data_1ICH
# 
_entry.id   1ICH 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1ICH         
RCSB  RCSB013155   
WWPDB D_1000013155 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1ICH 
_pdbx_database_status.recvd_initial_deposition_date   2001-04-01 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Sukits, S.F.' 1 
'Lin, L.-L.'   2 
'Malakian, K.' 3 
'Powers, R.'   4 
'Xu, G.-Y.'    5 
# 
_citation.id                        primary 
_citation.title                     'Solution structure of the tumor necrosis factor receptor-1 death domain.' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            310 
_citation.page_first                895 
_citation.page_last                 906 
_citation.year                      2001 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   11453696 
_citation.pdbx_database_id_DOI      10.1006/jmbi.2001.4790 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Sukits, S.F.' 1 
primary 'Lin, L.L.'    2 
primary 'Hsu, S.'      3 
primary 'Malakian, K.' 4 
primary 'Powers, R.'   5 
primary 'Xu, G.Y.'     6 
# 
_cell.entry_id           1ICH 
_cell.length_a           ? 
_cell.length_b           ? 
_cell.length_c           ? 
_cell.angle_alpha        ? 
_cell.angle_beta         ? 
_cell.angle_gamma        ? 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'TUMOR NECROSIS FACTOR RECEPTOR-1' 
_entity.formula_weight             12807.777 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              R347K 
_entity.pdbx_fragment              'DEATH DOMAIN' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        TNF-1 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MAHKPQSLDTDDPATLYAVVENVPPLRWKEFVKRLGLSDHEIDRLELQNGRCLREAQYSMLATWRRRTPRREATLELLGR
VLRDMDLLGCLEDIEEALCGPAALPPAPSLLR
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MAHKPQSLDTDDPATLYAVVENVPPLRWKEFVKRLGLSDHEIDRLELQNGRCLREAQYSMLATWRRRTPRREATLELLGR
VLRDMDLLGCLEDIEEALCGPAALPPAPSLLR
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   HIS n 
1 4   LYS n 
1 5   PRO n 
1 6   GLN n 
1 7   SER n 
1 8   LEU n 
1 9   ASP n 
1 10  THR n 
1 11  ASP n 
1 12  ASP n 
1 13  PRO n 
1 14  ALA n 
1 15  THR n 
1 16  LEU n 
1 17  TYR n 
1 18  ALA n 
1 19  VAL n 
1 20  VAL n 
1 21  GLU n 
1 22  ASN n 
1 23  VAL n 
1 24  PRO n 
1 25  PRO n 
1 26  LEU n 
1 27  ARG n 
1 28  TRP n 
1 29  LYS n 
1 30  GLU n 
1 31  PHE n 
1 32  VAL n 
1 33  LYS n 
1 34  ARG n 
1 35  LEU n 
1 36  GLY n 
1 37  LEU n 
1 38  SER n 
1 39  ASP n 
1 40  HIS n 
1 41  GLU n 
1 42  ILE n 
1 43  ASP n 
1 44  ARG n 
1 45  LEU n 
1 46  GLU n 
1 47  LEU n 
1 48  GLN n 
1 49  ASN n 
1 50  GLY n 
1 51  ARG n 
1 52  CYS n 
1 53  LEU n 
1 54  ARG n 
1 55  GLU n 
1 56  ALA n 
1 57  GLN n 
1 58  TYR n 
1 59  SER n 
1 60  MET n 
1 61  LEU n 
1 62  ALA n 
1 63  THR n 
1 64  TRP n 
1 65  ARG n 
1 66  ARG n 
1 67  ARG n 
1 68  THR n 
1 69  PRO n 
1 70  ARG n 
1 71  ARG n 
1 72  GLU n 
1 73  ALA n 
1 74  THR n 
1 75  LEU n 
1 76  GLU n 
1 77  LEU n 
1 78  LEU n 
1 79  GLY n 
1 80  ARG n 
1 81  VAL n 
1 82  LEU n 
1 83  ARG n 
1 84  ASP n 
1 85  MET n 
1 86  ASP n 
1 87  LEU n 
1 88  LEU n 
1 89  GLY n 
1 90  CYS n 
1 91  LEU n 
1 92  GLU n 
1 93  ASP n 
1 94  ILE n 
1 95  GLU n 
1 96  GLU n 
1 97  ALA n 
1 98  LEU n 
1 99  CYS n 
1 100 GLY n 
1 101 PRO n 
1 102 ALA n 
1 103 ALA n 
1 104 LEU n 
1 105 PRO n 
1 106 PRO n 
1 107 ALA n 
1 108 PRO n 
1 109 SER n 
1 110 LEU n 
1 111 LEU n 
1 112 ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL-21 (DE) PLYS' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'PRSET(T7)' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    TNR1A_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;AHKPQSLDTDDPATLYAVVENVPPLRWKEFVRRLGLSDHEIDRLELQNGRCLREAQYSMLATWRRRTPRREATLELLGRV
LRDMDLLGCLEDIEEALCGPAALPPAPSLLR
;
_struct_ref.pdbx_align_begin           345 
_struct_ref.pdbx_db_accession          P19438 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1ICH 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 2 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 112 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P19438 
_struct_ref_seq.db_align_beg                  345 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  455 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       316 
_struct_ref_seq.pdbx_auth_seq_align_end       426 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1ICH MET A 1  ? UNP P19438 ?   ?   'INITIATING METHIONINE' 315 1 
1 1ICH LYS A 33 ? UNP P19438 ARG 376 ENGINEERED              347 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
1 1 1 3D_15N-separated_NOESY 
2 1 1 3D_13C-separated_NOESY 
3 1 1 4D_13C-separated_NOESY 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         308 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  4.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      '10 mM' 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         '1 mM sample' 
_pdbx_nmr_sample_details.solvent_system   '10 mM Sodium acetate at pH 4.0, 10 mM DTT' 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.type              ? 
_pdbx_nmr_spectrometer.manufacturer      Varian 
_pdbx_nmr_spectrometer.model             UNITYPLUS 
_pdbx_nmr_spectrometer.field_strength    600 
# 
_pdbx_nmr_refine.entry_id           1ICH 
_pdbx_nmr_refine.method             'Distance geometry, Simulated annealing molecular dynamics' 
_pdbx_nmr_refine.details            
;The structures were based on a total of 1167 distance constraints from NOE and H-Bond, 117 dihedral angle constraints from 3D HNHA and TALOS program and 81 pairs of CA/CB chemical shift contraints.
;
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   1ICH 
_pdbx_nmr_details.text       
'The structure was determinined using 3D triple-resonance experiments with the enhanced-sensitivity pulse field gradient approach.' 
# 
_pdbx_nmr_ensemble.entry_id                                      1ICH 
_pdbx_nmr_ensemble.conformers_calculated_total_number            ? 
_pdbx_nmr_ensemble.conformers_submitted_total_number             1 
_pdbx_nmr_ensemble.conformer_selection_criteria                  ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
loop_
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
X-PLOR  9.8           'structure solution' 'Badger, J., Kumar, R.A., Yip, P.' 1 
NMRPipe '1.8, 2000'   processing           'Delaglio, F.'                     2 
pipp    '4.2.2, 1998' 'data analysis'      'Garrett, D.'                      3 
X-PLOR  9.8           refinement           'Badger, J., Kumar, R.A., Yip, P.' 4 
# 
_exptl.entry_id          1ICH 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.crystal_id             1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_struct.entry_id                  1ICH 
_struct.title                     'SOLUTION STRUCTURE OF THE TUMOR NECROSIS FACTOR RECEPTOR-1 DEATH DOMAIN' 
_struct.pdbx_descriptor           'TUMOR NECROSIS FACTOR RECEPTOR-1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1ICH 
_struct_keywords.pdbx_keywords   APOPTOSIS 
_struct_keywords.text            'death domain, APOPTOSIS' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 PRO A 13 ? VAL A 23 ? PRO A 327 VAL A 337 1 ? 11 
HELX_P HELX_P2 2 ARG A 27 ? GLY A 36 ? ARG A 341 GLY A 350 1 ? 10 
HELX_P HELX_P3 3 SER A 38 ? ASN A 49 ? SER A 352 ASN A 363 1 ? 12 
HELX_P HELX_P4 4 CYS A 52 ? THR A 68 ? CYS A 366 THR A 382 1 ? 17 
HELX_P HELX_P5 5 ALA A 73 ? MET A 85 ? ALA A 387 MET A 399 1 ? 13 
HELX_P HELX_P6 6 LEU A 87 ? CYS A 99 ? LEU A 401 CYS A 413 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_database_PDB_matrix.entry_id          1ICH 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1ICH 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    N N    . PRO A 1 13 ? 3.263   0.319   11.216  1.00 0.54 ? 327 PRO A N    1 
ATOM 2    C CA   . PRO A 1 13 ? 2.585   1.591   10.831  1.00 0.54 ? 327 PRO A CA   1 
ATOM 3    C C    . PRO A 1 13 ? 3.562   2.551   10.153  1.00 0.46 ? 327 PRO A C    1 
ATOM 4    O O    . PRO A 1 13 ? 3.255   3.127   9.134   1.00 0.42 ? 327 PRO A O    1 
ATOM 5    C CB   . PRO A 1 13 ? 2.116   2.177   12.153  1.00 0.63 ? 327 PRO A CB   1 
ATOM 6    C CG   . PRO A 1 13 ? 3.037   1.592   13.169  1.00 0.66 ? 327 PRO A CG   1 
ATOM 7    C CD   . PRO A 1 13 ? 3.423   0.224   12.673  1.00 0.62 ? 327 PRO A CD   1 
ATOM 8    H HA   . PRO A 1 13 ? 1.737   1.399   10.194  1.00 0.55 ? 327 PRO A HA   1 
ATOM 9    H HB2  . PRO A 1 13 ? 2.205   3.256   12.136  1.00 0.63 ? 327 PRO A HB2  1 
ATOM 10   H HB3  . PRO A 1 13 ? 1.097   1.885   12.357  1.00 0.68 ? 327 PRO A HB3  1 
ATOM 11   H HG2  . PRO A 1 13 ? 3.918   2.209   13.260  1.00 0.65 ? 327 PRO A HG2  1 
ATOM 12   H HG3  . PRO A 1 13 ? 2.539   1.507   14.120  1.00 0.73 ? 327 PRO A HG3  1 
ATOM 13   H HD2  . PRO A 1 13 ? 4.452   0.005   12.931  1.00 0.61 ? 327 PRO A HD2  1 
ATOM 14   H HD3  . PRO A 1 13 ? 2.762   -0.531  13.071  1.00 0.67 ? 327 PRO A HD3  1 
ATOM 15   N N    . ALA A 1 14 ? 4.734   2.737   10.713  1.00 0.47 ? 328 ALA A N    1 
ATOM 16   C CA   . ALA A 1 14 ? 5.717   3.670   10.085  1.00 0.44 ? 328 ALA A CA   1 
ATOM 17   C C    . ALA A 1 14 ? 5.991   3.219   8.647   1.00 0.36 ? 328 ALA A C    1 
ATOM 18   O O    . ALA A 1 14 ? 6.055   4.020   7.735   1.00 0.35 ? 328 ALA A O    1 
ATOM 19   C CB   . ALA A 1 14 ? 7.017   3.666   10.895  1.00 0.50 ? 328 ALA A CB   1 
ATOM 20   H H    . ALA A 1 14 ? 4.964   2.266   11.547  1.00 0.51 ? 328 ALA A H    1 
ATOM 21   H HA   . ALA A 1 14 ? 5.308   4.669   10.072  1.00 0.45 ? 328 ALA A HA   1 
ATOM 22   H HB1  . ALA A 1 14 ? 6.809   3.983   11.907  1.00 1.15 ? 328 ALA A HB1  1 
ATOM 23   H HB2  . ALA A 1 14 ? 7.723   4.348   10.442  1.00 1.09 ? 328 ALA A HB2  1 
ATOM 24   H HB3  . ALA A 1 14 ? 7.437   2.672   10.909  1.00 1.17 ? 328 ALA A HB3  1 
ATOM 25   N N    . THR A 1 15 ? 6.134   1.944   8.430   1.00 0.34 ? 329 THR A N    1 
ATOM 26   C CA   . THR A 1 15 ? 6.373   1.451   7.048   1.00 0.31 ? 329 THR A CA   1 
ATOM 27   C C    . THR A 1 15 ? 5.193   1.856   6.166   1.00 0.29 ? 329 THR A C    1 
ATOM 28   O O    . THR A 1 15 ? 5.353   2.224   5.023   1.00 0.28 ? 329 THR A O    1 
ATOM 29   C CB   . THR A 1 15 ? 6.469   -0.073  7.064   1.00 0.32 ? 329 THR A CB   1 
ATOM 30   O OG1  . THR A 1 15 ? 7.395   -0.482  8.055   1.00 0.34 ? 329 THR A OG1  1 
ATOM 31   C CG2  . THR A 1 15 ? 6.926   -0.578  5.694   1.00 0.32 ? 329 THR A CG2  1 
ATOM 32   H H    . THR A 1 15 ? 6.068   1.305   9.173   1.00 0.36 ? 329 THR A H    1 
ATOM 33   H HA   . THR A 1 15 ? 7.290   1.867   6.658   1.00 0.31 ? 329 THR A HA   1 
ATOM 34   H HB   . THR A 1 15 ? 5.501   -0.494  7.286   1.00 0.34 ? 329 THR A HB   1 
ATOM 35   H HG1  . THR A 1 15 ? 7.022   -1.246  8.509   1.00 0.75 ? 329 THR A HG1  1 
ATOM 36   H HG21 . THR A 1 15 ? 7.200   0.265   5.073   1.00 1.03 ? 329 THR A HG21 1 
ATOM 37   H HG22 . THR A 1 15 ? 6.119   -1.124  5.225   1.00 1.06 ? 329 THR A HG22 1 
ATOM 38   H HG23 . THR A 1 15 ? 7.779   -1.236  5.814   1.00 1.04 ? 329 THR A HG23 1 
ATOM 39   N N    . LEU A 1 16 ? 4.001   1.774   6.697   1.00 0.31 ? 330 LEU A N    1 
ATOM 40   C CA   . LEU A 1 16 ? 2.806   2.144   5.895   1.00 0.32 ? 330 LEU A CA   1 
ATOM 41   C C    . LEU A 1 16 ? 2.929   3.609   5.464   1.00 0.30 ? 330 LEU A C    1 
ATOM 42   O O    . LEU A 1 16 ? 2.668   3.954   4.332   1.00 0.28 ? 330 LEU A O    1 
ATOM 43   C CB   . LEU A 1 16 ? 1.530   1.951   6.738   1.00 0.39 ? 330 LEU A CB   1 
ATOM 44   C CG   . LEU A 1 16 ? 1.507   0.544   7.350   1.00 0.40 ? 330 LEU A CG   1 
ATOM 45   C CD1  . LEU A 1 16 ? 0.161   0.312   8.048   1.00 1.04 ? 330 LEU A CD1  1 
ATOM 46   C CD2  . LEU A 1 16 ? 1.699   -0.517  6.263   1.00 1.42 ? 330 LEU A CD2  1 
ATOM 47   H H    . LEU A 1 16 ? 3.893   1.467   7.626   1.00 0.34 ? 330 LEU A H    1 
ATOM 48   H HA   . LEU A 1 16 ? 2.760   1.517   5.020   1.00 0.32 ? 330 LEU A HA   1 
ATOM 49   H HB2  . LEU A 1 16 ? 1.509   2.682   7.535   1.00 0.39 ? 330 LEU A HB2  1 
ATOM 50   H HB3  . LEU A 1 16 ? 0.656   2.082   6.114   1.00 0.53 ? 330 LEU A HB3  1 
ATOM 51   H HG   . LEU A 1 16 ? 2.302   0.458   8.079   1.00 0.98 ? 330 LEU A HG   1 
ATOM 52   H HD11 . LEU A 1 16 ? 0.132   0.876   8.968   1.00 1.54 ? 330 LEU A HD11 1 
ATOM 53   H HD12 . LEU A 1 16 ? 0.038   -0.741  8.269   1.00 1.65 ? 330 LEU A HD12 1 
ATOM 54   H HD13 . LEU A 1 16 ? -0.637  0.638   7.402   1.00 1.65 ? 330 LEU A HD13 1 
ATOM 55   H HD21 . LEU A 1 16 ? 1.589   -0.068  5.290   1.00 2.08 ? 330 LEU A HD21 1 
ATOM 56   H HD22 . LEU A 1 16 ? 0.959   -1.295  6.389   1.00 1.84 ? 330 LEU A HD22 1 
ATOM 57   H HD23 . LEU A 1 16 ? 2.686   -0.947  6.351   1.00 1.95 ? 330 LEU A HD23 1 
ATOM 58   N N    . TYR A 1 17 ? 3.344   4.480   6.351   1.00 0.32 ? 331 TYR A N    1 
ATOM 59   C CA   . TYR A 1 17 ? 3.494   5.912   5.960   1.00 0.33 ? 331 TYR A CA   1 
ATOM 60   C C    . TYR A 1 17 ? 4.511   6.002   4.833   1.00 0.30 ? 331 TYR A C    1 
ATOM 61   O O    . TYR A 1 17 ? 4.352   6.754   3.894   1.00 0.31 ? 331 TYR A O    1 
ATOM 62   C CB   . TYR A 1 17 ? 3.994   6.729   7.153   1.00 0.38 ? 331 TYR A CB   1 
ATOM 63   C CG   . TYR A 1 17 ? 2.861   6.952   8.139   1.00 0.44 ? 331 TYR A CG   1 
ATOM 64   C CD1  . TYR A 1 17 ? 1.604   7.416   7.686   1.00 1.40 ? 331 TYR A CD1  1 
ATOM 65   C CD2  . TYR A 1 17 ? 3.074   6.700   9.512   1.00 1.20 ? 331 TYR A CD2  1 
ATOM 66   C CE1  . TYR A 1 17 ? 0.562   7.606   8.598   1.00 1.43 ? 331 TYR A CE1  1 
ATOM 67   C CE2  . TYR A 1 17 ? 2.029   6.898   10.425  1.00 1.22 ? 331 TYR A CE2  1 
ATOM 68   C CZ   . TYR A 1 17 ? 0.773   7.341   9.969   1.00 0.59 ? 331 TYR A CZ   1 
ATOM 69   O OH   . TYR A 1 17 ? -0.247  7.528   10.878  1.00 0.67 ? 331 TYR A OH   1 
ATOM 70   H H    . TYR A 1 17 ? 3.570   4.192   7.266   1.00 0.34 ? 331 TYR A H    1 
ATOM 71   H HA   . TYR A 1 17 ? 2.549   6.301   5.625   1.00 0.35 ? 331 TYR A HA   1 
ATOM 72   H HB2  . TYR A 1 17 ? 4.799   6.190   7.634   1.00 0.39 ? 331 TYR A HB2  1 
ATOM 73   H HB3  . TYR A 1 17 ? 4.363   7.680   6.809   1.00 0.40 ? 331 TYR A HB3  1 
ATOM 74   H HD1  . TYR A 1 17 ? 1.453   7.642   6.638   1.00 2.30 ? 331 TYR A HD1  1 
ATOM 75   H HD2  . TYR A 1 17 ? 4.037   6.326   9.857   1.00 2.09 ? 331 TYR A HD2  1 
ATOM 76   H HE1  . TYR A 1 17 ? -0.407  7.932   8.248   1.00 2.33 ? 331 TYR A HE1  1 
ATOM 77   H HE2  . TYR A 1 17 ? 2.189   6.726   11.484  1.00 2.11 ? 331 TYR A HE2  1 
ATOM 78   H HH   . TYR A 1 17 ? -0.761  8.285   10.593  1.00 1.05 ? 331 TYR A HH   1 
ATOM 79   N N    . ALA A 1 18 ? 5.559   5.234   4.924   1.00 0.30 ? 332 ALA A N    1 
ATOM 80   C CA   . ALA A 1 18 ? 6.593   5.265   3.870   1.00 0.31 ? 332 ALA A CA   1 
ATOM 81   C C    . ALA A 1 18 ? 5.986   4.803   2.552   1.00 0.28 ? 332 ALA A C    1 
ATOM 82   O O    . ALA A 1 18 ? 6.147   5.430   1.527   1.00 0.30 ? 332 ALA A O    1 
ATOM 83   C CB   . ALA A 1 18 ? 7.738   4.327   4.253   1.00 0.35 ? 332 ALA A CB   1 
ATOM 84   H H    . ALA A 1 18 ? 5.663   4.639   5.690   1.00 0.32 ? 332 ALA A H    1 
ATOM 85   H HA   . ALA A 1 18 ? 6.964   6.271   3.762   1.00 0.35 ? 332 ALA A HA   1 
ATOM 86   H HB1  . ALA A 1 18 ? 8.195   3.947   3.358   1.00 1.06 ? 332 ALA A HB1  1 
ATOM 87   H HB2  . ALA A 1 18 ? 7.357   3.501   4.840   1.00 0.95 ? 332 ALA A HB2  1 
ATOM 88   H HB3  . ALA A 1 18 ? 8.469   4.871   4.833   1.00 1.11 ? 332 ALA A HB3  1 
ATOM 89   N N    . VAL A 1 19 ? 5.296   3.703   2.569   1.00 0.26 ? 333 VAL A N    1 
ATOM 90   C CA   . VAL A 1 19 ? 4.690   3.197   1.310   1.00 0.25 ? 333 VAL A CA   1 
ATOM 91   C C    . VAL A 1 19 ? 3.714   4.242   0.770   1.00 0.23 ? 333 VAL A C    1 
ATOM 92   O O    . VAL A 1 19 ? 3.632   4.467   -0.422  1.00 0.26 ? 333 VAL A O    1 
ATOM 93   C CB   . VAL A 1 19 ? 3.961   1.893   1.587   1.00 0.28 ? 333 VAL A CB   1 
ATOM 94   C CG1  . VAL A 1 19 ? 3.346   1.379   0.290   1.00 0.30 ? 333 VAL A CG1  1 
ATOM 95   C CG2  . VAL A 1 19 ? 4.963   0.871   2.134   1.00 0.32 ? 333 VAL A CG2  1 
ATOM 96   H H    . VAL A 1 19 ? 5.180   3.207   3.411   1.00 0.27 ? 333 VAL A H    1 
ATOM 97   H HA   . VAL A 1 19 ? 5.467   3.024   0.579   1.00 0.28 ? 333 VAL A HA   1 
ATOM 98   H HB   . VAL A 1 19 ? 3.181   2.064   2.315   1.00 0.27 ? 333 VAL A HB   1 
ATOM 99   H HG11 . VAL A 1 19 ? 2.577   2.064   -0.036  1.00 1.07 ? 333 VAL A HG11 1 
ATOM 100  H HG12 . VAL A 1 19 ? 2.919   0.403   0.462   1.00 0.99 ? 333 VAL A HG12 1 
ATOM 101  H HG13 . VAL A 1 19 ? 4.113   1.313   -0.467  1.00 1.05 ? 333 VAL A HG13 1 
ATOM 102  H HG21 . VAL A 1 19 ? 5.737   0.698   1.402   1.00 1.03 ? 333 VAL A HG21 1 
ATOM 103  H HG22 . VAL A 1 19 ? 4.451   -0.057  2.352   1.00 0.99 ? 333 VAL A HG22 1 
ATOM 104  H HG23 . VAL A 1 19 ? 5.409   1.257   3.037   1.00 1.06 ? 333 VAL A HG23 1 
ATOM 105  N N    . VAL A 1 20 ? 2.959   4.884   1.632   1.00 0.21 ? 334 VAL A N    1 
ATOM 106  C CA   . VAL A 1 20 ? 1.993   5.909   1.142   1.00 0.24 ? 334 VAL A CA   1 
ATOM 107  C C    . VAL A 1 20 ? 2.750   7.025   0.415   1.00 0.26 ? 334 VAL A C    1 
ATOM 108  O O    . VAL A 1 20 ? 2.304   7.539   -0.591  1.00 0.30 ? 334 VAL A O    1 
ATOM 109  C CB   . VAL A 1 20 ? 1.208   6.515   2.313   1.00 0.29 ? 334 VAL A CB   1 
ATOM 110  C CG1  . VAL A 1 20 ? 0.302   7.633   1.786   1.00 0.40 ? 334 VAL A CG1  1 
ATOM 111  C CG2  . VAL A 1 20 ? 0.339   5.440   2.963   1.00 0.34 ? 334 VAL A CG2  1 
ATOM 112  H H    . VAL A 1 20 ? 3.026   4.693   2.588   1.00 0.21 ? 334 VAL A H    1 
ATOM 113  H HA   . VAL A 1 20 ? 1.304   5.445   0.460   1.00 0.27 ? 334 VAL A HA   1 
ATOM 114  H HB   . VAL A 1 20 ? 1.897   6.919   3.042   1.00 0.30 ? 334 VAL A HB   1 
ATOM 115  H HG11 . VAL A 1 20 ? 0.259   7.576   0.707   1.00 1.16 ? 334 VAL A HG11 1 
ATOM 116  H HG12 . VAL A 1 20 ? 0.704   8.591   2.079   1.00 1.12 ? 334 VAL A HG12 1 
ATOM 117  H HG13 . VAL A 1 20 ? -0.692  7.514   2.191   1.00 0.98 ? 334 VAL A HG13 1 
ATOM 118  H HG21 . VAL A 1 20 ? 0.157   4.649   2.253   1.00 1.13 ? 334 VAL A HG21 1 
ATOM 119  H HG22 . VAL A 1 20 ? -0.605  5.876   3.266   1.00 1.08 ? 334 VAL A HG22 1 
ATOM 120  H HG23 . VAL A 1 20 ? 0.849   5.043   3.828   1.00 0.99 ? 334 VAL A HG23 1 
ATOM 121  N N    . GLU A 1 21 ? 3.875   7.421   0.939   1.00 0.32 ? 335 GLU A N    1 
ATOM 122  C CA   . GLU A 1 21 ? 4.650   8.524   0.308   1.00 0.39 ? 335 GLU A CA   1 
ATOM 123  C C    . GLU A 1 21 ? 5.505   7.997   -0.845  1.00 0.43 ? 335 GLU A C    1 
ATOM 124  O O    . GLU A 1 21 ? 5.487   8.533   -1.936  1.00 0.49 ? 335 GLU A O    1 
ATOM 125  C CB   . GLU A 1 21 ? 5.553   9.160   1.369   1.00 0.43 ? 335 GLU A CB   1 
ATOM 126  C CG   . GLU A 1 21 ? 4.690   9.909   2.390   1.00 1.18 ? 335 GLU A CG   1 
ATOM 127  C CD   . GLU A 1 21 ? 5.594   10.549  3.443   1.00 1.50 ? 335 GLU A CD   1 
ATOM 128  O OE1  . GLU A 1 21 ? 6.739   10.139  3.537   1.00 1.92 ? 335 GLU A OE1  1 
ATOM 129  O OE2  . GLU A 1 21 ? 5.130   11.435  4.136   1.00 2.12 ? 335 GLU A OE2  1 
ATOM 130  H H    . GLU A 1 21 ? 4.205   7.008   1.767   1.00 0.37 ? 335 GLU A H    1 
ATOM 131  H HA   . GLU A 1 21 ? 3.974   9.273   -0.067  1.00 0.42 ? 335 GLU A HA   1 
ATOM 132  H HB2  . GLU A 1 21 ? 6.118   8.389   1.872   1.00 0.99 ? 335 GLU A HB2  1 
ATOM 133  H HB3  . GLU A 1 21 ? 6.233   9.856   0.898   1.00 0.93 ? 335 GLU A HB3  1 
ATOM 134  H HG2  . GLU A 1 21 ? 4.121   10.675  1.883   1.00 1.74 ? 335 GLU A HG2  1 
ATOM 135  H HG3  . GLU A 1 21 ? 4.018   9.218   2.874   1.00 1.94 ? 335 GLU A HG3  1 
ATOM 136  N N    . ASN A 1 22 ? 6.274   6.969   -0.617  1.00 0.42 ? 336 ASN A N    1 
ATOM 137  C CA   . ASN A 1 22 ? 7.144   6.431   -1.708  1.00 0.48 ? 336 ASN A CA   1 
ATOM 138  C C    . ASN A 1 22 ? 6.310   5.980   -2.905  1.00 0.46 ? 336 ASN A C    1 
ATOM 139  O O    . ASN A 1 22 ? 6.690   6.184   -4.047  1.00 0.55 ? 336 ASN A O    1 
ATOM 140  C CB   . ASN A 1 22 ? 7.963   5.252   -1.186  1.00 0.52 ? 336 ASN A CB   1 
ATOM 141  C CG   . ASN A 1 22 ? 9.045   5.769   -0.248  1.00 0.81 ? 336 ASN A CG   1 
ATOM 142  O OD1  . ASN A 1 22 ? 10.042  6.302   -0.693  1.00 1.69 ? 336 ASN A OD1  1 
ATOM 143  N ND2  . ASN A 1 22 ? 8.887   5.632   1.034   1.00 1.26 ? 336 ASN A ND2  1 
ATOM 144  H H    . ASN A 1 22 ? 6.292   6.555   0.271   1.00 0.40 ? 336 ASN A H    1 
ATOM 145  H HA   . ASN A 1 22 ? 7.814   7.208   -2.042  1.00 0.55 ? 336 ASN A HA   1 
ATOM 146  H HB2  . ASN A 1 22 ? 7.317   4.574   -0.653  1.00 0.89 ? 336 ASN A HB2  1 
ATOM 147  H HB3  . ASN A 1 22 ? 8.421   4.730   -2.017  1.00 0.71 ? 336 ASN A HB3  1 
ATOM 148  H HD21 . ASN A 1 22 ? 8.080   5.200   1.381   1.00 1.80 ? 336 ASN A HD21 1 
ATOM 149  H HD22 . ASN A 1 22 ? 9.573   5.954   1.649   1.00 1.61 ? 336 ASN A HD22 1 
ATOM 150  N N    . VAL A 1 23 ? 5.190   5.363   -2.680  1.00 0.37 ? 337 VAL A N    1 
ATOM 151  C CA   . VAL A 1 23 ? 4.368   4.910   -3.831  1.00 0.36 ? 337 VAL A CA   1 
ATOM 152  C C    . VAL A 1 23 ? 3.495   6.080   -4.321  1.00 0.41 ? 337 VAL A C    1 
ATOM 153  O O    . VAL A 1 23 ? 2.966   6.827   -3.523  1.00 0.43 ? 337 VAL A O    1 
ATOM 154  C CB   . VAL A 1 23 ? 3.507   3.735   -3.387  1.00 0.32 ? 337 VAL A CB   1 
ATOM 155  C CG1  . VAL A 1 23 ? 2.683   3.237   -4.568  1.00 0.37 ? 337 VAL A CG1  1 
ATOM 156  C CG2  . VAL A 1 23 ? 4.413   2.601   -2.895  1.00 0.38 ? 337 VAL A CG2  1 
ATOM 157  H H    . VAL A 1 23 ? 4.888   5.198   -1.767  1.00 0.32 ? 337 VAL A H    1 
ATOM 158  H HA   . VAL A 1 23 ? 5.027   4.590   -4.629  1.00 0.41 ? 337 VAL A HA   1 
ATOM 159  H HB   . VAL A 1 23 ? 2.852   4.045   -2.590  1.00 0.34 ? 337 VAL A HB   1 
ATOM 160  H HG11 . VAL A 1 23 ? 3.338   2.756   -5.282  1.00 1.00 ? 337 VAL A HG11 1 
ATOM 161  H HG12 . VAL A 1 23 ? 2.189   4.073   -5.037  1.00 1.09 ? 337 VAL A HG12 1 
ATOM 162  H HG13 . VAL A 1 23 ? 1.947   2.527   -4.221  1.00 1.11 ? 337 VAL A HG13 1 
ATOM 163  H HG21 . VAL A 1 23 ? 5.132   2.349   -3.666  1.00 1.02 ? 337 VAL A HG21 1 
ATOM 164  H HG22 . VAL A 1 23 ? 3.812   1.733   -2.668  1.00 1.16 ? 337 VAL A HG22 1 
ATOM 165  H HG23 . VAL A 1 23 ? 4.938   2.916   -2.004  1.00 1.06 ? 337 VAL A HG23 1 
ATOM 166  N N    . PRO A 1 24 ? 3.393   6.221   -5.620  1.00 0.48 ? 338 PRO A N    1 
ATOM 167  C CA   . PRO A 1 24 ? 2.603   7.337   -6.213  1.00 0.58 ? 338 PRO A CA   1 
ATOM 168  C C    . PRO A 1 24 ? 1.118   7.209   -5.845  1.00 0.58 ? 338 PRO A C    1 
ATOM 169  O O    . PRO A 1 24 ? 0.620   6.112   -5.688  1.00 0.57 ? 338 PRO A O    1 
ATOM 170  C CB   . PRO A 1 24 ? 2.833   7.165   -7.719  1.00 0.67 ? 338 PRO A CB   1 
ATOM 171  C CG   . PRO A 1 24 ? 3.186   5.723   -7.878  1.00 0.61 ? 338 PRO A CG   1 
ATOM 172  C CD   . PRO A 1 24 ? 3.974   5.360   -6.651  1.00 0.52 ? 338 PRO A CD   1 
ATOM 173  H HA   . PRO A 1 24 ? 2.995   8.290   -5.890  1.00 0.62 ? 338 PRO A HA   1 
ATOM 174  H HB2  . PRO A 1 24 ? 1.932   7.399   -8.269  1.00 0.72 ? 338 PRO A HB2  1 
ATOM 175  H HB3  . PRO A 1 24 ? 3.652   7.783   -8.055  1.00 0.74 ? 338 PRO A HB3  1 
ATOM 176  H HG2  . PRO A 1 24 ? 2.287   5.123   -7.942  1.00 0.59 ? 338 PRO A HG2  1 
ATOM 177  H HG3  . PRO A 1 24 ? 3.796   5.577   -8.757  1.00 0.69 ? 338 PRO A HG3  1 
ATOM 178  H HD2  . PRO A 1 24 ? 3.838   4.318   -6.400  1.00 0.48 ? 338 PRO A HD2  1 
ATOM 179  H HD3  . PRO A 1 24 ? 5.019   5.592   -6.781  1.00 0.57 ? 338 PRO A HD3  1 
ATOM 180  N N    . PRO A 1 25 ? 0.460   8.339   -5.703  1.00 0.65 ? 339 PRO A N    1 
ATOM 181  C CA   . PRO A 1 25 ? -0.982  8.339   -5.339  1.00 0.70 ? 339 PRO A CA   1 
ATOM 182  C C    . PRO A 1 25 ? -1.863  8.079   -6.566  1.00 0.82 ? 339 PRO A C    1 
ATOM 183  O O    . PRO A 1 25 ? -2.760  7.254   -6.544  1.00 1.07 ? 339 PRO A O    1 
ATOM 184  C CB   . PRO A 1 25 ? -1.213  9.754   -4.824  1.00 0.76 ? 339 PRO A CB   1 
ATOM 185  C CG   . PRO A 1 25 ? -0.167  10.599  -5.483  1.00 0.83 ? 339 PRO A CG   1 
ATOM 186  C CD   . PRO A 1 25 ? 0.986   9.702   -5.855  1.00 0.74 ? 339 PRO A CD   1 
ATOM 187  H HA   . PRO A 1 25 ? -1.186  7.625   -4.559  1.00 0.66 ? 339 PRO A HA   1 
ATOM 188  H HB2  . PRO A 1 25 ? -2.201  10.096  -5.101  1.00 0.85 ? 339 PRO A HB2  1 
ATOM 189  H HB3  . PRO A 1 25 ? -1.088  9.790   -3.756  1.00 0.73 ? 339 PRO A HB3  1 
ATOM 190  H HG2  . PRO A 1 25 ? -0.575  11.062  -6.370  1.00 0.93 ? 339 PRO A HG2  1 
ATOM 191  H HG3  . PRO A 1 25 ? 0.174   11.358  -4.796  1.00 0.88 ? 339 PRO A HG3  1 
ATOM 192  H HD2  . PRO A 1 25 ? 1.288   9.884   -6.877  1.00 0.79 ? 339 PRO A HD2  1 
ATOM 193  H HD3  . PRO A 1 25 ? 1.814   9.857   -5.182  1.00 0.74 ? 339 PRO A HD3  1 
ATOM 194  N N    . LEU A 1 26 ? -1.635  8.795   -7.630  1.00 0.90 ? 340 LEU A N    1 
ATOM 195  C CA   . LEU A 1 26 ? -2.474  8.614   -8.852  1.00 1.01 ? 340 LEU A CA   1 
ATOM 196  C C    . LEU A 1 26 ? -2.437  7.156   -9.337  1.00 0.66 ? 340 LEU A C    1 
ATOM 197  O O    . LEU A 1 26 ? -3.454  6.586   -9.684  1.00 0.93 ? 340 LEU A O    1 
ATOM 198  C CB   . LEU A 1 26 ? -1.949  9.543   -9.945  1.00 1.23 ? 340 LEU A CB   1 
ATOM 199  C CG   . LEU A 1 26 ? -2.782  9.373   -11.217 1.00 1.32 ? 340 LEU A CG   1 
ATOM 200  C CD1  . LEU A 1 26 ? -4.210  9.866   -10.964 1.00 1.73 ? 340 LEU A CD1  1 
ATOM 201  C CD2  . LEU A 1 26 ? -2.148  10.188  -12.347 1.00 1.63 ? 340 LEU A CD2  1 
ATOM 202  H H    . LEU A 1 26 ? -0.925  9.468   -7.623  1.00 1.05 ? 340 LEU A H    1 
ATOM 203  H HA   . LEU A 1 26 ? -3.495  8.883   -8.624  1.00 1.37 ? 340 LEU A HA   1 
ATOM 204  H HB2  . LEU A 1 26 ? -2.020  10.565  -9.604  1.00 1.62 ? 340 LEU A HB2  1 
ATOM 205  H HB3  . LEU A 1 26 ? -0.919  9.308   -10.154 1.00 1.11 ? 340 LEU A HB3  1 
ATOM 206  H HG   . LEU A 1 26 ? -2.807  8.329   -11.493 1.00 1.09 ? 340 LEU A HG   1 
ATOM 207  H HD11 . LEU A 1 26 ? -4.209  10.570  -10.146 1.00 2.34 ? 340 LEU A HD11 1 
ATOM 208  H HD12 . LEU A 1 26 ? -4.841  9.027   -10.714 1.00 1.85 ? 340 LEU A HD12 1 
ATOM 209  H HD13 . LEU A 1 26 ? -4.588  10.349  -11.852 1.00 1.94 ? 340 LEU A HD13 1 
ATOM 210  H HD21 . LEU A 1 26 ? -1.091  9.972   -12.397 1.00 1.55 ? 340 LEU A HD21 1 
ATOM 211  H HD22 . LEU A 1 26 ? -2.291  11.242  -12.154 1.00 2.28 ? 340 LEU A HD22 1 
ATOM 212  H HD23 . LEU A 1 26 ? -2.612  9.927   -13.284 1.00 2.06 ? 340 LEU A HD23 1 
ATOM 213  N N    . ARG A 1 27 ? -1.289  6.543   -9.365  1.00 0.40 ? 341 ARG A N    1 
ATOM 214  C CA   . ARG A 1 27 ? -1.217  5.122   -9.829  1.00 0.74 ? 341 ARG A CA   1 
ATOM 215  C C    . ARG A 1 27 ? -1.368  4.171   -8.636  1.00 0.60 ? 341 ARG A C    1 
ATOM 216  O O    . ARG A 1 27 ? -1.185  2.975   -8.760  1.00 0.54 ? 341 ARG A O    1 
ATOM 217  C CB   . ARG A 1 27 ? 0.141   4.877   -10.487 1.00 1.21 ? 341 ARG A CB   1 
ATOM 218  C CG   . ARG A 1 27 ? 0.297   5.814   -11.678 1.00 1.99 ? 341 ARG A CG   1 
ATOM 219  C CD   . ARG A 1 27 ? 0.720   7.191   -11.168 1.00 2.92 ? 341 ARG A CD   1 
ATOM 220  N NE   . ARG A 1 27 ? 1.544   7.878   -12.200 1.00 3.88 ? 341 ARG A NE   1 
ATOM 221  C CZ   . ARG A 1 27 ? 2.847   7.815   -12.144 1.00 4.75 ? 341 ARG A CZ   1 
ATOM 222  N NH1  . ARG A 1 27 ? 3.473   8.193   -11.060 1.00 5.30 ? 341 ARG A NH1  1 
ATOM 223  N NH2  . ARG A 1 27 ? 3.520   7.367   -13.168 1.00 5.38 ? 341 ARG A NH2  1 
ATOM 224  H H    . ARG A 1 27 ? -0.474  7.008   -9.081  1.00 0.41 ? 341 ARG A H    1 
ATOM 225  H HA   . ARG A 1 27 ? -2.001  4.935   -10.547 1.00 1.05 ? 341 ARG A HA   1 
ATOM 226  H HB2  . ARG A 1 27 ? 0.928   5.071   -9.773  1.00 1.55 ? 341 ARG A HB2  1 
ATOM 227  H HB3  . ARG A 1 27 ? 0.204   3.852   -10.827 1.00 1.54 ? 341 ARG A HB3  1 
ATOM 228  H HG2  . ARG A 1 27 ? 1.051   5.423   -12.349 1.00 2.35 ? 341 ARG A HG2  1 
ATOM 229  H HG3  . ARG A 1 27 ? -0.645  5.896   -12.198 1.00 2.22 ? 341 ARG A HG3  1 
ATOM 230  H HD2  . ARG A 1 27 ? -0.160  7.778   -10.958 1.00 2.98 ? 341 ARG A HD2  1 
ATOM 231  H HD3  . ARG A 1 27 ? 1.297   7.078   -10.260 1.00 3.16 ? 341 ARG A HD3  1 
ATOM 232  H HE   . ARG A 1 27 ? 1.109   8.382   -12.920 1.00 4.00 ? 341 ARG A HE   1 
ATOM 233  H HH11 . ARG A 1 27 ? 2.950   8.527   -10.273 1.00 5.14 ? 341 ARG A HH11 1 
ATOM 234  H HH12 . ARG A 1 27 ? 4.472   8.149   -11.017 1.00 6.07 ? 341 ARG A HH12 1 
ATOM 235  H HH21 . ARG A 1 27 ? 3.035   7.072   -13.992 1.00 5.30 ? 341 ARG A HH21 1 
ATOM 236  H HH22 . ARG A 1 27 ? 4.517   7.320   -13.131 1.00 6.13 ? 341 ARG A HH22 1 
ATOM 237  N N    . TRP A 1 28 ? -1.672  4.688   -7.478  1.00 0.59 ? 342 TRP A N    1 
ATOM 238  C CA   . TRP A 1 28 ? -1.791  3.807   -6.285  1.00 0.47 ? 342 TRP A CA   1 
ATOM 239  C C    . TRP A 1 28 ? -2.678  2.593   -6.590  1.00 0.40 ? 342 TRP A C    1 
ATOM 240  O O    . TRP A 1 28 ? -2.307  1.465   -6.330  1.00 0.36 ? 342 TRP A O    1 
ATOM 241  C CB   . TRP A 1 28 ? -2.407  4.589   -5.129  1.00 0.47 ? 342 TRP A CB   1 
ATOM 242  C CG   . TRP A 1 28 ? -2.304  3.761   -3.890  1.00 0.37 ? 342 TRP A CG   1 
ATOM 243  C CD1  . TRP A 1 28 ? -3.175  2.794   -3.520  1.00 0.38 ? 342 TRP A CD1  1 
ATOM 244  C CD2  . TRP A 1 28 ? -1.284  3.810   -2.855  1.00 0.31 ? 342 TRP A CD2  1 
ATOM 245  N NE1  . TRP A 1 28 ? -2.744  2.240   -2.323  1.00 0.33 ? 342 TRP A NE1  1 
ATOM 246  C CE2  . TRP A 1 28 ? -1.583  2.840   -1.872  1.00 0.28 ? 342 TRP A CE2  1 
ATOM 247  C CE3  . TRP A 1 28 ? -0.137  4.600   -2.685  1.00 0.35 ? 342 TRP A CE3  1 
ATOM 248  C CZ2  . TRP A 1 28 ? -0.762  2.664   -0.749  1.00 0.30 ? 342 TRP A CZ2  1 
ATOM 249  C CZ3  . TRP A 1 28 ? 0.686   4.429   -1.565  1.00 0.37 ? 342 TRP A CZ3  1 
ATOM 250  C CH2  . TRP A 1 28 ? 0.376   3.464   -0.597  1.00 0.35 ? 342 TRP A CH2  1 
ATOM 251  H H    . TRP A 1 28 ? -1.797  5.657   -7.387  1.00 0.67 ? 342 TRP A H    1 
ATOM 252  H HA   . TRP A 1 28 ? -0.808  3.473   -6.000  1.00 0.47 ? 342 TRP A HA   1 
ATOM 253  H HB2  . TRP A 1 28 ? -1.869  5.515   -4.992  1.00 0.54 ? 342 TRP A HB2  1 
ATOM 254  H HB3  . TRP A 1 28 ? -3.446  4.803   -5.342  1.00 0.52 ? 342 TRP A HB3  1 
ATOM 255  H HD1  . TRP A 1 28 ? -4.053  2.493   -4.074  1.00 0.46 ? 342 TRP A HD1  1 
ATOM 256  H HE1  . TRP A 1 28 ? -3.193  1.514   -1.839  1.00 0.36 ? 342 TRP A HE1  1 
ATOM 257  H HE3  . TRP A 1 28 ? 0.109   5.344   -3.426  1.00 0.41 ? 342 TRP A HE3  1 
ATOM 258  H HZ2  . TRP A 1 28 ? -1.000  1.917   -0.006  1.00 0.34 ? 342 TRP A HZ2  1 
ATOM 259  H HZ3  . TRP A 1 28 ? 1.563   5.043   -1.447  1.00 0.45 ? 342 TRP A HZ3  1 
ATOM 260  H HH2  . TRP A 1 28 ? 1.012   3.342   0.269   1.00 0.41 ? 342 TRP A HH2  1 
ATOM 261  N N    . LYS A 1 29 ? -3.846  2.804   -7.143  1.00 0.42 ? 343 LYS A N    1 
ATOM 262  C CA   . LYS A 1 29 ? -4.738  1.642   -7.451  1.00 0.39 ? 343 LYS A CA   1 
ATOM 263  C C    . LYS A 1 29 ? -3.965  0.598   -8.253  1.00 0.36 ? 343 LYS A C    1 
ATOM 264  O O    . LYS A 1 29 ? -4.012  -0.579  -7.955  1.00 0.36 ? 343 LYS A O    1 
ATOM 265  C CB   . LYS A 1 29 ? -5.935  2.112   -8.279  1.00 0.46 ? 343 LYS A CB   1 
ATOM 266  C CG   . LYS A 1 29 ? -6.929  0.954   -8.457  1.00 0.46 ? 343 LYS A CG   1 
ATOM 267  C CD   . LYS A 1 29 ? -8.029  1.366   -9.450  1.00 0.55 ? 343 LYS A CD   1 
ATOM 268  C CE   . LYS A 1 29 ? -9.164  0.340   -9.425  1.00 0.91 ? 343 LYS A CE   1 
ATOM 269  N NZ   . LYS A 1 29 ? -10.229 0.732   -10.395 1.00 1.62 ? 343 LYS A NZ   1 
ATOM 270  H H    . LYS A 1 29 ? -4.134  3.717   -7.354  1.00 0.48 ? 343 LYS A H    1 
ATOM 271  H HA   . LYS A 1 29 ? -5.092  1.200   -6.525  1.00 0.39 ? 343 LYS A HA   1 
ATOM 272  H HB2  . LYS A 1 29 ? -6.422  2.928   -7.766  1.00 0.54 ? 343 LYS A HB2  1 
ATOM 273  H HB3  . LYS A 1 29 ? -5.592  2.447   -9.246  1.00 0.47 ? 343 LYS A HB3  1 
ATOM 274  H HG2  . LYS A 1 29 ? -6.408  0.079   -8.829  1.00 0.40 ? 343 LYS A HG2  1 
ATOM 275  H HG3  . LYS A 1 29 ? -7.375  0.724   -7.505  1.00 0.50 ? 343 LYS A HG3  1 
ATOM 276  H HD2  . LYS A 1 29 ? -8.414  2.334   -9.172  1.00 0.93 ? 343 LYS A HD2  1 
ATOM 277  H HD3  . LYS A 1 29 ? -7.615  1.414   -10.447 1.00 0.77 ? 343 LYS A HD3  1 
ATOM 278  H HE2  . LYS A 1 29 ? -8.773  -0.629  -9.698  1.00 1.43 ? 343 LYS A HE2  1 
ATOM 279  H HE3  . LYS A 1 29 ? -9.584  0.292   -8.431  1.00 1.53 ? 343 LYS A HE3  1 
ATOM 280  H HZ1  . LYS A 1 29 ? -10.717 1.586   -10.057 1.00 2.06 ? 343 LYS A HZ1  1 
ATOM 281  H HZ2  . LYS A 1 29 ? -10.914 -0.045  -10.482 1.00 2.12 ? 343 LYS A HZ2  1 
ATOM 282  H HZ3  . LYS A 1 29 ? -9.800  0.922   -11.325 1.00 2.17 ? 343 LYS A HZ3  1 
ATOM 283  N N    . GLU A 1 30 ? -3.232  1.013   -9.250  1.00 0.40 ? 344 GLU A N    1 
ATOM 284  C CA   . GLU A 1 30 ? -2.457  0.014   -10.032 1.00 0.43 ? 344 GLU A CA   1 
ATOM 285  C C    . GLU A 1 30 ? -1.500  -0.682  -9.077  1.00 0.41 ? 344 GLU A C    1 
ATOM 286  O O    . GLU A 1 30 ? -1.384  -1.891  -9.052  1.00 0.42 ? 344 GLU A O    1 
ATOM 287  C CB   . GLU A 1 30 ? -1.661  0.708   -11.133 1.00 0.51 ? 344 GLU A CB   1 
ATOM 288  C CG   . GLU A 1 30 ? -2.621  1.340   -12.143 1.00 1.03 ? 344 GLU A CG   1 
ATOM 289  C CD   . GLU A 1 30 ? -1.817  1.887   -13.320 1.00 1.11 ? 344 GLU A CD   1 
ATOM 290  O OE1  . GLU A 1 30 ? -1.605  1.143   -14.264 1.00 1.22 ? 344 GLU A OE1  1 
ATOM 291  O OE2  . GLU A 1 30 ? -1.412  3.036   -13.251 1.00 1.85 ? 344 GLU A OE2  1 
ATOM 292  H H    . GLU A 1 30 ? -3.186  1.971   -9.468  1.00 0.43 ? 344 GLU A H    1 
ATOM 293  H HA   . GLU A 1 30 ? -3.131  -0.708  -10.468 1.00 0.45 ? 344 GLU A HA   1 
ATOM 294  H HB2  . GLU A 1 30 ? -1.035  1.475   -10.699 1.00 0.68 ? 344 GLU A HB2  1 
ATOM 295  H HB3  . GLU A 1 30 ? -1.045  -0.019  -11.635 1.00 0.71 ? 344 GLU A HB3  1 
ATOM 296  H HG2  . GLU A 1 30 ? -3.317  0.594   -12.497 1.00 1.33 ? 344 GLU A HG2  1 
ATOM 297  H HG3  . GLU A 1 30 ? -3.162  2.150   -11.675 1.00 1.32 ? 344 GLU A HG3  1 
ATOM 298  N N    . PHE A 1 31 ? -0.855  0.084   -8.248  1.00 0.40 ? 345 PHE A N    1 
ATOM 299  C CA   . PHE A 1 31 ? 0.069   -0.511  -7.250  1.00 0.38 ? 345 PHE A CA   1 
ATOM 300  C C    . PHE A 1 31 ? -0.750  -1.457  -6.386  1.00 0.36 ? 345 PHE A C    1 
ATOM 301  O O    . PHE A 1 31 ? -0.319  -2.537  -6.026  1.00 0.36 ? 345 PHE A O    1 
ATOM 302  C CB   . PHE A 1 31 ? 0.672   0.612   -6.398  1.00 0.38 ? 345 PHE A CB   1 
ATOM 303  C CG   . PHE A 1 31 ? 1.402   0.043   -5.211  1.00 0.34 ? 345 PHE A CG   1 
ATOM 304  C CD1  . PHE A 1 31 ? 0.691   -0.246  -4.049  1.00 1.28 ? 345 PHE A CD1  1 
ATOM 305  C CD2  . PHE A 1 31 ? 2.781   -0.177  -5.259  1.00 1.21 ? 345 PHE A CD2  1 
ATOM 306  C CE1  . PHE A 1 31 ? 1.352   -0.753  -2.934  1.00 1.29 ? 345 PHE A CE1  1 
ATOM 307  C CE2  . PHE A 1 31 ? 3.439   -0.691  -4.137  1.00 1.20 ? 345 PHE A CE2  1 
ATOM 308  C CZ   . PHE A 1 31 ? 2.722   -0.976  -2.977  1.00 0.34 ? 345 PHE A CZ   1 
ATOM 309  H H    . PHE A 1 31 ? -1.005  1.054   -8.265  1.00 0.40 ? 345 PHE A H    1 
ATOM 310  H HA   . PHE A 1 31 ? 0.852   -1.057  -7.751  1.00 0.40 ? 345 PHE A HA   1 
ATOM 311  H HB2  . PHE A 1 31 ? 1.362   1.181   -6.997  1.00 0.40 ? 345 PHE A HB2  1 
ATOM 312  H HB3  . PHE A 1 31 ? -0.119  1.262   -6.051  1.00 0.40 ? 345 PHE A HB3  1 
ATOM 313  H HD1  . PHE A 1 31 ? -0.374  -0.080  -4.012  1.00 2.18 ? 345 PHE A HD1  1 
ATOM 314  H HD2  . PHE A 1 31 ? 3.335   0.041   -6.157  1.00 2.12 ? 345 PHE A HD2  1 
ATOM 315  H HE1  . PHE A 1 31 ? 0.801   -0.971  -2.037  1.00 2.20 ? 345 PHE A HE1  1 
ATOM 316  H HE2  . PHE A 1 31 ? 4.500   -0.862  -4.165  1.00 2.10 ? 345 PHE A HE2  1 
ATOM 317  H HZ   . PHE A 1 31 ? 3.229   -1.368  -2.115  1.00 0.36 ? 345 PHE A HZ   1 
ATOM 318  N N    . VAL A 1 32 ? -1.946  -1.060  -6.076  1.00 0.38 ? 346 VAL A N    1 
ATOM 319  C CA   . VAL A 1 32 ? -2.827  -1.927  -5.263  1.00 0.40 ? 346 VAL A CA   1 
ATOM 320  C C    . VAL A 1 32 ? -3.187  -3.177  -6.082  1.00 0.37 ? 346 VAL A C    1 
ATOM 321  O O    . VAL A 1 32 ? -3.212  -4.282  -5.572  1.00 0.36 ? 346 VAL A O    1 
ATOM 322  C CB   . VAL A 1 32 ? -4.091  -1.149  -4.914  1.00 0.53 ? 346 VAL A CB   1 
ATOM 323  C CG1  . VAL A 1 32 ? -5.073  -2.057  -4.198  1.00 1.24 ? 346 VAL A CG1  1 
ATOM 324  C CG2  . VAL A 1 32 ? -3.721  -0.001  -3.990  1.00 0.88 ? 346 VAL A CG2  1 
ATOM 325  H H    . VAL A 1 32 ? -2.272  -0.196  -6.398  1.00 0.40 ? 346 VAL A H    1 
ATOM 326  H HA   . VAL A 1 32 ? -2.317  -2.216  -4.354  1.00 0.40 ? 346 VAL A HA   1 
ATOM 327  H HB   . VAL A 1 32 ? -4.544  -0.763  -5.815  1.00 1.32 ? 346 VAL A HB   1 
ATOM 328  H HG11 . VAL A 1 32 ? -4.586  -2.510  -3.349  1.00 1.81 ? 346 VAL A HG11 1 
ATOM 329  H HG12 . VAL A 1 32 ? -5.406  -2.823  -4.874  1.00 1.86 ? 346 VAL A HG12 1 
ATOM 330  H HG13 . VAL A 1 32 ? -5.918  -1.472  -3.868  1.00 1.76 ? 346 VAL A HG13 1 
ATOM 331  H HG21 . VAL A 1 32 ? -4.575  0.647   -3.860  1.00 1.42 ? 346 VAL A HG21 1 
ATOM 332  H HG22 . VAL A 1 32 ? -2.906  0.557   -4.422  1.00 1.50 ? 346 VAL A HG22 1 
ATOM 333  H HG23 . VAL A 1 32 ? -3.417  -0.397  -3.032  1.00 1.52 ? 346 VAL A HG23 1 
ATOM 334  N N    . LYS A 1 33 ? -3.445  -3.018  -7.360  1.00 0.37 ? 347 LYS A N    1 
ATOM 335  C CA   . LYS A 1 33 ? -3.787  -4.207  -8.197  1.00 0.38 ? 347 LYS A CA   1 
ATOM 336  C C    . LYS A 1 33 ? -2.617  -5.187  -8.131  1.00 0.37 ? 347 LYS A C    1 
ATOM 337  O O    . LYS A 1 33 ? -2.796  -6.382  -8.015  1.00 0.38 ? 347 LYS A O    1 
ATOM 338  C CB   . LYS A 1 33 ? -4.020  -3.776  -9.651  1.00 0.41 ? 347 LYS A CB   1 
ATOM 339  C CG   . LYS A 1 33 ? -5.307  -2.950  -9.755  1.00 0.90 ? 347 LYS A CG   1 
ATOM 340  C CD   . LYS A 1 33 ? -5.592  -2.620  -11.225 1.00 1.10 ? 347 LYS A CD   1 
ATOM 341  C CE   . LYS A 1 33 ? -6.803  -1.690  -11.316 1.00 2.01 ? 347 LYS A CE   1 
ATOM 342  N NZ   . LYS A 1 33 ? -6.803  -1.010  -12.637 1.00 2.28 ? 347 LYS A NZ   1 
ATOM 343  H H    . LYS A 1 33 ? -3.404  -2.123  -7.765  1.00 0.39 ? 347 LYS A H    1 
ATOM 344  H HA   . LYS A 1 33 ? -4.678  -4.679  -7.808  1.00 0.39 ? 347 LYS A HA   1 
ATOM 345  H HB2  . LYS A 1 33 ? -3.184  -3.178  -9.983  1.00 0.78 ? 347 LYS A HB2  1 
ATOM 346  H HB3  . LYS A 1 33 ? -4.108  -4.650  -10.275 1.00 0.80 ? 347 LYS A HB3  1 
ATOM 347  H HG2  . LYS A 1 33 ? -6.130  -3.518  -9.349  1.00 1.23 ? 347 LYS A HG2  1 
ATOM 348  H HG3  . LYS A 1 33 ? -5.192  -2.031  -9.197  1.00 1.26 ? 347 LYS A HG3  1 
ATOM 349  H HD2  . LYS A 1 33 ? -4.730  -2.134  -11.662 1.00 1.20 ? 347 LYS A HD2  1 
ATOM 350  H HD3  . LYS A 1 33 ? -5.804  -3.532  -11.761 1.00 1.27 ? 347 LYS A HD3  1 
ATOM 351  H HE2  . LYS A 1 33 ? -7.709  -2.268  -11.211 1.00 2.52 ? 347 LYS A HE2  1 
ATOM 352  H HE3  . LYS A 1 33 ? -6.754  -0.951  -10.529 1.00 2.41 ? 347 LYS A HE3  1 
ATOM 353  H HZ1  . LYS A 1 33 ? -7.423  -0.176  -12.599 1.00 2.88 ? 347 LYS A HZ1  1 
ATOM 354  H HZ2  . LYS A 1 33 ? -7.150  -1.671  -13.363 1.00 2.51 ? 347 LYS A HZ2  1 
ATOM 355  H HZ3  . LYS A 1 33 ? -5.834  -0.712  -12.873 1.00 2.23 ? 347 LYS A HZ3  1 
ATOM 356  N N    . ARG A 1 34 ? -1.419  -4.676  -8.162  1.00 0.37 ? 348 ARG A N    1 
ATOM 357  C CA   . ARG A 1 34 ? -0.232  -5.558  -8.056  1.00 0.39 ? 348 ARG A CA   1 
ATOM 358  C C    . ARG A 1 34 ? -0.218  -6.152  -6.650  1.00 0.37 ? 348 ARG A C    1 
ATOM 359  O O    . ARG A 1 34 ? 0.293   -7.230  -6.425  1.00 0.41 ? 348 ARG A O    1 
ATOM 360  C CB   . ARG A 1 34 ? 1.040   -4.739  -8.286  1.00 0.42 ? 348 ARG A CB   1 
ATOM 361  C CG   . ARG A 1 34 ? 1.015   -4.133  -9.690  1.00 1.18 ? 348 ARG A CG   1 
ATOM 362  C CD   . ARG A 1 34 ? 1.188   -5.243  -10.730 1.00 1.36 ? 348 ARG A CD   1 
ATOM 363  N NE   . ARG A 1 34 ? 1.435   -4.637  -12.068 1.00 2.17 ? 348 ARG A NE   1 
ATOM 364  C CZ   . ARG A 1 34 ? 1.636   -5.399  -13.113 1.00 2.60 ? 348 ARG A CZ   1 
ATOM 365  N NH1  . ARG A 1 34 ? 2.845   -5.798  -13.425 1.00 2.99 ? 348 ARG A NH1  1 
ATOM 366  N NH2  . ARG A 1 34 ? 0.623   -5.760  -13.858 1.00 3.18 ? 348 ARG A NH2  1 
ATOM 367  H H    . ARG A 1 34 ? -1.303  -3.705  -8.222  1.00 0.37 ? 348 ARG A H    1 
ATOM 368  H HA   . ARG A 1 34 ? -0.299  -6.349  -8.787  1.00 0.43 ? 348 ARG A HA   1 
ATOM 369  H HB2  . ARG A 1 34 ? 1.093   -3.947  -7.553  1.00 0.98 ? 348 ARG A HB2  1 
ATOM 370  H HB3  . ARG A 1 34 ? 1.904   -5.379  -8.187  1.00 0.76 ? 348 ARG A HB3  1 
ATOM 371  H HG2  . ARG A 1 34 ? 0.066   -3.637  -9.847  1.00 1.85 ? 348 ARG A HG2  1 
ATOM 372  H HG3  . ARG A 1 34 ? 1.818   -3.417  -9.791  1.00 1.94 ? 348 ARG A HG3  1 
ATOM 373  H HD2  . ARG A 1 34 ? 2.027   -5.867  -10.460 1.00 1.84 ? 348 ARG A HD2  1 
ATOM 374  H HD3  . ARG A 1 34 ? 0.290   -5.843  -10.763 1.00 1.59 ? 348 ARG A HD3  1 
ATOM 375  H HE   . ARG A 1 34 ? 1.443   -3.664  -12.167 1.00 2.67 ? 348 ARG A HE   1 
ATOM 376  H HH11 . ARG A 1 34 ? 3.626   -5.519  -12.867 1.00 3.09 ? 348 ARG A HH11 1 
ATOM 377  H HH12 . ARG A 1 34 ? 2.989   -6.381  -14.229 1.00 3.48 ? 348 ARG A HH12 1 
ATOM 378  H HH21 . ARG A 1 34 ? -0.301  -5.453  -13.631 1.00 3.43 ? 348 ARG A HH21 1 
ATOM 379  H HH22 . ARG A 1 34 ? 0.774   -6.340  -14.658 1.00 3.62 ? 348 ARG A HH22 1 
ATOM 380  N N    . LEU A 1 35 ? -0.782  -5.444  -5.696  1.00 0.34 ? 349 LEU A N    1 
ATOM 381  C CA   . LEU A 1 35 ? -0.812  -5.955  -4.294  1.00 0.35 ? 349 LEU A CA   1 
ATOM 382  C C    . LEU A 1 35 ? -1.578  -7.278  -4.270  1.00 0.35 ? 349 LEU A C    1 
ATOM 383  O O    . LEU A 1 35 ? -1.221  -8.205  -3.571  1.00 0.38 ? 349 LEU A O    1 
ATOM 384  C CB   . LEU A 1 35 ? -1.507  -4.938  -3.388  1.00 0.35 ? 349 LEU A CB   1 
ATOM 385  C CG   . LEU A 1 35 ? -0.719  -4.798  -2.084  1.00 0.40 ? 349 LEU A CG   1 
ATOM 386  C CD1  . LEU A 1 35 ? 0.598   -4.074  -2.357  1.00 0.53 ? 349 LEU A CD1  1 
ATOM 387  C CD2  . LEU A 1 35 ? -1.545  -4.001  -1.070  1.00 0.56 ? 349 LEU A CD2  1 
ATOM 388  H H    . LEU A 1 35 ? -1.190  -4.578  -5.905  1.00 0.34 ? 349 LEU A H    1 
ATOM 389  H HA   . LEU A 1 35 ? 0.194   -6.115  -3.945  1.00 0.37 ? 349 LEU A HA   1 
ATOM 390  H HB2  . LEU A 1 35 ? -1.553  -3.983  -3.888  1.00 0.41 ? 349 LEU A HB2  1 
ATOM 391  H HB3  . LEU A 1 35 ? -2.508  -5.278  -3.167  1.00 0.47 ? 349 LEU A HB3  1 
ATOM 392  H HG   . LEU A 1 35 ? -0.509  -5.781  -1.685  1.00 0.66 ? 349 LEU A HG   1 
ATOM 393  H HD11 . LEU A 1 35 ? 1.256   -4.201  -1.512  1.00 0.99 ? 349 LEU A HD11 1 
ATOM 394  H HD12 . LEU A 1 35 ? 0.407   -3.021  -2.513  1.00 1.17 ? 349 LEU A HD12 1 
ATOM 395  H HD13 . LEU A 1 35 ? 1.060   -4.493  -3.239  1.00 1.32 ? 349 LEU A HD13 1 
ATOM 396  H HD21 . LEU A 1 35 ? -1.218  -2.974  -1.063  1.00 1.19 ? 349 LEU A HD21 1 
ATOM 397  H HD22 . LEU A 1 35 ? -1.416  -4.426  -0.085  1.00 1.10 ? 349 LEU A HD22 1 
ATOM 398  H HD23 . LEU A 1 35 ? -2.589  -4.045  -1.344  1.00 1.10 ? 349 LEU A HD23 1 
ATOM 399  N N    . GLY A 1 36 ? -2.625  -7.371  -5.052  1.00 0.36 ? 350 GLY A N    1 
ATOM 400  C CA   . GLY A 1 36 ? -3.422  -8.632  -5.113  1.00 0.38 ? 350 GLY A CA   1 
ATOM 401  C C    . GLY A 1 36 ? -4.691  -8.516  -4.254  1.00 0.29 ? 350 GLY A C    1 
ATOM 402  O O    . GLY A 1 36 ? -5.392  -9.487  -4.040  1.00 0.27 ? 350 GLY A O    1 
ATOM 403  H H    . GLY A 1 36 ? -2.882  -6.607  -5.612  1.00 0.37 ? 350 GLY A H    1 
ATOM 404  H HA2  . GLY A 1 36 ? -3.706  -8.820  -6.140  1.00 0.43 ? 350 GLY A HA2  1 
ATOM 405  H HA3  . GLY A 1 36 ? -2.824  -9.455  -4.753  1.00 0.46 ? 350 GLY A HA3  1 
ATOM 406  N N    . LEU A 1 37 ? -4.997  -7.346  -3.757  1.00 0.28 ? 351 LEU A N    1 
ATOM 407  C CA   . LEU A 1 37 ? -6.226  -7.192  -2.913  1.00 0.26 ? 351 LEU A CA   1 
ATOM 408  C C    . LEU A 1 37 ? -7.469  -7.228  -3.812  1.00 0.25 ? 351 LEU A C    1 
ATOM 409  O O    . LEU A 1 37 ? -7.396  -6.932  -4.987  1.00 0.27 ? 351 LEU A O    1 
ATOM 410  C CB   . LEU A 1 37 ? -6.179  -5.852  -2.174  1.00 0.32 ? 351 LEU A CB   1 
ATOM 411  C CG   . LEU A 1 37 ? -7.062  -5.913  -0.920  1.00 0.72 ? 351 LEU A CG   1 
ATOM 412  C CD1  . LEU A 1 37 ? -6.473  -6.892  0.098   1.00 1.10 ? 351 LEU A CD1  1 
ATOM 413  C CD2  . LEU A 1 37 ? -7.122  -4.529  -0.283  1.00 1.43 ? 351 LEU A CD2  1 
ATOM 414  H H    . LEU A 1 37 ? -4.426  -6.573  -3.937  1.00 0.33 ? 351 LEU A H    1 
ATOM 415  H HA   . LEU A 1 37 ? -6.269  -8.000  -2.201  1.00 0.28 ? 351 LEU A HA   1 
ATOM 416  H HB2  . LEU A 1 37 ? -5.160  -5.631  -1.891  1.00 0.77 ? 351 LEU A HB2  1 
ATOM 417  H HB3  . LEU A 1 37 ? -6.546  -5.072  -2.828  1.00 0.80 ? 351 LEU A HB3  1 
ATOM 418  H HG   . LEU A 1 37 ? -8.059  -6.232  -1.191  1.00 1.63 ? 351 LEU A HG   1 
ATOM 419  H HD11 . LEU A 1 37 ? -7.080  -6.886  0.992   1.00 1.67 ? 351 LEU A HD11 1 
ATOM 420  H HD12 . LEU A 1 37 ? -5.467  -6.588  0.348   1.00 1.65 ? 351 LEU A HD12 1 
ATOM 421  H HD13 . LEU A 1 37 ? -6.462  -7.888  -0.316  1.00 1.54 ? 351 LEU A HD13 1 
ATOM 422  H HD21 . LEU A 1 37 ? -7.770  -4.560  0.579   1.00 1.76 ? 351 LEU A HD21 1 
ATOM 423  H HD22 . LEU A 1 37 ? -7.503  -3.818  -1.001  1.00 1.97 ? 351 LEU A HD22 1 
ATOM 424  H HD23 . LEU A 1 37 ? -6.131  -4.234  0.026   1.00 2.05 ? 351 LEU A HD23 1 
ATOM 425  N N    . SER A 1 38 ? -8.614  -7.584  -3.279  1.00 0.31 ? 352 SER A N    1 
ATOM 426  C CA   . SER A 1 38 ? -9.848  -7.630  -4.123  1.00 0.39 ? 352 SER A CA   1 
ATOM 427  C C    . SER A 1 38 ? -9.991  -6.321  -4.902  1.00 0.37 ? 352 SER A C    1 
ATOM 428  O O    . SER A 1 38 ? -9.957  -5.244  -4.342  1.00 0.34 ? 352 SER A O    1 
ATOM 429  C CB   . SER A 1 38 ? -11.056 -7.827  -3.216  1.00 0.51 ? 352 SER A CB   1 
ATOM 430  O OG   . SER A 1 38 ? -12.245 -7.812  -3.991  1.00 1.23 ? 352 SER A OG   1 
ATOM 431  H H    . SER A 1 38 ? -8.664  -7.820  -2.329  1.00 0.34 ? 352 SER A H    1 
ATOM 432  H HA   . SER A 1 38 ? -9.780  -8.453  -4.818  1.00 0.42 ? 352 SER A HA   1 
ATOM 433  H HB2  . SER A 1 38 ? -10.972 -8.775  -2.716  1.00 1.04 ? 352 SER A HB2  1 
ATOM 434  H HB3  . SER A 1 38 ? -11.081 -7.033  -2.481  1.00 0.89 ? 352 SER A HB3  1 
ATOM 435  H HG   . SER A 1 38 ? -12.966 -8.100  -3.431  1.00 1.46 ? 352 SER A HG   1 
ATOM 436  N N    . ASP A 1 39 ? -10.145 -6.405  -6.195  1.00 0.40 ? 353 ASP A N    1 
ATOM 437  C CA   . ASP A 1 39 ? -10.271 -5.163  -7.012  1.00 0.41 ? 353 ASP A CA   1 
ATOM 438  C C    . ASP A 1 39 ? -11.487 -4.347  -6.571  1.00 0.42 ? 353 ASP A C    1 
ATOM 439  O O    . ASP A 1 39 ? -11.423 -3.143  -6.459  1.00 0.39 ? 353 ASP A O    1 
ATOM 440  C CB   . ASP A 1 39 ? -10.446 -5.539  -8.485  1.00 0.50 ? 353 ASP A CB   1 
ATOM 441  C CG   . ASP A 1 39 ? -10.408 -4.272  -9.346  1.00 1.48 ? 353 ASP A CG   1 
ATOM 442  O OD1  . ASP A 1 39 ? -11.388 -3.549  -9.342  1.00 2.28 ? 353 ASP A OD1  1 
ATOM 443  O OD2  . ASP A 1 39 ? -9.399  -4.047  -9.994  1.00 2.16 ? 353 ASP A OD2  1 
ATOM 444  H H    . ASP A 1 39 ? -10.166 -7.283  -6.629  1.00 0.44 ? 353 ASP A H    1 
ATOM 445  H HA   . ASP A 1 39 ? -9.377  -4.571  -6.901  1.00 0.39 ? 353 ASP A HA   1 
ATOM 446  H HB2  . ASP A 1 39 ? -9.649  -6.207  -8.784  1.00 1.04 ? 353 ASP A HB2  1 
ATOM 447  H HB3  . ASP A 1 39 ? -11.395 -6.032  -8.617  1.00 1.03 ? 353 ASP A HB3  1 
ATOM 448  N N    . HIS A 1 40 ? -12.595 -4.988  -6.331  1.00 0.52 ? 354 HIS A N    1 
ATOM 449  C CA   . HIS A 1 40 ? -13.812 -4.232  -5.915  1.00 0.58 ? 354 HIS A CA   1 
ATOM 450  C C    . HIS A 1 40 ? -13.568 -3.528  -4.574  1.00 0.51 ? 354 HIS A C    1 
ATOM 451  O O    . HIS A 1 40 ? -13.966 -2.396  -4.385  1.00 0.50 ? 354 HIS A O    1 
ATOM 452  C CB   . HIS A 1 40 ? -14.987 -5.201  -5.782  1.00 0.72 ? 354 HIS A CB   1 
ATOM 453  C CG   . HIS A 1 40 ? -15.428 -5.693  -7.142  1.00 1.34 ? 354 HIS A CG   1 
ATOM 454  N ND1  . HIS A 1 40 ? -15.660 -4.848  -8.229  1.00 2.16 ? 354 HIS A ND1  1 
ATOM 455  C CD2  . HIS A 1 40 ? -15.706 -6.957  -7.592  1.00 2.30 ? 354 HIS A CD2  1 
ATOM 456  C CE1  . HIS A 1 40 ? -16.064 -5.617  -9.261  1.00 3.00 ? 354 HIS A CE1  1 
ATOM 457  N NE2  . HIS A 1 40 ? -16.112 -6.911  -8.924  1.00 3.11 ? 354 HIS A NE2  1 
ATOM 458  H H    . HIS A 1 40 ? -12.632 -5.964  -6.438  1.00 0.58 ? 354 HIS A H    1 
ATOM 459  H HA   . HIS A 1 40 ? -14.043 -3.488  -6.663  1.00 0.60 ? 354 HIS A HA   1 
ATOM 460  H HB2  . HIS A 1 40 ? -14.675 -6.047  -5.189  1.00 1.37 ? 354 HIS A HB2  1 
ATOM 461  H HB3  . HIS A 1 40 ? -15.813 -4.709  -5.291  1.00 1.09 ? 354 HIS A HB3  1 
ATOM 462  H HD1  . HIS A 1 40 ? -15.555 -3.876  -8.244  1.00 2.53 ? 354 HIS A HD1  1 
ATOM 463  H HD2  . HIS A 1 40 ? -15.594 -7.858  -7.008  1.00 2.79 ? 354 HIS A HD2  1 
ATOM 464  H HE1  . HIS A 1 40 ? -16.297 -5.236  -10.251 1.00 3.83 ? 354 HIS A HE1  1 
ATOM 465  N N    . GLU A 1 41 ? -12.911 -4.169  -3.649  1.00 0.49 ? 355 GLU A N    1 
ATOM 466  C CA   . GLU A 1 41 ? -12.650 -3.497  -2.344  1.00 0.49 ? 355 GLU A CA   1 
ATOM 467  C C    . GLU A 1 41 ? -11.830 -2.228  -2.605  1.00 0.39 ? 355 GLU A C    1 
ATOM 468  O O    . GLU A 1 41 ? -11.967 -1.236  -1.918  1.00 0.42 ? 355 GLU A O    1 
ATOM 469  C CB   . GLU A 1 41 ? -11.847 -4.426  -1.435  1.00 0.53 ? 355 GLU A CB   1 
ATOM 470  C CG   . GLU A 1 41 ? -11.804 -3.856  -0.017  1.00 0.92 ? 355 GLU A CG   1 
ATOM 471  C CD   . GLU A 1 41 ? -10.916 -4.745  0.855   1.00 1.30 ? 355 GLU A CD   1 
ATOM 472  O OE1  . GLU A 1 41 ? -10.062 -5.417  0.302   1.00 2.11 ? 355 GLU A OE1  1 
ATOM 473  O OE2  . GLU A 1 41 ? -11.105 -4.742  2.061   1.00 1.64 ? 355 GLU A OE2  1 
ATOM 474  H H    . GLU A 1 41 ? -12.588 -5.081  -3.813  1.00 0.50 ? 355 GLU A H    1 
ATOM 475  H HA   . GLU A 1 41 ? -13.589 -3.240  -1.871  1.00 0.57 ? 355 GLU A HA   1 
ATOM 476  H HB2  . GLU A 1 41 ? -12.307 -5.405  -1.418  1.00 0.90 ? 355 GLU A HB2  1 
ATOM 477  H HB3  . GLU A 1 41 ? -10.841 -4.507  -1.815  1.00 0.86 ? 355 GLU A HB3  1 
ATOM 478  H HG2  . GLU A 1 41 ? -11.403 -2.853  -0.042  1.00 1.50 ? 355 GLU A HG2  1 
ATOM 479  H HG3  . GLU A 1 41 ? -12.803 -3.834  0.395   1.00 1.59 ? 355 GLU A HG3  1 
ATOM 480  N N    . ILE A 1 42 ? -10.969 -2.265  -3.592  1.00 0.31 ? 356 ILE A N    1 
ATOM 481  C CA   . ILE A 1 42 ? -10.121 -1.074  -3.900  1.00 0.28 ? 356 ILE A CA   1 
ATOM 482  C C    . ILE A 1 42 ? -11.010 0.122   -4.238  1.00 0.31 ? 356 ILE A C    1 
ATOM 483  O O    . ILE A 1 42 ? -10.769 1.229   -3.792  1.00 0.34 ? 356 ILE A O    1 
ATOM 484  C CB   . ILE A 1 42 ? -9.213  -1.395  -5.088  1.00 0.32 ? 356 ILE A CB   1 
ATOM 485  C CG1  . ILE A 1 42 ? -8.322  -2.578  -4.729  1.00 0.37 ? 356 ILE A CG1  1 
ATOM 486  C CG2  . ILE A 1 42 ? -8.328  -0.188  -5.412  1.00 0.39 ? 356 ILE A CG2  1 
ATOM 487  C CD1  . ILE A 1 42 ? -7.524  -2.990  -5.966  1.00 0.47 ? 356 ILE A CD1  1 
ATOM 488  H H    . ILE A 1 42 ? -10.876 -3.083  -4.125  1.00 0.32 ? 356 ILE A H    1 
ATOM 489  H HA   . ILE A 1 42 ? -9.510  -0.840  -3.038  1.00 0.33 ? 356 ILE A HA   1 
ATOM 490  H HB   . ILE A 1 42 ? -9.822  -1.649  -5.947  1.00 0.35 ? 356 ILE A HB   1 
ATOM 491  H HG12 . ILE A 1 42 ? -7.647  -2.287  -3.936  1.00 0.41 ? 356 ILE A HG12 1 
ATOM 492  H HG13 . ILE A 1 42 ? -8.929  -3.400  -4.400  1.00 0.35 ? 356 ILE A HG13 1 
ATOM 493  H HG21 . ILE A 1 42 ? -8.258  0.446   -4.542  1.00 1.07 ? 356 ILE A HG21 1 
ATOM 494  H HG22 . ILE A 1 42 ? -8.756  0.371   -6.231  1.00 1.07 ? 356 ILE A HG22 1 
ATOM 495  H HG23 . ILE A 1 42 ? -7.338  -0.530  -5.688  1.00 1.12 ? 356 ILE A HG23 1 
ATOM 496  H HD11 . ILE A 1 42 ? -7.066  -3.956  -5.799  1.00 1.19 ? 356 ILE A HD11 1 
ATOM 497  H HD12 . ILE A 1 42 ? -6.755  -2.253  -6.159  1.00 1.14 ? 356 ILE A HD12 1 
ATOM 498  H HD13 . ILE A 1 42 ? -8.187  -3.046  -6.814  1.00 1.04 ? 356 ILE A HD13 1 
ATOM 499  N N    . ASP A 1 43 ? -12.044 -0.091  -5.007  1.00 0.36 ? 357 ASP A N    1 
ATOM 500  C CA   . ASP A 1 43 ? -12.954 1.038   -5.352  1.00 0.43 ? 357 ASP A CA   1 
ATOM 501  C C    . ASP A 1 43 ? -13.668 1.505   -4.080  1.00 0.43 ? 357 ASP A C    1 
ATOM 502  O O    . ASP A 1 43 ? -13.867 2.683   -3.867  1.00 0.46 ? 357 ASP A O    1 
ATOM 503  C CB   . ASP A 1 43 ? -13.997 0.576   -6.383  1.00 0.53 ? 357 ASP A CB   1 
ATOM 504  C CG   . ASP A 1 43 ? -13.326 0.358   -7.743  1.00 1.34 ? 357 ASP A CG   1 
ATOM 505  O OD1  . ASP A 1 43 ? -12.165 0.709   -7.873  1.00 1.91 ? 357 ASP A OD1  1 
ATOM 506  O OD2  . ASP A 1 43 ? -13.985 -0.153  -8.630  1.00 2.19 ? 357 ASP A OD2  1 
ATOM 507  H H    . ASP A 1 43 ? -12.224 -0.996  -5.349  1.00 0.39 ? 357 ASP A H    1 
ATOM 508  H HA   . ASP A 1 43 ? -12.374 1.852   -5.765  1.00 0.45 ? 357 ASP A HA   1 
ATOM 509  H HB2  . ASP A 1 43 ? -14.448 -0.349  -6.051  1.00 1.01 ? 357 ASP A HB2  1 
ATOM 510  H HB3  . ASP A 1 43 ? -14.761 1.332   -6.484  1.00 1.00 ? 357 ASP A HB3  1 
ATOM 511  N N    . ARG A 1 44 ? -14.060 0.576   -3.240  1.00 0.44 ? 358 ARG A N    1 
ATOM 512  C CA   . ARG A 1 44 ? -14.782 0.927   -1.975  1.00 0.49 ? 358 ARG A CA   1 
ATOM 513  C C    . ARG A 1 44 ? -13.884 1.728   -1.028  1.00 0.48 ? 358 ARG A C    1 
ATOM 514  O O    . ARG A 1 44 ? -14.356 2.444   -0.162  1.00 0.54 ? 358 ARG A O    1 
ATOM 515  C CB   . ARG A 1 44 ? -15.243 -0.365  -1.285  1.00 0.58 ? 358 ARG A CB   1 
ATOM 516  C CG   . ARG A 1 44 ? -16.183 -1.128  -2.216  1.00 1.07 ? 358 ARG A CG   1 
ATOM 517  C CD   . ARG A 1 44 ? -16.811 -2.313  -1.471  1.00 1.30 ? 358 ARG A CD   1 
ATOM 518  N NE   . ARG A 1 44 ? -17.764 -1.821  -0.419  1.00 1.94 ? 358 ARG A NE   1 
ATOM 519  C CZ   . ARG A 1 44 ? -18.011 -2.540  0.639   1.00 2.39 ? 358 ARG A CZ   1 
ATOM 520  N NH1  . ARG A 1 44 ? -17.029 -3.094  1.293   1.00 2.99 ? 358 ARG A NH1  1 
ATOM 521  N NH2  . ARG A 1 44 ? -19.246 -2.698  1.035   1.00 2.86 ? 358 ARG A NH2  1 
ATOM 522  H H    . ARG A 1 44 ? -13.890 -0.366  -3.449  1.00 0.45 ? 358 ARG A H    1 
ATOM 523  H HA   . ARG A 1 44 ? -15.643 1.521   -2.220  1.00 0.50 ? 358 ARG A HA   1 
ATOM 524  H HB2  . ARG A 1 44 ? -14.385 -0.980  -1.060  1.00 0.74 ? 358 ARG A HB2  1 
ATOM 525  H HB3  . ARG A 1 44 ? -15.763 -0.125  -0.372  1.00 0.89 ? 358 ARG A HB3  1 
ATOM 526  H HG2  . ARG A 1 44 ? -16.962 -0.465  -2.559  1.00 1.61 ? 358 ARG A HG2  1 
ATOM 527  H HG3  . ARG A 1 44 ? -15.625 -1.496  -3.065  1.00 1.41 ? 358 ARG A HG3  1 
ATOM 528  H HD2  . ARG A 1 44 ? -17.349 -2.923  -2.179  1.00 1.67 ? 358 ARG A HD2  1 
ATOM 529  H HD3  . ARG A 1 44 ? -16.032 -2.904  -1.013  1.00 1.77 ? 358 ARG A HD3  1 
ATOM 530  H HE   . ARG A 1 44 ? -18.211 -0.955  -0.525  1.00 2.52 ? 358 ARG A HE   1 
ATOM 531  H HH11 . ARG A 1 44 ? -16.088 -2.970  0.976   1.00 3.25 ? 358 ARG A HH11 1 
ATOM 532  H HH12 . ARG A 1 44 ? -17.212 -3.629  2.115   1.00 3.51 ? 358 ARG A HH12 1 
ATOM 533  H HH21 . ARG A 1 44 ? -19.990 -2.266  0.523   1.00 3.06 ? 358 ARG A HH21 1 
ATOM 534  H HH22 . ARG A 1 44 ? -19.450 -3.248  1.847   1.00 3.37 ? 358 ARG A HH22 1 
ATOM 535  N N    . LEU A 1 45 ? -12.602 1.608   -1.172  1.00 0.46 ? 359 LEU A N    1 
ATOM 536  C CA   . LEU A 1 45 ? -11.690 2.356   -0.266  1.00 0.51 ? 359 LEU A CA   1 
ATOM 537  C C    . LEU A 1 45 ? -11.988 3.855   -0.386  1.00 0.56 ? 359 LEU A C    1 
ATOM 538  O O    . LEU A 1 45 ? -11.977 4.576   0.590   1.00 0.66 ? 359 LEU A O    1 
ATOM 539  C CB   . LEU A 1 45 ? -10.220 2.106   -0.659  1.00 0.53 ? 359 LEU A CB   1 
ATOM 540  C CG   . LEU A 1 45 ? -9.917  0.608   -0.808  1.00 0.56 ? 359 LEU A CG   1 
ATOM 541  C CD1  . LEU A 1 45 ? -8.407  0.409   -0.943  1.00 0.82 ? 359 LEU A CD1  1 
ATOM 542  C CD2  . LEU A 1 45 ? -10.411 -0.159  0.410   1.00 1.03 ? 359 LEU A CD2  1 
ATOM 543  H H    . LEU A 1 45 ? -12.244 1.024   -1.867  1.00 0.44 ? 359 LEU A H    1 
ATOM 544  H HA   . LEU A 1 45 ? -11.855 2.039   0.753   1.00 0.58 ? 359 LEU A HA   1 
ATOM 545  H HB2  . LEU A 1 45 ? -10.023 2.595   -1.600  1.00 0.90 ? 359 LEU A HB2  1 
ATOM 546  H HB3  . LEU A 1 45 ? -9.575  2.525   0.099   1.00 0.80 ? 359 LEU A HB3  1 
ATOM 547  H HG   . LEU A 1 45 ? -10.406 0.233   -1.694  1.00 1.15 ? 359 LEU A HG   1 
ATOM 548  H HD11 . LEU A 1 45 ? -8.187  -0.645  -1.033  1.00 1.52 ? 359 LEU A HD11 1 
ATOM 549  H HD12 . LEU A 1 45 ? -7.911  0.808   -0.067  1.00 1.27 ? 359 LEU A HD12 1 
ATOM 550  H HD13 . LEU A 1 45 ? -8.055  0.927   -1.823  1.00 1.35 ? 359 LEU A HD13 1 
ATOM 551  H HD21 . LEU A 1 45 ? -11.475 -0.310  0.325   1.00 1.67 ? 359 LEU A HD21 1 
ATOM 552  H HD22 . LEU A 1 45 ? -10.194 0.407   1.301   1.00 1.56 ? 359 LEU A HD22 1 
ATOM 553  H HD23 . LEU A 1 45 ? -9.909  -1.116  0.456   1.00 1.52 ? 359 LEU A HD23 1 
ATOM 554  N N    . GLU A 1 46 ? -12.244 4.336   -1.577  1.00 0.59 ? 360 GLU A N    1 
ATOM 555  C CA   . GLU A 1 46 ? -12.529 5.790   -1.734  1.00 0.74 ? 360 GLU A CA   1 
ATOM 556  C C    . GLU A 1 46 ? -13.755 6.157   -0.893  1.00 0.77 ? 360 GLU A C    1 
ATOM 557  O O    . GLU A 1 46 ? -13.775 7.165   -0.221  1.00 0.88 ? 360 GLU A O    1 
ATOM 558  C CB   . GLU A 1 46 ? -12.786 6.115   -3.207  1.00 0.86 ? 360 GLU A CB   1 
ATOM 559  C CG   . GLU A 1 46 ? -12.820 7.634   -3.392  1.00 1.71 ? 360 GLU A CG   1 
ATOM 560  C CD   . GLU A 1 46 ? -13.267 7.963   -4.812  1.00 1.97 ? 360 GLU A CD   1 
ATOM 561  O OE1  . GLU A 1 46 ? -14.464 7.980   -5.046  1.00 2.51 ? 360 GLU A OE1  1 
ATOM 562  O OE2  . GLU A 1 46 ? -12.408 8.193   -5.643  1.00 2.34 ? 360 GLU A OE2  1 
ATOM 563  H H    . GLU A 1 46 ? -12.253 3.744   -2.360  1.00 0.57 ? 360 GLU A H    1 
ATOM 564  H HA   . GLU A 1 46 ? -11.676 6.354   -1.390  1.00 0.80 ? 360 GLU A HA   1 
ATOM 565  H HB2  . GLU A 1 46 ? -11.997 5.694   -3.812  1.00 0.96 ? 360 GLU A HB2  1 
ATOM 566  H HB3  . GLU A 1 46 ? -13.737 5.695   -3.509  1.00 1.13 ? 360 GLU A HB3  1 
ATOM 567  H HG2  . GLU A 1 46 ? -13.512 8.069   -2.686  1.00 2.23 ? 360 GLU A HG2  1 
ATOM 568  H HG3  . GLU A 1 46 ? -11.833 8.039   -3.227  1.00 2.34 ? 360 GLU A HG3  1 
ATOM 569  N N    . LEU A 1 47 ? -14.777 5.335   -0.919  1.00 0.75 ? 361 LEU A N    1 
ATOM 570  C CA   . LEU A 1 47 ? -15.995 5.629   -0.112  1.00 0.87 ? 361 LEU A CA   1 
ATOM 571  C C    . LEU A 1 47 ? -15.627 5.681   1.370   1.00 0.87 ? 361 LEU A C    1 
ATOM 572  O O    . LEU A 1 47 ? -16.139 6.491   2.115   1.00 1.02 ? 361 LEU A O    1 
ATOM 573  C CB   . LEU A 1 47 ? -17.052 4.536   -0.336  1.00 0.98 ? 361 LEU A CB   1 
ATOM 574  C CG   . LEU A 1 47 ? -18.340 4.919   0.397   1.00 1.77 ? 361 LEU A CG   1 
ATOM 575  C CD1  . LEU A 1 47 ? -18.920 6.181   -0.230  1.00 2.10 ? 361 LEU A CD1  1 
ATOM 576  C CD2  . LEU A 1 47 ? -19.365 3.781   0.289   1.00 2.36 ? 361 LEU A CD2  1 
ATOM 577  H H    . LEU A 1 47 ? -14.737 4.519   -1.461  1.00 0.68 ? 361 LEU A H    1 
ATOM 578  H HA   . LEU A 1 47 ? -16.398 6.585   -0.408  1.00 0.99 ? 361 LEU A HA   1 
ATOM 579  H HB2  . LEU A 1 47 ? -17.253 4.432   -1.393  1.00 1.13 ? 361 LEU A HB2  1 
ATOM 580  H HB3  . LEU A 1 47 ? -16.687 3.598   0.053   1.00 1.34 ? 361 LEU A HB3  1 
ATOM 581  H HG   . LEU A 1 47 ? -18.117 5.107   1.439   1.00 2.48 ? 361 LEU A HG   1 
ATOM 582  H HD11 . LEU A 1 47 ? -18.287 7.022   0.010   1.00 2.52 ? 361 LEU A HD11 1 
ATOM 583  H HD12 . LEU A 1 47 ? -19.914 6.352   0.159   1.00 2.48 ? 361 LEU A HD12 1 
ATOM 584  H HD13 . LEU A 1 47 ? -18.969 6.058   -1.301  1.00 2.41 ? 361 LEU A HD13 1 
ATOM 585  H HD21 . LEU A 1 47 ? -18.859 2.828   0.370   1.00 2.82 ? 361 LEU A HD21 1 
ATOM 586  H HD22 . LEU A 1 47 ? -19.872 3.840   -0.661  1.00 2.81 ? 361 LEU A HD22 1 
ATOM 587  H HD23 . LEU A 1 47 ? -20.092 3.875   1.086   1.00 2.64 ? 361 LEU A HD23 1 
ATOM 588  N N    . GLN A 1 48 ? -14.750 4.815   1.812   1.00 0.80 ? 362 GLN A N    1 
ATOM 589  C CA   . GLN A 1 48 ? -14.373 4.811   3.255   1.00 0.92 ? 362 GLN A CA   1 
ATOM 590  C C    . GLN A 1 48 ? -13.914 6.208   3.669   1.00 1.00 ? 362 GLN A C    1 
ATOM 591  O O    . GLN A 1 48 ? -14.209 6.675   4.755   1.00 1.28 ? 362 GLN A O    1 
ATOM 592  C CB   . GLN A 1 48 ? -13.245 3.804   3.491   1.00 0.95 ? 362 GLN A CB   1 
ATOM 593  C CG   . GLN A 1 48 ? -12.958 3.719   4.991   1.00 1.44 ? 362 GLN A CG   1 
ATOM 594  C CD   . GLN A 1 48 ? -11.734 2.840   5.239   1.00 1.50 ? 362 GLN A CD   1 
ATOM 595  O OE1  . GLN A 1 48 ? -10.711 3.012   4.604   1.00 1.38 ? 362 GLN A OE1  1 
ATOM 596  N NE2  . GLN A 1 48 ? -11.797 1.899   6.146   1.00 2.37 ? 362 GLN A NE2  1 
ATOM 597  H H    . GLN A 1 48 ? -14.349 4.161   1.199   1.00 0.74 ? 362 GLN A H    1 
ATOM 598  H HA   . GLN A 1 48 ? -15.229 4.529   3.848   1.00 1.08 ? 362 GLN A HA   1 
ATOM 599  H HB2  . GLN A 1 48 ? -13.544 2.833   3.119   1.00 1.22 ? 362 GLN A HB2  1 
ATOM 600  H HB3  . GLN A 1 48 ? -12.357 4.131   2.975   1.00 1.36 ? 362 GLN A HB3  1 
ATOM 601  H HG2  . GLN A 1 48 ? -12.764 4.711   5.366   1.00 2.12 ? 362 GLN A HG2  1 
ATOM 602  H HG3  . GLN A 1 48 ? -13.811 3.301   5.504   1.00 1.93 ? 362 GLN A HG3  1 
ATOM 603  H HE21 . GLN A 1 48 ? -12.626 1.764   6.654   1.00 2.91 ? 362 GLN A HE21 1 
ATOM 604  H HE22 . GLN A 1 48 ? -11.015 1.336   6.324   1.00 2.65 ? 362 GLN A HE22 1 
ATOM 605  N N    . ASN A 1 49 ? -13.185 6.878   2.823   1.00 1.00 ? 363 ASN A N    1 
ATOM 606  C CA   . ASN A 1 49 ? -12.707 8.243   3.187   1.00 1.21 ? 363 ASN A CA   1 
ATOM 607  C C    . ASN A 1 49 ? -11.870 8.841   2.048   1.00 1.37 ? 363 ASN A C    1 
ATOM 608  O O    . ASN A 1 49 ? -10.670 8.665   1.997   1.00 2.20 ? 363 ASN A O    1 
ATOM 609  C CB   . ASN A 1 49 ? -11.851 8.126   4.447   1.00 1.33 ? 363 ASN A CB   1 
ATOM 610  C CG   . ASN A 1 49 ? -12.515 8.889   5.601   1.00 2.08 ? 363 ASN A CG   1 
ATOM 611  O OD1  . ASN A 1 49 ? -12.949 10.010  5.435   1.00 2.57 ? 363 ASN A OD1  1 
ATOM 612  N ND2  . ASN A 1 49 ? -12.622 8.320   6.771   1.00 2.83 ? 363 ASN A ND2  1 
ATOM 613  H H    . ASN A 1 49 ? -12.949 6.483   1.959   1.00 1.04 ? 363 ASN A H    1 
ATOM 614  H HA   . ASN A 1 49 ? -13.554 8.886   3.388   1.00 1.43 ? 363 ASN A HA   1 
ATOM 615  H HB2  . ASN A 1 49 ? -11.761 7.083   4.711   1.00 1.45 ? 363 ASN A HB2  1 
ATOM 616  H HB3  . ASN A 1 49 ? -10.869 8.536   4.258   1.00 1.43 ? 363 ASN A HB3  1 
ATOM 617  H HD21 . ASN A 1 49 ? -12.282 7.412   6.908   1.00 3.10 ? 363 ASN A HD21 1 
ATOM 618  H HD22 . ASN A 1 49 ? -13.035 8.804   7.515   1.00 3.42 ? 363 ASN A HD22 1 
ATOM 619  N N    . GLY A 1 50 ? -12.488 9.555   1.137   1.00 1.12 ? 364 GLY A N    1 
ATOM 620  C CA   . GLY A 1 50 ? -11.716 10.171  0.014   1.00 1.30 ? 364 GLY A CA   1 
ATOM 621  C C    . GLY A 1 50 ? -11.286 11.592  0.393   1.00 1.32 ? 364 GLY A C    1 
ATOM 622  O O    . GLY A 1 50 ? -10.506 12.213  -0.300  1.00 1.62 ? 364 GLY A O    1 
ATOM 623  H H    . GLY A 1 50 ? -13.454 9.693   1.195   1.00 1.40 ? 364 GLY A H    1 
ATOM 624  H HA2  . GLY A 1 50 ? -10.837 9.578   -0.187  1.00 1.31 ? 364 GLY A HA2  1 
ATOM 625  H HA3  . GLY A 1 50 ? -12.332 10.211  -0.875  1.00 1.60 ? 364 GLY A HA3  1 
ATOM 626  N N    . ARG A 1 51 ? -11.779 12.115  1.484   1.00 1.32 ? 365 ARG A N    1 
ATOM 627  C CA   . ARG A 1 51 ? -11.388 13.496  1.888   1.00 1.44 ? 365 ARG A CA   1 
ATOM 628  C C    . ARG A 1 51 ? -9.862  13.568  2.067   1.00 1.00 ? 365 ARG A C    1 
ATOM 629  O O    . ARG A 1 51 ? -9.243  14.585  1.821   1.00 1.31 ? 365 ARG A O    1 
ATOM 630  C CB   . ARG A 1 51 ? -12.070 13.839  3.211   1.00 1.73 ? 365 ARG A CB   1 
ATOM 631  C CG   . ARG A 1 51 ? -13.586 13.770  3.028   1.00 2.26 ? 365 ARG A CG   1 
ATOM 632  C CD   . ARG A 1 51 ? -14.267 14.351  4.269   1.00 2.80 ? 365 ARG A CD   1 
ATOM 633  N NE   . ARG A 1 51 ? -13.856 13.600  5.489   1.00 3.60 ? 365 ARG A NE   1 
ATOM 634  C CZ   . ARG A 1 51 ? -14.714 13.410  6.457   1.00 4.26 ? 365 ARG A CZ   1 
ATOM 635  N NH1  . ARG A 1 51 ? -15.254 14.442  7.062   1.00 4.86 ? 365 ARG A NH1  1 
ATOM 636  N NH2  . ARG A 1 51 ? -15.020 12.193  6.831   1.00 4.67 ? 365 ARG A NH2  1 
ATOM 637  H H    . ARG A 1 51 ? -12.412 11.607  2.034   1.00 1.47 ? 365 ARG A H    1 
ATOM 638  H HA   . ARG A 1 51 ? -11.702 14.200  1.132   1.00 1.77 ? 365 ARG A HA   1 
ATOM 639  H HB2  . ARG A 1 51 ? -11.759 13.141  3.974   1.00 2.20 ? 365 ARG A HB2  1 
ATOM 640  H HB3  . ARG A 1 51 ? -11.795 14.841  3.503   1.00 1.98 ? 365 ARG A HB3  1 
ATOM 641  H HG2  . ARG A 1 51 ? -13.862 14.354  2.159   1.00 2.53 ? 365 ARG A HG2  1 
ATOM 642  H HG3  . ARG A 1 51 ? -13.896 12.744  2.884   1.00 2.72 ? 365 ARG A HG3  1 
ATOM 643  H HD2  . ARG A 1 51 ? -13.972 15.383  4.380   1.00 3.15 ? 365 ARG A HD2  1 
ATOM 644  H HD3  . ARG A 1 51 ? -15.339 14.292  4.154   1.00 2.82 ? 365 ARG A HD3  1 
ATOM 645  H HE   . ARG A 1 51 ? -12.937 13.277  5.576   1.00 3.95 ? 365 ARG A HE   1 
ATOM 646  H HH11 . ARG A 1 51 ? -15.003 15.370  6.785   1.00 4.92 ? 365 ARG A HH11 1 
ATOM 647  H HH12 . ARG A 1 51 ? -15.918 14.305  7.799   1.00 5.46 ? 365 ARG A HH12 1 
ATOM 648  H HH21 . ARG A 1 51 ? -14.595 11.407  6.378   1.00 4.54 ? 365 ARG A HH21 1 
ATOM 649  H HH22 . ARG A 1 51 ? -15.674 12.046  7.571   1.00 5.32 ? 365 ARG A HH22 1 
ATOM 650  N N    . CYS A 1 52 ? -9.257  12.493  2.489   1.00 0.69 ? 366 CYS A N    1 
ATOM 651  C CA   . CYS A 1 52 ? -7.776  12.489  2.683   1.00 0.67 ? 366 CYS A CA   1 
ATOM 652  C C    . CYS A 1 52 ? -7.156  11.394  1.798   1.00 0.57 ? 366 CYS A C    1 
ATOM 653  O O    . CYS A 1 52 ? -7.298  10.220  2.067   1.00 0.60 ? 366 CYS A O    1 
ATOM 654  C CB   . CYS A 1 52 ? -7.460  12.217  4.167   1.00 1.00 ? 366 CYS A CB   1 
ATOM 655  S SG   . CYS A 1 52 ? -8.118  13.559  5.189   1.00 1.90 ? 366 CYS A SG   1 
ATOM 656  H H    . CYS A 1 52 ? -9.779  11.684  2.678   1.00 0.95 ? 366 CYS A H    1 
ATOM 657  H HA   . CYS A 1 52 ? -7.380  13.451  2.397   1.00 0.86 ? 366 CYS A HA   1 
ATOM 658  H HB2  . CYS A 1 52 ? -7.920  11.289  4.470   1.00 1.33 ? 366 CYS A HB2  1 
ATOM 659  H HB3  . CYS A 1 52 ? -6.390  12.153  4.311   1.00 1.24 ? 366 CYS A HB3  1 
ATOM 660  H HG   . CYS A 1 52 ? -8.035  13.297  6.112   1.00 2.18 ? 366 CYS A HG   1 
ATOM 661  N N    . LEU A 1 53 ? -6.477  11.766  0.742   1.00 0.58 ? 367 LEU A N    1 
ATOM 662  C CA   . LEU A 1 53 ? -5.874  10.733  -0.140  1.00 0.57 ? 367 LEU A CA   1 
ATOM 663  C C    . LEU A 1 53 ? -4.915  9.871   0.679   1.00 0.48 ? 367 LEU A C    1 
ATOM 664  O O    . LEU A 1 53 ? -4.877  8.667   0.525   1.00 0.48 ? 367 LEU A O    1 
ATOM 665  C CB   . LEU A 1 53 ? -5.117  11.415  -1.283  1.00 0.72 ? 367 LEU A CB   1 
ATOM 666  C CG   . LEU A 1 53 ? -4.546  10.350  -2.226  1.00 1.17 ? 367 LEU A CG   1 
ATOM 667  C CD1  . LEU A 1 53 ? -5.703  9.622   -2.922  1.00 1.90 ? 367 LEU A CD1  1 
ATOM 668  C CD2  . LEU A 1 53 ? -3.659  11.020  -3.286  1.00 1.52 ? 367 LEU A CD2  1 
ATOM 669  H H    . LEU A 1 53 ? -6.372  12.718  0.529   1.00 0.66 ? 367 LEU A H    1 
ATOM 670  H HA   . LEU A 1 53 ? -6.655  10.109  -0.547  1.00 0.59 ? 367 LEU A HA   1 
ATOM 671  H HB2  . LEU A 1 53 ? -5.797  12.057  -1.829  1.00 1.26 ? 367 LEU A HB2  1 
ATOM 672  H HB3  . LEU A 1 53 ? -4.312  12.006  -0.874  1.00 1.26 ? 367 LEU A HB3  1 
ATOM 673  H HG   . LEU A 1 53 ? -3.959  9.641   -1.655  1.00 1.72 ? 367 LEU A HG   1 
ATOM 674  H HD11 . LEU A 1 53 ? -5.949  8.722   -2.375  1.00 2.35 ? 367 LEU A HD11 1 
ATOM 675  H HD12 . LEU A 1 53 ? -5.416  9.362   -3.928  1.00 2.50 ? 367 LEU A HD12 1 
ATOM 676  H HD13 . LEU A 1 53 ? -6.565  10.269  -2.952  1.00 2.19 ? 367 LEU A HD13 1 
ATOM 677  H HD21 . LEU A 1 53 ? -3.940  10.665  -4.265  1.00 1.95 ? 367 LEU A HD21 1 
ATOM 678  H HD22 . LEU A 1 53 ? -2.623  10.777  -3.100  1.00 1.86 ? 367 LEU A HD22 1 
ATOM 679  H HD23 . LEU A 1 53 ? -3.792  12.092  -3.244  1.00 1.99 ? 367 LEU A HD23 1 
ATOM 680  N N    . ARG A 1 54 ? -4.158  10.461  1.565   1.00 0.46 ? 368 ARG A N    1 
ATOM 681  C CA   . ARG A 1 54 ? -3.226  9.645   2.387   1.00 0.42 ? 368 ARG A CA   1 
ATOM 682  C C    . ARG A 1 54 ? -4.055  8.633   3.185   1.00 0.37 ? 368 ARG A C    1 
ATOM 683  O O    . ARG A 1 54 ? -3.690  7.481   3.317   1.00 0.35 ? 368 ARG A O    1 
ATOM 684  C CB   . ARG A 1 54 ? -2.476  10.575  3.343   1.00 0.47 ? 368 ARG A CB   1 
ATOM 685  C CG   . ARG A 1 54 ? -1.265  9.856   3.930   1.00 1.39 ? 368 ARG A CG   1 
ATOM 686  C CD   . ARG A 1 54 ? -0.569  10.793  4.905   1.00 1.54 ? 368 ARG A CD   1 
ATOM 687  N NE   . ARG A 1 54 ? -0.141  12.020  4.176   1.00 2.24 ? 368 ARG A NE   1 
ATOM 688  C CZ   . ARG A 1 54 ? 1.119   12.187  3.870   1.00 2.68 ? 368 ARG A CZ   1 
ATOM 689  N NH1  . ARG A 1 54 ? 1.785   11.245  3.237   1.00 3.34 ? 368 ARG A NH1  1 
ATOM 690  N NH2  . ARG A 1 54 ? 1.713   13.301  4.205   1.00 2.90 ? 368 ARG A NH2  1 
ATOM 691  H H    . ARG A 1 54 ? -4.202  11.433  1.688   1.00 0.51 ? 368 ARG A H    1 
ATOM 692  H HA   . ARG A 1 54 ? -2.522  9.122   1.750   1.00 0.43 ? 368 ARG A HA   1 
ATOM 693  H HB2  . ARG A 1 54 ? -2.148  11.451  2.806   1.00 0.90 ? 368 ARG A HB2  1 
ATOM 694  H HB3  . ARG A 1 54 ? -3.135  10.874  4.145   1.00 1.15 ? 368 ARG A HB3  1 
ATOM 695  H HG2  . ARG A 1 54 ? -1.589  8.967   4.450   1.00 2.11 ? 368 ARG A HG2  1 
ATOM 696  H HG3  . ARG A 1 54 ? -0.581  9.588   3.139   1.00 1.90 ? 368 ARG A HG3  1 
ATOM 697  H HD2  . ARG A 1 54 ? -1.255  11.056  5.697   1.00 1.58 ? 368 ARG A HD2  1 
ATOM 698  H HD3  . ARG A 1 54 ? 0.296   10.303  5.321   1.00 2.06 ? 368 ARG A HD3  1 
ATOM 699  H HE   . ARG A 1 54 ? -0.806  12.707  3.935   1.00 2.74 ? 368 ARG A HE   1 
ATOM 700  H HH11 . ARG A 1 54 ? 1.330   10.389  2.982   1.00 3.62 ? 368 ARG A HH11 1 
ATOM 701  H HH12 . ARG A 1 54 ? 2.754   11.379  3.019   1.00 3.80 ? 368 ARG A HH12 1 
ATOM 702  H HH21 . ARG A 1 54 ? 1.200   14.012  4.690   1.00 2.98 ? 368 ARG A HH21 1 
ATOM 703  H HH22 . ARG A 1 54 ? 2.676   13.443  3.987   1.00 3.30 ? 368 ARG A HH22 1 
ATOM 704  N N    . GLU A 1 55 ? -5.182  9.059   3.699   1.00 0.39 ? 369 GLU A N    1 
ATOM 705  C CA   . GLU A 1 55 ? -6.060  8.134   4.476   1.00 0.39 ? 369 GLU A CA   1 
ATOM 706  C C    . GLU A 1 55 ? -6.520  7.003   3.560   1.00 0.40 ? 369 GLU A C    1 
ATOM 707  O O    . GLU A 1 55 ? -6.577  5.851   3.950   1.00 0.42 ? 369 GLU A O    1 
ATOM 708  C CB   . GLU A 1 55 ? -7.277  8.906   5.002   1.00 0.44 ? 369 GLU A CB   1 
ATOM 709  C CG   . GLU A 1 55 ? -8.095  8.020   5.955   1.00 1.24 ? 369 GLU A CG   1 
ATOM 710  C CD   . GLU A 1 55 ? -9.299  8.806   6.480   1.00 1.53 ? 369 GLU A CD   1 
ATOM 711  O OE1  . GLU A 1 55 ? -9.438  9.961   6.112   1.00 1.96 ? 369 GLU A OE1  1 
ATOM 712  O OE2  . GLU A 1 55 ? -10.065 8.239   7.240   1.00 2.18 ? 369 GLU A OE2  1 
ATOM 713  H H    . GLU A 1 55 ? -5.455  9.989   3.562   1.00 0.42 ? 369 GLU A H    1 
ATOM 714  H HA   . GLU A 1 55 ? -5.505  7.724   5.309   1.00 0.40 ? 369 GLU A HA   1 
ATOM 715  H HB2  . GLU A 1 55 ? -6.941  9.787   5.530   1.00 1.03 ? 369 GLU A HB2  1 
ATOM 716  H HB3  . GLU A 1 55 ? -7.899  9.203   4.170   1.00 0.69 ? 369 GLU A HB3  1 
ATOM 717  H HG2  . GLU A 1 55 ? -8.444  7.145   5.424   1.00 1.72 ? 369 GLU A HG2  1 
ATOM 718  H HG3  . GLU A 1 55 ? -7.479  7.714   6.787   1.00 2.06 ? 369 GLU A HG3  1 
ATOM 719  N N    . ALA A 1 56 ? -6.844  7.322   2.340   1.00 0.42 ? 370 ALA A N    1 
ATOM 720  C CA   . ALA A 1 56 ? -7.291  6.264   1.394   1.00 0.46 ? 370 ALA A CA   1 
ATOM 721  C C    . ALA A 1 56 ? -6.128  5.324   1.119   1.00 0.42 ? 370 ALA A C    1 
ATOM 722  O O    . ALA A 1 56 ? -6.218  4.129   1.315   1.00 0.41 ? 370 ALA A O    1 
ATOM 723  C CB   . ALA A 1 56 ? -7.728  6.904   0.083   1.00 0.54 ? 370 ALA A CB   1 
ATOM 724  H H    . ALA A 1 56 ? -6.786  8.257   2.047   1.00 0.43 ? 370 ALA A H    1 
ATOM 725  H HA   . ALA A 1 56 ? -8.112  5.714   1.826   1.00 0.50 ? 370 ALA A HA   1 
ATOM 726  H HB1  . ALA A 1 56 ? -8.523  7.608   0.272   1.00 1.16 ? 370 ALA A HB1  1 
ATOM 727  H HB2  . ALA A 1 56 ? -8.075  6.137   -0.595  1.00 1.01 ? 370 ALA A HB2  1 
ATOM 728  H HB3  . ALA A 1 56 ? -6.890  7.420   -0.358  1.00 1.12 ? 370 ALA A HB3  1 
ATOM 729  N N    . GLN A 1 57 ? -5.020  5.858   0.686   1.00 0.42 ? 371 GLN A N    1 
ATOM 730  C CA   . GLN A 1 57 ? -3.850  4.994   0.422   1.00 0.39 ? 371 GLN A CA   1 
ATOM 731  C C    . GLN A 1 57 ? -3.496  4.293   1.734   1.00 0.35 ? 371 GLN A C    1 
ATOM 732  O O    . GLN A 1 57 ? -3.173  3.120   1.757   1.00 0.33 ? 371 GLN A O    1 
ATOM 733  C CB   . GLN A 1 57 ? -2.684  5.860   -0.062  1.00 0.44 ? 371 GLN A CB   1 
ATOM 734  C CG   . GLN A 1 57 ? -3.016  6.440   -1.442  1.00 0.81 ? 371 GLN A CG   1 
ATOM 735  C CD   . GLN A 1 57 ? -1.903  7.389   -1.885  1.00 1.46 ? 371 GLN A CD   1 
ATOM 736  O OE1  . GLN A 1 57 ? -2.147  8.311   -2.634  1.00 2.15 ? 371 GLN A OE1  1 
ATOM 737  N NE2  . GLN A 1 57 ? -0.685  7.209   -1.455  1.00 2.14 ? 371 GLN A NE2  1 
ATOM 738  H H    . GLN A 1 57 ? -4.957  6.824   0.549   1.00 0.44 ? 371 GLN A H    1 
ATOM 739  H HA   . GLN A 1 57 ? -4.101  4.257   -0.331  1.00 0.41 ? 371 GLN A HA   1 
ATOM 740  H HB2  . GLN A 1 57 ? -2.514  6.666   0.638   1.00 0.80 ? 371 GLN A HB2  1 
ATOM 741  H HB3  . GLN A 1 57 ? -1.796  5.253   -0.136  1.00 0.87 ? 371 GLN A HB3  1 
ATOM 742  H HG2  . GLN A 1 57 ? -3.107  5.638   -2.160  1.00 1.46 ? 371 GLN A HG2  1 
ATOM 743  H HG3  . GLN A 1 57 ? -3.948  6.985   -1.391  1.00 1.44 ? 371 GLN A HG3  1 
ATOM 744  H HE21 . GLN A 1 57 ? -0.480  6.471   -0.848  1.00 2.36 ? 371 GLN A HE21 1 
ATOM 745  H HE22 . GLN A 1 57 ? 0.027   7.814   -1.743  1.00 2.78 ? 371 GLN A HE22 1 
ATOM 746  N N    . TYR A 1 58 ? -3.595  4.999   2.837   1.00 0.35 ? 372 TYR A N    1 
ATOM 747  C CA   . TYR A 1 58 ? -3.301  4.360   4.146   1.00 0.35 ? 372 TYR A CA   1 
ATOM 748  C C    . TYR A 1 58 ? -4.346  3.277   4.397   1.00 0.36 ? 372 TYR A C    1 
ATOM 749  O O    . TYR A 1 58 ? -4.070  2.272   5.014   1.00 0.38 ? 372 TYR A O    1 
ATOM 750  C CB   . TYR A 1 58 ? -3.345  5.388   5.282   1.00 0.38 ? 372 TYR A CB   1 
ATOM 751  C CG   . TYR A 1 58 ? -2.635  4.820   6.493   1.00 0.37 ? 372 TYR A CG   1 
ATOM 752  C CD1  . TYR A 1 58 ? -1.243  5.023   6.657   1.00 1.25 ? 372 TYR A CD1  1 
ATOM 753  C CD2  . TYR A 1 58 ? -3.364  4.079   7.454   1.00 1.27 ? 372 TYR A CD2  1 
ATOM 754  C CE1  . TYR A 1 58 ? -0.587  4.493   7.778   1.00 1.25 ? 372 TYR A CE1  1 
ATOM 755  C CE2  . TYR A 1 58 ? -2.705  3.546   8.574   1.00 1.29 ? 372 TYR A CE2  1 
ATOM 756  C CZ   . TYR A 1 58 ? -1.317  3.754   8.734   1.00 0.42 ? 372 TYR A CZ   1 
ATOM 757  O OH   . TYR A 1 58 ? -0.668  3.226   9.827   1.00 0.46 ? 372 TYR A OH   1 
ATOM 758  H H    . TYR A 1 58 ? -3.889  5.935   2.798   1.00 0.37 ? 372 TYR A H    1 
ATOM 759  H HA   . TYR A 1 58 ? -2.322  3.909   4.105   1.00 0.34 ? 372 TYR A HA   1 
ATOM 760  H HB2  . TYR A 1 58 ? -2.855  6.301   4.968   1.00 0.38 ? 372 TYR A HB2  1 
ATOM 761  H HB3  . TYR A 1 58 ? -4.371  5.600   5.537   1.00 0.41 ? 372 TYR A HB3  1 
ATOM 762  H HD1  . TYR A 1 58 ? -0.678  5.587   5.919   1.00 2.16 ? 372 TYR A HD1  1 
ATOM 763  H HD2  . TYR A 1 58 ? -4.434  3.921   7.330   1.00 2.17 ? 372 TYR A HD2  1 
ATOM 764  H HE1  . TYR A 1 58 ? 0.483   4.651   7.912   1.00 2.15 ? 372 TYR A HE1  1 
ATOM 765  H HE2  . TYR A 1 58 ? -3.267  2.978   9.321   1.00 2.19 ? 372 TYR A HE2  1 
ATOM 766  H HH   . TYR A 1 58 ? -0.325  3.954   10.344  1.00 0.90 ? 372 TYR A HH   1 
ATOM 767  N N    . SER A 1 59 ? -5.550  3.467   3.905   1.00 0.39 ? 373 SER A N    1 
ATOM 768  C CA   . SER A 1 59 ? -6.601  2.428   4.108   1.00 0.43 ? 373 SER A CA   1 
ATOM 769  C C    . SER A 1 59 ? -6.112  1.124   3.490   1.00 0.41 ? 373 SER A C    1 
ATOM 770  O O    . SER A 1 59 ? -6.298  0.062   4.036   1.00 0.46 ? 373 SER A O    1 
ATOM 771  C CB   . SER A 1 59 ? -7.910  2.848   3.434   1.00 0.48 ? 373 SER A CB   1 
ATOM 772  O OG   . SER A 1 59 ? -8.397  4.026   4.059   1.00 1.09 ? 373 SER A OG   1 
ATOM 773  H H    . SER A 1 59 ? -5.756  4.283   3.401   1.00 0.39 ? 373 SER A H    1 
ATOM 774  H HA   . SER A 1 59 ? -6.767  2.287   5.166   1.00 0.46 ? 373 SER A HA   1 
ATOM 775  H HB2  . SER A 1 59 ? -7.736  3.047   2.389   1.00 0.64 ? 373 SER A HB2  1 
ATOM 776  H HB3  . SER A 1 59 ? -8.634  2.050   3.530   1.00 0.93 ? 373 SER A HB3  1 
ATOM 777  H HG   . SER A 1 59 ? -9.347  3.939   4.161   1.00 1.33 ? 373 SER A HG   1 
ATOM 778  N N    . MET A 1 60 ? -5.475  1.201   2.361   1.00 0.37 ? 374 MET A N    1 
ATOM 779  C CA   . MET A 1 60 ? -4.956  -0.036  1.727   1.00 0.35 ? 374 MET A CA   1 
ATOM 780  C C    . MET A 1 60 ? -3.913  -0.671  2.660   1.00 0.33 ? 374 MET A C    1 
ATOM 781  O O    . MET A 1 60 ? -3.984  -1.839  2.984   1.00 0.36 ? 374 MET A O    1 
ATOM 782  C CB   . MET A 1 60 ? -4.312  0.325   0.372   1.00 0.35 ? 374 MET A CB   1 
ATOM 783  C CG   . MET A 1 60 ? -3.327  -0.769  -0.076  1.00 0.33 ? 374 MET A CG   1 
ATOM 784  S SD   . MET A 1 60 ? -4.107  -2.408  -0.004  1.00 1.09 ? 374 MET A SD   1 
ATOM 785  C CE   . MET A 1 60 ? -5.501  -2.058  -1.089  1.00 0.38 ? 374 MET A CE   1 
ATOM 786  H H    . MET A 1 60 ? -5.323  2.074   1.938   1.00 0.36 ? 374 MET A H    1 
ATOM 787  H HA   . MET A 1 60 ? -5.771  -0.728  1.568   1.00 0.39 ? 374 MET A HA   1 
ATOM 788  H HB2  . MET A 1 60 ? -5.085  0.441   -0.374  1.00 0.39 ? 374 MET A HB2  1 
ATOM 789  H HB3  . MET A 1 60 ? -3.777  1.259   0.474   1.00 0.38 ? 374 MET A HB3  1 
ATOM 790  H HG2  . MET A 1 60 ? -2.996  -0.569  -1.080  1.00 0.76 ? 374 MET A HG2  1 
ATOM 791  H HG3  . MET A 1 60 ? -2.477  -0.755  0.587   1.00 0.75 ? 374 MET A HG3  1 
ATOM 792  H HE1  . MET A 1 60 ? -5.781  -2.960  -1.610  1.00 1.03 ? 374 MET A HE1  1 
ATOM 793  H HE2  . MET A 1 60 ? -5.220  -1.304  -1.804  1.00 1.11 ? 374 MET A HE2  1 
ATOM 794  H HE3  . MET A 1 60 ? -6.332  -1.704  -0.498  1.00 1.06 ? 374 MET A HE3  1 
ATOM 795  N N    . LEU A 1 61 ? -2.943  0.098   3.076   1.00 0.30 ? 375 LEU A N    1 
ATOM 796  C CA   . LEU A 1 61 ? -1.877  -0.442  3.970   1.00 0.31 ? 375 LEU A CA   1 
ATOM 797  C C    . LEU A 1 61 ? -2.456  -0.781  5.339   1.00 0.35 ? 375 LEU A C    1 
ATOM 798  O O    . LEU A 1 61 ? -2.007  -1.698  5.999   1.00 0.39 ? 375 LEU A O    1 
ATOM 799  C CB   . LEU A 1 61 ? -0.764  0.606   4.116   1.00 0.32 ? 375 LEU A CB   1 
ATOM 800  C CG   . LEU A 1 61 ? 0.200   0.578   2.902   1.00 0.28 ? 375 LEU A CG   1 
ATOM 801  C CD1  . LEU A 1 61 ? -0.523  0.147   1.624   1.00 0.30 ? 375 LEU A CD1  1 
ATOM 802  C CD2  . LEU A 1 61 ? 0.767   1.979   2.672   1.00 0.33 ? 375 LEU A CD2  1 
ATOM 803  H H    . LEU A 1 61 ? -2.909  1.035   2.790   1.00 0.30 ? 375 LEU A H    1 
ATOM 804  H HA   . LEU A 1 61 ? -1.465  -1.339  3.529   1.00 0.31 ? 375 LEU A HA   1 
ATOM 805  H HB2  . LEU A 1 61 ? -1.213  1.583   4.188   1.00 0.36 ? 375 LEU A HB2  1 
ATOM 806  H HB3  . LEU A 1 61 ? -0.207  0.408   5.018   1.00 0.39 ? 375 LEU A HB3  1 
ATOM 807  H HG   . LEU A 1 61 ? 1.011   -0.106  3.103   1.00 0.34 ? 375 LEU A HG   1 
ATOM 808  H HD11 . LEU A 1 61 ? 0.124   0.307   0.775   1.00 1.08 ? 375 LEU A HD11 1 
ATOM 809  H HD12 . LEU A 1 61 ? -1.423  0.734   1.507   1.00 0.98 ? 375 LEU A HD12 1 
ATOM 810  H HD13 . LEU A 1 61 ? -0.781  -0.899  1.692   1.00 0.99 ? 375 LEU A HD13 1 
ATOM 811  H HD21 . LEU A 1 61 ? 1.447   2.231   3.472   1.00 0.95 ? 375 LEU A HD21 1 
ATOM 812  H HD22 . LEU A 1 61 ? -0.044  2.695   2.644   1.00 1.10 ? 375 LEU A HD22 1 
ATOM 813  H HD23 . LEU A 1 61 ? 1.297   2.000   1.730   1.00 1.11 ? 375 LEU A HD23 1 
ATOM 814  N N    . ALA A 1 62 ? -3.444  -0.054  5.775   1.00 0.37 ? 376 ALA A N    1 
ATOM 815  C CA   . ALA A 1 62 ? -4.045  -0.345  7.107   1.00 0.43 ? 376 ALA A CA   1 
ATOM 816  C C    . ALA A 1 62 ? -5.095  -1.457  6.969   1.00 0.44 ? 376 ALA A C    1 
ATOM 817  O O    . ALA A 1 62 ? -5.029  -2.470  7.638   1.00 0.47 ? 376 ALA A O    1 
ATOM 818  C CB   . ALA A 1 62 ? -4.689  0.926   7.662   1.00 0.47 ? 376 ALA A CB   1 
ATOM 819  H H    . ALA A 1 62 ? -3.791  0.684   5.230   1.00 0.37 ? 376 ALA A H    1 
ATOM 820  H HA   . ALA A 1 62 ? -3.269  -0.674  7.784   1.00 0.45 ? 376 ALA A HA   1 
ATOM 821  H HB1  . ALA A 1 62 ? -5.740  0.941   7.414   1.00 1.08 ? 376 ALA A HB1  1 
ATOM 822  H HB2  . ALA A 1 62 ? -4.203  1.792   7.233   1.00 1.12 ? 376 ALA A HB2  1 
ATOM 823  H HB3  . ALA A 1 62 ? -4.572  0.944   8.736   1.00 1.14 ? 376 ALA A HB3  1 
ATOM 824  N N    . THR A 1 63 ? -6.053  -1.284  6.098   1.00 0.43 ? 377 THR A N    1 
ATOM 825  C CA   . THR A 1 63 ? -7.099  -2.337  5.912   1.00 0.46 ? 377 THR A CA   1 
ATOM 826  C C    . THR A 1 63 ? -6.442  -3.661  5.497   1.00 0.44 ? 377 THR A C    1 
ATOM 827  O O    . THR A 1 63 ? -6.866  -4.724  5.902   1.00 0.49 ? 377 THR A O    1 
ATOM 828  C CB   . THR A 1 63 ? -8.076  -1.905  4.821   1.00 0.49 ? 377 THR A CB   1 
ATOM 829  O OG1  . THR A 1 63 ? -8.602  -0.624  5.135   1.00 0.53 ? 377 THR A OG1  1 
ATOM 830  C CG2  . THR A 1 63 ? -9.217  -2.924  4.729   1.00 0.55 ? 377 THR A CG2  1 
ATOM 831  H H    . THR A 1 63 ? -6.087  -0.461  5.565   1.00 0.43 ? 377 THR A H    1 
ATOM 832  H HA   . THR A 1 63 ? -7.639  -2.477  6.838   1.00 0.51 ? 377 THR A HA   1 
ATOM 833  H HB   . THR A 1 63 ? -7.563  -1.859  3.874   1.00 0.46 ? 377 THR A HB   1 
ATOM 834  H HG1  . THR A 1 63 ? -8.717  -0.144  4.306   1.00 0.49 ? 377 THR A HG1  1 
ATOM 835  H HG21 . THR A 1 63 ? -8.814  -3.895  4.484   1.00 1.21 ? 377 THR A HG21 1 
ATOM 836  H HG22 . THR A 1 63 ? -9.915  -2.619  3.962   1.00 1.13 ? 377 THR A HG22 1 
ATOM 837  H HG23 . THR A 1 63 ? -9.729  -2.976  5.678   1.00 1.06 ? 377 THR A HG23 1 
ATOM 838  N N    . TRP A 1 64 ? -5.418  -3.602  4.690   1.00 0.38 ? 378 TRP A N    1 
ATOM 839  C CA   . TRP A 1 64 ? -4.730  -4.849  4.239   1.00 0.37 ? 378 TRP A CA   1 
ATOM 840  C C    . TRP A 1 64 ? -4.258  -5.657  5.454   1.00 0.44 ? 378 TRP A C    1 
ATOM 841  O O    . TRP A 1 64 ? -4.516  -6.838  5.561   1.00 0.51 ? 378 TRP A O    1 
ATOM 842  C CB   . TRP A 1 64 ? -3.524  -4.431  3.388   1.00 0.34 ? 378 TRP A CB   1 
ATOM 843  C CG   . TRP A 1 64 ? -2.655  -5.603  3.074   1.00 0.36 ? 378 TRP A CG   1 
ATOM 844  C CD1  . TRP A 1 64 ? -1.833  -6.210  3.955   1.00 0.47 ? 378 TRP A CD1  1 
ATOM 845  C CD2  . TRP A 1 64 ? -2.494  -6.296  1.809   1.00 0.31 ? 378 TRP A CD2  1 
ATOM 846  N NE1  . TRP A 1 64 ? -1.168  -7.235  3.311   1.00 0.49 ? 378 TRP A NE1  1 
ATOM 847  C CE2  . TRP A 1 64 ? -1.541  -7.328  1.980   1.00 0.39 ? 378 TRP A CE2  1 
ATOM 848  C CE3  . TRP A 1 64 ? -3.075  -6.124  0.539   1.00 0.29 ? 378 TRP A CE3  1 
ATOM 849  C CZ2  . TRP A 1 64 ? -1.178  -8.169  0.922   1.00 0.39 ? 378 TRP A CZ2  1 
ATOM 850  C CZ3  . TRP A 1 64 ? -2.715  -6.967  -0.527  1.00 0.32 ? 378 TRP A CZ3  1 
ATOM 851  C CH2  . TRP A 1 64 ? -1.764  -7.985  -0.336  1.00 0.35 ? 378 TRP A CH2  1 
ATOM 852  H H    . TRP A 1 64 ? -5.100  -2.730  4.373   1.00 0.35 ? 378 TRP A H    1 
ATOM 853  H HA   . TRP A 1 64 ? -5.403  -5.448  3.642   1.00 0.40 ? 378 TRP A HA   1 
ATOM 854  H HB2  . TRP A 1 64 ? -3.875  -3.994  2.465   1.00 0.33 ? 378 TRP A HB2  1 
ATOM 855  H HB3  . TRP A 1 64 ? -2.947  -3.697  3.929   1.00 0.37 ? 378 TRP A HB3  1 
ATOM 856  H HD1  . TRP A 1 64 ? -1.717  -5.935  4.994   1.00 0.55 ? 378 TRP A HD1  1 
ATOM 857  H HE1  . TRP A 1 64 ? -0.510  -7.834  3.729   1.00 0.58 ? 378 TRP A HE1  1 
ATOM 858  H HE3  . TRP A 1 64 ? -3.810  -5.343  0.385   1.00 0.30 ? 378 TRP A HE3  1 
ATOM 859  H HZ2  . TRP A 1 64 ? -0.446  -8.948  1.071   1.00 0.47 ? 378 TRP A HZ2  1 
ATOM 860  H HZ3  . TRP A 1 64 ? -3.168  -6.827  -1.498  1.00 0.38 ? 378 TRP A HZ3  1 
ATOM 861  H HH2  . TRP A 1 64 ? -1.490  -8.627  -1.156  1.00 0.38 ? 378 TRP A HH2  1 
ATOM 862  N N    . ARG A 1 65 ? -3.577  -5.027  6.369   1.00 0.46 ? 379 ARG A N    1 
ATOM 863  C CA   . ARG A 1 65 ? -3.096  -5.766  7.571   1.00 0.58 ? 379 ARG A CA   1 
ATOM 864  C C    . ARG A 1 65 ? -4.307  -6.355  8.294   1.00 0.66 ? 379 ARG A C    1 
ATOM 865  O O    . ARG A 1 65 ? -4.271  -7.458  8.806   1.00 0.77 ? 379 ARG A O    1 
ATOM 866  C CB   . ARG A 1 65 ? -2.348  -4.815  8.516   1.00 0.61 ? 379 ARG A CB   1 
ATOM 867  C CG   . ARG A 1 65 ? -1.744  -5.627  9.669   1.00 1.17 ? 379 ARG A CG   1 
ATOM 868  C CD   . ARG A 1 65 ? -1.063  -4.684  10.671  1.00 1.19 ? 379 ARG A CD   1 
ATOM 869  N NE   . ARG A 1 65 ? -2.095  -3.835  11.323  1.00 1.87 ? 379 ARG A NE   1 
ATOM 870  C CZ   . ARG A 1 65 ? -1.735  -2.831  12.072  1.00 2.15 ? 379 ARG A CZ   1 
ATOM 871  N NH1  . ARG A 1 65 ? -0.655  -2.899  12.793  1.00 2.59 ? 379 ARG A NH1  1 
ATOM 872  N NH2  . ARG A 1 65 ? -2.445  -1.747  12.094  1.00 2.67 ? 379 ARG A NH2  1 
ATOM 873  H H    . ARG A 1 65 ? -3.385  -4.073  6.264   1.00 0.42 ? 379 ARG A H    1 
ATOM 874  H HA   . ARG A 1 65 ? -2.431  -6.561  7.264   1.00 0.61 ? 379 ARG A HA   1 
ATOM 875  H HB2  . ARG A 1 65 ? -1.557  -4.319  7.971   1.00 0.96 ? 379 ARG A HB2  1 
ATOM 876  H HB3  . ARG A 1 65 ? -3.035  -4.078  8.913   1.00 0.93 ? 379 ARG A HB3  1 
ATOM 877  H HG2  . ARG A 1 65 ? -2.528  -6.185  10.167  1.00 1.60 ? 379 ARG A HG2  1 
ATOM 878  H HG3  . ARG A 1 65 ? -1.015  -6.315  9.270   1.00 1.61 ? 379 ARG A HG3  1 
ATOM 879  H HD2  . ARG A 1 65 ? -0.543  -5.264  11.424  1.00 1.37 ? 379 ARG A HD2  1 
ATOM 880  H HD3  . ARG A 1 65 ? -0.357  -4.052  10.154  1.00 1.71 ? 379 ARG A HD3  1 
ATOM 881  H HE   . ARG A 1 65 ? -3.048  -4.024  11.181  1.00 2.57 ? 379 ARG A HE   1 
ATOM 882  H HH11 . ARG A 1 65 ? -0.095  -3.724  12.779  1.00 2.87 ? 379 ARG A HH11 1 
ATOM 883  H HH12 . ARG A 1 65 ? -0.387  -2.120  13.360  1.00 3.01 ? 379 ARG A HH12 1 
ATOM 884  H HH21 . ARG A 1 65 ? -3.274  -1.681  11.542  1.00 2.97 ? 379 ARG A HH21 1 
ATOM 885  H HH22 . ARG A 1 65 ? -2.155  -0.975  12.659  1.00 3.11 ? 379 ARG A HH22 1 
ATOM 886  N N    . ARG A 1 66 ? -5.382  -5.620  8.340   1.00 0.63 ? 380 ARG A N    1 
ATOM 887  C CA   . ARG A 1 66 ? -6.596  -6.122  9.036   1.00 0.75 ? 380 ARG A CA   1 
ATOM 888  C C    . ARG A 1 66 ? -7.296  -7.194  8.186   1.00 0.73 ? 380 ARG A C    1 
ATOM 889  O O    . ARG A 1 66 ? -7.379  -8.340  8.578   1.00 0.82 ? 380 ARG A O    1 
ATOM 890  C CB   . ARG A 1 66 ? -7.553  -4.955  9.277   1.00 0.83 ? 380 ARG A CB   1 
ATOM 891  C CG   . ARG A 1 66 ? -8.695  -5.420  10.181  1.00 1.69 ? 380 ARG A CG   1 
ATOM 892  C CD   . ARG A 1 66 ? -9.720  -4.300  10.314  1.00 2.15 ? 380 ARG A CD   1 
ATOM 893  N NE   . ARG A 1 66 ? -10.884 -4.786  11.102  1.00 2.57 ? 380 ARG A NE   1 
ATOM 894  C CZ   . ARG A 1 66 ? -10.966 -4.521  12.366  1.00 3.17 ? 380 ARG A CZ   1 
ATOM 895  N NH1  . ARG A 1 66 ? -10.871 -3.289  12.765  1.00 3.52 ? 380 ARG A NH1  1 
ATOM 896  N NH2  . ARG A 1 66 ? -11.176 -5.475  13.225  1.00 3.85 ? 380 ARG A NH2  1 
ATOM 897  H H    . ARG A 1 66 ? -5.386  -4.731  7.923   1.00 0.55 ? 380 ARG A H    1 
ATOM 898  H HA   . ARG A 1 66 ? -6.312  -6.547  9.985   1.00 0.85 ? 380 ARG A HA   1 
ATOM 899  H HB2  . ARG A 1 66 ? -7.018  -4.143  9.754   1.00 0.92 ? 380 ARG A HB2  1 
ATOM 900  H HB3  . ARG A 1 66 ? -7.956  -4.616  8.335   1.00 1.31 ? 380 ARG A HB3  1 
ATOM 901  H HG2  . ARG A 1 66 ? -9.167  -6.290  9.748   1.00 2.34 ? 380 ARG A HG2  1 
ATOM 902  H HG3  . ARG A 1 66 ? -8.307  -5.669  11.160  1.00 2.17 ? 380 ARG A HG3  1 
ATOM 903  H HD2  . ARG A 1 66 ? -9.270  -3.454  10.815  1.00 2.60 ? 380 ARG A HD2  1 
ATOM 904  H HD3  . ARG A 1 66 ? -10.053 -4.001  9.335   1.00 2.56 ? 380 ARG A HD3  1 
ATOM 905  H HE   . ARG A 1 66 ? -11.591 -5.289  10.663  1.00 2.80 ? 380 ARG A HE   1 
ATOM 906  H HH11 . ARG A 1 66 ? -10.734 -2.554  12.096  1.00 3.49 ? 380 ARG A HH11 1 
ATOM 907  H HH12 . ARG A 1 66 ? -10.937 -3.074  13.735  1.00 4.08 ? 380 ARG A HH12 1 
ATOM 908  H HH21 . ARG A 1 66 ? -11.275 -6.422  12.911  1.00 4.02 ? 380 ARG A HH21 1 
ATOM 909  H HH22 . ARG A 1 66 ? -11.238 -5.260  14.196  1.00 4.41 ? 380 ARG A HH22 1 
ATOM 910  N N    . ARG A 1 67 ? -7.808  -6.831  7.034   1.00 0.73 ? 381 ARG A N    1 
ATOM 911  C CA   . ARG A 1 67 ? -8.520  -7.829  6.179   1.00 0.82 ? 381 ARG A CA   1 
ATOM 912  C C    . ARG A 1 67 ? -7.606  -8.999  5.789   1.00 0.80 ? 381 ARG A C    1 
ATOM 913  O O    . ARG A 1 67 ? -8.006  -10.145 5.873   1.00 0.90 ? 381 ARG A O    1 
ATOM 914  C CB   . ARG A 1 67 ? -9.023  -7.134  4.913   1.00 0.96 ? 381 ARG A CB   1 
ATOM 915  C CG   . ARG A 1 67 ? -9.802  -8.145  4.057   1.00 1.75 ? 381 ARG A CG   1 
ATOM 916  C CD   . ARG A 1 67 ? -10.497 -7.436  2.897   1.00 1.96 ? 381 ARG A CD   1 
ATOM 917  N NE   . ARG A 1 67 ? -11.410 -8.405  2.221   1.00 2.95 ? 381 ARG A NE   1 
ATOM 918  C CZ   . ARG A 1 67 ? -12.585 -8.665  2.735   1.00 3.56 ? 381 ARG A CZ   1 
ATOM 919  N NH1  . ARG A 1 67 ? -13.324 -7.692  3.189   1.00 4.06 ? 381 ARG A NH1  1 
ATOM 920  N NH2  . ARG A 1 67 ? -13.020 -9.898  2.792   1.00 4.10 ? 381 ARG A NH2  1 
ATOM 921  H H    . ARG A 1 67 ? -7.744  -5.898  6.743   1.00 0.77 ? 381 ARG A H    1 
ATOM 922  H HA   . ARG A 1 67 ? -9.366  -8.218  6.723   1.00 0.90 ? 381 ARG A HA   1 
ATOM 923  H HB2  . ARG A 1 67 ? -9.665  -6.311  5.194   1.00 1.16 ? 381 ARG A HB2  1 
ATOM 924  H HB3  . ARG A 1 67 ? -8.180  -6.759  4.352   1.00 1.37 ? 381 ARG A HB3  1 
ATOM 925  H HG2  . ARG A 1 67 ? -9.112  -8.873  3.658   1.00 2.46 ? 381 ARG A HG2  1 
ATOM 926  H HG3  . ARG A 1 67 ? -10.541 -8.651  4.663   1.00 2.26 ? 381 ARG A HG3  1 
ATOM 927  H HD2  . ARG A 1 67 ? -11.067 -6.594  3.269   1.00 1.85 ? 381 ARG A HD2  1 
ATOM 928  H HD3  . ARG A 1 67 ? -9.757  -7.085  2.193   1.00 2.32 ? 381 ARG A HD3  1 
ATOM 929  H HE   . ARG A 1 67 ? -11.128 -8.845  1.391   1.00 3.39 ? 381 ARG A HE   1 
ATOM 930  H HH11 . ARG A 1 67 ? -12.996 -6.748  3.138   1.00 4.13 ? 381 ARG A HH11 1 
ATOM 931  H HH12 . ARG A 1 67 ? -14.206 -7.889  3.603   1.00 4.64 ? 381 ARG A HH12 1 
ATOM 932  H HH21 . ARG A 1 67 ? -12.450 -10.646 2.443   1.00 4.17 ? 381 ARG A HH21 1 
ATOM 933  H HH22 . ARG A 1 67 ? -13.921 -10.092 3.174   1.00 4.69 ? 381 ARG A HH22 1 
ATOM 934  N N    . THR A 1 68 ? -6.396  -8.753  5.357   1.00 0.79 ? 382 THR A N    1 
ATOM 935  C CA   . THR A 1 68 ? -5.531  -9.905  4.963   1.00 0.86 ? 382 THR A CA   1 
ATOM 936  C C    . THR A 1 68 ? -4.981  -10.594 6.213   1.00 0.92 ? 382 THR A C    1 
ATOM 937  O O    . THR A 1 68 ? -4.613  -9.941  7.165   1.00 1.06 ? 382 THR A O    1 
ATOM 938  C CB   . THR A 1 68 ? -4.371  -9.433  4.090   1.00 0.96 ? 382 THR A CB   1 
ATOM 939  O OG1  . THR A 1 68 ? -3.388  -8.804  4.901   1.00 1.74 ? 382 THR A OG1  1 
ATOM 940  C CG2  . THR A 1 68 ? -4.894  -8.461  3.028   1.00 0.88 ? 382 THR A CG2  1 
ATOM 941  H H    . THR A 1 68 ? -6.066  -7.832  5.282   1.00 0.81 ? 382 THR A H    1 
ATOM 942  H HA   . THR A 1 68 ? -6.129  -10.608 4.397   1.00 0.95 ? 382 THR A HA   1 
ATOM 943  H HB   . THR A 1 68 ? -3.932  -10.287 3.598   1.00 1.22 ? 382 THR A HB   1 
ATOM 944  H HG1  . THR A 1 68 ? -2.531  -9.120  4.625   1.00 1.98 ? 382 THR A HG1  1 
ATOM 945  H HG21 . THR A 1 68 ? -4.091  -8.203  2.353   1.00 1.32 ? 382 THR A HG21 1 
ATOM 946  H HG22 . THR A 1 68 ? -5.270  -7.570  3.503   1.00 1.41 ? 382 THR A HG22 1 
ATOM 947  H HG23 . THR A 1 68 ? -5.694  -8.934  2.474   1.00 1.52 ? 382 THR A HG23 1 
ATOM 948  N N    . PRO A 1 69 ? -4.948  -11.900 6.178   1.00 1.07 ? 383 PRO A N    1 
ATOM 949  C CA   . PRO A 1 69 ? -4.432  -12.670 7.335   1.00 1.20 ? 383 PRO A CA   1 
ATOM 950  C C    . PRO A 1 69 ? -2.902  -12.746 7.312   1.00 1.46 ? 383 PRO A C    1 
ATOM 951  O O    . PRO A 1 69 ? -2.333  -13.821 7.327   1.00 1.94 ? 383 PRO A O    1 
ATOM 952  C CB   . PRO A 1 69 ? -5.016  -14.055 7.123   1.00 1.44 ? 383 PRO A CB   1 
ATOM 953  C CG   . PRO A 1 69 ? -5.236  -14.168 5.642   1.00 1.63 ? 383 PRO A CG   1 
ATOM 954  C CD   . PRO A 1 69 ? -5.391  -12.776 5.086   1.00 1.35 ? 383 PRO A CD   1 
ATOM 955  H HA   . PRO A 1 69 ? -4.783  -12.259 8.267   1.00 1.25 ? 383 PRO A HA   1 
ATOM 956  H HB2  . PRO A 1 69 ? -4.316  -14.809 7.464   1.00 1.58 ? 383 PRO A HB2  1 
ATOM 957  H HB3  . PRO A 1 69 ? -5.954  -14.149 7.644   1.00 1.53 ? 383 PRO A HB3  1 
ATOM 958  H HG2  . PRO A 1 69 ? -4.382  -14.647 5.182   1.00 1.83 ? 383 PRO A HG2  1 
ATOM 959  H HG3  . PRO A 1 69 ? -6.127  -14.740 5.444   1.00 1.92 ? 383 PRO A HG3  1 
ATOM 960  H HD2  . PRO A 1 69 ? -4.763  -12.643 4.214   1.00 1.44 ? 383 PRO A HD2  1 
ATOM 961  H HD3  . PRO A 1 69 ? -6.423  -12.576 4.843   1.00 1.46 ? 383 PRO A HD3  1 
ATOM 962  N N    . ARG A 1 70 ? -2.235  -11.623 7.286   1.00 1.83 ? 384 ARG A N    1 
ATOM 963  C CA   . ARG A 1 70 ? -0.741  -11.634 7.276   1.00 2.27 ? 384 ARG A CA   1 
ATOM 964  C C    . ARG A 1 70 ? -0.223  -11.351 8.683   1.00 1.73 ? 384 ARG A C    1 
ATOM 965  O O    . ARG A 1 70 ? -0.232  -10.225 9.147   1.00 2.27 ? 384 ARG A O    1 
ATOM 966  C CB   . ARG A 1 70 ? -0.216  -10.548 6.334   1.00 3.35 ? 384 ARG A CB   1 
ATOM 967  C CG   . ARG A 1 70 ? -0.668  -10.859 4.922   1.00 4.28 ? 384 ARG A CG   1 
ATOM 968  C CD   . ARG A 1 70 ? 0.107   -12.066 4.419   1.00 5.30 ? 384 ARG A CD   1 
ATOM 969  N NE   . ARG A 1 70 ? -0.380  -12.418 3.063   1.00 6.10 ? 384 ARG A NE   1 
ATOM 970  C CZ   . ARG A 1 70 ? 0.320   -13.225 2.310   1.00 7.01 ? 384 ARG A CZ   1 
ATOM 971  N NH1  . ARG A 1 70 ? 0.841   -14.311 2.822   1.00 7.77 ? 384 ARG A NH1  1 
ATOM 972  N NH2  . ARG A 1 70 ? 0.494   -12.953 1.042   1.00 7.38 ? 384 ARG A NH2  1 
ATOM 973  H H    . ARG A 1 70 ? -2.715  -10.771 7.281   1.00 2.17 ? 384 ARG A H    1 
ATOM 974  H HA   . ARG A 1 70 ? -0.389  -12.598 6.948   1.00 2.75 ? 384 ARG A HA   1 
ATOM 975  H HB2  . ARG A 1 70 ? -0.602  -9.586  6.634   1.00 3.57 ? 384 ARG A HB2  1 
ATOM 976  H HB3  . ARG A 1 70 ? 0.865   -10.534 6.365   1.00 3.68 ? 384 ARG A HB3  1 
ATOM 977  H HG2  . ARG A 1 70 ? -1.726  -11.085 4.923   1.00 4.41 ? 384 ARG A HG2  1 
ATOM 978  H HG3  . ARG A 1 70 ? -0.475  -10.014 4.283   1.00 4.52 ? 384 ARG A HG3  1 
ATOM 979  H HD2  . ARG A 1 70 ? 1.161   -11.829 4.379   1.00 5.47 ? 384 ARG A HD2  1 
ATOM 980  H HD3  . ARG A 1 70 ? -0.052  -12.899 5.087   1.00 5.62 ? 384 ARG A HD3  1 
ATOM 981  H HE   . ARG A 1 70 ? -1.232  -12.055 2.743   1.00 6.12 ? 384 ARG A HE   1 
ATOM 982  H HH11 . ARG A 1 70 ? 0.700   -14.526 3.788   1.00 7.74 ? 384 ARG A HH11 1 
ATOM 983  H HH12 . ARG A 1 70 ? 1.390   -14.924 2.249   1.00 8.52 ? 384 ARG A HH12 1 
ATOM 984  H HH21 . ARG A 1 70 ? 0.093   -12.128 0.646   1.00 7.02 ? 384 ARG A HH21 1 
ATOM 985  H HH22 . ARG A 1 70 ? 1.034   -13.570 0.469   1.00 8.18 ? 384 ARG A HH22 1 
ATOM 986  N N    . ARG A 1 71 ? 0.234   -12.355 9.365   1.00 1.67 ? 385 ARG A N    1 
ATOM 987  C CA   . ARG A 1 71 ? 0.752   -12.143 10.743  1.00 2.15 ? 385 ARG A CA   1 
ATOM 988  C C    . ARG A 1 71 ? 1.945   -11.165 10.739  1.00 1.77 ? 385 ARG A C    1 
ATOM 989  O O    . ARG A 1 71 ? 2.177   -10.459 11.703  1.00 2.35 ? 385 ARG A O    1 
ATOM 990  C CB   . ARG A 1 71 ? 1.213   -13.485 11.320  1.00 3.13 ? 385 ARG A CB   1 
ATOM 991  C CG   . ARG A 1 71 ? 0.011   -14.396 11.552  1.00 3.76 ? 385 ARG A CG   1 
ATOM 992  C CD   . ARG A 1 71 ? 0.512   -15.691 12.198  1.00 4.84 ? 385 ARG A CD   1 
ATOM 993  N NE   . ARG A 1 71 ? 1.032   -15.425 13.578  1.00 5.32 ? 385 ARG A NE   1 
ATOM 994  C CZ   . ARG A 1 71 ? 1.826   -16.302 14.135  1.00 6.24 ? 385 ARG A CZ   1 
ATOM 995  N NH1  . ARG A 1 71 ? 2.951   -16.632 13.540  1.00 6.80 ? 385 ARG A NH1  1 
ATOM 996  N NH2  . ARG A 1 71 ? 1.491   -16.860 15.275  1.00 6.84 ? 385 ARG A NH2  1 
ATOM 997  H H    . ARG A 1 71 ? 0.225   -13.253 8.978   1.00 2.05 ? 385 ARG A H    1 
ATOM 998  H HA   . ARG A 1 71 ? -0.037  -11.743 11.361  1.00 2.72 ? 385 ARG A HA   1 
ATOM 999  H HB2  . ARG A 1 71 ? 1.894   -13.961 10.629  1.00 3.47 ? 385 ARG A HB2  1 
ATOM 1000 H HB3  . ARG A 1 71 ? 1.716   -13.320 12.260  1.00 3.63 ? 385 ARG A HB3  1 
ATOM 1001 H HG2  . ARG A 1 71 ? -0.698  -13.904 12.202  1.00 3.96 ? 385 ARG A HG2  1 
ATOM 1002 H HG3  . ARG A 1 71 ? -0.462  -14.626 10.604  1.00 3.75 ? 385 ARG A HG3  1 
ATOM 1003 H HD2  . ARG A 1 71 ? -0.292  -16.407 12.249  1.00 5.21 ? 385 ARG A HD2  1 
ATOM 1004 H HD3  . ARG A 1 71 ? 1.311   -16.097 11.595  1.00 5.23 ? 385 ARG A HD3  1 
ATOM 1005 H HE   . ARG A 1 71 ? 0.778   -14.608 14.062  1.00 5.18 ? 385 ARG A HE   1 
ATOM 1006 H HH11 . ARG A 1 71 ? 3.203   -16.204 12.671  1.00 6.61 ? 385 ARG A HH11 1 
ATOM 1007 H HH12 . ARG A 1 71 ? 3.547   -17.330 13.940  1.00 7.57 ? 385 ARG A HH12 1 
ATOM 1008 H HH21 . ARG A 1 71 ? 0.635   -16.612 15.716  1.00 6.70 ? 385 ARG A HH21 1 
ATOM 1009 H HH22 . ARG A 1 71 ? 2.094   -17.536 15.705  1.00 7.59 ? 385 ARG A HH22 1 
ATOM 1010 N N    . GLU A 1 72 ? 2.722   -11.120 9.687   1.00 1.67 ? 386 GLU A N    1 
ATOM 1011 C CA   . GLU A 1 72 ? 3.887   -10.194 9.692   1.00 2.14 ? 386 GLU A CA   1 
ATOM 1012 C C    . GLU A 1 72 ? 4.456   -10.071 8.280   1.00 1.59 ? 386 GLU A C    1 
ATOM 1013 O O    . GLU A 1 72 ? 4.051   -10.777 7.378   1.00 2.16 ? 386 GLU A O    1 
ATOM 1014 C CB   . GLU A 1 72 ? 4.956   -10.739 10.631  1.00 3.15 ? 386 GLU A CB   1 
ATOM 1015 C CG   . GLU A 1 72 ? 5.662   -9.571  11.305  1.00 3.94 ? 386 GLU A CG   1 
ATOM 1016 C CD   . GLU A 1 72 ? 6.465   -10.087 12.500  1.00 5.05 ? 386 GLU A CD   1 
ATOM 1017 O OE1  . GLU A 1 72 ? 6.120   -11.142 13.006  1.00 5.57 ? 386 GLU A OE1  1 
ATOM 1018 O OE2  . GLU A 1 72 ? 7.422   -9.434  12.875  1.00 5.61 ? 386 GLU A OE2  1 
ATOM 1019 H H    . GLU A 1 72 ? 2.554   -11.693 8.909   1.00 1.97 ? 386 GLU A H    1 
ATOM 1020 H HA   . GLU A 1 72 ? 3.571   -9.222  10.037  1.00 2.63 ? 386 GLU A HA   1 
ATOM 1021 H HB2  . GLU A 1 72 ? 4.493   -11.369 11.376  1.00 3.33 ? 386 GLU A HB2  1 
ATOM 1022 H HB3  . GLU A 1 72 ? 5.675   -11.315 10.067  1.00 3.61 ? 386 GLU A HB3  1 
ATOM 1023 H HG2  . GLU A 1 72 ? 6.325   -9.103  10.592  1.00 4.21 ? 386 GLU A HG2  1 
ATOM 1024 H HG3  . GLU A 1 72 ? 4.928   -8.853  11.643  1.00 3.83 ? 386 GLU A HG3  1 
ATOM 1025 N N    . ALA A 1 73 ? 5.390   -9.177  8.080   1.00 1.12 ? 387 ALA A N    1 
ATOM 1026 C CA   . ALA A 1 73 ? 5.984   -8.995  6.722   1.00 0.89 ? 387 ALA A CA   1 
ATOM 1027 C C    . ALA A 1 73 ? 4.957   -8.322  5.804   1.00 0.73 ? 387 ALA A C    1 
ATOM 1028 O O    . ALA A 1 73 ? 4.906   -8.579  4.614   1.00 0.65 ? 387 ALA A O    1 
ATOM 1029 C CB   . ALA A 1 73 ? 6.396   -10.351 6.141   1.00 1.34 ? 387 ALA A CB   1 
ATOM 1030 H H    . ALA A 1 73 ? 5.702   -8.620  8.823   1.00 1.59 ? 387 ALA A H    1 
ATOM 1031 H HA   . ALA A 1 73 ? 6.860   -8.365  6.797   1.00 1.08 ? 387 ALA A HA   1 
ATOM 1032 H HB1  . ALA A 1 73 ? 5.723   -10.626 5.343   1.00 1.75 ? 387 ALA A HB1  1 
ATOM 1033 H HB2  . ALA A 1 73 ? 6.365   -11.103 6.918   1.00 1.87 ? 387 ALA A HB2  1 
ATOM 1034 H HB3  . ALA A 1 73 ? 7.401   -10.277 5.753   1.00 1.75 ? 387 ALA A HB3  1 
ATOM 1035 N N    . THR A 1 74 ? 4.146   -7.446  6.340   1.00 0.72 ? 388 THR A N    1 
ATOM 1036 C CA   . THR A 1 74 ? 3.146   -6.760  5.482   1.00 0.64 ? 388 THR A CA   1 
ATOM 1037 C C    . THR A 1 74 ? 3.907   -5.996  4.393   1.00 0.47 ? 388 THR A C    1 
ATOM 1038 O O    . THR A 1 74 ? 3.577   -6.067  3.226   1.00 0.43 ? 388 THR A O    1 
ATOM 1039 C CB   . THR A 1 74 ? 2.319   -5.795  6.338   1.00 0.75 ? 388 THR A CB   1 
ATOM 1040 O OG1  . THR A 1 74 ? 1.880   -6.473  7.506   1.00 1.50 ? 388 THR A OG1  1 
ATOM 1041 C CG2  . THR A 1 74 ? 1.098   -5.312  5.545   1.00 1.09 ? 388 THR A CG2  1 
ATOM 1042 H H    . THR A 1 74 ? 4.203   -7.237  7.298   1.00 0.80 ? 388 THR A H    1 
ATOM 1043 H HA   . THR A 1 74 ? 2.494   -7.490  5.026   1.00 0.69 ? 388 THR A HA   1 
ATOM 1044 H HB   . THR A 1 74 ? 2.923   -4.949  6.618   1.00 1.36 ? 388 THR A HB   1 
ATOM 1045 H HG1  . THR A 1 74 ? 2.081   -5.918  8.262   1.00 1.91 ? 388 THR A HG1  1 
ATOM 1046 H HG21 . THR A 1 74 ? 1.007   -4.239  5.642   1.00 1.69 ? 388 THR A HG21 1 
ATOM 1047 H HG22 . THR A 1 74 ? 0.202   -5.786  5.930   1.00 1.63 ? 388 THR A HG22 1 
ATOM 1048 H HG23 . THR A 1 74 ? 1.221   -5.566  4.504   1.00 1.63 ? 388 THR A HG23 1 
ATOM 1049 N N    . LEU A 1 75 ? 4.954   -5.302  4.761   1.00 0.42 ? 389 LEU A N    1 
ATOM 1050 C CA   . LEU A 1 75 ? 5.769   -4.573  3.747   1.00 0.33 ? 389 LEU A CA   1 
ATOM 1051 C C    . LEU A 1 75 ? 6.410   -5.591  2.804   1.00 0.32 ? 389 LEU A C    1 
ATOM 1052 O O    . LEU A 1 75 ? 6.647   -5.310  1.652   1.00 0.31 ? 389 LEU A O    1 
ATOM 1053 C CB   . LEU A 1 75 ? 6.865   -3.772  4.456   1.00 0.37 ? 389 LEU A CB   1 
ATOM 1054 C CG   . LEU A 1 75 ? 7.714   -3.035  3.416   1.00 0.46 ? 389 LEU A CG   1 
ATOM 1055 C CD1  . LEU A 1 75 ? 6.948   -1.814  2.907   1.00 0.86 ? 389 LEU A CD1  1 
ATOM 1056 C CD2  . LEU A 1 75 ? 9.025   -2.573  4.056   1.00 0.94 ? 389 LEU A CD2  1 
ATOM 1057 H H    . LEU A 1 75 ? 5.222   -5.282  5.704   1.00 0.49 ? 389 LEU A H    1 
ATOM 1058 H HA   . LEU A 1 75 ? 5.136   -3.900  3.172   1.00 0.33 ? 389 LEU A HA   1 
ATOM 1059 H HB2  . LEU A 1 75 ? 6.409   -3.054  5.124   1.00 0.68 ? 389 LEU A HB2  1 
ATOM 1060 H HB3  . LEU A 1 75 ? 7.491   -4.443  5.024   1.00 0.60 ? 389 LEU A HB3  1 
ATOM 1061 H HG   . LEU A 1 75 ? 7.930   -3.700  2.592   1.00 0.88 ? 389 LEU A HG   1 
ATOM 1062 H HD11 . LEU A 1 75 ? 7.516   -0.920  3.121   1.00 1.52 ? 389 LEU A HD11 1 
ATOM 1063 H HD12 . LEU A 1 75 ? 5.991   -1.761  3.405   1.00 1.16 ? 389 LEU A HD12 1 
ATOM 1064 H HD13 . LEU A 1 75 ? 6.798   -1.898  1.841   1.00 1.57 ? 389 LEU A HD13 1 
ATOM 1065 H HD21 . LEU A 1 75 ? 8.971   -2.706  5.127   1.00 1.33 ? 389 LEU A HD21 1 
ATOM 1066 H HD22 . LEU A 1 75 ? 9.184   -1.528  3.831   1.00 1.59 ? 389 LEU A HD22 1 
ATOM 1067 H HD23 . LEU A 1 75 ? 9.844   -3.155  3.660   1.00 1.52 ? 389 LEU A HD23 1 
ATOM 1068 N N    . GLU A 1 76 ? 6.699   -6.773  3.285   1.00 0.38 ? 390 GLU A N    1 
ATOM 1069 C CA   . GLU A 1 76 ? 7.326   -7.802  2.397   1.00 0.42 ? 390 GLU A CA   1 
ATOM 1070 C C    . GLU A 1 76 ? 6.452   -8.026  1.169   1.00 0.36 ? 390 GLU A C    1 
ATOM 1071 O O    . GLU A 1 76 ? 6.922   -7.977  0.049   1.00 0.36 ? 390 GLU A O    1 
ATOM 1072 C CB   . GLU A 1 76 ? 7.464   -9.132  3.149   1.00 0.52 ? 390 GLU A CB   1 
ATOM 1073 C CG   . GLU A 1 76 ? 8.301   -10.096 2.310   1.00 1.02 ? 390 GLU A CG   1 
ATOM 1074 C CD   . GLU A 1 76 ? 8.451   -11.422 3.056   1.00 1.31 ? 390 GLU A CD   1 
ATOM 1075 O OE1  . GLU A 1 76 ? 7.775   -11.597 4.056   1.00 2.03 ? 390 GLU A OE1  1 
ATOM 1076 O OE2  . GLU A 1 76 ? 9.238   -12.241 2.615   1.00 1.78 ? 390 GLU A OE2  1 
ATOM 1077 H H    . GLU A 1 76 ? 6.506   -6.980  4.220   1.00 0.43 ? 390 GLU A H    1 
ATOM 1078 H HA   . GLU A 1 76 ? 8.303   -7.468  2.077   1.00 0.45 ? 390 GLU A HA   1 
ATOM 1079 H HB2  . GLU A 1 76 ? 7.948   -8.968  4.100   1.00 1.06 ? 390 GLU A HB2  1 
ATOM 1080 H HB3  . GLU A 1 76 ? 6.486   -9.561  3.311   1.00 1.02 ? 390 GLU A HB3  1 
ATOM 1081 H HG2  . GLU A 1 76 ? 7.805   -10.267 1.363   1.00 1.73 ? 390 GLU A HG2  1 
ATOM 1082 H HG3  . GLU A 1 76 ? 9.275   -9.667  2.134   1.00 1.66 ? 390 GLU A HG3  1 
ATOM 1083 N N    . LEU A 1 77 ? 5.183   -8.255  1.352   1.00 0.34 ? 391 LEU A N    1 
ATOM 1084 C CA   . LEU A 1 77 ? 4.316   -8.462  0.158   1.00 0.32 ? 391 LEU A CA   1 
ATOM 1085 C C    . LEU A 1 77 ? 4.347   -7.191  -0.674  1.00 0.27 ? 391 LEU A C    1 
ATOM 1086 O O    . LEU A 1 77 ? 4.403   -7.217  -1.889  1.00 0.27 ? 391 LEU A O    1 
ATOM 1087 C CB   . LEU A 1 77 ? 2.883   -8.751  0.582   1.00 0.37 ? 391 LEU A CB   1 
ATOM 1088 C CG   . LEU A 1 77 ? 2.031   -8.980  -0.667  1.00 0.42 ? 391 LEU A CG   1 
ATOM 1089 C CD1  . LEU A 1 77 ? 1.091   -10.169 -0.430  1.00 1.13 ? 391 LEU A CD1  1 
ATOM 1090 C CD2  . LEU A 1 77 ? 1.214   -7.712  -0.955  1.00 0.85 ? 391 LEU A CD2  1 
ATOM 1091 H H    . LEU A 1 77 ? 4.805   -8.280  2.259   1.00 0.38 ? 391 LEU A H    1 
ATOM 1092 H HA   . LEU A 1 77 ? 4.694   -9.285  -0.427  1.00 0.33 ? 391 LEU A HA   1 
ATOM 1093 H HB2  . LEU A 1 77 ? 2.861   -9.632  1.201   1.00 0.38 ? 391 LEU A HB2  1 
ATOM 1094 H HB3  . LEU A 1 77 ? 2.492   -7.908  1.135   1.00 0.43 ? 391 LEU A HB3  1 
ATOM 1095 H HG   . LEU A 1 77 ? 2.676   -9.191  -1.509  1.00 0.76 ? 391 LEU A HG   1 
ATOM 1096 H HD11 . LEU A 1 77 ? 0.908   -10.275 0.630   1.00 1.71 ? 391 LEU A HD11 1 
ATOM 1097 H HD12 . LEU A 1 77 ? 1.546   -11.075 -0.806  1.00 1.76 ? 391 LEU A HD12 1 
ATOM 1098 H HD13 . LEU A 1 77 ? 0.156   -9.998  -0.940  1.00 1.50 ? 391 LEU A HD13 1 
ATOM 1099 H HD21 . LEU A 1 77 ? 0.347   -7.966  -1.547  1.00 1.46 ? 391 LEU A HD21 1 
ATOM 1100 H HD22 . LEU A 1 77 ? 1.826   -7.005  -1.499  1.00 1.44 ? 391 LEU A HD22 1 
ATOM 1101 H HD23 . LEU A 1 77 ? 0.895   -7.268  -0.022  1.00 1.44 ? 391 LEU A HD23 1 
ATOM 1102 N N    . LEU A 1 78 ? 4.316   -6.077  -0.011  1.00 0.25 ? 392 LEU A N    1 
ATOM 1103 C CA   . LEU A 1 78 ? 4.351   -4.774  -0.707  1.00 0.23 ? 392 LEU A CA   1 
ATOM 1104 C C    . LEU A 1 78 ? 5.692   -4.604  -1.419  1.00 0.23 ? 392 LEU A C    1 
ATOM 1105 O O    . LEU A 1 78 ? 5.764   -4.075  -2.506  1.00 0.25 ? 392 LEU A O    1 
ATOM 1106 C CB   . LEU A 1 78 ? 4.195   -3.684  0.342   1.00 0.25 ? 392 LEU A CB   1 
ATOM 1107 C CG   . LEU A 1 78 ? 2.714   -3.457  0.643   1.00 0.27 ? 392 LEU A CG   1 
ATOM 1108 C CD1  . LEU A 1 78 ? 2.515   -3.403  2.159   1.00 0.40 ? 392 LEU A CD1  1 
ATOM 1109 C CD2  . LEU A 1 78 ? 2.271   -2.131  0.024   1.00 0.25 ? 392 LEU A CD2  1 
ATOM 1110 H H    . LEU A 1 78 ? 4.277   -6.096  0.968   1.00 0.27 ? 392 LEU A H    1 
ATOM 1111 H HA   . LEU A 1 78 ? 3.545   -4.717  -1.420  1.00 0.24 ? 392 LEU A HA   1 
ATOM 1112 H HB2  . LEU A 1 78 ? 4.700   -3.995  1.245   1.00 0.28 ? 392 LEU A HB2  1 
ATOM 1113 H HB3  . LEU A 1 78 ? 4.636   -2.774  -0.017  1.00 0.25 ? 392 LEU A HB3  1 
ATOM 1114 H HG   . LEU A 1 78 ? 2.129   -4.268  0.227   1.00 0.35 ? 392 LEU A HG   1 
ATOM 1115 H HD11 . LEU A 1 78 ? 2.633   -2.386  2.502   1.00 1.10 ? 392 LEU A HD11 1 
ATOM 1116 H HD12 . LEU A 1 78 ? 3.253   -4.029  2.636   1.00 1.09 ? 392 LEU A HD12 1 
ATOM 1117 H HD13 . LEU A 1 78 ? 1.526   -3.758  2.409   1.00 1.05 ? 392 LEU A HD13 1 
ATOM 1118 H HD21 . LEU A 1 78 ? 1.530   -1.673  0.659   1.00 0.92 ? 392 LEU A HD21 1 
ATOM 1119 H HD22 . LEU A 1 78 ? 1.846   -2.312  -0.952  1.00 0.96 ? 392 LEU A HD22 1 
ATOM 1120 H HD23 . LEU A 1 78 ? 3.123   -1.473  -0.071  1.00 0.96 ? 392 LEU A HD23 1 
ATOM 1121 N N    . GLY A 1 79 ? 6.754   -5.048  -0.800  1.00 0.23 ? 393 GLY A N    1 
ATOM 1122 C CA   . GLY A 1 79 ? 8.101   -4.921  -1.417  1.00 0.26 ? 393 GLY A CA   1 
ATOM 1123 C C    . GLY A 1 79 ? 8.125   -5.698  -2.737  1.00 0.26 ? 393 GLY A C    1 
ATOM 1124 O O    . GLY A 1 79 ? 8.589   -5.213  -3.748  1.00 0.27 ? 393 GLY A O    1 
ATOM 1125 H H    . GLY A 1 79 ? 6.663   -5.467  0.083   1.00 0.23 ? 393 GLY A H    1 
ATOM 1126 H HA2  . GLY A 1 79 ? 8.322   -3.875  -1.594  1.00 0.27 ? 393 GLY A HA2  1 
ATOM 1127 H HA3  . GLY A 1 79 ? 8.833   -5.336  -0.746  1.00 0.30 ? 393 GLY A HA3  1 
ATOM 1128 N N    . ARG A 1 80 ? 7.610   -6.901  -2.734  1.00 0.28 ? 394 ARG A N    1 
ATOM 1129 C CA   . ARG A 1 80 ? 7.587   -7.705  -3.987  1.00 0.31 ? 394 ARG A CA   1 
ATOM 1130 C C    . ARG A 1 80 ? 6.790   -6.927  -5.024  1.00 0.29 ? 394 ARG A C    1 
ATOM 1131 O O    . ARG A 1 80 ? 7.149   -6.871  -6.184  1.00 0.32 ? 394 ARG A O    1 
ATOM 1132 C CB   . ARG A 1 80 ? 6.920   -9.055  -3.721  1.00 0.34 ? 394 ARG A CB   1 
ATOM 1133 C CG   . ARG A 1 80 ? 7.718   -9.821  -2.666  1.00 1.17 ? 394 ARG A CG   1 
ATOM 1134 C CD   . ARG A 1 80 ? 7.105   -11.216 -2.480  1.00 1.43 ? 394 ARG A CD   1 
ATOM 1135 N NE   . ARG A 1 80 ? 7.817   -11.960 -1.398  1.00 2.16 ? 394 ARG A NE   1 
ATOM 1136 C CZ   . ARG A 1 80 ? 9.000   -12.465 -1.631  1.00 2.90 ? 394 ARG A CZ   1 
ATOM 1137 N NH1  . ARG A 1 80 ? 9.155   -13.357 -2.578  1.00 3.48 ? 394 ARG A NH1  1 
ATOM 1138 N NH2  . ARG A 1 80 ? 10.032  -12.071 -0.933  1.00 3.51 ? 394 ARG A NH2  1 
ATOM 1139 H H    . ARG A 1 80 ? 7.230   -7.266  -1.909  1.00 0.29 ? 394 ARG A H    1 
ATOM 1140 H HA   . ARG A 1 80 ? 8.598   -7.856  -4.343  1.00 0.34 ? 394 ARG A HA   1 
ATOM 1141 H HB2  . ARG A 1 80 ? 5.917   -8.888  -3.357  1.00 0.98 ? 394 ARG A HB2  1 
ATOM 1142 H HB3  . ARG A 1 80 ? 6.884   -9.631  -4.634  1.00 0.90 ? 394 ARG A HB3  1 
ATOM 1143 H HG2  . ARG A 1 80 ? 8.747   -9.913  -2.987  1.00 1.91 ? 394 ARG A HG2  1 
ATOM 1144 H HG3  . ARG A 1 80 ? 7.678   -9.284  -1.733  1.00 1.71 ? 394 ARG A HG3  1 
ATOM 1145 H HD2  . ARG A 1 80 ? 6.063   -11.117 -2.219  1.00 1.60 ? 394 ARG A HD2  1 
ATOM 1146 H HD3  . ARG A 1 80 ? 7.189   -11.768 -3.404  1.00 2.01 ? 394 ARG A HD3  1 
ATOM 1147 H HE   . ARG A 1 80 ? 7.387   -12.092 -0.525  1.00 2.52 ? 394 ARG A HE   1 
ATOM 1148 H HH11 . ARG A 1 80 ? 8.369   -13.647 -3.126  1.00 3.51 ? 394 ARG A HH11 1 
ATOM 1149 H HH12 . ARG A 1 80 ? 10.055  -13.758 -2.747  1.00 4.16 ? 394 ARG A HH12 1 
ATOM 1150 H HH21 . ARG A 1 80 ? 9.918   -11.382 -0.215  1.00 3.54 ? 394 ARG A HH21 1 
ATOM 1151 H HH22 . ARG A 1 80 ? 10.939  -12.454 -1.121  1.00 4.21 ? 394 ARG A HH22 1 
ATOM 1152 N N    . VAL A 1 81 ? 5.723   -6.299  -4.611  1.00 0.27 ? 395 VAL A N    1 
ATOM 1153 C CA   . VAL A 1 81 ? 4.936   -5.489  -5.576  1.00 0.29 ? 395 VAL A CA   1 
ATOM 1154 C C    . VAL A 1 81 ? 5.843   -4.379  -6.102  1.00 0.28 ? 395 VAL A C    1 
ATOM 1155 O O    . VAL A 1 81 ? 5.854   -4.057  -7.272  1.00 0.31 ? 395 VAL A O    1 
ATOM 1156 C CB   . VAL A 1 81 ? 3.739   -4.861  -4.866  1.00 0.29 ? 395 VAL A CB   1 
ATOM 1157 C CG1  . VAL A 1 81 ? 2.987   -3.950  -5.839  1.00 0.35 ? 395 VAL A CG1  1 
ATOM 1158 C CG2  . VAL A 1 81 ? 2.812   -5.973  -4.362  1.00 0.31 ? 395 VAL A CG2  1 
ATOM 1159 H H    . VAL A 1 81 ? 5.461   -6.338  -3.667  1.00 0.26 ? 395 VAL A H    1 
ATOM 1160 H HA   . VAL A 1 81 ? 4.596   -6.115  -6.391  1.00 0.32 ? 395 VAL A HA   1 
ATOM 1161 H HB   . VAL A 1 81 ? 4.087   -4.272  -4.028  1.00 0.26 ? 395 VAL A HB   1 
ATOM 1162 H HG11 . VAL A 1 81 ? 3.010   -4.383  -6.828  1.00 0.90 ? 395 VAL A HG11 1 
ATOM 1163 H HG12 . VAL A 1 81 ? 3.463   -2.979  -5.862  1.00 1.10 ? 395 VAL A HG12 1 
ATOM 1164 H HG13 . VAL A 1 81 ? 1.964   -3.843  -5.511  1.00 1.19 ? 395 VAL A HG13 1 
ATOM 1165 H HG21 . VAL A 1 81 ? 3.323   -6.921  -4.431  1.00 1.12 ? 395 VAL A HG21 1 
ATOM 1166 H HG22 . VAL A 1 81 ? 1.915   -6.000  -4.968  1.00 1.01 ? 395 VAL A HG22 1 
ATOM 1167 H HG23 . VAL A 1 81 ? 2.549   -5.784  -3.329  1.00 1.06 ? 395 VAL A HG23 1 
ATOM 1168 N N    . LEU A 1 82 ? 6.611   -3.792  -5.225  1.00 0.24 ? 396 LEU A N    1 
ATOM 1169 C CA   . LEU A 1 82 ? 7.533   -2.700  -5.641  1.00 0.25 ? 396 LEU A CA   1 
ATOM 1170 C C    . LEU A 1 82 ? 8.532   -3.230  -6.662  1.00 0.28 ? 396 LEU A C    1 
ATOM 1171 O O    . LEU A 1 82 ? 8.784   -2.616  -7.677  1.00 0.30 ? 396 LEU A O    1 
ATOM 1172 C CB   . LEU A 1 82 ? 8.295   -2.206  -4.419  1.00 0.23 ? 396 LEU A CB   1 
ATOM 1173 C CG   . LEU A 1 82 ? 7.329   -1.503  -3.462  1.00 0.24 ? 396 LEU A CG   1 
ATOM 1174 C CD1  . LEU A 1 82 ? 8.011   -1.242  -2.117  1.00 0.25 ? 396 LEU A CD1  1 
ATOM 1175 C CD2  . LEU A 1 82 ? 6.884   -0.169  -4.055  1.00 0.26 ? 396 LEU A CD2  1 
ATOM 1176 H H    . LEU A 1 82 ? 6.582   -4.074  -4.286  1.00 0.23 ? 396 LEU A H    1 
ATOM 1177 H HA   . LEU A 1 82 ? 6.964   -1.889  -6.069  1.00 0.27 ? 396 LEU A HA   1 
ATOM 1178 H HB2  . LEU A 1 82 ? 8.747   -3.049  -3.918  1.00 0.24 ? 396 LEU A HB2  1 
ATOM 1179 H HB3  . LEU A 1 82 ? 9.064   -1.521  -4.730  1.00 0.24 ? 396 LEU A HB3  1 
ATOM 1180 H HG   . LEU A 1 82 ? 6.466   -2.131  -3.309  1.00 0.26 ? 396 LEU A HG   1 
ATOM 1181 H HD11 . LEU A 1 82 ? 7.332   -1.498  -1.316  1.00 0.85 ? 396 LEU A HD11 1 
ATOM 1182 H HD12 . LEU A 1 82 ? 8.276   -0.198  -2.041  1.00 0.98 ? 396 LEU A HD12 1 
ATOM 1183 H HD13 . LEU A 1 82 ? 8.903   -1.845  -2.037  1.00 0.92 ? 396 LEU A HD13 1 
ATOM 1184 H HD21 . LEU A 1 82 ? 6.599   -0.312  -5.082  1.00 0.97 ? 396 LEU A HD21 1 
ATOM 1185 H HD22 . LEU A 1 82 ? 7.693   0.545   -3.999  1.00 1.12 ? 396 LEU A HD22 1 
ATOM 1186 H HD23 . LEU A 1 82 ? 6.039   0.200   -3.494  1.00 1.02 ? 396 LEU A HD23 1 
ATOM 1187 N N    . ARG A 1 83 ? 9.107   -4.367  -6.392  1.00 0.30 ? 397 ARG A N    1 
ATOM 1188 C CA   . ARG A 1 83 ? 10.095  -4.943  -7.345  1.00 0.35 ? 397 ARG A CA   1 
ATOM 1189 C C    . ARG A 1 83 ? 9.421   -5.163  -8.702  1.00 0.38 ? 397 ARG A C    1 
ATOM 1190 O O    . ARG A 1 83 ? 9.969   -4.823  -9.730  1.00 0.41 ? 397 ARG A O    1 
ATOM 1191 C CB   . ARG A 1 83 ? 10.600  -6.280  -6.815  1.00 0.40 ? 397 ARG A CB   1 
ATOM 1192 C CG   . ARG A 1 83 ? 11.370  -6.045  -5.507  1.00 1.12 ? 397 ARG A CG   1 
ATOM 1193 C CD   . ARG A 1 83 ? 11.917  -7.365  -4.951  1.00 1.29 ? 397 ARG A CD   1 
ATOM 1194 N NE   . ARG A 1 83 ? 13.012  -7.846  -5.832  1.00 1.94 ? 397 ARG A NE   1 
ATOM 1195 C CZ   . ARG A 1 83 ? 14.172  -7.250  -5.817  1.00 2.25 ? 397 ARG A CZ   1 
ATOM 1196 N NH1  . ARG A 1 83 ? 14.943  -7.346  -4.763  1.00 2.63 ? 397 ARG A NH1  1 
ATOM 1197 N NH2  . ARG A 1 83 ? 14.556  -6.536  -6.846  1.00 2.69 ? 397 ARG A NH2  1 
ATOM 1198 H H    . ARG A 1 83 ? 8.890   -4.834  -5.560  1.00 0.30 ? 397 ARG A H    1 
ATOM 1199 H HA   . ARG A 1 83 ? 10.929  -4.260  -7.457  1.00 0.35 ? 397 ARG A HA   1 
ATOM 1200 H HB2  . ARG A 1 83 ? 9.754   -6.927  -6.636  1.00 0.80 ? 397 ARG A HB2  1 
ATOM 1201 H HB3  . ARG A 1 83 ? 11.251  -6.728  -7.549  1.00 0.84 ? 397 ARG A HB3  1 
ATOM 1202 H HG2  . ARG A 1 83 ? 12.194  -5.374  -5.698  1.00 1.74 ? 397 ARG A HG2  1 
ATOM 1203 H HG3  . ARG A 1 83 ? 10.707  -5.600  -4.783  1.00 1.63 ? 397 ARG A HG3  1 
ATOM 1204 H HD2  . ARG A 1 83 ? 12.305  -7.204  -3.954  1.00 1.77 ? 397 ARG A HD2  1 
ATOM 1205 H HD3  . ARG A 1 83 ? 11.127  -8.103  -4.918  1.00 1.67 ? 397 ARG A HD3  1 
ATOM 1206 H HE   . ARG A 1 83 ? 12.858  -8.607  -6.432  1.00 2.49 ? 397 ARG A HE   1 
ATOM 1207 H HH11 . ARG A 1 83 ? 14.640  -7.874  -3.969  1.00 2.96 ? 397 ARG A HH11 1 
ATOM 1208 H HH12 . ARG A 1 83 ? 15.837  -6.898  -4.752  1.00 2.89 ? 397 ARG A HH12 1 
ATOM 1209 H HH21 . ARG A 1 83 ? 13.960  -6.444  -7.643  1.00 3.04 ? 397 ARG A HH21 1 
ATOM 1210 H HH22 . ARG A 1 83 ? 15.450  -6.088  -6.839  1.00 2.95 ? 397 ARG A HH22 1 
ATOM 1211 N N    . ASP A 1 84 ? 8.231   -5.713  -8.717  1.00 0.42 ? 398 ASP A N    1 
ATOM 1212 C CA   . ASP A 1 84 ? 7.530   -5.919  -10.014 1.00 0.48 ? 398 ASP A CA   1 
ATOM 1213 C C    . ASP A 1 84 ? 7.340   -4.556  -10.692 1.00 0.46 ? 398 ASP A C    1 
ATOM 1214 O O    . ASP A 1 84 ? 7.442   -4.427  -11.897 1.00 0.52 ? 398 ASP A O    1 
ATOM 1215 C CB   . ASP A 1 84 ? 6.159   -6.567  -9.775  1.00 0.54 ? 398 ASP A CB   1 
ATOM 1216 C CG   . ASP A 1 84 ? 6.344   -8.026  -9.348  1.00 1.32 ? 398 ASP A CG   1 
ATOM 1217 O OD1  . ASP A 1 84 ? 6.833   -8.242  -8.252  1.00 1.94 ? 398 ASP A OD1  1 
ATOM 1218 O OD2  . ASP A 1 84 ? 5.995   -8.899  -10.128 1.00 2.10 ? 398 ASP A OD2  1 
ATOM 1219 H H    . ASP A 1 84 ? 7.795   -5.973  -7.875  1.00 0.41 ? 398 ASP A H    1 
ATOM 1220 H HA   . ASP A 1 84 ? 8.125   -6.563  -10.650 1.00 0.54 ? 398 ASP A HA   1 
ATOM 1221 H HB2  . ASP A 1 84 ? 5.633   -6.027  -9.000  1.00 0.92 ? 398 ASP A HB2  1 
ATOM 1222 H HB3  . ASP A 1 84 ? 5.582   -6.533  -10.688 1.00 1.04 ? 398 ASP A HB3  1 
ATOM 1223 N N    . MET A 1 85 ? 7.055   -3.539  -9.920  1.00 0.43 ? 399 MET A N    1 
ATOM 1224 C CA   . MET A 1 85 ? 6.842   -2.179  -10.498 1.00 0.46 ? 399 MET A CA   1 
ATOM 1225 C C    . MET A 1 85 ? 8.168   -1.405  -10.557 1.00 0.41 ? 399 MET A C    1 
ATOM 1226 O O    . MET A 1 85 ? 8.189   -0.214  -10.803 1.00 0.45 ? 399 MET A O    1 
ATOM 1227 C CB   . MET A 1 85 ? 5.848   -1.436  -9.608  1.00 0.51 ? 399 MET A CB   1 
ATOM 1228 C CG   . MET A 1 85 ? 4.539   -2.231  -9.546  1.00 1.31 ? 399 MET A CG   1 
ATOM 1229 S SD   . MET A 1 85 ? 3.453   -1.509  -8.287  1.00 1.53 ? 399 MET A SD   1 
ATOM 1230 C CE   . MET A 1 85 ? 3.104   0.051   -9.138  1.00 0.62 ? 399 MET A CE   1 
ATOM 1231 H H    . MET A 1 85 ? 6.972   -3.670  -8.951  1.00 0.41 ? 399 MET A H    1 
ATOM 1232 H HA   . MET A 1 85 ? 6.435   -2.268  -11.491 1.00 0.54 ? 399 MET A HA   1 
ATOM 1233 H HB2  . MET A 1 85 ? 6.259   -1.339  -8.614  1.00 1.11 ? 399 MET A HB2  1 
ATOM 1234 H HB3  . MET A 1 85 ? 5.654   -0.454  -10.016 1.00 0.91 ? 399 MET A HB3  1 
ATOM 1235 H HG2  . MET A 1 85 ? 4.048   -2.201  -10.509 1.00 2.04 ? 399 MET A HG2  1 
ATOM 1236 H HG3  . MET A 1 85 ? 4.756   -3.258  -9.287  1.00 2.03 ? 399 MET A HG3  1 
ATOM 1237 H HE1  . MET A 1 85 ? 3.435   -0.016  -10.164 1.00 1.36 ? 399 MET A HE1  1 
ATOM 1238 H HE2  . MET A 1 85 ? 3.627   0.857   -8.647  1.00 1.18 ? 399 MET A HE2  1 
ATOM 1239 H HE3  . MET A 1 85 ? 2.041   0.246   -9.108  1.00 1.18 ? 399 MET A HE3  1 
ATOM 1240 N N    . ASP A 1 86 ? 9.271   -2.066  -10.334 1.00 0.38 ? 400 ASP A N    1 
ATOM 1241 C CA   . ASP A 1 86 ? 10.578  -1.360  -10.382 1.00 0.38 ? 400 ASP A CA   1 
ATOM 1242 C C    . ASP A 1 86 ? 10.583  -0.247  -9.328  1.00 0.34 ? 400 ASP A C    1 
ATOM 1243 O O    . ASP A 1 86 ? 11.051  0.850   -9.564  1.00 0.35 ? 400 ASP A O    1 
ATOM 1244 C CB   . ASP A 1 86 ? 10.780  -0.758  -11.778 1.00 0.45 ? 400 ASP A CB   1 
ATOM 1245 C CG   . ASP A 1 86 ? 10.732  -1.871  -12.824 1.00 1.00 ? 400 ASP A CG   1 
ATOM 1246 O OD1  . ASP A 1 86 ? 11.448  -2.843  -12.662 1.00 1.90 ? 400 ASP A OD1  1 
ATOM 1247 O OD2  . ASP A 1 86 ? 9.974   -1.732  -13.768 1.00 1.24 ? 400 ASP A OD2  1 
ATOM 1248 H H    . ASP A 1 86 ? 9.240   -3.023  -10.136 1.00 0.39 ? 400 ASP A H    1 
ATOM 1249 H HA   . ASP A 1 86 ? 11.371  -2.060  -10.175 1.00 0.40 ? 400 ASP A HA   1 
ATOM 1250 H HB2  . ASP A 1 86 ? 9.995   -0.042  -11.981 1.00 0.77 ? 400 ASP A HB2  1 
ATOM 1251 H HB3  . ASP A 1 86 ? 11.737  -0.262  -11.826 1.00 0.74 ? 400 ASP A HB3  1 
ATOM 1252 N N    . LEU A 1 87 ? 10.063  -0.524  -8.164  1.00 0.32 ? 401 LEU A N    1 
ATOM 1253 C CA   . LEU A 1 87 ? 10.041  0.509   -7.087  1.00 0.30 ? 401 LEU A CA   1 
ATOM 1254 C C    . LEU A 1 87 ? 11.055  0.135   -6.001  1.00 0.31 ? 401 LEU A C    1 
ATOM 1255 O O    . LEU A 1 87 ? 10.960  0.571   -4.867  1.00 0.29 ? 401 LEU A O    1 
ATOM 1256 C CB   . LEU A 1 87 ? 8.644   0.584   -6.469  1.00 0.31 ? 401 LEU A CB   1 
ATOM 1257 C CG   . LEU A 1 87 ? 7.702   1.344   -7.401  1.00 0.47 ? 401 LEU A CG   1 
ATOM 1258 C CD1  . LEU A 1 87 ? 6.258   1.100   -6.972  1.00 0.73 ? 401 LEU A CD1  1 
ATOM 1259 C CD2  . LEU A 1 87 ? 8.003   2.837   -7.293  1.00 0.86 ? 401 LEU A CD2  1 
ATOM 1260 H H    . LEU A 1 87 ? 9.692   -1.415  -7.996  1.00 0.33 ? 401 LEU A H    1 
ATOM 1261 H HA   . LEU A 1 87 ? 10.300  1.468   -7.506  1.00 0.33 ? 401 LEU A HA   1 
ATOM 1262 H HB2  . LEU A 1 87 ? 8.264   -0.414  -6.306  1.00 0.36 ? 401 LEU A HB2  1 
ATOM 1263 H HB3  . LEU A 1 87 ? 8.701   1.104   -5.525  1.00 0.34 ? 401 LEU A HB3  1 
ATOM 1264 H HG   . LEU A 1 87 ? 7.839   1.013   -8.417  1.00 0.98 ? 401 LEU A HG   1 
ATOM 1265 H HD11 . LEU A 1 87 ? 5.600   1.698   -7.578  1.00 1.20 ? 401 LEU A HD11 1 
ATOM 1266 H HD12 . LEU A 1 87 ? 6.141   1.378   -5.934  1.00 1.28 ? 401 LEU A HD12 1 
ATOM 1267 H HD13 . LEU A 1 87 ? 6.013   0.055   -7.095  1.00 1.24 ? 401 LEU A HD13 1 
ATOM 1268 H HD21 . LEU A 1 87 ? 7.117   3.400   -7.544  1.00 1.48 ? 401 LEU A HD21 1 
ATOM 1269 H HD22 . LEU A 1 87 ? 8.800   3.093   -7.971  1.00 1.52 ? 401 LEU A HD22 1 
ATOM 1270 H HD23 . LEU A 1 87 ? 8.305   3.070   -6.279  1.00 1.30 ? 401 LEU A HD23 1 
ATOM 1271 N N    . LEU A 1 88 ? 12.023  -0.675  -6.336  1.00 0.38 ? 402 LEU A N    1 
ATOM 1272 C CA   . LEU A 1 88 ? 13.039  -1.084  -5.330  1.00 0.45 ? 402 LEU A CA   1 
ATOM 1273 C C    . LEU A 1 88 ? 13.661  0.164   -4.694  1.00 0.45 ? 402 LEU A C    1 
ATOM 1274 O O    . LEU A 1 88 ? 13.978  0.178   -3.524  1.00 0.46 ? 402 LEU A O    1 
ATOM 1275 C CB   . LEU A 1 88 ? 14.131  -1.907  -6.013  1.00 0.56 ? 402 LEU A CB   1 
ATOM 1276 C CG   . LEU A 1 88 ? 15.042  -2.515  -4.946  1.00 1.06 ? 402 LEU A CG   1 
ATOM 1277 C CD1  . LEU A 1 88 ? 14.267  -3.579  -4.162  1.00 1.62 ? 402 LEU A CD1  1 
ATOM 1278 C CD2  . LEU A 1 88 ? 16.257  -3.152  -5.624  1.00 1.42 ? 402 LEU A CD2  1 
ATOM 1279 H H    . LEU A 1 88 ? 12.080  -1.018  -7.251  1.00 0.42 ? 402 LEU A H    1 
ATOM 1280 H HA   . LEU A 1 88 ? 12.570  -1.682  -4.564  1.00 0.43 ? 402 LEU A HA   1 
ATOM 1281 H HB2  . LEU A 1 88 ? 13.678  -2.696  -6.596  1.00 1.18 ? 402 LEU A HB2  1 
ATOM 1282 H HB3  . LEU A 1 88 ? 14.714  -1.268  -6.662  1.00 0.78 ? 402 LEU A HB3  1 
ATOM 1283 H HG   . LEU A 1 88 ? 15.372  -1.739  -4.269  1.00 1.82 ? 402 LEU A HG   1 
ATOM 1284 H HD11 . LEU A 1 88 ? 13.577  -4.080  -4.822  1.00 2.13 ? 402 LEU A HD11 1 
ATOM 1285 H HD12 . LEU A 1 88 ? 13.716  -3.105  -3.362  1.00 1.96 ? 402 LEU A HD12 1 
ATOM 1286 H HD13 . LEU A 1 88 ? 14.956  -4.300  -3.747  1.00 2.16 ? 402 LEU A HD13 1 
ATOM 1287 H HD21 . LEU A 1 88 ? 16.951  -2.379  -5.916  1.00 1.90 ? 402 LEU A HD21 1 
ATOM 1288 H HD22 . LEU A 1 88 ? 15.936  -3.697  -6.501  1.00 1.73 ? 402 LEU A HD22 1 
ATOM 1289 H HD23 . LEU A 1 88 ? 16.741  -3.827  -4.935  1.00 2.05 ? 402 LEU A HD23 1 
ATOM 1290 N N    . GLY A 1 89 ? 13.829  1.214   -5.454  1.00 0.46 ? 403 GLY A N    1 
ATOM 1291 C CA   . GLY A 1 89 ? 14.421  2.464   -4.879  1.00 0.50 ? 403 GLY A CA   1 
ATOM 1292 C C    . GLY A 1 89 ? 13.474  3.004   -3.807  1.00 0.43 ? 403 GLY A C    1 
ATOM 1293 O O    . GLY A 1 89 ? 13.890  3.498   -2.775  1.00 0.46 ? 403 GLY A O    1 
ATOM 1294 H H    . GLY A 1 89 ? 13.548  1.188   -6.397  1.00 0.47 ? 403 GLY A H    1 
ATOM 1295 H HA2  . GLY A 1 89 ? 15.383  2.241   -4.438  1.00 0.56 ? 403 GLY A HA2  1 
ATOM 1296 H HA3  . GLY A 1 89 ? 14.542  3.203   -5.657  1.00 0.56 ? 403 GLY A HA3  1 
ATOM 1297 N N    . CYS A 1 90 ? 12.198  2.897   -4.050  1.00 0.36 ? 404 CYS A N    1 
ATOM 1298 C CA   . CYS A 1 90 ? 11.197  3.378   -3.066  1.00 0.31 ? 404 CYS A CA   1 
ATOM 1299 C C    . CYS A 1 90 ? 11.260  2.500   -1.816  1.00 0.25 ? 404 CYS A C    1 
ATOM 1300 O O    . CYS A 1 90 ? 11.231  2.997   -0.706  1.00 0.23 ? 404 CYS A O    1 
ATOM 1301 C CB   . CYS A 1 90 ? 9.802   3.296   -3.692  1.00 0.31 ? 404 CYS A CB   1 
ATOM 1302 S SG   . CYS A 1 90 ? 9.444   4.835   -4.575  1.00 0.86 ? 404 CYS A SG   1 
ATOM 1303 H H    . CYS A 1 90 ? 11.898  2.487   -4.885  1.00 0.36 ? 404 CYS A H    1 
ATOM 1304 H HA   . CYS A 1 90 ? 11.414  4.402   -2.790  1.00 0.36 ? 404 CYS A HA   1 
ATOM 1305 H HB2  . CYS A 1 90 ? 9.771   2.469   -4.384  1.00 0.56 ? 404 CYS A HB2  1 
ATOM 1306 H HB3  . CYS A 1 90 ? 9.066   3.145   -2.916  1.00 0.67 ? 404 CYS A HB3  1 
ATOM 1307 H HG   . CYS A 1 90 ? 8.573   5.135   -4.307  1.00 1.38 ? 404 CYS A HG   1 
ATOM 1308 N N    . LEU A 1 91 ? 11.352  1.203   -1.975  1.00 0.24 ? 405 LEU A N    1 
ATOM 1309 C CA   . LEU A 1 91 ? 11.419  0.326   -0.772  1.00 0.21 ? 405 LEU A CA   1 
ATOM 1310 C C    . LEU A 1 91 ? 12.648  0.719   0.048   1.00 0.22 ? 405 LEU A C    1 
ATOM 1311 O O    . LEU A 1 91 ? 12.596  0.785   1.257   1.00 0.21 ? 405 LEU A O    1 
ATOM 1312 C CB   . LEU A 1 91 ? 11.532  -1.154  -1.185  1.00 0.25 ? 405 LEU A CB   1 
ATOM 1313 C CG   . LEU A 1 91 ? 11.232  -2.077  0.014   1.00 0.29 ? 405 LEU A CG   1 
ATOM 1314 C CD1  . LEU A 1 91 ? 12.351  -1.973  1.053   1.00 1.05 ? 405 LEU A CD1  1 
ATOM 1315 C CD2  . LEU A 1 91 ? 9.900   -1.676  0.663   1.00 0.92 ? 405 LEU A CD2  1 
ATOM 1316 H H    . LEU A 1 91 ? 11.377  0.817   -2.875  1.00 0.27 ? 405 LEU A H    1 
ATOM 1317 H HA   . LEU A 1 91 ? 10.529  0.475   -0.179  1.00 0.19 ? 405 LEU A HA   1 
ATOM 1318 H HB2  . LEU A 1 91 ? 10.829  -1.359  -1.980  1.00 0.27 ? 405 LEU A HB2  1 
ATOM 1319 H HB3  . LEU A 1 91 ? 12.535  -1.346  -1.537  1.00 0.31 ? 405 LEU A HB3  1 
ATOM 1320 H HG   . LEU A 1 91 ? 11.166  -3.098  -0.333  1.00 0.83 ? 405 LEU A HG   1 
ATOM 1321 H HD11 . LEU A 1 91 ? 13.259  -1.638  0.573   1.00 1.65 ? 405 LEU A HD11 1 
ATOM 1322 H HD12 . LEU A 1 91 ? 12.516  -2.940  1.502   1.00 1.53 ? 405 LEU A HD12 1 
ATOM 1323 H HD13 . LEU A 1 91 ? 12.067  -1.268  1.819   1.00 1.56 ? 405 LEU A HD13 1 
ATOM 1324 H HD21 . LEU A 1 91 ? 9.259   -1.231  -0.079  1.00 1.59 ? 405 LEU A HD21 1 
ATOM 1325 H HD22 . LEU A 1 91 ? 10.084  -0.959  1.451   1.00 1.51 ? 405 LEU A HD22 1 
ATOM 1326 H HD23 . LEU A 1 91 ? 9.418   -2.551  1.076   1.00 1.44 ? 405 LEU A HD23 1 
ATOM 1327 N N    . GLU A 1 92 ? 13.756  0.994   -0.594  1.00 0.28 ? 406 GLU A N    1 
ATOM 1328 C CA   . GLU A 1 92 ? 14.968  1.388   0.178   1.00 0.31 ? 406 GLU A CA   1 
ATOM 1329 C C    . GLU A 1 92 ? 14.636  2.646   0.977   1.00 0.30 ? 406 GLU A C    1 
ATOM 1330 O O    . GLU A 1 92 ? 15.029  2.787   2.120   1.00 0.31 ? 406 GLU A O    1 
ATOM 1331 C CB   . GLU A 1 92 ? 16.133  1.675   -0.777  1.00 0.39 ? 406 GLU A CB   1 
ATOM 1332 C CG   . GLU A 1 92 ? 16.502  0.398   -1.541  1.00 1.17 ? 406 GLU A CG   1 
ATOM 1333 C CD   . GLU A 1 92 ? 17.667  0.682   -2.496  1.00 1.21 ? 406 GLU A CD   1 
ATOM 1334 O OE1  . GLU A 1 92 ? 18.100  1.821   -2.556  1.00 1.58 ? 406 GLU A OE1  1 
ATOM 1335 O OE2  . GLU A 1 92 ? 18.110  -0.249  -3.145  1.00 1.65 ? 406 GLU A OE2  1 
ATOM 1336 H H    . GLU A 1 92 ? 13.789  0.945   -1.572  1.00 0.30 ? 406 GLU A H    1 
ATOM 1337 H HA   . GLU A 1 92 ? 15.238  0.590   0.860   1.00 0.31 ? 406 GLU A HA   1 
ATOM 1338 H HB2  . GLU A 1 92 ? 15.842  2.443   -1.476  1.00 0.88 ? 406 GLU A HB2  1 
ATOM 1339 H HB3  . GLU A 1 92 ? 16.989  2.011   -0.208  1.00 0.96 ? 406 GLU A HB3  1 
ATOM 1340 H HG2  . GLU A 1 92 ? 16.796  -0.369  -0.837  1.00 1.72 ? 406 GLU A HG2  1 
ATOM 1341 H HG3  . GLU A 1 92 ? 15.649  0.060   -2.108  1.00 1.68 ? 406 GLU A HG3  1 
ATOM 1342 N N    . ASP A 1 93 ? 13.886  3.554   0.399   1.00 0.30 ? 407 ASP A N    1 
ATOM 1343 C CA   . ASP A 1 93 ? 13.503  4.782   1.152   1.00 0.31 ? 407 ASP A CA   1 
ATOM 1344 C C    . ASP A 1 93 ? 12.542  4.367   2.265   1.00 0.27 ? 407 ASP A C    1 
ATOM 1345 O O    . ASP A 1 93 ? 12.663  4.784   3.396   1.00 0.29 ? 407 ASP A O    1 
ATOM 1346 C CB   . ASP A 1 93 ? 12.814  5.781   0.213   1.00 0.35 ? 407 ASP A CB   1 
ATOM 1347 C CG   . ASP A 1 93 ? 12.409  7.027   1.006   1.00 0.38 ? 407 ASP A CG   1 
ATOM 1348 O OD1  . ASP A 1 93 ? 13.300  7.750   1.418   1.00 1.16 ? 407 ASP A OD1  1 
ATOM 1349 O OD2  . ASP A 1 93 ? 11.221  7.239   1.186   1.00 1.11 ? 407 ASP A OD2  1 
ATOM 1350 H H    . ASP A 1 93 ? 13.558  3.415   -0.514  1.00 0.31 ? 407 ASP A H    1 
ATOM 1351 H HA   . ASP A 1 93 ? 14.384  5.230   1.582   1.00 0.35 ? 407 ASP A HA   1 
ATOM 1352 H HB2  . ASP A 1 93 ? 13.501  6.064   -0.573  1.00 0.39 ? 407 ASP A HB2  1 
ATOM 1353 H HB3  . ASP A 1 93 ? 11.936  5.326   -0.226  1.00 0.34 ? 407 ASP A HB3  1 
ATOM 1354 N N    . ILE A 1 94 ? 11.602  3.517   1.950   1.00 0.25 ? 408 ILE A N    1 
ATOM 1355 C CA   . ILE A 1 94 ? 10.648  3.034   2.988   1.00 0.25 ? 408 ILE A CA   1 
ATOM 1356 C C    . ILE A 1 94 ? 11.446  2.304   4.067   1.00 0.26 ? 408 ILE A C    1 
ATOM 1357 O O    . ILE A 1 94 ? 11.216  2.451   5.255   1.00 0.29 ? 408 ILE A O    1 
ATOM 1358 C CB   . ILE A 1 94 ? 9.669   2.052   2.343   1.00 0.26 ? 408 ILE A CB   1 
ATOM 1359 C CG1  . ILE A 1 94 ? 8.917   2.750   1.207   1.00 0.26 ? 408 ILE A CG1  1 
ATOM 1360 C CG2  . ILE A 1 94 ? 8.669   1.562   3.391   1.00 0.32 ? 408 ILE A CG2  1 
ATOM 1361 C CD1  . ILE A 1 94 ? 8.416   1.703   0.215   1.00 0.23 ? 408 ILE A CD1  1 
ATOM 1362 H H    . ILE A 1 94 ? 11.538  3.177   1.032   1.00 0.26 ? 408 ILE A H    1 
ATOM 1363 H HA   . ILE A 1 94 ? 10.111  3.867   3.423   1.00 0.28 ? 408 ILE A HA   1 
ATOM 1364 H HB   . ILE A 1 94 ? 10.216  1.210   1.951   1.00 0.25 ? 408 ILE A HB   1 
ATOM 1365 H HG12 . ILE A 1 94 ? 8.075   3.291   1.611   1.00 0.30 ? 408 ILE A HG12 1 
ATOM 1366 H HG13 . ILE A 1 94 ? 9.582   3.435   0.705   1.00 0.28 ? 408 ILE A HG13 1 
ATOM 1367 H HG21 . ILE A 1 94 ? 8.796   2.126   4.304   1.00 1.05 ? 408 ILE A HG21 1 
ATOM 1368 H HG22 . ILE A 1 94 ? 8.838   0.512   3.588   1.00 1.12 ? 408 ILE A HG22 1 
ATOM 1369 H HG23 . ILE A 1 94 ? 7.664   1.702   3.019   1.00 1.00 ? 408 ILE A HG23 1 
ATOM 1370 H HD11 . ILE A 1 94 ? 7.340   1.760   0.148   1.00 0.99 ? 408 ILE A HD11 1 
ATOM 1371 H HD12 . ILE A 1 94 ? 8.704   0.718   0.556   1.00 1.10 ? 408 ILE A HD12 1 
ATOM 1372 H HD13 . ILE A 1 94 ? 8.852   1.889   -0.757  1.00 0.99 ? 408 ILE A HD13 1 
ATOM 1373 N N    . GLU A 1 95 ? 12.391  1.515   3.647   1.00 0.25 ? 409 GLU A N    1 
ATOM 1374 C CA   . GLU A 1 95 ? 13.223  0.762   4.618   1.00 0.28 ? 409 GLU A CA   1 
ATOM 1375 C C    . GLU A 1 95 ? 13.904  1.760   5.547   1.00 0.31 ? 409 GLU A C    1 
ATOM 1376 O O    . GLU A 1 95 ? 14.002  1.557   6.742   1.00 0.34 ? 409 GLU A O    1 
ATOM 1377 C CB   . GLU A 1 95 ? 14.283  -0.033  3.856   1.00 0.31 ? 409 GLU A CB   1 
ATOM 1378 C CG   . GLU A 1 95 ? 14.831  -1.137  4.758   1.00 0.37 ? 409 GLU A CG   1 
ATOM 1379 C CD   . GLU A 1 95 ? 16.044  -1.782  4.089   1.00 0.95 ? 409 GLU A CD   1 
ATOM 1380 O OE1  . GLU A 1 95 ? 16.845  -1.054  3.527   1.00 1.74 ? 409 GLU A OE1  1 
ATOM 1381 O OE2  . GLU A 1 95 ? 16.152  -2.995  4.154   1.00 1.48 ? 409 GLU A OE2  1 
ATOM 1382 H H    . GLU A 1 95 ? 12.551  1.420   2.682   1.00 0.25 ? 409 GLU A H    1 
ATOM 1383 H HA   . GLU A 1 95 ? 12.603  0.090   5.193   1.00 0.30 ? 409 GLU A HA   1 
ATOM 1384 H HB2  . GLU A 1 95 ? 13.842  -0.471  2.971   1.00 0.30 ? 409 GLU A HB2  1 
ATOM 1385 H HB3  . GLU A 1 95 ? 15.088  0.627   3.568   1.00 0.31 ? 409 GLU A HB3  1 
ATOM 1386 H HG2  . GLU A 1 95 ? 15.119  -0.715  5.710   1.00 0.67 ? 409 GLU A HG2  1 
ATOM 1387 H HG3  . GLU A 1 95 ? 14.070  -1.886  4.912   1.00 0.70 ? 409 GLU A HG3  1 
ATOM 1388 N N    . GLU A 1 96 ? 14.356  2.851   5.003   1.00 0.31 ? 410 GLU A N    1 
ATOM 1389 C CA   . GLU A 1 96 ? 15.012  3.882   5.840   1.00 0.35 ? 410 GLU A CA   1 
ATOM 1390 C C    . GLU A 1 96 ? 14.015  4.370   6.891   1.00 0.33 ? 410 GLU A C    1 
ATOM 1391 O O    . GLU A 1 96 ? 14.376  4.662   8.017   1.00 0.37 ? 410 GLU A O    1 
ATOM 1392 C CB   . GLU A 1 96 ? 15.433  5.048   4.954   1.00 0.40 ? 410 GLU A CB   1 
ATOM 1393 C CG   . GLU A 1 96 ? 16.315  5.999   5.756   1.00 1.20 ? 410 GLU A CG   1 
ATOM 1394 C CD   . GLU A 1 96 ? 16.649  7.222   4.895   1.00 1.69 ? 410 GLU A CD   1 
ATOM 1395 O OE1  . GLU A 1 96 ? 16.832  7.046   3.704   1.00 2.32 ? 410 GLU A OE1  1 
ATOM 1396 O OE2  . GLU A 1 96 ? 16.719  8.312   5.440   1.00 2.21 ? 410 GLU A OE2  1 
ATOM 1397 H H    . GLU A 1 96 ? 14.253  2.996   4.042   1.00 0.30 ? 410 GLU A H    1 
ATOM 1398 H HA   . GLU A 1 96 ? 15.879  3.461   6.327   1.00 0.39 ? 410 GLU A HA   1 
ATOM 1399 H HB2  . GLU A 1 96 ? 15.985  4.673   4.102   1.00 0.97 ? 410 GLU A HB2  1 
ATOM 1400 H HB3  . GLU A 1 96 ? 14.555  5.573   4.612   1.00 1.08 ? 410 GLU A HB3  1 
ATOM 1401 H HG2  . GLU A 1 96 ? 15.790  6.308   6.651   1.00 1.82 ? 410 GLU A HG2  1 
ATOM 1402 H HG3  . GLU A 1 96 ? 17.228  5.492   6.028   1.00 1.92 ? 410 GLU A HG3  1 
ATOM 1403 N N    . ALA A 1 97 ? 12.756  4.447   6.534   1.00 0.30 ? 411 ALA A N    1 
ATOM 1404 C CA   . ALA A 1 97 ? 11.726  4.898   7.516   1.00 0.31 ? 411 ALA A CA   1 
ATOM 1405 C C    . ALA A 1 97 ? 11.788  3.974   8.734   1.00 0.33 ? 411 ALA A C    1 
ATOM 1406 O O    . ALA A 1 97 ? 11.836  4.411   9.869   1.00 0.39 ? 411 ALA A O    1 
ATOM 1407 C CB   . ALA A 1 97 ? 10.333  4.798   6.886   1.00 0.31 ? 411 ALA A CB   1 
ATOM 1408 H H    . ALA A 1 97 ? 12.491  4.198   5.626   1.00 0.29 ? 411 ALA A H    1 
ATOM 1409 H HA   . ALA A 1 97 ? 11.923  5.917   7.818   1.00 0.34 ? 411 ALA A HA   1 
ATOM 1410 H HB1  . ALA A 1 97 ? 9.963   3.789   6.997   1.00 1.02 ? 411 ALA A HB1  1 
ATOM 1411 H HB2  . ALA A 1 97 ? 10.389  5.047   5.837   1.00 1.08 ? 411 ALA A HB2  1 
ATOM 1412 H HB3  . ALA A 1 97 ? 9.663   5.481   7.385   1.00 0.90 ? 411 ALA A HB3  1 
ATOM 1413 N N    . LEU A 1 98 ? 11.806  2.693   8.499   1.00 0.32 ? 412 LEU A N    1 
ATOM 1414 C CA   . LEU A 1 98 ? 11.888  1.725   9.626   1.00 0.37 ? 412 LEU A CA   1 
ATOM 1415 C C    . LEU A 1 98 ? 13.203  1.945   10.381  1.00 0.41 ? 412 LEU A C    1 
ATOM 1416 O O    . LEU A 1 98 ? 13.289  1.717   11.571  1.00 0.46 ? 412 LEU A O    1 
ATOM 1417 C CB   . LEU A 1 98 ? 11.822  0.302   9.070   1.00 0.39 ? 412 LEU A CB   1 
ATOM 1418 C CG   . LEU A 1 98 ? 10.417  0.055   8.524   1.00 0.50 ? 412 LEU A CG   1 
ATOM 1419 C CD1  . LEU A 1 98 ? 10.369  -1.303  7.821   1.00 0.83 ? 412 LEU A CD1  1 
ATOM 1420 C CD2  . LEU A 1 98 ? 9.411   0.076   9.678   1.00 0.88 ? 412 LEU A CD2  1 
ATOM 1421 H H    . LEU A 1 98 ? 11.775  2.364   7.572   1.00 0.31 ? 412 LEU A H    1 
ATOM 1422 H HA   . LEU A 1 98 ? 11.056  1.886   10.296  1.00 0.41 ? 412 LEU A HA   1 
ATOM 1423 H HB2  . LEU A 1 98 ? 12.546  0.191   8.274   1.00 0.38 ? 412 LEU A HB2  1 
ATOM 1424 H HB3  . LEU A 1 98 ? 12.034  -0.409  9.854   1.00 0.54 ? 412 LEU A HB3  1 
ATOM 1425 H HG   . LEU A 1 98 ? 10.170  0.833   7.814   1.00 1.08 ? 412 LEU A HG   1 
ATOM 1426 H HD11 . LEU A 1 98 ? 10.726  -1.192  6.808   1.00 1.37 ? 412 LEU A HD11 1 
ATOM 1427 H HD12 . LEU A 1 98 ? 9.351   -1.666  7.807   1.00 1.43 ? 412 LEU A HD12 1 
ATOM 1428 H HD13 . LEU A 1 98 ? 10.998  -2.006  8.348   1.00 1.46 ? 412 LEU A HD13 1 
ATOM 1429 H HD21 . LEU A 1 98 ? 8.952   -0.896  9.770   1.00 1.57 ? 412 LEU A HD21 1 
ATOM 1430 H HD22 . LEU A 1 98 ? 8.650   0.819   9.479   1.00 1.34 ? 412 LEU A HD22 1 
ATOM 1431 H HD23 . LEU A 1 98 ? 9.920   0.320   10.597  1.00 1.44 ? 412 LEU A HD23 1 
ATOM 1432 N N    . CYS A 1 99 ? 14.225  2.389   9.691   1.00 0.40 ? 413 CYS A N    1 
ATOM 1433 C CA   . CYS A 1 99 ? 15.541  2.637   10.356  1.00 0.47 ? 413 CYS A CA   1 
ATOM 1434 C C    . CYS A 1 99 ? 15.712  4.136   10.621  1.00 1.37 ? 413 CYS A C    1 
ATOM 1435 O O    . CYS A 1 99 ? 16.337  4.843   9.855   1.00 2.04 ? 413 CYS A O    1 
ATOM 1436 C CB   . CYS A 1 99 ? 16.667  2.155   9.436   1.00 1.40 ? 413 CYS A CB   1 
ATOM 1437 S SG   . CYS A 1 99 ? 16.706  0.346   9.429   1.00 2.36 ? 413 CYS A SG   1 
ATOM 1438 H H    . CYS A 1 99 ? 14.124  2.566   8.733   1.00 0.37 ? 413 CYS A H    1 
ATOM 1439 H HA   . CYS A 1 99 ? 15.584  2.098   11.291  1.00 0.82 ? 413 CYS A HA   1 
ATOM 1440 H HB2  . CYS A 1 99 ? 16.492  2.516   8.434   1.00 1.87 ? 413 CYS A HB2  1 
ATOM 1441 H HB3  . CYS A 1 99 ? 17.617  2.534   9.794   1.00 2.04 ? 413 CYS A HB3  1 
ATOM 1442 H HG   . CYS A 1 99 ? 16.492  0.047   8.543   1.00 2.70 ? 413 CYS A HG   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   315 ?   ?   ?   A . n 
A 1 2   ALA 2   316 ?   ?   ?   A . n 
A 1 3   HIS 3   317 ?   ?   ?   A . n 
A 1 4   LYS 4   318 ?   ?   ?   A . n 
A 1 5   PRO 5   319 ?   ?   ?   A . n 
A 1 6   GLN 6   320 ?   ?   ?   A . n 
A 1 7   SER 7   321 ?   ?   ?   A . n 
A 1 8   LEU 8   322 ?   ?   ?   A . n 
A 1 9   ASP 9   323 ?   ?   ?   A . n 
A 1 10  THR 10  324 ?   ?   ?   A . n 
A 1 11  ASP 11  325 ?   ?   ?   A . n 
A 1 12  ASP 12  326 ?   ?   ?   A . n 
A 1 13  PRO 13  327 327 PRO PRO A . n 
A 1 14  ALA 14  328 328 ALA ALA A . n 
A 1 15  THR 15  329 329 THR THR A . n 
A 1 16  LEU 16  330 330 LEU LEU A . n 
A 1 17  TYR 17  331 331 TYR TYR A . n 
A 1 18  ALA 18  332 332 ALA ALA A . n 
A 1 19  VAL 19  333 333 VAL VAL A . n 
A 1 20  VAL 20  334 334 VAL VAL A . n 
A 1 21  GLU 21  335 335 GLU GLU A . n 
A 1 22  ASN 22  336 336 ASN ASN A . n 
A 1 23  VAL 23  337 337 VAL VAL A . n 
A 1 24  PRO 24  338 338 PRO PRO A . n 
A 1 25  PRO 25  339 339 PRO PRO A . n 
A 1 26  LEU 26  340 340 LEU LEU A . n 
A 1 27  ARG 27  341 341 ARG ARG A . n 
A 1 28  TRP 28  342 342 TRP TRP A . n 
A 1 29  LYS 29  343 343 LYS LYS A . n 
A 1 30  GLU 30  344 344 GLU GLU A . n 
A 1 31  PHE 31  345 345 PHE PHE A . n 
A 1 32  VAL 32  346 346 VAL VAL A . n 
A 1 33  LYS 33  347 347 LYS LYS A . n 
A 1 34  ARG 34  348 348 ARG ARG A . n 
A 1 35  LEU 35  349 349 LEU LEU A . n 
A 1 36  GLY 36  350 350 GLY GLY A . n 
A 1 37  LEU 37  351 351 LEU LEU A . n 
A 1 38  SER 38  352 352 SER SER A . n 
A 1 39  ASP 39  353 353 ASP ASP A . n 
A 1 40  HIS 40  354 354 HIS HIS A . n 
A 1 41  GLU 41  355 355 GLU GLU A . n 
A 1 42  ILE 42  356 356 ILE ILE A . n 
A 1 43  ASP 43  357 357 ASP ASP A . n 
A 1 44  ARG 44  358 358 ARG ARG A . n 
A 1 45  LEU 45  359 359 LEU LEU A . n 
A 1 46  GLU 46  360 360 GLU GLU A . n 
A 1 47  LEU 47  361 361 LEU LEU A . n 
A 1 48  GLN 48  362 362 GLN GLN A . n 
A 1 49  ASN 49  363 363 ASN ASN A . n 
A 1 50  GLY 50  364 364 GLY GLY A . n 
A 1 51  ARG 51  365 365 ARG ARG A . n 
A 1 52  CYS 52  366 366 CYS CYS A . n 
A 1 53  LEU 53  367 367 LEU LEU A . n 
A 1 54  ARG 54  368 368 ARG ARG A . n 
A 1 55  GLU 55  369 369 GLU GLU A . n 
A 1 56  ALA 56  370 370 ALA ALA A . n 
A 1 57  GLN 57  371 371 GLN GLN A . n 
A 1 58  TYR 58  372 372 TYR TYR A . n 
A 1 59  SER 59  373 373 SER SER A . n 
A 1 60  MET 60  374 374 MET MET A . n 
A 1 61  LEU 61  375 375 LEU LEU A . n 
A 1 62  ALA 62  376 376 ALA ALA A . n 
A 1 63  THR 63  377 377 THR THR A . n 
A 1 64  TRP 64  378 378 TRP TRP A . n 
A 1 65  ARG 65  379 379 ARG ARG A . n 
A 1 66  ARG 66  380 380 ARG ARG A . n 
A 1 67  ARG 67  381 381 ARG ARG A . n 
A 1 68  THR 68  382 382 THR THR A . n 
A 1 69  PRO 69  383 383 PRO PRO A . n 
A 1 70  ARG 70  384 384 ARG ARG A . n 
A 1 71  ARG 71  385 385 ARG ARG A . n 
A 1 72  GLU 72  386 386 GLU GLU A . n 
A 1 73  ALA 73  387 387 ALA ALA A . n 
A 1 74  THR 74  388 388 THR THR A . n 
A 1 75  LEU 75  389 389 LEU LEU A . n 
A 1 76  GLU 76  390 390 GLU GLU A . n 
A 1 77  LEU 77  391 391 LEU LEU A . n 
A 1 78  LEU 78  392 392 LEU LEU A . n 
A 1 79  GLY 79  393 393 GLY GLY A . n 
A 1 80  ARG 80  394 394 ARG ARG A . n 
A 1 81  VAL 81  395 395 VAL VAL A . n 
A 1 82  LEU 82  396 396 LEU LEU A . n 
A 1 83  ARG 83  397 397 ARG ARG A . n 
A 1 84  ASP 84  398 398 ASP ASP A . n 
A 1 85  MET 85  399 399 MET MET A . n 
A 1 86  ASP 86  400 400 ASP ASP A . n 
A 1 87  LEU 87  401 401 LEU LEU A . n 
A 1 88  LEU 88  402 402 LEU LEU A . n 
A 1 89  GLY 89  403 403 GLY GLY A . n 
A 1 90  CYS 90  404 404 CYS CYS A . n 
A 1 91  LEU 91  405 405 LEU LEU A . n 
A 1 92  GLU 92  406 406 GLU GLU A . n 
A 1 93  ASP 93  407 407 ASP ASP A . n 
A 1 94  ILE 94  408 408 ILE ILE A . n 
A 1 95  GLU 95  409 409 GLU GLU A . n 
A 1 96  GLU 96  410 410 GLU GLU A . n 
A 1 97  ALA 97  411 411 ALA ALA A . n 
A 1 98  LEU 98  412 412 LEU LEU A . n 
A 1 99  CYS 99  413 413 CYS CYS A . n 
A 1 100 GLY 100 414 ?   ?   ?   A . n 
A 1 101 PRO 101 415 ?   ?   ?   A . n 
A 1 102 ALA 102 416 ?   ?   ?   A . n 
A 1 103 ALA 103 417 ?   ?   ?   A . n 
A 1 104 LEU 104 418 ?   ?   ?   A . n 
A 1 105 PRO 105 419 ?   ?   ?   A . n 
A 1 106 PRO 106 420 ?   ?   ?   A . n 
A 1 107 ALA 107 421 ?   ?   ?   A . n 
A 1 108 PRO 108 422 ?   ?   ?   A . n 
A 1 109 SER 109 423 ?   ?   ?   A . n 
A 1 110 LEU 110 424 ?   ?   ?   A . n 
A 1 111 LEU 111 425 ?   ?   ?   A . n 
A 1 112 ARG 112 426 ?   ?   ?   A . n 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2002-04-01 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O A LEU 396 ? ? H A LEU 401 ? ? 1.54 
2 1 O A LEU 405 ? ? H A GLU 409 ? ? 1.56 
3 1 O A LEU 389 ? ? H A GLY 393 ? ? 1.58 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASN A 363 ? ? 179.96 90.89 
2 1 ALA A 387 ? ? 71.77  34.22 
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1  1 ARG A 341 ? ? 0.259 'SIDE CHAIN' 
2  1 ARG A 348 ? ? 0.316 'SIDE CHAIN' 
3  1 ARG A 358 ? ? 0.223 'SIDE CHAIN' 
4  1 ARG A 365 ? ? 0.270 'SIDE CHAIN' 
5  1 ARG A 368 ? ? 0.247 'SIDE CHAIN' 
6  1 ARG A 379 ? ? 0.176 'SIDE CHAIN' 
7  1 ARG A 380 ? ? 0.246 'SIDE CHAIN' 
8  1 ARG A 381 ? ? 0.215 'SIDE CHAIN' 
9  1 ARG A 384 ? ? 0.215 'SIDE CHAIN' 
10 1 ARG A 385 ? ? 0.274 'SIDE CHAIN' 
11 1 ARG A 394 ? ? 0.277 'SIDE CHAIN' 
12 1 ARG A 397 ? ? 0.297 'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 315 ? A MET 1   
2  1 Y 1 A ALA 316 ? A ALA 2   
3  1 Y 1 A HIS 317 ? A HIS 3   
4  1 Y 1 A LYS 318 ? A LYS 4   
5  1 Y 1 A PRO 319 ? A PRO 5   
6  1 Y 1 A GLN 320 ? A GLN 6   
7  1 Y 1 A SER 321 ? A SER 7   
8  1 Y 1 A LEU 322 ? A LEU 8   
9  1 Y 1 A ASP 323 ? A ASP 9   
10 1 Y 1 A THR 324 ? A THR 10  
11 1 Y 1 A ASP 325 ? A ASP 11  
12 1 Y 1 A ASP 326 ? A ASP 12  
13 1 Y 1 A GLY 414 ? A GLY 100 
14 1 Y 1 A PRO 415 ? A PRO 101 
15 1 Y 1 A ALA 416 ? A ALA 102 
16 1 Y 1 A ALA 417 ? A ALA 103 
17 1 Y 1 A LEU 418 ? A LEU 104 
18 1 Y 1 A PRO 419 ? A PRO 105 
19 1 Y 1 A PRO 420 ? A PRO 106 
20 1 Y 1 A ALA 421 ? A ALA 107 
21 1 Y 1 A PRO 422 ? A PRO 108 
22 1 Y 1 A SER 423 ? A SER 109 
23 1 Y 1 A LEU 424 ? A LEU 110 
24 1 Y 1 A LEU 425 ? A LEU 111 
25 1 Y 1 A ARG 426 ? A ARG 112 
#