   5630  C  CB   . THR A 1 24  ? -2.667  14.893 25.044  1.00 0.00  ? 24  THR A CB   3  
ATOM   5631  O  OG1  . THR A 1 24  ? -3.787  14.951 24.174  1.00 0.00  ? 24  THR A OG1  3  
ATOM   5632  C  CG2  . THR A 1 24  ? -1.552  14.066 24.399  1.00 0.00  ? 24  THR A CG2  3  
ATOM   5633  H  H    . THR A 1 24  ? -1.186  13.282 26.618  1.00 0.00  ? 24  THR A H    3  
ATOM   5634  H  HA   . THR A 1 24  ? -3.603  14.978 26.977  1.00 0.00  ? 24  THR A HA   3  
ATOM   5635  H  HB   . THR A 1 24  ? -2.302  15.892 25.227  1.00 0.00  ? 24  THR A HB   3  
ATOM   5636  H  HG1  . THR A 1 24  ? -3.537  15.475 23.410  1.00 0.00  ? 24  THR A HG1  3  
ATOM   5637  H  HG21 . THR A 1 24  ? -0.615  14.292 24.885  1.00 0.00  ? 24  THR A HG21 3  
ATOM   5638  H  HG22 . THR A 1 24  ? -1.481  14.312 23.350  1.00 0.00  ? 24  THR A HG22 3  
ATOM   5639  H  HG23 . THR A 1 24  ? -1.772  13.012 24.508  1.00 0.00  ? 24  THR A HG23 3  
ATOM   5640  N  N    . PRO A 1 25  ? -5.267  13.294 26.144  1.00 0.00  ? 25  PRO A N    3  
ATOM   5641  C  CA   . PRO A 1 25  ? -6.278  12.247 25.919  1.00 0.00  ? 25  PRO A CA   3  
ATOM   5642  C  C    . PRO A 1 25  ? -6.317  11.852 24.444  1.00 0.00  ? 25  PRO A C    3  
ATOM   5643  O  O    . PRO A 1 25  ? -6.687  10.747 24.102  1.00 0.00  ? 25  PRO A O    3  
ATOM   5644  C  CB   . PRO A 1 25  ? -7.582  12.914 26.349  1.00 0.00  ? 25  PRO A CB   3  
ATOM   5645  C  CG   . PRO A 1 25  ? -7.339  14.438 26.283  1.00 0.00  ? 25  PRO A CG   3  
ATOM   5646  C  CD   . PRO A 1 25  ? -5.823  14.637 26.398  1.00 0.00  ? 25  PRO A CD   3  
ATOM   5647  H  HA   . PRO A 1 25  ? -6.080  11.388 26.537  1.00 0.00  ? 25  PRO A HA   3  
ATOM   5648  H  HB2  . PRO A 1 25  ? -8.378  12.636 25.673  1.00 0.00  ? 25  PRO A HB2  3  
ATOM   5649  H  HB3  . PRO A 1 25  ? -7.826  12.630 27.358  1.00 0.00  ? 25  PRO A HB3  3  
ATOM   5650  H  HG2  . PRO A 1 25  ? -7.695  14.831 25.344  1.00 0.00  ? 25  PRO A HG2  3  
ATOM   5651  H  HG3  . PRO A 1 25  ? -7.831  14.930 27.105  1.00 0.00  ? 25  PRO A HG3  3  
ATOM   5652  H  HD2  . PRO A 1 25  ? -5.473  15.344 25.658  1.00 0.00  ? 25  PRO A HD2  3  
ATOM   5653  H  HD3  . PRO A 1 25  ? -5.561  14.964 27.392  1.00 0.00  ? 25  PRO A HD3  3  
ATOM   5654  N  N    . ASP A 1 26  ? -5.932  12.749 23.581  1.00 0.00  ? 26  ASP A N    3  
ATOM   5655  C  CA   . ASP A 1 26  ? -5.925  12.445 22.110  1.00 0.00  ? 26  ASP A CA   3  
ATOM   5656  C  C    . ASP A 1 26  ? -5.544  10.984 21.881  1.00 0.00  ? 26  ASP A C    3  
ATOM   5657  O  O    . ASP A 1 26  ? -6.035  10.336 20.980  1.00 0.00  ? 26  ASP A O    3  
ATOM   5658  C  CB   . ASP A 1 26  ? -4.904  13.329 21.384  1.00 0.00  ? 26  ASP A CB   3  
ATOM   5659  C  CG   . ASP A 1 26  ? -3.585  13.352 22.160  1.00 0.00  ? 26  ASP A CG   3  
ATOM   5660  O  OD1  . ASP A 1 26  ? -3.554  12.822 23.255  1.00 0.00  ? 26  ASP A OD1  3  
ATOM   5661  O  OD2  . ASP A 1 26  ? -2.627  13.897 21.640  1.00 0.00  ? 26  ASP A OD2  3  
ATOM   5662  H  H    . ASP A 1 26  ? -5.648  13.628 23.904  1.00 0.00  ? 26  ASP A H    3  
ATOM   5663  H  HA   . ASP A 1 26  ? -6.908  12.623 21.704  1.00 0.00  ? 26  ASP A HA   3  
ATOM   5664  H  HB2  . ASP A 1 26  ? -4.729  12.928 20.395  1.00 0.00  ? 26  ASP A HB2  3  
ATOM   5665  H  HB3  . ASP A 1 26  ? -5.290  14.331 21.300  1.00 0.00  ? 26  ASP A HB3  3  
ATOM   5666  N  N    . LEU A 1 27  ? -4.668  10.456 22.686  1.00 0.00  ? 27  LEU A N    3  
ATOM   5667  C  CA   . LEU A 1 27  ? -4.272  9.038  22.495  1.00 0.00  ? 27  LEU A CA   3  
ATOM   5668  C  C    . LEU A 1 27  ? -4.294  8.297  23.834  1.00 0.00  ? 27  LEU A C    3  
ATOM   5669  O  O    . LEU A 1 27  ? -4.473  8.885  24.882  1.00 0.00  ? 27  LEU A O    3  
ATOM   5670  C  CB   . LEU A 1 27  ? -2.880  8.953  21.857  1.00 0.00  ? 27  LEU A CB   3  
ATOM   5671  C  CG   . LEU A 1 27  ? -2.099  10.244 22.095  1.00 0.00  ? 27  LEU A CG   3  
ATOM   5672  C  CD1  . LEU A 1 27  ? -0.653  9.899  22.446  1.00 0.00  ? 27  LEU A CD1  3  
ATOM   5673  C  CD2  . LEU A 1 27  ? -2.136  11.101 20.827  1.00 0.00  ? 27  LEU A CD2  3  
ATOM   5674  H  H    . LEU A 1 27  ? -4.272  10.988 23.404  1.00 0.00  ? 27  LEU A H    3  
ATOM   5675  H  HA   . LEU A 1 27  ? -4.978  8.575  21.836  1.00 0.00  ? 27  LEU A HA   3  
ATOM   5676  H  HB2  . LEU A 1 27  ? -2.338  8.125  22.285  1.00 0.00  ? 27  LEU A HB2  3  
ATOM   5677  H  HB3  . LEU A 1 27  ? -2.990  8.798  20.795  1.00 0.00  ? 27  LEU A HB3  3  
ATOM   5678  H  HG   . LEU A 1 27  ? -2.544  10.785 22.911  1.00 0.00  ? 27  LEU A HG   3  
ATOM   5679  H  HD11 . LEU A 1 27  ? -0.170  10.760 22.884  1.00 0.00  ? 27  LEU A HD11 3  
ATOM   5680  H  HD12 . LEU A 1 27  ? -0.122  9.602  21.553  1.00 0.00  ? 27  LEU A HD12 3  
ATOM   5681  H  HD13 . LEU A 1 27  ? -0.650  9.085  23.156  1.00 0.00  ? 27  LEU A HD13 3  
ATOM   5682  H  HD21 . LEU A 1 27  ? -1.911  10.486 19.971  1.00 0.00  ? 27  LEU A HD21 3  
ATOM   5683  H  HD22 . LEU A 1 27  ? -1.405  11.894 20.904  1.00 0.00  ? 27  LEU A HD22 3  
ATOM   5684  H  HD23 . LEU A 1 27  ? -3.123  11.530 20.711  1.00 0.00  ? 27  LEU A HD23 3  
ATOM   5685  N  N    . ASP A 1 28  ? -4.131  7.004  23.800  1.00 0.00  ? 28  ASP A N    3  
ATOM   5686  C  CA   . ASP A 1 28  ? -4.152  6.205  25.060  1.00 0.00  ? 28  ASP A CA   3  
ATOM   5687  C  C    . ASP A 1 28  ? -3.187  6.812  26.063  1.00 0.00  ? 28  ASP A C    3  
ATOM   5688  O  O    . ASP A 1 28  ? -2.172  7.360  25.693  1.00 0.00  ? 28  ASP A O    3  
ATOM   5689  C  CB   . ASP A 1 28  ? -3.768  4.759  24.731  1.00 0.00  ? 28  ASP A CB   3  
ATOM   5690  C  CG   . ASP A 1 28  ? -4.998  4.042  24.162  1.00 0.00  ? 28  ASP A CG   3  
ATOM   5691  O  OD1  . ASP A 1 28  ? -5.818  4.712  23.556  1.00 0.00  ? 28  ASP A OD1  3  
ATOM   5692  O  OD2  . ASP A 1 28  ? -5.102  2.841  24.344  1.00 0.00  ? 28  ASP A OD2  3  
ATOM   5693  H  H    . ASP A 1 28  ? -4.002  6.553  22.940  1.00 0.00  ? 28  ASP A H    3  
ATOM   5694  H  HA   . ASP A 1 28  ? -5.129  6.215  25.490  1.00 0.00  ? 28  ASP A HA   3  
ATOM   5695  H  HB2  . ASP A 1 28  ? -2.979  4.759  23.994  1.00 0.00  ? 28  ASP A HB2  3  
ATOM   5696  H  HB3  . ASP A 1 28  ? -3.436  4.250  25.624  1.00 0.00  ? 28  ASP A HB3  3  
ATOM   5697  N  N    . PRO A 1 29  ? -3.525  6.687  27.319  1.00 0.00  ? 29  PRO A N    3  
ATOM   5698  C  CA   . PRO A 1 29  ? -2.688  7.216  28.397  1.00 0.00  ? 29  PRO A CA   3  
ATOM   5699  C  C    . PRO A 1 29  ? -1.456  6.342  28.424  1.00 0.00  ? 29  PRO A C    3  
ATOM   5700  O  O    . PRO A 1 29  ? -0.355  6.774  28.689  1.00 0.00  ? 29  PRO A O    3  
ATOM   5701  C  CB   . PRO A 1 29  ? -3.549  7.046  29.650  1.00 0.00  ? 29  PRO A CB   3  
ATOM   5702  C  CG   . PRO A 1 29  ? -4.579  5.945  29.308  1.00 0.00  ? 29  PRO A CG   3  
ATOM   5703  C  CD   . PRO A 1 29  ? -4.739  5.980  27.779  1.00 0.00  ? 29  PRO A CD   3  
ATOM   5704  H  HA   . PRO A 1 29  ? -2.435  8.255  28.229  1.00 0.00  ? 29  PRO A HA   3  
ATOM   5705  H  HB2  . PRO A 1 29  ? -2.932  6.744  30.484  1.00 0.00  ? 29  PRO A HB2  3  
ATOM   5706  H  HB3  . PRO A 1 29  ? -4.062  7.967  29.876  1.00 0.00  ? 29  PRO A HB3  3  
ATOM   5707  H  HG2  . PRO A 1 29  ? -4.204  4.981  29.622  1.00 0.00  ? 29  PRO A HG2  3  
ATOM   5708  H  HG3  . PRO A 1 29  ? -5.524  6.155  29.780  1.00 0.00  ? 29  PRO A HG3  3  
ATOM   5709  H  HD2  . PRO A 1 29  ? -4.774  4.974  27.382  1.00 0.00  ? 29  PRO A HD2  3  
ATOM   5710  H  HD3  . PRO A 1 29  ? -5.622  6.533  27.504  1.00 0.00  ? 29  PRO A HD3  3  
ATOM   5711  N  N    . GLU A 1 30  ? -1.648  5.106  28.091  1.00 0.00  ? 30  GLU A N    3  
ATOM   5712  C  CA   . GLU A 1 30  ? -0.513  4.172  28.023  1.00 0.00  ? 30  GLU A CA   3  
ATOM   5713  C  C    . GLU A 1 30  ? 0.226   4.432  26.710  1.00 0.00  ? 30  GLU A C    3  
ATOM   5714  O  O    . GLU A 1 30  ? 1.430   4.285  26.627  1.00 0.00  ? 30  GLU A O    3  
ATOM   5715  C  CB   . GLU A 1 30  ? -1.025  2.729  28.072  1.00 0.00  ? 30  GLU A CB   3  
ATOM   5716  C  CG   . GLU A 1 30  ? -1.560  2.424  29.476  1.00 0.00  ? 30  GLU A CG   3  
ATOM   5717  C  CD   . GLU A 1 30  ? -2.920  1.732  29.366  1.00 0.00  ? 30  GLU A CD   3  
ATOM   5718  O  OE1  . GLU A 1 30  ? -2.968  0.656  28.790  1.00 0.00  ? 30  GLU A OE1  3  
ATOM   5719  O  OE2  . GLU A 1 30  ? -3.889  2.286  29.858  1.00 0.00  ? 30  GLU A OE2  3  
ATOM   5720  H  H    . GLU A 1 30  ? -2.548  4.800  27.851  1.00 0.00  ? 30  GLU A H    3  
ATOM   5721  H  HA   . GLU A 1 30  ? 0.151   4.356  28.850  1.00 0.00  ? 30  GLU A HA   3  
ATOM   5722  H  HB2  . GLU A 1 30  ? -1.818  2.603  27.348  1.00 0.00  ? 30  GLU A HB2  3  
ATOM   5723  H  HB3  . GLU A 1 30  ? -0.218  2.054  27.842  1.00 0.00  ? 30  GLU A HB3  3  
ATOM   5724  H  HG2  . GLU A 1 30  ? -0.865  1.776  29.990  1.00 0.00  ? 30  GLU A HG2  3  
ATOM   5725  H  HG3  . GLU A 1 30  ? -1.673  3.347  30.030  1.00 0.00  ? 30  GLU A HG3  3  
ATOM   5726  N  N    . THR A 1 31  ? -0.477  4.848  25.677  1.00 0.00  ? 31  THR A N    3  
ATOM   5727  C  CA   . THR A 1 31  ? 0.229   5.135  24.391  1.00 0.00  ? 31  THR A CA   3  
ATOM   5728  C  C    . THR A 1 31  ? 1.003   6.441  24.546  1.00 0.00  ? 31  THR A C    3  
ATOM   5729  O  O    . THR A 1 31  ? 2.190   6.506  24.295  1.00 0.00  ? 31  THR A O    3  
ATOM   5730  C  CB   . THR A 1 31  ? -0.780  5.270  23.251  1.00 0.00  ? 31  THR A CB   3  
ATOM   5731  O  OG1  . THR A 1 31  ? -1.349  3.994  22.975  1.00 0.00  ? 31  THR A OG1  3  
ATOM   5732  C  CG2  . THR A 1 31  ? -0.079  5.797  21.996  1.00 0.00  ? 31  THR A CG2  3  
ATOM   5733  H  H    . THR A 1 31  ? -1.459  4.989  25.756  1.00 0.00  ? 31  THR A H    3  
ATOM   5734  H  HA   . THR A 1 31  ? 0.919   4.332  24.171  1.00 0.00  ? 31  THR A HA   3  
ATOM   5735  H  HB   . THR A 1 31  ? -1.557  5.958  23.541  1.00 0.00  ? 31  THR A HB   3  
ATOM   5736  H  HG1  . THR A 1 31  ? -2.102  4.123  22.392  1.00 0.00  ? 31  THR A HG1  3  
ATOM   5737  H  HG21 . THR A 1 31  ? 0.687   6.507  22.273  1.00 0.00  ? 31  THR A HG21 3  
ATOM   5738  H  HG22 . THR A 1 31  ? -0.802  6.283  21.360  1.00 0.00  ? 31  THR A HG22 3  
ATOM   5739  H  HG23 . THR A 1 31  ? 0.370   4.972  21.463  1.00 0.00  ? 31  THR A HG23 3  
ATOM   5740  N  N    . VAL A 1 32  ? 0.341   7.482  24.971  1.00 0.00  ? 32  VAL A N    3  
ATOM   5741  C  CA   . VAL A 1 32  ? 1.042   8.779  25.158  1.00 0.00  ? 32  VAL A CA   3  
ATOM   5742  C  C    . VAL A 1 32  ? 2.326   8.506  25.936  1.00 0.00  ? 32  VAL A C    3  
ATOM   5743  O  O    . VAL A 1 32  ? 3.380   9.031  25.635  1.00 0.00  ? 32  VAL A O    3  
ATOM   5744  C  CB   . VAL A 1 32  ? 0.118   9.742  25.922  1.00 0.00  ? 32  VAL A CB   3  
ATOM   5745  C  CG1  . VAL A 1 32  ? 0.199   9.512  27.431  1.00 0.00  ? 32  VAL A CG1  3  
ATOM   5746  C  CG2  . VAL A 1 32  ? 0.517   11.187 25.617  1.00 0.00  ? 32  VAL A CG2  3  
ATOM   5747  H  H    . VAL A 1 32  ? -0.611  7.407  25.177  1.00 0.00  ? 32  VAL A H    3  
ATOM   5748  H  HA   . VAL A 1 32  ? 1.290   9.201  24.193  1.00 0.00  ? 32  VAL A HA   3  
ATOM   5749  H  HB   . VAL A 1 32  ? -0.896  9.571  25.606  1.00 0.00  ? 32  VAL A HB   3  
ATOM   5750  H  HG11 . VAL A 1 32  ? 1.113   9.939  27.811  1.00 0.00  ? 32  VAL A HG11 3  
ATOM   5751  H  HG12 . VAL A 1 32  ? 0.176   8.459  27.637  1.00 0.00  ? 32  VAL A HG12 3  
ATOM   5752  H  HG13 . VAL A 1 32  ? -0.645  9.984  27.909  1.00 0.00  ? 32  VAL A HG13 3  
ATOM   5753  H  HG21 . VAL A 1 32  ? 1.529   11.356 25.948  1.00 0.00  ? 32  VAL A HG21 3  
ATOM   5754  H  HG22 . VAL A 1 32  ? -0.146  11.855 26.139  1.00 0.00  ? 32  VAL A HG22 3  
ATOM   5755  H  HG23 . VAL A 1 32  ? 0.448   11.368 24.555  1.00 0.00  ? 32  VAL A HG23 3  
ATOM   5756  N  N    . ASP A 1 33  ? 2.241   7.656  26.920  1.00 0.00  ? 33  ASP A N    3  
ATOM   5757  C  CA   . ASP A 1 33  ? 3.451   7.304  27.716  1.00 0.00  ? 33  ASP A CA   3  
ATOM   5758  C  C    . ASP A 1 33  ? 4.498   6.658  26.804  1.00 0.00  ? 33  ASP A C    3  
ATOM   5759  O  O    . ASP A 1 33  ? 5.684   6.892  26.940  1.00 0.00  ? 33  ASP A O    3  
ATOM   5760  C  CB   . ASP A 1 33  ? 3.070   6.299  28.801  1.00 0.00  ? 33  ASP A CB   3  
ATOM   5761  C  CG   . ASP A 1 33  ? 2.120   6.961  29.791  1.00 0.00  ? 33  ASP A CG   3  
ATOM   5762  O  OD1  . ASP A 1 33  ? 1.484   7.930  29.411  1.00 0.00  ? 33  ASP A OD1  3  
ATOM   5763  O  OD2  . ASP A 1 33  ? 2.048   6.494  30.916  1.00 0.00  ? 33  ASP A OD2  3  
ATOM   5764  H  H    . ASP A 1 33  ? 1.376   7.234  27.126  1.00 0.00  ? 33  ASP A H    3  
ATOM   5765  H  HA   . ASP A 1 33  ? 3.859   8.192  28.172  1.00 0.00  ? 33  ASP A HA   3  
ATOM   5766  H  HB2  . ASP A 1 33  ? 2.584   5.444  28.348  1.00 0.00  ? 33  ASP A HB2  3  
ATOM   5767  H  HB3  . ASP A 1 33  ? 3.959   5.975  29.320  1.00 0.00  ? 33  ASP A HB3  3  
ATOM   5768  N  N    . ASP A 1 34  ? 4.071   5.832  25.881  1.00 0.00  ? 34  ASP A N    3  
ATOM   5769  C  CA   . ASP A 1 34  ? 5.047   5.161  24.978  1.00 0.00  ? 34  ASP A CA   3  
ATOM   5770  C  C    . ASP A 1 34  ? 5.802   6.218  24.182  1.00 0.00  ? 34  ASP A C    3  
ATOM   5771  O  O    . ASP A 1 34  ? 6.984   6.098  23.930  1.00 0.00  ? 34  ASP A O    3  
ATOM   5772  C  CB   . ASP A 1 34  ? 4.302   4.231  24.019  1.00 0.00  ? 34  ASP A CB   3  
ATOM   5773  C  CG   . ASP A 1 34  ? 5.305   3.547  23.090  1.00 0.00  ? 34  ASP A CG   3  
ATOM   5774  O  OD1  . ASP A 1 34  ? 6.494   3.651  23.352  1.00 0.00  ? 34  ASP A OD1  3  
ATOM   5775  O  OD2  . ASP A 1 34  ? 4.868   2.930  22.132  1.00 0.00  ? 34  ASP A OD2  3  
ATOM   5776  H  H    . ASP A 1 34  ? 3.110   5.647  25.789  1.00 0.00  ? 34  ASP A H    3  
ATOM   5777  H  HA   . ASP A 1 34  ? 5.745   4.586  25.569  1.00 0.00  ? 34  ASP A HA   3  
ATOM   5778  H  HB2  . ASP A 1 34  ? 3.764   3.484  24.586  1.00 0.00  ? 34  ASP A HB2  3  
ATOM   5779  H  HB3  . ASP A 1 34  ? 3.606   4.807  23.430  1.00 0.00  ? 34  ASP A HB3  3  
ATOM   5780  N  N    . ALA A 1 35  ? 5.130   7.260  23.787  1.00 0.00  ? 35  ALA A N    3  
ATOM   5781  C  CA   . ALA A 1 35  ? 5.812   8.324  23.017  1.00 0.00  ? 35  ALA A CA   3  
ATOM   5782  C  C    . ALA A 1 35  ? 7.035   8.796  23.795  1.00 0.00  ? 35  ALA A C    3  
ATOM   5783  O  O    . ALA A 1 35  ? 8.011   9.240  23.226  1.00 0.00  ? 35  ALA A O    3  
ATOM   5784  C  CB   . ALA A 1 35  ? 4.855   9.494  22.818  1.00 0.00  ? 35  ALA A CB   3  
ATOM   5785  H  H    . ALA A 1 35  ? 4.178   7.343  24.004  1.00 0.00  ? 35  ALA A H    3  
ATOM   5786  H  HA   . ALA A 1 35  ? 6.119   7.940  22.054  1.00 0.00  ? 35  ALA A HA   3  
ATOM   5787  H  HB1  . ALA A 1 35  ? 4.455   9.794  23.774  1.00 0.00  ? 35  ALA A HB1  3  
ATOM   5788  H  HB2  . ALA A 1 35  ? 4.049   9.190  22.168  1.00 0.00  ? 35  ALA A HB2  3  
ATOM   5789  H  HB3  . ALA A 1 35  ? 5.386   10.322 22.376  1.00 0.00  ? 35  ALA A HB3  3  
ATOM   5790  N  N    . PHE A 1 36  ? 7.000   8.703  25.096  1.00 0.00  ? 36  PHE A N    3  
ATOM   5791  C  CA   . PHE A 1 36  ? 8.177   9.154  25.887  1.00 0.00  ? 36  PHE A CA   3  
ATOM   5792  C  C    . PHE A 1 36  ? 9.119   7.965  26.096  1.00 0.00  ? 36  PHE A C    3  
ATOM   5793  O  O    . PHE A 1 36  ? 10.310  8.129  26.267  1.00 0.00  ? 36  PHE A O    3  
ATOM   5794  C  CB   . PHE A 1 36  ? 7.721   9.708  27.241  1.00 0.00  ? 36  PHE A CB   3  
ATOM   5795  C  CG   . PHE A 1 36  ? 6.891   10.958 27.033  1.00 0.00  ? 36  PHE A CG   3  
ATOM   5796  C  CD1  . PHE A 1 36  ? 5.621   10.880 26.446  1.00 0.00  ? 36  PHE A CD1  3  
ATOM   5797  C  CD2  . PHE A 1 36  ? 7.396   12.196 27.434  1.00 0.00  ? 36  PHE A CD2  3  
ATOM   5798  C  CE1  . PHE A 1 36  ? 4.862   12.046 26.262  1.00 0.00  ? 36  PHE A CE1  3  
ATOM   5799  C  CE2  . PHE A 1 36  ? 6.639   13.358 27.252  1.00 0.00  ? 36  PHE A CE2  3  
ATOM   5800  C  CZ   . PHE A 1 36  ? 5.373   13.284 26.666  1.00 0.00  ? 36  PHE A CZ   3  
ATOM   5801  H  H    . PHE A 1 36  ? 6.208   8.337  25.547  1.00 0.00  ? 36  PHE A H    3  
ATOM   5802  H  HA   . PHE A 1 36  ? 8.697   9.927  25.342  1.00 0.00  ? 36  PHE A HA   3  
ATOM   5803  H  HB2  . PHE A 1 36  ? 7.134   8.965  27.759  1.00 0.00  ? 36  PHE A HB2  3  
ATOM   5804  H  HB3  . PHE A 1 36  ? 8.590   9.955  27.835  1.00 0.00  ? 36  PHE A HB3  3  
ATOM   5805  H  HD1  . PHE A 1 36  ? 5.228   9.925  26.134  1.00 0.00  ? 36  PHE A HD1  3  
ATOM   5806  H  HD2  . PHE A 1 36  ? 8.372   12.257 27.888  1.00 0.00  ? 36  PHE A HD2  3  
ATOM   5807  H  HE1  . PHE A 1 36  ? 3.882   11.989 25.812  1.00 0.00  ? 36  PHE A HE1  3  
ATOM   5808  H  HE2  . PHE A 1 36  ? 7.033   14.310 27.565  1.00 0.00  ? 36  PHE A HE2  3  
ATOM   5809  H  HZ   . PHE A 1 36  ? 4.789   14.183 26.524  1.00 0.00  ? 36  PHE A HZ   3  
ATOM   5810  N  N    . ALA A 1 37  ? 8.599   6.764  26.051  1.00 0.00  ? 37  ALA A N    3  
ATOM   5811  C  CA   . ALA A 1 37  ? 9.480   5.574  26.212  1.00 0.00  ? 37  ALA A CA   3  
ATOM   5812  C  C    . ALA A 1 37  ? 10.352  5.471  24.963  1.00 0.00  ? 37  ALA A C    3  
ATOM   5813  O  O    . ALA A 1 37  ? 11.554  5.305  25.037  1.00 0.00  ? 37  ALA A O    3  
ATOM   5814  C  CB   . ALA A 1 37  ? 8.630   4.308  26.342  1.00 0.00  ? 37  ALA A CB   3  
ATOM   5815  H  H    . ALA A 1 37  ? 7.640   6.646  25.891  1.00 0.00  ? 37  ALA A H    3  
ATOM   5816  H  HA   . ALA A 1 37  ? 10.101  5.694  27.088  1.00 0.00  ? 37  ALA A HA   3  
ATOM   5817  H  HB1  . ALA A 1 37  ? 8.978   3.570  25.634  1.00 0.00  ? 37  ALA A HB1  3  
ATOM   5818  H  HB2  . ALA A 1 37  ? 7.596   4.546  26.135  1.00 0.00  ? 37  ALA A HB2  3  
ATOM   5819  H  HB3  . ALA A 1 37  ? 8.717   3.915  27.344  1.00 0.00  ? 37  ALA A HB3  3  
ATOM   5820  N  N    . ARG A 1 38  ? 9.750   5.585  23.809  1.00 0.00  ? 38  ARG A N    3  
ATOM   5821  C  CA   . ARG A 1 38  ? 10.542  5.513  22.555  1.00 0.00  ? 38  ARG A CA   3  
ATOM   5822  C  C    . ARG A 1 38  ? 11.376  6.779  22.442  1.00 0.00  ? 38  ARG A C    3  
ATOM   5823  O  O    . ARG A 1 38  ? 12.522  6.748  22.042  1.00 0.00  ? 38  ARG A O    3  
ATOM   5824  C  CB   . ARG A 1 38  ? 9.608   5.404  21.355  1.00 0.00  ? 38  ARG A CB   3  
ATOM   5825  C  CG   . ARG A 1 38  ? 9.870   4.076  20.645  1.00 0.00  ? 38  ARG A CG   3  
ATOM   5826  C  CD   . ARG A 1 38  ? 11.306  4.061  20.106  1.00 0.00  ? 38  ARG A CD   3  
ATOM   5827  N  NE   . ARG A 1 38  ? 11.845  2.672  20.143  1.00 0.00  ? 38  ARG A NE   3  
ATOM   5828  C  CZ   . ARG A 1 38  ? 11.458  1.789  19.260  1.00 0.00  ? 38  ARG A CZ   3  
ATOM   5829  N  NH1  . ARG A 1 38  ? 10.556  2.100  18.366  1.00 0.00  ? 38  ARG A NH1  3  
ATOM   5830  N  NH2  . ARG A 1 38  ? 11.958  0.584  19.286  1.00 0.00  ? 38  ARG A NH2  3  
ATOM   5831  H  H    . ARG A 1 38  ? 8.780   5.730  23.772  1.00 0.00  ? 38  ARG A H    3  
ATOM   5832  H  HA   . ARG A 1 38  ? 11.194  4.652  22.587  1.00 0.00  ? 38  ARG A HA   3  
ATOM   5833  H  HB2  . ARG A 1 38  ? 8.584   5.444  21.691  1.00 0.00  ? 38  ARG A HB2  3  
ATOM   5834  H  HB3  . ARG A 1 38  ? 9.799   6.221  20.674  1.00 0.00  ? 38  ARG A HB3  3  
ATOM   5835  H  HG2  . ARG A 1 38  ? 9.738   3.264  21.346  1.00 0.00  ? 38  ARG A HG2  3  
ATOM   5836  H  HG3  . ARG A 1 38  ? 9.177   3.961  19.825  1.00 0.00  ? 38  ARG A HG3  3  
ATOM   5837  H  HD2  . ARG A 1 38  ? 11.317  4.424  19.090  1.00 0.00  ? 38  ARG A HD2  3  
ATOM   5838  H  HD3  . ARG A 1 38  ? 11.924  4.700  20.720  1.00 0.00  ? 38  ARG A HD3  3  
ATOM   5839  H  HE   . ARG A 1 38  ? 12.503  2.423  20.825  1.00 0.00  ? 38  ARG A HE   3  
ATOM   5840  H  HH11 . ARG A 1 38  ? 10.155  3.017  18.356  1.00 0.00  ? 38  ARG A HH11 3  
ATOM   5841  H  HH12 . ARG A 1 38  ? 10.264  1.420  17.691  1.00 0.00  ? 38  ARG A HH12 3  
ATOM   5842  H  HH21 . ARG A 1 38  ? 12.636  0.339  19.980  1.00 0.00  ? 38  ARG A HH21 3  
ATOM   5843  H  HH22 . ARG A 1 38  ? 11.660  -0.095 18.616  1.00 0.00  ? 38  ARG A HH22 3  
ATOM   5844  N  N    . ALA A 1 39  ? 10.817  7.897  22.811  1.00 0.00  ? 39  ALA A N    3  
ATOM   5845  C  CA   . ALA A 1 39  ? 11.597  9.156  22.744  1.00 0.00  ? 39  ALA A CA   3  
ATOM   5846  C  C    . ALA A 1 39  ? 12.853  8.977  23.591  1.00 0.00  ? 39  ALA A C    3  
ATOM   5847  O  O    . ALA A 1 39  ? 13.930  9.397  23.220  1.00 0.00  ? 39  ALA A O    3  
ATOM   5848  C  CB   . ALA A 1 39  ? 10.764  10.312 23.303  1.00 0.00  ? 39  ALA A CB   3  
ATOM   5849  H  H    . ALA A 1 39  ? 9.896   7.904  23.144  1.00 0.00  ? 39  ALA A H    3  
ATOM   5850  H  HA   . ALA A 1 39  ? 11.869  9.359  21.719  1.00 0.00  ? 39  ALA A HA   3  
ATOM   5851  H  HB1  . ALA A 1 39  ? 9.854   10.410 22.731  1.00 0.00  ? 39  ALA A HB1  3  
ATOM   5852  H  HB2  . ALA A 1 39  ? 11.330  11.229 23.237  1.00 0.00  ? 39  ALA A HB2  3  
ATOM   5853  H  HB3  . ALA A 1 39  ? 10.522  10.111 24.336  1.00 0.00  ? 39  ALA A HB3  3  
ATOM   5854  N  N    . PHE A 1 40  ? 12.716  8.345  24.730  1.00 0.00  ? 40  PHE A N    3  
ATOM   5855  C  CA   . PHE A 1 40  ? 13.895  8.123  25.614  1.00 0.00  ? 40  PHE A CA   3  
ATOM   5856  C  C    . PHE A 1 40  ? 14.935  7.288  24.862  1.00 0.00  ? 40  PHE A C    3  
ATOM   5857  O  O    . PHE A 1 40  ? 16.111  7.588  24.872  1.00 0.00  ? 40  PHE A O    3  
ATOM   5858  C  CB   . PHE A 1 40  ? 13.444  7.388  26.887  1.00 0.00  ? 40  PHE A CB   3  
ATOM   5859  C  CG   . PHE A 1 40  ? 14.621  6.696  27.550  1.00 0.00  ? 40  PHE A CG   3  
ATOM   5860  C  CD1  . PHE A 1 40  ? 15.776  7.420  27.886  1.00 0.00  ? 40  PHE A CD1  3  
ATOM   5861  C  CD2  . PHE A 1 40  ? 14.547  5.327  27.831  1.00 0.00  ? 40  PHE A CD2  3  
ATOM   5862  C  CE1  . PHE A 1 40  ? 16.857  6.770  28.499  1.00 0.00  ? 40  PHE A CE1  3  
ATOM   5863  C  CE2  . PHE A 1 40  ? 15.627  4.677  28.443  1.00 0.00  ? 40  PHE A CE2  3  
ATOM   5864  C  CZ   . PHE A 1 40  ? 16.782  5.397  28.776  1.00 0.00  ? 40  PHE A CZ   3  
ATOM   5865  H  H    . PHE A 1 40  ? 11.835  8.012  25.002  1.00 0.00  ? 40  PHE A H    3  
ATOM   5866  H  HA   . PHE A 1 40  ? 14.322  9.076  25.882  1.00 0.00  ? 40  PHE A HA   3  
ATOM   5867  H  HB2  . PHE A 1 40  ? 13.018  8.101  27.576  1.00 0.00  ? 40  PHE A HB2  3  
ATOM   5868  H  HB3  . PHE A 1 40  ? 12.696  6.651  26.630  1.00 0.00  ? 40  PHE A HB3  3  
ATOM   5869  H  HD1  . PHE A 1 40  ? 15.834  8.479  27.673  1.00 0.00  ? 40  PHE A HD1  3  
ATOM   5870  H  HD2  . PHE A 1 40  ? 13.658  4.770  27.570  1.00 0.00  ? 40  PHE A HD2  3  
ATOM   5871  H  HE1  . PHE A 1 40  ? 17.749  7.327  28.756  1.00 0.00  ? 40  PHE A HE1  3  
ATOM   5872  H  HE2  . PHE A 1 40  ? 15.567  3.621  28.662  1.00 0.00  ? 40  PHE A HE2  3  
ATOM   5873  H  HZ   . PHE A 1 40  ? 17.615  4.892  29.246  1.00 0.00  ? 40  PHE A HZ   3  
ATOM   5874  N  N    . GLN A 1 41  ? 14.510  6.240  24.211  1.00 0.00  ? 41  GLN A N    3  
ATOM   5875  C  CA   . GLN A 1 41  ? 15.472  5.386  23.460  1.00 0.00  ? 41  GLN A CA   3  
ATOM   5876  C  C    . GLN A 1 41  ? 15.893  6.093  22.177  1.00 0.00  ? 41  GLN A C    3  
ATOM   5877  O  O    . GLN A 1 41  ? 16.860  5.724  21.547  1.00 0.00  ? 41  GLN A O    3  
ATOM   5878  C  CB   . GLN A 1 41  ? 14.793  4.072  23.087  1.00 0.00  ? 41  GLN A CB   3  
ATOM   5879  C  CG   . GLN A 1 41  ? 15.801  2.926  23.143  1.00 0.00  ? 41  GLN A CG   3  
ATOM   5880  C  CD   . GLN A 1 41  ? 15.141  1.735  23.831  1.00 0.00  ? 41  GLN A CD   3  
ATOM   5881  O  OE1  . GLN A 1 41  ? 14.161  1.210  23.345  1.00 0.00  ? 41  GLN A OE1  3  
ATOM   5882  N  NE2  . GLN A 1 41  ? 15.633  1.288  24.954  1.00 0.00  ? 41  GLN A NE2  3  
ATOM   5883  H  H    . GLN A 1 41  ? 13.556  6.013  24.214  1.00 0.00  ? 41  GLN A H    3  
ATOM   5884  H  HA   . GLN A 1 41  ? 16.341  5.187  24.068  1.00 0.00  ? 41  GLN A HA   3  
ATOM   5885  H  HB2  . GLN A 1 41  ? 13.988  3.875  23.779  1.00 0.00  ? 41  GLN A HB2  3  
ATOM   5886  H  HB3  . GLN A 1 41  ? 14.396  4.149  22.088  1.00 0.00  ? 41  GLN A HB3  3  
ATOM   5887  H  HG2  . GLN A 1 41  ? 16.095  2.650  22.138  1.00 0.00  ? 41  GLN A HG2  3  
ATOM   5888  H  HG3  . GLN A 1 41  ? 16.671  3.231  23.708  1.00 0.00  ? 41  GLN A HG3  3  
ATOM   5889  H  HE21 . GLN A 1 41  ? 16.423  1.714  25.349  1.00 0.00  ? 41  GLN A HE21 3  
ATOM   5890  H  HE22 . GLN A 1 41  ? 15.207  0.527  25.406  1.00 0.00  ? 41  GLN A HE22 3  
ATOM   5891  N  N    . VAL A 1 42  ? 15.175  7.098  21.768  1.00 0.00  ? 42  VAL A N    3  
ATOM   5892  C  CA   . VAL A 1 42  ? 15.550  7.792  20.519  1.00 0.00  ? 42  VAL A CA   3  
ATOM   5893  C  C    . VAL A 1 42  ? 16.617  8.834  20.830  1.00 0.00  ? 42  VAL A C    3  
ATOM   5894  O  O    . VAL A 1 42  ? 17.426  9.177  19.993  1.00 0.00  ? 42  VAL A O    3  
ATOM   5895  C  CB   . VAL A 1 42  ? 14.299  8.437  19.905  1.00 0.00  ? 42  VAL A CB   3  
ATOM   5896  C  CG1  . VAL A 1 42  ? 14.270  9.944  20.171  1.00 0.00  ? 42  VAL A CG1  3  
ATOM   5897  C  CG2  . VAL A 1 42  ? 14.320  8.183  18.399  1.00 0.00  ? 42  VAL A CG2  3  
ATOM   5898  H  H    . VAL A 1 42  ? 14.388  7.390  22.275  1.00 0.00  ? 42  VAL A H    3  
ATOM   5899  H  HA   . VAL A 1 42  ? 15.955  7.074  19.823  1.00 0.00  ? 42  VAL A HA   3  
ATOM   5900  H  HB   . VAL A 1 42  ? 13.417  7.988  20.337  1.00 0.00  ? 42  VAL A HB   3  
ATOM   5901  H  HG11 . VAL A 1 42  ? 14.230  10.120 21.237  1.00 0.00  ? 42  VAL A HG11 3  
ATOM   5902  H  HG12 . VAL A 1 42  ? 13.401  10.379 19.701  1.00 0.00  ? 42  VAL A HG12 3  
ATOM   5903  H  HG13 . VAL A 1 42  ? 15.165  10.394 19.767  1.00 0.00  ? 42  VAL A HG13 3  
ATOM   5904  H  HG21 . VAL A 1 42  ? 15.180  7.577  18.155  1.00 0.00  ? 42  VAL A HG21 3  
ATOM   5905  H  HG22 . VAL A 1 42  ? 14.385  9.126  17.877  1.00 0.00  ? 42  VAL A HG22 3  
ATOM   5906  H  HG23 . VAL A 1 42  ? 13.419  7.666  18.106  1.00 0.00  ? 42  VAL A HG23 3  
ATOM   5907  N  N    . TRP A 1 43  ? 16.615  9.339  22.025  1.00 0.00  ? 43  TRP A N    3  
ATOM   5908  C  CA   . TRP A 1 43  ? 17.625  10.370 22.395  1.00 0.00  ? 43  TRP A CA   3  
ATOM   5909  C  C    . TRP A 1 43  ? 18.696  9.745  23.289  1.00 0.00  ? 43  TRP A C    3  
ATOM   5910  O  O    . TRP A 1 43  ? 19.817  10.205 23.341  1.00 0.00  ? 43  TRP A O    3  
ATOM   5911  C  CB   . TRP A 1 43  ? 16.936  11.521 23.134  1.00 0.00  ? 43  TRP A CB   3  
ATOM   5912  C  CG   . TRP A 1 43  ? 16.707  12.642 22.170  1.00 0.00  ? 43  TRP A CG   3  
ATOM   5913  C  CD1  . TRP A 1 43  ? 15.699  12.679 21.273  1.00 0.00  ? 43  TRP A CD1  3  
ATOM   5914  C  CD2  . TRP A 1 43  ? 17.472  13.872 21.978  1.00 0.00  ? 43  TRP A CD2  3  
ATOM   5915  N  NE1  . TRP A 1 43  ? 15.791  13.846 20.540  1.00 0.00  ? 43  TRP A NE1  3  
ATOM   5916  C  CE2  . TRP A 1 43  ? 16.864  14.617 20.936  1.00 0.00  ? 43  TRP A CE2  3  
ATOM   5917  C  CE3  . TRP A 1 43  ? 18.618  14.413 22.592  1.00 0.00  ? 43  TRP A CE3  3  
ATOM   5918  C  CZ2  . TRP A 1 43  ? 17.369  15.848 20.521  1.00 0.00  ? 43  TRP A CZ2  3  
ATOM   5919  C  CZ3  . TRP A 1 43  ? 19.128  15.653 22.174  1.00 0.00  ? 43  TRP A CZ3  3  
ATOM   5920  C  CH2  . TRP A 1 43  ? 18.505  16.368 21.141  1.00 0.00  ? 43  TRP A CH2  3  
ATOM   5921  H  H    . TRP A 1 43  ? 15.942  9.042  22.674  1.00 0.00  ? 43  TRP A H    3  
ATOM   5922  H  HA   . TRP A 1 43  ? 18.087  10.750 21.497  1.00 0.00  ? 43  TRP A HA   3  
ATOM   5923  H  HB2  . TRP A 1 43  ? 15.987  11.179 23.521  1.00 0.00  ? 43  TRP A HB2  3  
ATOM   5924  H  HB3  . TRP A 1 43  ? 17.558  11.862 23.950  1.00 0.00  ? 43  TRP A HB3  3  
ATOM   5925  H  HD1  . TRP A 1 43  ? 14.948  11.919 21.148  1.00 0.00  ? 43  TRP A HD1  3  
ATOM   5926  H  HE1  . TRP A 1 43  ? 15.178  14.113 19.824  1.00 0.00  ? 43  TRP A HE1  3  
ATOM   5927  H  HE3  . TRP A 1 43  ? 19.109  13.872 23.388  1.00 0.00  ? 43  TRP A HE3  3  
ATOM   5928  H  HZ2  . TRP A 1 43  ? 16.885  16.395 19.725  1.00 0.00  ? 43  TRP A HZ2  3  
ATOM   5929  H  HZ3  . TRP A 1 43  ? 20.006  16.060 22.650  1.00 0.00  ? 43  TRP A HZ3  3  
ATOM   5930  H  HH2  . TRP A 1 43  ? 18.905  17.321 20.826  1.00 0.00  ? 43  TRP A HH2  3  
ATOM   5931  N  N    . SER A 1 44  ? 18.363  8.693  23.983  1.00 0.00  ? 44  SER A N    3  
ATOM   5932  C  CA   . SER A 1 44  ? 19.368  8.032  24.865  1.00 0.00  ? 44  SER A CA   3  
ATOM   5933  C  C    . SER A 1 44  ? 20.193  7.046  24.043  1.00 0.00  ? 44  SER A C    3  
ATOM   5934  O  O    . SER A 1 44  ? 21.297  6.699  24.404  1.00 0.00  ? 44  SER A O    3  
ATOM   5935  C  CB   . SER A 1 44  ? 18.650  7.278  25.983  1.00 0.00  ? 44  SER A CB   3  
ATOM   5936  O  OG   . SER A 1 44  ? 19.597  6.897  26.975  1.00 0.00  ? 44  SER A OG   3  
ATOM   5937  H  H    . SER A 1 44  ? 17.453  8.332  23.922  1.00 0.00  ? 44  SER A H    3  
ATOM   5938  H  HA   . SER A 1 44  ? 20.023  8.777  25.292  1.00 0.00  ? 44  SER A HA   3  
ATOM   5939  H  HB2  . SER A 1 44  ? 17.904  7.914  26.430  1.00 0.00  ? 44  SER A HB2  3  
ATOM   5940  H  HB3  . SER A 1 44  ? 18.172  6.398  25.569  1.00 0.00  ? 44  SER A HB3  3  
ATOM   5941  H  HG   . SER A 1 44  ? 19.975  7.696  27.348  1.00 0.00  ? 44  SER A HG   3  
ATOM   5942  N  N    . ASP A 1 45  ? 19.666  6.582  22.947  1.00 0.00  ? 45  ASP A N    3  
ATOM   5943  C  CA   . ASP A 1 45  ? 20.434  5.604  22.118  1.00 0.00  ? 45  ASP A CA   3  
ATOM   5944  C  C    . ASP A 1 45  ? 21.751  6.231  21.656  1.00 0.00  ? 45  ASP A C    3  
ATOM   5945  O  O    . ASP A 1 45  ? 22.689  5.534  21.322  1.00 0.00  ? 45  ASP A O    3  
ATOM   5946  C  CB   . ASP A 1 45  ? 19.623  5.209  20.886  1.00 0.00  ? 45  ASP A CB   3  
ATOM   5947  C  CG   . ASP A 1 45  ? 19.392  6.450  20.019  1.00 0.00  ? 45  ASP A CG   3  
ATOM   5948  O  OD1  . ASP A 1 45  ? 20.308  6.829  19.306  1.00 0.00  ? 45  ASP A OD1  3  
ATOM   5949  O  OD2  . ASP A 1 45  ? 18.307  7.003  20.086  1.00 0.00  ? 45  ASP A OD2  3  
ATOM   5950  H  H    . ASP A 1 45  ? 18.766  6.869  22.673  1.00 0.00  ? 45  ASP A H    3  
ATOM   5951  H  HA   . ASP A 1 45  ? 20.644  4.723  22.707  1.00 0.00  ? 45  ASP A HA   3  
ATOM   5952  H  HB2  . ASP A 1 45  ? 20.171  4.466  20.321  1.00 0.00  ? 45  ASP A HB2  3  
ATOM   5953  H  HB3  . ASP A 1 45  ? 18.675  4.798  21.193  1.00 0.00  ? 45  ASP A HB3  3  
ATOM   5954  N  N    . VAL A 1 46  ? 21.832  7.536  21.621  1.00 0.00  ? 46  VAL A N    3  
ATOM   5955  C  CA   . VAL A 1 46  ? 23.095  8.183  21.164  1.00 0.00  ? 46  VAL A CA   3  
ATOM   5956  C  C    . VAL A 1 46  ? 23.925  8.620  22.371  1.00 0.00  ? 46  VAL A C    3  
ATOM   5957  O  O    . VAL A 1 46  ? 24.830  9.418  22.250  1.00 0.00  ? 46  VAL A O    3  
ATOM   5958  C  CB   . VAL A 1 46  ? 22.771  9.407  20.300  1.00 0.00  ? 46  VAL A CB   3  
ATOM   5959  C  CG1  . VAL A 1 46  ? 21.795  9.018  19.188  1.00 0.00  ? 46  VAL A CG1  3  
ATOM   5960  C  CG2  . VAL A 1 46  ? 22.145  10.496 21.172  1.00 0.00  ? 46  VAL A CG2  3  
ATOM   5961  H  H    . VAL A 1 46  ? 21.065  8.088  21.886  1.00 0.00  ? 46  VAL A H    3  
ATOM   5962  H  HA   . VAL A 1 46  ? 23.665  7.476  20.581  1.00 0.00  ? 46  VAL A HA   3  
ATOM   5963  H  HB   . VAL A 1 46  ? 23.683  9.782  19.858  1.00 0.00  ? 46  VAL A HB   3  
ATOM   5964  H  HG11 . VAL A 1 46  ? 20.813  8.861  19.608  1.00 0.00  ? 46  VAL A HG11 3  
ATOM   5965  H  HG12 . VAL A 1 46  ? 22.136  8.108  18.715  1.00 0.00  ? 46  VAL A HG12 3  
ATOM   5966  H  HG13 . VAL A 1 46  ? 21.750  9.811  18.455  1.00 0.00  ? 46  VAL A HG13 3  
ATOM   5967  H  HG21 . VAL A 1 46  ? 21.303  10.933 20.653  1.00 0.00  ? 46  VAL A HG21 3  
ATOM   5968  H  HG22 . VAL A 1 46  ? 22.881  11.260 21.374  1.00 0.00  ? 46  VAL A HG22 3  
ATOM   5969  H  HG23 . VAL A 1 46  ? 21.811  10.065 22.105  1.00 0.00  ? 46  VAL A HG23 3  
ATOM   5970  N  N    . THR A 1 47  ? 23.631  8.107  23.532  1.00 0.00  ? 47  THR A N    3  
ATOM   5971  C  CA   . THR A 1 47  ? 24.424  8.506  24.736  1.00 0.00  ? 47  THR A CA   3  
ATOM   5972  C  C    . THR A 1 47  ? 24.005  7.659  25.947  1.00 0.00  ? 47  THR A C    3  
ATOM   5973  O  O    . THR A 1 47  ? 22.887  7.191  26.019  1.00 0.00  ? 47  THR A O    3  
ATOM   5974  C  CB   . THR A 1 47  ? 24.188  9.993  25.014  1.00 0.00  ? 47  THR A CB   3  
ATOM   5975  O  OG1  . THR A 1 47  ? 24.663  10.334 26.305  1.00 0.00  ? 47  THR A OG1  3  
ATOM   5976  C  CG2  . THR A 1 47  ? 22.703  10.289 24.935  1.00 0.00  ? 47  THR A CG2  3  
ATOM   5977  H  H    . THR A 1 47  ? 22.892  7.464  23.612  1.00 0.00  ? 47  THR A H    3  
ATOM   5978  H  HA   . THR A 1 47  ? 25.470  8.349  24.540  1.00 0.00  ? 47  THR A HA   3  
ATOM   5979  H  HB   . THR A 1 47  ? 24.706  10.580 24.276  1.00 0.00  ? 47  THR A HB   3  
ATOM   5980  H  HG1  . THR A 1 47  ? 24.875  11.273 26.305  1.00 0.00  ? 47  THR A HG1  3  
ATOM   5981  H  HG21 . THR A 1 47  ? 22.152  9.438  25.305  1.00 0.00  ? 47  THR A HG21 3  
ATOM   5982  H  HG22 . THR A 1 47  ? 22.433  10.478 23.909  1.00 0.00  ? 47  THR A HG22 3  
ATOM   5983  H  HG23 . THR A 1 47  ? 22.482  11.156 25.536  1.00 0.00  ? 47  THR A HG23 3  
ATOM   5984  N  N    . PRO A 1 48  ? 24.924  7.488  26.866  1.00 0.00  ? 48  PRO A N    3  
ATOM   5985  C  CA   . PRO A 1 48  ? 24.697  6.696  28.094  1.00 0.00  ? 48  PRO A CA   3  
ATOM   5986  C  C    . PRO A 1 48  ? 23.822  7.481  29.081  1.00 0.00  ? 48  PRO A C    3  
ATOM   5987  O  O    . PRO A 1 48  ? 24.101  7.537  30.261  1.00 0.00  ? 48  PRO A O    3  
ATOM   5988  C  CB   . PRO A 1 48  ? 26.114  6.488  28.651  1.00 0.00  ? 48  PRO A CB   3  
ATOM   5989  C  CG   . PRO A 1 48  ? 26.986  7.611  28.049  1.00 0.00  ? 48  PRO A CG   3  
ATOM   5990  C  CD   . PRO A 1 48  ? 26.277  8.069  26.763  1.00 0.00  ? 48  PRO A CD   3  
ATOM   5991  H  HA   . PRO A 1 48  ? 24.250  5.743  27.860  1.00 0.00  ? 48  PRO A HA   3  
ATOM   5992  H  HB2  . PRO A 1 48  ? 26.107  6.558  29.728  1.00 0.00  ? 48  PRO A HB2  3  
ATOM   5993  H  HB3  . PRO A 1 48  ? 26.498  5.528  28.344  1.00 0.00  ? 48  PRO A HB3  3  
ATOM   5994  H  HG2  . PRO A 1 48  ? 27.058  8.432  28.749  1.00 0.00  ? 48  PRO A HG2  3  
ATOM   5995  H  HG3  . PRO A 1 48  ? 27.969  7.236  27.815  1.00 0.00  ? 48  PRO A HG3  3  
ATOM   5996  H  HD2  . PRO A 1 48  ? 26.225  9.146  26.727  1.00 0.00  ? 48  PRO A HD2  3  
ATOM   5997  H  HD3  . PRO A 1 48  ? 26.780  7.682  25.892  1.00 0.00  ? 48  PRO A HD3  3  
ATOM   5998  N  N    . LEU A 1 49  ? 22.757  8.077  28.608  1.00 0.00  ? 49  LEU A N    3  
ATOM   5999  C  CA   . LEU A 1 49  ? 21.861  8.849  29.515  1.00 0.00  ? 49  LEU A CA   3  
ATOM   6000  C  C    . LEU A 1 49  ? 20.819  7.901  30.123  1.00 0.00  ? 49  LEU A C    3  
ATOM   6001  O  O    . LEU A 1 49  ? 20.349  6.982  29.483  1.00 0.00  ? 49  LEU A O    3  
ATOM   6002  C  CB   . LEU A 1 49  ? 21.144  9.945  28.712  1.00 0.00  ? 49  LEU A CB   3  
ATOM   6003  C  CG   . LEU A 1 49  ? 21.628  11.330 29.161  1.00 0.00  ? 49  LEU A CG   3  
ATOM   6004  C  CD1  . LEU A 1 49  ? 23.155  11.364 29.179  1.00 0.00  ? 49  LEU A CD1  3  
ATOM   6005  C  CD2  . LEU A 1 49  ? 21.122  12.394 28.181  1.00 0.00  ? 49  LEU A CD2  3  
ATOM   6006  H  H    . LEU A 1 49  ? 22.541  8.012  27.657  1.00 0.00  ? 49  LEU A H    3  
ATOM   6007  H  HA   . LEU A 1 49  ? 22.443  9.300  30.308  1.00 0.00  ? 49  LEU A HA   3  
ATOM   6008  H  HB2  . LEU A 1 49  ? 21.349  9.815  27.658  1.00 0.00  ? 49  LEU A HB2  3  
ATOM   6009  H  HB3  . LEU A 1 49  ? 20.080  9.870  28.880  1.00 0.00  ? 49  LEU A HB3  3  
ATOM   6010  H  HG   . LEU A 1 49  ? 21.249  11.539 30.150  1.00 0.00  ? 49  LEU A HG   3  
ATOM   6011  H  HD11 . LEU A 1 49  ? 23.500  12.191 28.573  1.00 0.00  ? 49  LEU A HD11 3  
ATOM   6012  H  HD12 . LEU A 1 49  ? 23.537  10.439 28.777  1.00 0.00  ? 49  LEU A HD12 3  
ATOM   6013  H  HD13 . LEU A 1 49  ? 23.500  11.490 30.193  1.00 0.00  ? 49  LEU A HD13 3  
ATOM   6014  H  HD21 . LEU A 1 49  ? 21.955  12.775 27.608  1.00 0.00  ? 49  LEU A HD21 3  
ATOM   6015  H  HD22 . LEU A 1 49  ? 20.661  13.202 28.729  1.00 0.00  ? 49  LEU A HD22 3  
ATOM   6016  H  HD23 . LEU A 1 49  ? 20.398  11.953 27.513  1.00 0.00  ? 49  LEU A HD23 3  
ATOM   6017  N  N    . ARG A 1 50  ? 20.454  8.122  31.356  1.00 0.00  ? 50  ARG A N    3  
ATOM   6018  C  CA   . ARG A 1 50  ? 19.440  7.243  32.008  1.00 0.00  ? 50  ARG A CA   3  
ATOM   6019  C  C    . ARG A 1 50  ? 18.349  8.110  32.637  1.00 0.00  ? 50  ARG A C    3  
ATOM   6020  O  O    . ARG A 1 50  ? 18.514  8.633  33.720  1.00 0.00  ? 50  ARG A O    3  
ATOM   6021  C  CB   . ARG A 1 50  ? 20.106  6.410  33.107  1.00 0.00  ? 50  ARG A CB   3  
ATOM   6022  C  CG   . ARG A 1 50  ? 19.586  4.974  33.046  1.00 0.00  ? 50  ARG A CG   3  
ATOM   6023  C  CD   . ARG A 1 50  ? 20.425  4.161  32.059  1.00 0.00  ? 50  ARG A CD   3  
ATOM   6024  N  NE   . ARG A 1 50  ? 19.523  3.525  31.055  1.00 0.00  ? 50  ARG A NE   3  
ATOM   6025  C  CZ   . ARG A 1 50  ? 18.833  2.463  31.372  1.00 0.00  ? 50  ARG A CZ   3  
ATOM   6026  N  NH1  . ARG A 1 50  ? 18.949  1.934  32.562  1.00 0.00  ? 50  ARG A NH1  3  
ATOM   6027  N  NH2  . ARG A 1 50  ? 18.032  1.924  30.494  1.00 0.00  ? 50  ARG A NH2  3  
ATOM   6028  H  H    . ARG A 1 50  ? 20.845  8.870  31.852  1.00 0.00  ? 50  ARG A H    3  
ATOM   6029  H  HA   . ARG A 1 50  ? 19.003  6.586  31.269  1.00 0.00  ? 50  ARG A HA   3  
ATOM   6030  H  HB2  . ARG A 1 50  ? 21.176  6.414  32.969  1.00 0.00  ? 50  ARG A HB2  3  
ATOM   6031  H  HB3  . ARG A 1 50  ? 19.865  6.833  34.070  1.00 0.00  ? 50  ARG A HB3  3  
ATOM   6032  H  HG2  . ARG A 1 50  ? 19.650  4.527  34.028  1.00 0.00  ? 50  ARG A HG2  3  
ATOM   6033  H  HG3  . ARG A 1 50  ? 18.555  4.979  32.716  1.00 0.00  ? 50  ARG A HG3  3  
ATOM   6034  H  HD2  . ARG A 1 50  ? 21.124  4.811  31.555  1.00 0.00  ? 50  ARG A HD2  3  
ATOM   6035  H  HD3  . ARG A 1 50  ? 20.966  3.393  32.592  1.00 0.00  ? 50  ARG A HD3  3  
ATOM   6036  H  HE   . ARG A 1 50  ? 19.438  3.912  30.159  1.00 0.00  ? 50  ARG A HE   3  
ATOM   6037  H  HH11 . ARG A 1 50  ? 19.568  2.342  33.237  1.00 0.00  ? 50  ARG A HH11 3  
ATOM   6038  H  HH12 . ARG A 1 50  ? 18.417  1.120  32.801  1.00 0.00  ? 50  ARG A HH12 3  
ATOM   6039  H  HH21 . ARG A 1 50  ? 17.946  2.324  29.582  1.00 0.00  ? 50  ARG A HH21 3  
ATOM   6040  H  HH22 . ARG A 1 50  ? 17.505  1.110  30.733  1.00 0.00  ? 50  ARG A HH22 3  
ATOM   6041  N  N    . PHE A 1 51  ? 17.233  8.272  31.977  1.00 0.00  ? 51  PHE A N    3  
ATOM   6042  C  CA   . PHE A 1 51  ? 16.150  9.116  32.566  1.00 0.00  ? 51  PHE A CA   3  
ATOM   6043  C  C    . PHE A 1 51  ? 15.174  8.243  33.349  1.00 0.00  ? 51  PHE A C    3  
ATOM   6044  O  O    . PHE A 1 51  ? 14.727  7.214  32.883  1.00 0.00  ? 51  PHE A O    3  
ATOM   6045  C  CB   . PHE A 1 51  ? 15.377  9.835  31.462  1.00 0.00  ? 51  PHE A CB   3  
ATOM   6046  C  CG   . PHE A 1 51  ? 16.332  10.615 30.599  1.00 0.00  ? 51  PHE A CG   3  
ATOM   6047  C  CD1  . PHE A 1 51  ? 17.454  11.214 31.175  1.00 0.00  ? 51  PHE A CD1  3  
ATOM   6048  C  CD2  . PHE A 1 51  ? 16.091  10.745 29.228  1.00 0.00  ? 51  PHE A CD2  3  
ATOM   6049  C  CE1  . PHE A 1 51  ? 18.341  11.947 30.379  1.00 0.00  ? 51  PHE A CE1  3  
ATOM   6050  C  CE2  . PHE A 1 51  ? 16.976  11.475 28.430  1.00 0.00  ? 51  PHE A CE2  3  
ATOM   6051  C  CZ   . PHE A 1 51  ? 18.103  12.077 29.004  1.00 0.00  ? 51  PHE A CZ   3  
ATOM   6052  H  H    . PHE A 1 51  ? 17.109  7.845  31.103  1.00 0.00  ? 51  PHE A H    3  
ATOM   6053  H  HA   . PHE A 1 51  ? 16.590  9.848  33.231  1.00 0.00  ? 51  PHE A HA   3  
ATOM   6054  H  HB2  . PHE A 1 51  ? 14.856  9.108  30.859  1.00 0.00  ? 51  PHE A HB2  3  
ATOM   6055  H  HB3  . PHE A 1 51  ? 14.663  10.514 31.910  1.00 0.00  ? 51  PHE A HB3  3  
ATOM   6056  H  HD1  . PHE A 1 51  ? 17.637  11.104 32.232  1.00 0.00  ? 51  PHE A HD1  3  
ATOM   6057  H  HD2  . PHE A 1 51  ? 15.222  10.279 28.787  1.00 0.00  ? 51  PHE A HD2  3  
ATOM   6058  H  HE1  . PHE A 1 51  ? 19.212  12.409 30.821  1.00 0.00  ? 51  PHE A HE1  3  
ATOM   6059  H  HE2  . PHE A 1 51  ? 16.792  11.570 27.371  1.00 0.00  ? 51  PHE A HE2  3  
ATOM   6060  H  HZ   . PHE A 1 51  ? 18.784  12.645 28.388  1.00 0.00  ? 51  PHE A HZ   3  
ATOM   6061  N  N    . SER A 1 52  ? 14.837  8.659  34.533  1.00 0.00  ? 52  SER A N    3  
ATOM   6062  C  CA   . SER A 1 52  ? 13.879  7.873  35.365  1.00 0.00  ? 52  SER A CA   3  
ATOM   6063  C  C    . SER A 1 52  ? 12.599  8.687  35.592  1.00 0.00  ? 52  SER A C    3  
ATOM   6064  O  O    . SER A 1 52  ? 12.570  9.882  35.379  1.00 0.00  ? 52  SER A O    3  
ATOM   6065  C  CB   . SER A 1 52  ? 14.524  7.563  36.714  1.00 0.00  ? 52  SER A CB   3  
ATOM   6066  O  OG   . SER A 1 52  ? 13.515  7.521  37.720  1.00 0.00  ? 52  SER A OG   3  
ATOM   6067  H  H    . SER A 1 52  ? 15.212  9.497  34.875  1.00 0.00  ? 52  SER A H    3  
ATOM   6068  H  HA   . SER A 1 52  ? 13.635  6.949  34.862  1.00 0.00  ? 52  SER A HA   3  
ATOM   6069  H  HB2  . SER A 1 52  ? 15.021  6.610  36.667  1.00 0.00  ? 52  SER A HB2  3  
ATOM   6070  H  HB3  . SER A 1 52  ? 15.249  8.333  36.946  1.00 0.00  ? 52  SER A HB3  3  
ATOM   6071  H  HG   . SER A 1 52  ? 13.651  6.730  38.247  1.00 0.00  ? 52  SER A HG   3  
ATOM   6072  N  N    . ARG A 1 53  ? 11.545  8.049  36.037  1.00 0.00  ? 53  ARG A N    3  
ATOM   6073  C  CA   . ARG A 1 53  ? 10.272  8.785  36.294  1.00 0.00  ? 53  ARG A CA   3  
ATOM   6074  C  C    . ARG A 1 53  ? 10.018  8.819  37.801  1.00 0.00  ? 53  ARG A C    3  
ATOM   6075  O  O    . ARG A 1 53  ? 10.197  7.833  38.486  1.00 0.00  ? 53  ARG A O    3  
ATOM   6076  C  CB   . ARG A 1 53  ? 9.110   8.070  35.607  1.00 0.00  ? 53  ARG A CB   3  
ATOM   6077  C  CG   . ARG A 1 53  ? 9.366   8.010  34.099  1.00 0.00  ? 53  ARG A CG   3  
ATOM   6078  C  CD   . ARG A 1 53  ? 9.177   6.576  33.604  1.00 0.00  ? 53  ARG A CD   3  
ATOM   6079  N  NE   . ARG A 1 53  ? 7.954   5.988  34.225  1.00 0.00  ? 53  ARG A NE   3  
ATOM   6080  C  CZ   . ARG A 1 53  ? 8.043   5.140  35.221  1.00 0.00  ? 53  ARG A CZ   3  
ATOM   6081  N  NH1  . ARG A 1 53  ? 9.201   4.862  35.765  1.00 0.00  ? 53  ARG A NH1  3  
ATOM   6082  N  NH2  . ARG A 1 53  ? 6.957   4.599  35.706  1.00 0.00  ? 53  ARG A NH2  3  
ATOM   6083  H  H    . ARG A 1 53  ? 11.596  7.087  36.211  1.00 0.00  ? 53  ARG A H    3  
ATOM   6084  H  HA   . ARG A 1 53  ? 10.350  9.793  35.916  1.00 0.00  ? 53  ARG A HA   3  
ATOM   6085  H  HB2  . ARG A 1 53  ? 9.023   7.071  36.001  1.00 0.00  ? 53  ARG A HB2  3  
ATOM   6086  H  HB3  . ARG A 1 53  ? 8.195   8.611  35.793  1.00 0.00  ? 53  ARG A HB3  3  
ATOM   6087  H  HG2  . ARG A 1 53  ? 8.672   8.662  33.589  1.00 0.00  ? 53  ARG A HG2  3  
ATOM   6088  H  HG3  . ARG A 1 53  ? 10.377  8.328  33.893  1.00 0.00  ? 53  ARG A HG3  3  
ATOM   6089  H  HD2  . ARG A 1 53  ? 9.062   6.582  32.530  1.00 0.00  ? 53  ARG A HD2  3  
ATOM   6090  H  HD3  . ARG A 1 53  ? 10.039  5.987  33.864  1.00 0.00  ? 53  ARG A HD3  3  
ATOM   6091  H  HE   . ARG A 1 53  ? 7.072   6.216  33.863  1.00 0.00  ? 53  ARG A HE   3  
ATOM   6092  H  HH11 . ARG A 1 53  ? 10.035  5.297  35.433  1.00 0.00  ? 53  ARG A HH11 3  
ATOM   6093  H  HH12 . ARG A 1 53  ? 9.249   4.208  36.518  1.00 0.00  ? 53  ARG A HH12 3  
ATOM   6094  H  HH21 . ARG A 1 53  ? 6.065   4.836  35.321  1.00 0.00  ? 53  ARG A HH21 3  
ATOM   6095  H  HH22 . ARG A 1 53  ? 7.018   3.942  36.457  1.00 0.00  ? 53  ARG A HH22 3  
ATOM   6096  N  N    . ILE A 1 54  ? 9.594   9.933  38.326  1.00 0.00  ? 54  ILE A N    3  
ATOM   6097  C  CA   . ILE A 1 54  ? 9.325   9.994  39.790  1.00 0.00  ? 54  ILE A CA   3  
ATOM   6098  C  C    . ILE A 1 54  ? 8.138   10.916 40.056  1.00 0.00  ? 54  ILE A C    3  
ATOM   6099  O  O    . ILE A 1 54  ? 8.047   12.005 39.526  1.00 0.00  ? 54  ILE A O    3  
ATOM   6100  C  CB   . ILE A 1 54  ? 10.552  10.531 40.541  1.00 0.00  ? 54  ILE A CB   3  
ATOM   6101  C  CG1  . ILE A 1 54  ? 11.079  11.779 39.837  1.00 0.00  ? 54  ILE A CG1  3  
ATOM   6102  C  CG2  . ILE A 1 54  ? 11.653  9.473  40.579  1.00 0.00  ? 54  ILE A CG2  3  
ATOM   6103  C  CD1  . ILE A 1 54  ? 12.338  12.269 40.552  1.00 0.00  ? 54  ILE A CD1  3  
ATOM   6104  H  H    . ILE A 1 54  ? 9.440   10.721 37.759  1.00 0.00  ? 54  ILE A H    3  
ATOM   6105  H  HA   . ILE A 1 54  ? 9.089   9.002  40.153  1.00 0.00  ? 54  ILE A HA   3  
ATOM   6106  H  HB   . ILE A 1 54  ? 10.268  10.783 41.552  1.00 0.00  ? 54  ILE A HB   3  
ATOM   6107  H  HG12 . ILE A 1 54  ? 11.319  11.540 38.810  1.00 0.00  ? 54  ILE A HG12 3  
ATOM   6108  H  HG13 . ILE A 1 54  ? 10.327  12.551 39.866  1.00 0.00  ? 54  ILE A HG13 3  
ATOM   6109  H  HG21 . ILE A 1 54  ? 11.970  9.252  39.572  1.00 0.00  ? 54  ILE A HG21 3  
ATOM   6110  H  HG22 . ILE A 1 54  ? 11.278  8.576  41.049  1.00 0.00  ? 54  ILE A HG22 3  
ATOM   6111  H  HG23 . ILE A 1 54  ? 12.492  9.850  41.148  1.00 0.00  ? 54  ILE A HG23 3  
ATOM   6112  H  HD11 . ILE A 1 54  ? 12.090  12.566 41.562  1.00 0.00  ? 54  ILE A HD11 3  
ATOM   6113  H  HD12 . ILE A 1 54  ? 12.749  13.111 40.018  1.00 0.00  ? 54  ILE A HD12 3  
ATOM   6114  H  HD13 . ILE A 1 54  ? 13.064  11.471 40.577  1.00 0.00  ? 54  ILE A HD13 3  
ATOM   6115  N  N    . HIS A 1 55  ? 7.239   10.484 40.890  1.00 0.00  ? 55  HIS A N    3  
ATOM   6116  C  CA   . HIS A 1 55  ? 6.060   11.321 41.228  1.00 0.00  ? 55  HIS A CA   3  
ATOM   6117  C  C    . HIS A 1 55  ? 5.855   11.265 42.743  1.00 0.00  ? 55  HIS A C    3  
ATOM   6118  O  O    . HIS A 1 55  ? 4.750   11.139 43.231  1.00 0.00  ? 55  HIS A O    3  
ATOM   6119  C  CB   . HIS A 1 55  ? 4.809   10.803 40.497  1.00 0.00  ? 55  HIS A CB   3  
ATOM   6120  C  CG   . HIS A 1 55  ? 4.726   9.296  40.565  1.00 0.00  ? 55  HIS A CG   3  
ATOM   6121  N  ND1  . HIS A 1 55  ? 4.029   8.553  39.619  1.00 0.00  ? 55  HIS A ND1  3  
ATOM   6122  C  CD2  . HIS A 1 55  ? 5.221   8.382  41.464  1.00 0.00  ? 55  HIS A CD2  3  
ATOM   6123  C  CE1  . HIS A 1 55  ? 4.123   7.256  39.969  1.00 0.00  ? 55  HIS A CE1  3  
ATOM   6124  N  NE2  . HIS A 1 55  ? 4.837   7.097  41.083  1.00 0.00  ? 55  HIS A NE2  3  
ATOM   6125  H  H    . HIS A 1 55  ? 7.350   9.606  41.308  1.00 0.00  ? 55  HIS A H    3  
ATOM   6126  H  HA   . HIS A 1 55  ? 6.252   12.345 40.934  1.00 0.00  ? 55  HIS A HA   3  
ATOM   6127  H  HB2  . HIS A 1 55  ? 3.929   11.226 40.956  1.00 0.00  ? 55  HIS A HB2  3  
ATOM   6128  H  HB3  . HIS A 1 55  ? 4.848   11.111 39.460  1.00 0.00  ? 55  HIS A HB3  3  
ATOM   6129  H  HD1  . HIS A 1 55  ? 3.561   8.907  38.837  1.00 0.00  ? 55  HIS A HD1  3  
ATOM   6130  H  HD2  . HIS A 1 55  ? 5.822   8.622  42.330  1.00 0.00  ? 55  HIS A HD2  3  
ATOM   6131  H  HE1  . HIS A 1 55  ? 3.673   6.444  39.420  1.00 0.00  ? 55  HIS A HE1  3  
ATOM   6132  N  N    . ASP A 1 56  ? 6.925   11.350 43.494  1.00 0.00  ? 56  ASP A N    3  
ATOM   6133  C  CA   . ASP A 1 56  ? 6.808   11.293 44.983  1.00 0.00  ? 56  ASP A CA   3  
ATOM   6134  C  C    . ASP A 1 56  ? 7.578   12.456 45.615  1.00 0.00  ? 56  ASP A C    3  
ATOM   6135  O  O    . ASP A 1 56  ? 7.004   13.345 46.213  1.00 0.00  ? 56  ASP A O    3  
ATOM   6136  C  CB   . ASP A 1 56  ? 7.403   9.975  45.491  1.00 0.00  ? 56  ASP A CB   3  
ATOM   6137  C  CG   . ASP A 1 56  ? 6.280   9.058  45.979  1.00 0.00  ? 56  ASP A CG   3  
ATOM   6138  O  OD1  . ASP A 1 56  ? 5.201   9.566  46.242  1.00 0.00  ? 56  ASP A OD1  3  
ATOM   6139  O  OD2  . ASP A 1 56  ? 6.517   7.865  46.083  1.00 0.00  ? 56  ASP A OD2  3  
ATOM   6140  H  H    . ASP A 1 56  ? 7.807   11.445 43.077  1.00 0.00  ? 56  ASP A H    3  
ATOM   6141  H  HA   . ASP A 1 56  ? 5.769   11.352 45.265  1.00 0.00  ? 56  ASP A HA   3  
ATOM   6142  H  HB2  . ASP A 1 56  ? 7.947   9.494  44.693  1.00 0.00  ? 56  ASP A HB2  3  
ATOM   6143  H  HB3  . ASP A 1 56  ? 8.076   10.180 46.308  1.00 0.00  ? 56  ASP A HB3  3  
ATOM   6144  N  N    . GLY A 1 57  ? 8.879   12.445 45.499  1.00 0.00  ? 57  GLY A N    3  
ATOM   6145  C  CA   . GLY A 1 57  ? 9.700   13.536 46.104  1.00 0.00  ? 57  GLY A CA   3  
ATOM   6146  C  C    . GLY A 1 57  ? 10.075  14.560 45.031  1.00 0.00  ? 57  GLY A C    3  
ATOM   6147  O  O    . GLY A 1 57  ? 11.225  14.929 44.885  1.00 0.00  ? 57  GLY A O    3  
ATOM   6148  H  H    . GLY A 1 57  ? 9.317   11.710 45.020  1.00 0.00  ? 57  GLY A H    3  
ATOM   6149  H  HA2  . GLY A 1 57  ? 9.128   14.025 46.881  1.00 0.00  ? 57  GLY A HA2  3  
ATOM   6150  H  HA3  . GLY A 1 57  ? 10.601  13.116 46.531  1.00 0.00  ? 57  GLY A HA3  3  
ATOM   6151  N  N    . GLU A 1 58  ? 9.114   15.025 44.282  1.00 0.00  ? 58  GLU A N    3  
ATOM   6152  C  CA   . GLU A 1 58  ? 9.407   16.028 43.223  1.00 0.00  ? 58  GLU A CA   3  
ATOM   6153  C  C    . GLU A 1 58  ? 10.233  15.386 42.113  1.00 0.00  ? 58  GLU A C    3  
ATOM   6154  O  O    . GLU A 1 58  ? 10.825  14.340 42.287  1.00 0.00  ? 58  GLU A O    3  
ATOM   6155  C  CB   . GLU A 1 58  ? 10.186  17.202 43.823  1.00 0.00  ? 58  GLU A CB   3  
ATOM   6156  C  CG   . GLU A 1 58  ? 9.279   18.434 43.868  1.00 0.00  ? 58  GLU A CG   3  
ATOM   6157  C  CD   . GLU A 1 58  ? 9.362   19.087 45.247  1.00 0.00  ? 58  GLU A CD   3  
ATOM   6158  O  OE1  . GLU A 1 58  ? 8.890   18.487 46.196  1.00 0.00  ? 58  GLU A OE1  3  
ATOM   6159  O  OE2  . GLU A 1 58  ? 9.896   20.179 45.328  1.00 0.00  ? 58  GLU A OE2  3  
ATOM   6160  H  H    . GLU A 1 58  ? 8.195   14.715 44.419  1.00 0.00  ? 58  GLU A H    3  
ATOM   6161  H  HA   . GLU A 1 58  ? 8.479   16.391 42.811  1.00 0.00  ? 58  GLU A HA   3  
ATOM   6162  H  HB2  . GLU A 1 58  ? 10.509  16.949 44.823  1.00 0.00  ? 58  GLU A HB2  3  
ATOM   6163  H  HB3  . GLU A 1 58  ? 11.048  17.414 43.208  1.00 0.00  ? 58  GLU A HB3  3  
ATOM   6164  H  HG2  . GLU A 1 58  ? 9.597   19.139 43.115  1.00 0.00  ? 58  GLU A HG2  3  
ATOM   6165  H  HG3  . GLU A 1 58  ? 8.258   18.137 43.671  1.00 0.00  ? 58  GLU A HG3  3  
ATOM   6166  N  N    . ALA A 1 59  ? 10.277  16.013 40.973  1.00 0.00  ? 59  ALA A N    3  
ATOM   6167  C  CA   . ALA A 1 59  ? 11.064  15.458 39.841  1.00 0.00  ? 59  ALA A CA   3  
ATOM   6168  C  C    . ALA A 1 59  ? 11.976  16.558 39.287  1.00 0.00  ? 59  ALA A C    3  
ATOM   6169  O  O    . ALA A 1 59  ? 11.898  17.701 39.694  1.00 0.00  ? 59  ALA A O    3  
ATOM   6170  C  CB   . ALA A 1 59  ? 10.109  14.968 38.749  1.00 0.00  ? 59  ALA A CB   3  
ATOM   6171  H  H    . ALA A 1 59  ? 9.791   16.858 40.862  1.00 0.00  ? 59  ALA A H    3  
ATOM   6172  H  HA   . ALA A 1 59  ? 11.665  14.630 40.192  1.00 0.00  ? 59  ALA A HA   3  
ATOM   6173  H  HB1  . ALA A 1 59  ? 9.353   15.719 38.565  1.00 0.00  ? 59  ALA A HB1  3  
ATOM   6174  H  HB2  . ALA A 1 59  ? 9.637   14.054 39.069  1.00 0.00  ? 59  ALA A HB2  3  
ATOM   6175  H  HB3  . ALA A 1 59  ? 10.662  14.786 37.842  1.00 0.00  ? 59  ALA A HB3  3  
ATOM   6176  N  N    . ASP A 1 60  ? 12.844  16.224 38.375  1.00 0.00  ? 60  ASP A N    3  
ATOM   6177  C  CA   . ASP A 1 60  ? 13.763  17.252 37.811  1.00 0.00  ? 60  ASP A CA   3  
ATOM   6178  C  C    . ASP A 1 60  ? 13.077  18.000 36.667  1.00 0.00  ? 60  ASP A C    3  
ATOM   6179  O  O    . ASP A 1 60  ? 12.962  19.211 36.687  1.00 0.00  ? 60  ASP A O    3  
ATOM   6180  C  CB   . ASP A 1 60  ? 15.022  16.568 37.282  1.00 0.00  ? 60  ASP A CB   3  
ATOM   6181  C  CG   . ASP A 1 60  ? 16.232  17.473 37.518  1.00 0.00  ? 60  ASP A CG   3  
ATOM   6182  O  OD1  . ASP A 1 60  ? 16.432  18.381 36.727  1.00 0.00  ? 60  ASP A OD1  3  
ATOM   6183  O  OD2  . ASP A 1 60  ? 16.942  17.241 38.481  1.00 0.00  ? 60  ASP A OD2  3  
ATOM   6184  H  H    . ASP A 1 60  ? 12.898  15.295 38.066  1.00 0.00  ? 60  ASP A H    3  
ATOM   6185  H  HA   . ASP A 1 60  ? 14.037  17.955 38.585  1.00 0.00  ? 60  ASP A HA   3  
ATOM   6186  H  HB2  . ASP A 1 60  ? 15.166  15.630 37.798  1.00 0.00  ? 60  ASP A HB2  3  
ATOM   6187  H  HB3  . ASP A 1 60  ? 14.914  16.383 36.221  1.00 0.00  ? 60  ASP A HB3  3  
ATOM   6188  N  N    . ILE A 1 61  ? 12.630  17.297 35.661  1.00 0.00  ? 61  ILE A N    3  
ATOM   6189  C  CA   . ILE A 1 61  ? 11.965  17.984 34.518  1.00 0.00  ? 61  ILE A CA   3  
ATOM   6190  C  C    . ILE A 1 61  ? 10.444  17.960 34.709  1.00 0.00  ? 61  ILE A C    3  
ATOM   6191  O  O    . ILE A 1 61  ? 9.894   17.041 35.287  1.00 0.00  ? 61  ILE A O    3  
ATOM   6192  C  CB   . ILE A 1 61  ? 12.345  17.294 33.201  1.00 0.00  ? 61  ILE A CB   3  
ATOM   6193  C  CG1  . ILE A 1 61  ? 13.728  16.641 33.341  1.00 0.00  ? 61  ILE A CG1  3  
ATOM   6194  C  CG2  . ILE A 1 61  ? 12.393  18.335 32.081  1.00 0.00  ? 61  ILE A CG2  3  
ATOM   6195  C  CD1  . ILE A 1 61  ? 14.288  16.305 31.954  1.00 0.00  ? 61  ILE A CD1  3  
ATOM   6196  H  H    . ILE A 1 61  ? 12.739  16.323 35.654  1.00 0.00  ? 61  ILE A H    3  
ATOM   6197  H  HA   . ILE A 1 61  ? 12.300  19.005 34.489  1.00 0.00  ? 61  ILE A HA   3  
ATOM   6198  H  HB   . ILE A 1 61  ? 11.608  16.541 32.962  1.00 0.00  ? 61  ILE A HB   3  
ATOM   6199  H  HG12 . ILE A 1 61  ? 14.396  17.326 33.844  1.00 0.00  ? 61  ILE A HG12 3  
ATOM   6200  H  HG13 . ILE A 1 61  ? 13.642  15.734 33.921  1.00 0.00  ? 61  ILE A HG13 3  
ATOM   6201  H  HG21 . ILE A 1 61  ? 11.521  18.967 32.137  1.00 0.00  ? 61  ILE A HG21 3  
ATOM   6202  H  HG22 . ILE A 1 61  ? 12.415  17.832 31.126  1.00 0.00  ? 61  ILE A HG22 3  
ATOM   6203  H  HG23 . ILE A 1 61  ? 13.283  18.940 32.188  1.00 0.00  ? 61  ILE A HG23 3  
ATOM   6204  H  HD11 . ILE A 1 61  ? 13.515  15.842 31.359  1.00 0.00  ? 61  ILE A HD11 3  
ATOM   6205  H  HD12 . ILE A 1 61  ? 15.121  15.625 32.054  1.00 0.00  ? 61  ILE A HD12 3  
ATOM   6206  H  HD13 . ILE A 1 61  ? 14.621  17.211 31.469  1.00 0.00  ? 61  ILE A HD13 3  
ATOM   6207  N  N    . MET A 1 62  ? 9.758   18.968 34.234  1.00 0.00  ? 62  MET A N    3  
ATOM   6208  C  CA   . MET A 1 62  ? 8.275   19.011 34.387  1.00 0.00  ? 62  MET A CA   3  
ATOM   6209  C  C    . MET A 1 62  ? 7.621   19.146 33.005  1.00 0.00  ? 62  MET A C    3  
ATOM   6210  O  O    . MET A 1 62  ? 7.810   20.127 32.308  1.00 0.00  ? 62  MET A O    3  
ATOM   6211  C  CB   . MET A 1 62  ? 7.893   20.210 35.262  1.00 0.00  ? 62  MET A CB   3  
ATOM   6212  C  CG   . MET A 1 62  ? 8.658   20.134 36.584  1.00 0.00  ? 62  MET A CG   3  
ATOM   6213  S  SD   . MET A 1 62  ? 7.512   19.720 37.919  1.00 0.00  ? 62  MET A SD   3  
ATOM   6214  C  CE   . MET A 1 62  ? 7.637   21.294 38.796  1.00 0.00  ? 62  MET A CE   3  
ATOM   6215  H  H    . MET A 1 62  ? 10.220  19.700 33.775  1.00 0.00  ? 62  MET A H    3  
ATOM   6216  H  HA   . MET A 1 62  ? 7.935   18.100 34.855  1.00 0.00  ? 62  MET A HA   3  
ATOM   6217  H  HB2  . MET A 1 62  ? 8.151   21.125 34.753  1.00 0.00  ? 62  MET A HB2  3  
ATOM   6218  H  HB3  . MET A 1 62  ? 6.832   20.196 35.462  1.00 0.00  ? 62  MET A HB3  3  
ATOM   6219  H  HG2  . MET A 1 62  ? 9.422   19.375 36.516  1.00 0.00  ? 62  MET A HG2  3  
ATOM   6220  H  HG3  . MET A 1 62  ? 9.118   21.090 36.789  1.00 0.00  ? 62  MET A HG3  3  
ATOM   6221  H  HE1  . MET A 1 62  ? 8.453   21.871 38.383  1.00 0.00  ? 62  MET A HE1  3  
ATOM   6222  H  HE2  . MET A 1 62  ? 7.823   21.112 39.840  1.00 0.00  ? 62  MET A HE2  3  
ATOM   6223  H  HE3  . MET A 1 62  ? 6.709   21.837 38.684  1.00 0.00  ? 62  MET A HE3  3  
ATOM   6224  N  N    . ILE A 1 63  ? 6.851   18.168 32.604  1.00 0.00  ? 63  ILE A N    3  
ATOM   6225  C  CA   . ILE A 1 63  ? 6.182   18.241 31.275  1.00 0.00  ? 63  ILE A CA   3  
ATOM   6226  C  C    . ILE A 1 63  ? 4.671   18.291 31.484  1.00 0.00  ? 63  ILE A C    3  
ATOM   6227  O  O    . ILE A 1 63  ? 4.135   17.612 32.336  1.00 0.00  ? 63  ILE A O    3  
ATOM   6228  C  CB   . ILE A 1 63  ? 6.531   17.006 30.445  1.00 0.00  ? 63  ILE A CB   3  
ATOM   6229  C  CG1  . ILE A 1 63  ? 8.051   16.866 30.357  1.00 0.00  ? 63  ILE A CG1  3  
ATOM   6230  C  CG2  . ILE A 1 63  ? 5.956   17.156 29.034  1.00 0.00  ? 63  ILE A CG2  3  
ATOM   6231  C  CD1  . ILE A 1 63  ? 8.409   15.457 29.889  1.00 0.00  ? 63  ILE A CD1  3  
ATOM   6232  H  H    . ILE A 1 63  ? 6.712   17.386 33.178  1.00 0.00  ? 63  ILE A H    3  
ATOM   6233  H  HA   . ILE A 1 63  ? 6.507   19.126 30.758  1.00 0.00  ? 63  ILE A HA   3  
ATOM   6234  H  HB   . ILE A 1 63  ? 6.110   16.128 30.914  1.00 0.00  ? 63  ILE A HB   3  
ATOM   6235  H  HG12 . ILE A 1 63  ? 8.439   17.589 29.656  1.00 0.00  ? 63  ILE A HG12 3  
ATOM   6236  H  HG13 . ILE A 1 63  ? 8.485   17.040 31.328  1.00 0.00  ? 63  ILE A HG13 3  
ATOM   6237  H  HG21 . ILE A 1 63  ? 5.987   16.203 28.529  1.00 0.00  ? 63  ILE A HG21 3  
ATOM   6238  H  HG22 . ILE A 1 63  ? 6.544   17.872 28.482  1.00 0.00  ? 63  ILE A HG22 3  
ATOM   6239  H  HG23 . ILE A 1 63  ? 4.931   17.498 29.093  1.00 0.00  ? 63  ILE A HG23 3  
ATOM   6240  H  HD11 . ILE A 1 63  ? 7.623   14.774 30.171  1.00 0.00  ? 63  ILE A HD11 3  
ATOM   6241  H  HD12 . ILE A 1 63  ? 9.335   15.153 30.351  1.00 0.00  ? 63  ILE A HD12 3  
ATOM   6242  H  HD13 . ILE A 1 63  ? 8.521   15.449 28.813  1.00 0.00  ? 63  ILE A HD13 3  
ATOM   6243  N  N    . ASN A 1 64  ? 3.968   19.074 30.720  1.00 0.00  ? 64  ASN A N    3  
ATOM   6244  C  CA   . ASN A 1 64  ? 2.512   19.125 30.906  1.00 0.00  ? 64  ASN A CA   3  
ATOM   6245  C  C    . ASN A 1 64  ? 1.825   19.549 29.609  1.00 0.00  ? 64  ASN A C    3  
ATOM   6246  O  O    . ASN A 1 64  ? 2.288   19.247 28.528  1.00 0.00  ? 64  ASN A O    3  
ATOM   6247  C  CB   . ASN A 1 64  ? 2.178   20.090 32.039  1.00 0.00  ? 64  ASN A CB   3  
ATOM   6248  C  CG   . ASN A 1 64  ? 2.364   21.532 31.566  1.00 0.00  ? 64  ASN A CG   3  
ATOM   6249  O  OD1  . ASN A 1 64  ? 3.469   21.957 31.292  1.00 0.00  ? 64  ASN A OD1  3  
ATOM   6250  N  ND2  . ASN A 1 64  ? 1.321   22.309 31.464  1.00 0.00  ? 64  ASN A ND2  3  
ATOM   6251  H  H    . ASN A 1 64  ? 4.388   19.610 30.036  1.00 0.00  ? 64  ASN A H    3  
ATOM   6252  H  HA   . ASN A 1 64  ? 2.187   18.146 31.168  1.00 0.00  ? 64  ASN A HA   3  
ATOM   6253  H  HB2  . ASN A 1 64  ? 1.155   19.939 32.353  1.00 0.00  ? 64  ASN A HB2  3  
ATOM   6254  H  HB3  . ASN A 1 64  ? 2.842   19.900 32.867  1.00 0.00  ? 64  ASN A HB3  3  
ATOM   6255  H  HD21 . ASN A 1 64  ? 0.431   21.966 31.689  1.00 0.00  ? 64  ASN A HD21 3  
ATOM   6256  H  HD22 . ASN A 1 64  ? 1.427   23.236 31.163  1.00 0.00  ? 64  ASN A HD22 3  
ATOM   6257  N  N    . PHE A 1 65  ? 0.715   20.228 29.696  1.00 0.00  ? 65  PHE A N    3  
ATOM   6258  C  CA   . PHE A 1 65  ? 0.013   20.635 28.447  1.00 0.00  ? 65  PHE A CA   3  
ATOM   6259  C  C    . PHE A 1 65  ? -0.470  22.088 28.548  1.00 0.00  ? 65  PHE A C    3  
ATOM   6260  O  O    . PHE A 1 65  ? -0.347  22.725 29.575  1.00 0.00  ? 65  PHE A O    3  
ATOM   6261  C  CB   . PHE A 1 65  ? -1.188  19.713 28.216  1.00 0.00  ? 65  PHE A CB   3  
ATOM   6262  C  CG   . PHE A 1 65  ? -1.819  19.361 29.541  1.00 0.00  ? 65  PHE A CG   3  
ATOM   6263  C  CD1  . PHE A 1 65  ? -2.223  20.373 30.416  1.00 0.00  ? 65  PHE A CD1  3  
ATOM   6264  C  CD2  . PHE A 1 65  ? -1.996  18.022 29.894  1.00 0.00  ? 65  PHE A CD2  3  
ATOM   6265  C  CE1  . PHE A 1 65  ? -2.804  20.045 31.648  1.00 0.00  ? 65  PHE A CE1  3  
ATOM   6266  C  CE2  . PHE A 1 65  ? -2.577  17.689 31.125  1.00 0.00  ? 65  PHE A CE2  3  
ATOM   6267  C  CZ   . PHE A 1 65  ? -2.980  18.702 32.004  1.00 0.00  ? 65  PHE A CZ   3  
ATOM   6268  H  H    . PHE A 1 65  ? 0.341   20.455 30.571  1.00 0.00  ? 65  PHE A H    3  
ATOM   6269  H  HA   . PHE A 1 65  ? 0.696   20.541 27.619  1.00 0.00  ? 65  PHE A HA   3  
ATOM   6270  H  HB2  . PHE A 1 65  ? -1.914  20.215 27.595  1.00 0.00  ? 65  PHE A HB2  3  
ATOM   6271  H  HB3  . PHE A 1 65  ? -0.859  18.809 27.726  1.00 0.00  ? 65  PHE A HB3  3  
ATOM   6272  H  HD1  . PHE A 1 65  ? -2.086  21.405 30.143  1.00 0.00  ? 65  PHE A HD1  3  
ATOM   6273  H  HD2  . PHE A 1 65  ? -1.689  17.244 29.213  1.00 0.00  ? 65  PHE A HD2  3  
ATOM   6274  H  HE1  . PHE A 1 65  ? -3.117  20.828 32.322  1.00 0.00  ? 65  PHE A HE1  3  
ATOM   6275  H  HE2  . PHE A 1 65  ? -2.711  16.654 31.398  1.00 0.00  ? 65  PHE A HE2  3  
ATOM   6276  H  HZ   . PHE A 1 65  ? -3.427  18.449 32.955  1.00 0.00  ? 65  PHE A HZ   3  
ATOM   6277  N  N    . GLY A 1 66  ? -1.018  22.614 27.478  1.00 0.00  ? 66  GLY A N    3  
ATOM   6278  C  CA   . GLY A 1 66  ? -1.514  24.025 27.496  1.00 0.00  ? 66  GLY A CA   3  
ATOM   6279  C  C    . GLY A 1 66  ? -3.006  24.065 27.125  1.00 0.00  ? 66  GLY A C    3  
ATOM   6280  O  O    . GLY A 1 66  ? -3.370  24.012 25.968  1.00 0.00  ? 66  GLY A O    3  
ATOM   6281  H  H    . GLY A 1 66  ? -1.101  22.079 26.660  1.00 0.00  ? 66  GLY A H    3  
ATOM   6282  H  HA2  . GLY A 1 66  ? -1.378  24.438 28.486  1.00 0.00  ? 66  GLY A HA2  3  
ATOM   6283  H  HA3  . GLY A 1 66  ? -0.954  24.610 26.783  1.00 0.00  ? 66  GLY A HA3  3  
ATOM   6284  N  N    . ARG A 1 67  ? -3.867  24.155 28.107  1.00 0.00  ? 67  ARG A N    3  
ATOM   6285  C  CA   . ARG A 1 67  ? -5.343  24.191 27.847  1.00 0.00  ? 67  ARG A CA   3  
ATOM   6286  C  C    . ARG A 1 67  ? -5.820  25.635 27.669  1.00 0.00  ? 67  ARG A C    3  
ATOM   6287  O  O    . ARG A 1 67  ? -6.960  25.888 27.332  1.00 0.00  ? 67  ARG A O    3  
ATOM   6288  C  CB   . ARG A 1 67  ? -6.057  23.598 29.061  1.00 0.00  ? 67  ARG A CB   3  
ATOM   6289  C  CG   . ARG A 1 67  ? -5.789  22.097 29.130  1.00 0.00  ? 67  ARG A CG   3  
ATOM   6290  C  CD   . ARG A 1 67  ? -7.017  21.377 29.691  1.00 0.00  ? 67  ARG A CD   3  
ATOM   6291  N  NE   . ARG A 1 67  ? -6.649  20.703 30.966  1.00 0.00  ? 67  ARG A NE   3  
ATOM   6292  C  CZ   . ARG A 1 67  ? -7.559  20.089 31.670  1.00 0.00  ? 67  ARG A CZ   3  
ATOM   6293  N  NH1  . ARG A 1 67  ? -8.811  20.140 31.309  1.00 0.00  ? 67  ARG A NH1  3  
ATOM   6294  N  NH2  . ARG A 1 67  ? -7.216  19.442 32.748  1.00 0.00  ? 67  ARG A NH2  3  
ATOM   6295  H  H    . ARG A 1 67  ? -3.543  24.185 29.020  1.00 0.00  ? 67  ARG A H    3  
ATOM   6296  H  HA   . ARG A 1 67  ? -5.577  23.613 26.968  1.00 0.00  ? 67  ARG A HA   3  
ATOM   6297  H  HB2  . ARG A 1 67  ? -5.678  24.072 29.957  1.00 0.00  ? 67  ARG A HB2  3  
ATOM   6298  H  HB3  . ARG A 1 67  ? -7.116  23.775 28.982  1.00 0.00  ? 67  ARG A HB3  3  
ATOM   6299  H  HG2  . ARG A 1 67  ? -5.575  21.726 28.139  1.00 0.00  ? 67  ARG A HG2  3  
ATOM   6300  H  HG3  . ARG A 1 67  ? -4.942  21.914 29.774  1.00 0.00  ? 67  ARG A HG3  3  
ATOM   6301  H  HD2  . ARG A 1 67  ? -7.808  22.091 29.873  1.00 0.00  ? 67  ARG A HD2  3  
ATOM   6302  H  HD3  . ARG A 1 67  ? -7.355  20.637 28.980  1.00 0.00  ? 67  ARG A HD3  3  
ATOM   6303  H  HE   . ARG A 1 67  ? -5.716  20.684 31.255  1.00 0.00  ? 67  ARG A HE   3  
ATOM   6304  H  HH11 . ARG A 1 67  ? -9.077  20.652 30.491  1.00 0.00  ? 67  ARG A HH11 3  
ATOM   6305  H  HH12 . ARG A 1 67  ? -9.506  19.666 31.852  1.00 0.00  ? 67  ARG A HH12 3  
ATOM   6306  H  HH21 . ARG A 1 67  ? -6.257  19.417 33.032  1.00 0.00  ? 67  ARG A HH21 3  
ATOM   6307  H  HH22 . ARG A 1 67  ? -7.908  18.960 33.286  1.00 0.00  ? 67  ARG A HH22 3  
ATOM   6308  N  N    . TRP A 1 68  ? -4.958  26.578 27.900  1.00 0.00  ? 68  TRP A N    3  
ATOM   6309  C  CA   . TRP A 1 68  ? -5.348  28.009 27.752  1.00 0.00  ? 68  TRP A CA   3  
ATOM   6310  C  C    . TRP A 1 68  ? -4.157  28.887 28.148  1.00 0.00  ? 68  TRP A C    3  
ATOM   6311  O  O    . TRP A 1 68  ? -3.032  28.433 28.182  1.00 0.00  ? 68  TRP A O    3  
ATOM   6312  C  CB   . TRP A 1 68  ? -6.548  28.311 28.654  1.00 0.00  ? 68  TRP A CB   3  
ATOM   6313  C  CG   . TRP A 1 68  ? -7.694  28.803 27.826  1.00 0.00  ? 68  TRP A CG   3  
ATOM   6314  C  CD1  . TRP A 1 68  ? -8.070  28.300 26.625  1.00 0.00  ? 68  TRP A CD1  3  
ATOM   6315  C  CD2  . TRP A 1 68  ? -8.620  29.885 28.121  1.00 0.00  ? 68  TRP A CD2  3  
ATOM   6316  N  NE1  . TRP A 1 68  ? -9.165  29.010 26.166  1.00 0.00  ? 68  TRP A NE1  3  
ATOM   6317  C  CE2  . TRP A 1 68  ? -9.543  29.997 27.054  1.00 0.00  ? 68  TRP A CE2  3  
ATOM   6318  C  CE3  . TRP A 1 68  ? -8.743  30.769 29.204  1.00 0.00  ? 68  TRP A CE3  3  
ATOM   6319  C  CZ2  . TRP A 1 68  ? -10.554 30.959 27.061  1.00 0.00  ? 68  TRP A CZ2  3  
ATOM   6320  C  CZ3  . TRP A 1 68  ? -9.759  31.738 29.217  1.00 0.00  ? 68  TRP A CZ3  3  
ATOM   6321  C  CH2  . TRP A 1 68  ? -10.663 31.834 28.147  1.00 0.00  ? 68  TRP A CH2  3  
ATOM   6322  H  H    . TRP A 1 68  ? -4.051  26.345 28.179  1.00 0.00  ? 68  TRP A H    3  
ATOM   6323  H  HA   . TRP A 1 68  ? -5.613  28.205 26.722  1.00 0.00  ? 68  TRP A HA   3  
ATOM   6324  H  HB2  . TRP A 1 68  ? -6.841  27.412 29.172  1.00 0.00  ? 68  TRP A HB2  3  
ATOM   6325  H  HB3  . TRP A 1 68  ? -6.275  29.068 29.375  1.00 0.00  ? 68  TRP A HB3  3  
ATOM   6326  H  HD1  . TRP A 1 68  ? -7.592  27.481 26.106  1.00 0.00  ? 68  TRP A HD1  3  
ATOM   6327  H  HE1  . TRP A 1 68  ? -9.631  28.845 25.318  1.00 0.00  ? 68  TRP A HE1  3  
ATOM   6328  H  HE3  . TRP A 1 68  ? -8.052  30.701 30.031  1.00 0.00  ? 68  TRP A HE3  3  
ATOM   6329  H  HZ2  . TRP A 1 68  ? -11.249 31.028 26.234  1.00 0.00  ? 68  TRP A HZ2  3  
ATOM   6330  H  HZ3  . TRP A 1 68  ? -9.844  32.413 30.056  1.00 0.00  ? 68  TRP A HZ3  3  
ATOM   6331  H  HH2  . TRP A 1 68  ? -11.443 32.581 28.163  1.00 0.00  ? 68  TRP A HH2  3  
ATOM   6332  N  N    . GLU A 1 69  ? -4.379  30.142 28.431  1.00 0.00  ? 69  GLU A N    3  
ATOM   6333  C  CA   . GLU A 1 69  ? -3.238  31.028 28.800  1.00 0.00  ? 69  GLU A CA   3  
ATOM   6334  C  C    . GLU A 1 69  ? -2.897  30.895 30.290  1.00 0.00  ? 69  GLU A C    3  
ATOM   6335  O  O    . GLU A 1 69  ? -3.067  31.826 31.050  1.00 0.00  ? 69  GLU A O    3  
ATOM   6336  C  CB   . GLU A 1 69  ? -3.612  32.479 28.493  1.00 0.00  ? 69  GLU A CB   3  
ATOM   6337  C  CG   . GLU A 1 69  ? -4.946  32.802 29.163  1.00 0.00  ? 69  GLU A CG   3  
ATOM   6338  C  CD   . GLU A 1 69  ? -5.058  34.306 29.387  1.00 0.00  ? 69  GLU A CD   3  
ATOM   6339  O  OE1  . GLU A 1 69  ? -4.117  35.009 29.054  1.00 0.00  ? 69  GLU A OE1  3  
ATOM   6340  O  OE2  . GLU A 1 69  ? -6.085  34.731 29.886  1.00 0.00  ? 69  GLU A OE2  3  
ATOM   6341  H  H    . GLU A 1 69  ? -5.289  30.506 28.386  1.00 0.00  ? 69  GLU A H    3  
ATOM   6342  H  HA   . GLU A 1 69  ? -2.375  30.753 28.215  1.00 0.00  ? 69  GLU A HA   3  
ATOM   6343  H  HB2  . GLU A 1 69  ? -2.844  33.142 28.872  1.00 0.00  ? 69  GLU A HB2  3  
ATOM   6344  H  HB3  . GLU A 1 69  ? -3.709  32.610 27.426  1.00 0.00  ? 69  GLU A HB3  3  
ATOM   6345  H  HG2  . GLU A 1 69  ? -5.755  32.473 28.528  1.00 0.00  ? 69  GLU A HG2  3  
ATOM   6346  H  HG3  . GLU A 1 69  ? -5.004  32.295 30.115  1.00 0.00  ? 69  GLU A HG3  3  
ATOM   6347  N  N    . HIS A 1 70  ? -2.403  29.751 30.707  1.00 0.00  ? 70  HIS A N    3  
ATOM   6348  C  CA   . HIS A 1 70  ? -2.027  29.565 32.142  1.00 0.00  ? 70  HIS A CA   3  
ATOM   6349  C  C    . HIS A 1 70  ? -1.147  30.743 32.589  1.00 0.00  ? 70  HIS A C    3  
ATOM   6350  O  O    . HIS A 1 70  ? -0.960  31.697 31.861  1.00 0.00  ? 70  HIS A O    3  
ATOM   6351  C  CB   . HIS A 1 70  ? -1.246  28.249 32.309  1.00 0.00  ? 70  HIS A CB   3  
ATOM   6352  C  CG   . HIS A 1 70  ? -0.376  27.991 31.098  1.00 0.00  ? 70  HIS A CG   3  
ATOM   6353  N  ND1  . HIS A 1 70  ? 0.083   29.014 30.287  1.00 0.00  ? 70  HIS A ND1  3  
ATOM   6354  C  CD2  . HIS A 1 70  ? 0.122   26.828 30.546  1.00 0.00  ? 70  HIS A CD2  3  
ATOM   6355  C  CE1  . HIS A 1 70  ? 0.815   28.456 29.302  1.00 0.00  ? 70  HIS A CE1  3  
ATOM   6356  N  NE2  . HIS A 1 70  ? 0.872   27.127 29.413  1.00 0.00  ? 70  HIS A NE2  3  
ATOM   6357  H  H    . HIS A 1 70  ? -2.272  29.017 30.072  1.00 0.00  ? 70  HIS A H    3  
ATOM   6358  H  HA   . HIS A 1 70  ? -2.921  29.535 32.749  1.00 0.00  ? 70  HIS A HA   3  
ATOM   6359  H  HB2  . HIS A 1 70  ? -0.624  28.316 33.189  1.00 0.00  ? 70  HIS A HB2  3  
ATOM   6360  H  HB3  . HIS A 1 70  ? -1.945  27.433 32.426  1.00 0.00  ? 70  HIS A HB3  3  
ATOM   6361  H  HD1  . HIS A 1 70  ? -0.081  29.970 30.414  1.00 0.00  ? 70  HIS A HD1  3  
ATOM   6362  H  HD2  . HIS A 1 70  ? -0.042  25.834 30.934  1.00 0.00  ? 70  HIS A HD2  3  
ATOM   6363  H  HE1  . HIS A 1 70  ? 1.308   29.020 28.523  1.00 0.00  ? 70  HIS A HE1  3  
ATOM   6364  N  N    . GLY A 1 71  ? -0.596  30.692 33.774  1.00 0.00  ? 71  GLY A N    3  
ATOM   6365  C  CA   . GLY A 1 71  ? 0.263   31.826 34.228  1.00 0.00  ? 71  GLY A CA   3  
ATOM   6366  C  C    . GLY A 1 71  ? 1.503   31.918 33.334  1.00 0.00  ? 71  GLY A C    3  
ATOM   6367  O  O    . GLY A 1 71  ? 2.254   32.871 33.395  1.00 0.00  ? 71  GLY A O    3  
ATOM   6368  H  H    . GLY A 1 71  ? -0.742  29.917 34.358  1.00 0.00  ? 71  GLY A H    3  
ATOM   6369  H  HA2  . GLY A 1 71  ? -0.300  32.747 34.158  1.00 0.00  ? 71  GLY A HA2  3  
ATOM   6370  H  HA3  . GLY A 1 71  ? 0.569   31.667 35.252  1.00 0.00  ? 71  GLY A HA3  3  
ATOM   6371  N  N    . ASP A 1 72  ? 1.720   30.943 32.493  1.00 0.00  ? 72  ASP A N    3  
ATOM   6372  C  CA   . ASP A 1 72  ? 2.893   30.990 31.595  1.00 0.00  ? 72  ASP A CA   3  
ATOM   6373  C  C    . ASP A 1 72  ? 2.848   32.303 30.810  1.00 0.00  ? 72  ASP A C    3  
ATOM   6374  O  O    . ASP A 1 72  ? 2.050   33.174 31.095  1.00 0.00  ? 72  ASP A O    3  
ATOM   6375  C  CB   . ASP A 1 72  ? 2.844   29.812 30.621  1.00 0.00  ? 72  ASP A CB   3  
ATOM   6376  C  CG   . ASP A 1 72  ? 4.261   29.364 30.256  1.00 0.00  ? 72  ASP A CG   3  
ATOM   6377  O  OD1  . ASP A 1 72  ? 5.200   29.993 30.716  1.00 0.00  ? 72  ASP A OD1  3  
ATOM   6378  O  OD2  . ASP A 1 72  ? 4.383   28.396 29.516  1.00 0.00  ? 72  ASP A OD2  3  
ATOM   6379  H  H    . ASP A 1 72  ? 1.114   30.189 32.450  1.00 0.00  ? 72  ASP A H    3  
ATOM   6380  H  HA   . ASP A 1 72  ? 3.785   30.940 32.184  1.00 0.00  ? 72  ASP A HA   3  
ATOM   6381  H  HB2  . ASP A 1 72  ? 2.315   28.987 31.078  1.00 0.00  ? 72  ASP A HB2  3  
ATOM   6382  H  HB3  . ASP A 1 72  ? 2.330   30.119 29.724  1.00 0.00  ? 72  ASP A HB3  3  
ATOM   6383  N  N    . GLY A 1 73  ? 3.680   32.456 29.821  1.00 0.00  ? 73  GLY A N    3  
ATOM   6384  C  CA   . GLY A 1 73  ? 3.653   33.722 29.032  1.00 0.00  ? 73  GLY A CA   3  
ATOM   6385  C  C    . GLY A 1 73  ? 3.092   33.458 27.634  1.00 0.00  ? 73  GLY A C    3  
ATOM   6386  O  O    . GLY A 1 73  ? 2.830   34.373 26.879  1.00 0.00  ? 73  GLY A O    3  
ATOM   6387  H  H    . GLY A 1 73  ? 4.314   31.744 29.596  1.00 0.00  ? 73  GLY A H    3  
ATOM   6388  H  HA2  . GLY A 1 73  ? 3.025   34.447 29.537  1.00 0.00  ? 73  GLY A HA2  3  
ATOM   6389  H  HA3  . GLY A 1 73  ? 4.655   34.111 28.943  1.00 0.00  ? 73  GLY A HA3  3  
ATOM   6390  N  N    . TYR A 1 74  ? 2.905   32.218 27.282  1.00 0.00  ? 74  TYR A N    3  
ATOM   6391  C  CA   . TYR A 1 74  ? 2.363   31.905 25.933  1.00 0.00  ? 74  TYR A CA   3  
ATOM   6392  C  C    . TYR A 1 74  ? 0.941   31.350 26.092  1.00 0.00  ? 74  TYR A C    3  
ATOM   6393  O  O    . TYR A 1 74  ? 0.754   30.327 26.723  1.00 0.00  ? 74  TYR A O    3  
ATOM   6394  C  CB   . TYR A 1 74  ? 3.262   30.862 25.260  1.00 0.00  ? 74  TYR A CB   3  
ATOM   6395  C  CG   . TYR A 1 74  ? 4.366   31.556 24.484  1.00 0.00  ? 74  TYR A CG   3  
ATOM   6396  C  CD1  . TYR A 1 74  ? 4.087   32.151 23.245  1.00 0.00  ? 74  TYR A CD1  3  
ATOM   6397  C  CD2  . TYR A 1 74  ? 5.669   31.597 25.000  1.00 0.00  ? 74  TYR A CD2  3  
ATOM   6398  C  CE1  . TYR A 1 74  ? 5.110   32.784 22.526  1.00 0.00  ? 74  TYR A CE1  3  
ATOM   6399  C  CE2  . TYR A 1 74  ? 6.688   32.232 24.282  1.00 0.00  ? 74  TYR A CE2  3  
ATOM   6400  C  CZ   . TYR A 1 74  ? 6.410   32.824 23.045  1.00 0.00  ? 74  TYR A CZ   3  
ATOM   6401  O  OH   . TYR A 1 74  ? 7.419   33.444 22.338  1.00 0.00  ? 74  TYR A OH   3  
ATOM   6402  H  H    . TYR A 1 74  ? 3.119   31.492 27.904  1.00 0.00  ? 74  TYR A H    3  
ATOM   6403  H  HA   . TYR A 1 74  ? 2.346   32.803 25.337  1.00 0.00  ? 74  TYR A HA   3  
ATOM   6404  H  HB2  . TYR A 1 74  ? 3.698   30.223 26.016  1.00 0.00  ? 74  TYR A HB2  3  
ATOM   6405  H  HB3  . TYR A 1 74  ? 2.669   30.267 24.585  1.00 0.00  ? 74  TYR A HB3  3  
ATOM   6406  H  HD1  . TYR A 1 74  ? 3.084   32.123 22.845  1.00 0.00  ? 74  TYR A HD1  3  
ATOM   6407  H  HD2  . TYR A 1 74  ? 5.886   31.143 25.955  1.00 0.00  ? 74  TYR A HD2  3  
ATOM   6408  H  HE1  . TYR A 1 74  ? 4.897   33.240 21.571  1.00 0.00  ? 74  TYR A HE1  3  
ATOM   6409  H  HE2  . TYR A 1 74  ? 7.692   32.262 24.681  1.00 0.00  ? 74  TYR A HE2  3  
ATOM   6410  H  HH   . TYR A 1 74  ? 7.141   34.344 22.148  1.00 0.00  ? 74  TYR A HH   3  
ATOM   6411  N  N    . PRO A 1 75  ? -0.024  32.040 25.531  1.00 0.00  ? 75  PRO A N    3  
ATOM   6412  C  CA   . PRO A 1 75  ? -1.434  31.626 25.620  1.00 0.00  ? 75  PRO A CA   3  
ATOM   6413  C  C    . PRO A 1 75  ? -1.701  30.447 24.684  1.00 0.00  ? 75  PRO A C    3  
ATOM   6414  O  O    . PRO A 1 75  ? -0.803  29.934 24.047  1.00 0.00  ? 75  PRO A O    3  
ATOM   6415  C  CB   . PRO A 1 75  ? -2.208  32.875 25.186  1.00 0.00  ? 75  PRO A CB   3  
ATOM   6416  C  CG   . PRO A 1 75  ? -1.222  33.735 24.366  1.00 0.00  ? 75  PRO A CG   3  
ATOM   6417  C  CD   . PRO A 1 75  ? 0.195   33.279 24.756  1.00 0.00  ? 75  PRO A CD   3  
ATOM   6418  H  HA   . PRO A 1 75  ? -1.688  31.371 26.634  1.00 0.00  ? 75  PRO A HA   3  
ATOM   6419  H  HB2  . PRO A 1 75  ? -3.055  32.591 24.576  1.00 0.00  ? 75  PRO A HB2  3  
ATOM   6420  H  HB3  . PRO A 1 75  ? -2.542  33.430 26.049  1.00 0.00  ? 75  PRO A HB3  3  
ATOM   6421  H  HG2  . PRO A 1 75  ? -1.386  33.582 23.310  1.00 0.00  ? 75  PRO A HG2  3  
ATOM   6422  H  HG3  . PRO A 1 75  ? -1.348  34.776 24.615  1.00 0.00  ? 75  PRO A HG3  3  
ATOM   6423  H  HD2  . PRO A 1 75  ? 0.781   33.078 23.870  1.00 0.00  ? 75  PRO A HD2  3  
ATOM   6424  H  HD3  . PRO A 1 75  ? 0.674   34.024 25.369  1.00 0.00  ? 75  PRO A HD3  3  
ATOM   6425  N  N    . PHE A 1 76  ? -2.927  30.016 24.602  1.00 0.00  ? 76  PHE A N    3  
ATOM   6426  C  CA   . PHE A 1 76  ? -3.260  28.870 23.710  1.00 0.00  ? 76  PHE A CA   3  
ATOM   6427  C  C    . PHE A 1 76  ? -3.345  29.365 22.274  1.00 0.00  ? 76  PHE A C    3  
ATOM   6428  O  O    . PHE A 1 76  ? -3.846  30.438 22.004  1.00 0.00  ? 76  PHE A O    3  
ATOM   6429  C  CB   . PHE A 1 76  ? -4.606  28.260 24.118  1.00 0.00  ? 76  PHE A CB   3  
ATOM   6430  C  CG   . PHE A 1 76  ? -5.686  29.319 24.107  1.00 0.00  ? 76  PHE A CG   3  
ATOM   6431  C  CD1  . PHE A 1 76  ? -5.864  30.146 25.220  1.00 0.00  ? 76  PHE A CD1  3  
ATOM   6432  C  CD2  . PHE A 1 76  ? -6.517  29.463 22.987  1.00 0.00  ? 76  PHE A CD2  3  
ATOM   6433  C  CE1  . PHE A 1 76  ? -6.867  31.121 25.217  1.00 0.00  ? 76  PHE A CE1  3  
ATOM   6434  C  CE2  . PHE A 1 76  ? -7.523  30.436 22.984  1.00 0.00  ? 76  PHE A CE2  3  
ATOM   6435  C  CZ   . PHE A 1 76  ? -7.698  31.266 24.100  1.00 0.00  ? 76  PHE A CZ   3  
ATOM   6436  H  H    . PHE A 1 76  ? -3.626  30.447 25.126  1.00 0.00  ? 76  PHE A H    3  
ATOM   6437  H  HA   . PHE A 1 76  ? -2.491  28.116 23.779  1.00 0.00  ? 76  PHE A HA   3  
ATOM   6438  H  HB2  . PHE A 1 76  ? -4.865  27.480 23.420  1.00 0.00  ? 76  PHE A HB2  3  
ATOM   6439  H  HB3  . PHE A 1 76  ? -4.525  27.842 25.112  1.00 0.00  ? 76  PHE A HB3  3  
ATOM   6440  H  HD1  . PHE A 1 76  ? -5.220  30.034 26.082  1.00 0.00  ? 76  PHE A HD1  3  
ATOM   6441  H  HD2  . PHE A 1 76  ? -6.380  28.826 22.126  1.00 0.00  ? 76  PHE A HD2  3  
ATOM   6442  H  HE1  . PHE A 1 76  ? -6.999  31.761 26.077  1.00 0.00  ? 76  PHE A HE1  3  
ATOM   6443  H  HE2  . PHE A 1 76  ? -8.164  30.547 22.123  1.00 0.00  ? 76  PHE A HE2  3  
ATOM   6444  H  HZ   . PHE A 1 76  ? -8.474  32.018 24.098  1.00 0.00  ? 76  PHE A HZ   3  
ATOM   6445  N  N    . ASP A 1 77  ? -2.862  28.591 21.347  1.00 0.00  ? 77  ASP A N    3  
ATOM   6446  C  CA   . ASP A 1 77  ? -2.919  29.020 19.928  1.00 0.00  ? 77  ASP A CA   3  
ATOM   6447  C  C    . ASP A 1 77  ? -3.820  28.064 19.149  1.00 0.00  ? 77  ASP A C    3  
ATOM   6448  O  O    . ASP A 1 77  ? -3.932  28.149 17.943  1.00 0.00  ? 77  ASP A O    3  
ATOM   6449  C  CB   . ASP A 1 77  ? -1.510  29.013 19.332  1.00 0.00  ? 77  ASP A CB   3  
ATOM   6450  C  CG   . ASP A 1 77  ? -0.942  27.596 19.377  1.00 0.00  ? 77  ASP A CG   3  
ATOM   6451  O  OD1  . ASP A 1 77  ? -0.645  27.131 20.464  1.00 0.00  ? 77  ASP A OD1  3  
ATOM   6452  O  OD2  . ASP A 1 77  ? -0.809  27.003 18.321  1.00 0.00  ? 77  ASP A OD2  3  
ATOM   6453  H  H    . ASP A 1 77  ? -2.464  27.726 21.584  1.00 0.00  ? 77  ASP A H    3  
ATOM   6454  H  HA   . ASP A 1 77  ? -3.326  30.019 19.875  1.00 0.00  ? 77  ASP A HA   3  
ATOM   6455  H  HB2  . ASP A 1 77  ? -1.552  29.350 18.307  1.00 0.00  ? 77  ASP A HB2  3  
ATOM   6456  H  HB3  . ASP A 1 77  ? -0.872  29.673 19.903  1.00 0.00  ? 77  ASP A HB3  3  
ATOM   6457  N  N    . GLY A 1 78  ? -4.473  27.159 19.830  1.00 0.00  ? 78  GLY A N    3  
ATOM   6458  C  CA   . GLY A 1 78  ? -5.381  26.202 19.120  1.00 0.00  ? 78  GLY A CA   3  
ATOM   6459  C  C    . GLY A 1 78  ? -4.579  25.333 18.146  1.00 0.00  ? 78  GLY A C    3  
ATOM   6460  O  O    . GLY A 1 78  ? -3.365  25.307 18.181  1.00 0.00  ? 78  GLY A O    3  
ATOM   6461  H  H    . GLY A 1 78  ? -4.371  27.112 20.811  1.00 0.00  ? 78  GLY A H    3  
ATOM   6462  H  HA2  . GLY A 1 78  ? -5.876  25.571 19.846  1.00 0.00  ? 78  GLY A HA2  3  
ATOM   6463  H  HA3  . GLY A 1 78  ? -6.122  26.760 18.567  1.00 0.00  ? 78  GLY A HA3  3  
ATOM   6464  N  N    . LYS A 1 79  ? -5.253  24.621 17.274  1.00 0.00  ? 79  LYS A N    3  
ATOM   6465  C  CA   . LYS A 1 79  ? -4.540  23.755 16.294  1.00 0.00  ? 79  LYS A CA   3  
ATOM   6466  C  C    . LYS A 1 79  ? -3.344  24.499 15.721  1.00 0.00  ? 79  LYS A C    3  
ATOM   6467  O  O    . LYS A 1 79  ? -3.216  25.697 15.877  1.00 0.00  ? 79  LYS A O    3  
ATOM   6468  C  CB   . LYS A 1 79  ? -5.484  23.410 15.147  1.00 0.00  ? 79  LYS A CB   3  
ATOM   6469  C  CG   . LYS A 1 79  ? -5.882  21.945 15.228  1.00 0.00  ? 79  LYS A CG   3  
ATOM   6470  C  CD   . LYS A 1 79  ? -7.091  21.709 14.323  1.00 0.00  ? 79  LYS A CD   3  
ATOM   6471  C  CE   . LYS A 1 79  ? -6.832  20.506 13.416  1.00 0.00  ? 79  LYS A CE   3  
ATOM   6472  N  NZ   . LYS A 1 79  ? -7.230  20.846 12.022  1.00 0.00  ? 79  LYS A NZ   3  
ATOM   6473  H  H    . LYS A 1 79  ? -6.232  24.655 17.263  1.00 0.00  ? 79  LYS A H    3  
ATOM   6474  H  HA   . LYS A 1 79  ? -4.206  22.850 16.777  1.00 0.00  ? 79  LYS A HA   3  
ATOM   6475  H  HB2  . LYS A 1 79  ? -6.368  24.027 15.207  1.00 0.00  ? 79  LYS A HB2  3  
ATOM   6476  H  HB3  . LYS A 1 79  ? -4.985  23.590 14.207  1.00 0.00  ? 79  LYS A HB3  3  
ATOM   6477  H  HG2  . LYS A 1 79  ? -5.055  21.336 14.900  1.00 0.00  ? 79  LYS A HG2  3  
ATOM   6478  H  HG3  . LYS A 1 79  ? -6.139  21.695 16.248  1.00 0.00  ? 79  LYS A HG3  3  
ATOM   6479  H  HD2  . LYS A 1 79  ? -7.963  21.523 14.930  1.00 0.00  ? 79  LYS A HD2  3  
ATOM   6480  H  HD3  . LYS A 1 79  ? -7.258  22.587 13.713  1.00 0.00  ? 79  LYS A HD3  3  
ATOM   6481  H  HE2  . LYS A 1 79  ? -5.782  20.255 13.440  1.00 0.00  ? 79  LYS A HE2  3  
ATOM   6482  H  HE3  . LYS A 1 79  ? -7.411  19.664 13.762  1.00 0.00  ? 79  LYS A HE3  3  
ATOM   6483  H  HZ1  . LYS A 1 79  ? -8.161  21.307 12.030  1.00 0.00  ? 79  LYS A HZ1  3  
ATOM   6484  H  HZ2  . LYS A 1 79  ? -7.277  19.977 11.454  1.00 0.00  ? 79  LYS A HZ2  3  
ATOM   6485  H  HZ3  . LYS A 1 79  ? -6.530  21.495 11.610  1.00 0.00  ? 79  LYS A HZ3  3  
ATOM   6486  N  N    . ASP A 1 80  ? -2.477  23.796 15.040  1.00 0.00  ? 80  ASP A N    3  
ATOM   6487  C  CA   . ASP A 1 80  ? -1.293  24.460 14.436  1.00 0.00  ? 80  ASP A CA   3  
ATOM   6488  C  C    . ASP A 1 80  ? -0.727  25.483 15.426  1.00 0.00  ? 80  ASP A C    3  
ATOM   6489  O  O    . ASP A 1 80  ? -1.025  25.449 16.606  1.00 0.00  ? 80  ASP A O    3  
ATOM   6490  C  CB   . ASP A 1 80  ? -1.731  25.172 13.150  1.00 0.00  ? 80  ASP A CB   3  
ATOM   6491  C  CG   . ASP A 1 80  ? -2.196  24.136 12.125  1.00 0.00  ? 80  ASP A CG   3  
ATOM   6492  O  OD1  . ASP A 1 80  ? -1.481  23.167 11.925  1.00 0.00  ? 80  ASP A OD1  3  
ATOM   6493  O  OD2  . ASP A 1 80  ? -3.260  24.330 11.559  1.00 0.00  ? 80  ASP A OD2  3  
ATOM   6494  H  H    . ASP A 1 80  ? -2.613  22.832 14.918  1.00 0.00  ? 80  ASP A H    3  
ATOM   6495  H  HA   . ASP A 1 80  ? -0.541  23.723 14.204  1.00 0.00  ? 80  ASP A HA   3  
ATOM   6496  H  HB2  . ASP A 1 80  ? -2.546  25.849 13.373  1.00 0.00  ? 80  ASP A HB2  3  
ATOM   6497  H  HB3  . ASP A 1 80  ? -0.901  25.731 12.745  1.00 0.00  ? 80  ASP A HB3  3  
ATOM   6498  N  N    . GLY A 1 81  ? 0.070   26.400 14.951  1.00 0.00  ? 81  GLY A N    3  
ATOM   6499  C  CA   . GLY A 1 81  ? 0.637   27.447 15.852  1.00 0.00  ? 81  GLY A CA   3  
ATOM   6500  C  C    . GLY A 1 81  ? 1.573   26.834 16.897  1.00 0.00  ? 81  GLY A C    3  
ATOM   6501  O  O    . GLY A 1 81  ? 2.258   25.862 16.647  1.00 0.00  ? 81  GLY A O    3  
ATOM   6502  H  H    . GLY A 1 81  ? 0.284   26.413 13.994  1.00 0.00  ? 81  GLY A H    3  
ATOM   6503  H  HA2  . GLY A 1 81  ? 1.187   28.163 15.259  1.00 0.00  ? 81  GLY A HA2  3  
ATOM   6504  H  HA3  . GLY A 1 81  ? -0.174  27.950 16.358  1.00 0.00  ? 81  GLY A HA3  3  
ATOM   6505  N  N    . LEU A 1 82  ? 1.608   27.411 18.071  1.00 0.00  ? 82  LEU A N    3  
ATOM   6506  C  CA   . LEU A 1 82  ? 2.489   26.891 19.147  1.00 0.00  ? 82  LEU A CA   3  
ATOM   6507  C  C    . LEU A 1 82  ? 2.308   25.378 19.250  1.00 0.00  ? 82  LEU A C    3  
ATOM   6508  O  O    . LEU A 1 82  ? 1.297   24.901 19.726  1.00 0.00  ? 82  LEU A O    3  
ATOM   6509  C  CB   . LEU A 1 82  ? 2.081   27.556 20.469  1.00 0.00  ? 82  LEU A CB   3  
ATOM   6510  C  CG   . LEU A 1 82  ? 3.227   28.427 20.998  1.00 0.00  ? 82  LEU A CG   3  
ATOM   6511  C  CD1  . LEU A 1 82  ? 2.751   29.875 21.153  1.00 0.00  ? 82  LEU A CD1  3  
ATOM   6512  C  CD2  . LEU A 1 82  ? 3.677   27.893 22.362  1.00 0.00  ? 82  LEU A CD2  3  
ATOM   6513  H  H    . LEU A 1 82  ? 1.047   28.193 18.249  1.00 0.00  ? 82  LEU A H    3  
ATOM   6514  H  HA   . LEU A 1 82  ? 3.519   27.123 18.924  1.00 0.00  ? 82  LEU A HA   3  
ATOM   6515  H  HB2  . LEU A 1 82  ? 1.208   28.172 20.301  1.00 0.00  ? 82  LEU A HB2  3  
ATOM   6516  H  HB3  . LEU A 1 82  ? 1.845   26.794 21.194  1.00 0.00  ? 82  LEU A HB3  3  
ATOM   6517  H  HG   . LEU A 1 82  ? 4.054   28.395 20.304  1.00 0.00  ? 82  LEU A HG   3  
ATOM   6518  H  HD11 . LEU A 1 82  ? 1.827   29.895 21.712  1.00 0.00  ? 82  LEU A HD11 3  
ATOM   6519  H  HD12 . LEU A 1 82  ? 2.588   30.306 20.176  1.00 0.00  ? 82  LEU A HD12 3  
ATOM   6520  H  HD13 . LEU A 1 82  ? 3.503   30.447 21.679  1.00 0.00  ? 82  LEU A HD13 3  
ATOM   6521  H  HD21 . LEU A 1 82  ? 4.611   27.360 22.251  1.00 0.00  ? 82  LEU A HD21 3  
ATOM   6522  H  HD22 . LEU A 1 82  ? 2.925   27.223 22.745  1.00 0.00  ? 82  LEU A HD22 3  
ATOM   6523  H  HD23 . LEU A 1 82  ? 3.806   28.716 23.051  1.00 0.00  ? 82  LEU A HD23 3  
ATOM   6524  N  N    . LEU A 1 83  ? 3.273   24.614 18.809  1.00 0.00  ? 83  LEU A N    3  
ATOM   6525  C  CA   . LEU A 1 83  ? 3.131   23.133 18.892  1.00 0.00  ? 83  LEU A CA   3  
ATOM   6526  C  C    . LEU A 1 83  ? 3.722   22.649 20.217  1.00 0.00  ? 83  LEU A C    3  
ATOM   6527  O  O    . LEU A 1 83  ? 3.487   21.537 20.646  1.00 0.00  ? 83  LEU A O    3  
ATOM   6528  C  CB   . LEU A 1 83  ? 3.882   22.474 17.731  1.00 0.00  ? 83  LEU A CB   3  
ATOM   6529  C  CG   . LEU A 1 83  ? 3.058   22.578 16.443  1.00 0.00  ? 83  LEU A CG   3  
ATOM   6530  C  CD1  . LEU A 1 83  ? 3.714   21.729 15.352  1.00 0.00  ? 83  LEU A CD1  3  
ATOM   6531  C  CD2  . LEU A 1 83  ? 1.639   22.064 16.699  1.00 0.00  ? 83  LEU A CD2  3  
ATOM   6532  H  H    . LEU A 1 83  ? 4.089   25.012 18.428  1.00 0.00  ? 83  LEU A H    3  
ATOM   6533  H  HA   . LEU A 1 83  ? 2.085   22.868 18.844  1.00 0.00  ? 83  LEU A HA   3  
ATOM   6534  H  HB2  . LEU A 1 83  ? 4.830   22.971 17.592  1.00 0.00  ? 83  LEU A HB2  3  
ATOM   6535  H  HB3  . LEU A 1 83  ? 4.054   21.432 17.961  1.00 0.00  ? 83  LEU A HB3  3  
ATOM   6536  H  HG   . LEU A 1 83  ? 3.019   23.608 16.121  1.00 0.00  ? 83  LEU A HG   3  
ATOM   6537  H  HD11 . LEU A 1 83  ? 3.908   20.739 15.736  1.00 0.00  ? 83  LEU A HD11 3  
ATOM   6538  H  HD12 . LEU A 1 83  ? 4.644   22.187 15.052  1.00 0.00  ? 83  LEU A HD12 3  
ATOM   6539  H  HD13 . LEU A 1 83  ? 3.053   21.663 14.501  1.00 0.00  ? 83  LEU A HD13 3  
ATOM   6540  H  HD21 . LEU A 1 83  ? 0.971   22.905 16.826  1.00 0.00  ? 83  LEU A HD21 3  
ATOM   6541  H  HD22 . LEU A 1 83  ? 1.631   21.460 17.593  1.00 0.00  ? 83  LEU A HD22 3  
ATOM   6542  H  HD23 . LEU A 1 83  ? 1.313   21.468 15.861  1.00 0.00  ? 83  LEU A HD23 3  
ATOM   6543  N  N    . ALA A 1 84  ? 4.488   23.482 20.865  1.00 0.00  ? 84  ALA A N    3  
ATOM   6544  C  CA   . ALA A 1 84  ? 5.097   23.087 22.165  1.00 0.00  ? 84  ALA A CA   3  
ATOM   6545  C  C    . ALA A 1 84  ? 6.142   24.136 22.567  1.00 0.00  ? 84  ALA A C    3  
ATOM   6546  O  O    . ALA A 1 84  ? 6.643   24.869 21.738  1.00 0.00  ? 84  ALA A O    3  
ATOM   6547  C  CB   . ALA A 1 84  ? 5.765   21.724 22.007  1.00 0.00  ? 84  ALA A CB   3  
ATOM   6548  H  H    . ALA A 1 84  ? 4.667   24.372 20.493  1.00 0.00  ? 84  ALA A H    3  
ATOM   6549  H  HA   . ALA A 1 84  ? 4.330   23.030 22.924  1.00 0.00  ? 84  ALA A HA   3  
ATOM   6550  H  HB1  . ALA A 1 84  ? 6.057   21.587 20.976  1.00 0.00  ? 84  ALA A HB1  3  
ATOM   6551  H  HB2  . ALA A 1 84  ? 5.069   20.946 22.290  1.00 0.00  ? 84  ALA A HB2  3  
ATOM   6552  H  HB3  . ALA A 1 84  ? 6.639   21.675 22.637  1.00 0.00  ? 84  ALA A HB3  3  
ATOM   6553  N  N    . HIS A 1 85  ? 6.482   24.214 23.829  1.00 0.00  ? 85  HIS A N    3  
ATOM   6554  C  CA   . HIS A 1 85  ? 7.503   25.215 24.265  1.00 0.00  ? 85  HIS A CA   3  
ATOM   6555  C  C    . HIS A 1 85  ? 8.145   24.766 25.577  1.00 0.00  ? 85  HIS A C    3  
ATOM   6556  O  O    . HIS A 1 85  ? 7.511   24.159 26.418  1.00 0.00  ? 85  HIS A O    3  
ATOM   6557  C  CB   . HIS A 1 85  ? 6.854   26.589 24.467  1.00 0.00  ? 85  HIS A CB   3  
ATOM   6558  C  CG   . HIS A 1 85  ? 5.671   26.467 25.388  1.00 0.00  ? 85  HIS A CG   3  
ATOM   6559  N  ND1  . HIS A 1 85  ? 4.530   25.769 25.034  1.00 0.00  ? 85  HIS A ND1  3  
ATOM   6560  C  CD2  . HIS A 1 85  ? 5.439   26.950 26.651  1.00 0.00  ? 85  HIS A CD2  3  
ATOM   6561  C  CE1  . HIS A 1 85  ? 3.668   25.848 26.064  1.00 0.00  ? 85  HIS A CE1  3  
ATOM   6562  N  NE2  . HIS A 1 85  ? 4.172   26.557 27.077  1.00 0.00  ? 85  HIS A NE2  3  
ATOM   6563  H  H    . HIS A 1 85  ? 6.072   23.611 24.485  1.00 0.00  ? 85  HIS A H    3  
ATOM   6564  H  HA   . HIS A 1 85  ? 8.266   25.293 23.508  1.00 0.00  ? 85  HIS A HA   3  
ATOM   6565  H  HB2  . HIS A 1 85  ? 7.578   27.262 24.903  1.00 0.00  ? 85  HIS A HB2  3  
ATOM   6566  H  HB3  . HIS A 1 85  ? 6.531   26.981 23.513  1.00 0.00  ? 85  HIS A HB3  3  
ATOM   6567  H  HD1  . HIS A 1 85  ? 4.381   25.300 24.190  1.00 0.00  ? 85  HIS A HD1  3  
ATOM   6568  H  HD2  . HIS A 1 85  ? 6.135   27.544 27.227  1.00 0.00  ? 85  HIS A HD2  3  
ATOM   6569  H  HE1  . HIS A 1 85  ? 2.688   25.395 26.069  1.00 0.00  ? 85  HIS A HE1  3  
ATOM   6570  N  N    . ALA A 1 86  ? 9.403   25.065 25.759  1.00 0.00  ? 86  ALA A N    3  
ATOM   6571  C  CA   . ALA A 1 86  ? 10.094  24.656 27.011  1.00 0.00  ? 86  ALA A CA   3  
ATOM   6572  C  C    . ALA A 1 86  ? 10.797  25.865 27.631  1.00 0.00  ? 86  ALA A C    3  
ATOM   6573  O  O    . ALA A 1 86  ? 11.023  26.867 26.981  1.00 0.00  ? 86  ALA A O    3  
ATOM   6574  C  CB   . ALA A 1 86  ? 11.125  23.574 26.686  1.00 0.00  ? 86  ALA A CB   3  
ATOM   6575  H  H    . ALA A 1 86  ? 9.894   25.558 25.069  1.00 0.00  ? 86  ALA A H    3  
ATOM   6576  H  HA   . ALA A 1 86  ? 9.373   24.266 27.711  1.00 0.00  ? 86  ALA A HA   3  
ATOM   6577  H  HB1  . ALA A 1 86  ? 12.082  24.037 26.496  1.00 0.00  ? 86  ALA A HB1  3  
ATOM   6578  H  HB2  . ALA A 1 86  ? 10.809  23.027 25.809  1.00 0.00  ? 86  ALA A HB2  3  
ATOM   6579  H  HB3  . ALA A 1 86  ? 11.213  22.895 27.522  1.00 0.00  ? 86  ALA A HB3  3  
ATOM   6580  N  N    . PHE A 1 87  ? 11.131  25.783 28.889  1.00 0.00  ? 87  PHE A N    3  
ATOM   6581  C  CA   . PHE A 1 87  ? 11.800  26.931 29.558  1.00 0.00  ? 87  PHE A CA   3  
ATOM   6582  C  C    . PHE A 1 87  ? 13.301  26.684 29.695  1.00 0.00  ? 87  PHE A C    3  
ATOM   6583  O  O    . PHE A 1 87  ? 13.782  25.577 29.546  1.00 0.00  ? 87  PHE A O    3  
ATOM   6584  C  CB   . PHE A 1 87  ? 11.209  27.102 30.950  1.00 0.00  ? 87  PHE A CB   3  
ATOM   6585  C  CG   . PHE A 1 87  ? 10.587  28.462 31.056  1.00 0.00  ? 87  PHE A CG   3  
ATOM   6586  C  CD1  . PHE A 1 87  ? 9.385   28.735 30.395  1.00 0.00  ? 87  PHE A CD1  3  
ATOM   6587  C  CD2  . PHE A 1 87  ? 11.211  29.450 31.820  1.00 0.00  ? 87  PHE A CD2  3  
ATOM   6588  C  CE1  . PHE A 1 87  ? 8.807   30.004 30.500  1.00 0.00  ? 87  PHE A CE1  3  
ATOM   6589  C  CE2  . PHE A 1 87  ? 10.635  30.716 31.927  1.00 0.00  ? 87  PHE A CE2  3  
ATOM   6590  C  CZ   . PHE A 1 87  ? 9.431   30.995 31.266  1.00 0.00  ? 87  PHE A CZ   3  
ATOM   6591  H  H    . PHE A 1 87  ? 10.928  24.973 29.397  1.00 0.00  ? 87  PHE A H    3  
ATOM   6592  H  HA   . PHE A 1 87  ? 11.632  27.830 28.987  1.00 0.00  ? 87  PHE A HA   3  
ATOM   6593  H  HB2  . PHE A 1 87  ? 10.459  26.344 31.122  1.00 0.00  ? 87  PHE A HB2  3  
ATOM   6594  H  HB3  . PHE A 1 87  ? 11.992  27.008 31.687  1.00 0.00  ? 87  PHE A HB3  3  
ATOM   6595  H  HD1  . PHE A 1 87  ? 8.906   27.968 29.803  1.00 0.00  ? 87  PHE A HD1  3  
ATOM   6596  H  HD2  . PHE A 1 87  ? 12.142  29.234 32.326  1.00 0.00  ? 87  PHE A HD2  3  
ATOM   6597  H  HE1  . PHE A 1 87  ? 7.879   30.220 29.990  1.00 0.00  ? 87  PHE A HE1  3  
ATOM   6598  H  HE2  . PHE A 1 87  ? 11.118  31.480 32.520  1.00 0.00  ? 87  PHE A HE2  3  
ATOM   6599  H  HZ   . PHE A 1 87  ? 8.983   31.974 31.347  1.00 0.00  ? 87  PHE A HZ   3  
ATOM   6600  N  N    . ALA A 1 88  ? 14.043  27.716 30.003  1.00 0.00  ? 88  ALA A N    3  
ATOM   6601  C  CA   . ALA A 1 88  ? 15.509  27.557 30.180  1.00 0.00  ? 88  ALA A CA   3  
ATOM   6602  C  C    . ALA A 1 88  ? 15.785  26.973 31.567  1.00 0.00  ? 88  ALA A C    3  
ATOM   6603  O  O    . ALA A 1 88  ? 14.909  26.936 32.405  1.00 0.00  ? 88  ALA A O    3  
ATOM   6604  C  CB   . ALA A 1 88  ? 16.198  28.917 30.055  1.00 0.00  ? 88  ALA A CB   3  
ATOM   6605  H  H    . ALA A 1 88  ? 13.628  28.595 30.133  1.00 0.00  ? 88  ALA A H    3  
ATOM   6606  H  HA   . ALA A 1 88  ? 15.890  26.889 29.424  1.00 0.00  ? 88  ALA A HA   3  
ATOM   6607  H  HB1  . ALA A 1 88  ? 15.484  29.653 29.715  1.00 0.00  ? 88  ALA A HB1  3  
ATOM   6608  H  HB2  . ALA A 1 88  ? 17.007  28.843 29.344  1.00 0.00  ? 88  ALA A HB2  3  
ATOM   6609  H  HB3  . ALA A 1 88  ? 16.590  29.212 31.018  1.00 0.00  ? 88  ALA A HB3  3  
ATOM   6610  N  N    . PRO A 1 89  ? 16.998  26.534 31.761  1.00 0.00  ? 89  PRO A N    3  
ATOM   6611  C  CA   . PRO A 1 89  ? 17.428  25.941 33.032  1.00 0.00  ? 89  PRO A CA   3  
ATOM   6612  C  C    . PRO A 1 89  ? 17.668  27.035 34.072  1.00 0.00  ? 89  PRO A C    3  
ATOM   6613  O  O    . PRO A 1 89  ? 17.899  28.182 33.743  1.00 0.00  ? 89  PRO A O    3  
ATOM   6614  C  CB   . PRO A 1 89  ? 18.728  25.219 32.674  1.00 0.00  ? 89  PRO A CB   3  
ATOM   6615  C  CG   . PRO A 1 89  ? 19.254  25.887 31.384  1.00 0.00  ? 89  PRO A CG   3  
ATOM   6616  C  CD   . PRO A 1 89  ? 18.054  26.596 30.732  1.00 0.00  ? 89  PRO A CD   3  
ATOM   6617  H  HA   . PRO A 1 89  ? 16.698  25.230 33.384  1.00 0.00  ? 89  PRO A HA   3  
ATOM   6618  H  HB2  . PRO A 1 89  ? 19.445  25.335 33.475  1.00 0.00  ? 89  PRO A HB2  3  
ATOM   6619  H  HB3  . PRO A 1 89  ? 18.539  24.171 32.491  1.00 0.00  ? 89  PRO A HB3  3  
ATOM   6620  H  HG2  . PRO A 1 89  ? 20.024  26.603 31.630  1.00 0.00  ? 89  PRO A HG2  3  
ATOM   6621  H  HG3  . PRO A 1 89  ? 19.641  25.139 30.715  1.00 0.00  ? 89  PRO A HG3  3  
ATOM   6622  H  HD2  . PRO A 1 89  ? 18.303  27.623 30.503  1.00 0.00  ? 89  PRO A HD2  3  
ATOM   6623  H  HD3  . PRO A 1 89  ? 17.736  26.072 29.842  1.00 0.00  ? 89  PRO A HD3  3  
ATOM   6624  N  N    . GLY A 1 90  ? 17.612  26.689 35.328  1.00 0.00  ? 90  GLY A N    3  
ATOM   6625  C  CA   . GLY A 1 90  ? 17.833  27.706 36.393  1.00 0.00  ? 90  GLY A CA   3  
ATOM   6626  C  C    . GLY A 1 90  ? 17.751  27.027 37.764  1.00 0.00  ? 90  GLY A C    3  
ATOM   6627  O  O    . GLY A 1 90  ? 18.678  26.367 38.192  1.00 0.00  ? 90  GLY A O    3  
ATOM   6628  H  H    . GLY A 1 90  ? 17.423  25.759 35.571  1.00 0.00  ? 90  GLY A H    3  
ATOM   6629  H  HA2  . GLY A 1 90  ? 18.809  28.152 36.265  1.00 0.00  ? 90  GLY A HA2  3  
ATOM   6630  H  HA3  . GLY A 1 90  ? 17.075  28.471 36.323  1.00 0.00  ? 90  GLY A HA3  3  
ATOM   6631  N  N    . THR A 1 91  ? 16.654  27.176 38.456  1.00 0.00  ? 91  THR A N    3  
ATOM   6632  C  CA   . THR A 1 91  ? 16.536  26.527 39.796  1.00 0.00  ? 91  THR A CA   3  
ATOM   6633  C  C    . THR A 1 91  ? 15.071  26.200 40.093  1.00 0.00  ? 91  THR A C    3  
ATOM   6634  O  O    . THR A 1 91  ? 14.343  27.001 40.650  1.00 0.00  ? 91  THR A O    3  
ATOM   6635  C  CB   . THR A 1 91  ? 17.076  27.470 40.875  1.00 0.00  ? 91  THR A CB   3  
ATOM   6636  O  OG1  . THR A 1 91  ? 18.303  28.036 40.437  1.00 0.00  ? 91  THR A OG1  3  
ATOM   6637  C  CG2  . THR A 1 91  ? 17.307  26.684 42.166  1.00 0.00  ? 91  THR A CG2  3  
ATOM   6638  H  H    . THR A 1 91  ? 15.915  27.708 38.097  1.00 0.00  ? 91  THR A H    3  
ATOM   6639  H  HA   . THR A 1 91  ? 17.112  25.614 39.802  1.00 0.00  ? 91  THR A HA   3  
ATOM   6640  H  HB   . THR A 1 91  ? 16.361  28.255 41.060  1.00 0.00  ? 91  THR A HB   3  
ATOM   6641  H  HG1  . THR A 1 91  ? 19.019  27.499 40.786  1.00 0.00  ? 91  THR A HG1  3  
ATOM   6642  H  HG21 . THR A 1 91  ? 16.494  26.874 42.851  1.00 0.00  ? 91  THR A HG21 3  
ATOM   6643  H  HG22 . THR A 1 91  ? 18.241  26.993 42.614  1.00 0.00  ? 91  THR A HG22 3  
ATOM   6644  H  HG23 . THR A 1 91  ? 17.349  25.628 41.942  1.00 0.00  ? 91  THR A HG23 3  
ATOM   6645  N  N    . GLY A 1 92  ? 14.635  25.024 39.734  1.00 0.00  ? 92  GLY A N    3  
ATOM   6646  C  CA   . GLY A 1 92  ? 13.221  24.638 40.002  1.00 0.00  ? 92  GLY A CA   3  
ATOM   6647  C  C    . GLY A 1 92  ? 12.422  24.669 38.695  1.00 0.00  ? 92  GLY A C    3  
ATOM   6648  O  O    . GLY A 1 92  ? 12.074  23.642 38.144  1.00 0.00  ? 92  GLY A O    3  
ATOM   6649  H  H    . GLY A 1 92  ? 15.239  24.393 39.292  1.00 0.00  ? 92  GLY A H    3  
ATOM   6650  H  HA2  . GLY A 1 92  ? 13.196  23.639 40.421  1.00 0.00  ? 92  GLY A HA2  3  
ATOM   6651  H  HA3  . GLY A 1 92  ? 12.785  25.333 40.706  1.00 0.00  ? 92  GLY A HA3  3  
ATOM   6652  N  N    . VAL A 1 93  ? 12.125  25.839 38.194  1.00 0.00  ? 93  VAL A N    3  
ATOM   6653  C  CA   . VAL A 1 93  ? 11.344  25.926 36.925  1.00 0.00  ? 93  VAL A CA   3  
ATOM   6654  C  C    . VAL A 1 93  ? 12.252  25.632 35.730  1.00 0.00  ? 93  VAL A C    3  
ATOM   6655  O  O    . VAL A 1 93  ? 11.813  25.610 34.597  1.00 0.00  ? 93  VAL A O    3  
ATOM   6656  C  CB   . VAL A 1 93  ? 10.744  27.324 36.778  1.00 0.00  ? 93  VAL A CB   3  
ATOM   6657  C  CG1  . VAL A 1 93  ? 9.674   27.300 35.687  1.00 0.00  ? 93  VAL A CG1  3  
ATOM   6658  C  CG2  . VAL A 1 93  ? 10.107  27.750 38.104  1.00 0.00  ? 93  VAL A CG2  3  
ATOM   6659  H  H    . VAL A 1 93  ? 12.412  26.656 38.652  1.00 0.00  ? 93  VAL A H    3  
ATOM   6660  H  HA   . VAL A 1 93  ? 10.547  25.199 36.950  1.00 0.00  ? 93  VAL A HA   3  
ATOM   6661  H  HB   . VAL A 1 93  ? 11.519  28.023 36.505  1.00 0.00  ? 93  VAL A HB   3  
ATOM   6662  H  HG11 . VAL A 1 93  ? 9.367   28.310 35.464  1.00 0.00  ? 93  VAL A HG11 3  
ATOM   6663  H  HG12 . VAL A 1 93  ? 8.822   26.731 36.031  1.00 0.00  ? 93  VAL A HG12 3  
ATOM   6664  H  HG13 . VAL A 1 93  ? 10.078  26.840 34.797  1.00 0.00  ? 93  VAL A HG13 3  
ATOM   6665  H  HG21 . VAL A 1 93  ? 10.810  28.351 38.662  1.00 0.00  ? 93  VAL A HG21 3  
ATOM   6666  H  HG22 . VAL A 1 93  ? 9.846   26.873 38.677  1.00 0.00  ? 93  VAL A HG22 3  
ATOM   6667  H  HG23 . VAL A 1 93  ? 9.215   28.328 37.908  1.00 0.00  ? 93  VAL A HG23 3  
ATOM   6668  N  N    . GLY A 1 94  ? 13.510  25.397 35.970  1.00 0.00  ? 94  GLY A N    3  
ATOM   6669  C  CA   . GLY A 1 94  ? 14.432  25.092 34.840  1.00 0.00  ? 94  GLY A CA   3  
ATOM   6670  C  C    . GLY A 1 94  ? 14.198  23.650 34.383  1.00 0.00  ? 94  GLY A C    3  
ATOM   6671  O  O    . GLY A 1 94  ? 14.002  22.762 35.188  1.00 0.00  ? 94  GLY A O    3  
ATOM   6672  H  H    . GLY A 1 94  ? 13.847  25.414 36.889  1.00 0.00  ? 94  GLY A H    3  
ATOM   6673  H  HA2  . GLY A 1 94  ? 14.234  25.768 34.022  1.00 0.00  ? 94  GLY A HA2  3  
ATOM   6674  H  HA3  . GLY A 1 94  ? 15.455  25.205 35.164  1.00 0.00  ? 94  GLY A HA3  3  
ATOM   6675  N  N    . GLY A 1 95  ? 14.216  23.409 33.099  1.00 0.00  ? 95  GLY A N    3  
ATOM   6676  C  CA   . GLY A 1 95  ? 13.996  22.015 32.596  1.00 0.00  ? 95  GLY A CA   3  
ATOM   6677  C  C    . GLY A 1 95  ? 12.522  21.638 32.734  1.00 0.00  ? 95  GLY A C    3  
ATOM   6678  O  O    . GLY A 1 95  ? 12.164  20.788 33.519  1.00 0.00  ? 95  GLY A O    3  
ATOM   6679  H  H    . GLY A 1 95  ? 14.377  24.140 32.465  1.00 0.00  ? 95  GLY A H    3  
ATOM   6680  H  HA2  . GLY A 1 95  ? 14.283  21.957 31.557  1.00 0.00  ? 95  GLY A HA2  3  
ATOM   6681  H  HA3  . GLY A 1 95  ? 14.594  21.327 33.172  1.00 0.00  ? 95  GLY A HA3  3  
ATOM   6682  N  N    . ASP A 1 96  ? 11.667  22.268 31.977  1.00 0.00  ? 96  ASP A N    3  
ATOM   6683  C  CA   . ASP A 1 96  ? 10.213  21.962 32.068  1.00 0.00  ? 96  ASP A CA   3  
ATOM   6684  C  C    . ASP A 1 96  ? 9.520   22.454 30.797  1.00 0.00  ? 96  ASP A C    3  
ATOM   6685  O  O    . ASP A 1 96  ? 9.511   23.632 30.497  1.00 0.00  ? 96  ASP A O    3  
ATOM   6686  C  CB   . ASP A 1 96  ? 9.627   22.677 33.288  1.00 0.00  ? 96  ASP A CB   3  
ATOM   6687  C  CG   . ASP A 1 96  ? 10.484  22.369 34.516  1.00 0.00  ? 96  ASP A CG   3  
ATOM   6688  O  OD1  . ASP A 1 96  ? 10.367  21.270 35.029  1.00 0.00  ? 96  ASP A OD1  3  
ATOM   6689  O  OD2  . ASP A 1 96  ? 11.250  23.233 34.915  1.00 0.00  ? 96  ASP A OD2  3  
ATOM   6690  H  H    . ASP A 1 96  ? 11.981  22.950 31.351  1.00 0.00  ? 96  ASP A H    3  
ATOM   6691  H  HA   . ASP A 1 96  ? 10.073  20.897 32.170  1.00 0.00  ? 96  ASP A HA   3  
ATOM   6692  H  HB2  . ASP A 1 96  ? 9.617   23.742 33.114  1.00 0.00  ? 96  ASP A HB2  3  
ATOM   6693  H  HB3  . ASP A 1 96  ? 8.622   22.330 33.458  1.00 0.00  ? 96  ASP A HB3  3  
ATOM   6694  N  N    . SER A 1 97  ? 8.952   21.553 30.040  1.00 0.00  ? 97  SER A N    3  
ATOM   6695  C  CA   . SER A 1 97  ? 8.273   21.960 28.776  1.00 0.00  ? 97  SER A CA   3  
ATOM   6696  C  C    . SER A 1 97  ? 6.781   21.633 28.859  1.00 0.00  ? 97  SER A C    3  
ATOM   6697  O  O    . SER A 1 97  ? 6.363   20.785 29.613  1.00 0.00  ? 97  SER A O    3  
ATOM   6698  C  CB   . SER A 1 97  ? 8.891   21.211 27.589  1.00 0.00  ? 97  SER A CB   3  
ATOM   6699  O  OG   . SER A 1 97  ? 9.903   20.327 28.059  1.00 0.00  ? 97  SER A OG   3  
ATOM   6700  H  H    . SER A 1 97  ? 8.980   20.607 30.301  1.00 0.00  ? 97  SER A H    3  
ATOM   6701  H  HA   . SER A 1 97  ? 8.397   23.021 28.631  1.00 0.00  ? 97  SER A HA   3  
ATOM   6702  H  HB2  . SER A 1 97  ? 8.128   20.640 27.082  1.00 0.00  ? 97  SER A HB2  3  
ATOM   6703  H  HB3  . SER A 1 97  ? 9.318   21.927 26.898  1.00 0.00  ? 97  SER A HB3  3  
ATOM   6704  H  HG   . SER A 1 97  ? 10.726  20.816 28.101  1.00 0.00  ? 97  SER A HG   3  
ATOM   6705  N  N    . HIS A 1 98  ? 5.978   22.301 28.079  1.00 0.00  ? 98  HIS A N    3  
ATOM   6706  C  CA   . HIS A 1 98  ? 4.510   22.031 28.099  1.00 0.00  ? 98  HIS A CA   3  
ATOM   6707  C  C    . HIS A 1 98  ? 4.036   21.822 26.658  1.00 0.00  ? 98  HIS A C    3  
ATOM   6708  O  O    . HIS A 1 98  ? 4.563   22.408 25.734  1.00 0.00  ? 98  HIS A O    3  
ATOM   6709  C  CB   . HIS A 1 98  ? 3.763   23.222 28.724  1.00 0.00  ? 98  HIS A CB   3  
ATOM   6710  C  CG   . HIS A 1 98  ? 4.700   24.024 29.589  1.00 0.00  ? 98  HIS A CG   3  
ATOM   6711  N  ND1  . HIS A 1 98  ? 4.966   25.363 29.344  1.00 0.00  ? 98  HIS A ND1  3  
ATOM   6712  C  CD2  . HIS A 1 98  ? 5.442   23.689 30.694  1.00 0.00  ? 98  HIS A CD2  3  
ATOM   6713  C  CE1  . HIS A 1 98  ? 5.840   25.779 30.280  1.00 0.00  ? 98  HIS A CE1  3  
ATOM   6714  N  NE2  . HIS A 1 98  ? 6.162   24.799 31.129  1.00 0.00  ? 98  HIS A NE2  3  
ATOM   6715  H  H    . HIS A 1 98  ? 6.341   22.979 27.472  1.00 0.00  ? 98  HIS A H    3  
ATOM   6716  H  HA   . HIS A 1 98  ? 4.315   21.137 28.678  1.00 0.00  ? 98  HIS A HA   3  
ATOM   6717  H  HB2  . HIS A 1 98  ? 3.375   23.854 27.939  1.00 0.00  ? 98  HIS A HB2  3  
ATOM   6718  H  HB3  . HIS A 1 98  ? 2.943   22.858 29.329  1.00 0.00  ? 98  HIS A HB3  3  
ATOM   6719  H  HD1  . HIS A 1 98  ? 4.589   25.907 28.620  1.00 0.00  ? 98  HIS A HD1  3  
ATOM   6720  H  HD2  . HIS A 1 98  ? 5.466   22.711 31.155  1.00 0.00  ? 98  HIS A HD2  3  
ATOM   6721  H  HE1  . HIS A 1 98  ? 6.233   26.785 30.337  1.00 0.00  ? 98  HIS A HE1  3  
ATOM   6722  N  N    . PHE A 1 99  ? 3.061   20.980 26.454  1.00 0.00  ? 99  PHE A N    3  
ATOM   6723  C  CA   . PHE A 1 99  ? 2.573   20.719 25.066  1.00 0.00  ? 99  PHE A CA   3  
ATOM   6724  C  C    . PHE A 1 99  ? 1.155   21.293 24.889  1.00 0.00  ? 99  PHE A C    3  
ATOM   6725  O  O    . PHE A 1 99  ? 0.355   21.269 25.797  1.00 0.00  ? 99  PHE A O    3  
ATOM   6726  C  CB   . PHE A 1 99  ? 2.552   19.204 24.846  1.00 0.00  ? 99  PHE A CB   3  
ATOM   6727  C  CG   . PHE A 1 99  ? 3.940   18.727 24.482  1.00 0.00  ? 99  PHE A CG   3  
ATOM   6728  C  CD1  . PHE A 1 99  ? 4.346   18.740 23.146  1.00 0.00  ? 99  PHE A CD1  3  
ATOM   6729  C  CD2  . PHE A 1 99  ? 4.820   18.282 25.477  1.00 0.00  ? 99  PHE A CD2  3  
ATOM   6730  C  CE1  . PHE A 1 99  ? 5.634   18.307 22.799  1.00 0.00  ? 99  PHE A CE1  3  
ATOM   6731  C  CE2  . PHE A 1 99  ? 6.108   17.849 25.131  1.00 0.00  ? 99  PHE A CE2  3  
ATOM   6732  C  CZ   . PHE A 1 99  ? 6.516   17.862 23.792  1.00 0.00  ? 99  PHE A CZ   3  
ATOM   6733  H  H    . PHE A 1 99  ? 2.661   20.504 27.209  1.00 0.00  ? 99  PHE A H    3  
ATOM   6734  H  HA   . PHE A 1 99  ? 3.244   21.177 24.351  1.00 0.00  ? 99  PHE A HA   3  
ATOM   6735  H  HB2  . PHE A 1 99  ? 2.232   18.715 25.755  1.00 0.00  ? 99  PHE A HB2  3  
ATOM   6736  H  HB3  . PHE A 1 99  ? 1.869   18.963 24.046  1.00 0.00  ? 99  PHE A HB3  3  
ATOM   6737  H  HD1  . PHE A 1 99  ? 3.667   19.081 22.381  1.00 0.00  ? 99  PHE A HD1  3  
ATOM   6738  H  HD2  . PHE A 1 99  ? 4.506   18.269 26.511  1.00 0.00  ? 99  PHE A HD2  3  
ATOM   6739  H  HE1  . PHE A 1 99  ? 5.949   18.320 21.764  1.00 0.00  ? 99  PHE A HE1  3  
ATOM   6740  H  HE2  . PHE A 1 99  ? 6.787   17.508 25.899  1.00 0.00  ? 99  PHE A HE2  3  
ATOM   6741  H  HZ   . PHE A 1 99  ? 7.511   17.527 23.525  1.00 0.00  ? 99  PHE A HZ   3  
ATOM   6742  N  N    . ASP A 1 100 ? 0.832   21.811 23.729  1.00 0.00  ? 100 ASP A N    3  
ATOM   6743  C  CA   . ASP A 1 100 ? -0.538  22.378 23.525  1.00 0.00  ? 100 ASP A CA   3  
ATOM   6744  C  C    . ASP A 1 100 ? -1.577  21.415 24.109  1.00 0.00  ? 100 ASP A C    3  
ATOM   6745  O  O    . ASP A 1 100 ? -1.277  20.277 24.411  1.00 0.00  ? 100 ASP A O    3  
ATOM   6746  C  CB   . ASP A 1 100 ? -0.810  22.560 22.026  1.00 0.00  ? 100 ASP A CB   3  
ATOM   6747  C  CG   . ASP A 1 100 ? -1.135  24.025 21.719  1.00 0.00  ? 100 ASP A CG   3  
ATOM   6748  O  OD1  . ASP A 1 100 ? -0.208  24.810 21.615  1.00 0.00  ? 100 ASP A OD1  3  
ATOM   6749  O  OD2  . ASP A 1 100 ? -2.306  24.334 21.578  1.00 0.00  ? 100 ASP A OD2  3  
ATOM   6750  H  H    . ASP A 1 100 ? 1.482   21.827 22.997  1.00 0.00  ? 100 ASP A H    3  
ATOM   6751  H  HA   . ASP A 1 100 ? -0.609  23.333 24.024  1.00 0.00  ? 100 ASP A HA   3  
ATOM   6752  H  HB2  . ASP A 1 100 ? 0.059   22.260 21.462  1.00 0.00  ? 100 ASP A HB2  3  
ATOM   6753  H  HB3  . ASP A 1 100 ? -1.649  21.946 21.743  1.00 0.00  ? 100 ASP A HB3  3  
ATOM   6754  N  N    . ASP A 1 101 ? -2.800  21.858 24.256  1.00 0.00  ? 101 ASP A N    3  
ATOM   6755  C  CA   . ASP A 1 101 ? -3.861  20.967 24.805  1.00 0.00  ? 101 ASP A CA   3  
ATOM   6756  C  C    . ASP A 1 101 ? -4.650  20.377 23.628  1.00 0.00  ? 101 ASP A C    3  
ATOM   6757  O  O    . ASP A 1 101 ? -5.208  19.299 23.707  1.00 0.00  ? 101 ASP A O    3  
ATOM   6758  C  CB   . ASP A 1 101 ? -4.780  21.805 25.716  1.00 0.00  ? 101 ASP A CB   3  
ATOM   6759  C  CG   . ASP A 1 101 ? -6.125  21.101 25.927  1.00 0.00  ? 101 ASP A CG   3  
ATOM   6760  O  OD1  . ASP A 1 101 ? -6.217  19.926 25.626  1.00 0.00  ? 101 ASP A OD1  3  
ATOM   6761  O  OD2  . ASP A 1 101 ? -7.046  21.754 26.394  1.00 0.00  ? 101 ASP A OD2  3  
ATOM   6762  H  H    . ASP A 1 101 ? -3.022  22.777 23.994  1.00 0.00  ? 101 ASP A H    3  
ATOM   6763  H  HA   . ASP A 1 101 ? -3.408  20.167 25.373  1.00 0.00  ? 101 ASP A HA   3  
ATOM   6764  H  HB2  . ASP A 1 101 ? -4.299  21.947 26.676  1.00 0.00  ? 101 ASP A HB2  3  
ATOM   6765  H  HB3  . ASP A 1 101 ? -4.951  22.769 25.259  1.00 0.00  ? 101 ASP A HB3  3  
ATOM   6766  N  N    . ASP A 1 102 ? -4.659  21.063 22.522  1.00 0.00  ? 102 ASP A N    3  
ATOM   6767  C  CA   . ASP A 1 102 ? -5.374  20.542 21.322  1.00 0.00  ? 102 ASP A CA   3  
ATOM   6768  C  C    . ASP A 1 102 ? -4.356  19.894 20.373  1.00 0.00  ? 102 ASP A C    3  
ATOM   6769  O  O    . ASP A 1 102 ? -3.383  19.304 20.799  1.00 0.00  ? 102 ASP A O    3  
ATOM   6770  C  CB   . ASP A 1 102 ? -6.068  21.699 20.595  1.00 0.00  ? 102 ASP A CB   3  
ATOM   6771  C  CG   . ASP A 1 102 ? -6.917  22.506 21.580  1.00 0.00  ? 102 ASP A CG   3  
ATOM   6772  O  OD1  . ASP A 1 102 ? -6.439  22.761 22.675  1.00 0.00  ? 102 ASP A OD1  3  
ATOM   6773  O  OD2  . ASP A 1 102 ? -8.029  22.861 21.220  1.00 0.00  ? 102 ASP A OD2  3  
ATOM   6774  H  H    . ASP A 1 102 ? -4.177  21.914 22.473  1.00 0.00  ? 102 ASP A H    3  
ATOM   6775  H  HA   . ASP A 1 102 ? -6.109  19.811 21.626  1.00 0.00  ? 102 ASP A HA   3  
ATOM   6776  H  HB2  . ASP A 1 102 ? -5.321  22.340 20.153  1.00 0.00  ? 102 ASP A HB2  3  
ATOM   6777  H  HB3  . ASP A 1 102 ? -6.703  21.301 19.818  1.00 0.00  ? 102 ASP A HB3  3  
ATOM   6778  N  N    . GLU A 1 103 ? -4.569  20.014 19.085  1.00 0.00  ? 103 GLU A N    3  
ATOM   6779  C  CA   . GLU A 1 103 ? -3.618  19.423 18.095  1.00 0.00  ? 103 GLU A CA   3  
ATOM   6780  C  C    . GLU A 1 103 ? -3.811  17.902 18.039  1.00 0.00  ? 103 GLU A C    3  
ATOM   6781  O  O    . GLU A 1 103 ? -3.964  17.250 19.051  1.00 0.00  ? 103 GLU A O    3  
ATOM   6782  C  CB   . GLU A 1 103 ? -2.178  19.758 18.498  1.00 0.00  ? 103 GLU A CB   3  
ATOM   6783  C  CG   . GLU A 1 103 ? -2.136  21.147 19.147  1.00 0.00  ? 103 GLU A CG   3  
ATOM   6784  C  CD   . GLU A 1 103 ? -0.983  21.967 18.559  1.00 0.00  ? 103 GLU A CD   3  
ATOM   6785  O  OE1  . GLU A 1 103 ? -1.198  22.608 17.544  1.00 0.00  ? 103 GLU A OE1  3  
ATOM   6786  O  OE2  . GLU A 1 103 ? 0.089   21.951 19.143  1.00 0.00  ? 103 GLU A OE2  3  
ATOM   6787  H  H    . GLU A 1 103 ? -5.356  20.501 18.766  1.00 0.00  ? 103 GLU A H    3  
ATOM   6788  H  HA   . GLU A 1 103 ? -3.819  19.841 17.119  1.00 0.00  ? 103 GLU A HA   3  
ATOM   6789  H  HB2  . GLU A 1 103 ? -1.820  19.020 19.200  1.00 0.00  ? 103 GLU A HB2  3  
ATOM   6790  H  HB3  . GLU A 1 103 ? -1.549  19.754 17.621  1.00 0.00  ? 103 GLU A HB3  3  
ATOM   6791  H  HG2  . GLU A 1 103 ? -3.067  21.660 18.962  1.00 0.00  ? 103 GLU A HG2  3  
ATOM   6792  H  HG3  . GLU A 1 103 ? -1.991  21.041 20.210  1.00 0.00  ? 103 GLU A HG3  3  
ATOM   6793  N  N    . LEU A 1 104 ? -3.816  17.337 16.858  1.00 0.00  ? 104 LEU A N    3  
ATOM   6794  C  CA   . LEU A 1 104 ? -4.009  15.859 16.731  1.00 0.00  ? 104 LEU A CA   3  
ATOM   6795  C  C    . LEU A 1 104 ? -2.654  15.144 16.649  1.00 0.00  ? 104 LEU A C    3  
ATOM   6796  O  O    . LEU A 1 104 ? -2.116  14.936 15.579  1.00 0.00  ? 104 LEU A O    3  
ATOM   6797  C  CB   . LEU A 1 104 ? -4.813  15.557 15.470  1.00 0.00  ? 104 LEU A CB   3  
ATOM   6798  C  CG   . LEU A 1 104 ? -6.103  14.814 15.839  1.00 0.00  ? 104 LEU A CG   3  
ATOM   6799  C  CD1  . LEU A 1 104 ? -5.806  13.351 16.181  1.00 0.00  ? 104 LEU A CD1  3  
ATOM   6800  C  CD2  . LEU A 1 104 ? -6.777  15.490 17.036  1.00 0.00  ? 104 LEU A CD2  3  
ATOM   6801  H  H    . LEU A 1 104 ? -3.698  17.884 16.054  1.00 0.00  ? 104 LEU A H    3  
ATOM   6802  H  HA   . LEU A 1 104 ? -4.554  15.494 17.584  1.00 0.00  ? 104 LEU A HA   3  
ATOM   6803  H  HB2  . LEU A 1 104 ? -5.063  16.484 14.974  1.00 0.00  ? 104 LEU A HB2  3  
ATOM   6804  H  HB3  . LEU A 1 104 ? -4.222  14.943 14.806  1.00 0.00  ? 104 LEU A HB3  3  
ATOM   6805  H  HG   . LEU A 1 104 ? -6.764  14.846 15.002  1.00 0.00  ? 104 LEU A HG   3  
ATOM   6806  H  HD11 . LEU A 1 104 ? -5.762  13.231 17.253  1.00 0.00  ? 104 LEU A HD11 3  
ATOM   6807  H  HD12 . LEU A 1 104 ? -4.862  13.060 15.744  1.00 0.00  ? 104 LEU A HD12 3  
ATOM   6808  H  HD13 . LEU A 1 104 ? -6.592  12.724 15.785  1.00 0.00  ? 104 LEU A HD13 3  
ATOM   6809  H  HD21 . LEU A 1 104 ? -7.798  15.734 16.782  1.00 0.00  ? 104 LEU A HD21 3  
ATOM   6810  H  HD22 . LEU A 1 104 ? -6.244  16.395 17.285  1.00 0.00  ? 104 LEU A HD22 3  
ATOM   6811  H  HD23 . LEU A 1 104 ? -6.766  14.818 17.884  1.00 0.00  ? 104 LEU A HD23 3  
ATOM   6812  N  N    . TRP A 1 105 ? -2.110  14.750 17.769  1.00 0.00  ? 105 TRP A N    3  
ATOM   6813  C  CA   . TRP A 1 105 ? -0.804  14.030 17.751  1.00 0.00  ? 105 TRP A CA   3  
ATOM   6814  C  C    . TRP A 1 105 ? -1.082  12.526 17.801  1.00 0.00  ? 105 TRP A C    3  
ATOM   6815  O  O    . TRP A 1 105 ? -2.105  12.096 18.300  1.00 0.00  ? 105 TRP A O    3  
ATOM   6816  C  CB   . TRP A 1 105 ? 0.024   14.427 18.973  1.00 0.00  ? 105 TRP A CB   3  
ATOM   6817  C  CG   . TRP A 1 105 ? 0.490   15.841 18.839  1.00 0.00  ? 105 TRP A CG   3  
ATOM   6818  C  CD1  . TRP A 1 105 ? 0.990   16.408 17.714  1.00 0.00  ? 105 TRP A CD1  3  
ATOM   6819  C  CD2  . TRP A 1 105 ? 0.505   16.872 19.860  1.00 0.00  ? 105 TRP A CD2  3  
ATOM   6820  N  NE1  . TRP A 1 105 ? 1.311   17.728 17.990  1.00 0.00  ? 105 TRP A NE1  3  
ATOM   6821  C  CE2  . TRP A 1 105 ? 1.027   18.059 19.302  1.00 0.00  ? 105 TRP A CE2  3  
ATOM   6822  C  CE3  . TRP A 1 105 ? 0.115   16.886 21.208  1.00 0.00  ? 105 TRP A CE3  3  
ATOM   6823  C  CZ2  . TRP A 1 105 ? 1.159   19.222 20.061  1.00 0.00  ? 105 TRP A CZ2  3  
ATOM   6824  C  CZ3  . TRP A 1 105 ? 0.245   18.050 21.974  1.00 0.00  ? 105 TRP A CZ3  3  
ATOM   6825  C  CH2  . TRP A 1 105 ? 0.765   19.218 21.404  1.00 0.00  ? 105 TRP A CH2  3  
ATOM   6826  H  H    . TRP A 1 105 ? -2.566  14.916 18.619  1.00 0.00  ? 105 TRP A H    3  
ATOM   6827  H  HA   . TRP A 1 105 ? -0.266  14.274 16.847  1.00 0.00  ? 105 TRP A HA   3  
ATOM   6828  H  HB2  . TRP A 1 105 ? -0.585  14.338 19.860  1.00 0.00  ? 105 TRP A HB2  3  
ATOM   6829  H  HB3  . TRP A 1 105 ? 0.881   13.774 19.059  1.00 0.00  ? 105 TRP A HB3  3  
ATOM   6830  H  HD1  . TRP A 1 105 ? 1.121   15.913 16.761  1.00 0.00  ? 105 TRP A HD1  3  
ATOM   6831  H  HE1  . TRP A 1 105 ? 1.691   18.363 17.349  1.00 0.00  ? 105 TRP A HE1  3  
ATOM   6832  H  HE3  . TRP A 1 105 ? -0.287  15.990 21.656  1.00 0.00  ? 105 TRP A HE3  3  
ATOM   6833  H  HZ2  . TRP A 1 105 ? 1.561   20.120 19.614  1.00 0.00  ? 105 TRP A HZ2  3  
ATOM   6834  H  HZ3  . TRP A 1 105 ? -0.060  18.046 23.009  1.00 0.00  ? 105 TRP A HZ3  3  
ATOM   6835  H  HH2  . TRP A 1 105 ? 0.861   20.113 22.001  1.00 0.00  ? 105 TRP A HH2  3  
ATOM   6836  N  N    . THR A 1 106 ? -0.196  11.717 17.284  1.00 0.00  ? 106 THR A N    3  
ATOM   6837  C  CA   . THR A 1 106 ? -0.453  10.248 17.306  1.00 0.00  ? 106 THR A CA   3  
ATOM   6838  C  C    . THR A 1 106 ? 0.814   9.469  17.668  1.00 0.00  ? 106 THR A C    3  
ATOM   6839  O  O    . THR A 1 106 ? 1.918   9.950  17.532  1.00 0.00  ? 106 THR A O    3  
ATOM   6840  C  CB   . THR A 1 106 ? -0.944  9.809  15.922  1.00 0.00  ? 106 THR A CB   3  
ATOM   6841  O  OG1  . THR A 1 106 ? 0.100   9.996  14.973  1.00 0.00  ? 106 THR A OG1  3  
ATOM   6842  C  CG2  . THR A 1 106 ? -2.155  10.651 15.512  1.00 0.00  ? 106 THR A CG2  3  
ATOM   6843  H  H    . THR A 1 106 ? 0.621   12.072 16.878  1.00 0.00  ? 106 THR A H    3  
ATOM   6844  H  HA   . THR A 1 106 ? -1.209  10.038 18.037  1.00 0.00  ? 106 THR A HA   3  
ATOM   6845  H  HB   . THR A 1 106 ? -1.226  8.769  15.952  1.00 0.00  ? 106 THR A HB   3  
ATOM   6846  H  HG1  . THR A 1 106 ? 0.844   9.450  15.236  1.00 0.00  ? 106 THR A HG1  3  
ATOM   6847  H  HG21 . THR A 1 106 ? -1.863  11.690 15.429  1.00 0.00  ? 106 THR A HG21 3  
ATOM   6848  H  HG22 . THR A 1 106 ? -2.930  10.553 16.258  1.00 0.00  ? 106 THR A HG22 3  
ATOM   6849  H  HG23 . THR A 1 106 ? -2.528  10.303 14.560  1.00 0.00  ? 106 THR A HG23 3  
ATOM   6850  N  N    . ASN A 1 107 ? 0.651   8.253  18.118  1.00 0.00  ? 107 ASN A N    3  
ATOM   6851  C  CA   . ASN A 1 107 ? 1.831   7.420  18.479  1.00 0.00  ? 107 ASN A CA   3  
ATOM   6852  C  C    . ASN A 1 107 ? 1.940   6.249  17.495  1.00 0.00  ? 107 ASN A C    3  
ATOM   6853  O  O    . ASN A 1 107 ? 2.777   5.382  17.645  1.00 0.00  ? 107 ASN A O    3  
ATOM   6854  C  CB   . ASN A 1 107 ? 1.662   6.868  19.892  1.00 0.00  ? 107 ASN A CB   3  
ATOM   6855  C  CG   . ASN A 1 107 ? 2.872   5.998  20.242  1.00 0.00  ? 107 ASN A CG   3  
ATOM   6856  O  OD1  . ASN A 1 107 ? 3.881   6.492  20.705  1.00 0.00  ? 107 ASN A OD1  3  
ATOM   6857  N  ND2  . ASN A 1 107 ? 2.812   4.712  20.038  1.00 0.00  ? 107 ASN A ND2  3  
ATOM   6858  H  H    . ASN A 1 107 ? -0.252  7.882  18.209  1.00 0.00  ? 107 ASN A H    3  
ATOM   6859  H  HA   . ASN A 1 107 ? 2.727   8.015  18.434  1.00 0.00  ? 107 ASN A HA   3  
ATOM   6860  H  HB2  . ASN A 1 107 ? 1.585   7.684  20.596  1.00 0.00  ? 107 ASN A HB2  3  
ATOM   6861  H  HB3  . ASN A 1 107 ? 0.767   6.271  19.932  1.00 0.00  ? 107 ASN A HB3  3  
ATOM   6862  H  HD21 . ASN A 1 107 ? 1.999   4.312  19.666  1.00 0.00  ? 107 ASN A HD21 3  
ATOM   6863  H  HD22 . ASN A 1 107 ? 3.582   4.145  20.254  1.00 0.00  ? 107 ASN A HD22 3  
ATOM   6864  N  N    . THR A 1 108 ? 1.092   6.210  16.495  1.00 0.00  ? 108 THR A N    3  
ATOM   6865  C  CA   . THR A 1 108 ? 1.150   5.085  15.519  1.00 0.00  ? 108 THR A CA   3  
ATOM   6866  C  C    . THR A 1 108 ? 0.928   5.600  14.090  1.00 0.00  ? 108 THR A C    3  
ATOM   6867  O  O    . THR A 1 108 ? 0.142   5.053  13.341  1.00 0.00  ? 108 THR A O    3  
ATOM   6868  C  CB   . THR A 1 108 ? 0.070   4.060  15.865  1.00 0.00  ? 108 THR A CB   3  
ATOM   6869  O  OG1  . THR A 1 108 ? 0.150   2.964  14.963  1.00 0.00  ? 108 THR A OG1  3  
ATOM   6870  C  CG2  . THR A 1 108 ? -1.299  4.714  15.748  1.00 0.00  ? 108 THR A CG2  3  
ATOM   6871  H  H    . THR A 1 108 ? 0.415   6.914  16.394  1.00 0.00  ? 108 THR A H    3  
ATOM   6872  H  HA   . THR A 1 108 ? 2.112   4.612  15.579  1.00 0.00  ? 108 THR A HA   3  
ATOM   6873  H  HB   . THR A 1 108 ? 0.214   3.708  16.873  1.00 0.00  ? 108 THR A HB   3  
ATOM   6874  H  HG1  . THR A 1 108 ? -0.155  2.177  15.423  1.00 0.00  ? 108 THR A HG1  3  
ATOM   6875  H  HG21 . THR A 1 108 ? -1.485  5.315  16.623  1.00 0.00  ? 108 THR A HG21 3  
ATOM   6876  H  HG22 . THR A 1 108 ? -2.054  3.947  15.666  1.00 0.00  ? 108 THR A HG22 3  
ATOM   6877  H  HG23 . THR A 1 108 ? -1.321  5.340  14.869  1.00 0.00  ? 108 THR A HG23 3  
ATOM   6878  N  N    . SER A 1 109 ? 1.620   6.637  13.696  1.00 0.00  ? 109 SER A N    3  
ATOM   6879  C  CA   . SER A 1 109 ? 1.445   7.166  12.306  1.00 0.00  ? 109 SER A CA   3  
ATOM   6880  C  C    . SER A 1 109 ? -0.049  7.258  11.967  1.00 0.00  ? 109 SER A C    3  
ATOM   6881  O  O    . SER A 1 109 ? -0.594  6.391  11.315  1.00 0.00  ? 109 SER A O    3  
ATOM   6882  C  CB   . SER A 1 109 ? 2.126   6.215  11.319  1.00 0.00  ? 109 SER A CB   3  
ATOM   6883  O  OG   . SER A 1 109 ? 1.483   4.946  11.366  1.00 0.00  ? 109 SER A OG   3  
ATOM   6884  H  H    . SER A 1 109 ? 2.257   7.062  14.309  1.00 0.00  ? 109 SER A H    3  
ATOM   6885  H  HA   . SER A 1 109 ? 1.893   8.146  12.231  1.00 0.00  ? 109 SER A HA   3  
ATOM   6886  H  HB2  . SER A 1 109 ? 2.050   6.613  10.322  1.00 0.00  ? 109 SER A HB2  3  
ATOM   6887  H  HB3  . SER A 1 109 ? 3.171   6.110  11.585  1.00 0.00  ? 109 SER A HB3  3  
ATOM   6888  H  HG   . SER A 1 109 ? 2.124   4.279  11.100  1.00 0.00  ? 109 SER A HG   3  
ATOM   6889  N  N    . ALA A 1 110 ? -0.720  8.300  12.397  1.00 0.00  ? 110 ALA A N    3  
ATOM   6890  C  CA   . ALA A 1 110 ? -2.176  8.422  12.081  1.00 0.00  ? 110 ALA A CA   3  
ATOM   6891  C  C    . ALA A 1 110 ? -2.500  9.860  11.645  1.00 0.00  ? 110 ALA A C    3  
ATOM   6892  O  O    . ALA A 1 110 ? -3.224  10.079 10.693  1.00 0.00  ? 110 ALA A O    3  
ATOM   6893  C  CB   . ALA A 1 110 ? -3.004  8.033  13.308  1.00 0.00  ? 110 ALA A CB   3  
ATOM   6894  H  H    . ALA A 1 110 ? -0.268  8.996  12.921  1.00 0.00  ? 110 ALA A H    3  
ATOM   6895  H  HA   . ALA A 1 110 ? -2.411  7.753  11.272  1.00 0.00  ? 110 ALA A HA   3  
ATOM   6896  H  HB1  . ALA A 1 110 ? -3.660  7.211  13.051  1.00 0.00  ? 110 ALA A HB1  3  
ATOM   6897  H  HB2  . ALA A 1 110 ? -3.592  8.877  13.633  1.00 0.00  ? 110 ALA A HB2  3  
ATOM   6898  H  HB3  . ALA A 1 110 ? -2.343  7.725  14.104  1.00 0.00  ? 110 ALA A HB3  3  
ATOM   6899  N  N    . ASN A 1 111 ? -1.947  10.836 12.317  1.00 0.00  ? 111 ASN A N    3  
ATOM   6900  C  CA   . ASN A 1 111 ? -2.185  12.264 11.929  1.00 0.00  ? 111 ASN A CA   3  
ATOM   6901  C  C    . ASN A 1 111 ? -0.845  13.003 12.018  1.00 0.00  ? 111 ASN A C    3  
ATOM   6902  O  O    . ASN A 1 111 ? -0.191  13.239 11.021  1.00 0.00  ? 111 ASN A O    3  
ATOM   6903  C  CB   . ASN A 1 111 ? -3.200  12.921 12.874  1.00 0.00  ? 111 ASN A CB   3  
ATOM   6904  C  CG   . ASN A 1 111 ? -4.624  12.690 12.359  1.00 0.00  ? 111 ASN A CG   3  
ATOM   6905  O  OD1  . ASN A 1 111 ? -5.042  13.296 11.390  1.00 0.00  ? 111 ASN A OD1  3  
ATOM   6906  N  ND2  . ASN A 1 111 ? -5.396  11.835 12.973  1.00 0.00  ? 111 ASN A ND2  3  
ATOM   6907  H  H    . ASN A 1 111 ? -1.353  10.628 13.066  1.00 0.00  ? 111 ASN A H    3  
ATOM   6908  H  HA   . ASN A 1 111 ? -2.551  12.305 10.915  1.00 0.00  ? 111 ASN A HA   3  
ATOM   6909  H  HB2  . ASN A 1 111 ? -3.101  12.495 13.859  1.00 0.00  ? 111 ASN A HB2  3  
ATOM   6910  H  HB3  . ASN A 1 111 ? -3.009  13.984 12.920  1.00 0.00  ? 111 ASN A HB3  3  
ATOM   6911  H  HD21 . ASN A 1 111 ? -5.061  11.347 13.755  1.00 0.00  ? 111 ASN A HD21 3  
ATOM   6912  H  HD22 . ASN A 1 111 ? -6.313  11.684 12.657  1.00 0.00  ? 111 ASN A HD22 3  
ATOM   6913  N  N    . TYR A 1 112 ? -0.417  13.337 13.211  1.00 0.00  ? 112 TYR A N    3  
ATOM   6914  C  CA   . TYR A 1 112 ? 0.902   14.020 13.374  1.00 0.00  ? 112 TYR A CA   3  
ATOM   6915  C  C    . TYR A 1 112 ? 1.876   13.008 13.994  1.00 0.00  ? 112 TYR A C    3  
ATOM   6916  O  O    . TYR A 1 112 ? 2.365   12.123 13.321  1.00 0.00  ? 112 TYR A O    3  
ATOM   6917  C  CB   . TYR A 1 112 ? 0.770   15.251 14.286  1.00 0.00  ? 112 TYR A CB   3  
ATOM   6918  C  CG   . TYR A 1 112 ? 0.379   16.462 13.464  1.00 0.00  ? 112 TYR A CG   3  
ATOM   6919  C  CD1  . TYR A 1 112 ? -0.379  16.301 12.296  1.00 0.00  ? 112 TYR A CD1  3  
ATOM   6920  C  CD2  . TYR A 1 112 ? 0.774   17.745 13.869  1.00 0.00  ? 112 TYR A CD2  3  
ATOM   6921  C  CE1  . TYR A 1 112 ? -0.742  17.420 11.534  1.00 0.00  ? 112 TYR A CE1  3  
ATOM   6922  C  CE2  . TYR A 1 112 ? 0.412   18.863 13.108  1.00 0.00  ? 112 TYR A CE2  3  
ATOM   6923  C  CZ   . TYR A 1 112 ? -0.346  18.700 11.942  1.00 0.00  ? 112 TYR A CZ   3  
ATOM   6924  O  OH   . TYR A 1 112 ? -0.705  19.804 11.195  1.00 0.00  ? 112 TYR A OH   3  
ATOM   6925  H  H    . TYR A 1 112 ? -0.951  13.113 14.001  1.00 0.00  ? 112 TYR A H    3  
ATOM   6926  H  HA   . TYR A 1 112 ? 1.269   14.323 12.402  1.00 0.00  ? 112 TYR A HA   3  
ATOM   6927  H  HB2  . TYR A 1 112 ? 0.016   15.067 15.033  1.00 0.00  ? 112 TYR A HB2  3  
ATOM   6928  H  HB3  . TYR A 1 112 ? 1.718   15.441 14.771  1.00 0.00  ? 112 TYR A HB3  3  
ATOM   6929  H  HD1  . TYR A 1 112 ? -0.683  15.315 11.984  1.00 0.00  ? 112 TYR A HD1  3  
ATOM   6930  H  HD2  . TYR A 1 112 ? 1.357   17.872 14.768  1.00 0.00  ? 112 TYR A HD2  3  
ATOM   6931  H  HE1  . TYR A 1 112 ? -1.329  17.297 10.633  1.00 0.00  ? 112 TYR A HE1  3  
ATOM   6932  H  HE2  . TYR A 1 112 ? 0.717   19.849 13.419  1.00 0.00  ? 112 TYR A HE2  3  
ATOM   6933  H  HH   . TYR A 1 112 ? 0.088   20.139 10.763  1.00 0.00  ? 112 TYR A HH   3  
ATOM   6934  N  N    . SER A 1 113 ? 2.141   13.103 15.274  1.00 0.00  ? 113 SER A N    3  
ATOM   6935  C  CA   . SER A 1 113 ? 3.059   12.110 15.915  1.00 0.00  ? 113 SER A CA   3  
ATOM   6936  C  C    . SER A 1 113 ? 3.512   12.605 17.297  1.00 0.00  ? 113 SER A C    3  
ATOM   6937  O  O    . SER A 1 113 ? 4.434   13.391 17.425  1.00 0.00  ? 113 SER A O    3  
ATOM   6938  C  CB   . SER A 1 113 ? 4.278   11.863 15.025  1.00 0.00  ? 113 SER A CB   3  
ATOM   6939  O  OG   . SER A 1 113 ? 4.096   10.647 14.309  1.00 0.00  ? 113 SER A OG   3  
ATOM   6940  H  H    . SER A 1 113 ? 1.724   13.805 15.816  1.00 0.00  ? 113 SER A H    3  
ATOM   6941  H  HA   . SER A 1 113 ? 2.525   11.184 16.040  1.00 0.00  ? 113 SER A HA   3  
ATOM   6942  H  HB2  . SER A 1 113 ? 4.390   12.673 14.323  1.00 0.00  ? 113 SER A HB2  3  
ATOM   6943  H  HB3  . SER A 1 113 ? 5.164   11.796 15.642  1.00 0.00  ? 113 SER A HB3  3  
ATOM   6944  H  HG   . SER A 1 113 ? 3.911   10.868 13.394  1.00 0.00  ? 113 SER A HG   3  
ATOM   6945  N  N    . LEU A 1 114 ? 2.866   12.133 18.336  1.00 0.00  ? 114 LEU A N    3  
ATOM   6946  C  CA   . LEU A 1 114 ? 3.242   12.553 19.722  1.00 0.00  ? 114 LEU A CA   3  
ATOM   6947  C  C    . LEU A 1 114 ? 4.746   12.352 19.944  1.00 0.00  ? 114 LEU A C    3  
ATOM   6948  O  O    . LEU A 1 114 ? 5.387   13.116 20.639  1.00 0.00  ? 114 LEU A O    3  
ATOM   6949  C  CB   . LEU A 1 114 ? 2.463   11.698 20.726  1.00 0.00  ? 114 LEU A CB   3  
ATOM   6950  C  CG   . LEU A 1 114 ? 2.068   12.540 21.937  1.00 0.00  ? 114 LEU A CG   3  
ATOM   6951  C  CD1  . LEU A 1 114 ? 3.302   13.252 22.487  1.00 0.00  ? 114 LEU A CD1  3  
ATOM   6952  C  CD2  . LEU A 1 114 ? 1.021   13.580 21.523  1.00 0.00  ? 114 LEU A CD2  3  
ATOM   6953  H  H    . LEU A 1 114 ? 2.128   11.494 18.202  1.00 0.00  ? 114 LEU A H    3  
ATOM   6954  H  HA   . LEU A 1 114 ? 2.994   13.595 19.864  1.00 0.00  ? 114 LEU A HA   3  
ATOM   6955  H  HB2  . LEU A 1 114 ? 1.573   11.313 20.252  1.00 0.00  ? 114 LEU A HB2  3  
ATOM   6956  H  HB3  . LEU A 1 114 ? 3.081   10.877 21.051  1.00 0.00  ? 114 LEU A HB3  3  
ATOM   6957  H  HG   . LEU A 1 114 ? 1.655   11.897 22.701  1.00 0.00  ? 114 LEU A HG   3  
ATOM   6958  H  HD11 . LEU A 1 114 ? 4.091   12.533 22.647  1.00 0.00  ? 114 LEU A HD11 3  
ATOM   6959  H  HD12 . LEU A 1 114 ? 3.055   13.728 23.424  1.00 0.00  ? 114 LEU A HD12 3  
ATOM   6960  H  HD13 . LEU A 1 114 ? 3.632   13.997 21.779  1.00 0.00  ? 114 LEU A HD13 3  
ATOM   6961  H  HD21 . LEU A 1 114 ? 0.232   13.094 20.969  1.00 0.00  ? 114 LEU A HD21 3  
ATOM   6962  H  HD22 . LEU A 1 114 ? 1.485   14.332 20.904  1.00 0.00  ? 114 LEU A HD22 3  
ATOM   6963  H  HD23 . LEU A 1 114 ? 0.606   14.046 22.409  1.00 0.00  ? 114 LEU A HD23 3  
ATOM   6964  N  N    . PHE A 1 115 ? 5.313   11.326 19.370  1.00 0.00  ? 115 PHE A N    3  
ATOM   6965  C  CA   . PHE A 1 115 ? 6.773   11.074 19.560  1.00 0.00  ? 115 PHE A CA   3  
ATOM   6966  C  C    . PHE A 1 115 ? 7.589   12.195 18.903  1.00 0.00  ? 115 PHE A C    3  
ATOM   6967  O  O    . PHE A 1 115 ? 8.559   12.677 19.457  1.00 0.00  ? 115 PHE A O    3  
ATOM   6968  C  CB   . PHE A 1 115 ? 7.140   9.728  18.923  1.00 0.00  ? 115 PHE A CB   3  
ATOM   6969  C  CG   . PHE A 1 115 ? 8.635   9.657  18.711  1.00 0.00  ? 115 PHE A CG   3  
ATOM   6970  C  CD1  . PHE A 1 115 ? 9.505   10.154 19.692  1.00 0.00  ? 115 PHE A CD1  3  
ATOM   6971  C  CD2  . PHE A 1 115 ? 9.154   9.104  17.534  1.00 0.00  ? 115 PHE A CD2  3  
ATOM   6972  C  CE1  . PHE A 1 115 ? 10.887  10.096 19.495  1.00 0.00  ? 115 PHE A CE1  3  
ATOM   6973  C  CE2  . PHE A 1 115 ? 10.535  9.052  17.339  1.00 0.00  ? 115 PHE A CE2  3  
ATOM   6974  C  CZ   . PHE A 1 115 ? 11.401  9.547  18.319  1.00 0.00  ? 115 PHE A CZ   3  
ATOM   6975  H  H    . PHE A 1 115 ? 4.778   10.717 18.820  1.00 0.00  ? 115 PHE A H    3  
ATOM   6976  H  HA   . PHE A 1 115 ? 6.997   11.042 20.615  1.00 0.00  ? 115 PHE A HA   3  
ATOM   6977  H  HB2  . PHE A 1 115 ? 6.834   8.927  19.579  1.00 0.00  ? 115 PHE A HB2  3  
ATOM   6978  H  HB3  . PHE A 1 115 ? 6.636   9.627  17.973  1.00 0.00  ? 115 PHE A HB3  3  
ATOM   6979  H  HD1  . PHE A 1 115 ? 9.109   10.577 20.602  1.00 0.00  ? 115 PHE A HD1  3  
ATOM   6980  H  HD2  . PHE A 1 115 ? 8.489   8.717  16.777  1.00 0.00  ? 115 PHE A HD2  3  
ATOM   6981  H  HE1  . PHE A 1 115 ? 11.559  10.474 20.252  1.00 0.00  ? 115 PHE A HE1  3  
ATOM   6982  H  HE2  . PHE A 1 115 ? 10.934  8.624  16.431  1.00 0.00  ? 115 PHE A HE2  3  
ATOM   6983  H  HZ   . PHE A 1 115 ? 12.465  9.510  18.165  1.00 0.00  ? 115 PHE A HZ   3  
ATOM   6984  N  N    . LEU A 1 116 ? 7.218   12.604 17.722  1.00 0.00  ? 116 LEU A N    3  
ATOM   6985  C  CA   . LEU A 1 116 ? 7.995   13.677 17.038  1.00 0.00  ? 116 LEU A CA   3  
ATOM   6986  C  C    . LEU A 1 116 ? 7.994   14.938 17.900  1.00 0.00  ? 116 LEU A C    3  
ATOM   6987  O  O    . LEU A 1 116 ? 9.027   15.406 18.332  1.00 0.00  ? 116 LEU A O    3  
ATOM   6988  C  CB   . LEU A 1 116 ? 7.366   13.981 15.666  1.00 0.00  ? 116 LEU A CB   3  
ATOM   6989  C  CG   . LEU A 1 116 ? 8.022   13.157 14.535  1.00 0.00  ? 116 LEU A CG   3  
ATOM   6990  C  CD1  . LEU A 1 116 ? 7.988   13.969 13.241  1.00 0.00  ? 116 LEU A CD1  3  
ATOM   6991  C  CD2  . LEU A 1 116 ? 9.480   12.821 14.865  1.00 0.00  ? 116 LEU A CD2  3  
ATOM   6992  H  H    . LEU A 1 116 ? 6.441   12.203 17.282  1.00 0.00  ? 116 LEU A H    3  
ATOM   6993  H  HA   . LEU A 1 116 ? 9.006   13.351 16.917  1.00 0.00  ? 116 LEU A HA   3  
ATOM   6994  H  HB2  . LEU A 1 116 ? 6.313   13.742 15.705  1.00 0.00  ? 116 LEU A HB2  3  
ATOM   6995  H  HB3  . LEU A 1 116 ? 7.481   15.031 15.449  1.00 0.00  ? 116 LEU A HB3  3  
ATOM   6996  H  HG   . LEU A 1 116 ? 7.462   12.243 14.390  1.00 0.00  ? 116 LEU A HG   3  
ATOM   6997  H  HD11 . LEU A 1 116 ? 6.972   14.020 12.873  1.00 0.00  ? 116 LEU A HD11 3  
ATOM   6998  H  HD12 . LEU A 1 116 ? 8.612   13.489 12.503  1.00 0.00  ? 116 LEU A HD12 3  
ATOM   6999  H  HD13 . LEU A 1 116 ? 8.356   14.969 13.428  1.00 0.00  ? 116 LEU A HD13 3  
ATOM   7000  H  HD21 . LEU A 1 116 ? 9.987   13.714 15.197  1.00 0.00  ? 116 LEU A HD21 3  
ATOM   7001  H  HD22 . LEU A 1 116 ? 9.969   12.434 13.984  1.00 0.00  ? 116 LEU A HD22 3  
ATOM   7002  H  HD23 . LEU A 1 116 ? 9.507   12.078 15.650  1.00 0.00  ? 116 LEU A HD23 3  
ATOM   7003  N  N    . VAL A 1 117 ? 6.847   15.483 18.162  1.00 0.00  ? 117 VAL A N    3  
ATOM   7004  C  CA   . VAL A 1 117 ? 6.776   16.707 19.005  1.00 0.00  ? 117 VAL A CA   3  
ATOM   7005  C  C    . VAL A 1 117 ? 7.530   16.465 20.320  1.00 0.00  ? 117 VAL A C    3  
ATOM   7006  O  O    . VAL A 1 117 ? 8.209   17.336 20.834  1.00 0.00  ? 117 VAL A O    3  
ATOM   7007  C  CB   . VAL A 1 117 ? 5.308   17.000 19.280  1.00 0.00  ? 117 VAL A CB   3  
ATOM   7008  C  CG1  . VAL A 1 117 ? 4.624   17.408 17.974  1.00 0.00  ? 117 VAL A CG1  3  
ATOM   7009  C  CG2  . VAL A 1 117 ? 4.640   15.739 19.823  1.00 0.00  ? 117 VAL A CG2  3  
ATOM   7010  H  H    . VAL A 1 117 ? 6.023   15.086 17.812  1.00 0.00  ? 117 VAL A H    3  
ATOM   7011  H  HA   . VAL A 1 117 ? 7.222   17.537 18.481  1.00 0.00  ? 117 VAL A HA   3  
ATOM   7012  H  HB   . VAL A 1 117 ? 5.227   17.792 20.000  1.00 0.00  ? 117 VAL A HB   3  
ATOM   7013  H  HG11 . VAL A 1 117 ? 4.150   18.369 18.097  1.00 0.00  ? 117 VAL A HG11 3  
ATOM   7014  H  HG12 . VAL A 1 117 ? 3.881   16.669 17.716  1.00 0.00  ? 117 VAL A HG12 3  
ATOM   7015  H  HG13 . VAL A 1 117 ? 5.360   17.466 17.186  1.00 0.00  ? 117 VAL A HG13 3  
ATOM   7016  H  HG21 . VAL A 1 117 ? 5.241   14.879 19.568  1.00 0.00  ? 117 VAL A HG21 3  
ATOM   7017  H  HG22 . VAL A 1 117 ? 3.658   15.632 19.388  1.00 0.00  ? 117 VAL A HG22 3  
ATOM   7018  H  HG23 . VAL A 1 117 ? 4.552   15.812 20.898  1.00 0.00  ? 117 VAL A HG23 3  
ATOM   7019  N  N    . ALA A 1 118 ? 7.421   15.282 20.857  1.00 0.00  ? 118 ALA A N    3  
ATOM   7020  C  CA   . ALA A 1 118 ? 8.131   14.952 22.129  1.00 0.00  ? 118 ALA A CA   3  
ATOM   7021  C  C    . ALA A 1 118 ? 9.644   15.075 21.921  1.00 0.00  ? 118 ALA A C    3  
ATOM   7022  O  O    . ALA A 1 118 ? 10.334  15.726 22.680  1.00 0.00  ? 118 ALA A O    3  
ATOM   7023  C  CB   . ALA A 1 118 ? 7.800   13.513 22.537  1.00 0.00  ? 118 ALA A CB   3  
ATOM   7024  H  H    . ALA A 1 118 ? 6.872   14.604 20.418  1.00 0.00  ? 118 ALA A H    3  
ATOM   7025  H  HA   . ALA A 1 118 ? 7.815   15.632 22.907  1.00 0.00  ? 118 ALA A HA   3  
ATOM   7026  H  HB1  . ALA A 1 118 ? 8.198   12.831 21.801  1.00 0.00  ? 118 ALA A HB1  3  
ATOM   7027  H  HB2  . ALA A 1 118 ? 6.729   13.392 22.596  1.00 0.00  ? 118 ALA A HB2  3  
ATOM   7028  H  HB3  . ALA A 1 118 ? 8.241   13.299 23.499  1.00 0.00  ? 118 ALA A HB3  3  
ATOM   7029  N  N    . ALA A 1 119 ? 10.160  14.447 20.898  1.00 0.00  ? 119 ALA A N    3  
ATOM   7030  C  CA   . ALA A 1 119 ? 11.627  14.518 20.636  1.00 0.00  ? 119 ALA A CA   3  
ATOM   7031  C  C    . ALA A 1 119 ? 12.058  15.987 20.587  1.00 0.00  ? 119 ALA A C    3  
ATOM   7032  O  O    . ALA A 1 119 ? 13.005  16.397 21.232  1.00 0.00  ? 119 ALA A O    3  
ATOM   7033  C  CB   . ALA A 1 119 ? 11.938  13.847 19.298  1.00 0.00  ? 119 ALA A CB   3  
ATOM   7034  H  H    . ALA A 1 119 ? 9.582   13.928 20.302  1.00 0.00  ? 119 ALA A H    3  
ATOM   7035  H  HA   . ALA A 1 119 ? 12.158  14.004 21.425  1.00 0.00  ? 119 ALA A HA   3  
ATOM   7036  H  HB1  . ALA A 1 119 ? 11.181  13.108 19.081  1.00 0.00  ? 119 ALA A HB1  3  
ATOM   7037  H  HB2  . ALA A 1 119 ? 12.905  13.367 19.351  1.00 0.00  ? 119 ALA A HB2  3  
ATOM   7038  H  HB3  . ALA A 1 119 ? 11.949  14.593 18.518  1.00 0.00  ? 119 ALA A HB3  3  
ATOM   7039  N  N    . HIS A 1 120 ? 11.358  16.787 19.831  1.00 0.00  ? 120 HIS A N    3  
ATOM   7040  C  CA   . HIS A 1 120 ? 11.710  18.232 19.747  1.00 0.00  ? 120 HIS A CA   3  
ATOM   7041  C  C    . HIS A 1 120 ? 11.942  18.765 21.167  1.00 0.00  ? 120 HIS A C    3  
ATOM   7042  O  O    . HIS A 1 120 ? 13.051  19.079 21.552  1.00 0.00  ? 120 HIS A O    3  
ATOM   7043  C  CB   . HIS A 1 120 ? 10.550  18.984 19.089  1.00 0.00  ? 120 HIS A CB   3  
ATOM   7044  C  CG   . HIS A 1 120 ? 10.965  20.395 18.778  1.00 0.00  ? 120 HIS A CG   3  
ATOM   7045  N  ND1  . HIS A 1 120 ? 11.443  20.771 17.532  1.00 0.00  ? 120 HIS A ND1  3  
ATOM   7046  C  CD2  . HIS A 1 120 ? 10.982  21.533 19.545  1.00 0.00  ? 120 HIS A CD2  3  
ATOM   7047  C  CE1  . HIS A 1 120 ? 11.727  22.084 17.588  1.00 0.00  ? 120 HIS A CE1  3  
ATOM   7048  N  NE2  . HIS A 1 120 ? 11.464  22.596 18.791  1.00 0.00  ? 120 HIS A NE2  3  
ATOM   7049  H  H    . HIS A 1 120 ? 10.593  16.439 19.326  1.00 0.00  ? 120 HIS A H    3  
ATOM   7050  H  HA   . HIS A 1 120 ? 12.607  18.357 19.158  1.00 0.00  ? 120 HIS A HA   3  
ATOM   7051  H  HB2  . HIS A 1 120 ? 10.267  18.481 18.175  1.00 0.00  ? 120 HIS A HB2  3  
ATOM   7052  H  HB3  . HIS A 1 120 ? 9.707   19.000 19.764  1.00 0.00  ? 120 HIS A HB3  3  
ATOM   7053  H  HD1  . HIS A 1 120 ? 11.549  20.191 16.749  1.00 0.00  ? 120 HIS A HD1  3  
ATOM   7054  H  HD2  . HIS A 1 120 ? 10.661  21.596 20.574  1.00 0.00  ? 120 HIS A HD2  3  
ATOM   7055  H  HE1  . HIS A 1 120 ? 12.124  22.652 16.762  1.00 0.00  ? 120 HIS A HE1  3  
ATOM   7056  N  N    . GLU A 1 121 ? 10.901  18.851 21.955  1.00 0.00  ? 121 GLU A N    3  
ATOM   7057  C  CA   . GLU A 1 121 ? 11.061  19.345 23.357  1.00 0.00  ? 121 GLU A CA   3  
ATOM   7058  C  C    . GLU A 1 121 ? 12.078  18.465 24.076  1.00 0.00  ? 121 GLU A C    3  
ATOM   7059  O  O    . GLU A 1 121 ? 12.675  18.859 25.060  1.00 0.00  ? 121 GLU A O    3  
ATOM   7060  C  CB   . GLU A 1 121 ? 9.716   19.261 24.084  1.00 0.00  ? 121 GLU A CB   3  
ATOM   7061  C  CG   . GLU A 1 121 ? 8.706   20.182 23.402  1.00 0.00  ? 121 GLU A CG   3  
ATOM   7062  C  CD   . GLU A 1 121 ? 9.317   21.575 23.254  1.00 0.00  ? 121 GLU A CD   3  
ATOM   7063  O  OE1  . GLU A 1 121 ? 10.162  21.916 24.066  1.00 0.00  ? 121 GLU A OE1  3  
ATOM   7064  O  OE2  . GLU A 1 121 ? 8.934   22.275 22.334  1.00 0.00  ? 121 GLU A OE2  3  
ATOM   7065  H  H    . GLU A 1 121 ? 10.017  18.581 21.628  1.00 0.00  ? 121 GLU A H    3  
ATOM   7066  H  HA   . GLU A 1 121 ? 11.414  20.368 23.351  1.00 0.00  ? 121 GLU A HA   3  
ATOM   7067  H  HB2  . GLU A 1 121 ? 9.355   18.242 24.049  1.00 0.00  ? 121 GLU A HB2  3  
ATOM   7068  H  HB3  . GLU A 1 121 ? 9.842   19.564 25.113  1.00 0.00  ? 121 GLU A HB3  3  
ATOM   7069  H  HG2  . GLU A 1 121 ? 8.462   19.787 22.426  1.00 0.00  ? 121 GLU A HG2  3  
ATOM   7070  H  HG3  . GLU A 1 121 ? 7.810   20.244 24.002  1.00 0.00  ? 121 GLU A HG3  3  
ATOM   7071  N  N    . PHE A 1 122 ? 12.289  17.278 23.582  1.00 0.00  ? 122 PHE A N    3  
ATOM   7072  C  CA   . PHE A 1 122 ? 13.275  16.368 24.216  1.00 0.00  ? 122 PHE A CA   3  
ATOM   7073  C  C    . PHE A 1 122 ? 14.680  16.855 23.878  1.00 0.00  ? 122 PHE A C    3  
ATOM   7074  O  O    . PHE A 1 122 ? 15.659  16.428 24.457  1.00 0.00  ? 122 PHE A O    3  
ATOM   7075  C  CB   . PHE A 1 122 ? 13.078  14.973 23.636  1.00 0.00  ? 122 PHE A CB   3  
ATOM   7076  C  CG   . PHE A 1 122 ? 12.606  14.043 24.715  1.00 0.00  ? 122 PHE A CG   3  
ATOM   7077  C  CD1  . PHE A 1 122 ? 11.364  14.257 25.317  1.00 0.00  ? 122 PHE A CD1  3  
ATOM   7078  C  CD2  . PHE A 1 122 ? 13.409  12.972 25.121  1.00 0.00  ? 122 PHE A CD2  3  
ATOM   7079  C  CE1  . PHE A 1 122 ? 10.921  13.401 26.327  1.00 0.00  ? 122 PHE A CE1  3  
ATOM   7080  C  CE2  . PHE A 1 122 ? 12.968  12.111 26.133  1.00 0.00  ? 122 PHE A CE2  3  
ATOM   7081  C  CZ   . PHE A 1 122 ? 11.722  12.327 26.737  1.00 0.00  ? 122 PHE A CZ   3  
ATOM   7082  H  H    . PHE A 1 122 ? 11.802  16.986 22.783  1.00 0.00  ? 122 PHE A H    3  
ATOM   7083  H  HA   . PHE A 1 122 ? 13.132  16.348 25.286  1.00 0.00  ? 122 PHE A HA   3  
ATOM   7084  H  HB2  . PHE A 1 122 ? 12.335  15.022 22.856  1.00 0.00  ? 122 PHE A HB2  3  
ATOM   7085  H  HB3  . PHE A 1 122 ? 14.012  14.614 23.229  1.00 0.00  ? 122 PHE A HB3  3  
ATOM   7086  H  HD1  . PHE A 1 122 ? 10.746  15.085 25.002  1.00 0.00  ? 122 PHE A HD1  3  
ATOM   7087  H  HD2  . PHE A 1 122 ? 14.368  12.810 24.649  1.00 0.00  ? 122 PHE A HD2  3  
ATOM   7088  H  HE1  . PHE A 1 122 ? 9.963   13.568 26.793  1.00 0.00  ? 122 PHE A HE1  3  
ATOM   7089  H  HE2  . PHE A 1 122 ? 13.588  11.284 26.449  1.00 0.00  ? 122 PHE A HE2  3  
ATOM   7090  H  HZ   . PHE A 1 122 ? 11.378  11.665 27.518  1.00 0.00  ? 122 PHE A HZ   3  
ATOM   7091  N  N    . GLY A 1 123 ? 14.776  17.762 22.947  1.00 0.00  ? 123 GLY A N    3  
ATOM   7092  C  CA   . GLY A 1 123 ? 16.104  18.308 22.554  1.00 0.00  ? 123 GLY A CA   3  
ATOM   7093  C  C    . GLY A 1 123 ? 16.343  19.624 23.295  1.00 0.00  ? 123 GLY A C    3  
ATOM   7094  O  O    . GLY A 1 123 ? 17.391  19.848 23.866  1.00 0.00  ? 123 GLY A O    3  
ATOM   7095  H  H    . GLY A 1 123 ? 13.967  18.091 22.505  1.00 0.00  ? 123 GLY A H    3  
ATOM   7096  H  HA2  . GLY A 1 123 ? 16.879  17.598 22.812  1.00 0.00  ? 123 GLY A HA2  3  
ATOM   7097  H  HA3  . GLY A 1 123 ? 16.118  18.488 21.491  1.00 0.00  ? 123 GLY A HA3  3  
ATOM   7098  N  N    . HIS A 1 124 ? 15.371  20.496 23.293  1.00 0.00  ? 124 HIS A N    3  
ATOM   7099  C  CA   . HIS A 1 124 ? 15.533  21.795 24.004  1.00 0.00  ? 124 HIS A CA   3  
ATOM   7100  C  C    . HIS A 1 124 ? 15.801  21.538 25.482  1.00 0.00  ? 124 HIS A C    3  
ATOM   7101  O  O    . HIS A 1 124 ? 16.709  22.097 26.064  1.00 0.00  ? 124 HIS A O    3  
ATOM   7102  C  CB   . HIS A 1 124 ? 14.249  22.617 23.893  1.00 0.00  ? 124 HIS A CB   3  
ATOM   7103  C  CG   . HIS A 1 124 ? 14.114  23.173 22.505  1.00 0.00  ? 124 HIS A CG   3  
ATOM   7104  N  ND1  . HIS A 1 124 ? 14.623  22.527 21.389  1.00 0.00  ? 124 HIS A ND1  3  
ATOM   7105  C  CD2  . HIS A 1 124 ? 13.524  24.319 22.040  1.00 0.00  ? 124 HIS A CD2  3  
ATOM   7106  C  CE1  . HIS A 1 124 ? 14.333  23.288 20.317  1.00 0.00  ? 124 HIS A CE1  3  
ATOM   7107  N  NE2  . HIS A 1 124 ? 13.663  24.390 20.659  1.00 0.00  ? 124 HIS A NE2  3  
ATOM   7108  H  H    . HIS A 1 124 ? 14.532  20.292 22.827  1.00 0.00  ? 124 HIS A H    3  
ATOM   7109  H  HA   . HIS A 1 124 ? 16.357  22.346 23.574  1.00 0.00  ? 124 HIS A HA   3  
ATOM   7110  H  HB2  . HIS A 1 124 ? 13.401  21.988 24.115  1.00 0.00  ? 124 HIS A HB2  3  
ATOM   7111  H  HB3  . HIS A 1 124 ? 14.284  23.434 24.604  1.00 0.00  ? 124 HIS A HB3  3  
ATOM   7112  H  HD1  . HIS A 1 124 ? 15.095  21.666 21.381  1.00 0.00  ? 124 HIS A HD1  3  
ATOM   7113  H  HD2  . HIS A 1 124 ? 13.025  25.052 22.651  1.00 0.00  ? 124 HIS A HD2  3  
ATOM   7114  H  HE1  . HIS A 1 124 ? 14.616  23.042 19.305  1.00 0.00  ? 124 HIS A HE1  3  
ATOM   7115  N  N    . ALA A 1 125 ? 15.001  20.712 26.100  1.00 0.00  ? 125 ALA A N    3  
ATOM   7116  C  CA   . ALA A 1 125 ? 15.199  20.434 27.557  1.00 0.00  ? 125 ALA A CA   3  
ATOM   7117  C  C    . ALA A 1 125 ? 16.471  19.607 27.772  1.00 0.00  ? 125 ALA A C    3  
ATOM   7118  O  O    . ALA A 1 125 ? 16.858  19.331 28.892  1.00 0.00  ? 125 ALA A O    3  
ATOM   7119  C  CB   . ALA A 1 125 ? 14.004  19.651 28.106  1.00 0.00  ? 125 ALA A CB   3  
ATOM   7120  H  H    . ALA A 1 125 ? 14.261  20.283 25.609  1.00 0.00  ? 125 ALA A H    3  
ATOM   7121  H  HA   . ALA A 1 125 ? 15.287  21.370 28.089  1.00 0.00  ? 125 ALA A HA   3  
ATOM   7122  H  HB1  . ALA A 1 125 ? 14.344  18.982 28.887  1.00 0.00  ? 125 ALA A HB1  3  
ATOM   7123  H  HB2  . ALA A 1 125 ? 13.552  19.076 27.312  1.00 0.00  ? 125 ALA A HB2  3  
ATOM   7124  H  HB3  . ALA A 1 125 ? 13.278  20.338 28.514  1.00 0.00  ? 125 ALA A HB3  3  
ATOM   7125  N  N    . MET A 1 126 ? 17.119  19.201 26.718  1.00 0.00  ? 126 MET A N    3  
ATOM   7126  C  CA   . MET A 1 126 ? 18.351  18.384 26.878  1.00 0.00  ? 126 MET A CA   3  
ATOM   7127  C  C    . MET A 1 126 ? 19.581  19.251 26.617  1.00 0.00  ? 126 MET A C    3  
ATOM   7128  O  O    . MET A 1 126 ? 20.697  18.857 26.890  1.00 0.00  ? 126 MET A O    3  
ATOM   7129  C  CB   . MET A 1 126 ? 18.310  17.219 25.889  1.00 0.00  ? 126 MET A CB   3  
ATOM   7130  C  CG   . MET A 1 126 ? 17.540  16.065 26.528  1.00 0.00  ? 126 MET A CG   3  
ATOM   7131  S  SD   . MET A 1 126 ? 17.994  14.505 25.732  1.00 0.00  ? 126 MET A SD   3  
ATOM   7132  C  CE   . MET A 1 126 ? 16.351  13.747 25.804  1.00 0.00  ? 126 MET A CE   3  
ATOM   7133  H  H    . MET A 1 126 ? 16.791  19.426 25.823  1.00 0.00  ? 126 MET A H    3  
ATOM   7134  H  HA   . MET A 1 126 ? 18.396  17.998 27.884  1.00 0.00  ? 126 MET A HA   3  
ATOM   7135  H  HB2  . MET A 1 126 ? 17.809  17.533 24.983  1.00 0.00  ? 126 MET A HB2  3  
ATOM   7136  H  HB3  . MET A 1 126 ? 19.316  16.900 25.657  1.00 0.00  ? 126 MET A HB3  3  
ATOM   7137  H  HG2  . MET A 1 126 ? 17.779  16.014 27.580  1.00 0.00  ? 126 MET A HG2  3  
ATOM   7138  H  HG3  . MET A 1 126 ? 16.481  16.235 26.411  1.00 0.00  ? 126 MET A HG3  3  
ATOM   7139  H  HE1  . MET A 1 126 ? 15.616  14.451 25.438  1.00 0.00  ? 126 MET A HE1  3  
ATOM   7140  H  HE2  . MET A 1 126 ? 16.117  13.485 26.825  1.00 0.00  ? 126 MET A HE2  3  
ATOM   7141  H  HE3  . MET A 1 126 ? 16.338  12.855 25.193  1.00 0.00  ? 126 MET A HE3  3  
ATOM   7142  N  N    . GLY A 1 127 ? 19.387  20.434 26.108  1.00 0.00  ? 127 GLY A N    3  
ATOM   7143  C  CA   . GLY A 1 127 ? 20.553  21.325 25.853  1.00 0.00  ? 127 GLY A CA   3  
ATOM   7144  C  C    . GLY A 1 127 ? 20.510  21.843 24.421  1.00 0.00  ? 127 GLY A C    3  
ATOM   7145  O  O    . GLY A 1 127 ? 20.373  23.027 24.183  1.00 0.00  ? 127 GLY A O    3  
ATOM   7146  H  H    . GLY A 1 127 ? 18.477  20.738 25.905  1.00 0.00  ? 127 GLY A H    3  
ATOM   7147  H  HA2  . GLY A 1 127 ? 20.520  22.159 26.538  1.00 0.00  ? 127 GLY A HA2  3  
ATOM   7148  H  HA3  . GLY A 1 127 ? 21.467  20.771 26.004  1.00 0.00  ? 127 GLY A HA3  3  
ATOM   7149  N  N    . LEU A 1 128 ? 20.628  20.974 23.459  1.00 0.00  ? 128 LEU A N    3  
ATOM   7150  C  CA   . LEU A 1 128 ? 20.594  21.443 22.050  1.00 0.00  ? 128 LEU A CA   3  
ATOM   7151  C  C    . LEU A 1 128 ? 19.389  22.356 21.852  1.00 0.00  ? 128 LEU A C    3  
ATOM   7152  O  O    . LEU A 1 128 ? 18.585  22.552 22.746  1.00 0.00  ? 128 LEU A O    3  
ATOM   7153  C  CB   . LEU A 1 128 ? 20.479  20.252 21.101  1.00 0.00  ? 128 LEU A CB   3  
ATOM   7154  C  CG   . LEU A 1 128 ? 21.872  19.697 20.802  1.00 0.00  ? 128 LEU A CG   3  
ATOM   7155  C  CD1  . LEU A 1 128 ? 21.731  18.307 20.183  1.00 0.00  ? 128 LEU A CD1  3  
ATOM   7156  C  CD2  . LEU A 1 128 ? 22.592  20.625 19.819  1.00 0.00  ? 128 LEU A CD2  3  
ATOM   7157  H  H    . LEU A 1 128 ? 20.740  20.022 23.663  1.00 0.00  ? 128 LEU A H    3  
ATOM   7158  H  HA   . LEU A 1 128 ? 21.497  21.991 21.831  1.00 0.00  ? 128 LEU A HA   3  
ATOM   7159  H  HB2  . LEU A 1 128 ? 19.875  19.485 21.557  1.00 0.00  ? 128 LEU A HB2  3  
ATOM   7160  H  HB3  . LEU A 1 128 ? 20.016  20.572 20.179  1.00 0.00  ? 128 LEU A HB3  3  
ATOM   7161  H  HG   . LEU A 1 128 ? 22.438  19.630 21.719  1.00 0.00  ? 128 LEU A HG   3  
ATOM   7162  H  HD11 . LEU A 1 128 ? 21.013  17.737 20.753  1.00 0.00  ? 128 LEU A HD11 3  
ATOM   7163  H  HD12 . LEU A 1 128 ? 22.687  17.803 20.200  1.00 0.00  ? 128 LEU A HD12 3  
ATOM   7164  H  HD13 . LEU A 1 128 ? 21.389  18.397 19.163  1.00 0.00  ? 128 LEU A HD13 3  
ATOM   7165  H  HD21 . LEU A 1 128 ? 22.258  20.413 18.815  1.00 0.00  ? 128 LEU A HD21 3  
ATOM   7166  H  HD22 . LEU A 1 128 ? 23.658  20.467 19.888  1.00 0.00  ? 128 LEU A HD22 3  
ATOM   7167  H  HD23 . LEU A 1 128 ? 22.364  21.652 20.064  1.00 0.00  ? 128 LEU A HD23 3  
ATOM   7168  N  N    . GLU A 1 129 ? 19.262  22.914 20.689  1.00 0.00  ? 129 GLU A N    3  
ATOM   7169  C  CA   . GLU A 1 129 ? 18.115  23.819 20.415  1.00 0.00  ? 129 GLU A CA   3  
ATOM   7170  C  C    . GLU A 1 129 ? 18.058  24.127 18.923  1.00 0.00  ? 129 GLU A C    3  
ATOM   7171  O  O    . GLU A 1 129 ? 18.772  23.554 18.125  1.00 0.00  ? 129 GLU A O    3  
ATOM   7172  C  CB   . GLU A 1 129 ? 18.285  25.120 21.203  1.00 0.00  ? 129 GLU A CB   3  
ATOM   7173  C  CG   . GLU A 1 129 ? 17.464  25.047 22.494  1.00 0.00  ? 129 GLU A CG   3  
ATOM   7174  C  CD   . GLU A 1 129 ? 17.029  26.454 22.888  1.00 0.00  ? 129 GLU A CD   3  
ATOM   7175  O  OE1  . GLU A 1 129 ? 16.009  26.895 22.392  1.00 0.00  ? 129 GLU A OE1  3  
ATOM   7176  O  OE2  . GLU A 1 129 ? 17.729  27.070 23.672  1.00 0.00  ? 129 GLU A OE2  3  
ATOM   7177  H  H    . GLU A 1 129 ? 19.923  22.737 19.989  1.00 0.00  ? 129 GLU A H    3  
ATOM   7178  H  HA   . GLU A 1 129 ? 17.195  23.344 20.711  1.00 0.00  ? 129 GLU A HA   3  
ATOM   7179  H  HB2  . GLU A 1 129 ? 19.329  25.261 21.444  1.00 0.00  ? 129 GLU A HB2  3  
ATOM   7180  H  HB3  . GLU A 1 129 ? 17.940  25.951 20.605  1.00 0.00  ? 129 GLU A HB3  3  
ATOM   7181  H  HG2  . GLU A 1 129 ? 16.591  24.428 22.336  1.00 0.00  ? 129 GLU A HG2  3  
ATOM   7182  H  HG3  . GLU A 1 129 ? 18.070  24.626 23.282  1.00 0.00  ? 129 GLU A HG3  3  
ATOM   7183  N  N    . HIS A 1 130 ? 17.202  25.020 18.543  1.00 0.00  ? 130 HIS A N    3  
ATOM   7184  C  CA   . HIS A 1 130 ? 17.080  25.368 17.099  1.00 0.00  ? 130 HIS A CA   3  
ATOM   7185  C  C    . HIS A 1 130 ? 18.466  25.659 16.511  1.00 0.00  ? 130 HIS A C    3  
ATOM   7186  O  O    . HIS A 1 130 ? 19.118  26.625 16.857  1.00 0.00  ? 130 HIS A O    3  
ATOM   7187  C  CB   . HIS A 1 130 ? 16.182  26.599 16.931  1.00 0.00  ? 130 HIS A CB   3  
ATOM   7188  C  CG   . HIS A 1 130 ? 14.946  26.443 17.774  1.00 0.00  ? 130 HIS A CG   3  
ATOM   7189  N  ND1  . HIS A 1 130 ? 14.789  27.112 18.977  1.00 0.00  ? 130 HIS A ND1  3  
ATOM   7190  C  CD2  . HIS A 1 130 ? 13.796  25.712 17.596  1.00 0.00  ? 130 HIS A CD2  3  
ATOM   7191  C  CE1  . HIS A 1 130 ? 13.583  26.777 19.470  1.00 0.00  ? 130 HIS A CE1  3  
ATOM   7192  N  NE2  . HIS A 1 130 ? 12.938  25.926 18.668  1.00 0.00  ? 130 HIS A NE2  3  
ATOM   7193  H  H    . HIS A 1 130 ? 16.631  25.454 19.210  1.00 0.00  ? 130 HIS A H    3  
ATOM   7194  H  HA   . HIS A 1 130 ? 16.642  24.533 16.571  1.00 0.00  ? 130 HIS A HA   3  
ATOM   7195  H  HB2  . HIS A 1 130 ? 16.718  27.483 17.243  1.00 0.00  ? 130 HIS A HB2  3  
ATOM   7196  H  HB3  . HIS A 1 130 ? 15.896  26.699 15.894  1.00 0.00  ? 130 HIS A HB3  3  
ATOM   7197  H  HD1  . HIS A 1 130 ? 15.438  27.714 19.395  1.00 0.00  ? 130 HIS A HD1  3  
ATOM   7198  H  HD2  . HIS A 1 130 ? 13.591  25.064 16.756  1.00 0.00  ? 130 HIS A HD2  3  
ATOM   7199  H  HE1  . HIS A 1 130 ? 13.184  27.151 20.398  1.00 0.00  ? 130 HIS A HE1  3  
ATOM   7200  N  N    . SER A 1 131 ? 18.910  24.830 15.606  1.00 0.00  ? 131 SER A N    3  
ATOM   7201  C  CA   . SER A 1 131 ? 20.239  25.051 14.972  1.00 0.00  ? 131 SER A CA   3  
ATOM   7202  C  C    . SER A 1 131 ? 20.067  26.021 13.806  1.00 0.00  ? 131 SER A C    3  
ATOM   7203  O  O    . SER A 1 131 ? 20.367  27.192 13.909  1.00 0.00  ? 131 SER A O    3  
ATOM   7204  C  CB   . SER A 1 131 ? 20.785  23.718 14.450  1.00 0.00  ? 131 SER A CB   3  
ATOM   7205  O  OG   . SER A 1 131 ? 21.862  23.967 13.556  1.00 0.00  ? 131 SER A OG   3  
ATOM   7206  H  H    . SER A 1 131 ? 18.362  24.065 15.334  1.00 0.00  ? 131 SER A H    3  
ATOM   7207  H  HA   . SER A 1 131 ? 20.923  25.469 15.693  1.00 0.00  ? 131 SER A HA   3  
ATOM   7208  H  HB2  . SER A 1 131 ? 21.139  23.122 15.273  1.00 0.00  ? 131 SER A HB2  3  
ATOM   7209  H  HB3  . SER A 1 131 ? 19.996  23.184 13.936  1.00 0.00  ? 131 SER A HB3  3  
ATOM   7210  H  HG   . SER A 1 131 ? 21.496  24.099 12.678  1.00 0.00  ? 131 SER A HG   3  
ATOM   7211  N  N    . GLN A 1 132 ? 19.566  25.527 12.710  1.00 0.00  ? 132 GLN A N    3  
ATOM   7212  C  CA   . GLN A 1 132 ? 19.332  26.371 11.502  1.00 0.00  ? 132 GLN A CA   3  
ATOM   7213  C  C    . GLN A 1 132 ? 19.206  25.442 10.302  1.00 0.00  ? 132 GLN A C    3  
ATOM   7214  O  O    . GLN A 1 132 ? 18.525  25.734 9.339   1.00 0.00  ? 132 GLN A O    3  
ATOM   7215  C  CB   . GLN A 1 132 ? 20.500  27.332 11.253  1.00 0.00  ? 132 GLN A CB   3  
ATOM   7216  C  CG   . GLN A 1 132 ? 20.214  28.120 9.973   1.00 0.00  ? 132 GLN A CG   3  
ATOM   7217  C  CD   . GLN A 1 132 ? 21.348  29.112 9.703   1.00 0.00  ? 132 GLN A CD   3  
ATOM   7218  O  OE1  . GLN A 1 132 ? 21.982  29.600 10.617  1.00 0.00  ? 132 GLN A OE1  3  
ATOM   7219  N  NE2  . GLN A 1 132 ? 21.628  29.433 8.470   1.00 0.00  ? 132 GLN A NE2  3  
ATOM   7220  H  H    . GLN A 1 132 ? 19.328  24.578 12.683  1.00 0.00  ? 132 GLN A H    3  
ATOM   7221  H  HA   . GLN A 1 132 ? 18.416  26.932 11.622  1.00 0.00  ? 132 GLN A HA   3  
ATOM   7222  H  HB2  . GLN A 1 132 ? 20.598  28.017 12.080  1.00 0.00  ? 132 GLN A HB2  3  
ATOM   7223  H  HB3  . GLN A 1 132 ? 21.414  26.771 11.133  1.00 0.00  ? 132 GLN A HB3  3  
ATOM   7224  H  HG2  . GLN A 1 132 ? 20.130  27.433 9.142   1.00 0.00  ? 132 GLN A HG2  3  
ATOM   7225  H  HG3  . GLN A 1 132 ? 19.286  28.659 10.086  1.00 0.00  ? 132 GLN A HG3  3  
ATOM   7226  H  HE21 . GLN A 1 132 ? 21.115  29.038 7.734   1.00 0.00  ? 132 GLN A HE21 3  
ATOM   7227  H  HE22 . GLN A 1 132 ? 22.349  30.066 8.278   1.00 0.00  ? 132 GLN A HE22 3  
ATOM   7228  N  N    . ASP A 1 133 ? 19.868  24.322 10.358  1.00 0.00  ? 133 ASP A N    3  
ATOM   7229  C  CA   . ASP A 1 133 ? 19.809  23.358 9.229   1.00 0.00  ? 133 ASP A CA   3  
ATOM   7230  C  C    . ASP A 1 133 ? 18.355  22.953 8.974   1.00 0.00  ? 133 ASP A C    3  
ATOM   7231  O  O    . ASP A 1 133 ? 17.636  22.621 9.899   1.00 0.00  ? 133 ASP A O    3  
ATOM   7232  C  CB   . ASP A 1 133 ? 20.630  22.117 9.582   1.00 0.00  ? 133 ASP A CB   3  
ATOM   7233  C  CG   . ASP A 1 133 ? 21.610  21.822 8.445   1.00 0.00  ? 133 ASP A CG   3  
ATOM   7234  O  OD1  . ASP A 1 133 ? 21.158  21.386 7.400   1.00 0.00  ? 133 ASP A OD1  3  
ATOM   7235  O  OD2  . ASP A 1 133 ? 22.796  22.039 8.637   1.00 0.00  ? 133 ASP A OD2  3  
ATOM   7236  H  H    . ASP A 1 133 ? 20.411  24.117 11.148  1.00 0.00  ? 133 ASP A H    3  
ATOM   7237  H  HA   . ASP A 1 133 ? 20.221  23.821 8.346   1.00 0.00  ? 133 ASP A HA   3  
ATOM   7238  H  HB2  . ASP A 1 133 ? 21.178  22.296 10.496  1.00 0.00  ? 133 ASP A HB2  3  
ATOM   7239  H  HB3  . ASP A 1 133 ? 19.972  21.272 9.717   1.00 0.00  ? 133 ASP A HB3  3  
ATOM   7240  N  N    . PRO A 1 134 ? 17.964  22.976 7.722   1.00 0.00  ? 134 PRO A N    3  
ATOM   7241  C  CA   . PRO A 1 134 ? 16.611  22.616 7.316   1.00 0.00  ? 134 PRO A CA   3  
ATOM   7242  C  C    . PRO A 1 134 ? 16.439  21.115 7.360   1.00 0.00  ? 134 PRO A C    3  
ATOM   7243  O  O    . PRO A 1 134 ? 17.028  20.367 6.608   1.00 0.00  ? 134 PRO A O    3  
ATOM   7244  C  CB   . PRO A 1 134 ? 16.480  23.126 5.897   1.00 0.00  ? 134 PRO A CB   3  
ATOM   7245  C  CG   . PRO A 1 134 ? 17.923  23.283 5.365   1.00 0.00  ? 134 PRO A CG   3  
ATOM   7246  C  CD   . PRO A 1 134 ? 18.833  23.354 6.606   1.00 0.00  ? 134 PRO A CD   3  
ATOM   7247  H  HA   . PRO A 1 134 ? 15.884  23.100 7.948   1.00 0.00  ? 134 PRO A HA   3  
ATOM   7248  H  HB2  . PRO A 1 134 ? 15.932  22.402 5.307   1.00 0.00  ? 134 PRO A HB2  3  
ATOM   7249  H  HB3  . PRO A 1 134 ? 15.974  24.074 5.894   1.00 0.00  ? 134 PRO A HB3  3  
ATOM   7250  H  HG2  . PRO A 1 134 ? 18.188  22.433 4.753   1.00 0.00  ? 134 PRO A HG2  3  
ATOM   7251  H  HG3  . PRO A 1 134 ? 18.012  24.194 4.795   1.00 0.00  ? 134 PRO A HG3  3  
ATOM   7252  H  HD2  . PRO A 1 134 ? 19.640  22.648 6.522   1.00 0.00  ? 134 PRO A HD2  3  
ATOM   7253  H  HD3  . PRO A 1 134 ? 19.201  24.350 6.753   1.00 0.00  ? 134 PRO A HD3  3  
ATOM   7254  N  N    . GLY A 1 135 ? 15.625  20.697 8.244   1.00 0.00  ? 135 GLY A N    3  
ATOM   7255  C  CA   . GLY A 1 135 ? 15.347  19.241 8.398   1.00 0.00  ? 135 GLY A CA   3  
ATOM   7256  C  C    . GLY A 1 135 ? 15.850  18.738 9.757   1.00 0.00  ? 135 GLY A C    3  
ATOM   7257  O  O    . GLY A 1 135 ? 15.511  17.649 10.179  1.00 0.00  ? 135 GLY A O    3  
ATOM   7258  H  H    . GLY A 1 135 ? 15.188  21.357 8.807   1.00 0.00  ? 135 GLY A H    3  
ATOM   7259  H  HA2  . GLY A 1 135 ? 14.280  19.071 8.322   1.00 0.00  ? 135 GLY A HA2  3  
ATOM   7260  H  HA3  . GLY A 1 135 ? 15.849  18.697 7.613   1.00 0.00  ? 135 GLY A HA3  3  
ATOM   7261  N  N    . ALA A 1 136 ? 16.658  19.504 10.446  1.00 0.00  ? 136 ALA A N    3  
ATOM   7262  C  CA   . ALA A 1 136 ? 17.174  19.034 11.770  1.00 0.00  ? 136 ALA A CA   3  
ATOM   7263  C  C    . ALA A 1 136 ? 16.002  18.799 12.727  1.00 0.00  ? 136 ALA A C    3  
ATOM   7264  O  O    . ALA A 1 136 ? 14.922  19.322 12.540  1.00 0.00  ? 136 ALA A O    3  
ATOM   7265  C  CB   . ALA A 1 136 ? 18.117  20.089 12.355  1.00 0.00  ? 136 ALA A CB   3  
ATOM   7266  H  H    . ALA A 1 136 ? 16.930  20.382 10.095  1.00 0.00  ? 136 ALA A H    3  
ATOM   7267  H  HA   . ALA A 1 136 ? 17.712  18.108 11.633  1.00 0.00  ? 136 ALA A HA   3  
ATOM   7268  H  HB1  . ALA A 1 136 ? 18.134  20.950 11.705  1.00 0.00  ? 136 ALA A HB1  3  
ATOM   7269  H  HB2  . ALA A 1 136 ? 19.115  19.678 12.438  1.00 0.00  ? 136 ALA A HB2  3  
ATOM   7270  H  HB3  . ALA A 1 136 ? 17.770  20.386 13.334  1.00 0.00  ? 136 ALA A HB3  3  
ATOM   7271  N  N    . LEU A 1 137 ? 16.202  18.009 13.748  1.00 0.00  ? 137 LEU A N    3  
ATOM   7272  C  CA   . LEU A 1 137 ? 15.090  17.736 14.707  1.00 0.00  ? 137 LEU A CA   3  
ATOM   7273  C  C    . LEU A 1 137 ? 14.793  18.988 15.535  1.00 0.00  ? 137 LEU A C    3  
ATOM   7274  O  O    . LEU A 1 137 ? 13.723  19.134 16.093  1.00 0.00  ? 137 LEU A O    3  
ATOM   7275  C  CB   . LEU A 1 137 ? 15.485  16.590 15.640  1.00 0.00  ? 137 LEU A CB   3  
ATOM   7276  C  CG   . LEU A 1 137 ? 14.282  16.185 16.501  1.00 0.00  ? 137 LEU A CG   3  
ATOM   7277  C  CD1  . LEU A 1 137 ? 13.023  16.096 15.635  1.00 0.00  ? 137 LEU A CD1  3  
ATOM   7278  C  CD2  . LEU A 1 137 ? 14.549  14.821 17.135  1.00 0.00  ? 137 LEU A CD2  3  
ATOM   7279  H  H    . LEU A 1 137 ? 17.079  17.592 13.880  1.00 0.00  ? 137 LEU A H    3  
ATOM   7280  H  HA   . LEU A 1 137 ? 14.206  17.457 14.154  1.00 0.00  ? 137 LEU A HA   3  
ATOM   7281  H  HB2  . LEU A 1 137 ? 15.809  15.745 15.052  1.00 0.00  ? 137 LEU A HB2  3  
ATOM   7282  H  HB3  . LEU A 1 137 ? 16.292  16.911 16.283  1.00 0.00  ? 137 LEU A HB3  3  
ATOM   7283  H  HG   . LEU A 1 137 ? 14.130  16.922 17.276  1.00 0.00  ? 137 LEU A HG   3  
ATOM   7284  H  HD11 . LEU A 1 137 ? 13.261  15.623 14.695  1.00 0.00  ? 137 LEU A HD11 3  
ATOM   7285  H  HD12 . LEU A 1 137 ? 12.645  17.091 15.452  1.00 0.00  ? 137 LEU A HD12 3  
ATOM   7286  H  HD13 . LEU A 1 137 ? 12.271  15.514 16.151  1.00 0.00  ? 137 LEU A HD13 3  
ATOM   7287  H  HD21 . LEU A 1 137 ? 14.251  14.840 18.172  1.00 0.00  ? 137 LEU A HD21 3  
ATOM   7288  H  HD22 . LEU A 1 137 ? 15.601  14.592 17.065  1.00 0.00  ? 137 LEU A HD22 3  
ATOM   7289  H  HD23 . LEU A 1 137 ? 13.980  14.067 16.611  1.00 0.00  ? 137 LEU A HD23 3  
ATOM   7290  N  N    . MET A 1 138 ? 15.720  19.898 15.615  1.00 0.00  ? 138 MET A N    3  
ATOM   7291  C  CA   . MET A 1 138 ? 15.473  21.142 16.404  1.00 0.00  ? 138 MET A CA   3  
ATOM   7292  C  C    . MET A 1 138 ? 15.099  22.279 15.454  1.00 0.00  ? 138 MET A C    3  
ATOM   7293  O  O    . MET A 1 138 ? 14.900  23.407 15.865  1.00 0.00  ? 138 MET A O    3  
ATOM   7294  C  CB   . MET A 1 138 ? 16.748  21.536 17.153  1.00 0.00  ? 138 MET A CB   3  
ATOM   7295  C  CG   . MET A 1 138 ? 17.171  20.402 18.083  1.00 0.00  ? 138 MET A CG   3  
ATOM   7296  S  SD   . MET A 1 138 ? 18.152  19.198 17.153  1.00 0.00  ? 138 MET A SD   3  
ATOM   7297  C  CE   . MET A 1 138 ? 19.625  20.231 16.942  1.00 0.00  ? 138 MET A CE   3  
ATOM   7298  H  H    . MET A 1 138 ? 16.574  19.770 15.153  1.00 0.00  ? 138 MET A H    3  
ATOM   7299  H  HA   . MET A 1 138 ? 14.674  20.972 17.110  1.00 0.00  ? 138 MET A HA   3  
ATOM   7300  H  HB2  . MET A 1 138 ? 17.538  21.730 16.439  1.00 0.00  ? 138 MET A HB2  3  
ATOM   7301  H  HB3  . MET A 1 138 ? 16.563  22.427 17.736  1.00 0.00  ? 138 MET A HB3  3  
ATOM   7302  H  HG2  . MET A 1 138 ? 17.765  20.803 18.890  1.00 0.00  ? 138 MET A HG2  3  
ATOM   7303  H  HG3  . MET A 1 138 ? 16.294  19.923 18.487  1.00 0.00  ? 138 MET A HG3  3  
ATOM   7304  H  HE1  . MET A 1 138 ? 20.415  19.641 16.502  1.00 0.00  ? 138 MET A HE1  3  
ATOM   7305  H  HE2  . MET A 1 138 ? 19.947  20.602 17.902  1.00 0.00  ? 138 MET A HE2  3  
ATOM   7306  H  HE3  . MET A 1 138 ? 19.388  21.066 16.298  1.00 0.00  ? 138 MET A HE3  3  
ATOM   7307  N  N    . ALA A 1 139 ? 15.015  21.998 14.185  1.00 0.00  ? 139 ALA A N    3  
ATOM   7308  C  CA   . ALA A 1 139 ? 14.673  23.064 13.209  1.00 0.00  ? 139 ALA A CA   3  
ATOM   7309  C  C    . ALA A 1 139 ? 13.210  23.479 13.378  1.00 0.00  ? 139 ALA A C    3  
ATOM   7310  O  O    . ALA A 1 139 ? 12.404  22.729 13.892  1.00 0.00  ? 139 ALA A O    3  
ATOM   7311  C  CB   . ALA A 1 139 ? 14.898  22.544 11.791  1.00 0.00  ? 139 ALA A CB   3  
ATOM   7312  H  H    . ALA A 1 139 ? 15.191  21.087 13.871  1.00 0.00  ? 139 ALA A H    3  
ATOM   7313  H  HA   . ALA A 1 139 ? 15.308  23.921 13.383  1.00 0.00  ? 139 ALA A HA   3  
ATOM   7314  H  HB1  . ALA A 1 139 ? 15.949  22.618 11.546  1.00 0.00  ? 139 ALA A HB1  3  
ATOM   7315  H  HB2  . ALA A 1 139 ? 14.322  23.133 11.093  1.00 0.00  ? 139 ALA A HB2  3  
ATOM   7316  H  HB3  . ALA A 1 139 ? 14.585  21.512 11.735  1.00 0.00  ? 139 ALA A HB3  3  
ATOM   7317  N  N    . PRO A 1 140 ? 12.922  24.678 12.946  1.00 0.00  ? 140 PRO A N    3  
ATOM   7318  C  CA   . PRO A 1 140 ? 11.572  25.254 13.032  1.00 0.00  ? 140 PRO A CA   3  
ATOM   7319  C  C    . PRO A 1 140 ? 10.663  24.679 11.951  1.00 0.00  ? 140 PRO A C    3  
ATOM   7320  O  O    . PRO A 1 140 ? 10.201  25.384 11.074  1.00 0.00  ? 140 PRO A O    3  
ATOM   7321  C  CB   . PRO A 1 140 ? 11.805  26.753 12.816  1.00 0.00  ? 140 PRO A CB   3  
ATOM   7322  C  CG   . PRO A 1 140 ? 13.157  26.883 12.073  1.00 0.00  ? 140 PRO A CG   3  
ATOM   7323  C  CD   . PRO A 1 140 ? 13.922  25.569 12.317  1.00 0.00  ? 140 PRO A CD   3  
ATOM   7324  H  HA   . PRO A 1 140 ? 11.151  25.089 14.009  1.00 0.00  ? 140 PRO A HA   3  
ATOM   7325  H  HB2  . PRO A 1 140 ? 11.007  27.167 12.215  1.00 0.00  ? 140 PRO A HB2  3  
ATOM   7326  H  HB3  . PRO A 1 140 ? 11.859  27.263 13.764  1.00 0.00  ? 140 PRO A HB3  3  
ATOM   7327  H  HG2  . PRO A 1 140 ? 12.988  27.026 11.015  1.00 0.00  ? 140 PRO A HG2  3  
ATOM   7328  H  HG3  . PRO A 1 140 ? 13.722  27.709 12.477  1.00 0.00  ? 140 PRO A HG3  3  
ATOM   7329  H  HD2  . PRO A 1 140 ? 14.270  25.155 11.381  1.00 0.00  ? 140 PRO A HD2  3  
ATOM   7330  H  HD3  . PRO A 1 140 ? 14.749  25.733 12.990  1.00 0.00  ? 140 PRO A HD3  3  
ATOM   7331  N  N    . ILE A 1 141 ? 10.392  23.405 12.008  1.00 0.00  ? 141 ILE A N    3  
ATOM   7332  C  CA   . ILE A 1 141 ? 9.500   22.796 10.984  1.00 0.00  ? 141 ILE A CA   3  
ATOM   7333  C  C    . ILE A 1 141 ? 8.929   21.480 11.517  1.00 0.00  ? 141 ILE A C    3  
ATOM   7334  O  O    . ILE A 1 141 ? 8.845   21.273 12.711  1.00 0.00  ? 141 ILE A O    3  
ATOM   7335  C  CB   . ILE A 1 141 ? 10.265  22.538 9.681   1.00 0.00  ? 141 ILE A CB   3  
ATOM   7336  C  CG1  . ILE A 1 141 ? 11.649  23.205 9.726   1.00 0.00  ? 141 ILE A CG1  3  
ATOM   7337  C  CG2  . ILE A 1 141 ? 9.460   23.124 8.524   1.00 0.00  ? 141 ILE A CG2  3  
ATOM   7338  C  CD1  . ILE A 1 141 ? 12.555  22.573 8.666   1.00 0.00  ? 141 ILE A CD1  3  
ATOM   7339  H  H    . ILE A 1 141 ? 10.767  22.853 12.727  1.00 0.00  ? 141 ILE A H    3  
ATOM   7340  H  HA   . ILE A 1 141 ? 8.683   23.476 10.784  1.00 0.00  ? 141 ILE A HA   3  
ATOM   7341  H  HB   . ILE A 1 141 ? 10.379  21.473 9.536   1.00 0.00  ? 141 ILE A HB   3  
ATOM   7342  H  HG12 . ILE A 1 141 ? 11.545  24.262 9.531   1.00 0.00  ? 141 ILE A HG12 3  
ATOM   7343  H  HG13 . ILE A 1 141 ? 12.090  23.060 10.701  1.00 0.00  ? 141 ILE A HG13 3  
ATOM   7344  H  HG21 . ILE A 1 141 ? 8.853   23.940 8.891   1.00 0.00  ? 141 ILE A HG21 3  
ATOM   7345  H  HG22 . ILE A 1 141 ? 8.821   22.359 8.110   1.00 0.00  ? 141 ILE A HG22 3  
ATOM   7346  H  HG23 . ILE A 1 141 ? 10.130  23.487 7.759   1.00 0.00  ? 141 ILE A HG23 3  
ATOM   7347  H  HD11 . ILE A 1 141 ? 12.964  21.649 9.046   1.00 0.00  ? 141 ILE A HD11 3  
ATOM   7348  H  HD12 . ILE A 1 141 ? 13.361  23.252 8.430   1.00 0.00  ? 141 ILE A HD12 3  
ATOM   7349  H  HD13 . ILE A 1 141 ? 11.980  22.371 7.774   1.00 0.00  ? 141 ILE A HD13 3  
ATOM   7350  N  N    . TYR A 1 142 ? 8.517   20.597 10.649  1.00 0.00  ? 142 TYR A N    3  
ATOM   7351  C  CA   . TYR A 1 142 ? 7.930   19.309 11.125  1.00 0.00  ? 142 TYR A CA   3  
ATOM   7352  C  C    . TYR A 1 142 ? 7.855   18.308 9.960   1.00 0.00  ? 142 TYR A C    3  
ATOM   7353  O  O    . TYR A 1 142 ? 7.199   18.545 8.963   1.00 0.00  ? 142 TYR A O    3  
ATOM   7354  C  CB   . TYR A 1 142 ? 6.529   19.606 11.673  1.00 0.00  ? 142 TYR A CB   3  
ATOM   7355  C  CG   . TYR A 1 142 ? 5.834   18.338 12.119  1.00 0.00  ? 142 TYR A CG   3  
ATOM   7356  C  CD1  . TYR A 1 142 ? 5.075   17.605 11.201  1.00 0.00  ? 142 TYR A CD1  3  
ATOM   7357  C  CD2  . TYR A 1 142 ? 5.919   17.913 13.454  1.00 0.00  ? 142 TYR A CD2  3  
ATOM   7358  C  CE1  . TYR A 1 142 ? 4.401   16.449 11.607  1.00 0.00  ? 142 TYR A CE1  3  
ATOM   7359  C  CE2  . TYR A 1 142 ? 5.247   16.750 13.863  1.00 0.00  ? 142 TYR A CE2  3  
ATOM   7360  C  CZ   . TYR A 1 142 ? 4.487   16.019 12.936  1.00 0.00  ? 142 TYR A CZ   3  
ATOM   7361  O  OH   . TYR A 1 142 ? 3.819   14.879 13.334  1.00 0.00  ? 142 TYR A OH   3  
ATOM   7362  H  H    . TYR A 1 142 ? 8.576   20.786 9.688   1.00 0.00  ? 142 TYR A H    3  
ATOM   7363  H  HA   . TYR A 1 142 ? 8.546   18.900 11.913  1.00 0.00  ? 142 TYR A HA   3  
ATOM   7364  H  HB2  . TYR A 1 142 ? 6.613   20.278 12.514  1.00 0.00  ? 142 TYR A HB2  3  
ATOM   7365  H  HB3  . TYR A 1 142 ? 5.943   20.079 10.900  1.00 0.00  ? 142 TYR A HB3  3  
ATOM   7366  H  HD1  . TYR A 1 142 ? 5.012   17.934 10.175  1.00 0.00  ? 142 TYR A HD1  3  
ATOM   7367  H  HD2  . TYR A 1 142 ? 6.504   18.477 14.168  1.00 0.00  ? 142 TYR A HD2  3  
ATOM   7368  H  HE1  . TYR A 1 142 ? 3.815   15.888 10.893  1.00 0.00  ? 142 TYR A HE1  3  
ATOM   7369  H  HE2  . TYR A 1 142 ? 5.313   16.418 14.890  1.00 0.00  ? 142 TYR A HE2  3  
ATOM   7370  H  HH   . TYR A 1 142 ? 4.171   14.611 14.184  1.00 0.00  ? 142 TYR A HH   3  
ATOM   7371  N  N    . THR A 1 143 ? 8.532   17.189 10.080  1.00 0.00  ? 143 THR A N    3  
ATOM   7372  C  CA   . THR A 1 143 ? 8.512   16.165 8.990   1.00 0.00  ? 143 THR A CA   3  
ATOM   7373  C  C    . THR A 1 143 ? 8.395   14.765 9.612   1.00 0.00  ? 143 THR A C    3  
ATOM   7374  O  O    . THR A 1 143 ? 9.377   14.170 10.007  1.00 0.00  ? 143 THR A O    3  
ATOM   7375  C  CB   . THR A 1 143 ? 9.815   16.250 8.185   1.00 0.00  ? 143 THR A CB   3  
ATOM   7376  O  OG1  . THR A 1 143 ? 9.990   17.578 7.706   1.00 0.00  ? 143 THR A OG1  3  
ATOM   7377  C  CG2  . THR A 1 143 ? 9.763   15.276 7.001   1.00 0.00  ? 143 THR A CG2  3  
ATOM   7378  H  H    . THR A 1 143 ? 9.057   17.025 10.891  1.00 0.00  ? 143 THR A H    3  
ATOM   7379  H  HA   . THR A 1 143 ? 7.673   16.348 8.338   1.00 0.00  ? 143 THR A HA   3  
ATOM   7380  H  HB   . THR A 1 143 ? 10.647  15.987 8.823   1.00 0.00  ? 143 THR A HB   3  
ATOM   7381  H  HG1  . THR A 1 143 ? 10.169  17.538 6.764   1.00 0.00  ? 143 THR A HG1  3  
ATOM   7382  H  HG21 . THR A 1 143 ? 8.839   15.410 6.462   1.00 0.00  ? 143 THR A HG21 3  
ATOM   7383  H  HG22 . THR A 1 143 ? 9.826   14.262 7.367   1.00 0.00  ? 143 THR A HG22 3  
ATOM   7384  H  HG23 . THR A 1 143 ? 10.593  15.471 6.338   1.00 0.00  ? 143 THR A HG23 3  
ATOM   7385  N  N    . TYR A 1 144 ? 7.206   14.230 9.705   1.00 0.00  ? 144 TYR A N    3  
ATOM   7386  C  CA   . TYR A 1 144 ? 7.051   12.868 10.304  1.00 0.00  ? 144 TYR A CA   3  
ATOM   7387  C  C    . TYR A 1 144 ? 8.116   11.933 9.728   1.00 0.00  ? 144 TYR A C    3  
ATOM   7388  O  O    . TYR A 1 144 ? 8.661   12.165 8.669   1.00 0.00  ? 144 TYR A O    3  
ATOM   7389  C  CB   . TYR A 1 144 ? 5.662   12.301 9.990   1.00 0.00  ? 144 TYR A CB   3  
ATOM   7390  C  CG   . TYR A 1 144 ? 5.500   10.954 10.662  1.00 0.00  ? 144 TYR A CG   3  
ATOM   7391  C  CD1  . TYR A 1 144 ? 5.843   10.797 12.013  1.00 0.00  ? 144 TYR A CD1  3  
ATOM   7392  C  CD2  . TYR A 1 144 ? 5.020   9.858  9.929   1.00 0.00  ? 144 TYR A CD2  3  
ATOM   7393  C  CE1  . TYR A 1 144 ? 5.708   9.547  12.627  1.00 0.00  ? 144 TYR A CE1  3  
ATOM   7394  C  CE2  . TYR A 1 144 ? 4.882   8.609  10.549  1.00 0.00  ? 144 TYR A CE2  3  
ATOM   7395  C  CZ   . TYR A 1 144 ? 5.227   8.454  11.896  1.00 0.00  ? 144 TYR A CZ   3  
ATOM   7396  O  OH   . TYR A 1 144 ? 5.095   7.220  12.502  1.00 0.00  ? 144 TYR A OH   3  
ATOM   7397  H  H    . TYR A 1 144 ? 6.421   14.720 9.385   1.00 0.00  ? 144 TYR A H    3  
ATOM   7398  H  HA   . TYR A 1 144 ? 7.175   12.929 11.375  1.00 0.00  ? 144 TYR A HA   3  
ATOM   7399  H  HB2  . TYR A 1 144 ? 4.906   12.974 10.356  1.00 0.00  ? 144 TYR A HB2  3  
ATOM   7400  H  HB3  . TYR A 1 144 ? 5.557   12.182 8.923   1.00 0.00  ? 144 TYR A HB3  3  
ATOM   7401  H  HD1  . TYR A 1 144 ? 6.217   11.640 12.579  1.00 0.00  ? 144 TYR A HD1  3  
ATOM   7402  H  HD2  . TYR A 1 144 ? 4.753   9.977  8.889   1.00 0.00  ? 144 TYR A HD2  3  
ATOM   7403  H  HE1  . TYR A 1 144 ? 5.972   9.426  13.666  1.00 0.00  ? 144 TYR A HE1  3  
ATOM   7404  H  HE2  . TYR A 1 144 ? 4.510   7.765  9.988   1.00 0.00  ? 144 TYR A HE2  3  
ATOM   7405  H  HH   . TYR A 1 144 ? 4.386   7.279  13.144  1.00 0.00  ? 144 TYR A HH   3  
ATOM   7406  N  N    . THR A 1 145 ? 8.404   10.877 10.429  1.00 0.00  ? 145 THR A N    3  
ATOM   7407  C  CA   . THR A 1 145 ? 9.421   9.899  9.959   1.00 0.00  ? 145 THR A CA   3  
ATOM   7408  C  C    . THR A 1 145 ? 9.082   8.517  10.524  1.00 0.00  ? 145 THR A C    3  
ATOM   7409  O  O    . THR A 1 145 ? 8.964   8.344  11.721  1.00 0.00  ? 145 THR A O    3  
ATOM   7410  C  CB   . THR A 1 145 ? 10.798  10.313 10.462  1.00 0.00  ? 145 THR A CB   3  
ATOM   7411  O  OG1  . THR A 1 145 ? 11.707  9.236  10.282  1.00 0.00  ? 145 THR A OG1  3  
ATOM   7412  C  CG2  . THR A 1 145 ? 10.705  10.657 11.943  1.00 0.00  ? 145 THR A CG2  3  
ATOM   7413  H  H    . THR A 1 145 ? 7.943   10.725 11.273  1.00 0.00  ? 145 THR A H    3  
ATOM   7414  H  HA   . THR A 1 145 ? 9.423   9.865  8.886   1.00 0.00  ? 145 THR A HA   3  
ATOM   7415  H  HB   . THR A 1 145 ? 11.143  11.178 9.916   1.00 0.00  ? 145 THR A HB   3  
ATOM   7416  H  HG1  . THR A 1 145 ? 12.189  9.382  9.463   1.00 0.00  ? 145 THR A HG1  3  
ATOM   7417  H  HG21 . THR A 1 145 ? 11.475  11.369 12.195  1.00 0.00  ? 145 THR A HG21 3  
ATOM   7418  H  HG22 . THR A 1 145 ? 10.836  9.758  12.528  1.00 0.00  ? 145 THR A HG22 3  
ATOM   7419  H  HG23 . THR A 1 145 ? 9.735   11.083 12.149  1.00 0.00  ? 145 THR A HG23 3  
ATOM   7420  N  N    . LYS A 1 146 ? 8.925   7.526  9.686   1.00 0.00  ? 146 LYS A N    3  
ATOM   7421  C  CA   . LYS A 1 146 ? 8.598   6.171  10.214  1.00 0.00  ? 146 LYS A CA   3  
ATOM   7422  C  C    . LYS A 1 146 ? 9.561   5.847  11.349  1.00 0.00  ? 146 LYS A C    3  
ATOM   7423  O  O    . LYS A 1 146 ? 10.764  5.857  11.176  1.00 0.00  ? 146 LYS A O    3  
ATOM   7424  C  CB   . LYS A 1 146 ? 8.743   5.120  9.116   1.00 0.00  ? 146 LYS A CB   3  
ATOM   7425  C  CG   . LYS A 1 146 ? 8.494   3.729  9.712   1.00 0.00  ? 146 LYS A CG   3  
ATOM   7426  C  CD   . LYS A 1 146 ? 7.160   3.176  9.196   1.00 0.00  ? 146 LYS A CD   3  
ATOM   7427  C  CE   . LYS A 1 146 ? 6.126   3.182  10.327  1.00 0.00  ? 146 LYS A CE   3  
ATOM   7428  N  NZ   . LYS A 1 146 ? 5.596   1.800  10.537  1.00 0.00  ? 146 LYS A NZ   3  
ATOM   7429  H  H    . LYS A 1 146 ? 9.023   7.672  8.722   1.00 0.00  ? 146 LYS A H    3  
ATOM   7430  H  HA   . LYS A 1 146 ? 7.585   6.164  10.591  1.00 0.00  ? 146 LYS A HA   3  
ATOM   7431  H  HB2  . LYS A 1 146 ? 8.023   5.313  8.337   1.00 0.00  ? 146 LYS A HB2  3  
ATOM   7432  H  HB3  . LYS A 1 146 ? 9.741   5.161  8.705   1.00 0.00  ? 146 LYS A HB3  3  
ATOM   7433  H  HG2  . LYS A 1 146 ? 9.297   3.064  9.421   1.00 0.00  ? 146 LYS A HG2  3  
ATOM   7434  H  HG3  . LYS A 1 146 ? 8.460   3.797  10.790  1.00 0.00  ? 146 LYS A HG3  3  
ATOM   7435  H  HD2  . LYS A 1 146 ? 6.809   3.793  8.382   1.00 0.00  ? 146 LYS A HD2  3  
ATOM   7436  H  HD3  . LYS A 1 146 ? 7.303   2.165  8.847   1.00 0.00  ? 146 LYS A HD3  3  
ATOM   7437  H  HE2  . LYS A 1 146 ? 6.595   3.527  11.236  1.00 0.00  ? 146 LYS A HE2  3  
ATOM   7438  H  HE3  . LYS A 1 146 ? 5.314   3.845  10.068  1.00 0.00  ? 146 LYS A HE3  3  
ATOM   7439  H  HZ1  . LYS A 1 146 ? 6.205   1.114  10.045  1.00 0.00  ? 146 LYS A HZ1  3  
ATOM   7440  H  HZ2  . LYS A 1 146 ? 4.627   1.738  10.162  1.00 0.00  ? 146 LYS A HZ2  3  
ATOM   7441  H  HZ3  . LYS A 1 146 ? 5.586   1.584  11.552  1.00 0.00  ? 146 LYS A HZ3  3  
ATOM   7442  N  N    . ASN A 1 147 ? 9.048   5.567  12.513  1.00 0.00  ? 147 ASN A N    3  
ATOM   7443  C  CA   . ASN A 1 147 ? 9.943   5.256  13.654  1.00 0.00  ? 147 ASN A CA   3  
ATOM   7444  C  C    . ASN A 1 147 ? 10.865  6.455  13.891  1.00 0.00  ? 147 ASN A C    3  
ATOM   7445  O  O    . ASN A 1 147 ? 10.500  7.399  14.564  1.00 0.00  ? 147 ASN A O    3  
ATOM   7446  C  CB   . ASN A 1 147 ? 10.773  4.012  13.335  1.00 0.00  ? 147 ASN A CB   3  
ATOM   7447  C  CG   . ASN A 1 147 ? 10.112  2.784  13.967  1.00 0.00  ? 147 ASN A CG   3  
ATOM   7448  O  OD1  . ASN A 1 147 ? 9.814   2.780  15.145  1.00 0.00  ? 147 ASN A OD1  3  
ATOM   7449  N  ND2  . ASN A 1 147 ? 9.865   1.735  13.231  1.00 0.00  ? 147 ASN A ND2  3  
ATOM   7450  H  H    . ASN A 1 147 ? 8.077   5.570  12.638  1.00 0.00  ? 147 ASN A H    3  
ATOM   7451  H  HA   . ASN A 1 147 ? 9.348   5.075  14.536  1.00 0.00  ? 147 ASN A HA   3  
ATOM   7452  H  HB2  . ASN A 1 147 ? 10.831  3.881  12.263  1.00 0.00  ? 147 ASN A HB2  3  
ATOM   7453  H  HB3  . ASN A 1 147 ? 11.766  4.128  13.739  1.00 0.00  ? 147 ASN A HB3  3  
ATOM   7454  H  HD21 . ASN A 1 147 ? 10.103  1.736  12.280  1.00 0.00  ? 147 ASN A HD21 3  
ATOM   7455  H  HD22 . ASN A 1 147 ? 9.440   0.947  13.628  1.00 0.00  ? 147 ASN A HD22 3  
ATOM   7456  N  N    . PHE A 1 148 ? 12.053  6.436  13.341  1.00 0.00  ? 148 PHE A N    3  
ATOM   7457  C  CA   . PHE A 1 148 ? 12.978  7.585  13.547  1.00 0.00  ? 148 PHE A CA   3  
ATOM   7458  C  C    . PHE A 1 148 ? 14.323  7.299  12.851  1.00 0.00  ? 148 PHE A C    3  
ATOM   7459  O  O    . PHE A 1 148 ? 14.796  6.180  12.838  1.00 0.00  ? 148 PHE A O    3  
ATOM   7460  C  CB   . PHE A 1 148 ? 13.178  7.791  15.061  1.00 0.00  ? 148 PHE A CB   3  
ATOM   7461  C  CG   . PHE A 1 148 ? 14.338  6.964  15.567  1.00 0.00  ? 148 PHE A CG   3  
ATOM   7462  C  CD1  . PHE A 1 148 ? 15.648  7.411  15.366  1.00 0.00  ? 148 PHE A CD1  3  
ATOM   7463  C  CD2  . PHE A 1 148 ? 14.103  5.760  16.242  1.00 0.00  ? 148 PHE A CD2  3  
ATOM   7464  C  CE1  . PHE A 1 148 ? 16.727  6.657  15.839  1.00 0.00  ? 148 PHE A CE1  3  
ATOM   7465  C  CE2  . PHE A 1 148 ? 15.180  5.006  16.715  1.00 0.00  ? 148 PHE A CE2  3  
ATOM   7466  C  CZ   . PHE A 1 148 ? 16.491  5.451  16.516  1.00 0.00  ? 148 PHE A CZ   3  
ATOM   7467  H  H    . PHE A 1 148 ? 12.333  5.672  12.797  1.00 0.00  ? 148 PHE A H    3  
ATOM   7468  H  HA   . PHE A 1 148 ? 12.539  8.475  13.121  1.00 0.00  ? 148 PHE A HA   3  
ATOM   7469  H  HB2  . PHE A 1 148 ? 13.372  8.835  15.259  1.00 0.00  ? 148 PHE A HB2  3  
ATOM   7470  H  HB3  . PHE A 1 148 ? 12.281  7.493  15.584  1.00 0.00  ? 148 PHE A HB3  3  
ATOM   7471  H  HD1  . PHE A 1 148 ? 15.827  8.339  14.847  1.00 0.00  ? 148 PHE A HD1  3  
ATOM   7472  H  HD2  . PHE A 1 148 ? 13.090  5.411  16.396  1.00 0.00  ? 148 PHE A HD2  3  
ATOM   7473  H  HE1  . PHE A 1 148 ? 17.738  7.009  15.684  1.00 0.00  ? 148 PHE A HE1  3  
ATOM   7474  H  HE2  . PHE A 1 148 ? 15.001  4.082  17.237  1.00 0.00  ? 148 PHE A HE2  3  
ATOM   7475  H  HZ   . PHE A 1 148 ? 17.319  4.866  16.886  1.00 0.00  ? 148 PHE A HZ   3  
ATOM   7476  N  N    . ARG A 1 149 ? 14.942  8.297  12.273  1.00 0.00  ? 149 ARG A N    3  
ATOM   7477  C  CA   . ARG A 1 149 ? 16.250  8.066  11.589  1.00 0.00  ? 149 ARG A CA   3  
ATOM   7478  C  C    . ARG A 1 149 ? 17.369  8.682  12.418  1.00 0.00  ? 149 ARG A C    3  
ATOM   7479  O  O    . ARG A 1 149 ? 18.536  8.474  12.163  1.00 0.00  ? 149 ARG A O    3  
ATOM   7480  C  CB   . ARG A 1 149 ? 16.239  8.728  10.213  1.00 0.00  ? 149 ARG A CB   3  
ATOM   7481  C  CG   . ARG A 1 149 ? 17.275  8.041  9.314   1.00 0.00  ? 149 ARG A CG   3  
ATOM   7482  C  CD   . ARG A 1 149 ? 17.721  9.003  8.210   1.00 0.00  ? 149 ARG A CD   3  
ATOM   7483  N  NE   . ARG A 1 149 ? 16.567  9.308  7.313   1.00 0.00  ? 149 ARG A NE   3  
ATOM   7484  C  CZ   . ARG A 1 149 ? 16.724  10.100 6.284   1.00 0.00  ? 149 ARG A CZ   3  
ATOM   7485  N  NH1  . ARG A 1 149 ? 17.898  10.604 6.015   1.00 0.00  ? 149 ARG A NH1  3  
ATOM   7486  N  NH2  . ARG A 1 149 ? 15.707  10.381 5.514   1.00 0.00  ? 149 ARG A NH2  3  
ATOM   7487  H  H    . ARG A 1 149 ? 14.550  9.195  12.289  1.00 0.00  ? 149 ARG A H    3  
ATOM   7488  H  HA   . ARG A 1 149 ? 16.420  7.007  11.481  1.00 0.00  ? 149 ARG A HA   3  
ATOM   7489  H  HB2  . ARG A 1 149 ? 15.255  8.637  9.778   1.00 0.00  ? 149 ARG A HB2  3  
ATOM   7490  H  HB3  . ARG A 1 149 ? 16.494  9.773  10.318  1.00 0.00  ? 149 ARG A HB3  3  
ATOM   7491  H  HG2  . ARG A 1 149 ? 18.131  7.756  9.910   1.00 0.00  ? 149 ARG A HG2  3  
ATOM   7492  H  HG3  . ARG A 1 149 ? 16.839  7.162  8.870   1.00 0.00  ? 149 ARG A HG3  3  
ATOM   7493  H  HD2  . ARG A 1 149 ? 18.081  9.918  8.658   1.00 0.00  ? 149 ARG A HD2  3  
ATOM   7494  H  HD3  . ARG A 1 149 ? 18.517  8.549  7.634   1.00 0.00  ? 149 ARG A HD3  3  
ATOM   7495  H  HE   . ARG A 1 149 ? 15.685  8.923  7.503   1.00 0.00  ? 149 ARG A HE   3  
ATOM   7496  H  HH11 . ARG A 1 149 ? 18.684  10.386 6.595   1.00 0.00  ? 149 ARG A HH11 3  
ATOM   7497  H  HH12 . ARG A 1 149 ? 18.011  11.211 5.228   1.00 0.00  ? 149 ARG A HH12 3  
ATOM   7498  H  HH21 . ARG A 1 149 ? 14.807  9.991  5.708   1.00 0.00  ? 149 ARG A HH21 3  
ATOM   7499  H  HH22 . ARG A 1 149 ? 15.829  10.990 4.730   1.00 0.00  ? 149 ARG A HH22 3  
ATOM   7500  N  N    . LEU A 1 150 ? 17.019  9.454  13.398  1.00 0.00  ? 150 LEU A N    3  
ATOM   7501  C  CA   . LEU A 1 150 ? 18.054  10.103 14.239  1.00 0.00  ? 150 LEU A CA   3  
ATOM   7502  C  C    . LEU A 1 150 ? 18.817  11.114 13.374  1.00 0.00  ? 150 LEU A C    3  
ATOM   7503  O  O    . LEU A 1 150 ? 19.116  10.852 12.225  1.00 0.00  ? 150 LEU A O    3  
ATOM   7504  C  CB   . LEU A 1 150 ? 19.028  9.056  14.780  1.00 0.00  ? 150 LEU A CB   3  
ATOM   7505  C  CG   . LEU A 1 150 ? 18.849  8.944  16.297  1.00 0.00  ? 150 LEU A CG   3  
ATOM   7506  C  CD1  . LEU A 1 150 ? 19.647  7.751  16.829  1.00 0.00  ? 150 LEU A CD1  3  
ATOM   7507  C  CD2  . LEU A 1 150 ? 19.342  10.225 16.974  1.00 0.00  ? 150 LEU A CD2  3  
ATOM   7508  H  H    . LEU A 1 150 ? 16.072  9.620  13.570  1.00 0.00  ? 150 LEU A H    3  
ATOM   7509  H  HA   . LEU A 1 150 ? 17.574  10.602 15.066  1.00 0.00  ? 150 LEU A HA   3  
ATOM   7510  H  HB2  . LEU A 1 150 ? 18.826  8.103  14.319  1.00 0.00  ? 150 LEU A HB2  3  
ATOM   7511  H  HB3  . LEU A 1 150 ? 20.041  9.357  14.560  1.00 0.00  ? 150 LEU A HB3  3  
ATOM   7512  H  HG   . LEU A 1 150 ? 17.801  8.803  16.520  1.00 0.00  ? 150 LEU A HG   3  
ATOM   7513  H  HD11 . LEU A 1 150 ? 20.550  8.103  17.305  1.00 0.00  ? 150 LEU A HD11 3  
ATOM   7514  H  HD12 . LEU A 1 150 ? 19.904  7.098  16.009  1.00 0.00  ? 150 LEU A HD12 3  
ATOM   7515  H  HD13 . LEU A 1 150 ? 19.048  7.209  17.548  1.00 0.00  ? 150 LEU A HD13 3  
ATOM   7516  H  HD21 . LEU A 1 150 ? 18.769  11.069 16.616  1.00 0.00  ? 150 LEU A HD21 3  
ATOM   7517  H  HD22 . LEU A 1 150 ? 20.388  10.375 16.747  1.00 0.00  ? 150 LEU A HD22 3  
ATOM   7518  H  HD23 . LEU A 1 150 ? 19.217  10.135 18.041  1.00 0.00  ? 150 LEU A HD23 3  
ATOM   7519  N  N    . SER A 1 151 ? 19.130  12.263 13.903  1.00 0.00  ? 151 SER A N    3  
ATOM   7520  C  CA   . SER A 1 151 ? 19.865  13.274 13.090  1.00 0.00  ? 151 SER A CA   3  
ATOM   7521  C  C    . SER A 1 151 ? 21.276  13.448 13.641  1.00 0.00  ? 151 SER A C    3  
ATOM   7522  O  O    . SER A 1 151 ? 21.460  13.781 14.793  1.00 0.00  ? 151 SER A O    3  
ATOM   7523  C  CB   . SER A 1 151 ? 19.140  14.610 13.155  1.00 0.00  ? 151 SER A CB   3  
ATOM   7524  O  OG   . SER A 1 151 ? 17.995  14.483 13.985  1.00 0.00  ? 151 SER A OG   3  
ATOM   7525  H  H    . SER A 1 151 ? 18.880  12.463 14.829  1.00 0.00  ? 151 SER A H    3  
ATOM   7526  H  HA   . SER A 1 151 ? 19.918  12.942 12.063  1.00 0.00  ? 151 SER A HA   3  
ATOM   7527  H  HB2  . SER A 1 151 ? 19.799  15.352 13.567  1.00 0.00  ? 151 SER A HB2  3  
ATOM   7528  H  HB3  . SER A 1 151 ? 18.845  14.905 12.157  1.00 0.00  ? 151 SER A HB3  3  
ATOM   7529  H  HG   . SER A 1 151 ? 17.222  14.700 13.461  1.00 0.00  ? 151 SER A HG   3  
ATOM   7530  N  N    . GLN A 1 152 ? 22.265  13.234 12.816  1.00 0.00  ? 152 GLN A N    3  
ATOM   7531  C  CA   . GLN A 1 152 ? 23.686  13.377 13.267  1.00 0.00  ? 152 GLN A CA   3  
ATOM   7532  C  C    . GLN A 1 152 ? 23.875  14.714 13.976  1.00 0.00  ? 152 GLN A C    3  
ATOM   7533  O  O    . GLN A 1 152 ? 24.359  14.771 15.083  1.00 0.00  ? 152 GLN A O    3  
ATOM   7534  C  CB   . GLN A 1 152 ? 24.607  13.327 12.048  1.00 0.00  ? 152 GLN A CB   3  
ATOM   7535  C  CG   . GLN A 1 152 ? 26.005  12.890 12.480  1.00 0.00  ? 152 GLN A CG   3  
ATOM   7536  C  CD   . GLN A 1 152 ? 27.023  13.303 11.416  1.00 0.00  ? 152 GLN A CD   3  
ATOM   7537  O  OE1  . GLN A 1 152 ? 27.071  12.727 10.347  1.00 0.00  ? 152 GLN A OE1  3  
ATOM   7538  N  NE2  . GLN A 1 152 ? 27.844  14.287 11.666  1.00 0.00  ? 152 GLN A NE2  3  
ATOM   7539  H  H    . GLN A 1 152 ? 22.071  12.982 11.890  1.00 0.00  ? 152 GLN A H    3  
ATOM   7540  H  HA   . GLN A 1 152 ? 23.935  12.572 13.950  1.00 0.00  ? 152 GLN A HA   3  
ATOM   7541  H  HB2  . GLN A 1 152 ? 24.216  12.627 11.326  1.00 0.00  ? 152 GLN A HB2  3  
ATOM   7542  H  HB3  . GLN A 1 152 ? 24.662  14.309 11.604  1.00 0.00  ? 152 GLN A HB3  3  
ATOM   7543  H  HG2  . GLN A 1 152 ? 26.255  13.358 13.422  1.00 0.00  ? 152 GLN A HG2  3  
ATOM   7544  H  HG3  . GLN A 1 152 ? 26.023  11.816 12.594  1.00 0.00  ? 152 GLN A HG3  3  
ATOM   7545  H  HE21 . GLN A 1 152 ? 27.800  14.753 12.527  1.00 0.00  ? 152 GLN A HE21 3  
ATOM   7546  H  HE22 . GLN A 1 152 ? 28.506  14.557 10.995  1.00 0.00  ? 152 GLN A HE22 3  
ATOM   7547  N  N    . ASP A 1 153 ? 23.498  15.789 13.348  1.00 0.00  ? 153 ASP A N    3  
ATOM   7548  C  CA   . ASP A 1 153 ? 23.650  17.122 13.999  1.00 0.00  ? 153 ASP A CA   3  
ATOM   7549  C  C    . ASP A 1 153 ? 23.227  16.997 15.468  1.00 0.00  ? 153 ASP A C    3  
ATOM   7550  O  O    . ASP A 1 153 ? 23.719  17.696 16.333  1.00 0.00  ? 153 ASP A O    3  
ATOM   7551  C  CB   . ASP A 1 153 ? 22.749  18.135 13.293  1.00 0.00  ? 153 ASP A CB   3  
ATOM   7552  C  CG   . ASP A 1 153 ? 23.583  19.003 12.347  1.00 0.00  ? 153 ASP A CG   3  
ATOM   7553  O  OD1  . ASP A 1 153 ? 24.476  19.686 12.826  1.00 0.00  ? 153 ASP A OD1  3  
ATOM   7554  O  OD2  . ASP A 1 153 ? 23.315  18.966 11.158  1.00 0.00  ? 153 ASP A OD2  3  
ATOM   7555  H  H    . ASP A 1 153 ? 23.113  15.718 12.451  1.00 0.00  ? 153 ASP A H    3  
ATOM   7556  H  HA   . ASP A 1 153 ? 24.681  17.442 13.938  1.00 0.00  ? 153 ASP A HA   3  
ATOM   7557  H  HB2  . ASP A 1 153 ? 21.999  17.606 12.723  1.00 0.00  ? 153 ASP A HB2  3  
ATOM   7558  H  HB3  . ASP A 1 153 ? 22.267  18.764 14.028  1.00 0.00  ? 153 ASP A HB3  3  
ATOM   7559  N  N    . ASP A 1 154 ? 22.326  16.087 15.745  1.00 0.00  ? 154 ASP A N    3  
ATOM   7560  C  CA   . ASP A 1 154 ? 21.860  15.868 17.147  1.00 0.00  ? 154 ASP A CA   3  
ATOM   7561  C  C    . ASP A 1 154 ? 22.744  14.803 17.809  1.00 0.00  ? 154 ASP A C    3  
ATOM   7562  O  O    . ASP A 1 154 ? 22.959  14.813 19.005  1.00 0.00  ? 154 ASP A O    3  
ATOM   7563  C  CB   . ASP A 1 154 ? 20.410  15.370 17.127  1.00 0.00  ? 154 ASP A CB   3  
ATOM   7564  C  CG   . ASP A 1 154 ? 19.592  16.179 16.117  1.00 0.00  ? 154 ASP A CG   3  
ATOM   7565  O  OD1  . ASP A 1 154 ? 20.137  17.110 15.551  1.00 0.00  ? 154 ASP A OD1  3  
ATOM   7566  O  OD2  . ASP A 1 154 ? 18.432  15.850 15.928  1.00 0.00  ? 154 ASP A OD2  3  
ATOM   7567  H  H    . ASP A 1 154 ? 21.962  15.533 15.027  1.00 0.00  ? 154 ASP A H    3  
ATOM   7568  H  HA   . ASP A 1 154 ? 21.922  16.792 17.702  1.00 0.00  ? 154 ASP A HA   3  
ATOM   7569  H  HB2  . ASP A 1 154 ? 20.395  14.326 16.848  1.00 0.00  ? 154 ASP A HB2  3  
ATOM   7570  H  HB3  . ASP A 1 154 ? 19.978  15.482 18.109  1.00 0.00  ? 154 ASP A HB3  3  
ATOM   7571  N  N    . ILE A 1 155 ? 23.270  13.896 17.026  1.00 0.00  ? 155 ILE A N    3  
ATOM   7572  C  CA   . ILE A 1 155 ? 24.159  12.831 17.577  1.00 0.00  ? 155 ILE A CA   3  
ATOM   7573  C  C    . ILE A 1 155 ? 25.502  13.470 17.926  1.00 0.00  ? 155 ILE A C    3  
ATOM   7574  O  O    . ILE A 1 155 ? 26.183  13.069 18.852  1.00 0.00  ? 155 ILE A O    3  
ATOM   7575  C  CB   . ILE A 1 155 ? 24.347  11.704 16.533  1.00 0.00  ? 155 ILE A CB   3  
ATOM   7576  C  CG1  . ILE A 1 155 ? 25.484  12.041 15.557  1.00 0.00  ? 155 ILE A CG1  3  
ATOM   7577  C  CG2  . ILE A 1 155 ? 23.052  11.473 15.758  1.00 0.00  ? 155 ILE A CG2  3  
ATOM   7578  C  CD1  . ILE A 1 155 ? 26.810  11.530 16.123  1.00 0.00  ? 155 ILE A CD1  3  
ATOM   7579  H  H    . ILE A 1 155 ? 23.094  13.927 16.068  1.00 0.00  ? 155 ILE A H    3  
ATOM   7580  H  HA   . ILE A 1 155 ? 23.718  12.422 18.476  1.00 0.00  ? 155 ILE A HA   3  
ATOM   7581  H  HB   . ILE A 1 155 ? 24.590  10.803 17.035  1.00 0.00  ? 155 ILE A HB   3  
ATOM   7582  H  HG12 . ILE A 1 155 ? 25.296  11.561 14.608  1.00 0.00  ? 155 ILE A HG12 3  
ATOM   7583  H  HG13 . ILE A 1 155 ? 25.541  13.108 15.419  1.00 0.00  ? 155 ILE A HG13 3  
ATOM   7584  H  HG21 . ILE A 1 155 ? 22.301  11.068 16.421  1.00 0.00  ? 155 ILE A HG21 3  
ATOM   7585  H  HG22 . ILE A 1 155 ? 23.234  10.779 14.953  1.00 0.00  ? 155 ILE A HG22 3  
ATOM   7586  H  HG23 . ILE A 1 155 ? 22.708  12.399 15.355  1.00 0.00  ? 155 ILE A HG23 3  
ATOM   7587  H  HD11 . ILE A 1 155 ? 27.607  12.201 15.835  1.00 0.00  ? 155 ILE A HD11 3  
ATOM   7588  H  HD12 . ILE A 1 155 ? 27.010  10.544 15.733  1.00 0.00  ? 155 ILE A HD12 3  
ATOM   7589  H  HD13 . ILE A 1 155 ? 26.747  11.482 17.200  1.00 0.00  ? 155 ILE A HD13 3  
ATOM   7590  N  N    . LYS A 1 156 ? 25.865  14.487 17.197  1.00 0.00  ? 156 LYS A N    3  
ATOM   7591  C  CA   . LYS A 1 156 ? 27.142  15.193 17.468  1.00 0.00  ? 156 LYS A CA   3  
ATOM   7592  C  C    . LYS A 1 156 ? 26.891  16.295 18.497  1.00 0.00  ? 156 LYS A C    3  
ATOM   7593  O  O    . LYS A 1 156 ? 27.657  16.478 19.424  1.00 0.00  ? 156 LYS A O    3  
ATOM   7594  C  CB   . LYS A 1 156 ? 27.655  15.805 16.167  1.00 0.00  ? 156 LYS A CB   3  
ATOM   7595  C  CG   . LYS A 1 156 ? 29.091  16.272 16.361  1.00 0.00  ? 156 LYS A CG   3  
ATOM   7596  C  CD   . LYS A 1 156 ? 29.085  17.645 17.024  1.00 0.00  ? 156 LYS A CD   3  
ATOM   7597  C  CE   . LYS A 1 156 ? 30.245  18.464 16.472  1.00 0.00  ? 156 LYS A CE   3  
ATOM   7598  N  NZ   . LYS A 1 156 ? 29.880  19.906 16.468  1.00 0.00  ? 156 LYS A NZ   3  
ATOM   7599  H  H    . LYS A 1 156 ? 25.280  14.798 16.475  1.00 0.00  ? 156 LYS A H    3  
ATOM   7600  H  HA   . LYS A 1 156 ? 27.869  14.497 17.852  1.00 0.00  ? 156 LYS A HA   3  
ATOM   7601  H  HB2  . LYS A 1 156 ? 27.619  15.065 15.383  1.00 0.00  ? 156 LYS A HB2  3  
ATOM   7602  H  HB3  . LYS A 1 156 ? 27.038  16.648 15.895  1.00 0.00  ? 156 LYS A HB3  3  
ATOM   7603  H  HG2  . LYS A 1 156 ? 29.619  15.568 16.989  1.00 0.00  ? 156 LYS A HG2  3  
ATOM   7604  H  HG3  . LYS A 1 156 ? 29.582  16.339 15.402  1.00 0.00  ? 156 LYS A HG3  3  
ATOM   7605  H  HD2  . LYS A 1 156 ? 28.149  18.145 16.810  1.00 0.00  ? 156 LYS A HD2  3  
ATOM   7606  H  HD3  . LYS A 1 156 ? 29.201  17.529 18.090  1.00 0.00  ? 156 LYS A HD3  3  
ATOM   7607  H  HE2  . LYS A 1 156 ? 31.119  18.315 17.091  1.00 0.00  ? 156 LYS A HE2  3  
ATOM   7608  H  HE3  . LYS A 1 156 ? 30.459  18.145 15.463  1.00 0.00  ? 156 LYS A HE3  3  
ATOM   7609  H  HZ1  . LYS A 1 156 ? 30.064  20.305 15.526  1.00 0.00  ? 156 LYS A HZ1  3  
ATOM   7610  H  HZ2  . LYS A 1 156 ? 30.452  20.406 17.178  1.00 0.00  ? 156 LYS A HZ2  3  
ATOM   7611  H  HZ3  . LYS A 1 156 ? 28.872  20.011 16.696  1.00 0.00  ? 156 LYS A HZ3  3  
ATOM   7612  N  N    . GLY A 1 157 ? 25.816  17.023 18.342  1.00 0.00  ? 157 GLY A N    3  
ATOM   7613  C  CA   . GLY A 1 157 ? 25.492  18.113 19.312  1.00 0.00  ? 157 GLY A CA   3  
ATOM   7614  C  C    . GLY A 1 157 ? 25.222  17.512 20.699  1.00 0.00  ? 157 GLY A C    3  
ATOM   7615  O  O    . GLY A 1 157 ? 25.397  18.161 21.714  1.00 0.00  ? 157 GLY A O    3  
ATOM   7616  H  H    . GLY A 1 157 ? 25.220  16.850 17.587  1.00 0.00  ? 157 GLY A H    3  
ATOM   7617  H  HA2  . GLY A 1 157 ? 26.322  18.798 19.372  1.00 0.00  ? 157 GLY A HA2  3  
ATOM   7618  H  HA3  . GLY A 1 157 ? 24.612  18.641 18.977  1.00 0.00  ? 157 GLY A HA3  3  
ATOM   7619  N  N    . ILE A 1 158 ? 24.804  16.275 20.758  1.00 0.00  ? 158 ILE A N    3  
ATOM   7620  C  CA   . ILE A 1 158 ? 24.534  15.653 22.087  1.00 0.00  ? 158 ILE A CA   3  
ATOM   7621  C  C    . ILE A 1 158 ? 25.834  15.086 22.645  1.00 0.00  ? 158 ILE A C    3  
ATOM   7622  O  O    . ILE A 1 158 ? 26.178  15.312 23.784  1.00 0.00  ? 158 ILE A O    3  
ATOM   7623  C  CB   . ILE A 1 158 ? 23.487  14.537 21.952  1.00 0.00  ? 158 ILE A CB   3  
ATOM   7624  C  CG1  . ILE A 1 158 ? 23.261  13.885 23.321  1.00 0.00  ? 158 ILE A CG1  3  
ATOM   7625  C  CG2  . ILE A 1 158 ? 23.965  13.474 20.957  1.00 0.00  ? 158 ILE A CG2  3  
ATOM   7626  C  CD1  . ILE A 1 158 ? 21.762  13.842 23.616  1.00 0.00  ? 158 ILE A CD1  3  
ATOM   7627  H  H    . ILE A 1 158 ? 24.673  15.762 19.934  1.00 0.00  ? 158 ILE A H    3  
ATOM   7628  H  HA   . ILE A 1 158 ? 24.163  16.409 22.764  1.00 0.00  ? 158 ILE A HA   3  
ATOM   7629  H  HB   . ILE A 1 158 ? 22.557  14.962 21.601  1.00 0.00  ? 158 ILE A HB   3  
ATOM   7630  H  HG12 . ILE A 1 158 ? 23.655  12.879 23.312  1.00 0.00  ? 158 ILE A HG12 3  
ATOM   7631  H  HG13 . ILE A 1 158 ? 23.760  14.462 24.086  1.00 0.00  ? 158 ILE A HG13 3  
ATOM   7632  H  HG21 . ILE A 1 158 ? 24.497  12.699 21.485  1.00 0.00  ? 158 ILE A HG21 3  
ATOM   7633  H  HG22 . ILE A 1 158 ? 24.619  13.930 20.228  1.00 0.00  ? 158 ILE A HG22 3  
ATOM   7634  H  HG23 . ILE A 1 158 ? 23.110  13.041 20.456  1.00 0.00  ? 158 ILE A HG23 3  
ATOM   7635  H  HD11 . ILE A 1 158 ? 21.512  12.894 24.071  1.00 0.00  ? 158 ILE A HD11 3  
ATOM   7636  H  HD12 . ILE A 1 158 ? 21.212  13.955 22.694  1.00 0.00  ? 158 ILE A HD12 3  
ATOM   7637  H  HD13 . ILE A 1 158 ? 21.504  14.645 24.291  1.00 0.00  ? 158 ILE A HD13 3  
ATOM   7638  N  N    . GLN A 1 159 ? 26.570  14.363 21.856  1.00 0.00  ? 159 GLN A N    3  
ATOM   7639  C  CA   . GLN A 1 159 ? 27.846  13.803 22.360  1.00 0.00  ? 159 GLN A CA   3  
ATOM   7640  C  C    . GLN A 1 159 ? 28.685  14.915 22.975  1.00 0.00  ? 159 GLN A C    3  
ATOM   7641  O  O    . GLN A 1 159 ? 29.444  14.692 23.900  1.00 0.00  ? 159 GLN A O    3  
ATOM   7642  C  CB   . GLN A 1 159 ? 28.615  13.177 21.207  1.00 0.00  ? 159 GLN A CB   3  
ATOM   7643  C  CG   . GLN A 1 159 ? 28.201  11.718 21.060  1.00 0.00  ? 159 GLN A CG   3  
ATOM   7644  C  CD   . GLN A 1 159 ? 28.982  11.092 19.909  1.00 0.00  ? 159 GLN A CD   3  
ATOM   7645  O  OE1  . GLN A 1 159 ? 28.473  10.242 19.208  1.00 0.00  ? 159 GLN A OE1  3  
ATOM   7646  N  NE2  . GLN A 1 159 ? 30.203  11.485 19.679  1.00 0.00  ? 159 GLN A NE2  3  
ATOM   7647  H  H    . GLN A 1 159 ? 26.290  14.195 20.931  1.00 0.00  ? 159 GLN A H    3  
ATOM   7648  H  HA   . GLN A 1 159 ? 27.637  13.054 23.109  1.00 0.00  ? 159 GLN A HA   3  
ATOM   7649  H  HB2  . GLN A 1 159 ? 28.396  13.713 20.293  1.00 0.00  ? 159 GLN A HB2  3  
ATOM   7650  H  HB3  . GLN A 1 159 ? 29.672  13.230 21.413  1.00 0.00  ? 159 GLN A HB3  3  
ATOM   7651  H  HG2  . GLN A 1 159 ? 28.419  11.189 21.977  1.00 0.00  ? 159 GLN A HG2  3  
ATOM   7652  H  HG3  . GLN A 1 159 ? 27.143  11.659 20.850  1.00 0.00  ? 159 GLN A HG3  3  
ATOM   7653  H  HE21 . GLN A 1 159 ? 30.612  12.174 20.243  1.00 0.00  ? 159 GLN A HE21 3  
ATOM   7654  H  HE22 . GLN A 1 159 ? 30.710  11.092 18.940  1.00 0.00  ? 159 GLN A HE22 3  
ATOM   7655  N  N    . GLU A 1 160 ? 28.564  16.111 22.473  1.00 0.00  ? 160 GLU A N    3  
ATOM   7656  C  CA   . GLU A 1 160 ? 29.363  17.226 23.035  1.00 0.00  ? 160 GLU A CA   3  
ATOM   7657  C  C    . GLU A 1 160 ? 28.605  17.843 24.213  1.00 0.00  ? 160 GLU A C    3  
ATOM   7658  O  O    . GLU A 1 160 ? 29.198  18.374 25.131  1.00 0.00  ? 160 GLU A O    3  
ATOM   7659  C  CB   . GLU A 1 160 ? 29.603  18.280 21.952  1.00 0.00  ? 160 GLU A CB   3  
ATOM   7660  C  CG   . GLU A 1 160 ? 30.689  17.779 20.994  1.00 0.00  ? 160 GLU A CG   3  
ATOM   7661  C  CD   . GLU A 1 160 ? 32.055  18.311 21.436  1.00 0.00  ? 160 GLU A CD   3  
ATOM   7662  O  OE1  . GLU A 1 160 ? 32.118  19.461 21.839  1.00 0.00  ? 160 GLU A OE1  3  
ATOM   7663  O  OE2  . GLU A 1 160 ? 33.015  17.562 21.357  1.00 0.00  ? 160 GLU A OE2  3  
ATOM   7664  H  H    . GLU A 1 160 ? 27.951  16.273 21.725  1.00 0.00  ? 160 GLU A H    3  
ATOM   7665  H  HA   . GLU A 1 160 ? 30.313  16.845 23.380  1.00 0.00  ? 160 GLU A HA   3  
ATOM   7666  H  HB2  . GLU A 1 160 ? 28.687  18.451 21.404  1.00 0.00  ? 160 GLU A HB2  3  
ATOM   7667  H  HB3  . GLU A 1 160 ? 29.923  19.203 22.409  1.00 0.00  ? 160 GLU A HB3  3  
ATOM   7668  H  HG2  . GLU A 1 160 ? 30.703  16.699 21.003  1.00 0.00  ? 160 GLU A HG2  3  
ATOM   7669  H  HG3  . GLU A 1 160 ? 30.475  18.127 19.995  1.00 0.00  ? 160 GLU A HG3  3  
ATOM   7670  N  N    . LEU A 1 161 ? 27.297  17.776 24.197  1.00 0.00  ? 161 LEU A N    3  
ATOM   7671  C  CA   . LEU A 1 161 ? 26.510  18.361 25.321  1.00 0.00  ? 161 LEU A CA   3  
ATOM   7672  C  C    . LEU A 1 161 ? 26.303  17.313 26.418  1.00 0.00  ? 161 LEU A C    3  
ATOM   7673  O  O    . LEU A 1 161 ? 25.941  17.638 27.529  1.00 0.00  ? 161 LEU A O    3  
ATOM   7674  C  CB   . LEU A 1 161 ? 25.142  18.817 24.810  1.00 0.00  ? 161 LEU A CB   3  
ATOM   7675  C  CG   . LEU A 1 161 ? 24.957  20.310 25.103  1.00 0.00  ? 161 LEU A CG   3  
ATOM   7676  C  CD1  . LEU A 1 161 ? 24.262  20.989 23.922  1.00 0.00  ? 161 LEU A CD1  3  
ATOM   7677  C  CD2  . LEU A 1 161 ? 24.099  20.484 26.360  1.00 0.00  ? 161 LEU A CD2  3  
ATOM   7678  H  H    . LEU A 1 161 ? 26.834  17.344 23.446  1.00 0.00  ? 161 LEU A H    3  
ATOM   7679  H  HA   . LEU A 1 161 ? 27.040  19.208 25.730  1.00 0.00  ? 161 LEU A HA   3  
ATOM   7680  H  HB2  . LEU A 1 161 ? 25.080  18.646 23.744  1.00 0.00  ? 161 LEU A HB2  3  
ATOM   7681  H  HB3  . LEU A 1 161 ? 24.367  18.256 25.311  1.00 0.00  ? 161 LEU A HB3  3  
ATOM   7682  H  HG   . LEU A 1 161 ? 25.921  20.769 25.261  1.00 0.00  ? 161 LEU A HG   3  
ATOM   7683  H  HD11 . LEU A 1 161 ? 23.202  21.062 24.123  1.00 0.00  ? 161 LEU A HD11 3  
ATOM   7684  H  HD12 . LEU A 1 161 ? 24.421  20.407 23.027  1.00 0.00  ? 161 LEU A HD12 3  
ATOM   7685  H  HD13 . LEU A 1 161 ? 24.671  21.979 23.786  1.00 0.00  ? 161 LEU A HD13 3  
ATOM   7686  H  HD21 . LEU A 1 161 ? 24.721  20.374 27.238  1.00 0.00  ? 161 LEU A HD21 3  
ATOM   7687  H  HD22 . LEU A 1 161 ? 23.320  19.736 26.375  1.00 0.00  ? 161 LEU A HD22 3  
ATOM   7688  H  HD23 . LEU A 1 161 ? 23.652  21.467 26.354  1.00 0.00  ? 161 LEU A HD23 3  
ATOM   7689  N  N    . TYR A 1 162 ? 26.515  16.059 26.124  1.00 0.00  ? 162 TYR A N    3  
ATOM   7690  C  CA   . TYR A 1 162 ? 26.308  15.018 27.175  1.00 0.00  ? 162 TYR A CA   3  
ATOM   7691  C  C    . TYR A 1 162 ? 27.562  14.155 27.312  1.00 0.00  ? 162 TYR A C    3  
ATOM   7692  O  O    . TYR A 1 162 ? 28.038  13.903 28.400  1.00 0.00  ? 162 TYR A O    3  
ATOM   7693  C  CB   . TYR A 1 162 ? 25.115  14.141 26.794  1.00 0.00  ? 162 TYR A CB   3  
ATOM   7694  C  CG   . TYR A 1 162 ? 23.887  14.631 27.525  1.00 0.00  ? 162 TYR A CG   3  
ATOM   7695  C  CD1  . TYR A 1 162 ? 23.905  14.752 28.921  1.00 0.00  ? 162 TYR A CD1  3  
ATOM   7696  C  CD2  . TYR A 1 162 ? 22.738  14.980 26.806  1.00 0.00  ? 162 TYR A CD2  3  
ATOM   7697  C  CE1  . TYR A 1 162 ? 22.773  15.222 29.597  1.00 0.00  ? 162 TYR A CE1  3  
ATOM   7698  C  CE2  . TYR A 1 162 ? 21.606  15.446 27.481  1.00 0.00  ? 162 TYR A CE2  3  
ATOM   7699  C  CZ   . TYR A 1 162 ? 21.624  15.568 28.877  1.00 0.00  ? 162 TYR A CZ   3  
ATOM   7700  O  OH   . TYR A 1 162 ? 20.510  16.035 29.539  1.00 0.00  ? 162 TYR A OH   3  
ATOM   7701  H  H    . TYR A 1 162 ? 26.800  15.801 25.222  1.00 0.00  ? 162 TYR A H    3  
ATOM   7702  H  HA   . TYR A 1 162 ? 26.104  15.499 28.120  1.00 0.00  ? 162 TYR A HA   3  
ATOM   7703  H  HB2  . TYR A 1 162 ? 24.951  14.203 25.726  1.00 0.00  ? 162 TYR A HB2  3  
ATOM   7704  H  HB3  . TYR A 1 162 ? 25.315  13.118 27.070  1.00 0.00  ? 162 TYR A HB3  3  
ATOM   7705  H  HD1  . TYR A 1 162 ? 24.791  14.479 29.475  1.00 0.00  ? 162 TYR A HD1  3  
ATOM   7706  H  HD2  . TYR A 1 162 ? 22.722  14.887 25.733  1.00 0.00  ? 162 TYR A HD2  3  
ATOM   7707  H  HE1  . TYR A 1 162 ? 22.787  15.315 30.673  1.00 0.00  ? 162 TYR A HE1  3  
ATOM   7708  H  HE2  . TYR A 1 162 ? 20.719  15.713 26.925  1.00 0.00  ? 162 TYR A HE2  3  
ATOM   7709  H  HH   . TYR A 1 162 ? 19.791  16.095 28.906  1.00 0.00  ? 162 TYR A HH   3  
ATOM   7710  N  N    . GLY A 1 163 ? 28.104  13.700 26.220  1.00 0.00  ? 163 GLY A N    3  
ATOM   7711  C  CA   . GLY A 1 163 ? 29.327  12.854 26.297  1.00 0.00  ? 163 GLY A CA   3  
ATOM   7712  C  C    . GLY A 1 163 ? 29.047  11.493 25.660  1.00 0.00  ? 163 GLY A C    3  
ATOM   7713  O  O    . GLY A 1 163 ? 29.298  10.493 26.313  1.00 0.00  ? 163 GLY A O    3  
ATOM   7714  O  OXT  . GLY A 1 163 ? 28.587  11.473 24.530  1.00 0.00  ? 163 GLY A OXT  3  
ATOM   7715  H  H    . GLY A 1 163 ? 27.707  13.914 25.349  1.00 0.00  ? 163 GLY A H    3  
ATOM   7716  H  HA2  . GLY A 1 163 ? 30.137  13.343 25.770  1.00 0.00  ? 163 GLY A HA2  3  
ATOM   7717  H  HA3  . GLY A 1 163 ? 29.604  12.711 27.331  1.00 0.00  ? 163 GLY A HA3  3  
HETATM 7718  ZN ZN   . ZN  B 2 .   ? 3.105   26.753 29.005  1.00 11.59 ? 165 ZN  A ZN   3  
HETATM 7719  ZN ZN   . ZN  C 2 .   ? 11.712  24.508 19.514  1.00 10.57 ? 166 ZN  A ZN   3  
HETATM 7720  CA CA   . CA  D 3 .   ? -1.084  24.669 19.057  1.00 9.12  ? 167 CA  A CA   3  
HETATM 7721  CA CA   . CA  E 3 .   ? 12.374  21.613 36.657  1.00 8.09  ? 168 CA  A CA   3  
HETATM 7722  C  C38  . I52 F 4 .   ? 12.450  13.342 14.001  1.00 20.00 ? 800 I52 A C38  3  
HETATM 7723  C  C39  . I52 F 4 .   ? 12.811  11.989 14.577  1.00 20.00 ? 800 I52 A C39  3  
HETATM 7724  C  C37  . I52 F 4 .   ? 12.905  13.492 12.557  1.00 20.00 ? 800 I52 A C37  3  
HETATM 7725  C  C35  . I52 F 4 .   ? 12.412  15.751 11.574  1.00 20.00 ? 800 I52 A C35  3  
HETATM 7726  C  C36  . I52 F 4 .   ? 13.441  14.892 12.288  1.00 20.00 ? 800 I52 A C36  3  
HETATM 7727  C  C25  . I52 F 4 .   ? 8.017   28.096 21.728  1.00 20.00 ? 800 I52 A C25  3  
HETATM 7728  C  C24  . I52 F 4 .   ? 7.315   28.715 19.414  1.00 20.00 ? 800 I52 A C24  3  
HETATM 7729  N  N8   . I52 F 4 .   ? 8.987   28.808 15.639  1.00 20.00 ? 800 I52 A N8   3  
HETATM 7730  C  C7   . I52 F 4 .   ? 8.505   27.530 16.182  1.00 20.00 ? 800 I52 A C7   3  
HETATM 7731  C  C9   . I52 F 4 .   ? 10.472  28.939 15.511  1.00 20.00 ? 800 I52 A C9   3  
HETATM 7732  C  C13  . I52 F 4 .   ? 8.397   29.985 16.361  1.00 20.00 ? 800 I52 A C13  3  
HETATM 7733  O  O11  . I52 F 4 .   ? 10.620  30.663 17.296  1.00 20.00 ? 800 I52 A O11  3  
HETATM 7734  C  C12  . I52 F 4 .   ? 9.199   30.537 17.574  1.00 20.00 ? 800 I52 A C12  3  
HETATM 7735  C  C10  . I52 F 4 .   ? 11.217  29.450 16.767  1.00 20.00 ? 800 I52 A C10  3  
HETATM 7736  C  C31  . I52 F 4 .   ? 10.688  16.064 13.429  1.00 20.00 ? 800 I52 A C31  3  
HETATM 7737  C  C23  . I52 F 4 .   ? 8.357   27.973 20.243  1.00 20.00 ? 800 I52 A C23  3  
HETATM 7738  O  O26  . I52 F 4 .   ? 10.961  26.408 20.072  1.00 20.00 ? 800 I52 A O26  3  
HETATM 7739  C  C4   . I52 F 4 .   ? 8.507   26.482 19.836  1.00 20.00 ? 800 I52 A C4   3  
HETATM 7740  C  C6   . I52 F 4 .   ? 9.183   26.916 17.424  1.00 20.00 ? 800 I52 A C6   3  
HETATM 7741  S  S14  . I52 F 4 .   ? 6.960   25.293 17.814  1.00 20.00 ? 800 I52 A S14  3  
HETATM 7742  N  N5   . I52 F 4 .   ? 8.247   26.254 18.376  1.00 20.00 ? 800 I52 A N5   3  
HETATM 7743  C  C3   . I52 F 4 .   ? 9.857   25.942 20.343  1.00 20.00 ? 800 I52 A C3   3  
HETATM 7744  O  O1   . I52 F 4 .   ? 10.951  24.317 21.658  1.00 20.00 ? 800 I52 A O1   3  
HETATM 7745  N  N2   . I52 F 4 .   ? 9.732   24.844 21.169  1.00 20.00 ? 800 I52 A N2   3  
HETATM 7746  O  O21  . I52 F 4 .   ? 6.218   24.803 18.967  1.00 20.00 ? 800 I52 A O21  3  
HETATM 7747  O  O41  . I52 F 4 .   ? 8.530   18.742 15.942  1.00 20.00 ? 800 I52 A O41  3  
HETATM 7748  C  C28  . I52 F 4 .   ? 9.301   19.237 15.128  1.00 20.00 ? 800 I52 A C28  3  
HETATM 7749  N  N27  . I52 F 4 .   ? 9.530   20.594 14.911  1.00 20.00 ? 800 I52 A N27  3  
HETATM 7750  C  C29  . I52 F 4 .   ? 10.097  18.325 14.261  1.00 20.00 ? 800 I52 A C29  3  
HETATM 7751  C  C33  . I52 F 4 .   ? 11.810  18.058 12.484  1.00 20.00 ? 800 I52 A C33  3  
HETATM 7752  C  C34  . I52 F 4 .   ? 11.044  18.901 13.353  1.00 20.00 ? 800 I52 A C34  3  
HETATM 7753  C  C30  . I52 F 4 .   ? 9.921   16.902 14.299  1.00 20.00 ? 800 I52 A C30  3  
HETATM 7754  C  C32  . I52 F 4 .   ? 11.634  16.633 12.513  1.00 20.00 ? 800 I52 A C32  3  
HETATM 7755  C  C16  . I52 F 4 .   ? 7.339   22.586 17.285  1.00 20.00 ? 800 I52 A C16  3  
HETATM 7756  C  C18  . I52 F 4 .   ? 8.938   21.720 15.559  1.00 20.00 ? 800 I52 A C18  3  
HETATM 7757  C  C15  . I52 F 4 .   ? 7.706   23.930 16.954  1.00 20.00 ? 800 I52 A C15  3  
HETATM 7758  O  O22  . I52 F 4 .   ? 6.261   26.046 16.800  1.00 20.00 ? 800 I52 A O22  3  
HETATM 7759  C  C20  . I52 F 4 .   ? 8.678   24.173 15.934  1.00 20.00 ? 800 I52 A C20  3  
HETATM 7760  C  C17  . I52 F 4 .   ? 7.950   21.488 16.593  1.00 20.00 ? 800 I52 A C17  3  
HETATM 7761  C  C19  . I52 F 4 .   ? 9.288   23.075 15.243  1.00 20.00 ? 800 I52 A C19  3  
HETATM 7762  H  H381 . I52 F 4 .   ? 12.966  14.109 14.602  1.00 20.00 ? 800 I52 A H381 3  
HETATM 7763  H  H382 . I52 F 4 .   ? 11.372  13.514 14.088  1.00 20.00 ? 800 I52 A H382 3  
HETATM 7764  H  H391 . I52 F 4 .   ? 13.763  12.046 15.110  1.00 20.00 ? 800 I52 A H391 3  
HETATM 7765  H  H392 . I52 F 4 .   ? 12.927  11.250 13.776  1.00 20.00 ? 800 I52 A H392 3  
HETATM 7766  H  H393 . I52 F 4 .   ? 12.044  11.634 15.274  1.00 20.00 ? 800 I52 A H393 3  
HETATM 7767  H  H371 . I52 F 4 .   ? 13.724  12.766 12.377  1.00 20.00 ? 800 I52 A H371 3  
HETATM 7768  H  H372 . I52 F 4 .   ? 12.085  13.255 11.868  1.00 20.00 ? 800 I52 A H372 3  
HETATM 7769  H  H351 . I52 F 4 .   ? 12.939  16.405 10.860  1.00 20.00 ? 800 I52 A H351 3  
HETATM 7770  H  H352 . I52 F 4 .   ? 11.726  15.128 10.987  1.00 20.00 ? 800 I52 A H352 3  
HETATM 7771  H  H361 . I52 F 4 .   ? 14.330  14.800 11.634  1.00 20.00 ? 800 I52 A H361 3  
HETATM 7772  H  H362 . I52 F 4 .   ? 13.763  15.367 13.222  1.00 20.00 ? 800 I52 A H362 3  
HETATM 7773  H  H251 . I52 F 4 .   ? 8.377   27.239 22.300  1.00 20.00 ? 800 I52 A H251 3  
HETATM 7774  H  H252 . I52 F 4 .   ? 6.929   28.138 21.865  1.00 20.00 ? 800 I52 A H252 3  
HETATM 7775  H  H253 . I52 F 4 .   ? 8.440   29.009 22.162  1.00 20.00 ? 800 I52 A H253 3  
HETATM 7776  H  H241 . I52 F 4 .   ? 6.303   28.547 19.795  1.00 20.00 ? 800 I52 A H241 3  
HETATM 7777  H  H242 . I52 F 4 .   ? 7.331   28.349 18.378  1.00 20.00 ? 800 I52 A H242 3  
HETATM 7778  H  H243 . I52 F 4 .   ? 7.510   29.788 19.382  1.00 20.00 ? 800 I52 A H243 3  
HETATM 7779  H  H71  . I52 F 4 .   ? 8.566   26.789 15.362  1.00 20.00 ? 800 I52 A H71  3  
HETATM 7780  H  H72  . I52 F 4 .   ? 7.436   27.658 16.378  1.00 20.00 ? 800 I52 A H72  3  
HETATM 7781  H  H91  . I52 F 4 .   ? 10.642  29.687 14.721  6.00 20.00 ? 800 I52 A H91  3  
HETATM 7782  H  H92  . I52 F 4 .   ? 10.927  28.010 15.150  6.00 20.00 ? 800 I52 A H92  3  
HETATM 7783  H  H131 . I52 F 4 .   ? 7.388   29.707 16.723  6.00 20.00 ? 800 I52 A H131 3  
HETATM 7784  H  H132 . I52 F 4 .   ? 8.258   30.793 15.632  6.00 20.00 ? 800 I52 A H132 3  
HETATM 7785  H  H121 . I52 F 4 .   ? 8.842   31.554 17.784  7.00 20.00 ? 800 I52 A H121 3  
HETATM 7786  H  H122 . I52 F 4 .   ? 9.050   29.941 18.481  7.00 20.00 ? 800 I52 A H122 3  
HETATM 7787  H  H101 . I52 F 4 .   ? 11.182  28.687 17.566  7.00 20.00 ? 800 I52 A H101 3  
HETATM 7788  H  H102 . I52 F 4 .   ? 12.269  29.650 16.534  7.00 20.00 ? 800 I52 A H102 3  
HETATM 7789  H  H31  . I52 F 4 .   ? 10.549  14.989 13.470  3.00 20.00 ? 800 I52 A H31  3  
HETATM 7790  H  H23  . I52 F 4 .   ? 9.323   28.474 20.091  1.00 20.00 ? 800 I52 A H23  3  
HETATM 7791  H  H4   . I52 F 4 .   ? 7.772   25.910 20.428  1.00 20.00 ? 800 I52 A H4   3  
HETATM 7792  H  H61  . I52 F 4 .   ? 9.878   26.143 17.061  1.00 20.00 ? 800 I52 A H61  3  
HETATM 7793  H  H62  . I52 F 4 .   ? 9.795   27.653 17.959  1.00 20.00 ? 800 I52 A H62  3  
HETATM 7794  H  H1   . I52 F 4 .   ? 10.650  23.579 22.236  1.00 20.00 ? 800 I52 A H1   3  
HETATM 7795  H  H2   . I52 F 4 .   ? 8.818   24.434 21.408  1.00 20.00 ? 800 I52 A H2   3  
HETATM 7796  H  H27  . I52 F 4 .   ? 10.222  20.814 14.180  1.00 20.00 ? 800 I52 A H27  3  
HETATM 7797  H  H33  . I52 F 4 .   ? 12.525  18.511 11.804  3.00 20.00 ? 800 I52 A H33  3  
HETATM 7798  H  H34  . I52 F 4 .   ? 11.188  19.978 13.326  3.00 20.00 ? 800 I52 A H34  3  
HETATM 7799  H  H30  . I52 F 4 .   ? 9.214   16.443 14.979  3.00 20.00 ? 800 I52 A H30  3  
HETATM 7800  H  H16  . I52 F 4 .   ? 6.604   22.382 18.056  2.00 20.00 ? 800 I52 A H16  3  
HETATM 7801  H  H20  . I52 F 4 .   ? 8.974   25.186 15.666  2.00 20.00 ? 800 I52 A H20  3  
HETATM 7802  H  H17  . I52 F 4 .   ? 7.651   20.474 16.858  2.00 20.00 ? 800 I52 A H17  3  
HETATM 7803  H  H19  . I52 F 4 .   ? 10.017  23.313 14.476  2.00 20.00 ? 800 I52 A H19  3  
ATOM   7804  N  N    . MET A 1 1   ? 41.256  23.255 37.562  1.00 0.00  ? 1   MET A N    4  
ATOM   7805  C  CA   . MET A 1 1   ? 41.194  24.050 36.301  1.00 0.00  ? 1   MET A CA   4  
ATOM   7806  C  C    . MET A 1 1   ? 39.758  24.063 35.768  1.00 0.00  ? 1   MET A C    4  
ATOM   7807  O  O    . MET A 1 1   ? 39.169  23.030 35.516  1.00 0.00  ? 1   MET A O    4  
ATOM   7808  C  CB   . MET A 1 1   ? 42.133  23.425 35.263  1.00 0.00  ? 1   MET A CB   4  
ATOM   7809  C  CG   . MET A 1 1   ? 43.483  23.113 35.921  1.00 0.00  ? 1   MET A CG   4  
ATOM   7810  S  SD   . MET A 1 1   ? 43.650  21.324 36.144  1.00 0.00  ? 1   MET A SD   4  
ATOM   7811  C  CE   . MET A 1 1   ? 44.979  21.061 34.943  1.00 0.00  ? 1   MET A CE   4  
ATOM   7812  H  H1   . MET A 1 1   ? 41.594  22.295 37.352  1.00 0.00  ? 1   MET A H1   4  
ATOM   7813  H  H2   . MET A 1 1   ? 40.309  23.206 37.989  1.00 0.00  ? 1   MET A H2   4  
ATOM   7814  H  H3   . MET A 1 1   ? 41.910  23.712 38.226  1.00 0.00  ? 1   MET A H3   4  
ATOM   7815  H  HA   . MET A 1 1   ? 41.506  25.063 36.500  1.00 0.00  ? 1   MET A HA   4  
ATOM   7816  H  HB2  . MET A 1 1   ? 41.696  22.512 34.886  1.00 0.00  ? 1   MET A HB2  4  
ATOM   7817  H  HB3  . MET A 1 1   ? 42.281  24.117 34.450  1.00 0.00  ? 1   MET A HB3  4  
ATOM   7818  H  HG2  . MET A 1 1   ? 44.285  23.474 35.294  1.00 0.00  ? 1   MET A HG2  4  
ATOM   7819  H  HG3  . MET A 1 1   ? 43.535  23.601 36.887  1.00 0.00  ? 1   MET A HG3  4  
ATOM   7820  H  HE1  . MET A 1 1   ? 45.195  21.992 34.438  1.00 0.00  ? 1   MET A HE1  4  
ATOM   7821  H  HE2  . MET A 1 1   ? 44.669  20.325 34.218  1.00 0.00  ? 1   MET A HE2  4  
ATOM   7822  H  HE3  . MET A 1 1   ? 45.863  20.708 35.455  1.00 0.00  ? 1   MET A HE3  4  
ATOM   7823  N  N    . TYR A 1 2   ? 39.192  25.232 35.599  1.00 0.00  ? 2   TYR A N    4  
ATOM   7824  C  CA   . TYR A 1 2   ? 37.793  25.320 35.089  1.00 0.00  ? 2   TYR A CA   4  
ATOM   7825  C  C    . TYR A 1 2   ? 37.801  25.255 33.555  1.00 0.00  ? 2   TYR A C    4  
ATOM   7826  O  O    . TYR A 1 2   ? 38.819  24.994 32.945  1.00 0.00  ? 2   TYR A O    4  
ATOM   7827  C  CB   . TYR A 1 2   ? 37.153  26.627 35.563  1.00 0.00  ? 2   TYR A CB   4  
ATOM   7828  C  CG   . TYR A 1 2   ? 37.832  27.796 34.900  1.00 0.00  ? 2   TYR A CG   4  
ATOM   7829  C  CD1  . TYR A 1 2   ? 37.390  28.238 33.649  1.00 0.00  ? 2   TYR A CD1  4  
ATOM   7830  C  CD2  . TYR A 1 2   ? 38.905  28.438 35.532  1.00 0.00  ? 2   TYR A CD2  4  
ATOM   7831  C  CE1  . TYR A 1 2   ? 38.013  29.328 33.033  1.00 0.00  ? 2   TYR A CE1  4  
ATOM   7832  C  CE2  . TYR A 1 2   ? 39.528  29.527 34.914  1.00 0.00  ? 2   TYR A CE2  4  
ATOM   7833  C  CZ   . TYR A 1 2   ? 39.085  29.969 33.662  1.00 0.00  ? 2   TYR A CZ   4  
ATOM   7834  O  OH   . TYR A 1 2   ? 39.697  31.046 33.057  1.00 0.00  ? 2   TYR A OH   4  
ATOM   7835  H  H    . TYR A 1 2   ? 39.686  26.052 35.811  1.00 0.00  ? 2   TYR A H    4  
ATOM   7836  H  HA   . TYR A 1 2   ? 37.226  24.485 35.477  1.00 0.00  ? 2   TYR A HA   4  
ATOM   7837  H  HB2  . TYR A 1 2   ? 36.103  26.627 35.302  1.00 0.00  ? 2   TYR A HB2  4  
ATOM   7838  H  HB3  . TYR A 1 2   ? 37.257  26.713 36.636  1.00 0.00  ? 2   TYR A HB3  4  
ATOM   7839  H  HD1  . TYR A 1 2   ? 36.562  27.740 33.163  1.00 0.00  ? 2   TYR A HD1  4  
ATOM   7840  H  HD2  . TYR A 1 2   ? 39.248  28.097 36.498  1.00 0.00  ? 2   TYR A HD2  4  
ATOM   7841  H  HE1  . TYR A 1 2   ? 37.671  29.668 32.066  1.00 0.00  ? 2   TYR A HE1  4  
ATOM   7842  H  HE2  . TYR A 1 2   ? 40.357  30.022 35.398  1.00 0.00  ? 2   TYR A HE2  4  
ATOM   7843  H  HH   . TYR A 1 2   ? 40.296  30.711 32.388  1.00 0.00  ? 2   TYR A HH   4  
ATOM   7844  N  N    . ASN A 1 3   ? 36.668  25.457 32.927  1.00 0.00  ? 3   ASN A N    4  
ATOM   7845  C  CA   . ASN A 1 3   ? 36.615  25.362 31.437  1.00 0.00  ? 3   ASN A CA   4  
ATOM   7846  C  C    . ASN A 1 3   ? 37.289  24.041 31.028  1.00 0.00  ? 3   ASN A C    4  
ATOM   7847  O  O    . ASN A 1 3   ? 38.493  23.971 30.883  1.00 0.00  ? 3   ASN A O    4  
ATOM   7848  C  CB   . ASN A 1 3   ? 37.346  26.557 30.798  1.00 0.00  ? 3   ASN A CB   4  
ATOM   7849  C  CG   . ASN A 1 3   ? 36.637  26.965 29.501  1.00 0.00  ? 3   ASN A CG   4  
ATOM   7850  O  OD1  . ASN A 1 3   ? 35.790  27.836 29.508  1.00 0.00  ? 3   ASN A OD1  4  
ATOM   7851  N  ND2  . ASN A 1 3   ? 36.951  26.372 28.381  1.00 0.00  ? 3   ASN A ND2  4  
ATOM   7852  H  H    . ASN A 1 3   ? 35.852  25.644 33.436  1.00 0.00  ? 3   ASN A H    4  
ATOM   7853  H  HA   . ASN A 1 3   ? 35.582  25.354 31.116  1.00 0.00  ? 3   ASN A HA   4  
ATOM   7854  H  HB2  . ASN A 1 3   ? 37.338  27.391 31.485  1.00 0.00  ? 3   ASN A HB2  4  
ATOM   7855  H  HB3  . ASN A 1 3   ? 38.366  26.283 30.577  1.00 0.00  ? 3   ASN A HB3  4  
ATOM   7856  H  HD21 . ASN A 1 3   ? 37.639  25.672 28.372  1.00 0.00  ? 3   ASN A HD21 4  
ATOM   7857  H  HD22 . ASN A 1 3   ? 36.497  26.622 27.550  1.00 0.00  ? 3   ASN A HD22 4  
ATOM   7858  N  N    . PHE A 1 4   ? 36.524  22.980 30.874  1.00 0.00  ? 4   PHE A N    4  
ATOM   7859  C  CA   . PHE A 1 4   ? 37.133  21.657 30.509  1.00 0.00  ? 4   PHE A CA   4  
ATOM   7860  C  C    . PHE A 1 4   ? 37.193  21.503 28.988  1.00 0.00  ? 4   PHE A C    4  
ATOM   7861  O  O    . PHE A 1 4   ? 38.106  20.902 28.458  1.00 0.00  ? 4   PHE A O    4  
ATOM   7862  C  CB   . PHE A 1 4   ? 36.296  20.510 31.096  1.00 0.00  ? 4   PHE A CB   4  
ATOM   7863  C  CG   . PHE A 1 4   ? 36.840  20.112 32.444  1.00 0.00  ? 4   PHE A CG   4  
ATOM   7864  C  CD1  . PHE A 1 4   ? 37.900  19.204 32.531  1.00 0.00  ? 4   PHE A CD1  4  
ATOM   7865  C  CD2  . PHE A 1 4   ? 36.272  20.641 33.605  1.00 0.00  ? 4   PHE A CD2  4  
ATOM   7866  C  CE1  . PHE A 1 4   ? 38.392  18.823 33.783  1.00 0.00  ? 4   PHE A CE1  4  
ATOM   7867  C  CE2  . PHE A 1 4   ? 36.763  20.264 34.859  1.00 0.00  ? 4   PHE A CE2  4  
ATOM   7868  C  CZ   . PHE A 1 4   ? 37.823  19.353 34.949  1.00 0.00  ? 4   PHE A CZ   4  
ATOM   7869  H  H    . PHE A 1 4   ? 35.557  23.051 31.017  1.00 0.00  ? 4   PHE A H    4  
ATOM   7870  H  HA   . PHE A 1 4   ? 38.134  21.607 30.912  1.00 0.00  ? 4   PHE A HA   4  
ATOM   7871  H  HB2  . PHE A 1 4   ? 35.271  20.825 31.209  1.00 0.00  ? 4   PHE A HB2  4  
ATOM   7872  H  HB3  . PHE A 1 4   ? 36.339  19.657 30.433  1.00 0.00  ? 4   PHE A HB3  4  
ATOM   7873  H  HD1  . PHE A 1 4   ? 38.339  18.796 31.631  1.00 0.00  ? 4   PHE A HD1  4  
ATOM   7874  H  HD2  . PHE A 1 4   ? 35.457  21.346 33.533  1.00 0.00  ? 4   PHE A HD2  4  
ATOM   7875  H  HE1  . PHE A 1 4   ? 39.211  18.122 33.851  1.00 0.00  ? 4   PHE A HE1  4  
ATOM   7876  H  HE2  . PHE A 1 4   ? 36.323  20.673 35.758  1.00 0.00  ? 4   PHE A HE2  4  
ATOM   7877  H  HZ   . PHE A 1 4   ? 38.201  19.058 35.917  1.00 0.00  ? 4   PHE A HZ   4  
ATOM   7878  N  N    . PHE A 1 5   ? 36.231  22.039 28.283  1.00 0.00  ? 5   PHE A N    4  
ATOM   7879  C  CA   . PHE A 1 5   ? 36.240  21.923 26.795  1.00 0.00  ? 5   PHE A CA   4  
ATOM   7880  C  C    . PHE A 1 5   ? 34.994  22.607 26.209  1.00 0.00  ? 5   PHE A C    4  
ATOM   7881  O  O    . PHE A 1 5   ? 35.113  23.486 25.379  1.00 0.00  ? 5   PHE A O    4  
ATOM   7882  C  CB   . PHE A 1 5   ? 36.260  20.446 26.385  1.00 0.00  ? 5   PHE A CB   4  
ATOM   7883  C  CG   . PHE A 1 5   ? 37.317  20.218 25.335  1.00 0.00  ? 5   PHE A CG   4  
ATOM   7884  C  CD1  . PHE A 1 5   ? 37.060  20.541 23.999  1.00 0.00  ? 5   PHE A CD1  4  
ATOM   7885  C  CD2  . PHE A 1 5   ? 38.551  19.674 25.701  1.00 0.00  ? 5   PHE A CD2  4  
ATOM   7886  C  CE1  . PHE A 1 5   ? 38.040  20.321 23.026  1.00 0.00  ? 5   PHE A CE1  4  
ATOM   7887  C  CE2  . PHE A 1 5   ? 39.531  19.454 24.730  1.00 0.00  ? 5   PHE A CE2  4  
ATOM   7888  C  CZ   . PHE A 1 5   ? 39.277  19.778 23.392  1.00 0.00  ? 5   PHE A CZ   4  
ATOM   7889  H  H    . PHE A 1 5   ? 35.507  22.522 28.732  1.00 0.00  ? 5   PHE A H    4  
ATOM   7890  H  HA   . PHE A 1 5   ? 37.126  22.412 26.409  1.00 0.00  ? 5   PHE A HA   4  
ATOM   7891  H  HB2  . PHE A 1 5   ? 36.478  19.835 27.248  1.00 0.00  ? 5   PHE A HB2  4  
ATOM   7892  H  HB3  . PHE A 1 5   ? 35.298  20.173 25.980  1.00 0.00  ? 5   PHE A HB3  4  
ATOM   7893  H  HD1  . PHE A 1 5   ? 36.105  20.959 23.718  1.00 0.00  ? 5   PHE A HD1  4  
ATOM   7894  H  HD2  . PHE A 1 5   ? 38.746  19.426 26.734  1.00 0.00  ? 5   PHE A HD2  4  
ATOM   7895  H  HE1  . PHE A 1 5   ? 37.842  20.569 21.993  1.00 0.00  ? 5   PHE A HE1  4  
ATOM   7896  H  HE2  . PHE A 1 5   ? 40.485  19.033 25.013  1.00 0.00  ? 5   PHE A HE2  4  
ATOM   7897  H  HZ   . PHE A 1 5   ? 40.035  19.608 22.641  1.00 0.00  ? 5   PHE A HZ   4  
ATOM   7898  N  N    . PRO A 1 6   ? 33.829  22.192 26.652  1.00 0.00  ? 6   PRO A N    4  
ATOM   7899  C  CA   . PRO A 1 6   ? 32.559  22.771 26.177  1.00 0.00  ? 6   PRO A CA   4  
ATOM   7900  C  C    . PRO A 1 6   ? 32.278  24.100 26.875  1.00 0.00  ? 6   PRO A C    4  
ATOM   7901  O  O    . PRO A 1 6   ? 32.800  24.375 27.938  1.00 0.00  ? 6   PRO A O    4  
ATOM   7902  C  CB   . PRO A 1 6   ? 31.512  21.736 26.576  1.00 0.00  ? 6   PRO A CB   4  
ATOM   7903  C  CG   . PRO A 1 6   ? 32.134  20.903 27.724  1.00 0.00  ? 6   PRO A CG   4  
ATOM   7904  C  CD   . PRO A 1 6   ? 33.659  21.123 27.662  1.00 0.00  ? 6   PRO A CD   4  
ATOM   7905  H  HA   . PRO A 1 6   ? 32.568  22.892 25.107  1.00 0.00  ? 6   PRO A HA   4  
ATOM   7906  H  HB2  . PRO A 1 6   ? 30.619  22.242 26.926  1.00 0.00  ? 6   PRO A HB2  4  
ATOM   7907  H  HB3  . PRO A 1 6   ? 31.274  21.098 25.741  1.00 0.00  ? 6   PRO A HB3  4  
ATOM   7908  H  HG2  . PRO A 1 6   ? 31.746  21.238 28.677  1.00 0.00  ? 6   PRO A HG2  4  
ATOM   7909  H  HG3  . PRO A 1 6   ? 31.911  19.857 27.578  1.00 0.00  ? 6   PRO A HG3  4  
ATOM   7910  H  HD2  . PRO A 1 6   ? 34.029  21.445 28.625  1.00 0.00  ? 6   PRO A HD2  4  
ATOM   7911  H  HD3  . PRO A 1 6   ? 34.156  20.223 27.346  1.00 0.00  ? 6   PRO A HD3  4  
ATOM   7912  N  N    . ARG A 1 7   ? 31.444  24.917 26.288  1.00 0.00  ? 7   ARG A N    4  
ATOM   7913  C  CA   . ARG A 1 7   ? 31.110  26.230 26.914  1.00 0.00  ? 7   ARG A CA   4  
ATOM   7914  C  C    . ARG A 1 7   ? 30.182  26.001 28.106  1.00 0.00  ? 7   ARG A C    4  
ATOM   7915  O  O    . ARG A 1 7   ? 30.577  26.154 29.244  1.00 0.00  ? 7   ARG A O    4  
ATOM   7916  C  CB   . ARG A 1 7   ? 30.422  27.143 25.889  1.00 0.00  ? 7   ARG A CB   4  
ATOM   7917  C  CG   . ARG A 1 7   ? 31.326  28.344 25.587  1.00 0.00  ? 7   ARG A CG   4  
ATOM   7918  C  CD   . ARG A 1 7   ? 30.493  29.630 25.573  1.00 0.00  ? 7   ARG A CD   4  
ATOM   7919  N  NE   . ARG A 1 7   ? 30.353  30.123 24.173  1.00 0.00  ? 7   ARG A NE   4  
ATOM   7920  C  CZ   . ARG A 1 7   ? 29.457  31.033 23.889  1.00 0.00  ? 7   ARG A CZ   4  
ATOM   7921  N  NH1  . ARG A 1 7   ? 28.675  31.498 24.825  1.00 0.00  ? 7   ARG A NH1  4  
ATOM   7922  N  NH2  . ARG A 1 7   ? 29.336  31.476 22.666  1.00 0.00  ? 7   ARG A NH2  4  
ATOM   7923  H  H    . ARG A 1 7   ? 31.031  24.662 25.437  1.00 0.00  ? 7   ARG A H    4  
ATOM   7924  H  HA   . ARG A 1 7   ? 32.018  26.700 27.258  1.00 0.00  ? 7   ARG A HA   4  
ATOM   7925  H  HB2  . ARG A 1 7   ? 30.242  26.591 24.977  1.00 0.00  ? 7   ARG A HB2  4  
ATOM   7926  H  HB3  . ARG A 1 7   ? 29.483  27.494 26.290  1.00 0.00  ? 7   ARG A HB3  4  
ATOM   7927  H  HG2  . ARG A 1 7   ? 32.092  28.417 26.346  1.00 0.00  ? 7   ARG A HG2  4  
ATOM   7928  H  HG3  . ARG A 1 7   ? 31.791  28.210 24.621  1.00 0.00  ? 7   ARG A HG3  4  
ATOM   7929  H  HD2  . ARG A 1 7   ? 29.513  29.428 25.982  1.00 0.00  ? 7   ARG A HD2  4  
ATOM   7930  H  HD3  . ARG A 1 7   ? 30.984  30.386 26.171  1.00 0.00  ? 7   ARG A HD3  4  
ATOM   7931  H  HE   . ARG A 1 7   ? 30.934  29.768 23.468  1.00 0.00  ? 7   ARG A HE   4  
ATOM   7932  H  HH11 . ARG A 1 7   ? 28.756  31.157 25.760  1.00 0.00  ? 7   ARG A HH11 4  
ATOM   7933  H  HH12 . ARG A 1 7   ? 27.999  32.200 24.606  1.00 0.00  ? 7   ARG A HH12 4  
ATOM   7934  H  HH21 . ARG A 1 7   ? 29.930  31.121 21.944  1.00 0.00  ? 7   ARG A HH21 4  
ATOM   7935  H  HH22 . ARG A 1 7   ? 28.646  32.167 22.453  1.00 0.00  ? 7   ARG A HH22 4  
ATOM   7936  N  N    . LYS A 1 8   ? 28.948  25.639 27.868  1.00 0.00  ? 8   LYS A N    4  
ATOM   7937  C  CA   . LYS A 1 8   ? 28.024  25.416 29.014  1.00 0.00  ? 8   LYS A CA   4  
ATOM   7938  C  C    . LYS A 1 8   ? 27.926  23.921 29.320  1.00 0.00  ? 8   LYS A C    4  
ATOM   7939  O  O    . LYS A 1 8   ? 27.904  23.100 28.426  1.00 0.00  ? 8   LYS A O    4  
ATOM   7940  C  CB   . LYS A 1 8   ? 26.632  25.965 28.682  1.00 0.00  ? 8   LYS A CB   4  
ATOM   7941  C  CG   . LYS A 1 8   ? 26.777  27.175 27.747  1.00 0.00  ? 8   LYS A CG   4  
ATOM   7942  C  CD   . LYS A 1 8   ? 25.408  27.816 27.509  1.00 0.00  ? 8   LYS A CD   4  
ATOM   7943  C  CE   . LYS A 1 8   ? 25.569  29.089 26.674  1.00 0.00  ? 8   LYS A CE   4  
ATOM   7944  N  NZ   . LYS A 1 8   ? 26.023  30.210 27.546  1.00 0.00  ? 8   LYS A NZ   4  
ATOM   7945  H  H    . LYS A 1 8   ? 28.633  25.518 26.948  1.00 0.00  ? 8   LYS A H    4  
ATOM   7946  H  HA   . LYS A 1 8   ? 28.412  25.933 29.877  1.00 0.00  ? 8   LYS A HA   4  
ATOM   7947  H  HB2  . LYS A 1 8   ? 26.039  25.192 28.204  1.00 0.00  ? 8   LYS A HB2  4  
ATOM   7948  H  HB3  . LYS A 1 8   ? 26.143  26.273 29.596  1.00 0.00  ? 8   LYS A HB3  4  
ATOM   7949  H  HG2  . LYS A 1 8   ? 27.438  27.900 28.197  1.00 0.00  ? 8   LYS A HG2  4  
ATOM   7950  H  HG3  . LYS A 1 8   ? 27.190  26.851 26.803  1.00 0.00  ? 8   LYS A HG3  4  
ATOM   7951  H  HD2  . LYS A 1 8   ? 24.774  27.119 26.982  1.00 0.00  ? 8   LYS A HD2  4  
ATOM   7952  H  HD3  . LYS A 1 8   ? 24.959  28.066 28.456  1.00 0.00  ? 8   LYS A HD3  4  
ATOM   7953  H  HE2  . LYS A 1 8   ? 26.299  28.921 25.897  1.00 0.00  ? 8   LYS A HE2  4  
ATOM   7954  H  HE3  . LYS A 1 8   ? 24.621  29.344 26.226  1.00 0.00  ? 8   LYS A HE3  4  
ATOM   7955  H  HZ1  . LYS A 1 8   ? 25.419  31.041 27.385  1.00 0.00  ? 8   LYS A HZ1  4  
ATOM   7956  H  HZ2  . LYS A 1 8   ? 27.011  30.450 27.317  1.00 0.00  ? 8   LYS A HZ2  4  
ATOM   7957  H  HZ3  . LYS A 1 8   ? 25.956  29.923 28.544  1.00 0.00  ? 8   LYS A HZ3  4  
ATOM   7958  N  N    . PRO A 1 9   ? 27.859  23.612 30.583  1.00 0.00  ? 9   PRO A N    4  
ATOM   7959  C  CA   . PRO A 1 9   ? 27.747  22.222 31.036  1.00 0.00  ? 9   PRO A CA   4  
ATOM   7960  C  C    . PRO A 1 9   ? 26.317  21.740 30.796  1.00 0.00  ? 9   PRO A C    4  
ATOM   7961  O  O    . PRO A 1 9   ? 25.487  21.765 31.682  1.00 0.00  ? 9   PRO A O    4  
ATOM   7962  C  CB   . PRO A 1 9   ? 28.079  22.308 32.530  1.00 0.00  ? 9   PRO A CB   4  
ATOM   7963  C  CG   . PRO A 1 9   ? 27.820  23.775 32.955  1.00 0.00  ? 9   PRO A CG   4  
ATOM   7964  C  CD   . PRO A 1 9   ? 27.872  24.616 31.669  1.00 0.00  ? 9   PRO A CD   4  
ATOM   7965  H  HA   . PRO A 1 9   ? 28.460  21.593 30.528  1.00 0.00  ? 9   PRO A HA   4  
ATOM   7966  H  HB2  . PRO A 1 9   ? 27.437  21.638 33.087  1.00 0.00  ? 9   PRO A HB2  4  
ATOM   7967  H  HB3  . PRO A 1 9   ? 29.113  22.059 32.695  1.00 0.00  ? 9   PRO A HB3  4  
ATOM   7968  H  HG2  . PRO A 1 9   ? 26.845  23.861 33.417  1.00 0.00  ? 9   PRO A HG2  4  
ATOM   7969  H  HG3  . PRO A 1 9   ? 28.587  24.107 33.636  1.00 0.00  ? 9   PRO A HG3  4  
ATOM   7970  H  HD2  . PRO A 1 9   ? 27.007  25.261 31.605  1.00 0.00  ? 9   PRO A HD2  4  
ATOM   7971  H  HD3  . PRO A 1 9   ? 28.782  25.195 31.629  1.00 0.00  ? 9   PRO A HD3  4  
ATOM   7972  N  N    . LYS A 1 10  ? 26.012  21.323 29.592  1.00 0.00  ? 10  LYS A N    4  
ATOM   7973  C  CA   . LYS A 1 10  ? 24.627  20.875 29.305  1.00 0.00  ? 10  LYS A CA   4  
ATOM   7974  C  C    . LYS A 1 10  ? 24.219  19.839 30.346  1.00 0.00  ? 10  LYS A C    4  
ATOM   7975  O  O    . LYS A 1 10  ? 25.006  19.433 31.178  1.00 0.00  ? 10  LYS A O    4  
ATOM   7976  C  CB   . LYS A 1 10  ? 24.526  20.235 27.914  1.00 0.00  ? 10  LYS A CB   4  
ATOM   7977  C  CG   . LYS A 1 10  ? 25.284  21.064 26.878  1.00 0.00  ? 10  LYS A CG   4  
ATOM   7978  C  CD   . LYS A 1 10  ? 24.797  22.514 26.901  1.00 0.00  ? 10  LYS A CD   4  
ATOM   7979  C  CE   . LYS A 1 10  ? 24.356  22.893 25.487  1.00 0.00  ? 10  LYS A CE   4  
ATOM   7980  N  NZ   . LYS A 1 10  ? 25.517  22.773 24.560  1.00 0.00  ? 10  LYS A NZ   4  
ATOM   7981  H  H    . LYS A 1 10  ? 26.688  21.322 28.883  1.00 0.00  ? 10  LYS A H    4  
ATOM   7982  H  HA   . LYS A 1 10  ? 23.968  21.734 29.360  1.00 0.00  ? 10  LYS A HA   4  
ATOM   7983  H  HB2  . LYS A 1 10  ? 24.946  19.240 27.947  1.00 0.00  ? 10  LYS A HB2  4  
ATOM   7984  H  HB3  . LYS A 1 10  ? 23.486  20.169 27.626  1.00 0.00  ? 10  LYS A HB3  4  
ATOM   7985  H  HG2  . LYS A 1 10  ? 26.340  21.030 27.088  1.00 0.00  ? 10  LYS A HG2  4  
ATOM   7986  H  HG3  . LYS A 1 10  ? 25.103  20.649 25.897  1.00 0.00  ? 10  LYS A HG3  4  
ATOM   7987  H  HD2  . LYS A 1 10  ? 23.963  22.608 27.584  1.00 0.00  ? 10  LYS A HD2  4  
ATOM   7988  H  HD3  . LYS A 1 10  ? 25.600  23.164 27.216  1.00 0.00  ? 10  LYS A HD3  4  
ATOM   7989  H  HE2  . LYS A 1 10  ? 23.577  22.218 25.166  1.00 0.00  ? 10  LYS A HE2  4  
ATOM   7990  H  HE3  . LYS A 1 10  ? 23.985  23.909 25.476  1.00 0.00  ? 10  LYS A HE3  4  
ATOM   7991  H  HZ1  . LYS A 1 10  ? 26.367  23.164 25.015  1.00 0.00  ? 10  LYS A HZ1  4  
ATOM   7992  H  HZ2  . LYS A 1 10  ? 25.316  23.297 23.684  1.00 0.00  ? 10  LYS A HZ2  4  
ATOM   7993  H  HZ3  . LYS A 1 10  ? 25.675  21.772 24.336  1.00 0.00  ? 10  LYS A HZ3  4  
ATOM   7994  N  N    . TRP A 1 11  ? 22.999  19.398 30.302  1.00 0.00  ? 11  TRP A N    4  
ATOM   7995  C  CA   . TRP A 1 11  ? 22.547  18.383 31.288  1.00 0.00  ? 11  TRP A CA   4  
ATOM   7996  C  C    . TRP A 1 11  ? 23.296  17.069 31.059  1.00 0.00  ? 11  TRP A C    4  
ATOM   7997  O  O    . TRP A 1 11  ? 23.532  16.654 29.940  1.00 0.00  ? 11  TRP A O    4  
ATOM   7998  C  CB   . TRP A 1 11  ? 21.047  18.154 31.129  1.00 0.00  ? 11  TRP A CB   4  
ATOM   7999  C  CG   . TRP A 1 11  ? 20.342  18.572 32.379  1.00 0.00  ? 11  TRP A CG   4  
ATOM   8000  C  CD1  . TRP A 1 11  ? 19.592  19.689 32.499  1.00 0.00  ? 11  TRP A CD1  4  
ATOM   8001  C  CD2  . TRP A 1 11  ? 20.307  17.915 33.681  1.00 0.00  ? 11  TRP A CD2  4  
ATOM   8002  N  NE1  . TRP A 1 11  ? 19.079  19.746 33.781  1.00 0.00  ? 11  TRP A NE1  4  
ATOM   8003  C  CE2  . TRP A 1 11  ? 19.493  18.681 34.547  1.00 0.00  ? 11  TRP A CE2  4  
ATOM   8004  C  CE3  . TRP A 1 11  ? 20.886  16.738 34.190  1.00 0.00  ? 11  TRP A CE3  4  
ATOM   8005  C  CZ2  . TRP A 1 11  ? 19.261  18.303 35.867  1.00 0.00  ? 11  TRP A CZ2  4  
ATOM   8006  C  CZ3  . TRP A 1 11  ? 20.658  16.353 35.526  1.00 0.00  ? 11  TRP A CZ3  4  
ATOM   8007  C  CH2  . TRP A 1 11  ? 19.844  17.135 36.360  1.00 0.00  ? 11  TRP A CH2  4  
ATOM   8008  H  H    . TRP A 1 11  ? 22.380  19.732 29.618  1.00 0.00  ? 11  TRP A H    4  
ATOM   8009  H  HA   . TRP A 1 11  ? 22.752  18.740 32.285  1.00 0.00  ? 11  TRP A HA   4  
ATOM   8010  H  HB2  . TRP A 1 11  ? 20.679  18.743 30.299  1.00 0.00  ? 11  TRP A HB2  4  
ATOM   8011  H  HB3  . TRP A 1 11  ? 20.855  17.108 30.939  1.00 0.00  ? 11  TRP A HB3  4  
ATOM   8012  H  HD1  . TRP A 1 11  ? 19.411  20.412 31.718  1.00 0.00  ? 11  TRP A HD1  4  
ATOM   8013  H  HE1  . TRP A 1 11  ? 18.497  20.451 34.124  1.00 0.00  ? 11  TRP A HE1  4  
ATOM   8014  H  HE3  . TRP A 1 11  ? 21.515  16.130 33.556  1.00 0.00  ? 11  TRP A HE3  4  
ATOM   8015  H  HZ2  . TRP A 1 11  ? 18.633  18.909 36.501  1.00 0.00  ? 11  TRP A HZ2  4  
ATOM   8016  H  HZ3  . TRP A 1 11  ? 21.111  15.450 35.910  1.00 0.00  ? 11  TRP A HZ3  4  
ATOM   8017  H  HH2  . TRP A 1 11  ? 19.671  16.837 37.384  1.00 0.00  ? 11  TRP A HH2  4  
ATOM   8018  N  N    . ASP A 1 12  ? 23.668  16.408 32.116  1.00 0.00  ? 12  ASP A N    4  
ATOM   8019  C  CA   . ASP A 1 12  ? 24.392  15.122 31.962  1.00 0.00  ? 12  ASP A CA   4  
ATOM   8020  C  C    . ASP A 1 12  ? 23.485  14.139 31.223  1.00 0.00  ? 12  ASP A C    4  
ATOM   8021  O  O    . ASP A 1 12  ? 22.301  14.372 31.084  1.00 0.00  ? 12  ASP A O    4  
ATOM   8022  C  CB   . ASP A 1 12  ? 24.776  14.574 33.338  1.00 0.00  ? 12  ASP A CB   4  
ATOM   8023  C  CG   . ASP A 1 12  ? 23.557  14.511 34.265  1.00 0.00  ? 12  ASP A CG   4  
ATOM   8024  O  OD1  . ASP A 1 12  ? 22.468  14.258 33.774  1.00 0.00  ? 12  ASP A OD1  4  
ATOM   8025  O  OD2  . ASP A 1 12  ? 23.739  14.710 35.455  1.00 0.00  ? 12  ASP A OD2  4  
ATOM   8026  H  H    . ASP A 1 12  ? 23.466  16.756 33.011  1.00 0.00  ? 12  ASP A H    4  
ATOM   8027  H  HA   . ASP A 1 12  ? 25.287  15.285 31.380  1.00 0.00  ? 12  ASP A HA   4  
ATOM   8028  H  HB2  . ASP A 1 12  ? 25.189  13.584 33.224  1.00 0.00  ? 12  ASP A HB2  4  
ATOM   8029  H  HB3  . ASP A 1 12  ? 25.519  15.223 33.778  1.00 0.00  ? 12  ASP A HB3  4  
ATOM   8030  N  N    . LYS A 1 13  ? 24.023  13.055 30.733  1.00 0.00  ? 13  LYS A N    4  
ATOM   8031  C  CA   . LYS A 1 13  ? 23.174  12.081 29.988  1.00 0.00  ? 13  LYS A CA   4  
ATOM   8032  C  C    . LYS A 1 13  ? 23.190  10.727 30.712  1.00 0.00  ? 13  LYS A C    4  
ATOM   8033  O  O    . LYS A 1 13  ? 23.756  10.586 31.778  1.00 0.00  ? 13  LYS A O    4  
ATOM   8034  C  CB   . LYS A 1 13  ? 23.708  11.903 28.553  1.00 0.00  ? 13  LYS A CB   4  
ATOM   8035  C  CG   . LYS A 1 13  ? 23.854  13.268 27.863  1.00 0.00  ? 13  LYS A CG   4  
ATOM   8036  C  CD   . LYS A 1 13  ? 22.486  13.949 27.762  1.00 0.00  ? 13  LYS A CD   4  
ATOM   8037  C  CE   . LYS A 1 13  ? 22.674  15.460 27.613  1.00 0.00  ? 13  LYS A CE   4  
ATOM   8038  N  NZ   . LYS A 1 13  ? 22.283  15.886 26.234  1.00 0.00  ? 13  LYS A NZ   4  
ATOM   8039  H  H    . LYS A 1 13  ? 24.983  12.887 30.847  1.00 0.00  ? 13  LYS A H    4  
ATOM   8040  H  HA   . LYS A 1 13  ? 22.161  12.448 29.951  1.00 0.00  ? 13  LYS A HA   4  
ATOM   8041  H  HB2  . LYS A 1 13  ? 24.673  11.417 28.587  1.00 0.00  ? 13  LYS A HB2  4  
ATOM   8042  H  HB3  . LYS A 1 13  ? 23.021  11.291 27.986  1.00 0.00  ? 13  LYS A HB3  4  
ATOM   8043  H  HG2  . LYS A 1 13  ? 24.524  13.889 28.436  1.00 0.00  ? 13  LYS A HG2  4  
ATOM   8044  H  HG3  . LYS A 1 13  ? 24.258  13.128 26.871  1.00 0.00  ? 13  LYS A HG3  4  
ATOM   8045  H  HD2  . LYS A 1 13  ? 21.953  13.568 26.908  1.00 0.00  ? 13  LYS A HD2  4  
ATOM   8046  H  HD3  . LYS A 1 13  ? 21.918  13.746 28.653  1.00 0.00  ? 13  LYS A HD3  4  
ATOM   8047  H  HE2  . LYS A 1 13  ? 22.055  15.969 28.336  1.00 0.00  ? 13  LYS A HE2  4  
ATOM   8048  H  HE3  . LYS A 1 13  ? 23.708  15.710 27.786  1.00 0.00  ? 13  LYS A HE3  4  
ATOM   8049  H  HZ1  . LYS A 1 13  ? 22.282  15.063 25.601  1.00 0.00  ? 13  LYS A HZ1  4  
ATOM   8050  H  HZ2  . LYS A 1 13  ? 22.964  16.592 25.883  1.00 0.00  ? 13  LYS A HZ2  4  
ATOM   8051  H  HZ3  . LYS A 1 13  ? 21.332  16.306 26.254  1.00 0.00  ? 13  LYS A HZ3  4  
ATOM   8052  N  N    . ASN A 1 14  ? 22.562  9.735  30.140  1.00 0.00  ? 14  ASN A N    4  
ATOM   8053  C  CA   . ASN A 1 14  ? 22.529  8.388  30.791  1.00 0.00  ? 14  ASN A CA   4  
ATOM   8054  C  C    . ASN A 1 14  ? 21.814  8.500  32.147  1.00 0.00  ? 14  ASN A C    4  
ATOM   8055  O  O    . ASN A 1 14  ? 21.988  9.464  32.864  1.00 0.00  ? 14  ASN A O    4  
ATOM   8056  C  CB   . ASN A 1 14  ? 23.965  7.886  31.012  1.00 0.00  ? 14  ASN A CB   4  
ATOM   8057  C  CG   . ASN A 1 14  ? 24.692  7.783  29.667  1.00 0.00  ? 14  ASN A CG   4  
ATOM   8058  O  OD1  . ASN A 1 14  ? 24.547  8.644  28.820  1.00 0.00  ? 14  ASN A OD1  4  
ATOM   8059  N  ND2  . ASN A 1 14  ? 25.476  6.762  29.432  1.00 0.00  ? 14  ASN A ND2  4  
ATOM   8060  H  H    . ASN A 1 14  ? 22.108  9.876  29.283  1.00 0.00  ? 14  ASN A H    4  
ATOM   8061  H  HA   . ASN A 1 14  ? 21.998  7.697  30.156  1.00 0.00  ? 14  ASN A HA   4  
ATOM   8062  H  HB2  . ASN A 1 14  ? 24.493  8.574  31.656  1.00 0.00  ? 14  ASN A HB2  4  
ATOM   8063  H  HB3  . ASN A 1 14  ? 23.935  6.912  31.477  1.00 0.00  ? 14  ASN A HB3  4  
ATOM   8064  H  HD21 . ASN A 1 14  ? 25.599  6.069  30.114  1.00 0.00  ? 14  ASN A HD21 4  
ATOM   8065  H  HD22 . ASN A 1 14  ? 25.935  6.685  28.568  1.00 0.00  ? 14  ASN A HD22 4  
ATOM   8066  N  N    . GLN A 1 15  ? 21.019  7.525  32.513  1.00 0.00  ? 15  GLN A N    4  
ATOM   8067  C  CA   . GLN A 1 15  ? 20.311  7.592  33.827  1.00 0.00  ? 15  GLN A CA   4  
ATOM   8068  C  C    . GLN A 1 15  ? 19.715  8.992  34.022  1.00 0.00  ? 15  GLN A C    4  
ATOM   8069  O  O    . GLN A 1 15  ? 20.235  9.789  34.777  1.00 0.00  ? 15  GLN A O    4  
ATOM   8070  C  CB   . GLN A 1 15  ? 21.315  7.319  34.945  1.00 0.00  ? 15  GLN A CB   4  
ATOM   8071  C  CG   . GLN A 1 15  ? 21.583  5.821  35.049  1.00 0.00  ? 15  GLN A CG   4  
ATOM   8072  C  CD   . GLN A 1 15  ? 23.074  5.572  34.850  1.00 0.00  ? 15  GLN A CD   4  
ATOM   8073  O  OE1  . GLN A 1 15  ? 23.799  6.453  34.432  1.00 0.00  ? 15  GLN A OE1  4  
ATOM   8074  N  NE2  . GLN A 1 15  ? 23.566  4.405  35.140  1.00 0.00  ? 15  GLN A NE2  4  
ATOM   8075  H  H    . GLN A 1 15  ? 20.891  6.750  31.931  1.00 0.00  ? 15  GLN A H    4  
ATOM   8076  H  HA   . GLN A 1 15  ? 19.523  6.851  33.858  1.00 0.00  ? 15  GLN A HA   4  
ATOM   8077  H  HB2  . GLN A 1 15  ? 22.239  7.830  34.724  1.00 0.00  ? 15  GLN A HB2  4  
ATOM   8078  H  HB3  . GLN A 1 15  ? 20.921  7.677  35.881  1.00 0.00  ? 15  GLN A HB3  4  
ATOM   8079  H  HG2  . GLN A 1 15  ? 21.285  5.467  36.027  1.00 0.00  ? 15  GLN A HG2  4  
ATOM   8080  H  HG3  . GLN A 1 15  ? 21.027  5.296  34.288  1.00 0.00  ? 15  GLN A HG3  4  
ATOM   8081  H  HE21 . GLN A 1 15  ? 22.978  3.697  35.479  1.00 0.00  ? 15  GLN A HE21 4  
ATOM   8082  H  HE22 . GLN A 1 15  ? 24.523  4.235  35.021  1.00 0.00  ? 15  GLN A HE22 4  
ATOM   8083  N  N    . ILE A 1 16  ? 18.625  9.293  33.357  1.00 0.00  ? 16  ILE A N    4  
ATOM   8084  C  CA   . ILE A 1 16  ? 17.996  10.640 33.509  1.00 0.00  ? 16  ILE A CA   4  
ATOM   8085  C  C    . ILE A 1 16  ? 16.666  10.485 34.252  1.00 0.00  ? 16  ILE A C    4  
ATOM   8086  O  O    . ILE A 1 16  ? 15.906  9.572  33.989  1.00 0.00  ? 16  ILE A O    4  
ATOM   8087  C  CB   . ILE A 1 16  ? 17.754  11.246 32.124  1.00 0.00  ? 16  ILE A CB   4  
ATOM   8088  C  CG1  . ILE A 1 16  ? 19.103  11.492 31.449  1.00 0.00  ? 16  ILE A CG1  4  
ATOM   8089  C  CG2  . ILE A 1 16  ? 17.020  12.582 32.260  1.00 0.00  ? 16  ILE A CG2  4  
ATOM   8090  C  CD1  . ILE A 1 16  ? 18.897  12.286 30.163  1.00 0.00  ? 16  ILE A CD1  4  
ATOM   8091  H  H    . ILE A 1 16  ? 18.216  8.632  32.762  1.00 0.00  ? 16  ILE A H    4  
ATOM   8092  H  HA   . ILE A 1 16  ? 18.653  11.286 34.073  1.00 0.00  ? 16  ILE A HA   4  
ATOM   8093  H  HB   . ILE A 1 16  ? 17.166  10.563 31.527  1.00 0.00  ? 16  ILE A HB   4  
ATOM   8094  H  HG12 . ILE A 1 16  ? 19.740  12.052 32.118  1.00 0.00  ? 16  ILE A HG12 4  
ATOM   8095  H  HG13 . ILE A 1 16  ? 19.567  10.546 31.215  1.00 0.00  ? 16  ILE A HG13 4  
ATOM   8096  H  HG21 . ILE A 1 16  ? 17.735  13.363 32.471  1.00 0.00  ? 16  ILE A HG21 4  
ATOM   8097  H  HG22 . ILE A 1 16  ? 16.305  12.522 33.067  1.00 0.00  ? 16  ILE A HG22 4  
ATOM   8098  H  HG23 . ILE A 1 16  ? 16.505  12.805 31.336  1.00 0.00  ? 16  ILE A HG23 4  
ATOM   8099  H  HD11 . ILE A 1 16  ? 18.718  13.323 30.406  1.00 0.00  ? 16  ILE A HD11 4  
ATOM   8100  H  HD12 . ILE A 1 16  ? 18.049  11.889 29.627  1.00 0.00  ? 16  ILE A HD12 4  
ATOM   8101  H  HD13 . ILE A 1 16  ? 19.781  12.208 29.550  1.00 0.00  ? 16  ILE A HD13 4  
ATOM   8102  N  N    . THR A 1 17  ? 16.389  11.354 35.190  1.00 0.00  ? 17  THR A N    4  
ATOM   8103  C  CA   . THR A 1 17  ? 15.114  11.239 35.970  1.00 0.00  ? 17  THR A CA   4  
ATOM   8104  C  C    . THR A 1 17  ? 14.245  12.491 35.808  1.00 0.00  ? 17  THR A C    4  
ATOM   8105  O  O    . THR A 1 17  ? 14.716  13.610 35.878  1.00 0.00  ? 17  THR A O    4  
ATOM   8106  C  CB   . THR A 1 17  ? 15.436  11.080 37.455  1.00 0.00  ? 17  THR A CB   4  
ATOM   8107  O  OG1  . THR A 1 17  ? 16.832  10.897 37.635  1.00 0.00  ? 17  THR A OG1  4  
ATOM   8108  C  CG2  . THR A 1 17  ? 14.688  9.875  38.011  1.00 0.00  ? 17  THR A CG2  4  
ATOM   8109  H  H    . THR A 1 17  ? 17.024  12.069 35.394  1.00 0.00  ? 17  THR A H    4  
ATOM   8110  H  HA   . THR A 1 17  ? 14.563  10.373 35.631  1.00 0.00  ? 17  THR A HA   4  
ATOM   8111  H  HB   . THR A 1 17  ? 15.120  11.965 37.983  1.00 0.00  ? 17  THR A HB   4  
ATOM   8112  H  HG1  . THR A 1 17  ? 17.044  11.137 38.542  1.00 0.00  ? 17  THR A HG1  4  
ATOM   8113  H  HG21 . THR A 1 17  ? 15.287  8.987  37.876  1.00 0.00  ? 17  THR A HG21 4  
ATOM   8114  H  HG22 . THR A 1 17  ? 13.751  9.762  37.487  1.00 0.00  ? 17  THR A HG22 4  
ATOM   8115  H  HG23 . THR A 1 17  ? 14.496  10.024 39.061  1.00 0.00  ? 17  THR A HG23 4  
ATOM   8116  N  N    . TYR A 1 18  ? 12.966  12.307 35.618  1.00 0.00  ? 18  TYR A N    4  
ATOM   8117  C  CA   . TYR A 1 18  ? 12.061  13.481 35.476  1.00 0.00  ? 18  TYR A CA   4  
ATOM   8118  C  C    . TYR A 1 18  ? 10.664  13.142 36.004  1.00 0.00  ? 18  TYR A C    4  
ATOM   8119  O  O    . TYR A 1 18  ? 10.245  12.003 36.002  1.00 0.00  ? 18  TYR A O    4  
ATOM   8120  C  CB   . TYR A 1 18  ? 11.955  13.864 34.003  1.00 0.00  ? 18  TYR A CB   4  
ATOM   8121  C  CG   . TYR A 1 18  ? 11.276  12.758 33.224  1.00 0.00  ? 18  TYR A CG   4  
ATOM   8122  C  CD1  . TYR A 1 18  ? 9.878   12.658 33.226  1.00 0.00  ? 18  TYR A CD1  4  
ATOM   8123  C  CD2  . TYR A 1 18  ? 12.041  11.844 32.487  1.00 0.00  ? 18  TYR A CD2  4  
ATOM   8124  C  CE1  . TYR A 1 18  ? 9.248   11.652 32.487  1.00 0.00  ? 18  TYR A CE1  4  
ATOM   8125  C  CE2  . TYR A 1 18  ? 11.407  10.836 31.752  1.00 0.00  ? 18  TYR A CE2  4  
ATOM   8126  C  CZ   . TYR A 1 18  ? 10.012  10.740 31.754  1.00 0.00  ? 18  TYR A CZ   4  
ATOM   8127  O  OH   . TYR A 1 18  ? 9.388   9.754  31.024  1.00 0.00  ? 18  TYR A OH   4  
ATOM   8128  H  H    . TYR A 1 18  ? 12.603  11.398 35.582  1.00 0.00  ? 18  TYR A H    4  
ATOM   8129  H  HA   . TYR A 1 18  ? 12.465  14.312 36.034  1.00 0.00  ? 18  TYR A HA   4  
ATOM   8130  H  HB2  . TYR A 1 18  ? 11.375  14.771 33.913  1.00 0.00  ? 18  TYR A HB2  4  
ATOM   8131  H  HB3  . TYR A 1 18  ? 12.943  14.029 33.604  1.00 0.00  ? 18  TYR A HB3  4  
ATOM   8132  H  HD1  . TYR A 1 18  ? 9.288   13.355 33.799  1.00 0.00  ? 18  TYR A HD1  4  
ATOM   8133  H  HD2  . TYR A 1 18  ? 13.118  11.916 32.485  1.00 0.00  ? 18  TYR A HD2  4  
ATOM   8134  H  HE1  . TYR A 1 18  ? 8.171   11.576 32.486  1.00 0.00  ? 18  TYR A HE1  4  
ATOM   8135  H  HE2  . TYR A 1 18  ? 11.995  10.128 31.186  1.00 0.00  ? 18  TYR A HE2  4  
ATOM   8136  H  HH   . TYR A 1 18  ? 8.452   9.971  30.982  1.00 0.00  ? 18  TYR A HH   4  
ATOM   8137  N  N    . ARG A 1 19  ? 9.937   14.132 36.452  1.00 0.00  ? 19  ARG A N    4  
ATOM   8138  C  CA   . ARG A 1 19  ? 8.565   13.875 36.971  1.00 0.00  ? 19  ARG A CA   4  
ATOM   8139  C  C    . ARG A 1 19  ? 7.600   14.922 36.407  1.00 0.00  ? 19  ARG A C    4  
ATOM   8140  O  O    . ARG A 1 19  ? 7.917   16.093 36.308  1.00 0.00  ? 19  ARG A O    4  
ATOM   8141  C  CB   . ARG A 1 19  ? 8.578   13.963 38.489  1.00 0.00  ? 19  ARG A CB   4  
ATOM   8142  C  CG   . ARG A 1 19  ? 8.814   15.415 38.882  1.00 0.00  ? 19  ARG A CG   4  
ATOM   8143  C  CD   . ARG A 1 19  ? 7.478   16.082 39.208  1.00 0.00  ? 19  ARG A CD   4  
ATOM   8144  N  NE   . ARG A 1 19  ? 7.168   15.834 40.640  1.00 0.00  ? 19  ARG A NE   4  
ATOM   8145  C  CZ   . ARG A 1 19  ? 7.997   16.249 41.563  1.00 0.00  ? 19  ARG A CZ   4  
ATOM   8146  N  NH1  . ARG A 1 19  ? 9.030   16.986 41.230  1.00 0.00  ? 19  ARG A NH1  4  
ATOM   8147  N  NH2  . ARG A 1 19  ? 7.777   15.950 42.818  1.00 0.00  ? 19  ARG A NH2  4  
ATOM   8148  H  H    . ARG A 1 19  ? 10.294  15.045 36.443  1.00 0.00  ? 19  ARG A H    4  
ATOM   8149  H  HA   . ARG A 1 19  ? 8.241   12.892 36.670  1.00 0.00  ? 19  ARG A HA   4  
ATOM   8150  H  HB2  . ARG A 1 19  ? 7.630   13.621 38.885  1.00 0.00  ? 19  ARG A HB2  4  
ATOM   8151  H  HB3  . ARG A 1 19  ? 9.375   13.353 38.881  1.00 0.00  ? 19  ARG A HB3  4  
ATOM   8152  H  HG2  . ARG A 1 19  ? 9.456   15.449 39.748  1.00 0.00  ? 19  ARG A HG2  4  
ATOM   8153  H  HG3  . ARG A 1 19  ? 9.285   15.936 38.063  1.00 0.00  ? 19  ARG A HG3  4  
ATOM   8154  H  HD2  . ARG A 1 19  ? 7.552   17.144 39.028  1.00 0.00  ? 19  ARG A HD2  4  
ATOM   8155  H  HD3  . ARG A 1 19  ? 6.699   15.662 38.588  1.00 0.00  ? 19  ARG A HD3  4  
ATOM   8156  H  HE   . ARG A 1 19  ? 6.374   15.315 40.887  1.00 0.00  ? 19  ARG A HE   4  
ATOM   8157  H  HH11 . ARG A 1 19  ? 9.183   17.232 40.272  1.00 0.00  ? 19  ARG A HH11 4  
ATOM   8158  H  HH12 . ARG A 1 19  ? 9.663   17.310 41.932  1.00 0.00  ? 19  ARG A HH12 4  
ATOM   8159  H  HH21 . ARG A 1 19  ? 6.971   15.411 43.070  1.00 0.00  ? 19  ARG A HH21 4  
ATOM   8160  H  HH22 . ARG A 1 19  ? 8.421   16.246 43.525  1.00 0.00  ? 19  ARG A HH22 4  
ATOM   8161  N  N    . ILE A 1 20  ? 6.427   14.503 36.029  1.00 0.00  ? 20  ILE A N    4  
ATOM   8162  C  CA   . ILE A 1 20  ? 5.439   15.444 35.462  1.00 0.00  ? 20  ILE A CA   4  
ATOM   8163  C  C    . ILE A 1 20  ? 4.744   16.206 36.586  1.00 0.00  ? 20  ILE A C    4  
ATOM   8164  O  O    . ILE A 1 20  ? 4.109   15.629 37.446  1.00 0.00  ? 20  ILE A O    4  
ATOM   8165  C  CB   . ILE A 1 20  ? 4.398   14.641 34.700  1.00 0.00  ? 20  ILE A CB   4  
ATOM   8166  C  CG1  . ILE A 1 20  ? 3.729   13.681 35.699  1.00 0.00  ? 20  ILE A CG1  4  
ATOM   8167  C  CG2  . ILE A 1 20  ? 5.072   13.873 33.551  1.00 0.00  ? 20  ILE A CG2  4  
ATOM   8168  C  CD1  . ILE A 1 20  ? 3.280   12.387 35.014  1.00 0.00  ? 20  ILE A CD1  4  
ATOM   8169  H  H    . ILE A 1 20  ? 6.196   13.558 36.110  1.00 0.00  ? 20  ILE A H    4  
ATOM   8170  H  HA   . ILE A 1 20  ? 5.929   16.137 34.795  1.00 0.00  ? 20  ILE A HA   4  
ATOM   8171  H  HB   . ILE A 1 20  ? 3.660   15.309 34.296  1.00 0.00  ? 20  ILE A HB   4  
ATOM   8172  H  HG12 . ILE A 1 20  ? 4.428   13.438 36.481  1.00 0.00  ? 20  ILE A HG12 4  
ATOM   8173  H  HG13 . ILE A 1 20  ? 2.867   14.166 36.134  1.00 0.00  ? 20  ILE A HG13 4  
ATOM   8174  H  HG21 . ILE A 1 20  ? 4.361   13.188 33.107  1.00 0.00  ? 20  ILE A HG21 4  
ATOM   8175  H  HG22 . ILE A 1 20  ? 5.915   13.320 33.931  1.00 0.00  ? 20  ILE A HG22 4  
ATOM   8176  H  HG23 . ILE A 1 20  ? 5.408   14.572 32.800  1.00 0.00  ? 20  ILE A HG23 4  
ATOM   8177  H  HD11 . ILE A 1 20  ? 2.442   11.969 35.555  1.00 0.00  ? 20  ILE A HD11 4  
ATOM   8178  H  HD12 . ILE A 1 20  ? 4.096   11.680 35.014  1.00 0.00  ? 20  ILE A HD12 4  
ATOM   8179  H  HD13 . ILE A 1 20  ? 2.984   12.598 33.999  1.00 0.00  ? 20  ILE A HD13 4  
ATOM   8180  N  N    . ILE A 1 21  ? 4.840   17.502 36.568  1.00 0.00  ? 21  ILE A N    4  
ATOM   8181  C  CA   . ILE A 1 21  ? 4.170   18.321 37.615  1.00 0.00  ? 21  ILE A CA   4  
ATOM   8182  C  C    . ILE A 1 21  ? 2.642   18.213 37.462  1.00 0.00  ? 21  ILE A C    4  
ATOM   8183  O  O    . ILE A 1 21  ? 1.899   18.777 38.240  1.00 0.00  ? 21  ILE A O    4  
ATOM   8184  C  CB   . ILE A 1 21  ? 4.586   19.789 37.435  1.00 0.00  ? 21  ILE A CB   4  
ATOM   8185  C  CG1  . ILE A 1 21  ? 6.106   19.898 37.319  1.00 0.00  ? 21  ILE A CG1  4  
ATOM   8186  C  CG2  . ILE A 1 21  ? 4.128   20.622 38.629  1.00 0.00  ? 21  ILE A CG2  4  
ATOM   8187  C  CD1  . ILE A 1 21  ? 6.763   19.289 38.557  1.00 0.00  ? 21  ILE A CD1  4  
ATOM   8188  H  H    . ILE A 1 21  ? 5.347   17.943 35.855  1.00 0.00  ? 21  ILE A H    4  
ATOM   8189  H  HA   . ILE A 1 21  ? 4.459   17.975 38.594  1.00 0.00  ? 21  ILE A HA   4  
ATOM   8190  H  HB   . ILE A 1 21  ? 4.130   20.175 36.535  1.00 0.00  ? 21  ILE A HB   4  
ATOM   8191  H  HG12 . ILE A 1 21  ? 6.440   19.374 36.435  1.00 0.00  ? 21  ILE A HG12 4  
ATOM   8192  H  HG13 . ILE A 1 21  ? 6.383   20.939 37.245  1.00 0.00  ? 21  ILE A HG13 4  
ATOM   8193  H  HG21 . ILE A 1 21  ? 4.905   21.325 38.889  1.00 0.00  ? 21  ILE A HG21 4  
ATOM   8194  H  HG22 . ILE A 1 21  ? 3.932   19.974 39.469  1.00 0.00  ? 21  ILE A HG22 4  
ATOM   8195  H  HG23 . ILE A 1 21  ? 3.229   21.159 38.368  1.00 0.00  ? 21  ILE A HG23 4  
ATOM   8196  H  HD11 . ILE A 1 21  ? 6.911   20.057 39.301  1.00 0.00  ? 21  ILE A HD11 4  
ATOM   8197  H  HD12 . ILE A 1 21  ? 7.717   18.862 38.284  1.00 0.00  ? 21  ILE A HD12 4  
ATOM   8198  H  HD13 . ILE A 1 21  ? 6.128   18.516 38.961  1.00 0.00  ? 21  ILE A HD13 4  
ATOM   8199  N  N    . GLY A 1 22  ? 2.162   17.510 36.463  1.00 0.00  ? 22  GLY A N    4  
ATOM   8200  C  CA   . GLY A 1 22  ? 0.687   17.398 36.275  1.00 0.00  ? 22  GLY A CA   4  
ATOM   8201  C  C    . GLY A 1 22  ? 0.370   17.377 34.784  1.00 0.00  ? 22  GLY A C    4  
ATOM   8202  O  O    . GLY A 1 22  ? 0.044   18.390 34.196  1.00 0.00  ? 22  GLY A O    4  
ATOM   8203  H  H    . GLY A 1 22  ? 2.766   17.069 35.833  1.00 0.00  ? 22  GLY A H    4  
ATOM   8204  H  HA2  . GLY A 1 22  ? 0.325   16.487 36.732  1.00 0.00  ? 22  GLY A HA2  4  
ATOM   8205  H  HA3  . GLY A 1 22  ? 0.198   18.249 36.728  1.00 0.00  ? 22  GLY A HA3  4  
ATOM   8206  N  N    . TYR A 1 23  ? 0.440   16.231 34.164  1.00 0.00  ? 23  TYR A N    4  
ATOM   8207  C  CA   . TYR A 1 23  ? 0.108   16.171 32.714  1.00 0.00  ? 23  TYR A CA   4  
ATOM   8208  C  C    . TYR A 1 23  ? -1.257  16.853 32.559  1.00 0.00  ? 23  TYR A C    4  
ATOM   8209  O  O    . TYR A 1 23  ? -1.906  17.150 33.543  1.00 0.00  ? 23  TYR A O    4  
ATOM   8210  C  CB   . TYR A 1 23  ? 0.061   14.703 32.244  1.00 0.00  ? 23  TYR A CB   4  
ATOM   8211  C  CG   . TYR A 1 23  ? -0.374  13.817 33.392  1.00 0.00  ? 23  TYR A CG   4  
ATOM   8212  C  CD1  . TYR A 1 23  ? -1.503  14.175 34.121  1.00 0.00  ? 23  TYR A CD1  4  
ATOM   8213  C  CD2  . TYR A 1 23  ? 0.345   12.654 33.734  1.00 0.00  ? 23  TYR A CD2  4  
ATOM   8214  C  CE1  . TYR A 1 23  ? -1.930  13.393 35.197  1.00 0.00  ? 23  TYR A CE1  4  
ATOM   8215  C  CE2  . TYR A 1 23  ? -0.086  11.863 34.816  1.00 0.00  ? 23  TYR A CE2  4  
ATOM   8216  C  CZ   . TYR A 1 23  ? -1.226  12.236 35.548  1.00 0.00  ? 23  TYR A CZ   4  
ATOM   8217  O  OH   . TYR A 1 23  ? -1.655  11.469 36.619  1.00 0.00  ? 23  TYR A OH   4  
ATOM   8218  H  H    . TYR A 1 23  ? 0.686   15.421 34.654  1.00 0.00  ? 23  TYR A H    4  
ATOM   8219  H  HA   . TYR A 1 23  ? 0.849   16.716 32.150  1.00 0.00  ? 23  TYR A HA   4  
ATOM   8220  H  HB2  . TYR A 1 23  ? -0.645  14.608 31.432  1.00 0.00  ? 23  TYR A HB2  4  
ATOM   8221  H  HB3  . TYR A 1 23  ? 1.042   14.400 31.905  1.00 0.00  ? 23  TYR A HB3  4  
ATOM   8222  H  HD1  . TYR A 1 23  ? -2.045  15.064 33.851  1.00 0.00  ? 23  TYR A HD1  4  
ATOM   8223  H  HD2  . TYR A 1 23  ? 1.226   12.367 33.168  1.00 0.00  ? 23  TYR A HD2  4  
ATOM   8224  H  HE1  . TYR A 1 23  ? -2.809  13.683 35.757  1.00 0.00  ? 23  TYR A HE1  4  
ATOM   8225  H  HE2  . TYR A 1 23  ? 0.459   10.968 35.085  1.00 0.00  ? 23  TYR A HE2  4  
ATOM   8226  H  HH   . TYR A 1 23  ? -1.331  10.574 36.499  1.00 0.00  ? 23  TYR A HH   4  
ATOM   8227  N  N    . THR A 1 24  ? -1.709  17.133 31.371  1.00 0.00  ? 24  THR A N    4  
ATOM   8228  C  CA   . THR A 1 24  ? -3.027  17.824 31.262  1.00 0.00  ? 24  THR A CA   4  
ATOM   8229  C  C    . THR A 1 24  ? -4.145  16.785 31.295  1.00 0.00  ? 24  THR A C    4  
ATOM   8230  O  O    . THR A 1 24  ? -3.964  15.662 30.869  1.00 0.00  ? 24  THR A O    4  
ATOM   8231  C  CB   . THR A 1 24  ? -3.090  18.638 29.965  1.00 0.00  ? 24  THR A CB   4  
ATOM   8232  O  OG1  . THR A 1 24  ? -4.433  19.025 29.702  1.00 0.00  ? 24  THR A OG1  4  
ATOM   8233  C  CG2  . THR A 1 24  ? -2.575  17.798 28.806  1.00 0.00  ? 24  THR A CG2  4  
ATOM   8234  H  H    . THR A 1 24  ? -1.189  16.914 30.571  1.00 0.00  ? 24  THR A H    4  
ATOM   8235  H  HA   . THR A 1 24  ? -3.143  18.490 32.104  1.00 0.00  ? 24  THR A HA   4  
ATOM   8236  H  HB   . THR A 1 24  ? -2.476  19.521 30.063  1.00 0.00  ? 24  THR A HB   4  
ATOM   8237  H  HG1  . THR A 1 24  ? -4.523  19.143 28.752  1.00 0.00  ? 24  THR A HG1  4  
ATOM   8238  H  HG21 . THR A 1 24  ? -2.800  16.759 28.990  1.00 0.00  ? 24  THR A HG21 4  
ATOM   8239  H  HG22 . THR A 1 24  ? -1.508  17.928 28.717  1.00 0.00  ? 24  THR A HG22 4  
ATOM   8240  H  HG23 . THR A 1 24  ? -3.057  18.116 27.892  1.00 0.00  ? 24  THR A HG23 4  
ATOM   8241  N  N    . PRO A 1 25  ? -5.267  17.189 31.825  1.00 0.00  ? 25  PRO A N    4  
ATOM   8242  C  CA   . PRO A 1 25  ? -6.436  16.307 31.959  1.00 0.00  ? 25  PRO A CA   4  
ATOM   8243  C  C    . PRO A 1 25  ? -7.157  16.202 30.629  1.00 0.00  ? 25  PRO A C    4  
ATOM   8244  O  O    . PRO A 1 25  ? -7.900  15.278 30.373  1.00 0.00  ? 25  PRO A O    4  
ATOM   8245  C  CB   . PRO A 1 25  ? -7.314  17.033 32.969  1.00 0.00  ? 25  PRO A CB   4  
ATOM   8246  C  CG   . PRO A 1 25  ? -6.896  18.522 32.927  1.00 0.00  ? 25  PRO A CG   4  
ATOM   8247  C  CD   . PRO A 1 25  ? -5.481  18.562 32.327  1.00 0.00  ? 25  PRO A CD   4  
ATOM   8248  H  HA   . PRO A 1 25  ? -6.153  15.336 32.333  1.00 0.00  ? 25  PRO A HA   4  
ATOM   8249  H  HB2  . PRO A 1 25  ? -8.351  16.931 32.684  1.00 0.00  ? 25  PRO A HB2  4  
ATOM   8250  H  HB3  . PRO A 1 25  ? -7.149  16.636 33.951  1.00 0.00  ? 25  PRO A HB3  4  
ATOM   8251  H  HG2  . PRO A 1 25  ? -7.580  19.080 32.303  1.00 0.00  ? 25  PRO A HG2  4  
ATOM   8252  H  HG3  . PRO A 1 25  ? -6.882  18.932 33.923  1.00 0.00  ? 25  PRO A HG3  4  
ATOM   8253  H  HD2  . PRO A 1 25  ? -5.439  19.277 31.516  1.00 0.00  ? 25  PRO A HD2  4  
ATOM   8254  H  HD3  . PRO A 1 25  ? -4.751  18.802 33.086  1.00 0.00  ? 25  PRO A HD3  4  
ATOM   8255  N  N    . ASP A 1 26  ? -6.941  17.160 29.786  1.00 0.00  ? 26  ASP A N    4  
ATOM   8256  C  CA   . ASP A 1 26  ? -7.605  17.156 28.457  1.00 0.00  ? 26  ASP A CA   4  
ATOM   8257  C  C    . ASP A 1 26  ? -7.617  15.731 27.875  1.00 0.00  ? 26  ASP A C    4  
ATOM   8258  O  O    . ASP A 1 26  ? -8.460  15.401 27.068  1.00 0.00  ? 26  ASP A O    4  
ATOM   8259  C  CB   . ASP A 1 26  ? -6.855  18.100 27.506  1.00 0.00  ? 26  ASP A CB   4  
ATOM   8260  C  CG   . ASP A 1 26  ? -6.907  19.534 28.048  1.00 0.00  ? 26  ASP A CG   4  
ATOM   8261  O  OD1  . ASP A 1 26  ? -7.929  19.906 28.600  1.00 0.00  ? 26  ASP A OD1  4  
ATOM   8262  O  OD2  . ASP A 1 26  ? -5.924  20.237 27.895  1.00 0.00  ? 26  ASP A OD2  4  
ATOM   8263  H  H    . ASP A 1 26  ? -6.344  17.893 30.038  1.00 0.00  ? 26  ASP A H    4  
ATOM   8264  H  HA   . ASP A 1 26  ? -8.621  17.499 28.572  1.00 0.00  ? 26  ASP A HA   4  
ATOM   8265  H  HB2  . ASP A 1 26  ? -5.824  17.785 27.428  1.00 0.00  ? 26  ASP A HB2  4  
ATOM   8266  H  HB3  . ASP A 1 26  ? -7.318  18.069 26.531  1.00 0.00  ? 26  ASP A HB3  4  
ATOM   8267  N  N    . LEU A 1 27  ? -6.700  14.881 28.270  1.00 0.00  ? 27  LEU A N    4  
ATOM   8268  C  CA   . LEU A 1 27  ? -6.689  13.492 27.707  1.00 0.00  ? 27  LEU A CA   4  
ATOM   8269  C  C    . LEU A 1 27  ? -6.514  12.453 28.823  1.00 0.00  ? 27  LEU A C    4  
ATOM   8270  O  O    . LEU A 1 27  ? -6.280  12.782 29.969  1.00 0.00  ? 27  LEU A O    4  
ATOM   8271  C  CB   . LEU A 1 27  ? -5.544  13.376 26.689  1.00 0.00  ? 27  LEU A CB   4  
ATOM   8272  C  CG   . LEU A 1 27  ? -4.252  13.039 27.422  1.00 0.00  ? 27  LEU A CG   4  
ATOM   8273  C  CD1  . LEU A 1 27  ? -3.090  12.865 26.432  1.00 0.00  ? 27  LEU A CD1  4  
ATOM   8274  C  CD2  . LEU A 1 27  ? -3.956  14.180 28.387  1.00 0.00  ? 27  LEU A CD2  4  
ATOM   8275  H  H    . LEU A 1 27  ? -6.024  15.152 28.923  1.00 0.00  ? 27  LEU A H    4  
ATOM   8276  H  HA   . LEU A 1 27  ? -7.614  13.306 27.208  1.00 0.00  ? 27  LEU A HA   4  
ATOM   8277  H  HB2  . LEU A 1 27  ? -5.772  12.600 25.973  1.00 0.00  ? 27  LEU A HB2  4  
ATOM   8278  H  HB3  . LEU A 1 27  ? -5.428  14.319 26.178  1.00 0.00  ? 27  LEU A HB3  4  
ATOM   8279  H  HG   . LEU A 1 27  ? -4.395  12.127 27.976  1.00 0.00  ? 27  LEU A HG   4  
ATOM   8280  H  HD11 . LEU A 1 27  ? -2.772  13.831 26.069  1.00 0.00  ? 27  LEU A HD11 4  
ATOM   8281  H  HD12 . LEU A 1 27  ? -3.410  12.256 25.599  1.00 0.00  ? 27  LEU A HD12 4  
ATOM   8282  H  HD13 . LEU A 1 27  ? -2.263  12.379 26.930  1.00 0.00  ? 27  LEU A HD13 4  
ATOM   8283  H  HD21 . LEU A 1 27  ? -2.901  14.380 28.401  1.00 0.00  ? 27  LEU A HD21 4  
ATOM   8284  H  HD22 . LEU A 1 27  ? -4.289  13.906 29.377  1.00 0.00  ? 27  LEU A HD22 4  
ATOM   8285  H  HD23 . LEU A 1 27  ? -4.484  15.063 28.058  1.00 0.00  ? 27  LEU A HD23 4  
ATOM   8286  N  N    . ASP A 1 28  ? -6.611  11.195 28.486  1.00 0.00  ? 28  ASP A N    4  
ATOM   8287  C  CA   . ASP A 1 28  ? -6.433  10.132 29.513  1.00 0.00  ? 28  ASP A CA   4  
ATOM   8288  C  C    . ASP A 1 28  ? -5.166  10.421 30.306  1.00 0.00  ? 28  ASP A C    4  
ATOM   8289  O  O    . ASP A 1 28  ? -4.153  10.783 29.738  1.00 0.00  ? 28  ASP A O    4  
ATOM   8290  C  CB   . ASP A 1 28  ? -6.317  8.770  28.824  1.00 0.00  ? 28  ASP A CB   4  
ATOM   8291  C  CG   . ASP A 1 28  ? -7.714  8.182  28.606  1.00 0.00  ? 28  ASP A CG   4  
ATOM   8292  O  OD1  . ASP A 1 28  ? -8.631  8.952  28.373  1.00 0.00  ? 28  ASP A OD1  4  
ATOM   8293  O  OD2  . ASP A 1 28  ? -7.844  6.972  28.673  1.00 0.00  ? 28  ASP A OD2  4  
ATOM   8294  H  H    . ASP A 1 28  ? -6.788  10.949 27.553  1.00 0.00  ? 28  ASP A H    4  
ATOM   8295  H  HA   . ASP A 1 28  ? -7.265  10.119 30.178  1.00 0.00  ? 28  ASP A HA   4  
ATOM   8296  H  HB2  . ASP A 1 28  ? -5.830  8.891  27.870  1.00 0.00  ? 28  ASP A HB2  4  
ATOM   8297  H  HB3  . ASP A 1 28  ? -5.738  8.100  29.441  1.00 0.00  ? 28  ASP A HB3  4  
ATOM   8298  N  N    . PRO A 1 29  ? -5.243  10.234 31.595  1.00 0.00  ? 29  PRO A N    4  
ATOM   8299  C  CA   . PRO A 1 29  ? -4.089  10.447 32.475  1.00 0.00  ? 29  PRO A CA   4  
ATOM   8300  C  C    . PRO A 1 29  ? -3.082  9.356  32.171  1.00 0.00  ? 29  PRO A C    4  
ATOM   8301  O  O    . PRO A 1 29  ? -1.886  9.560  32.204  1.00 0.00  ? 29  PRO A O    4  
ATOM   8302  C  CB   . PRO A 1 29  ? -4.664  10.302 33.882  1.00 0.00  ? 29  PRO A CB   4  
ATOM   8303  C  CG   . PRO A 1 29  ? -5.966  9.486  33.719  1.00 0.00  ? 29  PRO A CG   4  
ATOM   8304  C  CD   . PRO A 1 29  ? -6.463  9.776  32.294  1.00 0.00  ? 29  PRO A CD   4  
ATOM   8305  H  HA   . PRO A 1 29  ? -3.663  11.428 32.328  1.00 0.00  ? 29  PRO A HA   4  
ATOM   8306  H  HB2  . PRO A 1 29  ? -3.962  9.772  34.511  1.00 0.00  ? 29  PRO A HB2  4  
ATOM   8307  H  HB3  . PRO A 1 29  ? -4.887  11.269 34.297  1.00 0.00  ? 29  PRO A HB3  4  
ATOM   8308  H  HG2  . PRO A 1 29  ? -5.759  8.429  33.835  1.00 0.00  ? 29  PRO A HG2  4  
ATOM   8309  H  HG3  . PRO A 1 29  ? -6.704  9.805  34.438  1.00 0.00  ? 29  PRO A HG3  4  
ATOM   8310  H  HD2  . PRO A 1 29  ? -6.859  8.879  31.837  1.00 0.00  ? 29  PRO A HD2  4  
ATOM   8311  H  HD3  . PRO A 1 29  ? -7.203  10.561 32.306  1.00 0.00  ? 29  PRO A HD3  4  
ATOM   8312  N  N    . GLU A 1 30  ? -3.576  8.197  31.833  1.00 0.00  ? 30  GLU A N    4  
ATOM   8313  C  CA   . GLU A 1 30  ? -2.664  7.086  31.474  1.00 0.00  ? 30  GLU A CA   4  
ATOM   8314  C  C    . GLU A 1 30  ? -2.193  7.313  30.041  1.00 0.00  ? 30  GLU A C    4  
ATOM   8315  O  O    . GLU A 1 30  ? -1.119  6.889  29.663  1.00 0.00  ? 30  GLU A O    4  
ATOM   8316  C  CB   . GLU A 1 30  ? -3.379  5.741  31.562  1.00 0.00  ? 30  GLU A CB   4  
ATOM   8317  C  CG   . GLU A 1 30  ? -4.762  5.859  30.932  1.00 0.00  ? 30  GLU A CG   4  
ATOM   8318  C  CD   . GLU A 1 30  ? -5.169  4.506  30.354  1.00 0.00  ? 30  GLU A CD   4  
ATOM   8319  O  OE1  . GLU A 1 30  ? -4.353  3.600  30.388  1.00 0.00  ? 30  GLU A OE1  4  
ATOM   8320  O  OE2  . GLU A 1 30  ? -6.289  4.395  29.884  1.00 0.00  ? 30  GLU A OE2  4  
ATOM   8321  H  H    . GLU A 1 30  ? -4.548  8.076  31.790  1.00 0.00  ? 30  GLU A H    4  
ATOM   8322  H  HA   . GLU A 1 30  ? -1.815  7.094  32.141  1.00 0.00  ? 30  GLU A HA   4  
ATOM   8323  H  HB2  . GLU A 1 30  ? -2.804  4.997  31.030  1.00 0.00  ? 30  GLU A HB2  4  
ATOM   8324  H  HB3  . GLU A 1 30  ? -3.477  5.445  32.596  1.00 0.00  ? 30  GLU A HB3  4  
ATOM   8325  H  HG2  . GLU A 1 30  ? -5.475  6.164  31.684  1.00 0.00  ? 30  GLU A HG2  4  
ATOM   8326  H  HG3  . GLU A 1 30  ? -4.734  6.593  30.142  1.00 0.00  ? 30  GLU A HG3  4  
ATOM   8327  N  N    . THR A 1 31  ? -2.982  7.996  29.230  1.00 0.00  ? 31  THR A N    4  
ATOM   8328  C  CA   . THR A 1 31  ? -2.524  8.250  27.826  1.00 0.00  ? 31  THR A CA   4  
ATOM   8329  C  C    . THR A 1 31  ? -1.441  9.322  27.888  1.00 0.00  ? 31  THR A C    4  
ATOM   8330  O  O    . THR A 1 31  ? -0.358  9.169  27.355  1.00 0.00  ? 31  THR A O    4  
ATOM   8331  C  CB   . THR A 1 31  ? -3.678  8.749  26.938  1.00 0.00  ? 31  THR A CB   4  
ATOM   8332  O  OG1  . THR A 1 31  ? -4.606  7.694  26.714  1.00 0.00  ? 31  THR A OG1  4  
ATOM   8333  C  CG2  . THR A 1 31  ? -3.119  9.231  25.589  1.00 0.00  ? 31  THR A CG2  4  
ATOM   8334  H  H    . THR A 1 31  ? -3.856  8.355  29.552  1.00 0.00  ? 31  THR A H    4  
ATOM   8335  H  HA   . THR A 1 31  ? -2.110  7.344  27.412  1.00 0.00  ? 31  THR A HA   4  
ATOM   8336  H  HB   . THR A 1 31  ? -4.176  9.572  27.427  1.00 0.00  ? 31  THR A HB   4  
ATOM   8337  H  HG1  . THR A 1 31  ? -5.314  8.035  26.153  1.00 0.00  ? 31  THR A HG1  4  
ATOM   8338  H  HG21 . THR A 1 31  ? -2.042  9.307  25.650  1.00 0.00  ? 31  THR A HG21 4  
ATOM   8339  H  HG22 . THR A 1 31  ? -3.535  10.198 25.350  1.00 0.00  ? 31  THR A HG22 4  
ATOM   8340  H  HG23 . THR A 1 31  ? -3.385  8.526  24.816  1.00 0.00  ? 31  THR A HG23 4  
ATOM   8341  N  N    . VAL A 1 32  ? -1.729  10.404 28.554  1.00 0.00  ? 32  VAL A N    4  
ATOM   8342  C  CA   . VAL A 1 32  ? -0.735  11.500 28.685  1.00 0.00  ? 32  VAL A CA   4  
ATOM   8343  C  C    . VAL A 1 32  ? 0.556   10.922 29.261  1.00 0.00  ? 32  VAL A C    4  
ATOM   8344  O  O    . VAL A 1 32  ? 1.653   11.298 28.890  1.00 0.00  ? 32  VAL A O    4  
ATOM   8345  C  CB   . VAL A 1 32  ? -1.330  12.568 29.605  1.00 0.00  ? 32  VAL A CB   4  
ATOM   8346  C  CG1  . VAL A 1 32  ? -0.986  12.285 31.069  1.00 0.00  ? 32  VAL A CG1  4  
ATOM   8347  C  CG2  . VAL A 1 32  ? -0.787  13.938 29.200  1.00 0.00  ? 32  VAL A CG2  4  
ATOM   8348  H  H    . VAL A 1 32  ? -2.605  10.492 28.982  1.00 0.00  ? 32  VAL A H    4  
ATOM   8349  H  HA   . VAL A 1 32  ? -0.536  11.926 27.714  1.00 0.00  ? 32  VAL A HA   4  
ATOM   8350  H  HB   . VAL A 1 32  ? -2.402  12.557 29.495  1.00 0.00  ? 32  VAL A HB   4  
ATOM   8351  H  HG11 . VAL A 1 32  ? -1.695  12.794 31.707  1.00 0.00  ? 32  VAL A HG11 4  
ATOM   8352  H  HG12 . VAL A 1 32  ? 0.009   12.637 31.276  1.00 0.00  ? 32  VAL A HG12 4  
ATOM   8353  H  HG13 . VAL A 1 32  ? -1.034  11.224 31.253  1.00 0.00  ? 32  VAL A HG13 4  
ATOM   8354  H  HG21 . VAL A 1 32  ? -1.391  14.712 29.649  1.00 0.00  ? 32  VAL A HG21 4  
ATOM   8355  H  HG22 . VAL A 1 32  ? -0.821  14.034 28.124  1.00 0.00  ? 32  VAL A HG22 4  
ATOM   8356  H  HG23 . VAL A 1 32  ? 0.233   14.033 29.536  1.00 0.00  ? 32  VAL A HG23 4  
ATOM   8357  N  N    . ASP A 1 33  ? 0.424   9.982  30.148  1.00 0.00  ? 33  ASP A N    4  
ATOM   8358  C  CA   . ASP A 1 33  ? 1.631   9.339  30.727  1.00 0.00  ? 33  ASP A CA   4  
ATOM   8359  C  C    . ASP A 1 33  ? 2.224   8.417  29.665  1.00 0.00  ? 33  ASP A C    4  
ATOM   8360  O  O    . ASP A 1 33  ? 3.400   8.112  29.672  1.00 0.00  ? 33  ASP A O    4  
ATOM   8361  C  CB   . ASP A 1 33  ? 1.263   8.500  31.951  1.00 0.00  ? 33  ASP A CB   4  
ATOM   8362  C  CG   . ASP A 1 33  ? 2.256   8.796  33.073  1.00 0.00  ? 33  ASP A CG   4  
ATOM   8363  O  OD1  . ASP A 1 33  ? 2.775   9.901  33.098  1.00 0.00  ? 33  ASP A OD1  4  
ATOM   8364  O  OD2  . ASP A 1 33  ? 2.487   7.913  33.879  1.00 0.00  ? 33  ASP A OD2  4  
ATOM   8365  H  H    . ASP A 1 33  ? -0.473  9.683  30.411  1.00 0.00  ? 33  ASP A H    4  
ATOM   8366  H  HA   . ASP A 1 33  ? 2.351   10.097 31.006  1.00 0.00  ? 33  ASP A HA   4  
ATOM   8367  H  HB2  . ASP A 1 33  ? 0.260   8.742  32.272  1.00 0.00  ? 33  ASP A HB2  4  
ATOM   8368  H  HB3  . ASP A 1 33  ? 1.318   7.452  31.694  1.00 0.00  ? 33  ASP A HB3  4  
ATOM   8369  N  N    . ASP A 1 34  ? 1.403   7.968  28.746  1.00 0.00  ? 34  ASP A N    4  
ATOM   8370  C  CA   . ASP A 1 34  ? 1.900   7.061  27.673  1.00 0.00  ? 34  ASP A CA   4  
ATOM   8371  C  C    . ASP A 1 34  ? 2.771   7.883  26.712  1.00 0.00  ? 34  ASP A C    4  
ATOM   8372  O  O    . ASP A 1 34  ? 3.828   7.450  26.293  1.00 0.00  ? 34  ASP A O    4  
ATOM   8373  C  CB   . ASP A 1 34  ? 0.698   6.439  26.933  1.00 0.00  ? 34  ASP A CB   4  
ATOM   8374  C  CG   . ASP A 1 34  ? 1.103   5.119  26.263  1.00 0.00  ? 34  ASP A CG   4  
ATOM   8375  O  OD1  . ASP A 1 34  ? 1.029   4.093  26.920  1.00 0.00  ? 34  ASP A OD1  4  
ATOM   8376  O  OD2  . ASP A 1 34  ? 1.466   5.155  25.098  1.00 0.00  ? 34  ASP A OD2  4  
ATOM   8377  H  H    . ASP A 1 34  ? 0.455   8.233  28.764  1.00 0.00  ? 34  ASP A H    4  
ATOM   8378  H  HA   . ASP A 1 34  ? 2.496   6.279  28.118  1.00 0.00  ? 34  ASP A HA   4  
ATOM   8379  H  HB2  . ASP A 1 34  ? -0.094  6.244  27.642  1.00 0.00  ? 34  ASP A HB2  4  
ATOM   8380  H  HB3  . ASP A 1 34  ? 0.341   7.126  26.181  1.00 0.00  ? 34  ASP A HB3  4  
ATOM   8381  N  N    . ALA A 1 35  ? 2.341   9.079  26.391  1.00 0.00  ? 35  ALA A N    4  
ATOM   8382  C  CA   . ALA A 1 35  ? 3.133   9.965  25.491  1.00 0.00  ? 35  ALA A CA   4  
ATOM   8383  C  C    . ALA A 1 35  ? 4.552   10.088 26.046  1.00 0.00  ? 35  ALA A C    4  
ATOM   8384  O  O    . ALA A 1 35  ? 5.521   10.096 25.311  1.00 0.00  ? 35  ALA A O    4  
ATOM   8385  C  CB   . ALA A 1 35  ? 2.476   11.347 25.470  1.00 0.00  ? 35  ALA A CB   4  
ATOM   8386  H  H    . ALA A 1 35  ? 1.499   9.405  26.763  1.00 0.00  ? 35  ALA A H    4  
ATOM   8387  H  HA   . ALA A 1 35  ? 3.160   9.554  24.492  1.00 0.00  ? 35  ALA A HA   4  
ATOM   8388  H  HB1  . ALA A 1 35  ? 2.037   11.544 26.437  1.00 0.00  ? 35  ALA A HB1  4  
ATOM   8389  H  HB2  . ALA A 1 35  ? 1.704   11.369 24.713  1.00 0.00  ? 35  ALA A HB2  4  
ATOM   8390  H  HB3  . ALA A 1 35  ? 3.219   12.101 25.252  1.00 0.00  ? 35  ALA A HB3  4  
ATOM   8391  N  N    . PHE A 1 36  ? 4.674   10.173 27.343  1.00 0.00  ? 36  PHE A N    4  
ATOM   8392  C  CA   . PHE A 1 36  ? 6.022   10.280 27.962  1.00 0.00  ? 36  PHE A CA   4  
ATOM   8393  C  C    . PHE A 1 36  ? 6.701   8.915  27.890  1.00 0.00  ? 36  PHE A C    4  
ATOM   8394  O  O    . PHE A 1 36  ? 7.910   8.807  27.861  1.00 0.00  ? 36  PHE A O    4  
ATOM   8395  C  CB   . PHE A 1 36  ? 5.885   10.691 29.425  1.00 0.00  ? 36  PHE A CB   4  
ATOM   8396  C  CG   . PHE A 1 36  ? 5.226   12.042 29.514  1.00 0.00  ? 36  PHE A CG   4  
ATOM   8397  C  CD1  . PHE A 1 36  ? 5.675   13.093 28.710  1.00 0.00  ? 36  PHE A CD1  4  
ATOM   8398  C  CD2  . PHE A 1 36  ? 4.172   12.245 30.407  1.00 0.00  ? 36  PHE A CD2  4  
ATOM   8399  C  CE1  . PHE A 1 36  ? 5.076   14.353 28.805  1.00 0.00  ? 36  PHE A CE1  4  
ATOM   8400  C  CE2  . PHE A 1 36  ? 3.567   13.503 30.502  1.00 0.00  ? 36  PHE A CE2  4  
ATOM   8401  C  CZ   . PHE A 1 36  ? 4.019   14.558 29.698  1.00 0.00  ? 36  PHE A CZ   4  
ATOM   8402  H  H    . PHE A 1 36  ? 3.875   10.156 27.910  1.00 0.00  ? 36  PHE A H    4  
ATOM   8403  H  HA   . PHE A 1 36  ? 6.612   11.012 27.431  1.00 0.00  ? 36  PHE A HA   4  
ATOM   8404  H  HB2  . PHE A 1 36  ? 5.285   9.960  29.949  1.00 0.00  ? 36  PHE A HB2  4  
ATOM   8405  H  HB3  . PHE A 1 36  ? 6.865   10.742 29.875  1.00 0.00  ? 36  PHE A HB3  4  
ATOM   8406  H  HD1  . PHE A 1 36  ? 6.487   12.932 28.019  1.00 0.00  ? 36  PHE A HD1  4  
ATOM   8407  H  HD2  . PHE A 1 36  ? 3.825   11.428 31.024  1.00 0.00  ? 36  PHE A HD2  4  
ATOM   8408  H  HE1  . PHE A 1 36  ? 5.425   15.164 28.183  1.00 0.00  ? 36  PHE A HE1  4  
ATOM   8409  H  HE2  . PHE A 1 36  ? 2.751   13.658 31.192  1.00 0.00  ? 36  PHE A HE2  4  
ATOM   8410  H  HZ   . PHE A 1 36  ? 3.555   15.532 29.770  1.00 0.00  ? 36  PHE A HZ   4  
ATOM   8411  N  N    . ALA A 1 37  ? 5.924   7.869  27.855  1.00 0.00  ? 37  ALA A N    4  
ATOM   8412  C  CA   . ALA A 1 37  ? 6.512   6.504  27.772  1.00 0.00  ? 37  ALA A CA   4  
ATOM   8413  C  C    . ALA A 1 37  ? 6.992   6.264  26.339  1.00 0.00  ? 37  ALA A C    4  
ATOM   8414  O  O    . ALA A 1 37  ? 8.132   5.909  26.092  1.00 0.00  ? 37  ALA A O    4  
ATOM   8415  C  CB   . ALA A 1 37  ? 5.440   5.473  28.131  1.00 0.00  ? 37  ALA A CB   4  
ATOM   8416  H  H    . ALA A 1 37  ? 4.946   7.983  27.879  1.00 0.00  ? 37  ALA A H    4  
ATOM   8417  H  HA   . ALA A 1 37  ? 7.342   6.421  28.456  1.00 0.00  ? 37  ALA A HA   4  
ATOM   8418  H  HB1  . ALA A 1 37  ? 5.900   4.634  28.633  1.00 0.00  ? 37  ALA A HB1  4  
ATOM   8419  H  HB2  . ALA A 1 37  ? 4.954   5.131  27.228  1.00 0.00  ? 37  ALA A HB2  4  
ATOM   8420  H  HB3  . ALA A 1 37  ? 4.708   5.927  28.782  1.00 0.00  ? 37  ALA A HB3  4  
ATOM   8421  N  N    . ARG A 1 38  ? 6.129   6.473  25.390  1.00 0.00  ? 38  ARG A N    4  
ATOM   8422  C  CA   . ARG A 1 38  ? 6.522   6.280  23.972  1.00 0.00  ? 38  ARG A CA   4  
ATOM   8423  C  C    . ARG A 1 38  ? 7.690   7.216  23.661  1.00 0.00  ? 38  ARG A C    4  
ATOM   8424  O  O    . ARG A 1 38  ? 8.582   6.899  22.896  1.00 0.00  ? 38  ARG A O    4  
ATOM   8425  C  CB   . ARG A 1 38  ? 5.335   6.629  23.074  1.00 0.00  ? 38  ARG A CB   4  
ATOM   8426  C  CG   . ARG A 1 38  ? 4.612   5.349  22.654  1.00 0.00  ? 38  ARG A CG   4  
ATOM   8427  C  CD   . ARG A 1 38  ? 4.416   5.341  21.134  1.00 0.00  ? 38  ARG A CD   4  
ATOM   8428  N  NE   . ARG A 1 38  ? 5.492   4.520  20.511  1.00 0.00  ? 38  ARG A NE   4  
ATOM   8429  C  CZ   . ARG A 1 38  ? 5.311   3.947  19.351  1.00 0.00  ? 38  ARG A CZ   4  
ATOM   8430  N  NH1  . ARG A 1 38  ? 4.180   4.088  18.706  1.00 0.00  ? 38  ARG A NH1  4  
ATOM   8431  N  NH2  . ARG A 1 38  ? 6.271   3.227  18.836  1.00 0.00  ? 38  ARG A NH2  4  
ATOM   8432  H  H    . ARG A 1 38  ? 5.222   6.770  25.611  1.00 0.00  ? 38  ARG A H    4  
ATOM   8433  H  HA   . ARG A 1 38  ? 6.819   5.252  23.810  1.00 0.00  ? 38  ARG A HA   4  
ATOM   8434  H  HB2  . ARG A 1 38  ? 4.653   7.264  23.617  1.00 0.00  ? 38  ARG A HB2  4  
ATOM   8435  H  HB3  . ARG A 1 38  ? 5.687   7.147  22.196  1.00 0.00  ? 38  ARG A HB3  4  
ATOM   8436  H  HG2  . ARG A 1 38  ? 5.203   4.492  22.945  1.00 0.00  ? 38  ARG A HG2  4  
ATOM   8437  H  HG3  . ARG A 1 38  ? 3.650   5.304  23.139  1.00 0.00  ? 38  ARG A HG3  4  
ATOM   8438  H  HD2  . ARG A 1 38  ? 3.453   4.917  20.899  1.00 0.00  ? 38  ARG A HD2  4  
ATOM   8439  H  HD3  . ARG A 1 38  ? 4.470   6.353  20.758  1.00 0.00  ? 38  ARG A HD3  4  
ATOM   8440  H  HE   . ARG A 1 38  ? 6.345   4.405  20.980  1.00 0.00  ? 38  ARG A HE   4  
ATOM   8441  H  HH11 . ARG A 1 38  ? 3.441   4.633  19.100  1.00 0.00  ? 38  ARG A HH11 4  
ATOM   8442  H  HH12 . ARG A 1 38  ? 4.058   3.655  17.812  1.00 0.00  ? 38  ARG A HH12 4  
ATOM   8443  H  HH21 . ARG A 1 38  ? 7.135   3.122  19.328  1.00 0.00  ? 38  ARG A HH21 4  
ATOM   8444  H  HH22 . ARG A 1 38  ? 6.141   2.777  17.952  1.00 0.00  ? 38  ARG A HH22 4  
ATOM   8445  N  N    . ALA A 1 39  ? 7.689   8.368  24.260  1.00 0.00  ? 39  ALA A N    4  
ATOM   8446  C  CA   . ALA A 1 39  ? 8.793   9.334  24.015  1.00 0.00  ? 39  ALA A CA   4  
ATOM   8447  C  C    . ALA A 1 39  ? 10.109  8.726  24.497  1.00 0.00  ? 39  ALA A C    4  
ATOM   8448  O  O    . ALA A 1 39  ? 11.117  8.758  23.811  1.00 0.00  ? 39  ALA A O    4  
ATOM   8449  C  CB   . ALA A 1 39  ? 8.534   10.620 24.798  1.00 0.00  ? 39  ALA A CB   4  
ATOM   8450  H  H    . ALA A 1 39  ? 6.963   8.597  24.878  1.00 0.00  ? 39  ALA A H    4  
ATOM   8451  H  HA   . ALA A 1 39  ? 8.853   9.555  22.959  1.00 0.00  ? 39  ALA A HA   4  
ATOM   8452  H  HB1  . ALA A 1 39  ? 8.922   11.463 24.246  1.00 0.00  ? 39  ALA A HB1  4  
ATOM   8453  H  HB2  . ALA A 1 39  ? 9.031   10.558 25.754  1.00 0.00  ? 39  ALA A HB2  4  
ATOM   8454  H  HB3  . ALA A 1 39  ? 7.476   10.746 24.952  1.00 0.00  ? 39  ALA A HB3  4  
ATOM   8455  N  N    . PHE A 1 40  ? 10.100  8.171  25.679  1.00 0.00  ? 40  PHE A N    4  
ATOM   8456  C  CA   . PHE A 1 40  ? 11.338  7.555  26.224  1.00 0.00  ? 40  PHE A CA   4  
ATOM   8457  C  C    . PHE A 1 40  ? 11.878  6.548  25.200  1.00 0.00  ? 40  PHE A C    4  
ATOM   8458  O  O    . PHE A 1 40  ? 13.072  6.392  25.040  1.00 0.00  ? 40  PHE A O    4  
ATOM   8459  C  CB   . PHE A 1 40  ? 11.023  6.893  27.587  1.00 0.00  ? 40  PHE A CB   4  
ATOM   8460  C  CG   . PHE A 1 40  ? 11.343  5.419  27.578  1.00 0.00  ? 40  PHE A CG   4  
ATOM   8461  C  CD1  . PHE A 1 40  ? 12.673  5.002  27.647  1.00 0.00  ? 40  PHE A CD1  4  
ATOM   8462  C  CD2  . PHE A 1 40  ? 10.311  4.478  27.511  1.00 0.00  ? 40  PHE A CD2  4  
ATOM   8463  C  CE1  . PHE A 1 40  ? 12.978  3.638  27.647  1.00 0.00  ? 40  PHE A CE1  4  
ATOM   8464  C  CE2  . PHE A 1 40  ? 10.614  3.112  27.508  1.00 0.00  ? 40  PHE A CE2  4  
ATOM   8465  C  CZ   . PHE A 1 40  ? 11.948  2.692  27.578  1.00 0.00  ? 40  PHE A CZ   4  
ATOM   8466  H  H    . PHE A 1 40  ? 9.273   8.160  26.204  1.00 0.00  ? 40  PHE A H    4  
ATOM   8467  H  HA   . PHE A 1 40  ? 12.078  8.327  26.371  1.00 0.00  ? 40  PHE A HA   4  
ATOM   8468  H  HB2  . PHE A 1 40  ? 11.616  7.370  28.354  1.00 0.00  ? 40  PHE A HB2  4  
ATOM   8469  H  HB3  . PHE A 1 40  ? 9.975   7.030  27.815  1.00 0.00  ? 40  PHE A HB3  4  
ATOM   8470  H  HD1  . PHE A 1 40  ? 13.466  5.735  27.694  1.00 0.00  ? 40  PHE A HD1  4  
ATOM   8471  H  HD2  . PHE A 1 40  ? 9.283   4.805  27.459  1.00 0.00  ? 40  PHE A HD2  4  
ATOM   8472  H  HE1  . PHE A 1 40  ? 14.008  3.317  27.702  1.00 0.00  ? 40  PHE A HE1  4  
ATOM   8473  H  HE2  . PHE A 1 40  ? 9.817   2.383  27.455  1.00 0.00  ? 40  PHE A HE2  4  
ATOM   8474  H  HZ   . PHE A 1 40  ? 12.181  1.639  27.579  1.00 0.00  ? 40  PHE A HZ   4  
ATOM   8475  N  N    . GLN A 1 41  ? 11.004  5.883  24.496  1.00 0.00  ? 41  GLN A N    4  
ATOM   8476  C  CA   . GLN A 1 41  ? 11.467  4.909  23.466  1.00 0.00  ? 41  GLN A CA   4  
ATOM   8477  C  C    . GLN A 1 41  ? 11.790  5.671  22.172  1.00 0.00  ? 41  GLN A C    4  
ATOM   8478  O  O    . GLN A 1 41  ? 12.394  5.142  21.264  1.00 0.00  ? 41  GLN A O    4  
ATOM   8479  C  CB   . GLN A 1 41  ? 10.359  3.883  23.202  1.00 0.00  ? 41  GLN A CB   4  
ATOM   8480  C  CG   . GLN A 1 41  ? 10.899  2.697  22.383  1.00 0.00  ? 41  GLN A CG   4  
ATOM   8481  C  CD   . GLN A 1 41  ? 10.878  1.421  23.239  1.00 0.00  ? 41  GLN A CD   4  
ATOM   8482  O  OE1  . GLN A 1 41  ? 11.037  1.483  24.442  1.00 0.00  ? 41  GLN A OE1  4  
ATOM   8483  N  NE2  . GLN A 1 41  ? 10.686  0.259  22.667  1.00 0.00  ? 41  GLN A NE2  4  
ATOM   8484  H  H    . GLN A 1 41  ? 10.040  6.034  24.634  1.00 0.00  ? 41  GLN A H    4  
ATOM   8485  H  HA   . GLN A 1 41  ? 12.360  4.405  23.819  1.00 0.00  ? 41  GLN A HA   4  
ATOM   8486  H  HB2  . GLN A 1 41  ? 9.979   3.523  24.141  1.00 0.00  ? 41  GLN A HB2  4  
ATOM   8487  H  HB3  . GLN A 1 41  ? 9.563   4.363  22.649  1.00 0.00  ? 41  GLN A HB3  4  
ATOM   8488  H  HG2  . GLN A 1 41  ? 10.275  2.553  21.513  1.00 0.00  ? 41  GLN A HG2  4  
ATOM   8489  H  HG3  . GLN A 1 41  ? 11.911  2.903  22.067  1.00 0.00  ? 41  GLN A HG3  4  
ATOM   8490  H  HE21 . GLN A 1 41  ? 10.556  0.204  21.699  1.00 0.00  ? 41  GLN A HE21 4  
ATOM   8491  H  HE22 . GLN A 1 41  ? 10.672  -0.559 23.210  1.00 0.00  ? 41  GLN A HE22 4  
ATOM   8492  N  N    . VAL A 1 42  ? 11.393  6.917  22.087  1.00 0.00  ? 42  VAL A N    4  
ATOM   8493  C  CA   . VAL A 1 42  ? 11.687  7.726  20.859  1.00 0.00  ? 42  VAL A CA   4  
ATOM   8494  C  C    . VAL A 1 42  ? 13.179  8.081  20.861  1.00 0.00  ? 42  VAL A C    4  
ATOM   8495  O  O    . VAL A 1 42  ? 13.804  8.177  19.825  1.00 0.00  ? 42  VAL A O    4  
ATOM   8496  C  CB   . VAL A 1 42  ? 10.810  9.002  20.857  1.00 0.00  ? 42  VAL A CB   4  
ATOM   8497  C  CG1  . VAL A 1 42  ? 11.602  10.208 21.350  1.00 0.00  ? 42  VAL A CG1  4  
ATOM   8498  C  CG2  . VAL A 1 42  ? 10.319  9.298  19.434  1.00 0.00  ? 42  VAL A CG2  4  
ATOM   8499  H  H    . VAL A 1 42  ? 10.908  7.324  22.835  1.00 0.00  ? 42  VAL A H    4  
ATOM   8500  H  HA   . VAL A 1 42  ? 11.470  7.140  19.978  1.00 0.00  ? 42  VAL A HA   4  
ATOM   8501  H  HB   . VAL A 1 42  ? 9.961   8.850  21.507  1.00 0.00  ? 42  VAL A HB   4  
ATOM   8502  H  HG11 . VAL A 1 42  ? 12.164  9.932  22.228  1.00 0.00  ? 42  VAL A HG11 4  
ATOM   8503  H  HG12 . VAL A 1 42  ? 10.922  11.010 21.591  1.00 0.00  ? 42  VAL A HG12 4  
ATOM   8504  H  HG13 . VAL A 1 42  ? 12.279  10.528 20.573  1.00 0.00  ? 42  VAL A HG13 4  
ATOM   8505  H  HG21 . VAL A 1 42  ? 9.559   8.585  19.149  1.00 0.00  ? 42  VAL A HG21 4  
ATOM   8506  H  HG22 . VAL A 1 42  ? 11.149  9.229  18.755  1.00 0.00  ? 42  VAL A HG22 4  
ATOM   8507  H  HG23 . VAL A 1 42  ? 9.907   10.297 19.394  1.00 0.00  ? 42  VAL A HG23 4  
ATOM   8508  N  N    . TRP A 1 43  ? 13.748  8.267  22.025  1.00 0.00  ? 43  TRP A N    4  
ATOM   8509  C  CA   . TRP A 1 43  ? 15.207  8.604  22.109  1.00 0.00  ? 43  TRP A CA   4  
ATOM   8510  C  C    . TRP A 1 43  ? 16.003  7.359  22.524  1.00 0.00  ? 43  TRP A C    4  
ATOM   8511  O  O    . TRP A 1 43  ? 16.971  6.993  21.889  1.00 0.00  ? 43  TRP A O    4  
ATOM   8512  C  CB   . TRP A 1 43  ? 15.432  9.700  23.151  1.00 0.00  ? 43  TRP A CB   4  
ATOM   8513  C  CG   . TRP A 1 43  ? 14.290  10.653 23.137  1.00 0.00  ? 43  TRP A CG   4  
ATOM   8514  C  CD1  . TRP A 1 43  ? 14.023  11.531 22.151  1.00 0.00  ? 43  TRP A CD1  4  
ATOM   8515  C  CD2  . TRP A 1 43  ? 13.267  10.841 24.148  1.00 0.00  ? 43  TRP A CD2  4  
ATOM   8516  N  NE1  . TRP A 1 43  ? 12.894  12.252 22.492  1.00 0.00  ? 43  TRP A NE1  4  
ATOM   8517  C  CE2  . TRP A 1 43  ? 12.391  11.862 23.718  1.00 0.00  ? 43  TRP A CE2  4  
ATOM   8518  C  CE3  . TRP A 1 43  ? 13.017  10.226 25.384  1.00 0.00  ? 43  TRP A CE3  4  
ATOM   8519  C  CZ2  . TRP A 1 43  ? 11.305  12.264 24.493  1.00 0.00  ? 43  TRP A CZ2  4  
ATOM   8520  C  CZ3  . TRP A 1 43  ? 11.927  10.627 26.166  1.00 0.00  ? 43  TRP A CZ3  4  
ATOM   8521  C  CH2  . TRP A 1 43  ? 11.072  11.643 25.723  1.00 0.00  ? 43  TRP A CH2  4  
ATOM   8522  H  H    . TRP A 1 43  ? 13.212  8.179  22.845  1.00 0.00  ? 43  TRP A H    4  
ATOM   8523  H  HA   . TRP A 1 43  ? 15.554  8.948  21.144  1.00 0.00  ? 43  TRP A HA   4  
ATOM   8524  H  HB2  . TRP A 1 43  ? 15.509  9.254  24.131  1.00 0.00  ? 43  TRP A HB2  4  
ATOM   8525  H  HB3  . TRP A 1 43  ? 16.346  10.234 22.930  1.00 0.00  ? 43  TRP A HB3  4  
ATOM   8526  H  HD1  . TRP A 1 43  ? 14.596  11.651 21.243  1.00 0.00  ? 43  TRP A HD1  4  
ATOM   8527  H  HE1  . TRP A 1 43  ? 12.487  12.955 21.947  1.00 0.00  ? 43  TRP A HE1  4  
ATOM   8528  H  HE3  . TRP A 1 43  ? 13.669  9.438  25.732  1.00 0.00  ? 43  TRP A HE3  4  
ATOM   8529  H  HZ2  . TRP A 1 43  ? 10.650  13.048 24.147  1.00 0.00  ? 43  TRP A HZ2  4  
ATOM   8530  H  HZ3  . TRP A 1 43  ? 11.745  10.147 27.115  1.00 0.00  ? 43  TRP A HZ3  4  
ATOM   8531  H  HH2  . TRP A 1 43  ? 10.234  11.946 26.332  1.00 0.00  ? 43  TRP A HH2  4  
ATOM   8532  N  N    . SER A 1 44  ? 15.600  6.703  23.582  1.00 0.00  ? 44  SER A N    4  
ATOM   8533  C  CA   . SER A 1 44  ? 16.331  5.479  24.034  1.00 0.00  ? 44  SER A CA   4  
ATOM   8534  C  C    . SER A 1 44  ? 16.436  4.498  22.867  1.00 0.00  ? 44  SER A C    4  
ATOM   8535  O  O    . SER A 1 44  ? 17.396  3.764  22.736  1.00 0.00  ? 44  SER A O    4  
ATOM   8536  C  CB   . SER A 1 44  ? 15.542  4.818  25.157  1.00 0.00  ? 44  SER A CB   4  
ATOM   8537  O  OG   . SER A 1 44  ? 16.011  3.490  25.341  1.00 0.00  ? 44  SER A OG   4  
ATOM   8538  H  H    . SER A 1 44  ? 14.809  7.010  24.077  1.00 0.00  ? 44  SER A H    4  
ATOM   8539  H  HA   . SER A 1 44  ? 17.323  5.743  24.388  1.00 0.00  ? 44  SER A HA   4  
ATOM   8540  H  HB2  . SER A 1 44  ? 15.674  5.371  26.071  1.00 0.00  ? 44  SER A HB2  4  
ATOM   8541  H  HB3  . SER A 1 44  ? 14.492  4.808  24.894  1.00 0.00  ? 44  SER A HB3  4  
ATOM   8542  H  HG   . SER A 1 44  ? 15.251  2.903  25.330  1.00 0.00  ? 44  SER A HG   4  
ATOM   8543  N  N    . ASP A 1 45  ? 15.446  4.482  22.024  1.00 0.00  ? 45  ASP A N    4  
ATOM   8544  C  CA   . ASP A 1 45  ? 15.455  3.556  20.857  1.00 0.00  ? 45  ASP A CA   4  
ATOM   8545  C  C    . ASP A 1 45  ? 16.744  3.765  20.041  1.00 0.00  ? 45  ASP A C    4  
ATOM   8546  O  O    . ASP A 1 45  ? 17.280  2.835  19.472  1.00 0.00  ? 45  ASP A O    4  
ATOM   8547  C  CB   . ASP A 1 45  ? 14.213  3.852  20.007  1.00 0.00  ? 45  ASP A CB   4  
ATOM   8548  C  CG   . ASP A 1 45  ? 14.412  3.381  18.565  1.00 0.00  ? 45  ASP A CG   4  
ATOM   8549  O  OD1  . ASP A 1 45  ? 14.373  2.182  18.338  1.00 0.00  ? 45  ASP A OD1  4  
ATOM   8550  O  OD2  . ASP A 1 45  ? 14.586  4.234  17.710  1.00 0.00  ? 45  ASP A OD2  4  
ATOM   8551  H  H    . ASP A 1 45  ? 14.680  5.081  22.162  1.00 0.00  ? 45  ASP A H    4  
ATOM   8552  H  HA   . ASP A 1 45  ? 15.414  2.534  21.208  1.00 0.00  ? 45  ASP A HA   4  
ATOM   8553  H  HB2  . ASP A 1 45  ? 13.359  3.344  20.433  1.00 0.00  ? 45  ASP A HB2  4  
ATOM   8554  H  HB3  . ASP A 1 45  ? 14.032  4.916  20.010  1.00 0.00  ? 45  ASP A HB3  4  
ATOM   8555  N  N    . VAL A 1 46  ? 17.251  4.979  19.984  1.00 0.00  ? 46  VAL A N    4  
ATOM   8556  C  CA   . VAL A 1 46  ? 18.510  5.231  19.204  1.00 0.00  ? 46  VAL A CA   4  
ATOM   8557  C  C    . VAL A 1 46  ? 19.702  5.446  20.151  1.00 0.00  ? 46  VAL A C    4  
ATOM   8558  O  O    . VAL A 1 46  ? 20.689  6.049  19.783  1.00 0.00  ? 46  VAL A O    4  
ATOM   8559  C  CB   . VAL A 1 46  ? 18.359  6.477  18.308  1.00 0.00  ? 46  VAL A CB   4  
ATOM   8560  C  CG1  . VAL A 1 46  ? 18.116  7.728  19.155  1.00 0.00  ? 46  VAL A CG1  4  
ATOM   8561  C  CG2  . VAL A 1 46  ? 19.652  6.669  17.516  1.00 0.00  ? 46  VAL A CG2  4  
ATOM   8562  H  H    . VAL A 1 46  ? 16.806  5.715  20.451  1.00 0.00  ? 46  VAL A H    4  
ATOM   8563  H  HA   . VAL A 1 46  ? 18.713  4.374  18.577  1.00 0.00  ? 46  VAL A HA   4  
ATOM   8564  H  HB   . VAL A 1 46  ? 17.537  6.336  17.627  1.00 0.00  ? 46  VAL A HB   4  
ATOM   8565  H  HG11 . VAL A 1 46  ? 18.557  8.583  18.660  1.00 0.00  ? 46  VAL A HG11 4  
ATOM   8566  H  HG12 . VAL A 1 46  ? 18.572  7.603  20.124  1.00 0.00  ? 46  VAL A HG12 4  
ATOM   8567  H  HG13 . VAL A 1 46  ? 17.056  7.888  19.272  1.00 0.00  ? 46  VAL A HG13 4  
ATOM   8568  H  HG21 . VAL A 1 46  ? 20.141  5.715  17.389  1.00 0.00  ? 46  VAL A HG21 4  
ATOM   8569  H  HG22 . VAL A 1 46  ? 20.308  7.337  18.056  1.00 0.00  ? 46  VAL A HG22 4  
ATOM   8570  H  HG23 . VAL A 1 46  ? 19.425  7.089  16.548  1.00 0.00  ? 46  VAL A HG23 4  
ATOM   8571  N  N    . THR A 1 47  ? 19.635  4.952  21.357  1.00 0.00  ? 47  THR A N    4  
ATOM   8572  C  CA   . THR A 1 47  ? 20.787  5.137  22.291  1.00 0.00  ? 47  THR A CA   4  
ATOM   8573  C  C    . THR A 1 47  ? 20.557  4.333  23.579  1.00 0.00  ? 47  THR A C    4  
ATOM   8574  O  O    . THR A 1 47  ? 19.432  4.068  23.956  1.00 0.00  ? 47  THR A O    4  
ATOM   8575  C  CB   . THR A 1 47  ? 20.951  6.622  22.643  1.00 0.00  ? 47  THR A CB   4  
ATOM   8576  O  OG1  . THR A 1 47  ? 21.486  6.749  23.954  1.00 0.00  ? 47  THR A OG1  4  
ATOM   8577  C  CG2  . THR A 1 47  ? 19.598  7.294  22.589  1.00 0.00  ? 47  THR A CG2  4  
ATOM   8578  H  H    . THR A 1 47  ? 18.840  4.455  21.643  1.00 0.00  ? 47  THR A H    4  
ATOM   8579  H  HA   . THR A 1 47  ? 21.688  4.787  21.813  1.00 0.00  ? 47  THR A HA   4  
ATOM   8580  H  HB   . THR A 1 47  ? 21.612  7.096  21.935  1.00 0.00  ? 47  THR A HB   4  
ATOM   8581  H  HG1  . THR A 1 47  ? 22.250  7.330  23.904  1.00 0.00  ? 47  THR A HG1  4  
ATOM   8582  H  HG21 . THR A 1 47  ? 18.833  6.539  22.626  1.00 0.00  ? 47  THR A HG21 4  
ATOM   8583  H  HG22 . THR A 1 47  ? 19.516  7.854  21.673  1.00 0.00  ? 47  THR A HG22 4  
ATOM   8584  H  HG23 . THR A 1 47  ? 19.494  7.957  23.431  1.00 0.00  ? 47  THR A HG23 4  
ATOM   8585  N  N    . PRO A 1 48  ? 21.652  3.978  24.208  1.00 0.00  ? 48  PRO A N    4  
ATOM   8586  C  CA   . PRO A 1 48  ? 21.665  3.207  25.471  1.00 0.00  ? 48  PRO A CA   4  
ATOM   8587  C  C    . PRO A 1 48  ? 21.384  4.119  26.664  1.00 0.00  ? 48  PRO A C    4  
ATOM   8588  O  O    . PRO A 1 48  ? 21.572  3.740  27.805  1.00 0.00  ? 48  PRO A O    4  
ATOM   8589  C  CB   . PRO A 1 48  ? 23.103  2.686  25.548  1.00 0.00  ? 48  PRO A CB   4  
ATOM   8590  C  CG   . PRO A 1 48  ? 23.956  3.638  24.678  1.00 0.00  ? 48  PRO A CG   4  
ATOM   8591  C  CD   . PRO A 1 48  ? 22.989  4.325  23.699  1.00 0.00  ? 48  PRO A CD   4  
ATOM   8592  H  HA   . PRO A 1 48  ? 20.972  2.382  25.435  1.00 0.00  ? 48  PRO A HA   4  
ATOM   8593  H  HB2  . PRO A 1 48  ? 23.449  2.708  26.575  1.00 0.00  ? 48  PRO A HB2  4  
ATOM   8594  H  HB3  . PRO A 1 48  ? 23.161  1.684  25.156  1.00 0.00  ? 48  PRO A HB3  4  
ATOM   8595  H  HG2  . PRO A 1 48  ? 24.436  4.377  25.304  1.00 0.00  ? 48  PRO A HG2  4  
ATOM   8596  H  HG3  . PRO A 1 48  ? 24.694  3.077  24.129  1.00 0.00  ? 48  PRO A HG3  4  
ATOM   8597  H  HD2  . PRO A 1 48  ? 23.127  5.398  23.709  1.00 0.00  ? 48  PRO A HD2  4  
ATOM   8598  H  HD3  . PRO A 1 48  ? 23.112  3.935  22.702  1.00 0.00  ? 48  PRO A HD3  4  
ATOM   8599  N  N    . LEU A 1 49  ? 20.934  5.316  26.418  1.00 0.00  ? 49  LEU A N    4  
ATOM   8600  C  CA   . LEU A 1 49  ? 20.645  6.234  27.543  1.00 0.00  ? 49  LEU A CA   4  
ATOM   8601  C  C    . LEU A 1 49  ? 19.509  5.638  28.361  1.00 0.00  ? 49  LEU A C    4  
ATOM   8602  O  O    . LEU A 1 49  ? 18.653  4.959  27.835  1.00 0.00  ? 49  LEU A O    4  
ATOM   8603  C  CB   . LEU A 1 49  ? 20.223  7.586  26.985  1.00 0.00  ? 49  LEU A CB   4  
ATOM   8604  C  CG   . LEU A 1 49  ? 19.671  8.456  28.108  1.00 0.00  ? 49  LEU A CG   4  
ATOM   8605  C  CD1  . LEU A 1 49  ? 20.064  9.913  27.860  1.00 0.00  ? 49  LEU A CD1  4  
ATOM   8606  C  CD2  . LEU A 1 49  ? 18.150  8.313  28.129  1.00 0.00  ? 49  LEU A CD2  4  
ATOM   8607  H  H    . LEU A 1 49  ? 20.778  5.606  25.496  1.00 0.00  ? 49  LEU A H    4  
ATOM   8608  H  HA   . LEU A 1 49  ? 21.524  6.350  28.161  1.00 0.00  ? 49  LEU A HA   4  
ATOM   8609  H  HB2  . LEU A 1 49  ? 21.075  8.068  26.538  1.00 0.00  ? 49  LEU A HB2  4  
ATOM   8610  H  HB3  . LEU A 1 49  ? 19.457  7.438  26.237  1.00 0.00  ? 49  LEU A HB3  4  
ATOM   8611  H  HG   . LEU A 1 49  ? 20.081  8.131  29.050  1.00 0.00  ? 49  LEU A HG   4  
ATOM   8612  H  HD11 . LEU A 1 49  ? 19.318  10.392 27.242  1.00 0.00  ? 49  LEU A HD11 4  
ATOM   8613  H  HD12 . LEU A 1 49  ? 21.019  9.943  27.363  1.00 0.00  ? 49  LEU A HD12 4  
ATOM   8614  H  HD13 . LEU A 1 49  ? 20.138  10.431 28.802  1.00 0.00  ? 49  LEU A HD13 4  
ATOM   8615  H  HD21 . LEU A 1 49  ? 17.887  7.415  28.669  1.00 0.00  ? 49  LEU A HD21 4  
ATOM   8616  H  HD22 . LEU A 1 49  ? 17.781  8.242  27.115  1.00 0.00  ? 49  LEU A HD22 4  
ATOM   8617  H  HD23 . LEU A 1 49  ? 17.711  9.170  28.615  1.00 0.00  ? 49  LEU A HD23 4  
ATOM   8618  N  N    . ARG A 1 50  ? 19.488  5.875  29.638  1.00 0.00  ? 50  ARG A N    4  
ATOM   8619  C  CA   . ARG A 1 50  ? 18.396  5.296  30.467  1.00 0.00  ? 50  ARG A CA   4  
ATOM   8620  C  C    . ARG A 1 50  ? 17.461  6.406  30.937  1.00 0.00  ? 50  ARG A C    4  
ATOM   8621  O  O    . ARG A 1 50  ? 17.891  7.473  31.328  1.00 0.00  ? 50  ARG A O    4  
ATOM   8622  C  CB   . ARG A 1 50  ? 18.998  4.595  31.689  1.00 0.00  ? 50  ARG A CB   4  
ATOM   8623  C  CG   . ARG A 1 50  ? 18.492  3.153  31.767  1.00 0.00  ? 50  ARG A CG   4  
ATOM   8624  C  CD   . ARG A 1 50  ? 19.509  2.240  31.089  1.00 0.00  ? 50  ARG A CD   4  
ATOM   8625  N  NE   . ARG A 1 50  ? 19.074  0.819  31.176  1.00 0.00  ? 50  ARG A NE   4  
ATOM   8626  C  CZ   . ARG A 1 50  ? 19.834  -0.112 30.673  1.00 0.00  ? 50  ARG A CZ   4  
ATOM   8627  N  NH1  . ARG A 1 50  ? 20.999  0.203  30.176  1.00 0.00  ? 50  ARG A NH1  4  
ATOM   8628  N  NH2  . ARG A 1 50  ? 19.449  -1.357 30.690  1.00 0.00  ? 50  ARG A NH2  4  
ATOM   8629  H  H    . ARG A 1 50  ? 20.189  6.422  30.052  1.00 0.00  ? 50  ARG A H    4  
ATOM   8630  H  HA   . ARG A 1 50  ? 17.840  4.581  29.878  1.00 0.00  ? 50  ARG A HA   4  
ATOM   8631  H  HB2  . ARG A 1 50  ? 20.076  4.587  31.604  1.00 0.00  ? 50  ARG A HB2  4  
ATOM   8632  H  HB3  . ARG A 1 50  ? 18.711  5.124  32.586  1.00 0.00  ? 50  ARG A HB3  4  
ATOM   8633  H  HG2  . ARG A 1 50  ? 18.380  2.865  32.804  1.00 0.00  ? 50  ARG A HG2  4  
ATOM   8634  H  HG3  . ARG A 1 50  ? 17.540  3.072  31.262  1.00 0.00  ? 50  ARG A HG3  4  
ATOM   8635  H  HD2  . ARG A 1 50  ? 19.602  2.518  30.051  1.00 0.00  ? 50  ARG A HD2  4  
ATOM   8636  H  HD3  . ARG A 1 50  ? 20.465  2.352  31.578  1.00 0.00  ? 50  ARG A HD3  4  
ATOM   8637  H  HE   . ARG A 1 50  ? 18.210  0.588  31.581  1.00 0.00  ? 50  ARG A HE   4  
ATOM   8638  H  HH11 . ARG A 1 50  ? 21.310  1.152  30.187  1.00 0.00  ? 50  ARG A HH11 4  
ATOM   8639  H  HH12 . ARG A 1 50  ? 21.579  -0.507 29.779  1.00 0.00  ? 50  ARG A HH12 4  
ATOM   8640  H  HH21 . ARG A 1 50  ? 18.569  -1.603 31.090  1.00 0.00  ? 50  ARG A HH21 4  
ATOM   8641  H  HH22 . ARG A 1 50  ? 20.036  -2.065 30.296  1.00 0.00  ? 50  ARG A HH22 4  
ATOM   8642  N  N    . PHE A 1 51  ? 16.183  6.159  30.917  1.00 0.00  ? 51  PHE A N    4  
ATOM   8643  C  CA   . PHE A 1 51  ? 15.229  7.201  31.386  1.00 0.00  ? 51  PHE A CA   4  
ATOM   8644  C  C    . PHE A 1 51  ? 14.484  6.683  32.613  1.00 0.00  ? 51  PHE A C    4  
ATOM   8645  O  O    . PHE A 1 51  ? 14.030  5.557  32.646  1.00 0.00  ? 51  PHE A O    4  
ATOM   8646  C  CB   . PHE A 1 51  ? 14.206  7.521  30.301  1.00 0.00  ? 51  PHE A CB   4  
ATOM   8647  C  CG   . PHE A 1 51  ? 14.797  8.497  29.318  1.00 0.00  ? 51  PHE A CG   4  
ATOM   8648  C  CD1  . PHE A 1 51  ? 15.148  9.787  29.734  1.00 0.00  ? 51  PHE A CD1  4  
ATOM   8649  C  CD2  . PHE A 1 51  ? 15.003  8.108  27.990  1.00 0.00  ? 51  PHE A CD2  4  
ATOM   8650  C  CE1  . PHE A 1 51  ? 15.695  10.692 28.818  1.00 0.00  ? 51  PHE A CE1  4  
ATOM   8651  C  CE2  . PHE A 1 51  ? 15.552  9.011  27.074  1.00 0.00  ? 51  PHE A CE2  4  
ATOM   8652  C  CZ   . PHE A 1 51  ? 15.903  10.301 27.488  1.00 0.00  ? 51  PHE A CZ   4  
ATOM   8653  H  H    . PHE A 1 51  ? 15.854  5.289  30.607  1.00 0.00  ? 51  PHE A H    4  
ATOM   8654  H  HA   . PHE A 1 51  ? 15.775  8.095  31.644  1.00 0.00  ? 51  PHE A HA   4  
ATOM   8655  H  HB2  . PHE A 1 51  ? 13.927  6.615  29.792  1.00 0.00  ? 51  PHE A HB2  4  
ATOM   8656  H  HB3  . PHE A 1 51  ? 13.333  7.959  30.761  1.00 0.00  ? 51  PHE A HB3  4  
ATOM   8657  H  HD1  . PHE A 1 51  ? 14.990  10.087 30.760  1.00 0.00  ? 51  PHE A HD1  4  
ATOM   8658  H  HD2  . PHE A 1 51  ? 14.729  7.112  27.672  1.00 0.00  ? 51  PHE A HD2  4  
ATOM   8659  H  HE1  . PHE A 1 51  ? 15.963  11.687 29.136  1.00 0.00  ? 51  PHE A HE1  4  
ATOM   8660  H  HE2  . PHE A 1 51  ? 15.713  8.709  26.050  1.00 0.00  ? 51  PHE A HE2  4  
ATOM   8661  H  HZ   . PHE A 1 51  ? 16.329  10.998 26.784  1.00 0.00  ? 51  PHE A HZ   4  
ATOM   8662  N  N    . SER A 1 52  ? 14.342  7.492  33.618  1.00 0.00  ? 52  SER A N    4  
ATOM   8663  C  CA   . SER A 1 52  ? 13.612  7.029  34.832  1.00 0.00  ? 52  SER A CA   4  
ATOM   8664  C  C    . SER A 1 52  ? 12.520  8.037  35.214  1.00 0.00  ? 52  SER A C    4  
ATOM   8665  O  O    . SER A 1 52  ? 12.797  9.177  35.529  1.00 0.00  ? 52  SER A O    4  
ATOM   8666  C  CB   . SER A 1 52  ? 14.579  6.880  36.003  1.00 0.00  ? 52  SER A CB   4  
ATOM   8667  O  OG   . SER A 1 52  ? 13.925  6.167  37.040  1.00 0.00  ? 52  SER A OG   4  
ATOM   8668  H  H    . SER A 1 52  ? 14.712  8.400  33.569  1.00 0.00  ? 52  SER A H    4  
ATOM   8669  H  HA   . SER A 1 52  ? 13.155  6.075  34.627  1.00 0.00  ? 52  SER A HA   4  
ATOM   8670  H  HB2  . SER A 1 52  ? 15.454  6.334  35.690  1.00 0.00  ? 52  SER A HB2  4  
ATOM   8671  H  HB3  . SER A 1 52  ? 14.873  7.861  36.358  1.00 0.00  ? 52  SER A HB3  4  
ATOM   8672  H  HG   . SER A 1 52  ? 13.013  6.464  37.070  1.00 0.00  ? 52  SER A HG   4  
ATOM   8673  N  N    . ARG A 1 53  ? 11.281  7.623  35.209  1.00 0.00  ? 53  ARG A N    4  
ATOM   8674  C  CA   . ARG A 1 53  ? 10.186  8.558  35.593  1.00 0.00  ? 53  ARG A CA   4  
ATOM   8675  C  C    . ARG A 1 53  ? 9.931   8.403  37.098  1.00 0.00  ? 53  ARG A C    4  
ATOM   8676  O  O    . ARG A 1 53  ? 9.814   7.306  37.602  1.00 0.00  ? 53  ARG A O    4  
ATOM   8677  C  CB   . ARG A 1 53  ? 8.918   8.216  34.800  1.00 0.00  ? 53  ARG A CB   4  
ATOM   8678  C  CG   . ARG A 1 53  ? 9.308   7.819  33.374  1.00 0.00  ? 53  ARG A CG   4  
ATOM   8679  C  CD   . ARG A 1 53  ? 8.083   7.293  32.626  1.00 0.00  ? 53  ARG A CD   4  
ATOM   8680  N  NE   . ARG A 1 53  ? 8.140   5.809  32.556  1.00 0.00  ? 53  ARG A NE   4  
ATOM   8681  C  CZ   . ARG A 1 53  ? 7.068   5.130  32.266  1.00 0.00  ? 53  ARG A CZ   4  
ATOM   8682  N  NH1  . ARG A 1 53  ? 5.961   5.753  31.949  1.00 0.00  ? 53  ARG A NH1  4  
ATOM   8683  N  NH2  . ARG A 1 53  ? 7.116   3.828  32.259  1.00 0.00  ? 53  ARG A NH2  4  
ATOM   8684  H  H    . ARG A 1 53  ? 11.073  6.695  34.966  1.00 0.00  ? 53  ARG A H    4  
ATOM   8685  H  HA   . ARG A 1 53  ? 10.489  9.573  35.376  1.00 0.00  ? 53  ARG A HA   4  
ATOM   8686  H  HB2  . ARG A 1 53  ? 8.404   7.394  35.275  1.00 0.00  ? 53  ARG A HB2  4  
ATOM   8687  H  HB3  . ARG A 1 53  ? 8.268   9.079  34.764  1.00 0.00  ? 53  ARG A HB3  4  
ATOM   8688  H  HG2  . ARG A 1 53  ? 9.699   8.684  32.857  1.00 0.00  ? 53  ARG A HG2  4  
ATOM   8689  H  HG3  . ARG A 1 53  ? 10.065  7.049  33.412  1.00 0.00  ? 53  ARG A HG3  4  
ATOM   8690  H  HD2  . ARG A 1 53  ? 7.185   7.590  33.148  1.00 0.00  ? 53  ARG A HD2  4  
ATOM   8691  H  HD3  . ARG A 1 53  ? 8.070   7.700  31.627  1.00 0.00  ? 53  ARG A HD3  4  
ATOM   8692  H  HE   . ARG A 1 53  ? 8.977   5.339  32.758  1.00 0.00  ? 53  ARG A HE   4  
ATOM   8693  H  HH11 . ARG A 1 53  ? 5.937   6.753  31.926  1.00 0.00  ? 53  ARG A HH11 4  
ATOM   8694  H  HH12 . ARG A 1 53  ? 5.140   5.231  31.722  1.00 0.00  ? 53  ARG A HH12 4  
ATOM   8695  H  HH21 . ARG A 1 53  ? 7.976   3.362  32.465  1.00 0.00  ? 53  ARG A HH21 4  
ATOM   8696  H  HH22 . ARG A 1 53  ? 6.292   3.297  32.065  1.00 0.00  ? 53  ARG A HH22 4  
ATOM   8697  N  N    . ILE A 1 54  ? 9.863   9.480  37.829  1.00 0.00  ? 54  ILE A N    4  
ATOM   8698  C  CA   . ILE A 1 54  ? 9.635   9.353  39.295  1.00 0.00  ? 54  ILE A CA   4  
ATOM   8699  C  C    . ILE A 1 54  ? 8.440   10.208 39.701  1.00 0.00  ? 54  ILE A C    4  
ATOM   8700  O  O    . ILE A 1 54  ? 8.178   11.239 39.115  1.00 0.00  ? 54  ILE A O    4  
ATOM   8701  C  CB   . ILE A 1 54  ? 10.887  9.815  40.040  1.00 0.00  ? 54  ILE A CB   4  
ATOM   8702  C  CG1  . ILE A 1 54  ? 11.292  11.200 39.548  1.00 0.00  ? 54  ILE A CG1  4  
ATOM   8703  C  CG2  . ILE A 1 54  ? 12.029  8.840  39.760  1.00 0.00  ? 54  ILE A CG2  4  
ATOM   8704  C  CD1  . ILE A 1 54  ? 12.224  11.837 40.576  1.00 0.00  ? 54  ILE A CD1  4  
ATOM   8705  H  H    . ILE A 1 54  ? 9.972   10.369 37.422  1.00 0.00  ? 54  ILE A H    4  
ATOM   8706  H  HA   . ILE A 1 54  ? 9.435   8.322  39.539  1.00 0.00  ? 54  ILE A HA   4  
ATOM   8707  H  HB   . ILE A 1 54  ? 10.688  9.850  41.102  1.00 0.00  ? 54  ILE A HB   4  
ATOM   8708  H  HG12 . ILE A 1 54  ? 11.804  11.107 38.602  1.00 0.00  ? 54  ILE A HG12 4  
ATOM   8709  H  HG13 . ILE A 1 54  ? 10.414  11.813 39.425  1.00 0.00  ? 54  ILE A HG13 4  
ATOM   8710  H  HG21 . ILE A 1 54  ? 12.950  9.238  40.163  1.00 0.00  ? 54  ILE A HG21 4  
ATOM   8711  H  HG22 . ILE A 1 54  ? 12.131  8.706  38.693  1.00 0.00  ? 54  ILE A HG22 4  
ATOM   8712  H  HG23 . ILE A 1 54  ? 11.813  7.889  40.223  1.00 0.00  ? 54  ILE A HG23 4  
ATOM   8713  H  HD11 . ILE A 1 54  ? 12.410  11.133 41.375  1.00 0.00  ? 54  ILE A HD11 4  
ATOM   8714  H  HD12 . ILE A 1 54  ? 11.764  12.726 40.977  1.00 0.00  ? 54  ILE A HD12 4  
ATOM   8715  H  HD13 . ILE A 1 54  ? 13.156  12.095 40.099  1.00 0.00  ? 54  ILE A HD13 4  
ATOM   8716  N  N    . HIS A 1 55  ? 7.713   9.790  40.696  1.00 0.00  ? 55  HIS A N    4  
ATOM   8717  C  CA   . HIS A 1 55  ? 6.537   10.588 41.127  1.00 0.00  ? 55  HIS A CA   4  
ATOM   8718  C  C    . HIS A 1 55  ? 6.839   11.227 42.482  1.00 0.00  ? 55  HIS A C    4  
ATOM   8719  O  O    . HIS A 1 55  ? 6.153   12.132 42.918  1.00 0.00  ? 55  HIS A O    4  
ATOM   8720  C  CB   . HIS A 1 55  ? 5.290   9.695  41.241  1.00 0.00  ? 55  HIS A CB   4  
ATOM   8721  C  CG   . HIS A 1 55  ? 5.437   8.480  40.369  1.00 0.00  ? 55  HIS A CG   4  
ATOM   8722  N  ND1  . HIS A 1 55  ? 5.134   7.206  40.824  1.00 0.00  ? 55  HIS A ND1  4  
ATOM   8723  C  CD2  . HIS A 1 55  ? 5.854   8.325  39.071  1.00 0.00  ? 55  HIS A CD2  4  
ATOM   8724  C  CE1  . HIS A 1 55  ? 5.373   6.348  39.816  1.00 0.00  ? 55  HIS A CE1  4  
ATOM   8725  N  NE2  . HIS A 1 55  ? 5.813   6.978  38.723  1.00 0.00  ? 55  HIS A NE2  4  
ATOM   8726  H  H    . HIS A 1 55  ? 7.941   8.956  41.159  1.00 0.00  ? 55  HIS A H    4  
ATOM   8727  H  HA   . HIS A 1 55  ? 6.355   11.368 40.401  1.00 0.00  ? 55  HIS A HA   4  
ATOM   8728  H  HB2  . HIS A 1 55  ? 5.161   9.384  42.267  1.00 0.00  ? 55  HIS A HB2  4  
ATOM   8729  H  HB3  . HIS A 1 55  ? 4.421   10.255 40.925  1.00 0.00  ? 55  HIS A HB3  4  
ATOM   8730  H  HD1  . HIS A 1 55  ? 4.796   6.975  41.715  1.00 0.00  ? 55  HIS A HD1  4  
ATOM   8731  H  HD2  . HIS A 1 55  ? 6.167   9.127  38.419  1.00 0.00  ? 55  HIS A HD2  4  
ATOM   8732  H  HE1  . HIS A 1 55  ? 5.238   5.277  39.888  1.00 0.00  ? 55  HIS A HE1  4  
ATOM   8733  N  N    . ASP A 1 56  ? 7.862   10.775 43.156  1.00 0.00  ? 56  ASP A N    4  
ATOM   8734  C  CA   . ASP A 1 56  ? 8.188   11.373 44.476  1.00 0.00  ? 56  ASP A CA   4  
ATOM   8735  C  C    . ASP A 1 56  ? 9.697   11.619 44.580  1.00 0.00  ? 56  ASP A C    4  
ATOM   8736  O  O    . ASP A 1 56  ? 10.416  11.554 43.606  1.00 0.00  ? 56  ASP A O    4  
ATOM   8737  C  CB   . ASP A 1 56  ? 7.748   10.417 45.575  1.00 0.00  ? 56  ASP A CB   4  
ATOM   8738  C  CG   . ASP A 1 56  ? 6.217   10.393 45.633  1.00 0.00  ? 56  ASP A CG   4  
ATOM   8739  O  OD1  . ASP A 1 56  ? 5.649   11.357 46.113  1.00 0.00  ? 56  ASP A OD1  4  
ATOM   8740  O  OD2  . ASP A 1 56  ? 5.638   9.411  45.193  1.00 0.00  ? 56  ASP A OD2  4  
ATOM   8741  H  H    . ASP A 1 56  ? 8.409   10.045 42.796  1.00 0.00  ? 56  ASP A H    4  
ATOM   8742  H  HA   . ASP A 1 56  ? 7.661   12.310 44.584  1.00 0.00  ? 56  ASP A HA   4  
ATOM   8743  H  HB2  . ASP A 1 56  ? 8.121   9.425  45.358  1.00 0.00  ? 56  ASP A HB2  4  
ATOM   8744  H  HB3  . ASP A 1 56  ? 8.140   10.755 46.520  1.00 0.00  ? 56  ASP A HB3  4  
ATOM   8745  N  N    . GLY A 1 57  ? 10.185  11.903 45.758  1.00 0.00  ? 57  GLY A N    4  
ATOM   8746  C  CA   . GLY A 1 57  ? 11.649  12.155 45.914  1.00 0.00  ? 57  GLY A CA   4  
ATOM   8747  C  C    . GLY A 1 57  ? 12.084  13.282 44.967  1.00 0.00  ? 57  GLY A C    4  
ATOM   8748  O  O    . GLY A 1 57  ? 11.267  13.945 44.359  1.00 0.00  ? 57  GLY A O    4  
ATOM   8749  H  H    . GLY A 1 57  ? 9.591   11.952 46.539  1.00 0.00  ? 57  GLY A H    4  
ATOM   8750  H  HA2  . GLY A 1 57  ? 11.857  12.438 46.936  1.00 0.00  ? 57  GLY A HA2  4  
ATOM   8751  H  HA3  . GLY A 1 57  ? 12.193  11.256 45.674  1.00 0.00  ? 57  GLY A HA3  4  
ATOM   8752  N  N    . GLU A 1 58  ? 13.370  13.507 44.844  1.00 0.00  ? 58  GLU A N    4  
ATOM   8753  C  CA   . GLU A 1 58  ? 13.869  14.592 43.946  1.00 0.00  ? 58  GLU A CA   4  
ATOM   8754  C  C    . GLU A 1 58  ? 13.848  14.129 42.491  1.00 0.00  ? 58  GLU A C    4  
ATOM   8755  O  O    . GLU A 1 58  ? 13.850  12.951 42.203  1.00 0.00  ? 58  GLU A O    4  
ATOM   8756  C  CB   . GLU A 1 58  ? 15.305  14.949 44.339  1.00 0.00  ? 58  GLU A CB   4  
ATOM   8757  C  CG   . GLU A 1 58  ? 15.442  16.468 44.410  1.00 0.00  ? 58  GLU A CG   4  
ATOM   8758  C  CD   . GLU A 1 58  ? 14.358  17.017 45.339  1.00 0.00  ? 58  GLU A CD   4  
ATOM   8759  O  OE1  . GLU A 1 58  ? 14.401  16.700 46.518  1.00 0.00  ? 58  GLU A OE1  4  
ATOM   8760  O  OE2  . GLU A 1 58  ? 13.497  17.731 44.852  1.00 0.00  ? 58  GLU A OE2  4  
ATOM   8761  H  H    . GLU A 1 58  ? 14.010  12.964 45.348  1.00 0.00  ? 58  GLU A H    4  
ATOM   8762  H  HA   . GLU A 1 58  ? 13.241  15.464 44.053  1.00 0.00  ? 58  GLU A HA   4  
ATOM   8763  H  HB2  . GLU A 1 58  ? 15.530  14.521 45.302  1.00 0.00  ? 58  GLU A HB2  4  
ATOM   8764  H  HB3  . GLU A 1 58  ? 15.992  14.561 43.601  1.00 0.00  ? 58  GLU A HB3  4  
ATOM   8765  H  HG2  . GLU A 1 58  ? 16.418  16.728 44.793  1.00 0.00  ? 58  GLU A HG2  4  
ATOM   8766  H  HG3  . GLU A 1 58  ? 15.319  16.888 43.421  1.00 0.00  ? 58  GLU A HG3  4  
ATOM   8767  N  N    . ALA A 1 59  ? 13.832  15.055 41.571  1.00 0.00  ? 59  ALA A N    4  
ATOM   8768  C  CA   . ALA A 1 59  ? 13.813  14.683 40.131  1.00 0.00  ? 59  ALA A CA   4  
ATOM   8769  C  C    . ALA A 1 59  ? 14.794  15.575 39.377  1.00 0.00  ? 59  ALA A C    4  
ATOM   8770  O  O    . ALA A 1 59  ? 15.680  16.166 39.959  1.00 0.00  ? 59  ALA A O    4  
ATOM   8771  C  CB   . ALA A 1 59  ? 12.401  14.879 39.582  1.00 0.00  ? 59  ALA A CB   4  
ATOM   8772  H  H    . ALA A 1 59  ? 13.833  16.000 41.831  1.00 0.00  ? 59  ALA A H    4  
ATOM   8773  H  HA   . ALA A 1 59  ? 14.106  13.651 40.018  1.00 0.00  ? 59  ALA A HA   4  
ATOM   8774  H  HB1  . ALA A 1 59  ? 12.228  15.928 39.399  1.00 0.00  ? 59  ALA A HB1  4  
ATOM   8775  H  HB2  . ALA A 1 59  ? 11.684  14.516 40.302  1.00 0.00  ? 59  ALA A HB2  4  
ATOM   8776  H  HB3  . ALA A 1 59  ? 12.292  14.330 38.656  1.00 0.00  ? 59  ALA A HB3  4  
ATOM   8777  N  N    . ASP A 1 60  ? 14.648  15.682 38.090  1.00 0.00  ? 60  ASP A N    4  
ATOM   8778  C  CA   . ASP A 1 60  ? 15.582  16.543 37.318  1.00 0.00  ? 60  ASP A CA   4  
ATOM   8779  C  C    . ASP A 1 60  ? 14.792  17.410 36.346  1.00 0.00  ? 60  ASP A C    4  
ATOM   8780  O  O    . ASP A 1 60  ? 14.889  18.621 36.359  1.00 0.00  ? 60  ASP A O    4  
ATOM   8781  C  CB   . ASP A 1 60  ? 16.571  15.677 36.531  1.00 0.00  ? 60  ASP A CB   4  
ATOM   8782  C  CG   . ASP A 1 60  ? 16.810  14.359 37.266  1.00 0.00  ? 60  ASP A CG   4  
ATOM   8783  O  OD1  . ASP A 1 60  ? 16.922  14.393 38.478  1.00 0.00  ? 60  ASP A OD1  4  
ATOM   8784  O  OD2  . ASP A 1 60  ? 16.889  13.339 36.601  1.00 0.00  ? 60  ASP A OD2  4  
ATOM   8785  H  H    . ASP A 1 60  ? 13.925  15.201 37.633  1.00 0.00  ? 60  ASP A H    4  
ATOM   8786  H  HA   . ASP A 1 60  ? 16.128  17.179 38.000  1.00 0.00  ? 60  ASP A HA   4  
ATOM   8787  H  HB2  . ASP A 1 60  ? 16.169  15.476 35.547  1.00 0.00  ? 60  ASP A HB2  4  
ATOM   8788  H  HB3  . ASP A 1 60  ? 17.506  16.205 36.433  1.00 0.00  ? 60  ASP A HB3  4  
ATOM   8789  N  N    . ILE A 1 61  ? 14.024  16.799 35.493  1.00 0.00  ? 61  ILE A N    4  
ATOM   8790  C  CA   . ILE A 1 61  ? 13.244  17.590 34.507  1.00 0.00  ? 61  ILE A CA   4  
ATOM   8791  C  C    . ILE A 1 61  ? 11.806  17.766 34.986  1.00 0.00  ? 61  ILE A C    4  
ATOM   8792  O  O    . ILE A 1 61  ? 11.281  16.949 35.712  1.00 0.00  ? 61  ILE A O    4  
ATOM   8793  C  CB   . ILE A 1 61  ? 13.241  16.872 33.165  1.00 0.00  ? 61  ILE A CB   4  
ATOM   8794  C  CG1  . ILE A 1 61  ? 14.562  16.126 32.977  1.00 0.00  ? 61  ILE A CG1  4  
ATOM   8795  C  CG2  . ILE A 1 61  ? 13.080  17.906 32.060  1.00 0.00  ? 61  ILE A CG2  4  
ATOM   8796  C  CD1  . ILE A 1 61  ? 14.450  15.176 31.783  1.00 0.00  ? 61  ILE A CD1  4  
ATOM   8797  H  H    . ILE A 1 61  ? 13.972  15.819 35.495  1.00 0.00  ? 61  ILE A H    4  
ATOM   8798  H  HA   . ILE A 1 61  ? 13.703  18.556 34.390  1.00 0.00  ? 61  ILE A HA   4  
ATOM   8799  H  HB   . ILE A 1 61  ? 12.416  16.173 33.133  1.00 0.00  ? 61  ILE A HB   4  
ATOM   8800  H  HG12 . ILE A 1 61  ? 15.353  16.842 32.799  1.00 0.00  ? 61  ILE A HG12 4  
ATOM   8801  H  HG13 . ILE A 1 61  ? 14.785  15.557 33.868  1.00 0.00  ? 61  ILE A HG13 4  
ATOM   8802  H  HG21 . ILE A 1 61  ? 12.497  18.736 32.429  1.00 0.00  ? 61  ILE A HG21 4  
ATOM   8803  H  HG22 . ILE A 1 61  ? 12.579  17.458 31.216  1.00 0.00  ? 61  ILE A HG22 4  
ATOM   8804  H  HG23 . ILE A 1 61  ? 14.055  18.258 31.756  1.00 0.00  ? 61  ILE A HG23 4  
ATOM   8805  H  HD11 . ILE A 1 61  ? 15.242  15.387 31.077  1.00 0.00  ? 61  ILE A HD11 4  
ATOM   8806  H  HD12 . ILE A 1 61  ? 13.491  15.312 31.301  1.00 0.00  ? 61  ILE A HD12 4  
ATOM   8807  H  HD13 . ILE A 1 61  ? 14.537  14.156 32.127  1.00 0.00  ? 61  ILE A HD13 4  
ATOM   8808  N  N    . MET A 1 62  ? 11.159  18.826 34.592  1.00 0.00  ? 62  MET A N    4  
ATOM   8809  C  CA   . MET A 1 62  ? 9.753   19.028 35.048  1.00 0.00  ? 62  MET A CA   4  
ATOM   8810  C  C    . MET A 1 62  ? 8.807   19.073 33.846  1.00 0.00  ? 62  MET A C    4  
ATOM   8811  O  O    . MET A 1 62  ? 8.962   19.879 32.950  1.00 0.00  ? 62  MET A O    4  
ATOM   8812  C  CB   . MET A 1 62  ? 9.669   20.336 35.835  1.00 0.00  ? 62  MET A CB   4  
ATOM   8813  C  CG   . MET A 1 62  ? 10.412  20.175 37.164  1.00 0.00  ? 62  MET A CG   4  
ATOM   8814  S  SD   . MET A 1 62  ? 10.379  21.750 38.059  1.00 0.00  ? 62  MET A SD   4  
ATOM   8815  C  CE   . MET A 1 62  ? 11.485  21.285 39.415  1.00 0.00  ? 62  MET A CE   4  
ATOM   8816  H  H    . MET A 1 62  ? 11.597  19.487 34.002  1.00 0.00  ? 62  MET A H    4  
ATOM   8817  H  HA   . MET A 1 62  ? 9.470   18.209 35.691  1.00 0.00  ? 62  MET A HA   4  
ATOM   8818  H  HB2  . MET A 1 62  ? 10.123  21.133 35.264  1.00 0.00  ? 62  MET A HB2  4  
ATOM   8819  H  HB3  . MET A 1 62  ? 8.634   20.577 36.032  1.00 0.00  ? 62  MET A HB3  4  
ATOM   8820  H  HG2  . MET A 1 62  ? 9.929   19.411 37.757  1.00 0.00  ? 62  MET A HG2  4  
ATOM   8821  H  HG3  . MET A 1 62  ? 11.436  19.890 36.974  1.00 0.00  ? 62  MET A HG3  4  
ATOM   8822  H  HE1  . MET A 1 62  ? 12.449  21.752 39.266  1.00 0.00  ? 62  MET A HE1  4  
ATOM   8823  H  HE2  . MET A 1 62  ? 11.607  20.214 39.434  1.00 0.00  ? 62  MET A HE2  4  
ATOM   8824  H  HE3  . MET A 1 62  ? 11.060  21.617 40.353  1.00 0.00  ? 62  MET A HE3  4  
ATOM   8825  N  N    . ILE A 1 63  ? 7.818   18.219 33.810  1.00 0.00  ? 63  ILE A N    4  
ATOM   8826  C  CA   . ILE A 1 63  ? 6.881   18.251 32.653  1.00 0.00  ? 63  ILE A CA   4  
ATOM   8827  C  C    . ILE A 1 63  ? 5.472   18.582 33.133  1.00 0.00  ? 63  ILE A C    4  
ATOM   8828  O  O    . ILE A 1 63  ? 5.040   18.135 34.179  1.00 0.00  ? 63  ILE A O    4  
ATOM   8829  C  CB   . ILE A 1 63  ? 6.853   16.903 31.930  1.00 0.00  ? 63  ILE A CB   4  
ATOM   8830  C  CG1  . ILE A 1 63  ? 8.278   16.387 31.729  1.00 0.00  ? 63  ILE A CG1  4  
ATOM   8831  C  CG2  . ILE A 1 63  ? 6.193   17.101 30.566  1.00 0.00  ? 63  ILE A CG2  4  
ATOM   8832  C  CD1  . ILE A 1 63  ? 8.487   15.129 32.570  1.00 0.00  ? 63  ILE A CD1  4  
ATOM   8833  H  H    . ILE A 1 63  ? 7.689   17.572 34.538  1.00 0.00  ? 63  ILE A H    4  
ATOM   8834  H  HA   . ILE A 1 63  ? 7.205   19.014 31.964  1.00 0.00  ? 63  ILE A HA   4  
ATOM   8835  H  HB   . ILE A 1 63  ? 6.283   16.191 32.512  1.00 0.00  ? 63  ILE A HB   4  
ATOM   8836  H  HG12 . ILE A 1 63  ? 8.427   16.149 30.686  1.00 0.00  ? 63  ILE A HG12 4  
ATOM   8837  H  HG13 . ILE A 1 63  ? 8.986   17.145 32.032  1.00 0.00  ? 63  ILE A HG13 4  
ATOM   8838  H  HG21 . ILE A 1 63  ? 6.874   16.788 29.788  1.00 0.00  ? 63  ILE A HG21 4  
ATOM   8839  H  HG22 . ILE A 1 63  ? 5.951   18.145 30.435  1.00 0.00  ? 63  ILE A HG22 4  
ATOM   8840  H  HG23 . ILE A 1 63  ? 5.289   16.515 30.511  1.00 0.00  ? 63  ILE A HG23 4  
ATOM   8841  H  HD11 . ILE A 1 63  ? 8.274   14.258 31.972  1.00 0.00  ? 63  ILE A HD11 4  
ATOM   8842  H  HD12 . ILE A 1 63  ? 7.823   15.150 33.421  1.00 0.00  ? 63  ILE A HD12 4  
ATOM   8843  H  HD13 . ILE A 1 63  ? 9.511   15.090 32.911  1.00 0.00  ? 63  ILE A HD13 4  
ATOM   8844  N  N    . ASN A 1 64  ? 4.745   19.354 32.370  1.00 0.00  ? 64  ASN A N    4  
ATOM   8845  C  CA   . ASN A 1 64  ? 3.368   19.698 32.776  1.00 0.00  ? 64  ASN A CA   4  
ATOM   8846  C  C    . ASN A 1 64  ? 2.758   20.705 31.785  1.00 0.00  ? 64  ASN A C    4  
ATOM   8847  O  O    . ASN A 1 64  ? 3.335   21.009 30.764  1.00 0.00  ? 64  ASN A O    4  
ATOM   8848  C  CB   . ASN A 1 64  ? 3.390   20.267 34.193  1.00 0.00  ? 64  ASN A CB   4  
ATOM   8849  C  CG   . ASN A 1 64  ? 4.581   21.212 34.344  1.00 0.00  ? 64  ASN A CG   4  
ATOM   8850  O  OD1  . ASN A 1 64  ? 5.719   20.787 34.371  1.00 0.00  ? 64  ASN A OD1  4  
ATOM   8851  N  ND2  . ASN A 1 64  ? 4.364   22.491 34.444  1.00 0.00  ? 64  ASN A ND2  4  
ATOM   8852  H  H    . ASN A 1 64  ? 5.101   19.696 31.529  1.00 0.00  ? 64  ASN A H    4  
ATOM   8853  H  HA   . ASN A 1 64  ? 2.785   18.800 32.763  1.00 0.00  ? 64  ASN A HA   4  
ATOM   8854  H  HB2  . ASN A 1 64  ? 2.473   20.805 34.382  1.00 0.00  ? 64  ASN A HB2  4  
ATOM   8855  H  HB3  . ASN A 1 64  ? 3.484   19.456 34.902  1.00 0.00  ? 64  ASN A HB3  4  
ATOM   8856  H  HD21 . ASN A 1 64  ? 3.447   22.831 34.422  1.00 0.00  ? 64  ASN A HD21 4  
ATOM   8857  H  HD22 . ASN A 1 64  ? 5.116   23.109 34.542  1.00 0.00  ? 64  ASN A HD22 4  
ATOM   8858  N  N    . PHE A 1 65  ? 1.578   21.193 32.062  1.00 0.00  ? 65  PHE A N    4  
ATOM   8859  C  CA   . PHE A 1 65  ? 0.906   22.144 31.117  1.00 0.00  ? 65  PHE A CA   4  
ATOM   8860  C  C    . PHE A 1 65  ? 1.277   23.607 31.445  1.00 0.00  ? 65  PHE A C    4  
ATOM   8861  O  O    . PHE A 1 65  ? 2.188   23.863 32.204  1.00 0.00  ? 65  PHE A O    4  
ATOM   8862  C  CB   . PHE A 1 65  ? -0.604  21.949 31.248  1.00 0.00  ? 65  PHE A CB   4  
ATOM   8863  C  CG   . PHE A 1 65  ? -0.976  21.815 32.712  1.00 0.00  ? 65  PHE A CG   4  
ATOM   8864  C  CD1  . PHE A 1 65  ? -0.913  22.930 33.556  1.00 0.00  ? 65  PHE A CD1  4  
ATOM   8865  C  CD2  . PHE A 1 65  ? -1.396  20.579 33.223  1.00 0.00  ? 65  PHE A CD2  4  
ATOM   8866  C  CE1  . PHE A 1 65  ? -1.267  22.812 34.908  1.00 0.00  ? 65  PHE A CE1  4  
ATOM   8867  C  CE2  . PHE A 1 65  ? -1.756  20.462 34.574  1.00 0.00  ? 65  PHE A CE2  4  
ATOM   8868  C  CZ   . PHE A 1 65  ? -1.689  21.579 35.417  1.00 0.00  ? 65  PHE A CZ   4  
ATOM   8869  H  H    . PHE A 1 65  ? 1.119   20.910 32.877  1.00 0.00  ? 65  PHE A H    4  
ATOM   8870  H  HA   . PHE A 1 65  ? 1.208   21.913 30.103  1.00 0.00  ? 65  PHE A HA   4  
ATOM   8871  H  HB2  . PHE A 1 65  ? -1.115  22.796 30.819  1.00 0.00  ? 65  PHE A HB2  4  
ATOM   8872  H  HB3  . PHE A 1 65  ? -0.895  21.050 30.721  1.00 0.00  ? 65  PHE A HB3  4  
ATOM   8873  H  HD1  . PHE A 1 65  ? -0.583  23.882 33.167  1.00 0.00  ? 65  PHE A HD1  4  
ATOM   8874  H  HD2  . PHE A 1 65  ? -1.438  19.714 32.576  1.00 0.00  ? 65  PHE A HD2  4  
ATOM   8875  H  HE1  . PHE A 1 65  ? -1.214  23.675 35.557  1.00 0.00  ? 65  PHE A HE1  4  
ATOM   8876  H  HE2  . PHE A 1 65  ? -2.080  19.509 34.966  1.00 0.00  ? 65  PHE A HE2  4  
ATOM   8877  H  HZ   . PHE A 1 65  ? -1.968  21.490 36.458  1.00 0.00  ? 65  PHE A HZ   4  
ATOM   8878  N  N    . GLY A 1 66  ? 0.576   24.571 30.876  1.00 0.00  ? 66  GLY A N    4  
ATOM   8879  C  CA   . GLY A 1 66  ? 0.899   26.007 31.166  1.00 0.00  ? 66  GLY A CA   4  
ATOM   8880  C  C    . GLY A 1 66  ? -0.374  26.864 31.078  1.00 0.00  ? 66  GLY A C    4  
ATOM   8881  O  O    . GLY A 1 66  ? -0.401  27.891 30.427  1.00 0.00  ? 66  GLY A O    4  
ATOM   8882  H  H    . GLY A 1 66  ? -0.156  24.351 30.261  1.00 0.00  ? 66  GLY A H    4  
ATOM   8883  H  HA2  . GLY A 1 66  ? 1.313   26.087 32.162  1.00 0.00  ? 66  GLY A HA2  4  
ATOM   8884  H  HA3  . GLY A 1 66  ? 1.620   26.371 30.448  1.00 0.00  ? 66  GLY A HA3  4  
ATOM   8885  N  N    . ARG A 1 67  ? -1.427  26.455 31.729  1.00 0.00  ? 67  ARG A N    4  
ATOM   8886  C  CA   . ARG A 1 67  ? -2.687  27.251 31.681  1.00 0.00  ? 67  ARG A CA   4  
ATOM   8887  C  C    . ARG A 1 67  ? -2.405  28.685 32.148  1.00 0.00  ? 67  ARG A C    4  
ATOM   8888  O  O    . ARG A 1 67  ? -1.270  29.080 32.330  1.00 0.00  ? 67  ARG A O    4  
ATOM   8889  C  CB   . ARG A 1 67  ? -3.718  26.611 32.614  1.00 0.00  ? 67  ARG A CB   4  
ATOM   8890  C  CG   . ARG A 1 67  ? -4.878  26.020 31.803  1.00 0.00  ? 67  ARG A CG   4  
ATOM   8891  C  CD   . ARG A 1 67  ? -6.168  26.796 32.095  1.00 0.00  ? 67  ARG A CD   4  
ATOM   8892  N  NE   . ARG A 1 67  ? -7.091  26.685 30.925  1.00 0.00  ? 67  ARG A NE   4  
ATOM   8893  C  CZ   . ARG A 1 67  ? -8.256  27.281 30.946  1.00 0.00  ? 67  ARG A CZ   4  
ATOM   8894  N  NH1  . ARG A 1 67  ? -8.646  27.916 32.018  1.00 0.00  ? 67  ARG A NH1  4  
ATOM   8895  N  NH2  . ARG A 1 67  ? -9.039  27.232 29.898  1.00 0.00  ? 67  ARG A NH2  4  
ATOM   8896  H  H    . ARG A 1 67  ? -1.392  25.626 32.248  1.00 0.00  ? 67  ARG A H    4  
ATOM   8897  H  HA   . ARG A 1 67  ? -3.069  27.266 30.671  1.00 0.00  ? 67  ARG A HA   4  
ATOM   8898  H  HB2  . ARG A 1 67  ? -3.242  25.826 33.182  1.00 0.00  ? 67  ARG A HB2  4  
ATOM   8899  H  HB3  . ARG A 1 67  ? -4.100  27.360 33.290  1.00 0.00  ? 67  ARG A HB3  4  
ATOM   8900  H  HG2  . ARG A 1 67  ? -4.651  26.085 30.752  1.00 0.00  ? 67  ARG A HG2  4  
ATOM   8901  H  HG3  . ARG A 1 67  ? -5.013  24.984 32.082  1.00 0.00  ? 67  ARG A HG3  4  
ATOM   8902  H  HD2  . ARG A 1 67  ? -6.643  26.386 32.974  1.00 0.00  ? 67  ARG A HD2  4  
ATOM   8903  H  HD3  . ARG A 1 67  ? -5.930  27.835 32.268  1.00 0.00  ? 67  ARG A HD3  4  
ATOM   8904  H  HE   . ARG A 1 67  ? -6.808  26.192 30.127  1.00 0.00  ? 67  ARG A HE   4  
ATOM   8905  H  HH11 . ARG A 1 67  ? -8.058  27.941 32.826  1.00 0.00  ? 67  ARG A HH11 4  
ATOM   8906  H  HH12 . ARG A 1 67  ? -9.529  28.385 32.029  1.00 0.00  ? 67  ARG A HH12 4  
ATOM   8907  H  HH21 . ARG A 1 67  ? -8.749  26.740 29.077  1.00 0.00  ? 67  ARG A HH21 4  
ATOM   8908  H  HH22 . ARG A 1 67  ? -9.932  27.685 29.918  1.00 0.00  ? 67  ARG A HH22 4  
ATOM   8909  N  N    . TRP A 1 68  ? -3.430  29.464 32.350  1.00 0.00  ? 68  TRP A N    4  
ATOM   8910  C  CA   . TRP A 1 68  ? -3.233  30.867 32.813  1.00 0.00  ? 68  TRP A CA   4  
ATOM   8911  C  C    . TRP A 1 68  ? -2.297  30.889 34.026  1.00 0.00  ? 68  TRP A C    4  
ATOM   8912  O  O    . TRP A 1 68  ? -1.271  31.542 34.028  1.00 0.00  ? 68  TRP A O    4  
ATOM   8913  C  CB   . TRP A 1 68  ? -4.591  31.440 33.217  1.00 0.00  ? 68  TRP A CB   4  
ATOM   8914  C  CG   . TRP A 1 68  ? -4.433  32.855 33.660  1.00 0.00  ? 68  TRP A CG   4  
ATOM   8915  C  CD1  . TRP A 1 68  ? -3.524  33.717 33.167  1.00 0.00  ? 68  TRP A CD1  4  
ATOM   8916  C  CD2  . TRP A 1 68  ? -5.187  33.583 34.670  1.00 0.00  ? 68  TRP A CD2  4  
ATOM   8917  N  NE1  . TRP A 1 68  ? -3.671  34.933 33.805  1.00 0.00  ? 68  TRP A NE1  4  
ATOM   8918  C  CE2  . TRP A 1 68  ? -4.684  34.901 34.742  1.00 0.00  ? 68  TRP A CE2  4  
ATOM   8919  C  CE3  . TRP A 1 68  ? -6.250  33.232 35.518  1.00 0.00  ? 68  TRP A CE3  4  
ATOM   8920  C  CZ2  . TRP A 1 68  ? -5.211  35.841 35.630  1.00 0.00  ? 68  TRP A CZ2  4  
ATOM   8921  C  CZ3  . TRP A 1 68  ? -6.785  34.172 36.414  1.00 0.00  ? 68  TRP A CZ3  4  
ATOM   8922  C  CH2  . TRP A 1 68  ? -6.267  35.475 36.467  1.00 0.00  ? 68  TRP A CH2  4  
ATOM   8923  H  H    . TRP A 1 68  ? -4.337  29.125 32.204  1.00 0.00  ? 68  TRP A H    4  
ATOM   8924  H  HA   . TRP A 1 68  ? -2.810  31.460 32.016  1.00 0.00  ? 68  TRP A HA   4  
ATOM   8925  H  HB2  . TRP A 1 68  ? -5.263  31.399 32.374  1.00 0.00  ? 68  TRP A HB2  4  
ATOM   8926  H  HB3  . TRP A 1 68  ? -4.996  30.853 34.028  1.00 0.00  ? 68  TRP A HB3  4  
ATOM   8927  H  HD1  . TRP A 1 68  ? -2.802  33.494 32.397  1.00 0.00  ? 68  TRP A HD1  4  
ATOM   8928  H  HE1  . TRP A 1 68  ? -3.130  35.731 33.631  1.00 0.00  ? 68  TRP A HE1  4  
ATOM   8929  H  HE3  . TRP A 1 68  ? -6.657  32.232 35.485  1.00 0.00  ? 68  TRP A HE3  4  
ATOM   8930  H  HZ2  . TRP A 1 68  ? -4.809  36.841 35.666  1.00 0.00  ? 68  TRP A HZ2  4  
ATOM   8931  H  HZ3  . TRP A 1 68  ? -7.599  33.891 37.063  1.00 0.00  ? 68  TRP A HZ3  4  
ATOM   8932  H  HH2  . TRP A 1 68  ? -6.682  36.192 37.159  1.00 0.00  ? 68  TRP A HH2  4  
ATOM   8933  N  N    . GLU A 1 69  ? -2.660  30.183 35.057  1.00 0.00  ? 69  GLU A N    4  
ATOM   8934  C  CA   . GLU A 1 69  ? -1.825  30.148 36.288  1.00 0.00  ? 69  GLU A CA   4  
ATOM   8935  C  C    . GLU A 1 69  ? -0.505  29.433 36.008  1.00 0.00  ? 69  GLU A C    4  
ATOM   8936  O  O    . GLU A 1 69  ? -0.479  28.301 35.567  1.00 0.00  ? 69  GLU A O    4  
ATOM   8937  C  CB   . GLU A 1 69  ? -2.571  29.383 37.381  1.00 0.00  ? 69  GLU A CB   4  
ATOM   8938  C  CG   . GLU A 1 69  ? -2.642  30.220 38.659  1.00 0.00  ? 69  GLU A CG   4  
ATOM   8939  C  CD   . GLU A 1 69  ? -4.010  30.013 39.306  1.00 0.00  ? 69  GLU A CD   4  
ATOM   8940  O  OE1  . GLU A 1 69  ? -4.968  30.579 38.807  1.00 0.00  ? 69  GLU A OE1  4  
ATOM   8941  O  OE2  . GLU A 1 69  ? -4.078  29.286 40.281  1.00 0.00  ? 69  GLU A OE2  4  
ATOM   8942  H  H    . GLU A 1 69  ? -3.497  29.674 35.024  1.00 0.00  ? 69  GLU A H    4  
ATOM   8943  H  HA   . GLU A 1 69  ? -1.629  31.156 36.623  1.00 0.00  ? 69  GLU A HA   4  
ATOM   8944  H  HB2  . GLU A 1 69  ? -3.571  29.161 37.045  1.00 0.00  ? 69  GLU A HB2  4  
ATOM   8945  H  HB3  . GLU A 1 69  ? -2.050  28.462 37.590  1.00 0.00  ? 69  GLU A HB3  4  
ATOM   8946  H  HG2  . GLU A 1 69  ? -1.867  29.902 39.343  1.00 0.00  ? 69  GLU A HG2  4  
ATOM   8947  H  HG3  . GLU A 1 69  ? -2.510  31.265 38.421  1.00 0.00  ? 69  GLU A HG3  4  
ATOM   8948  N  N    . HIS A 1 70  ? 0.590   30.087 36.282  1.00 0.00  ? 70  HIS A N    4  
ATOM   8949  C  CA   . HIS A 1 70  ? 1.931   29.469 36.063  1.00 0.00  ? 70  HIS A CA   4  
ATOM   8950  C  C    . HIS A 1 70  ? 2.992   30.427 36.588  1.00 0.00  ? 70  HIS A C    4  
ATOM   8951  O  O    . HIS A 1 70  ? 3.613   30.192 37.604  1.00 0.00  ? 70  HIS A O    4  
ATOM   8952  C  CB   . HIS A 1 70  ? 2.166   29.239 34.574  1.00 0.00  ? 70  HIS A CB   4  
ATOM   8953  C  CG   . HIS A 1 70  ? 3.434   28.456 34.373  1.00 0.00  ? 70  HIS A CG   4  
ATOM   8954  N  ND1  . HIS A 1 70  ? 4.278   28.101 35.424  1.00 0.00  ? 70  HIS A ND1  4  
ATOM   8955  C  CD2  . HIS A 1 70  ? 4.019   27.959 33.239  1.00 0.00  ? 70  HIS A CD2  4  
ATOM   8956  C  CE1  . HIS A 1 70  ? 5.313   27.418 34.893  1.00 0.00  ? 70  HIS A CE1  4  
ATOM   8957  N  NE2  . HIS A 1 70  ? 5.202   27.304 33.566  1.00 0.00  ? 70  HIS A NE2  4  
ATOM   8958  H  H    . HIS A 1 70  ? 0.530   30.994 36.647  1.00 0.00  ? 70  HIS A H    4  
ATOM   8959  H  HA   . HIS A 1 70  ? 1.992   28.529 36.593  1.00 0.00  ? 70  HIS A HA   4  
ATOM   8960  H  HB2  . HIS A 1 70  ? 1.333   28.692 34.158  1.00 0.00  ? 70  HIS A HB2  4  
ATOM   8961  H  HB3  . HIS A 1 70  ? 2.252   30.189 34.075  1.00 0.00  ? 70  HIS A HB3  4  
ATOM   8962  H  HD1  . HIS A 1 70  ? 4.149   28.314 36.371  1.00 0.00  ? 70  HIS A HD1  4  
ATOM   8963  H  HD2  . HIS A 1 70  ? 3.628   28.075 32.242  1.00 0.00  ? 70  HIS A HD2  4  
ATOM   8964  H  HE1  . HIS A 1 70  ? 6.136   27.020 35.466  1.00 0.00  ? 70  HIS A HE1  4  
ATOM   8965  N  N    . GLY A 1 71  ? 3.190   31.521 35.905  1.00 0.00  ? 71  GLY A N    4  
ATOM   8966  C  CA   . GLY A 1 71  ? 4.197   32.517 36.366  1.00 0.00  ? 71  GLY A CA   4  
ATOM   8967  C  C    . GLY A 1 71  ? 5.069   32.965 35.189  1.00 0.00  ? 71  GLY A C    4  
ATOM   8968  O  O    . GLY A 1 71  ? 5.708   33.996 35.237  1.00 0.00  ? 71  GLY A O    4  
ATOM   8969  H  H    . GLY A 1 71  ? 2.666   31.691 35.095  1.00 0.00  ? 71  GLY A H    4  
ATOM   8970  H  HA2  . GLY A 1 71  ? 3.680   33.373 36.776  1.00 0.00  ? 71  GLY A HA2  4  
ATOM   8971  H  HA3  . GLY A 1 71  ? 4.821   32.073 37.128  1.00 0.00  ? 71  GLY A HA3  4  
ATOM   8972  N  N    . ASP A 1 72  ? 5.107   32.187 34.142  1.00 0.00  ? 72  ASP A N    4  
ATOM   8973  C  CA   . ASP A 1 72  ? 5.937   32.533 32.955  1.00 0.00  ? 72  ASP A CA   4  
ATOM   8974  C  C    . ASP A 1 72  ? 5.752   34.003 32.544  1.00 0.00  ? 72  ASP A C    4  
ATOM   8975  O  O    . ASP A 1 72  ? 5.038   34.762 33.170  1.00 0.00  ? 72  ASP A O    4  
ATOM   8976  C  CB   . ASP A 1 72  ? 5.531   31.647 31.777  1.00 0.00  ? 72  ASP A CB   4  
ATOM   8977  C  CG   . ASP A 1 72  ? 6.691   30.721 31.400  1.00 0.00  ? 72  ASP A CG   4  
ATOM   8978  O  OD1  . ASP A 1 72  ? 7.509   31.132 30.592  1.00 0.00  ? 72  ASP A OD1  4  
ATOM   8979  O  OD2  . ASP A 1 72  ? 6.739   29.613 31.921  1.00 0.00  ? 72  ASP A OD2  4  
ATOM   8980  H  H    . ASP A 1 72  ? 4.600   31.359 34.142  1.00 0.00  ? 72  ASP A H    4  
ATOM   8981  H  HA   . ASP A 1 72  ? 6.966   32.352 33.193  1.00 0.00  ? 72  ASP A HA   4  
ATOM   8982  H  HB2  . ASP A 1 72  ? 4.667   31.060 32.049  1.00 0.00  ? 72  ASP A HB2  4  
ATOM   8983  H  HB3  . ASP A 1 72  ? 5.285   32.273 30.933  1.00 0.00  ? 72  ASP A HB3  4  
ATOM   8984  N  N    . GLY A 1 73  ? 6.393   34.399 31.471  1.00 0.00  ? 73  GLY A N    4  
ATOM   8985  C  CA   . GLY A 1 73  ? 6.268   35.804 30.987  1.00 0.00  ? 73  GLY A CA   4  
ATOM   8986  C  C    . GLY A 1 73  ? 5.159   35.883 29.938  1.00 0.00  ? 73  GLY A C    4  
ATOM   8987  O  O    . GLY A 1 73  ? 4.848   36.940 29.430  1.00 0.00  ? 73  GLY A O    4  
ATOM   8988  H  H    . GLY A 1 73  ? 6.952   33.765 30.976  1.00 0.00  ? 73  GLY A H    4  
ATOM   8989  H  HA2  . GLY A 1 73  ? 6.028   36.452 31.816  1.00 0.00  ? 73  GLY A HA2  4  
ATOM   8990  H  HA3  . GLY A 1 73  ? 7.199   36.116 30.541  1.00 0.00  ? 73  GLY A HA3  4  
ATOM   8991  N  N    . TYR A 1 74  ? 4.554   34.779 29.610  1.00 0.00  ? 74  TYR A N    4  
ATOM   8992  C  CA   . TYR A 1 74  ? 3.468   34.826 28.602  1.00 0.00  ? 74  TYR A CA   4  
ATOM   8993  C  C    . TYR A 1 74  ? 2.347   33.860 28.989  1.00 0.00  ? 74  TYR A C    4  
ATOM   8994  O  O    . TYR A 1 74  ? 2.218   32.793 28.422  1.00 0.00  ? 74  TYR A O    4  
ATOM   8995  C  CB   . TYR A 1 74  ? 4.018   34.484 27.213  1.00 0.00  ? 74  TYR A CB   4  
ATOM   8996  C  CG   . TYR A 1 74  ? 4.513   35.764 26.561  1.00 0.00  ? 74  TYR A CG   4  
ATOM   8997  C  CD1  . TYR A 1 74  ? 3.602   36.631 25.935  1.00 0.00  ? 74  TYR A CD1  4  
ATOM   8998  C  CD2  . TYR A 1 74  ? 5.876   36.097 26.596  1.00 0.00  ? 74  TYR A CD2  4  
ATOM   8999  C  CE1  . TYR A 1 74  ? 4.053   37.825 25.349  1.00 0.00  ? 74  TYR A CE1  4  
ATOM   9000  C  CE2  . TYR A 1 74  ? 6.324   37.294 26.014  1.00 0.00  ? 74  TYR A CE2  4  
ATOM   9001  C  CZ   . TYR A 1 74  ? 5.414   38.156 25.390  1.00 0.00  ? 74  TYR A CZ   4  
ATOM   9002  O  OH   . TYR A 1 74  ? 5.858   39.340 24.828  1.00 0.00  ? 74  TYR A OH   4  
ATOM   9003  H  H    . TYR A 1 74  ? 4.808   33.926 30.029  1.00 0.00  ? 74  TYR A H    4  
ATOM   9004  H  HA   . TYR A 1 74  ? 3.065   35.825 28.580  1.00 0.00  ? 74  TYR A HA   4  
ATOM   9005  H  HB2  . TYR A 1 74  ? 4.832   33.777 27.306  1.00 0.00  ? 74  TYR A HB2  4  
ATOM   9006  H  HB3  . TYR A 1 74  ? 3.230   34.052 26.611  1.00 0.00  ? 74  TYR A HB3  4  
ATOM   9007  H  HD1  . TYR A 1 74  ? 2.553   36.379 25.898  1.00 0.00  ? 74  TYR A HD1  4  
ATOM   9008  H  HD2  . TYR A 1 74  ? 6.581   35.434 27.077  1.00 0.00  ? 74  TYR A HD2  4  
ATOM   9009  H  HE1  . TYR A 1 74  ? 3.352   38.491 24.868  1.00 0.00  ? 74  TYR A HE1  4  
ATOM   9010  H  HE2  . TYR A 1 74  ? 7.373   37.548 26.041  1.00 0.00  ? 74  TYR A HE2  4  
ATOM   9011  H  HH   . TYR A 1 74  ? 5.539   39.379 23.924  1.00 0.00  ? 74  TYR A HH   4  
ATOM   9012  N  N    . PRO A 1 75  ? 1.552   34.287 29.937  1.00 0.00  ? 75  PRO A N    4  
ATOM   9013  C  CA   . PRO A 1 75  ? 0.403   33.502 30.420  1.00 0.00  ? 75  PRO A CA   4  
ATOM   9014  C  C    . PRO A 1 75  ? -0.751  33.607 29.417  1.00 0.00  ? 75  PRO A C    4  
ATOM   9015  O  O    . PRO A 1 75  ? -1.013  34.662 28.873  1.00 0.00  ? 75  PRO A O    4  
ATOM   9016  C  CB   . PRO A 1 75  ? 0.039   34.172 31.743  1.00 0.00  ? 75  PRO A CB   4  
ATOM   9017  C  CG   . PRO A 1 75  ? 0.614   35.608 31.682  1.00 0.00  ? 75  PRO A CG   4  
ATOM   9018  C  CD   . PRO A 1 75  ? 1.732   35.587 30.625  1.00 0.00  ? 75  PRO A CD   4  
ATOM   9019  H  HA   . PRO A 1 75  ? 0.680   32.474 30.585  1.00 0.00  ? 75  PRO A HA   4  
ATOM   9020  H  HB2  . PRO A 1 75  ? -1.035  34.197 31.856  1.00 0.00  ? 75  PRO A HB2  4  
ATOM   9021  H  HB3  . PRO A 1 75  ? 0.488   33.634 32.561  1.00 0.00  ? 75  PRO A HB3  4  
ATOM   9022  H  HG2  . PRO A 1 75  ? -0.160  36.308 31.393  1.00 0.00  ? 75  PRO A HG2  4  
ATOM   9023  H  HG3  . PRO A 1 75  ? 1.024   35.884 32.641  1.00 0.00  ? 75  PRO A HG3  4  
ATOM   9024  H  HD2  . PRO A 1 75  ? 1.613   36.408 29.929  1.00 0.00  ? 75  PRO A HD2  4  
ATOM   9025  H  HD3  . PRO A 1 75  ? 2.700   35.629 31.100  1.00 0.00  ? 75  PRO A HD3  4  
ATOM   9026  N  N    . PHE A 1 76  ? -1.437  32.524 29.167  1.00 0.00  ? 76  PHE A N    4  
ATOM   9027  C  CA   . PHE A 1 76  ? -2.569  32.563 28.192  1.00 0.00  ? 76  PHE A CA   4  
ATOM   9028  C  C    . PHE A 1 76  ? -2.048  32.987 26.817  1.00 0.00  ? 76  PHE A C    4  
ATOM   9029  O  O    . PHE A 1 76  ? -0.988  33.564 26.690  1.00 0.00  ? 76  PHE A O    4  
ATOM   9030  C  CB   . PHE A 1 76  ? -3.621  33.563 28.677  1.00 0.00  ? 76  PHE A CB   4  
ATOM   9031  C  CG   . PHE A 1 76  ? -4.979  32.908 28.674  1.00 0.00  ? 76  PHE A CG   4  
ATOM   9032  C  CD1  . PHE A 1 76  ? -5.150  31.643 29.246  1.00 0.00  ? 76  PHE A CD1  4  
ATOM   9033  C  CD2  . PHE A 1 76  ? -6.065  33.567 28.095  1.00 0.00  ? 76  PHE A CD2  4  
ATOM   9034  C  CE1  . PHE A 1 76  ? -6.412  31.037 29.239  1.00 0.00  ? 76  PHE A CE1  4  
ATOM   9035  C  CE2  . PHE A 1 76  ? -7.327  32.964 28.085  1.00 0.00  ? 76  PHE A CE2  4  
ATOM   9036  C  CZ   . PHE A 1 76  ? -7.501  31.698 28.659  1.00 0.00  ? 76  PHE A CZ   4  
ATOM   9037  H  H    . PHE A 1 76  ? -1.206  31.686 29.618  1.00 0.00  ? 76  PHE A H    4  
ATOM   9038  H  HA   . PHE A 1 76  ? -3.015  31.581 28.106  1.00 0.00  ? 76  PHE A HA   4  
ATOM   9039  H  HB2  . PHE A 1 76  ? -3.379  33.885 29.677  1.00 0.00  ? 76  PHE A HB2  4  
ATOM   9040  H  HB3  . PHE A 1 76  ? -3.635  34.417 28.017  1.00 0.00  ? 76  PHE A HB3  4  
ATOM   9041  H  HD1  . PHE A 1 76  ? -4.310  31.132 29.693  1.00 0.00  ? 76  PHE A HD1  4  
ATOM   9042  H  HD2  . PHE A 1 76  ? -5.927  34.544 27.655  1.00 0.00  ? 76  PHE A HD2  4  
ATOM   9043  H  HE1  . PHE A 1 76  ? -6.547  30.062 29.683  1.00 0.00  ? 76  PHE A HE1  4  
ATOM   9044  H  HE2  . PHE A 1 76  ? -8.164  33.475 27.635  1.00 0.00  ? 76  PHE A HE2  4  
ATOM   9045  H  HZ   . PHE A 1 76  ? -8.475  31.230 28.650  1.00 0.00  ? 76  PHE A HZ   4  
ATOM   9046  N  N    . ASP A 1 77  ? -2.791  32.690 25.785  1.00 0.00  ? 77  ASP A N    4  
ATOM   9047  C  CA   . ASP A 1 77  ? -2.361  33.047 24.404  1.00 0.00  ? 77  ASP A CA   4  
ATOM   9048  C  C    . ASP A 1 77  ? -3.440  32.600 23.411  1.00 0.00  ? 77  ASP A C    4  
ATOM   9049  O  O    . ASP A 1 77  ? -3.636  33.199 22.370  1.00 0.00  ? 77  ASP A O    4  
ATOM   9050  C  CB   . ASP A 1 77  ? -1.038  32.331 24.094  1.00 0.00  ? 77  ASP A CB   4  
ATOM   9051  C  CG   . ASP A 1 77  ? -1.304  30.912 23.568  1.00 0.00  ? 77  ASP A CG   4  
ATOM   9052  O  OD1  . ASP A 1 77  ? -1.857  30.118 24.313  1.00 0.00  ? 77  ASP A OD1  4  
ATOM   9053  O  OD2  . ASP A 1 77  ? -0.954  30.649 22.430  1.00 0.00  ? 77  ASP A OD2  4  
ATOM   9054  H  H    . ASP A 1 77  ? -3.632  32.221 25.920  1.00 0.00  ? 77  ASP A H    4  
ATOM   9055  H  HA   . ASP A 1 77  ? -2.221  34.117 24.331  1.00 0.00  ? 77  ASP A HA   4  
ATOM   9056  H  HB2  . ASP A 1 77  ? -0.499  32.892 23.347  1.00 0.00  ? 77  ASP A HB2  4  
ATOM   9057  H  HB3  . ASP A 1 77  ? -0.447  32.273 24.998  1.00 0.00  ? 77  ASP A HB3  4  
ATOM   9058  N  N    . GLY A 1 78  ? -4.130  31.539 23.729  1.00 0.00  ? 78  GLY A N    4  
ATOM   9059  C  CA   . GLY A 1 78  ? -5.188  31.028 22.812  1.00 0.00  ? 78  GLY A CA   4  
ATOM   9060  C  C    . GLY A 1 78  ? -4.637  29.847 22.003  1.00 0.00  ? 78  GLY A C    4  
ATOM   9061  O  O    . GLY A 1 78  ? -3.728  29.158 22.429  1.00 0.00  ? 78  GLY A O    4  
ATOM   9062  H  H    . GLY A 1 78  ? -3.944  31.069 24.576  1.00 0.00  ? 78  GLY A H    4  
ATOM   9063  H  HA2  . GLY A 1 78  ? -6.037  30.698 23.398  1.00 0.00  ? 78  GLY A HA2  4  
ATOM   9064  H  HA3  . GLY A 1 78  ? -5.500  31.812 22.138  1.00 0.00  ? 78  GLY A HA3  4  
ATOM   9065  N  N    . LYS A 1 79  ? -5.194  29.600 20.847  1.00 0.00  ? 79  LYS A N    4  
ATOM   9066  C  CA   . LYS A 1 79  ? -4.732  28.456 20.006  1.00 0.00  ? 79  LYS A CA   4  
ATOM   9067  C  C    . LYS A 1 79  ? -3.336  28.713 19.447  1.00 0.00  ? 79  LYS A C    4  
ATOM   9068  O  O    . LYS A 1 79  ? -2.822  29.812 19.494  1.00 0.00  ? 79  LYS A O    4  
ATOM   9069  C  CB   . LYS A 1 79  ? -5.714  28.255 18.859  1.00 0.00  ? 79  LYS A CB   4  
ATOM   9070  C  CG   . LYS A 1 79  ? -5.570  29.402 17.859  1.00 0.00  ? 79  LYS A CG   4  
ATOM   9071  C  CD   . LYS A 1 79  ? -6.855  30.236 17.846  1.00 0.00  ? 79  LYS A CD   4  
ATOM   9072  C  CE   . LYS A 1 79  ? -7.603  30.012 16.537  1.00 0.00  ? 79  LYS A CE   4  
ATOM   9073  N  NZ   . LYS A 1 79  ? -8.333  31.259 16.192  1.00 0.00  ? 79  LYS A NZ   4  
ATOM   9074  H  H    . LYS A 1 79  ? -5.931  30.163 20.534  1.00 0.00  ? 79  LYS A H    4  
ATOM   9075  H  HA   . LYS A 1 79  ? -4.706  27.562 20.606  1.00 0.00  ? 79  LYS A HA   4  
ATOM   9076  H  HB2  . LYS A 1 79  ? -5.503  27.316 18.367  1.00 0.00  ? 79  LYS A HB2  4  
ATOM   9077  H  HB3  . LYS A 1 79  ? -6.721  28.242 19.250  1.00 0.00  ? 79  LYS A HB3  4  
ATOM   9078  H  HG2  . LYS A 1 79  ? -4.735  30.025 18.146  1.00 0.00  ? 79  LYS A HG2  4  
ATOM   9079  H  HG3  . LYS A 1 79  ? -5.394  28.994 16.876  1.00 0.00  ? 79  LYS A HG3  4  
ATOM   9080  H  HD2  . LYS A 1 79  ? -7.487  29.940 18.671  1.00 0.00  ? 79  LYS A HD2  4  
ATOM   9081  H  HD3  . LYS A 1 79  ? -6.609  31.284 17.939  1.00 0.00  ? 79  LYS A HD3  4  
ATOM   9082  H  HE2  . LYS A 1 79  ? -6.904  29.768 15.752  1.00 0.00  ? 79  LYS A HE2  4  
ATOM   9083  H  HE3  . LYS A 1 79  ? -8.310  29.204 16.660  1.00 0.00  ? 79  LYS A HE3  4  
ATOM   9084  H  HZ1  . LYS A 1 79  ? -8.276  31.425 15.170  1.00 0.00  ? 79  LYS A HZ1  4  
ATOM   9085  H  HZ2  . LYS A 1 79  ? -7.902  32.059 16.699  1.00 0.00  ? 79  LYS A HZ2  4  
ATOM   9086  H  HZ3  . LYS A 1 79  ? -9.328  31.163 16.473  1.00 0.00  ? 79  LYS A HZ3  4  
ATOM   9087  N  N    . ASP A 1 80  ? -2.725  27.691 18.915  1.00 0.00  ? 80  ASP A N    4  
ATOM   9088  C  CA   . ASP A 1 80  ? -1.360  27.843 18.348  1.00 0.00  ? 80  ASP A CA   4  
ATOM   9089  C  C    . ASP A 1 80  ? -0.523  28.730 19.281  1.00 0.00  ? 80  ASP A C    4  
ATOM   9090  O  O    . ASP A 1 80  ? -0.737  28.761 20.479  1.00 0.00  ? 80  ASP A O    4  
ATOM   9091  C  CB   . ASP A 1 80  ? -1.453  28.485 16.962  1.00 0.00  ? 80  ASP A CB   4  
ATOM   9092  C  CG   . ASP A 1 80  ? -0.669  27.646 15.946  1.00 0.00  ? 80  ASP A CG   4  
ATOM   9093  O  OD1  . ASP A 1 80  ? 0.042   26.747 16.368  1.00 0.00  ? 80  ASP A OD1  4  
ATOM   9094  O  OD2  . ASP A 1 80  ? -0.794  27.918 14.763  1.00 0.00  ? 80  ASP A OD2  4  
ATOM   9095  H  H    . ASP A 1 80  ? -3.172  26.820 18.888  1.00 0.00  ? 80  ASP A H    4  
ATOM   9096  H  HA   . ASP A 1 80  ? -0.900  26.868 18.264  1.00 0.00  ? 80  ASP A HA   4  
ATOM   9097  H  HB2  . ASP A 1 80  ? -2.489  28.534 16.663  1.00 0.00  ? 80  ASP A HB2  4  
ATOM   9098  H  HB3  . ASP A 1 80  ? -1.043  29.482 16.999  1.00 0.00  ? 80  ASP A HB3  4  
ATOM   9099  N  N    . GLY A 1 81  ? 0.424   29.450 18.742  1.00 0.00  ? 81  GLY A N    4  
ATOM   9100  C  CA   . GLY A 1 81  ? 1.274   30.338 19.594  1.00 0.00  ? 81  GLY A CA   4  
ATOM   9101  C  C    . GLY A 1 81  ? 1.899   29.529 20.722  1.00 0.00  ? 81  GLY A C    4  
ATOM   9102  O  O    . GLY A 1 81  ? 2.405   28.442 20.523  1.00 0.00  ? 81  GLY A O    4  
ATOM   9103  H  H    . GLY A 1 81  ? 0.576   29.410 17.776  1.00 0.00  ? 81  GLY A H    4  
ATOM   9104  H  HA2  . GLY A 1 81  ? 2.057   30.776 18.994  1.00 0.00  ? 81  GLY A HA2  4  
ATOM   9105  H  HA3  . GLY A 1 81  ? 0.666   31.124 20.018  1.00 0.00  ? 81  GLY A HA3  4  
ATOM   9106  N  N    . LEU A 1 82  ? 1.863   30.056 21.909  1.00 0.00  ? 82  LEU A N    4  
ATOM   9107  C  CA   . LEU A 1 82  ? 2.445   29.330 23.068  1.00 0.00  ? 82  LEU A CA   4  
ATOM   9108  C  C    . LEU A 1 82  ? 1.893   27.909 23.092  1.00 0.00  ? 82  LEU A C    4  
ATOM   9109  O  O    . LEU A 1 82  ? 0.802   27.672 23.562  1.00 0.00  ? 82  LEU A O    4  
ATOM   9110  C  CB   . LEU A 1 82  ? 2.042   30.051 24.353  1.00 0.00  ? 82  LEU A CB   4  
ATOM   9111  C  CG   . LEU A 1 82  ? 2.832   29.495 25.538  1.00 0.00  ? 82  LEU A CG   4  
ATOM   9112  C  CD1  . LEU A 1 82  ? 3.305   30.655 26.417  1.00 0.00  ? 82  LEU A CD1  4  
ATOM   9113  C  CD2  . LEU A 1 82  ? 1.930   28.566 26.358  1.00 0.00  ? 82  LEU A CD2  4  
ATOM   9114  H  H    . LEU A 1 82  ? 1.447   30.933 22.039  1.00 0.00  ? 82  LEU A H    4  
ATOM   9115  H  HA   . LEU A 1 82  ? 3.523   29.302 22.983  1.00 0.00  ? 82  LEU A HA   4  
ATOM   9116  H  HB2  . LEU A 1 82  ? 2.244   31.105 24.249  1.00 0.00  ? 82  LEU A HB2  4  
ATOM   9117  H  HB3  . LEU A 1 82  ? 0.988   29.906 24.524  1.00 0.00  ? 82  LEU A HB3  4  
ATOM   9118  H  HG   . LEU A 1 82  ? 3.689   28.942 25.173  1.00 0.00  ? 82  LEU A HG   4  
ATOM   9119  H  HD11 . LEU A 1 82  ? 3.238   30.373 27.457  1.00 0.00  ? 82  LEU A HD11 4  
ATOM   9120  H  HD12 . LEU A 1 82  ? 2.680   31.519 26.239  1.00 0.00  ? 82  LEU A HD12 4  
ATOM   9121  H  HD13 . LEU A 1 82  ? 4.330   30.896 26.174  1.00 0.00  ? 82  LEU A HD13 4  
ATOM   9122  H  HD21 . LEU A 1 82  ? 0.900   28.704 26.057  1.00 0.00  ? 82  LEU A HD21 4  
ATOM   9123  H  HD22 . LEU A 1 82  ? 2.032   28.797 27.407  1.00 0.00  ? 82  LEU A HD22 4  
ATOM   9124  H  HD23 . LEU A 1 82  ? 2.218   27.539 26.187  1.00 0.00  ? 82  LEU A HD23 4  
ATOM   9125  N  N    . LEU A 1 83  ? 2.630   26.960 22.585  1.00 0.00  ? 83  LEU A N    4  
ATOM   9126  C  CA   . LEU A 1 83  ? 2.132   25.556 22.584  1.00 0.00  ? 83  LEU A CA   4  
ATOM   9127  C  C    . LEU A 1 83  ? 2.959   24.737 23.569  1.00 0.00  ? 83  LEU A C    4  
ATOM   9128  O  O    . LEU A 1 83  ? 2.500   23.764 24.133  1.00 0.00  ? 83  LEU A O    4  
ATOM   9129  C  CB   . LEU A 1 83  ? 2.288   24.970 21.176  1.00 0.00  ? 83  LEU A CB   4  
ATOM   9130  C  CG   . LEU A 1 83  ? 1.388   25.726 20.197  1.00 0.00  ? 83  LEU A CG   4  
ATOM   9131  C  CD1  . LEU A 1 83  ? 2.219   26.199 19.009  1.00 0.00  ? 83  LEU A CD1  4  
ATOM   9132  C  CD2  . LEU A 1 83  ? 0.287   24.804 19.688  1.00 0.00  ? 83  LEU A CD2  4  
ATOM   9133  H  H    . LEU A 1 83  ? 3.509   27.170 22.203  1.00 0.00  ? 83  LEU A H    4  
ATOM   9134  H  HA   . LEU A 1 83  ? 1.092   25.536 22.876  1.00 0.00  ? 83  LEU A HA   4  
ATOM   9135  H  HB2  . LEU A 1 83  ? 3.317   25.069 20.861  1.00 0.00  ? 83  LEU A HB2  4  
ATOM   9136  H  HB3  . LEU A 1 83  ? 2.013   23.926 21.183  1.00 0.00  ? 83  LEU A HB3  4  
ATOM   9137  H  HG   . LEU A 1 83  ? 0.947   26.578 20.693  1.00 0.00  ? 83  LEU A HG   4  
ATOM   9138  H  HD11 . LEU A 1 83  ? 1.869   27.166 18.688  1.00 0.00  ? 83  LEU A HD11 4  
ATOM   9139  H  HD12 . LEU A 1 83  ? 2.120   25.491 18.197  1.00 0.00  ? 83  LEU A HD12 4  
ATOM   9140  H  HD13 . LEU A 1 83  ? 3.255   26.267 19.303  1.00 0.00  ? 83  LEU A HD13 4  
ATOM   9141  H  HD21 . LEU A 1 83  ? 0.537   23.781 19.922  1.00 0.00  ? 83  LEU A HD21 4  
ATOM   9142  H  HD22 . LEU A 1 83  ? 0.197   24.918 18.617  1.00 0.00  ? 83  LEU A HD22 4  
ATOM   9143  H  HD23 . LEU A 1 83  ? -0.647  25.066 20.161  1.00 0.00  ? 83  LEU A HD23 4  
ATOM   9144  N  N    . ALA A 1 84  ? 4.183   25.123 23.772  1.00 0.00  ? 84  ALA A N    4  
ATOM   9145  C  CA   . ALA A 1 84  ? 5.054   24.370 24.706  1.00 0.00  ? 84  ALA A CA   4  
ATOM   9146  C  C    . ALA A 1 84  ? 6.396   25.087 24.772  1.00 0.00  ? 84  ALA A C    4  
ATOM   9147  O  O    . ALA A 1 84  ? 6.766   25.799 23.861  1.00 0.00  ? 84  ALA A O    4  
ATOM   9148  C  CB   . ALA A 1 84  ? 5.232   22.946 24.177  1.00 0.00  ? 84  ALA A CB   4  
ATOM   9149  H  H    . ALA A 1 84  ? 4.538   25.910 23.296  1.00 0.00  ? 84  ALA A H    4  
ATOM   9150  H  HA   . ALA A 1 84  ? 4.604   24.343 25.690  1.00 0.00  ? 84  ALA A HA   4  
ATOM   9151  H  HB1  . ALA A 1 84  ? 5.317   22.257 25.004  1.00 0.00  ? 84  ALA A HB1  4  
ATOM   9152  H  HB2  . ALA A 1 84  ? 6.122   22.895 23.570  1.00 0.00  ? 84  ALA A HB2  4  
ATOM   9153  H  HB3  . ALA A 1 84  ? 4.371   22.681 23.579  1.00 0.00  ? 84  ALA A HB3  4  
ATOM   9154  N  N    . HIS A 1 85  ? 7.124   24.929 25.836  1.00 0.00  ? 85  HIS A N    4  
ATOM   9155  C  CA   . HIS A 1 85  ? 8.433   25.633 25.930  1.00 0.00  ? 85  HIS A CA   4  
ATOM   9156  C  C    . HIS A 1 85  ? 9.384   24.839 26.826  1.00 0.00  ? 85  HIS A C    4  
ATOM   9157  O  O    . HIS A 1 85  ? 9.012   23.848 27.424  1.00 0.00  ? 85  HIS A O    4  
ATOM   9158  C  CB   . HIS A 1 85  ? 8.218   27.055 26.490  1.00 0.00  ? 85  HIS A CB   4  
ATOM   9159  C  CG   . HIS A 1 85  ? 8.187   27.036 27.995  1.00 0.00  ? 85  HIS A CG   4  
ATOM   9160  N  ND1  . HIS A 1 85  ? 9.293   27.357 28.773  1.00 0.00  ? 85  HIS A ND1  4  
ATOM   9161  C  CD2  . HIS A 1 85  ? 7.183   26.737 28.875  1.00 0.00  ? 85  HIS A CD2  4  
ATOM   9162  C  CE1  . HIS A 1 85  ? 8.925   27.235 30.062  1.00 0.00  ? 85  HIS A CE1  4  
ATOM   9163  N  NE2  . HIS A 1 85  ? 7.648   26.862 30.178  1.00 0.00  ? 85  HIS A NE2  4  
ATOM   9164  H  H    . HIS A 1 85  ? 6.813   24.358 26.569  1.00 0.00  ? 85  HIS A H    4  
ATOM   9165  H  HA   . HIS A 1 85  ? 8.863   25.705 24.939  1.00 0.00  ? 85  HIS A HA   4  
ATOM   9166  H  HB2  . HIS A 1 85  ? 9.018   27.698 26.158  1.00 0.00  ? 85  HIS A HB2  4  
ATOM   9167  H  HB3  . HIS A 1 85  ? 7.278   27.442 26.125  1.00 0.00  ? 85  HIS A HB3  4  
ATOM   9168  H  HD1  . HIS A 1 85  ? 10.172  27.638 28.447  1.00 0.00  ? 85  HIS A HD1  4  
ATOM   9169  H  HD2  . HIS A 1 85  ? 6.181   26.451 28.593  1.00 0.00  ? 85  HIS A HD2  4  
ATOM   9170  H  HE1  . HIS A 1 85  ? 9.584   27.403 30.901  1.00 0.00  ? 85  HIS A HE1  4  
ATOM   9171  N  N    . ALA A 1 86  ? 10.611  25.269 26.920  1.00 0.00  ? 86  ALA A N    4  
ATOM   9172  C  CA   . ALA A 1 86  ? 11.585  24.542 27.777  1.00 0.00  ? 86  ALA A CA   4  
ATOM   9173  C  C    . ALA A 1 86  ? 12.546  25.539 28.435  1.00 0.00  ? 86  ALA A C    4  
ATOM   9174  O  O    . ALA A 1 86  ? 12.928  26.531 27.846  1.00 0.00  ? 86  ALA A O    4  
ATOM   9175  C  CB   . ALA A 1 86  ? 12.375  23.549 26.916  1.00 0.00  ? 86  ALA A CB   4  
ATOM   9176  H  H    . ALA A 1 86  ? 10.888  26.068 26.426  1.00 0.00  ? 86  ALA A H    4  
ATOM   9177  H  HA   . ALA A 1 86  ? 11.050  24.004 28.540  1.00 0.00  ? 86  ALA A HA   4  
ATOM   9178  H  HB1  . ALA A 1 86  ? 12.915  24.083 26.149  1.00 0.00  ? 86  ALA A HB1  4  
ATOM   9179  H  HB2  . ALA A 1 86  ? 11.692  22.850 26.455  1.00 0.00  ? 86  ALA A HB2  4  
ATOM   9180  H  HB3  . ALA A 1 86  ? 13.072  23.009 27.539  1.00 0.00  ? 86  ALA A HB3  4  
ATOM   9181  N  N    . PHE A 1 87  ? 12.945  25.282 29.655  1.00 0.00  ? 87  PHE A N    4  
ATOM   9182  C  CA   . PHE A 1 87  ? 13.888  26.216 30.341  1.00 0.00  ? 87  PHE A CA   4  
ATOM   9183  C  C    . PHE A 1 87  ? 15.319  25.842 29.953  1.00 0.00  ? 87  PHE A C    4  
ATOM   9184  O  O    . PHE A 1 87  ? 15.593  24.724 29.572  1.00 0.00  ? 87  PHE A O    4  
ATOM   9185  C  CB   . PHE A 1 87  ? 13.740  26.092 31.859  1.00 0.00  ? 87  PHE A CB   4  
ATOM   9186  C  CG   . PHE A 1 87  ? 13.507  27.456 32.466  1.00 0.00  ? 87  PHE A CG   4  
ATOM   9187  C  CD1  . PHE A 1 87  ? 12.215  27.995 32.519  1.00 0.00  ? 87  PHE A CD1  4  
ATOM   9188  C  CD2  . PHE A 1 87  ? 14.589  28.181 32.980  1.00 0.00  ? 87  PHE A CD2  4  
ATOM   9189  C  CE1  . PHE A 1 87  ? 12.006  29.257 33.088  1.00 0.00  ? 87  PHE A CE1  4  
ATOM   9190  C  CE2  . PHE A 1 87  ? 14.379  29.443 33.548  1.00 0.00  ? 87  PHE A CE2  4  
ATOM   9191  C  CZ   . PHE A 1 87  ? 13.089  29.982 33.601  1.00 0.00  ? 87  PHE A CZ   4  
ATOM   9192  H  H    . PHE A 1 87  ? 12.628  24.476 30.116  1.00 0.00  ? 87  PHE A H    4  
ATOM   9193  H  HA   . PHE A 1 87  ? 13.679  27.233 30.037  1.00 0.00  ? 87  PHE A HA   4  
ATOM   9194  H  HB2  . PHE A 1 87  ? 12.905  25.446 32.091  1.00 0.00  ? 87  PHE A HB2  4  
ATOM   9195  H  HB3  . PHE A 1 87  ? 14.648  25.671 32.271  1.00 0.00  ? 87  PHE A HB3  4  
ATOM   9196  H  HD1  . PHE A 1 87  ? 11.380  27.435 32.121  1.00 0.00  ? 87  PHE A HD1  4  
ATOM   9197  H  HD2  . PHE A 1 87  ? 15.584  27.766 32.939  1.00 0.00  ? 87  PHE A HD2  4  
ATOM   9198  H  HE1  . PHE A 1 87  ? 11.012  29.673 33.130  1.00 0.00  ? 87  PHE A HE1  4  
ATOM   9199  H  HE2  . PHE A 1 87  ? 15.213  30.002 33.944  1.00 0.00  ? 87  PHE A HE2  4  
ATOM   9200  H  HZ   . PHE A 1 87  ? 12.929  30.954 34.041  1.00 0.00  ? 87  PHE A HZ   4  
ATOM   9201  N  N    . ALA A 1 88  ? 16.235  26.762 30.051  1.00 0.00  ? 88  ALA A N    4  
ATOM   9202  C  CA   . ALA A 1 88  ? 17.647  26.449 29.690  1.00 0.00  ? 88  ALA A CA   4  
ATOM   9203  C  C    . ALA A 1 88  ? 18.224  25.420 30.661  1.00 0.00  ? 88  ALA A C    4  
ATOM   9204  O  O    . ALA A 1 88  ? 17.597  25.067 31.637  1.00 0.00  ? 88  ALA A O    4  
ATOM   9205  C  CB   . ALA A 1 88  ? 18.490  27.714 29.768  1.00 0.00  ? 88  ALA A CB   4  
ATOM   9206  H  H    . ALA A 1 88  ? 15.997  27.658 30.364  1.00 0.00  ? 88  ALA A H    4  
ATOM   9207  H  HA   . ALA A 1 88  ? 17.686  26.053 28.685  1.00 0.00  ? 88  ALA A HA   4  
ATOM   9208  H  HB1  . ALA A 1 88  ? 19.025  27.847 28.841  1.00 0.00  ? 88  ALA A HB1  4  
ATOM   9209  H  HB2  . ALA A 1 88  ? 19.195  27.621 30.582  1.00 0.00  ? 88  ALA A HB2  4  
ATOM   9210  H  HB3  . ALA A 1 88  ? 17.848  28.562 29.943  1.00 0.00  ? 88  ALA A HB3  4  
ATOM   9211  N  N    . PRO A 1 89  ? 19.415  24.975 30.349  1.00 0.00  ? 89  PRO A N    4  
ATOM   9212  C  CA   . PRO A 1 89  ? 20.140  23.982 31.155  1.00 0.00  ? 89  PRO A CA   4  
ATOM   9213  C  C    . PRO A 1 89  ? 20.854  24.657 32.331  1.00 0.00  ? 89  PRO A C    4  
ATOM   9214  O  O    . PRO A 1 89  ? 21.174  25.828 32.291  1.00 0.00  ? 89  PRO A O    4  
ATOM   9215  C  CB   . PRO A 1 89  ? 21.165  23.412 30.179  1.00 0.00  ? 89  PRO A CB   4  
ATOM   9216  C  CG   . PRO A 1 89  ? 21.367  24.487 29.081  1.00 0.00  ? 89  PRO A CG   4  
ATOM   9217  C  CD   . PRO A 1 89  ? 20.139  25.417 29.144  1.00 0.00  ? 89  PRO A CD   4  
ATOM   9218  H  HA   . PRO A 1 89  ? 19.481  23.203 31.497  1.00 0.00  ? 89  PRO A HA   4  
ATOM   9219  H  HB2  . PRO A 1 89  ? 22.096  23.215 30.693  1.00 0.00  ? 89  PRO A HB2  4  
ATOM   9220  H  HB3  . PRO A 1 89  ? 20.784  22.506 29.731  1.00 0.00  ? 89  PRO A HB3  4  
ATOM   9221  H  HG2  . PRO A 1 89  ? 22.273  25.050 29.276  1.00 0.00  ? 89  PRO A HG2  4  
ATOM   9222  H  HG3  . PRO A 1 89  ? 21.422  24.020 28.107  1.00 0.00  ? 89  PRO A HG3  4  
ATOM   9223  H  HD2  . PRO A 1 89  ? 20.447  26.451 29.245  1.00 0.00  ? 89  PRO A HD2  4  
ATOM   9224  H  HD3  . PRO A 1 89  ? 19.520  25.290 28.270  1.00 0.00  ? 89  PRO A HD3  4  
ATOM   9225  N  N    . GLY A 1 90  ? 21.113  23.924 33.372  1.00 0.00  ? 90  GLY A N    4  
ATOM   9226  C  CA   . GLY A 1 90  ? 21.810  24.522 34.542  1.00 0.00  ? 90  GLY A CA   4  
ATOM   9227  C  C    . GLY A 1 90  ? 22.046  23.446 35.593  1.00 0.00  ? 90  GLY A C    4  
ATOM   9228  O  O    . GLY A 1 90  ? 22.577  22.392 35.307  1.00 0.00  ? 90  GLY A O    4  
ATOM   9229  H  H    . GLY A 1 90  ? 20.855  22.977 33.386  1.00 0.00  ? 90  GLY A H    4  
ATOM   9230  H  HA2  . GLY A 1 90  ? 22.760  24.932 34.224  1.00 0.00  ? 90  GLY A HA2  4  
ATOM   9231  H  HA3  . GLY A 1 90  ? 21.203  25.305 34.963  1.00 0.00  ? 90  GLY A HA3  4  
ATOM   9232  N  N    . THR A 1 91  ? 21.664  23.700 36.811  1.00 0.00  ? 91  THR A N    4  
ATOM   9233  C  CA   . THR A 1 91  ? 21.884  22.684 37.867  1.00 0.00  ? 91  THR A CA   4  
ATOM   9234  C  C    . THR A 1 91  ? 20.638  22.542 38.740  1.00 0.00  ? 91  THR A C    4  
ATOM   9235  O  O    . THR A 1 91  ? 20.677  22.750 39.937  1.00 0.00  ? 91  THR A O    4  
ATOM   9236  C  CB   . THR A 1 91  ? 23.065  23.105 38.731  1.00 0.00  ? 91  THR A CB   4  
ATOM   9237  O  OG1  . THR A 1 91  ? 23.994  23.838 37.941  1.00 0.00  ? 91  THR A OG1  4  
ATOM   9238  C  CG2  . THR A 1 91  ? 23.731  21.854 39.296  1.00 0.00  ? 91  THR A CG2  4  
ATOM   9239  H  H    . THR A 1 91  ? 21.244  24.559 37.029  1.00 0.00  ? 91  THR A H    4  
ATOM   9240  H  HA   . THR A 1 91  ? 22.104  21.735 37.405  1.00 0.00  ? 91  THR A HA   4  
ATOM   9241  H  HB   . THR A 1 91  ? 22.717  23.722 39.543  1.00 0.00  ? 91  THR A HB   4  
ATOM   9242  H  HG1  . THR A 1 91  ? 24.195  24.657 38.402  1.00 0.00  ? 91  THR A HG1  4  
ATOM   9243  H  HG21 . THR A 1 91  ? 24.766  22.062 39.519  1.00 0.00  ? 91  THR A HG21 4  
ATOM   9244  H  HG22 . THR A 1 91  ? 23.670  21.055 38.570  1.00 0.00  ? 91  THR A HG22 4  
ATOM   9245  H  HG23 . THR A 1 91  ? 23.220  21.556 40.198  1.00 0.00  ? 91  THR A HG23 4  
ATOM   9246  N  N    . GLY A 1 92  ? 19.536  22.176 38.153  1.00 0.00  ? 92  GLY A N    4  
ATOM   9247  C  CA   . GLY A 1 92  ? 18.292  22.009 38.953  1.00 0.00  ? 92  GLY A CA   4  
ATOM   9248  C  C    . GLY A 1 92  ? 17.086  22.478 38.140  1.00 0.00  ? 92  GLY A C    4  
ATOM   9249  O  O    . GLY A 1 92  ? 16.253  21.690 37.746  1.00 0.00  ? 92  GLY A O    4  
ATOM   9250  H  H    . GLY A 1 92  ? 19.529  22.004 37.189  1.00 0.00  ? 92  GLY A H    4  
ATOM   9251  H  HA2  . GLY A 1 92  ? 18.172  20.964 39.207  1.00 0.00  ? 92  GLY A HA2  4  
ATOM   9252  H  HA3  . GLY A 1 92  ? 18.364  22.594 39.856  1.00 0.00  ? 92  GLY A HA3  4  
ATOM   9253  N  N    . VAL A 1 93  ? 16.986  23.751 37.874  1.00 0.00  ? 93  VAL A N    4  
ATOM   9254  C  CA   . VAL A 1 93  ? 15.839  24.251 37.070  1.00 0.00  ? 93  VAL A CA   4  
ATOM   9255  C  C    . VAL A 1 93  ? 16.132  23.985 35.599  1.00 0.00  ? 93  VAL A C    4  
ATOM   9256  O  O    . VAL A 1 93  ? 15.361  24.326 34.724  1.00 0.00  ? 93  VAL A O    4  
ATOM   9257  C  CB   . VAL A 1 93  ? 15.681  25.752 37.294  1.00 0.00  ? 93  VAL A CB   4  
ATOM   9258  C  CG1  . VAL A 1 93  ? 14.482  26.264 36.497  1.00 0.00  ? 93  VAL A CG1  4  
ATOM   9259  C  CG2  . VAL A 1 93  ? 15.459  26.023 38.782  1.00 0.00  ? 93  VAL A CG2  4  
ATOM   9260  H  H    . VAL A 1 93  ? 17.672  24.376 38.188  1.00 0.00  ? 93  VAL A H    4  
ATOM   9261  H  HA   . VAL A 1 93  ? 14.936  23.740 37.360  1.00 0.00  ? 93  VAL A HA   4  
ATOM   9262  H  HB   . VAL A 1 93  ? 16.575  26.258 36.963  1.00 0.00  ? 93  VAL A HB   4  
ATOM   9263  H  HG11 . VAL A 1 93  ? 13.860  25.431 36.207  1.00 0.00  ? 93  VAL A HG11 4  
ATOM   9264  H  HG12 . VAL A 1 93  ? 14.831  26.778 35.614  1.00 0.00  ? 93  VAL A HG12 4  
ATOM   9265  H  HG13 . VAL A 1 93  ? 13.909  26.946 37.110  1.00 0.00  ? 93  VAL A HG13 4  
ATOM   9266  H  HG21 . VAL A 1 93  ? 14.404  25.965 39.007  1.00 0.00  ? 93  VAL A HG21 4  
ATOM   9267  H  HG22 . VAL A 1 93  ? 15.824  27.009 39.026  1.00 0.00  ? 93  VAL A HG22 4  
ATOM   9268  H  HG23 . VAL A 1 93  ? 15.992  25.289 39.366  1.00 0.00  ? 93  VAL A HG23 4  
ATOM   9269  N  N    . GLY A 1 94  ? 17.252  23.381 35.320  1.00 0.00  ? 94  GLY A N    4  
ATOM   9270  C  CA   . GLY A 1 94  ? 17.601  23.097 33.913  1.00 0.00  ? 94  GLY A CA   4  
ATOM   9271  C  C    . GLY A 1 94  ? 16.837  21.866 33.424  1.00 0.00  ? 94  GLY A C    4  
ATOM   9272  O  O    . GLY A 1 94  ? 16.769  20.855 34.095  1.00 0.00  ? 94  GLY A O    4  
ATOM   9273  H  H    . GLY A 1 94  ? 17.866  23.119 36.037  1.00 0.00  ? 94  GLY A H    4  
ATOM   9274  H  HA2  . GLY A 1 94  ? 17.333  23.948 33.309  1.00 0.00  ? 94  GLY A HA2  4  
ATOM   9275  H  HA3  . GLY A 1 94  ? 18.662  22.917 33.834  1.00 0.00  ? 94  GLY A HA3  4  
ATOM   9276  N  N    . GLY A 1 95  ? 16.277  21.944 32.249  1.00 0.00  ? 95  GLY A N    4  
ATOM   9277  C  CA   . GLY A 1 95  ? 15.533  20.780 31.687  1.00 0.00  ? 95  GLY A CA   4  
ATOM   9278  C  C    . GLY A 1 95  ? 14.100  20.755 32.207  1.00 0.00  ? 95  GLY A C    4  
ATOM   9279  O  O    . GLY A 1 95  ? 13.806  20.183 33.234  1.00 0.00  ? 95  GLY A O    4  
ATOM   9280  H  H    . GLY A 1 95  ? 16.360  22.768 31.728  1.00 0.00  ? 95  GLY A H    4  
ATOM   9281  H  HA2  . GLY A 1 95  ? 15.518  20.854 30.610  1.00 0.00  ? 95  GLY A HA2  4  
ATOM   9282  H  HA3  . GLY A 1 95  ? 16.027  19.866 31.975  1.00 0.00  ? 95  GLY A HA3  4  
ATOM   9283  N  N    . ASP A 1 96  ? 13.199  21.357 31.498  1.00 0.00  ? 96  ASP A N    4  
ATOM   9284  C  CA   . ASP A 1 96  ? 11.786  21.350 31.954  1.00 0.00  ? 96  ASP A CA   4  
ATOM   9285  C  C    . ASP A 1 96  ? 10.890  21.682 30.773  1.00 0.00  ? 96  ASP A C    4  
ATOM   9286  O  O    . ASP A 1 96  ? 11.013  22.725 30.161  1.00 0.00  ? 96  ASP A O    4  
ATOM   9287  C  CB   . ASP A 1 96  ? 11.586  22.392 33.056  1.00 0.00  ? 96  ASP A CB   4  
ATOM   9288  C  CG   . ASP A 1 96  ? 12.587  22.161 34.193  1.00 0.00  ? 96  ASP A CG   4  
ATOM   9289  O  OD1  . ASP A 1 96  ? 13.678  22.706 34.119  1.00 0.00  ? 96  ASP A OD1  4  
ATOM   9290  O  OD2  . ASP A 1 96  ? 12.248  21.442 35.118  1.00 0.00  ? 96  ASP A OD2  4  
ATOM   9291  H  H    . ASP A 1 96  ? 13.444  21.803 30.659  1.00 0.00  ? 96  ASP A H    4  
ATOM   9292  H  HA   . ASP A 1 96  ? 11.536  20.370 32.331  1.00 0.00  ? 96  ASP A HA   4  
ATOM   9293  H  HB2  . ASP A 1 96  ? 11.734  23.377 32.645  1.00 0.00  ? 96  ASP A HB2  4  
ATOM   9294  H  HB3  . ASP A 1 96  ? 10.582  22.312 33.441  1.00 0.00  ? 96  ASP A HB3  4  
ATOM   9295  N  N    . SER A 1 97  ? 10.002  20.790 30.435  1.00 0.00  ? 97  SER A N    4  
ATOM   9296  C  CA   . SER A 1 97  ? 9.110   21.036 29.273  1.00 0.00  ? 97  SER A CA   4  
ATOM   9297  C  C    . SER A 1 97  ? 7.673   21.271 29.741  1.00 0.00  ? 97  SER A C    4  
ATOM   9298  O  O    . SER A 1 97  ? 7.109   20.508 30.504  1.00 0.00  ? 97  SER A O    4  
ATOM   9299  C  CB   . SER A 1 97  ? 9.152   19.825 28.347  1.00 0.00  ? 97  SER A CB   4  
ATOM   9300  O  OG   . SER A 1 97  ? 8.133   18.909 28.721  1.00 0.00  ? 97  SER A OG   4  
ATOM   9301  H  H    . SER A 1 97  ? 9.939   19.949 30.936  1.00 0.00  ? 97  SER A H    4  
ATOM   9302  H  HA   . SER A 1 97  ? 9.455   21.906 28.737  1.00 0.00  ? 97  SER A HA   4  
ATOM   9303  H  HB2  . SER A 1 97  ? 8.988   20.142 27.331  1.00 0.00  ? 97  SER A HB2  4  
ATOM   9304  H  HB3  . SER A 1 97  ? 10.122  19.351 28.425  1.00 0.00  ? 97  SER A HB3  4  
ATOM   9305  H  HG   . SER A 1 97  ? 8.448   18.024 28.530  1.00 0.00  ? 97  SER A HG   4  
ATOM   9306  N  N    . HIS A 1 98  ? 7.074   22.324 29.268  1.00 0.00  ? 98  HIS A N    4  
ATOM   9307  C  CA   . HIS A 1 98  ? 5.676   22.615 29.662  1.00 0.00  ? 98  HIS A CA   4  
ATOM   9308  C  C    . HIS A 1 98  ? 4.793   22.620 28.421  1.00 0.00  ? 98  HIS A C    4  
ATOM   9309  O  O    . HIS A 1 98  ? 5.227   22.962 27.338  1.00 0.00  ? 98  HIS A O    4  
ATOM   9310  C  CB   . HIS A 1 98  ? 5.611   23.981 30.334  1.00 0.00  ? 98  HIS A CB   4  
ATOM   9311  C  CG   . HIS A 1 98  ? 6.496   23.972 31.544  1.00 0.00  ? 98  HIS A CG   4  
ATOM   9312  N  ND1  . HIS A 1 98  ? 7.306   25.042 31.869  1.00 0.00  ? 98  HIS A ND1  4  
ATOM   9313  C  CD2  . HIS A 1 98  ? 6.722   23.023 32.507  1.00 0.00  ? 98  HIS A CD2  4  
ATOM   9314  C  CE1  . HIS A 1 98  ? 7.978   24.718 32.986  1.00 0.00  ? 98  HIS A CE1  4  
ATOM   9315  N  NE2  . HIS A 1 98  ? 7.658   23.495 33.419  1.00 0.00  ? 98  HIS A NE2  4  
ATOM   9316  H  H    . HIS A 1 98  ? 7.544   22.920 28.650  1.00 0.00  ? 98  HIS A H    4  
ATOM   9317  H  HA   . HIS A 1 98  ? 5.330   21.857 30.352  1.00 0.00  ? 98  HIS A HA   4  
ATOM   9318  H  HB2  . HIS A 1 98  ? 5.950   24.739 29.643  1.00 0.00  ? 98  HIS A HB2  4  
ATOM   9319  H  HB3  . HIS A 1 98  ? 4.595   24.192 30.630  1.00 0.00  ? 98  HIS A HB3  4  
ATOM   9320  H  HD1  . HIS A 1 98  ? 7.388   25.877 31.366  1.00 0.00  ? 98  HIS A HD1  4  
ATOM   9321  H  HD2  . HIS A 1 98  ? 6.254   22.048 32.541  1.00 0.00  ? 98  HIS A HD2  4  
ATOM   9322  H  HE1  . HIS A 1 98  ? 8.700   25.362 33.467  1.00 0.00  ? 98  HIS A HE1  4  
ATOM   9323  N  N    . PHE A 1 99  ? 3.557   22.242 28.571  1.00 0.00  ? 99  PHE A N    4  
ATOM   9324  C  CA   . PHE A 1 99  ? 2.636   22.218 27.401  1.00 0.00  ? 99  PHE A CA   4  
ATOM   9325  C  C    . PHE A 1 99  ? 1.547   23.294 27.571  1.00 0.00  ? 99  PHE A C    4  
ATOM   9326  O  O    . PHE A 1 99  ? 1.120   23.593 28.673  1.00 0.00  ? 99  PHE A O    4  
ATOM   9327  C  CB   . PHE A 1 99  ? 1.989   20.832 27.301  1.00 0.00  ? 99  PHE A CB   4  
ATOM   9328  C  CG   . PHE A 1 99  ? 3.056   19.763 27.283  1.00 0.00  ? 99  PHE A CG   4  
ATOM   9329  C  CD1  . PHE A 1 99  ? 4.342   20.054 26.813  1.00 0.00  ? 99  PHE A CD1  4  
ATOM   9330  C  CD2  . PHE A 1 99  ? 2.747   18.474 27.721  1.00 0.00  ? 99  PHE A CD2  4  
ATOM   9331  C  CE1  . PHE A 1 99  ? 5.320   19.051 26.788  1.00 0.00  ? 99  PHE A CE1  4  
ATOM   9332  C  CE2  . PHE A 1 99  ? 3.721   17.473 27.699  1.00 0.00  ? 99  PHE A CE2  4  
ATOM   9333  C  CZ   . PHE A 1 99  ? 5.007   17.760 27.229  1.00 0.00  ? 99  PHE A CZ   4  
ATOM   9334  H  H    . PHE A 1 99  ? 3.236   21.968 29.454  1.00 0.00  ? 99  PHE A H    4  
ATOM   9335  H  HA   . PHE A 1 99  ? 3.197   22.417 26.499  1.00 0.00  ? 99  PHE A HA   4  
ATOM   9336  H  HB2  . PHE A 1 99  ? 1.342   20.672 28.147  1.00 0.00  ? 99  PHE A HB2  4  
ATOM   9337  H  HB3  . PHE A 1 99  ? 1.412   20.771 26.391  1.00 0.00  ? 99  PHE A HB3  4  
ATOM   9338  H  HD1  . PHE A 1 99  ? 4.583   21.051 26.477  1.00 0.00  ? 99  PHE A HD1  4  
ATOM   9339  H  HD2  . PHE A 1 99  ? 1.753   18.252 28.082  1.00 0.00  ? 99  PHE A HD2  4  
ATOM   9340  H  HE1  . PHE A 1 99  ? 6.312   19.272 26.421  1.00 0.00  ? 99  PHE A HE1  4  
ATOM   9341  H  HE2  . PHE A 1 99  ? 3.477   16.476 28.038  1.00 0.00  ? 99  PHE A HE2  4  
ATOM   9342  H  HZ   . PHE A 1 99  ? 5.761   16.986 27.212  1.00 0.00  ? 99  PHE A HZ   4  
ATOM   9343  N  N    . ASP A 1 100 ? 1.101   23.868 26.475  1.00 0.00  ? 100 ASP A N    4  
ATOM   9344  C  CA   . ASP A 1 100 ? 0.037   24.920 26.523  1.00 0.00  ? 100 ASP A CA   4  
ATOM   9345  C  C    . ASP A 1 100 ? -1.315  24.227 26.640  1.00 0.00  ? 100 ASP A C    4  
ATOM   9346  O  O    . ASP A 1 100 ? -1.737  23.506 25.753  1.00 0.00  ? 100 ASP A O    4  
ATOM   9347  C  CB   . ASP A 1 100 ? 0.095   25.753 25.233  1.00 0.00  ? 100 ASP A CB   4  
ATOM   9348  C  CG   . ASP A 1 100 ? -1.086  26.726 25.182  1.00 0.00  ? 100 ASP A CG   4  
ATOM   9349  O  OD1  . ASP A 1 100 ? -2.210  26.257 25.179  1.00 0.00  ? 100 ASP A OD1  4  
ATOM   9350  O  OD2  . ASP A 1 100 ? -0.846  27.921 25.138  1.00 0.00  ? 100 ASP A OD2  4  
ATOM   9351  H  H    . ASP A 1 100 ? 1.463   23.597 25.612  1.00 0.00  ? 100 ASP A H    4  
ATOM   9352  H  HA   . ASP A 1 100 ? 0.184   25.564 27.380  1.00 0.00  ? 100 ASP A HA   4  
ATOM   9353  H  HB2  . ASP A 1 100 ? 1.022   26.308 25.206  1.00 0.00  ? 100 ASP A HB2  4  
ATOM   9354  H  HB3  . ASP A 1 100 ? 0.049   25.093 24.379  1.00 0.00  ? 100 ASP A HB3  4  
ATOM   9355  N  N    . ASP A 1 101 ? -1.986  24.420 27.734  1.00 0.00  ? 101 ASP A N    4  
ATOM   9356  C  CA   . ASP A 1 101 ? -3.296  23.754 27.920  1.00 0.00  ? 101 ASP A CA   4  
ATOM   9357  C  C    . ASP A 1 101 ? -4.220  24.151 26.773  1.00 0.00  ? 101 ASP A C    4  
ATOM   9358  O  O    . ASP A 1 101 ? -4.175  23.559 25.713  1.00 0.00  ? 101 ASP A O    4  
ATOM   9359  C  CB   . ASP A 1 101 ? -3.891  24.176 29.268  1.00 0.00  ? 101 ASP A CB   4  
ATOM   9360  C  CG   . ASP A 1 101 ? -5.304  23.607 29.419  1.00 0.00  ? 101 ASP A CG   4  
ATOM   9361  O  OD1  . ASP A 1 101 ? -5.463  22.411 29.237  1.00 0.00  ? 101 ASP A OD1  4  
ATOM   9362  O  OD2  . ASP A 1 101 ? -6.203  24.378 29.719  1.00 0.00  ? 101 ASP A OD2  4  
ATOM   9363  H  H    . ASP A 1 101 ? -1.623  24.996 28.437  1.00 0.00  ? 101 ASP A H    4  
ATOM   9364  H  HA   . ASP A 1 101 ? -3.150  22.686 27.909  1.00 0.00  ? 101 ASP A HA   4  
ATOM   9365  H  HB2  . ASP A 1 101 ? -3.266  23.797 30.068  1.00 0.00  ? 101 ASP A HB2  4  
ATOM   9366  H  HB3  . ASP A 1 101 ? -3.928  25.252 29.321  1.00 0.00  ? 101 ASP A HB3  4  
ATOM   9367  N  N    . ASP A 1 102 ? -5.036  25.156 26.983  1.00 0.00  ? 102 ASP A N    4  
ATOM   9368  C  CA   . ASP A 1 102 ? -5.983  25.639 25.927  1.00 0.00  ? 102 ASP A CA   4  
ATOM   9369  C  C    . ASP A 1 102 ? -6.252  24.545 24.874  1.00 0.00  ? 102 ASP A C    4  
ATOM   9370  O  O    . ASP A 1 102 ? -7.132  23.726 25.042  1.00 0.00  ? 102 ASP A O    4  
ATOM   9371  C  CB   . ASP A 1 102 ? -5.404  26.892 25.248  1.00 0.00  ? 102 ASP A CB   4  
ATOM   9372  C  CG   . ASP A 1 102 ? -5.054  27.956 26.297  1.00 0.00  ? 102 ASP A CG   4  
ATOM   9373  O  OD1  . ASP A 1 102 ? -5.854  28.170 27.194  1.00 0.00  ? 102 ASP A OD1  4  
ATOM   9374  O  OD2  . ASP A 1 102 ? -3.989  28.546 26.178  1.00 0.00  ? 102 ASP A OD2  4  
ATOM   9375  H  H    . ASP A 1 102 ? -5.024  25.607 27.851  1.00 0.00  ? 102 ASP A H    4  
ATOM   9376  H  HA   . ASP A 1 102 ? -6.919  25.901 26.399  1.00 0.00  ? 102 ASP A HA   4  
ATOM   9377  H  HB2  . ASP A 1 102 ? -4.512  26.627 24.705  1.00 0.00  ? 102 ASP A HB2  4  
ATOM   9378  H  HB3  . ASP A 1 102 ? -6.136  27.296 24.565  1.00 0.00  ? 102 ASP A HB3  4  
ATOM   9379  N  N    . GLU A 1 103 ? -5.508  24.525 23.790  1.00 0.00  ? 103 GLU A N    4  
ATOM   9380  C  CA   . GLU A 1 103 ? -5.738  23.487 22.733  1.00 0.00  ? 103 GLU A CA   4  
ATOM   9381  C  C    . GLU A 1 103 ? -5.992  22.124 23.381  1.00 0.00  ? 103 GLU A C    4  
ATOM   9382  O  O    . GLU A 1 103 ? -5.658  21.895 24.526  1.00 0.00  ? 103 GLU A O    4  
ATOM   9383  C  CB   . GLU A 1 103 ? -4.508  23.372 21.823  1.00 0.00  ? 103 GLU A CB   4  
ATOM   9384  C  CG   . GLU A 1 103 ? -4.298  24.671 21.036  1.00 0.00  ? 103 GLU A CG   4  
ATOM   9385  C  CD   . GLU A 1 103 ? -3.390  25.608 21.832  1.00 0.00  ? 103 GLU A CD   4  
ATOM   9386  O  OE1  . GLU A 1 103 ? -2.188  25.398 21.809  1.00 0.00  ? 103 GLU A OE1  4  
ATOM   9387  O  OE2  . GLU A 1 103 ? -3.911  26.519 22.450  1.00 0.00  ? 103 GLU A OE2  4  
ATOM   9388  H  H    . GLU A 1 103 ? -4.805  25.193 23.666  1.00 0.00  ? 103 GLU A H    4  
ATOM   9389  H  HA   . GLU A 1 103 ? -6.596  23.767 22.140  1.00 0.00  ? 103 GLU A HA   4  
ATOM   9390  H  HB2  . GLU A 1 103 ? -3.635  23.172 22.425  1.00 0.00  ? 103 GLU A HB2  4  
ATOM   9391  H  HB3  . GLU A 1 103 ? -4.654  22.557 21.131  1.00 0.00  ? 103 GLU A HB3  4  
ATOM   9392  H  HG2  . GLU A 1 103 ? -3.833  24.444 20.087  1.00 0.00  ? 103 GLU A HG2  4  
ATOM   9393  H  HG3  . GLU A 1 103 ? -5.248  25.151 20.865  1.00 0.00  ? 103 GLU A HG3  4  
ATOM   9394  N  N    . LEU A 1 104 ? -6.573  21.210 22.647  1.00 0.00  ? 104 LEU A N    4  
ATOM   9395  C  CA   . LEU A 1 104 ? -6.838  19.859 23.213  1.00 0.00  ? 104 LEU A CA   4  
ATOM   9396  C  C    . LEU A 1 104 ? -5.858  18.849 22.616  1.00 0.00  ? 104 LEU A C    4  
ATOM   9397  O  O    . LEU A 1 104 ? -6.019  18.389 21.502  1.00 0.00  ? 104 LEU A O    4  
ATOM   9398  C  CB   . LEU A 1 104 ? -8.263  19.433 22.883  1.00 0.00  ? 104 LEU A CB   4  
ATOM   9399  C  CG   . LEU A 1 104 ? -8.575  18.128 23.614  1.00 0.00  ? 104 LEU A CG   4  
ATOM   9400  C  CD1  . LEU A 1 104 ? -9.412  18.424 24.865  1.00 0.00  ? 104 LEU A CD1  4  
ATOM   9401  C  CD2  . LEU A 1 104 ? -9.345  17.199 22.677  1.00 0.00  ? 104 LEU A CD2  4  
ATOM   9402  H  H    . LEU A 1 104 ? -6.828  21.412 21.722  1.00 0.00  ? 104 LEU A H    4  
ATOM   9403  H  HA   . LEU A 1 104 ? -6.711  19.888 24.286  1.00 0.00  ? 104 LEU A HA   4  
ATOM   9404  H  HB2  . LEU A 1 104 ? -8.949  20.204 23.202  1.00 0.00  ? 104 LEU A HB2  4  
ATOM   9405  H  HB3  . LEU A 1 104 ? -8.357  19.280 21.820  1.00 0.00  ? 104 LEU A HB3  4  
ATOM   9406  H  HG   . LEU A 1 104 ? -7.649  17.656 23.912  1.00 0.00  ? 104 LEU A HG   4  
ATOM   9407  H  HD11 . LEU A 1 104 ? -10.205 19.116 24.617  1.00 0.00  ? 104 LEU A HD11 4  
ATOM   9408  H  HD12 . LEU A 1 104 ? -8.780  18.859 25.627  1.00 0.00  ? 104 LEU A HD12 4  
ATOM   9409  H  HD13 . LEU A 1 104 ? -9.840  17.505 25.239  1.00 0.00  ? 104 LEU A HD13 4  
ATOM   9410  H  HD21 . LEU A 1 104 ? -10.240 17.696 22.330  1.00 0.00  ? 104 LEU A HD21 4  
ATOM   9411  H  HD22 . LEU A 1 104 ? -9.615  16.298 23.206  1.00 0.00  ? 104 LEU A HD22 4  
ATOM   9412  H  HD23 . LEU A 1 104 ? -8.722  16.949 21.832  1.00 0.00  ? 104 LEU A HD23 4  
ATOM   9413  N  N    . TRP A 1 105 ? -4.841  18.506 23.349  1.00 0.00  ? 105 TRP A N    4  
ATOM   9414  C  CA   . TRP A 1 105 ? -3.840  17.535 22.831  1.00 0.00  ? 105 TRP A CA   4  
ATOM   9415  C  C    . TRP A 1 105 ? -4.066  16.152 23.471  1.00 0.00  ? 105 TRP A C    4  
ATOM   9416  O  O    . TRP A 1 105 ? -4.465  16.051 24.615  1.00 0.00  ? 105 TRP A O    4  
ATOM   9417  C  CB   . TRP A 1 105 ? -2.440  18.039 23.187  1.00 0.00  ? 105 TRP A CB   4  
ATOM   9418  C  CG   . TRP A 1 105 ? -2.225  19.433 22.658  1.00 0.00  ? 105 TRP A CG   4  
ATOM   9419  C  CD1  . TRP A 1 105 ? -1.690  20.451 23.373  1.00 0.00  ? 105 TRP A CD1  4  
ATOM   9420  C  CD2  . TRP A 1 105 ? -2.516  19.980 21.332  1.00 0.00  ? 105 TRP A CD2  4  
ATOM   9421  N  NE1  . TRP A 1 105 ? -1.623  21.577 22.575  1.00 0.00  ? 105 TRP A NE1  4  
ATOM   9422  C  CE2  . TRP A 1 105 ? -2.114  21.340 21.310  1.00 0.00  ? 105 TRP A CE2  4  
ATOM   9423  C  CE3  . TRP A 1 105 ? -3.071  19.440 20.155  1.00 0.00  ? 105 TRP A CE3  4  
ATOM   9424  C  CZ2  . TRP A 1 105 ? -2.262  22.132 20.172  1.00 0.00  ? 105 TRP A CZ2  4  
ATOM   9425  C  CZ3  . TRP A 1 105 ? -3.222  20.239 19.007  1.00 0.00  ? 105 TRP A CZ3  4  
ATOM   9426  C  CH2  . TRP A 1 105 ? -2.813  21.579 19.016  1.00 0.00  ? 105 TRP A CH2  4  
ATOM   9427  H  H    . TRP A 1 105 ? -4.730  18.894 24.242  1.00 0.00  ? 105 TRP A H    4  
ATOM   9428  H  HA   . TRP A 1 105 ? -3.932  17.457 21.759  1.00 0.00  ? 105 TRP A HA   4  
ATOM   9429  H  HB2  . TRP A 1 105 ? -2.328  18.049 24.263  1.00 0.00  ? 105 TRP A HB2  4  
ATOM   9430  H  HB3  . TRP A 1 105 ? -1.702  17.377 22.760  1.00 0.00  ? 105 TRP A HB3  4  
ATOM   9431  H  HD1  . TRP A 1 105 ? -1.364  20.391 24.400  1.00 0.00  ? 105 TRP A HD1  4  
ATOM   9432  H  HE1  . TRP A 1 105 ? -1.271  22.449 22.855  1.00 0.00  ? 105 TRP A HE1  4  
ATOM   9433  H  HE3  . TRP A 1 105 ? -3.392  18.408 20.135  1.00 0.00  ? 105 TRP A HE3  4  
ATOM   9434  H  HZ2  . TRP A 1 105 ? -1.943  23.165 20.182  1.00 0.00  ? 105 TRP A HZ2  4  
ATOM   9435  H  HZ3  . TRP A 1 105 ? -3.649  19.815 18.111  1.00 0.00  ? 105 TRP A HZ3  4  
ATOM   9436  H  HH2  . TRP A 1 105 ? -2.930  22.186 18.130  1.00 0.00  ? 105 TRP A HH2  4  
ATOM   9437  N  N    . THR A 1 106 ? -3.793  15.088 22.745  1.00 0.00  ? 106 THR A N    4  
ATOM   9438  C  CA   . THR A 1 106 ? -3.968  13.708 23.311  1.00 0.00  ? 106 THR A CA   4  
ATOM   9439  C  C    . THR A 1 106 ? -3.126  12.705 22.517  1.00 0.00  ? 106 THR A C    4  
ATOM   9440  O  O    . THR A 1 106 ? -2.184  13.064 21.840  1.00 0.00  ? 106 THR A O    4  
ATOM   9441  C  CB   . THR A 1 106 ? -5.440  13.258 23.252  1.00 0.00  ? 106 THR A CB   4  
ATOM   9442  O  OG1  . THR A 1 106 ? -5.710  12.709 21.970  1.00 0.00  ? 106 THR A OG1  4  
ATOM   9443  C  CG2  . THR A 1 106 ? -6.386  14.432 23.505  1.00 0.00  ? 106 THR A CG2  4  
ATOM   9444  H  H    . THR A 1 106 ? -3.454  15.198 21.833  1.00 0.00  ? 106 THR A H    4  
ATOM   9445  H  HA   . THR A 1 106 ? -3.628  13.702 24.332  1.00 0.00  ? 106 THR A HA   4  
ATOM   9446  H  HB   . THR A 1 106 ? -5.608  12.501 24.005  1.00 0.00  ? 106 THR A HB   4  
ATOM   9447  H  HG1  . THR A 1 106 ? -5.534  13.387 21.314  1.00 0.00  ? 106 THR A HG1  4  
ATOM   9448  H  HG21 . THR A 1 106 ? -7.401  14.067 23.540  1.00 0.00  ? 106 THR A HG21 4  
ATOM   9449  H  HG22 . THR A 1 106 ? -6.291  15.151 22.705  1.00 0.00  ? 106 THR A HG22 4  
ATOM   9450  H  HG23 . THR A 1 106 ? -6.141  14.899 24.445  1.00 0.00  ? 106 THR A HG23 4  
ATOM   9451  N  N    . ASN A 1 107 ? -3.464  11.443 22.602  1.00 0.00  ? 107 ASN A N    4  
ATOM   9452  C  CA   . ASN A 1 107 ? -2.693  10.405 21.862  1.00 0.00  ? 107 ASN A CA   4  
ATOM   9453  C  C    . ASN A 1 107 ? -3.623  9.246  21.475  1.00 0.00  ? 107 ASN A C    4  
ATOM   9454  O  O    . ASN A 1 107 ? -3.520  8.152  21.994  1.00 0.00  ? 107 ASN A O    4  
ATOM   9455  C  CB   . ASN A 1 107 ? -1.565  9.877  22.752  1.00 0.00  ? 107 ASN A CB   4  
ATOM   9456  C  CG   . ASN A 1 107 ? -0.434  9.329  21.879  1.00 0.00  ? 107 ASN A CG   4  
ATOM   9457  O  OD1  . ASN A 1 107 ? 0.723   9.469  22.217  1.00 0.00  ? 107 ASN A OD1  4  
ATOM   9458  N  ND2  . ASN A 1 107 ? -0.716  8.713  20.761  1.00 0.00  ? 107 ASN A ND2  4  
ATOM   9459  H  H    . ASN A 1 107 ? -4.229  11.179 23.157  1.00 0.00  ? 107 ASN A H    4  
ATOM   9460  H  HA   . ASN A 1 107 ? -2.270  10.841 20.971  1.00 0.00  ? 107 ASN A HA   4  
ATOM   9461  H  HB2  . ASN A 1 107 ? -1.186  10.684 23.366  1.00 0.00  ? 107 ASN A HB2  4  
ATOM   9462  H  HB3  . ASN A 1 107 ? -1.943  9.092  23.387  1.00 0.00  ? 107 ASN A HB3  4  
ATOM   9463  H  HD21 . ASN A 1 107 ? -1.647  8.604  20.479  1.00 0.00  ? 107 ASN A HD21 4  
ATOM   9464  H  HD22 . ASN A 1 107 ? 0.006   8.355  20.207  1.00 0.00  ? 107 ASN A HD22 4  
ATOM   9465  N  N    . THR A 1 108 ? -4.519  9.485  20.556  1.00 0.00  ? 108 THR A N    4  
ATOM   9466  C  CA   . THR A 1 108 ? -5.460  8.418  20.105  1.00 0.00  ? 108 THR A CA   4  
ATOM   9467  C  C    . THR A 1 108 ? -6.165  8.919  18.837  1.00 0.00  ? 108 THR A C    4  
ATOM   9468  O  O    . THR A 1 108 ? -5.607  8.878  17.760  1.00 0.00  ? 108 THR A O    4  
ATOM   9469  C  CB   . THR A 1 108 ? -6.482  8.125  21.207  1.00 0.00  ? 108 THR A CB   4  
ATOM   9470  O  OG1  . THR A 1 108 ? -7.651  7.568  20.623  1.00 0.00  ? 108 THR A OG1  4  
ATOM   9471  C  CG2  . THR A 1 108 ? -6.834  9.417  21.942  1.00 0.00  ? 108 THR A CG2  4  
ATOM   9472  H  H    . THR A 1 108 ? -4.570  10.374 20.151  1.00 0.00  ? 108 THR A H    4  
ATOM   9473  H  HA   . THR A 1 108 ? -4.906  7.522  19.883  1.00 0.00  ? 108 THR A HA   4  
ATOM   9474  H  HB   . THR A 1 108 ? -6.061  7.420  21.909  1.00 0.00  ? 108 THR A HB   4  
ATOM   9475  H  HG1  . THR A 1 108 ? -8.408  7.868  21.127  1.00 0.00  ? 108 THR A HG1  4  
ATOM   9476  H  HG21 . THR A 1 108 ? -6.513  10.264 21.356  1.00 0.00  ? 108 THR A HG21 4  
ATOM   9477  H  HG22 . THR A 1 108 ? -6.336  9.433  22.901  1.00 0.00  ? 108 THR A HG22 4  
ATOM   9478  H  HG23 . THR A 1 108 ? -7.901  9.465  22.092  1.00 0.00  ? 108 THR A HG23 4  
ATOM   9479  N  N    . SER A 1 109 ? -7.373  9.426  18.950  1.00 0.00  ? 109 SER A N    4  
ATOM   9480  C  CA   . SER A 1 109 ? -8.074  9.961  17.737  1.00 0.00  ? 109 SER A CA   4  
ATOM   9481  C  C    . SER A 1 109 ? -8.879  11.214 18.117  1.00 0.00  ? 109 SER A C    4  
ATOM   9482  O  O    . SER A 1 109 ? -10.084 11.259 17.963  1.00 0.00  ? 109 SER A O    4  
ATOM   9483  C  CB   . SER A 1 109 ? -9.015  8.906  17.150  1.00 0.00  ? 109 SER A CB   4  
ATOM   9484  O  OG   . SER A 1 109 ? -8.751  8.782  15.760  1.00 0.00  ? 109 SER A OG   4  
ATOM   9485  H  H    . SER A 1 109 ? -7.805  9.474  19.826  1.00 0.00  ? 109 SER A H    4  
ATOM   9486  H  HA   . SER A 1 109 ? -7.337  10.230 16.994  1.00 0.00  ? 109 SER A HA   4  
ATOM   9487  H  HB2  . SER A 1 109 ? -8.846  7.955  17.628  1.00 0.00  ? 109 SER A HB2  4  
ATOM   9488  H  HB3  . SER A 1 109 ? -10.045 9.210  17.303  1.00 0.00  ? 109 SER A HB3  4  
ATOM   9489  H  HG   . SER A 1 109 ? -7.805  8.682  15.647  1.00 0.00  ? 109 SER A HG   4  
ATOM   9490  N  N    . ALA A 1 110 ? -8.217  12.234 18.614  1.00 0.00  ? 110 ALA A N    4  
ATOM   9491  C  CA   . ALA A 1 110 ? -8.941  13.487 19.009  1.00 0.00  ? 110 ALA A CA   4  
ATOM   9492  C  C    . ALA A 1 110 ? -8.123  14.737 18.636  1.00 0.00  ? 110 ALA A C    4  
ATOM   9493  O  O    . ALA A 1 110 ? -8.668  15.809 18.470  1.00 0.00  ? 110 ALA A O    4  
ATOM   9494  C  CB   . ALA A 1 110 ? -9.175  13.488 20.519  1.00 0.00  ? 110 ALA A CB   4  
ATOM   9495  H  H    . ALA A 1 110 ? -7.248  12.172 18.730  1.00 0.00  ? 110 ALA A H    4  
ATOM   9496  H  HA   . ALA A 1 110 ? -9.894  13.521 18.500  1.00 0.00  ? 110 ALA A HA   4  
ATOM   9497  H  HB1  . ALA A 1 110 ? -8.557  14.250 20.973  1.00 0.00  ? 110 ALA A HB1  4  
ATOM   9498  H  HB2  . ALA A 1 110 ? -8.913  12.522 20.927  1.00 0.00  ? 110 ALA A HB2  4  
ATOM   9499  H  HB3  . ALA A 1 110 ? -10.215 13.699 20.723  1.00 0.00  ? 110 ALA A HB3  4  
ATOM   9500  N  N    . ASN A 1 111 ? -6.826  14.620 18.512  1.00 0.00  ? 111 ASN A N    4  
ATOM   9501  C  CA   . ASN A 1 111 ? -5.997  15.813 18.154  1.00 0.00  ? 111 ASN A CA   4  
ATOM   9502  C  C    . ASN A 1 111 ? -4.573  15.349 17.821  1.00 0.00  ? 111 ASN A C    4  
ATOM   9503  O  O    . ASN A 1 111 ? -4.366  14.225 17.409  1.00 0.00  ? 111 ASN A O    4  
ATOM   9504  C  CB   . ASN A 1 111 ? -5.971  16.807 19.324  1.00 0.00  ? 111 ASN A CB   4  
ATOM   9505  C  CG   . ASN A 1 111 ? -6.113  18.239 18.794  1.00 0.00  ? 111 ASN A CG   4  
ATOM   9506  O  OD1  . ASN A 1 111 ? -6.791  19.053 19.389  1.00 0.00  ? 111 ASN A OD1  4  
ATOM   9507  N  ND2  . ASN A 1 111 ? -5.503  18.582 17.690  1.00 0.00  ? 111 ASN A ND2  4  
ATOM   9508  H  H    . ASN A 1 111 ? -6.396  13.753 18.654  1.00 0.00  ? 111 ASN A H    4  
ATOM   9509  H  HA   . ASN A 1 111 ? -6.426  16.293 17.288  1.00 0.00  ? 111 ASN A HA   4  
ATOM   9510  H  HB2  . ASN A 1 111 ? -6.788  16.591 19.999  1.00 0.00  ? 111 ASN A HB2  4  
ATOM   9511  H  HB3  . ASN A 1 111 ? -5.036  16.716 19.856  1.00 0.00  ? 111 ASN A HB3  4  
ATOM   9512  H  HD21 . ASN A 1 111 ? -4.962  17.925 17.205  1.00 0.00  ? 111 ASN A HD21 4  
ATOM   9513  H  HD22 . ASN A 1 111 ? -5.582  19.497 17.350  1.00 0.00  ? 111 ASN A HD22 4  
ATOM   9514  N  N    . TYR A 1 112 ? -3.586  16.193 17.992  1.00 0.00  ? 112 TYR A N    4  
ATOM   9515  C  CA   . TYR A 1 112 ? -2.193  15.761 17.674  1.00 0.00  ? 112 TYR A CA   4  
ATOM   9516  C  C    . TYR A 1 112 ? -1.778  14.697 18.679  1.00 0.00  ? 112 TYR A C    4  
ATOM   9517  O  O    . TYR A 1 112 ? -2.596  14.164 19.402  1.00 0.00  ? 112 TYR A O    4  
ATOM   9518  C  CB   . TYR A 1 112 ? -1.226  16.947 17.772  1.00 0.00  ? 112 TYR A CB   4  
ATOM   9519  C  CG   . TYR A 1 112 ? -1.259  17.749 16.498  1.00 0.00  ? 112 TYR A CG   4  
ATOM   9520  C  CD1  . TYR A 1 112 ? -1.322  17.108 15.254  1.00 0.00  ? 112 TYR A CD1  4  
ATOM   9521  C  CD2  . TYR A 1 112 ? -1.228  19.143 16.566  1.00 0.00  ? 112 TYR A CD2  4  
ATOM   9522  C  CE1  . TYR A 1 112 ? -1.359  17.867 14.081  1.00 0.00  ? 112 TYR A CE1  4  
ATOM   9523  C  CE2  . TYR A 1 112 ? -1.270  19.900 15.394  1.00 0.00  ? 112 TYR A CE2  4  
ATOM   9524  C  CZ   . TYR A 1 112 ? -1.335  19.261 14.152  1.00 0.00  ? 112 TYR A CZ   4  
ATOM   9525  O  OH   . TYR A 1 112 ? -1.390  20.002 12.993  1.00 0.00  ? 112 TYR A OH   4  
ATOM   9526  H  H    . TYR A 1 112 ? -3.758  17.096 18.329  1.00 0.00  ? 112 TYR A H    4  
ATOM   9527  H  HA   . TYR A 1 112 ? -2.163  15.346 16.679  1.00 0.00  ? 112 TYR A HA   4  
ATOM   9528  H  HB2  . TYR A 1 112 ? -1.516  17.580 18.599  1.00 0.00  ? 112 TYR A HB2  4  
ATOM   9529  H  HB3  . TYR A 1 112 ? -0.223  16.584 17.938  1.00 0.00  ? 112 TYR A HB3  4  
ATOM   9530  H  HD1  . TYR A 1 112 ? -1.336  16.031 15.197  1.00 0.00  ? 112 TYR A HD1  4  
ATOM   9531  H  HD2  . TYR A 1 112 ? -1.176  19.634 17.525  1.00 0.00  ? 112 TYR A HD2  4  
ATOM   9532  H  HE1  . TYR A 1 112 ? -1.406  17.377 13.120  1.00 0.00  ? 112 TYR A HE1  4  
ATOM   9533  H  HE2  . TYR A 1 112 ? -1.243  20.977 15.448  1.00 0.00  ? 112 TYR A HE2  4  
ATOM   9534  H  HH   . TYR A 1 112 ? -1.796  19.456 12.316  1.00 0.00  ? 112 TYR A HH   4  
ATOM   9535  N  N    . SER A 1 113 ? -0.519  14.378 18.731  1.00 0.00  ? 113 SER A N    4  
ATOM   9536  C  CA   . SER A 1 113 ? -0.060  13.344 19.689  1.00 0.00  ? 113 SER A CA   4  
ATOM   9537  C  C    . SER A 1 113 ? 0.667   14.005 20.859  1.00 0.00  ? 113 SER A C    4  
ATOM   9538  O  O    . SER A 1 113 ? 1.696   14.634 20.690  1.00 0.00  ? 113 SER A O    4  
ATOM   9539  C  CB   . SER A 1 113 ? 0.884   12.379 18.977  1.00 0.00  ? 113 SER A CB   4  
ATOM   9540  O  OG   . SER A 1 113 ? 0.913   11.148 19.681  1.00 0.00  ? 113 SER A OG   4  
ATOM   9541  H  H    . SER A 1 113 ? 0.125   14.812 18.135  1.00 0.00  ? 113 SER A H    4  
ATOM   9542  H  HA   . SER A 1 113 ? -0.914  12.800 20.064  1.00 0.00  ? 113 SER A HA   4  
ATOM   9543  H  HB2  . SER A 1 113 ? 0.535   12.205 17.973  1.00 0.00  ? 113 SER A HB2  4  
ATOM   9544  H  HB3  . SER A 1 113 ? 1.876   12.809 18.940  1.00 0.00  ? 113 SER A HB3  4  
ATOM   9545  H  HG   . SER A 1 113 ? 0.987   10.442 19.037  1.00 0.00  ? 113 SER A HG   4  
ATOM   9546  N  N    . LEU A 1 114 ? 0.142   13.855 22.048  1.00 0.00  ? 114 LEU A N    4  
ATOM   9547  C  CA   . LEU A 1 114 ? 0.799   14.450 23.240  1.00 0.00  ? 114 LEU A CA   4  
ATOM   9548  C  C    . LEU A 1 114 ? 2.245   13.996 23.277  1.00 0.00  ? 114 LEU A C    4  
ATOM   9549  O  O    . LEU A 1 114 ? 3.098   14.621 23.874  1.00 0.00  ? 114 LEU A O    4  
ATOM   9550  C  CB   . LEU A 1 114 ? 0.092   13.953 24.496  1.00 0.00  ? 114 LEU A CB   4  
ATOM   9551  C  CG   . LEU A 1 114 ? 0.143   15.036 25.561  1.00 0.00  ? 114 LEU A CG   4  
ATOM   9552  C  CD1  . LEU A 1 114 ? 1.601   15.306 25.956  1.00 0.00  ? 114 LEU A CD1  4  
ATOM   9553  C  CD2  . LEU A 1 114 ? -0.496  16.305 24.991  1.00 0.00  ? 114 LEU A CD2  4  
ATOM   9554  H  H    . LEU A 1 114 ? -0.686  13.337 22.158  1.00 0.00  ? 114 LEU A H    4  
ATOM   9555  H  HA   . LEU A 1 114 ? 0.755   15.528 23.191  1.00 0.00  ? 114 LEU A HA   4  
ATOM   9556  H  HB2  . LEU A 1 114 ? -0.937  13.728 24.257  1.00 0.00  ? 114 LEU A HB2  4  
ATOM   9557  H  HB3  . LEU A 1 114 ? 0.584   13.063 24.860  1.00 0.00  ? 114 LEU A HB3  4  
ATOM   9558  H  HG   . LEU A 1 114 ? -0.408  14.710 26.429  1.00 0.00  ? 114 LEU A HG   4  
ATOM   9559  H  HD11 . LEU A 1 114 ? 2.044   15.999 25.257  1.00 0.00  ? 114 LEU A HD11 4  
ATOM   9560  H  HD12 . LEU A 1 114 ? 2.156   14.378 25.944  1.00 0.00  ? 114 LEU A HD12 4  
ATOM   9561  H  HD13 . LEU A 1 114 ? 1.631   15.728 26.950  1.00 0.00  ? 114 LEU A HD13 4  
ATOM   9562  H  HD21 . LEU A 1 114 ? 0.238   16.857 24.424  1.00 0.00  ? 114 LEU A HD21 4  
ATOM   9563  H  HD22 . LEU A 1 114 ? -0.867  16.919 25.797  1.00 0.00  ? 114 LEU A HD22 4  
ATOM   9564  H  HD23 . LEU A 1 114 ? -1.315  16.029 24.342  1.00 0.00  ? 114 LEU A HD23 4  
ATOM   9565  N  N    . PHE A 1 115 ? 2.526   12.911 22.636  1.00 0.00  ? 115 PHE A N    4  
ATOM   9566  C  CA   . PHE A 1 115 ? 3.911   12.412 22.621  1.00 0.00  ? 115 PHE A CA   4  
ATOM   9567  C  C    . PHE A 1 115 ? 4.722   13.274 21.651  1.00 0.00  ? 115 PHE A C    4  
ATOM   9568  O  O    . PHE A 1 115 ? 5.873   13.577 21.889  1.00 0.00  ? 115 PHE A O    4  
ATOM   9569  C  CB   . PHE A 1 115 ? 3.902   10.937 22.167  1.00 0.00  ? 115 PHE A CB   4  
ATOM   9570  C  CG   . PHE A 1 115 ? 5.065   10.647 21.228  1.00 0.00  ? 115 PHE A CG   4  
ATOM   9571  C  CD1  . PHE A 1 115 ? 6.366   11.012 21.597  1.00 0.00  ? 115 PHE A CD1  4  
ATOM   9572  C  CD2  . PHE A 1 115 ? 4.836   10.029 19.989  1.00 0.00  ? 115 PHE A CD2  4  
ATOM   9573  C  CE1  . PHE A 1 115 ? 7.438   10.765 20.729  1.00 0.00  ? 115 PHE A CE1  4  
ATOM   9574  C  CE2  . PHE A 1 115 ? 5.910   9.779  19.121  1.00 0.00  ? 115 PHE A CE2  4  
ATOM   9575  C  CZ   . PHE A 1 115 ? 7.211   10.147 19.492  1.00 0.00  ? 115 PHE A CZ   4  
ATOM   9576  H  H    . PHE A 1 115 ? 1.822   12.425 22.158  1.00 0.00  ? 115 PHE A H    4  
ATOM   9577  H  HA   . PHE A 1 115 ? 4.330   12.485 23.615  1.00 0.00  ? 115 PHE A HA   4  
ATOM   9578  H  HB2  . PHE A 1 115 ? 3.979   10.300 23.033  1.00 0.00  ? 115 PHE A HB2  4  
ATOM   9579  H  HB3  . PHE A 1 115 ? 2.971   10.733 21.656  1.00 0.00  ? 115 PHE A HB3  4  
ATOM   9580  H  HD1  . PHE A 1 115 ? 6.543   11.485 22.551  1.00 0.00  ? 115 PHE A HD1  4  
ATOM   9581  H  HD2  . PHE A 1 115 ? 3.834   9.744  19.704  1.00 0.00  ? 115 PHE A HD2  4  
ATOM   9582  H  HE1  . PHE A 1 115 ? 8.442   11.050 21.016  1.00 0.00  ? 115 PHE A HE1  4  
ATOM   9583  H  HE2  . PHE A 1 115 ? 5.733   9.300  18.167  1.00 0.00  ? 115 PHE A HE2  4  
ATOM   9584  H  HZ   . PHE A 1 115 ? 8.040   9.958  18.821  1.00 0.00  ? 115 PHE A HZ   4  
ATOM   9585  N  N    . LEU A 1 116 ? 4.131   13.656 20.550  1.00 0.00  ? 116 LEU A N    4  
ATOM   9586  C  CA   . LEU A 1 116 ? 4.862   14.467 19.556  1.00 0.00  ? 116 LEU A CA   4  
ATOM   9587  C  C    . LEU A 1 116 ? 5.214   15.819 20.156  1.00 0.00  ? 116 LEU A C    4  
ATOM   9588  O  O    . LEU A 1 116 ? 6.362   16.216 20.181  1.00 0.00  ? 116 LEU A O    4  
ATOM   9589  C  CB   . LEU A 1 116 ? 3.968   14.651 18.323  1.00 0.00  ? 116 LEU A CB   4  
ATOM   9590  C  CG   . LEU A 1 116 ? 4.795   15.111 17.115  1.00 0.00  ? 116 LEU A CG   4  
ATOM   9591  C  CD1  . LEU A 1 116 ? 5.005   16.619 17.177  1.00 0.00  ? 116 LEU A CD1  4  
ATOM   9592  C  CD2  . LEU A 1 116 ? 6.160   14.430 17.124  1.00 0.00  ? 116 LEU A CD2  4  
ATOM   9593  H  H    . LEU A 1 116 ? 3.207   13.397 20.368  1.00 0.00  ? 116 LEU A H    4  
ATOM   9594  H  HA   . LEU A 1 116 ? 5.765   13.949 19.279  1.00 0.00  ? 116 LEU A HA   4  
ATOM   9595  H  HB2  . LEU A 1 116 ? 3.490   13.711 18.091  1.00 0.00  ? 116 LEU A HB2  4  
ATOM   9596  H  HB3  . LEU A 1 116 ? 3.211   15.388 18.541  1.00 0.00  ? 116 LEU A HB3  4  
ATOM   9597  H  HG   . LEU A 1 116 ? 4.271   14.858 16.203  1.00 0.00  ? 116 LEU A HG   4  
ATOM   9598  H  HD11 . LEU A 1 116 ? 5.697   16.914 16.405  1.00 0.00  ? 116 LEU A HD11 4  
ATOM   9599  H  HD12 . LEU A 1 116 ? 5.406   16.886 18.141  1.00 0.00  ? 116 LEU A HD12 4  
ATOM   9600  H  HD13 . LEU A 1 116 ? 4.064   17.117 17.028  1.00 0.00  ? 116 LEU A HD13 4  
ATOM   9601  H  HD21 . LEU A 1 116 ? 6.046   13.407 17.452  1.00 0.00  ? 116 LEU A HD21 4  
ATOM   9602  H  HD22 . LEU A 1 116 ? 6.812   14.956 17.807  1.00 0.00  ? 116 LEU A HD22 4  
ATOM   9603  H  HD23 . LEU A 1 116 ? 6.584   14.450 16.133  1.00 0.00  ? 116 LEU A HD23 4  
ATOM   9604  N  N    . VAL A 1 117 ? 4.241   16.531 20.643  1.00 0.00  ? 117 VAL A N    4  
ATOM   9605  C  CA   . VAL A 1 117 ? 4.533   17.850 21.248  1.00 0.00  ? 117 VAL A CA   4  
ATOM   9606  C  C    . VAL A 1 117 ? 5.610   17.655 22.312  1.00 0.00  ? 117 VAL A C    4  
ATOM   9607  O  O    . VAL A 1 117 ? 6.619   18.333 22.330  1.00 0.00  ? 117 VAL A O    4  
ATOM   9608  C  CB   . VAL A 1 117 ? 3.263   18.422 21.904  1.00 0.00  ? 117 VAL A CB   4  
ATOM   9609  C  CG1  . VAL A 1 117 ? 2.355   19.053 20.844  1.00 0.00  ? 117 VAL A CG1  4  
ATOM   9610  C  CG2  . VAL A 1 117 ? 2.490   17.307 22.625  1.00 0.00  ? 117 VAL A CG2  4  
ATOM   9611  H  H    . VAL A 1 117 ? 3.324   16.196 20.615  1.00 0.00  ? 117 VAL A H    4  
ATOM   9612  H  HA   . VAL A 1 117 ? 4.893   18.528 20.487  1.00 0.00  ? 117 VAL A HA   4  
ATOM   9613  H  HB   . VAL A 1 117 ? 3.548   19.177 22.615  1.00 0.00  ? 117 VAL A HB   4  
ATOM   9614  H  HG11 . VAL A 1 117 ? 2.516   20.122 20.821  1.00 0.00  ? 117 VAL A HG11 4  
ATOM   9615  H  HG12 . VAL A 1 117 ? 1.324   18.851 21.092  1.00 0.00  ? 117 VAL A HG12 4  
ATOM   9616  H  HG13 . VAL A 1 117 ? 2.578   18.634 19.875  1.00 0.00  ? 117 VAL A HG13 4  
ATOM   9617  H  HG21 . VAL A 1 117 ? 2.921   16.348 22.382  1.00 0.00  ? 117 VAL A HG21 4  
ATOM   9618  H  HG22 . VAL A 1 117 ? 1.457   17.324 22.312  1.00 0.00  ? 117 VAL A HG22 4  
ATOM   9619  H  HG23 . VAL A 1 117 ? 2.542   17.463 23.691  1.00 0.00  ? 117 VAL A HG23 4  
ATOM   9620  N  N    . ALA A 1 118 ? 5.404   16.723 23.196  1.00 0.00  ? 118 ALA A N    4  
ATOM   9621  C  CA   . ALA A 1 118 ? 6.408   16.473 24.260  1.00 0.00  ? 118 ALA A CA   4  
ATOM   9622  C  C    . ALA A 1 118 ? 7.763   16.152 23.603  1.00 0.00  ? 118 ALA A C    4  
ATOM   9623  O  O    . ALA A 1 118 ? 8.766   16.768 23.907  1.00 0.00  ? 118 ALA A O    4  
ATOM   9624  C  CB   . ALA A 1 118 ? 5.926   15.312 25.134  1.00 0.00  ? 118 ALA A CB   4  
ATOM   9625  H  H    . ALA A 1 118 ? 4.585   16.185 23.157  1.00 0.00  ? 118 ALA A H    4  
ATOM   9626  H  HA   . ALA A 1 118 ? 6.508   17.361 24.869  1.00 0.00  ? 118 ALA A HA   4  
ATOM   9627  H  HB1  . ALA A 1 118 ? 4.867   15.159 24.975  1.00 0.00  ? 118 ALA A HB1  4  
ATOM   9628  H  HB2  . ALA A 1 118 ? 6.098   15.549 26.172  1.00 0.00  ? 118 ALA A HB2  4  
ATOM   9629  H  HB3  . ALA A 1 118 ? 6.462   14.413 24.878  1.00 0.00  ? 118 ALA A HB3  4  
ATOM   9630  N  N    . ALA A 1 119 ? 7.789   15.216 22.679  1.00 0.00  ? 119 ALA A N    4  
ATOM   9631  C  CA   . ALA A 1 119 ? 9.064   14.870 21.962  1.00 0.00  ? 119 ALA A CA   4  
ATOM   9632  C  C    . ALA A 1 119 ? 9.776   16.161 21.541  1.00 0.00  ? 119 ALA A C    4  
ATOM   9633  O  O    . ALA A 1 119 ? 10.910  16.421 21.906  1.00 0.00  ? 119 ALA A O    4  
ATOM   9634  C  CB   . ALA A 1 119 ? 8.718   14.074 20.695  1.00 0.00  ? 119 ALA A CB   4  
ATOM   9635  H  H    . ALA A 1 119 ? 6.961   14.753 22.440  1.00 0.00  ? 119 ALA A H    4  
ATOM   9636  H  HA   . ALA A 1 119 ? 9.708   14.280 22.600  1.00 0.00  ? 119 ALA A HA   4  
ATOM   9637  H  HB1  . ALA A 1 119 ? 9.532   13.407 20.449  1.00 0.00  ? 119 ALA A HB1  4  
ATOM   9638  H  HB2  . ALA A 1 119 ? 8.555   14.760 19.875  1.00 0.00  ? 119 ALA A HB2  4  
ATOM   9639  H  HB3  . ALA A 1 119 ? 7.819   13.501 20.865  1.00 0.00  ? 119 ALA A HB3  4  
ATOM   9640  N  N    . HIS A 1 120 ? 9.104   16.969 20.769  1.00 0.00  ? 120 HIS A N    4  
ATOM   9641  C  CA   . HIS A 1 120 ? 9.701   18.249 20.306  1.00 0.00  ? 120 HIS A CA   4  
ATOM   9642  C  C    . HIS A 1 120 ? 10.429  18.915 21.473  1.00 0.00  ? 120 HIS A C    4  
ATOM   9643  O  O    . HIS A 1 120 ? 11.644  19.024 21.490  1.00 0.00  ? 120 HIS A O    4  
ATOM   9644  C  CB   . HIS A 1 120 ? 8.573   19.158 19.817  1.00 0.00  ? 120 HIS A CB   4  
ATOM   9645  C  CG   . HIS A 1 120 ? 9.144   20.491 19.419  1.00 0.00  ? 120 HIS A CG   4  
ATOM   9646  N  ND1  . HIS A 1 120 ? 9.848   20.672 18.240  1.00 0.00  ? 120 HIS A ND1  4  
ATOM   9647  C  CD2  . HIS A 1 120 ? 9.154   21.710 20.053  1.00 0.00  ? 120 HIS A CD2  4  
ATOM   9648  C  CE1  . HIS A 1 120 ? 10.257  21.953 18.207  1.00 0.00  ? 120 HIS A CE1  4  
ATOM   9649  N  NE2  . HIS A 1 120 ? 9.861   22.630 19.289  1.00 0.00  ? 120 HIS A NE2  4  
ATOM   9650  H  H    . HIS A 1 120 ? 8.194   16.732 20.493  1.00 0.00  ? 120 HIS A H    4  
ATOM   9651  H  HA   . HIS A 1 120 ? 10.393  18.061 19.500  1.00 0.00  ? 120 HIS A HA   4  
ATOM   9652  H  HB2  . HIS A 1 120 ? 8.083   18.699 18.970  1.00 0.00  ? 120 HIS A HB2  4  
ATOM   9653  H  HB3  . HIS A 1 120 ? 7.855   19.296 20.612  1.00 0.00  ? 120 HIS A HB3  4  
ATOM   9654  H  HD1  . HIS A 1 120 ? 9.998   19.999 17.544  1.00 0.00  ? 120 HIS A HD1  4  
ATOM   9655  H  HD2  . HIS A 1 120 ? 8.665   21.923 20.991  1.00 0.00  ? 120 HIS A HD2  4  
ATOM   9656  H  HE1  . HIS A 1 120 ? 10.841  22.385 17.408  1.00 0.00  ? 120 HIS A HE1  4  
ATOM   9657  N  N    . GLU A 1 121 ? 9.695   19.354 22.455  1.00 0.00  ? 121 GLU A N    4  
ATOM   9658  C  CA   . GLU A 1 121 ? 10.339  20.004 23.632  1.00 0.00  ? 121 GLU A CA   4  
ATOM   9659  C  C    . GLU A 1 121 ? 11.247  18.997 24.320  1.00 0.00  ? 121 GLU A C    4  
ATOM   9660  O  O    . GLU A 1 121 ? 12.173  19.358 25.018  1.00 0.00  ? 121 GLU A O    4  
ATOM   9661  C  CB   . GLU A 1 121 ? 9.272   20.473 24.618  1.00 0.00  ? 121 GLU A CB   4  
ATOM   9662  C  CG   . GLU A 1 121 ? 8.316   21.430 23.916  1.00 0.00  ? 121 GLU A CG   4  
ATOM   9663  C  CD   . GLU A 1 121 ? 9.063   22.715 23.583  1.00 0.00  ? 121 GLU A CD   4  
ATOM   9664  O  OE1  . GLU A 1 121 ? 10.256  22.763 23.839  1.00 0.00  ? 121 GLU A OE1  4  
ATOM   9665  O  OE2  . GLU A 1 121 ? 8.436   23.630 23.080  1.00 0.00  ? 121 GLU A OE2  4  
ATOM   9666  H  H    . GLU A 1 121 ? 8.722   19.250 22.420  1.00 0.00  ? 121 GLU A H    4  
ATOM   9667  H  HA   . GLU A 1 121 ? 10.930  20.847 23.303  1.00 0.00  ? 121 GLU A HA   4  
ATOM   9668  H  HB2  . GLU A 1 121 ? 8.724   19.621 24.991  1.00 0.00  ? 121 GLU A HB2  4  
ATOM   9669  H  HB3  . GLU A 1 121 ? 9.746   20.984 25.439  1.00 0.00  ? 121 GLU A HB3  4  
ATOM   9670  H  HG2  . GLU A 1 121 ? 7.949   20.974 23.007  1.00 0.00  ? 121 GLU A HG2  4  
ATOM   9671  H  HG3  . GLU A 1 121 ? 7.486   21.655 24.570  1.00 0.00  ? 121 GLU A HG3  4  
ATOM   9672  N  N    . PHE A 1 122 ? 11.012  17.734 24.117  1.00 0.00  ? 122 PHE A N    4  
ATOM   9673  C  CA   . PHE A 1 122 ? 11.898  16.726 24.750  1.00 0.00  ? 122 PHE A CA   4  
ATOM   9674  C  C    . PHE A 1 122 ? 13.215  16.720 23.990  1.00 0.00  ? 122 PHE A C    4  
ATOM   9675  O  O    . PHE A 1 122 ? 14.161  16.059 24.364  1.00 0.00  ? 122 PHE A O    4  
ATOM   9676  C  CB   . PHE A 1 122 ? 11.287  15.342 24.612  1.00 0.00  ? 122 PHE A CB   4  
ATOM   9677  C  CG   . PHE A 1 122 ? 10.828  14.823 25.944  1.00 0.00  ? 122 PHE A CG   4  
ATOM   9678  C  CD1  . PHE A 1 122 ? 11.740  14.643 26.990  1.00 0.00  ? 122 PHE A CD1  4  
ATOM   9679  C  CD2  . PHE A 1 122 ? 9.487   14.491 26.117  1.00 0.00  ? 122 PHE A CD2  4  
ATOM   9680  C  CE1  . PHE A 1 122 ? 11.300  14.134 28.216  1.00 0.00  ? 122 PHE A CE1  4  
ATOM   9681  C  CE2  . PHE A 1 122 ? 9.046   13.978 27.335  1.00 0.00  ? 122 PHE A CE2  4  
ATOM   9682  C  CZ   . PHE A 1 122 ? 9.951   13.799 28.388  1.00 0.00  ? 122 PHE A CZ   4  
ATOM   9683  H  H    . PHE A 1 122 ? 10.273  17.453 23.538  1.00 0.00  ? 122 PHE A H    4  
ATOM   9684  H  HA   . PHE A 1 122 ? 12.061  16.966 25.790  1.00 0.00  ? 122 PHE A HA   4  
ATOM   9685  H  HB2  . PHE A 1 122 ? 10.450  15.385 23.939  1.00 0.00  ? 122 PHE A HB2  4  
ATOM   9686  H  HB3  . PHE A 1 122 ? 12.031  14.671 24.211  1.00 0.00  ? 122 PHE A HB3  4  
ATOM   9687  H  HD1  . PHE A 1 122 ? 12.781  14.901 26.853  1.00 0.00  ? 122 PHE A HD1  4  
ATOM   9688  H  HD2  . PHE A 1 122 ? 8.787   14.636 25.306  1.00 0.00  ? 122 PHE A HD2  4  
ATOM   9689  H  HE1  . PHE A 1 122 ? 11.997  13.997 29.029  1.00 0.00  ? 122 PHE A HE1  4  
ATOM   9690  H  HE2  . PHE A 1 122 ? 8.010   13.720 27.464  1.00 0.00  ? 122 PHE A HE2  4  
ATOM   9691  H  HZ   . PHE A 1 122 ? 9.609   13.399 29.328  1.00 0.00  ? 122 PHE A HZ   4  
ATOM   9692  N  N    . GLY A 1 123 ? 13.283  17.464 22.920  1.00 0.00  ? 123 GLY A N    4  
ATOM   9693  C  CA   . GLY A 1 123 ? 14.535  17.523 22.130  1.00 0.00  ? 123 GLY A CA   4  
ATOM   9694  C  C    . GLY A 1 123 ? 15.279  18.778 22.558  1.00 0.00  ? 123 GLY A C    4  
ATOM   9695  O  O    . GLY A 1 123 ? 16.448  18.740 22.880  1.00 0.00  ? 123 GLY A O    4  
ATOM   9696  H  H    . GLY A 1 123 ? 12.507  17.991 22.637  1.00 0.00  ? 123 GLY A H    4  
ATOM   9697  H  HA2  . GLY A 1 123 ? 15.134  16.648 22.337  1.00 0.00  ? 123 GLY A HA2  4  
ATOM   9698  H  HA3  . GLY A 1 123 ? 14.304  17.576 21.077  1.00 0.00  ? 123 GLY A HA3  4  
ATOM   9699  N  N    . HIS A 1 124 ? 14.593  19.891 22.604  1.00 0.00  ? 124 HIS A N    4  
ATOM   9700  C  CA   . HIS A 1 124 ? 15.263  21.132 23.062  1.00 0.00  ? 124 HIS A CA   4  
ATOM   9701  C  C    . HIS A 1 124 ? 15.734  20.888 24.498  1.00 0.00  ? 124 HIS A C    4  
ATOM   9702  O  O    . HIS A 1 124 ? 16.833  21.239 24.875  1.00 0.00  ? 124 HIS A O    4  
ATOM   9703  C  CB   . HIS A 1 124 ? 14.288  22.321 23.048  1.00 0.00  ? 124 HIS A CB   4  
ATOM   9704  C  CG   . HIS A 1 124 ? 13.728  22.550 21.672  1.00 0.00  ? 124 HIS A CG   4  
ATOM   9705  N  ND1  . HIS A 1 124 ? 14.498  23.061 20.643  1.00 0.00  ? 124 HIS A ND1  4  
ATOM   9706  C  CD2  . HIS A 1 124 ? 12.463  22.405 21.157  1.00 0.00  ? 124 HIS A CD2  4  
ATOM   9707  C  CE1  . HIS A 1 124 ? 13.698  23.210 19.572  1.00 0.00  ? 124 HIS A CE1  4  
ATOM   9708  N  NE2  . HIS A 1 124 ? 12.447  22.823 19.831  1.00 0.00  ? 124 HIS A NE2  4  
ATOM   9709  H  H    . HIS A 1 124 ? 13.640  19.896 22.368  1.00 0.00  ? 124 HIS A H    4  
ATOM   9710  H  HA   . HIS A 1 124 ? 16.116  21.343 22.430  1.00 0.00  ? 124 HIS A HA   4  
ATOM   9711  H  HB2  . HIS A 1 124 ? 13.479  22.130 23.732  1.00 0.00  ? 124 HIS A HB2  4  
ATOM   9712  H  HB3  . HIS A 1 124 ? 14.816  23.211 23.362  1.00 0.00  ? 124 HIS A HB3  4  
ATOM   9713  H  HD1  . HIS A 1 124 ? 15.452  23.277 20.688  1.00 0.00  ? 124 HIS A HD1  4  
ATOM   9714  H  HD2  . HIS A 1 124 ? 11.607  22.032 21.701  1.00 0.00  ? 124 HIS A HD2  4  
ATOM   9715  H  HE1  . HIS A 1 124 ? 14.023  23.610 18.622  1.00 0.00  ? 124 HIS A HE1  4  
ATOM   9716  N  N    . ALA A 1 125 ? 14.907  20.272 25.301  1.00 0.00  ? 125 ALA A N    4  
ATOM   9717  C  CA   . ALA A 1 125 ? 15.311  19.990 26.709  1.00 0.00  ? 125 ALA A CA   4  
ATOM   9718  C  C    . ALA A 1 125 ? 16.555  19.095 26.707  1.00 0.00  ? 125 ALA A C    4  
ATOM   9719  O  O    . ALA A 1 125 ? 17.239  18.963 27.705  1.00 0.00  ? 125 ALA A O    4  
ATOM   9720  C  CB   . ALA A 1 125 ? 14.176  19.258 27.427  1.00 0.00  ? 125 ALA A CB   4  
ATOM   9721  H  H    . ALA A 1 125 ? 14.021  19.986 24.975  1.00 0.00  ? 125 ALA A H    4  
ATOM   9722  H  HA   . ALA A 1 125 ? 15.525  20.919 27.220  1.00 0.00  ? 125 ALA A HA   4  
ATOM   9723  H  HB1  . ALA A 1 125 ? 14.567  18.761 28.304  1.00 0.00  ? 125 ALA A HB1  4  
ATOM   9724  H  HB2  . ALA A 1 125 ? 13.747  18.525 26.761  1.00 0.00  ? 125 ALA A HB2  4  
ATOM   9725  H  HB3  . ALA A 1 125 ? 13.417  19.965 27.722  1.00 0.00  ? 125 ALA A HB3  4  
ATOM   9726  N  N    . MET A 1 126 ? 16.845  18.473 25.594  1.00 0.00  ? 126 MET A N    4  
ATOM   9727  C  CA   . MET A 1 126 ? 18.035  17.572 25.525  1.00 0.00  ? 126 MET A CA   4  
ATOM   9728  C  C    . MET A 1 126 ? 19.295  18.387 25.224  1.00 0.00  ? 126 MET A C    4  
ATOM   9729  O  O    . MET A 1 126 ? 20.321  17.849 24.860  1.00 0.00  ? 126 MET A O    4  
ATOM   9730  C  CB   . MET A 1 126 ? 17.819  16.512 24.430  1.00 0.00  ? 126 MET A CB   4  
ATOM   9731  C  CG   . MET A 1 126 ? 16.989  15.361 25.006  1.00 0.00  ? 126 MET A CG   4  
ATOM   9732  S  SD   . MET A 1 126 ? 16.650  14.147 23.703  1.00 0.00  ? 126 MET A SD   4  
ATOM   9733  C  CE   . MET A 1 126 ? 15.513  13.078 24.628  1.00 0.00  ? 126 MET A CE   4  
ATOM   9734  H  H    . MET A 1 126 ? 16.273  18.590 24.806  1.00 0.00  ? 126 MET A H    4  
ATOM   9735  H  HA   . MET A 1 126 ? 18.156  17.076 26.473  1.00 0.00  ? 126 MET A HA   4  
ATOM   9736  H  HB2  . MET A 1 126 ? 17.297  16.951 23.591  1.00 0.00  ? 126 MET A HB2  4  
ATOM   9737  H  HB3  . MET A 1 126 ? 18.775  16.132 24.098  1.00 0.00  ? 126 MET A HB3  4  
ATOM   9738  H  HG2  . MET A 1 126 ? 17.542  14.889 25.807  1.00 0.00  ? 126 MET A HG2  4  
ATOM   9739  H  HG3  . MET A 1 126 ? 16.059  15.749 25.389  1.00 0.00  ? 126 MET A HG3  4  
ATOM   9740  H  HE1  . MET A 1 126 ? 15.756  12.040 24.436  1.00 0.00  ? 126 MET A HE1  4  
ATOM   9741  H  HE2  . MET A 1 126 ? 14.500  13.269 24.311  1.00 0.00  ? 126 MET A HE2  4  
ATOM   9742  H  HE3  . MET A 1 126 ? 15.601  13.282 25.686  1.00 0.00  ? 126 MET A HE3  4  
ATOM   9743  N  N    . GLY A 1 127 ? 19.241  19.679 25.386  1.00 0.00  ? 127 GLY A N    4  
ATOM   9744  C  CA   . GLY A 1 127 ? 20.454  20.500 25.116  1.00 0.00  ? 127 GLY A CA   4  
ATOM   9745  C  C    . GLY A 1 127 ? 20.335  21.164 23.742  1.00 0.00  ? 127 GLY A C    4  
ATOM   9746  O  O    . GLY A 1 127 ? 20.115  22.353 23.631  1.00 0.00  ? 127 GLY A O    4  
ATOM   9747  H  H    . GLY A 1 127 ? 18.413  20.106 25.689  1.00 0.00  ? 127 GLY A H    4  
ATOM   9748  H  HA2  . GLY A 1 127 ? 20.556  21.256 25.882  1.00 0.00  ? 127 GLY A HA2  4  
ATOM   9749  H  HA3  . GLY A 1 127 ? 21.325  19.858 25.127  1.00 0.00  ? 127 GLY A HA3  4  
ATOM   9750  N  N    . LEU A 1 128 ? 20.484  20.386 22.700  1.00 0.00  ? 128 LEU A N    4  
ATOM   9751  C  CA   . LEU A 1 128 ? 20.393  20.907 21.301  1.00 0.00  ? 128 LEU A CA   4  
ATOM   9752  C  C    . LEU A 1 128 ? 19.395  22.072 21.206  1.00 0.00  ? 128 LEU A C    4  
ATOM   9753  O  O    . LEU A 1 128 ? 18.389  22.105 21.887  1.00 0.00  ? 128 LEU A O    4  
ATOM   9754  C  CB   . LEU A 1 128 ? 19.945  19.744 20.407  1.00 0.00  ? 128 LEU A CB   4  
ATOM   9755  C  CG   . LEU A 1 128 ? 21.046  18.669 20.378  1.00 0.00  ? 128 LEU A CG   4  
ATOM   9756  C  CD1  . LEU A 1 128 ? 20.433  17.299 20.071  1.00 0.00  ? 128 LEU A CD1  4  
ATOM   9757  C  CD2  . LEU A 1 128 ? 22.071  19.006 19.291  1.00 0.00  ? 128 LEU A CD2  4  
ATOM   9758  H  H    . LEU A 1 128 ? 20.662  19.434 22.838  1.00 0.00  ? 128 LEU A H    4  
ATOM   9759  H  HA   . LEU A 1 128 ? 21.366  21.248 20.979  1.00 0.00  ? 128 LEU A HA   4  
ATOM   9760  H  HB2  . LEU A 1 128 ? 19.037  19.318 20.812  1.00 0.00  ? 128 LEU A HB2  4  
ATOM   9761  H  HB3  . LEU A 1 128 ? 19.760  20.099 19.407  1.00 0.00  ? 128 LEU A HB3  4  
ATOM   9762  H  HG   . LEU A 1 128 ? 21.539  18.635 21.339  1.00 0.00  ? 128 LEU A HG   4  
ATOM   9763  H  HD11 . LEU A 1 128 ? 19.761  17.013 20.869  1.00 0.00  ? 128 LEU A HD11 4  
ATOM   9764  H  HD12 . LEU A 1 128 ? 21.220  16.563 19.985  1.00 0.00  ? 128 LEU A HD12 4  
ATOM   9765  H  HD13 . LEU A 1 128 ? 19.888  17.347 19.141  1.00 0.00  ? 128 LEU A HD13 4  
ATOM   9766  H  HD21 . LEU A 1 128 ? 21.612  19.642 18.550  1.00 0.00  ? 128 LEU A HD21 4  
ATOM   9767  H  HD22 . LEU A 1 128 ? 22.407  18.092 18.823  1.00 0.00  ? 128 LEU A HD22 4  
ATOM   9768  H  HD23 . LEU A 1 128 ? 22.915  19.514 19.733  1.00 0.00  ? 128 LEU A HD23 4  
ATOM   9769  N  N    . GLU A 1 129 ? 19.666  23.036 20.363  1.00 0.00  ? 129 GLU A N    4  
ATOM   9770  C  CA   . GLU A 1 129 ? 18.727  24.184 20.238  1.00 0.00  ? 129 GLU A CA   4  
ATOM   9771  C  C    . GLU A 1 129 ? 18.044  24.131 18.885  1.00 0.00  ? 129 GLU A C    4  
ATOM   9772  O  O    . GLU A 1 129 ? 18.286  23.254 18.079  1.00 0.00  ? 129 GLU A O    4  
ATOM   9773  C  CB   . GLU A 1 129 ? 19.488  25.507 20.345  1.00 0.00  ? 129 GLU A CB   4  
ATOM   9774  C  CG   . GLU A 1 129 ? 20.836  25.357 19.646  1.00 0.00  ? 129 GLU A CG   4  
ATOM   9775  C  CD   . GLU A 1 129 ? 21.609  26.676 19.686  1.00 0.00  ? 129 GLU A CD   4  
ATOM   9776  O  OE1  . GLU A 1 129 ? 21.143  27.600 20.329  1.00 0.00  ? 129 GLU A OE1  4  
ATOM   9777  O  OE2  . GLU A 1 129 ? 22.659  26.736 19.067  1.00 0.00  ? 129 GLU A OE2  4  
ATOM   9778  H  H    . GLU A 1 129 ? 20.480  23.002 19.815  1.00 0.00  ? 129 GLU A H    4  
ATOM   9779  H  HA   . GLU A 1 129 ? 17.983  24.132 21.015  1.00 0.00  ? 129 GLU A HA   4  
ATOM   9780  H  HB2  . GLU A 1 129 ? 18.915  26.290 19.867  1.00 0.00  ? 129 GLU A HB2  4  
ATOM   9781  H  HB3  . GLU A 1 129 ? 19.642  25.753 21.385  1.00 0.00  ? 129 GLU A HB3  4  
ATOM   9782  H  HG2  . GLU A 1 129 ? 21.412  24.591 20.145  1.00 0.00  ? 129 GLU A HG2  4  
ATOM   9783  H  HG3  . GLU A 1 129 ? 20.673  25.071 18.616  1.00 0.00  ? 129 GLU A HG3  4  
ATOM   9784  N  N    . HIS A 1 130 ? 17.197  25.079 18.630  1.00 0.00  ? 130 HIS A N    4  
ATOM   9785  C  CA   . HIS A 1 130 ? 16.496  25.110 17.328  1.00 0.00  ? 130 HIS A CA   4  
ATOM   9786  C  C    . HIS A 1 130 ? 17.530  24.940 16.223  1.00 0.00  ? 130 HIS A C    4  
ATOM   9787  O  O    . HIS A 1 130 ? 18.591  25.534 16.249  1.00 0.00  ? 130 HIS A O    4  
ATOM   9788  C  CB   . HIS A 1 130 ? 15.769  26.444 17.162  1.00 0.00  ? 130 HIS A CB   4  
ATOM   9789  C  CG   . HIS A 1 130 ? 14.480  26.402 17.933  1.00 0.00  ? 130 HIS A CG   4  
ATOM   9790  N  ND1  . HIS A 1 130 ? 14.431  26.533 19.312  1.00 0.00  ? 130 HIS A ND1  4  
ATOM   9791  C  CD2  . HIS A 1 130 ? 13.184  26.229 17.525  1.00 0.00  ? 130 HIS A CD2  4  
ATOM   9792  C  CE1  . HIS A 1 130 ? 13.139  26.434 19.681  1.00 0.00  ? 130 HIS A CE1  4  
ATOM   9793  N  NE2  . HIS A 1 130 ? 12.336  26.248 18.630  1.00 0.00  ? 130 HIS A NE2  4  
ATOM   9794  H  H    . HIS A 1 130 ? 17.032  25.776 19.298  1.00 0.00  ? 130 HIS A H    4  
ATOM   9795  H  HA   . HIS A 1 130 ? 15.783  24.299 17.282  1.00 0.00  ? 130 HIS A HA   4  
ATOM   9796  H  HB2  . HIS A 1 130 ? 16.387  27.243 17.534  1.00 0.00  ? 130 HIS A HB2  4  
ATOM   9797  H  HB3  . HIS A 1 130 ? 15.555  26.607 16.116  1.00 0.00  ? 130 HIS A HB3  4  
ATOM   9798  H  HD1  . HIS A 1 130 ? 15.195  26.675 19.908  1.00 0.00  ? 130 HIS A HD1  4  
ATOM   9799  H  HD2  . HIS A 1 130 ? 12.871  26.099 16.503  1.00 0.00  ? 130 HIS A HD2  4  
ATOM   9800  H  HE1  . HIS A 1 130 ? 12.794  26.494 20.702  1.00 0.00  ? 130 HIS A HE1  4  
ATOM   9801  N  N    . SER A 1 131 ? 17.237  24.119 15.262  1.00 0.00  ? 131 SER A N    4  
ATOM   9802  C  CA   . SER A 1 131 ? 18.203  23.885 14.156  1.00 0.00  ? 131 SER A CA   4  
ATOM   9803  C  C    . SER A 1 131 ? 17.898  24.831 12.987  1.00 0.00  ? 131 SER A C    4  
ATOM   9804  O  O    . SER A 1 131 ? 17.376  25.913 13.170  1.00 0.00  ? 131 SER A O    4  
ATOM   9805  C  CB   . SER A 1 131 ? 18.069  22.437 13.694  1.00 0.00  ? 131 SER A CB   4  
ATOM   9806  O  OG   . SER A 1 131 ? 16.829  22.277 13.021  1.00 0.00  ? 131 SER A OG   4  
ATOM   9807  H  H    . SER A 1 131 ? 16.381  23.641 15.274  1.00 0.00  ? 131 SER A H    4  
ATOM   9808  H  HA   . SER A 1 131 ? 19.207  24.061 14.509  1.00 0.00  ? 131 SER A HA   4  
ATOM   9809  H  HB2  . SER A 1 131 ? 18.873  22.192 13.020  1.00 0.00  ? 131 SER A HB2  4  
ATOM   9810  H  HB3  . SER A 1 131 ? 18.109  21.782 14.555  1.00 0.00  ? 131 SER A HB3  4  
ATOM   9811  H  HG   . SER A 1 131 ? 16.362  21.549 13.433  1.00 0.00  ? 131 SER A HG   4  
ATOM   9812  N  N    . GLN A 1 132 ? 18.229  24.427 11.791  1.00 0.00  ? 132 GLN A N    4  
ATOM   9813  C  CA   . GLN A 1 132 ? 17.968  25.287 10.602  1.00 0.00  ? 132 GLN A CA   4  
ATOM   9814  C  C    . GLN A 1 132 ? 17.323  24.451 9.494   1.00 0.00  ? 132 GLN A C    4  
ATOM   9815  O  O    . GLN A 1 132 ? 16.952  24.958 8.455   1.00 0.00  ? 132 GLN A O    4  
ATOM   9816  C  CB   . GLN A 1 132 ? 19.291  25.843 10.095  1.00 0.00  ? 132 GLN A CB   4  
ATOM   9817  C  CG   . GLN A 1 132 ? 19.172  27.357 9.915   1.00 0.00  ? 132 GLN A CG   4  
ATOM   9818  C  CD   . GLN A 1 132 ? 20.537  27.920 9.533   1.00 0.00  ? 132 GLN A CD   4  
ATOM   9819  O  OE1  . GLN A 1 132 ? 21.011  28.866 10.131  1.00 0.00  ? 132 GLN A OE1  4  
ATOM   9820  N  NE2  . GLN A 1 132 ? 21.195  27.361 8.559   1.00 0.00  ? 132 GLN A NE2  4  
ATOM   9821  H  H    . GLN A 1 132 ? 18.655  23.554 11.677  1.00 0.00  ? 132 GLN A H    4  
ATOM   9822  H  HA   . GLN A 1 132 ? 17.315  26.102 10.874  1.00 0.00  ? 132 GLN A HA   4  
ATOM   9823  H  HB2  . GLN A 1 132 ? 20.069  25.620 10.810  1.00 0.00  ? 132 GLN A HB2  4  
ATOM   9824  H  HB3  . GLN A 1 132 ? 19.531  25.386 9.147   1.00 0.00  ? 132 GLN A HB3  4  
ATOM   9825  H  HG2  . GLN A 1 132 ? 18.461  27.571 9.130   1.00 0.00  ? 132 GLN A HG2  4  
ATOM   9826  H  HG3  . GLN A 1 132 ? 18.840  27.808 10.836  1.00 0.00  ? 132 GLN A HG3  4  
ATOM   9827  H  HE21 . GLN A 1 132 ? 20.810  26.591 8.089   1.00 0.00  ? 132 GLN A HE21 4  
ATOM   9828  H  HE22 . GLN A 1 132 ? 22.070  27.709 8.295   1.00 0.00  ? 132 GLN A HE22 4  
ATOM   9829  N  N    . ASP A 1 133 ? 17.196  23.168 9.705   1.00 0.00  ? 133 ASP A N    4  
ATOM   9830  C  CA   . ASP A 1 133 ? 16.585  22.292 8.663   1.00 0.00  ? 133 ASP A CA   4  
ATOM   9831  C  C    . ASP A 1 133 ? 15.056  22.367 8.749   1.00 0.00  ? 133 ASP A C    4  
ATOM   9832  O  O    . ASP A 1 133 ? 14.493  22.292 9.824   1.00 0.00  ? 133 ASP A O    4  
ATOM   9833  C  CB   . ASP A 1 133 ? 17.020  20.846 8.892   1.00 0.00  ? 133 ASP A CB   4  
ATOM   9834  C  CG   . ASP A 1 133 ? 17.395  20.212 7.552   1.00 0.00  ? 133 ASP A CG   4  
ATOM   9835  O  OD1  . ASP A 1 133 ? 17.865  20.935 6.690   1.00 0.00  ? 133 ASP A OD1  4  
ATOM   9836  O  OD2  . ASP A 1 133 ? 17.206  19.017 7.409   1.00 0.00  ? 133 ASP A OD2  4  
ATOM   9837  H  H    . ASP A 1 133 ? 17.511  22.778 10.543  1.00 0.00  ? 133 ASP A H    4  
ATOM   9838  H  HA   . ASP A 1 133 ? 16.914  22.616 7.689   1.00 0.00  ? 133 ASP A HA   4  
ATOM   9839  H  HB2  . ASP A 1 133 ? 17.872  20.829 9.556   1.00 0.00  ? 133 ASP A HB2  4  
ATOM   9840  H  HB3  . ASP A 1 133 ? 16.205  20.292 9.334   1.00 0.00  ? 133 ASP A HB3  4  
ATOM   9841  N  N    . PRO A 1 134 ? 14.427  22.509 7.607   1.00 0.00  ? 134 PRO A N    4  
ATOM   9842  C  CA   . PRO A 1 134 ? 12.974  22.594 7.519   1.00 0.00  ? 134 PRO A CA   4  
ATOM   9843  C  C    . PRO A 1 134 ? 12.342  21.232 7.673   1.00 0.00  ? 134 PRO A C    4  
ATOM   9844  O  O    . PRO A 1 134 ? 12.470  20.349 6.849   1.00 0.00  ? 134 PRO A O    4  
ATOM   9845  C  CB   . PRO A 1 134 ? 12.704  23.128 6.134   1.00 0.00  ? 134 PRO A CB   4  
ATOM   9846  C  CG   . PRO A 1 134 ? 13.958  22.798 5.298   1.00 0.00  ? 134 PRO A CG   4  
ATOM   9847  C  CD   . PRO A 1 134 ? 15.101  22.586 6.308   1.00 0.00  ? 134 PRO A CD   4  
ATOM   9848  H  HA   . PRO A 1 134 ? 12.591  23.280 8.256   1.00 0.00  ? 134 PRO A HA   4  
ATOM   9849  H  HB2  . PRO A 1 134 ? 11.832  22.634 5.726   1.00 0.00  ? 134 PRO A HB2  4  
ATOM   9850  H  HB3  . PRO A 1 134 ? 12.552  24.190 6.175   1.00 0.00  ? 134 PRO A HB3  4  
ATOM   9851  H  HG2  . PRO A 1 134 ? 13.791  21.896 4.723   1.00 0.00  ? 134 PRO A HG2  4  
ATOM   9852  H  HG3  . PRO A 1 134 ? 14.195  23.622 4.641   1.00 0.00  ? 134 PRO A HG3  4  
ATOM   9853  H  HD2  . PRO A 1 134 ? 15.618  21.667 6.105   1.00 0.00  ? 134 PRO A HD2  4  
ATOM   9854  H  HD3  . PRO A 1 134 ? 15.773  23.425 6.297   1.00 0.00  ? 134 PRO A HD3  4  
ATOM   9855  N  N    . GLY A 1 135 ? 11.654  21.082 8.728   1.00 0.00  ? 135 GLY A N    4  
ATOM   9856  C  CA   . GLY A 1 135 ? 10.960  19.793 9.008   1.00 0.00  ? 135 GLY A CA   4  
ATOM   9857  C  C    . GLY A 1 135 ? 11.721  19.034 10.095  1.00 0.00  ? 135 GLY A C    4  
ATOM   9858  O  O    . GLY A 1 135 ? 11.295  17.998 10.567  1.00 0.00  ? 135 GLY A O    4  
ATOM   9859  H  H    . GLY A 1 135 ? 11.592  21.834 9.338   1.00 0.00  ? 135 GLY A H    4  
ATOM   9860  H  HA2  . GLY A 1 135 ? 9.953   19.996 9.339   1.00 0.00  ? 135 GLY A HA2  4  
ATOM   9861  H  HA3  . GLY A 1 135 ? 10.934  19.200 8.107   1.00 0.00  ? 135 GLY A HA3  4  
ATOM   9862  N  N    . ALA A 1 136 ? 12.845  19.555 10.493  1.00 0.00  ? 136 ALA A N    4  
ATOM   9863  C  CA   . ALA A 1 136 ? 13.660  18.903 11.551  1.00 0.00  ? 136 ALA A CA   4  
ATOM   9864  C  C    . ALA A 1 136 ? 12.801  18.670 12.789  1.00 0.00  ? 136 ALA A C    4  
ATOM   9865  O  O    . ALA A 1 136 ? 11.764  19.280 12.961  1.00 0.00  ? 136 ALA A O    4  
ATOM   9866  C  CB   . ALA A 1 136 ? 14.804  19.844 11.919  1.00 0.00  ? 136 ALA A CB   4  
ATOM   9867  H  H    . ALA A 1 136 ? 13.161  20.392 10.096  1.00 0.00  ? 136 ALA A H    4  
ATOM   9868  H  HA   . ALA A 1 136 ? 14.058  17.962 11.191  1.00 0.00  ? 136 ALA A HA   4  
ATOM   9869  H  HB1  . ALA A 1 136 ? 15.613  19.723 11.217  1.00 0.00  ? 136 ALA A HB1  4  
ATOM   9870  H  HB2  . ALA A 1 136 ? 15.152  19.617 12.915  1.00 0.00  ? 136 ALA A HB2  4  
ATOM   9871  H  HB3  . ALA A 1 136 ? 14.448  20.866 11.885  1.00 0.00  ? 136 ALA A HB3  4  
ATOM   9872  N  N    . LEU A 1 137 ? 13.235  17.805 13.660  1.00 0.00  ? 137 LEU A N    4  
ATOM   9873  C  CA   . LEU A 1 137 ? 12.457  17.543 14.898  1.00 0.00  ? 137 LEU A CA   4  
ATOM   9874  C  C    . LEU A 1 137 ? 12.483  18.796 15.781  1.00 0.00  ? 137 LEU A C    4  
ATOM   9875  O  O    . LEU A 1 137 ? 11.531  19.101 16.477  1.00 0.00  ? 137 LEU A O    4  
ATOM   9876  C  CB   . LEU A 1 137 ? 13.105  16.386 15.663  1.00 0.00  ? 137 LEU A CB   4  
ATOM   9877  C  CG   . LEU A 1 137 ? 12.497  16.284 17.063  1.00 0.00  ? 137 LEU A CG   4  
ATOM   9878  C  CD1  . LEU A 1 137 ? 10.972  16.195 16.962  1.00 0.00  ? 137 LEU A CD1  4  
ATOM   9879  C  CD2  . LEU A 1 137 ? 13.038  15.030 17.749  1.00 0.00  ? 137 LEU A CD2  4  
ATOM   9880  H  H    . LEU A 1 137 ? 14.079  17.333 13.503  1.00 0.00  ? 137 LEU A H    4  
ATOM   9881  H  HA   . LEU A 1 137 ? 11.440  17.288 14.643  1.00 0.00  ? 137 LEU A HA   4  
ATOM   9882  H  HB2  . LEU A 1 137 ? 12.939  15.460 15.129  1.00 0.00  ? 137 LEU A HB2  4  
ATOM   9883  H  HB3  . LEU A 1 137 ? 14.167  16.565 15.750  1.00 0.00  ? 137 LEU A HB3  4  
ATOM   9884  H  HG   . LEU A 1 137 ? 12.768  17.157 17.639  1.00 0.00  ? 137 LEU A HG   4  
ATOM   9885  H  HD11 . LEU A 1 137 ? 10.634  15.273 17.410  1.00 0.00  ? 137 LEU A HD11 4  
ATOM   9886  H  HD12 . LEU A 1 137 ? 10.676  16.217 15.925  1.00 0.00  ? 137 LEU A HD12 4  
ATOM   9887  H  HD13 . LEU A 1 137 ? 10.528  17.030 17.480  1.00 0.00  ? 137 LEU A HD13 4  
ATOM   9888  H  HD21 . LEU A 1 137 ? 13.145  14.240 17.019  1.00 0.00  ? 137 LEU A HD21 4  
ATOM   9889  H  HD22 . LEU A 1 137 ? 12.354  14.718 18.523  1.00 0.00  ? 137 LEU A HD22 4  
ATOM   9890  H  HD23 . LEU A 1 137 ? 14.001  15.248 18.185  1.00 0.00  ? 137 LEU A HD23 4  
ATOM   9891  N  N    . MET A 1 138 ? 13.579  19.518 15.763  1.00 0.00  ? 138 MET A N    4  
ATOM   9892  C  CA   . MET A 1 138 ? 13.697  20.748 16.608  1.00 0.00  ? 138 MET A CA   4  
ATOM   9893  C  C    . MET A 1 138 ? 13.622  22.002 15.737  1.00 0.00  ? 138 MET A C    4  
ATOM   9894  O  O    . MET A 1 138 ? 14.163  23.034 16.079  1.00 0.00  ? 138 MET A O    4  
ATOM   9895  C  CB   . MET A 1 138 ? 15.046  20.746 17.337  1.00 0.00  ? 138 MET A CB   4  
ATOM   9896  C  CG   . MET A 1 138 ? 15.112  19.576 18.319  1.00 0.00  ? 138 MET A CG   4  
ATOM   9897  S  SD   . MET A 1 138 ? 16.684  18.707 18.092  1.00 0.00  ? 138 MET A SD   4  
ATOM   9898  C  CE   . MET A 1 138 ? 16.457  17.444 19.367  1.00 0.00  ? 138 MET A CE   4  
ATOM   9899  H  H    . MET A 1 138 ? 14.330  19.243 15.199  1.00 0.00  ? 138 MET A H    4  
ATOM   9900  H  HA   . MET A 1 138 ? 12.901  20.766 17.333  1.00 0.00  ? 138 MET A HA   4  
ATOM   9901  H  HB2  . MET A 1 138 ? 15.846  20.651 16.614  1.00 0.00  ? 138 MET A HB2  4  
ATOM   9902  H  HB3  . MET A 1 138 ? 15.163  21.672 17.875  1.00 0.00  ? 138 MET A HB3  4  
ATOM   9903  H  HG2  . MET A 1 138 ? 15.050  19.954 19.327  1.00 0.00  ? 138 MET A HG2  4  
ATOM   9904  H  HG3  . MET A 1 138 ? 14.293  18.899 18.134  1.00 0.00  ? 138 MET A HG3  4  
ATOM   9905  H  HE1  . MET A 1 138 ? 16.242  17.920 20.314  1.00 0.00  ? 138 MET A HE1  4  
ATOM   9906  H  HE2  . MET A 1 138 ? 17.359  16.861 19.456  1.00 0.00  ? 138 MET A HE2  4  
ATOM   9907  H  HE3  . MET A 1 138 ? 15.639  16.795 19.089  1.00 0.00  ? 138 MET A HE3  4  
ATOM   9908  N  N    . ALA A 1 139 ? 12.953  21.939 14.625  1.00 0.00  ? 139 ALA A N    4  
ATOM   9909  C  CA   . ALA A 1 139 ? 12.853  23.152 13.775  1.00 0.00  ? 139 ALA A CA   4  
ATOM   9910  C  C    . ALA A 1 139 ? 11.802  24.099 14.372  1.00 0.00  ? 139 ALA A C    4  
ATOM   9911  O  O    . ALA A 1 139 ? 11.018  23.704 15.213  1.00 0.00  ? 139 ALA A O    4  
ATOM   9912  C  CB   . ALA A 1 139 ? 12.461  22.752 12.355  1.00 0.00  ? 139 ALA A CB   4  
ATOM   9913  H  H    . ALA A 1 139 ? 12.516  21.103 14.354  1.00 0.00  ? 139 ALA A H    4  
ATOM   9914  H  HA   . ALA A 1 139 ? 13.811  23.654 13.756  1.00 0.00  ? 139 ALA A HA   4  
ATOM   9915  H  HB1  . ALA A 1 139 ? 11.655  23.380 12.010  1.00 0.00  ? 139 ALA A HB1  4  
ATOM   9916  H  HB2  . ALA A 1 139 ? 12.143  21.719 12.349  1.00 0.00  ? 139 ALA A HB2  4  
ATOM   9917  H  HB3  . ALA A 1 139 ? 13.316  22.871 11.705  1.00 0.00  ? 139 ALA A HB3  4  
ATOM   9918  N  N    . PRO A 1 140 ? 11.833  25.331 13.923  1.00 0.00  ? 140 PRO A N    4  
ATOM   9919  C  CA   . PRO A 1 140 ? 10.910  26.393 14.395  1.00 0.00  ? 140 PRO A CA   4  
ATOM   9920  C  C    . PRO A 1 140 ? 9.481   26.213 13.850  1.00 0.00  ? 140 PRO A C    4  
ATOM   9921  O  O    . PRO A 1 140 ? 8.686   27.132 13.888  1.00 0.00  ? 140 PRO A O    4  
ATOM   9922  C  CB   . PRO A 1 140 ? 11.534  27.677 13.833  1.00 0.00  ? 140 PRO A CB   4  
ATOM   9923  C  CG   . PRO A 1 140 ? 12.413  27.243 12.637  1.00 0.00  ? 140 PRO A CG   4  
ATOM   9924  C  CD   . PRO A 1 140 ? 12.796  25.778 12.897  1.00 0.00  ? 140 PRO A CD   4  
ATOM   9925  H  HA   . PRO A 1 140 ? 10.904  26.439 15.470  1.00 0.00  ? 140 PRO A HA   4  
ATOM   9926  H  HB2  . PRO A 1 140 ? 10.758  28.351 13.500  1.00 0.00  ? 140 PRO A HB2  4  
ATOM   9927  H  HB3  . PRO A 1 140 ? 12.149  28.153 14.579  1.00 0.00  ? 140 PRO A HB3  4  
ATOM   9928  H  HG2  . PRO A 1 140 ? 11.849  27.323 11.717  1.00 0.00  ? 140 PRO A HG2  4  
ATOM   9929  H  HG3  . PRO A 1 140 ? 13.302  27.849 12.585  1.00 0.00  ? 140 PRO A HG3  4  
ATOM   9930  H  HD2  . PRO A 1 140 ? 12.693  25.190 11.996  1.00 0.00  ? 140 PRO A HD2  4  
ATOM   9931  H  HD3  . PRO A 1 140 ? 13.802  25.712 13.281  1.00 0.00  ? 140 PRO A HD3  4  
ATOM   9932  N  N    . ILE A 1 141 ? 9.147   25.058 13.335  1.00 0.00  ? 141 ILE A N    4  
ATOM   9933  C  CA   . ILE A 1 141 ? 7.777   24.852 12.782  1.00 0.00  ? 141 ILE A CA   4  
ATOM   9934  C  C    . ILE A 1 141 ? 7.255   23.468 13.205  1.00 0.00  ? 141 ILE A C    4  
ATOM   9935  O  O    . ILE A 1 141 ? 7.981   22.494 13.219  1.00 0.00  ? 141 ILE A O    4  
ATOM   9936  C  CB   . ILE A 1 141 ? 7.852   24.930 11.255  1.00 0.00  ? 141 ILE A CB   4  
ATOM   9937  C  CG1  . ILE A 1 141 ? 9.227   24.425 10.807  1.00 0.00  ? 141 ILE A CG1  4  
ATOM   9938  C  CG2  . ILE A 1 141 ? 7.651   26.377 10.793  1.00 0.00  ? 141 ILE A CG2  4  
ATOM   9939  C  CD1  . ILE A 1 141 ? 9.386   24.541 9.291   1.00 0.00  ? 141 ILE A CD1  4  
ATOM   9940  H  H    . ILE A 1 141 ? 9.794   24.331 13.294  1.00 0.00  ? 141 ILE A H    4  
ATOM   9941  H  HA   . ILE A 1 141 ? 7.115   25.618 13.156  1.00 0.00  ? 141 ILE A HA   4  
ATOM   9942  H  HB   . ILE A 1 141 ? 7.084   24.306 10.832  1.00 0.00  ? 141 ILE A HB   4  
ATOM   9943  H  HG12 . ILE A 1 141 ? 9.992   25.015 11.288  1.00 0.00  ? 141 ILE A HG12 4  
ATOM   9944  H  HG13 . ILE A 1 141 ? 9.336   23.393 11.098  1.00 0.00  ? 141 ILE A HG13 4  
ATOM   9945  H  HG21 . ILE A 1 141 ? 8.526   26.960 11.040  1.00 0.00  ? 141 ILE A HG21 4  
ATOM   9946  H  HG22 . ILE A 1 141 ? 6.788   26.801 11.287  1.00 0.00  ? 141 ILE A HG22 4  
ATOM   9947  H  HG23 . ILE A 1 141 ? 7.498   26.395 9.722   1.00 0.00  ? 141 ILE A HG23 4  
ATOM   9948  H  HD11 . ILE A 1 141 ? 8.798   23.774 8.806   1.00 0.00  ? 141 ILE A HD11 4  
ATOM   9949  H  HD12 . ILE A 1 141 ? 10.428  24.412 9.034   1.00 0.00  ? 141 ILE A HD12 4  
ATOM   9950  H  HD13 . ILE A 1 141 ? 9.054   25.514 8.961   1.00 0.00  ? 141 ILE A HD13 4  
ATOM   9951  N  N    . TYR A 1 142 ? 6.003   23.380 13.558  1.00 0.00  ? 142 TYR A N    4  
ATOM   9952  C  CA   . TYR A 1 142 ? 5.431   22.072 13.992  1.00 0.00  ? 142 TYR A CA   4  
ATOM   9953  C  C    . TYR A 1 142 ? 5.169   21.184 12.768  1.00 0.00  ? 142 TYR A C    4  
ATOM   9954  O  O    . TYR A 1 142 ? 4.559   21.598 11.802  1.00 0.00  ? 142 TYR A O    4  
ATOM   9955  C  CB   . TYR A 1 142 ? 4.123   22.336 14.749  1.00 0.00  ? 142 TYR A CB   4  
ATOM   9956  C  CG   . TYR A 1 142 ? 3.571   21.057 15.332  1.00 0.00  ? 142 TYR A CG   4  
ATOM   9957  C  CD1  . TYR A 1 142 ? 3.985   20.626 16.598  1.00 0.00  ? 142 TYR A CD1  4  
ATOM   9958  C  CD2  . TYR A 1 142 ? 2.626   20.313 14.615  1.00 0.00  ? 142 TYR A CD2  4  
ATOM   9959  C  CE1  . TYR A 1 142 ? 3.454   19.455 17.147  1.00 0.00  ? 142 TYR A CE1  4  
ATOM   9960  C  CE2  . TYR A 1 142 ? 2.097   19.138 15.164  1.00 0.00  ? 142 TYR A CE2  4  
ATOM   9961  C  CZ   . TYR A 1 142 ? 2.511   18.711 16.431  1.00 0.00  ? 142 TYR A CZ   4  
ATOM   9962  O  OH   . TYR A 1 142 ? 1.992   17.555 16.975  1.00 0.00  ? 142 TYR A OH   4  
ATOM   9963  H  H    . TYR A 1 142 ? 5.436   24.180 13.547  1.00 0.00  ? 142 TYR A H    4  
ATOM   9964  H  HA   . TYR A 1 142 ? 6.131   21.577 14.649  1.00 0.00  ? 142 TYR A HA   4  
ATOM   9965  H  HB2  . TYR A 1 142 ? 4.314   23.033 15.551  1.00 0.00  ? 142 TYR A HB2  4  
ATOM   9966  H  HB3  . TYR A 1 142 ? 3.396   22.762 14.074  1.00 0.00  ? 142 TYR A HB3  4  
ATOM   9967  H  HD1  . TYR A 1 142 ? 4.716   21.199 17.151  1.00 0.00  ? 142 TYR A HD1  4  
ATOM   9968  H  HD2  . TYR A 1 142 ? 2.310   20.642 13.637  1.00 0.00  ? 142 TYR A HD2  4  
ATOM   9969  H  HE1  . TYR A 1 142 ? 3.773   19.124 18.124  1.00 0.00  ? 142 TYR A HE1  4  
ATOM   9970  H  HE2  . TYR A 1 142 ? 1.368   18.565 14.612  1.00 0.00  ? 142 TYR A HE2  4  
ATOM   9971  H  HH   . TYR A 1 142 ? 2.424   17.407 17.821  1.00 0.00  ? 142 TYR A HH   4  
ATOM   9972  N  N    . THR A 1 143 ? 5.634   19.965 12.797  1.00 0.00  ? 143 THR A N    4  
ATOM   9973  C  CA   . THR A 1 143 ? 5.419   19.056 11.638  1.00 0.00  ? 143 THR A CA   4  
ATOM   9974  C  C    . THR A 1 143 ? 5.352   17.620 12.155  1.00 0.00  ? 143 THR A C    4  
ATOM   9975  O  O    . THR A 1 143 ? 6.337   16.910 12.178  1.00 0.00  ? 143 THR A O    4  
ATOM   9976  C  CB   . THR A 1 143 ? 6.583   19.217 10.654  1.00 0.00  ? 143 THR A CB   4  
ATOM   9977  O  OG1  . THR A 1 143 ? 6.865   20.601 10.492  1.00 0.00  ? 143 THR A OG1  4  
ATOM   9978  C  CG2  . THR A 1 143 ? 6.220   18.610 9.296   1.00 0.00  ? 143 THR A CG2  4  
ATOM   9979  H  H    . THR A 1 143 ? 6.130   19.647 13.582  1.00 0.00  ? 143 THR A H    4  
ATOM   9980  H  HA   . THR A 1 143 ? 4.491   19.309 11.148  1.00 0.00  ? 143 THR A HA   4  
ATOM   9981  H  HB   . THR A 1 143 ? 7.452   18.716 11.048  1.00 0.00  ? 143 THR A HB   4  
ATOM   9982  H  HG1  . THR A 1 143 ? 6.056   21.039 10.214  1.00 0.00  ? 143 THR A HG1  4  
ATOM   9983  H  HG21 . THR A 1 143 ? 6.039   19.402 8.585   1.00 0.00  ? 143 THR A HG21 4  
ATOM   9984  H  HG22 . THR A 1 143 ? 5.331   18.006 9.395   1.00 0.00  ? 143 THR A HG22 4  
ATOM   9985  H  HG23 . THR A 1 143 ? 7.037   17.995 8.950   1.00 0.00  ? 143 THR A HG23 4  
ATOM   9986  N  N    . TYR A 1 144 ? 4.191   17.198 12.589  1.00 0.00  ? 144 TYR A N    4  
ATOM   9987  C  CA   . TYR A 1 144 ? 4.049   15.814 13.128  1.00 0.00  ? 144 TYR A CA   4  
ATOM   9988  C  C    . TYR A 1 144 ? 4.820   14.842 12.236  1.00 0.00  ? 144 TYR A C    4  
ATOM   9989  O  O    . TYR A 1 144 ? 5.198   15.170 11.129  1.00 0.00  ? 144 TYR A O    4  
ATOM   9990  C  CB   . TYR A 1 144 ? 2.572   15.417 13.166  1.00 0.00  ? 144 TYR A CB   4  
ATOM   9991  C  CG   . TYR A 1 144 ? 2.440   14.039 13.774  1.00 0.00  ? 144 TYR A CG   4  
ATOM   9992  C  CD1  . TYR A 1 144 ? 2.377   13.880 15.165  1.00 0.00  ? 144 TYR A CD1  4  
ATOM   9993  C  CD2  . TYR A 1 144 ? 2.388   12.919 12.939  1.00 0.00  ? 144 TYR A CD2  4  
ATOM   9994  C  CE1  . TYR A 1 144 ? 2.248   12.598 15.717  1.00 0.00  ? 144 TYR A CE1  4  
ATOM   9995  C  CE2  . TYR A 1 144 ? 2.263   11.637 13.490  1.00 0.00  ? 144 TYR A CE2  4  
ATOM   9996  C  CZ   . TYR A 1 144 ? 2.196   11.476 14.880  1.00 0.00  ? 144 TYR A CZ   4  
ATOM   9997  O  OH   . TYR A 1 144 ? 2.054   10.213 15.429  1.00 0.00  ? 144 TYR A OH   4  
ATOM   9998  H  H    . TYR A 1 144 ? 3.417   17.798 12.570  1.00 0.00  ? 144 TYR A H    4  
ATOM   9999  H  HA   . TYR A 1 144 ? 4.454   15.782 14.129  1.00 0.00  ? 144 TYR A HA   4  
ATOM   10000 H  HB2  . TYR A 1 144 ? 2.024   16.131 13.761  1.00 0.00  ? 144 TYR A HB2  4  
ATOM   10001 H  HB3  . TYR A 1 144 ? 2.180   15.404 12.163  1.00 0.00  ? 144 TYR A HB3  4  
ATOM   10002 H  HD1  . TYR A 1 144 ? 2.416   14.745 15.812  1.00 0.00  ? 144 TYR A HD1  4  
ATOM   10003 H  HD2  . TYR A 1 144 ? 2.441   13.043 11.867  1.00 0.00  ? 144 TYR A HD2  4  
ATOM   10004 H  HE1  . TYR A 1 144 ? 2.202   12.473 16.789  1.00 0.00  ? 144 TYR A HE1  4  
ATOM   10005 H  HE2  . TYR A 1 144 ? 2.223   10.772 12.843  1.00 0.00  ? 144 TYR A HE2  4  
ATOM   10006 H  HH   . TYR A 1 144 ? 2.914   9.787  15.432  1.00 0.00  ? 144 TYR A HH   4  
ATOM   10007 N  N    . THR A 1 145 ? 5.075   13.655 12.709  1.00 0.00  ? 145 THR A N    4  
ATOM   10008 C  CA   . THR A 1 145 ? 5.848   12.684 11.878  1.00 0.00  ? 145 THR A CA   4  
ATOM   10009 C  C    . THR A 1 145 ? 4.952   11.520 11.434  1.00 0.00  ? 145 THR A C    4  
ATOM   10010 O  O    . THR A 1 145 ? 4.421   10.789 12.245  1.00 0.00  ? 145 THR A O    4  
ATOM   10011 C  CB   . THR A 1 145 ? 7.034   12.164 12.692  1.00 0.00  ? 145 THR A CB   4  
ATOM   10012 O  OG1  . THR A 1 145 ? 7.623   11.052 12.035  1.00 0.00  ? 145 THR A OG1  4  
ATOM   10013 C  CG2  . THR A 1 145 ? 6.553   11.741 14.072  1.00 0.00  ? 145 THR A CG2  4  
ATOM   10014 H  H    . THR A 1 145 ? 4.771   13.409 13.609  1.00 0.00  ? 145 THR A H    4  
ATOM   10015 H  HA   . THR A 1 145 ? 6.222   13.190 11.006  1.00 0.00  ? 145 THR A HA   4  
ATOM   10016 H  HB   . THR A 1 145 ? 7.765   12.948 12.800  1.00 0.00  ? 145 THR A HB   4  
ATOM   10017 H  HG1  . THR A 1 145 ? 7.194   10.256 12.359  1.00 0.00  ? 145 THR A HG1  4  
ATOM   10018 H  HG21 . THR A 1 145 ? 6.890   12.458 14.805  1.00 0.00  ? 145 THR A HG21 4  
ATOM   10019 H  HG22 . THR A 1 145 ? 6.958   10.770 14.308  1.00 0.00  ? 145 THR A HG22 4  
ATOM   10020 H  HG23 . THR A 1 145 ? 5.477   11.700 14.074  1.00 0.00  ? 145 THR A HG23 4  
ATOM   10021 N  N    . LYS A 1 146 ? 4.782   11.347 10.142  1.00 0.00  ? 146 LYS A N    4  
ATOM   10022 C  CA   . LYS A 1 146 ? 3.919   10.236 9.636   1.00 0.00  ? 146 LYS A CA   4  
ATOM   10023 C  C    . LYS A 1 146 ? 4.254   8.951  10.416  1.00 0.00  ? 146 LYS A C    4  
ATOM   10024 O  O    . LYS A 1 146 ? 5.274   8.327  10.194  1.00 0.00  ? 146 LYS A O    4  
ATOM   10025 C  CB   . LYS A 1 146 ? 4.179   10.017 8.129   1.00 0.00  ? 146 LYS A CB   4  
ATOM   10026 C  CG   . LYS A 1 146 ? 2.987   10.520 7.285   1.00 0.00  ? 146 LYS A CG   4  
ATOM   10027 C  CD   . LYS A 1 146 ? 2.932   9.753  5.952   1.00 0.00  ? 146 LYS A CD   4  
ATOM   10028 C  CE   . LYS A 1 146 ? 1.480   9.414  5.603   1.00 0.00  ? 146 LYS A CE   4  
ATOM   10029 N  NZ   . LYS A 1 146 ? 0.882   8.635  6.721   1.00 0.00  ? 146 LYS A NZ   4  
ATOM   10030 H  H    . LYS A 1 146 ? 5.222   11.951 9.507   1.00 0.00  ? 146 LYS A H    4  
ATOM   10031 H  HA   . LYS A 1 146 ? 2.883   10.491 9.791   1.00 0.00  ? 146 LYS A HA   4  
ATOM   10032 H  HB2  . LYS A 1 146 ? 5.071   10.552 7.841   1.00 0.00  ? 146 LYS A HB2  4  
ATOM   10033 H  HB3  . LYS A 1 146 ? 4.323   8.963  7.945   1.00 0.00  ? 146 LYS A HB3  4  
ATOM   10034 H  HG2  . LYS A 1 146 ? 2.064   10.363 7.827   1.00 0.00  ? 146 LYS A HG2  4  
ATOM   10035 H  HG3  . LYS A 1 146 ? 3.107   11.573 7.081   1.00 0.00  ? 146 LYS A HG3  4  
ATOM   10036 H  HD2  . LYS A 1 146 ? 3.354   10.361 5.167   1.00 0.00  ? 146 LYS A HD2  4  
ATOM   10037 H  HD3  . LYS A 1 146 ? 3.497   8.840  6.042   1.00 0.00  ? 146 LYS A HD3  4  
ATOM   10038 H  HE2  . LYS A 1 146 ? 0.918   10.325 5.452   1.00 0.00  ? 146 LYS A HE2  4  
ATOM   10039 H  HE3  . LYS A 1 146 ? 1.455   8.823  4.699   1.00 0.00  ? 146 LYS A HE3  4  
ATOM   10040 H  HZ1  . LYS A 1 146 ? 0.622   7.689  6.387   1.00 0.00  ? 146 LYS A HZ1  4  
ATOM   10041 H  HZ2  . LYS A 1 146 ? 0.031   9.123  7.070   1.00 0.00  ? 146 LYS A HZ2  4  
ATOM   10042 H  HZ3  . LYS A 1 146 ? 1.576   8.549  7.490   1.00 0.00  ? 146 LYS A HZ3  4  
ATOM   10043 N  N    . ASN A 1 147 ? 3.404   8.562  11.338  1.00 0.00  ? 147 ASN A N    4  
ATOM   10044 C  CA   . ASN A 1 147 ? 3.661   7.329  12.151  1.00 0.00  ? 147 ASN A CA   4  
ATOM   10045 C  C    . ASN A 1 147 ? 4.847   7.569  13.084  1.00 0.00  ? 147 ASN A C    4  
ATOM   10046 O  O    . ASN A 1 147 ? 4.686   7.837  14.259  1.00 0.00  ? 147 ASN A O    4  
ATOM   10047 C  CB   . ASN A 1 147 ? 3.952   6.139  11.229  1.00 0.00  ? 147 ASN A CB   4  
ATOM   10048 C  CG   . ASN A 1 147 ? 2.775   5.945  10.264  1.00 0.00  ? 147 ASN A CG   4  
ATOM   10049 O  OD1  . ASN A 1 147 ? 1.642   6.211  10.612  1.00 0.00  ? 147 ASN A OD1  4  
ATOM   10050 N  ND2  . ASN A 1 147 ? 2.993   5.482  9.062   1.00 0.00  ? 147 ASN A ND2  4  
ATOM   10051 H  H    . ASN A 1 147 ? 2.596   9.090  11.502  1.00 0.00  ? 147 ASN A H    4  
ATOM   10052 H  HA   . ASN A 1 147 ? 2.786   7.110  12.747  1.00 0.00  ? 147 ASN A HA   4  
ATOM   10053 H  HB2  . ASN A 1 147 ? 4.857   6.326  10.670  1.00 0.00  ? 147 ASN A HB2  4  
ATOM   10054 H  HB3  . ASN A 1 147 ? 4.075   5.246  11.825  1.00 0.00  ? 147 ASN A HB3  4  
ATOM   10055 H  HD21 . ASN A 1 147 ? 3.902   5.252  8.781   1.00 0.00  ? 147 ASN A HD21 4  
ATOM   10056 H  HD22 . ASN A 1 147 ? 2.246   5.378  8.436   1.00 0.00  ? 147 ASN A HD22 4  
ATOM   10057 N  N    . PHE A 1 148 ? 6.037   7.485  12.574  1.00 0.00  ? 148 PHE A N    4  
ATOM   10058 C  CA   . PHE A 1 148 ? 7.222   7.721  13.433  1.00 0.00  ? 148 PHE A CA   4  
ATOM   10059 C  C    . PHE A 1 148 ? 8.480   7.348  12.655  1.00 0.00  ? 148 PHE A C    4  
ATOM   10060 O  O    . PHE A 1 148 ? 8.708   6.203  12.317  1.00 0.00  ? 148 PHE A O    4  
ATOM   10061 C  CB   . PHE A 1 148 ? 7.118   6.890  14.720  1.00 0.00  ? 148 PHE A CB   4  
ATOM   10062 C  CG   . PHE A 1 148 ? 8.489   6.763  15.345  1.00 0.00  ? 148 PHE A CG   4  
ATOM   10063 C  CD1  . PHE A 1 148 ? 9.016   7.835  16.070  1.00 0.00  ? 148 PHE A CD1  4  
ATOM   10064 C  CD2  . PHE A 1 148 ? 9.245   5.594  15.173  1.00 0.00  ? 148 PHE A CD2  4  
ATOM   10065 C  CE1  . PHE A 1 148 ? 10.295  7.742  16.626  1.00 0.00  ? 148 PHE A CE1  4  
ATOM   10066 C  CE2  . PHE A 1 148 ? 10.525  5.501  15.738  1.00 0.00  ? 148 PHE A CE2  4  
ATOM   10067 C  CZ   . PHE A 1 148 ? 11.051  6.577  16.461  1.00 0.00  ? 148 PHE A CZ   4  
ATOM   10068 H  H    . PHE A 1 148 ? 6.153   7.273  11.624  1.00 0.00  ? 148 PHE A H    4  
ATOM   10069 H  HA   . PHE A 1 148 ? 7.268   8.768  13.690  1.00 0.00  ? 148 PHE A HA   4  
ATOM   10070 H  HB2  . PHE A 1 148 ? 6.454   7.396  15.410  1.00 0.00  ? 148 PHE A HB2  4  
ATOM   10071 H  HB3  . PHE A 1 148 ? 6.727   5.913  14.494  1.00 0.00  ? 148 PHE A HB3  4  
ATOM   10072 H  HD1  . PHE A 1 148 ? 8.433   8.732  16.205  1.00 0.00  ? 148 PHE A HD1  4  
ATOM   10073 H  HD2  . PHE A 1 148 ? 8.838   4.763  14.615  1.00 0.00  ? 148 PHE A HD2  4  
ATOM   10074 H  HE1  . PHE A 1 148 ? 10.700  8.569  17.180  1.00 0.00  ? 148 PHE A HE1  4  
ATOM   10075 H  HE2  . PHE A 1 148 ? 11.108  4.602  15.608  1.00 0.00  ? 148 PHE A HE2  4  
ATOM   10076 H  HZ   . PHE A 1 148 ? 12.039  6.508  16.889  1.00 0.00  ? 148 PHE A HZ   4  
ATOM   10077 N  N    . ARG A 1 149 ? 9.291   8.317  12.362  1.00 0.00  ? 149 ARG A N    4  
ATOM   10078 C  CA   . ARG A 1 149 ? 10.533  8.040  11.603  1.00 0.00  ? 149 ARG A CA   4  
ATOM   10079 C  C    . ARG A 1 149 ? 11.722  8.732  12.266  1.00 0.00  ? 149 ARG A C    4  
ATOM   10080 O  O    . ARG A 1 149 ? 12.861  8.381  12.027  1.00 0.00  ? 149 ARG A O    4  
ATOM   10081 C  CB   . ARG A 1 149 ? 10.401  8.600  10.201  1.00 0.00  ? 149 ARG A CB   4  
ATOM   10082 C  CG   . ARG A 1 149 ? 11.141  7.694  9.229   1.00 0.00  ? 149 ARG A CG   4  
ATOM   10083 C  CD   . ARG A 1 149 ? 11.344  8.453  7.924   1.00 0.00  ? 149 ARG A CD   4  
ATOM   10084 N  NE   . ARG A 1 149 ? 12.197  7.654  7.007   1.00 0.00  ? 149 ARG A NE   4  
ATOM   10085 C  CZ   . ARG A 1 149 ? 11.689  6.652  6.351   1.00 0.00  ? 149 ARG A CZ   4  
ATOM   10086 N  NH1  . ARG A 1 149 ? 10.422  6.361  6.475   1.00 0.00  ? 149 ARG A NH1  4  
ATOM   10087 N  NH2  . ARG A 1 149 ? 12.448  5.955  5.554   1.00 0.00  ? 149 ARG A NH2  4  
ATOM   10088 H  H    . ARG A 1 149 ? 9.076   9.230  12.636  1.00 0.00  ? 149 ARG A H    4  
ATOM   10089 H  HA   . ARG A 1 149 ? 10.701  6.974  11.553  1.00 0.00  ? 149 ARG A HA   4  
ATOM   10090 H  HB2  . ARG A 1 149 ? 9.358   8.662  9.926   1.00 0.00  ? 149 ARG A HB2  4  
ATOM   10091 H  HB3  . ARG A 1 149 ? 10.843  9.584  10.172  1.00 0.00  ? 149 ARG A HB3  4  
ATOM   10092 H  HG2  . ARG A 1 149 ? 12.100  7.420  9.649   1.00 0.00  ? 149 ARG A HG2  4  
ATOM   10093 H  HG3  . ARG A 1 149 ? 10.558  6.803  9.045   1.00 0.00  ? 149 ARG A HG3  4  
ATOM   10094 H  HD2  . ARG A 1 149 ? 10.386  8.631  7.461   1.00 0.00  ? 149 ARG A HD2  4  
ATOM   10095 H  HD3  . ARG A 1 149 ? 11.823  9.397  8.131   1.00 0.00  ? 149 ARG A HD3  4  
ATOM   10096 H  HE   . ARG A 1 149 ? 13.143  7.879  6.899   1.00 0.00  ? 149 ARG A HE   4  
ATOM   10097 H  HH11 . ARG A 1 149 ? 9.837   6.909  7.073   1.00 0.00  ? 149 ARG A HH11 4  
ATOM   10098 H  HH12 . ARG A 1 149 ? 10.035  5.586  5.977   1.00 0.00  ? 149 ARG A HH12 4  
ATOM   10099 H  HH21 . ARG A 1 149 ? 13.412  6.196  5.447   1.00 0.00  ? 149 ARG A HH21 4  
ATOM   10100 H  HH22 . ARG A 1 149 ? 12.070  5.177  5.056   1.00 0.00  ? 149 ARG A HH22 4  
ATOM   10101 N  N    . LEU A 1 150 ? 11.480  9.737  13.066  1.00 0.00  ? 150 LEU A N    4  
ATOM   10102 C  CA   . LEU A 1 150 ? 12.614  10.464 13.700  1.00 0.00  ? 150 LEU A CA   4  
ATOM   10103 C  C    . LEU A 1 150 ? 13.317  11.297 12.608  1.00 0.00  ? 150 LEU A C    4  
ATOM   10104 O  O    . LEU A 1 150 ? 12.744  11.568 11.571  1.00 0.00  ? 150 LEU A O    4  
ATOM   10105 C  CB   . LEU A 1 150 ? 13.576  9.432  14.310  1.00 0.00  ? 150 LEU A CB   4  
ATOM   10106 C  CG   . LEU A 1 150 ? 13.728  9.634  15.830  1.00 0.00  ? 150 LEU A CG   4  
ATOM   10107 C  CD1  . LEU A 1 150 ? 14.778  10.711 16.107  1.00 0.00  ? 150 LEU A CD1  4  
ATOM   10108 C  CD2  . LEU A 1 150 ? 12.390  10.036 16.470  1.00 0.00  ? 150 LEU A CD2  4  
ATOM   10109 H  H    . LEU A 1 150 ? 10.562  10.027 13.230  1.00 0.00  ? 150 LEU A H    4  
ATOM   10110 H  HA   . LEU A 1 150 ? 12.238  11.123 14.466  1.00 0.00  ? 150 LEU A HA   4  
ATOM   10111 H  HB2  . LEU A 1 150 ? 13.186  8.438  14.128  1.00 0.00  ? 150 LEU A HB2  4  
ATOM   10112 H  HB3  . LEU A 1 150 ? 14.543  9.527  13.842  1.00 0.00  ? 150 LEU A HB3  4  
ATOM   10113 H  HG   . LEU A 1 150 ? 14.062  8.705  16.270  1.00 0.00  ? 150 LEU A HG   4  
ATOM   10114 H  HD11 . LEU A 1 150 ? 15.763  10.310 15.910  1.00 0.00  ? 150 LEU A HD11 4  
ATOM   10115 H  HD12 . LEU A 1 150 ? 14.715  11.020 17.141  1.00 0.00  ? 150 LEU A HD12 4  
ATOM   10116 H  HD13 . LEU A 1 150 ? 14.601  11.560 15.466  1.00 0.00  ? 150 LEU A HD13 4  
ATOM   10117 H  HD21 . LEU A 1 150 ? 12.346  9.644  17.474  1.00 0.00  ? 150 LEU A HD21 4  
ATOM   10118 H  HD22 . LEU A 1 150 ? 11.573  9.630  15.892  1.00 0.00  ? 150 LEU A HD22 4  
ATOM   10119 H  HD23 . LEU A 1 150 ? 12.311  11.113 16.503  1.00 0.00  ? 150 LEU A HD23 4  
ATOM   10120 N  N    . SER A 1 151 ? 14.540  11.706 12.822  1.00 0.00  ? 151 SER A N    4  
ATOM   10121 C  CA   . SER A 1 151 ? 15.257  12.521 11.790  1.00 0.00  ? 151 SER A CA   4  
ATOM   10122 C  C    . SER A 1 151 ? 16.752  12.507 12.097  1.00 0.00  ? 151 SER A C    4  
ATOM   10123 O  O    . SER A 1 151 ? 17.171  12.816 13.196  1.00 0.00  ? 151 SER A O    4  
ATOM   10124 C  CB   . SER A 1 151 ? 14.747  13.966 11.820  1.00 0.00  ? 151 SER A CB   4  
ATOM   10125 O  OG   . SER A 1 151 ? 13.924  14.154 12.966  1.00 0.00  ? 151 SER A OG   4  
ATOM   10126 H  H    . SER A 1 151 ? 14.990  11.480 13.658  1.00 0.00  ? 151 SER A H    4  
ATOM   10127 H  HA   . SER A 1 151 ? 15.089  12.099 10.809  1.00 0.00  ? 151 SER A HA   4  
ATOM   10128 H  HB2  . SER A 1 151 ? 15.587  14.645 11.867  1.00 0.00  ? 151 SER A HB2  4  
ATOM   10129 H  HB3  . SER A 1 151 ? 14.179  14.166 10.919  1.00 0.00  ? 151 SER A HB3  4  
ATOM   10130 H  HG   . SER A 1 151 ? 14.324  14.836 13.513  1.00 0.00  ? 151 SER A HG   4  
ATOM   10131 N  N    . GLN A 1 152 ? 17.558  12.146 11.141  1.00 0.00  ? 152 GLN A N    4  
ATOM   10132 C  CA   . GLN A 1 152 ? 19.029  12.105 11.384  1.00 0.00  ? 152 GLN A CA   4  
ATOM   10133 C  C    . GLN A 1 152 ? 19.452  13.370 12.108  1.00 0.00  ? 152 GLN A C    4  
ATOM   10134 O  O    . GLN A 1 152 ? 20.221  13.320 13.038  1.00 0.00  ? 152 GLN A O    4  
ATOM   10135 C  CB   . GLN A 1 152 ? 19.780  12.028 10.055  1.00 0.00  ? 152 GLN A CB   4  
ATOM   10136 C  CG   . GLN A 1 152 ? 19.234  10.866 9.231   1.00 0.00  ? 152 GLN A CG   4  
ATOM   10137 C  CD   . GLN A 1 152 ? 20.235  9.707  9.230   1.00 0.00  ? 152 GLN A CD   4  
ATOM   10138 O  OE1  . GLN A 1 152 ? 21.291  9.809  8.642   1.00 0.00  ? 152 GLN A OE1  4  
ATOM   10139 N  NE2  . GLN A 1 152 ? 19.948  8.608  9.873   1.00 0.00  ? 152 GLN A NE2  4  
ATOM   10140 H  H    . GLN A 1 152 ? 17.197  11.902 10.266  1.00 0.00  ? 152 GLN A H    4  
ATOM   10141 H  HA   . GLN A 1 152 ? 19.280  11.241 11.991  1.00 0.00  ? 152 GLN A HA   4  
ATOM   10142 H  HB2  . GLN A 1 152 ? 19.640  12.952 9.510   1.00 0.00  ? 152 GLN A HB2  4  
ATOM   10143 H  HB3  . GLN A 1 152 ? 20.834  11.878 10.241  1.00 0.00  ? 152 GLN A HB3  4  
ATOM   10144 H  HG2  . GLN A 1 152 ? 18.301  10.534 9.659   1.00 0.00  ? 152 GLN A HG2  4  
ATOM   10145 H  HG3  . GLN A 1 152 ? 19.069  11.196 8.217   1.00 0.00  ? 152 GLN A HG3  4  
ATOM   10146 H  HE21 . GLN A 1 152 ? 19.102  8.529  10.362  1.00 0.00  ? 152 GLN A HE21 4  
ATOM   10147 H  HE22 . GLN A 1 152 ? 20.569  7.848  9.846   1.00 0.00  ? 152 GLN A HE22 4  
ATOM   10148 N  N    . ASP A 1 153 ? 18.967  14.510 11.694  1.00 0.00  ? 153 ASP A N    4  
ATOM   10149 C  CA   . ASP A 1 153 ? 19.383  15.757 12.390  1.00 0.00  ? 153 ASP A CA   4  
ATOM   10150 C  C    . ASP A 1 153 ? 19.307  15.516 13.893  1.00 0.00  ? 153 ASP A C    4  
ATOM   10151 O  O    . ASP A 1 153 ? 20.133  15.982 14.659  1.00 0.00  ? 153 ASP A O    4  
ATOM   10152 C  CB   . ASP A 1 153 ? 18.482  16.941 12.017  1.00 0.00  ? 153 ASP A CB   4  
ATOM   10153 C  CG   . ASP A 1 153 ? 19.062  18.196 12.670  1.00 0.00  ? 153 ASP A CG   4  
ATOM   10154 O  OD1  . ASP A 1 153 ? 20.251  18.192 12.939  1.00 0.00  ? 153 ASP A OD1  4  
ATOM   10155 O  OD2  . ASP A 1 153 ? 18.312  19.131 12.898  1.00 0.00  ? 153 ASP A OD2  4  
ATOM   10156 H  H    . ASP A 1 153 ? 18.345  14.538 10.938  1.00 0.00  ? 153 ASP A H    4  
ATOM   10157 H  HA   . ASP A 1 153 ? 20.401  15.985 12.116  1.00 0.00  ? 153 ASP A HA   4  
ATOM   10158 H  HB2  . ASP A 1 153 ? 18.464  17.063 10.942  1.00 0.00  ? 153 ASP A HB2  4  
ATOM   10159 H  HB3  . ASP A 1 153 ? 17.478  16.775 12.382  1.00 0.00  ? 153 ASP A HB3  4  
ATOM   10160 N  N    . ASP A 1 154 ? 18.330  14.764 14.316  1.00 0.00  ? 154 ASP A N    4  
ATOM   10161 C  CA   . ASP A 1 154 ? 18.192  14.466 15.765  1.00 0.00  ? 154 ASP A CA   4  
ATOM   10162 C  C    . ASP A 1 154 ? 19.046  13.243 16.119  1.00 0.00  ? 154 ASP A C    4  
ATOM   10163 O  O    . ASP A 1 154 ? 19.563  13.137 17.212  1.00 0.00  ? 154 ASP A O    4  
ATOM   10164 C  CB   . ASP A 1 154 ? 16.720  14.210 16.108  1.00 0.00  ? 154 ASP A CB   4  
ATOM   10165 C  CG   . ASP A 1 154 ? 16.542  14.307 17.624  1.00 0.00  ? 154 ASP A CG   4  
ATOM   10166 O  OD1  . ASP A 1 154 ? 17.286  15.056 18.237  1.00 0.00  ? 154 ASP A OD1  4  
ATOM   10167 O  OD2  . ASP A 1 154 ? 15.671  13.633 18.149  1.00 0.00  ? 154 ASP A OD2  4  
ATOM   10168 H  H    . ASP A 1 154 ? 17.694  14.387 13.674  1.00 0.00  ? 154 ASP A H    4  
ATOM   10169 H  HA   . ASP A 1 154 ? 18.545  15.312 16.330  1.00 0.00  ? 154 ASP A HA   4  
ATOM   10170 H  HB2  . ASP A 1 154 ? 16.104  14.956 15.623  1.00 0.00  ? 154 ASP A HB2  4  
ATOM   10171 H  HB3  . ASP A 1 154 ? 16.428  13.225 15.772  1.00 0.00  ? 154 ASP A HB3  4  
ATOM   10172 N  N    . ILE A 1 155 ? 19.220  12.329 15.197  1.00 0.00  ? 155 ILE A N    4  
ATOM   10173 C  CA   . ILE A 1 155 ? 20.064  11.135 15.483  1.00 0.00  ? 155 ILE A CA   4  
ATOM   10174 C  C    . ILE A 1 155 ? 21.539  11.578 15.570  1.00 0.00  ? 155 ILE A C    4  
ATOM   10175 O  O    . ILE A 1 155 ? 22.304  11.078 16.369  1.00 0.00  ? 155 ILE A O    4  
ATOM   10176 C  CB   . ILE A 1 155 ? 19.895  10.072 14.368  1.00 0.00  ? 155 ILE A CB   4  
ATOM   10177 C  CG1  . ILE A 1 155 ? 20.918  10.301 13.242  1.00 0.00  ? 155 ILE A CG1  4  
ATOM   10178 C  CG2  . ILE A 1 155 ? 18.466  10.080 13.812  1.00 0.00  ? 155 ILE A CG2  4  
ATOM   10179 C  CD1  . ILE A 1 155 ? 22.251  9.649  13.640  1.00 0.00  ? 155 ILE A CD1  4  
ATOM   10180 H  H    . ILE A 1 155 ? 18.809  12.436 14.318  1.00 0.00  ? 155 ILE A H    4  
ATOM   10181 H  HA   . ILE A 1 155 ? 19.764  10.708 16.431  1.00 0.00  ? 155 ILE A HA   4  
ATOM   10182 H  HB   . ILE A 1 155 ? 20.070  9.111  14.785  1.00 0.00  ? 155 ILE A HB   4  
ATOM   10183 H  HG12 . ILE A 1 155 ? 20.557  9.854  12.328  1.00 0.00  ? 155 ILE A HG12 4  
ATOM   10184 H  HG13 . ILE A 1 155 ? 21.068  11.359 13.094  1.00 0.00  ? 155 ILE A HG13 4  
ATOM   10185 H  HG21 . ILE A 1 155 ? 18.252  11.028 13.356  1.00 0.00  ? 155 ILE A HG21 4  
ATOM   10186 H  HG22 . ILE A 1 155 ? 17.768  9.906  14.617  1.00 0.00  ? 155 ILE A HG22 4  
ATOM   10187 H  HG23 . ILE A 1 155 ? 18.365  9.293  13.075  1.00 0.00  ? 155 ILE A HG23 4  
ATOM   10188 H  HD11 . ILE A 1 155 ? 22.935  10.408 13.998  1.00 0.00  ? 155 ILE A HD11 4  
ATOM   10189 H  HD12 . ILE A 1 155 ? 22.682  9.151  12.784  1.00 0.00  ? 155 ILE A HD12 4  
ATOM   10190 H  HD13 . ILE A 1 155 ? 22.076  8.927  14.425  1.00 0.00  ? 155 ILE A HD13 4  
ATOM   10191 N  N    . LYS A 1 156 ? 21.938  12.507 14.740  1.00 0.00  ? 156 LYS A N    4  
ATOM   10192 C  CA   . LYS A 1 156 ? 23.351  12.977 14.750  1.00 0.00  ? 156 LYS A CA   4  
ATOM   10193 C  C    . LYS A 1 156 ? 23.603  13.832 15.988  1.00 0.00  ? 156 LYS A C    4  
ATOM   10194 O  O    . LYS A 1 156 ? 24.614  13.704 16.642  1.00 0.00  ? 156 LYS A O    4  
ATOM   10195 C  CB   . LYS A 1 156 ? 23.606  13.815 13.503  1.00 0.00  ? 156 LYS A CB   4  
ATOM   10196 C  CG   . LYS A 1 156 ? 25.104  14.091 13.382  1.00 0.00  ? 156 LYS A CG   4  
ATOM   10197 C  CD   . LYS A 1 156 ? 25.471  15.329 14.204  1.00 0.00  ? 156 LYS A CD   4  
ATOM   10198 C  CE   . LYS A 1 156 ? 26.882  15.767 13.823  1.00 0.00  ? 156 LYS A CE   4  
ATOM   10199 N  NZ   . LYS A 1 156 ? 26.884  17.220 13.494  1.00 0.00  ? 156 LYS A NZ   4  
ATOM   10200 H  H    . LYS A 1 156 ? 21.309  12.890 14.102  1.00 0.00  ? 156 LYS A H    4  
ATOM   10201 H  HA   . LYS A 1 156 ? 24.017  12.128 14.753  1.00 0.00  ? 156 LYS A HA   4  
ATOM   10202 H  HB2  . LYS A 1 156 ? 23.267  13.274 12.632  1.00 0.00  ? 156 LYS A HB2  4  
ATOM   10203 H  HB3  . LYS A 1 156 ? 23.072  14.750 13.581  1.00 0.00  ? 156 LYS A HB3  4  
ATOM   10204 H  HG2  . LYS A 1 156 ? 25.657  13.240 13.750  1.00 0.00  ? 156 LYS A HG2  4  
ATOM   10205 H  HG3  . LYS A 1 156 ? 25.354  14.264 12.348  1.00 0.00  ? 156 LYS A HG3  4  
ATOM   10206 H  HD2  . LYS A 1 156 ? 24.770  16.124 13.993  1.00 0.00  ? 156 LYS A HD2  4  
ATOM   10207 H  HD3  . LYS A 1 156 ? 25.440  15.090 15.258  1.00 0.00  ? 156 LYS A HD3  4  
ATOM   10208 H  HE2  . LYS A 1 156 ? 27.553  15.582 14.647  1.00 0.00  ? 156 LYS A HE2  4  
ATOM   10209 H  HE3  . LYS A 1 156 ? 27.207  15.203 12.961  1.00 0.00  ? 156 LYS A HE3  4  
ATOM   10210 H  HZ1  . LYS A 1 156 ? 26.801  17.775 14.369  1.00 0.00  ? 156 LYS A HZ1  4  
ATOM   10211 H  HZ2  . LYS A 1 156 ? 26.077  17.434 12.868  1.00 0.00  ? 156 LYS A HZ2  4  
ATOM   10212 H  HZ3  . LYS A 1 156 ? 27.772  17.463 13.012  1.00 0.00  ? 156 LYS A HZ3  4  
ATOM   10213 N  N    . GLY A 1 157 ? 22.690  14.703 16.316  1.00 0.00  ? 157 GLY A N    4  
ATOM   10214 C  CA   . GLY A 1 157 ? 22.883  15.555 17.519  1.00 0.00  ? 157 GLY A CA   4  
ATOM   10215 C  C    . GLY A 1 157 ? 22.827  14.674 18.770  1.00 0.00  ? 157 GLY A C    4  
ATOM   10216 O  O    . GLY A 1 157 ? 23.692  14.738 19.621  1.00 0.00  ? 157 GLY A O    4  
ATOM   10217 H  H    . GLY A 1 157 ? 21.877  14.791 15.774  1.00 0.00  ? 157 GLY A H    4  
ATOM   10218 H  HA2  . GLY A 1 157 ? 23.844  16.046 17.462  1.00 0.00  ? 157 GLY A HA2  4  
ATOM   10219 H  HA3  . GLY A 1 157 ? 22.101  16.297 17.569  1.00 0.00  ? 157 GLY A HA3  4  
ATOM   10220 N  N    . ILE A 1 158 ? 21.820  13.846 18.896  1.00 0.00  ? 158 ILE A N    4  
ATOM   10221 C  CA   . ILE A 1 158 ? 21.734  12.973 20.105  1.00 0.00  ? 158 ILE A CA   4  
ATOM   10222 C  C    . ILE A 1 158 ? 23.032  12.174 20.253  1.00 0.00  ? 158 ILE A C    4  
ATOM   10223 O  O    . ILE A 1 158 ? 23.563  12.044 21.333  1.00 0.00  ? 158 ILE A O    4  
ATOM   10224 C  CB   . ILE A 1 158 ? 20.531  12.021 19.994  1.00 0.00  ? 158 ILE A CB   4  
ATOM   10225 C  CG1  . ILE A 1 158 ? 20.222  11.420 21.367  1.00 0.00  ? 158 ILE A CG1  4  
ATOM   10226 C  CG2  . ILE A 1 158 ? 20.826  10.887 19.015  1.00 0.00  ? 158 ILE A CG2  4  
ATOM   10227 C  CD1  . ILE A 1 158 ? 18.867  11.931 21.846  1.00 0.00  ? 158 ILE A CD1  4  
ATOM   10228 H  H    . ILE A 1 158 ? 21.128  13.803 18.202  1.00 0.00  ? 158 ILE A H    4  
ATOM   10229 H  HA   . ILE A 1 158 ? 21.608  13.598 20.977  1.00 0.00  ? 158 ILE A HA   4  
ATOM   10230 H  HB   . ILE A 1 158 ? 19.671  12.575 19.645  1.00 0.00  ? 158 ILE A HB   4  
ATOM   10231 H  HG12 . ILE A 1 158 ? 20.194  10.342 21.291  1.00 0.00  ? 158 ILE A HG12 4  
ATOM   10232 H  HG13 . ILE A 1 158 ? 20.984  11.714 22.071  1.00 0.00  ? 158 ILE A HG13 4  
ATOM   10233 H  HG21 . ILE A 1 158 ? 20.045  10.145 19.086  1.00 0.00  ? 158 ILE A HG21 4  
ATOM   10234 H  HG22 . ILE A 1 158 ? 21.772  10.433 19.262  1.00 0.00  ? 158 ILE A HG22 4  
ATOM   10235 H  HG23 . ILE A 1 158 ? 20.860  11.277 18.009  1.00 0.00  ? 158 ILE A HG23 4  
ATOM   10236 H  HD11 . ILE A 1 158 ? 18.206  12.042 20.998  1.00 0.00  ? 158 ILE A HD11 4  
ATOM   10237 H  HD12 . ILE A 1 158 ? 18.998  12.885 22.331  1.00 0.00  ? 158 ILE A HD12 4  
ATOM   10238 H  HD13 . ILE A 1 158 ? 18.445  11.226 22.544  1.00 0.00  ? 158 ILE A HD13 4  
ATOM   10239 N  N    . GLN A 1 159 ? 23.556  11.643 19.182  1.00 0.00  ? 159 GLN A N    4  
ATOM   10240 C  CA   . GLN A 1 159 ? 24.824  10.863 19.295  1.00 0.00  ? 159 GLN A CA   4  
ATOM   10241 C  C    . GLN A 1 159 ? 25.961  11.792 19.720  1.00 0.00  ? 159 GLN A C    4  
ATOM   10242 O  O    . GLN A 1 159 ? 26.754  11.457 20.575  1.00 0.00  ? 159 GLN A O    4  
ATOM   10243 C  CB   . GLN A 1 159 ? 25.155  10.210 17.955  1.00 0.00  ? 159 GLN A CB   4  
ATOM   10244 C  CG   . GLN A 1 159 ? 24.194  9.047  17.728  1.00 0.00  ? 159 GLN A CG   4  
ATOM   10245 C  CD   . GLN A 1 159 ? 24.898  7.722  18.037  1.00 0.00  ? 159 GLN A CD   4  
ATOM   10246 O  OE1  . GLN A 1 159 ? 26.059  7.548  17.730  1.00 0.00  ? 159 GLN A OE1  4  
ATOM   10247 N  NE2  . GLN A 1 159 ? 24.234  6.775  18.642  1.00 0.00  ? 159 GLN A NE2  4  
ATOM   10248 H  H    . GLN A 1 159 ? 23.120  11.755 18.312  1.00 0.00  ? 159 GLN A H    4  
ATOM   10249 H  HA   . GLN A 1 159 ? 24.701  10.096 20.047  1.00 0.00  ? 159 GLN A HA   4  
ATOM   10250 H  HB2  . GLN A 1 159 ? 25.043  10.934 17.160  1.00 0.00  ? 159 GLN A HB2  4  
ATOM   10251 H  HB3  . GLN A 1 159 ? 26.168  9.839  17.968  1.00 0.00  ? 159 GLN A HB3  4  
ATOM   10252 H  HG2  . GLN A 1 159 ? 23.340  9.161  18.379  1.00 0.00  ? 159 GLN A HG2  4  
ATOM   10253 H  HG3  . GLN A 1 159 ? 23.864  9.047  16.700  1.00 0.00  ? 159 GLN A HG3  4  
ATOM   10254 H  HE21 . GLN A 1 159 ? 23.298  6.919  18.897  1.00 0.00  ? 159 GLN A HE21 4  
ATOM   10255 H  HE22 . GLN A 1 159 ? 24.668  5.920  18.840  1.00 0.00  ? 159 GLN A HE22 4  
ATOM   10256 N  N    . GLU A 1 160 ? 26.047  12.964 19.153  1.00 0.00  ? 160 GLU A N    4  
ATOM   10257 C  CA   . GLU A 1 160 ? 27.133  13.895 19.569  1.00 0.00  ? 160 GLU A CA   4  
ATOM   10258 C  C    . GLU A 1 160 ? 27.009  14.143 21.077  1.00 0.00  ? 160 GLU A C    4  
ATOM   10259 O  O    . GLU A 1 160 ? 27.957  14.522 21.737  1.00 0.00  ? 160 GLU A O    4  
ATOM   10260 C  CB   . GLU A 1 160 ? 26.975  15.233 18.848  1.00 0.00  ? 160 GLU A CB   4  
ATOM   10261 C  CG   . GLU A 1 160 ? 27.246  15.065 17.353  1.00 0.00  ? 160 GLU A CG   4  
ATOM   10262 C  CD   . GLU A 1 160 ? 28.684  14.590 17.130  1.00 0.00  ? 160 GLU A CD   4  
ATOM   10263 O  OE1  . GLU A 1 160 ? 29.452  14.614 18.077  1.00 0.00  ? 160 GLU A OE1  4  
ATOM   10264 O  OE2  . GLU A 1 160 ? 28.991  14.209 16.010  1.00 0.00  ? 160 GLU A OE2  4  
ATOM   10265 H  H    . GLU A 1 160 ? 25.397  13.236 18.473  1.00 0.00  ? 160 GLU A H    4  
ATOM   10266 H  HA   . GLU A 1 160 ? 28.097  13.462 19.339  1.00 0.00  ? 160 GLU A HA   4  
ATOM   10267 H  HB2  . GLU A 1 160 ? 25.965  15.591 18.988  1.00 0.00  ? 160 GLU A HB2  4  
ATOM   10268 H  HB3  . GLU A 1 160 ? 27.668  15.949 19.261  1.00 0.00  ? 160 GLU A HB3  4  
ATOM   10269 H  HG2  . GLU A 1 160 ? 26.562  14.340 16.945  1.00 0.00  ? 160 GLU A HG2  4  
ATOM   10270 H  HG3  . GLU A 1 160 ? 27.103  16.014 16.856  1.00 0.00  ? 160 GLU A HG3  4  
ATOM   10271 N  N    . LEU A 1 161 ? 25.830  13.943 21.613  1.00 0.00  ? 161 LEU A N    4  
ATOM   10272 C  CA   . LEU A 1 161 ? 25.598  14.175 23.072  1.00 0.00  ? 161 LEU A CA   4  
ATOM   10273 C  C    . LEU A 1 161 ? 25.658  12.834 23.815  1.00 0.00  ? 161 LEU A C    4  
ATOM   10274 O  O    . LEU A 1 161 ? 26.530  12.595 24.629  1.00 0.00  ? 161 LEU A O    4  
ATOM   10275 C  CB   . LEU A 1 161 ? 24.209  14.807 23.260  1.00 0.00  ? 161 LEU A CB   4  
ATOM   10276 C  CG   . LEU A 1 161 ? 24.282  16.324 23.091  1.00 0.00  ? 161 LEU A CG   4  
ATOM   10277 C  CD1  . LEU A 1 161 ? 24.982  16.937 24.310  1.00 0.00  ? 161 LEU A CD1  4  
ATOM   10278 C  CD2  . LEU A 1 161 ? 25.053  16.661 21.813  1.00 0.00  ? 161 LEU A CD2  4  
ATOM   10279 H  H    . LEU A 1 161 ? 25.088  13.646 21.047  1.00 0.00  ? 161 LEU A H    4  
ATOM   10280 H  HA   . LEU A 1 161 ? 26.356  14.841 23.460  1.00 0.00  ? 161 LEU A HA   4  
ATOM   10281 H  HB2  . LEU A 1 161 ? 23.529  14.402 22.525  1.00 0.00  ? 161 LEU A HB2  4  
ATOM   10282 H  HB3  . LEU A 1 161 ? 23.845  14.583 24.244  1.00 0.00  ? 161 LEU A HB3  4  
ATOM   10283 H  HG   . LEU A 1 161 ? 23.280  16.721 23.021  1.00 0.00  ? 161 LEU A HG   4  
ATOM   10284 H  HD11 . LEU A 1 161 ? 24.629  17.946 24.463  1.00 0.00  ? 161 LEU A HD11 4  
ATOM   10285 H  HD12 . LEU A 1 161 ? 26.049  16.951 24.148  1.00 0.00  ? 161 LEU A HD12 4  
ATOM   10286 H  HD13 . LEU A 1 161 ? 24.759  16.342 25.187  1.00 0.00  ? 161 LEU A HD13 4  
ATOM   10287 H  HD21 . LEU A 1 161 ? 25.994  16.133 21.808  1.00 0.00  ? 161 LEU A HD21 4  
ATOM   10288 H  HD22 . LEU A 1 161 ? 25.233  17.725 21.772  1.00 0.00  ? 161 LEU A HD22 4  
ATOM   10289 H  HD23 . LEU A 1 161 ? 24.470  16.363 20.954  1.00 0.00  ? 161 LEU A HD23 4  
ATOM   10290 N  N    . TYR A 1 162 ? 24.739  11.954 23.526  1.00 0.00  ? 162 TYR A N    4  
ATOM   10291 C  CA   . TYR A 1 162 ? 24.731  10.621 24.181  1.00 0.00  ? 162 TYR A CA   4  
ATOM   10292 C  C    . TYR A 1 162 ? 24.082  9.614  23.223  1.00 0.00  ? 162 TYR A C    4  
ATOM   10293 O  O    . TYR A 1 162 ? 22.900  9.358  23.291  1.00 0.00  ? 162 TYR A O    4  
ATOM   10294 C  CB   . TYR A 1 162 ? 23.924  10.678 25.475  1.00 0.00  ? 162 TYR A CB   4  
ATOM   10295 C  CG   . TYR A 1 162 ? 22.528  11.153 25.176  1.00 0.00  ? 162 TYR A CG   4  
ATOM   10296 C  CD1  . TYR A 1 162 ? 22.300  12.502 24.930  1.00 0.00  ? 162 TYR A CD1  4  
ATOM   10297 C  CD2  . TYR A 1 162 ? 21.463  10.249 25.156  1.00 0.00  ? 162 TYR A CD2  4  
ATOM   10298 C  CE1  . TYR A 1 162 ? 21.006  12.957 24.662  1.00 0.00  ? 162 TYR A CE1  4  
ATOM   10299 C  CE2  . TYR A 1 162 ? 20.169  10.700 24.897  1.00 0.00  ? 162 TYR A CE2  4  
ATOM   10300 C  CZ   . TYR A 1 162 ? 19.941  12.052 24.645  1.00 0.00  ? 162 TYR A CZ   4  
ATOM   10301 O  OH   . TYR A 1 162 ? 18.665  12.493 24.403  1.00 0.00  ? 162 TYR A OH   4  
ATOM   10302 H  H    . TYR A 1 162 ? 24.056  12.167 22.870  1.00 0.00  ? 162 TYR A H    4  
ATOM   10303 H  HA   . TYR A 1 162 ? 25.745  10.318 24.396  1.00 0.00  ? 162 TYR A HA   4  
ATOM   10304 H  HB2  . TYR A 1 162 ? 23.880  9.693  25.913  1.00 0.00  ? 162 TYR A HB2  4  
ATOM   10305 H  HB3  . TYR A 1 162 ? 24.394  11.359 26.165  1.00 0.00  ? 162 TYR A HB3  4  
ATOM   10306 H  HD1  . TYR A 1 162 ? 23.123  13.195 24.952  1.00 0.00  ? 162 TYR A HD1  4  
ATOM   10307 H  HD2  . TYR A 1 162 ? 21.643  9.205  25.339  1.00 0.00  ? 162 TYR A HD2  4  
ATOM   10308 H  HE1  . TYR A 1 162 ? 20.832  14.005 24.461  1.00 0.00  ? 162 TYR A HE1  4  
ATOM   10309 H  HE2  . TYR A 1 162 ? 19.346  10.002 24.884  1.00 0.00  ? 162 TYR A HE2  4  
ATOM   10310 H  HH   . TYR A 1 162 ? 18.337  12.896 25.211  1.00 0.00  ? 162 TYR A HH   4  
ATOM   10311 N  N    . GLY A 1 163 ? 24.840  9.052  22.322  1.00 0.00  ? 163 GLY A N    4  
ATOM   10312 C  CA   . GLY A 1 163 ? 24.248  8.072  21.362  1.00 0.00  ? 163 GLY A CA   4  
ATOM   10313 C  C    . GLY A 1 163 ? 24.438  6.650  21.895  1.00 0.00  ? 163 GLY A C    4  
ATOM   10314 O  O    . GLY A 1 163 ? 25.414  6.424  22.589  1.00 0.00  ? 163 GLY A O    4  
ATOM   10315 O  OXT  . GLY A 1 163 ? 23.605  5.809  21.596  1.00 0.00  ? 163 GLY A OXT  4  
ATOM   10316 H  H    . GLY A 1 163 ? 25.791  9.277  22.270  1.00 0.00  ? 163 GLY A H    4  
ATOM   10317 H  HA2  . GLY A 1 163 ? 23.189  8.275  21.246  1.00 0.00  ? 163 GLY A HA2  4  
ATOM   10318 H  HA3  . GLY A 1 163 ? 24.736  8.164  20.404  1.00 0.00  ? 163 GLY A HA3  4  
HETATM 10319 ZN ZN   . ZN  B 2 .   ? 6.680   27.263 31.959  1.00 11.59 ? 165 ZN  A ZN   4  
HETATM 10320 ZN ZN   . ZN  C 2 .   ? 11.047  24.437 19.225  1.00 10.57 ? 166 ZN  A ZN   4  
HETATM 10321 CA CA   . CA  D 3 .   ? -1.554  27.895 22.742  1.00 9.12  ? 167 CA  A CA   4  
HETATM 10322 CA CA   . CA  E 3 .   ? 14.925  21.024 35.796  1.00 8.09  ? 168 CA  A CA   4  
HETATM 10323 C  C38  . I52 F 4 .   ? 10.478  13.353 15.045  1.00 20.00 ? 800 I52 A C38  4  
HETATM 10324 C  C39  . I52 F 4 .   ? 9.345   13.005 15.983  1.00 20.00 ? 800 I52 A C39  4  
HETATM 10325 C  C37  . I52 F 4 .   ? 9.964   13.852 13.704  1.00 20.00 ? 800 I52 A C37  4  
HETATM 10326 C  C35  . I52 F 4 .   ? 8.446   15.823 14.068  1.00 20.00 ? 800 I52 A C35  4  
HETATM 10327 C  C36  . I52 F 4 .   ? 9.851   15.362 13.695  1.00 20.00 ? 800 I52 A C36  4  
HETATM 10328 C  C25  . I52 F 4 .   ? 9.894   29.285 21.457  1.00 20.00 ? 800 I52 A C25  4  
HETATM 10329 C  C24  . I52 F 4 .   ? 9.385   28.042 23.555  1.00 20.00 ? 800 I52 A C24  4  
HETATM 10330 N  N8   . I52 F 4 .   ? 7.056   31.254 19.288  1.00 20.00 ? 800 I52 A N8   4  
HETATM 10331 C  C7   . I52 F 4 .   ? 6.659   29.841 19.218  1.00 20.00 ? 800 I52 A C7   4  
HETATM 10332 C  C9   . I52 F 4 .   ? 7.948   31.723 18.191  1.00 20.00 ? 800 I52 A C9   4  
HETATM 10333 C  C13  . I52 F 4 .   ? 7.641   31.646 20.608  1.00 20.00 ? 800 I52 A C13  4  
HETATM 10334 O  O11  . I52 F 4 .   ? 7.795   33.855 19.465  1.00 20.00 ? 800 I52 A O11  4  
HETATM 10335 C  C12  . I52 F 4 .   ? 8.043   33.144 20.712  1.00 20.00 ? 800 I52 A C12  4  
HETATM 10336 C  C10  . I52 F 4 .   ? 8.391   33.207 18.310  1.00 20.00 ? 800 I52 A C10  4  
HETATM 10337 C  C31  . I52 F 4 .   ? 8.657   18.344 13.696  1.00 20.00 ? 800 I52 A C31  4  
HETATM 10338 C  C23  . I52 F 4 .   ? 8.827   28.472 22.205  1.00 20.00 ? 800 I52 A C23  4  
HETATM 10339 O  O26  . I52 F 4 .   ? 9.986   26.323 19.825  1.00 20.00 ? 800 I52 A O26  4  
HETATM 10340 C  C4   . I52 F 4 .   ? 8.289   27.246 21.367  1.00 20.00 ? 800 I52 A C4   4  
HETATM 10341 C  C6   . I52 F 4 .   ? 7.723   28.742 19.334  1.00 20.00 ? 800 I52 A C6   4  
HETATM 10342 S  S14  . I52 F 4 .   ? 5.898   26.739 20.019  1.00 20.00 ? 800 I52 A S14  4  
HETATM 10343 N  N5   . I52 F 4 .   ? 7.346   27.607 20.245  1.00 20.00 ? 800 I52 A N5   4  
HETATM 10344 C  C3   . I52 F 4 .   ? 9.445   26.313 20.928  1.00 20.00 ? 800 I52 A C3   4  
HETATM 10345 O  O1   . I52 F 4 .   ? 10.904  24.551 21.528  1.00 20.00 ? 800 I52 A O1   4  
HETATM 10346 N  N2   . I52 F 4 .   ? 9.845   25.419 21.908  1.00 20.00 ? 800 I52 A N2   4  
HETATM 10347 O  O21  . I52 F 4 .   ? 5.334   26.456 21.331  1.00 20.00 ? 800 I52 A O21  4  
HETATM 10348 O  O41  . I52 F 4 .   ? 8.852   22.238 15.525  1.00 20.00 ? 800 I52 A O41  4  
HETATM 10349 C  C28  . I52 F 4 .   ? 8.189   21.366 16.073  1.00 20.00 ? 800 I52 A C28  4  
HETATM 10350 N  N27  . I52 F 4 .   ? 7.330   21.532 17.161  1.00 20.00 ? 800 I52 A N27  4  
HETATM 10351 C  C29  . I52 F 4 .   ? 8.290   19.964 15.554  1.00 20.00 ? 800 I52 A C29  4  
HETATM 10352 C  C33  . I52 F 4 .   ? 8.098   17.509 15.966  1.00 20.00 ? 800 I52 A C33  4  
HETATM 10353 C  C34  . I52 F 4 .   ? 8.045   18.862 16.453  1.00 20.00 ? 800 I52 A C34  4  
HETATM 10354 C  C30  . I52 F 4 .   ? 8.603   19.697 14.175  1.00 20.00 ? 800 I52 A C30  4  
HETATM 10355 C  C32  . I52 F 4 .   ? 8.410   17.242 14.586  1.00 20.00 ? 800 I52 A C32  4  
HETATM 10356 C  C16  . I52 F 4 .   ? 7.272   25.215 18.137  1.00 20.00 ? 800 I52 A C16  4  
HETATM 10357 C  C18  . I52 F 4 .   ? 6.995   22.728 17.876  1.00 20.00 ? 800 I52 A C18  4  
HETATM 10358 C  C15  . I52 F 4 .   ? 6.338   25.207 19.225  1.00 20.00 ? 800 I52 A C15  4  
HETATM 10359 O  O22  . I52 F 4 .   ? 5.105   27.457 19.051  1.00 20.00 ? 800 I52 A O22  4  
HETATM 10360 C  C20  . I52 F 4 .   ? 5.736   23.975 19.643  1.00 20.00 ? 800 I52 A C20  4  
HETATM 10361 C  C17  . I52 F 4 .   ? 7.601   23.985 17.469  1.00 20.00 ? 800 I52 A C17  4  
HETATM 10362 C  C19  . I52 F 4 .   ? 6.068   22.744 18.973  1.00 20.00 ? 800 I52 A C19  4  
HETATM 10363 H  H381 . I52 F 4 .   ? 11.069  12.436 14.870  1.00 20.00 ? 800 I52 A H381 4  
HETATM 10364 H  H382 . I52 F 4 .   ? 11.134  14.103 15.508  1.00 20.00 ? 800 I52 A H382 4  
HETATM 10365 H  H391 . I52 F 4 .   ? 8.759   12.177 15.579  1.00 20.00 ? 800 I52 A H391 4  
HETATM 10366 H  H392 . I52 F 4 .   ? 8.672   13.862 16.098  1.00 20.00 ? 800 I52 A H392 4  
HETATM 10367 H  H393 . I52 F 4 .   ? 9.718   12.721 16.967  1.00 20.00 ? 800 I52 A H393 4  
HETATM 10368 H  H371 . I52 F 4 .   ? 10.690  13.558 12.922  1.00 20.00 ? 800 I52 A H371 4  
HETATM 10369 H  H372 . I52 F 4 .   ? 8.999   13.394 13.465  1.00 20.00 ? 800 I52 A H372 4  
HETATM 10370 H  H351 . I52 F 4 .   ? 7.817   15.783 13.163  1.00 20.00 ? 800 I52 A H351 4  
HETATM 10371 H  H352 . I52 F 4 .   ? 7.991   15.143 14.799  1.00 20.00 ? 800 I52 A H352 4  
HETATM 10372 H  H361 . I52 F 4 .   ? 10.068  15.708 12.669  1.00 20.00 ? 800 I52 A H361 4  
HETATM 10373 H  H362 . I52 F 4 .   ? 10.599  15.798 14.365  1.00 20.00 ? 800 I52 A H362 4  
HETATM 10374 H  H251 . I52 F 4 .   ? 9.543   30.293 21.220  1.00 20.00 ? 800 I52 A H251 4  
HETATM 10375 H  H252 . I52 F 4 .   ? 10.140  28.799 20.505  1.00 20.00 ? 800 I52 A H252 4  
HETATM 10376 H  H253 . I52 F 4 .   ? 10.816  29.364 22.040  1.00 20.00 ? 800 I52 A H253 4  
HETATM 10377 H  H241 . I52 F 4 .   ? 8.666   27.436 24.109  1.00 20.00 ? 800 I52 A H241 4  
HETATM 10378 H  H242 . I52 F 4 .   ? 9.597   28.923 24.174  1.00 20.00 ? 800 I52 A H242 4  
HETATM 10379 H  H243 . I52 F 4 .   ? 10.318  27.481 23.450  1.00 20.00 ? 800 I52 A H243 4  
HETATM 10380 H  H71  . I52 F 4 .   ? 6.136   29.703 18.256  1.00 20.00 ? 800 I52 A H71  4  
HETATM 10381 H  H72  . I52 F 4 .   ? 5.898   29.692 19.989  1.00 20.00 ? 800 I52 A H72  4  
HETATM 10382 H  H91  . I52 F 4 .   ? 7.356   31.638 17.267  6.00 20.00 ? 800 I52 A H91  4  
HETATM 10383 H  H92  . I52 F 4 .   ? 8.816   31.070 18.059  6.00 20.00 ? 800 I52 A H92  4  
HETATM 10384 H  H131 . I52 F 4 .   ? 8.542   31.032 20.805  6.00 20.00 ? 800 I52 A H131 4  
HETATM 10385 H  H132 . I52 F 4 .   ? 6.909   31.414 21.392  6.00 20.00 ? 800 I52 A H132 4  
HETATM 10386 H  H121 . I52 F 4 .   ? 7.407   33.622 21.473  7.00 20.00 ? 800 I52 A H121 4  
HETATM 10387 H  H122 . I52 F 4 .   ? 9.087   33.282 21.010  7.00 20.00 ? 800 I52 A H122 4  
HETATM 10388 H  H101 . I52 F 4 .   ? 9.485   33.270 18.434  7.00 20.00 ? 800 I52 A H101 4  
HETATM 10389 H  H102 . I52 F 4 .   ? 8.116   33.770 17.410  7.00 20.00 ? 800 I52 A H102 4  
HETATM 10390 H  H31  . I52 F 4 .   ? 8.889   18.158 12.650  3.00 20.00 ? 800 I52 A H31  4  
HETATM 10391 H  H23  . I52 F 4 .   ? 7.984   29.154 22.397  1.00 20.00 ? 800 I52 A H23  4  
HETATM 10392 H  H4   . I52 F 4 .   ? 7.739   26.610 22.080  1.00 20.00 ? 800 I52 A H4   4  
HETATM 10393 H  H61  . I52 F 4 .   ? 7.862   28.324 18.326  1.00 20.00 ? 800 I52 A H61  4  
HETATM 10394 H  H62  . I52 F 4 .   ? 8.693   29.152 19.636  1.00 20.00 ? 800 I52 A H62  4  
HETATM 10395 H  H1   . I52 F 4 .   ? 10.908  23.885 22.252  1.00 20.00 ? 800 I52 A H1   4  
HETATM 10396 H  H2   . I52 F 4 .   ? 9.409   25.383 22.839  1.00 20.00 ? 800 I52 A H2   4  
HETATM 10397 H  H27  . I52 F 4 .   ? 6.873   20.672 17.497  1.00 20.00 ? 800 I52 A H27  4  
HETATM 10398 H  H33  . I52 F 4 .   ? 7.900   16.689 16.653  3.00 20.00 ? 800 I52 A H33  4  
HETATM 10399 H  H34  . I52 F 4 .   ? 7.817   19.050 17.499  3.00 20.00 ? 800 I52 A H34  4  
HETATM 10400 H  H30  . I52 F 4 .   ? 8.794   20.508 13.479  3.00 20.00 ? 800 I52 A H30  4  
HETATM 10401 H  H16  . I52 F 4 .   ? 7.750   26.137 17.816  2.00 20.00 ? 800 I52 A H16  4  
HETATM 10402 H  H20  . I52 F 4 .   ? 5.027   23.948 20.470  2.00 20.00 ? 800 I52 A H20  4  
HETATM 10403 H  H17  . I52 F 4 .   ? 8.302   24.017 16.638  2.00 20.00 ? 800 I52 A H17  4  
HETATM 10404 H  H19  . I52 F 4 .   ? 5.593   21.837 19.330  2.00 20.00 ? 800 I52 A H19  4  
ATOM   10405 N  N    . MET A 1 1   ? 45.454  31.202 30.624  1.00 0.00  ? 1   MET A N    5  
ATOM   10406 C  CA   . MET A 1 1   ? 45.966  29.805 30.701  1.00 0.00  ? 1   MET A CA   5  
ATOM   10407 C  C    . MET A 1 1   ? 44.835  28.824 30.387  1.00 0.00  ? 1   MET A C    5  
ATOM   10408 O  O    . MET A 1 1   ? 44.958  27.974 29.527  1.00 0.00  ? 1   MET A O    5  
ATOM   10409 C  CB   . MET A 1 1   ? 46.495  29.536 32.111  1.00 0.00  ? 1   MET A CB   5  
ATOM   10410 C  CG   . MET A 1 1   ? 48.024  29.599 32.107  1.00 0.00  ? 1   MET A CG   5  
ATOM   10411 S  SD   . MET A 1 1   ? 48.567  31.119 31.287  1.00 0.00  ? 1   MET A SD   5  
ATOM   10412 C  CE   . MET A 1 1   ? 48.519  32.188 32.745  1.00 0.00  ? 1   MET A CE   5  
ATOM   10413 H  H1   . MET A 1 1   ? 44.659  31.320 31.285  1.00 0.00  ? 1   MET A H1   5  
ATOM   10414 H  H2   . MET A 1 1   ? 45.130  31.399 29.655  1.00 0.00  ? 1   MET A H2   5  
ATOM   10415 H  H3   . MET A 1 1   ? 46.212  31.866 30.878  1.00 0.00  ? 1   MET A H3   5  
ATOM   10416 H  HA   . MET A 1 1   ? 46.765  29.674 29.987  1.00 0.00  ? 1   MET A HA   5  
ATOM   10417 H  HB2  . MET A 1 1   ? 46.105  30.281 32.790  1.00 0.00  ? 1   MET A HB2  5  
ATOM   10418 H  HB3  . MET A 1 1   ? 46.179  28.554 32.434  1.00 0.00  ? 1   MET A HB3  5  
ATOM   10419 H  HG2  . MET A 1 1   ? 48.388  29.590 33.124  1.00 0.00  ? 1   MET A HG2  5  
ATOM   10420 H  HG3  . MET A 1 1   ? 48.416  28.744 31.576  1.00 0.00  ? 1   MET A HG3  5  
ATOM   10421 H  HE1  . MET A 1 1   ? 47.626  32.799 32.715  1.00 0.00  ? 1   MET A HE1  5  
ATOM   10422 H  HE2  . MET A 1 1   ? 49.388  32.826 32.754  1.00 0.00  ? 1   MET A HE2  5  
ATOM   10423 H  HE3  . MET A 1 1   ? 48.514  31.577 33.637  1.00 0.00  ? 1   MET A HE3  5  
ATOM   10424 N  N    . TYR A 1 2   ? 43.731  28.938 31.073  1.00 0.00  ? 2   TYR A N    5  
ATOM   10425 C  CA   . TYR A 1 2   ? 42.591  28.018 30.809  1.00 0.00  ? 2   TYR A CA   5  
ATOM   10426 C  C    . TYR A 1 2   ? 41.279  28.715 31.194  1.00 0.00  ? 2   TYR A C    5  
ATOM   10427 O  O    . TYR A 1 2   ? 40.753  28.541 32.274  1.00 0.00  ? 2   TYR A O    5  
ATOM   10428 C  CB   . TYR A 1 2   ? 42.778  26.716 31.606  1.00 0.00  ? 2   TYR A CB   5  
ATOM   10429 C  CG   . TYR A 1 2   ? 42.532  26.941 33.083  1.00 0.00  ? 2   TYR A CG   5  
ATOM   10430 C  CD1  . TYR A 1 2   ? 43.214  27.953 33.773  1.00 0.00  ? 2   TYR A CD1  5  
ATOM   10431 C  CD2  . TYR A 1 2   ? 41.619  26.125 33.765  1.00 0.00  ? 2   TYR A CD2  5  
ATOM   10432 C  CE1  . TYR A 1 2   ? 42.982  28.147 35.141  1.00 0.00  ? 2   TYR A CE1  5  
ATOM   10433 C  CE2  . TYR A 1 2   ? 41.389  26.318 35.132  1.00 0.00  ? 2   TYR A CE2  5  
ATOM   10434 C  CZ   . TYR A 1 2   ? 42.069  27.329 35.819  1.00 0.00  ? 2   TYR A CZ   5  
ATOM   10435 O  OH   . TYR A 1 2   ? 41.841  27.516 37.168  1.00 0.00  ? 2   TYR A OH   5  
ATOM   10436 H  H    . TYR A 1 2   ? 43.650  29.633 31.759  1.00 0.00  ? 2   TYR A H    5  
ATOM   10437 H  HA   . TYR A 1 2   ? 42.567  27.785 29.752  1.00 0.00  ? 2   TYR A HA   5  
ATOM   10438 H  HB2  . TYR A 1 2   ? 42.084  25.972 31.241  1.00 0.00  ? 2   TYR A HB2  5  
ATOM   10439 H  HB3  . TYR A 1 2   ? 43.787  26.356 31.464  1.00 0.00  ? 2   TYR A HB3  5  
ATOM   10440 H  HD1  . TYR A 1 2   ? 43.920  28.581 33.252  1.00 0.00  ? 2   TYR A HD1  5  
ATOM   10441 H  HD2  . TYR A 1 2   ? 41.094  25.345 33.237  1.00 0.00  ? 2   TYR A HD2  5  
ATOM   10442 H  HE1  . TYR A 1 2   ? 43.507  28.924 35.674  1.00 0.00  ? 2   TYR A HE1  5  
ATOM   10443 H  HE2  . TYR A 1 2   ? 40.685  25.689 35.656  1.00 0.00  ? 2   TYR A HE2  5  
ATOM   10444 H  HH   . TYR A 1 2   ? 42.559  28.044 37.518  1.00 0.00  ? 2   TYR A HH   5  
ATOM   10445 N  N    . ASN A 1 3   ? 40.752  29.519 30.306  1.00 0.00  ? 3   ASN A N    5  
ATOM   10446 C  CA   . ASN A 1 3   ? 39.482  30.243 30.608  1.00 0.00  ? 3   ASN A CA   5  
ATOM   10447 C  C    . ASN A 1 3   ? 38.314  29.564 29.891  1.00 0.00  ? 3   ASN A C    5  
ATOM   10448 O  O    . ASN A 1 3   ? 37.354  30.206 29.511  1.00 0.00  ? 3   ASN A O    5  
ATOM   10449 C  CB   . ASN A 1 3   ? 39.591  31.696 30.133  1.00 0.00  ? 3   ASN A CB   5  
ATOM   10450 C  CG   . ASN A 1 3   ? 40.446  31.766 28.863  1.00 0.00  ? 3   ASN A CG   5  
ATOM   10451 O  OD1  . ASN A 1 3   ? 40.253  30.996 27.941  1.00 0.00  ? 3   ASN A OD1  5  
ATOM   10452 N  ND2  . ASN A 1 3   ? 41.396  32.659 28.777  1.00 0.00  ? 3   ASN A ND2  5  
ATOM   10453 H  H    . ASN A 1 3   ? 41.196  29.649 29.443  1.00 0.00  ? 3   ASN A H    5  
ATOM   10454 H  HA   . ASN A 1 3   ? 39.307  30.227 31.674  1.00 0.00  ? 3   ASN A HA   5  
ATOM   10455 H  HB2  . ASN A 1 3   ? 38.603  32.078 29.918  1.00 0.00  ? 3   ASN A HB2  5  
ATOM   10456 H  HB3  . ASN A 1 3   ? 40.048  32.296 30.906  1.00 0.00  ? 3   ASN A HB3  5  
ATOM   10457 H  HD21 . ASN A 1 3   ? 41.554  33.277 29.520  1.00 0.00  ? 3   ASN A HD21 5  
ATOM   10458 H  HD22 . ASN A 1 3   ? 41.947  32.714 27.966  1.00 0.00  ? 3   ASN A HD22 5  
ATOM   10459 N  N    . PHE A 1 4   ? 38.380  28.273 29.702  1.00 0.00  ? 4   PHE A N    5  
ATOM   10460 C  CA   . PHE A 1 4   ? 37.264  27.567 29.010  1.00 0.00  ? 4   PHE A CA   5  
ATOM   10461 C  C    . PHE A 1 4   ? 36.117  27.332 29.995  1.00 0.00  ? 4   PHE A C    5  
ATOM   10462 O  O    . PHE A 1 4   ? 36.299  26.753 31.049  1.00 0.00  ? 4   PHE A O    5  
ATOM   10463 C  CB   . PHE A 1 4   ? 37.756  26.217 28.480  1.00 0.00  ? 4   PHE A CB   5  
ATOM   10464 C  CG   . PHE A 1 4   ? 38.951  26.429 27.584  1.00 0.00  ? 4   PHE A CG   5  
ATOM   10465 C  CD1  . PHE A 1 4   ? 38.768  26.818 26.252  1.00 0.00  ? 4   PHE A CD1  5  
ATOM   10466 C  CD2  . PHE A 1 4   ? 40.243  26.236 28.086  1.00 0.00  ? 4   PHE A CD2  5  
ATOM   10467 C  CE1  . PHE A 1 4   ? 39.879  27.013 25.420  1.00 0.00  ? 4   PHE A CE1  5  
ATOM   10468 C  CE2  . PHE A 1 4   ? 41.353  26.430 27.255  1.00 0.00  ? 4   PHE A CE2  5  
ATOM   10469 C  CZ   . PHE A 1 4   ? 41.171  26.819 25.921  1.00 0.00  ? 4   PHE A CZ   5  
ATOM   10470 H  H    . PHE A 1 4   ? 39.161  27.770 30.017  1.00 0.00  ? 4   PHE A H    5  
ATOM   10471 H  HA   . PHE A 1 4   ? 36.912  28.170 28.188  1.00 0.00  ? 4   PHE A HA   5  
ATOM   10472 H  HB2  . PHE A 1 4   ? 38.036  25.585 29.311  1.00 0.00  ? 4   PHE A HB2  5  
ATOM   10473 H  HB3  . PHE A 1 4   ? 36.965  25.742 27.920  1.00 0.00  ? 4   PHE A HB3  5  
ATOM   10474 H  HD1  . PHE A 1 4   ? 37.771  26.966 25.865  1.00 0.00  ? 4   PHE A HD1  5  
ATOM   10475 H  HD2  . PHE A 1 4   ? 40.383  25.936 29.113  1.00 0.00  ? 4   PHE A HD2  5  
ATOM   10476 H  HE1  . PHE A 1 4   ? 39.738  27.312 24.392  1.00 0.00  ? 4   PHE A HE1  5  
ATOM   10477 H  HE2  . PHE A 1 4   ? 42.351  26.280 27.643  1.00 0.00  ? 4   PHE A HE2  5  
ATOM   10478 H  HZ   . PHE A 1 4   ? 42.029  26.968 25.279  1.00 0.00  ? 4   PHE A HZ   5  
ATOM   10479 N  N    . PHE A 1 5   ? 34.935  27.770 29.661  1.00 0.00  ? 5   PHE A N    5  
ATOM   10480 C  CA   . PHE A 1 5   ? 33.782  27.562 30.579  1.00 0.00  ? 5   PHE A CA   5  
ATOM   10481 C  C    . PHE A 1 5   ? 33.455  26.068 30.637  1.00 0.00  ? 5   PHE A C    5  
ATOM   10482 O  O    . PHE A 1 5   ? 33.771  25.332 29.723  1.00 0.00  ? 5   PHE A O    5  
ATOM   10483 C  CB   . PHE A 1 5   ? 32.572  28.339 30.059  1.00 0.00  ? 5   PHE A CB   5  
ATOM   10484 C  CG   . PHE A 1 5   ? 32.565  29.718 30.670  1.00 0.00  ? 5   PHE A CG   5  
ATOM   10485 C  CD1  . PHE A 1 5   ? 33.734  30.489 30.672  1.00 0.00  ? 5   PHE A CD1  5  
ATOM   10486 C  CD2  . PHE A 1 5   ? 31.391  30.224 31.237  1.00 0.00  ? 5   PHE A CD2  5  
ATOM   10487 C  CE1  . PHE A 1 5   ? 33.726  31.768 31.240  1.00 0.00  ? 5   PHE A CE1  5  
ATOM   10488 C  CE2  . PHE A 1 5   ? 31.383  31.503 31.806  1.00 0.00  ? 5   PHE A CE2  5  
ATOM   10489 C  CZ   . PHE A 1 5   ? 32.551  32.276 31.807  1.00 0.00  ? 5   PHE A CZ   5  
ATOM   10490 H  H    . PHE A 1 5   ? 34.806  28.232 28.805  1.00 0.00  ? 5   PHE A H    5  
ATOM   10491 H  HA   . PHE A 1 5   ? 34.040  27.914 31.567  1.00 0.00  ? 5   PHE A HA   5  
ATOM   10492 H  HB2  . PHE A 1 5   ? 32.632  28.421 28.984  1.00 0.00  ? 5   PHE A HB2  5  
ATOM   10493 H  HB3  . PHE A 1 5   ? 31.665  27.819 30.332  1.00 0.00  ? 5   PHE A HB3  5  
ATOM   10494 H  HD1  . PHE A 1 5   ? 34.641  30.098 30.235  1.00 0.00  ? 5   PHE A HD1  5  
ATOM   10495 H  HD2  . PHE A 1 5   ? 30.491  29.627 31.235  1.00 0.00  ? 5   PHE A HD2  5  
ATOM   10496 H  HE1  . PHE A 1 5   ? 34.627  32.365 31.239  1.00 0.00  ? 5   PHE A HE1  5  
ATOM   10497 H  HE2  . PHE A 1 5   ? 30.476  31.892 32.246  1.00 0.00  ? 5   PHE A HE2  5  
ATOM   10498 H  HZ   . PHE A 1 5   ? 32.546  33.263 32.245  1.00 0.00  ? 5   PHE A HZ   5  
ATOM   10499 N  N    . PRO A 1 6   ? 32.838  25.660 31.716  1.00 0.00  ? 6   PRO A N    5  
ATOM   10500 C  CA   . PRO A 1 6   ? 32.463  24.252 31.927  1.00 0.00  ? 6   PRO A CA   5  
ATOM   10501 C  C    . PRO A 1 6   ? 31.191  23.923 31.144  1.00 0.00  ? 6   PRO A C    5  
ATOM   10502 O  O    . PRO A 1 6   ? 30.412  24.797 30.816  1.00 0.00  ? 6   PRO A O    5  
ATOM   10503 C  CB   . PRO A 1 6   ? 32.209  24.172 33.434  1.00 0.00  ? 6   PRO A CB   5  
ATOM   10504 C  CG   . PRO A 1 6   ? 31.885  25.612 33.897  1.00 0.00  ? 6   PRO A CG   5  
ATOM   10505 C  CD   . PRO A 1 6   ? 32.453  26.559 32.822  1.00 0.00  ? 6   PRO A CD   5  
ATOM   10506 H  HA   . PRO A 1 6   ? 33.270  23.593 31.649  1.00 0.00  ? 6   PRO A HA   5  
ATOM   10507 H  HB2  . PRO A 1 6   ? 31.373  23.515 33.634  1.00 0.00  ? 6   PRO A HB2  5  
ATOM   10508 H  HB3  . PRO A 1 6   ? 33.091  23.816 33.942  1.00 0.00  ? 6   PRO A HB3  5  
ATOM   10509 H  HG2  . PRO A 1 6   ? 30.814  25.741 33.980  1.00 0.00  ? 6   PRO A HG2  5  
ATOM   10510 H  HG3  . PRO A 1 6   ? 32.358  25.813 34.846  1.00 0.00  ? 6   PRO A HG3  5  
ATOM   10511 H  HD2  . PRO A 1 6   ? 31.694  27.258 32.498  1.00 0.00  ? 6   PRO A HD2  5  
ATOM   10512 H  HD3  . PRO A 1 6   ? 33.319  27.083 33.195  1.00 0.00  ? 6   PRO A HD3  5  
ATOM   10513 N  N    . ARG A 1 7   ? 30.968  22.674 30.844  1.00 0.00  ? 7   ARG A N    5  
ATOM   10514 C  CA   . ARG A 1 7   ? 29.740  22.308 30.084  1.00 0.00  ? 7   ARG A CA   5  
ATOM   10515 C  C    . ARG A 1 7   ? 28.595  22.038 31.063  1.00 0.00  ? 7   ARG A C    5  
ATOM   10516 O  O    . ARG A 1 7   ? 27.485  21.747 30.665  1.00 0.00  ? 7   ARG A O    5  
ATOM   10517 C  CB   . ARG A 1 7   ? 30.003  21.047 29.257  1.00 0.00  ? 7   ARG A CB   5  
ATOM   10518 C  CG   . ARG A 1 7   ? 30.952  21.375 28.101  1.00 0.00  ? 7   ARG A CG   5  
ATOM   10519 C  CD   . ARG A 1 7   ? 30.321  22.443 27.206  1.00 0.00  ? 7   ARG A CD   5  
ATOM   10520 N  NE   . ARG A 1 7   ? 30.681  22.170 25.784  1.00 0.00  ? 7   ARG A NE   5  
ATOM   10521 C  CZ   . ARG A 1 7   ? 30.743  23.146 24.913  1.00 0.00  ? 7   ARG A CZ   5  
ATOM   10522 N  NH1  . ARG A 1 7   ? 30.479  24.377 25.270  1.00 0.00  ? 7   ARG A NH1  5  
ATOM   10523 N  NH2  . ARG A 1 7   ? 31.065  22.888 23.674  1.00 0.00  ? 7   ARG A NH2  5  
ATOM   10524 H  H    . ARG A 1 7   ? 31.605  21.981 31.117  1.00 0.00  ? 7   ARG A H    5  
ATOM   10525 H  HA   . ARG A 1 7   ? 29.469  23.120 29.427  1.00 0.00  ? 7   ARG A HA   5  
ATOM   10526 H  HB2  . ARG A 1 7   ? 30.451  20.292 29.888  1.00 0.00  ? 7   ARG A HB2  5  
ATOM   10527 H  HB3  . ARG A 1 7   ? 29.069  20.676 28.859  1.00 0.00  ? 7   ARG A HB3  5  
ATOM   10528 H  HG2  . ARG A 1 7   ? 31.887  21.744 28.497  1.00 0.00  ? 7   ARG A HG2  5  
ATOM   10529 H  HG3  . ARG A 1 7   ? 31.134  20.483 27.520  1.00 0.00  ? 7   ARG A HG3  5  
ATOM   10530 H  HD2  . ARG A 1 7   ? 29.246  22.419 27.318  1.00 0.00  ? 7   ARG A HD2  5  
ATOM   10531 H  HD3  . ARG A 1 7   ? 30.694  23.412 27.496  1.00 0.00  ? 7   ARG A HD3  5  
ATOM   10532 H  HE   . ARG A 1 7   ? 30.875  21.252 25.499  1.00 0.00  ? 7   ARG A HE   5  
ATOM   10533 H  HH11 . ARG A 1 7   ? 30.226  24.584 26.211  1.00 0.00  ? 7   ARG A HH11 5  
ATOM   10534 H  HH12 . ARG A 1 7   ? 30.529  25.112 24.597  1.00 0.00  ? 7   ARG A HH12 5  
ATOM   10535 H  HH21 . ARG A 1 7   ? 31.262  21.948 23.394  1.00 0.00  ? 7   ARG A HH21 5  
ATOM   10536 H  HH22 . ARG A 1 7   ? 31.117  23.630 23.007  1.00 0.00  ? 7   ARG A HH22 5  
ATOM   10537 N  N    . LYS A 1 8   ? 28.852  22.127 32.341  1.00 0.00  ? 8   LYS A N    5  
ATOM   10538 C  CA   . LYS A 1 8   ? 27.768  21.865 33.331  1.00 0.00  ? 8   LYS A CA   5  
ATOM   10539 C  C    . LYS A 1 8   ? 27.299  20.419 33.183  1.00 0.00  ? 8   LYS A C    5  
ATOM   10540 O  O    . LYS A 1 8   ? 27.239  19.903 32.085  1.00 0.00  ? 8   LYS A O    5  
ATOM   10541 C  CB   . LYS A 1 8   ? 26.584  22.800 33.062  1.00 0.00  ? 8   LYS A CB   5  
ATOM   10542 C  CG   . LYS A 1 8   ? 27.051  24.256 33.146  1.00 0.00  ? 8   LYS A CG   5  
ATOM   10543 C  CD   . LYS A 1 8   ? 27.311  24.792 31.736  1.00 0.00  ? 8   LYS A CD   5  
ATOM   10544 C  CE   . LYS A 1 8   ? 26.544  26.099 31.537  1.00 0.00  ? 8   LYS A CE   5  
ATOM   10545 N  NZ   . LYS A 1 8   ? 25.085  25.853 31.730  1.00 0.00  ? 8   LYS A NZ   5  
ATOM   10546 H  H    . LYS A 1 8   ? 29.754  22.360 32.649  1.00 0.00  ? 8   LYS A H    5  
ATOM   10547 H  HA   . LYS A 1 8   ? 28.142  22.030 34.331  1.00 0.00  ? 8   LYS A HA   5  
ATOM   10548 H  HB2  . LYS A 1 8   ? 26.186  22.602 32.075  1.00 0.00  ? 8   LYS A HB2  5  
ATOM   10549 H  HB3  . LYS A 1 8   ? 25.811  22.626 33.798  1.00 0.00  ? 8   LYS A HB3  5  
ATOM   10550 H  HG2  . LYS A 1 8   ? 26.286  24.853 33.623  1.00 0.00  ? 8   LYS A HG2  5  
ATOM   10551 H  HG3  . LYS A 1 8   ? 27.961  24.311 33.723  1.00 0.00  ? 8   LYS A HG3  5  
ATOM   10552 H  HD2  . LYS A 1 8   ? 28.368  24.972 31.609  1.00 0.00  ? 8   LYS A HD2  5  
ATOM   10553 H  HD3  . LYS A 1 8   ? 26.980  24.068 31.009  1.00 0.00  ? 8   LYS A HD3  5  
ATOM   10554 H  HE2  . LYS A 1 8   ? 26.887  26.829 32.255  1.00 0.00  ? 8   LYS A HE2  5  
ATOM   10555 H  HE3  . LYS A 1 8   ? 26.718  26.468 30.537  1.00 0.00  ? 8   LYS A HE3  5  
ATOM   10556 H  HZ1  . LYS A 1 8   ? 24.815  24.969 31.252  1.00 0.00  ? 8   LYS A HZ1  5  
ATOM   10557 H  HZ2  . LYS A 1 8   ? 24.543  26.647 31.325  1.00 0.00  ? 8   LYS A HZ2  5  
ATOM   10558 H  HZ3  . LYS A 1 8   ? 24.877  25.772 32.747  1.00 0.00  ? 8   LYS A HZ3  5  
ATOM   10559 N  N    . PRO A 1 9   ? 26.962  19.811 34.288  1.00 0.00  ? 9   PRO A N    5  
ATOM   10560 C  CA   . PRO A 1 9   ? 26.474  18.425 34.298  1.00 0.00  ? 9   PRO A CA   5  
ATOM   10561 C  C    . PRO A 1 9   ? 25.025  18.409 33.819  1.00 0.00  ? 9   PRO A C    5  
ATOM   10562 O  O    . PRO A 1 9   ? 24.099  18.413 34.605  1.00 0.00  ? 9   PRO A O    5  
ATOM   10563 C  CB   . PRO A 1 9   ? 26.584  18.012 35.770  1.00 0.00  ? 9   PRO A CB   5  
ATOM   10564 C  CG   . PRO A 1 9   ? 26.594  19.325 36.588  1.00 0.00  ? 9   PRO A CG   5  
ATOM   10565 C  CD   . PRO A 1 9   ? 27.025  20.444 35.619  1.00 0.00  ? 9   PRO A CD   5  
ATOM   10566 H  HA   . PRO A 1 9   ? 27.095  17.794 33.684  1.00 0.00  ? 9   PRO A HA   5  
ATOM   10567 H  HB2  . PRO A 1 9   ? 25.734  17.405 36.047  1.00 0.00  ? 9   PRO A HB2  5  
ATOM   10568 H  HB3  . PRO A 1 9   ? 27.500  17.470 35.939  1.00 0.00  ? 9   PRO A HB3  5  
ATOM   10569 H  HG2  . PRO A 1 9   ? 25.605  19.524 36.977  1.00 0.00  ? 9   PRO A HG2  5  
ATOM   10570 H  HG3  . PRO A 1 9   ? 27.303  19.251 37.398  1.00 0.00  ? 9   PRO A HG3  5  
ATOM   10571 H  HD2  . PRO A 1 9   ? 26.340  21.278 35.679  1.00 0.00  ? 9   PRO A HD2  5  
ATOM   10572 H  HD3  . PRO A 1 9   ? 28.033  20.765 35.832  1.00 0.00  ? 9   PRO A HD3  5  
ATOM   10573 N  N    . LYS A 1 10  ? 24.822  18.416 32.531  1.00 0.00  ? 10  LYS A N    5  
ATOM   10574 C  CA   . LYS A 1 10  ? 23.434  18.431 32.004  1.00 0.00  ? 10  LYS A CA   5  
ATOM   10575 C  C    . LYS A 1 10  ? 22.638  17.268 32.598  1.00 0.00  ? 10  LYS A C    5  
ATOM   10576 O  O    . LYS A 1 10  ? 23.194  16.329 33.133  1.00 0.00  ? 10  LYS A O    5  
ATOM   10577 C  CB   . LYS A 1 10  ? 23.462  18.279 30.482  1.00 0.00  ? 10  LYS A CB   5  
ATOM   10578 C  CG   . LYS A 1 10  ? 24.381  19.333 29.866  1.00 0.00  ? 10  LYS A CG   5  
ATOM   10579 C  CD   . LYS A 1 10  ? 24.151  19.372 28.353  1.00 0.00  ? 10  LYS A CD   5  
ATOM   10580 C  CE   . LYS A 1 10  ? 24.500  20.761 27.818  1.00 0.00  ? 10  LYS A CE   5  
ATOM   10581 N  NZ   . LYS A 1 10  ? 25.606  20.652 26.823  1.00 0.00  ? 10  LYS A NZ   5  
ATOM   10582 H  H    . LYS A 1 10  ? 25.584  18.432 31.912  1.00 0.00  ? 10  LYS A H    5  
ATOM   10583 H  HA   . LYS A 1 10  ? 22.967  19.372 32.263  1.00 0.00  ? 10  LYS A HA   5  
ATOM   10584 H  HB2  . LYS A 1 10  ? 23.826  17.293 30.227  1.00 0.00  ? 10  LYS A HB2  5  
ATOM   10585 H  HB3  . LYS A 1 10  ? 22.464  18.406 30.091  1.00 0.00  ? 10  LYS A HB3  5  
ATOM   10586 H  HG2  . LYS A 1 10  ? 24.155  20.300 30.294  1.00 0.00  ? 10  LYS A HG2  5  
ATOM   10587 H  HG3  . LYS A 1 10  ? 25.411  19.081 30.069  1.00 0.00  ? 10  LYS A HG3  5  
ATOM   10588 H  HD2  . LYS A 1 10  ? 24.772  18.631 27.875  1.00 0.00  ? 10  LYS A HD2  5  
ATOM   10589 H  HD3  . LYS A 1 10  ? 23.114  19.158 28.143  1.00 0.00  ? 10  LYS A HD3  5  
ATOM   10590 H  HE2  . LYS A 1 10  ? 23.630  21.192 27.343  1.00 0.00  ? 10  LYS A HE2  5  
ATOM   10591 H  HE3  . LYS A 1 10  ? 24.815  21.394 28.637  1.00 0.00  ? 10  LYS A HE3  5  
ATOM   10592 H  HZ1  . LYS A 1 10  ? 25.373  19.922 26.121  1.00 0.00  ? 10  LYS A HZ1  5  
ATOM   10593 H  HZ2  . LYS A 1 10  ? 26.489  20.395 27.311  1.00 0.00  ? 10  LYS A HZ2  5  
ATOM   10594 H  HZ3  . LYS A 1 10  ? 25.729  21.566 26.340  1.00 0.00  ? 10  LYS A HZ3  5  
ATOM   10595 N  N    . TRP A 1 11  ? 21.336  17.314 32.488  1.00 0.00  ? 11  TRP A N    5  
ATOM   10596 C  CA   . TRP A 1 11  ? 20.503  16.201 33.026  1.00 0.00  ? 11  TRP A CA   5  
ATOM   10597 C  C    . TRP A 1 11  ? 20.689  14.974 32.131  1.00 0.00  ? 11  TRP A C    5  
ATOM   10598 O  O    . TRP A 1 11  ? 20.604  15.062 30.923  1.00 0.00  ? 11  TRP A O    5  
ATOM   10599 C  CB   . TRP A 1 11  ? 19.029  16.612 33.034  1.00 0.00  ? 11  TRP A CB   5  
ATOM   10600 C  CG   . TRP A 1 11  ? 18.884  17.973 33.642  1.00 0.00  ? 11  TRP A CG   5  
ATOM   10601 C  CD1  . TRP A 1 11  ? 17.929  18.873 33.305  1.00 0.00  ? 11  TRP A CD1  5  
ATOM   10602 C  CD2  . TRP A 1 11  ? 19.689  18.605 34.686  1.00 0.00  ? 11  TRP A CD2  5  
ATOM   10603 N  NE1  . TRP A 1 11  ? 18.099  20.013 34.069  1.00 0.00  ? 11  TRP A NE1  5  
ATOM   10604 C  CE2  . TRP A 1 11  ? 19.168  19.899 34.933  1.00 0.00  ? 11  TRP A CE2  5  
ATOM   10605 C  CE3  . TRP A 1 11  ? 20.810  18.192 35.434  1.00 0.00  ? 11  TRP A CE3  5  
ATOM   10606 C  CZ2  . TRP A 1 11  ? 19.735  20.749 35.884  1.00 0.00  ? 11  TRP A CZ2  5  
ATOM   10607 C  CZ3  . TRP A 1 11  ? 21.380  19.047 36.393  1.00 0.00  ? 11  TRP A CZ3  5  
ATOM   10608 C  CH2  . TRP A 1 11  ? 20.844  20.322 36.617  1.00 0.00  ? 11  TRP A CH2  5  
ATOM   10609 H  H    . TRP A 1 11  ? 20.909  18.073 32.041  1.00 0.00  ? 11  TRP A H    5  
ATOM   10610 H  HA   . TRP A 1 11  ? 20.817  15.960 34.030  1.00 0.00  ? 11  TRP A HA   5  
ATOM   10611 H  HB2  . TRP A 1 11  ? 18.655  16.630 32.020  1.00 0.00  ? 11  TRP A HB2  5  
ATOM   10612 H  HB3  . TRP A 1 11  ? 18.460  15.898 33.612  1.00 0.00  ? 11  TRP A HB3  5  
ATOM   10613 H  HD1  . TRP A 1 11  ? 17.159  18.726 32.559  1.00 0.00  ? 11  TRP A HD1  5  
ATOM   10614 H  HE1  . TRP A 1 11  ? 17.541  20.816 34.018  1.00 0.00  ? 11  TRP A HE1  5  
ATOM   10615 H  HE3  . TRP A 1 11  ? 21.233  17.215 35.272  1.00 0.00  ? 11  TRP A HE3  5  
ATOM   10616 H  HZ2  . TRP A 1 11  ? 19.317  21.730 36.054  1.00 0.00  ? 11  TRP A HZ2  5  
ATOM   10617 H  HZ3  . TRP A 1 11  ? 22.237  18.721 36.961  1.00 0.00  ? 11  TRP A HZ3  5  
ATOM   10618 H  HH2  . TRP A 1 11  ? 21.288  20.972 37.357  1.00 0.00  ? 11  TRP A HH2  5  
ATOM   10619 N  N    . ASP A 1 12  ? 20.953  13.836 32.712  1.00 0.00  ? 12  ASP A N    5  
ATOM   10620 C  CA   . ASP A 1 12  ? 21.156  12.606 31.892  1.00 0.00  ? 12  ASP A CA   5  
ATOM   10621 C  C    . ASP A 1 12  ? 21.739  11.500 32.772  1.00 0.00  ? 12  ASP A C    5  
ATOM   10622 O  O    . ASP A 1 12  ? 22.923  11.467 33.038  1.00 0.00  ? 12  ASP A O    5  
ATOM   10623 C  CB   . ASP A 1 12  ? 22.124  12.900 30.741  1.00 0.00  ? 12  ASP A CB   5  
ATOM   10624 C  CG   . ASP A 1 12  ? 23.348  13.658 31.263  1.00 0.00  ? 12  ASP A CG   5  
ATOM   10625 O  OD1  . ASP A 1 12  ? 23.331  14.060 32.414  1.00 0.00  ? 12  ASP A OD1  5  
ATOM   10626 O  OD2  . ASP A 1 12  ? 24.285  13.824 30.500  1.00 0.00  ? 12  ASP A OD2  5  
ATOM   10627 H  H    . ASP A 1 12  ? 21.025  13.792 33.688  1.00 0.00  ? 12  ASP A H    5  
ATOM   10628 H  HA   . ASP A 1 12  ? 20.207  12.282 31.490  1.00 0.00  ? 12  ASP A HA   5  
ATOM   10629 H  HB2  . ASP A 1 12  ? 22.444  11.968 30.297  1.00 0.00  ? 12  ASP A HB2  5  
ATOM   10630 H  HB3  . ASP A 1 12  ? 21.624  13.499 29.994  1.00 0.00  ? 12  ASP A HB3  5  
ATOM   10631 N  N    . LYS A 1 13  ? 20.917  10.600 33.231  1.00 0.00  ? 13  LYS A N    5  
ATOM   10632 C  CA   . LYS A 1 13  ? 21.421  9.504  34.096  1.00 0.00  ? 13  LYS A CA   5  
ATOM   10633 C  C    . LYS A 1 13  ? 20.402  8.364  34.121  1.00 0.00  ? 13  LYS A C    5  
ATOM   10634 O  O    . LYS A 1 13  ? 20.259  7.669  35.108  1.00 0.00  ? 13  LYS A O    5  
ATOM   10635 C  CB   . LYS A 1 13  ? 21.610  10.041 35.511  1.00 0.00  ? 13  LYS A CB   5  
ATOM   10636 C  CG   . LYS A 1 13  ? 20.258  10.473 36.078  1.00 0.00  ? 13  LYS A CG   5  
ATOM   10637 C  CD   . LYS A 1 13  ? 20.044  11.965 35.817  1.00 0.00  ? 13  LYS A CD   5  
ATOM   10638 C  CE   . LYS A 1 13  ? 19.379  12.605 37.037  1.00 0.00  ? 13  LYS A CE   5  
ATOM   10639 N  NZ   . LYS A 1 13  ? 19.345  14.083 36.863  1.00 0.00  ? 13  LYS A NZ   5  
ATOM   10640 H  H    . LYS A 1 13  ? 19.966  10.649 33.013  1.00 0.00  ? 13  LYS A H    5  
ATOM   10641 H  HA   . LYS A 1 13  ? 22.365  9.143  33.715  1.00 0.00  ? 13  LYS A HA   5  
ATOM   10642 H  HB2  . LYS A 1 13  ? 22.031  9.268  36.133  1.00 0.00  ? 13  LYS A HB2  5  
ATOM   10643 H  HB3  . LYS A 1 13  ? 22.275  10.890 35.487  1.00 0.00  ? 13  LYS A HB3  5  
ATOM   10644 H  HG2  . LYS A 1 13  ? 19.470  9.906  35.602  1.00 0.00  ? 13  LYS A HG2  5  
ATOM   10645 H  HG3  . LYS A 1 13  ? 20.241  10.290 37.141  1.00 0.00  ? 13  LYS A HG3  5  
ATOM   10646 H  HD2  . LYS A 1 13  ? 20.998  12.439 35.633  1.00 0.00  ? 13  LYS A HD2  5  
ATOM   10647 H  HD3  . LYS A 1 13  ? 19.406  12.091 34.955  1.00 0.00  ? 13  LYS A HD3  5  
ATOM   10648 H  HE2  . LYS A 1 13  ? 18.370  12.230 37.135  1.00 0.00  ? 13  LYS A HE2  5  
ATOM   10649 H  HE3  . LYS A 1 13  ? 19.945  12.360 37.925  1.00 0.00  ? 13  LYS A HE3  5  
ATOM   10650 H  HZ1  . LYS A 1 13  ? 18.699  14.325 36.089  1.00 0.00  ? 13  LYS A HZ1  5  
ATOM   10651 H  HZ2  . LYS A 1 13  ? 20.302  14.427 36.638  1.00 0.00  ? 13  LYS A HZ2  5  
ATOM   10652 H  HZ3  . LYS A 1 13  ? 19.012  14.528 37.740  1.00 0.00  ? 13  LYS A HZ3  5  
ATOM   10653 N  N    . ASN A 1 14  ? 19.690  8.166  33.049  1.00 0.00  ? 14  ASN A N    5  
ATOM   10654 C  CA   . ASN A 1 14  ? 18.680  7.073  33.023  1.00 0.00  ? 14  ASN A CA   5  
ATOM   10655 C  C    . ASN A 1 14  ? 17.494  7.472  33.901  1.00 0.00  ? 14  ASN A C    5  
ATOM   10656 O  O    . ASN A 1 14  ? 16.385  7.632  33.433  1.00 0.00  ? 14  ASN A O    5  
ATOM   10657 C  CB   . ASN A 1 14  ? 19.313  5.791  33.563  1.00 0.00  ? 14  ASN A CB   5  
ATOM   10658 C  CG   . ASN A 1 14  ? 18.621  4.582  32.939  1.00 0.00  ? 14  ASN A CG   5  
ATOM   10659 O  OD1  . ASN A 1 14  ? 19.263  3.746  32.336  1.00 0.00  ? 14  ASN A OD1  5  
ATOM   10660 N  ND2  . ASN A 1 14  ? 17.328  4.457  33.055  1.00 0.00  ? 14  ASN A ND2  5  
ATOM   10661 H  H    . ASN A 1 14  ? 19.817  8.738  32.266  1.00 0.00  ? 14  ASN A H    5  
ATOM   10662 H  HA   . ASN A 1 14  ? 18.343  6.914  32.008  1.00 0.00  ? 14  ASN A HA   5  
ATOM   10663 H  HB2  . ASN A 1 14  ? 20.363  5.775  33.314  1.00 0.00  ? 14  ASN A HB2  5  
ATOM   10664 H  HB3  . ASN A 1 14  ? 19.195  5.757  34.635  1.00 0.00  ? 14  ASN A HB3  5  
ATOM   10665 H  HD21 . ASN A 1 14  ? 16.813  5.136  33.540  1.00 0.00  ? 14  ASN A HD21 5  
ATOM   10666 H  HD22 . ASN A 1 14  ? 16.874  3.683  32.661  1.00 0.00  ? 14  ASN A HD22 5  
ATOM   10667 N  N    . GLN A 1 15  ? 17.729  7.643  35.175  1.00 0.00  ? 15  GLN A N    5  
ATOM   10668 C  CA   . GLN A 1 15  ? 16.630  8.040  36.099  1.00 0.00  ? 15  GLN A CA   5  
ATOM   10669 C  C    . GLN A 1 15  ? 16.373  9.541  35.963  1.00 0.00  ? 15  GLN A C    5  
ATOM   10670 O  O    . GLN A 1 15  ? 17.116  10.350 36.479  1.00 0.00  ? 15  GLN A O    5  
ATOM   10671 C  CB   . GLN A 1 15  ? 17.038  7.736  37.540  1.00 0.00  ? 15  GLN A CB   5  
ATOM   10672 C  CG   . GLN A 1 15  ? 16.791  6.259  37.844  1.00 0.00  ? 15  GLN A CG   5  
ATOM   10673 C  CD   . GLN A 1 15  ? 17.660  5.830  39.026  1.00 0.00  ? 15  GLN A CD   5  
ATOM   10674 O  OE1  . GLN A 1 15  ? 18.423  4.888  38.925  1.00 0.00  ? 15  GLN A OE1  5  
ATOM   10675 N  NE2  . GLN A 1 15  ? 17.580  6.487  40.150  1.00 0.00  ? 15  GLN A NE2  5  
ATOM   10676 H  H    . GLN A 1 15  ? 18.634  7.513  35.523  1.00 0.00  ? 15  GLN A H    5  
ATOM   10677 H  HA   . GLN A 1 15  ? 15.736  7.492  35.855  1.00 0.00  ? 15  GLN A HA   5  
ATOM   10678 H  HB2  . GLN A 1 15  ? 18.087  7.961  37.671  1.00 0.00  ? 15  GLN A HB2  5  
ATOM   10679 H  HB3  . GLN A 1 15  ? 16.454  8.343  38.216  1.00 0.00  ? 15  GLN A HB3  5  
ATOM   10680 H  HG2  . GLN A 1 15  ? 15.748  6.111  38.089  1.00 0.00  ? 15  GLN A HG2  5  
ATOM   10681 H  HG3  . GLN A 1 15  ? 17.046  5.666  36.978  1.00 0.00  ? 15  GLN A HG3  5  
ATOM   10682 H  HE21 . GLN A 1 15  ? 16.968  7.249  40.230  1.00 0.00  ? 15  GLN A HE21 5  
ATOM   10683 H  HE22 . GLN A 1 15  ? 18.127  6.215  40.917  1.00 0.00  ? 15  GLN A HE22 5  
ATOM   10684 N  N    . ILE A 1 16  ? 15.330  9.923  35.284  1.00 0.00  ? 16  ILE A N    5  
ATOM   10685 C  CA   . ILE A 1 16  ? 15.042  11.375 35.136  1.00 0.00  ? 16  ILE A CA   5  
ATOM   10686 C  C    . ILE A 1 16  ? 13.939  11.755 36.121  1.00 0.00  ? 16  ILE A C    5  
ATOM   10687 O  O    . ILE A 1 16  ? 13.237  10.907 36.636  1.00 0.00  ? 16  ILE A O    5  
ATOM   10688 C  CB   . ILE A 1 16  ? 14.590  11.685 33.703  1.00 0.00  ? 16  ILE A CB   5  
ATOM   10689 C  CG1  . ILE A 1 16  ? 15.120  10.613 32.746  1.00 0.00  ? 16  ILE A CG1  5  
ATOM   10690 C  CG2  . ILE A 1 16  ? 15.139  13.047 33.278  1.00 0.00  ? 16  ILE A CG2  5  
ATOM   10691 C  CD1  . ILE A 1 16  ? 16.644  10.544 32.851  1.00 0.00  ? 16  ILE A CD1  5  
ATOM   10692 H  H    . ILE A 1 16  ? 14.734  9.260  34.879  1.00 0.00  ? 16  ILE A H    5  
ATOM   10693 H  HA   . ILE A 1 16  ? 15.933  11.941 35.364  1.00 0.00  ? 16  ILE A HA   5  
ATOM   10694 H  HB   . ILE A 1 16  ? 13.511  11.705 33.662  1.00 0.00  ? 16  ILE A HB   5  
ATOM   10695 H  HG12 . ILE A 1 16  ? 14.696  9.654  33.009  1.00 0.00  ? 16  ILE A HG12 5  
ATOM   10696 H  HG13 . ILE A 1 16  ? 14.842  10.866 31.735  1.00 0.00  ? 16  ILE A HG13 5  
ATOM   10697 H  HG21 . ILE A 1 16  ? 14.943  13.201 32.227  1.00 0.00  ? 16  ILE A HG21 5  
ATOM   10698 H  HG22 . ILE A 1 16  ? 16.204  13.076 33.453  1.00 0.00  ? 16  ILE A HG22 5  
ATOM   10699 H  HG23 . ILE A 1 16  ? 14.658  13.824 33.852  1.00 0.00  ? 16  ILE A HG23 5  
ATOM   10700 H  HD11 . ILE A 1 16  ? 16.980  9.556  32.572  1.00 0.00  ? 16  ILE A HD11 5  
ATOM   10701 H  HD12 . ILE A 1 16  ? 16.944  10.752 33.867  1.00 0.00  ? 16  ILE A HD12 5  
ATOM   10702 H  HD13 . ILE A 1 16  ? 17.085  11.274 32.189  1.00 0.00  ? 16  ILE A HD13 5  
ATOM   10703 N  N    . THR A 1 17  ? 13.783  13.017 36.401  1.00 0.00  ? 17  THR A N    5  
ATOM   10704 C  CA   . THR A 1 17  ? 12.731  13.429 37.366  1.00 0.00  ? 17  THR A CA   5  
ATOM   10705 C  C    . THR A 1 17  ? 11.859  14.525 36.754  1.00 0.00  ? 17  THR A C    5  
ATOM   10706 O  O    . THR A 1 17  ? 12.350  15.474 36.176  1.00 0.00  ? 17  THR A O    5  
ATOM   10707 C  CB   . THR A 1 17  ? 13.396  13.950 38.640  1.00 0.00  ? 17  THR A CB   5  
ATOM   10708 O  OG1  . THR A 1 17  ? 14.719  14.374 38.339  1.00 0.00  ? 17  THR A OG1  5  
ATOM   10709 C  CG2  . THR A 1 17  ? 13.436  12.830 39.678  1.00 0.00  ? 17  THR A CG2  5  
ATOM   10710 H  H    . THR A 1 17  ? 14.362  13.690 35.986  1.00 0.00  ? 17  THR A H    5  
ATOM   10711 H  HA   . THR A 1 17  ? 12.117  12.576 37.607  1.00 0.00  ? 17  THR A HA   5  
ATOM   10712 H  HB   . THR A 1 17  ? 12.829  14.780 39.031  1.00 0.00  ? 17  THR A HB   5  
ATOM   10713 H  HG1  . THR A 1 17  ? 14.943  15.092 38.933  1.00 0.00  ? 17  THR A HG1  5  
ATOM   10714 H  HG21 . THR A 1 17  ? 14.421  12.389 39.695  1.00 0.00  ? 17  THR A HG21 5  
ATOM   10715 H  HG22 . THR A 1 17  ? 12.707  12.075 39.419  1.00 0.00  ? 17  THR A HG22 5  
ATOM   10716 H  HG23 . THR A 1 17  ? 13.205  13.232 40.652  1.00 0.00  ? 17  THR A HG23 5  
ATOM   10717 N  N    . TYR A 1 18  ? 10.565  14.400 36.878  1.00 0.00  ? 18  TYR A N    5  
ATOM   10718 C  CA   . TYR A 1 18  ? 9.655   15.431 36.304  1.00 0.00  ? 18  TYR A CA   5  
ATOM   10719 C  C    . TYR A 1 18  ? 8.423   15.582 37.201  1.00 0.00  ? 18  TYR A C    5  
ATOM   10720 O  O    . TYR A 1 18  ? 8.081   14.693 37.953  1.00 0.00  ? 18  TYR A O    5  
ATOM   10721 C  CB   . TYR A 1 18  ? 9.214   14.997 34.900  1.00 0.00  ? 18  TYR A CB   5  
ATOM   10722 C  CG   . TYR A 1 18  ? 8.524   13.655 34.973  1.00 0.00  ? 18  TYR A CG   5  
ATOM   10723 C  CD1  . TYR A 1 18  ? 9.258   12.504 35.278  1.00 0.00  ? 18  TYR A CD1  5  
ATOM   10724 C  CD2  . TYR A 1 18  ? 7.146   13.565 34.739  1.00 0.00  ? 18  TYR A CD2  5  
ATOM   10725 C  CE1  . TYR A 1 18  ? 8.616   11.262 35.349  1.00 0.00  ? 18  TYR A CE1  5  
ATOM   10726 C  CE2  . TYR A 1 18  ? 6.504   12.324 34.808  1.00 0.00  ? 18  TYR A CE2  5  
ATOM   10727 C  CZ   . TYR A 1 18  ? 7.239   11.172 35.114  1.00 0.00  ? 18  TYR A CZ   5  
ATOM   10728 O  OH   . TYR A 1 18  ? 6.604   9.948  35.188  1.00 0.00  ? 18  TYR A OH   5  
ATOM   10729 H  H    . TYR A 1 18  ? 10.190  13.625 37.350  1.00 0.00  ? 18  TYR A H    5  
ATOM   10730 H  HA   . TYR A 1 18  ? 10.173  16.376 36.244  1.00 0.00  ? 18  TYR A HA   5  
ATOM   10731 H  HB2  . TYR A 1 18  ? 8.531   15.731 34.497  1.00 0.00  ? 18  TYR A HB2  5  
ATOM   10732 H  HB3  . TYR A 1 18  ? 10.079  14.922 34.258  1.00 0.00  ? 18  TYR A HB3  5  
ATOM   10733 H  HD1  . TYR A 1 18  ? 10.320  12.573 35.455  1.00 0.00  ? 18  TYR A HD1  5  
ATOM   10734 H  HD2  . TYR A 1 18  ? 6.580   14.452 34.502  1.00 0.00  ? 18  TYR A HD2  5  
ATOM   10735 H  HE1  . TYR A 1 18  ? 9.182   10.375 35.586  1.00 0.00  ? 18  TYR A HE1  5  
ATOM   10736 H  HE2  . TYR A 1 18  ? 5.441   12.254 34.629  1.00 0.00  ? 18  TYR A HE2  5  
ATOM   10737 H  HH   . TYR A 1 18  ? 6.905   9.412  34.452  1.00 0.00  ? 18  TYR A HH   5  
ATOM   10738 N  N    . ARG A 1 19  ? 7.754   16.700 37.128  1.00 0.00  ? 19  ARG A N    5  
ATOM   10739 C  CA   . ARG A 1 19  ? 6.543   16.901 37.977  1.00 0.00  ? 19  ARG A CA   5  
ATOM   10740 C  C    . ARG A 1 19  ? 5.539   17.804 37.250  1.00 0.00  ? 19  ARG A C    5  
ATOM   10741 O  O    . ARG A 1 19  ? 5.902   18.802 36.658  1.00 0.00  ? 19  ARG A O    5  
ATOM   10742 C  CB   . ARG A 1 19  ? 6.951   17.555 39.298  1.00 0.00  ? 19  ARG A CB   5  
ATOM   10743 C  CG   . ARG A 1 19  ? 5.974   17.130 40.393  1.00 0.00  ? 19  ARG A CG   5  
ATOM   10744 C  CD   . ARG A 1 19  ? 5.248   18.361 40.937  1.00 0.00  ? 19  ARG A CD   5  
ATOM   10745 N  NE   . ARG A 1 19  ? 6.242   19.427 41.253  1.00 0.00  ? 19  ARG A NE   5  
ATOM   10746 C  CZ   . ARG A 1 19  ? 5.847   20.551 41.791  1.00 0.00  ? 19  ARG A CZ   5  
ATOM   10747 N  NH1  . ARG A 1 19  ? 4.580   20.747 42.046  1.00 0.00  ? 19  ARG A NH1  5  
ATOM   10748 N  NH2  . ARG A 1 19  ? 6.718   21.482 42.067  1.00 0.00  ? 19  ARG A NH2  5  
ATOM   10749 H  H    . ARG A 1 19  ? 8.048   17.407 36.518  1.00 0.00  ? 19  ARG A H    5  
ATOM   10750 H  HA   . ARG A 1 19  ? 6.085   15.944 38.179  1.00 0.00  ? 19  ARG A HA   5  
ATOM   10751 H  HB2  . ARG A 1 19  ? 7.950   17.241 39.564  1.00 0.00  ? 19  ARG A HB2  5  
ATOM   10752 H  HB3  . ARG A 1 19  ? 6.925   18.629 39.192  1.00 0.00  ? 19  ARG A HB3  5  
ATOM   10753 H  HG2  . ARG A 1 19  ? 5.254   16.441 39.980  1.00 0.00  ? 19  ARG A HG2  5  
ATOM   10754 H  HG3  . ARG A 1 19  ? 6.513   16.648 41.195  1.00 0.00  ? 19  ARG A HG3  5  
ATOM   10755 H  HD2  . ARG A 1 19  ? 4.552   18.725 40.196  1.00 0.00  ? 19  ARG A HD2  5  
ATOM   10756 H  HD3  . ARG A 1 19  ? 4.710   18.093 41.834  1.00 0.00  ? 19  ARG A HD3  5  
ATOM   10757 H  HE   . ARG A 1 19  ? 7.193   19.284 41.058  1.00 0.00  ? 19  ARG A HE   5  
ATOM   10758 H  HH11 . ARG A 1 19  ? 3.910   20.039 41.829  1.00 0.00  ? 19  ARG A HH11 5  
ATOM   10759 H  HH12 . ARG A 1 19  ? 4.281   21.607 42.461  1.00 0.00  ? 19  ARG A HH12 5  
ATOM   10760 H  HH21 . ARG A 1 19  ? 7.686   21.336 41.867  1.00 0.00  ? 19  ARG A HH21 5  
ATOM   10761 H  HH22 . ARG A 1 19  ? 6.416   22.341 42.480  1.00 0.00  ? 19  ARG A HH22 5  
ATOM   10762 N  N    . ILE A 1 20  ? 4.278   17.461 37.292  1.00 0.00  ? 20  ILE A N    5  
ATOM   10763 C  CA   . ILE A 1 20  ? 3.254   18.299 36.611  1.00 0.00  ? 20  ILE A CA   5  
ATOM   10764 C  C    . ILE A 1 20  ? 2.799   19.410 37.563  1.00 0.00  ? 20  ILE A C    5  
ATOM   10765 O  O    . ILE A 1 20  ? 2.727   19.219 38.762  1.00 0.00  ? 20  ILE A O    5  
ATOM   10766 C  CB   . ILE A 1 20  ? 2.069   17.415 36.229  1.00 0.00  ? 20  ILE A CB   5  
ATOM   10767 C  CG1  . ILE A 1 20  ? 2.554   16.336 35.259  1.00 0.00  ? 20  ILE A CG1  5  
ATOM   10768 C  CG2  . ILE A 1 20  ? 0.983   18.262 35.563  1.00 0.00  ? 20  ILE A CG2  5  
ATOM   10769 C  CD1  . ILE A 1 20  ? 1.942   14.991 35.649  1.00 0.00  ? 20  ILE A CD1  5  
ATOM   10770 H  H    . ILE A 1 20  ? 4.003   16.650 37.773  1.00 0.00  ? 20  ILE A H    5  
ATOM   10771 H  HA   . ILE A 1 20  ? 3.681   18.738 35.720  1.00 0.00  ? 20  ILE A HA   5  
ATOM   10772 H  HB   . ILE A 1 20  ? 1.667   16.948 37.117  1.00 0.00  ? 20  ILE A HB   5  
ATOM   10773 H  HG12 . ILE A 1 20  ? 2.259   16.594 34.252  1.00 0.00  ? 20  ILE A HG12 5  
ATOM   10774 H  HG13 . ILE A 1 20  ? 3.630   16.267 35.312  1.00 0.00  ? 20  ILE A HG13 5  
ATOM   10775 H  HG21 . ILE A 1 20  ? 0.550   17.714 34.739  1.00 0.00  ? 20  ILE A HG21 5  
ATOM   10776 H  HG22 . ILE A 1 20  ? 1.417   19.181 35.197  1.00 0.00  ? 20  ILE A HG22 5  
ATOM   10777 H  HG23 . ILE A 1 20  ? 0.213   18.491 36.286  1.00 0.00  ? 20  ILE A HG23 5  
ATOM   10778 H  HD11 . ILE A 1 20  ? 2.448   14.603 36.519  1.00 0.00  ? 20  ILE A HD11 5  
ATOM   10779 H  HD12 . ILE A 1 20  ? 2.052   14.295 34.831  1.00 0.00  ? 20  ILE A HD12 5  
ATOM   10780 H  HD13 . ILE A 1 20  ? 0.893   15.125 35.872  1.00 0.00  ? 20  ILE A HD13 5  
ATOM   10781 N  N    . ILE A 1 21  ? 2.505   20.573 37.047  1.00 0.00  ? 21  ILE A N    5  
ATOM   10782 C  CA   . ILE A 1 21  ? 2.074   21.693 37.934  1.00 0.00  ? 21  ILE A CA   5  
ATOM   10783 C  C    . ILE A 1 21  ? 0.579   21.955 37.759  1.00 0.00  ? 21  ILE A C    5  
ATOM   10784 O  O    . ILE A 1 21  ? -0.126  22.239 38.708  1.00 0.00  ? 21  ILE A O    5  
ATOM   10785 C  CB   . ILE A 1 21  ? 2.851   22.957 37.560  1.00 0.00  ? 21  ILE A CB   5  
ATOM   10786 C  CG1  . ILE A 1 21  ? 4.313   22.587 37.318  1.00 0.00  ? 21  ILE A CG1  5  
ATOM   10787 C  CG2  . ILE A 1 21  ? 2.768   23.975 38.701  1.00 0.00  ? 21  ILE A CG2  5  
ATOM   10788 C  CD1  . ILE A 1 21  ? 4.864   21.872 38.556  1.00 0.00  ? 21  ILE A CD1  5  
ATOM   10789 H  H    . ILE A 1 21  ? 2.578   20.713 36.080  1.00 0.00  ? 21  ILE A H    5  
ATOM   10790 H  HA   . ILE A 1 21  ? 2.278   21.438 38.963  1.00 0.00  ? 21  ILE A HA   5  
ATOM   10791 H  HB   . ILE A 1 21  ? 2.431   23.385 36.662  1.00 0.00  ? 21  ILE A HB   5  
ATOM   10792 H  HG12 . ILE A 1 21  ? 4.382   21.931 36.461  1.00 0.00  ? 21  ILE A HG12 5  
ATOM   10793 H  HG13 . ILE A 1 21  ? 4.888   23.481 37.134  1.00 0.00  ? 21  ILE A HG13 5  
ATOM   10794 H  HG21 . ILE A 1 21  ? 2.263   23.529 39.546  1.00 0.00  ? 21  ILE A HG21 5  
ATOM   10795 H  HG22 . ILE A 1 21  ? 2.218   24.844 38.369  1.00 0.00  ? 21  ILE A HG22 5  
ATOM   10796 H  HG23 . ILE A 1 21  ? 3.765   24.270 38.993  1.00 0.00  ? 21  ILE A HG23 5  
ATOM   10797 H  HD11 . ILE A 1 21  ? 4.221   22.067 39.401  1.00 0.00  ? 21  ILE A HD11 5  
ATOM   10798 H  HD12 . ILE A 1 21  ? 5.859   22.236 38.769  1.00 0.00  ? 21  ILE A HD12 5  
ATOM   10799 H  HD13 . ILE A 1 21  ? 4.902   20.808 38.370  1.00 0.00  ? 21  ILE A HD13 5  
ATOM   10800 N  N    . GLY A 1 22  ? 0.087   21.871 36.558  1.00 0.00  ? 22  GLY A N    5  
ATOM   10801 C  CA   . GLY A 1 22  ? -1.359  22.128 36.333  1.00 0.00  ? 22  GLY A CA   5  
ATOM   10802 C  C    . GLY A 1 22  ? -1.780  21.527 34.997  1.00 0.00  ? 22  GLY A C    5  
ATOM   10803 O  O    . GLY A 1 22  ? -1.619  22.126 33.953  1.00 0.00  ? 22  GLY A O    5  
ATOM   10804 H  H    . GLY A 1 22  ? 0.666   21.645 35.803  1.00 0.00  ? 22  GLY A H    5  
ATOM   10805 H  HA2  . GLY A 1 22  ? -1.934  21.679 37.130  1.00 0.00  ? 22  GLY A HA2  5  
ATOM   10806 H  HA3  . GLY A 1 22  ? -1.535  23.191 36.316  1.00 0.00  ? 22  GLY A HA3  5  
ATOM   10807 N  N    . TYR A 1 23  ? -2.318  20.346 35.022  1.00 0.00  ? 23  TYR A N    5  
ATOM   10808 C  CA   . TYR A 1 23  ? -2.756  19.704 33.754  1.00 0.00  ? 23  TYR A CA   5  
ATOM   10809 C  C    . TYR A 1 23  ? -3.728  20.643 33.025  1.00 0.00  ? 23  TYR A C    5  
ATOM   10810 O  O    . TYR A 1 23  ? -4.038  21.714 33.505  1.00 0.00  ? 23  TYR A O    5  
ATOM   10811 C  CB   . TYR A 1 23  ? -3.454  18.386 34.082  1.00 0.00  ? 23  TYR A CB   5  
ATOM   10812 C  CG   . TYR A 1 23  ? -2.455  17.253 34.012  1.00 0.00  ? 23  TYR A CG   5  
ATOM   10813 C  CD1  . TYR A 1 23  ? -1.645  17.099 32.881  1.00 0.00  ? 23  TYR A CD1  5  
ATOM   10814 C  CD2  . TYR A 1 23  ? -2.351  16.346 35.076  1.00 0.00  ? 23  TYR A CD2  5  
ATOM   10815 C  CE1  . TYR A 1 23  ? -0.734  16.038 32.813  1.00 0.00  ? 23  TYR A CE1  5  
ATOM   10816 C  CE2  . TYR A 1 23  ? -1.438  15.290 35.007  1.00 0.00  ? 23  TYR A CE2  5  
ATOM   10817 C  CZ   . TYR A 1 23  ? -0.631  15.134 33.876  1.00 0.00  ? 23  TYR A CZ   5  
ATOM   10818 O  OH   . TYR A 1 23  ? 0.260   14.084 33.809  1.00 0.00  ? 23  TYR A OH   5  
ATOM   10819 H  H    . TYR A 1 23  ? -2.434  19.880 35.875  1.00 0.00  ? 23  TYR A H    5  
ATOM   10820 H  HA   . TYR A 1 23  ? -1.898  19.514 33.128  1.00 0.00  ? 23  TYR A HA   5  
ATOM   10821 H  HB2  . TYR A 1 23  ? -3.869  18.439 35.078  1.00 0.00  ? 23  TYR A HB2  5  
ATOM   10822 H  HB3  . TYR A 1 23  ? -4.246  18.213 33.371  1.00 0.00  ? 23  TYR A HB3  5  
ATOM   10823 H  HD1  . TYR A 1 23  ? -1.722  17.797 32.061  1.00 0.00  ? 23  TYR A HD1  5  
ATOM   10824 H  HD2  . TYR A 1 23  ? -2.973  16.465 35.951  1.00 0.00  ? 23  TYR A HD2  5  
ATOM   10825 H  HE1  . TYR A 1 23  ? -0.107  15.920 31.941  1.00 0.00  ? 23  TYR A HE1  5  
ATOM   10826 H  HE2  . TYR A 1 23  ? -1.358  14.592 35.827  1.00 0.00  ? 23  TYR A HE2  5  
ATOM   10827 H  HH   . TYR A 1 23  ? 0.450   13.918 32.885  1.00 0.00  ? 23  TYR A HH   5  
ATOM   10828 N  N    . THR A 1 24  ? -4.209  20.255 31.871  1.00 0.00  ? 24  THR A N    5  
ATOM   10829 C  CA   . THR A 1 24  ? -5.158  21.137 31.120  1.00 0.00  ? 24  THR A CA   5  
ATOM   10830 C  C    . THR A 1 24  ? -6.584  20.576 31.243  1.00 0.00  ? 24  THR A C    5  
ATOM   10831 O  O    . THR A 1 24  ? -6.764  19.383 31.398  1.00 0.00  ? 24  THR A O    5  
ATOM   10832 C  CB   . THR A 1 24  ? -4.735  21.201 29.646  1.00 0.00  ? 24  THR A CB   5  
ATOM   10833 O  OG1  . THR A 1 24  ? -5.347  22.322 29.023  1.00 0.00  ? 24  THR A OG1  5  
ATOM   10834 C  CG2  . THR A 1 24  ? -5.160  19.920 28.928  1.00 0.00  ? 24  THR A CG2  5  
ATOM   10835 H  H    . THR A 1 24  ? -3.947  19.388 31.497  1.00 0.00  ? 24  THR A H    5  
ATOM   10836 H  HA   . THR A 1 24  ? -5.129  22.130 31.543  1.00 0.00  ? 24  THR A HA   5  
ATOM   10837 H  HB   . THR A 1 24  ? -3.661  21.302 29.584  1.00 0.00  ? 24  THR A HB   5  
ATOM   10838 H  HG1  . THR A 1 24  ? -5.470  22.115 28.095  1.00 0.00  ? 24  THR A HG1  5  
ATOM   10839 H  HG21 . THR A 1 24  ? -6.232  19.922 28.792  1.00 0.00  ? 24  THR A HG21 5  
ATOM   10840 H  HG22 . THR A 1 24  ? -4.875  19.064 29.521  1.00 0.00  ? 24  THR A HG22 5  
ATOM   10841 H  HG23 . THR A 1 24  ? -4.675  19.870 27.964  1.00 0.00  ? 24  THR A HG23 5  
ATOM   10842 N  N    . PRO A 1 25  ? -7.555  21.459 31.191  1.00 0.00  ? 25  PRO A N    5  
ATOM   10843 C  CA   . PRO A 1 25  ? -8.981  21.088 31.320  1.00 0.00  ? 25  PRO A CA   5  
ATOM   10844 C  C    . PRO A 1 25  ? -9.540  20.570 29.996  1.00 0.00  ? 25  PRO A C    5  
ATOM   10845 O  O    . PRO A 1 25  ? -10.403 19.713 29.965  1.00 0.00  ? 25  PRO A O    5  
ATOM   10846 C  CB   . PRO A 1 25  ? -9.655  22.408 31.692  1.00 0.00  ? 25  PRO A CB   5  
ATOM   10847 C  CG   . PRO A 1 25  ? -8.714  23.538 31.204  1.00 0.00  ? 25  PRO A CG   5  
ATOM   10848 C  CD   . PRO A 1 25  ? -7.326  22.905 30.999  1.00 0.00  ? 25  PRO A CD   5  
ATOM   10849 H  HA   . PRO A 1 25  ? -9.123  20.368 32.107  1.00 0.00  ? 25  PRO A HA   5  
ATOM   10850 H  HB2  . PRO A 1 25  ? -10.612 22.480 31.197  1.00 0.00  ? 25  PRO A HB2  5  
ATOM   10851 H  HB3  . PRO A 1 25  ? -9.781  22.474 32.758  1.00 0.00  ? 25  PRO A HB3  5  
ATOM   10852 H  HG2  . PRO A 1 25  ? -9.077  23.945 30.269  1.00 0.00  ? 25  PRO A HG2  5  
ATOM   10853 H  HG3  . PRO A 1 25  ? -8.652  24.315 31.948  1.00 0.00  ? 25  PRO A HG3  5  
ATOM   10854 H  HD2  . PRO A 1 25  ? -6.973  23.107 29.998  1.00 0.00  ? 25  PRO A HD2  5  
ATOM   10855 H  HD3  . PRO A 1 25  ? -6.624  23.273 31.732  1.00 0.00  ? 25  PRO A HD3  5  
ATOM   10856 N  N    . ASP A 1 26  ? -9.056  21.092 28.907  1.00 0.00  ? 26  ASP A N    5  
ATOM   10857 C  CA   . ASP A 1 26  ? -9.546  20.651 27.568  1.00 0.00  ? 26  ASP A CA   5  
ATOM   10858 C  C    . ASP A 1 26  ? -9.770  19.133 27.562  1.00 0.00  ? 26  ASP A C    5  
ATOM   10859 O  O    . ASP A 1 26  ? -10.585 18.622 26.819  1.00 0.00  ? 26  ASP A O    5  
ATOM   10860 C  CB   . ASP A 1 26  ? -8.503  21.014 26.505  1.00 0.00  ? 26  ASP A CB   5  
ATOM   10861 C  CG   . ASP A 1 26  ? -8.604  22.503 26.173  1.00 0.00  ? 26  ASP A CG   5  
ATOM   10862 O  OD1  . ASP A 1 26  ? -9.715  22.985 26.028  1.00 0.00  ? 26  ASP A OD1  5  
ATOM   10863 O  OD2  . ASP A 1 26  ? -7.567  23.138 26.069  1.00 0.00  ? 26  ASP A OD2  5  
ATOM   10864 H  H    . ASP A 1 26  ? -8.370  21.786 28.972  1.00 0.00  ? 26  ASP A H    5  
ATOM   10865 H  HA   . ASP A 1 26  ? -10.476 21.151 27.341  1.00 0.00  ? 26  ASP A HA   5  
ATOM   10866 H  HB2  . ASP A 1 26  ? -7.516  20.793 26.881  1.00 0.00  ? 26  ASP A HB2  5  
ATOM   10867 H  HB3  . ASP A 1 26  ? -8.684  20.436 25.611  1.00 0.00  ? 26  ASP A HB3  5  
ATOM   10868 N  N    . LEU A 1 27  ? -9.058  18.407 28.381  1.00 0.00  ? 27  LEU A N    5  
ATOM   10869 C  CA   . LEU A 1 27  ? -9.241  16.928 28.411  1.00 0.00  ? 27  LEU A CA   5  
ATOM   10870 C  C    . LEU A 1 27  ? -9.307  16.437 29.859  1.00 0.00  ? 27  LEU A C    5  
ATOM   10871 O  O    . LEU A 1 27  ? -9.248  17.211 30.794  1.00 0.00  ? 27  LEU A O    5  
ATOM   10872 C  CB   . LEU A 1 27  ? -8.077  16.246 27.700  1.00 0.00  ? 27  LEU A CB   5  
ATOM   10873 C  CG   . LEU A 1 27  ? -6.815  17.057 27.925  1.00 0.00  ? 27  LEU A CG   5  
ATOM   10874 C  CD1  . LEU A 1 27  ? -6.419  16.942 29.394  1.00 0.00  ? 27  LEU A CD1  5  
ATOM   10875 C  CD2  . LEU A 1 27  ? -5.695  16.509 27.037  1.00 0.00  ? 27  LEU A CD2  5  
ATOM   10876 H  H    . LEU A 1 27  ? -8.404  18.831 28.974  1.00 0.00  ? 27  LEU A H    5  
ATOM   10877 H  HA   . LEU A 1 27  ? -10.151 16.677 27.907  1.00 0.00  ? 27  LEU A HA   5  
ATOM   10878 H  HB2  . LEU A 1 27  ? -7.943  15.252 28.103  1.00 0.00  ? 27  LEU A HB2  5  
ATOM   10879 H  HB3  . LEU A 1 27  ? -8.283  16.186 26.644  1.00 0.00  ? 27  LEU A HB3  5  
ATOM   10880 H  HG   . LEU A 1 27  ? -7.009  18.089 27.679  1.00 0.00  ? 27  LEU A HG   5  
ATOM   10881 H  HD11 . LEU A 1 27  ? -6.577  15.926 29.726  1.00 0.00  ? 27  LEU A HD11 5  
ATOM   10882 H  HD12 . LEU A 1 27  ? -7.029  17.613 29.982  1.00 0.00  ? 27  LEU A HD12 5  
ATOM   10883 H  HD13 . LEU A 1 27  ? -5.380  17.202 29.512  1.00 0.00  ? 27  LEU A HD13 5  
ATOM   10884 H  HD21 . LEU A 1 27  ? -4.997  17.300 26.806  1.00 0.00  ? 27  LEU A HD21 5  
ATOM   10885 H  HD22 . LEU A 1 27  ? -6.122  16.126 26.121  1.00 0.00  ? 27  LEU A HD22 5  
ATOM   10886 H  HD23 . LEU A 1 27  ? -5.180  15.713 27.553  1.00 0.00  ? 27  LEU A HD23 5  
ATOM   10887 N  N    . ASP A 1 28  ? -9.429  15.149 30.045  1.00 0.00  ? 28  ASP A N    5  
ATOM   10888 C  CA   . ASP A 1 28  ? -9.502  14.582 31.423  1.00 0.00  ? 28  ASP A CA   5  
ATOM   10889 C  C    . ASP A 1 28  ? -8.133  14.626 32.084  1.00 0.00  ? 28  ASP A C    5  
ATOM   10890 O  O    . ASP A 1 28  ? -7.127  14.548 31.422  1.00 0.00  ? 28  ASP A O    5  
ATOM   10891 C  CB   . ASP A 1 28  ? -9.984  13.129 31.348  1.00 0.00  ? 28  ASP A CB   5  
ATOM   10892 C  CG   . ASP A 1 28  ? -11.507 13.094 31.466  1.00 0.00  ? 28  ASP A CG   5  
ATOM   10893 O  OD1  . ASP A 1 28  ? -11.996 13.088 32.583  1.00 0.00  ? 28  ASP A OD1  5  
ATOM   10894 O  OD2  . ASP A 1 28  ? -12.160 13.070 30.435  1.00 0.00  ? 28  ASP A OD2  5  
ATOM   10895 H  H    . ASP A 1 28  ? -9.473  14.550 29.269  1.00 0.00  ? 28  ASP A H    5  
ATOM   10896 H  HA   . ASP A 1 28  ? -10.185 15.142 32.018  1.00 0.00  ? 28  ASP A HA   5  
ATOM   10897 H  HB2  . ASP A 1 28  ? -9.688  12.697 30.404  1.00 0.00  ? 28  ASP A HB2  5  
ATOM   10898 H  HB3  . ASP A 1 28  ? -9.550  12.562 32.157  1.00 0.00  ? 28  ASP A HB3  5  
ATOM   10899 N  N    . PRO A 1 29  ? -8.142  14.713 33.386  1.00 0.00  ? 29  PRO A N    5  
ATOM   10900 C  CA   . PRO A 1 29  ? -6.909  14.712 34.179  1.00 0.00  ? 29  PRO A CA   5  
ATOM   10901 C  C    . PRO A 1 29  ? -6.398  13.285 34.167  1.00 0.00  ? 29  PRO A C    5  
ATOM   10902 O  O    . PRO A 1 29  ? -5.217  13.015 34.189  1.00 0.00  ? 29  PRO A O    5  
ATOM   10903 C  CB   . PRO A 1 29  ? -7.364  15.144 35.572  1.00 0.00  ? 29  PRO A CB   5  
ATOM   10904 C  CG   . PRO A 1 29  ? -8.881  14.844 35.639  1.00 0.00  ? 29  PRO A CG   5  
ATOM   10905 C  CD   . PRO A 1 29  ? -9.378  14.807 34.186  1.00 0.00  ? 29  PRO A CD   5  
ATOM   10906 H  HA   . PRO A 1 29  ? -6.181  15.400 33.776  1.00 0.00  ? 29  PRO A HA   5  
ATOM   10907 H  HB2  . PRO A 1 29  ? -6.833  14.573 36.323  1.00 0.00  ? 29  PRO A HB2  5  
ATOM   10908 H  HB3  . PRO A 1 29  ? -7.191  16.197 35.710  1.00 0.00  ? 29  PRO A HB3  5  
ATOM   10909 H  HG2  . PRO A 1 29  ? -9.048  13.888 36.113  1.00 0.00  ? 29  PRO A HG2  5  
ATOM   10910 H  HG3  . PRO A 1 29  ? -9.394  15.625 36.177  1.00 0.00  ? 29  PRO A HG3  5  
ATOM   10911 H  HD2  . PRO A 1 29  ? -10.005 13.942 34.023  1.00 0.00  ? 29  PRO A HD2  5  
ATOM   10912 H  HD3  . PRO A 1 29  ? -9.909  15.713 33.945  1.00 0.00  ? 29  PRO A HD3  5  
ATOM   10913 N  N    . GLU A 1 30  ? -7.310  12.367 34.074  1.00 0.00  ? 30  GLU A N    5  
ATOM   10914 C  CA   . GLU A 1 30  ? -6.926  10.947 33.985  1.00 0.00  ? 30  GLU A CA   5  
ATOM   10915 C  C    . GLU A 1 30  ? -6.480  10.713 32.547  1.00 0.00  ? 30  GLU A C    5  
ATOM   10916 O  O    . GLU A 1 30  ? -5.614  9.903  32.274  1.00 0.00  ? 30  GLU A O    5  
ATOM   10917 C  CB   . GLU A 1 30  ? -8.127  10.057 34.313  1.00 0.00  ? 30  GLU A CB   5  
ATOM   10918 C  CG   . GLU A 1 30  ? -8.553  10.289 35.761  1.00 0.00  ? 30  GLU A CG   5  
ATOM   10919 C  CD   . GLU A 1 30  ? -8.054  9.135  36.628  1.00 0.00  ? 30  GLU A CD   5  
ATOM   10920 O  OE1  . GLU A 1 30  ? -8.561  8.037  36.467  1.00 0.00  ? 30  GLU A OE1  5  
ATOM   10921 O  OE2  . GLU A 1 30  ? -7.171  9.367  37.436  1.00 0.00  ? 30  GLU A OE2  5  
ATOM   10922 H  H    . GLU A 1 30  ? -8.253  12.626 34.020  1.00 0.00  ? 30  GLU A H    5  
ATOM   10923 H  HA   . GLU A 1 30  ? -6.110  10.741 34.662  1.00 0.00  ? 30  GLU A HA   5  
ATOM   10924 H  HB2  . GLU A 1 30  ? -8.946  10.299 33.653  1.00 0.00  ? 30  GLU A HB2  5  
ATOM   10925 H  HB3  . GLU A 1 30  ? -7.854  9.021  34.183  1.00 0.00  ? 30  GLU A HB3  5  
ATOM   10926 H  HG2  . GLU A 1 30  ? -8.131  11.217 36.117  1.00 0.00  ? 30  GLU A HG2  5  
ATOM   10927 H  HG3  . GLU A 1 30  ? -9.629  10.339 35.817  1.00 0.00  ? 30  GLU A HG3  5  
ATOM   10928 N  N    . THR A 1 31  ? -7.052  11.452 31.620  1.00 0.00  ? 31  THR A N    5  
ATOM   10929 C  CA   . THR A 1 31  ? -6.634  11.299 30.196  1.00 0.00  ? 31  THR A CA   5  
ATOM   10930 C  C    . THR A 1 31  ? -5.290  12.005 30.020  1.00 0.00  ? 31  THR A C    5  
ATOM   10931 O  O    . THR A 1 31  ? -4.339  11.452 29.508  1.00 0.00  ? 31  THR A O    5  
ATOM   10932 C  CB   . THR A 1 31  ? -7.679  11.952 29.285  1.00 0.00  ? 31  THR A CB   5  
ATOM   10933 O  OG1  . THR A 1 31  ? -8.787  11.076 29.136  1.00 0.00  ? 31  THR A OG1  5  
ATOM   10934 C  CG2  . THR A 1 31  ? -7.079  12.249 27.907  1.00 0.00  ? 31  THR A CG2  5  
ATOM   10935 H  H    . THR A 1 31  ? -7.741  12.129 31.870  1.00 0.00  ? 31  THR A H    5  
ATOM   10936 H  HA   . THR A 1 31  ? -6.536  10.252 29.953  1.00 0.00  ? 31  THR A HA   5  
ATOM   10937 H  HB   . THR A 1 31  ? -8.008  12.876 29.731  1.00 0.00  ? 31  THR A HB   5  
ATOM   10938 H  HG1  . THR A 1 31  ? -9.170  10.932 30.003  1.00 0.00  ? 31  THR A HG1  5  
ATOM   10939 H  HG21 . THR A 1 31  ? -7.078  13.317 27.743  1.00 0.00  ? 31  THR A HG21 5  
ATOM   10940 H  HG22 . THR A 1 31  ? -7.671  11.767 27.141  1.00 0.00  ? 31  THR A HG22 5  
ATOM   10941 H  HG23 . THR A 1 31  ? -6.066  11.877 27.861  1.00 0.00  ? 31  THR A HG23 5  
ATOM   10942 N  N    . VAL A 1 32  ? -5.218  13.228 30.459  1.00 0.00  ? 32  VAL A N    5  
ATOM   10943 C  CA   . VAL A 1 32  ? -3.959  14.002 30.353  1.00 0.00  ? 32  VAL A CA   5  
ATOM   10944 C  C    . VAL A 1 32  ? -2.844  13.200 31.019  1.00 0.00  ? 32  VAL A C    5  
ATOM   10945 O  O    . VAL A 1 32  ? -1.744  13.104 30.515  1.00 0.00  ? 32  VAL A O    5  
ATOM   10946 C  CB   . VAL A 1 32  ? -4.163  15.352 31.054  1.00 0.00  ? 32  VAL A CB   5  
ATOM   10947 C  CG1  . VAL A 1 32  ? -3.901  15.228 32.555  1.00 0.00  ? 32  VAL A CG1  5  
ATOM   10948 C  CG2  . VAL A 1 32  ? -3.226  16.396 30.449  1.00 0.00  ? 32  VAL A CG2  5  
ATOM   10949 H  H    . VAL A 1 32  ? -5.998  13.635 30.873  1.00 0.00  ? 32  VAL A H    5  
ATOM   10950 H  HA   . VAL A 1 32  ? -3.720  14.166 29.312  1.00 0.00  ? 32  VAL A HA   5  
ATOM   10951 H  HB   . VAL A 1 32  ? -5.183  15.661 30.911  1.00 0.00  ? 32  VAL A HB   5  
ATOM   10952 H  HG11 . VAL A 1 32  ? -2.851  15.066 32.729  1.00 0.00  ? 32  VAL A HG11 5  
ATOM   10953 H  HG12 . VAL A 1 32  ? -4.462  14.399 32.945  1.00 0.00  ? 32  VAL A HG12 5  
ATOM   10954 H  HG13 . VAL A 1 32  ? -4.213  16.134 33.048  1.00 0.00  ? 32  VAL A HG13 5  
ATOM   10955 H  HG21 . VAL A 1 32  ? -2.214  16.020 30.456  1.00 0.00  ? 32  VAL A HG21 5  
ATOM   10956 H  HG22 . VAL A 1 32  ? -3.278  17.304 31.029  1.00 0.00  ? 32  VAL A HG22 5  
ATOM   10957 H  HG23 . VAL A 1 32  ? -3.529  16.601 29.433  1.00 0.00  ? 32  VAL A HG23 5  
ATOM   10958 N  N    . ASP A 1 33  ? -3.137  12.601 32.140  1.00 0.00  ? 33  ASP A N    5  
ATOM   10959 C  CA   . ASP A 1 33  ? -2.109  11.775 32.828  1.00 0.00  ? 33  ASP A CA   5  
ATOM   10960 C  C    . ASP A 1 33  ? -1.897  10.503 32.005  1.00 0.00  ? 33  ASP A C    5  
ATOM   10961 O  O    . ASP A 1 33  ? -0.853  9.874  32.056  1.00 0.00  ? 33  ASP A O    5  
ATOM   10962 C  CB   . ASP A 1 33  ? -2.593  11.406 34.234  1.00 0.00  ? 33  ASP A CB   5  
ATOM   10963 C  CG   . ASP A 1 33  ? -1.463  11.627 35.242  1.00 0.00  ? 33  ASP A CG   5  
ATOM   10964 O  OD1  . ASP A 1 33  ? -0.393  11.082 35.031  1.00 0.00  ? 33  ASP A OD1  5  
ATOM   10965 O  OD2  . ASP A 1 33  ? -1.688  12.337 36.209  1.00 0.00  ? 33  ASP A OD2  5  
ATOM   10966 H  H    . ASP A 1 33  ? -4.042  12.677 32.515  1.00 0.00  ? 33  ASP A H    5  
ATOM   10967 H  HA   . ASP A 1 33  ? -1.181  12.328 32.896  1.00 0.00  ? 33  ASP A HA   5  
ATOM   10968 H  HB2  . ASP A 1 33  ? -3.434  12.026 34.498  1.00 0.00  ? 33  ASP A HB2  5  
ATOM   10969 H  HB3  . ASP A 1 33  ? -2.891  10.367 34.252  1.00 0.00  ? 33  ASP A HB3  5  
ATOM   10970 N  N    . ASP A 1 34  ? -2.882  10.127 31.229  1.00 0.00  ? 34  ASP A N    5  
ATOM   10971 C  CA   . ASP A 1 34  ? -2.737  8.907  30.395  1.00 0.00  ? 34  ASP A CA   5  
ATOM   10972 C  C    . ASP A 1 34  ? -1.954  9.258  29.132  1.00 0.00  ? 34  ASP A C    5  
ATOM   10973 O  O    . ASP A 1 34  ? -1.179  8.467  28.634  1.00 0.00  ? 34  ASP A O    5  
ATOM   10974 C  CB   . ASP A 1 34  ? -4.118  8.368  30.026  1.00 0.00  ? 34  ASP A CB   5  
ATOM   10975 C  CG   . ASP A 1 34  ? -4.026  6.859  29.797  1.00 0.00  ? 34  ASP A CG   5  
ATOM   10976 O  OD1  . ASP A 1 34  ? -3.733  6.468  28.680  1.00 0.00  ? 34  ASP A OD1  5  
ATOM   10977 O  OD2  . ASP A 1 34  ? -4.245  6.120  30.743  1.00 0.00  ? 34  ASP A OD2  5  
ATOM   10978 H  H    . ASP A 1 34  ? -3.712  10.655 31.189  1.00 0.00  ? 34  ASP A H    5  
ATOM   10979 H  HA   . ASP A 1 34  ? -2.197  8.156  30.953  1.00 0.00  ? 34  ASP A HA   5  
ATOM   10980 H  HB2  . ASP A 1 34  ? -4.810  8.570  30.833  1.00 0.00  ? 34  ASP A HB2  5  
ATOM   10981 H  HB3  . ASP A 1 34  ? -4.466  8.849  29.125  1.00 0.00  ? 34  ASP A HB3  5  
ATOM   10982 N  N    . ALA A 1 35  ? -2.132  10.444 28.616  1.00 0.00  ? 35  ALA A N    5  
ATOM   10983 C  CA   . ALA A 1 35  ? -1.370  10.830 27.398  1.00 0.00  ? 35  ALA A CA   5  
ATOM   10984 C  C    . ALA A 1 35  ? 0.121   10.829 27.737  1.00 0.00  ? 35  ALA A C    5  
ATOM   10985 O  O    . ALA A 1 35  ? 0.959   10.548 26.904  1.00 0.00  ? 35  ALA A O    5  
ATOM   10986 C  CB   . ALA A 1 35  ? -1.791  12.228 26.937  1.00 0.00  ? 35  ALA A CB   5  
ATOM   10987 H  H    . ALA A 1 35  ? -2.750  11.080 29.035  1.00 0.00  ? 35  ALA A H    5  
ATOM   10988 H  HA   . ALA A 1 35  ? -1.561  10.116 26.611  1.00 0.00  ? 35  ALA A HA   5  
ATOM   10989 H  HB1  . ALA A 1 35  ? -2.868  12.308 26.961  1.00 0.00  ? 35  ALA A HB1  5  
ATOM   10990 H  HB2  . ALA A 1 35  ? -1.441  12.394 25.929  1.00 0.00  ? 35  ALA A HB2  5  
ATOM   10991 H  HB3  . ALA A 1 35  ? -1.359  12.967 27.594  1.00 0.00  ? 35  ALA A HB3  5  
ATOM   10992 N  N    . PHE A 1 36  ? 0.457   11.135 28.961  1.00 0.00  ? 36  PHE A N    5  
ATOM   10993 C  CA   . PHE A 1 36  ? 1.891   11.144 29.353  1.00 0.00  ? 36  PHE A CA   5  
ATOM   10994 C  C    . PHE A 1 36  ? 2.388   9.701  29.454  1.00 0.00  ? 36  PHE A C    5  
ATOM   10995 O  O    . PHE A 1 36  ? 3.422   9.359  28.914  1.00 0.00  ? 36  PHE A O    5  
ATOM   10996 C  CB   . PHE A 1 36  ? 2.052   11.859 30.698  1.00 0.00  ? 36  PHE A CB   5  
ATOM   10997 C  CG   . PHE A 1 36  ? 2.041   13.350 30.457  1.00 0.00  ? 36  PHE A CG   5  
ATOM   10998 C  CD1  . PHE A 1 36  ? 0.985   13.931 29.748  1.00 0.00  ? 36  PHE A CD1  5  
ATOM   10999 C  CD2  . PHE A 1 36  ? 3.093   14.149 30.923  1.00 0.00  ? 36  PHE A CD2  5  
ATOM   11000 C  CE1  . PHE A 1 36  ? 0.979   15.309 29.504  1.00 0.00  ? 36  PHE A CE1  5  
ATOM   11001 C  CE2  . PHE A 1 36  ? 3.084   15.529 30.681  1.00 0.00  ? 36  PHE A CE2  5  
ATOM   11002 C  CZ   . PHE A 1 36  ? 2.027   16.108 29.970  1.00 0.00  ? 36  PHE A CZ   5  
ATOM   11003 H  H    . PHE A 1 36  ? -0.233  11.352 29.620  1.00 0.00  ? 36  PHE A H    5  
ATOM   11004 H  HA   . PHE A 1 36  ? 2.462   11.666 28.598  1.00 0.00  ? 36  PHE A HA   5  
ATOM   11005 H  HB2  . PHE A 1 36  ? 1.237   11.588 31.354  1.00 0.00  ? 36  PHE A HB2  5  
ATOM   11006 H  HB3  . PHE A 1 36  ? 2.990   11.574 31.150  1.00 0.00  ? 36  PHE A HB3  5  
ATOM   11007 H  HD1  . PHE A 1 36  ? 0.174   13.315 29.388  1.00 0.00  ? 36  PHE A HD1  5  
ATOM   11008 H  HD2  . PHE A 1 36  ? 3.909   13.705 31.474  1.00 0.00  ? 36  PHE A HD2  5  
ATOM   11009 H  HE1  . PHE A 1 36  ? 0.164   15.757 28.955  1.00 0.00  ? 36  PHE A HE1  5  
ATOM   11010 H  HE2  . PHE A 1 36  ? 3.894   16.145 31.041  1.00 0.00  ? 36  PHE A HE2  5  
ATOM   11011 H  HZ   . PHE A 1 36  ? 2.022   17.170 29.777  1.00 0.00  ? 36  PHE A HZ   5  
ATOM   11012 N  N    . ALA A 1 37  ? 1.659   8.844  30.124  1.00 0.00  ? 37  ALA A N    5  
ATOM   11013 C  CA   . ALA A 1 37  ? 2.108   7.425  30.221  1.00 0.00  ? 37  ALA A CA   5  
ATOM   11014 C  C    . ALA A 1 37  ? 2.530   6.951  28.831  1.00 0.00  ? 37  ALA A C    5  
ATOM   11015 O  O    . ALA A 1 37  ? 3.609   6.427  28.644  1.00 0.00  ? 37  ALA A O    5  
ATOM   11016 C  CB   . ALA A 1 37  ? 0.966   6.544  30.732  1.00 0.00  ? 37  ALA A CB   5  
ATOM   11017 H  H    . ALA A 1 37  ? 0.818   9.129  30.547  1.00 0.00  ? 37  ALA A H    5  
ATOM   11018 H  HA   . ALA A 1 37  ? 2.950   7.357  30.896  1.00 0.00  ? 37  ALA A HA   5  
ATOM   11019 H  HB1  . ALA A 1 37  ? 1.119   6.327  31.779  1.00 0.00  ? 37  ALA A HB1  5  
ATOM   11020 H  HB2  . ALA A 1 37  ? 0.950   5.619  30.172  1.00 0.00  ? 37  ALA A HB2  5  
ATOM   11021 H  HB3  . ALA A 1 37  ? 0.026   7.059  30.603  1.00 0.00  ? 37  ALA A HB3  5  
ATOM   11022 N  N    . ARG A 1 38  ? 1.693   7.138  27.846  1.00 0.00  ? 38  ARG A N    5  
ATOM   11023 C  CA   . ARG A 1 38  ? 2.071   6.703  26.475  1.00 0.00  ? 38  ARG A CA   5  
ATOM   11024 C  C    . ARG A 1 38  ? 3.402   7.358  26.110  1.00 0.00  ? 38  ARG A C    5  
ATOM   11025 O  O    . ARG A 1 38  ? 4.335   6.698  25.698  1.00 0.00  ? 38  ARG A O    5  
ATOM   11026 C  CB   . ARG A 1 38  ? 0.990   7.124  25.478  1.00 0.00  ? 38  ARG A CB   5  
ATOM   11027 C  CG   . ARG A 1 38  ? -0.298  6.348  25.767  1.00 0.00  ? 38  ARG A CG   5  
ATOM   11028 C  CD   . ARG A 1 38  ? -0.822  5.730  24.473  1.00 0.00  ? 38  ARG A CD   5  
ATOM   11029 N  NE   . ARG A 1 38  ? -1.249  6.810  23.542  1.00 0.00  ? 38  ARG A NE   5  
ATOM   11030 C  CZ   . ARG A 1 38  ? -1.872  6.505  22.436  1.00 0.00  ? 38  ARG A CZ   5  
ATOM   11031 N  NH1  . ARG A 1 38  ? -2.127  5.254  22.149  1.00 0.00  ? 38  ARG A NH1  5  
ATOM   11032 N  NH2  . ARG A 1 38  ? -2.241  7.451  21.616  1.00 0.00  ? 38  ARG A NH2  5  
ATOM   11033 H  H    . ARG A 1 38  ? 0.827   7.570  28.008  1.00 0.00  ? 38  ARG A H    5  
ATOM   11034 H  HA   . ARG A 1 38  ? 2.180   5.629  26.458  1.00 0.00  ? 38  ARG A HA   5  
ATOM   11035 H  HB2  . ARG A 1 38  ? 0.806   8.184  25.574  1.00 0.00  ? 38  ARG A HB2  5  
ATOM   11036 H  HB3  . ARG A 1 38  ? 1.322   6.905  24.474  1.00 0.00  ? 38  ARG A HB3  5  
ATOM   11037 H  HG2  . ARG A 1 38  ? -0.092  5.565  26.480  1.00 0.00  ? 38  ARG A HG2  5  
ATOM   11038 H  HG3  . ARG A 1 38  ? -1.043  7.019  26.171  1.00 0.00  ? 38  ARG A HG3  5  
ATOM   11039 H  HD2  . ARG A 1 38  ? -0.042  5.144  24.010  1.00 0.00  ? 38  ARG A HD2  5  
ATOM   11040 H  HD3  . ARG A 1 38  ? -1.666  5.095  24.696  1.00 0.00  ? 38  ARG A HD3  5  
ATOM   11041 H  HE   . ARG A 1 38  ? -1.060  7.748  23.758  1.00 0.00  ? 38  ARG A HE   5  
ATOM   11042 H  HH11 . ARG A 1 38  ? -1.845  4.528  22.776  1.00 0.00  ? 38  ARG A HH11 5  
ATOM   11043 H  HH12 . ARG A 1 38  ? -2.603  5.023  21.301  1.00 0.00  ? 38  ARG A HH12 5  
ATOM   11044 H  HH21 . ARG A 1 38  ? -2.046  8.406  21.834  1.00 0.00  ? 38  ARG A HH21 5  
ATOM   11045 H  HH22 . ARG A 1 38  ? -2.719  7.219  20.769  1.00 0.00  ? 38  ARG A HH22 5  
ATOM   11046 N  N    . ALA A 1 39  ? 3.511   8.649  26.280  1.00 0.00  ? 39  ALA A N    5  
ATOM   11047 C  CA   . ALA A 1 39  ? 4.798   9.323  25.962  1.00 0.00  ? 39  ALA A CA   5  
ATOM   11048 C  C    . ALA A 1 39  ? 5.913   8.602  26.722  1.00 0.00  ? 39  ALA A C    5  
ATOM   11049 O  O    . ALA A 1 39  ? 6.963   8.308  26.188  1.00 0.00  ? 39  ALA A O    5  
ATOM   11050 C  CB   . ALA A 1 39  ? 4.741   10.790 26.403  1.00 0.00  ? 39  ALA A CB   5  
ATOM   11051 H  H    . ALA A 1 39  ? 2.756   9.166  26.632  1.00 0.00  ? 39  ALA A H    5  
ATOM   11052 H  HA   . ALA A 1 39  ? 4.984   9.268  24.898  1.00 0.00  ? 39  ALA A HA   5  
ATOM   11053 H  HB1  . ALA A 1 39  ? 3.723   11.055 26.648  1.00 0.00  ? 39  ALA A HB1  5  
ATOM   11054 H  HB2  . ALA A 1 39  ? 5.093   11.422 25.599  1.00 0.00  ? 39  ALA A HB2  5  
ATOM   11055 H  HB3  . ALA A 1 39  ? 5.368   10.929 27.271  1.00 0.00  ? 39  ALA A HB3  5  
ATOM   11056 N  N    . PHE A 1 40  ? 5.681   8.299  27.969  1.00 0.00  ? 40  PHE A N    5  
ATOM   11057 C  CA   . PHE A 1 40  ? 6.717   7.581  28.762  1.00 0.00  ? 40  PHE A CA   5  
ATOM   11058 C  C    . PHE A 1 40  ? 7.167   6.347  27.979  1.00 0.00  ? 40  PHE A C    5  
ATOM   11059 O  O    . PHE A 1 40  ? 8.334   6.017  27.938  1.00 0.00  ? 40  PHE A O    5  
ATOM   11060 C  CB   . PHE A 1 40  ? 6.123   7.147  30.105  1.00 0.00  ? 40  PHE A CB   5  
ATOM   11061 C  CG   . PHE A 1 40  ? 7.127   6.310  30.862  1.00 0.00  ? 40  PHE A CG   5  
ATOM   11062 C  CD1  . PHE A 1 40  ? 8.352   6.865  31.250  1.00 0.00  ? 40  PHE A CD1  5  
ATOM   11063 C  CD2  . PHE A 1 40  ? 6.830   4.979  31.177  1.00 0.00  ? 40  PHE A CD2  5