data_1IU1
# 
_entry.id   1IU1 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.316 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1IU1         
RCSB  RCSB005274   
WWPDB D_1000005274 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1IU1 
_pdbx_database_status.recvd_initial_deposition_date   2002-02-19 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Nogi, T.'      1  
'Shiba, Y.'     2  
'Kawasaki, M.'  3  
'Shiba, T.'     4  
'Matsugaki, N.' 5  
'Igarashi, N.'  6  
'Suzuki, M.'    7  
'Kato, R.'      8  
'Takatsu, H.'   9  
'Nakayama, K.'  10 
'Wakatsuki, S.' 11 
# 
_citation.id                        primary 
_citation.title                     'Structural basis for the accessory protein recruitment by the gamma-adaptin ear domain.' 
_citation.journal_abbrev            Nat.Struct.Biol. 
_citation.journal_volume            9 
_citation.page_first                527 
_citation.page_last                 531 
_citation.year                      2002 
_citation.journal_id_ASTM           NSBIEW 
_citation.country                   US 
_citation.journal_id_ISSN           1072-8368 
_citation.journal_id_CSD            2024 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12042876 
_citation.pdbx_database_id_DOI      10.1038/nsb808 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Nogi, T.'      1  ? 
primary 'Shiba, Y.'     2  ? 
primary 'Kawasaki, M.'  3  ? 
primary 'Shiba, T.'     4  ? 
primary 'Matsugaki, N.' 5  ? 
primary 'Igarashi, N.'  6  ? 
primary 'Suzuki, M.'    7  ? 
primary 'Kato, R.'      8  ? 
primary 'Takatsu, H.'   9  ? 
primary 'Nakayama, K.'  10 ? 
primary 'Wakatsuki, S.' 11 ? 
# 
_cell.entry_id           1IU1 
_cell.length_a           62.132 
_cell.length_b           62.132 
_cell.length_c           147.869 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         1IU1 
_symmetry.space_group_name_H-M             'P 43 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                96 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man gamma1-adaptin 16135.265 2   ? ? 'ear domain' ? 
2 water   nat water          18.015    132 ? ? ?            ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'adapter-related protein complex 1 gamma 1 subunit' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SVPQISQPHFLLDGLSSQPLFNDIAAGIPSITAYSKNGLKIEFTFERSNTNPSVTVITIQASNSTELDMTDFVFQAAVPK
TFQLQLLSPSSSIVPAFNTGTITQVIKVLNPQKQQLRMRIKLTYNHKGSAMQDLAEVNNFPPQSWQ
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SVPQISQPHFLLDGLSSQPLFNDIAAGIPSITAYSKNGLKIEFTFERSNTNPSVTVITIQASNSTELDMTDFVFQAAVPK
TFQLQLLSPSSSIVPAFNTGTITQVIKVLNPQKQQLRMRIKLTYNHKGSAMQDLAEVNNFPPQSWQ
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   VAL n 
1 3   PRO n 
1 4   GLN n 
1 5   ILE n 
1 6   SER n 
1 7   GLN n 
1 8   PRO n 
1 9   HIS n 
1 10  PHE n 
1 11  LEU n 
1 12  LEU n 
1 13  ASP n 
1 14  GLY n 
1 15  LEU n 
1 16  SER n 
1 17  SER n 
1 18  GLN n 
1 19  PRO n 
1 20  LEU n 
1 21  PHE n 
1 22  ASN n 
1 23  ASP n 
1 24  ILE n 
1 25  ALA n 
1 26  ALA n 
1 27  GLY n 
1 28  ILE n 
1 29  PRO n 
1 30  SER n 
1 31  ILE n 
1 32  THR n 
1 33  ALA n 
1 34  TYR n 
1 35  SER n 
1 36  LYS n 
1 37  ASN n 
1 38  GLY n 
1 39  LEU n 
1 40  LYS n 
1 41  ILE n 
1 42  GLU n 
1 43  PHE n 
1 44  THR n 
1 45  PHE n 
1 46  GLU n 
1 47  ARG n 
1 48  SER n 
1 49  ASN n 
1 50  THR n 
1 51  ASN n 
1 52  PRO n 
1 53  SER n 
1 54  VAL n 
1 55  THR n 
1 56  VAL n 
1 57  ILE n 
1 58  THR n 
1 59  ILE n 
1 60  GLN n 
1 61  ALA n 
1 62  SER n 
1 63  ASN n 
1 64  SER n 
1 65  THR n 
1 66  GLU n 
1 67  LEU n 
1 68  ASP n 
1 69  MET n 
1 70  THR n 
1 71  ASP n 
1 72  PHE n 
1 73  VAL n 
1 74  PHE n 
1 75  GLN n 
1 76  ALA n 
1 77  ALA n 
1 78  VAL n 
1 79  PRO n 
1 80  LYS n 
1 81  THR n 
1 82  PHE n 
1 83  GLN n 
1 84  LEU n 
1 85  GLN n 
1 86  LEU n 
1 87  LEU n 
1 88  SER n 
1 89  PRO n 
1 90  SER n 
1 91  SER n 
1 92  SER n 
1 93  ILE n 
1 94  VAL n 
1 95  PRO n 
1 96  ALA n 
1 97  PHE n 
1 98  ASN n 
1 99  THR n 
1 100 GLY n 
1 101 THR n 
1 102 ILE n 
1 103 THR n 
1 104 GLN n 
1 105 VAL n 
1 106 ILE n 
1 107 LYS n 
1 108 VAL n 
1 109 LEU n 
1 110 ASN n 
1 111 PRO n 
1 112 GLN n 
1 113 LYS n 
1 114 GLN n 
1 115 GLN n 
1 116 LEU n 
1 117 ARG n 
1 118 MET n 
1 119 ARG n 
1 120 ILE n 
1 121 LYS n 
1 122 LEU n 
1 123 THR n 
1 124 TYR n 
1 125 ASN n 
1 126 HIS n 
1 127 LYS n 
1 128 GLY n 
1 129 SER n 
1 130 ALA n 
1 131 MET n 
1 132 GLN n 
1 133 ASP n 
1 134 LEU n 
1 135 ALA n 
1 136 GLU n 
1 137 VAL n 
1 138 ASN n 
1 139 ASN n 
1 140 PHE n 
1 141 PRO n 
1 142 PRO n 
1 143 GLN n 
1 144 SER n 
1 145 TRP n 
1 146 GLN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pGEX4T-2 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    AP1G1_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;SVPQISQPHFLLDGLSSQPLFNDIAAGIPSITAYSKNGLKIEFTFERSNTNPSVTVITIQASNSTELDMTDFVFQAAVPK
TFQLQLLSPSSSIVPAFNTGTITQVIKVLNPQKQQLRMRIKLTYNHKGSAMQDLAEVNNFPPQSWQ
;
_struct_ref.pdbx_align_begin           676 
_struct_ref.pdbx_db_accession          O43747 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1IU1 A 1 ? 146 ? O43747 676 ? 821 ? 677 822 
2 1 1IU1 B 1 ? 146 ? O43747 676 ? 821 ? 677 822 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1IU1 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   3 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   44.33 
_exptl_crystal.density_Matthews      2.21 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pdbx_details    'PEG4000, magnesium chloride, HEPES, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_diffrn.id 
_diffrn.ambient_temp 
_diffrn.ambient_temp_details 
_diffrn.crystal_id 
1 100 ? 1 
2 100 ? 1 
3 100 ? 1 
# 
loop_
_diffrn_detector.diffrn_id 
_diffrn_detector.detector 
_diffrn_detector.type 
_diffrn_detector.pdbx_collection_date 
_diffrn_detector.details 
1 CCD 'OXFORD PX210'   2001-09-18 ? 
2 CCD 'OXFORD PX210'   2001-09-18 ? 
3 CCD 'ADSC QUANTUM 4' 2001-12-12 ? 
# 
_diffrn_radiation.diffrn_id                        3 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             MAD 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 0.900  1.0 
2 0.96   1.0 
3 0.9778 1.0 
4 0.9785 1.0 
# 
loop_
_diffrn_source.diffrn_id 
_diffrn_source.source 
_diffrn_source.type 
_diffrn_source.pdbx_synchrotron_site 
_diffrn_source.pdbx_synchrotron_beamline 
_diffrn_source.pdbx_wavelength 
_diffrn_source.pdbx_wavelength_list 
1 SYNCHROTRON 'SPRING-8 BEAMLINE BL44XU'      SPring-8         BL44XU ? 0.900                  
2 SYNCHROTRON 'SPRING-8 BEAMLINE BL44XU'      SPring-8         BL44XU ? 0.900                  
3 SYNCHROTRON 'PHOTON FACTORY BEAMLINE BL-6A' 'Photon Factory' BL-6A  ? '0.96, 0.9778, 0.9785' 
# 
_reflns.entry_id                     1IU1 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             57.0 
_reflns.d_resolution_high            1.8 
_reflns.number_obs                   27518 
_reflns.number_all                   27518 
_reflns.percent_possible_obs         99.2 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               3 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.80 
_reflns_shell.d_res_low              1.89 
_reflns_shell.percent_possible_all   99.2 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1IU1 
_refine.ls_number_reflns_obs                     26023 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             20.00 
_refine.ls_d_res_high                            1.80 
_refine.ls_percent_reflns_obs                    98.86 
_refine.ls_R_factor_obs                          0.2275600 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2264900 
_refine.ls_R_factor_R_free                       0.2476400 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  1363 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.926 
_refine.correlation_coeff_Fo_to_Fc_free          0.919 
_refine.B_iso_mean                               24.188 
_refine.aniso_B[1][1]                            -0.05 
_refine.aniso_B[2][2]                            -0.05 
_refine.aniso_B[3][3]                            0.10 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  0.127 
_refine.overall_SU_B                             2.849 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            0.091 
_refine.pdbx_overall_ESU_R                       0.140 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           3 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1898 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             132 
_refine_hist.number_atoms_total               2030 
_refine_hist.d_res_high                       1.80 
_refine_hist.d_res_low                        20.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.009  0.022  ? 1936 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.331  1.942  ? 2633 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   4.123  3.000  ? 241  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   18.209 15.000 ? 365  'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.087  0.200  ? 312  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.004  0.020  ? 1444 'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.210  0.300  ? 798  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.127  0.500  ? 255  'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.218  0.300  ? 21   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.216  0.500  ? 9    'X-RAY DIFFRACTION' ? 
r_mcbond_it              0.836  1.500  ? 1223 'X-RAY DIFFRACTION' ? 
r_mcangle_it             1.610  2.000  ? 2007 'X-RAY DIFFRACTION' ? 
r_scbond_it              2.324  3.000  ? 713  'X-RAY DIFFRACTION' ? 
r_scangle_it             4.088  4.500  ? 626  'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.80 
_refine_ls_shell.d_res_low                        1.846 
_refine_ls_shell.number_reflns_R_work             1884 
_refine_ls_shell.R_factor_R_work                  0.2690000 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.3210000 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             94 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1IU1 
_struct.title                     'Crystal structure of human gamma1-adaptin ear domain' 
_struct.pdbx_descriptor           gamma1-adaptin 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1IU1 
_struct_keywords.pdbx_keywords   ENDOCYTOSIS 
_struct_keywords.text            'Coated pits, ENDOCYTOSIS' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
# 
loop_
_struct_biol.id 
_struct_biol.pdbx_parent_biol_id 
_struct_biol.details 
1 ? ? 
2 ? ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 PRO A 95  ? THR A 99  ? PRO A 771 THR A 775 5 ? 5 
HELX_P HELX_P2 2 PRO A 141 ? TRP A 145 ? PRO A 817 TRP A 821 5 ? 5 
HELX_P HELX_P3 3 PRO B 95  ? THR B 99  ? PRO B 771 THR B 775 5 ? 5 
HELX_P HELX_P4 4 PRO B 141 ? TRP B 145 ? PRO B 817 TRP B 821 5 ? 5 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 3 ? 
C ? 5 ? 
D ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
C 4 5 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 31  ? LYS A 36  ? ILE A 707 LYS A 712 
A 2 LEU A 39  ? ARG A 47  ? LEU A 715 ARG A 723 
A 3 VAL A 54  ? ASN A 63  ? VAL A 730 ASN A 739 
A 4 ILE A 102 ? LEU A 109 ? ILE A 778 LEU A 785 
A 5 GLN A 83  ? LEU A 86  ? GLN A 759 LEU A 762 
B 1 THR A 70  ? ALA A 77  ? THR A 746 ALA A 753 
B 2 ARG A 119 ? HIS A 126 ? ARG A 795 HIS A 802 
B 3 SER A 129 ? GLU A 136 ? SER A 805 GLU A 812 
C 1 ILE B 31  ? LYS B 36  ? ILE B 707 LYS B 712 
C 2 LEU B 39  ? ARG B 47  ? LEU B 715 ARG B 723 
C 3 VAL B 54  ? ASN B 63  ? VAL B 730 ASN B 739 
C 4 ILE B 102 ? LEU B 109 ? ILE B 778 LEU B 785 
C 5 GLN B 83  ? LEU B 86  ? GLN B 759 LEU B 762 
D 1 THR B 70  ? ALA B 77  ? THR B 746 ALA B 753 
D 2 ARG B 119 ? HIS B 126 ? ARG B 795 HIS B 802 
D 3 SER B 129 ? GLU B 136 ? SER B 805 GLU B 812 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N TYR A 34  ? N TYR A 710 O ILE A 41  ? O ILE A 717 
A 2 3 N GLU A 46  ? N GLU A 722 O VAL A 56  ? O VAL A 732 
A 3 4 N ILE A 57  ? N ILE A 733 O ILE A 106 ? O ILE A 782 
A 4 5 O LYS A 107 ? O LYS A 783 N GLN A 85  ? N GLN A 761 
B 1 2 N THR A 70  ? N THR A 746 O ASN A 125 ? O ASN A 801 
B 2 3 N ILE A 120 ? N ILE A 796 O ALA A 135 ? O ALA A 811 
C 1 2 N TYR B 34  ? N TYR B 710 O ILE B 41  ? O ILE B 717 
C 2 3 N GLU B 46  ? N GLU B 722 O VAL B 56  ? O VAL B 732 
C 3 4 N ILE B 57  ? N ILE B 733 O ILE B 106 ? O ILE B 782 
C 4 5 O LYS B 107 ? O LYS B 783 N GLN B 85  ? N GLN B 761 
D 1 2 N VAL B 73  ? N VAL B 749 O THR B 123 ? O THR B 799 
D 2 3 N TYR B 124 ? N TYR B 800 O MET B 131 ? O MET B 807 
# 
_database_PDB_matrix.entry_id          1IU1 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1IU1 
_atom_sites.fract_transf_matrix[1][1]   0.016095 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.016095 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006763 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLY A 1 27  ? 17.239  32.439 32.162  1.00 30.72 ? 703 GLY A N   1 
ATOM   2    C CA  . GLY A 1 27  ? 18.181  31.592 31.356  1.00 30.29 ? 703 GLY A CA  1 
ATOM   3    C C   . GLY A 1 27  ? 18.086  31.909 29.875  1.00 29.54 ? 703 GLY A C   1 
ATOM   4    O O   . GLY A 1 27  ? 17.294  32.760 29.479  1.00 30.30 ? 703 GLY A O   1 
ATOM   5    N N   . ILE A 1 28  ? 18.885  31.228 29.054  1.00 27.91 ? 704 ILE A N   1 
ATOM   6    C CA  . ILE A 1 28  ? 18.848  31.449 27.610  1.00 26.04 ? 704 ILE A CA  1 
ATOM   7    C C   . ILE A 1 28  ? 17.673  30.668 27.020  1.00 24.80 ? 704 ILE A C   1 
ATOM   8    O O   . ILE A 1 28  ? 17.533  29.490 27.267  1.00 24.64 ? 704 ILE A O   1 
ATOM   9    C CB  . ILE A 1 28  ? 20.168  30.989 26.970  1.00 26.26 ? 704 ILE A CB  1 
ATOM   10   C CG1 . ILE A 1 28  ? 21.351  31.684 27.652  1.00 26.28 ? 704 ILE A CG1 1 
ATOM   11   C CG2 . ILE A 1 28  ? 20.173  31.296 25.480  1.00 24.87 ? 704 ILE A CG2 1 
ATOM   12   C CD1 . ILE A 1 28  ? 22.692  31.065 27.337  1.00 27.24 ? 704 ILE A CD1 1 
ATOM   13   N N   . PRO A 1 29  ? 16.821  31.340 26.258  1.00 24.10 ? 705 PRO A N   1 
ATOM   14   C CA  . PRO A 1 29  ? 15.627  30.699 25.692  1.00 23.28 ? 705 PRO A CA  1 
ATOM   15   C C   . PRO A 1 29  ? 16.015  29.623 24.688  1.00 21.98 ? 705 PRO A C   1 
ATOM   16   O O   . PRO A 1 29  ? 16.946  29.890 23.953  1.00 22.41 ? 705 PRO A O   1 
ATOM   17   C CB  . PRO A 1 29  ? 14.951  31.825 24.913  1.00 23.51 ? 705 PRO A CB  1 
ATOM   18   C CG  . PRO A 1 29  ? 15.586  33.118 25.384  1.00 25.24 ? 705 PRO A CG  1 
ATOM   19   C CD  . PRO A 1 29  ? 16.955  32.754 25.877  1.00 24.29 ? 705 PRO A CD  1 
ATOM   20   N N   . SER A 1 30  ? 15.334  28.478 24.658  1.00 20.89 ? 706 SER A N   1 
ATOM   21   C CA  . SER A 1 30  ? 15.594  27.468 23.623  1.00 19.38 ? 706 SER A CA  1 
ATOM   22   C C   . SER A 1 30  ? 14.860  27.844 22.334  1.00 17.89 ? 706 SER A C   1 
ATOM   23   O O   . SER A 1 30  ? 13.896  28.606 22.369  1.00 16.89 ? 706 SER A O   1 
ATOM   24   C CB  . SER A 1 30  ? 15.146  26.082 24.072  1.00 19.90 ? 706 SER A CB  1 
ATOM   25   O OG  . SER A 1 30  ? 15.689  25.748 25.354  1.00 23.83 ? 706 SER A OG  1 
ATOM   26   N N   . ILE A 1 31  ? 15.302  27.298 21.197  1.00 15.83 ? 707 ILE A N   1 
ATOM   27   C CA  . ILE A 1 31  ? 14.673  27.602 19.910  1.00 14.79 ? 707 ILE A CA  1 
ATOM   28   C C   . ILE A 1 31  ? 14.525  26.342 19.052  1.00 14.86 ? 707 ILE A C   1 
ATOM   29   O O   . ILE A 1 31  ? 15.146  25.304 19.320  1.00 14.86 ? 707 ILE A O   1 
ATOM   30   C CB  . ILE A 1 31  ? 15.545  28.614 19.102  1.00 14.85 ? 707 ILE A CB  1 
ATOM   31   C CG1 . ILE A 1 31  ? 16.937  28.013 18.851  1.00 14.25 ? 707 ILE A CG1 1 
ATOM   32   C CG2 . ILE A 1 31  ? 15.626  29.971 19.810  1.00 16.32 ? 707 ILE A CG2 1 
ATOM   33   C CD1 . ILE A 1 31  ? 17.784  28.731 17.806  1.00 16.68 ? 707 ILE A CD1 1 
ATOM   34   N N   . THR A 1 32  ? 13.674  26.431 18.043  1.00 14.32 ? 708 THR A N   1 
ATOM   35   C CA  . THR A 1 32  ? 13.624  25.409 17.016  1.00 13.54 ? 708 THR A CA  1 
ATOM   36   C C   . THR A 1 32  ? 14.485  25.998 15.910  1.00 12.64 ? 708 THR A C   1 
ATOM   37   O O   . THR A 1 32  ? 14.099  26.971 15.273  1.00 12.38 ? 708 THR A O   1 
ATOM   38   C CB  . THR A 1 32  ? 12.199  25.212 16.510  1.00 14.25 ? 708 THR A CB  1 
ATOM   39   O OG1 . THR A 1 32  ? 11.380  24.660 17.555  1.00 14.19 ? 708 THR A OG1 1 
ATOM   40   C CG2 . THR A 1 32  ? 12.151  24.153 15.397  1.00 14.00 ? 708 THR A CG2 1 
ATOM   41   N N   . ALA A 1 33  ? 15.651  25.401 15.677  1.00 10.69 ? 709 ALA A N   1 
ATOM   42   C CA  . ALA A 1 33  ? 16.581  25.948 14.709  1.00 10.99 ? 709 ALA A CA  1 
ATOM   43   C C   . ALA A 1 33  ? 16.174  25.540 13.287  1.00 10.73 ? 709 ALA A C   1 
ATOM   44   O O   . ALA A 1 33  ? 16.535  26.200 12.309  1.00 10.85 ? 709 ALA A O   1 
ATOM   45   C CB  . ALA A 1 33  ? 17.983  25.425 15.003  1.00 11.67 ? 709 ALA A CB  1 
ATOM   46   N N   . TYR A 1 34  ? 15.454  24.437 13.189  1.00 10.28 ? 710 TYR A N   1 
ATOM   47   C CA  . TYR A 1 34  ? 15.120  23.860 11.892  1.00 10.78 ? 710 TYR A CA  1 
ATOM   48   C C   . TYR A 1 34  ? 13.927  22.947 12.077  1.00 11.39 ? 710 TYR A C   1 
ATOM   49   O O   . TYR A 1 34  ? 13.873  22.182 13.050  1.00 11.33 ? 710 TYR A O   1 
ATOM   50   C CB  . TYR A 1 34  ? 16.327  23.052 11.396  1.00 10.46 ? 710 TYR A CB  1 
ATOM   51   C CG  . TYR A 1 34  ? 16.153  22.411 10.004  1.00 10.76 ? 710 TYR A CG  1 
ATOM   52   C CD1 . TYR A 1 34  ? 16.598  23.061 8.851   1.00 11.55 ? 710 TYR A CD1 1 
ATOM   53   C CD2 . TYR A 1 34  ? 15.562  21.162 9.865   1.00 10.90 ? 710 TYR A CD2 1 
ATOM   54   C CE1 . TYR A 1 34  ? 16.447  22.472 7.595   1.00 11.94 ? 710 TYR A CE1 1 
ATOM   55   C CE2 . TYR A 1 34  ? 15.418  20.551 8.606   1.00 10.32 ? 710 TYR A CE2 1 
ATOM   56   C CZ  . TYR A 1 34  ? 15.867  21.230 7.484   1.00 11.60 ? 710 TYR A CZ  1 
ATOM   57   O OH  . TYR A 1 34  ? 15.737  20.657 6.223   1.00 11.74 ? 710 TYR A OH  1 
ATOM   58   N N   . SER A 1 35  ? 12.975  23.035 11.151  1.00 10.56 ? 711 SER A N   1 
ATOM   59   C CA  . SER A 1 35  ? 11.815  22.168 11.151  1.00 12.12 ? 711 SER A CA  1 
ATOM   60   C C   . SER A 1 35  ? 11.313  22.050 9.711   1.00 11.59 ? 711 SER A C   1 
ATOM   61   O O   . SER A 1 35  ? 10.684  22.968 9.194   1.00 12.01 ? 711 SER A O   1 
ATOM   62   C CB  . SER A 1 35  ? 10.710  22.757 12.033  1.00 12.31 ? 711 SER A CB  1 
ATOM   63   O OG  . SER A 1 35  ? 9.714   21.778 12.260  1.00 15.59 ? 711 SER A OG  1 
ATOM   64   N N   . LYS A 1 36  ? 11.591  20.916 9.080   1.00 10.94 ? 712 LYS A N   1 
ATOM   65   C CA  . LYS A 1 36  ? 11.256  20.735 7.662   1.00 10.86 ? 712 LYS A CA  1 
ATOM   66   C C   . LYS A 1 36  ? 11.243  19.255 7.314   1.00 9.83  ? 712 LYS A C   1 
ATOM   67   O O   . LYS A 1 36  ? 12.078  18.489 7.792   1.00 9.58  ? 712 LYS A O   1 
ATOM   68   C CB  . LYS A 1 36  ? 12.305  21.451 6.791   1.00 11.73 ? 712 LYS A CB  1 
ATOM   69   C CG  . LYS A 1 36  ? 11.886  21.552 5.347   1.00 14.95 ? 712 LYS A CG  1 
ATOM   70   C CD  . LYS A 1 36  ? 13.036  21.795 4.393   1.00 21.54 ? 712 LYS A CD  1 
ATOM   71   C CE  . LYS A 1 36  ? 13.316  23.229 4.197   1.00 23.25 ? 712 LYS A CE  1 
ATOM   72   N NZ  . LYS A 1 36  ? 14.284  23.402 3.055   1.00 24.22 ? 712 LYS A NZ  1 
ATOM   73   N N   . ASN A 1 37  ? 10.293  18.845 6.485   1.00 9.24  ? 713 ASN A N   1 
ATOM   74   C CA  . ASN A 1 37  ? 10.215  17.448 6.048   1.00 9.46  ? 713 ASN A CA  1 
ATOM   75   C C   . ASN A 1 37  ? 10.128  16.451 7.193   1.00 9.92  ? 713 ASN A C   1 
ATOM   76   O O   . ASN A 1 37  ? 10.607  15.323 7.087   1.00 9.97  ? 713 ASN A O   1 
ATOM   77   C CB  . ASN A 1 37  ? 11.405  17.108 5.149   1.00 10.33 ? 713 ASN A CB  1 
ATOM   78   C CG  . ASN A 1 37  ? 11.437  17.959 3.913   1.00 10.32 ? 713 ASN A CG  1 
ATOM   79   O OD1 . ASN A 1 37  ? 10.377  18.284 3.349   1.00 13.72 ? 713 ASN A OD1 1 
ATOM   80   N ND2 . ASN A 1 37  ? 12.644  18.345 3.480   1.00 13.32 ? 713 ASN A ND2 1 
ATOM   81   N N   . GLY A 1 38  ? 9.507   16.876 8.292   1.00 9.78  ? 714 GLY A N   1 
ATOM   82   C CA  . GLY A 1 38  ? 9.348   15.992 9.438   1.00 9.99  ? 714 GLY A CA  1 
ATOM   83   C C   . GLY A 1 38  ? 10.537  15.884 10.382  1.00 10.08 ? 714 GLY A C   1 
ATOM   84   O O   . GLY A 1 38  ? 10.449  15.195 11.393  1.00 11.16 ? 714 GLY A O   1 
ATOM   85   N N   . LEU A 1 39  ? 11.646  16.528 10.039  1.00 9.07  ? 715 LEU A N   1 
ATOM   86   C CA  . LEU A 1 39  ? 12.833  16.565 10.895  1.00 9.39  ? 715 LEU A CA  1 
ATOM   87   C C   . LEU A 1 39  ? 12.812  17.881 11.669  1.00 9.28  ? 715 LEU A C   1 
ATOM   88   O O   . LEU A 1 39  ? 12.740  18.988 11.090  1.00 10.46 ? 715 LEU A O   1 
ATOM   89   C CB  . LEU A 1 39  ? 14.122  16.493 10.052  1.00 8.55  ? 715 LEU A CB  1 
ATOM   90   C CG  . LEU A 1 39  ? 15.442  16.813 10.755  1.00 8.73  ? 715 LEU A CG  1 
ATOM   91   C CD1 . LEU A 1 39  ? 15.739  15.713 11.757  1.00 8.71  ? 715 LEU A CD1 1 
ATOM   92   C CD2 . LEU A 1 39  ? 16.606  16.893 9.755   1.00 9.42  ? 715 LEU A CD2 1 
ATOM   93   N N   . LYS A 1 40  ? 12.883  17.771 12.988  1.00 10.20 ? 716 LYS A N   1 
ATOM   94   C CA  . LYS A 1 40  ? 12.904  18.946 13.840  1.00 10.29 ? 716 LYS A CA  1 
ATOM   95   C C   . LYS A 1 40  ? 14.204  19.000 14.640  1.00 10.78 ? 716 LYS A C   1 
ATOM   96   O O   . LYS A 1 40  ? 14.604  17.991 15.221  1.00 10.89 ? 716 LYS A O   1 
ATOM   97   C CB  . LYS A 1 40  ? 11.733  18.901 14.823  1.00 11.49 ? 716 LYS A CB  1 
ATOM   98   C CG  . LYS A 1 40  ? 11.691  20.153 15.685  1.00 12.50 ? 716 LYS A CG  1 
ATOM   99   C CD  . LYS A 1 40  ? 10.381  20.212 16.464  1.00 18.67 ? 716 LYS A CD  1 
ATOM   100  C CE  . LYS A 1 40  ? 10.520  21.063 17.712  1.00 20.62 ? 716 LYS A CE  1 
ATOM   101  N NZ  . LYS A 1 40  ? 9.234   21.102 18.473  1.00 22.29 ? 716 LYS A NZ  1 
ATOM   102  N N   . ILE A 1 41  ? 14.869  20.150 14.637  1.00 10.40 ? 717 ILE A N   1 
ATOM   103  C CA  . ILE A 1 41  ? 16.117  20.313 15.400  1.00 11.31 ? 717 ILE A CA  1 
ATOM   104  C C   . ILE A 1 41  ? 15.966  21.468 16.387  1.00 11.87 ? 717 ILE A C   1 
ATOM   105  O O   . ILE A 1 41  ? 15.830  22.621 15.993  1.00 11.57 ? 717 ILE A O   1 
ATOM   106  C CB  . ILE A 1 41  ? 17.290  20.580 14.471  1.00 11.28 ? 717 ILE A CB  1 
ATOM   107  C CG1 . ILE A 1 41  ? 17.451  19.405 13.500  1.00 13.31 ? 717 ILE A CG1 1 
ATOM   108  C CG2 . ILE A 1 41  ? 18.592  20.687 15.286  1.00 11.72 ? 717 ILE A CG2 1 
ATOM   109  C CD1 . ILE A 1 41  ? 18.482  19.657 12.489  1.00 19.40 ? 717 ILE A CD1 1 
ATOM   110  N N   . GLU A 1 42  ? 15.936  21.146 17.672  1.00 12.69 ? 718 GLU A N   1 
ATOM   111  C CA  . GLU A 1 42  ? 15.819  22.152 18.716  1.00 13.59 ? 718 GLU A CA  1 
ATOM   112  C C   . GLU A 1 42  ? 17.210  22.403 19.285  1.00 13.19 ? 718 GLU A C   1 
ATOM   113  O O   . GLU A 1 42  ? 18.002  21.458 19.397  1.00 12.67 ? 718 GLU A O   1 
ATOM   114  C CB  . GLU A 1 42  ? 14.908  21.613 19.834  1.00 14.81 ? 718 GLU A CB  1 
ATOM   115  C CG  . GLU A 1 42  ? 13.614  20.998 19.303  1.00 20.55 ? 718 GLU A CG  1 
ATOM   116  C CD  . GLU A 1 42  ? 12.729  20.399 20.389  1.00 29.06 ? 718 GLU A CD  1 
ATOM   117  O OE1 . GLU A 1 42  ? 11.789  21.103 20.829  1.00 32.05 ? 718 GLU A OE1 1 
ATOM   118  O OE2 . GLU A 1 42  ? 12.954  19.219 20.779  1.00 32.66 ? 718 GLU A OE2 1 
ATOM   119  N N   . PHE A 1 43  ? 17.499  23.655 19.650  1.00 13.19 ? 719 PHE A N   1 
ATOM   120  C CA  . PHE A 1 43  ? 18.749  24.011 20.315  1.00 13.50 ? 719 PHE A CA  1 
ATOM   121  C C   . PHE A 1 43  ? 18.402  24.465 21.739  1.00 15.18 ? 719 PHE A C   1 
ATOM   122  O O   . PHE A 1 43  ? 17.487  25.280 21.919  1.00 15.50 ? 719 PHE A O   1 
ATOM   123  C CB  . PHE A 1 43  ? 19.407  25.244 19.672  1.00 13.31 ? 719 PHE A CB  1 
ATOM   124  C CG  . PHE A 1 43  ? 20.169  24.993 18.392  1.00 12.00 ? 719 PHE A CG  1 
ATOM   125  C CD1 . PHE A 1 43  ? 20.851  26.043 17.807  1.00 12.04 ? 719 PHE A CD1 1 
ATOM   126  C CD2 . PHE A 1 43  ? 20.141  23.773 17.740  1.00 13.71 ? 719 PHE A CD2 1 
ATOM   127  C CE1 . PHE A 1 43  ? 21.578  25.884 16.636  1.00 12.79 ? 719 PHE A CE1 1 
ATOM   128  C CE2 . PHE A 1 43  ? 20.837  23.608 16.547  1.00 12.18 ? 719 PHE A CE2 1 
ATOM   129  C CZ  . PHE A 1 43  ? 21.553  24.681 15.992  1.00 13.08 ? 719 PHE A CZ  1 
ATOM   130  N N   . THR A 1 44  ? 19.112  23.948 22.740  1.00 16.20 ? 720 THR A N   1 
ATOM   131  C CA  . THR A 1 44  ? 19.026  24.519 24.092  1.00 17.50 ? 720 THR A CA  1 
ATOM   132  C C   . THR A 1 44  ? 20.429  25.052 24.402  1.00 17.92 ? 720 THR A C   1 
ATOM   133  O O   . THR A 1 44  ? 21.415  24.564 23.854  1.00 17.63 ? 720 THR A O   1 
ATOM   134  C CB  . THR A 1 44  ? 18.556  23.493 25.133  1.00 17.58 ? 720 THR A CB  1 
ATOM   135  O OG1 . THR A 1 44  ? 19.491  22.422 25.225  1.00 19.51 ? 720 THR A OG1 1 
ATOM   136  C CG2 . THR A 1 44  ? 17.252  22.820 24.678  1.00 18.81 ? 720 THR A CG2 1 
ATOM   137  N N   . PHE A 1 45  ? 20.538  26.057 25.265  1.00 18.52 ? 721 PHE A N   1 
ATOM   138  C CA  . PHE A 1 45  ? 21.823  26.729 25.434  1.00 19.42 ? 721 PHE A CA  1 
ATOM   139  C C   . PHE A 1 45  ? 22.257  26.824 26.899  1.00 21.35 ? 721 PHE A C   1 
ATOM   140  O O   . PHE A 1 45  ? 21.419  26.967 27.785  1.00 20.67 ? 721 PHE A O   1 
ATOM   141  C CB  . PHE A 1 45  ? 21.739  28.163 24.912  1.00 19.17 ? 721 PHE A CB  1 
ATOM   142  C CG  . PHE A 1 45  ? 21.260  28.295 23.481  1.00 17.77 ? 721 PHE A CG  1 
ATOM   143  C CD1 . PHE A 1 45  ? 19.898  28.398 23.182  1.00 15.92 ? 721 PHE A CD1 1 
ATOM   144  C CD2 . PHE A 1 45  ? 22.179  28.352 22.443  1.00 15.23 ? 721 PHE A CD2 1 
ATOM   145  C CE1 . PHE A 1 45  ? 19.467  28.531 21.863  1.00 15.91 ? 721 PHE A CE1 1 
ATOM   146  C CE2 . PHE A 1 45  ? 21.760  28.506 21.125  1.00 16.39 ? 721 PHE A CE2 1 
ATOM   147  C CZ  . PHE A 1 45  ? 20.400  28.595 20.834  1.00 15.04 ? 721 PHE A CZ  1 
ATOM   148  N N   . GLU A 1 46  ? 23.561  26.735 27.134  1.00 23.28 ? 722 GLU A N   1 
ATOM   149  C CA  . GLU A 1 46  ? 24.112  26.927 28.475  1.00 25.66 ? 722 GLU A CA  1 
ATOM   150  C C   . GLU A 1 46  ? 25.393  27.742 28.373  1.00 26.93 ? 722 GLU A C   1 
ATOM   151  O O   . GLU A 1 46  ? 26.292  27.411 27.607  1.00 26.36 ? 722 GLU A O   1 
ATOM   152  C CB  . GLU A 1 46  ? 24.381  25.590 29.165  1.00 26.03 ? 722 GLU A CB  1 
ATOM   153  C CG  . GLU A 1 46  ? 23.133  24.860 29.635  1.00 30.64 ? 722 GLU A CG  1 
ATOM   154  C CD  . GLU A 1 46  ? 23.445  23.725 30.605  1.00 35.93 ? 722 GLU A CD  1 
ATOM   155  O OE1 . GLU A 1 46  ? 24.107  23.989 31.628  1.00 39.37 ? 722 GLU A OE1 1 
ATOM   156  O OE2 . GLU A 1 46  ? 23.034  22.566 30.353  1.00 39.74 ? 722 GLU A OE2 1 
ATOM   157  N N   . ARG A 1 47  ? 25.472  28.823 29.135  1.00 28.59 ? 723 ARG A N   1 
ATOM   158  C CA  . ARG A 1 47  ? 26.661  29.670 29.119  1.00 31.20 ? 723 ARG A CA  1 
ATOM   159  C C   . ARG A 1 47  ? 27.693  29.113 30.098  1.00 32.51 ? 723 ARG A C   1 
ATOM   160  O O   . ARG A 1 47  ? 27.334  28.499 31.106  1.00 33.01 ? 723 ARG A O   1 
ATOM   161  C CB  . ARG A 1 47  ? 26.281  31.118 29.471  1.00 31.41 ? 723 ARG A CB  1 
ATOM   162  C CG  . ARG A 1 47  ? 27.444  32.096 29.599  1.00 33.21 ? 723 ARG A CG  1 
ATOM   163  C CD  . ARG A 1 47  ? 28.242  32.304 28.316  1.00 36.23 ? 723 ARG A CD  1 
ATOM   164  N NE  . ARG A 1 47  ? 27.383  32.657 27.190  1.00 37.75 ? 723 ARG A NE  1 
ATOM   165  C CZ  . ARG A 1 47  ? 27.125  33.901 26.811  1.00 39.72 ? 723 ARG A CZ  1 
ATOM   166  N NH1 . ARG A 1 47  ? 27.662  34.923 27.460  1.00 40.21 ? 723 ARG A NH1 1 
ATOM   167  N NH2 . ARG A 1 47  ? 26.333  34.129 25.770  1.00 41.23 ? 723 ARG A NH2 1 
ATOM   168  N N   . SER A 1 48  ? 28.975  29.278 29.788  1.00 34.19 ? 724 SER A N   1 
ATOM   169  C CA  . SER A 1 48  ? 30.009  28.830 30.714  1.00 35.49 ? 724 SER A CA  1 
ATOM   170  C C   . SER A 1 48  ? 30.049  29.807 31.873  1.00 36.35 ? 724 SER A C   1 
ATOM   171  O O   . SER A 1 48  ? 29.879  31.018 31.682  1.00 36.29 ? 724 SER A O   1 
ATOM   172  C CB  . SER A 1 48  ? 31.384  28.779 30.053  1.00 35.68 ? 724 SER A CB  1 
ATOM   173  O OG  . SER A 1 48  ? 32.380  28.514 31.032  1.00 35.60 ? 724 SER A OG  1 
ATOM   174  N N   . ASN A 1 49  ? 30.246  29.274 33.072  1.00 37.55 ? 725 ASN A N   1 
ATOM   175  C CA  . ASN A 1 49  ? 30.362  30.090 34.278  1.00 38.46 ? 725 ASN A CA  1 
ATOM   176  C C   . ASN A 1 49  ? 31.779  30.639 34.379  1.00 38.56 ? 725 ASN A C   1 
ATOM   177  O O   . ASN A 1 49  ? 32.035  31.651 35.035  1.00 38.49 ? 725 ASN A O   1 
ATOM   178  C CB  . ASN A 1 49  ? 30.060  29.259 35.532  1.00 38.80 ? 725 ASN A CB  1 
ATOM   179  C CG  . ASN A 1 49  ? 28.773  28.464 35.421  1.00 40.42 ? 725 ASN A CG  1 
ATOM   180  O OD1 . ASN A 1 49  ? 27.684  29.033 35.315  1.00 42.48 ? 725 ASN A OD1 1 
ATOM   181  N ND2 . ASN A 1 49  ? 28.888  27.134 35.465  1.00 41.92 ? 725 ASN A ND2 1 
ATOM   182  N N   . THR A 1 50  ? 32.700  29.968 33.702  1.00 38.53 ? 726 THR A N   1 
ATOM   183  C CA  . THR A 1 50  ? 34.103  30.338 33.767  1.00 38.63 ? 726 THR A CA  1 
ATOM   184  C C   . THR A 1 50  ? 34.567  31.105 32.547  1.00 38.04 ? 726 THR A C   1 
ATOM   185  O O   . THR A 1 50  ? 35.596  31.767 32.584  1.00 38.18 ? 726 THR A O   1 
ATOM   186  C CB  . THR A 1 50  ? 34.947  29.073 33.879  1.00 38.88 ? 726 THR A CB  1 
ATOM   187  O OG1 . THR A 1 50  ? 34.543  28.151 32.857  1.00 39.81 ? 726 THR A OG1 1 
ATOM   188  C CG2 . THR A 1 50  ? 34.632  28.330 35.177  1.00 39.53 ? 726 THR A CG2 1 
ATOM   189  N N   . ASN A 1 51  ? 33.815  31.011 31.460  1.00 37.35 ? 727 ASN A N   1 
ATOM   190  C CA  . ASN A 1 51  ? 34.261  31.600 30.213  1.00 36.46 ? 727 ASN A CA  1 
ATOM   191  C C   . ASN A 1 51  ? 33.140  32.318 29.483  1.00 36.38 ? 727 ASN A C   1 
ATOM   192  O O   . ASN A 1 51  ? 32.315  31.688 28.836  1.00 36.56 ? 727 ASN A O   1 
ATOM   193  C CB  . ASN A 1 51  ? 34.839  30.496 29.340  1.00 36.27 ? 727 ASN A CB  1 
ATOM   194  C CG  . ASN A 1 51  ? 35.752  31.023 28.264  1.00 35.54 ? 727 ASN A CG  1 
ATOM   195  O OD1 . ASN A 1 51  ? 36.592  30.289 27.744  1.00 34.02 ? 727 ASN A OD1 1 
ATOM   196  N ND2 . ASN A 1 51  ? 35.593  32.302 27.914  1.00 35.51 ? 727 ASN A ND2 1 
ATOM   197  N N   . PRO A 1 52  ? 33.131  33.644 29.576  1.00 35.92 ? 728 PRO A N   1 
ATOM   198  C CA  . PRO A 1 52  ? 32.068  34.475 28.993  1.00 35.07 ? 728 PRO A CA  1 
ATOM   199  C C   . PRO A 1 52  ? 31.941  34.273 27.495  1.00 34.09 ? 728 PRO A C   1 
ATOM   200  O O   . PRO A 1 52  ? 30.963  34.706 26.879  1.00 33.77 ? 728 PRO A O   1 
ATOM   201  C CB  . PRO A 1 52  ? 32.575  35.897 29.258  1.00 35.59 ? 728 PRO A CB  1 
ATOM   202  C CG  . PRO A 1 52  ? 34.068  35.710 29.398  1.00 35.77 ? 728 PRO A CG  1 
ATOM   203  C CD  . PRO A 1 52  ? 34.160  34.466 30.240  1.00 36.14 ? 728 PRO A CD  1 
ATOM   204  N N   . SER A 1 53  ? 32.934  33.614 26.919  1.00 32.63 ? 729 SER A N   1 
ATOM   205  C CA  . SER A 1 53  ? 32.975  33.410 25.487  1.00 31.65 ? 729 SER A CA  1 
ATOM   206  C C   . SER A 1 53  ? 32.506  32.029 25.020  1.00 29.74 ? 729 SER A C   1 
ATOM   207  O O   . SER A 1 53  ? 32.451  31.798 23.828  1.00 29.34 ? 729 SER A O   1 
ATOM   208  C CB  . SER A 1 53  ? 34.388  33.709 24.964  1.00 31.81 ? 729 SER A CB  1 
ATOM   209  O OG  . SER A 1 53  ? 35.334  33.687 26.023  1.00 34.01 ? 729 SER A OG  1 
ATOM   210  N N   . VAL A 1 54  ? 32.186  31.127 25.946  1.00 28.30 ? 730 VAL A N   1 
ATOM   211  C CA  . VAL A 1 54  ? 31.755  29.771 25.574  1.00 26.70 ? 730 VAL A CA  1 
ATOM   212  C C   . VAL A 1 54  ? 30.277  29.487 25.822  1.00 25.18 ? 730 VAL A C   1 
ATOM   213  O O   . VAL A 1 54  ? 29.793  29.572 26.943  1.00 24.69 ? 730 VAL A O   1 
ATOM   214  C CB  . VAL A 1 54  ? 32.538  28.694 26.326  1.00 27.11 ? 730 VAL A CB  1 
ATOM   215  C CG1 . VAL A 1 54  ? 32.006  27.310 25.989  1.00 27.35 ? 730 VAL A CG1 1 
ATOM   216  C CG2 . VAL A 1 54  ? 34.021  28.789 25.999  1.00 27.82 ? 730 VAL A CG2 1 
ATOM   217  N N   . THR A 1 55  ? 29.565  29.122 24.768  1.00 22.70 ? 731 THR A N   1 
ATOM   218  C CA  . THR A 1 55  ? 28.175  28.756 24.917  1.00 21.12 ? 731 THR A CA  1 
ATOM   219  C C   . THR A 1 55  ? 28.023  27.315 24.450  1.00 19.73 ? 731 THR A C   1 
ATOM   220  O O   . THR A 1 55  ? 28.483  26.959 23.376  1.00 18.57 ? 731 THR A O   1 
ATOM   221  C CB  . THR A 1 55  ? 27.305  29.712 24.112  1.00 21.37 ? 731 THR A CB  1 
ATOM   222  O OG1 . THR A 1 55  ? 27.469  31.038 24.642  1.00 22.47 ? 731 THR A OG1 1 
ATOM   223  C CG2 . THR A 1 55  ? 25.817  29.408 24.344  1.00 21.38 ? 731 THR A CG2 1 
ATOM   224  N N   . VAL A 1 56  ? 27.429  26.484 25.297  1.00 18.57 ? 732 VAL A N   1 
ATOM   225  C CA  . VAL A 1 56  ? 27.237  25.085 24.995  1.00 17.07 ? 732 VAL A CA  1 
ATOM   226  C C   . VAL A 1 56  ? 25.841  24.898 24.424  1.00 16.47 ? 732 VAL A C   1 
ATOM   227  O O   . VAL A 1 56  ? 24.839  25.242 25.058  1.00 15.81 ? 732 VAL A O   1 
ATOM   228  C CB  . VAL A 1 56  ? 27.399  24.229 26.256  1.00 17.58 ? 732 VAL A CB  1 
ATOM   229  C CG1 . VAL A 1 56  ? 27.228  22.788 25.939  1.00 18.29 ? 732 VAL A CG1 1 
ATOM   230  C CG2 . VAL A 1 56  ? 28.782  24.507 26.927  1.00 17.51 ? 732 VAL A CG2 1 
ATOM   231  N N   . ILE A 1 57  ? 25.769  24.347 23.219  1.00 15.05 ? 733 ILE A N   1 
ATOM   232  C CA  . ILE A 1 57  ? 24.473  24.128 22.587  1.00 14.81 ? 733 ILE A CA  1 
ATOM   233  C C   . ILE A 1 57  ? 24.189  22.644 22.553  1.00 15.03 ? 733 ILE A C   1 
ATOM   234  O O   . ILE A 1 57  ? 25.026  21.864 22.074  1.00 14.99 ? 733 ILE A O   1 
ATOM   235  C CB  . ILE A 1 57  ? 24.469  24.667 21.140  1.00 14.98 ? 733 ILE A CB  1 
ATOM   236  C CG1 . ILE A 1 57  ? 24.866  26.151 21.115  1.00 15.94 ? 733 ILE A CG1 1 
ATOM   237  C CG2 . ILE A 1 57  ? 23.119  24.370 20.473  1.00 15.64 ? 733 ILE A CG2 1 
ATOM   238  C CD1 . ILE A 1 57  ? 24.838  26.814 19.725  1.00 17.60 ? 733 ILE A CD1 1 
ATOM   239  N N   . THR A 1 58  ? 23.018  22.237 23.050  1.00 14.07 ? 734 THR A N   1 
ATOM   240  C CA  . THR A 1 58  ? 22.638  20.852 22.956  1.00 15.27 ? 734 THR A CA  1 
ATOM   241  C C   . THR A 1 58  ? 21.565  20.756 21.878  1.00 15.07 ? 734 THR A C   1 
ATOM   242  O O   . THR A 1 58  ? 20.526  21.407 21.964  1.00 14.09 ? 734 THR A O   1 
ATOM   243  C CB  . THR A 1 58  ? 22.099  20.324 24.289  1.00 16.26 ? 734 THR A CB  1 
ATOM   244  O OG1 . THR A 1 58  ? 23.147  20.341 25.273  1.00 17.94 ? 734 THR A OG1 1 
ATOM   245  C CG2 . THR A 1 58  ? 21.787  18.851 24.180  1.00 16.95 ? 734 THR A CG2 1 
ATOM   246  N N   . ILE A 1 59  ? 21.818  19.970 20.849  1.00 15.27 ? 735 ILE A N   1 
ATOM   247  C CA  . ILE A 1 59  ? 20.792  19.847 19.828  1.00 15.74 ? 735 ILE A CA  1 
ATOM   248  C C   . ILE A 1 59  ? 20.019  18.568 20.054  1.00 15.36 ? 735 ILE A C   1 
ATOM   249  O O   . ILE A 1 59  ? 20.567  17.554 20.523  1.00 15.55 ? 735 ILE A O   1 
ATOM   250  C CB  . ILE A 1 59  ? 21.361  19.853 18.401  1.00 16.65 ? 735 ILE A CB  1 
ATOM   251  C CG1 . ILE A 1 59  ? 21.490  18.427 17.876  1.00 19.91 ? 735 ILE A CG1 1 
ATOM   252  C CG2 . ILE A 1 59  ? 22.629  20.684 18.323  1.00 18.28 ? 735 ILE A CG2 1 
ATOM   253  C CD1 . ILE A 1 59  ? 22.367  18.309 16.647  1.00 24.54 ? 735 ILE A CD1 1 
ATOM   254  N N   . GLN A 1 60  ? 18.733  18.618 19.721  1.00 14.37 ? 736 GLN A N   1 
ATOM   255  C CA  . GLN A 1 60  ? 17.885  17.448 19.826  1.00 14.69 ? 736 GLN A CA  1 
ATOM   256  C C   . GLN A 1 60  ? 17.175  17.316 18.497  1.00 13.24 ? 736 GLN A C   1 
ATOM   257  O O   . GLN A 1 60  ? 16.436  18.218 18.118  1.00 13.62 ? 736 GLN A O   1 
ATOM   258  C CB  . GLN A 1 60  ? 16.853  17.591 20.953  1.00 15.80 ? 736 GLN A CB  1 
ATOM   259  C CG  . GLN A 1 60  ? 17.496  17.661 22.323  1.00 22.04 ? 736 GLN A CG  1 
ATOM   260  C CD  . GLN A 1 60  ? 17.003  16.567 23.219  1.00 30.40 ? 736 GLN A CD  1 
ATOM   261  O OE1 . GLN A 1 60  ? 17.694  15.560 23.399  1.00 35.04 ? 736 GLN A OE1 1 
ATOM   262  N NE2 . GLN A 1 60  ? 15.794  16.732 23.765  1.00 32.15 ? 736 GLN A NE2 1 
ATOM   263  N N   . ALA A 1 61  ? 17.426  16.219 17.789  1.00 12.58 ? 737 ALA A N   1 
ATOM   264  C CA  . ALA A 1 61  ? 16.794  15.963 16.494  1.00 11.97 ? 737 ALA A CA  1 
ATOM   265  C C   . ALA A 1 61  ? 15.701  14.930 16.642  1.00 11.42 ? 737 ALA A C   1 
ATOM   266  O O   . ALA A 1 61  ? 15.923  13.852 17.188  1.00 12.53 ? 737 ALA A O   1 
ATOM   267  C CB  . ALA A 1 61  ? 17.840  15.479 15.479  1.00 11.53 ? 737 ALA A CB  1 
ATOM   268  N N   . SER A 1 62  ? 14.519  15.259 16.138  1.00 11.05 ? 738 SER A N   1 
ATOM   269  C CA  . SER A 1 62  ? 13.386  14.367 16.253  1.00 11.20 ? 738 SER A CA  1 
ATOM   270  C C   . SER A 1 62  ? 12.728  14.203 14.898  1.00 11.47 ? 738 SER A C   1 
ATOM   271  O O   . SER A 1 62  ? 12.931  15.010 13.999  1.00 10.67 ? 738 SER A O   1 
ATOM   272  C CB  . SER A 1 62  ? 12.356  14.910 17.251  1.00 11.64 ? 738 SER A CB  1 
ATOM   273  O OG  . SER A 1 62  ? 11.864  16.173 16.840  1.00 13.50 ? 738 SER A OG  1 
ATOM   274  N N   . ASN A 1 63  ? 11.929  13.156 14.779  1.00 10.66 ? 739 ASN A N   1 
ATOM   275  C CA  . ASN A 1 63  ? 11.352  12.790 13.492  1.00 11.00 ? 739 ASN A CA  1 
ATOM   276  C C   . ASN A 1 63  ? 9.884   12.472 13.701  1.00 11.49 ? 739 ASN A C   1 
ATOM   277  O O   . ASN A 1 63  ? 9.553   11.501 14.373  1.00 12.43 ? 739 ASN A O   1 
ATOM   278  C CB  . ASN A 1 63  ? 12.137  11.582 12.998  1.00 10.88 ? 739 ASN A CB  1 
ATOM   279  C CG  . ASN A 1 63  ? 11.528  10.897 11.791  1.00 10.15 ? 739 ASN A CG  1 
ATOM   280  O OD1 . ASN A 1 63  ? 10.555  11.357 11.195  1.00 11.78 ? 739 ASN A OD1 1 
ATOM   281  N ND2 . ASN A 1 63  ? 12.100  9.750  11.448  1.00 11.12 ? 739 ASN A ND2 1 
ATOM   282  N N   . SER A 1 64  ? 9.020   13.324 13.145  1.00 12.41 ? 740 SER A N   1 
ATOM   283  C CA  . SER A 1 64  ? 7.581   13.167 13.297  1.00 12.71 ? 740 SER A CA  1 
ATOM   284  C C   . SER A 1 64  ? 6.938   12.359 12.171  1.00 13.36 ? 740 SER A C   1 
ATOM   285  O O   . SER A 1 64  ? 5.720   12.320 12.071  1.00 13.04 ? 740 SER A O   1 
ATOM   286  C CB  . SER A 1 64  ? 6.905   14.546 13.420  1.00 13.09 ? 740 SER A CB  1 
ATOM   287  O OG  . SER A 1 64  ? 7.148   15.371 12.274  1.00 11.81 ? 740 SER A OG  1 
ATOM   288  N N   . THR A 1 65  ? 7.749   11.749 11.305  1.00 13.37 ? 741 THR A N   1 
ATOM   289  C CA  . THR A 1 65  ? 7.219   10.942 10.196  1.00 13.99 ? 741 THR A CA  1 
ATOM   290  C C   . THR A 1 65  ? 7.056   9.483  10.573  1.00 15.11 ? 741 THR A C   1 
ATOM   291  O O   . THR A 1 65  ? 7.388   9.093  11.683  1.00 14.92 ? 741 THR A O   1 
ATOM   292  C CB  . THR A 1 65  ? 8.095   11.050 8.922   1.00 13.83 ? 741 THR A CB  1 
ATOM   293  O OG1 . THR A 1 65  ? 9.294   10.271 9.072   1.00 13.88 ? 741 THR A OG1 1 
ATOM   294  C CG2 . THR A 1 65  ? 8.601   12.466 8.719   1.00 14.60 ? 741 THR A CG2 1 
ATOM   295  N N   . GLU A 1 66  ? 6.554   8.689  9.628   1.00 15.82 ? 742 GLU A N   1 
ATOM   296  C CA  . GLU A 1 66  ? 6.345   7.265  9.839   1.00 17.94 ? 742 GLU A CA  1 
ATOM   297  C C   . GLU A 1 66  ? 7.560   6.422  9.460   1.00 18.43 ? 742 GLU A C   1 
ATOM   298  O O   . GLU A 1 66  ? 7.537   5.209  9.627   1.00 19.39 ? 742 GLU A O   1 
ATOM   299  C CB  . GLU A 1 66  ? 5.123   6.795  9.046   1.00 18.09 ? 742 GLU A CB  1 
ATOM   300  C CG  . GLU A 1 66  ? 3.861   7.537  9.430   1.00 19.29 ? 742 GLU A CG  1 
ATOM   301  C CD  . GLU A 1 66  ? 2.651   6.998  8.710   1.00 22.26 ? 742 GLU A CD  1 
ATOM   302  O OE1 . GLU A 1 66  ? 2.789   5.969  8.019   1.00 24.46 ? 742 GLU A OE1 1 
ATOM   303  O OE2 . GLU A 1 66  ? 1.580   7.604  8.832   1.00 22.55 ? 742 GLU A OE2 1 
ATOM   304  N N   . LEU A 1 67  ? 8.622   7.050  8.952   1.00 18.51 ? 743 LEU A N   1 
ATOM   305  C CA  . LEU A 1 67  ? 9.836   6.292  8.600   1.00 18.91 ? 743 LEU A CA  1 
ATOM   306  C C   . LEU A 1 67  ? 11.115  6.854  9.255   1.00 17.72 ? 743 LEU A C   1 
ATOM   307  O O   . LEU A 1 67  ? 11.297  8.075  9.354   1.00 15.61 ? 743 LEU A O   1 
ATOM   308  C CB  . LEU A 1 67  ? 10.016  6.232  7.096   1.00 19.65 ? 743 LEU A CB  1 
ATOM   309  C CG  . LEU A 1 67  ? 8.886   5.576  6.288   1.00 22.33 ? 743 LEU A CG  1 
ATOM   310  C CD1 . LEU A 1 67  ? 9.011   5.908  4.801   1.00 26.94 ? 743 LEU A CD1 1 
ATOM   311  C CD2 . LEU A 1 67  ? 8.894   4.087  6.514   1.00 25.92 ? 743 LEU A CD2 1 
ATOM   312  N N   . ASP A 1 68  ? 11.993  5.959  9.711   1.00 17.23 ? 744 ASP A N   1 
ATOM   313  C CA  . ASP A 1 68  ? 13.256  6.406  10.311  1.00 17.62 ? 744 ASP A CA  1 
ATOM   314  C C   . ASP A 1 68  ? 14.091  7.235  9.352   1.00 16.32 ? 744 ASP A C   1 
ATOM   315  O O   . ASP A 1 68  ? 14.059  7.035  8.144   1.00 17.12 ? 744 ASP A O   1 
ATOM   316  C CB  . ASP A 1 68  ? 14.149  5.220  10.695  1.00 18.58 ? 744 ASP A CB  1 
ATOM   317  C CG  . ASP A 1 68  ? 13.570  4.376  11.798  1.00 21.45 ? 744 ASP A CG  1 
ATOM   318  O OD1 . ASP A 1 68  ? 14.062  3.234  11.974  1.00 24.67 ? 744 ASP A OD1 1 
ATOM   319  O OD2 . ASP A 1 68  ? 12.667  4.769  12.560  1.00 22.33 ? 744 ASP A OD2 1 
ATOM   320  N N   . MET A 1 69  ? 14.883  8.142  9.921   1.00 14.54 ? 745 MET A N   1 
ATOM   321  C CA  . MET A 1 69  ? 15.836  8.908  9.149   1.00 14.01 ? 745 MET A CA  1 
ATOM   322  C C   . MET A 1 69  ? 17.153  8.298  9.549   1.00 13.86 ? 745 MET A C   1 
ATOM   323  O O   . MET A 1 69  ? 17.510  8.340  10.723  1.00 13.96 ? 745 MET A O   1 
ATOM   324  C CB  . MET A 1 69  ? 15.764  10.377 9.554   1.00 13.66 ? 745 MET A CB  1 
ATOM   325  C CG  . MET A 1 69  ? 14.452  11.015 9.121   1.00 13.77 ? 745 MET A CG  1 
ATOM   326  S SD  . MET A 1 69  ? 14.214  12.639 9.876   1.00 11.59 ? 745 MET A SD  1 
ATOM   327  C CE  . MET A 1 69  ? 12.717  13.114 9.059   1.00 13.79 ? 745 MET A CE  1 
ATOM   328  N N   . THR A 1 70  ? 17.871  7.691  8.605   1.00 13.23 ? 746 THR A N   1 
ATOM   329  C CA  . THR A 1 70  ? 19.089  6.975  8.969   1.00 12.99 ? 746 THR A CA  1 
ATOM   330  C C   . THR A 1 70  ? 20.359  7.671  8.479   1.00 13.13 ? 746 THR A C   1 
ATOM   331  O O   . THR A 1 70  ? 20.300  8.566  7.636   1.00 11.60 ? 746 THR A O   1 
ATOM   332  C CB  . THR A 1 70  ? 19.050  5.547  8.391   1.00 13.68 ? 746 THR A CB  1 
ATOM   333  O OG1 . THR A 1 70  ? 18.861  5.625  6.984   1.00 14.52 ? 746 THR A OG1 1 
ATOM   334  C CG2 . THR A 1 70  ? 17.794  4.796  8.871   1.00 14.47 ? 746 THR A CG2 1 
ATOM   335  N N   . ASP A 1 71  ? 21.505  7.213  8.994   1.00 12.88 ? 747 ASP A N   1 
ATOM   336  C CA  . ASP A 1 71  ? 22.806  7.779  8.649   1.00 13.80 ? 747 ASP A CA  1 
ATOM   337  C C   . ASP A 1 71  ? 22.769  9.292  8.813   1.00 12.94 ? 747 ASP A C   1 
ATOM   338  O O   . ASP A 1 71  ? 23.350  10.051 8.028   1.00 12.44 ? 747 ASP A O   1 
ATOM   339  C CB  . ASP A 1 71  ? 23.199  7.387  7.221   1.00 16.34 ? 747 ASP A CB  1 
ATOM   340  C CG  . ASP A 1 71  ? 23.128  5.881  6.994   1.00 21.65 ? 747 ASP A CG  1 
ATOM   341  O OD1 . ASP A 1 71  ? 23.827  5.132  7.713   1.00 26.71 ? 747 ASP A OD1 1 
ATOM   342  O OD2 . ASP A 1 71  ? 22.378  5.363  6.135   1.00 29.28 ? 747 ASP A OD2 1 
ATOM   343  N N   . PHE A 1 72  ? 22.118  9.744  9.883   1.00 11.55 ? 748 PHE A N   1 
ATOM   344  C CA  . PHE A 1 72  ? 21.946  11.165 10.079  1.00 10.75 ? 748 PHE A CA  1 
ATOM   345  C C   . PHE A 1 72  ? 23.240  11.819 10.503  1.00 11.22 ? 748 PHE A C   1 
ATOM   346  O O   . PHE A 1 72  ? 23.919  11.333 11.423  1.00 11.48 ? 748 PHE A O   1 
ATOM   347  C CB  . PHE A 1 72  ? 20.875  11.406 11.155  1.00 11.55 ? 748 PHE A CB  1 
ATOM   348  C CG  . PHE A 1 72  ? 20.648  12.860 11.466  1.00 11.09 ? 748 PHE A CG  1 
ATOM   349  C CD1 . PHE A 1 72  ? 19.721  13.594 10.737  1.00 13.40 ? 748 PHE A CD1 1 
ATOM   350  C CD2 . PHE A 1 72  ? 21.336  13.482 12.497  1.00 12.27 ? 748 PHE A CD2 1 
ATOM   351  C CE1 . PHE A 1 72  ? 19.503  14.932 11.012  1.00 11.97 ? 748 PHE A CE1 1 
ATOM   352  C CE2 . PHE A 1 72  ? 21.118  14.828 12.789  1.00 11.29 ? 748 PHE A CE2 1 
ATOM   353  C CZ  . PHE A 1 72  ? 20.205  15.555 12.021  1.00 13.43 ? 748 PHE A CZ  1 
ATOM   354  N N   . VAL A 1 73  ? 23.579  12.914 9.836   1.00 9.92  ? 749 VAL A N   1 
ATOM   355  C CA  . VAL A 1 73  ? 24.764  13.691 10.177  1.00 11.18 ? 749 VAL A CA  1 
ATOM   356  C C   . VAL A 1 73  ? 24.444  15.170 10.228  1.00 11.59 ? 749 VAL A C   1 
ATOM   357  O O   . VAL A 1 73  ? 23.941  15.751 9.255   1.00 10.45 ? 749 VAL A O   1 
ATOM   358  C CB  . VAL A 1 73  ? 25.909  13.496 9.142   1.00 11.53 ? 749 VAL A CB  1 
ATOM   359  C CG1 . VAL A 1 73  ? 27.077  14.432 9.449   1.00 12.28 ? 749 VAL A CG1 1 
ATOM   360  C CG2 . VAL A 1 73  ? 26.360  12.038 9.117   1.00 13.68 ? 749 VAL A CG2 1 
ATOM   361  N N   . PHE A 1 74  ? 24.764  15.781 11.362  1.00 10.35 ? 750 PHE A N   1 
ATOM   362  C CA  . PHE A 1 74  ? 24.631  17.219 11.555  1.00 11.94 ? 750 PHE A CA  1 
ATOM   363  C C   . PHE A 1 74  ? 26.006  17.851 11.523  1.00 11.94 ? 750 PHE A C   1 
ATOM   364  O O   . PHE A 1 74  ? 26.933  17.391 12.219  1.00 12.72 ? 750 PHE A O   1 
ATOM   365  C CB  . PHE A 1 74  ? 23.947  17.502 12.918  1.00 11.39 ? 750 PHE A CB  1 
ATOM   366  C CG  . PHE A 1 74  ? 23.996  18.953 13.339  1.00 11.59 ? 750 PHE A CG  1 
ATOM   367  C CD1 . PHE A 1 74  ? 22.900  19.785 13.143  1.00 12.07 ? 750 PHE A CD1 1 
ATOM   368  C CD2 . PHE A 1 74  ? 25.139  19.492 13.916  1.00 13.42 ? 750 PHE A CD2 1 
ATOM   369  C CE1 . PHE A 1 74  ? 22.948  21.121 13.530  1.00 13.17 ? 750 PHE A CE1 1 
ATOM   370  C CE2 . PHE A 1 74  ? 25.184  20.826 14.290  1.00 13.47 ? 750 PHE A CE2 1 
ATOM   371  C CZ  . PHE A 1 74  ? 24.089  21.635 14.098  1.00 13.93 ? 750 PHE A CZ  1 
ATOM   372  N N   . GLN A 1 75  ? 26.170  18.875 10.686  1.00 12.02 ? 751 GLN A N   1 
ATOM   373  C CA  . GLN A 1 75  ? 27.410  19.640 10.595  1.00 12.50 ? 751 GLN A CA  1 
ATOM   374  C C   . GLN A 1 75  ? 27.084  21.118 10.724  1.00 12.44 ? 751 GLN A C   1 
ATOM   375  O O   . GLN A 1 75  ? 25.970  21.554 10.435  1.00 13.15 ? 751 GLN A O   1 
ATOM   376  C CB  . GLN A 1 75  ? 28.113  19.401 9.253   1.00 13.05 ? 751 GLN A CB  1 
ATOM   377  C CG  . GLN A 1 75  ? 28.467  17.949 9.014   1.00 16.77 ? 751 GLN A CG  1 
ATOM   378  C CD  . GLN A 1 75  ? 29.109  17.752 7.672   1.00 22.41 ? 751 GLN A CD  1 
ATOM   379  O OE1 . GLN A 1 75  ? 30.291  18.062 7.496   1.00 26.44 ? 751 GLN A OE1 1 
ATOM   380  N NE2 . GLN A 1 75  ? 28.334  17.272 6.708   1.00 24.54 ? 751 GLN A NE2 1 
ATOM   381  N N   . ALA A 1 76  ? 28.049  21.908 11.156  1.00 13.36 ? 752 ALA A N   1 
ATOM   382  C CA  . ALA A 1 76  ? 27.800  23.330 11.303  1.00 13.72 ? 752 ALA A CA  1 
ATOM   383  C C   . ALA A 1 76  ? 29.061  24.134 11.059  1.00 14.60 ? 752 ALA A C   1 
ATOM   384  O O   . ALA A 1 76  ? 30.179  23.615 11.171  1.00 14.33 ? 752 ALA A O   1 
ATOM   385  C CB  . ALA A 1 76  ? 27.273  23.618 12.680  1.00 15.13 ? 752 ALA A CB  1 
ATOM   386  N N   . ALA A 1 77  ? 28.867  25.397 10.713  1.00 14.46 ? 753 ALA A N   1 
ATOM   387  C CA  . ALA A 1 77  ? 29.967  26.316 10.506  1.00 15.82 ? 753 ALA A CA  1 
ATOM   388  C C   . ALA A 1 77  ? 29.613  27.638 11.162  1.00 16.61 ? 753 ALA A C   1 
ATOM   389  O O   . ALA A 1 77  ? 28.449  28.033 11.187  1.00 16.64 ? 753 ALA A O   1 
ATOM   390  C CB  . ALA A 1 77  ? 30.193  26.531 9.034   1.00 15.57 ? 753 ALA A CB  1 
ATOM   391  N N   . VAL A 1 78  ? 30.630  28.334 11.654  1.00 17.90 ? 754 VAL A N   1 
ATOM   392  C CA  . VAL A 1 78  ? 30.453  29.642 12.266  1.00 19.08 ? 754 VAL A CA  1 
ATOM   393  C C   . VAL A 1 78  ? 31.437  30.625 11.625  1.00 20.22 ? 754 VAL A C   1 
ATOM   394  O O   . VAL A 1 78  ? 32.361  30.210 10.931  1.00 19.49 ? 754 VAL A O   1 
ATOM   395  C CB  . VAL A 1 78  ? 30.684  29.574 13.778  1.00 19.24 ? 754 VAL A CB  1 
ATOM   396  C CG1 . VAL A 1 78  ? 29.580  28.744 14.442  1.00 18.78 ? 754 VAL A CG1 1 
ATOM   397  C CG2 . VAL A 1 78  ? 32.050  28.981 14.078  1.00 20.18 ? 754 VAL A CG2 1 
ATOM   398  N N   . PRO A 1 79  ? 31.235  31.916 11.830  1.00 21.17 ? 755 PRO A N   1 
ATOM   399  C CA  . PRO A 1 79  ? 32.122  32.924 11.229  1.00 22.49 ? 755 PRO A CA  1 
ATOM   400  C C   . PRO A 1 79  ? 33.563  32.747 11.683  1.00 23.41 ? 755 PRO A C   1 
ATOM   401  O O   . PRO A 1 79  ? 33.823  32.155 12.725  1.00 22.68 ? 755 PRO A O   1 
ATOM   402  C CB  . PRO A 1 79  ? 31.553  34.239 11.758  1.00 22.36 ? 755 PRO A CB  1 
ATOM   403  C CG  . PRO A 1 79  ? 30.108  33.927 12.002  1.00 22.13 ? 755 PRO A CG  1 
ATOM   404  C CD  . PRO A 1 79  ? 30.137  32.537 12.594  1.00 21.80 ? 755 PRO A CD  1 
ATOM   405  N N   . LYS A 1 80  ? 34.484  33.309 10.917  1.00 25.60 ? 756 LYS A N   1 
ATOM   406  C CA  . LYS A 1 80  ? 35.919  33.119 11.131  1.00 28.31 ? 756 LYS A CA  1 
ATOM   407  C C   . LYS A 1 80  ? 36.468  33.528 12.505  1.00 28.99 ? 756 LYS A C   1 
ATOM   408  O O   . LYS A 1 80  ? 37.425  32.925 13.006  1.00 29.76 ? 756 LYS A O   1 
ATOM   409  C CB  . LYS A 1 80  ? 36.685  33.807 10.004  1.00 29.18 ? 756 LYS A CB  1 
ATOM   410  C CG  . LYS A 1 80  ? 36.363  33.247 8.624   1.00 31.38 ? 756 LYS A CG  1 
ATOM   411  C CD  . LYS A 1 80  ? 35.435  34.164 7.797   1.00 35.26 ? 756 LYS A CD  1 
ATOM   412  C CE  . LYS A 1 80  ? 33.967  33.787 7.922   1.00 35.71 ? 756 LYS A CE  1 
ATOM   413  N NZ  . LYS A 1 80  ? 33.142  34.810 8.630   1.00 35.69 ? 756 LYS A NZ  1 
ATOM   414  N N   . THR A 1 81  ? 35.865  34.529 13.130  1.00 29.60 ? 757 THR A N   1 
ATOM   415  C CA  . THR A 1 81  ? 36.328  34.928 14.454  1.00 29.96 ? 757 THR A CA  1 
ATOM   416  C C   . THR A 1 81  ? 35.926  33.918 15.518  1.00 29.25 ? 757 THR A C   1 
ATOM   417  O O   . THR A 1 81  ? 36.521  33.883 16.596  1.00 30.12 ? 757 THR A O   1 
ATOM   418  C CB  . THR A 1 81  ? 35.825  36.337 14.828  1.00 30.35 ? 757 THR A CB  1 
ATOM   419  O OG1 . THR A 1 81  ? 34.409  36.416 14.625  1.00 33.13 ? 757 THR A OG1 1 
ATOM   420  C CG2 . THR A 1 81  ? 36.373  37.367 13.850  1.00 31.17 ? 757 THR A CG2 1 
ATOM   421  N N   . PHE A 1 82  ? 34.934  33.084 15.215  1.00 27.17 ? 758 PHE A N   1 
ATOM   422  C CA  . PHE A 1 82  ? 34.472  32.073 16.164  1.00 25.70 ? 758 PHE A CA  1 
ATOM   423  C C   . PHE A 1 82  ? 35.222  30.746 16.029  1.00 25.18 ? 758 PHE A C   1 
ATOM   424  O O   . PHE A 1 82  ? 35.875  30.478 15.022  1.00 25.23 ? 758 PHE A O   1 
ATOM   425  C CB  . PHE A 1 82  ? 33.001  31.738 15.928  1.00 25.59 ? 758 PHE A CB  1 
ATOM   426  C CG  . PHE A 1 82  ? 32.029  32.858 16.220  1.00 25.54 ? 758 PHE A CG  1 
ATOM   427  C CD1 . PHE A 1 82  ? 32.059  34.052 15.523  1.00 25.29 ? 758 PHE A CD1 1 
ATOM   428  C CD2 . PHE A 1 82  ? 31.030  32.661 17.157  1.00 25.14 ? 758 PHE A CD2 1 
ATOM   429  C CE1 . PHE A 1 82  ? 31.103  35.058 15.802  1.00 26.57 ? 758 PHE A CE1 1 
ATOM   430  C CE2 . PHE A 1 82  ? 30.086  33.640 17.432  1.00 26.27 ? 758 PHE A CE2 1 
ATOM   431  C CZ  . PHE A 1 82  ? 30.113  34.839 16.756  1.00 24.18 ? 758 PHE A CZ  1 
ATOM   432  N N   . GLN A 1 83  ? 35.085  29.908 17.052  1.00 24.00 ? 759 GLN A N   1 
ATOM   433  C CA  . GLN A 1 83  ? 35.562  28.533 17.013  1.00 23.73 ? 759 GLN A CA  1 
ATOM   434  C C   . GLN A 1 83  ? 34.387  27.596 17.327  1.00 22.10 ? 759 GLN A C   1 
ATOM   435  O O   . GLN A 1 83  ? 33.523  27.911 18.155  1.00 21.88 ? 759 GLN A O   1 
ATOM   436  C CB  . GLN A 1 83  ? 36.718  28.320 17.987  1.00 24.46 ? 759 GLN A CB  1 
ATOM   437  C CG  . GLN A 1 83  ? 37.912  29.218 17.704  1.00 29.10 ? 759 GLN A CG  1 
ATOM   438  C CD  . GLN A 1 83  ? 39.216  28.526 17.956  1.00 34.49 ? 759 GLN A CD  1 
ATOM   439  O OE1 . GLN A 1 83  ? 39.474  28.051 19.066  1.00 37.87 ? 759 GLN A OE1 1 
ATOM   440  N NE2 . GLN A 1 83  ? 40.054  28.456 16.930  1.00 35.65 ? 759 GLN A NE2 1 
ATOM   441  N N   . LEU A 1 84  ? 34.342  26.452 16.652  1.00 20.23 ? 760 LEU A N   1 
ATOM   442  C CA  . LEU A 1 84  ? 33.263  25.494 16.863  1.00 18.97 ? 760 LEU A CA  1 
ATOM   443  C C   . LEU A 1 84  ? 33.794  24.082 17.134  1.00 18.10 ? 760 LEU A C   1 
ATOM   444  O O   . LEU A 1 84  ? 34.660  23.580 16.411  1.00 17.99 ? 760 LEU A O   1 
ATOM   445  C CB  . LEU A 1 84  ? 32.299  25.497 15.664  1.00 19.75 ? 760 LEU A CB  1 
ATOM   446  C CG  . LEU A 1 84  ? 31.041  24.642 15.761  1.00 21.74 ? 760 LEU A CG  1 
ATOM   447  C CD1 . LEU A 1 84  ? 30.098  25.231 16.788  1.00 24.79 ? 760 LEU A CD1 1 
ATOM   448  C CD2 . LEU A 1 84  ? 30.352  24.599 14.398  1.00 24.79 ? 760 LEU A CD2 1 
ATOM   449  N N   . GLN A 1 85  ? 33.293  23.469 18.204  1.00 15.74 ? 761 GLN A N   1 
ATOM   450  C CA  . GLN A 1 85  ? 33.588  22.079 18.513  1.00 15.43 ? 761 GLN A CA  1 
ATOM   451  C C   . GLN A 1 85  ? 32.322  21.222 18.502  1.00 15.24 ? 761 GLN A C   1 
ATOM   452  O O   . GLN A 1 85  ? 31.367  21.515 19.212  1.00 15.45 ? 761 GLN A O   1 
ATOM   453  C CB  . GLN A 1 85  ? 34.301  21.944 19.874  1.00 14.59 ? 761 GLN A CB  1 
ATOM   454  C CG  . GLN A 1 85  ? 34.574  20.485 20.245  1.00 15.01 ? 761 GLN A CG  1 
ATOM   455  C CD  . GLN A 1 85  ? 35.017  20.337 21.694  1.00 15.63 ? 761 GLN A CD  1 
ATOM   456  O OE1 . GLN A 1 85  ? 34.677  21.169 22.523  1.00 16.36 ? 761 GLN A OE1 1 
ATOM   457  N NE2 . GLN A 1 85  ? 35.749  19.275 21.995  1.00 18.79 ? 761 GLN A NE2 1 
ATOM   458  N N   . LEU A 1 86  ? 32.290  20.179 17.676  1.00 15.03 ? 762 LEU A N   1 
ATOM   459  C CA  . LEU A 1 86  ? 31.176  19.240 17.698  1.00 16.08 ? 762 LEU A CA  1 
ATOM   460  C C   . LEU A 1 86  ? 31.549  17.937 18.387  1.00 16.15 ? 762 LEU A C   1 
ATOM   461  O O   . LEU A 1 86  ? 32.528  17.272 18.017  1.00 16.09 ? 762 LEU A O   1 
ATOM   462  C CB  . LEU A 1 86  ? 30.634  18.939 16.299  1.00 16.93 ? 762 LEU A CB  1 
ATOM   463  C CG  . LEU A 1 86  ? 30.274  20.102 15.388  1.00 19.32 ? 762 LEU A CG  1 
ATOM   464  C CD1 . LEU A 1 86  ? 31.534  20.632 14.746  1.00 22.09 ? 762 LEU A CD1 1 
ATOM   465  C CD2 . LEU A 1 86  ? 29.273  19.614 14.303  1.00 21.65 ? 762 LEU A CD2 1 
ATOM   466  N N   . LEU A 1 87  ? 30.771  17.576 19.398  1.00 16.28 ? 763 LEU A N   1 
ATOM   467  C CA  . LEU A 1 87  ? 30.980  16.323 20.107  1.00 17.34 ? 763 LEU A CA  1 
ATOM   468  C C   . LEU A 1 87  ? 30.174  15.238 19.403  1.00 16.94 ? 763 LEU A C   1 
ATOM   469  O O   . LEU A 1 87  ? 29.332  15.546 18.540  1.00 17.79 ? 763 LEU A O   1 
ATOM   470  C CB  . LEU A 1 87  ? 30.560  16.440 21.574  1.00 16.68 ? 763 LEU A CB  1 
ATOM   471  C CG  . LEU A 1 87  ? 31.412  17.423 22.379  1.00 19.40 ? 763 LEU A CG  1 
ATOM   472  C CD1 . LEU A 1 87  ? 31.082  17.254 23.863  1.00 21.13 ? 763 LEU A CD1 1 
ATOM   473  C CD2 . LEU A 1 87  ? 32.908  17.213 22.140  1.00 21.38 ? 763 LEU A CD2 1 
ATOM   474  N N   . SER A 1 88  ? 30.400  13.980 19.769  1.00 16.70 ? 764 SER A N   1 
ATOM   475  C CA  . SER A 1 88  ? 29.711  12.867 19.096  1.00 16.17 ? 764 SER A CA  1 
ATOM   476  C C   . SER A 1 88  ? 28.207  12.872 19.325  1.00 15.38 ? 764 SER A C   1 
ATOM   477  O O   . SER A 1 88  ? 27.742  13.132 20.437  1.00 15.34 ? 764 SER A O   1 
ATOM   478  C CB  . SER A 1 88  ? 30.250  11.506 19.565  1.00 17.16 ? 764 SER A CB  1 
ATOM   479  O OG  . SER A 1 88  ? 31.625  11.370 19.247  1.00 19.45 ? 764 SER A OG  1 
ATOM   480  N N   . PRO A 1 89  ? 27.435  12.580 18.284  1.00 14.33 ? 765 PRO A N   1 
ATOM   481  C CA  . PRO A 1 89  ? 25.995  12.452 18.470  1.00 14.33 ? 765 PRO A CA  1 
ATOM   482  C C   . PRO A 1 89  ? 25.690  11.135 19.167  1.00 14.47 ? 765 PRO A C   1 
ATOM   483  O O   . PRO A 1 89  ? 26.477  10.185 19.086  1.00 15.18 ? 765 PRO A O   1 
ATOM   484  C CB  . PRO A 1 89  ? 25.439  12.408 17.039  1.00 13.52 ? 765 PRO A CB  1 
ATOM   485  C CG  . PRO A 1 89  ? 26.587  11.776 16.262  1.00 14.31 ? 765 PRO A CG  1 
ATOM   486  C CD  . PRO A 1 89  ? 27.860  12.380 16.882  1.00 13.85 ? 765 PRO A CD  1 
ATOM   487  N N   . SER A 1 90  ? 24.537  11.083 19.826  1.00 15.19 ? 766 SER A N   1 
ATOM   488  C CA  . SER A 1 90  ? 24.107  9.884  20.549  1.00 16.08 ? 766 SER A CA  1 
ATOM   489  C C   . SER A 1 90  ? 23.866  8.689  19.651  1.00 16.75 ? 766 SER A C   1 
ATOM   490  O O   . SER A 1 90  ? 24.010  7.553  20.079  1.00 17.28 ? 766 SER A O   1 
ATOM   491  C CB  . SER A 1 90  ? 22.854  10.179 21.382  1.00 16.76 ? 766 SER A CB  1 
ATOM   492  O OG  . SER A 1 90  ? 21.745  10.512 20.554  1.00 17.41 ? 766 SER A OG  1 
ATOM   493  N N   . SER A 1 91  ? 23.509  8.950  18.394  1.00 15.60 ? 767 SER A N   1 
ATOM   494  C CA  . SER A 1 91  ? 23.159  7.902  17.435  1.00 16.80 ? 767 SER A CA  1 
ATOM   495  C C   . SER A 1 91  ? 23.117  8.491  16.034  1.00 16.16 ? 767 SER A C   1 
ATOM   496  O O   . SER A 1 91  ? 23.318  9.699  15.871  1.00 15.58 ? 767 SER A O   1 
ATOM   497  C CB  . SER A 1 91  ? 21.787  7.298  17.796  1.00 17.66 ? 767 SER A CB  1 
ATOM   498  O OG  . SER A 1 91  ? 20.898  7.228  16.686  1.00 23.02 ? 767 SER A OG  1 
ATOM   499  N N   . SER A 1 92  ? 22.888  7.643  15.040  1.00 15.72 ? 768 SER A N   1 
ATOM   500  C CA  . SER A 1 92  ? 22.796  8.116  13.658  1.00 16.06 ? 768 SER A CA  1 
ATOM   501  C C   . SER A 1 92  ? 21.395  7.858  13.103  1.00 15.48 ? 768 SER A C   1 
ATOM   502  O O   . SER A 1 92  ? 21.175  7.950  11.898  1.00 13.61 ? 768 SER A O   1 
ATOM   503  C CB  . SER A 1 92  ? 23.844  7.414  12.778  1.00 16.74 ? 768 SER A CB  1 
ATOM   504  O OG  . SER A 1 92  ? 23.569  6.037  12.766  1.00 21.95 ? 768 SER A OG  1 
ATOM   505  N N   . ILE A 1 93  ? 20.448  7.521  13.984  1.00 13.93 ? 769 ILE A N   1 
ATOM   506  C CA  . ILE A 1 93  ? 19.080  7.291  13.529  1.00 14.92 ? 769 ILE A CA  1 
ATOM   507  C C   . ILE A 1 93  ? 18.105  8.201  14.260  1.00 14.03 ? 769 ILE A C   1 
ATOM   508  O O   . ILE A 1 93  ? 18.096  8.231  15.488  1.00 13.45 ? 769 ILE A O   1 
ATOM   509  C CB  . ILE A 1 93  ? 18.692  5.825  13.747  1.00 15.09 ? 769 ILE A CB  1 
ATOM   510  C CG1 . ILE A 1 93  ? 19.671  4.916  13.003  1.00 16.24 ? 769 ILE A CG1 1 
ATOM   511  C CG2 . ILE A 1 93  ? 17.293  5.564  13.240  1.00 15.82 ? 769 ILE A CG2 1 
ATOM   512  C CD1 . ILE A 1 93  ? 19.294  3.431  13.080  1.00 20.96 ? 769 ILE A CD1 1 
ATOM   513  N N   . VAL A 1 94  ? 17.332  8.982  13.509  1.00 13.40 ? 770 VAL A N   1 
ATOM   514  C CA  . VAL A 1 94  ? 16.274  9.786  14.128  1.00 13.49 ? 770 VAL A CA  1 
ATOM   515  C C   . VAL A 1 94  ? 15.045  8.902  13.993  1.00 15.04 ? 770 VAL A C   1 
ATOM   516  O O   . VAL A 1 94  ? 14.547  8.684  12.904  1.00 14.82 ? 770 VAL A O   1 
ATOM   517  C CB  . VAL A 1 94  ? 16.012  11.129 13.423  1.00 13.37 ? 770 VAL A CB  1 
ATOM   518  C CG1 . VAL A 1 94  ? 15.275  12.054 14.381  1.00 12.10 ? 770 VAL A CG1 1 
ATOM   519  C CG2 . VAL A 1 94  ? 17.337  11.808 12.950  1.00 12.62 ? 770 VAL A CG2 1 
ATOM   520  N N   . PRO A 1 95  ? 14.565  8.345  15.098  1.00 16.65 ? 771 PRO A N   1 
ATOM   521  C CA  . PRO A 1 95  ? 13.520  7.326  15.015  1.00 18.07 ? 771 PRO A CA  1 
ATOM   522  C C   . PRO A 1 95  ? 12.150  7.884  14.626  1.00 17.81 ? 771 PRO A C   1 
ATOM   523  O O   . PRO A 1 95  ? 11.770  8.976  15.031  1.00 18.34 ? 771 PRO A O   1 
ATOM   524  C CB  . PRO A 1 95  ? 13.517  6.749  16.440  1.00 18.18 ? 771 PRO A CB  1 
ATOM   525  C CG  . PRO A 1 95  ? 13.762  7.981  17.236  1.00 18.47 ? 771 PRO A CG  1 
ATOM   526  C CD  . PRO A 1 95  ? 14.951  8.624  16.491  1.00 17.09 ? 771 PRO A CD  1 
ATOM   527  N N   . ALA A 1 96  ? 11.416  7.105  13.848  1.00 19.52 ? 772 ALA A N   1 
ATOM   528  C CA  . ALA A 1 96  ? 10.083  7.494  13.397  1.00 19.83 ? 772 ALA A CA  1 
ATOM   529  C C   . ALA A 1 96  ? 9.102   7.611  14.570  1.00 20.95 ? 772 ALA A C   1 
ATOM   530  O O   . ALA A 1 96  ? 9.388   7.158  15.677  1.00 20.65 ? 772 ALA A O   1 
ATOM   531  C CB  . ALA A 1 96  ? 9.580   6.488  12.382  1.00 19.95 ? 772 ALA A CB  1 
ATOM   532  N N   . PHE A 1 97  ? 7.974   8.273  14.316  1.00 22.04 ? 773 PHE A N   1 
ATOM   533  C CA  . PHE A 1 97  ? 6.892   8.436  15.289  1.00 22.69 ? 773 PHE A CA  1 
ATOM   534  C C   . PHE A 1 97  ? 7.268   9.169  16.583  1.00 23.28 ? 773 PHE A C   1 
ATOM   535  O O   . PHE A 1 97  ? 6.642   8.965  17.618  1.00 22.93 ? 773 PHE A O   1 
ATOM   536  C CB  . PHE A 1 97  ? 6.278   7.059  15.599  1.00 23.64 ? 773 PHE A CB  1 
ATOM   537  C CG  . PHE A 1 97  ? 5.794   6.329  14.382  1.00 24.43 ? 773 PHE A CG  1 
ATOM   538  C CD1 . PHE A 1 97  ? 6.548   5.312  13.808  1.00 27.09 ? 773 PHE A CD1 1 
ATOM   539  C CD2 . PHE A 1 97  ? 4.597   6.666  13.792  1.00 25.90 ? 773 PHE A CD2 1 
ATOM   540  C CE1 . PHE A 1 97  ? 6.105   4.651  12.694  1.00 26.59 ? 773 PHE A CE1 1 
ATOM   541  C CE2 . PHE A 1 97  ? 4.149   6.008  12.665  1.00 26.45 ? 773 PHE A CE2 1 
ATOM   542  C CZ  . PHE A 1 97  ? 4.906   4.998  12.114  1.00 27.60 ? 773 PHE A CZ  1 
ATOM   543  N N   . ASN A 1 98  ? 8.321   9.994  16.524  1.00 23.27 ? 774 ASN A N   1 
ATOM   544  C CA  . ASN A 1 98  ? 8.773   10.778 17.681  1.00 24.35 ? 774 ASN A CA  1 
ATOM   545  C C   . ASN A 1 98  ? 9.054   9.921  18.900  1.00 24.82 ? 774 ASN A C   1 
ATOM   546  O O   . ASN A 1 98  ? 8.815   10.335 20.026  1.00 26.00 ? 774 ASN A O   1 
ATOM   547  C CB  . ASN A 1 98  ? 7.740   11.841 18.062  1.00 24.20 ? 774 ASN A CB  1 
ATOM   548  C CG  . ASN A 1 98  ? 7.614   12.927 17.023  1.00 25.55 ? 774 ASN A CG  1 
ATOM   549  O OD1 . ASN A 1 98  ? 6.614   13.000 16.315  1.00 26.84 ? 774 ASN A OD1 1 
ATOM   550  N ND2 . ASN A 1 98  ? 8.620   13.787 16.934  1.00 26.24 ? 774 ASN A ND2 1 
ATOM   551  N N   . THR A 1 99  ? 9.555   8.725  18.664  1.00 25.81 ? 775 THR A N   1 
ATOM   552  C CA  . THR A 1 99  ? 9.812   7.778  19.739  1.00 26.58 ? 775 THR A CA  1 
ATOM   553  C C   . THR A 1 99  ? 11.144  8.000  20.471  1.00 26.59 ? 775 THR A C   1 
ATOM   554  O O   . THR A 1 99  ? 11.447  7.307  21.444  1.00 27.04 ? 775 THR A O   1 
ATOM   555  C CB  . THR A 1 99  ? 9.737   6.380  19.174  1.00 26.93 ? 775 THR A CB  1 
ATOM   556  O OG1 . THR A 1 99  ? 10.492  6.328  17.958  1.00 29.00 ? 775 THR A OG1 1 
ATOM   557  C CG2 . THR A 1 99  ? 8.326   6.100  18.696  1.00 27.28 ? 775 THR A CG2 1 
ATOM   558  N N   . GLY A 1 100 ? 11.922  8.974  20.017  1.00 25.43 ? 776 GLY A N   1 
ATOM   559  C CA  . GLY A 1 100 ? 13.212  9.280  20.610  1.00 24.55 ? 776 GLY A CA  1 
ATOM   560  C C   . GLY A 1 100 ? 13.876  10.405 19.839  1.00 24.03 ? 776 GLY A C   1 
ATOM   561  O O   . GLY A 1 100 ? 13.296  10.968 18.906  1.00 23.26 ? 776 GLY A O   1 
ATOM   562  N N   . THR A 1 101 ? 15.094  10.751 20.229  1.00 22.80 ? 777 THR A N   1 
ATOM   563  C CA  . THR A 1 101 ? 15.811  11.803 19.543  1.00 21.50 ? 777 THR A CA  1 
ATOM   564  C C   . THR A 1 101 ? 17.263  11.432 19.372  1.00 20.25 ? 777 THR A C   1 
ATOM   565  O O   . THR A 1 101 ? 17.729  10.397 19.886  1.00 20.75 ? 777 THR A O   1 
ATOM   566  C CB  . THR A 1 101 ? 15.775  13.102 20.348  1.00 21.97 ? 777 THR A CB  1 
ATOM   567  O OG1 . THR A 1 101 ? 16.439  12.902 21.615  1.00 24.24 ? 777 THR A OG1 1 
ATOM   568  C CG2 . THR A 1 101 ? 14.341  13.494 20.724  1.00 22.86 ? 777 THR A CG2 1 
ATOM   569  N N   . ILE A 1 102 ? 17.951  12.270 18.604  1.00 17.45 ? 778 ILE A N   1 
ATOM   570  C CA  . ILE A 1 102 ? 19.388  12.227 18.516  1.00 16.43 ? 778 ILE A CA  1 
ATOM   571  C C   . ILE A 1 102 ? 19.811  13.456 19.293  1.00 15.86 ? 778 ILE A C   1 
ATOM   572  O O   . ILE A 1 102 ? 19.329  14.572 19.024  1.00 15.99 ? 778 ILE A O   1 
ATOM   573  C CB  . ILE A 1 102 ? 19.902  12.332 17.054  1.00 15.63 ? 778 ILE A CB  1 
ATOM   574  C CG1 . ILE A 1 102 ? 19.697  11.013 16.301  1.00 14.88 ? 778 ILE A CG1 1 
ATOM   575  C CG2 . ILE A 1 102 ? 21.345  12.735 17.029  1.00 17.13 ? 778 ILE A CG2 1 
ATOM   576  C CD1 . ILE A 1 102 ? 20.326  10.998 14.880  1.00 13.65 ? 778 ILE A CD1 1 
ATOM   577  N N   . THR A 1 103 ? 20.678  13.258 20.283  1.00 15.13 ? 779 THR A N   1 
ATOM   578  C CA  . THR A 1 103 ? 21.244  14.371 21.020  1.00 15.82 ? 779 THR A CA  1 
ATOM   579  C C   . THR A 1 103 ? 22.691  14.562 20.600  1.00 15.25 ? 779 THR A C   1 
ATOM   580  O O   . THR A 1 103 ? 23.426  13.583 20.476  1.00 15.77 ? 779 THR A O   1 
ATOM   581  C CB  . THR A 1 103 ? 21.232  14.099 22.550  1.00 16.11 ? 779 THR A CB  1 
ATOM   582  O OG1 . THR A 1 103 ? 19.873  14.025 23.018  1.00 19.71 ? 779 THR A OG1 1 
ATOM   583  C CG2 . THR A 1 103 ? 21.779  15.317 23.263  1.00 18.62 ? 779 THR A CG2 1 
ATOM   584  N N   . GLN A 1 104 ? 23.101  15.815 20.425  1.00 14.84 ? 780 GLN A N   1 
ATOM   585  C CA  . GLN A 1 104 ? 24.481  16.159 20.090  1.00 14.87 ? 780 GLN A CA  1 
ATOM   586  C C   . GLN A 1 104 ? 24.866  17.506 20.672  1.00 15.11 ? 780 GLN A C   1 
ATOM   587  O O   . GLN A 1 104 ? 24.123  18.480 20.561  1.00 14.65 ? 780 GLN A O   1 
ATOM   588  C CB  . GLN A 1 104 ? 24.721  16.165 18.572  1.00 14.61 ? 780 GLN A CB  1 
ATOM   589  C CG  . GLN A 1 104 ? 26.200  16.313 18.168  1.00 13.78 ? 780 GLN A CG  1 
ATOM   590  C CD  . GLN A 1 104 ? 26.421  16.106 16.663  1.00 14.37 ? 780 GLN A CD  1 
ATOM   591  O OE1 . GLN A 1 104 ? 25.436  16.000 15.889  1.00 12.92 ? 780 GLN A OE1 1 
ATOM   592  N NE2 . GLN A 1 104 ? 27.682  16.046 16.244  1.00 13.44 ? 780 GLN A NE2 1 
ATOM   593  N N   . VAL A 1 105 ? 26.046  17.561 21.286  1.00 15.05 ? 781 VAL A N   1 
ATOM   594  C CA  . VAL A 1 105 ? 26.547  18.804 21.870  1.00 16.02 ? 781 VAL A CA  1 
ATOM   595  C C   . VAL A 1 105 ? 27.547  19.527 20.959  1.00 16.27 ? 781 VAL A C   1 
ATOM   596  O O   . VAL A 1 105 ? 28.438  18.895 20.379  1.00 16.97 ? 781 VAL A O   1 
ATOM   597  C CB  . VAL A 1 105 ? 27.205  18.530 23.249  1.00 15.28 ? 781 VAL A CB  1 
ATOM   598  C CG1 . VAL A 1 105 ? 27.953  19.743 23.747  1.00 16.40 ? 781 VAL A CG1 1 
ATOM   599  C CG2 . VAL A 1 105 ? 26.132  18.101 24.246  1.00 17.77 ? 781 VAL A CG2 1 
ATOM   600  N N   . ILE A 1 106 ? 27.338  20.827 20.790  1.00 16.47 ? 782 ILE A N   1 
ATOM   601  C CA  . ILE A 1 106 ? 28.259  21.689 20.075  1.00 18.11 ? 782 ILE A CA  1 
ATOM   602  C C   . ILE A 1 106 ? 28.675  22.786 21.016  1.00 17.58 ? 782 ILE A C   1 
ATOM   603  O O   . ILE A 1 106 ? 27.869  23.291 21.794  1.00 18.26 ? 782 ILE A O   1 
ATOM   604  C CB  . ILE A 1 106 ? 27.599  22.322 18.844  1.00 18.70 ? 782 ILE A CB  1 
ATOM   605  C CG1 . ILE A 1 106 ? 27.444  21.264 17.773  1.00 22.00 ? 782 ILE A CG1 1 
ATOM   606  C CG2 . ILE A 1 106 ? 28.468  23.447 18.289  1.00 20.01 ? 782 ILE A CG2 1 
ATOM   607  C CD1 . ILE A 1 106 ? 26.055  21.294 17.172  1.00 28.84 ? 782 ILE A CD1 1 
ATOM   608  N N   . LYS A 1 107 ? 29.943  23.147 20.968  1.00 16.93 ? 783 LYS A N   1 
ATOM   609  C CA  . LYS A 1 107 ? 30.407  24.242 21.786  1.00 16.57 ? 783 LYS A CA  1 
ATOM   610  C C   . LYS A 1 107 ? 30.864  25.354 20.889  1.00 16.78 ? 783 LYS A C   1 
ATOM   611  O O   . LYS A 1 107 ? 31.615  25.137 19.944  1.00 16.53 ? 783 LYS A O   1 
ATOM   612  C CB  . LYS A 1 107 ? 31.525  23.772 22.712  1.00 16.20 ? 783 LYS A CB  1 
ATOM   613  C CG  . LYS A 1 107 ? 31.075  22.589 23.537  1.00 16.41 ? 783 LYS A CG  1 
ATOM   614  C CD  . LYS A 1 107 ? 31.926  22.429 24.774  1.00 16.70 ? 783 LYS A CD  1 
ATOM   615  C CE  . LYS A 1 107 ? 31.514  21.219 25.559  1.00 15.81 ? 783 LYS A CE  1 
ATOM   616  N NZ  . LYS A 1 107 ? 32.554  20.992 26.604  1.00 14.68 ? 783 LYS A NZ  1 
ATOM   617  N N   . VAL A 1 108 ? 30.396  26.556 21.187  1.00 17.09 ? 784 VAL A N   1 
ATOM   618  C CA  . VAL A 1 108 ? 30.747  27.706 20.398  1.00 18.00 ? 784 VAL A CA  1 
ATOM   619  C C   . VAL A 1 108 ? 31.605  28.627 21.228  1.00 18.64 ? 784 VAL A C   1 
ATOM   620  O O   . VAL A 1 108 ? 31.198  29.017 22.316  1.00 17.74 ? 784 VAL A O   1 
ATOM   621  C CB  . VAL A 1 108 ? 29.508  28.486 19.985  1.00 17.42 ? 784 VAL A CB  1 
ATOM   622  C CG1 . VAL A 1 108 ? 29.908  29.765 19.265  1.00 19.67 ? 784 VAL A CG1 1 
ATOM   623  C CG2 . VAL A 1 108 ? 28.631  27.614 19.065  1.00 18.56 ? 784 VAL A CG2 1 
ATOM   624  N N   . LEU A 1 109 ? 32.789  28.946 20.711  1.00 19.94 ? 785 LEU A N   1 
ATOM   625  C CA  . LEU A 1 109 ? 33.651  29.935 21.350  1.00 21.24 ? 785 LEU A CA  1 
ATOM   626  C C   . LEU A 1 109 ? 33.488  31.240 20.579  1.00 22.17 ? 785 LEU A C   1 
ATOM   627  O O   . LEU A 1 109 ? 33.715  31.295 19.366  1.00 22.05 ? 785 LEU A O   1 
ATOM   628  C CB  . LEU A 1 109 ? 35.112  29.467 21.362  1.00 21.70 ? 785 LEU A CB  1 
ATOM   629  C CG  . LEU A 1 109 ? 36.154  30.364 22.049  1.00 22.39 ? 785 LEU A CG  1 
ATOM   630  C CD1 . LEU A 1 109 ? 35.945  30.370 23.554  1.00 25.01 ? 785 LEU A CD1 1 
ATOM   631  C CD2 . LEU A 1 109 ? 37.550  29.829 21.719  1.00 21.81 ? 785 LEU A CD2 1 
ATOM   632  N N   . ASN A 1 110 ? 33.110  32.293 21.303  1.00 23.38 ? 786 ASN A N   1 
ATOM   633  C CA  . ASN A 1 110 ? 32.832  33.606 20.740  1.00 24.79 ? 786 ASN A CA  1 
ATOM   634  C C   . ASN A 1 110 ? 33.675  34.661 21.462  1.00 26.46 ? 786 ASN A C   1 
ATOM   635  O O   . ASN A 1 110 ? 33.133  35.506 22.181  1.00 26.45 ? 786 ASN A O   1 
ATOM   636  C CB  . ASN A 1 110 ? 31.339  33.905 20.931  1.00 24.79 ? 786 ASN A CB  1 
ATOM   637  C CG  . ASN A 1 110 ? 30.860  35.128 20.167  1.00 24.65 ? 786 ASN A CG  1 
ATOM   638  O OD1 . ASN A 1 110 ? 31.638  35.854 19.534  1.00 26.45 ? 786 ASN A OD1 1 
ATOM   639  N ND2 . ASN A 1 110 ? 29.548  35.353 20.205  1.00 22.08 ? 786 ASN A ND2 1 
ATOM   640  N N   . PRO A 1 111 ? 34.986  34.632 21.219  1.00 27.80 ? 787 PRO A N   1 
ATOM   641  C CA  . PRO A 1 111 ? 35.956  35.485 21.922  1.00 28.97 ? 787 PRO A CA  1 
ATOM   642  C C   . PRO A 1 111 ? 35.630  36.967 21.901  1.00 29.70 ? 787 PRO A C   1 
ATOM   643  O O   . PRO A 1 111 ? 35.957  37.654 22.861  1.00 30.16 ? 787 PRO A O   1 
ATOM   644  C CB  . PRO A 1 111 ? 37.253  35.259 21.138  1.00 29.31 ? 787 PRO A CB  1 
ATOM   645  C CG  . PRO A 1 111 ? 37.101  33.940 20.506  1.00 29.35 ? 787 PRO A CG  1 
ATOM   646  C CD  . PRO A 1 111 ? 35.631  33.809 20.182  1.00 27.98 ? 787 PRO A CD  1 
ATOM   647  N N   . GLN A 1 112 ? 35.015  37.448 20.824  1.00 30.34 ? 788 GLN A N   1 
ATOM   648  C CA  . GLN A 1 112 ? 34.702  38.863 20.670  1.00 31.12 ? 788 GLN A CA  1 
ATOM   649  C C   . GLN A 1 112 ? 33.244  39.197 20.990  1.00 31.05 ? 788 GLN A C   1 
ATOM   650  O O   . GLN A 1 112 ? 32.776  40.305 20.713  1.00 31.13 ? 788 GLN A O   1 
ATOM   651  C CB  . GLN A 1 112 ? 35.022  39.291 19.238  1.00 31.18 ? 788 GLN A CB  1 
ATOM   652  C CG  . GLN A 1 112 ? 36.289  38.653 18.682  1.00 33.52 ? 788 GLN A CG  1 
ATOM   653  C CD  . GLN A 1 112 ? 36.829  39.370 17.458  1.00 35.93 ? 788 GLN A CD  1 
ATOM   654  O OE1 . GLN A 1 112 ? 36.302  40.405 17.054  1.00 39.12 ? 788 GLN A OE1 1 
ATOM   655  N NE2 . GLN A 1 112 ? 37.888  38.824 16.871  1.00 37.49 ? 788 GLN A NE2 1 
ATOM   656  N N   . LYS A 1 113 ? 32.518  38.233 21.552  1.00 30.87 ? 789 LYS A N   1 
ATOM   657  C CA  . LYS A 1 113 ? 31.105  38.427 21.891  1.00 30.96 ? 789 LYS A CA  1 
ATOM   658  C C   . LYS A 1 113 ? 30.308  39.087 20.760  1.00 30.00 ? 789 LYS A C   1 
ATOM   659  O O   . LYS A 1 113 ? 29.546  40.034 20.995  1.00 30.00 ? 789 LYS A O   1 
ATOM   660  C CB  . LYS A 1 113 ? 30.956  39.230 23.191  1.00 31.29 ? 789 LYS A CB  1 
ATOM   661  C CG  . LYS A 1 113 ? 29.553  39.191 23.794  1.00 34.28 ? 789 LYS A CG  1 
ATOM   662  C CD  . LYS A 1 113 ? 29.405  40.140 24.994  1.00 38.43 ? 789 LYS A CD  1 
ATOM   663  C CE  . LYS A 1 113 ? 29.019  41.574 24.569  1.00 39.98 ? 789 LYS A CE  1 
ATOM   664  N NZ  . LYS A 1 113 ? 27.545  41.855 24.633  1.00 41.72 ? 789 LYS A NZ  1 
ATOM   665  N N   . GLN A 1 114 ? 30.493  38.588 19.539  1.00 29.10 ? 790 GLN A N   1 
ATOM   666  C CA  . GLN A 1 114 ? 29.784  39.103 18.363  1.00 28.34 ? 790 GLN A CA  1 
ATOM   667  C C   . GLN A 1 114 ? 28.438  38.387 18.130  1.00 26.85 ? 790 GLN A C   1 
ATOM   668  O O   . GLN A 1 114 ? 28.190  37.326 18.708  1.00 26.50 ? 790 GLN A O   1 
ATOM   669  C CB  . GLN A 1 114 ? 30.633  38.948 17.103  1.00 28.64 ? 790 GLN A CB  1 
ATOM   670  C CG  . GLN A 1 114 ? 31.967  39.666 17.134  1.00 32.19 ? 790 GLN A CG  1 
ATOM   671  C CD  . GLN A 1 114 ? 32.779  39.408 15.880  1.00 35.21 ? 790 GLN A CD  1 
ATOM   672  O OE1 . GLN A 1 114 ? 33.272  38.300 15.670  1.00 37.34 ? 790 GLN A OE1 1 
ATOM   673  N NE2 . GLN A 1 114 ? 32.922  40.429 15.042  1.00 38.13 ? 790 GLN A NE2 1 
ATOM   674  N N   . GLN A 1 115 ? 27.597  38.960 17.270  1.00 25.45 ? 791 GLN A N   1 
ATOM   675  C CA  . GLN A 1 115 ? 26.299  38.360 16.922  1.00 23.97 ? 791 GLN A CA  1 
ATOM   676  C C   . GLN A 1 115 ? 26.543  36.930 16.477  1.00 23.07 ? 791 GLN A C   1 
ATOM   677  O O   . GLN A 1 115 ? 27.243  36.690 15.500  1.00 21.92 ? 791 GLN A O   1 
ATOM   678  C CB  . GLN A 1 115 ? 25.639  39.133 15.778  1.00 24.67 ? 791 GLN A CB  1 
ATOM   679  C CG  . GLN A 1 115 ? 24.454  38.403 15.088  1.00 25.43 ? 791 GLN A CG  1 
ATOM   680  C CD  . GLN A 1 115 ? 23.212  38.263 15.964  1.00 27.12 ? 791 GLN A CD  1 
ATOM   681  O OE1 . GLN A 1 115 ? 22.579  39.262 16.320  1.00 28.76 ? 791 GLN A OE1 1 
ATOM   682  N NE2 . GLN A 1 115 ? 22.840  37.029 16.282  1.00 25.79 ? 791 GLN A NE2 1 
ATOM   683  N N   . LEU A 1 116 ? 25.965  35.980 17.201  1.00 21.54 ? 792 LEU A N   1 
ATOM   684  C CA  . LEU A 1 116 ? 26.101  34.572 16.859  1.00 21.32 ? 792 LEU A CA  1 
ATOM   685  C C   . LEU A 1 116 ? 25.424  34.281 15.521  1.00 20.55 ? 792 LEU A C   1 
ATOM   686  O O   . LEU A 1 116 ? 24.286  34.693 15.283  1.00 20.90 ? 792 LEU A O   1 
ATOM   687  C CB  . LEU A 1 116 ? 25.512  33.703 17.970  1.00 21.02 ? 792 LEU A CB  1 
ATOM   688  C CG  . LEU A 1 116 ? 25.565  32.178 17.873  1.00 21.62 ? 792 LEU A CG  1 
ATOM   689  C CD1 . LEU A 1 116 ? 26.999  31.713 17.717  1.00 22.15 ? 792 LEU A CD1 1 
ATOM   690  C CD2 . LEU A 1 116 ? 24.951  31.552 19.110  1.00 21.92 ? 792 LEU A CD2 1 
ATOM   691  N N   . ARG A 1 117 ? 26.152  33.605 14.637  1.00 19.77 ? 793 ARG A N   1 
ATOM   692  C CA  . ARG A 1 117 ? 25.638  33.227 13.335  1.00 18.93 ? 793 ARG A CA  1 
ATOM   693  C C   . ARG A 1 117 ? 26.084  31.802 13.120  1.00 18.15 ? 793 ARG A C   1 
ATOM   694  O O   . ARG A 1 117 ? 27.120  31.401 13.644  1.00 17.68 ? 793 ARG A O   1 
ATOM   695  C CB  . ARG A 1 117 ? 26.180  34.143 12.230  1.00 19.72 ? 793 ARG A CB  1 
ATOM   696  C CG  . ARG A 1 117 ? 25.713  35.603 12.361  1.00 22.95 ? 793 ARG A CG  1 
ATOM   697  C CD  . ARG A 1 117 ? 26.159  36.541 11.245  1.00 30.17 ? 793 ARG A CD  1 
ATOM   698  N NE  . ARG A 1 117 ? 26.170  37.942 11.685  1.00 34.44 ? 793 ARG A NE  1 
ATOM   699  C CZ  . ARG A 1 117 ? 25.165  38.794 11.509  1.00 37.59 ? 793 ARG A CZ  1 
ATOM   700  N NH1 . ARG A 1 117 ? 24.053  38.396 10.902  1.00 39.49 ? 793 ARG A NH1 1 
ATOM   701  N NH2 . ARG A 1 117 ? 25.265  40.048 11.940  1.00 39.00 ? 793 ARG A NH2 1 
ATOM   702  N N   . MET A 1 118 ? 25.293  31.031 12.381  1.00 16.70 ? 794 MET A N   1 
ATOM   703  C CA  . MET A 1 118 ? 25.638  29.632 12.141  1.00 15.95 ? 794 MET A CA  1 
ATOM   704  C C   . MET A 1 118 ? 24.902  29.105 10.922  1.00 15.53 ? 794 MET A C   1 
ATOM   705  O O   . MET A 1 118 ? 23.732  29.414 10.716  1.00 15.02 ? 794 MET A O   1 
ATOM   706  C CB  . MET A 1 118 ? 25.247  28.778 13.340  1.00 15.82 ? 794 MET A CB  1 
ATOM   707  C CG  . MET A 1 118 ? 25.716  27.315 13.270  1.00 14.90 ? 794 MET A CG  1 
ATOM   708  S SD  . MET A 1 118 ? 25.128  26.328 14.691  1.00 16.11 ? 794 MET A SD  1 
ATOM   709  C CE  . MET A 1 118 ? 26.314  26.779 15.924  1.00 14.83 ? 794 MET A CE  1 
ATOM   710  N N   . ARG A 1 119 ? 25.600  28.303 10.125  1.00 14.66 ? 795 ARG A N   1 
ATOM   711  C CA  . ARG A 1 119 ? 24.978  27.622 8.999   1.00 14.68 ? 795 ARG A CA  1 
ATOM   712  C C   . ARG A 1 119 ? 25.058  26.153 9.320   1.00 14.05 ? 795 ARG A C   1 
ATOM   713  O O   . ARG A 1 119 ? 26.090  25.677 9.820   1.00 15.10 ? 795 ARG A O   1 
ATOM   714  C CB  . ARG A 1 119 ? 25.722  27.929 7.692   1.00 14.74 ? 795 ARG A CB  1 
ATOM   715  C CG  . ARG A 1 119 ? 25.596  29.390 7.285   1.00 20.69 ? 795 ARG A CG  1 
ATOM   716  C CD  . ARG A 1 119 ? 26.385  29.800 6.055   1.00 28.13 ? 795 ARG A CD  1 
ATOM   717  N NE  . ARG A 1 119 ? 26.347  31.252 5.863   1.00 34.12 ? 795 ARG A NE  1 
ATOM   718  C CZ  . ARG A 1 119 ? 27.211  31.924 5.108   1.00 37.16 ? 795 ARG A CZ  1 
ATOM   719  N NH1 . ARG A 1 119 ? 28.191  31.275 4.480   1.00 38.42 ? 795 ARG A NH1 1 
ATOM   720  N NH2 . ARG A 1 119 ? 27.108  33.241 4.987   1.00 38.44 ? 795 ARG A NH2 1 
ATOM   721  N N   . ILE A 1 120 ? 23.976  25.417 9.080   1.00 13.25 ? 796 ILE A N   1 
ATOM   722  C CA  . ILE A 1 120 ? 24.016  23.996 9.358   1.00 12.14 ? 796 ILE A CA  1 
ATOM   723  C C   . ILE A 1 120 ? 23.807  23.206 8.086   1.00 12.76 ? 796 ILE A C   1 
ATOM   724  O O   . ILE A 1 120 ? 23.152  23.685 7.168   1.00 12.35 ? 796 ILE A O   1 
ATOM   725  C CB  . ILE A 1 120 ? 22.954  23.593 10.402  1.00 12.16 ? 796 ILE A CB  1 
ATOM   726  C CG1 . ILE A 1 120 ? 21.541  23.876 9.907   1.00 12.76 ? 796 ILE A CG1 1 
ATOM   727  C CG2 . ILE A 1 120 ? 23.172  24.352 11.715  1.00 11.48 ? 796 ILE A CG2 1 
ATOM   728  C CD1 . ILE A 1 120 ? 20.477  23.378 10.883  1.00 12.76 ? 796 ILE A CD1 1 
ATOM   729  N N   . LYS A 1 121 ? 24.383  22.011 8.053   1.00 11.19 ? 797 LYS A N   1 
ATOM   730  C CA  . LYS A 1 121 ? 24.216  21.095 6.922   1.00 12.69 ? 797 LYS A CA  1 
ATOM   731  C C   . LYS A 1 121 ? 23.729  19.769 7.474   1.00 12.42 ? 797 LYS A C   1 
ATOM   732  O O   . LYS A 1 121 ? 24.325  19.202 8.395   1.00 12.65 ? 797 LYS A O   1 
ATOM   733  C CB  . LYS A 1 121 ? 25.538  20.919 6.202   1.00 12.88 ? 797 LYS A CB  1 
ATOM   734  C CG  . LYS A 1 121 ? 25.433  20.043 4.978   1.00 18.48 ? 797 LYS A CG  1 
ATOM   735  C CD  . LYS A 1 121 ? 26.812  19.797 4.421   1.00 22.87 ? 797 LYS A CD  1 
ATOM   736  C CE  . LYS A 1 121 ? 26.771  18.718 3.361   1.00 28.37 ? 797 LYS A CE  1 
ATOM   737  N NZ  . LYS A 1 121 ? 25.615  18.961 2.470   1.00 30.99 ? 797 LYS A NZ  1 
ATOM   738  N N   . LEU A 1 122 ? 22.618  19.297 6.927   1.00 12.03 ? 798 LEU A N   1 
ATOM   739  C CA  . LEU A 1 122 ? 22.016  18.062 7.380   1.00 12.03 ? 798 LEU A CA  1 
ATOM   740  C C   . LEU A 1 122 ? 22.034  17.078 6.238   1.00 12.74 ? 798 LEU A C   1 
ATOM   741  O O   . LEU A 1 122 ? 21.688  17.443 5.105   1.00 14.01 ? 798 LEU A O   1 
ATOM   742  C CB  . LEU A 1 122 ? 20.566  18.305 7.761   1.00 12.41 ? 798 LEU A CB  1 
ATOM   743  C CG  . LEU A 1 122 ? 20.371  19.524 8.653   1.00 12.88 ? 798 LEU A CG  1 
ATOM   744  C CD1 . LEU A 1 122 ? 18.909  19.741 8.928   1.00 15.43 ? 798 LEU A CD1 1 
ATOM   745  C CD2 . LEU A 1 122 ? 21.110  19.217 9.951   1.00 13.97 ? 798 LEU A CD2 1 
ATOM   746  N N   . THR A 1 123 ? 22.461  15.860 6.527   1.00 11.61 ? 799 THR A N   1 
ATOM   747  C CA  . THR A 1 123 ? 22.338  14.769 5.557   1.00 11.94 ? 799 THR A CA  1 
ATOM   748  C C   . THR A 1 123 ? 21.804  13.534 6.258   1.00 10.95 ? 799 THR A C   1 
ATOM   749  O O   . THR A 1 123 ? 22.157  13.248 7.408   1.00 11.26 ? 799 THR A O   1 
ATOM   750  C CB  . THR A 1 123 ? 23.669  14.426 4.854   1.00 12.52 ? 799 THR A CB  1 
ATOM   751  O OG1 . THR A 1 123 ? 24.668  14.107 5.822   1.00 14.46 ? 799 THR A OG1 1 
ATOM   752  C CG2 . THR A 1 123 ? 24.260  15.638 4.163   1.00 13.72 ? 799 THR A CG2 1 
ATOM   753  N N   . TYR A 1 124 ? 20.987  12.768 5.547   1.00 10.60 ? 800 TYR A N   1 
ATOM   754  C CA  . TYR A 1 124 ? 20.411  11.569 6.115   1.00 10.64 ? 800 TYR A CA  1 
ATOM   755  C C   . TYR A 1 124 ? 19.671  10.858 5.000   1.00 11.71 ? 800 TYR A C   1 
ATOM   756  O O   . TYR A 1 124 ? 19.413  11.462 3.964   1.00 12.19 ? 800 TYR A O   1 
ATOM   757  C CB  . TYR A 1 124 ? 19.430  11.895 7.277   1.00 10.66 ? 800 TYR A CB  1 
ATOM   758  C CG  . TYR A 1 124 ? 18.284  12.848 6.953   1.00 10.51 ? 800 TYR A CG  1 
ATOM   759  C CD1 . TYR A 1 124 ? 17.001  12.368 6.664   1.00 8.93  ? 800 TYR A CD1 1 
ATOM   760  C CD2 . TYR A 1 124 ? 18.481  14.213 6.950   1.00 11.88 ? 800 TYR A CD2 1 
ATOM   761  C CE1 . TYR A 1 124 ? 15.927  13.273 6.368   1.00 11.10 ? 800 TYR A CE1 1 
ATOM   762  C CE2 . TYR A 1 124 ? 17.419  15.112 6.659   1.00 12.25 ? 800 TYR A CE2 1 
ATOM   763  C CZ  . TYR A 1 124 ? 16.170  14.625 6.376   1.00 11.81 ? 800 TYR A CZ  1 
ATOM   764  O OH  . TYR A 1 124 ? 15.170  15.517 6.096   1.00 15.04 ? 800 TYR A OH  1 
ATOM   765  N N   . ASN A 1 125 ? 19.325  9.603  5.230   1.00 12.28 ? 801 ASN A N   1 
ATOM   766  C CA  . ASN A 1 125 ? 18.503  8.845  4.296   1.00 13.62 ? 801 ASN A CA  1 
ATOM   767  C C   . ASN A 1 125 ? 17.075  8.739  4.810   1.00 14.09 ? 801 ASN A C   1 
ATOM   768  O O   . ASN A 1 125 ? 16.861  8.437  5.974   1.00 13.60 ? 801 ASN A O   1 
ATOM   769  C CB  . ASN A 1 125 ? 19.072  7.448  4.103   1.00 14.73 ? 801 ASN A CB  1 
ATOM   770  C CG  . ASN A 1 125 ? 20.378  7.465  3.346   1.00 19.28 ? 801 ASN A CG  1 
ATOM   771  O OD1 . ASN A 1 125 ? 20.437  7.919  2.202   1.00 23.09 ? 801 ASN A OD1 1 
ATOM   772  N ND2 . ASN A 1 125 ? 21.424  6.939  3.965   1.00 21.03 ? 801 ASN A ND2 1 
ATOM   773  N N   . HIS A 1 126 ? 16.102  8.940  3.924   1.00 13.75 ? 802 HIS A N   1 
ATOM   774  C CA  . HIS A 1 126 ? 14.709  8.916  4.348   1.00 14.74 ? 802 HIS A CA  1 
ATOM   775  C C   . HIS A 1 126 ? 13.843  8.642  3.122   1.00 14.98 ? 802 HIS A C   1 
ATOM   776  O O   . HIS A 1 126 ? 14.046  9.249  2.065   1.00 14.92 ? 802 HIS A O   1 
ATOM   777  C CB  . HIS A 1 126 ? 14.361  10.274 4.942   1.00 14.45 ? 802 HIS A CB  1 
ATOM   778  C CG  . HIS A 1 126 ? 13.017  10.333 5.590   1.00 14.68 ? 802 HIS A CG  1 
ATOM   779  N ND1 . HIS A 1 126 ? 12.114  11.335 5.312   1.00 16.11 ? 802 HIS A ND1 1 
ATOM   780  C CD2 . HIS A 1 126 ? 12.424  9.527  6.498   1.00 14.31 ? 802 HIS A CD2 1 
ATOM   781  C CE1 . HIS A 1 126 ? 11.020  11.148 6.031   1.00 17.69 ? 802 HIS A CE1 1 
ATOM   782  N NE2 . HIS A 1 126 ? 11.178  10.053 6.751   1.00 13.11 ? 802 HIS A NE2 1 
ATOM   783  N N   . LYS A 1 127 ? 12.906  7.716  3.279   1.00 16.93 ? 803 LYS A N   1 
ATOM   784  C CA  . LYS A 1 127 ? 11.927  7.397  2.232   1.00 18.69 ? 803 LYS A CA  1 
ATOM   785  C C   . LYS A 1 127 ? 12.593  6.950  0.939   1.00 19.00 ? 803 LYS A C   1 
ATOM   786  O O   . LYS A 1 127 ? 12.088  7.175  -0.157  1.00 19.66 ? 803 LYS A O   1 
ATOM   787  C CB  . LYS A 1 127 ? 11.018  8.601  1.981   1.00 19.87 ? 803 LYS A CB  1 
ATOM   788  C CG  . LYS A 1 127 ? 10.327  9.072  3.243   1.00 23.36 ? 803 LYS A CG  1 
ATOM   789  C CD  . LYS A 1 127 ? 9.037   9.841  2.962   1.00 29.30 ? 803 LYS A CD  1 
ATOM   790  C CE  . LYS A 1 127 ? 9.305   11.180 2.316   1.00 30.04 ? 803 LYS A CE  1 
ATOM   791  N NZ  . LYS A 1 127 ? 8.060   11.990 2.223   1.00 33.42 ? 803 LYS A NZ  1 
ATOM   792  N N   . GLY A 1 128 ? 13.747  6.320  1.072   1.00 18.69 ? 804 GLY A N   1 
ATOM   793  C CA  . GLY A 1 128 ? 14.465  5.864  -0.093  1.00 18.14 ? 804 GLY A CA  1 
ATOM   794  C C   . GLY A 1 128 ? 15.292  6.912  -0.794  1.00 18.18 ? 804 GLY A C   1 
ATOM   795  O O   . GLY A 1 128 ? 15.836  6.608  -1.851  1.00 18.79 ? 804 GLY A O   1 
ATOM   796  N N   . SER A 1 129 ? 15.400  8.125  -0.231  1.00 16.78 ? 805 SER A N   1 
ATOM   797  C CA  . SER A 1 129 ? 16.228  9.176  -0.814  1.00 16.92 ? 805 SER A CA  1 
ATOM   798  C C   . SER A 1 129 ? 17.403  9.593  0.069   1.00 16.60 ? 805 SER A C   1 
ATOM   799  O O   . SER A 1 129 ? 17.359  9.397  1.285   1.00 16.56 ? 805 SER A O   1 
ATOM   800  C CB  . SER A 1 129 ? 15.411  10.441 -1.077  1.00 17.35 ? 805 SER A CB  1 
ATOM   801  O OG  . SER A 1 129 ? 14.466  10.225 -2.118  1.00 20.82 ? 805 SER A OG  1 
ATOM   802  N N   . ALA A 1 130 ? 18.442  10.107 -0.561  1.00 15.82 ? 806 ALA A N   1 
ATOM   803  C CA  . ALA A 1 130 ? 19.524  10.742 0.171   1.00 15.37 ? 806 ALA A CA  1 
ATOM   804  C C   . ALA A 1 130 ? 19.094  12.196 0.348   1.00 15.03 ? 806 ALA A C   1 
ATOM   805  O O   . ALA A 1 130 ? 19.090  12.996 -0.604  1.00 15.20 ? 806 ALA A O   1 
ATOM   806  C CB  . ALA A 1 130 ? 20.830  10.656 -0.593  1.00 15.52 ? 806 ALA A CB  1 
ATOM   807  N N   . MET A 1 131 ? 18.714  12.550 1.564   1.00 13.78 ? 807 MET A N   1 
ATOM   808  C CA  . MET A 1 131 ? 18.331  13.928 1.828   1.00 13.54 ? 807 MET A CA  1 
ATOM   809  C C   . MET A 1 131 ? 19.531  14.831 2.214   1.00 13.36 ? 807 MET A C   1 
ATOM   810  O O   . MET A 1 131 ? 20.481  14.392 2.866   1.00 12.77 ? 807 MET A O   1 
ATOM   811  C CB  . MET A 1 131 ? 17.291  13.972 2.964   1.00 12.97 ? 807 MET A CB  1 
ATOM   812  C CG  . MET A 1 131 ? 16.091  13.104 2.760   1.00 14.55 ? 807 MET A CG  1 
ATOM   813  S SD  . MET A 1 131 ? 15.041  13.807 1.480   1.00 18.77 ? 807 MET A SD  1 
ATOM   814  C CE  . MET A 1 131 ? 14.707  15.427 2.171   1.00 20.93 ? 807 MET A CE  1 
ATOM   815  N N   . GLN A 1 132 ? 19.485  16.100 1.815   1.00 13.86 ? 808 GLN A N   1 
ATOM   816  C CA  . GLN A 1 132 ? 20.487  17.066 2.235   1.00 15.26 ? 808 GLN A CA  1 
ATOM   817  C C   . GLN A 1 132 ? 19.834  18.420 2.348   1.00 14.99 ? 808 GLN A C   1 
ATOM   818  O O   . GLN A 1 132 ? 18.964  18.763 1.546   1.00 15.11 ? 808 GLN A O   1 
ATOM   819  C CB  . GLN A 1 132 ? 21.637  17.184 1.227   1.00 16.30 ? 808 GLN A CB  1 
ATOM   820  C CG  . GLN A 1 132 ? 22.515  18.415 1.487   1.00 23.71 ? 808 GLN A CG  1 
ATOM   821  C CD  . GLN A 1 132 ? 23.354  18.850 0.288   1.00 31.12 ? 808 GLN A CD  1 
ATOM   822  O OE1 . GLN A 1 132 ? 23.311  20.010 -0.128  1.00 33.87 ? 808 GLN A OE1 1 
ATOM   823  N NE2 . GLN A 1 132 ? 24.131  17.928 -0.251  1.00 34.64 ? 808 GLN A NE2 1 
ATOM   824  N N   . ASP A 1 133 ? 20.241  19.198 3.344   1.00 14.36 ? 809 ASP A N   1 
ATOM   825  C CA  . ASP A 1 133 ? 19.781  20.578 3.406   1.00 14.54 ? 809 ASP A CA  1 
ATOM   826  C C   . ASP A 1 133 ? 20.878  21.431 3.996   1.00 14.13 ? 809 ASP A C   1 
ATOM   827  O O   . ASP A 1 133 ? 21.670  20.952 4.792   1.00 14.23 ? 809 ASP A O   1 
ATOM   828  C CB  . ASP A 1 133 ? 18.494  20.697 4.221   1.00 14.32 ? 809 ASP A CB  1 
ATOM   829  C CG  . ASP A 1 133 ? 17.646  21.901 3.810   1.00 18.41 ? 809 ASP A CG  1 
ATOM   830  O OD1 . ASP A 1 133 ? 18.081  22.711 2.935   1.00 16.52 ? 809 ASP A OD1 1 
ATOM   831  O OD2 . ASP A 1 133 ? 16.516  22.118 4.306   1.00 19.89 ? 809 ASP A OD2 1 
ATOM   832  N N   . LEU A 1 134 ? 20.937  22.682 3.575   1.00 14.25 ? 810 LEU A N   1 
ATOM   833  C CA  . LEU A 1 134 ? 21.906  23.629 4.086   1.00 14.74 ? 810 LEU A CA  1 
ATOM   834  C C   . LEU A 1 134 ? 21.071  24.827 4.506   1.00 15.66 ? 810 LEU A C   1 
ATOM   835  O O   . LEU A 1 134 ? 20.274  25.342 3.711   1.00 16.86 ? 810 LEU A O   1 
ATOM   836  C CB  . LEU A 1 134 ? 22.944  23.991 3.000   1.00 15.93 ? 810 LEU A CB  1 
ATOM   837  C CG  . LEU A 1 134 ? 23.939  25.097 3.359   1.00 19.11 ? 810 LEU A CG  1 
ATOM   838  C CD1 . LEU A 1 134 ? 24.906  24.660 4.468   1.00 23.05 ? 810 LEU A CD1 1 
ATOM   839  C CD2 . LEU A 1 134 ? 24.725  25.606 2.145   1.00 24.21 ? 810 LEU A CD2 1 
ATOM   840  N N   . ALA A 1 135 ? 21.216  25.278 5.748   1.00 14.59 ? 811 ALA A N   1 
ATOM   841  C CA  . ALA A 1 135 ? 20.359  26.356 6.203   1.00 14.79 ? 811 ALA A CA  1 
ATOM   842  C C   . ALA A 1 135 ? 21.058  27.223 7.216   1.00 15.71 ? 811 ALA A C   1 
ATOM   843  O O   . ALA A 1 135 ? 21.893  26.750 7.978   1.00 15.89 ? 811 ALA A O   1 
ATOM   844  C CB  . ALA A 1 135 ? 19.099  25.787 6.835   1.00 14.63 ? 811 ALA A CB  1 
ATOM   845  N N   . GLU A 1 136 ? 20.724  28.506 7.191   1.00 16.02 ? 812 GLU A N   1 
ATOM   846  C CA  . GLU A 1 136 ? 21.226  29.430 8.200   1.00 17.10 ? 812 GLU A CA  1 
ATOM   847  C C   . GLU A 1 136 ? 20.304  29.334 9.424   1.00 16.65 ? 812 GLU A C   1 
ATOM   848  O O   . GLU A 1 136 ? 19.096  29.144 9.286   1.00 16.95 ? 812 GLU A O   1 
ATOM   849  C CB  . GLU A 1 136 ? 21.209  30.846 7.634   1.00 18.17 ? 812 GLU A CB  1 
ATOM   850  C CG  . GLU A 1 136 ? 21.671  31.920 8.605   1.00 24.38 ? 812 GLU A CG  1 
ATOM   851  C CD  . GLU A 1 136 ? 23.075  32.403 8.292   1.00 31.00 ? 812 GLU A CD  1 
ATOM   852  O OE1 . GLU A 1 136 ? 23.521  32.205 7.143   1.00 36.40 ? 812 GLU A OE1 1 
ATOM   853  O OE2 . GLU A 1 136 ? 23.730  32.982 9.188   1.00 34.78 ? 812 GLU A OE2 1 
ATOM   854  N N   . VAL A 1 137 ? 20.865  29.418 10.625  1.00 15.56 ? 813 VAL A N   1 
ATOM   855  C CA  . VAL A 1 137 ? 20.017  29.468 11.815  1.00 16.00 ? 813 VAL A CA  1 
ATOM   856  C C   . VAL A 1 137 ? 19.743  30.955 12.003  1.00 16.82 ? 813 VAL A C   1 
ATOM   857  O O   . VAL A 1 137 ? 20.664  31.709 12.240  1.00 16.64 ? 813 VAL A O   1 
ATOM   858  C CB  . VAL A 1 137 ? 20.720  28.887 13.049  1.00 15.96 ? 813 VAL A CB  1 
ATOM   859  C CG1 . VAL A 1 137 ? 19.836  29.061 14.306  1.00 16.75 ? 813 VAL A CG1 1 
ATOM   860  C CG2 . VAL A 1 137 ? 21.090  27.393 12.808  1.00 15.42 ? 813 VAL A CG2 1 
ATOM   861  N N   . ASN A 1 138 ? 18.477  31.358 11.888  1.00 16.89 ? 814 ASN A N   1 
ATOM   862  C CA  . ASN A 1 138 ? 18.104  32.770 11.845  1.00 17.69 ? 814 ASN A CA  1 
ATOM   863  C C   . ASN A 1 138 ? 17.630  33.348 13.153  1.00 16.66 ? 814 ASN A C   1 
ATOM   864  O O   . ASN A 1 138 ? 17.372  34.556 13.238  1.00 16.09 ? 814 ASN A O   1 
ATOM   865  C CB  . ASN A 1 138 ? 16.919  32.940 10.880  1.00 18.56 ? 814 ASN A CB  1 
ATOM   866  C CG  . ASN A 1 138 ? 17.253  32.558 9.468   1.00 21.87 ? 814 ASN A CG  1 
ATOM   867  O OD1 . ASN A 1 138 ? 18.292  32.947 8.949   1.00 23.11 ? 814 ASN A OD1 1 
ATOM   868  N ND2 . ASN A 1 138 ? 16.353  31.813 8.823   1.00 23.87 ? 814 ASN A ND2 1 
ATOM   869  N N   . ASN A 1 139 ? 17.539  32.502 14.162  1.00 16.12 ? 815 ASN A N   1 
ATOM   870  C CA  . ASN A 1 139 ? 16.822  32.871 15.383  1.00 16.13 ? 815 ASN A CA  1 
ATOM   871  C C   . ASN A 1 139 ? 17.526  32.560 16.686  1.00 16.05 ? 815 ASN A C   1 
ATOM   872  O O   . ASN A 1 139 ? 16.955  31.971 17.601  1.00 17.49 ? 815 ASN A O   1 
ATOM   873  C CB  . ASN A 1 139 ? 15.441  32.198 15.359  1.00 15.55 ? 815 ASN A CB  1 
ATOM   874  C CG  . ASN A 1 139 ? 15.520  30.662 15.293  1.00 16.39 ? 815 ASN A CG  1 
ATOM   875  O OD1 . ASN A 1 139 ? 16.518  30.087 14.826  1.00 14.38 ? 815 ASN A OD1 1 
ATOM   876  N ND2 . ASN A 1 139 ? 14.470  30.002 15.761  1.00 12.56 ? 815 ASN A ND2 1 
ATOM   877  N N   . PHE A 1 140 ? 18.788  32.947 16.755  1.00 16.50 ? 816 PHE A N   1 
ATOM   878  C CA  . PHE A 1 140 ? 19.549  32.812 17.980  1.00 16.56 ? 816 PHE A CA  1 
ATOM   879  C C   . PHE A 1 140 ? 19.058  33.944 18.856  1.00 17.10 ? 816 PHE A C   1 
ATOM   880  O O   . PHE A 1 140 ? 18.914  35.055 18.381  1.00 17.94 ? 816 PHE A O   1 
ATOM   881  C CB  . PHE A 1 140 ? 21.026  33.012 17.719  1.00 16.65 ? 816 PHE A CB  1 
ATOM   882  C CG  . PHE A 1 140 ? 21.701  31.818 17.151  1.00 15.14 ? 816 PHE A CG  1 
ATOM   883  C CD1 . PHE A 1 140 ? 22.253  31.866 15.882  1.00 14.72 ? 816 PHE A CD1 1 
ATOM   884  C CD2 . PHE A 1 140 ? 21.814  30.648 17.892  1.00 12.51 ? 816 PHE A CD2 1 
ATOM   885  C CE1 . PHE A 1 140 ? 22.894  30.740 15.350  1.00 12.72 ? 816 PHE A CE1 1 
ATOM   886  C CE2 . PHE A 1 140 ? 22.479  29.544 17.371  1.00 13.74 ? 816 PHE A CE2 1 
ATOM   887  C CZ  . PHE A 1 140 ? 23.003  29.594 16.097  1.00 13.33 ? 816 PHE A CZ  1 
ATOM   888  N N   . PRO A 1 141 ? 18.842  33.668 20.126  1.00 17.50 ? 817 PRO A N   1 
ATOM   889  C CA  . PRO A 1 141 ? 18.424  34.714 21.072  1.00 17.94 ? 817 PRO A CA  1 
ATOM   890  C C   . PRO A 1 141 ? 19.652  35.502 21.544  1.00 19.03 ? 817 PRO A C   1 
ATOM   891  O O   . PRO A 1 141 ? 20.754  34.954 21.594  1.00 18.40 ? 817 PRO A O   1 
ATOM   892  C CB  . PRO A 1 141 ? 17.824  33.915 22.211  1.00 17.24 ? 817 PRO A CB  1 
ATOM   893  C CG  . PRO A 1 141 ? 18.585  32.615 22.204  1.00 18.46 ? 817 PRO A CG  1 
ATOM   894  C CD  . PRO A 1 141 ? 18.988  32.357 20.773  1.00 16.95 ? 817 PRO A CD  1 
ATOM   895  N N   . PRO A 1 142 ? 19.477  36.781 21.856  1.00 20.71 ? 818 PRO A N   1 
ATOM   896  C CA  . PRO A 1 142 ? 20.590  37.617 22.307  1.00 21.47 ? 818 PRO A CA  1 
ATOM   897  C C   . PRO A 1 142 ? 21.371  36.983 23.451  1.00 21.90 ? 818 PRO A C   1 
ATOM   898  O O   . PRO A 1 142 ? 22.598  37.122 23.483  1.00 22.06 ? 818 PRO A O   1 
ATOM   899  C CB  . PRO A 1 142 ? 19.889  38.906 22.778  1.00 22.10 ? 818 PRO A CB  1 
ATOM   900  C CG  . PRO A 1 142 ? 18.639  38.973 21.960  1.00 21.16 ? 818 PRO A CG  1 
ATOM   901  C CD  . PRO A 1 142 ? 18.209  37.529 21.790  1.00 20.79 ? 818 PRO A CD  1 
ATOM   902  N N   . GLN A 1 143 ? 20.695  36.279 24.356  1.00 22.47 ? 819 GLN A N   1 
ATOM   903  C CA  . GLN A 1 143 ? 21.375  35.702 25.513  1.00 23.96 ? 819 GLN A CA  1 
ATOM   904  C C   . GLN A 1 143 ? 22.380  34.611 25.138  1.00 23.73 ? 819 GLN A C   1 
ATOM   905  O O   . GLN A 1 143 ? 23.231  34.231 25.949  1.00 23.23 ? 819 GLN A O   1 
ATOM   906  C CB  . GLN A 1 143 ? 20.363  35.178 26.540  1.00 24.60 ? 819 GLN A CB  1 
ATOM   907  C CG  . GLN A 1 143 ? 19.633  36.289 27.301  1.00 28.20 ? 819 GLN A CG  1 
ATOM   908  C CD  . GLN A 1 143 ? 18.152  35.996 27.528  1.00 33.40 ? 819 GLN A CD  1 
ATOM   909  O OE1 . GLN A 1 143 ? 17.289  36.706 27.004  1.00 36.34 ? 819 GLN A OE1 1 
ATOM   910  N NE2 . GLN A 1 143 ? 17.857  34.965 28.314  1.00 34.68 ? 819 GLN A NE2 1 
ATOM   911  N N   . SER A 1 144 ? 22.278  34.095 23.909  1.00 23.33 ? 820 SER A N   1 
ATOM   912  C CA  . SER A 1 144 ? 23.207  33.050 23.478  1.00 22.81 ? 820 SER A CA  1 
ATOM   913  C C   . SER A 1 144 ? 24.601  33.564 23.113  1.00 24.23 ? 820 SER A C   1 
ATOM   914  O O   . SER A 1 144 ? 25.513  32.767 22.866  1.00 24.22 ? 820 SER A O   1 
ATOM   915  C CB  . SER A 1 144 ? 22.615  32.259 22.294  1.00 22.12 ? 820 SER A CB  1 
ATOM   916  O OG  . SER A 1 144 ? 22.446  33.091 21.163  1.00 18.10 ? 820 SER A OG  1 
ATOM   917  N N   . TRP A 1 145 ? 24.771  34.882 23.060  1.00 25.03 ? 821 TRP A N   1 
ATOM   918  C CA  . TRP A 1 145 ? 26.066  35.447 22.704  1.00 26.59 ? 821 TRP A CA  1 
ATOM   919  C C   . TRP A 1 145 ? 26.450  36.718 23.457  1.00 27.88 ? 821 TRP A C   1 
ATOM   920  O O   . TRP A 1 145 ? 27.632  36.998 23.607  1.00 28.39 ? 821 TRP A O   1 
ATOM   921  C CB  . TRP A 1 145 ? 26.160  35.706 21.204  1.00 26.37 ? 821 TRP A CB  1 
ATOM   922  C CG  . TRP A 1 145 ? 25.105  36.615 20.653  1.00 25.69 ? 821 TRP A CG  1 
ATOM   923  C CD1 . TRP A 1 145 ? 23.862  36.254 20.197  1.00 24.49 ? 821 TRP A CD1 1 
ATOM   924  C CD2 . TRP A 1 145 ? 25.200  38.035 20.473  1.00 26.69 ? 821 TRP A CD2 1 
ATOM   925  N NE1 . TRP A 1 145 ? 23.186  37.363 19.751  1.00 24.29 ? 821 TRP A NE1 1 
ATOM   926  C CE2 . TRP A 1 145 ? 23.982  38.470 19.915  1.00 25.87 ? 821 TRP A CE2 1 
ATOM   927  C CE3 . TRP A 1 145 ? 26.194  38.989 20.742  1.00 28.19 ? 821 TRP A CE3 1 
ATOM   928  C CZ2 . TRP A 1 145 ? 23.730  39.808 19.607  1.00 27.68 ? 821 TRP A CZ2 1 
ATOM   929  C CZ3 . TRP A 1 145 ? 25.942  40.330 20.431  1.00 28.43 ? 821 TRP A CZ3 1 
ATOM   930  C CH2 . TRP A 1 145 ? 24.718  40.723 19.878  1.00 27.99 ? 821 TRP A CH2 1 
ATOM   931  N N   . GLN A 1 146 ? 25.458  37.482 23.908  1.00 29.48 ? 822 GLN A N   1 
ATOM   932  C CA  . GLN A 1 146 ? 25.718  38.735 24.618  1.00 31.30 ? 822 GLN A CA  1 
ATOM   933  C C   . GLN A 1 146 ? 26.302  38.512 26.008  1.00 32.00 ? 822 GLN A C   1 
ATOM   934  O O   . GLN A 1 146 ? 26.171  37.441 26.607  1.00 32.24 ? 822 GLN A O   1 
ATOM   935  C CB  . GLN A 1 146 ? 24.443  39.579 24.722  1.00 31.34 ? 822 GLN A CB  1 
ATOM   936  C CG  . GLN A 1 146 ? 24.113  40.367 23.461  1.00 32.69 ? 822 GLN A CG  1 
ATOM   937  C CD  . GLN A 1 146 ? 22.850  41.208 23.597  1.00 34.17 ? 822 GLN A CD  1 
ATOM   938  O OE1 . GLN A 1 146 ? 22.082  41.040 24.544  1.00 35.39 ? 822 GLN A OE1 1 
ATOM   939  N NE2 . GLN A 1 146 ? 22.634  42.114 22.648  1.00 36.12 ? 822 GLN A NE2 1 
ATOM   940  O OXT . GLN A 1 146 ? 26.913  39.426 26.582  1.00 33.34 ? 822 GLN A OXT 1 
ATOM   941  N N   . ILE B 1 24  ? 1.233   18.325 24.778  1.00 37.17 ? 700 ILE B N   1 
ATOM   942  C CA  . ILE B 1 24  ? 1.157   18.605 23.309  1.00 36.70 ? 700 ILE B CA  1 
ATOM   943  C C   . ILE B 1 24  ? 0.226   19.778 23.031  1.00 35.73 ? 700 ILE B C   1 
ATOM   944  O O   . ILE B 1 24  ? -0.996  19.649 23.099  1.00 36.36 ? 700 ILE B O   1 
ATOM   945  C CB  . ILE B 1 24  ? 0.691   17.362 22.528  1.00 36.81 ? 700 ILE B CB  1 
ATOM   946  C CG1 . ILE B 1 24  ? 1.685   16.214 22.686  1.00 38.21 ? 700 ILE B CG1 1 
ATOM   947  C CG2 . ILE B 1 24  ? 0.532   17.687 21.051  1.00 37.22 ? 700 ILE B CG2 1 
ATOM   948  C CD1 . ILE B 1 24  ? 1.361   15.273 23.828  1.00 39.84 ? 700 ILE B CD1 1 
ATOM   949  N N   . ALA B 1 25  ? 0.818   20.916 22.696  1.00 34.56 ? 701 ALA B N   1 
ATOM   950  C CA  . ALA B 1 25  ? 0.074   22.139 22.446  1.00 33.01 ? 701 ALA B CA  1 
ATOM   951  C C   . ALA B 1 25  ? -0.937  22.024 21.307  1.00 31.33 ? 701 ALA B C   1 
ATOM   952  O O   . ALA B 1 25  ? -0.703  21.354 20.293  1.00 30.76 ? 701 ALA B O   1 
ATOM   953  C CB  . ALA B 1 25  ? 1.041   23.301 22.186  1.00 33.52 ? 701 ALA B CB  1 
ATOM   954  N N   . ALA B 1 26  ? -2.073  22.677 21.494  1.00 29.61 ? 702 ALA B N   1 
ATOM   955  C CA  . ALA B 1 26  ? -3.128  22.661 20.493  1.00 28.01 ? 702 ALA B CA  1 
ATOM   956  C C   . ALA B 1 26  ? -2.835  23.667 19.397  1.00 26.49 ? 702 ALA B C   1 
ATOM   957  O O   . ALA B 1 26  ? -2.078  24.610 19.601  1.00 25.80 ? 702 ALA B O   1 
ATOM   958  C CB  . ALA B 1 26  ? -4.459  22.987 21.139  1.00 27.82 ? 702 ALA B CB  1 
ATOM   959  N N   . GLY B 1 27  ? -3.465  23.467 18.246  1.00 25.49 ? 703 GLY B N   1 
ATOM   960  C CA  . GLY B 1 27  ? -3.363  24.381 17.124  1.00 24.80 ? 703 GLY B CA  1 
ATOM   961  C C   . GLY B 1 27  ? -1.994  24.348 16.463  1.00 24.18 ? 703 GLY B C   1 
ATOM   962  O O   . GLY B 1 27  ? -1.467  23.276 16.184  1.00 24.82 ? 703 GLY B O   1 
ATOM   963  N N   . ILE B 1 28  ? -1.455  25.531 16.189  1.00 22.75 ? 704 ILE B N   1 
ATOM   964  C CA  . ILE B 1 28  ? -0.135  25.675 15.560  1.00 21.49 ? 704 ILE B CA  1 
ATOM   965  C C   . ILE B 1 28  ? 0.829   26.421 16.500  1.00 21.27 ? 704 ILE B C   1 
ATOM   966  O O   . ILE B 1 28  ? 0.520   27.534 16.925  1.00 21.29 ? 704 ILE B O   1 
ATOM   967  C CB  . ILE B 1 28  ? -0.282  26.462 14.242  1.00 21.11 ? 704 ILE B CB  1 
ATOM   968  C CG1 . ILE B 1 28  ? -1.377  25.839 13.359  1.00 20.46 ? 704 ILE B CG1 1 
ATOM   969  C CG2 . ILE B 1 28  ? 1.070   26.505 13.506  1.00 19.51 ? 704 ILE B CG2 1 
ATOM   970  C CD1 . ILE B 1 28  ? -1.854  26.726 12.202  1.00 20.52 ? 704 ILE B CD1 1 
ATOM   971  N N   . PRO B 1 29  ? 1.972   25.825 16.843  1.00 21.24 ? 705 PRO B N   1 
ATOM   972  C CA  . PRO B 1 29  ? 2.918   26.496 17.743  1.00 20.96 ? 705 PRO B CA  1 
ATOM   973  C C   . PRO B 1 29  ? 3.522   27.735 17.095  1.00 20.70 ? 705 PRO B C   1 
ATOM   974  O O   . PRO B 1 29  ? 3.777   27.751 15.886  1.00 20.22 ? 705 PRO B O   1 
ATOM   975  C CB  . PRO B 1 29  ? 4.020   25.453 17.970  1.00 21.65 ? 705 PRO B CB  1 
ATOM   976  C CG  . PRO B 1 29  ? 3.538   24.176 17.415  1.00 22.35 ? 705 PRO B CG  1 
ATOM   977  C CD  . PRO B 1 29  ? 2.441   24.495 16.420  1.00 20.95 ? 705 PRO B CD  1 
ATOM   978  N N   . SER B 1 30  ? 3.775   28.763 17.895  1.00 19.67 ? 706 SER B N   1 
ATOM   979  C CA  . SER B 1 30  ? 4.423   29.956 17.371  1.00 19.58 ? 706 SER B CA  1 
ATOM   980  C C   . SER B 1 30  ? 5.915   29.707 17.265  1.00 18.24 ? 706 SER B C   1 
ATOM   981  O O   . SER B 1 30  ? 6.442   28.821 17.934  1.00 17.99 ? 706 SER B O   1 
ATOM   982  C CB  . SER B 1 30  ? 4.188   31.150 18.285  1.00 19.69 ? 706 SER B CB  1 
ATOM   983  O OG  . SER B 1 30  ? 2.801   31.455 18.318  1.00 23.17 ? 706 SER B OG  1 
ATOM   984  N N   . ILE B 1 31  ? 6.578   30.487 16.419  1.00 17.64 ? 707 ILE B N   1 
ATOM   985  C CA  . ILE B 1 31  ? 8.026   30.383 16.252  1.00 17.15 ? 707 ILE B CA  1 
ATOM   986  C C   . ILE B 1 31  ? 8.702   31.745 16.255  1.00 17.34 ? 707 ILE B C   1 
ATOM   987  O O   . ILE B 1 31  ? 8.074   32.773 16.048  1.00 17.60 ? 707 ILE B O   1 
ATOM   988  C CB  . ILE B 1 31  ? 8.395   29.682 14.918  1.00 16.83 ? 707 ILE B CB  1 
ATOM   989  C CG1 . ILE B 1 31  ? 7.974   30.549 13.729  1.00 15.79 ? 707 ILE B CG1 1 
ATOM   990  C CG2 . ILE B 1 31  ? 7.772   28.310 14.833  1.00 17.73 ? 707 ILE B CG2 1 
ATOM   991  C CD1 . ILE B 1 31  ? 8.464   29.999 12.382  1.00 15.03 ? 707 ILE B CD1 1 
ATOM   992  N N   . THR B 1 32  ? 10.011  31.750 16.489  1.00 16.94 ? 708 THR B N   1 
ATOM   993  C CA  . THR B 1 32  ? 10.778  32.970 16.334  1.00 16.54 ? 708 THR B CA  1 
ATOM   994  C C   . THR B 1 32  ? 11.384  32.769 14.967  1.00 16.47 ? 708 THR B C   1 
ATOM   995  O O   . THR B 1 32  ? 12.219  31.870 14.772  1.00 15.28 ? 708 THR B O   1 
ATOM   996  C CB  . THR B 1 32  ? 11.862  33.082 17.425  1.00 17.07 ? 708 THR B CB  1 
ATOM   997  O OG1 . THR B 1 32  ? 11.211  33.271 18.690  1.00 17.05 ? 708 THR B OG1 1 
ATOM   998  C CG2 . THR B 1 32  ? 12.668  34.359 17.251  1.00 17.28 ? 708 THR B CG2 1 
ATOM   999  N N   . ALA B 1 33  ? 10.928  33.547 13.998  1.00 16.01 ? 709 ALA B N   1 
ATOM   1000 C CA  . ALA B 1 33  ? 11.409  33.364 12.629  1.00 17.08 ? 709 ALA B CA  1 
ATOM   1001 C C   . ALA B 1 33  ? 12.744  34.055 12.414  1.00 17.34 ? 709 ALA B C   1 
ATOM   1002 O O   . ALA B 1 33  ? 13.535  33.664 11.549  1.00 17.56 ? 709 ALA B O   1 
ATOM   1003 C CB  . ALA B 1 33  ? 10.383  33.875 11.630  1.00 16.54 ? 709 ALA B CB  1 
ATOM   1004 N N   . TYR B 1 34  ? 13.008  35.094 13.196  1.00 17.16 ? 710 TYR B N   1 
ATOM   1005 C CA  . TYR B 1 34  ? 14.228  35.864 12.992  1.00 17.76 ? 710 TYR B CA  1 
ATOM   1006 C C   . TYR B 1 34  ? 14.590  36.539 14.297  1.00 18.70 ? 710 TYR B C   1 
ATOM   1007 O O   . TYR B 1 34  ? 13.709  37.012 14.999  1.00 17.91 ? 710 TYR B O   1 
ATOM   1008 C CB  . TYR B 1 34  ? 13.971  36.904 11.908  1.00 17.57 ? 710 TYR B CB  1 
ATOM   1009 C CG  . TYR B 1 34  ? 15.128  37.817 11.555  1.00 19.22 ? 710 TYR B CG  1 
ATOM   1010 C CD1 . TYR B 1 34  ? 15.996  37.507 10.509  1.00 18.83 ? 710 TYR B CD1 1 
ATOM   1011 C CD2 . TYR B 1 34  ? 15.332  39.007 12.238  1.00 19.55 ? 710 TYR B CD2 1 
ATOM   1012 C CE1 . TYR B 1 34  ? 17.028  38.352 10.174  1.00 20.29 ? 710 TYR B CE1 1 
ATOM   1013 C CE2 . TYR B 1 34  ? 16.365  39.855 11.910  1.00 21.47 ? 710 TYR B CE2 1 
ATOM   1014 C CZ  . TYR B 1 34  ? 17.206  39.533 10.874  1.00 21.01 ? 710 TYR B CZ  1 
ATOM   1015 O OH  . TYR B 1 34  ? 18.241  40.391 10.554  1.00 21.95 ? 710 TYR B OH  1 
ATOM   1016 N N   . SER B 1 35  ? 15.879  36.551 14.621  1.00 19.80 ? 711 SER B N   1 
ATOM   1017 C CA  . SER B 1 35  ? 16.363  37.159 15.854  1.00 21.31 ? 711 SER B CA  1 
ATOM   1018 C C   . SER B 1 35  ? 17.811  37.572 15.597  1.00 21.68 ? 711 SER B C   1 
ATOM   1019 O O   . SER B 1 35  ? 18.723  36.773 15.784  1.00 21.67 ? 711 SER B O   1 
ATOM   1020 C CB  . SER B 1 35  ? 16.270  36.157 17.004  1.00 21.26 ? 711 SER B CB  1 
ATOM   1021 O OG  . SER B 1 35  ? 16.570  36.761 18.248  1.00 25.94 ? 711 SER B OG  1 
ATOM   1022 N N   . LYS B 1 36  ? 18.007  38.797 15.117  1.00 22.52 ? 712 LYS B N   1 
ATOM   1023 C CA  . LYS B 1 36  ? 19.348  39.304 14.814  1.00 23.53 ? 712 LYS B CA  1 
ATOM   1024 C C   . LYS B 1 36  ? 19.451  40.810 14.948  1.00 24.04 ? 712 LYS B C   1 
ATOM   1025 O O   . LYS B 1 36  ? 18.553  41.546 14.526  1.00 23.38 ? 712 LYS B O   1 
ATOM   1026 C CB  . LYS B 1 36  ? 19.719  39.025 13.368  1.00 23.74 ? 712 LYS B CB  1 
ATOM   1027 C CG  . LYS B 1 36  ? 20.060  37.619 12.997  1.00 26.31 ? 712 LYS B CG  1 
ATOM   1028 C CD  . LYS B 1 36  ? 20.801  37.676 11.668  1.00 29.66 ? 712 LYS B CD  1 
ATOM   1029 C CE  . LYS B 1 36  ? 20.458  36.518 10.775  1.00 32.14 ? 712 LYS B CE  1 
ATOM   1030 N NZ  . LYS B 1 36  ? 21.012  36.776 9.406   1.00 32.75 ? 712 LYS B NZ  1 
ATOM   1031 N N   . ASN B 1 37  ? 20.587  41.267 15.463  1.00 24.85 ? 713 ASN B N   1 
ATOM   1032 C CA  . ASN B 1 37  ? 20.839  42.697 15.574  1.00 26.13 ? 713 ASN B CA  1 
ATOM   1033 C C   . ASN B 1 37  ? 19.786  43.387 16.457  1.00 26.21 ? 713 ASN B C   1 
ATOM   1034 O O   . ASN B 1 37  ? 19.492  44.566 16.276  1.00 27.26 ? 713 ASN B O   1 
ATOM   1035 C CB  . ASN B 1 37  ? 20.919  43.341 14.185  1.00 26.09 ? 713 ASN B CB  1 
ATOM   1036 C CG  . ASN B 1 37  ? 22.007  42.721 13.309  1.00 29.03 ? 713 ASN B CG  1 
ATOM   1037 O OD1 . ASN B 1 37  ? 23.091  42.379 13.799  1.00 31.40 ? 713 ASN B OD1 1 
ATOM   1038 N ND2 . ASN B 1 37  ? 21.729  42.588 12.003  1.00 29.83 ? 713 ASN B ND2 1 
ATOM   1039 N N   . GLY B 1 38  ? 19.260  42.644 17.428  1.00 26.01 ? 714 GLY B N   1 
ATOM   1040 C CA  . GLY B 1 38  ? 18.297  43.175 18.373  1.00 25.33 ? 714 GLY B CA  1 
ATOM   1041 C C   . GLY B 1 38  ? 16.872  43.139 17.866  1.00 25.19 ? 714 GLY B C   1 
ATOM   1042 O O   . GLY B 1 38  ? 15.942  43.342 18.644  1.00 26.20 ? 714 GLY B O   1 
ATOM   1043 N N   . LEU B 1 39  ? 16.711  42.896 16.565  1.00 23.77 ? 715 LEU B N   1 
ATOM   1044 C CA  . LEU B 1 39  ? 15.392  42.792 15.937  1.00 22.62 ? 715 LEU B CA  1 
ATOM   1045 C C   . LEU B 1 39  ? 14.884  41.366 16.075  1.00 22.27 ? 715 LEU B C   1 
ATOM   1046 O O   . LEU B 1 39  ? 15.597  40.417 15.742  1.00 20.50 ? 715 LEU B O   1 
ATOM   1047 C CB  . LEU B 1 39  ? 15.462  43.195 14.461  1.00 22.57 ? 715 LEU B CB  1 
ATOM   1048 C CG  . LEU B 1 39  ? 14.209  43.015 13.587  1.00 22.14 ? 715 LEU B CG  1 
ATOM   1049 C CD1 . LEU B 1 39  ? 13.010  43.786 14.153  1.00 21.47 ? 715 LEU B CD1 1 
ATOM   1050 C CD2 . LEU B 1 39  ? 14.489  43.413 12.149  1.00 21.74 ? 715 LEU B CD2 1 
ATOM   1051 N N   . LYS B 1 40  ? 13.663  41.222 16.583  1.00 21.52 ? 716 LYS B N   1 
ATOM   1052 C CA  . LYS B 1 40  ? 13.050  39.912 16.761  1.00 21.66 ? 716 LYS B CA  1 
ATOM   1053 C C   . LYS B 1 40  ? 11.732  39.846 16.017  1.00 21.57 ? 716 LYS B C   1 
ATOM   1054 O O   . LYS B 1 40  ? 10.896  40.741 16.130  1.00 21.28 ? 716 LYS B O   1 
ATOM   1055 C CB  . LYS B 1 40  ? 12.856  39.599 18.249  1.00 21.83 ? 716 LYS B CB  1 
ATOM   1056 C CG  . LYS B 1 40  ? 12.237  38.223 18.537  1.00 22.92 ? 716 LYS B CG  1 
ATOM   1057 C CD  . LYS B 1 40  ? 11.857  38.099 20.005  1.00 27.54 ? 716 LYS B CD  1 
ATOM   1058 C CE  . LYS B 1 40  ? 11.542  36.669 20.402  1.00 30.50 ? 716 LYS B CE  1 
ATOM   1059 N NZ  . LYS B 1 40  ? 11.112  36.614 21.836  1.00 33.00 ? 716 LYS B NZ  1 
ATOM   1060 N N   . ILE B 1 41  ? 11.562  38.808 15.204  1.00 20.87 ? 717 ILE B N   1 
ATOM   1061 C CA  . ILE B 1 41  ? 10.304  38.646 14.500  1.00 20.55 ? 717 ILE B CA  1 
ATOM   1062 C C   . ILE B 1 41  ? 9.706   37.294 14.842  1.00 20.44 ? 717 ILE B C   1 
ATOM   1063 O O   . ILE B 1 41  ? 10.284  36.251 14.530  1.00 19.36 ? 717 ILE B O   1 
ATOM   1064 C CB  . ILE B 1 41  ? 10.499  38.764 12.991  1.00 20.24 ? 717 ILE B CB  1 
ATOM   1065 C CG1 . ILE B 1 41  ? 11.062  40.137 12.628  1.00 21.97 ? 717 ILE B CG1 1 
ATOM   1066 C CG2 . ILE B 1 41  ? 9.162   38.582 12.281  1.00 19.91 ? 717 ILE B CG2 1 
ATOM   1067 C CD1 . ILE B 1 41  ? 11.442  40.258 11.198  1.00 24.57 ? 717 ILE B CD1 1 
ATOM   1068 N N   . GLU B 1 42  ? 8.555   37.325 15.502  1.00 19.53 ? 718 GLU B N   1 
ATOM   1069 C CA  . GLU B 1 42  ? 7.833   36.114 15.849  1.00 20.21 ? 718 GLU B CA  1 
ATOM   1070 C C   . GLU B 1 42  ? 6.718   35.920 14.838  1.00 18.81 ? 718 GLU B C   1 
ATOM   1071 O O   . GLU B 1 42  ? 6.175   36.895 14.317  1.00 18.86 ? 718 GLU B O   1 
ATOM   1072 C CB  . GLU B 1 42  ? 7.202   36.239 17.235  1.00 20.88 ? 718 GLU B CB  1 
ATOM   1073 C CG  . GLU B 1 42  ? 8.183   36.544 18.354  1.00 25.75 ? 718 GLU B CG  1 
ATOM   1074 C CD  . GLU B 1 42  ? 7.500   36.580 19.711  1.00 32.92 ? 718 GLU B CD  1 
ATOM   1075 O OE1 . GLU B 1 42  ? 6.262   36.779 19.737  1.00 35.89 ? 718 GLU B OE1 1 
ATOM   1076 O OE2 . GLU B 1 42  ? 8.195   36.409 20.748  1.00 36.16 ? 718 GLU B OE2 1 
ATOM   1077 N N   . PHE B 1 43  ? 6.411   34.661 14.529  1.00 18.55 ? 719 PHE B N   1 
ATOM   1078 C CA  . PHE B 1 43  ? 5.282   34.322 13.674  1.00 17.95 ? 719 PHE B CA  1 
ATOM   1079 C C   . PHE B 1 43  ? 4.275   33.556 14.542  1.00 18.46 ? 719 PHE B C   1 
ATOM   1080 O O   . PHE B 1 43  ? 4.648   32.591 15.203  1.00 17.28 ? 719 PHE B O   1 
ATOM   1081 C CB  . PHE B 1 43  ? 5.706   33.333 12.576  1.00 17.48 ? 719 PHE B CB  1 
ATOM   1082 C CG  . PHE B 1 43  ? 6.404   33.952 11.395  1.00 17.02 ? 719 PHE B CG  1 
ATOM   1083 C CD1 . PHE B 1 43  ? 6.655   33.172 10.264  1.00 15.03 ? 719 PHE B CD1 1 
ATOM   1084 C CD2 . PHE B 1 43  ? 6.804   35.280 11.392  1.00 16.83 ? 719 PHE B CD2 1 
ATOM   1085 C CE1 . PHE B 1 43  ? 7.296   33.692 9.169   1.00 15.76 ? 719 PHE B CE1 1 
ATOM   1086 C CE2 . PHE B 1 43  ? 7.458   35.818 10.282  1.00 17.20 ? 719 PHE B CE2 1 
ATOM   1087 C CZ  . PHE B 1 43  ? 7.704   35.013 9.166   1.00 16.84 ? 719 PHE B CZ  1 
ATOM   1088 N N   . THR B 1 44  ? 3.013   33.986 14.554  1.00 19.51 ? 720 THR B N   1 
ATOM   1089 C CA  . THR B 1 44  ? 1.956   33.205 15.203  1.00 20.56 ? 720 THR B CA  1 
ATOM   1090 C C   . THR B 1 44  ? 1.038   32.719 14.089  1.00 20.71 ? 720 THR B C   1 
ATOM   1091 O O   . THR B 1 44  ? 0.897   33.403 13.079  1.00 20.51 ? 720 THR B O   1 
ATOM   1092 C CB  . THR B 1 44  ? 1.161   34.053 16.227  1.00 20.72 ? 720 THR B CB  1 
ATOM   1093 O OG1 . THR B 1 44  ? 0.533   35.136 15.539  1.00 22.68 ? 720 THR B OG1 1 
ATOM   1094 C CG2 . THR B 1 44  ? 2.106   34.748 17.198  1.00 21.89 ? 720 THR B CG2 1 
ATOM   1095 N N   . PHE B 1 45  ? 0.415   31.554 14.267  1.00 21.77 ? 721 PHE B N   1 
ATOM   1096 C CA  . PHE B 1 45  ? -0.396  30.963 13.201  1.00 22.45 ? 721 PHE B CA  1 
ATOM   1097 C C   . PHE B 1 45  ? -1.808  30.559 13.635  1.00 24.29 ? 721 PHE B C   1 
ATOM   1098 O O   . PHE B 1 45  ? -2.011  30.021 14.723  1.00 23.92 ? 721 PHE B O   1 
ATOM   1099 C CB  . PHE B 1 45  ? 0.249   29.680 12.658  1.00 21.75 ? 721 PHE B CB  1 
ATOM   1100 C CG  . PHE B 1 45  ? 1.721   29.795 12.319  1.00 19.19 ? 721 PHE B CG  1 
ATOM   1101 C CD1 . PHE B 1 45  ? 2.689   29.704 13.306  1.00 19.63 ? 721 PHE B CD1 1 
ATOM   1102 C CD2 . PHE B 1 45  ? 2.127   29.953 11.003  1.00 18.19 ? 721 PHE B CD2 1 
ATOM   1103 C CE1 . PHE B 1 45  ? 4.062   29.783 12.981  1.00 18.41 ? 721 PHE B CE1 1 
ATOM   1104 C CE2 . PHE B 1 45  ? 3.479   30.036 10.664  1.00 17.01 ? 721 PHE B CE2 1 
ATOM   1105 C CZ  . PHE B 1 45  ? 4.443   29.963 11.656  1.00 18.35 ? 721 PHE B CZ  1 
ATOM   1106 N N   . GLU B 1 46  ? -2.754  30.769 12.733  1.00 26.96 ? 722 GLU B N   1 
ATOM   1107 C CA  . GLU B 1 46  ? -4.134  30.333 12.913  1.00 30.32 ? 722 GLU B CA  1 
ATOM   1108 C C   . GLU B 1 46  ? -4.576  29.766 11.571  1.00 31.83 ? 722 GLU B C   1 
ATOM   1109 O O   . GLU B 1 46  ? -4.405  30.416 10.541  1.00 31.41 ? 722 GLU B O   1 
ATOM   1110 C CB  . GLU B 1 46  ? -5.050  31.512 13.242  1.00 30.57 ? 722 GLU B CB  1 
ATOM   1111 C CG  . GLU B 1 46  ? -5.217  31.850 14.713  1.00 33.75 ? 722 GLU B CG  1 
ATOM   1112 C CD  . GLU B 1 46  ? -6.253  32.950 14.938  1.00 37.00 ? 722 GLU B CD  1 
ATOM   1113 O OE1 . GLU B 1 46  ? -7.235  33.029 14.163  1.00 38.11 ? 722 GLU B OE1 1 
ATOM   1114 O OE2 . GLU B 1 46  ? -6.083  33.754 15.884  1.00 40.17 ? 722 GLU B OE2 1 
ATOM   1115 N N   . ARG B 1 47  ? -5.129  28.560 11.560  1.00 34.52 ? 723 ARG B N   1 
ATOM   1116 C CA  . ARG B 1 47  ? -5.675  28.053 10.307  1.00 37.46 ? 723 ARG B CA  1 
ATOM   1117 C C   . ARG B 1 47  ? -7.117  28.527 10.215  1.00 39.30 ? 723 ARG B C   1 
ATOM   1118 O O   . ARG B 1 47  ? -7.883  28.368 11.172  1.00 39.68 ? 723 ARG B O   1 
ATOM   1119 C CB  . ARG B 1 47  ? -5.605  26.532 10.218  1.00 37.70 ? 723 ARG B CB  1 
ATOM   1120 C CG  . ARG B 1 47  ? -6.229  25.998 8.938   1.00 39.31 ? 723 ARG B CG  1 
ATOM   1121 C CD  . ARG B 1 47  ? -5.409  24.933 8.265   1.00 41.41 ? 723 ARG B CD  1 
ATOM   1122 N NE  . ARG B 1 47  ? -4.009  25.327 8.169   1.00 41.36 ? 723 ARG B NE  1 
ATOM   1123 C CZ  . ARG B 1 47  ? -3.016  24.476 8.000   1.00 42.92 ? 723 ARG B CZ  1 
ATOM   1124 N NH1 . ARG B 1 47  ? -3.262  23.180 7.897   1.00 45.01 ? 723 ARG B NH1 1 
ATOM   1125 N NH2 . ARG B 1 47  ? -1.774  24.920 7.922   1.00 44.67 ? 723 ARG B NH2 1 
ATOM   1126 N N   . SER B 1 48  ? -7.468  29.113 9.071   1.00 41.56 ? 724 SER B N   1 
ATOM   1127 C CA  . SER B 1 48  ? -8.789  29.701 8.842   1.00 43.57 ? 724 SER B CA  1 
ATOM   1128 C C   . SER B 1 48  ? -9.938  28.696 8.853   1.00 44.82 ? 724 SER B C   1 
ATOM   1129 O O   . SER B 1 48  ? -9.743  27.503 8.614   1.00 44.97 ? 724 SER B O   1 
ATOM   1130 C CB  . SER B 1 48  ? -8.809  30.474 7.523   1.00 43.45 ? 724 SER B CB  1 
ATOM   1131 O OG  . SER B 1 48  ? -10.014 31.214 7.401   1.00 44.15 ? 724 SER B OG  1 
ATOM   1132 N N   . ASN B 1 49  ? -11.139 29.205 9.110   1.00 46.67 ? 725 ASN B N   1 
ATOM   1133 C CA  . ASN B 1 49  ? -12.342 28.378 9.200   1.00 48.14 ? 725 ASN B CA  1 
ATOM   1134 C C   . ASN B 1 49  ? -13.104 28.267 7.879   1.00 48.55 ? 725 ASN B C   1 
ATOM   1135 O O   . ASN B 1 49  ? -13.687 27.223 7.568   1.00 48.83 ? 725 ASN B O   1 
ATOM   1136 C CB  . ASN B 1 49  ? -13.254 28.904 10.311  1.00 48.70 ? 725 ASN B CB  1 
ATOM   1137 C CG  . ASN B 1 49  ? -12.609 28.810 11.685  1.00 50.05 ? 725 ASN B CG  1 
ATOM   1138 O OD1 . ASN B 1 49  ? -12.198 27.729 12.120  1.00 52.31 ? 725 ASN B OD1 1 
ATOM   1139 N ND2 . ASN B 1 49  ? -12.511 29.942 12.372  1.00 51.34 ? 725 ASN B ND2 1 
ATOM   1140 N N   . THR B 1 50  ? -13.098 29.344 7.102   1.00 48.87 ? 726 THR B N   1 
ATOM   1141 C CA  . THR B 1 50  ? -13.750 29.340 5.799   1.00 48.99 ? 726 THR B CA  1 
ATOM   1142 C C   . THR B 1 50  ? -12.908 28.571 4.788   1.00 48.65 ? 726 THR B C   1 
ATOM   1143 O O   . THR B 1 50  ? -13.317 27.501 4.318   1.00 48.95 ? 726 THR B O   1 
ATOM   1144 C CB  . THR B 1 50  ? -13.993 30.776 5.310   1.00 49.23 ? 726 THR B CB  1 
ATOM   1145 O OG1 . THR B 1 50  ? -13.055 31.657 5.942   1.00 49.56 ? 726 THR B OG1 1 
ATOM   1146 C CG2 . THR B 1 50  ? -15.341 31.284 5.814   1.00 49.91 ? 726 THR B CG2 1 
ATOM   1147 N N   . ASN B 1 51  ? -11.735 29.116 4.465   1.00 47.82 ? 727 ASN B N   1 
ATOM   1148 C CA  . ASN B 1 51  ? -10.812 28.487 3.522   1.00 46.66 ? 727 ASN B CA  1 
ATOM   1149 C C   . ASN B 1 51  ? -9.756  27.675 4.278   1.00 45.74 ? 727 ASN B C   1 
ATOM   1150 O O   . ASN B 1 51  ? -8.781  28.226 4.790   1.00 45.46 ? 727 ASN B O   1 
ATOM   1151 C CB  . ASN B 1 51  ? -10.156 29.549 2.631   1.00 46.98 ? 727 ASN B CB  1 
ATOM   1152 C CG  . ASN B 1 51  ? -9.793  29.021 1.249   1.00 47.24 ? 727 ASN B CG  1 
ATOM   1153 O OD1 . ASN B 1 51  ? -9.561  29.797 0.319   1.00 49.10 ? 727 ASN B OD1 1 
ATOM   1154 N ND2 . ASN B 1 51  ? -9.740  27.702 1.110   1.00 47.09 ? 727 ASN B ND2 1 
ATOM   1155 N N   . PRO B 1 52  ? -9.961  26.362 4.339   1.00 44.54 ? 728 PRO B N   1 
ATOM   1156 C CA  . PRO B 1 52  ? -9.085  25.459 5.093   1.00 43.42 ? 728 PRO B CA  1 
ATOM   1157 C C   . PRO B 1 52  ? -7.699  25.324 4.470   1.00 41.94 ? 728 PRO B C   1 
ATOM   1158 O O   . PRO B 1 52  ? -6.808  24.699 5.058   1.00 41.92 ? 728 PRO B O   1 
ATOM   1159 C CB  . PRO B 1 52  ? -9.822  24.113 5.021   1.00 43.68 ? 728 PRO B CB  1 
ATOM   1160 C CG  . PRO B 1 52  ? -11.214 24.455 4.561   1.00 44.34 ? 728 PRO B CG  1 
ATOM   1161 C CD  . PRO B 1 52  ? -11.056 25.641 3.667   1.00 44.59 ? 728 PRO B CD  1 
ATOM   1162 N N   . SER B 1 53  ? -7.525  25.900 3.287   1.00 39.88 ? 729 SER B N   1 
ATOM   1163 C CA  . SER B 1 53  ? -6.238  25.865 2.612   1.00 37.86 ? 729 SER B CA  1 
ATOM   1164 C C   . SER B 1 53  ? -5.434  27.094 3.012   1.00 36.06 ? 729 SER B C   1 
ATOM   1165 O O   . SER B 1 53  ? -4.266  27.223 2.657   1.00 35.98 ? 729 SER B O   1 
ATOM   1166 C CB  . SER B 1 53  ? -6.425  25.851 1.092   1.00 38.19 ? 729 SER B CB  1 
ATOM   1167 O OG  . SER B 1 53  ? -7.336  24.844 0.687   1.00 38.32 ? 729 SER B OG  1 
ATOM   1168 N N   . VAL B 1 54  ? -6.073  27.996 3.752   1.00 33.95 ? 730 VAL B N   1 
ATOM   1169 C CA  . VAL B 1 54  ? -5.435  29.245 4.161   1.00 31.44 ? 730 VAL B CA  1 
ATOM   1170 C C   . VAL B 1 54  ? -4.913  29.235 5.588   1.00 29.83 ? 730 VAL B C   1 
ATOM   1171 O O   . VAL B 1 54  ? -5.628  28.877 6.520   1.00 29.57 ? 730 VAL B O   1 
ATOM   1172 C CB  . VAL B 1 54  ? -6.408  30.434 4.020   1.00 31.63 ? 730 VAL B CB  1 
ATOM   1173 C CG1 . VAL B 1 54  ? -5.831  31.687 4.681   1.00 31.49 ? 730 VAL B CG1 1 
ATOM   1174 C CG2 . VAL B 1 54  ? -6.706  30.694 2.563   1.00 30.78 ? 730 VAL B CG2 1 
ATOM   1175 N N   . THR B 1 55  ? -3.654  29.627 5.751   1.00 27.82 ? 731 THR B N   1 
ATOM   1176 C CA  . THR B 1 55  ? -3.077  29.742 7.074   1.00 26.13 ? 731 THR B CA  1 
ATOM   1177 C C   . THR B 1 55  ? -2.729  31.208 7.224   1.00 24.77 ? 731 THR B C   1 
ATOM   1178 O O   . THR B 1 55  ? -2.088  31.793 6.357   1.00 23.92 ? 731 THR B O   1 
ATOM   1179 C CB  . THR B 1 55  ? -1.827  28.851 7.232   1.00 26.25 ? 731 THR B CB  1 
ATOM   1180 O OG1 . THR B 1 55  ? -2.224  27.474 7.285   1.00 27.05 ? 731 THR B OG1 1 
ATOM   1181 C CG2 . THR B 1 55  ? -1.172  29.073 8.604   1.00 26.06 ? 731 THR B CG2 1 
ATOM   1182 N N   . VAL B 1 56  ? -3.189  31.800 8.315   1.00 23.63 ? 732 VAL B N   1 
ATOM   1183 C CA  . VAL B 1 56  ? -2.972  33.210 8.562   1.00 22.69 ? 732 VAL B CA  1 
ATOM   1184 C C   . VAL B 1 56  ? -1.790  33.364 9.494   1.00 21.55 ? 732 VAL B C   1 
ATOM   1185 O O   . VAL B 1 56  ? -1.824  32.885 10.613  1.00 21.94 ? 732 VAL B O   1 
ATOM   1186 C CB  . VAL B 1 56  ? -4.204  33.838 9.234   1.00 22.68 ? 732 VAL B CB  1 
ATOM   1187 C CG1 . VAL B 1 56  ? -4.033  35.350 9.342   1.00 22.60 ? 732 VAL B CG1 1 
ATOM   1188 C CG2 . VAL B 1 56  ? -5.456  33.476 8.445   1.00 23.63 ? 732 VAL B CG2 1 
ATOM   1189 N N   . ILE B 1 57  ? -0.746  34.024 9.011   1.00 20.94 ? 733 ILE B N   1 
ATOM   1190 C CA  . ILE B 1 57  ? 0.441   34.279 9.812   1.00 19.99 ? 733 ILE B CA  1 
ATOM   1191 C C   . ILE B 1 57  ? 0.444   35.714 10.319  1.00 20.35 ? 733 ILE B C   1 
ATOM   1192 O O   . ILE B 1 57  ? 0.337   36.658 9.528   1.00 20.14 ? 733 ILE B O   1 
ATOM   1193 C CB  . ILE B 1 57  ? 1.702   34.024 8.968   1.00 20.47 ? 733 ILE B CB  1 
ATOM   1194 C CG1 . ILE B 1 57  ? 1.637   32.620 8.346   1.00 19.18 ? 733 ILE B CG1 1 
ATOM   1195 C CG2 . ILE B 1 57  ? 2.958   34.175 9.822   1.00 18.55 ? 733 ILE B CG2 1 
ATOM   1196 C CD1 . ILE B 1 57  ? 2.761   32.307 7.352   1.00 19.88 ? 733 ILE B CD1 1 
ATOM   1197 N N   . THR B 1 58  ? 0.562   35.879 11.630  1.00 20.31 ? 734 THR B N   1 
ATOM   1198 C CA  . THR B 1 58  ? 0.675   37.214 12.207  1.00 20.92 ? 734 THR B CA  1 
ATOM   1199 C C   . THR B 1 58  ? 2.112   37.381 12.656  1.00 20.69 ? 734 THR B C   1 
ATOM   1200 O O   . THR B 1 58  ? 2.582   36.635 13.510  1.00 20.53 ? 734 THR B O   1 
ATOM   1201 C CB  . THR B 1 58  ? -0.284  37.393 13.411  1.00 21.13 ? 734 THR B CB  1 
ATOM   1202 O OG1 . THR B 1 58  ? -1.636  37.208 12.982  1.00 21.59 ? 734 THR B OG1 1 
ATOM   1203 C CG2 . THR B 1 58  ? -0.264  38.834 13.902  1.00 21.91 ? 734 THR B CG2 1 
ATOM   1204 N N   . ILE B 1 59  ? 2.819   38.337 12.071  1.00 21.05 ? 735 ILE B N   1 
ATOM   1205 C CA  . ILE B 1 59  ? 4.191   38.577 12.483  1.00 21.94 ? 735 ILE B CA  1 
ATOM   1206 C C   . ILE B 1 59  ? 4.183   39.623 13.575  1.00 22.35 ? 735 ILE B C   1 
ATOM   1207 O O   . ILE B 1 59  ? 3.343   40.530 13.573  1.00 22.55 ? 735 ILE B O   1 
ATOM   1208 C CB  . ILE B 1 59  ? 5.092   39.038 11.311  1.00 22.63 ? 735 ILE B CB  1 
ATOM   1209 C CG1 . ILE B 1 59  ? 4.927   40.544 11.067  1.00 23.93 ? 735 ILE B CG1 1 
ATOM   1210 C CG2 . ILE B 1 59  ? 4.821   38.217 10.047  1.00 22.94 ? 735 ILE B CG2 1 
ATOM   1211 C CD1 . ILE B 1 59  ? 6.095   41.215 10.372  1.00 24.84 ? 735 ILE B CD1 1 
ATOM   1212 N N   . GLN B 1 60  ? 5.086   39.476 14.534  1.00 22.36 ? 736 GLN B N   1 
ATOM   1213 C CA  . GLN B 1 60  ? 5.219   40.471 15.589  1.00 23.07 ? 736 GLN B CA  1 
ATOM   1214 C C   . GLN B 1 60  ? 6.689   40.866 15.633  1.00 22.70 ? 736 GLN B C   1 
ATOM   1215 O O   . GLN B 1 60  ? 7.542   40.042 15.965  1.00 21.94 ? 736 GLN B O   1 
ATOM   1216 C CB  . GLN B 1 60  ? 4.786   39.903 16.943  1.00 23.13 ? 736 GLN B CB  1 
ATOM   1217 C CG  . GLN B 1 60  ? 3.335   39.378 16.995  1.00 26.82 ? 736 GLN B CG  1 
ATOM   1218 C CD  . GLN B 1 60  ? 2.280   40.478 17.081  1.00 31.55 ? 736 GLN B CD  1 
ATOM   1219 O OE1 . GLN B 1 60  ? 2.563   41.644 16.808  1.00 33.77 ? 736 GLN B OE1 1 
ATOM   1220 N NE2 . GLN B 1 60  ? 1.055   40.102 17.453  1.00 32.03 ? 736 GLN B NE2 1 
ATOM   1221 N N   . ALA B 1 61  ? 6.988   42.110 15.275  1.00 22.36 ? 737 ALA B N   1 
ATOM   1222 C CA  . ALA B 1 61  ? 8.367   42.583 15.301  1.00 22.33 ? 737 ALA B CA  1 
ATOM   1223 C C   . ALA B 1 61  ? 8.645   43.355 16.590  1.00 22.95 ? 737 ALA B C   1 
ATOM   1224 O O   . ALA B 1 61  ? 7.829   44.191 16.996  1.00 22.73 ? 737 ALA B O   1 
ATOM   1225 C CB  . ALA B 1 61  ? 8.661   43.424 14.076  1.00 22.00 ? 737 ALA B CB  1 
ATOM   1226 N N   . SER B 1 62  ? 9.759   43.037 17.250  1.00 23.18 ? 738 SER B N   1 
ATOM   1227 C CA  . SER B 1 62  ? 10.147  43.722 18.484  1.00 24.16 ? 738 SER B CA  1 
ATOM   1228 C C   . SER B 1 62  ? 11.616  44.126 18.461  1.00 24.63 ? 738 SER B C   1 
ATOM   1229 O O   . SER B 1 62  ? 12.422  43.568 17.708  1.00 23.93 ? 738 SER B O   1 
ATOM   1230 C CB  . SER B 1 62  ? 9.771   42.914 19.737  1.00 24.12 ? 738 SER B CB  1 
ATOM   1231 O OG  . SER B 1 62  ? 10.511  41.707 19.859  1.00 25.10 ? 738 SER B OG  1 
ATOM   1232 N N   . ASN B 1 63  ? 11.960  45.104 19.291  1.00 25.31 ? 739 ASN B N   1 
ATOM   1233 C CA  . ASN B 1 63  ? 13.288  45.721 19.296  1.00 26.64 ? 739 ASN B CA  1 
ATOM   1234 C C   . ASN B 1 63  ? 13.850  45.787 20.709  1.00 27.59 ? 739 ASN B C   1 
ATOM   1235 O O   . ASN B 1 63  ? 13.307  46.480 21.578  1.00 27.84 ? 739 ASN B O   1 
ATOM   1236 C CB  . ASN B 1 63  ? 13.166  47.123 18.689  1.00 26.58 ? 739 ASN B CB  1 
ATOM   1237 C CG  . ASN B 1 63  ? 14.454  47.936 18.752  1.00 27.77 ? 739 ASN B CG  1 
ATOM   1238 O OD1 . ASN B 1 63  ? 15.479  47.495 19.268  1.00 30.90 ? 739 ASN B OD1 1 
ATOM   1239 N ND2 . ASN B 1 63  ? 14.392  49.154 18.219  1.00 29.55 ? 739 ASN B ND2 1 
ATOM   1240 N N   . SER B 1 64  ? 14.930  45.057 20.944  1.00 28.36 ? 740 SER B N   1 
ATOM   1241 C CA  . SER B 1 64  ? 15.504  44.998 22.280  1.00 29.55 ? 740 SER B CA  1 
ATOM   1242 C C   . SER B 1 64  ? 16.655  45.980 22.486  1.00 30.18 ? 740 SER B C   1 
ATOM   1243 O O   . SER B 1 64  ? 17.257  46.015 23.552  1.00 31.19 ? 740 SER B O   1 
ATOM   1244 C CB  . SER B 1 64  ? 15.923  43.564 22.627  1.00 29.50 ? 740 SER B CB  1 
ATOM   1245 O OG  . SER B 1 64  ? 16.871  43.051 21.702  1.00 28.75 ? 740 SER B OG  1 
ATOM   1246 N N   . THR B 1 65  ? 16.953  46.788 21.477  1.00 31.30 ? 741 THR B N   1 
ATOM   1247 C CA  . THR B 1 65  ? 18.011  47.782 21.615  1.00 32.21 ? 741 THR B CA  1 
ATOM   1248 C C   . THR B 1 65  ? 17.492  49.039 22.313  1.00 33.19 ? 741 THR B C   1 
ATOM   1249 O O   . THR B 1 65  ? 16.300  49.160 22.594  1.00 32.43 ? 741 THR B O   1 
ATOM   1250 C CB  . THR B 1 65  ? 18.634  48.152 20.256  1.00 32.24 ? 741 THR B CB  1 
ATOM   1251 O OG1 . THR B 1 65  ? 17.715  48.944 19.495  1.00 31.20 ? 741 THR B OG1 1 
ATOM   1252 C CG2 . THR B 1 65  ? 18.871  46.901 19.394  1.00 31.89 ? 741 THR B CG2 1 
ATOM   1253 N N   . GLU B 1 66  ? 18.406  49.969 22.575  1.00 34.58 ? 742 GLU B N   1 
ATOM   1254 C CA  . GLU B 1 66  ? 18.092  51.209 23.271  1.00 35.93 ? 742 GLU B CA  1 
ATOM   1255 C C   . GLU B 1 66  ? 17.657  52.297 22.298  1.00 36.17 ? 742 GLU B C   1 
ATOM   1256 O O   . GLU B 1 66  ? 17.381  53.433 22.702  1.00 36.07 ? 742 GLU B O   1 
ATOM   1257 C CB  . GLU B 1 66  ? 19.312  51.680 24.078  1.00 36.26 ? 742 GLU B CB  1 
ATOM   1258 C CG  . GLU B 1 66  ? 19.697  50.758 25.227  1.00 38.96 ? 742 GLU B CG  1 
ATOM   1259 C CD  . GLU B 1 66  ? 20.959  51.196 25.970  1.00 42.84 ? 742 GLU B CD  1 
ATOM   1260 O OE1 . GLU B 1 66  ? 22.078  50.987 25.439  1.00 44.07 ? 742 GLU B OE1 1 
ATOM   1261 O OE2 . GLU B 1 66  ? 20.835  51.734 27.100  1.00 43.99 ? 742 GLU B OE2 1 
ATOM   1262 N N   . LEU B 1 67  ? 17.600  51.950 21.015  1.00 36.52 ? 743 LEU B N   1 
ATOM   1263 C CA  . LEU B 1 67  ? 17.243  52.908 19.972  1.00 36.77 ? 743 LEU B CA  1 
ATOM   1264 C C   . LEU B 1 67  ? 16.168  52.349 19.049  1.00 36.67 ? 743 LEU B C   1 
ATOM   1265 O O   . LEU B 1 67  ? 16.130  51.147 18.782  1.00 36.89 ? 743 LEU B O   1 
ATOM   1266 C CB  . LEU B 1 67  ? 18.475  53.283 19.152  1.00 37.18 ? 743 LEU B CB  1 
ATOM   1267 C CG  . LEU B 1 67  ? 19.657  53.913 19.895  1.00 38.52 ? 743 LEU B CG  1 
ATOM   1268 C CD1 . LEU B 1 67  ? 20.910  53.835 19.043  1.00 39.85 ? 743 LEU B CD1 1 
ATOM   1269 C CD2 . LEU B 1 67  ? 19.351  55.361 20.281  1.00 40.04 ? 743 LEU B CD2 1 
ATOM   1270 N N   . ASP B 1 68  ? 15.310  53.235 18.556  1.00 36.18 ? 744 ASP B N   1 
ATOM   1271 C CA  . ASP B 1 68  ? 14.214  52.856 17.676  1.00 35.31 ? 744 ASP B CA  1 
ATOM   1272 C C   . ASP B 1 68  ? 14.679  52.458 16.280  1.00 34.42 ? 744 ASP B C   1 
ATOM   1273 O O   . ASP B 1 68  ? 15.642  53.006 15.748  1.00 33.59 ? 744 ASP B O   1 
ATOM   1274 C CB  . ASP B 1 68  ? 13.228  54.020 17.523  1.00 35.89 ? 744 ASP B CB  1 
ATOM   1275 C CG  . ASP B 1 68  ? 12.323  54.201 18.729  1.00 37.32 ? 744 ASP B CG  1 
ATOM   1276 O OD1 . ASP B 1 68  ? 11.679  55.272 18.812  1.00 40.51 ? 744 ASP B OD1 1 
ATOM   1277 O OD2 . ASP B 1 68  ? 12.179  53.353 19.635  1.00 39.23 ? 744 ASP B OD2 1 
ATOM   1278 N N   . MET B 1 69  ? 13.963  51.507 15.691  1.00 33.43 ? 745 MET B N   1 
ATOM   1279 C CA  . MET B 1 69  ? 14.187  51.109 14.317  1.00 32.33 ? 745 MET B CA  1 
ATOM   1280 C C   . MET B 1 69  ? 13.069  51.763 13.541  1.00 32.26 ? 745 MET B C   1 
ATOM   1281 O O   . MET B 1 69  ? 11.902  51.519 13.823  1.00 32.25 ? 745 MET B O   1 
ATOM   1282 C CB  . MET B 1 69  ? 14.113  49.585 14.188  1.00 32.17 ? 745 MET B CB  1 
ATOM   1283 C CG  . MET B 1 69  ? 15.161  48.862 15.008  1.00 30.43 ? 745 MET B CG  1 
ATOM   1284 S SD  . MET B 1 69  ? 14.973  47.054 15.048  1.00 28.17 ? 745 MET B SD  1 
ATOM   1285 C CE  . MET B 1 69  ? 16.546  46.592 15.870  1.00 28.58 ? 745 MET B CE  1 
ATOM   1286 N N   . THR B 1 70  ? 13.418  52.603 12.570  1.00 32.37 ? 746 THR B N   1 
ATOM   1287 C CA  . THR B 1 70  ? 12.418  53.372 11.843  1.00 32.48 ? 746 THR B CA  1 
ATOM   1288 C C   . THR B 1 70  ? 12.284  52.974 10.384  1.00 32.31 ? 746 THR B C   1 
ATOM   1289 O O   . THR B 1 70  ? 13.126  52.251 9.851   1.00 32.61 ? 746 THR B O   1 
ATOM   1290 C CB  . THR B 1 70  ? 12.751  54.871 11.949  1.00 32.50 ? 746 THR B CB  1 
ATOM   1291 O OG1 . THR B 1 70  ? 14.001  55.130 11.296  1.00 32.95 ? 746 THR B OG1 1 
ATOM   1292 C CG2 . THR B 1 70  ? 13.030  55.239 13.394  1.00 33.15 ? 746 THR B CG2 1 
ATOM   1293 N N   . ASP B 1 71  ? 11.219  53.458 9.743   1.00 31.93 ? 747 ASP B N   1 
ATOM   1294 C CA  . ASP B 1 71  ? 10.937  53.141 8.344   1.00 32.02 ? 747 ASP B CA  1 
ATOM   1295 C C   . ASP B 1 71  ? 11.018  51.631 8.123   1.00 31.18 ? 747 ASP B C   1 
ATOM   1296 O O   . ASP B 1 71  ? 11.520  51.167 7.100   1.00 31.34 ? 747 ASP B O   1 
ATOM   1297 C CB  . ASP B 1 71  ? 11.927  53.842 7.412   1.00 33.04 ? 747 ASP B CB  1 
ATOM   1298 C CG  . ASP B 1 71  ? 11.616  55.325 7.217   1.00 35.46 ? 747 ASP B CG  1 
ATOM   1299 O OD1 . ASP B 1 71  ? 10.422  55.691 7.124   1.00 37.36 ? 747 ASP B OD1 1 
ATOM   1300 O OD2 . ASP B 1 71  ? 12.511  56.194 7.133   1.00 39.69 ? 747 ASP B OD2 1 
ATOM   1301 N N   . PHE B 1 72  ? 10.539  50.873 9.097   1.00 29.83 ? 748 PHE B N   1 
ATOM   1302 C CA  . PHE B 1 72  ? 10.587  49.421 9.019   1.00 28.21 ? 748 PHE B CA  1 
ATOM   1303 C C   . PHE B 1 72  ? 9.663   48.853 7.951   1.00 27.42 ? 748 PHE B C   1 
ATOM   1304 O O   . PHE B 1 72  ? 8.478   49.144 7.931   1.00 27.22 ? 748 PHE B O   1 
ATOM   1305 C CB  . PHE B 1 72  ? 10.245  48.805 10.372  1.00 27.99 ? 748 PHE B CB  1 
ATOM   1306 C CG  . PHE B 1 72  ? 10.346  47.306 10.390  1.00 26.93 ? 748 PHE B CG  1 
ATOM   1307 C CD1 . PHE B 1 72  ? 11.533  46.690 10.736  1.00 26.02 ? 748 PHE B CD1 1 
ATOM   1308 C CD2 . PHE B 1 72  ? 9.251   46.517 10.058  1.00 26.70 ? 748 PHE B CD2 1 
ATOM   1309 C CE1 . PHE B 1 72  ? 11.629  45.306 10.752  1.00 24.99 ? 748 PHE B CE1 1 
ATOM   1310 C CE2 . PHE B 1 72  ? 9.344   45.135 10.072  1.00 26.56 ? 748 PHE B CE2 1 
ATOM   1311 C CZ  . PHE B 1 72  ? 10.533  44.533 10.420  1.00 24.54 ? 748 PHE B CZ  1 
ATOM   1312 N N   . VAL B 1 73  ? 10.219  48.033 7.066   1.00 26.79 ? 749 VAL B N   1 
ATOM   1313 C CA  . VAL B 1 73  ? 9.438   47.360 6.040   1.00 25.91 ? 749 VAL B CA  1 
ATOM   1314 C C   . VAL B 1 73  ? 9.688   45.842 6.067   1.00 25.65 ? 749 VAL B C   1 
ATOM   1315 O O   . VAL B 1 73  ? 10.831  45.385 6.055   1.00 25.35 ? 749 VAL B O   1 
ATOM   1316 C CB  . VAL B 1 73  ? 9.752   47.895 4.636   1.00 26.79 ? 749 VAL B CB  1 
ATOM   1317 C CG1 . VAL B 1 73  ? 8.935   47.157 3.596   1.00 25.74 ? 749 VAL B CG1 1 
ATOM   1318 C CG2 . VAL B 1 73  ? 9.476   49.407 4.545   1.00 26.22 ? 749 VAL B CG2 1 
ATOM   1319 N N   . PHE B 1 74  ? 8.612   45.071 6.131   1.00 24.65 ? 750 PHE B N   1 
ATOM   1320 C CA  . PHE B 1 74  ? 8.718   43.619 6.078   1.00 24.01 ? 750 PHE B CA  1 
ATOM   1321 C C   . PHE B 1 74  ? 8.161   43.176 4.744   1.00 23.56 ? 750 PHE B C   1 
ATOM   1322 O O   . PHE B 1 74  ? 7.076   43.600 4.341   1.00 23.20 ? 750 PHE B O   1 
ATOM   1323 C CB  . PHE B 1 74  ? 7.931   42.985 7.238   1.00 24.05 ? 750 PHE B CB  1 
ATOM   1324 C CG  . PHE B 1 74  ? 7.735   41.473 7.126   1.00 22.03 ? 750 PHE B CG  1 
ATOM   1325 C CD1 . PHE B 1 74  ? 8.617   40.596 7.744   1.00 24.40 ? 750 PHE B CD1 1 
ATOM   1326 C CD2 . PHE B 1 74  ? 6.646   40.942 6.446   1.00 22.32 ? 750 PHE B CD2 1 
ATOM   1327 C CE1 . PHE B 1 74  ? 8.431   39.207 7.661   1.00 22.91 ? 750 PHE B CE1 1 
ATOM   1328 C CE2 . PHE B 1 74  ? 6.446   39.566 6.359   1.00 22.76 ? 750 PHE B CE2 1 
ATOM   1329 C CZ  . PHE B 1 74  ? 7.341   38.694 6.969   1.00 21.87 ? 750 PHE B CZ  1 
ATOM   1330 N N   . GLN B 1 75  ? 8.921   42.358 4.023   1.00 22.97 ? 751 GLN B N   1 
ATOM   1331 C CA  . GLN B 1 75  ? 8.432   41.780 2.791   1.00 22.93 ? 751 GLN B CA  1 
ATOM   1332 C C   . GLN B 1 75  ? 8.665   40.275 2.852   1.00 23.02 ? 751 GLN B C   1 
ATOM   1333 O O   . GLN B 1 75  ? 9.590   39.808 3.531   1.00 22.01 ? 751 GLN B O   1 
ATOM   1334 C CB  . GLN B 1 75  ? 9.155   42.360 1.578   1.00 24.08 ? 751 GLN B CB  1 
ATOM   1335 C CG  . GLN B 1 75  ? 9.153   43.878 1.509   1.00 26.31 ? 751 GLN B CG  1 
ATOM   1336 C CD  . GLN B 1 75  ? 9.983   44.407 0.358   1.00 29.02 ? 751 GLN B CD  1 
ATOM   1337 O OE1 . GLN B 1 75  ? 10.990  45.090 0.575   1.00 32.13 ? 751 GLN B OE1 1 
ATOM   1338 N NE2 . GLN B 1 75  ? 9.573   44.095 -0.867  1.00 30.35 ? 751 GLN B NE2 1 
ATOM   1339 N N   . ALA B 1 76  ? 7.827   39.535 2.141   1.00 22.72 ? 752 ALA B N   1 
ATOM   1340 C CA  . ALA B 1 76  ? 7.915   38.087 2.128   1.00 23.73 ? 752 ALA B CA  1 
ATOM   1341 C C   . ALA B 1 76  ? 7.570   37.546 0.758   1.00 24.22 ? 752 ALA B C   1 
ATOM   1342 O O   . ALA B 1 76  ? 6.865   38.188 -0.023  1.00 24.56 ? 752 ALA B O   1 
ATOM   1343 C CB  . ALA B 1 76  ? 6.997   37.506 3.157   1.00 23.45 ? 752 ALA B CB  1 
ATOM   1344 N N   . ALA B 1 77  ? 8.086   36.362 0.466   1.00 23.99 ? 753 ALA B N   1 
ATOM   1345 C CA  . ALA B 1 77  ? 7.799   35.706 -0.793  1.00 24.02 ? 753 ALA B CA  1 
ATOM   1346 C C   . ALA B 1 77  ? 7.718   34.217 -0.557  1.00 24.02 ? 753 ALA B C   1 
ATOM   1347 O O   . ALA B 1 77  ? 8.388   33.688 0.333   1.00 23.12 ? 753 ALA B O   1 
ATOM   1348 C CB  . ALA B 1 77  ? 8.891   36.016 -1.808  1.00 24.09 ? 753 ALA B CB  1 
ATOM   1349 N N   . VAL B 1 78  ? 6.878   33.547 -1.334  1.00 23.94 ? 754 VAL B N   1 
ATOM   1350 C CA  . VAL B 1 78  ? 6.789   32.103 -1.263  1.00 24.24 ? 754 VAL B CA  1 
ATOM   1351 C C   . VAL B 1 78  ? 6.946   31.563 -2.672  1.00 25.37 ? 754 VAL B C   1 
ATOM   1352 O O   . VAL B 1 78  ? 6.742   32.287 -3.645  1.00 25.22 ? 754 VAL B O   1 
ATOM   1353 C CB  . VAL B 1 78  ? 5.442   31.632 -0.699  1.00 24.19 ? 754 VAL B CB  1 
ATOM   1354 C CG1 . VAL B 1 78  ? 5.297   32.051 0.764   1.00 22.64 ? 754 VAL B CG1 1 
ATOM   1355 C CG2 . VAL B 1 78  ? 4.273   32.160 -1.551  1.00 24.70 ? 754 VAL B CG2 1 
ATOM   1356 N N   . PRO B 1 79  ? 7.349   30.304 -2.777  1.00 26.55 ? 755 PRO B N   1 
ATOM   1357 C CA  . PRO B 1 79  ? 7.445   29.620 -4.075  1.00 27.12 ? 755 PRO B CA  1 
ATOM   1358 C C   . PRO B 1 79  ? 6.086   29.561 -4.779  1.00 27.82 ? 755 PRO B C   1 
ATOM   1359 O O   . PRO B 1 79  ? 5.040   29.677 -4.143  1.00 26.93 ? 755 PRO B O   1 
ATOM   1360 C CB  . PRO B 1 79  ? 7.887   28.205 -3.696  1.00 27.84 ? 755 PRO B CB  1 
ATOM   1361 C CG  . PRO B 1 79  ? 8.574   28.362 -2.372  1.00 26.83 ? 755 PRO B CG  1 
ATOM   1362 C CD  . PRO B 1 79  ? 7.801   29.459 -1.659  1.00 26.39 ? 755 PRO B CD  1 
ATOM   1363 N N   . LYS B 1 80  ? 6.100   29.369 -6.096  1.00 28.94 ? 756 LYS B N   1 
ATOM   1364 C CA  . LYS B 1 80  ? 4.850   29.331 -6.852  1.00 29.84 ? 756 LYS B CA  1 
ATOM   1365 C C   . LYS B 1 80  ? 3.904   28.211 -6.417  1.00 29.88 ? 756 LYS B C   1 
ATOM   1366 O O   . LYS B 1 80  ? 2.740   28.189 -6.809  1.00 29.58 ? 756 LYS B O   1 
ATOM   1367 C CB  . LYS B 1 80  ? 5.117   29.303 -8.359  1.00 30.70 ? 756 LYS B CB  1 
ATOM   1368 C CG  . LYS B 1 80  ? 5.636   30.639 -8.879  1.00 32.40 ? 756 LYS B CG  1 
ATOM   1369 C CD  . LYS B 1 80  ? 5.561   30.724 -10.396 1.00 36.09 ? 756 LYS B CD  1 
ATOM   1370 C CE  . LYS B 1 80  ? 5.735   32.168 -10.879 1.00 37.97 ? 756 LYS B CE  1 
ATOM   1371 N NZ  . LYS B 1 80  ? 6.973   32.777 -10.331 1.00 39.60 ? 756 LYS B NZ  1 
ATOM   1372 N N   . THR B 1 81  ? 4.403   27.299 -5.588  1.00 29.84 ? 757 THR B N   1 
ATOM   1373 C CA  . THR B 1 81  ? 3.577   26.251 -5.014  1.00 30.37 ? 757 THR B CA  1 
ATOM   1374 C C   . THR B 1 81  ? 2.415   26.907 -4.270  1.00 30.52 ? 757 THR B C   1 
ATOM   1375 O O   . THR B 1 81  ? 1.304   26.365 -4.209  1.00 30.86 ? 757 THR B O   1 
ATOM   1376 C CB  . THR B 1 81  ? 4.412   25.426 -3.986  1.00 30.03 ? 757 THR B CB  1 
ATOM   1377 O OG1 . THR B 1 81  ? 5.675   25.053 -4.551  1.00 31.28 ? 757 THR B OG1 1 
ATOM   1378 C CG2 . THR B 1 81  ? 3.753   24.095 -3.676  1.00 31.19 ? 757 THR B CG2 1 
ATOM   1379 N N   . PHE B 1 82  ? 2.686   28.084 -3.708  1.00 29.80 ? 758 PHE B N   1 
ATOM   1380 C CA  . PHE B 1 82  ? 1.733   28.779 -2.847  1.00 29.82 ? 758 PHE B CA  1 
ATOM   1381 C C   . PHE B 1 82  ? 1.366   30.162 -3.370  1.00 29.95 ? 758 PHE B C   1 
ATOM   1382 O O   . PHE B 1 82  ? 1.973   30.663 -4.301  1.00 29.68 ? 758 PHE B O   1 
ATOM   1383 C CB  . PHE B 1 82  ? 2.336   28.964 -1.445  1.00 29.67 ? 758 PHE B CB  1 
ATOM   1384 C CG  . PHE B 1 82  ? 3.170   27.808 -0.978  1.00 28.20 ? 758 PHE B CG  1 
ATOM   1385 C CD1 . PHE B 1 82  ? 4.547   27.825 -1.125  1.00 28.54 ? 758 PHE B CD1 1 
ATOM   1386 C CD2 . PHE B 1 82  ? 2.583   26.710 -0.388  1.00 28.71 ? 758 PHE B CD2 1 
ATOM   1387 C CE1 . PHE B 1 82  ? 5.324   26.757 -0.693  1.00 27.94 ? 758 PHE B CE1 1 
ATOM   1388 C CE2 . PHE B 1 82  ? 3.358   25.642 0.042   1.00 28.44 ? 758 PHE B CE2 1 
ATOM   1389 C CZ  . PHE B 1 82  ? 4.723   25.669 -0.115  1.00 26.30 ? 758 PHE B CZ  1 
ATOM   1390 N N   . GLN B 1 83  ? 0.364   30.768 -2.745  1.00 30.58 ? 759 GLN B N   1 
ATOM   1391 C CA  . GLN B 1 83  ? -0.001  32.148 -3.024  1.00 31.16 ? 759 GLN B CA  1 
ATOM   1392 C C   . GLN B 1 83  ? 0.090   32.897 -1.709  1.00 30.90 ? 759 GLN B C   1 
ATOM   1393 O O   . GLN B 1 83  ? -0.204  32.347 -0.649  1.00 30.19 ? 759 GLN B O   1 
ATOM   1394 C CB  . GLN B 1 83  ? -1.415  32.250 -3.599  1.00 31.78 ? 759 GLN B CB  1 
ATOM   1395 C CG  . GLN B 1 83  ? -1.534  31.714 -5.023  1.00 34.74 ? 759 GLN B CG  1 
ATOM   1396 C CD  . GLN B 1 83  ? -2.909  31.945 -5.625  1.00 37.43 ? 759 GLN B CD  1 
ATOM   1397 O OE1 . GLN B 1 83  ? -3.612  30.992 -5.970  1.00 39.18 ? 759 GLN B OE1 1 
ATOM   1398 N NE2 . GLN B 1 83  ? -3.295  33.212 -5.755  1.00 38.80 ? 759 GLN B NE2 1 
ATOM   1399 N N   . LEU B 1 84  ? 0.495   34.154 -1.787  1.00 30.83 ? 760 LEU B N   1 
ATOM   1400 C CA  . LEU B 1 84  ? 0.691   34.951 -0.595  1.00 31.31 ? 760 LEU B CA  1 
ATOM   1401 C C   . LEU B 1 84  ? -0.044  36.291 -0.668  1.00 31.14 ? 760 LEU B C   1 
ATOM   1402 O O   . LEU B 1 84  ? -0.106  36.918 -1.723  1.00 30.64 ? 760 LEU B O   1 
ATOM   1403 C CB  . LEU B 1 84  ? 2.194   35.182 -0.406  1.00 31.37 ? 760 LEU B CB  1 
ATOM   1404 C CG  . LEU B 1 84  ? 2.758   35.629 0.936   1.00 33.21 ? 760 LEU B CG  1 
ATOM   1405 C CD1 . LEU B 1 84  ? 4.273   35.799 0.834   1.00 34.02 ? 760 LEU B CD1 1 
ATOM   1406 C CD2 . LEU B 1 84  ? 2.128   36.929 1.372   1.00 35.98 ? 760 LEU B CD2 1 
ATOM   1407 N N   . GLN B 1 85  ? -0.615  36.704 0.459   1.00 31.31 ? 761 GLN B N   1 
ATOM   1408 C CA  . GLN B 1 85  ? -1.246  38.016 0.573   1.00 31.98 ? 761 GLN B CA  1 
ATOM   1409 C C   . GLN B 1 85  ? -0.696  38.722 1.814   1.00 31.74 ? 761 GLN B C   1 
ATOM   1410 O O   . GLN B 1 85  ? -0.760  38.185 2.923   1.00 31.75 ? 761 GLN B O   1 
ATOM   1411 C CB  . GLN B 1 85  ? -2.768  37.874 0.650   1.00 32.37 ? 761 GLN B CB  1 
ATOM   1412 C CG  . GLN B 1 85  ? -3.489  39.017 1.352   1.00 35.18 ? 761 GLN B CG  1 
ATOM   1413 C CD  . GLN B 1 85  ? -4.986  38.758 1.472   1.00 38.70 ? 761 GLN B CD  1 
ATOM   1414 O OE1 . GLN B 1 85  ? -5.404  37.642 1.781   1.00 41.74 ? 761 GLN B OE1 1 
ATOM   1415 N NE2 . GLN B 1 85  ? -5.790  39.783 1.218   1.00 39.80 ? 761 GLN B NE2 1 
ATOM   1416 N N   . LEU B 1 86  ? -0.139  39.911 1.626   1.00 31.39 ? 762 LEU B N   1 
ATOM   1417 C CA  . LEU B 1 86  ? 0.417   40.653 2.740   1.00 31.33 ? 762 LEU B CA  1 
ATOM   1418 C C   . LEU B 1 86  ? -0.466  41.858 3.043   1.00 31.13 ? 762 LEU B C   1 
ATOM   1419 O O   . LEU B 1 86  ? -0.701  42.695 2.174   1.00 31.23 ? 762 LEU B O   1 
ATOM   1420 C CB  . LEU B 1 86  ? 1.843   41.080 2.406   1.00 31.78 ? 762 LEU B CB  1 
ATOM   1421 C CG  . LEU B 1 86  ? 2.816   41.527 3.502   1.00 32.98 ? 762 LEU B CG  1 
ATOM   1422 C CD1 . LEU B 1 86  ? 2.622   40.775 4.798   1.00 33.83 ? 762 LEU B CD1 1 
ATOM   1423 C CD2 . LEU B 1 86  ? 4.247   41.358 3.000   1.00 33.90 ? 762 LEU B CD2 1 
ATOM   1424 N N   . LEU B 1 87  ? -0.987  41.925 4.262   1.00 30.30 ? 763 LEU B N   1 
ATOM   1425 C CA  . LEU B 1 87  ? -1.823  43.050 4.663   1.00 30.00 ? 763 LEU B CA  1 
ATOM   1426 C C   . LEU B 1 87  ? -0.945  44.187 5.187   1.00 29.90 ? 763 LEU B C   1 
ATOM   1427 O O   . LEU B 1 87  ? 0.263   44.032 5.316   1.00 29.38 ? 763 LEU B O   1 
ATOM   1428 C CB  . LEU B 1 87  ? -2.848  42.617 5.703   1.00 29.92 ? 763 LEU B CB  1 
ATOM   1429 C CG  . LEU B 1 87  ? -3.776  41.507 5.210   1.00 30.72 ? 763 LEU B CG  1 
ATOM   1430 C CD1 . LEU B 1 87  ? -5.036  41.408 6.059   1.00 31.67 ? 763 LEU B CD1 1 
ATOM   1431 C CD2 . LEU B 1 87  ? -4.128  41.759 3.763   1.00 32.39 ? 763 LEU B CD2 1 
ATOM   1432 N N   . SER B 1 88  ? -1.548  45.341 5.465   1.00 29.58 ? 764 SER B N   1 
ATOM   1433 C CA  . SER B 1 88  ? -0.787  46.494 5.938   1.00 29.40 ? 764 SER B CA  1 
ATOM   1434 C C   . SER B 1 88  ? -0.264  46.315 7.364   1.00 28.15 ? 764 SER B C   1 
ATOM   1435 O O   . SER B 1 88  ? -0.952  45.757 8.215   1.00 27.72 ? 764 SER B O   1 
ATOM   1436 C CB  . SER B 1 88  ? -1.656  47.760 5.856   1.00 29.83 ? 764 SER B CB  1 
ATOM   1437 O OG  . SER B 1 88  ? -2.108  47.961 4.520   1.00 32.91 ? 764 SER B OG  1 
ATOM   1438 N N   . PRO B 1 89  ? 0.953   46.795 7.618   1.00 27.32 ? 765 PRO B N   1 
ATOM   1439 C CA  . PRO B 1 89  ? 1.555   46.736 8.955   1.00 27.30 ? 765 PRO B CA  1 
ATOM   1440 C C   . PRO B 1 89  ? 0.906   47.720 9.925   1.00 27.39 ? 765 PRO B C   1 
ATOM   1441 O O   . PRO B 1 89  ? 0.378   48.739 9.488   1.00 27.18 ? 765 PRO B O   1 
ATOM   1442 C CB  . PRO B 1 89  ? 2.999   47.168 8.697   1.00 26.88 ? 765 PRO B CB  1 
ATOM   1443 C CG  . PRO B 1 89  ? 2.898   48.028 7.514   1.00 26.98 ? 765 PRO B CG  1 
ATOM   1444 C CD  . PRO B 1 89  ? 1.878   47.372 6.628   1.00 27.31 ? 765 PRO B CD  1 
ATOM   1445 N N   . SER B 1 90  ? 0.965   47.419 11.216  1.00 27.56 ? 766 SER B N   1 
ATOM   1446 C CA  . SER B 1 90  ? 0.384   48.297 12.236  1.00 28.12 ? 766 SER B CA  1 
ATOM   1447 C C   . SER B 1 90  ? 1.081   49.654 12.305  1.00 28.20 ? 766 SER B C   1 
ATOM   1448 O O   . SER B 1 90  ? 0.468   50.659 12.668  1.00 28.35 ? 766 SER B O   1 
ATOM   1449 C CB  . SER B 1 90  ? 0.386   47.623 13.607  1.00 28.09 ? 766 SER B CB  1 
ATOM   1450 O OG  . SER B 1 90  ? 1.696   47.327 14.057  1.00 28.57 ? 766 SER B OG  1 
ATOM   1451 N N   . SER B 1 91  ? 2.360   49.676 11.970  1.00 27.99 ? 767 SER B N   1 
ATOM   1452 C CA  . SER B 1 91  ? 3.129   50.911 11.954  1.00 28.29 ? 767 SER B CA  1 
ATOM   1453 C C   . SER B 1 91  ? 4.473   50.666 11.287  1.00 28.49 ? 767 SER B C   1 
ATOM   1454 O O   . SER B 1 91  ? 4.720   49.562 10.800  1.00 28.38 ? 767 SER B O   1 
ATOM   1455 C CB  . SER B 1 91  ? 3.322   51.455 13.370  1.00 28.52 ? 767 SER B CB  1 
ATOM   1456 O OG  . SER B 1 91  ? 4.432   50.865 14.007  1.00 28.04 ? 767 SER B OG  1 
ATOM   1457 N N   . SER B 1 92  ? 5.321   51.696 11.257  1.00 28.30 ? 768 SER B N   1 
ATOM   1458 C CA  . SER B 1 92  ? 6.636   51.614 10.628  1.00 28.95 ? 768 SER B CA  1 
ATOM   1459 C C   . SER B 1 92  ? 7.792   51.778 11.608  1.00 28.61 ? 768 SER B C   1 
ATOM   1460 O O   . SER B 1 92  ? 8.924   51.996 11.189  1.00 29.12 ? 768 SER B O   1 
ATOM   1461 C CB  . SER B 1 92  ? 6.770   52.666 9.519   1.00 29.06 ? 768 SER B CB  1 
ATOM   1462 O OG  . SER B 1 92  ? 5.901   52.403 8.426   1.00 30.79 ? 768 SER B OG  1 
ATOM   1463 N N   . ILE B 1 93  ? 7.523   51.692 12.903  1.00 28.26 ? 769 ILE B N   1 
ATOM   1464 C CA  . ILE B 1 93  ? 8.588   51.828 13.896  1.00 28.98 ? 769 ILE B CA  1 
ATOM   1465 C C   . ILE B 1 93  ? 8.586   50.689 14.890  1.00 28.67 ? 769 ILE B C   1 
ATOM   1466 O O   . ILE B 1 93  ? 7.550   50.368 15.462  1.00 27.97 ? 769 ILE B O   1 
ATOM   1467 C CB  . ILE B 1 93  ? 8.481   53.161 14.677  1.00 29.34 ? 769 ILE B CB  1 
ATOM   1468 C CG1 . ILE B 1 93  ? 8.734   54.351 13.758  1.00 30.69 ? 769 ILE B CG1 1 
ATOM   1469 C CG2 . ILE B 1 93  ? 9.457   53.180 15.845  1.00 30.28 ? 769 ILE B CG2 1 
ATOM   1470 C CD1 . ILE B 1 93  ? 8.740   55.698 14.500  1.00 34.29 ? 769 ILE B CD1 1 
ATOM   1471 N N   . VAL B 1 94  ? 9.742   50.059 15.085  1.00 28.53 ? 770 VAL B N   1 
ATOM   1472 C CA  . VAL B 1 94  ? 9.858   49.050 16.125  1.00 28.69 ? 770 VAL B CA  1 
ATOM   1473 C C   . VAL B 1 94  ? 10.481  49.785 17.311  1.00 29.54 ? 770 VAL B C   1 
ATOM   1474 O O   . VAL B 1 94  ? 11.649  50.154 17.272  1.00 29.16 ? 770 VAL B O   1 
ATOM   1475 C CB  . VAL B 1 94  ? 10.741  47.871 15.686  1.00 28.40 ? 770 VAL B CB  1 
ATOM   1476 C CG1 . VAL B 1 94  ? 10.456  46.663 16.549  1.00 28.17 ? 770 VAL B CG1 1 
ATOM   1477 C CG2 . VAL B 1 94  ? 10.486  47.536 14.230  1.00 27.42 ? 770 VAL B CG2 1 
ATOM   1478 N N   . PRO B 1 95  ? 9.690   50.015 18.354  1.00 30.46 ? 771 PRO B N   1 
ATOM   1479 C CA  . PRO B 1 95  ? 10.121  50.812 19.510  1.00 31.44 ? 771 PRO B CA  1 
ATOM   1480 C C   . PRO B 1 95  ? 11.255  50.204 20.332  1.00 31.89 ? 771 PRO B C   1 
ATOM   1481 O O   . PRO B 1 95  ? 11.275  48.997 20.553  1.00 32.02 ? 771 PRO B O   1 
ATOM   1482 C CB  . PRO B 1 95  ? 8.847   50.889 20.372  1.00 31.64 ? 771 PRO B CB  1 
ATOM   1483 C CG  . PRO B 1 95  ? 7.744   50.564 19.451  1.00 31.57 ? 771 PRO B CG  1 
ATOM   1484 C CD  . PRO B 1 95  ? 8.308   49.533 18.508  1.00 30.88 ? 771 PRO B CD  1 
ATOM   1485 N N   . ALA B 1 96  ? 12.170  51.047 20.808  1.00 32.59 ? 772 ALA B N   1 
ATOM   1486 C CA  . ALA B 1 96  ? 13.276  50.580 21.634  1.00 32.93 ? 772 ALA B CA  1 
ATOM   1487 C C   . ALA B 1 96  ? 12.782  49.947 22.934  1.00 33.31 ? 772 ALA B C   1 
ATOM   1488 O O   . ALA B 1 96  ? 11.627  50.110 23.311  1.00 33.25 ? 772 ALA B O   1 
ATOM   1489 C CB  . ALA B 1 96  ? 14.230  51.725 21.927  1.00 33.09 ? 772 ALA B CB  1 
ATOM   1490 N N   . PHE B 1 97  ? 13.664  49.206 23.599  1.00 33.91 ? 773 PHE B N   1 
ATOM   1491 C CA  . PHE B 1 97  ? 13.371  48.580 24.891  1.00 34.79 ? 773 PHE B CA  1 
ATOM   1492 C C   . PHE B 1 97  ? 12.134  47.679 24.941  1.00 34.73 ? 773 PHE B C   1 
ATOM   1493 O O   . PHE B 1 97  ? 11.504  47.542 25.996  1.00 34.46 ? 773 PHE B O   1 
ATOM   1494 C CB  . PHE B 1 97  ? 13.260  49.650 25.989  1.00 35.31 ? 773 PHE B CB  1 
ATOM   1495 C CG  . PHE B 1 97  ? 14.471  50.530 26.108  1.00 36.90 ? 773 PHE B CG  1 
ATOM   1496 C CD1 . PHE B 1 97  ? 14.574  51.698 25.362  1.00 38.34 ? 773 PHE B CD1 1 
ATOM   1497 C CD2 . PHE B 1 97  ? 15.506  50.194 26.966  1.00 38.28 ? 773 PHE B CD2 1 
ATOM   1498 C CE1 . PHE B 1 97  ? 15.686  52.514 25.475  1.00 39.34 ? 773 PHE B CE1 1 
ATOM   1499 C CE2 . PHE B 1 97  ? 16.619  51.002 27.085  1.00 38.79 ? 773 PHE B CE2 1 
ATOM   1500 C CZ  . PHE B 1 97  ? 16.712  52.163 26.340  1.00 39.86 ? 773 PHE B CZ  1 
ATOM   1501 N N   . ASN B 1 98  ? 11.789  47.063 23.815  1.00 34.54 ? 774 ASN B N   1 
ATOM   1502 C CA  . ASN B 1 98  ? 10.640  46.165 23.764  1.00 34.57 ? 774 ASN B CA  1 
ATOM   1503 C C   . ASN B 1 98  ? 9.348   46.785 24.297  1.00 34.27 ? 774 ASN B C   1 
ATOM   1504 O O   . ASN B 1 98  ? 8.551   46.103 24.944  1.00 33.95 ? 774 ASN B O   1 
ATOM   1505 C CB  . ASN B 1 98  ? 10.945  44.875 24.534  1.00 34.88 ? 774 ASN B CB  1 
ATOM   1506 C CG  . ASN B 1 98  ? 12.044  44.043 23.876  1.00 35.95 ? 774 ASN B CG  1 
ATOM   1507 O OD1 . ASN B 1 98  ? 11.911  43.611 22.731  1.00 35.52 ? 774 ASN B OD1 1 
ATOM   1508 N ND2 . ASN B 1 98  ? 13.132  43.818 24.604  1.00 36.55 ? 774 ASN B ND2 1 
ATOM   1509 N N   . THR B 1 99  ? 9.132   48.067 24.008  1.00 34.01 ? 775 THR B N   1 
ATOM   1510 C CA  . THR B 1 99  ? 7.947   48.765 24.516  1.00 33.99 ? 775 THR B CA  1 
ATOM   1511 C C   . THR B 1 99  ? 6.748   48.695 23.583  1.00 33.75 ? 775 THR B C   1 
ATOM   1512 O O   . THR B 1 99  ? 5.685   49.252 23.872  1.00 33.88 ? 775 THR B O   1 
ATOM   1513 C CB  . THR B 1 99  ? 8.270   50.236 24.820  1.00 34.05 ? 775 THR B CB  1 
ATOM   1514 O OG1 . THR B 1 99  ? 8.821   50.857 23.654  1.00 34.65 ? 775 THR B OG1 1 
ATOM   1515 C CG2 . THR B 1 99  ? 9.396   50.336 25.846  1.00 34.36 ? 775 THR B CG2 1 
ATOM   1516 N N   . GLY B 1 100 ? 6.920   48.023 22.453  1.00 32.79 ? 776 GLY B N   1 
ATOM   1517 C CA  . GLY B 1 100 ? 5.838   47.872 21.502  1.00 31.96 ? 776 GLY B CA  1 
ATOM   1518 C C   . GLY B 1 100 ? 6.282   46.984 20.358  1.00 31.31 ? 776 GLY B C   1 
ATOM   1519 O O   . GLY B 1 100 ? 7.466   46.690 20.222  1.00 30.86 ? 776 GLY B O   1 
ATOM   1520 N N   . THR B 1 101 ? 5.333   46.557 19.533  1.00 30.76 ? 777 THR B N   1 
ATOM   1521 C CA  . THR B 1 101 ? 5.665   45.725 18.385  1.00 29.98 ? 777 THR B CA  1 
ATOM   1522 C C   . THR B 1 101 ? 4.986   46.243 17.137  1.00 29.09 ? 777 THR B C   1 
ATOM   1523 O O   . THR B 1 101 ? 4.035   47.023 17.213  1.00 28.83 ? 777 THR B O   1 
ATOM   1524 C CB  . THR B 1 101 ? 5.194   44.270 18.609  1.00 30.37 ? 777 THR B CB  1 
ATOM   1525 O OG1 . THR B 1 101 ? 3.757   44.218 18.603  1.00 31.51 ? 777 THR B OG1 1 
ATOM   1526 C CG2 . THR B 1 101 ? 5.581   43.778 19.992  1.00 30.36 ? 777 THR B CG2 1 
ATOM   1527 N N   . ILE B 1 102 ? 5.467   45.803 15.983  1.00 27.34 ? 778 ILE B N   1 
ATOM   1528 C CA  . ILE B 1 102 ? 4.773   46.052 14.743  1.00 26.23 ? 778 ILE B CA  1 
ATOM   1529 C C   . ILE B 1 102 ? 4.069   44.734 14.455  1.00 26.26 ? 778 ILE B C   1 
ATOM   1530 O O   . ILE B 1 102 ? 4.671   43.655 14.568  1.00 25.53 ? 778 ILE B O   1 
ATOM   1531 C CB  . ILE B 1 102 ? 5.740   46.393 13.601  1.00 26.47 ? 778 ILE B CB  1 
ATOM   1532 C CG1 . ILE B 1 102 ? 6.382   47.762 13.827  1.00 25.51 ? 778 ILE B CG1 1 
ATOM   1533 C CG2 . ILE B 1 102 ? 5.004   46.375 12.276  1.00 24.53 ? 778 ILE B CG2 1 
ATOM   1534 C CD1 . ILE B 1 102 ? 7.261   48.236 12.656  1.00 23.22 ? 778 ILE B CD1 1 
ATOM   1535 N N   . THR B 1 103 ? 2.786   44.812 14.129  1.00 25.47 ? 779 THR B N   1 
ATOM   1536 C CA  . THR B 1 103 ? 2.015   43.629 13.792  1.00 25.70 ? 779 THR B CA  1 
ATOM   1537 C C   . THR B 1 103 ? 1.702   43.692 12.316  1.00 24.66 ? 779 THR B C   1 
ATOM   1538 O O   . THR B 1 103 ? 1.369   44.750 11.800  1.00 24.54 ? 779 THR B O   1 
ATOM   1539 C CB  . THR B 1 103 ? 0.709   43.613 14.609  1.00 25.97 ? 779 THR B CB  1 
ATOM   1540 O OG1 . THR B 1 103 ? 1.025   43.454 15.998  1.00 28.32 ? 779 THR B OG1 1 
ATOM   1541 C CG2 . THR B 1 103 ? -0.107  42.368 14.288  1.00 26.66 ? 779 THR B CG2 1 
ATOM   1542 N N   . GLN B 1 104 ? 1.831   42.571 11.611  1.00 23.68 ? 780 GLN B N   1 
ATOM   1543 C CA  . GLN B 1 104 ? 1.474   42.536 10.202  1.00 22.83 ? 780 GLN B CA  1 
ATOM   1544 C C   . GLN B 1 104 ? 1.010   41.125 9.867   1.00 22.88 ? 780 GLN B C   1 
ATOM   1545 O O   . GLN B 1 104 ? 1.617   40.136 10.281  1.00 21.52 ? 780 GLN B O   1 
ATOM   1546 C CB  . GLN B 1 104 ? 2.648   42.957 9.313   1.00 22.77 ? 780 GLN B CB  1 
ATOM   1547 C CG  . GLN B 1 104 ? 2.343   43.056 7.827   1.00 22.66 ? 780 GLN B CG  1 
ATOM   1548 C CD  . GLN B 1 104 ? 3.460   43.732 7.046   1.00 21.75 ? 780 GLN B CD  1 
ATOM   1549 O OE1 . GLN B 1 104 ? 4.560   43.931 7.566   1.00 21.13 ? 780 GLN B OE1 1 
ATOM   1550 N NE2 . GLN B 1 104 ? 3.182   44.090 5.800   1.00 23.99 ? 780 GLN B NE2 1 
ATOM   1551 N N   . VAL B 1 105 ? -0.082  41.048 9.122   1.00 22.76 ? 781 VAL B N   1 
ATOM   1552 C CA  . VAL B 1 105 ? -0.665  39.767 8.778   1.00 23.09 ? 781 VAL B CA  1 
ATOM   1553 C C   . VAL B 1 105 ? -0.277  39.324 7.359   1.00 23.34 ? 781 VAL B C   1 
ATOM   1554 O O   . VAL B 1 105 ? -0.283  40.117 6.411   1.00 23.09 ? 781 VAL B O   1 
ATOM   1555 C CB  . VAL B 1 105 ? -2.189  39.845 8.935   1.00 22.79 ? 781 VAL B CB  1 
ATOM   1556 C CG1 . VAL B 1 105 ? -2.872  38.632 8.323   1.00 21.53 ? 781 VAL B CG1 1 
ATOM   1557 C CG2 . VAL B 1 105 ? -2.569  40.015 10.412  1.00 23.36 ? 781 VAL B CG2 1 
ATOM   1558 N N   . ILE B 1 106 ? 0.081   38.049 7.237   1.00 23.68 ? 782 ILE B N   1 
ATOM   1559 C CA  . ILE B 1 106 ? 0.379   37.420 5.962   1.00 24.26 ? 782 ILE B CA  1 
ATOM   1560 C C   . ILE B 1 106 ? -0.614  36.277 5.805   1.00 24.29 ? 782 ILE B C   1 
ATOM   1561 O O   . ILE B 1 106 ? -0.836  35.526 6.753   1.00 24.53 ? 782 ILE B O   1 
ATOM   1562 C CB  . ILE B 1 106 ? 1.781   36.749 5.963   1.00 24.21 ? 782 ILE B CB  1 
ATOM   1563 C CG1 . ILE B 1 106 ? 2.888   37.665 6.466   1.00 26.35 ? 782 ILE B CG1 1 
ATOM   1564 C CG2 . ILE B 1 106 ? 2.125   36.239 4.568   1.00 25.17 ? 782 ILE B CG2 1 
ATOM   1565 C CD1 . ILE B 1 106 ? 4.240   36.954 6.413   1.00 25.97 ? 782 ILE B CD1 1 
ATOM   1566 N N   . LYS B 1 107 ? -1.184  36.124 4.613   1.00 24.10 ? 783 LYS B N   1 
ATOM   1567 C CA  . LYS B 1 107 ? -2.082  35.012 4.340   1.00 24.90 ? 783 LYS B CA  1 
ATOM   1568 C C   . LYS B 1 107 ? -1.438  34.125 3.282   1.00 24.19 ? 783 LYS B C   1 
ATOM   1569 O O   . LYS B 1 107 ? -0.954  34.611 2.259   1.00 24.17 ? 783 LYS B O   1 
ATOM   1570 C CB  . LYS B 1 107 ? -3.456  35.492 3.857   1.00 24.88 ? 783 LYS B CB  1 
ATOM   1571 C CG  . LYS B 1 107 ? -4.297  36.191 4.932   1.00 27.45 ? 783 LYS B CG  1 
ATOM   1572 C CD  . LYS B 1 107 ? -5.634  36.651 4.359   1.00 30.74 ? 783 LYS B CD  1 
ATOM   1573 C CE  . LYS B 1 107 ? -6.316  37.658 5.283   1.00 33.34 ? 783 LYS B CE  1 
ATOM   1574 N NZ  . LYS B 1 107 ? -7.549  38.233 4.628   1.00 34.93 ? 783 LYS B NZ  1 
ATOM   1575 N N   . VAL B 1 108 ? -1.423  32.825 3.549   1.00 24.29 ? 784 VAL B N   1 
ATOM   1576 C CA  . VAL B 1 108 ? -0.814  31.872 2.628   1.00 24.47 ? 784 VAL B CA  1 
ATOM   1577 C C   . VAL B 1 108 ? -1.813  30.793 2.210   1.00 24.40 ? 784 VAL B C   1 
ATOM   1578 O O   . VAL B 1 108 ? -2.442  30.143 3.054   1.00 24.27 ? 784 VAL B O   1 
ATOM   1579 C CB  . VAL B 1 108 ? 0.420   31.199 3.260   1.00 24.62 ? 784 VAL B CB  1 
ATOM   1580 C CG1 . VAL B 1 108 ? 0.948   30.098 2.356   1.00 24.79 ? 784 VAL B CG1 1 
ATOM   1581 C CG2 . VAL B 1 108 ? 1.519   32.220 3.538   1.00 25.09 ? 784 VAL B CG2 1 
ATOM   1582 N N   . LEU B 1 109 ? -1.955  30.621 0.903   1.00 25.07 ? 785 LEU B N   1 
ATOM   1583 C CA  . LEU B 1 109 ? -2.826  29.606 0.348   1.00 25.73 ? 785 LEU B CA  1 
ATOM   1584 C C   . LEU B 1 109 ? -1.928  28.434 -0.026  1.00 25.68 ? 785 LEU B C   1 
ATOM   1585 O O   . LEU B 1 109 ? -0.965  28.612 -0.762  1.00 26.19 ? 785 LEU B O   1 
ATOM   1586 C CB  . LEU B 1 109 ? -3.533  30.173 -0.880  1.00 26.15 ? 785 LEU B CB  1 
ATOM   1587 C CG  . LEU B 1 109 ? -4.541  29.272 -1.587  1.00 27.09 ? 785 LEU B CG  1 
ATOM   1588 C CD1 . LEU B 1 109 ? -5.604  28.780 -0.610  1.00 29.89 ? 785 LEU B CD1 1 
ATOM   1589 C CD2 . LEU B 1 109 ? -5.186  30.030 -2.747  1.00 30.64 ? 785 LEU B CD2 1 
ATOM   1590 N N   . ASN B 1 110 ? -2.222  27.250 0.501   1.00 26.70 ? 786 ASN B N   1 
ATOM   1591 C CA  . ASN B 1 110 ? -1.391  26.076 0.252   1.00 27.36 ? 786 ASN B CA  1 
ATOM   1592 C C   . ASN B 1 110 ? -2.255  24.893 -0.144  1.00 28.57 ? 786 ASN B C   1 
ATOM   1593 O O   . ASN B 1 110 ? -2.426  23.969 0.637   1.00 29.16 ? 786 ASN B O   1 
ATOM   1594 C CB  . ASN B 1 110 ? -0.607  25.736 1.519   1.00 26.61 ? 786 ASN B CB  1 
ATOM   1595 C CG  . ASN B 1 110 ? 0.457   24.687 1.286   1.00 26.50 ? 786 ASN B CG  1 
ATOM   1596 O OD1 . ASN B 1 110 ? 0.508   24.066 0.229   1.00 21.18 ? 786 ASN B OD1 1 
ATOM   1597 N ND2 . ASN B 1 110 ? 1.316   24.486 2.279   1.00 25.89 ? 786 ASN B ND2 1 
ATOM   1598 N N   . PRO B 1 111 ? -2.778  24.927 -1.365  1.00 29.78 ? 787 PRO B N   1 
ATOM   1599 C CA  . PRO B 1 111 ? -3.735  23.927 -1.857  1.00 30.42 ? 787 PRO B CA  1 
ATOM   1600 C C   . PRO B 1 111 ? -3.242  22.493 -1.774  1.00 30.90 ? 787 PRO B C   1 
ATOM   1601 O O   . PRO B 1 111 ? -4.029  21.611 -1.428  1.00 31.59 ? 787 PRO B O   1 
ATOM   1602 C CB  . PRO B 1 111 ? -3.914  24.315 -3.325  1.00 30.27 ? 787 PRO B CB  1 
ATOM   1603 C CG  . PRO B 1 111 ? -3.581  25.731 -3.379  1.00 30.80 ? 787 PRO B CG  1 
ATOM   1604 C CD  . PRO B 1 111 ? -2.456  25.930 -2.389  1.00 29.83 ? 787 PRO B CD  1 
ATOM   1605 N N   . GLN B 1 112 ? -1.968  22.266 -2.085  1.00 31.16 ? 788 GLN B N   1 
ATOM   1606 C CA  . GLN B 1 112 ? -1.409  20.917 -2.055  1.00 31.22 ? 788 GLN B CA  1 
ATOM   1607 C C   . GLN B 1 112 ? -0.957  20.483 -0.658  1.00 30.63 ? 788 GLN B C   1 
ATOM   1608 O O   . GLN B 1 112 ? -0.513  19.344 -0.473  1.00 30.56 ? 788 GLN B O   1 
ATOM   1609 C CB  . GLN B 1 112 ? -0.250  20.793 -3.047  1.00 31.83 ? 788 GLN B CB  1 
ATOM   1610 C CG  . GLN B 1 112 ? -0.563  21.261 -4.468  1.00 35.09 ? 788 GLN B CG  1 
ATOM   1611 C CD  . GLN B 1 112 ? -1.756  20.544 -5.061  1.00 38.79 ? 788 GLN B CD  1 
ATOM   1612 O OE1 . GLN B 1 112 ? -1.773  19.315 -5.138  1.00 40.62 ? 788 GLN B OE1 1 
ATOM   1613 N NE2 . GLN B 1 112 ? -2.764  21.308 -5.473  1.00 40.39 ? 788 GLN B NE2 1 
ATOM   1614 N N   . LYS B 1 113 ? -1.098  21.377 0.323   1.00 29.44 ? 789 LYS B N   1 
ATOM   1615 C CA  . LYS B 1 113 ? -0.719  21.088 1.708   1.00 28.62 ? 789 LYS B CA  1 
ATOM   1616 C C   . LYS B 1 113 ? 0.725   20.609 1.775   1.00 26.99 ? 789 LYS B C   1 
ATOM   1617 O O   . LYS B 1 113 ? 1.026   19.607 2.427   1.00 26.67 ? 789 LYS B O   1 
ATOM   1618 C CB  . LYS B 1 113 ? -1.640  20.044 2.338   1.00 29.09 ? 789 LYS B CB  1 
ATOM   1619 C CG  . LYS B 1 113 ? -3.052  20.540 2.678   1.00 32.16 ? 789 LYS B CG  1 
ATOM   1620 C CD  . LYS B 1 113 ? -3.876  19.389 3.246   1.00 35.44 ? 789 LYS B CD  1 
ATOM   1621 C CE  . LYS B 1 113 ? -4.765  19.835 4.390   1.00 38.45 ? 789 LYS B CE  1 
ATOM   1622 N NZ  . LYS B 1 113 ? -4.934  18.738 5.403   1.00 40.99 ? 789 LYS B NZ  1 
ATOM   1623 N N   . GLN B 1 114 ? 1.602   21.312 1.075   1.00 25.09 ? 790 GLN B N   1 
ATOM   1624 C CA  . GLN B 1 114 ? 3.002   20.936 1.008   1.00 23.72 ? 790 GLN B CA  1 
ATOM   1625 C C   . GLN B 1 114 ? 3.881   21.772 1.936   1.00 21.93 ? 790 GLN B C   1 
ATOM   1626 O O   . GLN B 1 114 ? 3.471   22.829 2.416   1.00 20.73 ? 790 GLN B O   1 
ATOM   1627 C CB  . GLN B 1 114 ? 3.506   21.068 -0.429  1.00 24.25 ? 790 GLN B CB  1 
ATOM   1628 C CG  . GLN B 1 114 ? 3.148   19.873 -1.300  1.00 27.97 ? 790 GLN B CG  1 
ATOM   1629 C CD  . GLN B 1 114 ? 3.259   20.171 -2.778  1.00 31.01 ? 790 GLN B CD  1 
ATOM   1630 O OE1 . GLN B 1 114 ? 3.612   19.295 -3.568  1.00 34.82 ? 790 GLN B OE1 1 
ATOM   1631 N NE2 . GLN B 1 114 ? 2.941   21.400 -3.161  1.00 33.13 ? 790 GLN B NE2 1 
ATOM   1632 N N   . GLN B 1 115 ? 5.084   21.268 2.188   1.00 19.54 ? 791 GLN B N   1 
ATOM   1633 C CA  . GLN B 1 115 ? 6.070   21.943 3.035   1.00 18.55 ? 791 GLN B CA  1 
ATOM   1634 C C   . GLN B 1 115 ? 6.202   23.424 2.729   1.00 18.06 ? 791 GLN B C   1 
ATOM   1635 O O   . GLN B 1 115 ? 6.637   23.808 1.640   1.00 17.74 ? 791 GLN B O   1 
ATOM   1636 C CB  . GLN B 1 115 ? 7.438   21.269 2.869   1.00 18.39 ? 791 GLN B CB  1 
ATOM   1637 C CG  . GLN B 1 115 ? 8.555   22.017 3.588   1.00 17.71 ? 791 GLN B CG  1 
ATOM   1638 C CD  . GLN B 1 115 ? 8.404   21.936 5.089   1.00 18.05 ? 791 GLN B CD  1 
ATOM   1639 O OE1 . GLN B 1 115 ? 8.351   20.845 5.639   1.00 18.29 ? 791 GLN B OE1 1 
ATOM   1640 N NE2 . GLN B 1 115 ? 8.333   23.095 5.758   1.00 15.05 ? 791 GLN B NE2 1 
ATOM   1641 N N   . LEU B 1 116 ? 5.851   24.264 3.700   1.00 17.36 ? 792 LEU B N   1 
ATOM   1642 C CA  . LEU B 1 116 ? 5.907   25.709 3.520   1.00 17.58 ? 792 LEU B CA  1 
ATOM   1643 C C   . LEU B 1 116 ? 7.344   26.188 3.409   1.00 17.67 ? 792 LEU B C   1 
ATOM   1644 O O   . LEU B 1 116 ? 8.237   25.653 4.070   1.00 16.67 ? 792 LEU B O   1 
ATOM   1645 C CB  . LEU B 1 116 ? 5.189   26.386 4.695   1.00 18.43 ? 792 LEU B CB  1 
ATOM   1646 C CG  . LEU B 1 116 ? 4.721   27.823 4.651   1.00 21.30 ? 792 LEU B CG  1 
ATOM   1647 C CD1 . LEU B 1 116 ? 4.052   28.144 3.306   1.00 22.00 ? 792 LEU B CD1 1 
ATOM   1648 C CD2 . LEU B 1 116 ? 3.767   28.036 5.839   1.00 23.20 ? 792 LEU B CD2 1 
ATOM   1649 N N   . ARG B 1 117 ? 7.579   27.126 2.491   1.00 17.11 ? 793 ARG B N   1 
ATOM   1650 C CA  . ARG B 1 117 ? 8.871   27.750 2.321   1.00 17.49 ? 793 ARG B CA  1 
ATOM   1651 C C   . ARG B 1 117 ? 8.603   29.237 2.168   1.00 16.81 ? 793 ARG B C   1 
ATOM   1652 O O   . ARG B 1 117 ? 7.585   29.626 1.588   1.00 17.60 ? 793 ARG B O   1 
ATOM   1653 C CB  . ARG B 1 117 ? 9.637   27.251 1.090   1.00 18.12 ? 793 ARG B CB  1 
ATOM   1654 C CG  . ARG B 1 117 ? 10.180  25.829 1.215   1.00 20.66 ? 793 ARG B CG  1 
ATOM   1655 C CD  . ARG B 1 117 ? 10.850  25.292 -0.050  1.00 24.62 ? 793 ARG B CD  1 
ATOM   1656 N NE  . ARG B 1 117 ? 12.040  26.053 -0.409  1.00 26.91 ? 793 ARG B NE  1 
ATOM   1657 C CZ  . ARG B 1 117 ? 12.327  26.451 -1.640  1.00 29.12 ? 793 ARG B CZ  1 
ATOM   1658 N NH1 . ARG B 1 117 ? 11.511  26.149 -2.637  1.00 29.08 ? 793 ARG B NH1 1 
ATOM   1659 N NH2 . ARG B 1 117 ? 13.436  27.146 -1.876  1.00 29.95 ? 793 ARG B NH2 1 
ATOM   1660 N N   . MET B 1 118 ? 9.486   30.052 2.708   1.00 16.40 ? 794 MET B N   1 
ATOM   1661 C CA  . MET B 1 118 ? 9.310   31.496 2.650   1.00 16.92 ? 794 MET B CA  1 
ATOM   1662 C C   . MET B 1 118 ? 10.647  32.201 2.821   1.00 17.71 ? 794 MET B C   1 
ATOM   1663 O O   . MET B 1 118 ? 11.518  31.735 3.568   1.00 17.78 ? 794 MET B O   1 
ATOM   1664 C CB  . MET B 1 118 ? 8.335   31.954 3.752   1.00 16.48 ? 794 MET B CB  1 
ATOM   1665 C CG  . MET B 1 118 ? 8.029   33.454 3.728   1.00 16.06 ? 794 MET B CG  1 
ATOM   1666 S SD  . MET B 1 118 ? 6.916   33.938 5.104   1.00 18.41 ? 794 MET B SD  1 
ATOM   1667 C CE  . MET B 1 118 ? 5.399   33.274 4.584   1.00 18.52 ? 794 MET B CE  1 
ATOM   1668 N N   . ARG B 1 119 ? 10.821  33.305 2.096   1.00 17.99 ? 795 ARG B N   1 
ATOM   1669 C CA  . ARG B 1 119 ? 11.958  34.149 2.271   1.00 19.25 ? 795 ARG B CA  1 
ATOM   1670 C C   . ARG B 1 119 ? 11.419  35.493 2.691   1.00 19.15 ? 795 ARG B C   1 
ATOM   1671 O O   . ARG B 1 119 ? 10.401  35.960 2.181   1.00 19.51 ? 795 ARG B O   1 
ATOM   1672 C CB  . ARG B 1 119 ? 12.781  34.303 0.991   1.00 20.05 ? 795 ARG B CB  1 
ATOM   1673 C CG  . ARG B 1 119 ? 13.681  33.127 0.747   1.00 23.80 ? 795 ARG B CG  1 
ATOM   1674 C CD  . ARG B 1 119 ? 14.454  33.193 -0.536  1.00 28.66 ? 795 ARG B CD  1 
ATOM   1675 N NE  . ARG B 1 119 ? 15.344  32.045 -0.646  1.00 34.15 ? 795 ARG B NE  1 
ATOM   1676 C CZ  . ARG B 1 119 ? 15.682  31.475 -1.793  1.00 36.25 ? 795 ARG B CZ  1 
ATOM   1677 N NH1 . ARG B 1 119 ? 15.193  31.948 -2.933  1.00 37.66 ? 795 ARG B NH1 1 
ATOM   1678 N NH2 . ARG B 1 119 ? 16.501  30.428 -1.799  1.00 37.61 ? 795 ARG B NH2 1 
ATOM   1679 N N   . ILE B 1 120 ? 12.107  36.103 3.635   1.00 19.09 ? 796 ILE B N   1 
ATOM   1680 C CA  . ILE B 1 120 ? 11.683  37.407 4.114   1.00 19.44 ? 796 ILE B CA  1 
ATOM   1681 C C   . ILE B 1 120 ? 12.791  38.410 3.890   1.00 20.51 ? 796 ILE B C   1 
ATOM   1682 O O   . ILE B 1 120 ? 13.971  38.072 3.867   1.00 20.28 ? 796 ILE B O   1 
ATOM   1683 C CB  . ILE B 1 120 ? 11.265  37.338 5.589   1.00 18.59 ? 796 ILE B CB  1 
ATOM   1684 C CG1 . ILE B 1 120 ? 12.465  37.020 6.493   1.00 17.91 ? 796 ILE B CG1 1 
ATOM   1685 C CG2 . ILE B 1 120 ? 10.173  36.304 5.737   1.00 17.44 ? 796 ILE B CG2 1 
ATOM   1686 C CD1 . ILE B 1 120 ? 12.166  37.152 8.005   1.00 17.74 ? 796 ILE B CD1 1 
ATOM   1687 N N   . LYS B 1 121 ? 12.389  39.658 3.703   1.00 21.23 ? 797 LYS B N   1 
ATOM   1688 C CA  . LYS B 1 121 ? 13.333  40.736 3.490   1.00 21.99 ? 797 LYS B CA  1 
ATOM   1689 C C   . LYS B 1 121 ? 12.953  41.842 4.448   1.00 21.98 ? 797 LYS B C   1 
ATOM   1690 O O   . LYS B 1 121 ? 11.789  42.235 4.511   1.00 21.50 ? 797 LYS B O   1 
ATOM   1691 C CB  . LYS B 1 121 ? 13.243  41.240 2.052   1.00 22.26 ? 797 LYS B CB  1 
ATOM   1692 C CG  . LYS B 1 121 ? 14.031  42.522 1.817   1.00 25.66 ? 797 LYS B CG  1 
ATOM   1693 C CD  . LYS B 1 121 ? 14.098  42.899 0.347   1.00 28.24 ? 797 LYS B CD  1 
ATOM   1694 C CE  . LYS B 1 121 ? 15.115  44.025 0.111   1.00 31.38 ? 797 LYS B CE  1 
ATOM   1695 N NZ  . LYS B 1 121 ? 15.101  44.503 -1.317  1.00 33.83 ? 797 LYS B NZ  1 
ATOM   1696 N N   . LEU B 1 122 ? 13.933  42.326 5.200   1.00 22.37 ? 798 LEU B N   1 
ATOM   1697 C CA  . LEU B 1 122 ? 13.704  43.339 6.216   1.00 23.27 ? 798 LEU B CA  1 
ATOM   1698 C C   . LEU B 1 122 ? 14.566  44.549 5.923   1.00 24.56 ? 798 LEU B C   1 
ATOM   1699 O O   . LEU B 1 122 ? 15.767  44.419 5.678   1.00 24.78 ? 798 LEU B O   1 
ATOM   1700 C CB  . LEU B 1 122 ? 14.099  42.801 7.592   1.00 22.53 ? 798 LEU B CB  1 
ATOM   1701 C CG  . LEU B 1 122 ? 13.588  41.395 7.912   1.00 22.46 ? 798 LEU B CG  1 
ATOM   1702 C CD1 . LEU B 1 122 ? 14.202  40.879 9.195   1.00 21.65 ? 798 LEU B CD1 1 
ATOM   1703 C CD2 . LEU B 1 122 ? 12.059  41.381 7.976   1.00 20.52 ? 798 LEU B CD2 1 
ATOM   1704 N N   . THR B 1 123 ? 13.961  45.731 5.951   1.00 25.75 ? 799 THR B N   1 
ATOM   1705 C CA  . THR B 1 123 ? 14.714  46.959 5.761   1.00 27.01 ? 799 THR B CA  1 
ATOM   1706 C C   . THR B 1 123 ? 14.253  47.952 6.818   1.00 28.08 ? 799 THR B C   1 
ATOM   1707 O O   . THR B 1 123 ? 13.079  47.984 7.168   1.00 27.88 ? 799 THR B O   1 
ATOM   1708 C CB  . THR B 1 123 ? 14.520  47.551 4.339   1.00 26.94 ? 799 THR B CB  1 
ATOM   1709 O OG1 . THR B 1 123 ? 13.130  47.721 4.070   1.00 28.34 ? 799 THR B OG1 1 
ATOM   1710 C CG2 . THR B 1 123 ? 14.957  46.575 3.258   1.00 27.06 ? 799 THR B CG2 1 
ATOM   1711 N N   . TYR B 1 124 ? 15.188  48.732 7.345   1.00 29.57 ? 800 TYR B N   1 
ATOM   1712 C CA  . TYR B 1 124 ? 14.881  49.743 8.355   1.00 31.14 ? 800 TYR B CA  1 
ATOM   1713 C C   . TYR B 1 124 ? 16.117  50.583 8.645   1.00 32.49 ? 800 TYR B C   1 
ATOM   1714 O O   . TYR B 1 124 ? 17.206  50.280 8.169   1.00 32.57 ? 800 TYR B O   1 
ATOM   1715 C CB  . TYR B 1 124 ? 14.390  49.095 9.656   1.00 30.64 ? 800 TYR B CB  1 
ATOM   1716 C CG  . TYR B 1 124 ? 15.361  48.101 10.267  1.00 30.49 ? 800 TYR B CG  1 
ATOM   1717 C CD1 . TYR B 1 124 ? 16.151  48.449 11.359  1.00 29.50 ? 800 TYR B CD1 1 
ATOM   1718 C CD2 . TYR B 1 124 ? 15.464  46.800 9.769   1.00 30.23 ? 800 TYR B CD2 1 
ATOM   1719 C CE1 . TYR B 1 124 ? 17.033  47.543 11.931  1.00 29.89 ? 800 TYR B CE1 1 
ATOM   1720 C CE2 . TYR B 1 124 ? 16.347  45.890 10.332  1.00 30.34 ? 800 TYR B CE2 1 
ATOM   1721 C CZ  . TYR B 1 124 ? 17.126  46.261 11.407  1.00 30.78 ? 800 TYR B CZ  1 
ATOM   1722 O OH  . TYR B 1 124 ? 17.999  45.353 11.960  1.00 31.77 ? 800 TYR B OH  1 
ATOM   1723 N N   . ASN B 1 125 ? 15.930  51.640 9.431   1.00 34.24 ? 801 ASN B N   1 
ATOM   1724 C CA  . ASN B 1 125 ? 17.021  52.507 9.852   1.00 35.55 ? 801 ASN B CA  1 
ATOM   1725 C C   . ASN B 1 125 ? 17.291  52.321 11.340  1.00 36.23 ? 801 ASN B C   1 
ATOM   1726 O O   . ASN B 1 125 ? 16.362  52.254 12.150  1.00 35.88 ? 801 ASN B O   1 
ATOM   1727 C CB  . ASN B 1 125 ? 16.704  53.971 9.530   1.00 36.00 ? 801 ASN B CB  1 
ATOM   1728 C CG  . ASN B 1 125 ? 16.603  54.227 8.033   1.00 37.28 ? 801 ASN B CG  1 
ATOM   1729 O OD1 . ASN B 1 125 ? 17.423  53.736 7.255   1.00 38.93 ? 801 ASN B OD1 1 
ATOM   1730 N ND2 . ASN B 1 125 ? 15.598  54.997 7.622   1.00 39.42 ? 801 ASN B ND2 1 
ATOM   1731 N N   . HIS B 1 126 ? 18.564  52.233 11.706  1.00 37.07 ? 802 HIS B N   1 
ATOM   1732 C CA  . HIS B 1 126 ? 18.918  52.005 13.095  1.00 38.15 ? 802 HIS B CA  1 
ATOM   1733 C C   . HIS B 1 126 ? 20.277  52.584 13.420  1.00 39.33 ? 802 HIS B C   1 
ATOM   1734 O O   . HIS B 1 126 ? 21.204  52.494 12.618  1.00 39.20 ? 802 HIS B O   1 
ATOM   1735 C CB  . HIS B 1 126 ? 18.930  50.511 13.413  1.00 37.95 ? 802 HIS B CB  1 
ATOM   1736 C CG  . HIS B 1 126 ? 18.892  50.209 14.878  1.00 36.64 ? 802 HIS B CG  1 
ATOM   1737 N ND1 . HIS B 1 126 ? 19.668  49.230 15.460  1.00 36.72 ? 802 HIS B ND1 1 
ATOM   1738 C CD2 . HIS B 1 126 ? 18.168  50.760 15.881  1.00 35.47 ? 802 HIS B CD2 1 
ATOM   1739 C CE1 . HIS B 1 126 ? 19.417  49.186 16.757  1.00 36.59 ? 802 HIS B CE1 1 
ATOM   1740 N NE2 . HIS B 1 126 ? 18.509  50.103 17.038  1.00 35.18 ? 802 HIS B NE2 1 
ATOM   1741 N N   . LYS B 1 127 ? 20.385  53.152 14.617  1.00 40.60 ? 803 LYS B N   1 
ATOM   1742 C CA  . LYS B 1 127 ? 21.621  53.767 15.085  1.00 42.01 ? 803 LYS B CA  1 
ATOM   1743 C C   . LYS B 1 127 ? 22.201  54.705 14.030  1.00 42.17 ? 803 LYS B C   1 
ATOM   1744 O O   . LYS B 1 127 ? 23.414  54.917 13.963  1.00 42.57 ? 803 LYS B O   1 
ATOM   1745 C CB  . LYS B 1 127 ? 22.637  52.697 15.504  1.00 42.36 ? 803 LYS B CB  1 
ATOM   1746 C CG  . LYS B 1 127 ? 22.015  51.534 16.259  1.00 44.06 ? 803 LYS B CG  1 
ATOM   1747 C CD  . LYS B 1 127 ? 22.825  51.118 17.482  1.00 46.60 ? 803 LYS B CD  1 
ATOM   1748 C CE  . LYS B 1 127 ? 22.054  50.061 18.270  1.00 48.28 ? 803 LYS B CE  1 
ATOM   1749 N NZ  . LYS B 1 127 ? 22.264  50.132 19.746  1.00 49.54 ? 803 LYS B NZ  1 
ATOM   1750 N N   . GLY B 1 128 ? 21.316  55.267 13.212  1.00 42.52 ? 804 GLY B N   1 
ATOM   1751 C CA  . GLY B 1 128 ? 21.703  56.196 12.168  1.00 42.86 ? 804 GLY B CA  1 
ATOM   1752 C C   . GLY B 1 128 ? 22.047  55.556 10.840  1.00 43.12 ? 804 GLY B C   1 
ATOM   1753 O O   . GLY B 1 128 ? 22.324  56.256 9.866   1.00 43.66 ? 804 GLY B O   1 
ATOM   1754 N N   . SER B 1 129 ? 22.023  54.228 10.786  1.00 42.94 ? 805 SER B N   1 
ATOM   1755 C CA  . SER B 1 129 ? 22.395  53.516 9.568   1.00 42.71 ? 805 SER B CA  1 
ATOM   1756 C C   . SER B 1 129 ? 21.224  52.739 8.972   1.00 42.06 ? 805 SER B C   1 
ATOM   1757 O O   . SER B 1 129 ? 20.351  52.269 9.700   1.00 41.83 ? 805 SER B O   1 
ATOM   1758 C CB  . SER B 1 129 ? 23.545  52.543 9.856   1.00 43.13 ? 805 SER B CB  1 
ATOM   1759 O OG  . SER B 1 129 ? 24.302  52.948 10.992  1.00 43.84 ? 805 SER B OG  1 
ATOM   1760 N N   . ALA B 1 130 ? 21.210  52.619 7.647   1.00 41.19 ? 806 ALA B N   1 
ATOM   1761 C CA  . ALA B 1 130 ? 20.196  51.829 6.962   1.00 40.13 ? 806 ALA B CA  1 
ATOM   1762 C C   . ALA B 1 130 ? 20.550  50.355 7.101   1.00 39.55 ? 806 ALA B C   1 
ATOM   1763 O O   . ALA B 1 130 ? 21.683  49.954 6.826   1.00 39.56 ? 806 ALA B O   1 
ATOM   1764 C CB  . ALA B 1 130 ? 20.120  52.211 5.495   1.00 40.31 ? 806 ALA B CB  1 
ATOM   1765 N N   . MET B 1 131 ? 19.583  49.549 7.521   1.00 38.22 ? 807 MET B N   1 
ATOM   1766 C CA  . MET B 1 131 ? 19.820  48.126 7.708   1.00 37.44 ? 807 MET B CA  1 
ATOM   1767 C C   . MET B 1 131 ? 19.039  47.302 6.703   1.00 36.22 ? 807 MET B C   1 
ATOM   1768 O O   . MET B 1 131 ? 17.969  47.703 6.251   1.00 35.79 ? 807 MET B O   1 
ATOM   1769 C CB  . MET B 1 131 ? 19.446  47.701 9.128   1.00 37.46 ? 807 MET B CB  1 
ATOM   1770 C CG  . MET B 1 131 ? 20.225  48.408 10.205  1.00 39.85 ? 807 MET B CG  1 
ATOM   1771 S SD  . MET B 1 131 ? 21.928  47.848 10.245  1.00 43.32 ? 807 MET B SD  1 
ATOM   1772 C CE  . MET B 1 131 ? 21.737  46.241 10.989  1.00 44.64 ? 807 MET B CE  1 
ATOM   1773 N N   . GLN B 1 132 ? 19.572  46.136 6.358   1.00 34.91 ? 808 GLN B N   1 
ATOM   1774 C CA  . GLN B 1 132 ? 18.900  45.278 5.402   1.00 33.93 ? 808 GLN B CA  1 
ATOM   1775 C C   . GLN B 1 132 ? 19.307  43.830 5.611   1.00 32.71 ? 808 GLN B C   1 
ATOM   1776 O O   . GLN B 1 132 ? 20.486  43.535 5.806   1.00 32.12 ? 808 GLN B O   1 
ATOM   1777 C CB  . GLN B 1 132 ? 19.240  45.713 3.982   1.00 35.05 ? 808 GLN B CB  1 
ATOM   1778 C CG  . GLN B 1 132 ? 18.285  45.194 2.934   1.00 37.84 ? 808 GLN B CG  1 
ATOM   1779 C CD  . GLN B 1 132 ? 18.280  46.067 1.691   1.00 42.63 ? 808 GLN B CD  1 
ATOM   1780 O OE1 . GLN B 1 132 ? 17.720  45.682 0.664   1.00 44.75 ? 808 GLN B OE1 1 
ATOM   1781 N NE2 . GLN B 1 132 ? 18.905  47.245 1.781   1.00 44.06 ? 808 GLN B NE2 1 
ATOM   1782 N N   . ASP B 1 133 ? 18.326  42.932 5.586   1.00 30.74 ? 809 ASP B N   1 
ATOM   1783 C CA  . ASP B 1 133 ? 18.619  41.509 5.716   1.00 29.11 ? 809 ASP B CA  1 
ATOM   1784 C C   . ASP B 1 133 ? 17.626  40.676 4.908   1.00 28.21 ? 809 ASP B C   1 
ATOM   1785 O O   . ASP B 1 133 ? 16.507  41.102 4.648   1.00 27.66 ? 809 ASP B O   1 
ATOM   1786 C CB  . ASP B 1 133 ? 18.605  41.087 7.188   1.00 28.91 ? 809 ASP B CB  1 
ATOM   1787 C CG  . ASP B 1 133 ? 19.534  39.912 7.474   1.00 29.14 ? 809 ASP B CG  1 
ATOM   1788 O OD1 . ASP B 1 133 ? 20.210  39.431 6.525   1.00 28.72 ? 809 ASP B OD1 1 
ATOM   1789 O OD2 . ASP B 1 133 ? 19.642  39.405 8.614   1.00 27.99 ? 809 ASP B OD2 1 
ATOM   1790 N N   . LEU B 1 134 ? 18.061  39.493 4.490   1.00 27.08 ? 810 LEU B N   1 
ATOM   1791 C CA  . LEU B 1 134 ? 17.205  38.555 3.801   1.00 26.45 ? 810 LEU B CA  1 
ATOM   1792 C C   . LEU B 1 134 ? 17.413  37.245 4.540   1.00 25.59 ? 810 LEU B C   1 
ATOM   1793 O O   . LEU B 1 134 ? 18.541  36.921 4.932   1.00 25.93 ? 810 LEU B O   1 
ATOM   1794 C CB  . LEU B 1 134 ? 17.634  38.396 2.344   1.00 27.56 ? 810 LEU B CB  1 
ATOM   1795 C CG  . LEU B 1 134 ? 17.702  39.681 1.514   1.00 29.35 ? 810 LEU B CG  1 
ATOM   1796 C CD1 . LEU B 1 134 ? 18.801  39.612 0.466   1.00 33.41 ? 810 LEU B CD1 1 
ATOM   1797 C CD2 . LEU B 1 134 ? 16.360  39.956 0.870   1.00 31.02 ? 810 LEU B CD2 1 
ATOM   1798 N N   . ALA B 1 135 ? 16.337  36.506 4.765   1.00 24.14 ? 811 ALA B N   1 
ATOM   1799 C CA  . ALA B 1 135 ? 16.447  35.227 5.461   1.00 22.05 ? 811 ALA B CA  1 
ATOM   1800 C C   . ALA B 1 135 ? 15.451  34.233 4.898   1.00 21.24 ? 811 ALA B C   1 
ATOM   1801 O O   . ALA B 1 135 ? 14.375  34.610 4.436   1.00 20.75 ? 811 ALA B O   1 
ATOM   1802 C CB  . ALA B 1 135 ? 16.218  35.403 6.949   1.00 22.60 ? 811 ALA B CB  1 
ATOM   1803 N N   . GLU B 1 136 ? 15.808  32.957 4.931   1.00 19.72 ? 812 GLU B N   1 
ATOM   1804 C CA  . GLU B 1 136 ? 14.864  31.934 4.523   1.00 19.82 ? 812 GLU B CA  1 
ATOM   1805 C C   . GLU B 1 136 ? 14.375  31.253 5.802   1.00 19.11 ? 812 GLU B C   1 
ATOM   1806 O O   . GLU B 1 136 ? 15.179  30.802 6.631   1.00 18.98 ? 812 GLU B O   1 
ATOM   1807 C CB  . GLU B 1 136 ? 15.507  30.926 3.565   1.00 20.63 ? 812 GLU B CB  1 
ATOM   1808 C CG  . GLU B 1 136 ? 14.570  29.799 3.167   1.00 24.92 ? 812 GLU B CG  1 
ATOM   1809 C CD  . GLU B 1 136 ? 14.805  29.300 1.754   1.00 32.21 ? 812 GLU B CD  1 
ATOM   1810 O OE1 . GLU B 1 136 ? 14.099  28.353 1.326   1.00 37.26 ? 812 GLU B OE1 1 
ATOM   1811 O OE2 . GLU B 1 136 ? 15.691  29.862 1.073   1.00 34.22 ? 812 GLU B OE2 1 
ATOM   1812 N N   . VAL B 1 137 ? 13.062  31.209 5.975   1.00 17.87 ? 813 VAL B N   1 
ATOM   1813 C CA  . VAL B 1 137 ? 12.473  30.591 7.159   1.00 16.60 ? 813 VAL B CA  1 
ATOM   1814 C C   . VAL B 1 137 ? 12.482  29.077 7.051   1.00 16.48 ? 813 VAL B C   1 
ATOM   1815 O O   . VAL B 1 137 ? 11.791  28.497 6.234   1.00 15.70 ? 813 VAL B O   1 
ATOM   1816 C CB  . VAL B 1 137 ? 11.055  31.119 7.400   1.00 17.63 ? 813 VAL B CB  1 
ATOM   1817 C CG1 . VAL B 1 137 ? 10.459  30.523 8.669   1.00 16.65 ? 813 VAL B CG1 1 
ATOM   1818 C CG2 . VAL B 1 137 ? 11.087  32.644 7.462   1.00 17.18 ? 813 VAL B CG2 1 
ATOM   1819 N N   . ASN B 1 138 ? 13.271  28.413 7.880   1.00 15.30 ? 814 ASN B N   1 
ATOM   1820 C CA  . ASN B 1 138 ? 13.282  26.969 7.758   1.00 15.27 ? 814 ASN B CA  1 
ATOM   1821 C C   . ASN B 1 138 ? 12.842  26.284 9.034   1.00 13.98 ? 814 ASN B C   1 
ATOM   1822 O O   . ASN B 1 138 ? 13.174  25.124 9.244   1.00 12.69 ? 814 ASN B O   1 
ATOM   1823 C CB  . ASN B 1 138 ? 14.639  26.434 7.316   1.00 17.07 ? 814 ASN B CB  1 
ATOM   1824 C CG  . ASN B 1 138 ? 14.883  26.605 5.813   1.00 19.35 ? 814 ASN B CG  1 
ATOM   1825 O OD1 . ASN B 1 138 ? 14.106  26.123 4.963   1.00 23.68 ? 814 ASN B OD1 1 
ATOM   1826 N ND2 . ASN B 1 138 ? 15.962  27.264 5.485   1.00 21.54 ? 814 ASN B ND2 1 
ATOM   1827 N N   . ASN B 1 139 ? 12.102  27.014 9.870   1.00 13.33 ? 815 ASN B N   1 
ATOM   1828 C CA  . ASN B 1 139 ? 11.548  26.418 11.080  1.00 12.91 ? 815 ASN B CA  1 
ATOM   1829 C C   . ASN B 1 139 ? 10.016  26.514 11.182  1.00 13.17 ? 815 ASN B C   1 
ATOM   1830 O O   . ASN B 1 139 ? 9.450   26.616 12.290  1.00 12.35 ? 815 ASN B O   1 
ATOM   1831 C CB  . ASN B 1 139 ? 12.245  26.986 12.341  1.00 12.79 ? 815 ASN B CB  1 
ATOM   1832 C CG  . ASN B 1 139 ? 12.018  28.483 12.522  1.00 14.04 ? 815 ASN B CG  1 
ATOM   1833 O OD1 . ASN B 1 139 ? 11.758  29.219 11.554  1.00 14.34 ? 815 ASN B OD1 1 
ATOM   1834 N ND2 . ASN B 1 139 ? 12.130  28.946 13.772  1.00 13.37 ? 815 ASN B ND2 1 
ATOM   1835 N N   . PHE B 1 140 ? 9.321   26.467 10.045  1.00 12.36 ? 816 PHE B N   1 
ATOM   1836 C CA  . PHE B 1 140 ? 7.860   26.393 10.132  1.00 12.72 ? 816 PHE B CA  1 
ATOM   1837 C C   . PHE B 1 140 ? 7.479   25.077 10.808  1.00 12.76 ? 816 PHE B C   1 
ATOM   1838 O O   . PHE B 1 140 ? 8.013   24.020 10.469  1.00 12.05 ? 816 PHE B O   1 
ATOM   1839 C CB  . PHE B 1 140 ? 7.211   26.395 8.744   1.00 12.70 ? 816 PHE B CB  1 
ATOM   1840 C CG  . PHE B 1 140 ? 7.224   27.742 8.053   1.00 12.51 ? 816 PHE B CG  1 
ATOM   1841 C CD1 . PHE B 1 140 ? 8.051   27.974 6.961   1.00 12.30 ? 816 PHE B CD1 1 
ATOM   1842 C CD2 . PHE B 1 140 ? 6.411   28.787 8.503   1.00 14.34 ? 816 PHE B CD2 1 
ATOM   1843 C CE1 . PHE B 1 140 ? 8.035   29.221 6.312   1.00 12.42 ? 816 PHE B CE1 1 
ATOM   1844 C CE2 . PHE B 1 140 ? 6.410   30.046 7.863   1.00 14.74 ? 816 PHE B CE2 1 
ATOM   1845 C CZ  . PHE B 1 140 ? 7.210   30.259 6.774   1.00 13.76 ? 816 PHE B CZ  1 
ATOM   1846 N N   . PRO B 1 141 ? 6.501   25.096 11.699  1.00 13.12 ? 817 PRO B N   1 
ATOM   1847 C CA  . PRO B 1 141 ? 6.039   23.840 12.314  1.00 13.96 ? 817 PRO B CA  1 
ATOM   1848 C C   . PRO B 1 141 ? 5.172   23.047 11.318  1.00 14.39 ? 817 PRO B C   1 
ATOM   1849 O O   . PRO B 1 141 ? 4.513   23.671 10.476  1.00 14.49 ? 817 PRO B O   1 
ATOM   1850 C CB  . PRO B 1 141 ? 5.205   24.323 13.507  1.00 14.15 ? 817 PRO B CB  1 
ATOM   1851 C CG  . PRO B 1 141 ? 4.706   25.660 13.093  1.00 14.50 ? 817 PRO B CG  1 
ATOM   1852 C CD  . PRO B 1 141 ? 5.775   26.278 12.198  1.00 13.47 ? 817 PRO B CD  1 
ATOM   1853 N N   . PRO B 1 142 ? 5.189   21.719 11.369  1.00 15.22 ? 818 PRO B N   1 
ATOM   1854 C CA  . PRO B 1 142 ? 4.404   20.913 10.418  1.00 16.20 ? 818 PRO B CA  1 
ATOM   1855 C C   . PRO B 1 142 ? 2.933   21.311 10.451  1.00 16.57 ? 818 PRO B C   1 
ATOM   1856 O O   . PRO B 1 142 ? 2.241   21.232 9.440   1.00 16.64 ? 818 PRO B O   1 
ATOM   1857 C CB  . PRO B 1 142 ? 4.536   19.475 10.948  1.00 17.08 ? 818 PRO B CB  1 
ATOM   1858 C CG  . PRO B 1 142 ? 5.597   19.485 11.944  1.00 16.68 ? 818 PRO B CG  1 
ATOM   1859 C CD  . PRO B 1 142 ? 5.938   20.887 12.322  1.00 15.32 ? 818 PRO B CD  1 
ATOM   1860 N N   . GLN B 1 143 ? 2.468   21.729 11.621  1.00 16.89 ? 819 GLN B N   1 
ATOM   1861 C CA  . GLN B 1 143 ? 1.064   22.124 11.797  1.00 17.84 ? 819 GLN B CA  1 
ATOM   1862 C C   . GLN B 1 143 ? 0.673   23.339 10.973  1.00 17.89 ? 819 GLN B C   1 
ATOM   1863 O O   . GLN B 1 143 ? -0.518  23.576 10.724  1.00 19.04 ? 819 GLN B O   1 
ATOM   1864 C CB  . GLN B 1 143 ? 0.761   22.402 13.272  1.00 18.24 ? 819 GLN B CB  1 
ATOM   1865 C CG  . GLN B 1 143 ? 1.017   21.226 14.197  1.00 19.35 ? 819 GLN B CG  1 
ATOM   1866 C CD  . GLN B 1 143 ? 2.418   21.216 14.762  1.00 21.26 ? 819 GLN B CD  1 
ATOM   1867 O OE1 . GLN B 1 143 ? 3.343   21.747 14.157  1.00 19.94 ? 819 GLN B OE1 1 
ATOM   1868 N NE2 . GLN B 1 143 ? 2.580   20.612 15.934  1.00 24.42 ? 819 GLN B NE2 1 
ATOM   1869 N N   . SER B 1 144 ? 1.665   24.105 10.528  1.00 17.69 ? 820 SER B N   1 
ATOM   1870 C CA  . SER B 1 144 ? 1.381   25.300 9.759   1.00 17.43 ? 820 SER B CA  1 
ATOM   1871 C C   . SER B 1 144 ? 0.991   25.010 8.310   1.00 18.46 ? 820 SER B C   1 
ATOM   1872 O O   . SER B 1 144 ? 0.526   25.906 7.614   1.00 18.28 ? 820 SER B O   1 
ATOM   1873 C CB  . SER B 1 144 ? 2.559   26.289 9.797   1.00 17.66 ? 820 SER B CB  1 
ATOM   1874 O OG  . SER B 1 144 ? 3.692   25.781 9.102   1.00 15.52 ? 820 SER B OG  1 
ATOM   1875 N N   . TRP B 1 145 ? 1.206   23.782 7.846   1.00 18.74 ? 821 TRP B N   1 
ATOM   1876 C CA  . TRP B 1 145 ? 0.887   23.465 6.463   1.00 20.20 ? 821 TRP B CA  1 
ATOM   1877 C C   . TRP B 1 145 ? 0.243   22.109 6.231   1.00 21.95 ? 821 TRP B C   1 
ATOM   1878 O O   . TRP B 1 145 ? -0.395  21.906 5.199   1.00 22.03 ? 821 TRP B O   1 
ATOM   1879 C CB  . TRP B 1 145 ? 2.122   23.615 5.571   1.00 19.40 ? 821 TRP B CB  1 
ATOM   1880 C CG  . TRP B 1 145 ? 3.304   22.820 6.041   1.00 18.69 ? 821 TRP B CG  1 
ATOM   1881 C CD1 . TRP B 1 145 ? 4.317   23.244 6.867   1.00 16.30 ? 821 TRP B CD1 1 
ATOM   1882 C CD2 . TRP B 1 145 ? 3.603   21.473 5.703   1.00 17.47 ? 821 TRP B CD2 1 
ATOM   1883 N NE1 . TRP B 1 145 ? 5.224   22.231 7.060   1.00 15.71 ? 821 TRP B NE1 1 
ATOM   1884 C CE2 . TRP B 1 145 ? 4.804   21.126 6.363   1.00 16.75 ? 821 TRP B CE2 1 
ATOM   1885 C CE3 . TRP B 1 145 ? 2.972   20.506 4.907   1.00 19.98 ? 821 TRP B CE3 1 
ATOM   1886 C CZ2 . TRP B 1 145 ? 5.389   19.871 6.241   1.00 16.12 ? 821 TRP B CZ2 1 
ATOM   1887 C CZ3 . TRP B 1 145 ? 3.561   19.258 4.787   1.00 19.89 ? 821 TRP B CZ3 1 
ATOM   1888 C CH2 . TRP B 1 145 ? 4.754   18.951 5.455   1.00 17.83 ? 821 TRP B CH2 1 
ATOM   1889 N N   . GLN B 1 146 ? 0.394   21.187 7.173   1.00 23.51 ? 822 GLN B N   1 
ATOM   1890 C CA  . GLN B 1 146 ? -0.203  19.863 7.018   1.00 26.26 ? 822 GLN B CA  1 
ATOM   1891 C C   . GLN B 1 146 ? -1.724  19.877 7.097   1.00 27.56 ? 822 GLN B C   1 
ATOM   1892 O O   . GLN B 1 146 ? -2.363  18.999 6.515   1.00 29.45 ? 822 GLN B O   1 
ATOM   1893 C CB  . GLN B 1 146 ? 0.339   18.902 8.070   1.00 26.39 ? 822 GLN B CB  1 
ATOM   1894 C CG  . GLN B 1 146 ? 1.753   18.495 7.811   1.00 27.48 ? 822 GLN B CG  1 
ATOM   1895 C CD  . GLN B 1 146 ? 2.238   17.484 8.808   1.00 28.31 ? 822 GLN B CD  1 
ATOM   1896 O OE1 . GLN B 1 146 ? 1.729   17.418 9.928   1.00 28.17 ? 822 GLN B OE1 1 
ATOM   1897 N NE2 . GLN B 1 146 ? 3.225   16.686 8.408   1.00 30.62 ? 822 GLN B NE2 1 
ATOM   1898 O OXT . GLN B 1 146 ? -2.341  20.737 7.733   1.00 28.91 ? 822 GLN B OXT 1 
HETATM 1899 O O   . HOH C 2 .   ? 25.709  16.831 7.180   1.00 14.17 ? 1   HOH A O   1 
HETATM 1900 O O   . HOH C 2 .   ? 8.089   19.273 9.194   1.00 10.32 ? 2   HOH A O   1 
HETATM 1901 O O   . HOH C 2 .   ? 23.977  11.861 14.116  1.00 15.04 ? 3   HOH A O   1 
HETATM 1902 O O   . HOH C 2 .   ? 13.455  17.950 18.285  1.00 15.00 ? 4   HOH A O   1 
HETATM 1903 O O   . HOH C 2 .   ? 18.112  26.988 26.224  1.00 20.27 ? 5   HOH A O   1 
HETATM 1904 O O   . HOH C 2 .   ? 9.567   19.096 11.551  1.00 15.19 ? 6   HOH A O   1 
HETATM 1905 O O   . HOH C 2 .   ? 10.190  25.111 7.624   1.00 12.72 ? 7   HOH A O   1 
HETATM 1906 O O   . HOH C 2 .   ? 22.157  4.701  10.422  1.00 19.00 ? 8   HOH A O   1 
HETATM 1907 O O   . HOH C 2 .   ? 25.453  14.319 13.784  1.00 11.84 ? 9   HOH A O   1 
HETATM 1908 O O   . HOH C 2 .   ? 11.928  11.236 16.624  1.00 17.91 ? 10  HOH A O   1 
HETATM 1909 O O   . HOH C 2 .   ? 16.473  29.130 12.237  1.00 16.24 ? 11  HOH A O   1 
HETATM 1910 O O   . HOH C 2 .   ? 15.093  18.196 4.987   1.00 16.31 ? 12  HOH A O   1 
HETATM 1911 O O   . HOH C 2 .   ? 5.052   10.117 7.267   1.00 23.31 ? 13  HOH A O   1 
HETATM 1912 O O   . HOH C 2 .   ? 34.909  20.862 25.210  1.00 16.05 ? 14  HOH A O   1 
HETATM 1913 O O   . HOH C 2 .   ? 8.464   17.429 13.436  1.00 16.70 ? 15  HOH A O   1 
HETATM 1914 O O   . HOH C 2 .   ? 23.588  22.927 26.462  1.00 17.92 ? 16  HOH A O   1 
HETATM 1915 O O   . HOH C 2 .   ? 13.223  5.910  5.642   1.00 23.42 ? 17  HOH A O   1 
HETATM 1916 O O   . HOH C 2 .   ? 17.444  16.866 -0.087  0.50 14.90 ? 18  HOH A O   1 
HETATM 1917 O O   . HOH C 2 .   ? 20.594  36.910 18.490  1.00 25.96 ? 19  HOH A O   1 
HETATM 1918 O O   . HOH C 2 .   ? 27.197  14.966 22.255  1.00 19.43 ? 20  HOH A O   1 
HETATM 1919 O O   . HOH C 2 .   ? 18.984  29.490 5.158   1.00 20.37 ? 21  HOH A O   1 
HETATM 1920 O O   . HOH C 2 .   ? 18.072  6.434  17.331  1.00 28.69 ? 22  HOH A O   1 
HETATM 1921 O O   . HOH C 2 .   ? 12.809  14.315 5.781   1.00 19.10 ? 23  HOH A O   1 
HETATM 1922 O O   . HOH C 2 .   ? 22.328  12.565 1.874   1.00 19.63 ? 24  HOH A O   1 
HETATM 1923 O O   . HOH C 2 .   ? 32.335  13.337 21.932  1.00 22.46 ? 25  HOH A O   1 
HETATM 1924 O O   . HOH C 2 .   ? 24.459  11.259 5.956   1.00 20.69 ? 26  HOH A O   1 
HETATM 1925 O O   . HOH C 2 .   ? 9.432   16.265 15.800  1.00 23.31 ? 27  HOH A O   1 
HETATM 1926 O O   . HOH C 2 .   ? 15.308  33.412 19.636  1.00 20.93 ? 28  HOH A O   1 
HETATM 1927 O O   . HOH C 2 .   ? 7.602   18.135 3.916   1.00 21.37 ? 29  HOH A O   1 
HETATM 1928 O O   . HOH C 2 .   ? 25.017  22.109 28.583  1.00 29.49 ? 30  HOH A O   1 
HETATM 1929 O O   . HOH C 2 .   ? 8.364   22.289 14.450  1.00 20.94 ? 31  HOH A O   1 
HETATM 1930 O O   . HOH C 2 .   ? 15.860  5.466  3.120   1.00 25.08 ? 32  HOH A O   1 
HETATM 1931 O O   . HOH C 2 .   ? 11.407  3.278  9.528   1.00 27.41 ? 33  HOH A O   1 
HETATM 1932 O O   . HOH C 2 .   ? 23.060  32.622 11.632  1.00 24.70 ? 34  HOH A O   1 
HETATM 1933 O O   . HOH C 2 .   ? 27.995  32.809 21.395  1.00 25.77 ? 35  HOH A O   1 
HETATM 1934 O O   . HOH C 2 .   ? 27.302  13.882 4.968   1.00 23.53 ? 36  HOH A O   1 
HETATM 1935 O O   . HOH C 2 .   ? 22.305  34.952 13.214  1.00 23.98 ? 37  HOH A O   1 
HETATM 1936 O O   . HOH C 2 .   ? 22.942  4.691  15.357  1.00 23.47 ? 38  HOH A O   1 
HETATM 1937 O O   . HOH C 2 .   ? 4.236   16.752 14.886  1.00 24.79 ? 39  HOH A O   1 
HETATM 1938 O O   . HOH C 2 .   ? 5.679   15.327 10.225  1.00 25.27 ? 40  HOH A O   1 
HETATM 1939 O O   . HOH C 2 .   ? 22.647  10.592 3.723   1.00 27.80 ? 41  HOH A O   1 
HETATM 1940 O O   . HOH C 2 .   ? 19.898  8.721  19.870  1.00 23.58 ? 42  HOH A O   1 
HETATM 1941 O O   . HOH C 2 .   ? 6.420   18.523 15.167  1.00 27.64 ? 43  HOH A O   1 
HETATM 1942 O O   . HOH C 2 .   ? 6.888   16.338 5.811   1.00 25.80 ? 44  HOH A O   1 
HETATM 1943 O O   . HOH C 2 .   ? 21.168  14.804 -1.039  1.00 28.28 ? 45  HOH A O   1 
HETATM 1944 O O   . HOH C 2 .   ? 20.670  41.652 20.306  1.00 27.76 ? 46  HOH A O   1 
HETATM 1945 O O   . HOH C 2 .   ? 16.912  25.162 2.593   1.00 28.21 ? 47  HOH A O   1 
HETATM 1946 O O   . HOH C 2 .   ? 33.179  26.960 11.359  1.00 24.99 ? 48  HOH A O   1 
HETATM 1947 O O   . HOH C 2 .   ? 8.880   25.352 17.331  1.00 36.74 ? 49  HOH A O   1 
HETATM 1948 O O   . HOH C 2 .   ? 19.160  10.901 22.905  1.00 33.40 ? 50  HOH A O   1 
HETATM 1949 O O   . HOH C 2 .   ? 30.778  20.483 11.253  1.00 22.64 ? 51  HOH A O   1 
HETATM 1950 O O   . HOH C 2 .   ? 23.950  18.413 27.037  1.00 25.40 ? 52  HOH A O   1 
HETATM 1951 O O   . HOH C 2 .   ? 34.061  36.196 18.474  1.00 28.99 ? 53  HOH A O   1 
HETATM 1952 O O   . HOH C 2 .   ? 29.673  32.127 23.838  1.00 35.03 ? 54  HOH A O   1 
HETATM 1953 O O   . HOH C 2 .   ? 28.677  37.777 13.680  1.00 34.80 ? 55  HOH A O   1 
HETATM 1954 O O   . HOH C 2 .   ? 21.237  22.499 27.302  1.00 32.71 ? 56  HOH A O   1 
HETATM 1955 O O   . HOH C 2 .   ? 26.185  9.963  11.942  1.00 33.90 ? 57  HOH A O   1 
HETATM 1956 O O   . HOH C 2 .   ? 16.072  19.058 2.088   1.00 32.57 ? 58  HOH A O   1 
HETATM 1957 O O   . HOH C 2 .   ? 15.872  9.501  22.912  1.00 34.10 ? 59  HOH A O   1 
HETATM 1958 O O   . HOH C 2 .   ? 36.673  21.815 16.395  1.00 34.70 ? 60  HOH A O   1 
HETATM 1959 O O   . HOH C 2 .   ? 36.417  26.055 14.907  1.00 30.78 ? 61  HOH A O   1 
HETATM 1960 O O   . HOH C 2 .   ? 25.335  5.233  9.761   1.00 42.28 ? 62  HOH A O   1 
HETATM 1961 O O   . HOH C 2 .   ? 36.779  27.751 29.086  1.00 29.95 ? 63  HOH A O   1 
HETATM 1962 O O   . HOH C 2 .   ? 16.209  5.160  5.703   1.00 35.66 ? 64  HOH A O   1 
HETATM 1963 O O   . HOH C 2 .   ? 23.330  29.579 30.686  1.00 28.61 ? 65  HOH A O   1 
HETATM 1964 O O   . HOH C 2 .   ? 34.577  19.677 16.092  1.00 36.16 ? 66  HOH A O   1 
HETATM 1965 O O   . HOH C 2 .   ? 5.315   15.123 16.596  1.00 38.09 ? 67  HOH A O   1 
HETATM 1966 O O   . HOH C 2 .   ? 28.763  15.962 13.346  1.00 26.88 ? 68  HOH A O   1 
HETATM 1967 O O   . HOH C 2 .   ? 13.024  12.144 -3.230  1.00 35.35 ? 69  HOH A O   1 
HETATM 1968 O O   . HOH C 2 .   ? 7.560   16.915 17.218  1.00 41.30 ? 70  HOH A O   1 
HETATM 1969 O O   . HOH C 2 .   ? 29.587  34.907 24.203  1.00 30.65 ? 71  HOH A O   1 
HETATM 1970 O O   . HOH C 2 .   ? 28.525  15.084 24.566  1.00 28.09 ? 72  HOH A O   1 
HETATM 1971 O O   . HOH C 2 .   ? 7.096   23.151 17.698  1.00 37.13 ? 73  HOH A O   1 
HETATM 1972 O O   . HOH C 2 .   ? 25.507  7.043  22.730  1.00 42.45 ? 74  HOH A O   1 
HETATM 1973 O O   . HOH C 2 .   ? 6.987   12.560 5.385   1.00 39.21 ? 75  HOH A O   1 
HETATM 1974 O O   . HOH C 2 .   ? 32.720  29.539 7.634   1.00 46.72 ? 76  HOH A O   1 
HETATM 1975 O O   . HOH C 2 .   ? 15.113  2.790  15.070  1.00 38.99 ? 77  HOH A O   1 
HETATM 1976 O O   . HOH C 2 .   ? 20.539  28.778 29.677  1.00 30.69 ? 78  HOH A O   1 
HETATM 1977 O O   . HOH C 2 .   ? 30.497  26.127 32.925  1.00 39.29 ? 79  HOH A O   1 
HETATM 1978 O O   . HOH C 2 .   ? 21.211  3.663  17.569  1.00 51.66 ? 80  HOH A O   1 
HETATM 1979 O O   . HOH C 2 .   ? -1.123  8.663  7.477   1.00 42.13 ? 81  HOH A O   1 
HETATM 1980 O O   . HOH C 2 .   ? 25.447  16.493 0.938   1.00 57.37 ? 82  HOH A O   1 
HETATM 1981 O O   . HOH C 2 .   ? 11.659  28.953 17.533  1.00 7.45  ? 83  HOH A O   1 
HETATM 1982 O O   . HOH C 2 .   ? 14.272  23.713 0.041   1.00 29.31 ? 106 HOH A O   1 
HETATM 1983 O O   . HOH C 2 .   ? 4.544   13.277 8.624   1.00 29.20 ? 112 HOH A O   1 
HETATM 1984 O O   . HOH D 2 .   ? 7.641   22.128 8.569   1.00 14.19 ? 84  HOH B O   1 
HETATM 1985 O O   . HOH D 2 .   ? 8.769   25.010 14.437  1.00 16.88 ? 85  HOH B O   1 
HETATM 1986 O O   . HOH D 2 .   ? 20.227  34.723 14.853  1.00 16.78 ? 86  HOH B O   1 
HETATM 1987 O O   . HOH D 2 .   ? 10.864  25.516 5.079   1.00 16.28 ? 87  HOH B O   1 
HETATM 1988 O O   . HOH D 2 .   ? 19.706  39.855 18.818  1.00 23.02 ? 88  HOH B O   1 
HETATM 1989 O O   . HOH D 2 .   ? 17.090  28.681 7.129   1.00 24.40 ? 89  HOH B O   1 
HETATM 1990 O O   . HOH D 2 .   ? 13.532  31.053 10.446  1.00 20.38 ? 90  HOH B O   1 
HETATM 1991 O O   . HOH D 2 .   ? 6.249   17.195 8.365   1.00 17.11 ? 91  HOH B O   1 
HETATM 1992 O O   . HOH D 2 .   ? -2.506  34.563 12.730  1.00 22.76 ? 92  HOH B O   1 
HETATM 1993 O O   . HOH D 2 .   ? 11.760  28.460 3.548   1.00 19.12 ? 93  HOH B O   1 
HETATM 1994 O O   . HOH D 2 .   ? 7.314   23.030 -0.873  1.00 26.47 ? 94  HOH B O   1 
HETATM 1995 O O   . HOH D 2 .   ? 0.410   26.493 4.701   1.00 21.52 ? 95  HOH B O   1 
HETATM 1996 O O   . HOH D 2 .   ? 16.778  39.715 18.775  1.00 25.47 ? 96  HOH B O   1 
HETATM 1997 O O   . HOH D 2 .   ? 6.177   48.082 8.881   1.00 28.53 ? 97  HOH B O   1 
HETATM 1998 O O   . HOH D 2 .   ? 8.848   39.795 18.525  1.00 28.55 ? 98  HOH B O   1 
HETATM 1999 O O   . HOH D 2 .   ? 15.219  36.001 20.190  1.00 24.09 ? 99  HOH B O   1 
HETATM 2000 O O   . HOH D 2 .   ? 6.020   46.076 7.061   1.00 24.43 ? 100 HOH B O   1 
HETATM 2001 O O   . HOH D 2 .   ? 10.096  46.705 20.486  1.00 24.14 ? 101 HOH B O   1 
HETATM 2002 O O   . HOH D 2 .   ? 13.073  32.864 20.800  1.00 29.18 ? 102 HOH B O   1 
HETATM 2003 O O   . HOH D 2 .   ? 0.845   30.221 16.655  1.00 19.60 ? 103 HOH B O   1 
HETATM 2004 O O   . HOH D 2 .   ? 11.881  44.963 3.267   1.00 31.14 ? 104 HOH B O   1 
HETATM 2005 O O   . HOH D 2 .   ? 3.338   16.148 12.143  1.00 30.47 ? 105 HOH B O   1 
HETATM 2006 O O   . HOH D 2 .   ? 7.958   24.432 -2.920  1.00 27.80 ? 107 HOH B O   1 
HETATM 2007 O O   . HOH D 2 .   ? 3.119   28.469 20.651  1.00 28.43 ? 108 HOH B O   1 
HETATM 2008 O O   . HOH D 2 .   ? 18.360  32.354 5.868   1.00 25.20 ? 109 HOH B O   1 
HETATM 2009 O O   . HOH D 2 .   ? 5.819   18.514 1.757   1.00 27.79 ? 110 HOH B O   1 
HETATM 2010 O O   . HOH D 2 .   ? 6.124   21.309 15.649  1.00 25.32 ? 111 HOH B O   1 
HETATM 2011 O O   . HOH D 2 .   ? 15.538  41.057 20.614  1.00 25.42 ? 113 HOH B O   1 
HETATM 2012 O O   . HOH D 2 .   ? -1.861  43.420 9.066   1.00 30.22 ? 114 HOH B O   1 
HETATM 2013 O O   . HOH D 2 .   ? 18.937  43.041 10.991  1.00 28.91 ? 115 HOH B O   1 
HETATM 2014 O O   . HOH D 2 .   ? -2.836  27.919 16.174  1.00 32.76 ? 116 HOH B O   1 
HETATM 2015 O O   . HOH D 2 .   ? -5.422  35.135 12.869  1.00 31.90 ? 117 HOH B O   1 
HETATM 2016 O O   . HOH D 2 .   ? 10.871  54.495 21.695  1.00 46.37 ? 118 HOH B O   1 
HETATM 2017 O O   . HOH D 2 .   ? 14.279  35.142 -3.220  1.00 31.01 ? 119 HOH B O   1 
HETATM 2018 O O   . HOH D 2 .   ? -2.153  26.739 4.591   1.00 30.57 ? 120 HOH B O   1 
HETATM 2019 O O   . HOH D 2 .   ? 5.084   44.972 3.650   1.00 37.90 ? 121 HOH B O   1 
HETATM 2020 O O   . HOH D 2 .   ? 5.280   50.952 16.726  1.00 36.16 ? 122 HOH B O   1 
HETATM 2021 O O   . HOH D 2 .   ? -1.981  34.247 15.445  1.00 31.21 ? 123 HOH B O   1 
HETATM 2022 O O   . HOH D 2 .   ? 19.444  43.068 22.205  1.00 33.44 ? 124 HOH B O   1 
HETATM 2023 O O   . HOH D 2 .   ? 19.604  46.281 14.037  1.00 33.36 ? 125 HOH B O   1 
HETATM 2024 O O   . HOH D 2 .   ? 9.338   55.334 10.422  1.00 34.88 ? 126 HOH B O   1 
HETATM 2025 O O   . HOH D 2 .   ? 22.227  48.543 13.907  1.00 39.69 ? 127 HOH B O   1 
HETATM 2026 O O   . HOH D 2 .   ? 1.082   22.046 18.979  1.00 36.46 ? 128 HOH B O   1 
HETATM 2027 O O   . HOH D 2 .   ? 3.533   32.549 -5.477  1.00 43.21 ? 129 HOH B O   1 
HETATM 2028 O O   . HOH D 2 .   ? 15.839  28.433 -3.784  1.00 41.76 ? 130 HOH B O   1 
HETATM 2029 O O   . HOH D 2 .   ? -1.584  31.225 18.005  1.00 43.05 ? 131 HOH B O   1 
HETATM 2030 O O   . HOH D 2 .   ? 9.368   56.603 19.157  1.00 40.59 ? 132 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   677 ?   ?   ?   A . n 
A 1 2   VAL 2   678 ?   ?   ?   A . n 
A 1 3   PRO 3   679 ?   ?   ?   A . n 
A 1 4   GLN 4   680 ?   ?   ?   A . n 
A 1 5   ILE 5   681 ?   ?   ?   A . n 
A 1 6   SER 6   682 ?   ?   ?   A . n 
A 1 7   GLN 7   683 ?   ?   ?   A . n 
A 1 8   PRO 8   684 ?   ?   ?   A . n 
A 1 9   HIS 9   685 ?   ?   ?   A . n 
A 1 10  PHE 10  686 ?   ?   ?   A . n 
A 1 11  LEU 11  687 ?   ?   ?   A . n 
A 1 12  LEU 12  688 ?   ?   ?   A . n 
A 1 13  ASP 13  689 ?   ?   ?   A . n 
A 1 14  GLY 14  690 ?   ?   ?   A . n 
A 1 15  LEU 15  691 ?   ?   ?   A . n 
A 1 16  SER 16  692 ?   ?   ?   A . n 
A 1 17  SER 17  693 ?   ?   ?   A . n 
A 1 18  GLN 18  694 ?   ?   ?   A . n 
A 1 19  PRO 19  695 ?   ?   ?   A . n 
A 1 20  LEU 20  696 ?   ?   ?   A . n 
A 1 21  PHE 21  697 ?   ?   ?   A . n 
A 1 22  ASN 22  698 ?   ?   ?   A . n 
A 1 23  ASP 23  699 ?   ?   ?   A . n 
A 1 24  ILE 24  700 ?   ?   ?   A . n 
A 1 25  ALA 25  701 ?   ?   ?   A . n 
A 1 26  ALA 26  702 ?   ?   ?   A . n 
A 1 27  GLY 27  703 703 GLY GLY A . n 
A 1 28  ILE 28  704 704 ILE ILE A . n 
A 1 29  PRO 29  705 705 PRO PRO A . n 
A 1 30  SER 30  706 706 SER SER A . n 
A 1 31  ILE 31  707 707 ILE ILE A . n 
A 1 32  THR 32  708 708 THR THR A . n 
A 1 33  ALA 33  709 709 ALA ALA A . n 
A 1 34  TYR 34  710 710 TYR TYR A . n 
A 1 35  SER 35  711 711 SER SER A . n 
A 1 36  LYS 36  712 712 LYS LYS A . n 
A 1 37  ASN 37  713 713 ASN ASN A . n 
A 1 38  GLY 38  714 714 GLY GLY A . n 
A 1 39  LEU 39  715 715 LEU LEU A . n 
A 1 40  LYS 40  716 716 LYS LYS A . n 
A 1 41  ILE 41  717 717 ILE ILE A . n 
A 1 42  GLU 42  718 718 GLU GLU A . n 
A 1 43  PHE 43  719 719 PHE PHE A . n 
A 1 44  THR 44  720 720 THR THR A . n 
A 1 45  PHE 45  721 721 PHE PHE A . n 
A 1 46  GLU 46  722 722 GLU GLU A . n 
A 1 47  ARG 47  723 723 ARG ARG A . n 
A 1 48  SER 48  724 724 SER SER A . n 
A 1 49  ASN 49  725 725 ASN ASN A . n 
A 1 50  THR 50  726 726 THR THR A . n 
A 1 51  ASN 51  727 727 ASN ASN A . n 
A 1 52  PRO 52  728 728 PRO PRO A . n 
A 1 53  SER 53  729 729 SER SER A . n 
A 1 54  VAL 54  730 730 VAL VAL A . n 
A 1 55  THR 55  731 731 THR THR A . n 
A 1 56  VAL 56  732 732 VAL VAL A . n 
A 1 57  ILE 57  733 733 ILE ILE A . n 
A 1 58  THR 58  734 734 THR THR A . n 
A 1 59  ILE 59  735 735 ILE ILE A . n 
A 1 60  GLN 60  736 736 GLN GLN A . n 
A 1 61  ALA 61  737 737 ALA ALA A . n 
A 1 62  SER 62  738 738 SER SER A . n 
A 1 63  ASN 63  739 739 ASN ASN A . n 
A 1 64  SER 64  740 740 SER SER A . n 
A 1 65  THR 65  741 741 THR THR A . n 
A 1 66  GLU 66  742 742 GLU GLU A . n 
A 1 67  LEU 67  743 743 LEU LEU A . n 
A 1 68  ASP 68  744 744 ASP ASP A . n 
A 1 69  MET 69  745 745 MET MET A . n 
A 1 70  THR 70  746 746 THR THR A . n 
A 1 71  ASP 71  747 747 ASP ASP A . n 
A 1 72  PHE 72  748 748 PHE PHE A . n 
A 1 73  VAL 73  749 749 VAL VAL A . n 
A 1 74  PHE 74  750 750 PHE PHE A . n 
A 1 75  GLN 75  751 751 GLN GLN A . n 
A 1 76  ALA 76  752 752 ALA ALA A . n 
A 1 77  ALA 77  753 753 ALA ALA A . n 
A 1 78  VAL 78  754 754 VAL VAL A . n 
A 1 79  PRO 79  755 755 PRO PRO A . n 
A 1 80  LYS 80  756 756 LYS LYS A . n 
A 1 81  THR 81  757 757 THR THR A . n 
A 1 82  PHE 82  758 758 PHE PHE A . n 
A 1 83  GLN 83  759 759 GLN GLN A . n 
A 1 84  LEU 84  760 760 LEU LEU A . n 
A 1 85  GLN 85  761 761 GLN GLN A . n 
A 1 86  LEU 86  762 762 LEU LEU A . n 
A 1 87  LEU 87  763 763 LEU LEU A . n 
A 1 88  SER 88  764 764 SER SER A . n 
A 1 89  PRO 89  765 765 PRO PRO A . n 
A 1 90  SER 90  766 766 SER SER A . n 
A 1 91  SER 91  767 767 SER SER A . n 
A 1 92  SER 92  768 768 SER SER A . n 
A 1 93  ILE 93  769 769 ILE ILE A . n 
A 1 94  VAL 94  770 770 VAL VAL A . n 
A 1 95  PRO 95  771 771 PRO PRO A . n 
A 1 96  ALA 96  772 772 ALA ALA A . n 
A 1 97  PHE 97  773 773 PHE PHE A . n 
A 1 98  ASN 98  774 774 ASN ASN A . n 
A 1 99  THR 99  775 775 THR THR A . n 
A 1 100 GLY 100 776 776 GLY GLY A . n 
A 1 101 THR 101 777 777 THR THR A . n 
A 1 102 ILE 102 778 778 ILE ILE A . n 
A 1 103 THR 103 779 779 THR THR A . n 
A 1 104 GLN 104 780 780 GLN GLN A . n 
A 1 105 VAL 105 781 781 VAL VAL A . n 
A 1 106 ILE 106 782 782 ILE ILE A . n 
A 1 107 LYS 107 783 783 LYS LYS A . n 
A 1 108 VAL 108 784 784 VAL VAL A . n 
A 1 109 LEU 109 785 785 LEU LEU A . n 
A 1 110 ASN 110 786 786 ASN ASN A . n 
A 1 111 PRO 111 787 787 PRO PRO A . n 
A 1 112 GLN 112 788 788 GLN GLN A . n 
A 1 113 LYS 113 789 789 LYS LYS A . n 
A 1 114 GLN 114 790 790 GLN GLN A . n 
A 1 115 GLN 115 791 791 GLN GLN A . n 
A 1 116 LEU 116 792 792 LEU LEU A . n 
A 1 117 ARG 117 793 793 ARG ARG A . n 
A 1 118 MET 118 794 794 MET MET A . n 
A 1 119 ARG 119 795 795 ARG ARG A . n 
A 1 120 ILE 120 796 796 ILE ILE A . n 
A 1 121 LYS 121 797 797 LYS LYS A . n 
A 1 122 LEU 122 798 798 LEU LEU A . n 
A 1 123 THR 123 799 799 THR THR A . n 
A 1 124 TYR 124 800 800 TYR TYR A . n 
A 1 125 ASN 125 801 801 ASN ASN A . n 
A 1 126 HIS 126 802 802 HIS HIS A . n 
A 1 127 LYS 127 803 803 LYS LYS A . n 
A 1 128 GLY 128 804 804 GLY GLY A . n 
A 1 129 SER 129 805 805 SER SER A . n 
A 1 130 ALA 130 806 806 ALA ALA A . n 
A 1 131 MET 131 807 807 MET MET A . n 
A 1 132 GLN 132 808 808 GLN GLN A . n 
A 1 133 ASP 133 809 809 ASP ASP A . n 
A 1 134 LEU 134 810 810 LEU LEU A . n 
A 1 135 ALA 135 811 811 ALA ALA A . n 
A 1 136 GLU 136 812 812 GLU GLU A . n 
A 1 137 VAL 137 813 813 VAL VAL A . n 
A 1 138 ASN 138 814 814 ASN ASN A . n 
A 1 139 ASN 139 815 815 ASN ASN A . n 
A 1 140 PHE 140 816 816 PHE PHE A . n 
A 1 141 PRO 141 817 817 PRO PRO A . n 
A 1 142 PRO 142 818 818 PRO PRO A . n 
A 1 143 GLN 143 819 819 GLN GLN A . n 
A 1 144 SER 144 820 820 SER SER A . n 
A 1 145 TRP 145 821 821 TRP TRP A . n 
A 1 146 GLN 146 822 822 GLN GLN A . n 
B 1 1   SER 1   677 ?   ?   ?   B . n 
B 1 2   VAL 2   678 ?   ?   ?   B . n 
B 1 3   PRO 3   679 ?   ?   ?   B . n 
B 1 4   GLN 4   680 ?   ?   ?   B . n 
B 1 5   ILE 5   681 ?   ?   ?   B . n 
B 1 6   SER 6   682 ?   ?   ?   B . n 
B 1 7   GLN 7   683 ?   ?   ?   B . n 
B 1 8   PRO 8   684 ?   ?   ?   B . n 
B 1 9   HIS 9   685 ?   ?   ?   B . n 
B 1 10  PHE 10  686 ?   ?   ?   B . n 
B 1 11  LEU 11  687 ?   ?   ?   B . n 
B 1 12  LEU 12  688 ?   ?   ?   B . n 
B 1 13  ASP 13  689 ?   ?   ?   B . n 
B 1 14  GLY 14  690 ?   ?   ?   B . n 
B 1 15  LEU 15  691 ?   ?   ?   B . n 
B 1 16  SER 16  692 ?   ?   ?   B . n 
B 1 17  SER 17  693 ?   ?   ?   B . n 
B 1 18  GLN 18  694 ?   ?   ?   B . n 
B 1 19  PRO 19  695 ?   ?   ?   B . n 
B 1 20  LEU 20  696 ?   ?   ?   B . n 
B 1 21  PHE 21  697 ?   ?   ?   B . n 
B 1 22  ASN 22  698 ?   ?   ?   B . n 
B 1 23  ASP 23  699 ?   ?   ?   B . n 
B 1 24  ILE 24  700 700 ILE ILE B . n 
B 1 25  ALA 25  701 701 ALA ALA B . n 
B 1 26  ALA 26  702 702 ALA ALA B . n 
B 1 27  GLY 27  703 703 GLY GLY B . n 
B 1 28  ILE 28  704 704 ILE ILE B . n 
B 1 29  PRO 29  705 705 PRO PRO B . n 
B 1 30  SER 30  706 706 SER SER B . n 
B 1 31  ILE 31  707 707 ILE ILE B . n 
B 1 32  THR 32  708 708 THR THR B . n 
B 1 33  ALA 33  709 709 ALA ALA B . n 
B 1 34  TYR 34  710 710 TYR TYR B . n 
B 1 35  SER 35  711 711 SER SER B . n 
B 1 36  LYS 36  712 712 LYS LYS B . n 
B 1 37  ASN 37  713 713 ASN ASN B . n 
B 1 38  GLY 38  714 714 GLY GLY B . n 
B 1 39  LEU 39  715 715 LEU LEU B . n 
B 1 40  LYS 40  716 716 LYS LYS B . n 
B 1 41  ILE 41  717 717 ILE ILE B . n 
B 1 42  GLU 42  718 718 GLU GLU B . n 
B 1 43  PHE 43  719 719 PHE PHE B . n 
B 1 44  THR 44  720 720 THR THR B . n 
B 1 45  PHE 45  721 721 PHE PHE B . n 
B 1 46  GLU 46  722 722 GLU GLU B . n 
B 1 47  ARG 47  723 723 ARG ARG B . n 
B 1 48  SER 48  724 724 SER SER B . n 
B 1 49  ASN 49  725 725 ASN ASN B . n 
B 1 50  THR 50  726 726 THR THR B . n 
B 1 51  ASN 51  727 727 ASN ASN B . n 
B 1 52  PRO 52  728 728 PRO PRO B . n 
B 1 53  SER 53  729 729 SER SER B . n 
B 1 54  VAL 54  730 730 VAL VAL B . n 
B 1 55  THR 55  731 731 THR THR B . n 
B 1 56  VAL 56  732 732 VAL VAL B . n 
B 1 57  ILE 57  733 733 ILE ILE B . n 
B 1 58  THR 58  734 734 THR THR B . n 
B 1 59  ILE 59  735 735 ILE ILE B . n 
B 1 60  GLN 60  736 736 GLN GLN B . n 
B 1 61  ALA 61  737 737 ALA ALA B . n 
B 1 62  SER 62  738 738 SER SER B . n 
B 1 63  ASN 63  739 739 ASN ASN B . n 
B 1 64  SER 64  740 740 SER SER B . n 
B 1 65  THR 65  741 741 THR THR B . n 
B 1 66  GLU 66  742 742 GLU GLU B . n 
B 1 67  LEU 67  743 743 LEU LEU B . n 
B 1 68  ASP 68  744 744 ASP ASP B . n 
B 1 69  MET 69  745 745 MET MET B . n 
B 1 70  THR 70  746 746 THR THR B . n 
B 1 71  ASP 71  747 747 ASP ASP B . n 
B 1 72  PHE 72  748 748 PHE PHE B . n 
B 1 73  VAL 73  749 749 VAL VAL B . n 
B 1 74  PHE 74  750 750 PHE PHE B . n 
B 1 75  GLN 75  751 751 GLN GLN B . n 
B 1 76  ALA 76  752 752 ALA ALA B . n 
B 1 77  ALA 77  753 753 ALA ALA B . n 
B 1 78  VAL 78  754 754 VAL VAL B . n 
B 1 79  PRO 79  755 755 PRO PRO B . n 
B 1 80  LYS 80  756 756 LYS LYS B . n 
B 1 81  THR 81  757 757 THR THR B . n 
B 1 82  PHE 82  758 758 PHE PHE B . n 
B 1 83  GLN 83  759 759 GLN GLN B . n 
B 1 84  LEU 84  760 760 LEU LEU B . n 
B 1 85  GLN 85  761 761 GLN GLN B . n 
B 1 86  LEU 86  762 762 LEU LEU B . n 
B 1 87  LEU 87  763 763 LEU LEU B . n 
B 1 88  SER 88  764 764 SER SER B . n 
B 1 89  PRO 89  765 765 PRO PRO B . n 
B 1 90  SER 90  766 766 SER SER B . n 
B 1 91  SER 91  767 767 SER SER B . n 
B 1 92  SER 92  768 768 SER SER B . n 
B 1 93  ILE 93  769 769 ILE ILE B . n 
B 1 94  VAL 94  770 770 VAL VAL B . n 
B 1 95  PRO 95  771 771 PRO PRO B . n 
B 1 96  ALA 96  772 772 ALA ALA B . n 
B 1 97  PHE 97  773 773 PHE PHE B . n 
B 1 98  ASN 98  774 774 ASN ASN B . n 
B 1 99  THR 99  775 775 THR THR B . n 
B 1 100 GLY 100 776 776 GLY GLY B . n 
B 1 101 THR 101 777 777 THR THR B . n 
B 1 102 ILE 102 778 778 ILE ILE B . n 
B 1 103 THR 103 779 779 THR THR B . n 
B 1 104 GLN 104 780 780 GLN GLN B . n 
B 1 105 VAL 105 781 781 VAL VAL B . n 
B 1 106 ILE 106 782 782 ILE ILE B . n 
B 1 107 LYS 107 783 783 LYS LYS B . n 
B 1 108 VAL 108 784 784 VAL VAL B . n 
B 1 109 LEU 109 785 785 LEU LEU B . n 
B 1 110 ASN 110 786 786 ASN ASN B . n 
B 1 111 PRO 111 787 787 PRO PRO B . n 
B 1 112 GLN 112 788 788 GLN GLN B . n 
B 1 113 LYS 113 789 789 LYS LYS B . n 
B 1 114 GLN 114 790 790 GLN GLN B . n 
B 1 115 GLN 115 791 791 GLN GLN B . n 
B 1 116 LEU 116 792 792 LEU LEU B . n 
B 1 117 ARG 117 793 793 ARG ARG B . n 
B 1 118 MET 118 794 794 MET MET B . n 
B 1 119 ARG 119 795 795 ARG ARG B . n 
B 1 120 ILE 120 796 796 ILE ILE B . n 
B 1 121 LYS 121 797 797 LYS LYS B . n 
B 1 122 LEU 122 798 798 LEU LEU B . n 
B 1 123 THR 123 799 799 THR THR B . n 
B 1 124 TYR 124 800 800 TYR TYR B . n 
B 1 125 ASN 125 801 801 ASN ASN B . n 
B 1 126 HIS 126 802 802 HIS HIS B . n 
B 1 127 LYS 127 803 803 LYS LYS B . n 
B 1 128 GLY 128 804 804 GLY GLY B . n 
B 1 129 SER 129 805 805 SER SER B . n 
B 1 130 ALA 130 806 806 ALA ALA B . n 
B 1 131 MET 131 807 807 MET MET B . n 
B 1 132 GLN 132 808 808 GLN GLN B . n 
B 1 133 ASP 133 809 809 ASP ASP B . n 
B 1 134 LEU 134 810 810 LEU LEU B . n 
B 1 135 ALA 135 811 811 ALA ALA B . n 
B 1 136 GLU 136 812 812 GLU GLU B . n 
B 1 137 VAL 137 813 813 VAL VAL B . n 
B 1 138 ASN 138 814 814 ASN ASN B . n 
B 1 139 ASN 139 815 815 ASN ASN B . n 
B 1 140 PHE 140 816 816 PHE PHE B . n 
B 1 141 PRO 141 817 817 PRO PRO B . n 
B 1 142 PRO 142 818 818 PRO PRO B . n 
B 1 143 GLN 143 819 819 GLN GLN B . n 
B 1 144 SER 144 820 820 SER SER B . n 
B 1 145 TRP 145 821 821 TRP TRP B . n 
B 1 146 GLN 146 822 822 GLN GLN B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 HOH 1  1   1   HOH HOH A . 
C 2 HOH 2  2   2   HOH HOH A . 
C 2 HOH 3  3   3   HOH HOH A . 
C 2 HOH 4  4   4   HOH HOH A . 
C 2 HOH 5  5   5   HOH HOH A . 
C 2 HOH 6  6   6   HOH HOH A . 
C 2 HOH 7  7   7   HOH HOH A . 
C 2 HOH 8  8   8   HOH HOH A . 
C 2 HOH 9  9   9   HOH HOH A . 
C 2 HOH 10 10  10  HOH HOH A . 
C 2 HOH 11 11  11  HOH HOH A . 
C 2 HOH 12 12  12  HOH HOH A . 
C 2 HOH 13 13  13  HOH HOH A . 
C 2 HOH 14 14  14  HOH HOH A . 
C 2 HOH 15 15  15  HOH HOH A . 
C 2 HOH 16 16  16  HOH HOH A . 
C 2 HOH 17 17  17  HOH HOH A . 
C 2 HOH 18 18  18  HOH HOH A . 
C 2 HOH 19 19  19  HOH HOH A . 
C 2 HOH 20 20  20  HOH HOH A . 
C 2 HOH 21 21  21  HOH HOH A . 
C 2 HOH 22 22  22  HOH HOH A . 
C 2 HOH 23 23  23  HOH HOH A . 
C 2 HOH 24 24  24  HOH HOH A . 
C 2 HOH 25 25  25  HOH HOH A . 
C 2 HOH 26 26  26  HOH HOH A . 
C 2 HOH 27 27  27  HOH HOH A . 
C 2 HOH 28 28  28  HOH HOH A . 
C 2 HOH 29 29  29  HOH HOH A . 
C 2 HOH 30 30  30  HOH HOH A . 
C 2 HOH 31 31  31  HOH HOH A . 
C 2 HOH 32 32  32  HOH HOH A . 
C 2 HOH 33 33  33  HOH HOH A . 
C 2 HOH 34 34  34  HOH HOH A . 
C 2 HOH 35 35  35  HOH HOH A . 
C 2 HOH 36 36  36  HOH HOH A . 
C 2 HOH 37 37  37  HOH HOH A . 
C 2 HOH 38 38  38  HOH HOH A . 
C 2 HOH 39 39  39  HOH HOH A . 
C 2 HOH 40 40  40  HOH HOH A . 
C 2 HOH 41 41  41  HOH HOH A . 
C 2 HOH 42 42  42  HOH HOH A . 
C 2 HOH 43 43  43  HOH HOH A . 
C 2 HOH 44 44  44  HOH HOH A . 
C 2 HOH 45 45  45  HOH HOH A . 
C 2 HOH 46 46  46  HOH HOH A . 
C 2 HOH 47 47  47  HOH HOH A . 
C 2 HOH 48 48  48  HOH HOH A . 
C 2 HOH 49 49  49  HOH HOH A . 
C 2 HOH 50 50  50  HOH HOH A . 
C 2 HOH 51 51  51  HOH HOH A . 
C 2 HOH 52 52  52  HOH HOH A . 
C 2 HOH 53 53  53  HOH HOH A . 
C 2 HOH 54 54  54  HOH HOH A . 
C 2 HOH 55 55  55  HOH HOH A . 
C 2 HOH 56 56  56  HOH HOH A . 
C 2 HOH 57 57  57  HOH HOH A . 
C 2 HOH 58 58  58  HOH HOH A . 
C 2 HOH 59 59  59  HOH HOH A . 
C 2 HOH 60 60  60  HOH HOH A . 
C 2 HOH 61 61  61  HOH HOH A . 
C 2 HOH 62 62  62  HOH HOH A . 
C 2 HOH 63 63  63  HOH HOH A . 
C 2 HOH 64 64  64  HOH HOH A . 
C 2 HOH 65 65  65  HOH HOH A . 
C 2 HOH 66 66  66  HOH HOH A . 
C 2 HOH 67 67  67  HOH HOH A . 
C 2 HOH 68 68  68  HOH HOH A . 
C 2 HOH 69 69  69  HOH HOH A . 
C 2 HOH 70 70  70  HOH HOH A . 
C 2 HOH 71 71  71  HOH HOH A . 
C 2 HOH 72 72  72  HOH HOH A . 
C 2 HOH 73 73  73  HOH HOH A . 
C 2 HOH 74 74  74  HOH HOH A . 
C 2 HOH 75 75  75  HOH HOH A . 
C 2 HOH 76 76  76  HOH HOH A . 
C 2 HOH 77 77  77  HOH HOH A . 
C 2 HOH 78 78  78  HOH HOH A . 
C 2 HOH 79 79  79  HOH HOH A . 
C 2 HOH 80 80  80  HOH HOH A . 
C 2 HOH 81 81  81  HOH HOH A . 
C 2 HOH 82 82  82  HOH HOH A . 
C 2 HOH 83 83  83  HOH HOH A . 
C 2 HOH 84 106 106 HOH HOH A . 
C 2 HOH 85 112 112 HOH HOH A . 
D 2 HOH 1  84  84  HOH HOH B . 
D 2 HOH 2  85  85  HOH HOH B . 
D 2 HOH 3  86  86  HOH HOH B . 
D 2 HOH 4  87  87  HOH HOH B . 
D 2 HOH 5  88  88  HOH HOH B . 
D 2 HOH 6  89  89  HOH HOH B . 
D 2 HOH 7  90  90  HOH HOH B . 
D 2 HOH 8  91  91  HOH HOH B . 
D 2 HOH 9  92  92  HOH HOH B . 
D 2 HOH 10 93  93  HOH HOH B . 
D 2 HOH 11 94  94  HOH HOH B . 
D 2 HOH 12 95  95  HOH HOH B . 
D 2 HOH 13 96  96  HOH HOH B . 
D 2 HOH 14 97  97  HOH HOH B . 
D 2 HOH 15 98  98  HOH HOH B . 
D 2 HOH 16 99  99  HOH HOH B . 
D 2 HOH 17 100 100 HOH HOH B . 
D 2 HOH 18 101 101 HOH HOH B . 
D 2 HOH 19 102 102 HOH HOH B . 
D 2 HOH 20 103 103 HOH HOH B . 
D 2 HOH 21 104 104 HOH HOH B . 
D 2 HOH 22 105 105 HOH HOH B . 
D 2 HOH 23 107 107 HOH HOH B . 
D 2 HOH 24 108 108 HOH HOH B . 
D 2 HOH 25 109 109 HOH HOH B . 
D 2 HOH 26 110 110 HOH HOH B . 
D 2 HOH 27 111 111 HOH HOH B . 
D 2 HOH 28 113 113 HOH HOH B . 
D 2 HOH 29 114 114 HOH HOH B . 
D 2 HOH 30 115 115 HOH HOH B . 
D 2 HOH 31 116 116 HOH HOH B . 
D 2 HOH 32 117 117 HOH HOH B . 
D 2 HOH 33 118 118 HOH HOH B . 
D 2 HOH 34 119 119 HOH HOH B . 
D 2 HOH 35 120 120 HOH HOH B . 
D 2 HOH 36 121 121 HOH HOH B . 
D 2 HOH 37 122 122 HOH HOH B . 
D 2 HOH 38 123 123 HOH HOH B . 
D 2 HOH 39 124 124 HOH HOH B . 
D 2 HOH 40 125 125 HOH HOH B . 
D 2 HOH 41 126 126 HOH HOH B . 
D 2 HOH 42 127 127 HOH HOH B . 
D 2 HOH 43 128 128 HOH HOH B . 
D 2 HOH 44 129 129 HOH HOH B . 
D 2 HOH 45 130 130 HOH HOH B . 
D 2 HOH 46 131 131 HOH HOH B . 
D 2 HOH 47 132 132 HOH HOH B . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA monomeric 1 
2 author_and_software_defined_assembly PISA monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C 
2 1 B,D 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2002-07-10 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2019-10-23 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Data collection'           
4 4 'Structure model' 'Database references'       
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            citation 
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    4 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_citation.pdbx_database_id_DOI' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
MLPHARE phasing          .         ? 1 
REFMAC  refinement       5.0       ? 2 
MOSFLM  'data reduction' .         ? 3 
CCP4    'data scaling'   '(SCALA)' ? 4 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             CB 
_pdbx_validate_rmsd_angle.auth_asym_id_1             B 
_pdbx_validate_rmsd_angle.auth_comp_id_1             ASP 
_pdbx_validate_rmsd_angle.auth_seq_id_1              744 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CG 
_pdbx_validate_rmsd_angle.auth_asym_id_2             B 
_pdbx_validate_rmsd_angle.auth_comp_id_2             ASP 
_pdbx_validate_rmsd_angle.auth_seq_id_2              744 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             OD2 
_pdbx_validate_rmsd_angle.auth_asym_id_3             B 
_pdbx_validate_rmsd_angle.auth_comp_id_3             ASP 
_pdbx_validate_rmsd_angle.auth_seq_id_3              744 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                124.31 
_pdbx_validate_rmsd_angle.angle_target_value         118.30 
_pdbx_validate_rmsd_angle.angle_deviation            6.01 
_pdbx_validate_rmsd_angle.angle_standard_deviation   0.90 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 TRP A 821 ? ? -142.87 -26.86 
2 1 SER B 711 ? ? -153.93 89.98  
3 1 LYS B 803 ? ? 48.36   28.60  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A SER 677 ? A SER 1  
2  1 Y 1 A VAL 678 ? A VAL 2  
3  1 Y 1 A PRO 679 ? A PRO 3  
4  1 Y 1 A GLN 680 ? A GLN 4  
5  1 Y 1 A ILE 681 ? A ILE 5  
6  1 Y 1 A SER 682 ? A SER 6  
7  1 Y 1 A GLN 683 ? A GLN 7  
8  1 Y 1 A PRO 684 ? A PRO 8  
9  1 Y 1 A HIS 685 ? A HIS 9  
10 1 Y 1 A PHE 686 ? A PHE 10 
11 1 Y 1 A LEU 687 ? A LEU 11 
12 1 Y 1 A LEU 688 ? A LEU 12 
13 1 Y 1 A ASP 689 ? A ASP 13 
14 1 Y 1 A GLY 690 ? A GLY 14 
15 1 Y 1 A LEU 691 ? A LEU 15 
16 1 Y 1 A SER 692 ? A SER 16 
17 1 Y 1 A SER 693 ? A SER 17 
18 1 Y 1 A GLN 694 ? A GLN 18 
19 1 Y 1 A PRO 695 ? A PRO 19 
20 1 Y 1 A LEU 696 ? A LEU 20 
21 1 Y 1 A PHE 697 ? A PHE 21 
22 1 Y 1 A ASN 698 ? A ASN 22 
23 1 Y 1 A ASP 699 ? A ASP 23 
24 1 Y 1 A ILE 700 ? A ILE 24 
25 1 Y 1 A ALA 701 ? A ALA 25 
26 1 Y 1 A ALA 702 ? A ALA 26 
27 1 Y 1 B SER 677 ? B SER 1  
28 1 Y 1 B VAL 678 ? B VAL 2  
29 1 Y 1 B PRO 679 ? B PRO 3  
30 1 Y 1 B GLN 680 ? B GLN 4  
31 1 Y 1 B ILE 681 ? B ILE 5  
32 1 Y 1 B SER 682 ? B SER 6  
33 1 Y 1 B GLN 683 ? B GLN 7  
34 1 Y 1 B PRO 684 ? B PRO 8  
35 1 Y 1 B HIS 685 ? B HIS 9  
36 1 Y 1 B PHE 686 ? B PHE 10 
37 1 Y 1 B LEU 687 ? B LEU 11 
38 1 Y 1 B LEU 688 ? B LEU 12 
39 1 Y 1 B ASP 689 ? B ASP 13 
40 1 Y 1 B GLY 690 ? B GLY 14 
41 1 Y 1 B LEU 691 ? B LEU 15 
42 1 Y 1 B SER 692 ? B SER 16 
43 1 Y 1 B SER 693 ? B SER 17 
44 1 Y 1 B GLN 694 ? B GLN 18 
45 1 Y 1 B PRO 695 ? B PRO 19 
46 1 Y 1 B LEU 696 ? B LEU 20 
47 1 Y 1 B PHE 697 ? B PHE 21 
48 1 Y 1 B ASN 698 ? B ASN 22 
49 1 Y 1 B ASP 699 ? B ASP 23 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#