data_1IRS
# 
_entry.id   1IRS 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1IRS         
WWPDB D_1000174245 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1IRS 
_pdbx_database_status.recvd_initial_deposition_date   1996-03-22 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    ? 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Zhou, M.-M.'      1 
'Huang, B.'        2 
'Olejniczak, E.T.' 3 
'Meadows, R.P.'    4 
'Shuker, S.B.'     5 
'Miyazaki, M.'     6 
'Trub, T.'         7 
'Shoelson, S.E.'   8 
'Feisk, S.W.'      9 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Structural basis for IL-4 receptor phosphopeptide recognition by the IRS-1 PTB domain.' Nat.Struct.Biol. 3   388   393 
1996 NSBIEW US 1072-8368 2024 ? 8599766 10.1038/nsb0496-388 
1       'Ptb Domains of Irs-1 and Shc Have Distinct But Overlapping Binding Specificities' J.Biol.Chem.     270 27407 ?   1995 
JBCHA3 US 0021-9258 0071 ? ?       ?                   
2       'Structure and Ligand Recognition of the Phosphotyrosine Binding Domain of Shc' Nature           378 584   ?   1995 NATUAS 
UK 0028-0836 0006 ? ?       ?                   
3       
'Characterization of an Interaction between Insulin Receptor Substrate 1 and the Insulin Receptor by Using the Two-Hybrid System' 
Mol.Cell.Biol.   14  6433  ?   1994 MCEBD4 US 0270-7306 2044 ? ?       ?                   
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Zhou, M.M.'         1  
primary 'Huang, B.'          2  
primary 'Olejniczak, E.T.'   3  
primary 'Meadows, R.P.'      4  
primary 'Shuker, S.B.'       5  
primary 'Miyazaki, M.'       6  
primary 'Trub, T.'           7  
primary 'Shoelson, S.E.'     8  
primary 'Fesik, S.W.'        9  
1       'Wolf, G.'           10 
1       'Trub, T.'           11 
1       'Ottinger, E.'       12 
1       'Groninga, L.'       13 
1       'Lynch, A.'          14 
1       'White, M.F.'        15 
1       'Miyazaki, M.'       16 
1       'Lee, J.'            17 
1       'Shoelson, S.E.'     18 
2       'Zhou, M.M.'         19 
2       'Ravichandran, K.S.' 20 
2       'Olejniczak, E.F.'   21 
2       'Petros, A.M.'       22 
2       'Meadows, R.P.'      23 
2       'Sattler, M.'        24 
2       'Harlan, J.E.'       25 
2       'Wade, W.S.'         26 
2       'Burakoff, S.J.'     27 
2       'Fesik, S.W.'        28 
3       
;O'Neill, T.J.
;
29 
3       'Craparo, A.'        30 
3       'Gustafson, T.A.'    31 
# 
_cell.entry_id           1IRS 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1IRS 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man IRS-1                          12648.737 1 ? ? 'PTB DOMAIN' ? 
2 polymer man 'IL-4 RECEPTOR PHOSPHOPEPTIDE' 1241.311  1 ? ? ?            ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'INSULIN RECEPTOR SUBSTRATE 1' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no  
;MGPAFKEVWQVILKPKGLGQTKNLIGIYRLCLTSKTISFVKLNSEAAAVVLQLMNIRRCGHSENFFFIEVGRSAVTGPGE
FWMQVDDSVVAQNMHETILEAMRAMSDEFRPR
;
;MGPAFKEVWQVILKPKGLGQTKNLIGIYRLCLTSKTISFVKLNSEAAAVVLQLMNIRRCGHSENFFFIEVGRSAVTGPGE
FWMQVDDSVVAQNMHETILEAMRAMSDEFRPR
;
A ? 
2 'polypeptide(L)' no yes 'LVIAGNPA(PTR)RS' LVIAGNPAYRS B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   PRO n 
1 4   ALA n 
1 5   PHE n 
1 6   LYS n 
1 7   GLU n 
1 8   VAL n 
1 9   TRP n 
1 10  GLN n 
1 11  VAL n 
1 12  ILE n 
1 13  LEU n 
1 14  LYS n 
1 15  PRO n 
1 16  LYS n 
1 17  GLY n 
1 18  LEU n 
1 19  GLY n 
1 20  GLN n 
1 21  THR n 
1 22  LYS n 
1 23  ASN n 
1 24  LEU n 
1 25  ILE n 
1 26  GLY n 
1 27  ILE n 
1 28  TYR n 
1 29  ARG n 
1 30  LEU n 
1 31  CYS n 
1 32  LEU n 
1 33  THR n 
1 34  SER n 
1 35  LYS n 
1 36  THR n 
1 37  ILE n 
1 38  SER n 
1 39  PHE n 
1 40  VAL n 
1 41  LYS n 
1 42  LEU n 
1 43  ASN n 
1 44  SER n 
1 45  GLU n 
1 46  ALA n 
1 47  ALA n 
1 48  ALA n 
1 49  VAL n 
1 50  VAL n 
1 51  LEU n 
1 52  GLN n 
1 53  LEU n 
1 54  MET n 
1 55  ASN n 
1 56  ILE n 
1 57  ARG n 
1 58  ARG n 
1 59  CYS n 
1 60  GLY n 
1 61  HIS n 
1 62  SER n 
1 63  GLU n 
1 64  ASN n 
1 65  PHE n 
1 66  PHE n 
1 67  PHE n 
1 68  ILE n 
1 69  GLU n 
1 70  VAL n 
1 71  GLY n 
1 72  ARG n 
1 73  SER n 
1 74  ALA n 
1 75  VAL n 
1 76  THR n 
1 77  GLY n 
1 78  PRO n 
1 79  GLY n 
1 80  GLU n 
1 81  PHE n 
1 82  TRP n 
1 83  MET n 
1 84  GLN n 
1 85  VAL n 
1 86  ASP n 
1 87  ASP n 
1 88  SER n 
1 89  VAL n 
1 90  VAL n 
1 91  ALA n 
1 92  GLN n 
1 93  ASN n 
1 94  MET n 
1 95  HIS n 
1 96  GLU n 
1 97  THR n 
1 98  ILE n 
1 99  LEU n 
1 100 GLU n 
1 101 ALA n 
1 102 MET n 
1 103 ARG n 
1 104 ALA n 
1 105 MET n 
1 106 SER n 
1 107 ASP n 
1 108 GLU n 
1 109 PHE n 
1 110 ARG n 
1 111 PRO n 
1 112 ARG n 
2 1   LEU n 
2 2   VAL n 
2 3   ILE n 
2 4   ALA n 
2 5   GLY n 
2 6   ASN n 
2 7   PRO n 
2 8   ALA n 
2 9   PTR n 
2 10  ARG n 
2 11  SER n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human Homo 'PTB DOMAIN OF IRS-1' ? 'BL21 (DE2) PLYSS' ? ? ? ? 'Homo sapiens' 9606 ? BL21 ? SKELETAL ? ? ? ? 
'Escherichia coli' 562 Escherichia 'PTB DOMAIN OF IRS-1' ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? PET30B ? ? 
2 1 sample ? ? ? human Homo ?                     ? ?                  ? ? ? ? 'Homo sapiens' 9606 ? ?    ? ?        ? ? ? ? 
'Escherichia coli' 562 Escherichia ?                     ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ?      ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 UNP IRS1_HUMAN  1 P35568 1 
;MASPPESDGFSDVRKVGYLRKPKSMHKRFFVLRAASEAGGPARLEYYENEKKWRHKSSAPKRSIPLESCFNINKRADSKN
KHLVALYTRDEHFAIAADSEAEQDSWYQALLQLHNRAKGHHDGAAALGAGGGGGSCSGSSGLGEAGEDLSYGDVPPGPAF
KEVWQVILKPKGLGQTKNLIGIYRLCLTSKTISFVKLNSEAAAVVLQLMNIRRCGHSENFFFIEVGRSAVTGPGEFWMQV
DDSVVAQNMHETILEAMRAMSDEFRPRSKSQSSSNCSNPISVPLRRHHLNNPPPSQVGLTRRSRTESITATSPASMVGGK
PGSFRVRASSDGEGTMSRPASVDGSPVSPSTNRTHAHRHRGSARLHPPLNHSRSIPMPASRCSPSATSPVSLSSSSTSGH
GSTSDCLFPRRSSASVSGSPSDGGFISSDEYGSSPCDFRSSFRSVTPDSLGHTPPARGEEELSNYICMGGKGPSTLTAPN
GHYILSRGGNGHRCTPGTGLGTSPALAGDEAASAADLDNRFRKRTHSAGTSPTITHQKTPSQSSVASIEEYTEMMPAYPP
GGGSGGRLPGHRHSAFVPTRSYPEEGLEMHPLERRGGHHRPDSSTLHTDDGYMPMSPGVAPVPSGRKGSGDYMPMSPKSV
SAPQQIINPIRRHPQRVDPNGYMMMSPSGGCSPDIGGGPSSSSSSSNAVPSGTSYGKLWTNGVGGHHSHVLPHPKPPVES
SGGKLLPCTGDYMNMSPVGDSNTSSPSDCYYGPEDPQHKPVLSYYSLPRSFKHTQRPGEPEEGARHQHLRLSTSSGRLLY
AATADDSSSSTSSDSLGGGYCGARLEPSLPHPHHQVLQPHLPRKVDTAAQTNSRLARPTRLSLGDPKASTLPRAREQQQQ
QQPLLHPPEPKSPGEYVNIEFGSDQSGYLSGPVAFHSSPSVRCPSQLQPAPREEETGTEEYMKMDLGPGRRAAWQESTGV
EMGRLGPAPPGAASICRPTRAVPSSRGDYMTMQMSCPRQSYVDTSPAAPVSYADMRTGIAAEEVSLPRATMAAASSSSAA
SASPTGPQGAAELAAHSSLLGGPQGPGGMSAFTRVNLSPNRNQSAKVIRADPQGCRRRHSSETFSSTPSATRVGNTVPFG
AGAAVGGGGGSSSSSEDVKRHSSASFENVWLRPGELGGAPKEPAKLCGAAGGLENGLNYIDLDLVKDFKQCPQECTPEPQ
PPPPPPPHQPLGSGESSSTRRSSEDLSAYASISFQKQPEDRQ
;
? 
2 UNP IL4RA_HUMAN 2 P24394 1 
;MGWLCSGLLFPVSCLVLLQVASSGNMKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNG
GAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYA
VNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQHLLLGVSVS
CIVILAVCLLCYVSITKIKKEWWDQIPNPARSRLVAIIIQDAQGSQWEKRSRGQEPAKCPHWKNCLTKLLPCFLEHNMKR
DEDPHKAAKEMPFQGSGKSAWCPVEISKTVLWPESISVVRCVELFEAPVECEEEEEVEEEKGSFCASPESSRDDFQEGRE
GIVARLTESLFLDLLGEENGGFCQQDMGESCLLPPSGSTSAHMPWDEFPSAGPKEAPPWGKEQPLHLEPSPPASPTQSPD
NLTCTETPLVIAGNPAYRSFSNSLSQSPCPRELGPDPLLARHLEEVEPEMPCVPQLSEPTTVPQPEPETWEQILRRNVLQ
HGAAAAPVSAPTSGYQEFVHAVEQGGTQASAVVGLGPPGEAGYKAFSSLLASSAVSPEKCGFGASSGEEGYKPFQDLIPG
CPGDPAPVPVPLFTFGLDREPPRSPQSSHLPSSSPEHLGLEPGEKVEDMPKPPLPQEQATDPLVDSLGSGIVYSALTCHL
CGHLKQCHGQEDGGQTPVMASPCCGCCCGDRSSPPTTPLRAPDPSPGGVPLEASLCPASLAPSGISEKSKSSSSFHPAPG
NAQSSSQTPKIVNFVSVGPTYMRVS
;
? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1IRS A 2 ? 112 ? P35568 157 ? 267 ? 157 267 
2 2 1IRS B 1 ? 11  ? P24394 489 ? 499 ? 489 499 
# 
_struct_ref_seq_dif.align_id                     2 
_struct_ref_seq_dif.pdbx_pdb_id_code             1IRS 
_struct_ref_seq_dif.mon_id                       PTR 
_struct_ref_seq_dif.pdbx_pdb_strand_id           B 
_struct_ref_seq_dif.seq_num                      9 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P24394 
_struct_ref_seq_dif.db_mon_id                    TYR 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          497 
_struct_ref_seq_dif.details                      'MODIFIED RESIDUE' 
_struct_ref_seq_dif.pdbx_auth_seq_num            497 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE           ?                 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE          ?                 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE        ?                 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'   ?                 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE          ?                 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE         ?                 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'   ?                 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE           ?                 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE         ?                 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE        ?                 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE           ?                 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE            ?                 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE        ?                 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE     ?                 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE           ?                 'C5 H9 N O2'     115.130 
PTR 'L-peptide linking' n O-PHOSPHOTYROSINE PHOSPHONOTYROSINE 'C9 H12 N O6 P'  261.168 
SER 'L-peptide linking' y SERINE            ?                 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE         ?                 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN        ?                 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE          ?                 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE            ?                 'C5 H11 N O2'    117.146 
# 
_pdbx_nmr_refine.entry_id           1IRS 
_pdbx_nmr_refine.method             ? 
_pdbx_nmr_refine.details            'SET OF IDEAL BOND LENGTHS AND ANGLES USED DURING REFINEMENT: PARALLHDG.PRO IN X-PLOR.' 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      1IRS 
_pdbx_nmr_ensemble.conformers_calculated_total_number            ? 
_pdbx_nmr_ensemble.conformers_submitted_total_number             1 
_pdbx_nmr_ensemble.conformer_selection_criteria                  ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_software.classification   refinement 
_pdbx_nmr_software.name             X-PLOR 
_pdbx_nmr_software.version          ? 
_pdbx_nmr_software.authors          BRUNGER 
_pdbx_nmr_software.ordinal          1 
# 
_exptl.entry_id          1IRS 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  1IRS 
_struct.title                     
'IRS-1 PTB DOMAIN COMPLEXED WITH A IL-4 RECEPTOR PHOSPHOPEPTIDE, NMR, MINIMIZED AVERAGE STRUCTURE' 
_struct.pdbx_descriptor           'IRS-1, IL-4 RECEPTOR PHOSPHOPEPTIDE' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1IRS 
_struct_keywords.pdbx_keywords   'COMPLEX (SIGNAL TRANSDUCTION/PEPTIDE)' 
_struct_keywords.text            
;PHOSPHOTYROSINE BINDING DOMAIN (PTB), COMPLEX, SIGNAL TRANSDUCTION, COMPLEX (SIGNAL TRANSDUCTION-PEPTIDE), COMPLEX (SIGNAL TRANSDUCTION-PEPTIDE) complex
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 LEU A 18 ? THR A 21  ? LEU A 173 THR A 176 1 ? 4  
HELX_P HELX_P2 2 VAL A 90 ? ASP A 107 ? VAL A 245 ASP A 262 1 ? 18 
HELX_P HELX_P3 3 PRO B 7  ? PTR B 9   ? PRO B 495 PTR B 497 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? B PTR 9 N ? ? ? 1_555 B ALA 8  C ? ? B PTR 497 B ALA 496 1_555 ? ? ? ? ? ? ? 1.309 ? 
covale2 covale ? ? B PTR 9 C ? ? ? 1_555 B ARG 10 N ? ? B PTR 497 B ARG 498 1_555 ? ? ? ? ? ? ? 1.309 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLU A 7  ? ILE A 12 ? GLU A 162 ILE A 167 
A 2 ILE A 27 ? THR A 33 ? ILE A 182 THR A 188 
A 3 THR A 36 ? LYS A 41 ? THR A 191 LYS A 196 
A 4 VAL A 49 ? GLN A 52 ? VAL A 204 GLN A 207 
B 1 GLY A 79 ? PHE A 81 ? GLY A 234 PHE A 236 
B 2 PHE A 65 ? VAL A 70 ? PHE A 220 VAL A 225 
B 3 ILE A 56 ? SER A 62 ? ILE A 211 SER A 217 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O GLU A 7  ? O GLU A 162 N LEU A 32 ? N LEU A 187 
A 2 3 O ARG A 29 ? O ARG A 184 N VAL A 40 ? N VAL A 195 
A 3 4 O ILE A 37 ? O ILE A 192 N LEU A 51 ? N LEU A 206 
B 1 2 O GLY A 79 ? O GLY A 234 N VAL A 70 ? N VAL A 225 
B 2 3 O PHE A 65 ? O PHE A 220 N SER A 62 ? N SER A 217 
# 
_database_PDB_matrix.entry_id          1IRS 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1IRS 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N    . MET A 1 1   ? -11.572 16.552  6.878   1.00 7.13  ? 156 MET A N    1 
ATOM   2    C CA   . MET A 1 1   ? -10.494 17.586  6.941   1.00 6.16  ? 156 MET A CA   1 
ATOM   3    C C    . MET A 1 1   ? -9.471  17.309  5.838   1.00 5.29  ? 156 MET A C    1 
ATOM   4    O O    . MET A 1 1   ? -9.203  18.149  5.002   1.00 5.31  ? 156 MET A O    1 
ATOM   5    C CB   . MET A 1 1   ? -9.772  17.577  8.305   1.00 5.98  ? 156 MET A CB   1 
ATOM   6    C CG   . MET A 1 1   ? -10.372 16.536  9.261   1.00 6.77  ? 156 MET A CG   1 
ATOM   7    S SD   . MET A 1 1   ? -9.767  14.887  8.821   1.00 7.17  ? 156 MET A SD   1 
ATOM   8    C CE   . MET A 1 1   ? -11.299 13.985  9.154   1.00 7.95  ? 156 MET A CE   1 
ATOM   9    H H1   . MET A 1 1   ? -11.945 16.508  5.907   1.00 7.42  ? 156 MET A H1   1 
ATOM   10   H H2   . MET A 1 1   ? -11.188 15.624  7.138   1.00 7.31  ? 156 MET A H2   1 
ATOM   11   H H3   . MET A 1 1   ? -12.340 16.807  7.528   1.00 7.56  ? 156 MET A H3   1 
ATOM   12   H HA   . MET A 1 1   ? -10.932 18.560  6.778   1.00 6.50  ? 156 MET A HA   1 
ATOM   13   H HB2  . MET A 1 1   ? -8.729  17.348  8.148   1.00 6.26  ? 156 MET A HB2  1 
ATOM   14   H HB3  . MET A 1 1   ? -9.853  18.556  8.752   1.00 5.34  ? 156 MET A HB3  1 
ATOM   15   H HG2  . MET A 1 1   ? -10.069 16.768  10.272  1.00 7.00  ? 156 MET A HG2  1 
ATOM   16   H HG3  . MET A 1 1   ? -11.447 16.557  9.201   1.00 7.23  ? 156 MET A HG3  1 
ATOM   17   H HE1  . MET A 1 1   ? -12.028 14.659  9.581   1.00 8.32  ? 156 MET A HE1  1 
ATOM   18   H HE2  . MET A 1 1   ? -11.680 13.571  8.230   1.00 8.19  ? 156 MET A HE2  1 
ATOM   19   H HE3  . MET A 1 1   ? -11.103 13.184  9.849   1.00 8.11  ? 156 MET A HE3  1 
ATOM   20   N N    . GLY A 1 2   ? -8.897  16.138  5.830   1.00 4.93  ? 157 GLY A N    1 
ATOM   21   C CA   . GLY A 1 2   ? -7.891  15.810  4.781   1.00 4.54  ? 157 GLY A CA   1 
ATOM   22   C C    . GLY A 1 2   ? -7.129  14.544  5.179   1.00 3.57  ? 157 GLY A C    1 
ATOM   23   O O    . GLY A 1 2   ? -7.198  13.540  4.498   1.00 3.36  ? 157 GLY A O    1 
ATOM   24   H H    . GLY A 1 2   ? -9.126  15.475  6.514   1.00 5.25  ? 157 GLY A H    1 
ATOM   25   H HA2  . GLY A 1 2   ? -8.394  15.648  3.838   1.00 5.16  ? 157 GLY A HA2  1 
ATOM   26   H HA3  . GLY A 1 2   ? -7.194  16.628  4.682   1.00 4.69  ? 157 GLY A HA3  1 
ATOM   27   N N    . PRO A 1 3   ? -6.423  14.640  6.275   1.00 3.49  ? 158 PRO A N    1 
ATOM   28   C CA   . PRO A 1 3   ? -5.624  13.539  6.822   1.00 3.18  ? 158 PRO A CA   1 
ATOM   29   C C    . PRO A 1 3   ? -6.492  12.600  7.675   1.00 2.31  ? 158 PRO A C    1 
ATOM   30   O O    . PRO A 1 3   ? -6.122  12.232  8.772   1.00 2.64  ? 158 PRO A O    1 
ATOM   31   C CB   . PRO A 1 3   ? -4.577  14.207  7.702   1.00 4.13  ? 158 PRO A CB   1 
ATOM   32   C CG   . PRO A 1 3   ? -5.278  15.519  8.148   1.00 4.61  ? 158 PRO A CG   1 
ATOM   33   C CD   . PRO A 1 3   ? -6.345  15.876  7.079   1.00 4.34  ? 158 PRO A CD   1 
ATOM   34   H HA   . PRO A 1 3   ? -5.140  12.992  6.030   1.00 3.42  ? 158 PRO A HA   1 
ATOM   35   H HB2  . PRO A 1 3   ? -4.343  13.581  8.555   1.00 4.24  ? 158 PRO A HB2  1 
ATOM   36   H HB3  . PRO A 1 3   ? -3.689  14.436  7.136   1.00 4.72  ? 158 PRO A HB3  1 
ATOM   37   H HG2  . PRO A 1 3   ? -5.753  15.371  9.108   1.00 4.83  ? 158 PRO A HG2  1 
ATOM   38   H HG3  . PRO A 1 3   ? -4.554  16.316  8.216   1.00 5.29  ? 158 PRO A HG3  1 
ATOM   39   H HD2  . PRO A 1 3   ? -7.296  16.094  7.547   1.00 4.52  ? 158 PRO A HD2  1 
ATOM   40   H HD3  . PRO A 1 3   ? -6.016  16.702  6.468   1.00 4.91  ? 158 PRO A HD3  1 
ATOM   41   N N    . ALA A 1 4   ? -7.639  12.205  7.189   1.00 1.70  ? 159 ALA A N    1 
ATOM   42   C CA   . ALA A 1 4   ? -8.508  11.293  7.984   1.00 1.22  ? 159 ALA A CA   1 
ATOM   43   C C    . ALA A 1 4   ? -8.209  9.845   7.594   1.00 1.00  ? 159 ALA A C    1 
ATOM   44   O O    . ALA A 1 4   ? -9.062  9.134   7.099   1.00 1.26  ? 159 ALA A O    1 
ATOM   45   C CB   . ALA A 1 4   ? -9.978  11.608  7.696   1.00 1.82  ? 159 ALA A CB   1 
ATOM   46   H H    . ALA A 1 4   ? -7.929  12.504  6.306   1.00 2.09  ? 159 ALA A H    1 
ATOM   47   H HA   . ALA A 1 4   ? -8.309  11.432  9.036   1.00 1.40  ? 159 ALA A HA   1 
ATOM   48   H HB1  . ALA A 1 4   ? -10.073 12.643  7.402   1.00 2.18  ? 159 ALA A HB1  1 
ATOM   49   H HB2  . ALA A 1 4   ? -10.332 10.973  6.898   1.00 2.32  ? 159 ALA A HB2  1 
ATOM   50   H HB3  . ALA A 1 4   ? -10.565 11.431  8.585   1.00 2.28  ? 159 ALA A HB3  1 
ATOM   51   N N    . PHE A 1 5   ? -7.001  9.402   7.812   1.00 0.81  ? 160 PHE A N    1 
ATOM   52   C CA   . PHE A 1 5   ? -6.646  8.000   7.453   1.00 0.58  ? 160 PHE A CA   1 
ATOM   53   C C    . PHE A 1 5   ? -7.499  7.033   8.271   1.00 0.61  ? 160 PHE A C    1 
ATOM   54   O O    . PHE A 1 5   ? -7.609  7.153   9.475   1.00 1.08  ? 160 PHE A O    1 
ATOM   55   C CB   . PHE A 1 5   ? -5.169  7.740   7.762   1.00 0.62  ? 160 PHE A CB   1 
ATOM   56   C CG   . PHE A 1 5   ? -4.321  8.856   7.202   1.00 0.65  ? 160 PHE A CG   1 
ATOM   57   C CD1  . PHE A 1 5   ? -3.989  8.865   5.843   1.00 1.39  ? 160 PHE A CD1  1 
ATOM   58   C CD2  . PHE A 1 5   ? -3.863  9.879   8.041   1.00 1.39  ? 160 PHE A CD2  1 
ATOM   59   C CE1  . PHE A 1 5   ? -3.200  9.897   5.321   1.00 1.48  ? 160 PHE A CE1  1 
ATOM   60   C CE2  . PHE A 1 5   ? -3.074  10.911  7.520   1.00 1.44  ? 160 PHE A CE2  1 
ATOM   61   C CZ   . PHE A 1 5   ? -2.743  10.921  6.160   1.00 0.89  ? 160 PHE A CZ   1 
ATOM   62   H H    . PHE A 1 5   ? -6.330  9.991   8.211   1.00 1.05  ? 160 PHE A H    1 
ATOM   63   H HA   . PHE A 1 5   ? -6.827  7.840   6.401   1.00 0.50  ? 160 PHE A HA   1 
ATOM   64   H HB2  . PHE A 1 5   ? -5.034  7.684   8.830   1.00 0.81  ? 160 PHE A HB2  1 
ATOM   65   H HB3  . PHE A 1 5   ? -4.870  6.804   7.314   1.00 0.59  ? 160 PHE A HB3  1 
ATOM   66   H HD1  . PHE A 1 5   ? -4.341  8.075   5.198   1.00 2.23  ? 160 PHE A HD1  1 
ATOM   67   H HD2  . PHE A 1 5   ? -4.119  9.872   9.090   1.00 2.25  ? 160 PHE A HD2  1 
ATOM   68   H HE1  . PHE A 1 5   ? -2.946  9.904   4.272   1.00 2.34  ? 160 PHE A HE1  1 
ATOM   69   H HE2  . PHE A 1 5   ? -2.720  11.700  8.167   1.00 2.28  ? 160 PHE A HE2  1 
ATOM   70   H HZ   . PHE A 1 5   ? -2.135  11.717  5.757   1.00 1.02  ? 160 PHE A HZ   1 
ATOM   71   N N    . LYS A 1 6   ? -8.099  6.071   7.631   1.00 0.31  ? 161 LYS A N    1 
ATOM   72   C CA   . LYS A 1 6   ? -8.938  5.097   8.378   1.00 0.35  ? 161 LYS A CA   1 
ATOM   73   C C    . LYS A 1 6   ? -8.032  4.198   9.224   1.00 0.32  ? 161 LYS A C    1 
ATOM   74   O O    . LYS A 1 6   ? -8.204  4.075   10.421  1.00 0.37  ? 161 LYS A O    1 
ATOM   75   C CB   . LYS A 1 6   ? -9.738  4.240   7.401   1.00 0.38  ? 161 LYS A CB   1 
ATOM   76   C CG   . LYS A 1 6   ? -11.079 3.888   8.043   1.00 0.56  ? 161 LYS A CG   1 
ATOM   77   C CD   . LYS A 1 6   ? -12.145 3.748   6.960   1.00 0.91  ? 161 LYS A CD   1 
ATOM   78   C CE   . LYS A 1 6   ? -12.542 2.278   6.828   1.00 0.87  ? 161 LYS A CE   1 
ATOM   79   N NZ   . LYS A 1 6   ? -13.858 2.178   6.137   1.00 1.38  ? 161 LYS A NZ   1 
ATOM   80   H H    . LYS A 1 6   ? -7.995  5.989   6.662   1.00 0.52  ? 161 LYS A H    1 
ATOM   81   H HA   . LYS A 1 6   ? -9.619  5.630   9.020   1.00 0.43  ? 161 LYS A HA   1 
ATOM   82   H HB2  . LYS A 1 6   ? -9.905  4.793   6.488   1.00 0.38  ? 161 LYS A HB2  1 
ATOM   83   H HB3  . LYS A 1 6   ? -9.195  3.333   7.184   1.00 0.40  ? 161 LYS A HB3  1 
ATOM   84   H HG2  . LYS A 1 6   ? -10.985 2.958   8.583   1.00 0.95  ? 161 LYS A HG2  1 
ATOM   85   H HG3  . LYS A 1 6   ? -11.366 4.673   8.728   1.00 0.99  ? 161 LYS A HG3  1 
ATOM   86   H HD2  . LYS A 1 6   ? -13.010 4.334   7.233   1.00 1.65  ? 161 LYS A HD2  1 
ATOM   87   H HD3  . LYS A 1 6   ? -11.753 4.100   6.019   1.00 1.57  ? 161 LYS A HD3  1 
ATOM   88   H HE2  . LYS A 1 6   ? -11.792 1.754   6.254   1.00 1.28  ? 161 LYS A HE2  1 
ATOM   89   H HE3  . LYS A 1 6   ? -12.616 1.836   7.811   1.00 1.43  ? 161 LYS A HE3  1 
ATOM   90   H HZ1  . LYS A 1 6   ? -14.465 2.970   6.429   1.00 1.80  ? 161 LYS A HZ1  1 
ATOM   91   H HZ2  . LYS A 1 6   ? -13.712 2.212   5.107   1.00 1.79  ? 161 LYS A HZ2  1 
ATOM   92   H HZ3  . LYS A 1 6   ? -14.317 1.281   6.393   1.00 1.90  ? 161 LYS A HZ3  1 
ATOM   93   N N    . GLU A 1 7   ? -7.067  3.571   8.609   1.00 0.28  ? 162 GLU A N    1 
ATOM   94   C CA   . GLU A 1 7   ? -6.145  2.680   9.369   1.00 0.26  ? 162 GLU A CA   1 
ATOM   95   C C    . GLU A 1 7   ? -4.700  3.144   9.160   1.00 0.23  ? 162 GLU A C    1 
ATOM   96   O O    . GLU A 1 7   ? -4.411  3.910   8.263   1.00 0.23  ? 162 GLU A O    1 
ATOM   97   C CB   . GLU A 1 7   ? -6.297  1.246   8.861   1.00 0.27  ? 162 GLU A CB   1 
ATOM   98   C CG   . GLU A 1 7   ? -7.375  0.529   9.675   1.00 0.35  ? 162 GLU A CG   1 
ATOM   99   C CD   . GLU A 1 7   ? -6.730  -0.575  10.516  1.00 0.39  ? 162 GLU A CD   1 
ATOM   100  O OE1  . GLU A 1 7   ? -5.581  -0.411  10.891  1.00 1.13  ? 162 GLU A OE1  1 
ATOM   101  O OE2  . GLU A 1 7   ? -7.395  -1.565  10.770  1.00 1.15  ? 162 GLU A OE2  1 
ATOM   102  H H    . GLU A 1 7   ? -6.947  3.687   7.643   1.00 0.31  ? 162 GLU A H    1 
ATOM   103  H HA   . GLU A 1 7   ? -6.389  2.720   10.420  1.00 0.27  ? 162 GLU A HA   1 
ATOM   104  H HB2  . GLU A 1 7   ? -6.584  1.263   7.819   1.00 0.30  ? 162 GLU A HB2  1 
ATOM   105  H HB3  . GLU A 1 7   ? -5.359  0.724   8.968   1.00 0.26  ? 162 GLU A HB3  1 
ATOM   106  H HG2  . GLU A 1 7   ? -7.865  1.238   10.326  1.00 0.45  ? 162 GLU A HG2  1 
ATOM   107  H HG3  . GLU A 1 7   ? -8.100  0.092   9.006   1.00 0.39  ? 162 GLU A HG3  1 
ATOM   108  N N    . VAL A 1 8   ? -3.789  2.688   9.979   1.00 0.24  ? 163 VAL A N    1 
ATOM   109  C CA   . VAL A 1 8   ? -2.366  3.108   9.818   1.00 0.24  ? 163 VAL A CA   1 
ATOM   110  C C    . VAL A 1 8   ? -1.437  1.984   10.282  1.00 0.22  ? 163 VAL A C    1 
ATOM   111  O O    . VAL A 1 8   ? -1.574  1.458   11.368  1.00 0.31  ? 163 VAL A O    1 
ATOM   112  C CB   . VAL A 1 8   ? -2.091  4.354   10.663  1.00 0.27  ? 163 VAL A CB   1 
ATOM   113  C CG1  . VAL A 1 8   ? -0.764  4.979   10.229  1.00 0.59  ? 163 VAL A CG1  1 
ATOM   114  C CG2  . VAL A 1 8   ? -3.216  5.372   10.471  1.00 0.58  ? 163 VAL A CG2  1 
ATOM   115  H H    . VAL A 1 8   ? -4.040  2.070   10.698  1.00 0.25  ? 163 VAL A H    1 
ATOM   116  H HA   . VAL A 1 8   ? -2.172  3.330   8.779   1.00 0.25  ? 163 VAL A HA   1 
ATOM   117  H HB   . VAL A 1 8   ? -2.030  4.072   11.703  1.00 0.50  ? 163 VAL A HB   1 
ATOM   118  H HG11 . VAL A 1 8   ? -0.776  5.144   9.161   1.00 1.20  ? 163 VAL A HG11 1 
ATOM   119  H HG12 . VAL A 1 8   ? -0.627  5.923   10.737  1.00 1.26  ? 163 VAL A HG12 1 
ATOM   120  H HG13 . VAL A 1 8   ? 0.048   4.313   10.481  1.00 1.17  ? 163 VAL A HG13 1 
ATOM   121  H HG21 . VAL A 1 8   ? -3.324  5.597   9.420   1.00 1.29  ? 163 VAL A HG21 1 
ATOM   122  H HG22 . VAL A 1 8   ? -4.141  4.962   10.848  1.00 1.17  ? 163 VAL A HG22 1 
ATOM   123  H HG23 . VAL A 1 8   ? -2.979  6.278   11.010  1.00 1.18  ? 163 VAL A HG23 1 
ATOM   124  N N    . TRP A 1 9   ? -0.490  1.616   9.465   1.00 0.17  ? 164 TRP A N    1 
ATOM   125  C CA   . TRP A 1 9   ? 0.456   0.530   9.854   1.00 0.17  ? 164 TRP A CA   1 
ATOM   126  C C    . TRP A 1 9   ? 1.894   1.042   9.757   1.00 0.18  ? 164 TRP A C    1 
ATOM   127  O O    . TRP A 1 9   ? 2.177   2.007   9.074   1.00 0.23  ? 164 TRP A O    1 
ATOM   128  C CB   . TRP A 1 9   ? 0.298   -0.660  8.906   1.00 0.17  ? 164 TRP A CB   1 
ATOM   129  C CG   . TRP A 1 9   ? -0.936  -1.425  9.249   1.00 0.17  ? 164 TRP A CG   1 
ATOM   130  C CD1  . TRP A 1 9   ? -1.022  -2.386  10.198  1.00 0.19  ? 164 TRP A CD1  1 
ATOM   131  C CD2  . TRP A 1 9   ? -2.259  -1.315  8.657   1.00 0.18  ? 164 TRP A CD2  1 
ATOM   132  N NE1  . TRP A 1 9   ? -2.317  -2.873  10.223  1.00 0.19  ? 164 TRP A NE1  1 
ATOM   133  C CE2  . TRP A 1 9   ? -3.118  -2.242  9.291   1.00 0.19  ? 164 TRP A CE2  1 
ATOM   134  C CE3  . TRP A 1 9   ? -2.789  -0.505  7.640   1.00 0.19  ? 164 TRP A CE3  1 
ATOM   135  C CZ2  . TRP A 1 9   ? -4.459  -2.362  8.926   1.00 0.20  ? 164 TRP A CZ2  1 
ATOM   136  C CZ3  . TRP A 1 9   ? -4.136  -0.621  7.271   1.00 0.22  ? 164 TRP A CZ3  1 
ATOM   137  C CH2  . TRP A 1 9   ? -4.971  -1.548  7.912   1.00 0.22  ? 164 TRP A CH2  1 
ATOM   138  H H    . TRP A 1 9   ? -0.399  2.057   8.596   1.00 0.19  ? 164 TRP A H    1 
ATOM   139  H HA   . TRP A 1 9   ? 0.251   0.215   10.867  1.00 0.17  ? 164 TRP A HA   1 
ATOM   140  H HB2  . TRP A 1 9   ? 0.226   -0.300  7.890   1.00 0.17  ? 164 TRP A HB2  1 
ATOM   141  H HB3  . TRP A 1 9   ? 1.159   -1.306  8.997   1.00 0.19  ? 164 TRP A HB3  1 
ATOM   142  H HD1  . TRP A 1 9   ? -0.213  -2.719  10.830  1.00 0.20  ? 164 TRP A HD1  1 
ATOM   143  H HE1  . TRP A 1 9   ? -2.645  -3.576  10.821  1.00 0.21  ? 164 TRP A HE1  1 
ATOM   144  H HE3  . TRP A 1 9   ? -2.155  0.212   7.139   1.00 0.20  ? 164 TRP A HE3  1 
ATOM   145  H HZ2  . TRP A 1 9   ? -5.097  -3.078  9.424   1.00 0.22  ? 164 TRP A HZ2  1 
ATOM   146  H HZ3  . TRP A 1 9   ? -4.530  0.008   6.491   1.00 0.24  ? 164 TRP A HZ3  1 
ATOM   147  H HH2  . TRP A 1 9   ? -6.008  -1.633  7.623   1.00 0.24  ? 164 TRP A HH2  1 
ATOM   148  N N    . GLN A 1 10  ? 2.807   0.396   10.428  1.00 0.17  ? 165 GLN A N    1 
ATOM   149  C CA   . GLN A 1 10  ? 4.230   0.835   10.368  1.00 0.19  ? 165 GLN A CA   1 
ATOM   150  C C    . GLN A 1 10  ? 5.067   -0.296  9.764   1.00 0.18  ? 165 GLN A C    1 
ATOM   151  O O    . GLN A 1 10  ? 5.160   -1.376  10.313  1.00 0.21  ? 165 GLN A O    1 
ATOM   152  C CB   . GLN A 1 10  ? 4.735   1.171   11.777  1.00 0.24  ? 165 GLN A CB   1 
ATOM   153  C CG   . GLN A 1 10  ? 4.703   -0.078  12.662  1.00 0.94  ? 165 GLN A CG   1 
ATOM   154  C CD   . GLN A 1 10  ? 4.349   0.320   14.095  1.00 1.27  ? 165 GLN A CD   1 
ATOM   155  O OE1  . GLN A 1 10  ? 3.438   1.093   14.316  1.00 1.69  ? 165 GLN A OE1  1 
ATOM   156  N NE2  . GLN A 1 10  ? 5.037   -0.178  15.086  1.00 1.81  ? 165 GLN A NE2  1 
ATOM   157  H H    . GLN A 1 10  ? 2.557   -0.384  10.965  1.00 0.19  ? 165 GLN A H    1 
ATOM   158  H HA   . GLN A 1 10  ? 4.307   1.711   9.739   1.00 0.20  ? 165 GLN A HA   1 
ATOM   159  H HB2  . GLN A 1 10  ? 5.749   1.540   11.715  1.00 0.71  ? 165 GLN A HB2  1 
ATOM   160  H HB3  . GLN A 1 10  ? 4.104   1.932   12.212  1.00 0.76  ? 165 GLN A HB3  1 
ATOM   161  H HG2  . GLN A 1 10  ? 3.963   -0.769  12.286  1.00 1.30  ? 165 GLN A HG2  1 
ATOM   162  H HG3  . GLN A 1 10  ? 5.674   -0.551  12.652  1.00 1.33  ? 165 GLN A HG3  1 
ATOM   163  H HE21 . GLN A 1 10  ? 5.772   -0.800  14.908  1.00 2.27  ? 165 GLN A HE21 1 
ATOM   164  H HE22 . GLN A 1 10  ? 4.818   0.072   16.008  1.00 2.05  ? 165 GLN A HE22 1 
ATOM   165  N N    . VAL A 1 11  ? 5.670   -0.065  8.630   1.00 0.19  ? 166 VAL A N    1 
ATOM   166  C CA   . VAL A 1 11  ? 6.487   -1.139  7.997   1.00 0.22  ? 166 VAL A CA   1 
ATOM   167  C C    . VAL A 1 11  ? 7.882   -0.616  7.652   1.00 0.21  ? 166 VAL A C    1 
ATOM   168  O O    . VAL A 1 11  ? 8.178   0.554   7.791   1.00 0.26  ? 166 VAL A O    1 
ATOM   169  C CB   . VAL A 1 11  ? 5.794   -1.612  6.719   1.00 0.28  ? 166 VAL A CB   1 
ATOM   170  C CG1  . VAL A 1 11  ? 4.456   -2.264  7.074   1.00 0.46  ? 166 VAL A CG1  1 
ATOM   171  C CG2  . VAL A 1 11  ? 5.548   -0.412  5.801   1.00 0.41  ? 166 VAL A CG2  1 
ATOM   172  H H    . VAL A 1 11  ? 5.580   0.809   8.193   1.00 0.21  ? 166 VAL A H    1 
ATOM   173  H HA   . VAL A 1 11  ? 6.580   -1.970  8.680   1.00 0.28  ? 166 VAL A HA   1 
ATOM   174  H HB   . VAL A 1 11  ? 6.422   -2.332  6.214   1.00 0.40  ? 166 VAL A HB   1 
ATOM   175  H HG11 . VAL A 1 11  ? 4.579   -2.882  7.950   1.00 1.15  ? 166 VAL A HG11 1 
ATOM   176  H HG12 . VAL A 1 11  ? 3.724   -1.496  7.274   1.00 1.13  ? 166 VAL A HG12 1 
ATOM   177  H HG13 . VAL A 1 11  ? 4.122   -2.873  6.247   1.00 1.15  ? 166 VAL A HG13 1 
ATOM   178  H HG21 . VAL A 1 11  ? 4.998   0.346   6.339   1.00 1.15  ? 166 VAL A HG21 1 
ATOM   179  H HG22 . VAL A 1 11  ? 6.495   -0.007  5.477   1.00 1.17  ? 166 VAL A HG22 1 
ATOM   180  H HG23 . VAL A 1 11  ? 4.978   -0.727  4.941   1.00 1.04  ? 166 VAL A HG23 1 
ATOM   181  N N    . ILE A 1 12  ? 8.737   -1.490  7.197   1.00 0.21  ? 167 ILE A N    1 
ATOM   182  C CA   . ILE A 1 12  ? 10.117  -1.085  6.829   1.00 0.22  ? 167 ILE A CA   1 
ATOM   183  C C    . ILE A 1 12  ? 10.325  -1.380  5.349   1.00 0.22  ? 167 ILE A C    1 
ATOM   184  O O    . ILE A 1 12  ? 10.463  -2.517  4.953   1.00 0.24  ? 167 ILE A O    1 
ATOM   185  C CB   . ILE A 1 12  ? 11.122  -1.889  7.654   1.00 0.27  ? 167 ILE A CB   1 
ATOM   186  C CG1  . ILE A 1 12  ? 10.549  -2.145  9.049   1.00 0.38  ? 167 ILE A CG1  1 
ATOM   187  C CG2  . ILE A 1 12  ? 12.429  -1.105  7.777   1.00 0.41  ? 167 ILE A CG2  1 
ATOM   188  C CD1  . ILE A 1 12  ? 10.130  -0.818  9.682   1.00 0.38  ? 167 ILE A CD1  1 
ATOM   189  H H    . ILE A 1 12  ? 8.466   -2.421  7.094   1.00 0.25  ? 167 ILE A H    1 
ATOM   190  H HA   . ILE A 1 12  ? 10.252  -0.029  7.014   1.00 0.23  ? 167 ILE A HA   1 
ATOM   191  H HB   . ILE A 1 12  ? 11.312  -2.832  7.164   1.00 0.30  ? 167 ILE A HB   1 
ATOM   192  H HG12 . ILE A 1 12  ? 9.689   -2.795  8.970   1.00 0.55  ? 167 ILE A HG12 1 
ATOM   193  H HG13 . ILE A 1 12  ? 11.301  -2.615  9.666   1.00 0.56  ? 167 ILE A HG13 1 
ATOM   194  H HG21 . ILE A 1 12  ? 12.214  -0.095  8.091   1.00 1.05  ? 167 ILE A HG21 1 
ATOM   195  H HG22 . ILE A 1 12  ? 13.067  -1.582  8.506   1.00 1.16  ? 167 ILE A HG22 1 
ATOM   196  H HG23 . ILE A 1 12  ? 12.929  -1.086  6.819   1.00 1.13  ? 167 ILE A HG23 1 
ATOM   197  H HD11 . ILE A 1 12  ? 10.410  -0.003  9.031   1.00 1.05  ? 167 ILE A HD11 1 
ATOM   198  H HD12 . ILE A 1 12  ? 9.061   -0.812  9.827   1.00 1.16  ? 167 ILE A HD12 1 
ATOM   199  H HD13 . ILE A 1 12  ? 10.624  -0.704  10.634  1.00 1.06  ? 167 ILE A HD13 1 
ATOM   200  N N    . LEU A 1 13  ? 10.337  -0.361  4.537   1.00 0.22  ? 168 LEU A N    1 
ATOM   201  C CA   . LEU A 1 13  ? 10.524  -0.556  3.066   1.00 0.23  ? 168 LEU A CA   1 
ATOM   202  C C    . LEU A 1 13  ? 11.660  -1.545  2.790   1.00 0.25  ? 168 LEU A C    1 
ATOM   203  O O    . LEU A 1 13  ? 12.530  -1.761  3.611   1.00 0.42  ? 168 LEU A O    1 
ATOM   204  C CB   . LEU A 1 13  ? 10.855  0.782   2.400   1.00 0.31  ? 168 LEU A CB   1 
ATOM   205  C CG   . LEU A 1 13  ? 9.577   1.487   1.924   1.00 0.36  ? 168 LEU A CG   1 
ATOM   206  C CD1  . LEU A 1 13  ? 9.191   0.955   0.544   1.00 0.42  ? 168 LEU A CD1  1 
ATOM   207  C CD2  . LEU A 1 13  ? 8.426   1.237   2.905   1.00 0.74  ? 168 LEU A CD2  1 
ATOM   208  H H    . LEU A 1 13  ? 10.215  0.539   4.900   1.00 0.23  ? 168 LEU A H    1 
ATOM   209  H HA   . LEU A 1 13  ? 9.612   -0.951  2.645   1.00 0.23  ? 168 LEU A HA   1 
ATOM   210  H HB2  . LEU A 1 13  ? 11.369  1.416   3.107   1.00 0.35  ? 168 LEU A HB2  1 
ATOM   211  H HB3  . LEU A 1 13  ? 11.495  0.602   1.551   1.00 0.34  ? 168 LEU A HB3  1 
ATOM   212  H HG   . LEU A 1 13  ? 9.764   2.549   1.853   1.00 0.61  ? 168 LEU A HG   1 
ATOM   213  H HD11 . LEU A 1 13  ? 9.751   0.056   0.335   1.00 1.14  ? 168 LEU A HD11 1 
ATOM   214  H HD12 . LEU A 1 13  ? 8.134   0.735   0.525   1.00 1.09  ? 168 LEU A HD12 1 
ATOM   215  H HD13 . LEU A 1 13  ? 9.416   1.701   -0.205  1.00 1.17  ? 168 LEU A HD13 1 
ATOM   216  H HD21 . LEU A 1 13  ? 8.771   1.395   3.914   1.00 1.32  ? 168 LEU A HD21 1 
ATOM   217  H HD22 . LEU A 1 13  ? 7.621   1.924   2.692   1.00 1.25  ? 168 LEU A HD22 1 
ATOM   218  H HD23 . LEU A 1 13  ? 8.069   0.225   2.799   1.00 1.35  ? 168 LEU A HD23 1 
ATOM   219  N N    . LYS A 1 14  ? 11.648  -2.146  1.634   1.00 0.22  ? 169 LYS A N    1 
ATOM   220  C CA   . LYS A 1 14  ? 12.707  -3.127  1.278   1.00 0.25  ? 169 LYS A CA   1 
ATOM   221  C C    . LYS A 1 14  ? 13.231  -2.784  -0.129  1.00 0.28  ? 169 LYS A C    1 
ATOM   222  O O    . LYS A 1 14  ? 12.447  -2.494  -1.011  1.00 0.48  ? 169 LYS A O    1 
ATOM   223  C CB   . LYS A 1 14  ? 12.087  -4.532  1.279   1.00 0.29  ? 169 LYS A CB   1 
ATOM   224  C CG   . LYS A 1 14  ? 13.115  -5.584  1.720   1.00 0.72  ? 169 LYS A CG   1 
ATOM   225  C CD   . LYS A 1 14  ? 13.625  -5.290  3.137   1.00 0.83  ? 169 LYS A CD   1 
ATOM   226  C CE   . LYS A 1 14  ? 12.445  -4.985  4.061   1.00 0.76  ? 169 LYS A CE   1 
ATOM   227  N NZ   . LYS A 1 14  ? 12.892  -5.069  5.481   1.00 0.97  ? 169 LYS A NZ   1 
ATOM   228  H H    . LYS A 1 14  ? 10.933  -1.953  0.996   1.00 0.33  ? 169 LYS A H    1 
ATOM   229  H HA   . LYS A 1 14  ? 13.498  -3.072  2.003   1.00 0.27  ? 169 LYS A HA   1 
ATOM   230  H HB2  . LYS A 1 14  ? 11.243  -4.550  1.952   1.00 0.68  ? 169 LYS A HB2  1 
ATOM   231  H HB3  . LYS A 1 14  ? 11.746  -4.768  0.283   1.00 0.72  ? 169 LYS A HB3  1 
ATOM   232  H HG2  . LYS A 1 14  ? 12.652  -6.560  1.706   1.00 1.23  ? 169 LYS A HG2  1 
ATOM   233  H HG3  . LYS A 1 14  ? 13.943  -5.578  1.035   1.00 1.23  ? 169 LYS A HG3  1 
ATOM   234  H HD2  . LYS A 1 14  ? 14.156  -6.154  3.510   1.00 1.54  ? 169 LYS A HD2  1 
ATOM   235  H HD3  . LYS A 1 14  ? 14.294  -4.444  3.116   1.00 1.42  ? 169 LYS A HD3  1 
ATOM   236  H HE2  . LYS A 1 14  ? 12.077  -3.991  3.858   1.00 1.17  ? 169 LYS A HE2  1 
ATOM   237  H HE3  . LYS A 1 14  ? 11.658  -5.702  3.888   1.00 1.31  ? 169 LYS A HE3  1 
ATOM   238  H HZ1  . LYS A 1 14  ? 13.889  -4.786  5.548   1.00 1.46  ? 169 LYS A HZ1  1 
ATOM   239  H HZ2  . LYS A 1 14  ? 12.310  -4.435  6.065   1.00 1.35  ? 169 LYS A HZ2  1 
ATOM   240  H HZ3  . LYS A 1 14  ? 12.788  -6.046  5.820   1.00 1.38  ? 169 LYS A HZ3  1 
ATOM   241  N N    . PRO A 1 15  ? 14.534  -2.816  -0.310  1.00 0.28  ? 170 PRO A N    1 
ATOM   242  C CA   . PRO A 1 15  ? 15.157  -2.500  -1.604  1.00 0.33  ? 170 PRO A CA   1 
ATOM   243  C C    . PRO A 1 15  ? 14.896  -3.618  -2.619  1.00 0.30  ? 170 PRO A C    1 
ATOM   244  O O    . PRO A 1 15  ? 15.663  -4.552  -2.739  1.00 0.39  ? 170 PRO A O    1 
ATOM   245  C CB   . PRO A 1 15  ? 16.650  -2.370  -1.327  1.00 0.44  ? 170 PRO A CB   1 
ATOM   246  C CG   . PRO A 1 15  ? 16.843  -3.229  -0.054  1.00 0.82  ? 170 PRO A CG   1 
ATOM   247  C CD   . PRO A 1 15  ? 15.517  -3.166  0.742   1.00 0.52  ? 170 PRO A CD   1 
ATOM   248  H HA   . PRO A 1 15  ? 14.776  -1.564  -1.980  1.00 0.35  ? 170 PRO A HA   1 
ATOM   249  H HB2  . PRO A 1 15  ? 17.226  -2.766  -2.154  1.00 0.66  ? 170 PRO A HB2  1 
ATOM   250  H HB3  . PRO A 1 15  ? 16.916  -1.345  -1.126  1.00 0.60  ? 170 PRO A HB3  1 
ATOM   251  H HG2  . PRO A 1 15  ? 17.064  -4.251  -0.329  1.00 1.25  ? 170 PRO A HG2  1 
ATOM   252  H HG3  . PRO A 1 15  ? 17.645  -2.825  0.545   1.00 1.20  ? 170 PRO A HG3  1 
ATOM   253  H HD2  . PRO A 1 15  ? 15.290  -4.127  1.183   1.00 0.61  ? 170 PRO A HD2  1 
ATOM   254  H HD3  . PRO A 1 15  ? 15.554  -2.393  1.493   1.00 0.58  ? 170 PRO A HD3  1 
ATOM   255  N N    . LYS A 1 16  ? 13.819  -3.526  -3.355  1.00 0.26  ? 171 LYS A N    1 
ATOM   256  C CA   . LYS A 1 16  ? 13.509  -4.578  -4.365  1.00 0.31  ? 171 LYS A CA   1 
ATOM   257  C C    . LYS A 1 16  ? 13.574  -3.980  -5.773  1.00 0.39  ? 171 LYS A C    1 
ATOM   258  O O    . LYS A 1 16  ? 14.423  -4.332  -6.567  1.00 0.74  ? 171 LYS A O    1 
ATOM   259  C CB   . LYS A 1 16  ? 12.105  -5.134  -4.118  1.00 0.31  ? 171 LYS A CB   1 
ATOM   260  C CG   . LYS A 1 16  ? 12.183  -6.338  -3.184  1.00 0.35  ? 171 LYS A CG   1 
ATOM   261  C CD   . LYS A 1 16  ? 12.568  -5.869  -1.787  1.00 0.72  ? 171 LYS A CD   1 
ATOM   262  C CE   . LYS A 1 16  ? 13.992  -6.321  -1.481  1.00 0.35  ? 171 LYS A CE   1 
ATOM   263  N NZ   . LYS A 1 16  ? 13.957  -7.610  -0.733  1.00 0.51  ? 171 LYS A NZ   1 
ATOM   264  H H    . LYS A 1 16  ? 13.216  -2.762  -3.244  1.00 0.26  ? 171 LYS A H    1 
ATOM   265  H HA   . LYS A 1 16  ? 14.231  -5.378  -4.282  1.00 0.34  ? 171 LYS A HA   1 
ATOM   266  H HB2  . LYS A 1 16  ? 11.489  -4.369  -3.668  1.00 0.41  ? 171 LYS A HB2  1 
ATOM   267  H HB3  . LYS A 1 16  ? 11.670  -5.440  -5.051  1.00 0.48  ? 171 LYS A HB3  1 
ATOM   268  H HG2  . LYS A 1 16  ? 11.222  -6.829  -3.149  1.00 0.99  ? 171 LYS A HG2  1 
ATOM   269  H HG3  . LYS A 1 16  ? 12.929  -7.028  -3.548  1.00 0.88  ? 171 LYS A HG3  1 
ATOM   270  H HD2  . LYS A 1 16  ? 12.511  -4.791  -1.740  1.00 1.33  ? 171 LYS A HD2  1 
ATOM   271  H HD3  . LYS A 1 16  ? 11.891  -6.298  -1.068  1.00 1.40  ? 171 LYS A HD3  1 
ATOM   272  H HE2  . LYS A 1 16  ? 14.530  -6.458  -2.408  1.00 0.44  ? 171 LYS A HE2  1 
ATOM   273  H HE3  . LYS A 1 16  ? 14.487  -5.570  -0.885  1.00 0.39  ? 171 LYS A HE3  1 
ATOM   274  H HZ1  . LYS A 1 16  ? 13.064  -8.103  -0.933  1.00 1.05  ? 171 LYS A HZ1  1 
ATOM   275  H HZ2  . LYS A 1 16  ? 14.754  -8.207  -1.031  1.00 1.16  ? 171 LYS A HZ2  1 
ATOM   276  H HZ3  . LYS A 1 16  ? 14.028  -7.420  0.288   1.00 1.15  ? 171 LYS A HZ3  1 
ATOM   277  N N    . GLY A 1 17  ? 12.681  -3.081  -6.093  1.00 0.35  ? 172 GLY A N    1 
ATOM   278  C CA   . GLY A 1 17  ? 12.697  -2.472  -7.454  1.00 0.38  ? 172 GLY A CA   1 
ATOM   279  C C    . GLY A 1 17  ? 12.455  -0.963  -7.359  1.00 0.32  ? 172 GLY A C    1 
ATOM   280  O O    . GLY A 1 17  ? 13.382  -0.177  -7.377  1.00 0.32  ? 172 GLY A O    1 
ATOM   281  H H    . GLY A 1 17  ? 12.001  -2.811  -5.441  1.00 0.57  ? 172 GLY A H    1 
ATOM   282  H HA2  . GLY A 1 17  ? 13.656  -2.654  -7.916  1.00 0.43  ? 172 GLY A HA2  1 
ATOM   283  H HA3  . GLY A 1 17  ? 11.919  -2.918  -8.054  1.00 0.42  ? 172 GLY A HA3  1 
ATOM   284  N N    . LEU A 1 18  ? 11.218  -0.553  -7.264  1.00 0.31  ? 173 LEU A N    1 
ATOM   285  C CA   . LEU A 1 18  ? 10.917  0.906   -7.174  1.00 0.28  ? 173 LEU A CA   1 
ATOM   286  C C    . LEU A 1 18  ? 11.726  1.537   -6.039  1.00 0.27  ? 173 LEU A C    1 
ATOM   287  O O    . LEU A 1 18  ? 12.072  2.699   -6.089  1.00 0.29  ? 173 LEU A O    1 
ATOM   288  C CB   . LEU A 1 18  ? 9.423   1.111   -6.909  1.00 0.28  ? 173 LEU A CB   1 
ATOM   289  C CG   . LEU A 1 18  ? 8.671   1.228   -8.238  1.00 0.30  ? 173 LEU A CG   1 
ATOM   290  C CD1  . LEU A 1 18  ? 7.169   1.331   -7.968  1.00 0.33  ? 173 LEU A CD1  1 
ATOM   291  C CD2  . LEU A 1 18  ? 9.138   2.483   -8.980  1.00 0.34  ? 173 LEU A CD2  1 
ATOM   292  H H    . LEU A 1 18  ? 10.486  -1.205  -7.256  1.00 0.34  ? 173 LEU A H    1 
ATOM   293  H HA   . LEU A 1 18  ? 11.184  1.381   -8.106  1.00 0.29  ? 173 LEU A HA   1 
ATOM   294  H HB2  . LEU A 1 18  ? 9.038   0.268   -6.351  1.00 0.30  ? 173 LEU A HB2  1 
ATOM   295  H HB3  . LEU A 1 18  ? 9.280   2.015   -6.336  1.00 0.28  ? 173 LEU A HB3  1 
ATOM   296  H HG   . LEU A 1 18  ? 8.870   0.355   -8.842  1.00 0.31  ? 173 LEU A HG   1 
ATOM   297  H HD11 . LEU A 1 18  ? 6.920   0.752   -7.091  1.00 1.07  ? 173 LEU A HD11 1 
ATOM   298  H HD12 . LEU A 1 18  ? 6.903   2.365   -7.803  1.00 1.11  ? 173 LEU A HD12 1 
ATOM   299  H HD13 . LEU A 1 18  ? 6.623   0.951   -8.818  1.00 1.02  ? 173 LEU A HD13 1 
ATOM   300  H HD21 . LEU A 1 18  ? 9.876   3.000   -8.384  1.00 1.02  ? 173 LEU A HD21 1 
ATOM   301  H HD22 . LEU A 1 18  ? 9.574   2.201   -9.927  1.00 1.16  ? 173 LEU A HD22 1 
ATOM   302  H HD23 . LEU A 1 18  ? 8.294   3.135   -9.152  1.00 1.02  ? 173 LEU A HD23 1 
ATOM   303  N N    . GLY A 1 19  ? 12.030  0.785   -5.018  1.00 0.27  ? 174 GLY A N    1 
ATOM   304  C CA   . GLY A 1 19  ? 12.816  1.351   -3.885  1.00 0.29  ? 174 GLY A CA   1 
ATOM   305  C C    . GLY A 1 19  ? 14.311  1.152   -4.145  1.00 0.33  ? 174 GLY A C    1 
ATOM   306  O O    . GLY A 1 19  ? 15.035  0.649   -3.310  1.00 0.40  ? 174 GLY A O    1 
ATOM   307  H H    . GLY A 1 19  ? 11.743  -0.150  -4.994  1.00 0.29  ? 174 GLY A H    1 
ATOM   308  H HA2  . GLY A 1 19  ? 12.606  2.407   -3.797  1.00 0.30  ? 174 GLY A HA2  1 
ATOM   309  H HA3  . GLY A 1 19  ? 12.541  0.851   -2.970  1.00 0.31  ? 174 GLY A HA3  1 
ATOM   310  N N    . GLN A 1 20  ? 14.776  1.546   -5.298  1.00 0.36  ? 175 GLN A N    1 
ATOM   311  C CA   . GLN A 1 20  ? 16.220  1.386   -5.620  1.00 0.41  ? 175 GLN A CA   1 
ATOM   312  C C    . GLN A 1 20  ? 16.648  2.502   -6.576  1.00 0.43  ? 175 GLN A C    1 
ATOM   313  O O    . GLN A 1 20  ? 17.679  3.120   -6.401  1.00 0.48  ? 175 GLN A O    1 
ATOM   314  C CB   . GLN A 1 20  ? 16.443  0.029   -6.285  1.00 0.49  ? 175 GLN A CB   1 
ATOM   315  C CG   . GLN A 1 20  ? 17.847  -0.478  -5.949  1.00 0.56  ? 175 GLN A CG   1 
ATOM   316  C CD   . GLN A 1 20  ? 18.219  -1.622  -6.894  1.00 0.93  ? 175 GLN A CD   1 
ATOM   317  O OE1  . GLN A 1 20  ? 18.040  -1.518  -8.092  1.00 1.79  ? 175 GLN A OE1  1 
ATOM   318  N NE2  . GLN A 1 20  ? 18.734  -2.716  -6.404  1.00 1.40  ? 175 GLN A NE2  1 
ATOM   319  H H    . GLN A 1 20  ? 14.174  1.949   -5.954  1.00 0.39  ? 175 GLN A H    1 
ATOM   320  H HA   . GLN A 1 20  ? 16.801  1.444   -4.712  1.00 0.42  ? 175 GLN A HA   1 
ATOM   321  H HB2  . GLN A 1 20  ? 15.707  -0.673  -5.921  1.00 0.52  ? 175 GLN A HB2  1 
ATOM   322  H HB3  . GLN A 1 20  ? 16.345  0.131   -7.355  1.00 0.52  ? 175 GLN A HB3  1 
ATOM   323  H HG2  . GLN A 1 20  ? 18.556  0.329   -6.061  1.00 0.87  ? 175 GLN A HG2  1 
ATOM   324  H HG3  . GLN A 1 20  ? 17.866  -0.835  -4.930  1.00 1.04  ? 175 GLN A HG3  1 
ATOM   325  H HE21 . GLN A 1 20  ? 18.879  -2.799  -5.438  1.00 1.86  ? 175 GLN A HE21 1 
ATOM   326  H HE22 . GLN A 1 20  ? 18.977  -3.454  -7.001  1.00 1.81  ? 175 GLN A HE22 1 
ATOM   327  N N    . THR A 1 21  ? 15.861  2.766   -7.585  1.00 0.45  ? 176 THR A N    1 
ATOM   328  C CA   . THR A 1 21  ? 16.221  3.843   -8.549  1.00 0.53  ? 176 THR A CA   1 
ATOM   329  C C    . THR A 1 21  ? 15.715  5.182   -8.012  1.00 0.47  ? 176 THR A C    1 
ATOM   330  O O    . THR A 1 21  ? 16.366  6.200   -8.139  1.00 0.54  ? 176 THR A O    1 
ATOM   331  C CB   . THR A 1 21  ? 15.568  3.557   -9.904  1.00 0.63  ? 176 THR A CB   1 
ATOM   332  O OG1  . THR A 1 21  ? 16.423  2.721   -10.671 1.00 1.11  ? 176 THR A OG1  1 
ATOM   333  C CG2  . THR A 1 21  ? 15.333  4.872   -10.649 1.00 0.92  ? 176 THR A CG2  1 
ATOM   334  H H    . THR A 1 21  ? 15.033  2.257   -7.708  1.00 0.44  ? 176 THR A H    1 
ATOM   335  H HA   . THR A 1 21  ? 17.294  3.882   -8.665  1.00 0.61  ? 176 THR A HA   1 
ATOM   336  H HB   . THR A 1 21  ? 14.622  3.061   -9.750  1.00 0.73  ? 176 THR A HB   1 
ATOM   337  H HG1  . THR A 1 21  ? 15.935  2.428   -11.444 1.00 1.52  ? 176 THR A HG1  1 
ATOM   338  H HG21 . THR A 1 21  ? 16.226  5.477   -10.600 1.00 1.47  ? 176 THR A HG21 1 
ATOM   339  H HG22 . THR A 1 21  ? 15.096  4.663   -11.681 1.00 1.42  ? 176 THR A HG22 1 
ATOM   340  H HG23 . THR A 1 21  ? 14.512  5.404   -10.191 1.00 1.46  ? 176 THR A HG23 1 
ATOM   341  N N    . LYS A 1 22  ? 14.558  5.187   -7.410  1.00 0.38  ? 177 LYS A N    1 
ATOM   342  C CA   . LYS A 1 22  ? 14.007  6.456   -6.859  1.00 0.38  ? 177 LYS A CA   1 
ATOM   343  C C    . LYS A 1 22  ? 14.481  6.654   -5.410  1.00 0.37  ? 177 LYS A C    1 
ATOM   344  O O    . LYS A 1 22  ? 14.208  7.669   -4.800  1.00 0.41  ? 177 LYS A O    1 
ATOM   345  C CB   . LYS A 1 22  ? 12.481  6.399   -6.893  1.00 0.37  ? 177 LYS A CB   1 
ATOM   346  C CG   . LYS A 1 22  ? 11.991  6.738   -8.302  1.00 0.46  ? 177 LYS A CG   1 
ATOM   347  C CD   . LYS A 1 22  ? 11.175  8.032   -8.262  1.00 0.57  ? 177 LYS A CD   1 
ATOM   348  C CE   . LYS A 1 22  ? 9.694   7.696   -8.081  1.00 0.59  ? 177 LYS A CE   1 
ATOM   349  N NZ   . LYS A 1 22  ? 8.863   8.737   -8.749  1.00 0.87  ? 177 LYS A NZ   1 
ATOM   350  H H    . LYS A 1 22  ? 14.051  4.353   -7.316  1.00 0.38  ? 177 LYS A H    1 
ATOM   351  H HA   . LYS A 1 22  ? 14.347  7.285   -7.462  1.00 0.44  ? 177 LYS A HA   1 
ATOM   352  H HB2  . LYS A 1 22  ? 12.154  5.404   -6.628  1.00 0.33  ? 177 LYS A HB2  1 
ATOM   353  H HB3  . LYS A 1 22  ? 12.076  7.112   -6.191  1.00 0.42  ? 177 LYS A HB3  1 
ATOM   354  H HG2  . LYS A 1 22  ? 12.841  6.867   -8.957  1.00 0.57  ? 177 LYS A HG2  1 
ATOM   355  H HG3  . LYS A 1 22  ? 11.370  5.935   -8.670  1.00 0.48  ? 177 LYS A HG3  1 
ATOM   356  H HD2  . LYS A 1 22  ? 11.511  8.644   -7.437  1.00 0.60  ? 177 LYS A HD2  1 
ATOM   357  H HD3  . LYS A 1 22  ? 11.309  8.570   -9.188  1.00 0.72  ? 177 LYS A HD3  1 
ATOM   358  H HE2  . LYS A 1 22  ? 9.487   6.732   -8.521  1.00 0.57  ? 177 LYS A HE2  1 
ATOM   359  H HE3  . LYS A 1 22  ? 9.458   7.669   -7.027  1.00 0.57  ? 177 LYS A HE3  1 
ATOM   360  H HZ1  . LYS A 1 22  ? 9.477   9.363   -9.310  1.00 1.35  ? 177 LYS A HZ1  1 
ATOM   361  H HZ2  . LYS A 1 22  ? 8.169   8.279   -9.374  1.00 1.34  ? 177 LYS A HZ2  1 
ATOM   362  H HZ3  . LYS A 1 22  ? 8.361   9.296   -8.030  1.00 1.38  ? 177 LYS A HZ3  1 
ATOM   363  N N    . ASN A 1 23  ? 15.190  5.700   -4.854  1.00 0.37  ? 178 ASN A N    1 
ATOM   364  C CA   . ASN A 1 23  ? 15.680  5.841   -3.453  1.00 0.38  ? 178 ASN A CA   1 
ATOM   365  C C    . ASN A 1 23  ? 14.504  5.802   -2.473  1.00 0.33  ? 178 ASN A C    1 
ATOM   366  O O    . ASN A 1 23  ? 14.394  6.633   -1.594  1.00 0.38  ? 178 ASN A O    1 
ATOM   367  C CB   . ASN A 1 23  ? 16.428  7.168   -3.301  1.00 0.47  ? 178 ASN A CB   1 
ATOM   368  C CG   . ASN A 1 23  ? 17.676  6.954   -2.442  1.00 1.16  ? 178 ASN A CG   1 
ATOM   369  O OD1  . ASN A 1 23  ? 18.289  5.907   -2.490  1.00 1.97  ? 178 ASN A OD1  1 
ATOM   370  N ND2  . ASN A 1 23  ? 18.080  7.911   -1.652  1.00 1.75  ? 178 ASN A ND2  1 
ATOM   371  H H    . ASN A 1 23  ? 15.404  4.889   -5.357  1.00 0.38  ? 178 ASN A H    1 
ATOM   372  H HA   . ASN A 1 23  ? 16.353  5.027   -3.230  1.00 0.40  ? 178 ASN A HA   1 
ATOM   373  H HB2  . ASN A 1 23  ? 16.719  7.530   -4.277  1.00 0.79  ? 178 ASN A HB2  1 
ATOM   374  H HB3  . ASN A 1 23  ? 15.785  7.892   -2.825  1.00 0.84  ? 178 ASN A HB3  1 
ATOM   375  H HD21 . ASN A 1 23  ? 17.585  8.756   -1.612  1.00 2.12  ? 178 ASN A HD21 1 
ATOM   376  H HD22 . ASN A 1 23  ? 18.878  7.784   -1.097  1.00 2.27  ? 178 ASN A HD22 1 
ATOM   377  N N    . LEU A 1 24  ? 13.627  4.843   -2.606  1.00 0.28  ? 179 LEU A N    1 
ATOM   378  C CA   . LEU A 1 24  ? 12.473  4.765   -1.666  1.00 0.27  ? 179 LEU A CA   1 
ATOM   379  C C    . LEU A 1 24  ? 12.698  3.607   -0.695  1.00 0.27  ? 179 LEU A C    1 
ATOM   380  O O    . LEU A 1 24  ? 12.318  2.482   -0.954  1.00 0.30  ? 179 LEU A O    1 
ATOM   381  C CB   . LEU A 1 24  ? 11.177  4.535   -2.445  1.00 0.30  ? 179 LEU A CB   1 
ATOM   382  C CG   . LEU A 1 24  ? 10.911  5.729   -3.362  1.00 0.32  ? 179 LEU A CG   1 
ATOM   383  C CD1  . LEU A 1 24  ? 10.519  5.227   -4.752  1.00 0.34  ? 179 LEU A CD1  1 
ATOM   384  C CD2  . LEU A 1 24  ? 9.771   6.570   -2.786  1.00 0.39  ? 179 LEU A CD2  1 
ATOM   385  H H    . LEU A 1 24  ? 13.730  4.173   -3.317  1.00 0.28  ? 179 LEU A H    1 
ATOM   386  H HA   . LEU A 1 24  ? 12.399  5.688   -1.111  1.00 0.30  ? 179 LEU A HA   1 
ATOM   387  H HB2  . LEU A 1 24  ? 11.266  3.637   -3.038  1.00 0.30  ? 179 LEU A HB2  1 
ATOM   388  H HB3  . LEU A 1 24  ? 10.358  4.428   -1.751  1.00 0.34  ? 179 LEU A HB3  1 
ATOM   389  H HG   . LEU A 1 24  ? 11.805  6.331   -3.436  1.00 0.34  ? 179 LEU A HG   1 
ATOM   390  H HD11 . LEU A 1 24  ? 11.251  4.512   -5.094  1.00 1.07  ? 179 LEU A HD11 1 
ATOM   391  H HD12 . LEU A 1 24  ? 9.549   4.754   -4.703  1.00 1.05  ? 179 LEU A HD12 1 
ATOM   392  H HD13 . LEU A 1 24  ? 10.480  6.059   -5.438  1.00 1.07  ? 179 LEU A HD13 1 
ATOM   393  H HD21 . LEU A 1 24  ? 9.602   6.290   -1.757  1.00 1.10  ? 179 LEU A HD21 1 
ATOM   394  H HD22 . LEU A 1 24  ? 10.034  7.616   -2.837  1.00 1.14  ? 179 LEU A HD22 1 
ATOM   395  H HD23 . LEU A 1 24  ? 8.872   6.397   -3.359  1.00 1.01  ? 179 LEU A HD23 1 
ATOM   396  N N    . ILE A 1 25  ? 13.315  3.874   0.422   1.00 0.28  ? 180 ILE A N    1 
ATOM   397  C CA   . ILE A 1 25  ? 13.569  2.791   1.413   1.00 0.30  ? 180 ILE A CA   1 
ATOM   398  C C    . ILE A 1 25  ? 13.689  3.394   2.815   1.00 0.29  ? 180 ILE A C    1 
ATOM   399  O O    . ILE A 1 25  ? 13.780  4.594   2.980   1.00 0.34  ? 180 ILE A O    1 
ATOM   400  C CB   . ILE A 1 25  ? 14.868  2.065   1.055   1.00 0.36  ? 180 ILE A CB   1 
ATOM   401  C CG1  . ILE A 1 25  ? 15.981  3.090   0.827   1.00 0.47  ? 180 ILE A CG1  1 
ATOM   402  C CG2  . ILE A 1 25  ? 14.661  1.249   -0.223  1.00 0.47  ? 180 ILE A CG2  1 
ATOM   403  C CD1  . ILE A 1 25  ? 17.342  2.410   0.988   1.00 0.56  ? 180 ILE A CD1  1 
ATOM   404  H H    . ILE A 1 25  ? 13.612  4.788   0.608   1.00 0.28  ? 180 ILE A H    1 
ATOM   405  H HA   . ILE A 1 25  ? 12.751  2.091   1.393   1.00 0.32  ? 180 ILE A HA   1 
ATOM   406  H HB   . ILE A 1 25  ? 15.145  1.404   1.863   1.00 0.39  ? 180 ILE A HB   1 
ATOM   407  H HG12 . ILE A 1 25  ? 15.896  3.497   -0.171  1.00 0.61  ? 180 ILE A HG12 1 
ATOM   408  H HG13 . ILE A 1 25  ? 15.891  3.887   1.549   1.00 0.58  ? 180 ILE A HG13 1 
ATOM   409  H HG21 . ILE A 1 25  ? 13.794  0.615   -0.108  1.00 1.18  ? 180 ILE A HG21 1 
ATOM   410  H HG22 . ILE A 1 25  ? 14.510  1.918   -1.057  1.00 1.09  ? 180 ILE A HG22 1 
ATOM   411  H HG23 . ILE A 1 25  ? 15.532  0.638   -0.405  1.00 1.12  ? 180 ILE A HG23 1 
ATOM   412  H HD11 . ILE A 1 25  ? 17.298  1.414   0.573   1.00 1.09  ? 180 ILE A HD11 1 
ATOM   413  H HD12 . ILE A 1 25  ? 18.095  2.984   0.468   1.00 1.15  ? 180 ILE A HD12 1 
ATOM   414  H HD13 . ILE A 1 25  ? 17.593  2.352   2.037   1.00 1.29  ? 180 ILE A HD13 1 
ATOM   415  N N    . GLY A 1 26  ? 13.688  2.568   3.826   1.00 0.28  ? 181 GLY A N    1 
ATOM   416  C CA   . GLY A 1 26  ? 13.800  3.092   5.218   1.00 0.29  ? 181 GLY A CA   1 
ATOM   417  C C    . GLY A 1 26  ? 12.564  2.677   6.020   1.00 0.28  ? 181 GLY A C    1 
ATOM   418  O O    . GLY A 1 26  ? 11.957  1.657   5.760   1.00 0.31  ? 181 GLY A O    1 
ATOM   419  H H    . GLY A 1 26  ? 13.613  1.604   3.671   1.00 0.32  ? 181 GLY A H    1 
ATOM   420  H HA2  . GLY A 1 26  ? 14.687  2.686   5.684   1.00 0.32  ? 181 GLY A HA2  1 
ATOM   421  H HA3  . GLY A 1 26  ? 13.865  4.169   5.194   1.00 0.30  ? 181 GLY A HA3  1 
ATOM   422  N N    . ILE A 1 27  ? 12.185  3.461   6.992   1.00 0.27  ? 182 ILE A N    1 
ATOM   423  C CA   . ILE A 1 27  ? 10.987  3.111   7.807   1.00 0.27  ? 182 ILE A CA   1 
ATOM   424  C C    . ILE A 1 27  ? 9.806   3.977   7.366   1.00 0.27  ? 182 ILE A C    1 
ATOM   425  O O    . ILE A 1 27  ? 9.802   5.178   7.546   1.00 0.46  ? 182 ILE A O    1 
ATOM   426  C CB   . ILE A 1 27  ? 11.285  3.359   9.286   1.00 0.32  ? 182 ILE A CB   1 
ATOM   427  C CG1  . ILE A 1 27  ? 12.773  3.125   9.547   1.00 0.49  ? 182 ILE A CG1  1 
ATOM   428  C CG2  . ILE A 1 27  ? 10.464  2.394   10.142  1.00 0.42  ? 182 ILE A CG2  1 
ATOM   429  C CD1  . ILE A 1 27  ? 13.054  3.233   11.047  1.00 0.77  ? 182 ILE A CD1  1 
ATOM   430  H H    . ILE A 1 27  ? 12.686  4.280   7.186   1.00 0.30  ? 182 ILE A H    1 
ATOM   431  H HA   . ILE A 1 27  ? 10.743  2.069   7.659   1.00 0.27  ? 182 ILE A HA   1 
ATOM   432  H HB   . ILE A 1 27  ? 11.027  4.377   9.541   1.00 0.33  ? 182 ILE A HB   1 
ATOM   433  H HG12 . ILE A 1 27  ? 13.047  2.140   9.197   1.00 0.81  ? 182 ILE A HG12 1 
ATOM   434  H HG13 . ILE A 1 27  ? 13.351  3.868   9.019   1.00 0.91  ? 182 ILE A HG13 1 
ATOM   435  H HG21 . ILE A 1 27  ? 9.509   2.216   9.670   1.00 1.06  ? 182 ILE A HG21 1 
ATOM   436  H HG22 . ILE A 1 27  ? 10.996  1.460   10.242  1.00 1.11  ? 182 ILE A HG22 1 
ATOM   437  H HG23 . ILE A 1 27  ? 10.307  2.824   11.120  1.00 1.17  ? 182 ILE A HG23 1 
ATOM   438  H HD11 . ILE A 1 27  ? 12.726  4.197   11.406  1.00 1.45  ? 182 ILE A HD11 1 
ATOM   439  H HD12 . ILE A 1 27  ? 12.521  2.453   11.570  1.00 1.40  ? 182 ILE A HD12 1 
ATOM   440  H HD13 . ILE A 1 27  ? 14.114  3.125   11.223  1.00 1.22  ? 182 ILE A HD13 1 
ATOM   441  N N    . TYR A 1 28  ? 8.807   3.374   6.784   1.00 0.22  ? 183 TYR A N    1 
ATOM   442  C CA   . TYR A 1 28  ? 7.625   4.159   6.324   1.00 0.22  ? 183 TYR A CA   1 
ATOM   443  C C    . TYR A 1 28  ? 6.369   3.682   7.055   1.00 0.21  ? 183 TYR A C    1 
ATOM   444  O O    . TYR A 1 28  ? 6.430   2.853   7.940   1.00 0.23  ? 183 TYR A O    1 
ATOM   445  C CB   . TYR A 1 28  ? 7.437   3.953   4.820   1.00 0.23  ? 183 TYR A CB   1 
ATOM   446  C CG   . TYR A 1 28  ? 8.363   4.873   4.064   1.00 0.23  ? 183 TYR A CG   1 
ATOM   447  C CD1  . TYR A 1 28  ? 9.739   4.617   4.043   1.00 1.20  ? 183 TYR A CD1  1 
ATOM   448  C CD2  . TYR A 1 28  ? 7.847   5.983   3.384   1.00 1.24  ? 183 TYR A CD2  1 
ATOM   449  C CE1  . TYR A 1 28  ? 10.599  5.472   3.344   1.00 1.19  ? 183 TYR A CE1  1 
ATOM   450  C CE2  . TYR A 1 28  ? 8.707   6.836   2.684   1.00 1.27  ? 183 TYR A CE2  1 
ATOM   451  C CZ   . TYR A 1 28  ? 10.084  6.581   2.664   1.00 0.32  ? 183 TYR A CZ   1 
ATOM   452  O OH   . TYR A 1 28  ? 10.932  7.424   1.975   1.00 0.39  ? 183 TYR A OH   1 
ATOM   453  H H    . TYR A 1 28  ? 8.836   2.405   6.648   1.00 0.34  ? 183 TYR A H    1 
ATOM   454  H HA   . TYR A 1 28  ? 7.786   5.207   6.527   1.00 0.23  ? 183 TYR A HA   1 
ATOM   455  H HB2  . TYR A 1 28  ? 7.663   2.928   4.568   1.00 0.26  ? 183 TYR A HB2  1 
ATOM   456  H HB3  . TYR A 1 28  ? 6.414   4.171   4.552   1.00 0.25  ? 183 TYR A HB3  1 
ATOM   457  H HD1  . TYR A 1 28  ? 10.137  3.761   4.568   1.00 2.12  ? 183 TYR A HD1  1 
ATOM   458  H HD2  . TYR A 1 28  ? 6.785   6.179   3.399   1.00 2.14  ? 183 TYR A HD2  1 
ATOM   459  H HE1  . TYR A 1 28  ? 11.661  5.274   3.328   1.00 2.09  ? 183 TYR A HE1  1 
ATOM   460  H HE2  . TYR A 1 28  ? 8.310   7.692   2.159   1.00 2.19  ? 183 TYR A HE2  1 
ATOM   461  H HH   . TYR A 1 28  ? 11.390  6.904   1.310   1.00 0.98  ? 183 TYR A HH   1 
ATOM   462  N N    . ARG A 1 29  ? 5.230   4.202   6.686   1.00 0.19  ? 184 ARG A N    1 
ATOM   463  C CA   . ARG A 1 29  ? 3.963   3.785   7.350   1.00 0.19  ? 184 ARG A CA   1 
ATOM   464  C C    . ARG A 1 29  ? 2.857   3.666   6.297   1.00 0.18  ? 184 ARG A C    1 
ATOM   465  O O    . ARG A 1 29  ? 2.580   4.599   5.568   1.00 0.20  ? 184 ARG A O    1 
ATOM   466  C CB   . ARG A 1 29  ? 3.559   4.832   8.388   1.00 0.20  ? 184 ARG A CB   1 
ATOM   467  C CG   . ARG A 1 29  ? 4.316   4.583   9.693   1.00 0.27  ? 184 ARG A CG   1 
ATOM   468  C CD   . ARG A 1 29  ? 4.043   5.733   10.664  1.00 0.31  ? 184 ARG A CD   1 
ATOM   469  N NE   . ARG A 1 29  ? 3.269   5.227   11.831  1.00 1.34  ? 184 ARG A NE   1 
ATOM   470  C CZ   . ARG A 1 29  ? 2.725   6.068   12.667  1.00 1.67  ? 184 ARG A CZ   1 
ATOM   471  N NH1  . ARG A 1 29  ? 3.402   7.103   13.083  1.00 2.13  ? 184 ARG A NH1  1 
ATOM   472  N NH2  . ARG A 1 29  ? 1.505   5.876   13.087  1.00 2.25  ? 184 ARG A NH2  1 
ATOM   473  H H    . ARG A 1 29  ? 5.207   4.869   5.969   1.00 0.20  ? 184 ARG A H    1 
ATOM   474  H HA   . ARG A 1 29  ? 4.105   2.830   7.834   1.00 0.20  ? 184 ARG A HA   1 
ATOM   475  H HB2  . ARG A 1 29  ? 3.797   5.818   8.015   1.00 0.22  ? 184 ARG A HB2  1 
ATOM   476  H HB3  . ARG A 1 29  ? 2.499   4.763   8.571   1.00 0.19  ? 184 ARG A HB3  1 
ATOM   477  H HG2  . ARG A 1 29  ? 3.983   3.653   10.131  1.00 0.43  ? 184 ARG A HG2  1 
ATOM   478  H HG3  . ARG A 1 29  ? 5.375   4.528   9.492   1.00 0.42  ? 184 ARG A HG3  1 
ATOM   479  H HD2  . ARG A 1 29  ? 4.980   6.146   11.006  1.00 1.17  ? 184 ARG A HD2  1 
ATOM   480  H HD3  . ARG A 1 29  ? 3.475   6.501   10.161  1.00 1.05  ? 184 ARG A HD3  1 
ATOM   481  H HE   . ARG A 1 29  ? 3.167   4.262   11.971  1.00 2.09  ? 184 ARG A HE   1 
ATOM   482  H HH11 . ARG A 1 29  ? 4.338   7.252   12.761  1.00 2.54  ? 184 ARG A HH11 1 
ATOM   483  H HH12 . ARG A 1 29  ? 2.986   7.749   13.724  1.00 2.44  ? 184 ARG A HH12 1 
ATOM   484  H HH21 . ARG A 1 29  ? 0.986   5.083   12.768  1.00 2.67  ? 184 ARG A HH21 1 
ATOM   485  H HH22 . ARG A 1 29  ? 1.089   6.521   13.728  1.00 2.60  ? 184 ARG A HH22 1 
ATOM   486  N N    . LEU A 1 30  ? 2.224   2.527   6.210   1.00 0.18  ? 185 LEU A N    1 
ATOM   487  C CA   . LEU A 1 30  ? 1.138   2.353   5.203   1.00 0.18  ? 185 LEU A CA   1 
ATOM   488  C C    . LEU A 1 30  ? -0.176  2.897   5.770   1.00 0.17  ? 185 LEU A C    1 
ATOM   489  O O    . LEU A 1 30  ? -0.917  2.194   6.427   1.00 0.18  ? 185 LEU A O    1 
ATOM   490  C CB   . LEU A 1 30  ? 0.977   0.865   4.882   1.00 0.19  ? 185 LEU A CB   1 
ATOM   491  C CG   . LEU A 1 30  ? -0.063  0.688   3.775   1.00 0.21  ? 185 LEU A CG   1 
ATOM   492  C CD1  . LEU A 1 30  ? 0.645   0.417   2.446   1.00 0.27  ? 185 LEU A CD1  1 
ATOM   493  C CD2  . LEU A 1 30  ? -0.973  -0.494  4.116   1.00 0.28  ? 185 LEU A CD2  1 
ATOM   494  H H    . LEU A 1 30  ? 2.462   1.787   6.807   1.00 0.20  ? 185 LEU A H    1 
ATOM   495  H HA   . LEU A 1 30  ? 1.392   2.891   4.301   1.00 0.18  ? 185 LEU A HA   1 
ATOM   496  H HB2  . LEU A 1 30  ? 1.925   0.464   4.553   1.00 0.22  ? 185 LEU A HB2  1 
ATOM   497  H HB3  . LEU A 1 30  ? 0.651   0.339   5.766   1.00 0.19  ? 185 LEU A HB3  1 
ATOM   498  H HG   . LEU A 1 30  ? -0.655  1.588   3.690   1.00 0.20  ? 185 LEU A HG   1 
ATOM   499  H HD11 . LEU A 1 30  ? 1.441   1.133   2.310   1.00 1.05  ? 185 LEU A HD11 1 
ATOM   500  H HD12 . LEU A 1 30  ? 1.056   -0.582  2.456   1.00 1.02  ? 185 LEU A HD12 1 
ATOM   501  H HD13 . LEU A 1 30  ? -0.063  0.507   1.636   1.00 1.05  ? 185 LEU A HD13 1 
ATOM   502  H HD21 . LEU A 1 30  ? -0.534  -1.067  4.919   1.00 1.14  ? 185 LEU A HD21 1 
ATOM   503  H HD22 . LEU A 1 30  ? -1.941  -0.127  4.424   1.00 0.99  ? 185 LEU A HD22 1 
ATOM   504  H HD23 . LEU A 1 30  ? -1.088  -1.123  3.246   1.00 1.05  ? 185 LEU A HD23 1 
ATOM   505  N N    . CYS A 1 31  ? -0.471  4.145   5.524   1.00 0.20  ? 186 CYS A N    1 
ATOM   506  C CA   . CYS A 1 31  ? -1.735  4.728   6.051   1.00 0.20  ? 186 CYS A CA   1 
ATOM   507  C C    . CYS A 1 31  ? -2.865  4.483   5.051   1.00 0.21  ? 186 CYS A C    1 
ATOM   508  O O    . CYS A 1 31  ? -2.898  5.059   3.981   1.00 0.24  ? 186 CYS A O    1 
ATOM   509  C CB   . CYS A 1 31  ? -1.552  6.234   6.257   1.00 0.24  ? 186 CYS A CB   1 
ATOM   510  S SG   . CYS A 1 31  ? -0.151  6.525   7.365   1.00 1.28  ? 186 CYS A SG   1 
ATOM   511  H H    . CYS A 1 31  ? 0.138   4.697   4.992   1.00 0.23  ? 186 CYS A H    1 
ATOM   512  H HA   . CYS A 1 31  ? -1.980  4.263   6.994   1.00 0.19  ? 186 CYS A HA   1 
ATOM   513  H HB2  . CYS A 1 31  ? -1.363  6.707   5.305   1.00 0.89  ? 186 CYS A HB2  1 
ATOM   514  H HB3  . CYS A 1 31  ? -2.449  6.648   6.694   1.00 0.79  ? 186 CYS A HB3  1 
ATOM   515  H HG   . CYS A 1 31  ? -0.345  7.305   7.890   1.00 1.70  ? 186 CYS A HG   1 
ATOM   516  N N    . LEU A 1 32  ? -3.794  3.632   5.391   1.00 0.20  ? 187 LEU A N    1 
ATOM   517  C CA   . LEU A 1 32  ? -4.922  3.350   4.462   1.00 0.23  ? 187 LEU A CA   1 
ATOM   518  C C    . LEU A 1 32  ? -5.956  4.470   4.566   1.00 0.25  ? 187 LEU A C    1 
ATOM   519  O O    . LEU A 1 32  ? -6.604  4.635   5.579   1.00 0.45  ? 187 LEU A O    1 
ATOM   520  C CB   . LEU A 1 32  ? -5.579  2.022   4.841   1.00 0.25  ? 187 LEU A CB   1 
ATOM   521  C CG   . LEU A 1 32  ? -6.506  1.572   3.711   1.00 0.37  ? 187 LEU A CG   1 
ATOM   522  C CD1  . LEU A 1 32  ? -5.681  1.300   2.452   1.00 0.51  ? 187 LEU A CD1  1 
ATOM   523  C CD2  . LEU A 1 32  ? -7.236  0.293   4.129   1.00 0.47  ? 187 LEU A CD2  1 
ATOM   524  H H    . LEU A 1 32  ? -3.748  3.179   6.258   1.00 0.19  ? 187 LEU A H    1 
ATOM   525  H HA   . LEU A 1 32  ? -4.551  3.294   3.450   1.00 0.24  ? 187 LEU A HA   1 
ATOM   526  H HB2  . LEU A 1 32  ? -4.816  1.276   5.003   1.00 0.24  ? 187 LEU A HB2  1 
ATOM   527  H HB3  . LEU A 1 32  ? -6.154  2.150   5.746   1.00 0.29  ? 187 LEU A HB3  1 
ATOM   528  H HG   . LEU A 1 32  ? -7.227  2.350   3.507   1.00 0.52  ? 187 LEU A HG   1 
ATOM   529  H HD11 . LEU A 1 32  ? -4.630  1.326   2.698   1.00 1.13  ? 187 LEU A HD11 1 
ATOM   530  H HD12 . LEU A 1 32  ? -5.935  0.327   2.059   1.00 1.21  ? 187 LEU A HD12 1 
ATOM   531  H HD13 . LEU A 1 32  ? -5.896  2.055   1.710   1.00 1.15  ? 187 LEU A HD13 1 
ATOM   532  H HD21 . LEU A 1 32  ? -6.594  -0.297  4.765   1.00 1.15  ? 187 LEU A HD21 1 
ATOM   533  H HD22 . LEU A 1 32  ? -8.136  0.552   4.666   1.00 1.10  ? 187 LEU A HD22 1 
ATOM   534  H HD23 . LEU A 1 32  ? -7.494  -0.278  3.249   1.00 1.10  ? 187 LEU A HD23 1 
ATOM   535  N N    . THR A 1 33  ? -6.118  5.238   3.525   1.00 0.17  ? 188 THR A N    1 
ATOM   536  C CA   . THR A 1 33  ? -7.114  6.346   3.564   1.00 0.20  ? 188 THR A CA   1 
ATOM   537  C C    . THR A 1 33  ? -8.395  5.890   2.865   1.00 0.20  ? 188 THR A C    1 
ATOM   538  O O    . THR A 1 33  ? -8.958  6.608   2.060   1.00 0.20  ? 188 THR A O    1 
ATOM   539  C CB   . THR A 1 33  ? -6.551  7.576   2.848   1.00 0.23  ? 188 THR A CB   1 
ATOM   540  O OG1  . THR A 1 33  ? -5.176  7.723   3.170   1.00 0.72  ? 188 THR A OG1  1 
ATOM   541  C CG2  . THR A 1 33  ? -7.317  8.822   3.296   1.00 0.76  ? 188 THR A CG2  1 
ATOM   542  H H    . THR A 1 33  ? -5.587  5.084   2.718   1.00 0.27  ? 188 THR A H    1 
ATOM   543  H HA   . THR A 1 33  ? -7.337  6.594   4.594   1.00 0.23  ? 188 THR A HA   1 
ATOM   544  H HB   . THR A 1 33  ? -6.661  7.455   1.782   1.00 0.71  ? 188 THR A HB   1 
ATOM   545  H HG1  . THR A 1 33  ? -4.871  8.554   2.799   1.00 1.14  ? 188 THR A HG1  1 
ATOM   546  H HG21 . THR A 1 33  ? -7.431  8.808   4.370   1.00 1.30  ? 188 THR A HG21 1 
ATOM   547  H HG22 . THR A 1 33  ? -6.771  9.706   3.003   1.00 1.46  ? 188 THR A HG22 1 
ATOM   548  H HG23 . THR A 1 33  ? -8.292  8.831   2.831   1.00 1.37  ? 188 THR A HG23 1 
ATOM   549  N N    . SER A 1 34  ? -8.841  4.696   3.184   1.00 0.22  ? 189 SER A N    1 
ATOM   550  C CA   . SER A 1 34  ? -10.091 4.119   2.582   1.00 0.25  ? 189 SER A CA   1 
ATOM   551  C C    . SER A 1 34  ? -10.233 4.465   1.094   1.00 0.23  ? 189 SER A C    1 
ATOM   552  O O    . SER A 1 34  ? -11.332 4.551   0.590   1.00 0.26  ? 189 SER A O    1 
ATOM   553  C CB   . SER A 1 34  ? -11.302 4.669   3.334   1.00 0.30  ? 189 SER A CB   1 
ATOM   554  O OG   . SER A 1 34  ? -11.768 5.841   2.678   1.00 1.36  ? 189 SER A OG   1 
ATOM   555  H H    . SER A 1 34  ? -8.342  4.166   3.840   1.00 0.23  ? 189 SER A H    1 
ATOM   556  H HA   . SER A 1 34  ? -10.071 3.045   2.693   1.00 0.27  ? 189 SER A HA   1 
ATOM   557  H HB2  . SER A 1 34  ? -12.088 3.933   3.345   1.00 1.07  ? 189 SER A HB2  1 
ATOM   558  H HB3  . SER A 1 34  ? -11.017 4.904   4.352   1.00 1.09  ? 189 SER A HB3  1 
ATOM   559  H HG   . SER A 1 34  ? -12.536 6.163   3.154   1.00 1.71  ? 189 SER A HG   1 
ATOM   560  N N    . LYS A 1 35  ? -9.144  4.657   0.393   1.00 0.20  ? 190 LYS A N    1 
ATOM   561  C CA   . LYS A 1 35  ? -9.215  4.997   -1.060  1.00 0.21  ? 190 LYS A CA   1 
ATOM   562  C C    . LYS A 1 35  ? -7.823  5.415   -1.521  1.00 0.19  ? 190 LYS A C    1 
ATOM   563  O O    . LYS A 1 35  ? -7.430  5.155   -2.639  1.00 0.20  ? 190 LYS A O    1 
ATOM   564  C CB   . LYS A 1 35  ? -10.183 6.168   -1.303  1.00 0.24  ? 190 LYS A CB   1 
ATOM   565  C CG   . LYS A 1 35  ? -10.159 6.560   -2.783  1.00 0.86  ? 190 LYS A CG   1 
ATOM   566  C CD   . LYS A 1 35  ? -11.527 6.268   -3.402  1.00 0.78  ? 190 LYS A CD   1 
ATOM   567  C CE   . LYS A 1 35  ? -12.454 7.464   -3.185  1.00 1.16  ? 190 LYS A CE   1 
ATOM   568  N NZ   . LYS A 1 35  ? -13.460 7.519   -4.283  1.00 1.53  ? 190 LYS A NZ   1 
ATOM   569  H H    . LYS A 1 35  ? -8.268  4.574   0.821   1.00 0.19  ? 190 LYS A H    1 
ATOM   570  H HA   . LYS A 1 35  ? -9.540  4.133   -1.621  1.00 0.24  ? 190 LYS A HA   1 
ATOM   571  H HB2  . LYS A 1 35  ? -11.185 5.878   -1.036  1.00 0.59  ? 190 LYS A HB2  1 
ATOM   572  H HB3  . LYS A 1 35  ? -9.880  7.014   -0.705  1.00 0.61  ? 190 LYS A HB3  1 
ATOM   573  H HG2  . LYS A 1 35  ? -9.939  7.614   -2.874  1.00 1.62  ? 190 LYS A HG2  1 
ATOM   574  H HG3  . LYS A 1 35  ? -9.406  5.989   -3.302  1.00 1.65  ? 190 LYS A HG3  1 
ATOM   575  H HD2  . LYS A 1 35  ? -11.411 6.088   -4.462  1.00 1.25  ? 190 LYS A HD2  1 
ATOM   576  H HD3  . LYS A 1 35  ? -11.953 5.394   -2.932  1.00 1.14  ? 190 LYS A HD3  1 
ATOM   577  H HE2  . LYS A 1 35  ? -12.961 7.358   -2.237  1.00 1.91  ? 190 LYS A HE2  1 
ATOM   578  H HE3  . LYS A 1 35  ? -11.873 8.374   -3.183  1.00 1.53  ? 190 LYS A HE3  1 
ATOM   579  H HZ1  . LYS A 1 35  ? -13.954 6.606   -4.347  1.00 2.04  ? 190 LYS A HZ1  1 
ATOM   580  H HZ2  . LYS A 1 35  ? -14.149 8.270   -4.085  1.00 1.95  ? 190 LYS A HZ2  1 
ATOM   581  H HZ3  . LYS A 1 35  ? -12.978 7.717   -5.184  1.00 1.95  ? 190 LYS A HZ3  1 
ATOM   582  N N    . THR A 1 36  ? -7.072  6.068   -0.673  1.00 0.18  ? 191 THR A N    1 
ATOM   583  C CA   . THR A 1 36  ? -5.704  6.499   -1.091  1.00 0.18  ? 191 THR A CA   1 
ATOM   584  C C    . THR A 1 36  ? -4.668  6.075   -0.047  1.00 0.17  ? 191 THR A C    1 
ATOM   585  O O    . THR A 1 36  ? -4.784  6.386   1.119   1.00 0.22  ? 191 THR A O    1 
ATOM   586  C CB   . THR A 1 36  ? -5.669  8.020   -1.248  1.00 0.21  ? 191 THR A CB   1 
ATOM   587  O OG1  . THR A 1 36  ? -5.935  8.632   0.007   1.00 0.41  ? 191 THR A OG1  1 
ATOM   588  C CG2  . THR A 1 36  ? -6.723  8.457   -2.266  1.00 0.38  ? 191 THR A CG2  1 
ATOM   589  H H    . THR A 1 36  ? -7.408  6.277   0.229   1.00 0.18  ? 191 THR A H    1 
ATOM   590  H HA   . THR A 1 36  ? -5.463  6.041   -2.036  1.00 0.18  ? 191 THR A HA   1 
ATOM   591  H HB   . THR A 1 36  ? -4.694  8.320   -1.597  1.00 0.35  ? 191 THR A HB   1 
ATOM   592  H HG1  . THR A 1 36  ? -5.857  9.582   -0.104  1.00 1.04  ? 191 THR A HG1  1 
ATOM   593  H HG21 . THR A 1 36  ? -7.162  7.585   -2.727  1.00 1.03  ? 191 THR A HG21 1 
ATOM   594  H HG22 . THR A 1 36  ? -7.493  9.026   -1.766  1.00 1.14  ? 191 THR A HG22 1 
ATOM   595  H HG23 . THR A 1 36  ? -6.258  9.070   -3.024  1.00 1.14  ? 191 THR A HG23 1 
ATOM   596  N N    . ILE A 1 37  ? -3.649  5.368   -0.463  1.00 0.16  ? 192 ILE A N    1 
ATOM   597  C CA   . ILE A 1 37  ? -2.600  4.926   0.501   1.00 0.15  ? 192 ILE A CA   1 
ATOM   598  C C    . ILE A 1 37  ? -1.637  6.086   0.766   1.00 0.15  ? 192 ILE A C    1 
ATOM   599  O O    . ILE A 1 37  ? -1.488  6.977   -0.047  1.00 0.15  ? 192 ILE A O    1 
ATOM   600  C CB   . ILE A 1 37  ? -1.829  3.746   -0.094  1.00 0.18  ? 192 ILE A CB   1 
ATOM   601  C CG1  . ILE A 1 37  ? -2.653  2.467   0.065   1.00 0.22  ? 192 ILE A CG1  1 
ATOM   602  C CG2  . ILE A 1 37  ? -0.495  3.584   0.637   1.00 0.20  ? 192 ILE A CG2  1 
ATOM   603  C CD1  . ILE A 1 37  ? -1.920  1.301   -0.601  1.00 0.29  ? 192 ILE A CD1  1 
ATOM   604  H H    . ILE A 1 37  ? -3.573  5.132   -1.411  1.00 0.19  ? 192 ILE A H    1 
ATOM   605  H HA   . ILE A 1 37  ? -3.065  4.623   1.428   1.00 0.16  ? 192 ILE A HA   1 
ATOM   606  H HB   . ILE A 1 37  ? -1.644  3.929   -1.143  1.00 0.19  ? 192 ILE A HB   1 
ATOM   607  H HG12 . ILE A 1 37  ? -2.789  2.254   1.116   1.00 0.24  ? 192 ILE A HG12 1 
ATOM   608  H HG13 . ILE A 1 37  ? -3.617  2.598   -0.403  1.00 0.24  ? 192 ILE A HG13 1 
ATOM   609  H HG21 . ILE A 1 37  ? -0.665  3.606   1.704   1.00 1.02  ? 192 ILE A HG21 1 
ATOM   610  H HG22 . ILE A 1 37  ? -0.046  2.641   0.364   1.00 1.06  ? 192 ILE A HG22 1 
ATOM   611  H HG23 . ILE A 1 37  ? 0.167   4.392   0.361   1.00 1.02  ? 192 ILE A HG23 1 
ATOM   612  H HD11 . ILE A 1 37  ? -1.221  1.685   -1.329  1.00 1.03  ? 192 ILE A HD11 1 
ATOM   613  H HD12 . ILE A 1 37  ? -1.386  0.736   0.148   1.00 1.05  ? 192 ILE A HD12 1 
ATOM   614  H HD13 . ILE A 1 37  ? -2.636  0.660   -1.093  1.00 1.03  ? 192 ILE A HD13 1 
ATOM   615  N N    . SER A 1 38  ? -0.981  6.089   1.898   1.00 0.15  ? 193 SER A N    1 
ATOM   616  C CA   . SER A 1 38  ? -0.036  7.202   2.199   1.00 0.16  ? 193 SER A CA   1 
ATOM   617  C C    . SER A 1 38  ? 1.229   6.665   2.871   1.00 0.16  ? 193 SER A C    1 
ATOM   618  O O    . SER A 1 38  ? 1.236   6.351   4.043   1.00 0.18  ? 193 SER A O    1 
ATOM   619  C CB   . SER A 1 38  ? -0.707  8.193   3.141   1.00 0.19  ? 193 SER A CB   1 
ATOM   620  O OG   . SER A 1 38  ? -2.095  7.899   3.225   1.00 0.32  ? 193 SER A OG   1 
ATOM   621  H H    . SER A 1 38  ? -1.113  5.365   2.546   1.00 0.16  ? 193 SER A H    1 
ATOM   622  H HA   . SER A 1 38  ? 0.231   7.705   1.282   1.00 0.18  ? 193 SER A HA   1 
ATOM   623  H HB2  . SER A 1 38  ? -0.265  8.111   4.118   1.00 0.19  ? 193 SER A HB2  1 
ATOM   624  H HB3  . SER A 1 38  ? -0.562  9.195   2.767   1.00 0.24  ? 193 SER A HB3  1 
ATOM   625  H HG   . SER A 1 38  ? -2.576  8.606   2.789   1.00 0.79  ? 193 SER A HG   1 
ATOM   626  N N    . PHE A 1 39  ? 2.301   6.569   2.141   1.00 0.16  ? 194 PHE A N    1 
ATOM   627  C CA   . PHE A 1 39  ? 3.567   6.064   2.741   1.00 0.17  ? 194 PHE A CA   1 
ATOM   628  C C    . PHE A 1 39  ? 4.259   7.216   3.470   1.00 0.17  ? 194 PHE A C    1 
ATOM   629  O O    . PHE A 1 39  ? 5.004   7.976   2.884   1.00 0.20  ? 194 PHE A O    1 
ATOM   630  C CB   . PHE A 1 39  ? 4.481   5.529   1.637   1.00 0.19  ? 194 PHE A CB   1 
ATOM   631  C CG   . PHE A 1 39  ? 4.127   4.091   1.347   1.00 0.21  ? 194 PHE A CG   1 
ATOM   632  C CD1  . PHE A 1 39  ? 4.478   3.086   2.257   1.00 1.21  ? 194 PHE A CD1  1 
ATOM   633  C CD2  . PHE A 1 39  ? 3.446   3.761   0.169   1.00 1.22  ? 194 PHE A CD2  1 
ATOM   634  C CE1  . PHE A 1 39  ? 4.148   1.752   1.989   1.00 1.22  ? 194 PHE A CE1  1 
ATOM   635  C CE2  . PHE A 1 39  ? 3.116   2.427   -0.099  1.00 1.23  ? 194 PHE A CE2  1 
ATOM   636  C CZ   . PHE A 1 39  ? 3.467   1.423   0.811   1.00 0.29  ? 194 PHE A CZ   1 
ATOM   637  H H    . PHE A 1 39  ? 2.276   6.837   1.203   1.00 0.18  ? 194 PHE A H    1 
ATOM   638  H HA   . PHE A 1 39  ? 3.345   5.274   3.443   1.00 0.17  ? 194 PHE A HA   1 
ATOM   639  H HB2  . PHE A 1 39  ? 4.349   6.121   0.743   1.00 0.20  ? 194 PHE A HB2  1 
ATOM   640  H HB3  . PHE A 1 39  ? 5.509   5.588   1.960   1.00 0.21  ? 194 PHE A HB3  1 
ATOM   641  H HD1  . PHE A 1 39  ? 5.003   3.340   3.166   1.00 2.12  ? 194 PHE A HD1  1 
ATOM   642  H HD2  . PHE A 1 39  ? 3.175   4.536   -0.533  1.00 2.13  ? 194 PHE A HD2  1 
ATOM   643  H HE1  . PHE A 1 39  ? 4.419   0.977   2.691   1.00 2.13  ? 194 PHE A HE1  1 
ATOM   644  H HE2  . PHE A 1 39  ? 2.591   2.173   -1.008  1.00 2.13  ? 194 PHE A HE2  1 
ATOM   645  H HZ   . PHE A 1 39  ? 3.213   0.394   0.604   1.00 0.33  ? 194 PHE A HZ   1 
ATOM   646  N N    . VAL A 1 40  ? 4.013   7.356   4.743   1.00 0.17  ? 195 VAL A N    1 
ATOM   647  C CA   . VAL A 1 40  ? 4.651   8.465   5.507   1.00 0.18  ? 195 VAL A CA   1 
ATOM   648  C C    . VAL A 1 40  ? 5.911   7.959   6.209   1.00 0.17  ? 195 VAL A C    1 
ATOM   649  O O    . VAL A 1 40  ? 5.929   6.888   6.779   1.00 0.20  ? 195 VAL A O    1 
ATOM   650  C CB   . VAL A 1 40  ? 3.666   8.988   6.552   1.00 0.20  ? 195 VAL A CB   1 
ATOM   651  C CG1  . VAL A 1 40  ? 4.172   10.318  7.113   1.00 0.26  ? 195 VAL A CG1  1 
ATOM   652  C CG2  . VAL A 1 40  ? 2.297   9.198   5.902   1.00 0.25  ? 195 VAL A CG2  1 
ATOM   653  H H    . VAL A 1 40  ? 3.404   6.734   5.197   1.00 0.19  ? 195 VAL A H    1 
ATOM   654  H HA   . VAL A 1 40  ? 4.912   9.265   4.830   1.00 0.19  ? 195 VAL A HA   1 
ATOM   655  H HB   . VAL A 1 40  ? 3.579   8.269   7.354   1.00 0.21  ? 195 VAL A HB   1 
ATOM   656  H HG11 . VAL A 1 40  ? 4.304   11.022  6.305   1.00 1.00  ? 195 VAL A HG11 1 
ATOM   657  H HG12 . VAL A 1 40  ? 3.453   10.708  7.817   1.00 1.10  ? 195 VAL A HG12 1 
ATOM   658  H HG13 . VAL A 1 40  ? 5.117   10.162  7.612   1.00 1.05  ? 195 VAL A HG13 1 
ATOM   659  H HG21 . VAL A 1 40  ? 2.427   9.632   4.921   1.00 0.99  ? 195 VAL A HG21 1 
ATOM   660  H HG22 . VAL A 1 40  ? 1.792   8.248   5.811   1.00 1.09  ? 195 VAL A HG22 1 
ATOM   661  H HG23 . VAL A 1 40  ? 1.706   9.863   6.514   1.00 1.07  ? 195 VAL A HG23 1 
ATOM   662  N N    . LYS A 1 41  ? 6.967   8.725   6.175   1.00 0.18  ? 196 LYS A N    1 
ATOM   663  C CA   . LYS A 1 41  ? 8.224   8.288   6.843   1.00 0.20  ? 196 LYS A CA   1 
ATOM   664  C C    . LYS A 1 41  ? 8.120   8.574   8.342   1.00 0.21  ? 196 LYS A C    1 
ATOM   665  O O    . LYS A 1 41  ? 7.685   9.631   8.754   1.00 0.25  ? 196 LYS A O    1 
ATOM   666  C CB   . LYS A 1 41  ? 9.409   9.059   6.257   1.00 0.24  ? 196 LYS A CB   1 
ATOM   667  C CG   . LYS A 1 41  ? 10.451  8.077   5.710   1.00 0.31  ? 196 LYS A CG   1 
ATOM   668  C CD   . LYS A 1 41  ? 11.825  8.405   6.298   1.00 0.41  ? 196 LYS A CD   1 
ATOM   669  C CE   . LYS A 1 41  ? 12.865  8.441   5.177   1.00 0.66  ? 196 LYS A CE   1 
ATOM   670  N NZ   . LYS A 1 41  ? 14.202  8.764   5.750   1.00 0.97  ? 196 LYS A NZ   1 
ATOM   671  H H    . LYS A 1 41  ? 6.932   9.588   5.712   1.00 0.21  ? 196 LYS A H    1 
ATOM   672  H HA   . LYS A 1 41  ? 8.365   7.230   6.687   1.00 0.21  ? 196 LYS A HA   1 
ATOM   673  H HB2  . LYS A 1 41  ? 9.061   9.697   5.457   1.00 0.29  ? 196 LYS A HB2  1 
ATOM   674  H HB3  . LYS A 1 41  ? 9.857   9.666   7.029   1.00 0.26  ? 196 LYS A HB3  1 
ATOM   675  H HG2  . LYS A 1 41  ? 10.178  7.068   5.982   1.00 0.43  ? 196 LYS A HG2  1 
ATOM   676  H HG3  . LYS A 1 41  ? 10.494  8.160   4.635   1.00 0.41  ? 196 LYS A HG3  1 
ATOM   677  H HD2  . LYS A 1 41  ? 11.787  9.367   6.785   1.00 0.52  ? 196 LYS A HD2  1 
ATOM   678  H HD3  . LYS A 1 41  ? 12.100  7.648   7.017   1.00 0.55  ? 196 LYS A HD3  1 
ATOM   679  H HE2  . LYS A 1 41  ? 12.905  7.476   4.692   1.00 0.80  ? 196 LYS A HE2  1 
ATOM   680  H HE3  . LYS A 1 41  ? 12.590  9.195   4.455   1.00 0.89  ? 196 LYS A HE3  1 
ATOM   681  H HZ1  . LYS A 1 41  ? 14.086  9.418   6.551   1.00 1.46  ? 196 LYS A HZ1  1 
ATOM   682  H HZ2  . LYS A 1 41  ? 14.660  7.891   6.077   1.00 1.41  ? 196 LYS A HZ2  1 
ATOM   683  H HZ3  . LYS A 1 41  ? 14.793  9.210   5.020   1.00 1.45  ? 196 LYS A HZ3  1 
ATOM   684  N N    . LEU A 1 42  ? 8.513   7.639   9.162   1.00 0.24  ? 197 LEU A N    1 
ATOM   685  C CA   . LEU A 1 42  ? 8.434   7.858   10.634  1.00 0.29  ? 197 LEU A CA   1 
ATOM   686  C C    . LEU A 1 42  ? 9.274   9.078   11.021  1.00 0.34  ? 197 LEU A C    1 
ATOM   687  O O    . LEU A 1 42  ? 8.978   9.767   11.977  1.00 1.06  ? 197 LEU A O    1 
ATOM   688  C CB   . LEU A 1 42  ? 8.965   6.621   11.362  1.00 0.34  ? 197 LEU A CB   1 
ATOM   689  C CG   . LEU A 1 42  ? 7.814   5.647   11.613  1.00 0.40  ? 197 LEU A CG   1 
ATOM   690  C CD1  . LEU A 1 42  ? 8.236   4.237   11.199  1.00 1.16  ? 197 LEU A CD1  1 
ATOM   691  C CD2  . LEU A 1 42  ? 7.457   5.654   13.100  1.00 1.13  ? 197 LEU A CD2  1 
ATOM   692  H H    . LEU A 1 42  ? 8.859   6.792   8.810   1.00 0.25  ? 197 LEU A H    1 
ATOM   693  H HA   . LEU A 1 42  ? 7.406   8.026   10.916  1.00 0.31  ? 197 LEU A HA   1 
ATOM   694  H HB2  . LEU A 1 42  ? 9.718   6.142   10.754  1.00 0.33  ? 197 LEU A HB2  1 
ATOM   695  H HB3  . LEU A 1 42  ? 9.396   6.916   12.306  1.00 0.39  ? 197 LEU A HB3  1 
ATOM   696  H HG   . LEU A 1 42  ? 6.955   5.950   11.033  1.00 0.65  ? 197 LEU A HG   1 
ATOM   697  H HD11 . LEU A 1 42  ? 8.850   4.292   10.313  1.00 1.65  ? 197 LEU A HD11 1 
ATOM   698  H HD12 . LEU A 1 42  ? 8.797   3.780   12.000  1.00 1.77  ? 197 LEU A HD12 1 
ATOM   699  H HD13 . LEU A 1 42  ? 7.357   3.644   10.991  1.00 1.72  ? 197 LEU A HD13 1 
ATOM   700  H HD21 . LEU A 1 42  ? 7.270   6.668   13.421  1.00 1.68  ? 197 LEU A HD21 1 
ATOM   701  H HD22 . LEU A 1 42  ? 6.571   5.057   13.261  1.00 1.59  ? 197 LEU A HD22 1 
ATOM   702  H HD23 . LEU A 1 42  ? 8.277   5.242   13.669  1.00 1.77  ? 197 LEU A HD23 1 
ATOM   703  N N    . ASN A 1 43  ? 10.320  9.350   10.289  1.00 1.06  ? 198 ASN A N    1 
ATOM   704  C CA   . ASN A 1 43  ? 11.174  10.526  10.622  1.00 1.14  ? 198 ASN A CA   1 
ATOM   705  C C    . ASN A 1 43  ? 10.809  11.702  9.711   1.00 0.79  ? 198 ASN A C    1 
ATOM   706  O O    . ASN A 1 43  ? 11.658  12.464  9.291   1.00 0.96  ? 198 ASN A O    1 
ATOM   707  C CB   . ASN A 1 43  ? 12.646  10.156  10.422  1.00 1.49  ? 198 ASN A CB   1 
ATOM   708  C CG   . ASN A 1 43  ? 13.402  10.344  11.739  1.00 1.95  ? 198 ASN A CG   1 
ATOM   709  O OD1  . ASN A 1 43  ? 13.093  9.707   12.727  1.00 2.37  ? 198 ASN A OD1  1 
ATOM   710  N ND2  . ASN A 1 43  ? 14.385  11.200  11.797  1.00 2.59  ? 198 ASN A ND2  1 
ATOM   711  H H    . ASN A 1 43  ? 10.543  8.783   9.522   1.00 1.78  ? 198 ASN A H    1 
ATOM   712  H HA   . ASN A 1 43  ? 11.012  10.807  11.652  1.00 1.37  ? 198 ASN A HA   1 
ATOM   713  H HB2  . ASN A 1 43  ? 12.718  9.124   10.109  1.00 1.82  ? 198 ASN A HB2  1 
ATOM   714  H HB3  . ASN A 1 43  ? 13.081  10.792  9.667   1.00 1.61  ? 198 ASN A HB3  1 
ATOM   715  H HD21 . ASN A 1 43  ? 14.634  11.715  11.001  1.00 2.93  ? 198 ASN A HD21 1 
ATOM   716  H HD22 . ASN A 1 43  ? 14.875  11.328  12.636  1.00 3.03  ? 198 ASN A HD22 1 
ATOM   717  N N    . SER A 1 44  ? 9.551   11.858  9.403   1.00 0.89  ? 199 SER A N    1 
ATOM   718  C CA   . SER A 1 44  ? 9.134   12.986  8.523   1.00 0.67  ? 199 SER A CA   1 
ATOM   719  C C    . SER A 1 44  ? 7.897   13.663  9.114   1.00 0.93  ? 199 SER A C    1 
ATOM   720  O O    . SER A 1 44  ? 7.560   13.466  10.265  1.00 1.50  ? 199 SER A O    1 
ATOM   721  C CB   . SER A 1 44  ? 8.805   12.452  7.128   1.00 0.67  ? 199 SER A CB   1 
ATOM   722  O OG   . SER A 1 44  ? 9.022   13.479  6.169   1.00 1.44  ? 199 SER A OG   1 
ATOM   723  H H    . SER A 1 44  ? 8.881   11.236  9.753   1.00 1.34  ? 199 SER A H    1 
ATOM   724  H HA   . SER A 1 44  ? 9.938   13.704  8.453   1.00 0.77  ? 199 SER A HA   1 
ATOM   725  H HB2  . SER A 1 44  ? 9.442   11.614  6.901   1.00 1.01  ? 199 SER A HB2  1 
ATOM   726  H HB3  . SER A 1 44  ? 7.771   12.133  7.101   1.00 0.89  ? 199 SER A HB3  1 
ATOM   727  H HG   . SER A 1 44  ? 8.901   13.100  5.295   1.00 1.84  ? 199 SER A HG   1 
ATOM   728  N N    . GLU A 1 45  ? 7.217   14.460  8.337   1.00 0.96  ? 200 GLU A N    1 
ATOM   729  C CA   . GLU A 1 45  ? 6.002   15.149  8.855   1.00 1.44  ? 200 GLU A CA   1 
ATOM   730  C C    . GLU A 1 45  ? 4.866   15.008  7.840   1.00 1.09  ? 200 GLU A C    1 
ATOM   731  O O    . GLU A 1 45  ? 3.790   14.544  8.159   1.00 1.60  ? 200 GLU A O    1 
ATOM   732  C CB   . GLU A 1 45  ? 6.309   16.632  9.074   1.00 1.98  ? 200 GLU A CB   1 
ATOM   733  C CG   . GLU A 1 45  ? 6.429   16.914  10.574  1.00 2.78  ? 200 GLU A CG   1 
ATOM   734  C CD   . GLU A 1 45  ? 6.702   18.403  10.793  1.00 3.25  ? 200 GLU A CD   1 
ATOM   735  O OE1  . GLU A 1 45  ? 5.770   19.180  10.674  1.00 3.83  ? 200 GLU A OE1  1 
ATOM   736  O OE2  . GLU A 1 45  ? 7.840   18.740  11.078  1.00 3.54  ? 200 GLU A OE2  1 
ATOM   737  H H    . GLU A 1 45  ? 7.505   14.606  7.412   1.00 1.01  ? 200 GLU A H    1 
ATOM   738  H HA   . GLU A 1 45  ? 5.705   14.700  9.792   1.00 1.84  ? 200 GLU A HA   1 
ATOM   739  H HB2  . GLU A 1 45  ? 7.239   16.882  8.585   1.00 2.17  ? 200 GLU A HB2  1 
ATOM   740  H HB3  . GLU A 1 45  ? 5.511   17.230  8.661   1.00 2.10  ? 200 GLU A HB3  1 
ATOM   741  H HG2  . GLU A 1 45  ? 5.507   16.639  11.066  1.00 3.19  ? 200 GLU A HG2  1 
ATOM   742  H HG3  . GLU A 1 45  ? 7.243   16.336  10.985  1.00 3.18  ? 200 GLU A HG3  1 
ATOM   743  N N    . ALA A 1 46  ? 5.098   15.405  6.619   1.00 0.53  ? 201 ALA A N    1 
ATOM   744  C CA   . ALA A 1 46  ? 4.032   15.294  5.585   1.00 0.40  ? 201 ALA A CA   1 
ATOM   745  C C    . ALA A 1 46  ? 4.116   13.921  4.913   1.00 0.33  ? 201 ALA A C    1 
ATOM   746  O O    . ALA A 1 46  ? 5.127   13.250  4.977   1.00 0.36  ? 201 ALA A O    1 
ATOM   747  C CB   . ALA A 1 46  ? 4.224   16.389  4.535   1.00 0.58  ? 201 ALA A CB   1 
ATOM   748  H H    . ALA A 1 46  ? 5.973   15.777  6.383   1.00 0.77  ? 201 ALA A H    1 
ATOM   749  H HA   . ALA A 1 46  ? 3.064   15.407  6.051   1.00 0.66  ? 201 ALA A HA   1 
ATOM   750  H HB1  . ALA A 1 46  ? 5.213   16.812  4.632   1.00 1.16  ? 201 ALA A HB1  1 
ATOM   751  H HB2  . ALA A 1 46  ? 4.110   15.966  3.548   1.00 1.22  ? 201 ALA A HB2  1 
ATOM   752  H HB3  . ALA A 1 46  ? 3.486   17.163  4.682   1.00 1.24  ? 201 ALA A HB3  1 
ATOM   753  N N    . ALA A 1 47  ? 3.062   13.499  4.270   1.00 0.29  ? 202 ALA A N    1 
ATOM   754  C CA   . ALA A 1 47  ? 3.083   12.170  3.595   1.00 0.24  ? 202 ALA A CA   1 
ATOM   755  C C    . ALA A 1 47  ? 4.273   12.105  2.635   1.00 0.24  ? 202 ALA A C    1 
ATOM   756  O O    . ALA A 1 47  ? 4.737   13.111  2.137   1.00 0.31  ? 202 ALA A O    1 
ATOM   757  C CB   . ALA A 1 47  ? 1.783   11.975  2.812   1.00 0.27  ? 202 ALA A CB   1 
ATOM   758  H H    . ALA A 1 47  ? 2.256   14.056  4.231   1.00 0.33  ? 202 ALA A H    1 
ATOM   759  H HA   . ALA A 1 47  ? 3.176   11.392  4.338   1.00 0.25  ? 202 ALA A HA   1 
ATOM   760  H HB1  . ALA A 1 47  ? 1.074   12.740  3.095   1.00 1.07  ? 202 ALA A HB1  1 
ATOM   761  H HB2  . ALA A 1 47  ? 1.985   12.046  1.754   1.00 1.05  ? 202 ALA A HB2  1 
ATOM   762  H HB3  . ALA A 1 47  ? 1.370   11.003  3.036   1.00 1.04  ? 202 ALA A HB3  1 
ATOM   763  N N    . ALA A 1 48  ? 4.771   10.927  2.371   1.00 0.20  ? 203 ALA A N    1 
ATOM   764  C CA   . ALA A 1 48  ? 5.931   10.800  1.445   1.00 0.22  ? 203 ALA A CA   1 
ATOM   765  C C    . ALA A 1 48  ? 5.438   10.381  0.059   1.00 0.23  ? 203 ALA A C    1 
ATOM   766  O O    . ALA A 1 48  ? 5.646   11.071  -0.919  1.00 0.28  ? 203 ALA A O    1 
ATOM   767  C CB   . ALA A 1 48  ? 6.899   9.744   1.981   1.00 0.22  ? 203 ALA A CB   1 
ATOM   768  H H    . ALA A 1 48  ? 4.383   10.128  2.784   1.00 0.21  ? 203 ALA A H    1 
ATOM   769  H HA   . ALA A 1 48  ? 6.440   11.750  1.373   1.00 0.24  ? 203 ALA A HA   1 
ATOM   770  H HB1  . ALA A 1 48  ? 6.660   9.525   3.011   1.00 0.98  ? 203 ALA A HB1  1 
ATOM   771  H HB2  . ALA A 1 48  ? 6.811   8.842   1.392   1.00 1.03  ? 203 ALA A HB2  1 
ATOM   772  H HB3  . ALA A 1 48  ? 7.911   10.117  1.918   1.00 1.04  ? 203 ALA A HB3  1 
ATOM   773  N N    . VAL A 1 49  ? 4.786   9.254   -0.035  1.00 0.23  ? 204 VAL A N    1 
ATOM   774  C CA   . VAL A 1 49  ? 4.283   8.794   -1.360  1.00 0.25  ? 204 VAL A CA   1 
ATOM   775  C C    . VAL A 1 49  ? 2.773   8.563   -1.283  1.00 0.23  ? 204 VAL A C    1 
ATOM   776  O O    . VAL A 1 49  ? 2.317   7.494   -0.932  1.00 0.23  ? 204 VAL A O    1 
ATOM   777  C CB   . VAL A 1 49  ? 4.977   7.486   -1.742  1.00 0.29  ? 204 VAL A CB   1 
ATOM   778  C CG1  . VAL A 1 49  ? 4.801   7.231   -3.240  1.00 0.39  ? 204 VAL A CG1  1 
ATOM   779  C CG2  . VAL A 1 49  ? 6.468   7.587   -1.414  1.00 0.35  ? 204 VAL A CG2  1 
ATOM   780  H H    . VAL A 1 49  ? 4.629   8.710   0.765   1.00 0.24  ? 204 VAL A H    1 
ATOM   781  H HA   . VAL A 1 49  ? 4.495   9.545   -2.106  1.00 0.29  ? 204 VAL A HA   1 
ATOM   782  H HB   . VAL A 1 49  ? 4.538   6.670   -1.185  1.00 0.30  ? 204 VAL A HB   1 
ATOM   783  H HG11 . VAL A 1 49  ? 3.751   7.269   -3.491  1.00 1.06  ? 204 VAL A HG11 1 
ATOM   784  H HG12 . VAL A 1 49  ? 5.332   7.988   -3.798  1.00 1.07  ? 204 VAL A HG12 1 
ATOM   785  H HG13 . VAL A 1 49  ? 5.196   6.257   -3.488  1.00 1.13  ? 204 VAL A HG13 1 
ATOM   786  H HG21 . VAL A 1 49  ? 6.834   8.562   -1.702  1.00 1.06  ? 204 VAL A HG21 1 
ATOM   787  H HG22 . VAL A 1 49  ? 6.613   7.447   -0.353  1.00 1.13  ? 204 VAL A HG22 1 
ATOM   788  H HG23 . VAL A 1 49  ? 7.008   6.825   -1.955  1.00 1.06  ? 204 VAL A HG23 1 
ATOM   789  N N    . VAL A 1 50  ? 1.993   9.556   -1.610  1.00 0.25  ? 205 VAL A N    1 
ATOM   790  C CA   . VAL A 1 50  ? 0.515   9.385   -1.555  1.00 0.25  ? 205 VAL A CA   1 
ATOM   791  C C    . VAL A 1 50  ? 0.051   8.633   -2.802  1.00 0.23  ? 205 VAL A C    1 
ATOM   792  O O    . VAL A 1 50  ? -0.122  9.208   -3.858  1.00 0.29  ? 205 VAL A O    1 
ATOM   793  C CB   . VAL A 1 50  ? -0.159  10.757  -1.507  1.00 0.32  ? 205 VAL A CB   1 
ATOM   794  C CG1  . VAL A 1 50  ? -1.676  10.579  -1.420  1.00 0.47  ? 205 VAL A CG1  1 
ATOM   795  C CG2  . VAL A 1 50  ? 0.334   11.522  -0.277  1.00 0.40  ? 205 VAL A CG2  1 
ATOM   796  H H    . VAL A 1 50  ? 2.379   10.411  -1.893  1.00 0.28  ? 205 VAL A H    1 
ATOM   797  H HA   . VAL A 1 50  ? 0.249   8.821   -0.674  1.00 0.25  ? 205 VAL A HA   1 
ATOM   798  H HB   . VAL A 1 50  ? 0.088   11.311  -2.401  1.00 0.39  ? 205 VAL A HB   1 
ATOM   799  H HG11 . VAL A 1 50  ? -1.917  9.527   -1.444  1.00 1.07  ? 205 VAL A HG11 1 
ATOM   800  H HG12 . VAL A 1 50  ? -2.037  11.010  -0.498  1.00 1.15  ? 205 VAL A HG12 1 
ATOM   801  H HG13 . VAL A 1 50  ? -2.145  11.075  -2.257  1.00 1.20  ? 205 VAL A HG13 1 
ATOM   802  H HG21 . VAL A 1 50  ? 1.337   11.205  -0.034  1.00 1.13  ? 205 VAL A HG21 1 
ATOM   803  H HG22 . VAL A 1 50  ? 0.332   12.582  -0.487  1.00 1.01  ? 205 VAL A HG22 1 
ATOM   804  H HG23 . VAL A 1 50  ? -0.320  11.320  0.558   1.00 1.12  ? 205 VAL A HG23 1 
ATOM   805  N N    . LEU A 1 51  ? -0.149  7.350   -2.687  1.00 0.19  ? 206 LEU A N    1 
ATOM   806  C CA   . LEU A 1 51  ? -0.599  6.560   -3.865  1.00 0.19  ? 206 LEU A CA   1 
ATOM   807  C C    . LEU A 1 51  ? -2.101  6.305   -3.762  1.00 0.17  ? 206 LEU A C    1 
ATOM   808  O O    . LEU A 1 51  ? -2.752  6.742   -2.834  1.00 0.19  ? 206 LEU A O    1 
ATOM   809  C CB   . LEU A 1 51  ? 0.143   5.223   -3.896  1.00 0.21  ? 206 LEU A CB   1 
ATOM   810  C CG   . LEU A 1 51  ? 1.534   5.424   -4.498  1.00 0.27  ? 206 LEU A CG   1 
ATOM   811  C CD1  . LEU A 1 51  ? 2.578   4.752   -3.605  1.00 0.38  ? 206 LEU A CD1  1 
ATOM   812  C CD2  . LEU A 1 51  ? 1.579   4.799   -5.894  1.00 0.33  ? 206 LEU A CD2  1 
ATOM   813  H H    . LEU A 1 51  ? -0.002  6.906   -1.826  1.00 0.20  ? 206 LEU A H    1 
ATOM   814  H HA   . LEU A 1 51  ? -0.388  7.110   -4.771  1.00 0.24  ? 206 LEU A HA   1 
ATOM   815  H HB2  . LEU A 1 51  ? 0.237   4.841   -2.889  1.00 0.22  ? 206 LEU A HB2  1 
ATOM   816  H HB3  . LEU A 1 51  ? -0.409  4.518   -4.498  1.00 0.25  ? 206 LEU A HB3  1 
ATOM   817  H HG   . LEU A 1 51  ? 1.747   6.481   -4.567  1.00 0.36  ? 206 LEU A HG   1 
ATOM   818  H HD11 . LEU A 1 51  ? 2.474   5.116   -2.593  1.00 1.04  ? 206 LEU A HD11 1 
ATOM   819  H HD12 . LEU A 1 51  ? 2.429   3.682   -3.620  1.00 1.07  ? 206 LEU A HD12 1 
ATOM   820  H HD13 . LEU A 1 51  ? 3.567   4.983   -3.970  1.00 1.16  ? 206 LEU A HD13 1 
ATOM   821  H HD21 . LEU A 1 51  ? 0.612   4.900   -6.365  1.00 1.04  ? 206 LEU A HD21 1 
ATOM   822  H HD22 . LEU A 1 51  ? 2.324   5.304   -6.491  1.00 1.13  ? 206 LEU A HD22 1 
ATOM   823  H HD23 . LEU A 1 51  ? 1.832   3.752   -5.812  1.00 1.04  ? 206 LEU A HD23 1 
ATOM   824  N N    . GLN A 1 52  ? -2.657  5.601   -4.706  1.00 0.21  ? 207 GLN A N    1 
ATOM   825  C CA   . GLN A 1 52  ? -4.117  5.320   -4.658  1.00 0.20  ? 207 GLN A CA   1 
ATOM   826  C C    . GLN A 1 52  ? -4.354  3.820   -4.824  1.00 0.19  ? 207 GLN A C    1 
ATOM   827  O O    . GLN A 1 52  ? -3.637  3.143   -5.532  1.00 0.20  ? 207 GLN A O    1 
ATOM   828  C CB   . GLN A 1 52  ? -4.820  6.074   -5.787  1.00 0.24  ? 207 GLN A CB   1 
ATOM   829  C CG   . GLN A 1 52  ? -4.560  7.574   -5.640  1.00 0.83  ? 207 GLN A CG   1 
ATOM   830  C CD   . GLN A 1 52  ? -5.365  8.336   -6.693  1.00 0.91  ? 207 GLN A CD   1 
ATOM   831  O OE1  . GLN A 1 52  ? -6.232  7.776   -7.335  1.00 1.42  ? 207 GLN A OE1  1 
ATOM   832  N NE2  . GLN A 1 52  ? -5.113  9.600   -6.901  1.00 1.55  ? 207 GLN A NE2  1 
ATOM   833  H H    . GLN A 1 52  ? -2.115  5.256   -5.446  1.00 0.26  ? 207 GLN A H    1 
ATOM   834  H HA   . GLN A 1 52  ? -4.513  5.643   -3.709  1.00 0.20  ? 207 GLN A HA   1 
ATOM   835  H HB2  . GLN A 1 52  ? -4.439  5.733   -6.739  1.00 0.67  ? 207 GLN A HB2  1 
ATOM   836  H HB3  . GLN A 1 52  ? -5.882  5.889   -5.738  1.00 0.69  ? 207 GLN A HB3  1 
ATOM   837  H HG2  . GLN A 1 52  ? -4.860  7.896   -4.653  1.00 1.39  ? 207 GLN A HG2  1 
ATOM   838  H HG3  . GLN A 1 52  ? -3.508  7.772   -5.780  1.00 1.40  ? 207 GLN A HG3  1 
ATOM   839  H HE21 . GLN A 1 52  ? -4.414  10.052  -6.384  1.00 2.15  ? 207 GLN A HE21 1 
ATOM   840  H HE22 . GLN A 1 52  ? -5.624  10.097  -7.574  1.00 1.78  ? 207 GLN A HE22 1 
ATOM   841  N N    . LEU A 1 53  ? -5.356  3.295   -4.175  1.00 0.19  ? 208 LEU A N    1 
ATOM   842  C CA   . LEU A 1 53  ? -5.641  1.837   -4.298  1.00 0.21  ? 208 LEU A CA   1 
ATOM   843  C C    . LEU A 1 53  ? -6.131  1.529   -5.719  1.00 0.22  ? 208 LEU A C    1 
ATOM   844  O O    . LEU A 1 53  ? -5.992  0.425   -6.206  1.00 0.25  ? 208 LEU A O    1 
ATOM   845  C CB   . LEU A 1 53  ? -6.722  1.438   -3.290  1.00 0.22  ? 208 LEU A CB   1 
ATOM   846  C CG   . LEU A 1 53  ? -6.294  1.855   -1.882  1.00 0.22  ? 208 LEU A CG   1 
ATOM   847  C CD1  . LEU A 1 53  ? -7.531  1.997   -0.993  1.00 0.27  ? 208 LEU A CD1  1 
ATOM   848  C CD2  . LEU A 1 53  ? -5.367  0.788   -1.295  1.00 0.29  ? 208 LEU A CD2  1 
ATOM   849  H H    . LEU A 1 53  ? -5.922  3.860   -3.607  1.00 0.21  ? 208 LEU A H    1 
ATOM   850  H HA   . LEU A 1 53  ? -4.739  1.276   -4.100  1.00 0.22  ? 208 LEU A HA   1 
ATOM   851  H HB2  . LEU A 1 53  ? -7.650  1.929   -3.546  1.00 0.22  ? 208 LEU A HB2  1 
ATOM   852  H HB3  . LEU A 1 53  ? -6.862  0.367   -3.319  1.00 0.24  ? 208 LEU A HB3  1 
ATOM   853  H HG   . LEU A 1 53  ? -5.775  2.801   -1.927  1.00 0.22  ? 208 LEU A HG   1 
ATOM   854  H HD11 . LEU A 1 53  ? -8.349  2.397   -1.575  1.00 1.05  ? 208 LEU A HD11 1 
ATOM   855  H HD12 . LEU A 1 53  ? -7.807  1.029   -0.602  1.00 1.00  ? 208 LEU A HD12 1 
ATOM   856  H HD13 . LEU A 1 53  ? -7.311  2.667   -0.175  1.00 1.09  ? 208 LEU A HD13 1 
ATOM   857  H HD21 . LEU A 1 53  ? -4.521  0.646   -1.952  1.00 1.01  ? 208 LEU A HD21 1 
ATOM   858  H HD22 . LEU A 1 53  ? -5.019  1.109   -0.324  1.00 1.05  ? 208 LEU A HD22 1 
ATOM   859  H HD23 . LEU A 1 53  ? -5.906  -0.142  -1.196  1.00 1.08  ? 208 LEU A HD23 1 
ATOM   860  N N    . MET A 1 54  ? -6.707  2.494   -6.387  1.00 0.22  ? 209 MET A N    1 
ATOM   861  C CA   . MET A 1 54  ? -7.205  2.252   -7.773  1.00 0.24  ? 209 MET A CA   1 
ATOM   862  C C    . MET A 1 54  ? -6.029  2.050   -8.739  1.00 0.25  ? 209 MET A C    1 
ATOM   863  O O    . MET A 1 54  ? -6.208  1.597   -9.852  1.00 0.40  ? 209 MET A O    1 
ATOM   864  C CB   . MET A 1 54  ? -8.037  3.452   -8.230  1.00 0.28  ? 209 MET A CB   1 
ATOM   865  C CG   . MET A 1 54  ? -9.016  3.845   -7.123  1.00 0.29  ? 209 MET A CG   1 
ATOM   866  S SD   . MET A 1 54  ? -10.686 3.967   -7.811  1.00 0.47  ? 209 MET A SD   1 
ATOM   867  C CE   . MET A 1 54  ? -10.911 5.743   -7.549  1.00 1.62  ? 209 MET A CE   1 
ATOM   868  H H    . MET A 1 54  ? -6.813  3.379   -5.979  1.00 0.22  ? 209 MET A H    1 
ATOM   869  H HA   . MET A 1 54  ? -7.824  1.368   -7.777  1.00 0.26  ? 209 MET A HA   1 
ATOM   870  H HB2  . MET A 1 54  ? -7.381  4.283   -8.444  1.00 0.28  ? 209 MET A HB2  1 
ATOM   871  H HB3  . MET A 1 54  ? -8.589  3.189   -9.119  1.00 0.32  ? 209 MET A HB3  1 
ATOM   872  H HG2  . MET A 1 54  ? -9.001  3.096   -6.345  1.00 0.32  ? 209 MET A HG2  1 
ATOM   873  H HG3  . MET A 1 54  ? -8.727  4.800   -6.708  1.00 0.35  ? 209 MET A HG3  1 
ATOM   874  H HE1  . MET A 1 54  ? -9.984  6.258   -7.747  1.00 2.21  ? 209 MET A HE1  1 
ATOM   875  H HE2  . MET A 1 54  ? -11.675 6.111   -8.219  1.00 2.10  ? 209 MET A HE2  1 
ATOM   876  H HE3  . MET A 1 54  ? -11.207 5.920   -6.524  1.00 2.23  ? 209 MET A HE3  1 
ATOM   877  N N    . ASN A 1 55  ? -4.830  2.380   -8.334  1.00 0.21  ? 210 ASN A N    1 
ATOM   878  C CA   . ASN A 1 55  ? -3.659  2.201   -9.240  1.00 0.22  ? 210 ASN A CA   1 
ATOM   879  C C    . ASN A 1 55  ? -2.854  0.961   -8.824  1.00 0.23  ? 210 ASN A C    1 
ATOM   880  O O    . ASN A 1 55  ? -2.037  0.466   -9.576  1.00 0.43  ? 210 ASN A O    1 
ATOM   881  C CB   . ASN A 1 55  ? -2.765  3.440   -9.162  1.00 0.25  ? 210 ASN A CB   1 
ATOM   882  C CG   . ASN A 1 55  ? -3.620  4.697   -9.333  1.00 0.75  ? 210 ASN A CG   1 
ATOM   883  O OD1  . ASN A 1 55  ? -3.369  5.706   -8.704  1.00 1.20  ? 210 ASN A OD1  1 
ATOM   884  N ND2  . ASN A 1 55  ? -4.626  4.682   -10.166 1.00 1.69  ? 210 ASN A ND2  1 
ATOM   885  H H    . ASN A 1 55  ? -4.697  2.746   -7.438  1.00 0.29  ? 210 ASN A H    1 
ATOM   886  H HA   . ASN A 1 55  ? -4.007  2.077   -10.254 1.00 0.25  ? 210 ASN A HA   1 
ATOM   887  H HB2  . ASN A 1 55  ? -2.269  3.467   -8.202  1.00 0.64  ? 210 ASN A HB2  1 
ATOM   888  H HB3  . ASN A 1 55  ? -2.025  3.400   -9.948  1.00 0.45  ? 210 ASN A HB3  1 
ATOM   889  H HD21 . ASN A 1 55  ? -4.828  3.870   -10.676 1.00 2.26  ? 210 ASN A HD21 1 
ATOM   890  H HD22 . ASN A 1 55  ? -5.179  5.483   -10.281 1.00 2.06  ? 210 ASN A HD22 1 
ATOM   891  N N    . ILE A 1 56  ? -3.071  0.450   -7.638  1.00 0.23  ? 211 ILE A N    1 
ATOM   892  C CA   . ILE A 1 56  ? -2.311  -0.754  -7.197  1.00 0.22  ? 211 ILE A CA   1 
ATOM   893  C C    . ILE A 1 56  ? -2.858  -1.992  -7.909  1.00 0.23  ? 211 ILE A C    1 
ATOM   894  O O    . ILE A 1 56  ? -3.981  -2.401  -7.688  1.00 0.30  ? 211 ILE A O    1 
ATOM   895  C CB   . ILE A 1 56  ? -2.464  -0.928  -5.683  1.00 0.24  ? 211 ILE A CB   1 
ATOM   896  C CG1  . ILE A 1 56  ? -1.646  0.145   -4.959  1.00 0.34  ? 211 ILE A CG1  1 
ATOM   897  C CG2  . ILE A 1 56  ? -1.959  -2.313  -5.272  1.00 0.27  ? 211 ILE A CG2  1 
ATOM   898  C CD1  . ILE A 1 56  ? -2.146  0.284   -3.520  1.00 0.55  ? 211 ILE A CD1  1 
ATOM   899  H H    . ILE A 1 56  ? -3.730  0.855   -7.039  1.00 0.40  ? 211 ILE A H    1 
ATOM   900  H HA   . ILE A 1 56  ? -1.266  -0.631  -7.441  1.00 0.21  ? 211 ILE A HA   1 
ATOM   901  H HB   . ILE A 1 56  ? -3.506  -0.832  -5.414  1.00 0.30  ? 211 ILE A HB   1 
ATOM   902  H HG12 . ILE A 1 56  ? -0.604  -0.140  -4.953  1.00 0.75  ? 211 ILE A HG12 1 
ATOM   903  H HG13 . ILE A 1 56  ? -1.758  1.089   -5.470  1.00 0.64  ? 211 ILE A HG13 1 
ATOM   904  H HG21 . ILE A 1 56  ? -0.960  -2.460  -5.655  1.00 1.04  ? 211 ILE A HG21 1 
ATOM   905  H HG22 . ILE A 1 56  ? -1.946  -2.386  -4.195  1.00 1.01  ? 211 ILE A HG22 1 
ATOM   906  H HG23 . ILE A 1 56  ? -2.614  -3.070  -5.676  1.00 1.07  ? 211 ILE A HG23 1 
ATOM   907  H HD11 . ILE A 1 56  ? -3.209  0.093   -3.488  1.00 1.22  ? 211 ILE A HD11 1 
ATOM   908  H HD12 . ILE A 1 56  ? -1.633  -0.428  -2.890  1.00 1.17  ? 211 ILE A HD12 1 
ATOM   909  H HD13 . ILE A 1 56  ? -1.949  1.285   -3.165  1.00 1.22  ? 211 ILE A HD13 1 
ATOM   910  N N    . ARG A 1 57  ? -2.074  -2.594  -8.761  1.00 0.20  ? 212 ARG A N    1 
ATOM   911  C CA   . ARG A 1 57  ? -2.557  -3.809  -9.481  1.00 0.23  ? 212 ARG A CA   1 
ATOM   912  C C    . ARG A 1 57  ? -2.975  -4.856  -8.453  1.00 0.24  ? 212 ARG A C    1 
ATOM   913  O O    . ARG A 1 57  ? -4.046  -5.424  -8.523  1.00 0.29  ? 212 ARG A O    1 
ATOM   914  C CB   . ARG A 1 57  ? -1.436  -4.397  -10.347 1.00 0.23  ? 212 ARG A CB   1 
ATOM   915  C CG   . ARG A 1 57  ? -0.716  -3.283  -11.109 1.00 0.22  ? 212 ARG A CG   1 
ATOM   916  C CD   . ARG A 1 57  ? 0.066   -3.887  -12.276 1.00 0.28  ? 212 ARG A CD   1 
ATOM   917  N NE   . ARG A 1 57  ? -0.808  -3.954  -13.481 1.00 1.36  ? 212 ARG A NE   1 
ATOM   918  C CZ   . ARG A 1 57  ? -0.313  -4.337  -14.626 1.00 1.70  ? 212 ARG A CZ   1 
ATOM   919  N NH1  . ARG A 1 57  ? 0.534   -5.329  -14.672 1.00 2.27  ? 212 ARG A NH1  1 
ATOM   920  N NH2  . ARG A 1 57  ? -0.666  -3.729  -15.725 1.00 2.12  ? 212 ARG A NH2  1 
ATOM   921  H H    . ARG A 1 57  ? -1.173  -2.249  -8.921  1.00 0.18  ? 212 ARG A H    1 
ATOM   922  H HA   . ARG A 1 57  ? -3.401  -3.552  -10.104 1.00 0.27  ? 212 ARG A HA   1 
ATOM   923  H HB2  . ARG A 1 57  ? -0.729  -4.913  -9.712  1.00 0.22  ? 212 ARG A HB2  1 
ATOM   924  H HB3  . ARG A 1 57  ? -1.859  -5.096  -11.053 1.00 0.27  ? 212 ARG A HB3  1 
ATOM   925  H HG2  . ARG A 1 57  ? -1.442  -2.577  -11.484 1.00 0.25  ? 212 ARG A HG2  1 
ATOM   926  H HG3  . ARG A 1 57  ? -0.032  -2.778  -10.444 1.00 0.26  ? 212 ARG A HG3  1 
ATOM   927  H HD2  . ARG A 1 57  ? 0.927   -3.270  -12.490 1.00 1.03  ? 212 ARG A HD2  1 
ATOM   928  H HD3  . ARG A 1 57  ? 0.393   -4.882  -12.013 1.00 1.01  ? 212 ARG A HD3  1 
ATOM   929  H HE   . ARG A 1 57  ? -1.755  -3.710  -13.413 1.00 2.06  ? 212 ARG A HE   1 
ATOM   930  H HH11 . ARG A 1 57  ? 0.805   -5.795  -13.830 1.00 2.70  ? 212 ARG A HH11 1 
ATOM   931  H HH12 . ARG A 1 57  ? 0.914   -5.622  -15.550 1.00 2.58  ? 212 ARG A HH12 1 
ATOM   932  H HH21 . ARG A 1 57  ? -1.315  -2.969  -15.690 1.00 2.47  ? 212 ARG A HH21 1 
ATOM   933  H HH22 . ARG A 1 57  ? -0.286  -4.022  -16.602 1.00 2.46  ? 212 ARG A HH22 1 
ATOM   934  N N    . ARG A 1 58  ? -2.126  -5.114  -7.499  1.00 0.22  ? 213 ARG A N    1 
ATOM   935  C CA   . ARG A 1 58  ? -2.453  -6.126  -6.457  1.00 0.25  ? 213 ARG A CA   1 
ATOM   936  C C    . ARG A 1 58  ? -1.546  -5.913  -5.243  1.00 0.25  ? 213 ARG A C    1 
ATOM   937  O O    . ARG A 1 58  ? -0.663  -5.079  -5.256  1.00 0.37  ? 213 ARG A O    1 
ATOM   938  C CB   . ARG A 1 58  ? -2.227  -7.529  -7.024  1.00 0.27  ? 213 ARG A CB   1 
ATOM   939  C CG   . ARG A 1 58  ? -0.915  -7.565  -7.811  1.00 0.28  ? 213 ARG A CG   1 
ATOM   940  C CD   . ARG A 1 58  ? -0.737  -8.947  -8.442  1.00 0.34  ? 213 ARG A CD   1 
ATOM   941  N NE   . ARG A 1 58  ? 0.394   -8.909  -9.412  1.00 1.01  ? 213 ARG A NE   1 
ATOM   942  C CZ   . ARG A 1 58  ? 0.403   -9.718  -10.436 1.00 1.44  ? 213 ARG A CZ   1 
ATOM   943  N NH1  . ARG A 1 58  ? -0.089  -10.922 -10.320 1.00 1.96  ? 213 ARG A NH1  1 
ATOM   944  N NH2  . ARG A 1 58  ? 0.903   -9.324  -11.575 1.00 2.20  ? 213 ARG A NH2  1 
ATOM   945  H H    . ARG A 1 58  ? -1.266  -4.640  -7.471  1.00 0.21  ? 213 ARG A H    1 
ATOM   946  H HA   . ARG A 1 58  ? -3.485  -6.021  -6.159  1.00 0.26  ? 213 ARG A HA   1 
ATOM   947  H HB2  . ARG A 1 58  ? -2.177  -8.238  -6.214  1.00 0.30  ? 213 ARG A HB2  1 
ATOM   948  H HB3  . ARG A 1 58  ? -3.044  -7.788  -7.680  1.00 0.31  ? 213 ARG A HB3  1 
ATOM   949  H HG2  . ARG A 1 58  ? -0.940  -6.814  -8.587  1.00 0.36  ? 213 ARG A HG2  1 
ATOM   950  H HG3  . ARG A 1 58  ? -0.090  -7.367  -7.144  1.00 0.33  ? 213 ARG A HG3  1 
ATOM   951  H HD2  . ARG A 1 58  ? -0.525  -9.671  -7.670  1.00 0.86  ? 213 ARG A HD2  1 
ATOM   952  H HD3  . ARG A 1 58  ? -1.644  -9.226  -8.958  1.00 0.88  ? 213 ARG A HD3  1 
ATOM   953  H HE   . ARG A 1 58  ? 1.131   -8.277  -9.280  1.00 1.64  ? 213 ARG A HE   1 
ATOM   954  H HH11 . ARG A 1 58  ? -0.472  -11.224 -9.447  1.00 2.33  ? 213 ARG A HH11 1 
ATOM   955  H HH12 . ARG A 1 58  ? -0.083  -11.542 -11.105 1.00 2.42  ? 213 ARG A HH12 1 
ATOM   956  H HH21 . ARG A 1 58  ? 1.279   -8.402  -11.663 1.00 2.63  ? 213 ARG A HH21 1 
ATOM   957  H HH22 . ARG A 1 58  ? 0.909   -9.944  -12.359 1.00 2.69  ? 213 ARG A HH22 1 
ATOM   958  N N    . CYS A 1 59  ? -1.755  -6.661  -4.197  1.00 0.26  ? 214 CYS A N    1 
ATOM   959  C CA   . CYS A 1 59  ? -0.904  -6.503  -2.984  1.00 0.27  ? 214 CYS A CA   1 
ATOM   960  C C    . CYS A 1 59  ? -0.673  -7.878  -2.357  1.00 0.35  ? 214 CYS A C    1 
ATOM   961  O O    . CYS A 1 59  ? -1.604  -8.561  -1.979  1.00 1.01  ? 214 CYS A O    1 
ATOM   962  C CB   . CYS A 1 59  ? -1.604  -5.588  -1.978  1.00 0.42  ? 214 CYS A CB   1 
ATOM   963  S SG   . CYS A 1 59  ? -3.363  -5.473  -2.389  1.00 1.06  ? 214 CYS A SG   1 
ATOM   964  H H    . CYS A 1 59  ? -2.473  -7.328  -4.208  1.00 0.36  ? 214 CYS A H    1 
ATOM   965  H HA   . CYS A 1 59  ? 0.046   -6.072  -3.265  1.00 0.36  ? 214 CYS A HA   1 
ATOM   966  H HB2  . CYS A 1 59  ? -1.492  -5.993  -0.984  1.00 0.26  ? 214 CYS A HB2  1 
ATOM   967  H HB3  . CYS A 1 59  ? -1.160  -4.605  -2.018  1.00 0.76  ? 214 CYS A HB3  1 
ATOM   968  H HG   . CYS A 1 59  ? -3.838  -6.104  -1.844  1.00 1.40  ? 214 CYS A HG   1 
ATOM   969  N N    . GLY A 1 60  ? 0.559   -8.293  -2.250  1.00 0.41  ? 215 GLY A N    1 
ATOM   970  C CA   . GLY A 1 60  ? 0.838   -9.629  -1.655  1.00 0.32  ? 215 GLY A CA   1 
ATOM   971  C C    . GLY A 1 60  ? 1.452   -9.482  -0.262  1.00 0.29  ? 215 GLY A C    1 
ATOM   972  O O    . GLY A 1 60  ? 2.180   -8.549  0.023   1.00 0.39  ? 215 GLY A O    1 
ATOM   973  H H    . GLY A 1 60  ? 1.296   -7.731  -2.566  1.00 0.94  ? 215 GLY A H    1 
ATOM   974  H HA2  . GLY A 1 60  ? -0.086  -10.179 -1.576  1.00 0.29  ? 215 GLY A HA2  1 
ATOM   975  H HA3  . GLY A 1 60  ? 1.523   -10.168 -2.290  1.00 0.49  ? 215 GLY A HA3  1 
ATOM   976  N N    . HIS A 1 61  ? 1.157   -10.414 0.602   1.00 0.29  ? 216 HIS A N    1 
ATOM   977  C CA   . HIS A 1 61  ? 1.703   -10.373 1.986   1.00 0.31  ? 216 HIS A CA   1 
ATOM   978  C C    . HIS A 1 61  ? 2.300   -11.744 2.305   1.00 0.34  ? 216 HIS A C    1 
ATOM   979  O O    . HIS A 1 61  ? 1.800   -12.478 3.133   1.00 0.40  ? 216 HIS A O    1 
ATOM   980  C CB   . HIS A 1 61  ? 0.584   -10.034 2.984   1.00 0.37  ? 216 HIS A CB   1 
ATOM   981  C CG   . HIS A 1 61  ? -0.700  -10.731 2.599   1.00 0.46  ? 216 HIS A CG   1 
ATOM   982  N ND1  . HIS A 1 61  ? -1.372  -10.463 1.414   1.00 0.53  ? 216 HIS A ND1  1 
ATOM   983  C CD2  . HIS A 1 61  ? -1.449  -11.687 3.241   1.00 1.54  ? 216 HIS A CD2  1 
ATOM   984  C CE1  . HIS A 1 61  ? -2.466  -11.245 1.381   1.00 0.46  ? 216 HIS A CE1  1 
ATOM   985  N NE2  . HIS A 1 61  ? -2.560  -12.011 2.469   1.00 1.52  ? 216 HIS A NE2  1 
ATOM   986  H H    . HIS A 1 61  ? 0.572   -11.153 0.335   1.00 0.37  ? 216 HIS A H    1 
ATOM   987  H HA   . HIS A 1 61  ? 2.478   -9.627  2.043   1.00 0.31  ? 216 HIS A HA   1 
ATOM   988  H HB2  . HIS A 1 61  ? 0.879   -10.354 3.972   1.00 0.60  ? 216 HIS A HB2  1 
ATOM   989  H HB3  . HIS A 1 61  ? 0.422   -8.966  2.989   1.00 0.61  ? 216 HIS A HB3  1 
ATOM   990  H HD1  . HIS A 1 61  ? -1.101  -9.819  0.728   1.00 1.35  ? 216 HIS A HD1  1 
ATOM   991  H HD2  . HIS A 1 61  ? -1.226  -12.101 4.211   1.00 2.33  ? 216 HIS A HD2  1 
ATOM   992  H HE1  . HIS A 1 61  ? -3.188  -11.245 0.579   1.00 0.39  ? 216 HIS A HE1  1 
ATOM   993  N N    . SER A 1 62  ? 3.369   -12.088 1.637   1.00 0.32  ? 217 SER A N    1 
ATOM   994  C CA   . SER A 1 62  ? 4.020   -13.409 1.867   1.00 0.36  ? 217 SER A CA   1 
ATOM   995  C C    . SER A 1 62  ? 4.562   -13.500 3.291   1.00 0.38  ? 217 SER A C    1 
ATOM   996  O O    . SER A 1 62  ? 5.691   -13.148 3.550   1.00 0.57  ? 217 SER A O    1 
ATOM   997  C CB   . SER A 1 62  ? 5.177   -13.572 0.882   1.00 0.41  ? 217 SER A CB   1 
ATOM   998  O OG   . SER A 1 62  ? 5.667   -14.904 0.952   1.00 1.40  ? 217 SER A OG   1 
ATOM   999  H H    . SER A 1 62  ? 3.743   -11.474 0.972   1.00 0.30  ? 217 SER A H    1 
ATOM   1000 H HA   . SER A 1 62  ? 3.300   -14.197 1.705   1.00 0.40  ? 217 SER A HA   1 
ATOM   1001 H HB2  . SER A 1 62  ? 4.833   -13.370 -0.119  1.00 0.92  ? 217 SER A HB2  1 
ATOM   1002 H HB3  . SER A 1 62  ? 5.963   -12.874 1.136   1.00 0.97  ? 217 SER A HB3  1 
ATOM   1003 H HG   . SER A 1 62  ? 6.617   -14.878 0.817   1.00 1.86  ? 217 SER A HG   1 
ATOM   1004 N N    . GLU A 1 63  ? 3.770   -13.978 4.211   1.00 0.36  ? 218 GLU A N    1 
ATOM   1005 C CA   . GLU A 1 63  ? 4.238   -14.103 5.623   1.00 0.37  ? 218 GLU A CA   1 
ATOM   1006 C C    . GLU A 1 63  ? 4.534   -12.715 6.210   1.00 0.35  ? 218 GLU A C    1 
ATOM   1007 O O    . GLU A 1 63  ? 3.676   -12.100 6.808   1.00 0.40  ? 218 GLU A O    1 
ATOM   1008 C CB   . GLU A 1 63  ? 5.497   -14.977 5.672   1.00 0.38  ? 218 GLU A CB   1 
ATOM   1009 C CG   . GLU A 1 63  ? 5.125   -16.378 6.161   1.00 0.45  ? 218 GLU A CG   1 
ATOM   1010 C CD   . GLU A 1 63  ? 5.966   -17.418 5.420   1.00 1.18  ? 218 GLU A CD   1 
ATOM   1011 O OE1  . GLU A 1 63  ? 7.154   -17.189 5.266   1.00 1.98  ? 218 GLU A OE1  1 
ATOM   1012 O OE2  . GLU A 1 63  ? 5.408   -18.427 5.021   1.00 1.84  ? 218 GLU A OE2  1 
ATOM   1013 H H    . GLU A 1 63  ? 2.863   -14.263 3.972   1.00 0.49  ? 218 GLU A H    1 
ATOM   1014 H HA   . GLU A 1 63  ? 3.461   -14.572 6.209   1.00 0.40  ? 218 GLU A HA   1 
ATOM   1015 H HB2  . GLU A 1 63  ? 5.933   -15.042 4.686   1.00 0.38  ? 218 GLU A HB2  1 
ATOM   1016 H HB3  . GLU A 1 63  ? 6.210   -14.539 6.351   1.00 0.37  ? 218 GLU A HB3  1 
ATOM   1017 H HG2  . GLU A 1 63  ? 5.313   -16.450 7.222   1.00 0.88  ? 218 GLU A HG2  1 
ATOM   1018 H HG3  . GLU A 1 63  ? 4.078   -16.560 5.967   1.00 1.02  ? 218 GLU A HG3  1 
ATOM   1019 N N    . ASN A 1 64  ? 5.735   -12.212 6.057   1.00 0.32  ? 219 ASN A N    1 
ATOM   1020 C CA   . ASN A 1 64  ? 6.056   -10.868 6.620   1.00 0.34  ? 219 ASN A CA   1 
ATOM   1021 C C    . ASN A 1 64  ? 6.282   -9.857  5.490   1.00 0.31  ? 219 ASN A C    1 
ATOM   1022 O O    . ASN A 1 64  ? 6.178   -8.663  5.688   1.00 0.37  ? 219 ASN A O    1 
ATOM   1023 C CB   . ASN A 1 64  ? 7.326   -10.967 7.463   1.00 0.38  ? 219 ASN A CB   1 
ATOM   1024 C CG   . ASN A 1 64  ? 8.532   -11.161 6.543   1.00 0.39  ? 219 ASN A CG   1 
ATOM   1025 O OD1  . ASN A 1 64  ? 8.969   -10.234 5.891   1.00 0.96  ? 219 ASN A OD1  1 
ATOM   1026 N ND2  . ASN A 1 64  ? 9.091   -12.337 6.461   1.00 1.13  ? 219 ASN A ND2  1 
ATOM   1027 H H    . ASN A 1 64  ? 6.425   -12.714 5.579   1.00 0.31  ? 219 ASN A H    1 
ATOM   1028 H HA   . ASN A 1 64  ? 5.239   -10.535 7.242   1.00 0.37  ? 219 ASN A HA   1 
ATOM   1029 H HB2  . ASN A 1 64  ? 7.450   -10.060 8.037   1.00 0.44  ? 219 ASN A HB2  1 
ATOM   1030 H HB3  . ASN A 1 64  ? 7.247   -11.810 8.131   1.00 0.40  ? 219 ASN A HB3  1 
ATOM   1031 H HD21 . ASN A 1 64  ? 8.737   -13.085 6.985   1.00 1.83  ? 219 ASN A HD21 1 
ATOM   1032 H HD22 . ASN A 1 64  ? 9.864   -12.472 5.873   1.00 1.18  ? 219 ASN A HD22 1 
ATOM   1033 N N    . PHE A 1 65  ? 6.595   -10.318 4.309   1.00 0.28  ? 220 PHE A N    1 
ATOM   1034 C CA   . PHE A 1 65  ? 6.830   -9.372  3.182   1.00 0.28  ? 220 PHE A CA   1 
ATOM   1035 C C    . PHE A 1 65  ? 5.489   -8.885  2.630   1.00 0.26  ? 220 PHE A C    1 
ATOM   1036 O O    . PHE A 1 65  ? 4.727   -9.638  2.052   1.00 0.28  ? 220 PHE A O    1 
ATOM   1037 C CB   . PHE A 1 65  ? 7.616   -10.079 2.075   1.00 0.29  ? 220 PHE A CB   1 
ATOM   1038 C CG   . PHE A 1 65  ? 9.005   -10.395 2.576   1.00 0.32  ? 220 PHE A CG   1 
ATOM   1039 C CD1  . PHE A 1 65  ? 9.897   -9.359  2.873   1.00 1.25  ? 220 PHE A CD1  1 
ATOM   1040 C CD2  . PHE A 1 65  ? 9.395   -11.728 2.753   1.00 1.25  ? 220 PHE A CD2  1 
ATOM   1041 C CE1  . PHE A 1 65  ? 11.180  -9.656  3.345   1.00 1.27  ? 220 PHE A CE1  1 
ATOM   1042 C CE2  . PHE A 1 65  ? 10.677  -12.025 3.226   1.00 1.26  ? 220 PHE A CE2  1 
ATOM   1043 C CZ   . PHE A 1 65  ? 11.570  -10.989 3.522   1.00 0.41  ? 220 PHE A CZ   1 
ATOM   1044 H H    . PHE A 1 65  ? 6.681   -11.280 4.166   1.00 0.30  ? 220 PHE A H    1 
ATOM   1045 H HA   . PHE A 1 65  ? 7.397   -8.527  3.539   1.00 0.30  ? 220 PHE A HA   1 
ATOM   1046 H HB2  . PHE A 1 65  ? 7.114   -10.995 1.803   1.00 0.30  ? 220 PHE A HB2  1 
ATOM   1047 H HB3  . PHE A 1 65  ? 7.683   -9.436  1.211   1.00 0.31  ? 220 PHE A HB3  1 
ATOM   1048 H HD1  . PHE A 1 65  ? 9.596   -8.331  2.736   1.00 2.15  ? 220 PHE A HD1  1 
ATOM   1049 H HD2  . PHE A 1 65  ? 8.705   -12.527 2.524   1.00 2.16  ? 220 PHE A HD2  1 
ATOM   1050 H HE1  . PHE A 1 65  ? 11.870  -8.857  3.574   1.00 2.17  ? 220 PHE A HE1  1 
ATOM   1051 H HE2  . PHE A 1 65  ? 10.978  -13.053 3.363   1.00 2.17  ? 220 PHE A HE2  1 
ATOM   1052 H HZ   . PHE A 1 65  ? 12.560  -11.218 3.888   1.00 0.45  ? 220 PHE A HZ   1 
ATOM   1053 N N    . PHE A 1 66  ? 5.203   -7.623  2.807   1.00 0.29  ? 221 PHE A N    1 
ATOM   1054 C CA   . PHE A 1 66  ? 3.919   -7.061  2.299   1.00 0.28  ? 221 PHE A CA   1 
ATOM   1055 C C    . PHE A 1 66  ? 4.212   -6.144  1.117   1.00 0.27  ? 221 PHE A C    1 
ATOM   1056 O O    . PHE A 1 66  ? 4.272   -4.938  1.253   1.00 0.37  ? 221 PHE A O    1 
ATOM   1057 C CB   . PHE A 1 66  ? 3.237   -6.262  3.412   1.00 0.32  ? 221 PHE A CB   1 
ATOM   1058 C CG   . PHE A 1 66  ? 2.040   -5.533  2.850   1.00 0.31  ? 221 PHE A CG   1 
ATOM   1059 C CD1  . PHE A 1 66  ? 1.146   -6.201  2.005   1.00 1.23  ? 221 PHE A CD1  1 
ATOM   1060 C CD2  . PHE A 1 66  ? 1.825   -4.188  3.173   1.00 1.26  ? 221 PHE A CD2  1 
ATOM   1061 C CE1  . PHE A 1 66  ? 0.037   -5.525  1.483   1.00 1.25  ? 221 PHE A CE1  1 
ATOM   1062 C CE2  . PHE A 1 66  ? 0.716   -3.511  2.651   1.00 1.27  ? 221 PHE A CE2  1 
ATOM   1063 C CZ   . PHE A 1 66  ? -0.178  -4.180  1.806   1.00 0.38  ? 221 PHE A CZ   1 
ATOM   1064 H H    . PHE A 1 66  ? 5.841   -7.040  3.275   1.00 0.35  ? 221 PHE A H    1 
ATOM   1065 H HA   . PHE A 1 66  ? 3.273   -7.862  1.981   1.00 0.28  ? 221 PHE A HA   1 
ATOM   1066 H HB2  . PHE A 1 66  ? 2.914   -6.935  4.193   1.00 0.34  ? 221 PHE A HB2  1 
ATOM   1067 H HB3  . PHE A 1 66  ? 3.934   -5.546  3.819   1.00 0.36  ? 221 PHE A HB3  1 
ATOM   1068 H HD1  . PHE A 1 66  ? 1.312   -7.239  1.755   1.00 2.14  ? 221 PHE A HD1  1 
ATOM   1069 H HD2  . PHE A 1 66  ? 2.514   -3.672  3.825   1.00 2.18  ? 221 PHE A HD2  1 
ATOM   1070 H HE1  . PHE A 1 66  ? -0.652  -6.040  0.831   1.00 2.16  ? 221 PHE A HE1  1 
ATOM   1071 H HE2  . PHE A 1 66  ? 0.550   -2.474  2.901   1.00 2.17  ? 221 PHE A HE2  1 
ATOM   1072 H HZ   . PHE A 1 66  ? -1.034  -3.658  1.404   1.00 0.43  ? 221 PHE A HZ   1 
ATOM   1073 N N    . PHE A 1 67  ? 4.402   -6.701  -0.045  1.00 0.22  ? 222 PHE A N    1 
ATOM   1074 C CA   . PHE A 1 67  ? 4.700   -5.848  -1.224  1.00 0.22  ? 222 PHE A CA   1 
ATOM   1075 C C    . PHE A 1 67  ? 3.402   -5.400  -1.890  1.00 0.22  ? 222 PHE A C    1 
ATOM   1076 O O    . PHE A 1 67  ? 2.354   -5.979  -1.687  1.00 0.27  ? 222 PHE A O    1 
ATOM   1077 C CB   . PHE A 1 67  ? 5.554   -6.631  -2.223  1.00 0.21  ? 222 PHE A CB   1 
ATOM   1078 C CG   . PHE A 1 67  ? 4.719   -7.701  -2.883  1.00 0.25  ? 222 PHE A CG   1 
ATOM   1079 C CD1  . PHE A 1 67  ? 3.982   -7.402  -4.036  1.00 1.26  ? 222 PHE A CD1  1 
ATOM   1080 C CD2  . PHE A 1 67  ? 4.686   -8.993  -2.346  1.00 1.20  ? 222 PHE A CD2  1 
ATOM   1081 C CE1  . PHE A 1 67  ? 3.211   -8.395  -4.650  1.00 1.30  ? 222 PHE A CE1  1 
ATOM   1082 C CE2  . PHE A 1 67  ? 3.916   -9.986  -2.961  1.00 1.22  ? 222 PHE A CE2  1 
ATOM   1083 C CZ   . PHE A 1 67  ? 3.178   -9.688  -4.113  1.00 0.45  ? 222 PHE A CZ   1 
ATOM   1084 H H    . PHE A 1 67  ? 4.353   -7.676  -0.139  1.00 0.25  ? 222 PHE A H    1 
ATOM   1085 H HA   . PHE A 1 67  ? 5.245   -4.980  -0.896  1.00 0.23  ? 222 PHE A HA   1 
ATOM   1086 H HB2  . PHE A 1 67  ? 5.935   -5.956  -2.977  1.00 0.24  ? 222 PHE A HB2  1 
ATOM   1087 H HB3  . PHE A 1 67  ? 6.381   -7.092  -1.704  1.00 0.24  ? 222 PHE A HB3  1 
ATOM   1088 H HD1  . PHE A 1 67  ? 4.007   -6.405  -4.450  1.00 2.17  ? 222 PHE A HD1  1 
ATOM   1089 H HD2  . PHE A 1 67  ? 5.255   -9.223  -1.457  1.00 2.11  ? 222 PHE A HD2  1 
ATOM   1090 H HE1  . PHE A 1 67  ? 2.641   -8.165  -5.538  1.00 2.21  ? 222 PHE A HE1  1 
ATOM   1091 H HE2  . PHE A 1 67  ? 3.890   -10.983 -2.547  1.00 2.13  ? 222 PHE A HE2  1 
ATOM   1092 H HZ   . PHE A 1 67  ? 2.585   -10.454 -4.587  1.00 0.55  ? 222 PHE A HZ   1 
ATOM   1093 N N    . ILE A 1 68  ? 3.465   -4.368  -2.685  1.00 0.20  ? 223 ILE A N    1 
ATOM   1094 C CA   . ILE A 1 68  ? 2.237   -3.879  -3.367  1.00 0.21  ? 223 ILE A CA   1 
ATOM   1095 C C    . ILE A 1 68  ? 2.538   -3.636  -4.845  1.00 0.19  ? 223 ILE A C    1 
ATOM   1096 O O    . ILE A 1 68  ? 3.182   -2.673  -5.210  1.00 0.23  ? 223 ILE A O    1 
ATOM   1097 C CB   . ILE A 1 68  ? 1.775   -2.576  -2.715  1.00 0.24  ? 223 ILE A CB   1 
ATOM   1098 C CG1  . ILE A 1 68  ? 1.546   -2.819  -1.219  1.00 0.37  ? 223 ILE A CG1  1 
ATOM   1099 C CG2  . ILE A 1 68  ? 0.472   -2.115  -3.375  1.00 0.28  ? 223 ILE A CG2  1 
ATOM   1100 C CD1  . ILE A 1 68  ? 0.304   -2.059  -0.750  1.00 1.26  ? 223 ILE A CD1  1 
ATOM   1101 H H    . ILE A 1 68  ? 4.323   -3.916  -2.833  1.00 0.21  ? 223 ILE A H    1 
ATOM   1102 H HA   . ILE A 1 68  ? 1.458   -4.619  -3.279  1.00 0.23  ? 223 ILE A HA   1 
ATOM   1103 H HB   . ILE A 1 68  ? 2.534   -1.818  -2.848  1.00 0.26  ? 223 ILE A HB   1 
ATOM   1104 H HG12 . ILE A 1 68  ? 1.407   -3.876  -1.045  1.00 1.13  ? 223 ILE A HG12 1 
ATOM   1105 H HG13 . ILE A 1 68  ? 2.406   -2.474  -0.664  1.00 1.05  ? 223 ILE A HG13 1 
ATOM   1106 H HG21 . ILE A 1 68  ? 0.589   -2.132  -4.448  1.00 1.05  ? 223 ILE A HG21 1 
ATOM   1107 H HG22 . ILE A 1 68  ? -0.330  -2.780  -3.092  1.00 1.02  ? 223 ILE A HG22 1 
ATOM   1108 H HG23 . ILE A 1 68  ? 0.240   -1.111  -3.056  1.00 1.10  ? 223 ILE A HG23 1 
ATOM   1109 H HD11 . ILE A 1 68  ? 0.356   -1.036  -1.091  1.00 1.87  ? 223 ILE A HD11 1 
ATOM   1110 H HD12 . ILE A 1 68  ? -0.581  -2.529  -1.151  1.00 1.94  ? 223 ILE A HD12 1 
ATOM   1111 H HD13 . ILE A 1 68  ? 0.260   -2.075  0.329   1.00 1.75  ? 223 ILE A HD13 1 
ATOM   1112 N N    . GLU A 1 69  ? 2.075   -4.506  -5.699  1.00 0.19  ? 224 GLU A N    1 
ATOM   1113 C CA   . GLU A 1 69  ? 2.331   -4.329  -7.155  1.00 0.19  ? 224 GLU A CA   1 
ATOM   1114 C C    . GLU A 1 69  ? 1.568   -3.106  -7.657  1.00 0.17  ? 224 GLU A C    1 
ATOM   1115 O O    . GLU A 1 69  ? 0.373   -2.985  -7.472  1.00 0.19  ? 224 GLU A O    1 
ATOM   1116 C CB   . GLU A 1 69  ? 1.866   -5.573  -7.915  1.00 0.23  ? 224 GLU A CB   1 
ATOM   1117 C CG   . GLU A 1 69  ? 2.436   -5.546  -9.334  1.00 0.31  ? 224 GLU A CG   1 
ATOM   1118 C CD   . GLU A 1 69  ? 3.863   -6.095  -9.322  1.00 0.57  ? 224 GLU A CD   1 
ATOM   1119 O OE1  . GLU A 1 69  ? 4.110   -7.031  -8.580  1.00 1.26  ? 224 GLU A OE1  1 
ATOM   1120 O OE2  . GLU A 1 69  ? 4.685   -5.570  -10.055 1.00 1.27  ? 224 GLU A OE2  1 
ATOM   1121 H H    . GLU A 1 69  ? 1.558   -5.275  -5.381  1.00 0.23  ? 224 GLU A H    1 
ATOM   1122 H HA   . GLU A 1 69  ? 3.387   -4.179  -7.318  1.00 0.20  ? 224 GLU A HA   1 
ATOM   1123 H HB2  . GLU A 1 69  ? 2.216   -6.458  -7.403  1.00 0.32  ? 224 GLU A HB2  1 
ATOM   1124 H HB3  . GLU A 1 69  ? 0.788   -5.586  -7.962  1.00 0.26  ? 224 GLU A HB3  1 
ATOM   1125 H HG2  . GLU A 1 69  ? 1.820   -6.154  -9.981  1.00 0.38  ? 224 GLU A HG2  1 
ATOM   1126 H HG3  . GLU A 1 69  ? 2.446   -4.529  -9.698  1.00 0.46  ? 224 GLU A HG3  1 
ATOM   1127 N N    . VAL A 1 70  ? 2.255   -2.197  -8.290  1.00 0.16  ? 225 VAL A N    1 
ATOM   1128 C CA   . VAL A 1 70  ? 1.582   -0.975  -8.807  1.00 0.16  ? 225 VAL A CA   1 
ATOM   1129 C C    . VAL A 1 70  ? 1.669   -0.957  -10.335 1.00 0.17  ? 225 VAL A C    1 
ATOM   1130 O O    . VAL A 1 70  ? 2.594   -1.487  -10.918 1.00 0.22  ? 225 VAL A O    1 
ATOM   1131 C CB   . VAL A 1 70  ? 2.276   0.261   -8.232  1.00 0.17  ? 225 VAL A CB   1 
ATOM   1132 C CG1  . VAL A 1 70  ? 1.237   1.171   -7.582  1.00 0.19  ? 225 VAL A CG1  1 
ATOM   1133 C CG2  . VAL A 1 70  ? 3.294   -0.173  -7.174  1.00 0.18  ? 225 VAL A CG2  1 
ATOM   1134 H H    . VAL A 1 70  ? 3.218   -2.319  -8.426  1.00 0.17  ? 225 VAL A H    1 
ATOM   1135 H HA   . VAL A 1 70  ? 0.545   -0.980  -8.505  1.00 0.16  ? 225 VAL A HA   1 
ATOM   1136 H HB   . VAL A 1 70  ? 2.780   0.794   -9.025  1.00 0.18  ? 225 VAL A HB   1 
ATOM   1137 H HG11 . VAL A 1 70  ? 0.723   0.629   -6.802  1.00 1.01  ? 225 VAL A HG11 1 
ATOM   1138 H HG12 . VAL A 1 70  ? 1.730   2.032   -7.157  1.00 0.97  ? 225 VAL A HG12 1 
ATOM   1139 H HG13 . VAL A 1 70  ? 0.525   1.494   -8.326  1.00 1.06  ? 225 VAL A HG13 1 
ATOM   1140 H HG21 . VAL A 1 70  ? 2.815   -0.828  -6.461  1.00 0.99  ? 225 VAL A HG21 1 
ATOM   1141 H HG22 . VAL A 1 70  ? 4.110   -0.696  -7.652  1.00 0.99  ? 225 VAL A HG22 1 
ATOM   1142 H HG23 . VAL A 1 70  ? 3.676   0.698   -6.662  1.00 0.99  ? 225 VAL A HG23 1 
ATOM   1143 N N    . GLY A 1 71  ? 0.714   -0.354  -10.989 1.00 0.19  ? 226 GLY A N    1 
ATOM   1144 C CA   . GLY A 1 71  ? 0.749   -0.311  -12.478 1.00 0.22  ? 226 GLY A CA   1 
ATOM   1145 C C    . GLY A 1 71  ? 0.649   1.138   -12.954 1.00 0.48  ? 226 GLY A C    1 
ATOM   1146 O O    . GLY A 1 71  ? 1.112   2.051   -12.301 1.00 0.82  ? 226 GLY A O    1 
ATOM   1147 H H    . GLY A 1 71  ? -0.027  0.067   -10.504 1.00 0.22  ? 226 GLY A H    1 
ATOM   1148 H HA2  . GLY A 1 71  ? 1.675   -0.743  -12.828 1.00 0.41  ? 226 GLY A HA2  1 
ATOM   1149 H HA3  . GLY A 1 71  ? -0.083  -0.873  -12.874 1.00 0.37  ? 226 GLY A HA3  1 
ATOM   1150 N N    . ARG A 1 72  ? 0.047   1.355   -14.091 1.00 0.61  ? 227 ARG A N    1 
ATOM   1151 C CA   . ARG A 1 72  ? -0.085  2.743   -14.613 1.00 0.98  ? 227 ARG A CA   1 
ATOM   1152 C C    . ARG A 1 72  ? -0.894  3.585   -13.627 1.00 0.54  ? 227 ARG A C    1 
ATOM   1153 O O    . ARG A 1 72  ? -1.517  3.068   -12.720 1.00 1.42  ? 227 ARG A O    1 
ATOM   1154 C CB   . ARG A 1 72  ? -0.802  2.713   -15.964 1.00 1.83  ? 227 ARG A CB   1 
ATOM   1155 C CG   . ARG A 1 72  ? 0.018   1.891   -16.958 1.00 2.39  ? 227 ARG A CG   1 
ATOM   1156 C CD   . ARG A 1 72  ? -0.824  1.604   -18.202 1.00 3.19  ? 227 ARG A CD   1 
ATOM   1157 N NE   . ARG A 1 72  ? 0.016   1.775   -19.420 1.00 3.96  ? 227 ARG A NE   1 
ATOM   1158 C CZ   . ARG A 1 72  ? -0.350  2.610   -20.354 1.00 4.59  ? 227 ARG A CZ   1 
ATOM   1159 N NH1  . ARG A 1 72  ? -1.265  2.263   -21.217 1.00 5.09  ? 227 ARG A NH1  1 
ATOM   1160 N NH2  . ARG A 1 72  ? 0.199   3.792   -20.424 1.00 5.09  ? 227 ARG A NH2  1 
ATOM   1161 H H    . ARG A 1 72  ? -0.319  0.603   -14.602 1.00 0.64  ? 227 ARG A H    1 
ATOM   1162 H HA   . ARG A 1 72  ? 0.896   3.177   -14.736 1.00 1.54  ? 227 ARG A HA   1 
ATOM   1163 H HB2  . ARG A 1 72  ? -1.778  2.264   -15.842 1.00 2.27  ? 227 ARG A HB2  1 
ATOM   1164 H HB3  . ARG A 1 72  ? -0.913  3.720   -16.336 1.00 2.33  ? 227 ARG A HB3  1 
ATOM   1165 H HG2  . ARG A 1 72  ? 0.901   2.446   -17.241 1.00 2.52  ? 227 ARG A HG2  1 
ATOM   1166 H HG3  . ARG A 1 72  ? 0.310   0.959   -16.500 1.00 2.74  ? 227 ARG A HG3  1 
ATOM   1167 H HD2  . ARG A 1 72  ? -1.194  0.590   -18.159 1.00 3.58  ? 227 ARG A HD2  1 
ATOM   1168 H HD3  . ARG A 1 72  ? -1.658  2.290   -18.239 1.00 3.29  ? 227 ARG A HD3  1 
ATOM   1169 H HE   . ARG A 1 72  ? 0.844   1.261   -19.519 1.00 4.27  ? 227 ARG A HE   1 
ATOM   1170 H HH11 . ARG A 1 72  ? -1.686  1.357   -21.163 1.00 5.07  ? 227 ARG A HH11 1 
ATOM   1171 H HH12 . ARG A 1 72  ? -1.545  2.902   -21.933 1.00 5.69  ? 227 ARG A HH12 1 
ATOM   1172 H HH21 . ARG A 1 72  ? 0.900   4.058   -19.763 1.00 5.06  ? 227 ARG A HH21 1 
ATOM   1173 H HH22 . ARG A 1 72  ? -0.081  4.431   -21.141 1.00 5.72  ? 227 ARG A HH22 1 
ATOM   1174 N N    . SER A 1 73  ? -0.889  4.879   -13.798 1.00 0.63  ? 228 SER A N    1 
ATOM   1175 C CA   . SER A 1 73  ? -1.656  5.762   -12.874 1.00 0.94  ? 228 SER A CA   1 
ATOM   1176 C C    . SER A 1 73  ? -1.047  5.720   -11.465 1.00 0.79  ? 228 SER A C    1 
ATOM   1177 O O    . SER A 1 73  ? -1.644  6.187   -10.515 1.00 1.13  ? 228 SER A O    1 
ATOM   1178 C CB   . SER A 1 73  ? -3.109  5.291   -12.812 1.00 1.62  ? 228 SER A CB   1 
ATOM   1179 O OG   . SER A 1 73  ? -3.470  4.715   -14.060 1.00 2.00  ? 228 SER A OG   1 
ATOM   1180 H H    . SER A 1 73  ? -0.379  5.271   -14.537 1.00 1.34  ? 228 SER A H    1 
ATOM   1181 H HA   . SER A 1 73  ? -1.627  6.776   -13.245 1.00 1.32  ? 228 SER A HA   1 
ATOM   1182 H HB2  . SER A 1 73  ? -3.217  4.551   -12.037 1.00 2.05  ? 228 SER A HB2  1 
ATOM   1183 H HB3  . SER A 1 73  ? -3.751  6.135   -12.593 1.00 2.22  ? 228 SER A HB3  1 
ATOM   1184 H HG   . SER A 1 73  ? -3.705  5.428   -14.659 1.00 2.36  ? 228 SER A HG   1 
ATOM   1185 N N    . ALA A 1 74  ? 0.132   5.173   -11.312 1.00 0.38  ? 229 ALA A N    1 
ATOM   1186 C CA   . ALA A 1 74  ? 0.751   5.118   -9.960  1.00 0.36  ? 229 ALA A CA   1 
ATOM   1187 C C    . ALA A 1 74  ? 1.627   6.356   -9.759  1.00 0.36  ? 229 ALA A C    1 
ATOM   1188 O O    . ALA A 1 74  ? 2.267   6.829   -10.677 1.00 0.50  ? 229 ALA A O    1 
ATOM   1189 C CB   . ALA A 1 74  ? 1.610   3.857   -9.846  1.00 0.39  ? 229 ALA A CB   1 
ATOM   1190 H H    . ALA A 1 74  ? 0.610   4.800   -12.078 1.00 0.32  ? 229 ALA A H    1 
ATOM   1191 H HA   . ALA A 1 74  ? -0.024  5.098   -9.208  1.00 0.48  ? 229 ALA A HA   1 
ATOM   1192 H HB1  . ALA A 1 74  ? 2.019   3.613   -10.814 1.00 1.16  ? 229 ALA A HB1  1 
ATOM   1193 H HB2  . ALA A 1 74  ? 2.415   4.031   -9.147  1.00 1.07  ? 229 ALA A HB2  1 
ATOM   1194 H HB3  . ALA A 1 74  ? 1.000   3.038   -9.495  1.00 1.07  ? 229 ALA A HB3  1 
ATOM   1195 N N    . VAL A 1 75  ? 1.659   6.885   -8.566  1.00 0.39  ? 230 VAL A N    1 
ATOM   1196 C CA   . VAL A 1 75  ? 2.492   8.094   -8.306  1.00 0.43  ? 230 VAL A CA   1 
ATOM   1197 C C    . VAL A 1 75  ? 3.934   7.834   -8.754  1.00 0.39  ? 230 VAL A C    1 
ATOM   1198 O O    . VAL A 1 75  ? 4.658   8.745   -9.102  1.00 0.44  ? 230 VAL A O    1 
ATOM   1199 C CB   . VAL A 1 75  ? 2.470   8.413   -6.811  1.00 0.54  ? 230 VAL A CB   1 
ATOM   1200 C CG1  . VAL A 1 75  ? 3.683   9.273   -6.452  1.00 0.61  ? 230 VAL A CG1  1 
ATOM   1201 C CG2  . VAL A 1 75  ? 1.188   9.177   -6.473  1.00 0.66  ? 230 VAL A CG2  1 
ATOM   1202 H H    . VAL A 1 75  ? 1.133   6.487   -7.841  1.00 0.50  ? 230 VAL A H    1 
ATOM   1203 H HA   . VAL A 1 75  ? 2.091   8.932   -8.857  1.00 0.48  ? 230 VAL A HA   1 
ATOM   1204 H HB   . VAL A 1 75  ? 2.503   7.492   -6.246  1.00 0.56  ? 230 VAL A HB   1 
ATOM   1205 H HG11 . VAL A 1 75  ? 3.920   9.925   -7.280  1.00 1.14  ? 230 VAL A HG11 1 
ATOM   1206 H HG12 . VAL A 1 75  ? 3.457   9.868   -5.579  1.00 1.11  ? 230 VAL A HG12 1 
ATOM   1207 H HG13 . VAL A 1 75  ? 4.528   8.634   -6.243  1.00 1.19  ? 230 VAL A HG13 1 
ATOM   1208 H HG21 . VAL A 1 75  ? 0.697   9.477   -7.387  1.00 1.24  ? 230 VAL A HG21 1 
ATOM   1209 H HG22 . VAL A 1 75  ? 0.529   8.539   -5.903  1.00 1.17  ? 230 VAL A HG22 1 
ATOM   1210 H HG23 . VAL A 1 75  ? 1.433   10.053  -5.891  1.00 1.24  ? 230 VAL A HG23 1 
ATOM   1211 N N    . THR A 1 76  ? 4.356   6.598   -8.751  1.00 0.37  ? 231 THR A N    1 
ATOM   1212 C CA   . THR A 1 76  ? 5.749   6.285   -9.178  1.00 0.42  ? 231 THR A CA   1 
ATOM   1213 C C    . THR A 1 76  ? 5.722   5.608   -10.550 1.00 0.40  ? 231 THR A C    1 
ATOM   1214 O O    . THR A 1 76  ? 6.630   5.756   -11.343 1.00 0.50  ? 231 THR A O    1 
ATOM   1215 C CB   . THR A 1 76  ? 6.394   5.344   -8.160  1.00 0.49  ? 231 THR A CB   1 
ATOM   1216 O OG1  . THR A 1 76  ? 5.551   4.217   -7.964  1.00 0.78  ? 231 THR A OG1  1 
ATOM   1217 C CG2  . THR A 1 76  ? 6.586   6.079   -6.833  1.00 1.13  ? 231 THR A CG2  1 
ATOM   1218 H H    . THR A 1 76  ? 3.758   5.875   -8.468  1.00 0.39  ? 231 THR A H    1 
ATOM   1219 H HA   . THR A 1 76  ? 6.322   7.198   -9.238  1.00 0.47  ? 231 THR A HA   1 
ATOM   1220 H HB   . THR A 1 76  ? 7.354   5.017   -8.529  1.00 0.75  ? 231 THR A HB   1 
ATOM   1221 H HG1  . THR A 1 76  ? 4.815   4.490   -7.410  1.00 1.22  ? 231 THR A HG1  1 
ATOM   1222 H HG21 . THR A 1 76  ? 6.527   7.145   -7.000  1.00 1.70  ? 231 THR A HG21 1 
ATOM   1223 H HG22 . THR A 1 76  ? 5.814   5.780   -6.140  1.00 1.63  ? 231 THR A HG22 1 
ATOM   1224 H HG23 . THR A 1 76  ? 7.554   5.833   -6.422  1.00 1.64  ? 231 THR A HG23 1 
ATOM   1225 N N    . GLY A 1 77  ? 4.688   4.865   -10.835 1.00 0.34  ? 232 GLY A N    1 
ATOM   1226 C CA   . GLY A 1 77  ? 4.607   4.179   -12.156 1.00 0.36  ? 232 GLY A CA   1 
ATOM   1227 C C    . GLY A 1 77  ? 4.553   2.664   -11.941 1.00 0.31  ? 232 GLY A C    1 
ATOM   1228 O O    . GLY A 1 77  ? 4.226   2.204   -10.865 1.00 0.36  ? 232 GLY A O    1 
ATOM   1229 H H    . GLY A 1 77  ? 3.965   4.757   -10.181 1.00 0.35  ? 232 GLY A H    1 
ATOM   1230 H HA2  . GLY A 1 77  ? 3.716   4.504   -12.677 1.00 0.42  ? 232 GLY A HA2  1 
ATOM   1231 H HA3  . GLY A 1 77  ? 5.478   4.428   -12.741 1.00 0.43  ? 232 GLY A HA3  1 
ATOM   1232 N N    . PRO A 1 78  ? 4.876   1.933   -12.976 1.00 0.34  ? 233 PRO A N    1 
ATOM   1233 C CA   . PRO A 1 78  ? 4.880   0.466   -12.947 1.00 0.31  ? 233 PRO A CA   1 
ATOM   1234 C C    . PRO A 1 78  ? 6.055   -0.036  -12.105 1.00 0.30  ? 233 PRO A C    1 
ATOM   1235 O O    . PRO A 1 78  ? 7.167   0.439   -12.227 1.00 0.42  ? 233 PRO A O    1 
ATOM   1236 C CB   . PRO A 1 78  ? 5.032   0.022   -14.397 1.00 0.35  ? 233 PRO A CB   1 
ATOM   1237 C CG   . PRO A 1 78  ? 5.725   1.237   -15.061 1.00 0.71  ? 233 PRO A CG   1 
ATOM   1238 C CD   . PRO A 1 78  ? 5.273   2.499   -14.284 1.00 0.51  ? 233 PRO A CD   1 
ATOM   1239 H HA   . PRO A 1 78  ? 3.948   0.098   -12.547 1.00 0.34  ? 233 PRO A HA   1 
ATOM   1240 H HB2  . PRO A 1 78  ? 5.653   -0.863  -14.460 1.00 0.62  ? 233 PRO A HB2  1 
ATOM   1241 H HB3  . PRO A 1 78  ? 4.069   -0.148  -14.851 1.00 0.63  ? 233 PRO A HB3  1 
ATOM   1242 H HG2  . PRO A 1 78  ? 6.799   1.127   -14.999 1.00 1.11  ? 233 PRO A HG2  1 
ATOM   1243 H HG3  . PRO A 1 78  ? 5.420   1.318   -16.093 1.00 1.09  ? 233 PRO A HG3  1 
ATOM   1244 H HD2  . PRO A 1 78  ? 6.094   3.195   -14.176 1.00 0.55  ? 233 PRO A HD2  1 
ATOM   1245 H HD3  . PRO A 1 78  ? 4.428   2.966   -14.765 1.00 0.56  ? 233 PRO A HD3  1 
ATOM   1246 N N    . GLY A 1 79  ? 5.818   -0.993  -11.250 1.00 0.22  ? 234 GLY A N    1 
ATOM   1247 C CA   . GLY A 1 79  ? 6.920   -1.523  -10.400 1.00 0.23  ? 234 GLY A CA   1 
ATOM   1248 C C    . GLY A 1 79  ? 6.321   -2.259  -9.203  1.00 0.20  ? 234 GLY A C    1 
ATOM   1249 O O    . GLY A 1 79  ? 5.268   -2.858  -9.296  1.00 0.20  ? 234 GLY A O    1 
ATOM   1250 H H    . GLY A 1 79  ? 4.915   -1.363  -11.164 1.00 0.24  ? 234 GLY A H    1 
ATOM   1251 H HA2  . GLY A 1 79  ? 7.527   -2.205  -10.979 1.00 0.27  ? 234 GLY A HA2  1 
ATOM   1252 H HA3  . GLY A 1 79  ? 7.530   -0.706  -10.048 1.00 0.25  ? 234 GLY A HA3  1 
ATOM   1253 N N    . GLU A 1 80  ? 6.980   -2.222  -8.079  1.00 0.20  ? 235 GLU A N    1 
ATOM   1254 C CA   . GLU A 1 80  ? 6.440   -2.923  -6.883  1.00 0.19  ? 235 GLU A CA   1 
ATOM   1255 C C    . GLU A 1 80  ? 7.044   -2.317  -5.615  1.00 0.19  ? 235 GLU A C    1 
ATOM   1256 O O    . GLU A 1 80  ? 8.185   -1.901  -5.595  1.00 0.22  ? 235 GLU A O    1 
ATOM   1257 C CB   . GLU A 1 80  ? 6.794   -4.407  -6.964  1.00 0.22  ? 235 GLU A CB   1 
ATOM   1258 C CG   . GLU A 1 80  ? 8.302   -4.561  -7.169  1.00 0.27  ? 235 GLU A CG   1 
ATOM   1259 C CD   . GLU A 1 80  ? 8.592   -4.840  -8.645  1.00 0.56  ? 235 GLU A CD   1 
ATOM   1260 O OE1  . GLU A 1 80  ? 7.885   -5.647  -9.225  1.00 1.36  ? 235 GLU A OE1  1 
ATOM   1261 O OE2  . GLU A 1 80  ? 9.516   -4.241  -9.170  1.00 1.28  ? 235 GLU A OE2  1 
ATOM   1262 H H    . GLU A 1 80  ? 7.828   -1.735  -8.023  1.00 0.22  ? 235 GLU A H    1 
ATOM   1263 H HA   . GLU A 1 80  ? 5.366   -2.812  -6.857  1.00 0.19  ? 235 GLU A HA   1 
ATOM   1264 H HB2  . GLU A 1 80  ? 6.501   -4.898  -6.047  1.00 0.22  ? 235 GLU A HB2  1 
ATOM   1265 H HB3  . GLU A 1 80  ? 6.272   -4.854  -7.797  1.00 0.29  ? 235 GLU A HB3  1 
ATOM   1266 H HG2  . GLU A 1 80  ? 8.801   -3.651  -6.868  1.00 0.61  ? 235 GLU A HG2  1 
ATOM   1267 H HG3  . GLU A 1 80  ? 8.664   -5.384  -6.572  1.00 0.62  ? 235 GLU A HG3  1 
ATOM   1268 N N    . PHE A 1 81  ? 6.283   -2.266  -4.557  1.00 0.20  ? 236 PHE A N    1 
ATOM   1269 C CA   . PHE A 1 81  ? 6.806   -1.688  -3.286  1.00 0.21  ? 236 PHE A CA   1 
ATOM   1270 C C    . PHE A 1 81  ? 6.894   -2.790  -2.232  1.00 0.22  ? 236 PHE A C    1 
ATOM   1271 O O    . PHE A 1 81  ? 5.975   -2.998  -1.469  1.00 0.22  ? 236 PHE A O    1 
ATOM   1272 C CB   . PHE A 1 81  ? 5.854   -0.597  -2.793  1.00 0.22  ? 236 PHE A CB   1 
ATOM   1273 C CG   . PHE A 1 81  ? 5.985   0.624   -3.668  1.00 0.21  ? 236 PHE A CG   1 
ATOM   1274 C CD1  . PHE A 1 81  ? 7.234   1.232   -3.841  1.00 1.20  ? 236 PHE A CD1  1 
ATOM   1275 C CD2  . PHE A 1 81  ? 4.856   1.151   -4.305  1.00 1.26  ? 236 PHE A CD2  1 
ATOM   1276 C CE1  . PHE A 1 81  ? 7.354   2.366   -4.652  1.00 1.19  ? 236 PHE A CE1  1 
ATOM   1277 C CE2  . PHE A 1 81  ? 4.975   2.285   -5.115  1.00 1.27  ? 236 PHE A CE2  1 
ATOM   1278 C CZ   . PHE A 1 81  ? 6.224   2.893   -5.288  1.00 0.22  ? 236 PHE A CZ   1 
ATOM   1279 H H    . PHE A 1 81  ? 5.366   -2.608  -4.598  1.00 0.22  ? 236 PHE A H    1 
ATOM   1280 H HA   . PHE A 1 81  ? 7.785   -1.267  -3.455  1.00 0.22  ? 236 PHE A HA   1 
ATOM   1281 H HB2  . PHE A 1 81  ? 4.838   -0.962  -2.834  1.00 0.23  ? 236 PHE A HB2  1 
ATOM   1282 H HB3  . PHE A 1 81  ? 6.101   -0.338  -1.775  1.00 0.25  ? 236 PHE A HB3  1 
ATOM   1283 H HD1  . PHE A 1 81  ? 8.106   0.825   -3.349  1.00 2.12  ? 236 PHE A HD1  1 
ATOM   1284 H HD2  . PHE A 1 81  ? 3.892   0.681   -4.171  1.00 2.19  ? 236 PHE A HD2  1 
ATOM   1285 H HE1  . PHE A 1 81  ? 8.317   2.836   -4.786  1.00 2.12  ? 236 PHE A HE1  1 
ATOM   1286 H HE2  . PHE A 1 81  ? 4.104   2.691   -5.607  1.00 2.20  ? 236 PHE A HE2  1 
ATOM   1287 H HZ   . PHE A 1 81  ? 6.315   3.768   -5.913  1.00 0.24  ? 236 PHE A HZ   1 
ATOM   1288 N N    . TRP A 1 82  ? 7.991   -3.497  -2.184  1.00 0.26  ? 237 TRP A N    1 
ATOM   1289 C CA   . TRP A 1 82  ? 8.132   -4.588  -1.178  1.00 0.27  ? 237 TRP A CA   1 
ATOM   1290 C C    . TRP A 1 82  ? 8.504   -3.997  0.183   1.00 0.31  ? 237 TRP A C    1 
ATOM   1291 O O    . TRP A 1 82  ? 9.088   -2.938  0.271   1.00 0.46  ? 237 TRP A O    1 
ATOM   1292 C CB   . TRP A 1 82  ? 9.232   -5.552  -1.625  1.00 0.30  ? 237 TRP A CB   1 
ATOM   1293 C CG   . TRP A 1 82  ? 8.732   -6.390  -2.757  1.00 0.29  ? 237 TRP A CG   1 
ATOM   1294 C CD1  . TRP A 1 82  ? 8.400   -5.922  -3.982  1.00 0.30  ? 237 TRP A CD1  1 
ATOM   1295 C CD2  . TRP A 1 82  ? 8.501   -7.829  -2.792  1.00 0.31  ? 237 TRP A CD2  1 
ATOM   1296 N NE1  . TRP A 1 82  ? 7.983   -6.981  -4.767  1.00 0.30  ? 237 TRP A NE1  1 
ATOM   1297 C CE2  . TRP A 1 82  ? 8.027   -8.177  -4.079  1.00 0.31  ? 237 TRP A CE2  1 
ATOM   1298 C CE3  . TRP A 1 82  ? 8.657   -8.856  -1.842  1.00 0.37  ? 237 TRP A CE3  1 
ATOM   1299 C CZ2  . TRP A 1 82  ? 7.719   -9.497  -4.412  1.00 0.36  ? 237 TRP A CZ2  1 
ATOM   1300 C CZ3  . TRP A 1 82  ? 8.347   -10.184 -2.175  1.00 0.43  ? 237 TRP A CZ3  1 
ATOM   1301 C CH2  . TRP A 1 82  ? 7.879   -10.504 -3.457  1.00 0.42  ? 237 TRP A CH2  1 
ATOM   1302 H H    . TRP A 1 82  ? 8.720   -3.312  -2.812  1.00 0.30  ? 237 TRP A H    1 
ATOM   1303 H HA   . TRP A 1 82  ? 7.200   -5.124  -1.095  1.00 0.25  ? 237 TRP A HA   1 
ATOM   1304 H HB2  . TRP A 1 82  ? 10.095  -4.989  -1.949  1.00 0.32  ? 237 TRP A HB2  1 
ATOM   1305 H HB3  . TRP A 1 82  ? 9.509   -6.191  -0.800  1.00 0.33  ? 237 TRP A HB3  1 
ATOM   1306 H HD1  . TRP A 1 82  ? 8.453   -4.890  -4.295  1.00 0.33  ? 237 TRP A HD1  1 
ATOM   1307 H HE1  . TRP A 1 82  ? 7.688   -6.911  -5.699  1.00 0.33  ? 237 TRP A HE1  1 
ATOM   1308 H HE3  . TRP A 1 82  ? 9.015   -8.622  -0.850  1.00 0.39  ? 237 TRP A HE3  1 
ATOM   1309 H HZ2  . TRP A 1 82  ? 7.359   -9.738  -5.402  1.00 0.37  ? 237 TRP A HZ2  1 
ATOM   1310 H HZ3  . TRP A 1 82  ? 8.470   -10.965 -1.438  1.00 0.50  ? 237 TRP A HZ3  1 
ATOM   1311 H HH2  . TRP A 1 82  ? 7.643   -11.528 -3.707  1.00 0.48  ? 237 TRP A HH2  1 
ATOM   1312 N N    . MET A 1 83  ? 8.171   -4.679  1.246   1.00 0.30  ? 238 MET A N    1 
ATOM   1313 C CA   . MET A 1 83  ? 8.508   -4.166  2.604   1.00 0.35  ? 238 MET A CA   1 
ATOM   1314 C C    . MET A 1 83  ? 8.461   -5.324  3.603   1.00 0.32  ? 238 MET A C    1 
ATOM   1315 O O    . MET A 1 83  ? 8.130   -6.440  3.256   1.00 0.49  ? 238 MET A O    1 
ATOM   1316 C CB   . MET A 1 83  ? 7.507   -3.087  3.019   1.00 0.42  ? 238 MET A CB   1 
ATOM   1317 C CG   . MET A 1 83  ? 6.172   -3.741  3.375   1.00 1.22  ? 238 MET A CG   1 
ATOM   1318 S SD   . MET A 1 83  ? 4.864   -2.488  3.399   1.00 1.51  ? 238 MET A SD   1 
ATOM   1319 C CE   . MET A 1 83  ? 4.990   -1.977  1.667   1.00 0.78  ? 238 MET A CE   1 
ATOM   1320 H H    . MET A 1 83  ? 7.702   -5.534  1.150   1.00 0.37  ? 238 MET A H    1 
ATOM   1321 H HA   . MET A 1 83  ? 9.504   -3.747  2.589   1.00 0.42  ? 238 MET A HA   1 
ATOM   1322 H HB2  . MET A 1 83  ? 7.888   -2.554  3.879   1.00 1.22  ? 238 MET A HB2  1 
ATOM   1323 H HB3  . MET A 1 83  ? 7.365   -2.397  2.203   1.00 1.12  ? 238 MET A HB3  1 
ATOM   1324 H HG2  . MET A 1 83  ? 5.936   -4.495  2.641   1.00 1.88  ? 238 MET A HG2  1 
ATOM   1325 H HG3  . MET A 1 83  ? 6.247   -4.200  4.350   1.00 1.92  ? 238 MET A HG3  1 
ATOM   1326 H HE1  . MET A 1 83  ? 5.534   -2.728  1.111   1.00 1.19  ? 238 MET A HE1  1 
ATOM   1327 H HE2  . MET A 1 83  ? 3.999   -1.861  1.253   1.00 1.46  ? 238 MET A HE2  1 
ATOM   1328 H HE3  . MET A 1 83  ? 5.516   -1.037  1.606   1.00 1.25  ? 238 MET A HE3  1 
ATOM   1329 N N    . GLN A 1 84  ? 8.791   -5.070  4.840   1.00 0.26  ? 239 GLN A N    1 
ATOM   1330 C CA   . GLN A 1 84  ? 8.769   -6.162  5.854   1.00 0.31  ? 239 GLN A CA   1 
ATOM   1331 C C    . GLN A 1 84  ? 7.965   -5.718  7.078   1.00 0.32  ? 239 GLN A C    1 
ATOM   1332 O O    . GLN A 1 84  ? 7.990   -4.567  7.465   1.00 0.48  ? 239 GLN A O    1 
ATOM   1333 C CB   . GLN A 1 84  ? 10.207  -6.482  6.273   1.00 0.38  ? 239 GLN A CB   1 
ATOM   1334 C CG   . GLN A 1 84  ? 10.222  -7.713  7.181   1.00 0.70  ? 239 GLN A CG   1 
ATOM   1335 C CD   . GLN A 1 84  ? 11.397  -7.612  8.154   1.00 0.77  ? 239 GLN A CD   1 
ATOM   1336 O OE1  . GLN A 1 84  ? 11.736  -6.536  8.605   1.00 1.52  ? 239 GLN A OE1  1 
ATOM   1337 N NE2  . GLN A 1 84  ? 12.039  -8.695  8.499   1.00 1.35  ? 239 GLN A NE2  1 
ATOM   1338 H H    . GLN A 1 84  ? 9.054   -4.163  5.101   1.00 0.36  ? 239 GLN A H    1 
ATOM   1339 H HA   . GLN A 1 84  ? 8.315   -7.043  5.425   1.00 0.33  ? 239 GLN A HA   1 
ATOM   1340 H HB2  . GLN A 1 84  ? 10.800  -6.679  5.393   1.00 0.64  ? 239 GLN A HB2  1 
ATOM   1341 H HB3  . GLN A 1 84  ? 10.622  -5.640  6.806   1.00 0.54  ? 239 GLN A HB3  1 
ATOM   1342 H HG2  . GLN A 1 84  ? 9.297   -7.765  7.735   1.00 1.18  ? 239 GLN A HG2  1 
ATOM   1343 H HG3  . GLN A 1 84  ? 10.332  -8.602  6.579   1.00 1.21  ? 239 GLN A HG3  1 
ATOM   1344 H HE21 . GLN A 1 84  ? 11.766  -9.563  8.135   1.00 2.00  ? 239 GLN A HE21 1 
ATOM   1345 H HE22 . GLN A 1 84  ? 12.794  -8.639  9.122   1.00 1.58  ? 239 GLN A HE22 1 
ATOM   1346 N N    . VAL A 1 85  ? 7.253   -6.623  7.691   1.00 0.28  ? 240 VAL A N    1 
ATOM   1347 C CA   . VAL A 1 85  ? 6.449   -6.252  8.889   1.00 0.31  ? 240 VAL A CA   1 
ATOM   1348 C C    . VAL A 1 85  ? 7.106   -6.839  10.143  1.00 0.32  ? 240 VAL A C    1 
ATOM   1349 O O    . VAL A 1 85  ? 8.254   -7.236  10.125  1.00 0.34  ? 240 VAL A O    1 
ATOM   1350 C CB   . VAL A 1 85  ? 5.029   -6.806  8.739   1.00 0.32  ? 240 VAL A CB   1 
ATOM   1351 C CG1  . VAL A 1 85  ? 4.437   -6.341  7.408   1.00 0.39  ? 240 VAL A CG1  1 
ATOM   1352 C CG2  . VAL A 1 85  ? 5.070   -8.335  8.767   1.00 0.32  ? 240 VAL A CG2  1 
ATOM   1353 H H    . VAL A 1 85  ? 7.247   -7.546  7.363   1.00 0.33  ? 240 VAL A H    1 
ATOM   1354 H HA   . VAL A 1 85  ? 6.409   -5.176  8.975   1.00 0.35  ? 240 VAL A HA   1 
ATOM   1355 H HB   . VAL A 1 85  ? 4.414   -6.444  9.551   1.00 0.37  ? 240 VAL A HB   1 
ATOM   1356 H HG11 . VAL A 1 85  ? 5.095   -6.628  6.601   1.00 1.09  ? 240 VAL A HG11 1 
ATOM   1357 H HG12 . VAL A 1 85  ? 3.470   -6.802  7.264   1.00 1.05  ? 240 VAL A HG12 1 
ATOM   1358 H HG13 . VAL A 1 85  ? 4.326   -5.267  7.418   1.00 1.08  ? 240 VAL A HG13 1 
ATOM   1359 H HG21 . VAL A 1 85  ? 6.096   -8.669  8.788   1.00 1.09  ? 240 VAL A HG21 1 
ATOM   1360 H HG22 . VAL A 1 85  ? 4.557   -8.691  9.648   1.00 1.06  ? 240 VAL A HG22 1 
ATOM   1361 H HG23 . VAL A 1 85  ? 4.583   -8.724  7.885   1.00 1.05  ? 240 VAL A HG23 1 
ATOM   1362 N N    . ASP A 1 86  ? 6.389   -6.895  11.233  1.00 0.37  ? 241 ASP A N    1 
ATOM   1363 C CA   . ASP A 1 86  ? 6.976   -7.454  12.484  1.00 0.41  ? 241 ASP A CA   1 
ATOM   1364 C C    . ASP A 1 86  ? 7.169   -8.965  12.334  1.00 0.38  ? 241 ASP A C    1 
ATOM   1365 O O    . ASP A 1 86  ? 8.151   -9.522  12.784  1.00 0.44  ? 241 ASP A O    1 
ATOM   1366 C CB   . ASP A 1 86  ? 6.031   -7.177  13.655  1.00 0.45  ? 241 ASP A CB   1 
ATOM   1367 C CG   . ASP A 1 86  ? 6.153   -5.711  14.074  1.00 0.54  ? 241 ASP A CG   1 
ATOM   1368 O OD1  . ASP A 1 86  ? 6.632   -4.925  13.274  1.00 1.14  ? 241 ASP A OD1  1 
ATOM   1369 O OD2  . ASP A 1 86  ? 5.766   -5.400  15.188  1.00 1.27  ? 241 ASP A OD2  1 
ATOM   1370 H H    . ASP A 1 86  ? 5.466   -6.569  11.229  1.00 0.42  ? 241 ASP A H    1 
ATOM   1371 H HA   . ASP A 1 86  ? 7.930   -6.986  12.674  1.00 0.46  ? 241 ASP A HA   1 
ATOM   1372 H HB2  . ASP A 1 86  ? 5.014   -7.382  13.352  1.00 0.45  ? 241 ASP A HB2  1 
ATOM   1373 H HB3  . ASP A 1 86  ? 6.294   -7.811  14.488  1.00 0.55  ? 241 ASP A HB3  1 
ATOM   1374 N N    . ASP A 1 87  ? 6.240   -9.633  11.708  1.00 0.33  ? 242 ASP A N    1 
ATOM   1375 C CA   . ASP A 1 87  ? 6.371   -11.107 11.534  1.00 0.34  ? 242 ASP A CA   1 
ATOM   1376 C C    . ASP A 1 87  ? 5.259   -11.606 10.596  1.00 0.33  ? 242 ASP A C    1 
ATOM   1377 O O    . ASP A 1 87  ? 4.851   -10.907 9.691   1.00 0.41  ? 242 ASP A O    1 
ATOM   1378 C CB   . ASP A 1 87  ? 6.254   -11.778 12.905  1.00 0.39  ? 242 ASP A CB   1 
ATOM   1379 C CG   . ASP A 1 87  ? 7.123   -13.036 12.932  1.00 1.36  ? 242 ASP A CG   1 
ATOM   1380 O OD1  . ASP A 1 87  ? 8.215   -12.988 12.392  1.00 2.06  ? 242 ASP A OD1  1 
ATOM   1381 O OD2  . ASP A 1 87  ? 6.680   -14.025 13.491  1.00 2.17  ? 242 ASP A OD2  1 
ATOM   1382 H H    . ASP A 1 87  ? 5.455   -9.166  11.355  1.00 0.34  ? 242 ASP A H    1 
ATOM   1383 H HA   . ASP A 1 87  ? 7.335   -11.335 11.102  1.00 0.37  ? 242 ASP A HA   1 
ATOM   1384 H HB2  . ASP A 1 87  ? 6.587   -11.091 13.671  1.00 1.01  ? 242 ASP A HB2  1 
ATOM   1385 H HB3  . ASP A 1 87  ? 5.225   -12.049 13.087  1.00 1.02  ? 242 ASP A HB3  1 
ATOM   1386 N N    . SER A 1 88  ? 4.760   -12.804 10.792  1.00 0.37  ? 243 SER A N    1 
ATOM   1387 C CA   . SER A 1 88  ? 3.681   -13.313 9.897   1.00 0.40  ? 243 SER A CA   1 
ATOM   1388 C C    . SER A 1 88  ? 2.302   -12.974 10.481  1.00 0.41  ? 243 SER A C    1 
ATOM   1389 O O    . SER A 1 88  ? 1.315   -13.605 10.158  1.00 0.60  ? 243 SER A O    1 
ATOM   1390 C CB   . SER A 1 88  ? 3.812   -14.830 9.758   1.00 0.50  ? 243 SER A CB   1 
ATOM   1391 O OG   . SER A 1 88  ? 4.983   -15.133 9.010   1.00 1.45  ? 243 SER A OG   1 
ATOM   1392 H H    . SER A 1 88  ? 5.091   -13.368 11.520  1.00 0.46  ? 243 SER A H    1 
ATOM   1393 H HA   . SER A 1 88  ? 3.779   -12.856 8.923   1.00 0.39  ? 243 SER A HA   1 
ATOM   1394 H HB2  . SER A 1 88  ? 3.890   -15.278 10.735  1.00 1.08  ? 243 SER A HB2  1 
ATOM   1395 H HB3  . SER A 1 88  ? 2.939   -15.221 9.253   1.00 1.19  ? 243 SER A HB3  1 
ATOM   1396 H HG   . SER A 1 88  ? 5.217   -16.047 9.183   1.00 1.87  ? 243 SER A HG   1 
ATOM   1397 N N    . VAL A 1 89  ? 2.219   -11.986 11.333  1.00 0.33  ? 244 VAL A N    1 
ATOM   1398 C CA   . VAL A 1 89  ? 0.902   -11.618 11.923  1.00 0.32  ? 244 VAL A CA   1 
ATOM   1399 C C    . VAL A 1 89  ? 0.540   -10.205 11.479  1.00 0.26  ? 244 VAL A C    1 
ATOM   1400 O O    . VAL A 1 89  ? -0.547  -9.955  11.001  1.00 0.28  ? 244 VAL A O    1 
ATOM   1401 C CB   . VAL A 1 89  ? 0.994   -11.674 13.444  1.00 0.35  ? 244 VAL A CB   1 
ATOM   1402 C CG1  . VAL A 1 89  ? -0.347  -11.265 14.057  1.00 0.46  ? 244 VAL A CG1  1 
ATOM   1403 C CG2  . VAL A 1 89  ? 1.334   -13.102 13.862  1.00 0.43  ? 244 VAL A CG2  1 
ATOM   1404 H H    . VAL A 1 89  ? 3.018   -11.483 11.584  1.00 0.42  ? 244 VAL A H    1 
ATOM   1405 H HA   . VAL A 1 89  ? 0.146   -12.309 11.580  1.00 0.35  ? 244 VAL A HA   1 
ATOM   1406 H HB   . VAL A 1 89  ? 1.768   -11.001 13.785  1.00 0.39  ? 244 VAL A HB   1 
ATOM   1407 H HG11 . VAL A 1 89  ? -1.093  -11.200 13.279  1.00 1.12  ? 244 VAL A HG11 1 
ATOM   1408 H HG12 . VAL A 1 89  ? -0.649  -12.003 14.786  1.00 1.10  ? 244 VAL A HG12 1 
ATOM   1409 H HG13 . VAL A 1 89  ? -0.244  -10.304 14.539  1.00 1.12  ? 244 VAL A HG13 1 
ATOM   1410 H HG21 . VAL A 1 89  ? 0.753   -13.795 13.272  1.00 1.11  ? 244 VAL A HG21 1 
ATOM   1411 H HG22 . VAL A 1 89  ? 2.386   -13.282 13.697  1.00 1.10  ? 244 VAL A HG22 1 
ATOM   1412 H HG23 . VAL A 1 89  ? 1.103   -13.235 14.907  1.00 1.11  ? 244 VAL A HG23 1 
ATOM   1413 N N    . VAL A 1 90  ? 1.446   -9.279  11.625  1.00 0.24  ? 245 VAL A N    1 
ATOM   1414 C CA   . VAL A 1 90  ? 1.158   -7.884  11.200  1.00 0.22  ? 245 VAL A CA   1 
ATOM   1415 C C    . VAL A 1 90  ? 0.904   -7.872  9.690   1.00 0.21  ? 245 VAL A C    1 
ATOM   1416 O O    . VAL A 1 90  ? 0.216   -7.014  9.175   1.00 0.22  ? 245 VAL A O    1 
ATOM   1417 C CB   . VAL A 1 90  ? 2.357   -6.993  11.524  1.00 0.25  ? 245 VAL A CB   1 
ATOM   1418 C CG1  . VAL A 1 90  ? 2.250   -5.686  10.736  1.00 0.29  ? 245 VAL A CG1  1 
ATOM   1419 C CG2  . VAL A 1 90  ? 2.372   -6.685  13.023  1.00 0.31  ? 245 VAL A CG2  1 
ATOM   1420 H H    . VAL A 1 90  ? 2.318   -9.503  12.007  1.00 0.27  ? 245 VAL A H    1 
ATOM   1421 H HA   . VAL A 1 90  ? 0.283   -7.520  11.718  1.00 0.24  ? 245 VAL A HA   1 
ATOM   1422 H HB   . VAL A 1 90  ? 3.269   -7.504  11.249  1.00 0.26  ? 245 VAL A HB   1 
ATOM   1423 H HG11 . VAL A 1 90  ? 1.250   -5.290  10.830  1.00 0.98  ? 245 VAL A HG11 1 
ATOM   1424 H HG12 . VAL A 1 90  ? 2.958   -4.970  11.127  1.00 1.09  ? 245 VAL A HG12 1 
ATOM   1425 H HG13 . VAL A 1 90  ? 2.466   -5.874  9.695   1.00 1.11  ? 245 VAL A HG13 1 
ATOM   1426 H HG21 . VAL A 1 90  ? 1.430   -6.241  13.309  1.00 1.09  ? 245 VAL A HG21 1 
ATOM   1427 H HG22 . VAL A 1 90  ? 2.522   -7.600  13.577  1.00 1.10  ? 245 VAL A HG22 1 
ATOM   1428 H HG23 . VAL A 1 90  ? 3.175   -5.997  13.241  1.00 1.01  ? 245 VAL A HG23 1 
ATOM   1429 N N    . ALA A 1 91  ? 1.451   -8.824  8.975   1.00 0.23  ? 246 ALA A N    1 
ATOM   1430 C CA   . ALA A 1 91  ? 1.233   -8.866  7.503   1.00 0.26  ? 246 ALA A CA   1 
ATOM   1431 C C    . ALA A 1 91  ? -0.152  -9.447  7.236   1.00 0.27  ? 246 ALA A C    1 
ATOM   1432 O O    . ALA A 1 91  ? -0.888  -8.958  6.407   1.00 0.28  ? 246 ALA A O    1 
ATOM   1433 C CB   . ALA A 1 91  ? 2.295   -9.745  6.840   1.00 0.31  ? 246 ALA A CB   1 
ATOM   1434 H H    . ALA A 1 91  ? 1.999   -9.511  9.408   1.00 0.25  ? 246 ALA A H    1 
ATOM   1435 H HA   . ALA A 1 91  ? 1.287   -7.864  7.101   1.00 0.27  ? 246 ALA A HA   1 
ATOM   1436 H HB1  . ALA A 1 91  ? 2.990   -10.096 7.588   1.00 1.09  ? 246 ALA A HB1  1 
ATOM   1437 H HB2  . ALA A 1 91  ? 1.818   -10.591 6.367   1.00 1.06  ? 246 ALA A HB2  1 
ATOM   1438 H HB3  . ALA A 1 91  ? 2.826   -9.169  6.096   1.00 1.05  ? 246 ALA A HB3  1 
ATOM   1439 N N    . GLN A 1 92  ? -0.519  -10.484 7.944   1.00 0.28  ? 247 GLN A N    1 
ATOM   1440 C CA   . GLN A 1 92  ? -1.867  -11.080 7.734   1.00 0.30  ? 247 GLN A CA   1 
ATOM   1441 C C    . GLN A 1 92  ? -2.919  -10.214 8.444   1.00 0.27  ? 247 GLN A C    1 
ATOM   1442 O O    . GLN A 1 92  ? -4.106  -10.448 8.329   1.00 0.31  ? 247 GLN A O    1 
ATOM   1443 C CB   . GLN A 1 92  ? -1.898  -12.498 8.307   1.00 0.35  ? 247 GLN A CB   1 
ATOM   1444 C CG   . GLN A 1 92  ? -2.489  -13.454 7.269   1.00 0.56  ? 247 GLN A CG   1 
ATOM   1445 C CD   . GLN A 1 92  ? -2.133  -14.895 7.639   1.00 1.08  ? 247 GLN A CD   1 
ATOM   1446 O OE1  . GLN A 1 92  ? -1.320  -15.128 8.512   1.00 1.83  ? 247 GLN A OE1  1 
ATOM   1447 N NE2  . GLN A 1 92  ? -2.712  -15.880 7.007   1.00 1.58  ? 247 GLN A NE2  1 
ATOM   1448 H H    . GLN A 1 92  ? 0.088   -10.862 8.620   1.00 0.29  ? 247 GLN A H    1 
ATOM   1449 H HA   . GLN A 1 92  ? -2.085  -11.112 6.677   1.00 0.32  ? 247 GLN A HA   1 
ATOM   1450 H HB2  . GLN A 1 92  ? -0.892  -12.808 8.554   1.00 0.42  ? 247 GLN A HB2  1 
ATOM   1451 H HB3  . GLN A 1 92  ? -2.508  -12.514 9.197   1.00 0.45  ? 247 GLN A HB3  1 
ATOM   1452 H HG2  . GLN A 1 92  ? -3.563  -13.342 7.248   1.00 0.86  ? 247 GLN A HG2  1 
ATOM   1453 H HG3  . GLN A 1 92  ? -2.083  -13.224 6.296   1.00 0.71  ? 247 GLN A HG3  1 
ATOM   1454 H HE21 . GLN A 1 92  ? -3.367  -15.692 6.303   1.00 2.03  ? 247 GLN A HE21 1 
ATOM   1455 H HE22 . GLN A 1 92  ? -2.491  -16.806 7.236   1.00 1.95  ? 247 GLN A HE22 1 
ATOM   1456 N N    . ASN A 1 93  ? -2.493  -9.213  9.176   1.00 0.23  ? 248 ASN A N    1 
ATOM   1457 C CA   . ASN A 1 93  ? -3.455  -8.333  9.885   1.00 0.23  ? 248 ASN A CA   1 
ATOM   1458 C C    . ASN A 1 93  ? -3.697  -7.088  9.030   1.00 0.22  ? 248 ASN A C    1 
ATOM   1459 O O    . ASN A 1 93  ? -4.770  -6.518  9.027   1.00 0.27  ? 248 ASN A O    1 
ATOM   1460 C CB   . ASN A 1 93  ? -2.853  -7.926  11.233  1.00 0.25  ? 248 ASN A CB   1 
ATOM   1461 C CG   . ASN A 1 93  ? -3.943  -7.321  12.120  1.00 0.31  ? 248 ASN A CG   1 
ATOM   1462 O OD1  . ASN A 1 93  ? -5.110  -7.615  11.955  1.00 1.01  ? 248 ASN A OD1  1 
ATOM   1463 N ND2  . ASN A 1 93  ? -3.609  -6.480  13.061  1.00 1.00  ? 248 ASN A ND2  1 
ATOM   1464 H H    . ASN A 1 93  ? -1.538  -9.033  9.257   1.00 0.23  ? 248 ASN A H    1 
ATOM   1465 H HA   . ASN A 1 93  ? -4.386  -8.857  10.042  1.00 0.26  ? 248 ASN A HA   1 
ATOM   1466 H HB2  . ASN A 1 93  ? -2.434  -8.798  11.716  1.00 0.27  ? 248 ASN A HB2  1 
ATOM   1467 H HB3  . ASN A 1 93  ? -2.073  -7.196  11.074  1.00 0.23  ? 248 ASN A HB3  1 
ATOM   1468 H HD21 . ASN A 1 93  ? -2.668  -6.243  13.194  1.00 1.71  ? 248 ASN A HD21 1 
ATOM   1469 H HD22 . ASN A 1 93  ? -4.299  -6.087  13.634  1.00 1.03  ? 248 ASN A HD22 1 
ATOM   1470 N N    . MET A 1 94  ? -2.699  -6.670  8.298   1.00 0.22  ? 249 MET A N    1 
ATOM   1471 C CA   . MET A 1 94  ? -2.851  -5.470  7.432   1.00 0.26  ? 249 MET A CA   1 
ATOM   1472 C C    . MET A 1 94  ? -3.410  -5.892  6.068   1.00 0.29  ? 249 MET A C    1 
ATOM   1473 O O    . MET A 1 94  ? -3.995  -5.100  5.358   1.00 0.34  ? 249 MET A O    1 
ATOM   1474 C CB   . MET A 1 94  ? -1.484  -4.809  7.241   1.00 0.26  ? 249 MET A CB   1 
ATOM   1475 C CG   . MET A 1 94  ? -0.709  -5.545  6.146   1.00 0.30  ? 249 MET A CG   1 
ATOM   1476 S SD   . MET A 1 94  ? 1.050   -5.136  6.271   1.00 0.40  ? 249 MET A SD   1 
ATOM   1477 C CE   . MET A 1 94  ? 0.853   -3.352  6.505   1.00 0.52  ? 249 MET A CE   1 
ATOM   1478 H H    . MET A 1 94  ? -1.846  -7.150  8.316   1.00 0.24  ? 249 MET A H    1 
ATOM   1479 H HA   . MET A 1 94  ? -3.528  -4.769  7.899   1.00 0.28  ? 249 MET A HA   1 
ATOM   1480 H HB2  . MET A 1 94  ? -1.619  -3.777  6.955   1.00 0.28  ? 249 MET A HB2  1 
ATOM   1481 H HB3  . MET A 1 94  ? -0.929  -4.857  8.166   1.00 0.27  ? 249 MET A HB3  1 
ATOM   1482 H HG2  . MET A 1 94  ? -0.840  -6.611  6.267   1.00 0.42  ? 249 MET A HG2  1 
ATOM   1483 H HG3  . MET A 1 94  ? -1.080  -5.245  5.178   1.00 0.42  ? 249 MET A HG3  1 
ATOM   1484 H HE1  . MET A 1 94  ? -0.018  -3.013  5.962   1.00 1.09  ? 249 MET A HE1  1 
ATOM   1485 H HE2  . MET A 1 94  ? 0.726   -3.137  7.554   1.00 1.14  ? 249 MET A HE2  1 
ATOM   1486 H HE3  . MET A 1 94  ? 1.733   -2.842  6.139   1.00 1.23  ? 249 MET A HE3  1 
ATOM   1487 N N    . HIS A 1 95  ? -3.235  -7.134  5.691   1.00 0.31  ? 250 HIS A N    1 
ATOM   1488 C CA   . HIS A 1 95  ? -3.758  -7.592  4.375   1.00 0.38  ? 250 HIS A CA   1 
ATOM   1489 C C    . HIS A 1 95  ? -5.256  -7.868  4.492   1.00 0.34  ? 250 HIS A C    1 
ATOM   1490 O O    . HIS A 1 95  ? -6.001  -7.695  3.551   1.00 0.36  ? 250 HIS A O    1 
ATOM   1491 C CB   . HIS A 1 95  ? -3.039  -8.876  3.956   1.00 0.47  ? 250 HIS A CB   1 
ATOM   1492 C CG   . HIS A 1 95  ? -4.043  -9.984  3.785   1.00 0.48  ? 250 HIS A CG   1 
ATOM   1493 N ND1  . HIS A 1 95  ? -4.227  -10.971 4.740   1.00 0.95  ? 250 HIS A ND1  1 
ATOM   1494 C CD2  . HIS A 1 95  ? -4.916  -10.282 2.768   1.00 1.40  ? 250 HIS A CD2  1 
ATOM   1495 C CE1  . HIS A 1 95  ? -5.176  -11.808 4.281   1.00 0.54  ? 250 HIS A CE1  1 
ATOM   1496 N NE2  . HIS A 1 95  ? -5.631  -11.432 3.083   1.00 1.14  ? 250 HIS A NE2  1 
ATOM   1497 H H    . HIS A 1 95  ? -2.760  -7.764  6.271   1.00 0.30  ? 250 HIS A H    1 
ATOM   1498 H HA   . HIS A 1 95  ? -3.589  -6.826  3.634   1.00 0.43  ? 250 HIS A HA   1 
ATOM   1499 H HB2  . HIS A 1 95  ? -2.523  -8.711  3.021   1.00 0.58  ? 250 HIS A HB2  1 
ATOM   1500 H HB3  . HIS A 1 95  ? -2.326  -9.153  4.716   1.00 0.58  ? 250 HIS A HB3  1 
ATOM   1501 H HD1  . HIS A 1 95  ? -3.753  -11.047 5.593   1.00 1.84  ? 250 HIS A HD1  1 
ATOM   1502 H HD2  . HIS A 1 95  ? -5.023  -9.715  1.859   1.00 2.35  ? 250 HIS A HD2  1 
ATOM   1503 H HE1  . HIS A 1 95  ? -5.522  -12.680 4.812   1.00 0.96  ? 250 HIS A HE1  1 
ATOM   1504 N N    . GLU A 1 96  ? -5.705  -8.299  5.638   1.00 0.32  ? 251 GLU A N    1 
ATOM   1505 C CA   . GLU A 1 96  ? -7.157  -8.586  5.805   1.00 0.33  ? 251 GLU A CA   1 
ATOM   1506 C C    . GLU A 1 96  ? -7.917  -7.275  6.022   1.00 0.29  ? 251 GLU A C    1 
ATOM   1507 O O    . GLU A 1 96  ? -9.043  -7.121  5.590   1.00 0.33  ? 251 GLU A O    1 
ATOM   1508 C CB   . GLU A 1 96  ? -7.359  -9.502  7.013   1.00 0.39  ? 251 GLU A CB   1 
ATOM   1509 C CG   . GLU A 1 96  ? -7.492  -10.949 6.536   1.00 1.14  ? 251 GLU A CG   1 
ATOM   1510 C CD   . GLU A 1 96  ? -8.186  -11.781 7.616   1.00 1.60  ? 251 GLU A CD   1 
ATOM   1511 O OE1  . GLU A 1 96  ? -9.335  -11.495 7.910   1.00 2.10  ? 251 GLU A OE1  1 
ATOM   1512 O OE2  . GLU A 1 96  ? -7.557  -12.691 8.131   1.00 2.12  ? 251 GLU A OE2  1 
ATOM   1513 H H    . GLU A 1 96  ? -5.087  -8.437  6.387   1.00 0.32  ? 251 GLU A H    1 
ATOM   1514 H HA   . GLU A 1 96  ? -7.531  -9.074  4.917   1.00 0.35  ? 251 GLU A HA   1 
ATOM   1515 H HB2  . GLU A 1 96  ? -6.510  -9.416  7.676   1.00 0.67  ? 251 GLU A HB2  1 
ATOM   1516 H HB3  . GLU A 1 96  ? -8.257  -9.214  7.538   1.00 0.79  ? 251 GLU A HB3  1 
ATOM   1517 H HG2  . GLU A 1 96  ? -8.077  -10.975 5.627   1.00 1.50  ? 251 GLU A HG2  1 
ATOM   1518 H HG3  . GLU A 1 96  ? -6.511  -11.356 6.345   1.00 1.52  ? 251 GLU A HG3  1 
ATOM   1519 N N    . THR A 1 97  ? -7.313  -6.328  6.687   1.00 0.27  ? 252 THR A N    1 
ATOM   1520 C CA   . THR A 1 97  ? -8.003  -5.030  6.928   1.00 0.26  ? 252 THR A CA   1 
ATOM   1521 C C    . THR A 1 97  ? -7.947  -4.179  5.657   1.00 0.25  ? 252 THR A C    1 
ATOM   1522 O O    . THR A 1 97  ? -8.830  -3.390  5.386   1.00 0.28  ? 252 THR A O    1 
ATOM   1523 C CB   . THR A 1 97  ? -7.307  -4.286  8.070   1.00 0.29  ? 252 THR A CB   1 
ATOM   1524 O OG1  . THR A 1 97  ? -7.029  -5.196  9.125   1.00 0.37  ? 252 THR A OG1  1 
ATOM   1525 C CG2  . THR A 1 97  ? -8.217  -3.169  8.584   1.00 0.36  ? 252 THR A CG2  1 
ATOM   1526 H H    . THR A 1 97  ? -6.405  -6.472  7.027   1.00 0.30  ? 252 THR A H    1 
ATOM   1527 H HA   . THR A 1 97  ? -9.034  -5.214  7.193   1.00 0.27  ? 252 THR A HA   1 
ATOM   1528 H HB   . THR A 1 97  ? -6.385  -3.856  7.712   1.00 0.31  ? 252 THR A HB   1 
ATOM   1529 H HG1  . THR A 1 97  ? -7.788  -5.211  9.713   1.00 0.80  ? 252 THR A HG1  1 
ATOM   1530 H HG21 . THR A 1 97  ? -9.182  -3.242  8.104   1.00 1.08  ? 252 THR A HG21 1 
ATOM   1531 H HG22 . THR A 1 97  ? -8.338  -3.266  9.653   1.00 1.06  ? 252 THR A HG22 1 
ATOM   1532 H HG23 . THR A 1 97  ? -7.774  -2.211  8.357   1.00 1.10  ? 252 THR A HG23 1 
ATOM   1533 N N    . ILE A 1 98  ? -6.915  -4.336  4.875   1.00 0.25  ? 253 ILE A N    1 
ATOM   1534 C CA   . ILE A 1 98  ? -6.798  -3.540  3.621   1.00 0.27  ? 253 ILE A CA   1 
ATOM   1535 C C    . ILE A 1 98  ? -7.616  -4.206  2.511   1.00 0.30  ? 253 ILE A C    1 
ATOM   1536 O O    . ILE A 1 98  ? -8.080  -3.558  1.597   1.00 0.35  ? 253 ILE A O    1 
ATOM   1537 C CB   . ILE A 1 98  ? -5.330  -3.475  3.199   1.00 0.26  ? 253 ILE A CB   1 
ATOM   1538 C CG1  . ILE A 1 98  ? -5.108  -2.246  2.318   1.00 0.30  ? 253 ILE A CG1  1 
ATOM   1539 C CG2  . ILE A 1 98  ? -4.966  -4.736  2.415   1.00 0.30  ? 253 ILE A CG2  1 
ATOM   1540 C CD1  . ILE A 1 98  ? -4.158  -1.283  3.027   1.00 0.43  ? 253 ILE A CD1  1 
ATOM   1541 H H    . ILE A 1 98  ? -6.215  -4.979  5.113   1.00 0.28  ? 253 ILE A H    1 
ATOM   1542 H HA   . ILE A 1 98  ? -7.168  -2.540  3.792   1.00 0.30  ? 253 ILE A HA   1 
ATOM   1543 H HB   . ILE A 1 98  ? -4.707  -3.406  4.079   1.00 0.24  ? 253 ILE A HB   1 
ATOM   1544 H HG12 . ILE A 1 98  ? -4.678  -2.552  1.375   1.00 0.40  ? 253 ILE A HG12 1 
ATOM   1545 H HG13 . ILE A 1 98  ? -6.052  -1.753  2.141   1.00 0.36  ? 253 ILE A HG13 1 
ATOM   1546 H HG21 . ILE A 1 98  ? -5.333  -5.604  2.941   1.00 1.03  ? 253 ILE A HG21 1 
ATOM   1547 H HG22 . ILE A 1 98  ? -5.415  -4.692  1.434   1.00 1.03  ? 253 ILE A HG22 1 
ATOM   1548 H HG23 . ILE A 1 98  ? -3.892  -4.801  2.318   1.00 1.14  ? 253 ILE A HG23 1 
ATOM   1549 H HD11 . ILE A 1 98  ? -3.438  -1.848  3.602   1.00 1.06  ? 253 ILE A HD11 1 
ATOM   1550 H HD12 . ILE A 1 98  ? -3.641  -0.682  2.294   1.00 1.13  ? 253 ILE A HD12 1 
ATOM   1551 H HD13 . ILE A 1 98  ? -4.723  -0.642  3.687   1.00 1.09  ? 253 ILE A HD13 1 
ATOM   1552 N N    . LEU A 1 99  ? -7.795  -5.496  2.585   1.00 0.31  ? 254 LEU A N    1 
ATOM   1553 C CA   . LEU A 1 99  ? -8.583  -6.206  1.536   1.00 0.37  ? 254 LEU A CA   1 
ATOM   1554 C C    . LEU A 1 99  ? -10.064 -5.840  1.673   1.00 0.30  ? 254 LEU A C    1 
ATOM   1555 O O    . LEU A 1 99  ? -10.805 -5.847  0.711   1.00 0.35  ? 254 LEU A O    1 
ATOM   1556 C CB   . LEU A 1 99  ? -8.417  -7.719  1.712   1.00 0.47  ? 254 LEU A CB   1 
ATOM   1557 C CG   . LEU A 1 99  ? -7.413  -8.262  0.689   1.00 0.81  ? 254 LEU A CG   1 
ATOM   1558 C CD1  . LEU A 1 99  ? -8.075  -8.339  -0.686  1.00 0.93  ? 254 LEU A CD1  1 
ATOM   1559 C CD2  . LEU A 1 99  ? -6.195  -7.337  0.615   1.00 1.45  ? 254 LEU A CD2  1 
ATOM   1560 H H    . LEU A 1 99  ? -7.411  -5.998  3.330   1.00 0.31  ? 254 LEU A H    1 
ATOM   1561 H HA   . LEU A 1 99  ? -8.229  -5.914  0.558   1.00 0.49  ? 254 LEU A HA   1 
ATOM   1562 H HB2  . LEU A 1 99  ? -8.061  -7.926  2.710   1.00 0.70  ? 254 LEU A HB2  1 
ATOM   1563 H HB3  . LEU A 1 99  ? -9.371  -8.202  1.565   1.00 0.38  ? 254 LEU A HB3  1 
ATOM   1564 H HG   . LEU A 1 99  ? -7.097  -9.251  0.989   1.00 1.76  ? 254 LEU A HG   1 
ATOM   1565 H HD11 . LEU A 1 99  ? -9.144  -8.437  -0.566  1.00 1.50  ? 254 LEU A HD11 1 
ATOM   1566 H HD12 . LEU A 1 99  ? -7.856  -7.439  -1.242  1.00 1.48  ? 254 LEU A HD12 1 
ATOM   1567 H HD13 . LEU A 1 99  ? -7.692  -9.195  -1.222  1.00 1.54  ? 254 LEU A HD13 1 
ATOM   1568 H HD21 . LEU A 1 99  ? -6.126  -6.759  1.523   1.00 1.81  ? 254 LEU A HD21 1 
ATOM   1569 H HD22 . LEU A 1 99  ? -5.300  -7.930  0.496   1.00 2.10  ? 254 LEU A HD22 1 
ATOM   1570 H HD23 . LEU A 1 99  ? -6.300  -6.672  -0.229  1.00 2.05  ? 254 LEU A HD23 1 
ATOM   1571 N N    . GLU A 1 100 ? -10.502 -5.523  2.862   1.00 0.30  ? 255 GLU A N    1 
ATOM   1572 C CA   . GLU A 1 100 ? -11.935 -5.161  3.057   1.00 0.35  ? 255 GLU A CA   1 
ATOM   1573 C C    . GLU A 1 100 ? -12.172 -3.724  2.586   1.00 0.35  ? 255 GLU A C    1 
ATOM   1574 O O    . GLU A 1 100 ? -13.175 -3.422  1.972   1.00 0.50  ? 255 GLU A O    1 
ATOM   1575 C CB   . GLU A 1 100 ? -12.294 -5.275  4.540   1.00 0.45  ? 255 GLU A CB   1 
ATOM   1576 C CG   . GLU A 1 100 ? -13.814 -5.340  4.696   1.00 0.68  ? 255 GLU A CG   1 
ATOM   1577 C CD   . GLU A 1 100 ? -14.162 -6.031  6.015   1.00 1.19  ? 255 GLU A CD   1 
ATOM   1578 O OE1  . GLU A 1 100 ? -13.367 -5.940  6.936   1.00 2.01  ? 255 GLU A OE1  1 
ATOM   1579 O OE2  . GLU A 1 100 ? -15.216 -6.641  6.082   1.00 1.66  ? 255 GLU A OE2  1 
ATOM   1580 H H    . GLU A 1 100 ? -9.890  -5.525  3.627   1.00 0.32  ? 255 GLU A H    1 
ATOM   1581 H HA   . GLU A 1 100 ? -12.557 -5.833  2.484   1.00 0.42  ? 255 GLU A HA   1 
ATOM   1582 H HB2  . GLU A 1 100 ? -11.850 -6.171  4.949   1.00 0.60  ? 255 GLU A HB2  1 
ATOM   1583 H HB3  . GLU A 1 100 ? -11.916 -4.412  5.069   1.00 0.53  ? 255 GLU A HB3  1 
ATOM   1584 H HG2  . GLU A 1 100 ? -14.219 -4.338  4.696   1.00 1.06  ? 255 GLU A HG2  1 
ATOM   1585 H HG3  . GLU A 1 100 ? -14.238 -5.899  3.876   1.00 1.09  ? 255 GLU A HG3  1 
ATOM   1586 N N    . ALA A 1 101 ? -11.259 -2.836  2.868   1.00 0.30  ? 256 ALA A N    1 
ATOM   1587 C CA   . ALA A 1 101 ? -11.439 -1.421  2.434   1.00 0.41  ? 256 ALA A CA   1 
ATOM   1588 C C    . ALA A 1 101 ? -11.463 -1.359  0.906   1.00 0.36  ? 256 ALA A C    1 
ATOM   1589 O O    . ALA A 1 101 ? -12.339 -0.764  0.311   1.00 0.45  ? 256 ALA A O    1 
ATOM   1590 C CB   . ALA A 1 101 ? -10.278 -0.574  2.961   1.00 0.56  ? 256 ALA A CB   1 
ATOM   1591 H H    . ALA A 1 101 ? -10.456 -3.099  3.365   1.00 0.30  ? 256 ALA A H    1 
ATOM   1592 H HA   . ALA A 1 101 ? -12.370 -1.040  2.825   1.00 0.47  ? 256 ALA A HA   1 
ATOM   1593 H HB1  . ALA A 1 101 ? -9.948  -0.967  3.911   1.00 1.12  ? 256 ALA A HB1  1 
ATOM   1594 H HB2  . ALA A 1 101 ? -9.461  -0.604  2.255   1.00 1.28  ? 256 ALA A HB2  1 
ATOM   1595 H HB3  . ALA A 1 101 ? -10.607 0.447   3.088   1.00 1.14  ? 256 ALA A HB3  1 
ATOM   1596 N N    . MET A 1 102 ? -10.506 -1.972  0.267   1.00 0.32  ? 257 MET A N    1 
ATOM   1597 C CA   . MET A 1 102 ? -10.466 -1.955  -1.222  1.00 0.33  ? 257 MET A CA   1 
ATOM   1598 C C    . MET A 1 102 ? -11.699 -2.674  -1.770  1.00 0.28  ? 257 MET A C    1 
ATOM   1599 O O    . MET A 1 102 ? -12.271 -2.274  -2.764  1.00 0.27  ? 257 MET A O    1 
ATOM   1600 C CB   . MET A 1 102 ? -9.203  -2.668  -1.703  1.00 0.39  ? 257 MET A CB   1 
ATOM   1601 C CG   . MET A 1 102 ? -7.971  -1.925  -1.185  1.00 0.62  ? 257 MET A CG   1 
ATOM   1602 S SD   . MET A 1 102 ? -6.637  -2.044  -2.400  1.00 1.13  ? 257 MET A SD   1 
ATOM   1603 C CE   . MET A 1 102 ? -5.664  -3.311  -1.549  1.00 0.84  ? 257 MET A CE   1 
ATOM   1604 H H    . MET A 1 102 ? -9.811  -2.446  0.767   1.00 0.38  ? 257 MET A H    1 
ATOM   1605 H HA   . MET A 1 102 ? -10.459 -0.933  -1.571  1.00 0.37  ? 257 MET A HA   1 
ATOM   1606 H HB2  . MET A 1 102 ? -9.199  -3.682  -1.328  1.00 0.54  ? 257 MET A HB2  1 
ATOM   1607 H HB3  . MET A 1 102 ? -9.187  -2.683  -2.782  1.00 0.47  ? 257 MET A HB3  1 
ATOM   1608 H HG2  . MET A 1 102 ? -8.218  -0.886  -1.024  1.00 0.88  ? 257 MET A HG2  1 
ATOM   1609 H HG3  . MET A 1 102 ? -7.649  -2.367  -0.254  1.00 0.95  ? 257 MET A HG3  1 
ATOM   1610 H HE1  . MET A 1 102 ? -6.325  -3.987  -1.032  1.00 1.55  ? 257 MET A HE1  1 
ATOM   1611 H HE2  . MET A 1 102 ? -5.080  -3.863  -2.273  1.00 1.39  ? 257 MET A HE2  1 
ATOM   1612 H HE3  . MET A 1 102 ? -5.006  -2.837  -0.833  1.00 1.34  ? 257 MET A HE3  1 
ATOM   1613 N N    . ARG A 1 103 ? -12.114 -3.731  -1.130  1.00 0.29  ? 258 ARG A N    1 
ATOM   1614 C CA   . ARG A 1 103 ? -13.313 -4.471  -1.614  1.00 0.29  ? 258 ARG A CA   1 
ATOM   1615 C C    . ARG A 1 103 ? -14.547 -3.573  -1.493  1.00 0.29  ? 258 ARG A C    1 
ATOM   1616 O O    . ARG A 1 103 ? -15.509 -3.722  -2.218  1.00 0.33  ? 258 ARG A O    1 
ATOM   1617 C CB   . ARG A 1 103 ? -13.517 -5.725  -0.764  1.00 0.34  ? 258 ARG A CB   1 
ATOM   1618 C CG   . ARG A 1 103 ? -12.768 -6.901  -1.394  1.00 1.31  ? 258 ARG A CG   1 
ATOM   1619 C CD   . ARG A 1 103 ? -13.046 -8.172  -0.588  1.00 1.67  ? 258 ARG A CD   1 
ATOM   1620 N NE   . ARG A 1 103 ? -13.476 -9.262  -1.509  1.00 2.55  ? 258 ARG A NE   1 
ATOM   1621 C CZ   . ARG A 1 103 ? -14.588 -9.906  -1.283  1.00 3.04  ? 258 ARG A CZ   1 
ATOM   1622 N NH1  . ARG A 1 103 ? -14.692 -10.684 -0.241  1.00 3.42  ? 258 ARG A NH1  1 
ATOM   1623 N NH2  . ARG A 1 103 ? -15.597 -9.775  -2.101  1.00 3.64  ? 258 ARG A NH2  1 
ATOM   1624 H H    . ARG A 1 103 ? -11.640 -4.037  -0.329  1.00 0.33  ? 258 ARG A H    1 
ATOM   1625 H HA   . ARG A 1 103 ? -13.171 -4.753  -2.647  1.00 0.31  ? 258 ARG A HA   1 
ATOM   1626 H HB2  . ARG A 1 103 ? -13.139 -5.548  0.232   1.00 1.07  ? 258 ARG A HB2  1 
ATOM   1627 H HB3  . ARG A 1 103 ? -14.570 -5.956  -0.714  1.00 1.01  ? 258 ARG A HB3  1 
ATOM   1628 H HG2  . ARG A 1 103 ? -13.104 -7.038  -2.412  1.00 1.88  ? 258 ARG A HG2  1 
ATOM   1629 H HG3  . ARG A 1 103 ? -11.708 -6.698  -1.389  1.00 1.87  ? 258 ARG A HG3  1 
ATOM   1630 H HD2  . ARG A 1 103 ? -12.147 -8.472  -0.069  1.00 2.10  ? 258 ARG A HD2  1 
ATOM   1631 H HD3  . ARG A 1 103 ? -13.828 -7.978  0.131   1.00 1.69  ? 258 ARG A HD3  1 
ATOM   1632 H HE   . ARG A 1 103 ? -12.923 -9.495  -2.284  1.00 3.08  ? 258 ARG A HE   1 
ATOM   1633 H HH11 . ARG A 1 103 ? -13.919 -10.786 0.386   1.00 3.50  ? 258 ARG A HH11 1 
ATOM   1634 H HH12 . ARG A 1 103 ? -15.544 -11.178 -0.068  1.00 3.93  ? 258 ARG A HH12 1 
ATOM   1635 H HH21 . ARG A 1 103 ? -15.517 -9.180  -2.901  1.00 3.86  ? 258 ARG A HH21 1 
ATOM   1636 H HH22 . ARG A 1 103 ? -16.449 -10.269 -1.928  1.00 4.13  ? 258 ARG A HH22 1 
ATOM   1637 N N    . ALA A 1 104 ? -14.527 -2.639  -0.579  1.00 0.30  ? 259 ALA A N    1 
ATOM   1638 C CA   . ALA A 1 104 ? -15.698 -1.733  -0.413  1.00 0.35  ? 259 ALA A CA   1 
ATOM   1639 C C    . ALA A 1 104 ? -15.708 -0.690  -1.535  1.00 0.32  ? 259 ALA A C    1 
ATOM   1640 O O    . ALA A 1 104 ? -16.735 -0.129  -1.859  1.00 0.39  ? 259 ALA A O    1 
ATOM   1641 C CB   . ALA A 1 104 ? -15.606 -1.025  0.940   1.00 0.43  ? 259 ALA A CB   1 
ATOM   1642 H H    . ALA A 1 104 ? -13.742 -2.533  -0.003  1.00 0.31  ? 259 ALA A H    1 
ATOM   1643 H HA   . ALA A 1 104 ? -16.608 -2.313  -0.453  1.00 0.38  ? 259 ALA A HA   1 
ATOM   1644 H HB1  . ALA A 1 104 ? -15.424 -1.753  1.717   1.00 1.14  ? 259 ALA A HB1  1 
ATOM   1645 H HB2  . ALA A 1 104 ? -14.796 -0.311  0.919   1.00 1.09  ? 259 ALA A HB2  1 
ATOM   1646 H HB3  . ALA A 1 104 ? -16.534 -0.510  1.141   1.00 1.07  ? 259 ALA A HB3  1 
ATOM   1647 N N    . MET A 1 105 ? -14.575 -0.422  -2.130  1.00 0.29  ? 260 MET A N    1 
ATOM   1648 C CA   . MET A 1 105 ? -14.531 0.586   -3.226  1.00 0.29  ? 260 MET A CA   1 
ATOM   1649 C C    . MET A 1 105 ? -14.946 -0.070  -4.547  1.00 0.27  ? 260 MET A C    1 
ATOM   1650 O O    . MET A 1 105 ? -15.887 0.352   -5.189  1.00 0.30  ? 260 MET A O    1 
ATOM   1651 C CB   . MET A 1 105 ? -13.109 1.137   -3.353  1.00 0.32  ? 260 MET A CB   1 
ATOM   1652 C CG   . MET A 1 105 ? -13.133 2.657   -3.187  1.00 0.59  ? 260 MET A CG   1 
ATOM   1653 S SD   . MET A 1 105 ? -11.770 3.388   -4.128  1.00 1.15  ? 260 MET A SD   1 
ATOM   1654 C CE   . MET A 1 105 ? -10.446 2.355   -3.453  1.00 0.43  ? 260 MET A CE   1 
ATOM   1655 H H    . MET A 1 105 ? -13.755 -0.879  -1.856  1.00 0.31  ? 260 MET A H    1 
ATOM   1656 H HA   . MET A 1 105 ? -15.210 1.394   -2.998  1.00 0.31  ? 260 MET A HA   1 
ATOM   1657 H HB2  . MET A 1 105 ? -12.484 0.700   -2.588  1.00 0.50  ? 260 MET A HB2  1 
ATOM   1658 H HB3  . MET A 1 105 ? -12.713 0.890   -4.326  1.00 0.41  ? 260 MET A HB3  1 
ATOM   1659 H HG2  . MET A 1 105 ? -14.072 3.045   -3.554  1.00 0.86  ? 260 MET A HG2  1 
ATOM   1660 H HG3  . MET A 1 105 ? -13.024 2.908   -2.142  1.00 0.91  ? 260 MET A HG3  1 
ATOM   1661 H HE1  . MET A 1 105 ? -10.446 2.431   -2.374  1.00 1.22  ? 260 MET A HE1  1 
ATOM   1662 H HE2  . MET A 1 105 ? -10.608 1.328   -3.738  1.00 1.06  ? 260 MET A HE2  1 
ATOM   1663 H HE3  . MET A 1 105 ? -9.495  2.690   -3.843  1.00 1.04  ? 260 MET A HE3  1 
ATOM   1664 N N    . SER A 1 106 ? -14.253 -1.098  -4.962  1.00 0.27  ? 261 SER A N    1 
ATOM   1665 C CA   . SER A 1 106 ? -14.616 -1.770  -6.244  1.00 0.30  ? 261 SER A CA   1 
ATOM   1666 C C    . SER A 1 106 ? -16.040 -2.328  -6.152  1.00 0.34  ? 261 SER A C    1 
ATOM   1667 O O    . SER A 1 106 ? -16.782 -2.324  -7.114  1.00 0.43  ? 261 SER A O    1 
ATOM   1668 C CB   . SER A 1 106 ? -13.642 -2.916  -6.514  1.00 0.31  ? 261 SER A CB   1 
ATOM   1669 O OG   . SER A 1 106 ? -14.309 -4.154  -6.310  1.00 0.88  ? 261 SER A OG   1 
ATOM   1670 H H    . SER A 1 106 ? -13.494 -1.427  -4.434  1.00 0.29  ? 261 SER A H    1 
ATOM   1671 H HA   . SER A 1 106 ? -14.560 -1.055  -7.052  1.00 0.33  ? 261 SER A HA   1 
ATOM   1672 H HB2  . SER A 1 106 ? -13.296 -2.864  -7.533  1.00 0.76  ? 261 SER A HB2  1 
ATOM   1673 H HB3  . SER A 1 106 ? -12.797 -2.835  -5.844  1.00 0.76  ? 261 SER A HB3  1 
ATOM   1674 H HG   . SER A 1 106 ? -14.441 -4.565  -7.168  1.00 1.39  ? 261 SER A HG   1 
ATOM   1675 N N    . ASP A 1 107 ? -16.424 -2.812  -5.003  1.00 0.35  ? 262 ASP A N    1 
ATOM   1676 C CA   . ASP A 1 107 ? -17.797 -3.376  -4.847  1.00 0.43  ? 262 ASP A CA   1 
ATOM   1677 C C    . ASP A 1 107 ? -18.820 -2.241  -4.763  1.00 0.46  ? 262 ASP A C    1 
ATOM   1678 O O    . ASP A 1 107 ? -19.903 -2.328  -5.306  1.00 0.63  ? 262 ASP A O    1 
ATOM   1679 C CB   . ASP A 1 107 ? -17.861 -4.207  -3.567  1.00 0.53  ? 262 ASP A CB   1 
ATOM   1680 C CG   . ASP A 1 107 ? -19.109 -5.091  -3.594  1.00 1.00  ? 262 ASP A CG   1 
ATOM   1681 O OD1  . ASP A 1 107 ? -19.029 -6.177  -4.146  1.00 1.74  ? 262 ASP A OD1  1 
ATOM   1682 O OD2  . ASP A 1 107 ? -20.122 -4.668  -3.063  1.00 1.51  ? 262 ASP A OD2  1 
ATOM   1683 H H    . ASP A 1 107 ? -15.809 -2.808  -4.241  1.00 0.35  ? 262 ASP A H    1 
ATOM   1684 H HA   . ASP A 1 107 ? -18.027 -4.004  -5.695  1.00 0.59  ? 262 ASP A HA   1 
ATOM   1685 H HB2  . ASP A 1 107 ? -16.980 -4.827  -3.498  1.00 0.64  ? 262 ASP A HB2  1 
ATOM   1686 H HB3  . ASP A 1 107 ? -17.908 -3.548  -2.714  1.00 0.70  ? 262 ASP A HB3  1 
ATOM   1687 N N    . GLU A 1 108 ? -18.486 -1.177  -4.086  1.00 0.50  ? 263 GLU A N    1 
ATOM   1688 C CA   . GLU A 1 108 ? -19.442 -0.039  -3.969  1.00 0.73  ? 263 GLU A CA   1 
ATOM   1689 C C    . GLU A 1 108 ? -19.110 1.020   -5.022  1.00 0.80  ? 263 GLU A C    1 
ATOM   1690 O O    . GLU A 1 108 ? -19.395 2.188   -4.850  1.00 1.28  ? 263 GLU A O    1 
ATOM   1691 C CB   . GLU A 1 108 ? -19.332 0.583   -2.575  1.00 1.09  ? 263 GLU A CB   1 
ATOM   1692 C CG   . GLU A 1 108 ? -20.546 1.478   -2.316  1.00 1.74  ? 263 GLU A CG   1 
ATOM   1693 C CD   . GLU A 1 108 ? -20.074 2.878   -1.920  1.00 2.18  ? 263 GLU A CD   1 
ATOM   1694 O OE1  . GLU A 1 108 ? -19.580 3.583   -2.785  1.00 2.65  ? 263 GLU A OE1  1 
ATOM   1695 O OE2  . GLU A 1 108 ? -20.214 3.222   -0.758  1.00 2.72  ? 263 GLU A OE2  1 
ATOM   1696 H H    . GLU A 1 108 ? -17.609 -1.126  -3.655  1.00 0.48  ? 263 GLU A H    1 
ATOM   1697 H HA   . GLU A 1 108 ? -20.449 -0.398  -4.124  1.00 0.96  ? 263 GLU A HA   1 
ATOM   1698 H HB2  . GLU A 1 108 ? -19.296 -0.202  -1.832  1.00 1.38  ? 263 GLU A HB2  1 
ATOM   1699 H HB3  . GLU A 1 108 ? -18.432 1.176   -2.516  1.00 1.38  ? 263 GLU A HB3  1 
ATOM   1700 H HG2  . GLU A 1 108 ? -21.145 1.540   -3.214  1.00 2.21  ? 263 GLU A HG2  1 
ATOM   1701 H HG3  . GLU A 1 108 ? -21.137 1.060   -1.516  1.00 2.25  ? 263 GLU A HG3  1 
ATOM   1702 N N    . PHE A 1 109 ? -18.509 0.625   -6.112  1.00 0.74  ? 264 PHE A N    1 
ATOM   1703 C CA   . PHE A 1 109 ? -18.163 1.616   -7.167  1.00 1.08  ? 264 PHE A CA   1 
ATOM   1704 C C    . PHE A 1 109 ? -19.398 1.901   -8.024  1.00 1.47  ? 264 PHE A C    1 
ATOM   1705 O O    . PHE A 1 109 ? -19.971 2.970   -7.963  1.00 1.91  ? 264 PHE A O    1 
ATOM   1706 C CB   . PHE A 1 109 ? -17.048 1.053   -8.052  1.00 1.40  ? 264 PHE A CB   1 
ATOM   1707 C CG   . PHE A 1 109 ? -16.013 2.123   -8.299  1.00 2.06  ? 264 PHE A CG   1 
ATOM   1708 C CD1  . PHE A 1 109 ? -16.375 3.313   -8.942  1.00 2.69  ? 264 PHE A CD1  1 
ATOM   1709 C CD2  . PHE A 1 109 ? -14.691 1.925   -7.886  1.00 2.91  ? 264 PHE A CD2  1 
ATOM   1710 C CE1  . PHE A 1 109 ? -15.414 4.305   -9.171  1.00 3.68  ? 264 PHE A CE1  1 
ATOM   1711 C CE2  . PHE A 1 109 ? -13.730 2.917   -8.114  1.00 3.88  ? 264 PHE A CE2  1 
ATOM   1712 C CZ   . PHE A 1 109 ? -14.091 4.107   -8.757  1.00 4.14  ? 264 PHE A CZ   1 
ATOM   1713 H H    . PHE A 1 109 ? -18.284 -0.321  -6.237  1.00 0.82  ? 264 PHE A H    1 
ATOM   1714 H HA   . PHE A 1 109 ? -17.827 2.532   -6.704  1.00 1.49  ? 264 PHE A HA   1 
ATOM   1715 H HB2  . PHE A 1 109 ? -16.586 0.212   -7.557  1.00 1.60  ? 264 PHE A HB2  1 
ATOM   1716 H HB3  . PHE A 1 109 ? -17.463 0.732   -8.995  1.00 1.89  ? 264 PHE A HB3  1 
ATOM   1717 H HD1  . PHE A 1 109 ? -17.395 3.466   -9.261  1.00 2.87  ? 264 PHE A HD1  1 
ATOM   1718 H HD2  . PHE A 1 109 ? -14.412 1.007   -7.390  1.00 3.20  ? 264 PHE A HD2  1 
ATOM   1719 H HE1  . PHE A 1 109 ? -15.692 5.223   -9.667  1.00 4.39  ? 264 PHE A HE1  1 
ATOM   1720 H HE2  . PHE A 1 109 ? -12.710 2.763   -7.795  1.00 4.70  ? 264 PHE A HE2  1 
ATOM   1721 H HZ   . PHE A 1 109 ? -13.349 4.872   -8.933  1.00 5.01  ? 264 PHE A HZ   1 
ATOM   1722 N N    . ARG A 1 110 ? -19.810 0.948   -8.821  1.00 1.91  ? 265 ARG A N    1 
ATOM   1723 C CA   . ARG A 1 110 ? -21.001 1.144   -9.686  1.00 2.74  ? 265 ARG A CA   1 
ATOM   1724 C C    . ARG A 1 110 ? -21.109 -0.049  -10.656 1.00 3.15  ? 265 ARG A C    1 
ATOM   1725 O O    . ARG A 1 110 ? -20.101 -0.579  -11.074 1.00 3.44  ? 265 ARG A O    1 
ATOM   1726 C CB   . ARG A 1 110 ? -20.876 2.449   -10.494 1.00 3.36  ? 265 ARG A CB   1 
ATOM   1727 C CG   . ARG A 1 110 ? -19.463 2.600   -11.078 1.00 3.89  ? 265 ARG A CG   1 
ATOM   1728 C CD   . ARG A 1 110 ? -19.355 1.811   -12.383 1.00 4.80  ? 265 ARG A CD   1 
ATOM   1729 N NE   . ARG A 1 110 ? -18.270 0.797   -12.258 1.00 5.64  ? 265 ARG A NE   1 
ATOM   1730 C CZ   . ARG A 1 110 ? -18.065 -0.065  -13.215 1.00 6.42  ? 265 ARG A CZ   1 
ATOM   1731 N NH1  . ARG A 1 110 ? -17.952 0.343   -14.449 1.00 7.07  ? 265 ARG A NH1  1 
ATOM   1732 N NH2  . ARG A 1 110 ? -17.970 -1.337  -12.937 1.00 6.83  ? 265 ARG A NH2  1 
ATOM   1733 H H    . ARG A 1 110 ? -19.336 0.096   -8.850  1.00 1.96  ? 265 ARG A H    1 
ATOM   1734 H HA   . ARG A 1 110 ? -21.871 1.196   -9.056  1.00 3.27  ? 265 ARG A HA   1 
ATOM   1735 H HB2  . ARG A 1 110 ? -21.593 2.434   -11.302 1.00 3.65  ? 265 ARG A HB2  1 
ATOM   1736 H HB3  . ARG A 1 110 ? -21.087 3.290   -9.850  1.00 3.79  ? 265 ARG A HB3  1 
ATOM   1737 H HG2  . ARG A 1 110 ? -19.270 3.644   -11.276 1.00 4.07  ? 265 ARG A HG2  1 
ATOM   1738 H HG3  . ARG A 1 110 ? -18.731 2.232   -10.378 1.00 4.03  ? 265 ARG A HG3  1 
ATOM   1739 H HD2  . ARG A 1 110 ? -20.293 1.316   -12.582 1.00 5.08  ? 265 ARG A HD2  1 
ATOM   1740 H HD3  . ARG A 1 110 ? -19.125 2.487   -13.193 1.00 5.00  ? 265 ARG A HD3  1 
ATOM   1741 H HE   . ARG A 1 110 ? -17.709 0.778   -11.454 1.00 5.83  ? 265 ARG A HE   1 
ATOM   1742 H HH11 . ARG A 1 110 ? -18.021 1.318   -14.662 1.00 7.03  ? 265 ARG A HH11 1 
ATOM   1743 H HH12 . ARG A 1 110 ? -17.794 -0.319  -15.182 1.00 7.79  ? 265 ARG A HH12 1 
ATOM   1744 H HH21 . ARG A 1 110 ? -18.054 -1.650  -11.991 1.00 6.59  ? 265 ARG A HH21 1 
ATOM   1745 H HH22 . ARG A 1 110 ? -17.814 -1.999  -13.670 1.00 7.56  ? 265 ARG A HH22 1 
ATOM   1746 N N    . PRO A 1 111 ? -22.326 -0.436  -10.981 1.00 3.82  ? 266 PRO A N    1 
ATOM   1747 C CA   . PRO A 1 111 ? -22.608 -1.558  -11.902 1.00 4.75  ? 266 PRO A CA   1 
ATOM   1748 C C    . PRO A 1 111 ? -21.910 -1.343  -13.258 1.00 5.08  ? 266 PRO A C    1 
ATOM   1749 O O    . PRO A 1 111 ? -20.891 -0.693  -13.350 1.00 4.99  ? 266 PRO A O    1 
ATOM   1750 C CB   . PRO A 1 111 ? -24.124 -1.559  -12.097 1.00 5.62  ? 266 PRO A CB   1 
ATOM   1751 C CG   . PRO A 1 111 ? -24.638 -0.823  -10.840 1.00 5.39  ? 266 PRO A CG   1 
ATOM   1752 C CD   . PRO A 1 111 ? -23.548 0.201   -10.451 1.00 4.27  ? 266 PRO A CD   1 
ATOM   1753 H HA   . PRO A 1 111 ? -22.296 -2.492  -11.463 1.00 5.03  ? 266 PRO A HA   1 
ATOM   1754 H HB2  . PRO A 1 111 ? -24.391 -1.021  -12.998 1.00 6.18  ? 266 PRO A HB2  1 
ATOM   1755 H HB3  . PRO A 1 111 ? -24.508 -2.566  -12.120 1.00 6.11  ? 266 PRO A HB3  1 
ATOM   1756 H HG2  . PRO A 1 111 ? -25.566 -0.315  -11.063 1.00 5.87  ? 266 PRO A HG2  1 
ATOM   1757 H HG3  . PRO A 1 111 ? -24.783 -1.524  -10.033 1.00 5.85  ? 266 PRO A HG3  1 
ATOM   1758 H HD2  . PRO A 1 111 ? -23.729 1.157   -10.924 1.00 4.29  ? 266 PRO A HD2  1 
ATOM   1759 H HD3  . PRO A 1 111 ? -23.480 0.299   -9.379  1.00 4.29  ? 266 PRO A HD3  1 
ATOM   1760 N N    . ARG A 1 112 ? -22.454 -1.886  -14.318 1.00 5.85  ? 267 ARG A N    1 
ATOM   1761 C CA   . ARG A 1 112 ? -21.823 -1.711  -15.657 1.00 6.58  ? 267 ARG A CA   1 
ATOM   1762 C C    . ARG A 1 112 ? -20.460 -2.407  -15.671 1.00 7.13  ? 267 ARG A C    1 
ATOM   1763 O O    . ARG A 1 112 ? -20.365 -3.467  -16.267 1.00 7.64  ? 267 ARG A O    1 
ATOM   1764 C CB   . ARG A 1 112 ? -21.638 -0.219  -15.958 1.00 7.22  ? 267 ARG A CB   1 
ATOM   1765 C CG   . ARG A 1 112 ? -22.908 0.551   -15.581 1.00 7.47  ? 267 ARG A CG   1 
ATOM   1766 C CD   . ARG A 1 112 ? -22.674 1.343   -14.291 1.00 8.34  ? 267 ARG A CD   1 
ATOM   1767 N NE   . ARG A 1 112 ? -23.239 2.713   -14.441 1.00 8.99  ? 267 ARG A NE   1 
ATOM   1768 C CZ   . ARG A 1 112 ? -24.428 2.873   -14.951 1.00 9.68  ? 267 ARG A CZ   1 
ATOM   1769 N NH1  . ARG A 1 112 ? -25.451 2.253   -14.429 1.00 10.14 ? 267 ARG A NH1  1 
ATOM   1770 N NH2  . ARG A 1 112 ? -24.595 3.652   -15.984 1.00 10.11 ? 267 ARG A NH2  1 
ATOM   1771 O OXT  . ARG A 1 112 ? -19.536 -1.870  -15.085 1.00 7.31  ? 267 ARG A OXT  1 
ATOM   1772 H H    . ARG A 1 112 ? -23.276 -2.408  -14.237 1.00 6.17  ? 267 ARG A H    1 
ATOM   1773 H HA   . ARG A 1 112 ? -22.457 -2.153  -16.411 1.00 6.61  ? 267 ARG A HA   1 
ATOM   1774 H HB2  . ARG A 1 112 ? -20.800 0.163   -15.396 1.00 7.51  ? 267 ARG A HB2  1 
ATOM   1775 H HB3  . ARG A 1 112 ? -21.448 -0.093  -17.012 1.00 7.53  ? 267 ARG A HB3  1 
ATOM   1776 H HG2  . ARG A 1 112 ? -23.163 1.233   -16.379 1.00 7.45  ? 267 ARG A HG2  1 
ATOM   1777 H HG3  . ARG A 1 112 ? -23.720 -0.145  -15.431 1.00 7.39  ? 267 ARG A HG3  1 
ATOM   1778 H HD2  . ARG A 1 112 ? -23.163 0.842   -13.468 1.00 8.58  ? 267 ARG A HD2  1 
ATOM   1779 H HD3  . ARG A 1 112 ? -21.615 1.410   -14.093 1.00 8.50  ? 267 ARG A HD3  1 
ATOM   1780 H HE   . ARG A 1 112 ? -22.717 3.492   -14.157 1.00 9.07  ? 267 ARG A HE   1 
ATOM   1781 H HH11 . ARG A 1 112 ? -25.322 1.654   -13.638 1.00 9.99  ? 267 ARG A HH11 1 
ATOM   1782 H HH12 . ARG A 1 112 ? -26.363 2.375   -14.820 1.00 10.77 ? 267 ARG A HH12 1 
ATOM   1783 H HH21 . ARG A 1 112 ? -23.811 4.126   -16.385 1.00 9.93  ? 267 ARG A HH21 1 
ATOM   1784 H HH22 . ARG A 1 112 ? -25.507 3.774   -16.375 1.00 10.75 ? 267 ARG A HH22 1 
ATOM   1785 N N    . LEU B 2 1   ? 4.245   -18.101 -1.016  1.00 0.68  ? 489 LEU B N    1 
ATOM   1786 C CA   . LEU B 2 1   ? 4.187   -16.661 -1.398  1.00 0.60  ? 489 LEU B CA   1 
ATOM   1787 C C    . LEU B 2 1   ? 2.750   -16.154 -1.261  1.00 0.60  ? 489 LEU B C    1 
ATOM   1788 O O    . LEU B 2 1   ? 2.042   -15.978 -2.233  1.00 0.90  ? 489 LEU B O    1 
ATOM   1789 C CB   . LEU B 2 1   ? 4.663   -16.498 -2.845  1.00 0.68  ? 489 LEU B CB   1 
ATOM   1790 C CG   . LEU B 2 1   ? 5.555   -15.260 -2.949  1.00 0.69  ? 489 LEU B CG   1 
ATOM   1791 C CD1  . LEU B 2 1   ? 6.993   -15.692 -3.239  1.00 1.04  ? 489 LEU B CD1  1 
ATOM   1792 C CD2  . LEU B 2 1   ? 5.053   -14.364 -4.085  1.00 1.04  ? 489 LEU B CD2  1 
ATOM   1793 H H1   . LEU B 2 1   ? 3.924   -18.212 -0.034  1.00 1.23  ? 489 LEU B H1   1 
ATOM   1794 H H2   . LEU B 2 1   ? 3.628   -18.652 -1.648  1.00 1.11  ? 489 LEU B H2   1 
ATOM   1795 H H3   . LEU B 2 1   ? 5.223   -18.443 -1.100  1.00 1.26  ? 489 LEU B H3   1 
ATOM   1796 H HA   . LEU B 2 1   ? 4.829   -16.090 -0.743  1.00 0.56  ? 489 LEU B HA   1 
ATOM   1797 H HB2  . LEU B 2 1   ? 5.225   -17.372 -3.139  1.00 0.85  ? 489 LEU B HB2  1 
ATOM   1798 H HB3  . LEU B 2 1   ? 3.812   -16.382 -3.498  1.00 0.81  ? 489 LEU B HB3  1 
ATOM   1799 H HG   . LEU B 2 1   ? 5.525   -14.714 -2.017  1.00 0.82  ? 489 LEU B HG   1 
ATOM   1800 H HD11 . LEU B 2 1   ? 7.223   -16.582 -2.672  1.00 1.57  ? 489 LEU B HD11 1 
ATOM   1801 H HD12 . LEU B 2 1   ? 7.101   -15.900 -4.294  1.00 1.59  ? 489 LEU B HD12 1 
ATOM   1802 H HD13 . LEU B 2 1   ? 7.671   -14.900 -2.958  1.00 1.48  ? 489 LEU B HD13 1 
ATOM   1803 H HD21 . LEU B 2 1   ? 4.431   -14.943 -4.751  1.00 1.52  ? 489 LEU B HD21 1 
ATOM   1804 H HD22 . LEU B 2 1   ? 4.478   -13.548 -3.673  1.00 1.60  ? 489 LEU B HD22 1 
ATOM   1805 H HD23 . LEU B 2 1   ? 5.897   -13.970 -4.632  1.00 1.44  ? 489 LEU B HD23 1 
ATOM   1806 N N    . VAL B 2 2   ? 2.314   -15.915 -0.056  1.00 0.45  ? 490 VAL B N    1 
ATOM   1807 C CA   . VAL B 2 2   ? 0.925   -15.416 0.149   1.00 0.42  ? 490 VAL B CA   1 
ATOM   1808 C C    . VAL B 2 2   ? 0.740   -14.123 -0.648  1.00 0.48  ? 490 VAL B C    1 
ATOM   1809 O O    . VAL B 2 2   ? 1.378   -13.124 -0.380  1.00 0.86  ? 490 VAL B O    1 
ATOM   1810 C CB   . VAL B 2 2   ? 0.702   -15.141 1.638   1.00 0.39  ? 490 VAL B CB   1 
ATOM   1811 C CG1  . VAL B 2 2   ? -0.781  -14.875 1.896   1.00 0.44  ? 490 VAL B CG1  1 
ATOM   1812 C CG2  . VAL B 2 2   ? 1.150   -16.356 2.456   1.00 0.41  ? 490 VAL B CG2  1 
ATOM   1813 H H    . VAL B 2 2   ? 2.901   -16.062 0.715   1.00 0.58  ? 490 VAL B H    1 
ATOM   1814 H HA   . VAL B 2 2   ? 0.219   -16.158 -0.193  1.00 0.45  ? 490 VAL B HA   1 
ATOM   1815 H HB   . VAL B 2 2   ? 1.278   -14.277 1.931   1.00 0.43  ? 490 VAL B HB   1 
ATOM   1816 H HG11 . VAL B 2 2   ? -1.366  -15.698 1.514   1.00 1.04  ? 490 VAL B HG11 1 
ATOM   1817 H HG12 . VAL B 2 2   ? -0.949  -14.777 2.959   1.00 1.20  ? 490 VAL B HG12 1 
ATOM   1818 H HG13 . VAL B 2 2   ? -1.074  -13.962 1.400   1.00 1.08  ? 490 VAL B HG13 1 
ATOM   1819 H HG21 . VAL B 2 2   ? 1.169   -17.230 1.821   1.00 1.12  ? 490 VAL B HG21 1 
ATOM   1820 H HG22 . VAL B 2 2   ? 2.139   -16.178 2.852   1.00 1.03  ? 490 VAL B HG22 1 
ATOM   1821 H HG23 . VAL B 2 2   ? 0.460   -16.517 3.270   1.00 1.13  ? 490 VAL B HG23 1 
ATOM   1822 N N    . ILE B 2 3   ? -0.122  -14.131 -1.629  1.00 0.43  ? 491 ILE B N    1 
ATOM   1823 C CA   . ILE B 2 3   ? -0.333  -12.897 -2.439  1.00 0.45  ? 491 ILE B CA   1 
ATOM   1824 C C    . ILE B 2 3   ? -1.823  -12.542 -2.477  1.00 0.44  ? 491 ILE B C    1 
ATOM   1825 O O    . ILE B 2 3   ? -2.679  -13.376 -2.257  1.00 0.48  ? 491 ILE B O    1 
ATOM   1826 C CB   . ILE B 2 3   ? 0.204   -13.131 -3.858  1.00 0.48  ? 491 ILE B CB   1 
ATOM   1827 C CG1  . ILE B 2 3   ? 0.293   -11.790 -4.599  1.00 0.67  ? 491 ILE B CG1  1 
ATOM   1828 C CG2  . ILE B 2 3   ? -0.703  -14.102 -4.626  1.00 0.54  ? 491 ILE B CG2  1 
ATOM   1829 C CD1  . ILE B 2 3   ? -0.897  -11.628 -5.543  1.00 0.77  ? 491 ILE B CD1  1 
ATOM   1830 H H    . ILE B 2 3   ? -0.625  -14.946 -1.835  1.00 0.67  ? 491 ILE B H    1 
ATOM   1831 H HA   . ILE B 2 3   ? 0.211   -12.083 -1.989  1.00 0.52  ? 491 ILE B HA   1 
ATOM   1832 H HB   . ILE B 2 3   ? 1.194   -13.560 -3.787  1.00 0.57  ? 491 ILE B HB   1 
ATOM   1833 H HG12 . ILE B 2 3   ? 0.294   -10.983 -3.881  1.00 1.37  ? 491 ILE B HG12 1 
ATOM   1834 H HG13 . ILE B 2 3   ? 1.208   -11.761 -5.172  1.00 1.43  ? 491 ILE B HG13 1 
ATOM   1835 H HG21 . ILE B 2 3   ? -1.726  -13.763 -4.588  1.00 1.08  ? 491 ILE B HG21 1 
ATOM   1836 H HG22 . ILE B 2 3   ? -0.383  -14.152 -5.656  1.00 1.18  ? 491 ILE B HG22 1 
ATOM   1837 H HG23 . ILE B 2 3   ? -0.634  -15.084 -4.182  1.00 1.24  ? 491 ILE B HG23 1 
ATOM   1838 H HD11 . ILE B 2 3   ? -1.812  -11.833 -5.009  1.00 1.39  ? 491 ILE B HD11 1 
ATOM   1839 H HD12 . ILE B 2 3   ? -0.921  -10.616 -5.919  1.00 1.48  ? 491 ILE B HD12 1 
ATOM   1840 H HD13 . ILE B 2 3   ? -0.800  -12.316 -6.368  1.00 1.44  ? 491 ILE B HD13 1 
ATOM   1841 N N    . ALA B 2 4   ? -2.137  -11.304 -2.758  1.00 0.48  ? 492 ALA B N    1 
ATOM   1842 C CA   . ALA B 2 4   ? -3.565  -10.881 -2.815  1.00 0.51  ? 492 ALA B CA   1 
ATOM   1843 C C    . ALA B 2 4   ? -3.788  -10.052 -4.082  1.00 0.55  ? 492 ALA B C    1 
ATOM   1844 O O    . ALA B 2 4   ? -2.896  -9.885  -4.886  1.00 1.25  ? 492 ALA B O    1 
ATOM   1845 C CB   . ALA B 2 4   ? -3.900  -10.033 -1.586  1.00 0.64  ? 492 ALA B CB   1 
ATOM   1846 H H    . ALA B 2 4   ? -1.429  -10.652 -2.933  1.00 0.53  ? 492 ALA B H    1 
ATOM   1847 H HA   . ALA B 2 4   ? -4.201  -11.753 -2.837  1.00 0.47  ? 492 ALA B HA   1 
ATOM   1848 H HB1  . ALA B 2 4   ? -3.031  -9.963  -0.949  1.00 1.22  ? 492 ALA B HB1  1 
ATOM   1849 H HB2  . ALA B 2 4   ? -4.196  -9.043  -1.901  1.00 1.13  ? 492 ALA B HB2  1 
ATOM   1850 H HB3  . ALA B 2 4   ? -4.710  -10.494 -1.040  1.00 1.24  ? 492 ALA B HB3  1 
ATOM   1851 N N    . GLY B 2 5   ? -4.967  -9.529  -4.272  1.00 0.37  ? 493 GLY B N    1 
ATOM   1852 C CA   . GLY B 2 5   ? -5.221  -8.717  -5.495  1.00 0.30  ? 493 GLY B CA   1 
ATOM   1853 C C    . GLY B 2 5   ? -5.918  -7.410  -5.118  1.00 0.34  ? 493 GLY B C    1 
ATOM   1854 O O    . GLY B 2 5   ? -6.413  -7.250  -4.020  1.00 0.72  ? 493 GLY B O    1 
ATOM   1855 H H    . GLY B 2 5   ? -5.681  -9.671  -3.616  1.00 0.91  ? 493 GLY B H    1 
ATOM   1856 H HA2  . GLY B 2 5   ? -4.281  -8.495  -5.980  1.00 0.28  ? 493 GLY B HA2  1 
ATOM   1857 H HA3  . GLY B 2 5   ? -5.850  -9.272  -6.173  1.00 0.31  ? 493 GLY B HA3  1 
ATOM   1858 N N    . ASN B 2 6   ? -5.959  -6.475  -6.025  1.00 0.31  ? 494 ASN B N    1 
ATOM   1859 C CA   . ASN B 2 6   ? -6.622  -5.174  -5.735  1.00 0.30  ? 494 ASN B CA   1 
ATOM   1860 C C    . ASN B 2 6   ? -7.930  -5.090  -6.547  1.00 0.31  ? 494 ASN B C    1 
ATOM   1861 O O    . ASN B 2 6   ? -7.884  -5.035  -7.760  1.00 0.37  ? 494 ASN B O    1 
ATOM   1862 C CB   . ASN B 2 6   ? -5.687  -4.041  -6.157  1.00 0.31  ? 494 ASN B CB   1 
ATOM   1863 C CG   . ASN B 2 6   ? -5.796  -2.883  -5.165  1.00 0.44  ? 494 ASN B CG   1 
ATOM   1864 O OD1  . ASN B 2 6   ? -4.999  -2.772  -4.255  1.00 0.74  ? 494 ASN B OD1  1 
ATOM   1865 N ND2  . ASN B 2 6   ? -6.753  -2.007  -5.306  1.00 0.55  ? 494 ASN B ND2  1 
ATOM   1866 H H    . ASN B 2 6   ? -5.553  -6.629  -6.904  1.00 0.60  ? 494 ASN B H    1 
ATOM   1867 H HA   . ASN B 2 6   ? -6.819  -5.100  -4.679  1.00 0.35  ? 494 ASN B HA   1 
ATOM   1868 H HB2  . ASN B 2 6   ? -4.669  -4.403  -6.177  1.00 0.35  ? 494 ASN B HB2  1 
ATOM   1869 H HB3  . ASN B 2 6   ? -5.964  -3.698  -7.138  1.00 0.34  ? 494 ASN B HB3  1 
ATOM   1870 H HD21 . ASN B 2 6   ? -7.393  -2.095  -6.043  1.00 0.74  ? 494 ASN B HD21 1 
ATOM   1871 H HD22 . ASN B 2 6   ? -6.831  -1.261  -4.676  1.00 0.64  ? 494 ASN B HD22 1 
ATOM   1872 N N    . PRO B 2 7   ? -9.060  -5.091  -5.870  1.00 0.29  ? 495 PRO B N    1 
ATOM   1873 C CA   . PRO B 2 7   ? -10.376 -5.026  -6.525  1.00 0.31  ? 495 PRO B CA   1 
ATOM   1874 C C    . PRO B 2 7   ? -10.653 -3.621  -7.077  1.00 0.30  ? 495 PRO B C    1 
ATOM   1875 O O    . PRO B 2 7   ? -11.220 -3.466  -8.140  1.00 0.35  ? 495 PRO B O    1 
ATOM   1876 C CB   . PRO B 2 7   ? -11.391 -5.373  -5.442  1.00 0.35  ? 495 PRO B CB   1 
ATOM   1877 C CG   . PRO B 2 7   ? -10.662 -4.962  -4.142  1.00 0.35  ? 495 PRO B CG   1 
ATOM   1878 C CD   . PRO B 2 7   ? -9.148  -5.159  -4.393  1.00 0.32  ? 495 PRO B CD   1 
ATOM   1879 H HA   . PRO B 2 7   ? -10.432 -5.754  -7.319  1.00 0.36  ? 495 PRO B HA   1 
ATOM   1880 H HB2  . PRO B 2 7   ? -12.300 -4.801  -5.576  1.00 0.35  ? 495 PRO B HB2  1 
ATOM   1881 H HB3  . PRO B 2 7   ? -11.597 -6.431  -5.432  1.00 0.41  ? 495 PRO B HB3  1 
ATOM   1882 H HG2  . PRO B 2 7   ? -10.870 -3.925  -3.916  1.00 0.33  ? 495 PRO B HG2  1 
ATOM   1883 H HG3  . PRO B 2 7   ? -10.980 -5.590  -3.325  1.00 0.41  ? 495 PRO B HG3  1 
ATOM   1884 H HD2  . PRO B 2 7   ? -8.578  -4.363  -3.932  1.00 0.32  ? 495 PRO B HD2  1 
ATOM   1885 H HD3  . PRO B 2 7   ? -8.822  -6.124  -4.040  1.00 0.39  ? 495 PRO B HD3  1 
ATOM   1886 N N    . ALA B 2 8   ? -10.269 -2.597  -6.363  1.00 0.28  ? 496 ALA B N    1 
ATOM   1887 C CA   . ALA B 2 8   ? -10.524 -1.206  -6.848  1.00 0.34  ? 496 ALA B CA   1 
ATOM   1888 C C    . ALA B 2 8   ? -9.556  -0.817  -7.980  1.00 0.24  ? 496 ALA B C    1 
ATOM   1889 O O    . ALA B 2 8   ? -9.628  0.278   -8.500  1.00 0.24  ? 496 ALA B O    1 
ATOM   1890 C CB   . ALA B 2 8   ? -10.348 -0.230  -5.683  1.00 0.48  ? 496 ALA B CB   1 
ATOM   1891 H H    . ALA B 2 8   ? -9.821  -2.740  -5.504  1.00 0.28  ? 496 ALA B H    1 
ATOM   1892 H HA   . ALA B 2 8   ? -11.539 -1.140  -7.211  1.00 0.44  ? 496 ALA B HA   1 
ATOM   1893 H HB1  . ALA B 2 8   ? -9.515  -0.545  -5.072  1.00 1.11  ? 496 ALA B HB1  1 
ATOM   1894 H HB2  . ALA B 2 8   ? -10.157 0.760   -6.069  1.00 1.14  ? 496 ALA B HB2  1 
ATOM   1895 H HB3  . ALA B 2 8   ? -11.247 -0.217  -5.087  1.00 1.13  ? 496 ALA B HB3  1 
HETATM 1896 N N    . PTR B 2 9   ? -8.653  -1.681  -8.371  1.00 0.28  ? 497 PTR B N    1 
HETATM 1897 C CA   . PTR B 2 9   ? -7.703  -1.318  -9.468  1.00 0.26  ? 497 PTR B CA   1 
HETATM 1898 C C    . PTR B 2 9   ? -8.467  -1.135  -10.784 1.00 0.30  ? 497 PTR B C    1 
HETATM 1899 O O    . PTR B 2 9   ? -8.063  -0.375  -11.638 1.00 0.42  ? 497 PTR B O    1 
HETATM 1900 C CB   . PTR B 2 9   ? -6.667  -2.432  -9.631  1.00 0.28  ? 497 PTR B CB   1 
HETATM 1901 C CG   . PTR B 2 9   ? -5.656  -2.048  -10.685 1.00 0.30  ? 497 PTR B CG   1 
HETATM 1902 C CD1  . PTR B 2 9   ? -4.888  -0.889  -10.529 1.00 1.24  ? 497 PTR B CD1  1 
HETATM 1903 C CD2  . PTR B 2 9   ? -5.485  -2.853  -11.817 1.00 1.23  ? 497 PTR B CD2  1 
HETATM 1904 C CE1  . PTR B 2 9   ? -3.949  -0.534  -11.504 1.00 1.24  ? 497 PTR B CE1  1 
HETATM 1905 C CE2  . PTR B 2 9   ? -4.546  -2.498  -12.793 1.00 1.26  ? 497 PTR B CE2  1 
HETATM 1906 C CZ   . PTR B 2 9   ? -3.778  -1.338  -12.636 1.00 0.38  ? 497 PTR B CZ   1 
HETATM 1907 O OH   . PTR B 2 9   ? -2.837  -0.983  -13.611 1.00 0.44  ? 497 PTR B OH   1 
HETATM 1908 P P    . PTR B 2 9   ? -3.347  -0.711  -15.059 1.00 0.76  ? 497 PTR B P    1 
HETATM 1909 O O1P  . PTR B 2 9   ? -3.783  -2.102  -15.587 1.00 1.58  ? 497 PTR B O1P  1 
HETATM 1910 O O2P  . PTR B 2 9   ? -2.086  -0.252  -15.835 1.00 1.88  ? 497 PTR B O2P  1 
HETATM 1911 O O3P  . PTR B 2 9   ? -4.506  0.377   -14.879 1.00 1.76  ? 497 PTR B O3P  1 
HETATM 1912 H H    . PTR B 2 9   ? -8.595  -2.561  -7.949  1.00 0.38  ? 497 PTR B H    1 
HETATM 1913 H HA   . PTR B 2 9   ? -7.200  -0.396  -9.216  1.00 0.31  ? 497 PTR B HA   1 
HETATM 1914 H HB2  . PTR B 2 9   ? -7.163  -3.346  -9.925  1.00 0.30  ? 497 PTR B HB2  1 
HETATM 1915 H HB3  . PTR B 2 9   ? -6.160  -2.584  -8.694  1.00 0.30  ? 497 PTR B HB3  1 
HETATM 1916 H HD1  . PTR B 2 9   ? -5.018  -0.270  -9.655  1.00 2.16  ? 497 PTR B HD1  1 
HETATM 1917 H HD2  . PTR B 2 9   ? -6.076  -3.749  -11.935 1.00 2.13  ? 497 PTR B HD2  1 
HETATM 1918 H HE1  . PTR B 2 9   ? -3.356  0.361   -11.384 1.00 2.14  ? 497 PTR B HE1  1 
HETATM 1919 H HE2  . PTR B 2 9   ? -4.414  -3.120  -13.667 1.00 2.18  ? 497 PTR B HE2  1 
HETATM 1920 H HO3P . PTR B 2 9   ? -4.751  0.765   -15.708 1.00 2.19  ? 497 PTR B HO3P 1 
ATOM   1921 N N    . ARG B 2 10  ? -9.566  -1.828  -10.944 1.00 0.37  ? 498 ARG B N    1 
ATOM   1922 C CA   . ARG B 2 10  ? -10.380 -1.716  -12.193 1.00 0.50  ? 498 ARG B CA   1 
ATOM   1923 C C    . ARG B 2 10  ? -9.667  -2.417  -13.364 1.00 0.83  ? 498 ARG B C    1 
ATOM   1924 O O    . ARG B 2 10  ? -9.978  -3.545  -13.689 1.00 1.52  ? 498 ARG B O    1 
ATOM   1925 C CB   . ARG B 2 10  ? -10.649 -0.242  -12.526 1.00 0.52  ? 498 ARG B CB   1 
ATOM   1926 C CG   . ARG B 2 10  ? -11.081 0.498   -11.261 1.00 0.42  ? 498 ARG B CG   1 
ATOM   1927 C CD   . ARG B 2 10  ? -11.620 1.880   -11.636 1.00 0.71  ? 498 ARG B CD   1 
ATOM   1928 N NE   . ARG B 2 10  ? -12.666 1.737   -12.688 1.00 1.56  ? 498 ARG B NE   1 
ATOM   1929 C CZ   . ARG B 2 10  ? -12.661 2.531   -13.725 1.00 2.19  ? 498 ARG B CZ   1 
ATOM   1930 N NH1  . ARG B 2 10  ? -11.821 2.322   -14.702 1.00 2.85  ? 498 ARG B NH1  1 
ATOM   1931 N NH2  . ARG B 2 10  ? -13.495 3.532   -13.786 1.00 2.83  ? 498 ARG B NH2  1 
ATOM   1932 H H    . ARG B 2 10  ? -9.862  -2.430  -10.233 1.00 0.43  ? 498 ARG B H    1 
ATOM   1933 H HA   . ARG B 2 10  ? -11.327 -2.210  -12.027 1.00 0.69  ? 498 ARG B HA   1 
ATOM   1934 H HB2  . ARG B 2 10  ? -9.760  0.217   -12.923 1.00 0.88  ? 498 ARG B HB2  1 
ATOM   1935 H HB3  . ARG B 2 10  ? -11.438 -0.184  -13.255 1.00 0.84  ? 498 ARG B HB3  1 
ATOM   1936 H HG2  . ARG B 2 10  ? -11.852 -0.067  -10.758 1.00 0.75  ? 498 ARG B HG2  1 
ATOM   1937 H HG3  . ARG B 2 10  ? -10.233 0.614   -10.606 1.00 0.75  ? 498 ARG B HG3  1 
ATOM   1938 H HD2  . ARG B 2 10  ? -12.049 2.348   -10.763 1.00 1.15  ? 498 ARG B HD2  1 
ATOM   1939 H HD3  . ARG B 2 10  ? -10.813 2.491   -12.011 1.00 1.25  ? 498 ARG B HD3  1 
ATOM   1940 H HE   . ARG B 2 10  ? -13.358 1.049   -12.602 1.00 2.14  ? 498 ARG B HE   1 
ATOM   1941 H HH11 . ARG B 2 10  ? -11.182 1.555   -14.657 1.00 3.02  ? 498 ARG B HH11 1 
ATOM   1942 H HH12 . ARG B 2 10  ? -11.818 2.930   -15.496 1.00 3.52  ? 498 ARG B HH12 1 
ATOM   1943 H HH21 . ARG B 2 10  ? -14.139 3.693   -13.038 1.00 3.01  ? 498 ARG B HH21 1 
ATOM   1944 H HH22 . ARG B 2 10  ? -13.490 4.139   -14.580 1.00 3.47  ? 498 ARG B HH22 1 
ATOM   1945 N N    . SER B 2 11  ? -8.721  -1.777  -14.004 1.00 0.89  ? 499 SER B N    1 
ATOM   1946 C CA   . SER B 2 11  ? -8.019  -2.437  -15.141 1.00 1.22  ? 499 SER B CA   1 
ATOM   1947 C C    . SER B 2 11  ? -9.043  -2.877  -16.189 1.00 2.09  ? 499 SER B C    1 
ATOM   1948 O O    . SER B 2 11  ? -10.194 -2.497  -16.059 1.00 2.59  ? 499 SER B O    1 
ATOM   1949 C CB   . SER B 2 11  ? -7.260  -3.658  -14.626 1.00 1.63  ? 499 SER B CB   1 
ATOM   1950 O OG   . SER B 2 11  ? -7.943  -4.839  -15.025 1.00 2.40  ? 499 SER B OG   1 
ATOM   1951 O OXT  . SER B 2 11  ? -8.658  -3.588  -17.102 1.00 2.79  ? 499 SER B OXT  1 
ATOM   1952 H H    . SER B 2 11  ? -8.472  -0.872  -13.743 1.00 1.18  ? 499 SER B H    1 
ATOM   1953 H HA   . SER B 2 11  ? -7.323  -1.742  -15.587 1.00 1.30  ? 499 SER B HA   1 
ATOM   1954 H HB2  . SER B 2 11  ? -6.265  -3.667  -15.038 1.00 1.67  ? 499 SER B HB2  1 
ATOM   1955 H HB3  . SER B 2 11  ? -7.202  -3.611  -13.548 1.00 1.86  ? 499 SER B HB3  1 
ATOM   1956 H HG   . SER B 2 11  ? -7.532  -5.161  -15.831 1.00 2.83  ? 499 SER B HG   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   156 156 MET MET A . n 
A 1 2   GLY 2   157 157 GLY GLY A . n 
A 1 3   PRO 3   158 158 PRO PRO A . n 
A 1 4   ALA 4   159 159 ALA ALA A . n 
A 1 5   PHE 5   160 160 PHE PHE A . n 
A 1 6   LYS 6   161 161 LYS LYS A . n 
A 1 7   GLU 7   162 162 GLU GLU A . n 
A 1 8   VAL 8   163 163 VAL VAL A . n 
A 1 9   TRP 9   164 164 TRP TRP A . n 
A 1 10  GLN 10  165 165 GLN GLN A . n 
A 1 11  VAL 11  166 166 VAL VAL A . n 
A 1 12  ILE 12  167 167 ILE ILE A . n 
A 1 13  LEU 13  168 168 LEU LEU A . n 
A 1 14  LYS 14  169 169 LYS LYS A . n 
A 1 15  PRO 15  170 170 PRO PRO A . n 
A 1 16  LYS 16  171 171 LYS LYS A . n 
A 1 17  GLY 17  172 172 GLY GLY A . n 
A 1 18  LEU 18  173 173 LEU LEU A . n 
A 1 19  GLY 19  174 174 GLY GLY A . n 
A 1 20  GLN 20  175 175 GLN GLN A . n 
A 1 21  THR 21  176 176 THR THR A . n 
A 1 22  LYS 22  177 177 LYS LYS A . n 
A 1 23  ASN 23  178 178 ASN ASN A . n 
A 1 24  LEU 24  179 179 LEU LEU A . n 
A 1 25  ILE 25  180 180 ILE ILE A . n 
A 1 26  GLY 26  181 181 GLY GLY A . n 
A 1 27  ILE 27  182 182 ILE ILE A . n 
A 1 28  TYR 28  183 183 TYR TYR A . n 
A 1 29  ARG 29  184 184 ARG ARG A . n 
A 1 30  LEU 30  185 185 LEU LEU A . n 
A 1 31  CYS 31  186 186 CYS CYS A . n 
A 1 32  LEU 32  187 187 LEU LEU A . n 
A 1 33  THR 33  188 188 THR THR A . n 
A 1 34  SER 34  189 189 SER SER A . n 
A 1 35  LYS 35  190 190 LYS LYS A . n 
A 1 36  THR 36  191 191 THR THR A . n 
A 1 37  ILE 37  192 192 ILE ILE A . n 
A 1 38  SER 38  193 193 SER SER A . n 
A 1 39  PHE 39  194 194 PHE PHE A . n 
A 1 40  VAL 40  195 195 VAL VAL A . n 
A 1 41  LYS 41  196 196 LYS LYS A . n 
A 1 42  LEU 42  197 197 LEU LEU A . n 
A 1 43  ASN 43  198 198 ASN ASN A . n 
A 1 44  SER 44  199 199 SER SER A . n 
A 1 45  GLU 45  200 200 GLU GLU A . n 
A 1 46  ALA 46  201 201 ALA ALA A . n 
A 1 47  ALA 47  202 202 ALA ALA A . n 
A 1 48  ALA 48  203 203 ALA ALA A . n 
A 1 49  VAL 49  204 204 VAL VAL A . n 
A 1 50  VAL 50  205 205 VAL VAL A . n 
A 1 51  LEU 51  206 206 LEU LEU A . n 
A 1 52  GLN 52  207 207 GLN GLN A . n 
A 1 53  LEU 53  208 208 LEU LEU A . n 
A 1 54  MET 54  209 209 MET MET A . n 
A 1 55  ASN 55  210 210 ASN ASN A . n 
A 1 56  ILE 56  211 211 ILE ILE A . n 
A 1 57  ARG 57  212 212 ARG ARG A . n 
A 1 58  ARG 58  213 213 ARG ARG A . n 
A 1 59  CYS 59  214 214 CYS CYS A . n 
A 1 60  GLY 60  215 215 GLY GLY A . n 
A 1 61  HIS 61  216 216 HIS HIS A . n 
A 1 62  SER 62  217 217 SER SER A . n 
A 1 63  GLU 63  218 218 GLU GLU A . n 
A 1 64  ASN 64  219 219 ASN ASN A . n 
A 1 65  PHE 65  220 220 PHE PHE A . n 
A 1 66  PHE 66  221 221 PHE PHE A . n 
A 1 67  PHE 67  222 222 PHE PHE A . n 
A 1 68  ILE 68  223 223 ILE ILE A . n 
A 1 69  GLU 69  224 224 GLU GLU A . n 
A 1 70  VAL 70  225 225 VAL VAL A . n 
A 1 71  GLY 71  226 226 GLY GLY A . n 
A 1 72  ARG 72  227 227 ARG ARG A . n 
A 1 73  SER 73  228 228 SER SER A . n 
A 1 74  ALA 74  229 229 ALA ALA A . n 
A 1 75  VAL 75  230 230 VAL VAL A . n 
A 1 76  THR 76  231 231 THR THR A . n 
A 1 77  GLY 77  232 232 GLY GLY A . n 
A 1 78  PRO 78  233 233 PRO PRO A . n 
A 1 79  GLY 79  234 234 GLY GLY A . n 
A 1 80  GLU 80  235 235 GLU GLU A . n 
A 1 81  PHE 81  236 236 PHE PHE A . n 
A 1 82  TRP 82  237 237 TRP TRP A . n 
A 1 83  MET 83  238 238 MET MET A . n 
A 1 84  GLN 84  239 239 GLN GLN A . n 
A 1 85  VAL 85  240 240 VAL VAL A . n 
A 1 86  ASP 86  241 241 ASP ASP A . n 
A 1 87  ASP 87  242 242 ASP ASP A . n 
A 1 88  SER 88  243 243 SER SER A . n 
A 1 89  VAL 89  244 244 VAL VAL A . n 
A 1 90  VAL 90  245 245 VAL VAL A . n 
A 1 91  ALA 91  246 246 ALA ALA A . n 
A 1 92  GLN 92  247 247 GLN GLN A . n 
A 1 93  ASN 93  248 248 ASN ASN A . n 
A 1 94  MET 94  249 249 MET MET A . n 
A 1 95  HIS 95  250 250 HIS HIS A . n 
A 1 96  GLU 96  251 251 GLU GLU A . n 
A 1 97  THR 97  252 252 THR THR A . n 
A 1 98  ILE 98  253 253 ILE ILE A . n 
A 1 99  LEU 99  254 254 LEU LEU A . n 
A 1 100 GLU 100 255 255 GLU GLU A . n 
A 1 101 ALA 101 256 256 ALA ALA A . n 
A 1 102 MET 102 257 257 MET MET A . n 
A 1 103 ARG 103 258 258 ARG ARG A . n 
A 1 104 ALA 104 259 259 ALA ALA A . n 
A 1 105 MET 105 260 260 MET MET A . n 
A 1 106 SER 106 261 261 SER SER A . n 
A 1 107 ASP 107 262 262 ASP ASP A . n 
A 1 108 GLU 108 263 263 GLU GLU A . n 
A 1 109 PHE 109 264 264 PHE PHE A . n 
A 1 110 ARG 110 265 265 ARG ARG A . n 
A 1 111 PRO 111 266 266 PRO PRO A . n 
A 1 112 ARG 112 267 267 ARG ARG A . n 
B 2 1   LEU 1   489 489 LEU LEU B . n 
B 2 2   VAL 2   490 490 VAL VAL B . n 
B 2 3   ILE 3   491 491 ILE ILE B . n 
B 2 4   ALA 4   492 492 ALA ALA B . n 
B 2 5   GLY 5   493 493 GLY GLY B . n 
B 2 6   ASN 6   494 494 ASN ASN B . n 
B 2 7   PRO 7   495 495 PRO PRO B . n 
B 2 8   ALA 8   496 496 ALA ALA B . n 
B 2 9   PTR 9   497 497 PTR PTR B . n 
B 2 10  ARG 10  498 498 ARG ARG B . n 
B 2 11  SER 11  499 499 SER SER B . n 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    B 
_pdbx_struct_mod_residue.label_comp_id    PTR 
_pdbx_struct_mod_residue.label_seq_id     9 
_pdbx_struct_mod_residue.auth_asym_id     B 
_pdbx_struct_mod_residue.auth_comp_id     PTR 
_pdbx_struct_mod_residue.auth_seq_id      497 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   TYR 
_pdbx_struct_mod_residue.details          O-PHOSPHOTYROSINE 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1997-05-15 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR 'model building' . ? 1 
X-PLOR refinement       . ? 2 
X-PLOR phasing          . ? 3 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PRO A 158 ? ? -83.94  47.10   
2  1 LEU A 168 ? ? -45.06  157.63  
3  1 GLN A 175 ? ? -150.05 -45.21  
4  1 THR A 188 ? ? -99.16  46.08   
5  1 SER A 189 ? ? 38.61   28.74   
6  1 LYS A 190 ? ? 169.35  -34.83  
7  1 ASN A 198 ? ? -99.52  37.11   
8  1 GLU A 200 ? ? -133.27 -54.78  
9  1 SER A 217 ? ? -64.14  90.35   
10 1 GLU A 218 ? ? 64.01   -88.53  
11 1 VAL A 240 ? ? -107.86 -163.93 
12 1 ASP A 242 ? ? -171.81 -146.93 
13 1 PHE A 264 ? ? -81.13  -70.49  
14 1 ARG A 265 ? ? 171.37  145.98  
15 1 PRO A 266 ? ? -55.68  -152.33 
16 1 ARG B 498 ? ? 72.84   -81.78  
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1 1 ARG A 184 ? ? 0.217 'SIDE CHAIN' 
2 1 ARG A 212 ? ? 0.203 'SIDE CHAIN' 
3 1 ARG A 213 ? ? 0.176 'SIDE CHAIN' 
4 1 ARG A 227 ? ? 0.312 'SIDE CHAIN' 
5 1 ARG A 258 ? ? 0.292 'SIDE CHAIN' 
6 1 ARG A 265 ? ? 0.238 'SIDE CHAIN' 
7 1 ARG A 267 ? ? 0.258 'SIDE CHAIN' 
8 1 ARG B 498 ? ? 0.310 'SIDE CHAIN' 
#